3ANYB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and (r)-2-amino-1-propanol
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine ammonia-lyase heavy chain
publication title How coenzyme B12-dependent ethanolamine ammonia-lyase deals with both enantiomers of 2-amino-1-propanol as substrates: structure-based rationalization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 71
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3anyB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3anyB02
3ABSB 3ANYB 3AO0B 3ABOB 3ABQB 3ABRB
chains in the Genus database with same CATH superfamily
1EM8A 3TVDA 4OI1A 4X20A 2XSZD 5F4ZA 2JLSA 2H17A 3UATA 3N3BC 1EVLA 3H17A 3FZQA 2QLNA 1PSZA 4WKOA 2VDRB 1MQAA 3TBKA 2VRCD 3AW9A 3BTSA 1W87A 3OZRA 4Q6BA 5D3KA 1Q74A 1CUFA 5CT5A 4LZPA 2NZYA 2GHQA 5BXYA 4IGFA 4YUZA 5L8VA 4GMGA 2E21A 2JFBA 2SNIE 4P4GA 3ZGOA 4MWDA 1NW4A 4ENRA 3UJPA 3RADC 4P33A 2O3SA 3MYRA 5BQPA 2FW9A 4Q47A 2O8VA 2W4QA 4RYDA 4WY2A 5DSTA 1KJNA 1KDRA 2C92A 2AFRA 3PNKA 1WOMA 1KH1A 4KCGA 4AWAA 3ZDXB 3BKWA 4JUIA 1L5MA 3K9CA 4KQMA 3CW8X 4X44A 2C2KA 1CFZA 2BSXA 3ON5A 3FGNA 5GZ6A 1X9IA 1C7FA 4DAEA 4DWWA 4NDNE 2P11A 2XMGA 3WL4A 2J4DA 4BX0A 1UQTA 2NPIA 1G55A 2Q07A 1B0UA 5F23A 1G8JA 3A6ZA 1REQA 3A28A 1S2IA 4FCWA 2C78A 3VTZA 1SOWA 4ISBA 3HC7A 5E95A 1Z4KA 4B6QA 2J9XB 2I22A 2ORIA 2PSEA 2R6FA 4IHQA 3BJIC 3WLIA 4A1OA 5ETJA 5LN1A 3WNBA 3ZKWB 2YBDA 2P3LA 2IW3A 1QCCA 1S02A 1Z2AA 4PS1A 4RE6A 3IKJA 4D2IA 1NFQA 1N78A 5AJWA 4PZPA 3AIMA 5JJBA 3L7IA 2PX5A 3KXLA 3RS5A 3ZD8A 2E5FA 2PGLA 4LHVA 2AW5A 1QIJA 3HRKA 1FS6A 4GYKA 4EOGA 1JHOA 3DC7A 1SGWA 2WQZA 1PFGA 5HDBB 4AUKA 3U31A 4R41A 1FP4A 4IH9A 5EP3A 3GLFA 1AB6A 1Z2OX 10MHA 4RC9A 3KIPA 2KJQA 1MP0A 4J94A 4KKXB 4MYUA 4P35A 2DPHA 3C3KA 5GAJA 4AZTA 3SQWA 4IH4A 5D00A 3LO5A 1R4MB 1F2UB 3D3KA 4JIMA 2HK7A 4WZBE 1ADGA 4RKFA 1YQWA 4M21A 4UUOA 4H59A 3DLIA 4Q7QA 5AKJA 3WP0A 1FVFA 3M6FA 1G98A 2QROA 4BX2A 2PZMA 4MIYA 4WCFA 4BRSA 5F51A 3THWA 1SXQA 5J4KA 4L85A 3QKRB 3P52A 4OO3A 1HDXA 2FZKA 1KBQA 3IAUA 1UMBB 3VX4A 2AQ8A 1GXSB 2GPSA 1BA3A 2H31A 1JU4A 1XQWA 1T3SA 3GI1A 4JB8A 3SFZA 3VR2D 1HFWA 3G1UA 5JAZA 2YCLA 4DBLC 1MQ8B 4IMRA 3LWNA 1RWPA 5LD2C 1QKJA 1UMCB 4ZAFA 4IQ0A 2Q3CA 3FOWA 2IC5A 3M5WA 4CKYA 4PV7A 5JDIA 3I4CA 4PGHA 3GRVA 1LDYA 3VXKA 5DBEX 3G17A 3R7DA 2IYZA 2O23A 1DXHA 3WL8A 5K0CA 1E9BA 5JZ9A 2C7PA 2FN3A 1G2PA 3GCDA 3TFWA 2ZYAA 4RTNA 1JHUA 4BJ3A 3BDVA 4RLFA 1M2WA 2PMKA 3TUIC 1XMOB 5KKNB 5FFFA 5EJ8A 1FLDA 4FE4A 2Q2OA 5DCWA 1LV7A 4H1VA 4YHHB 2O52A 1YDGA 2QPOA 3ED5A 4YY3B 2VAPA 5AJXA 1RYDA 3ASYA 2GCOA 2C9ZA 3ND6A 5JALA 1CBUA 4KBYA 2VPQA 1V45E 3H86A 1XALA 3TLGA 2QN7A 3W5BA 5HUJA 4HFMA 1JFVA 2XGJA 2BEWA 1J06A 2JLZA 4IIJA 1KP2A 1VPDA 4BVGA 3BFKA 4LNUB 1QGAA 2G0NA 2WYOA 2OB1A 2ZVPX 2CB0A 3L7KA 3FTNA 1JZSA 2QUZA 3NATA 3RBZA 2DB3A 4DNXA 3CB2A 1BMQA 4YDRA 4TQ9A 3GBPA 4B7XA 2YV1A 1CWUA 4HJRA 1WPQA 1PE0A 1OXUA 3NTUA 3Q5DA 3UXYA 4FFOA 3ZE6A 4WJLA 3DEKA 2ZSIA 5FUXA 3S8MA 3ERCA 1MOZA 1JQAA 1HUQA 3K53A 3WDLA 1GL9B 4KC0A 3P8ZA 4UMEA 1IBCA 1USWA 3LH5A 1RJ9B 2NU8B 3R5FA 1GPMA 2WTXA 1FRZA 4X92A 1L2TA 5FQNA 1L5NA 1W59A 2ODAA 2C7BA 4CIWA 2X8LA 4WECA 4KO3S 3W5CA 2QTAA 1DRWA 2HPHA 1V48A 2PGDA 1KKLA 1C1DB 2CHFA 4GZMA 2QD3A 1A27A 1PT9A 2GCGA 2QD2A 3IDSA 4ZZIA 5HIAA 5JWRA 2WNSA 1Y1QA 3ITDA 4NEHB 2X40A 2QP4A 2JS7A 2ANCA 2NQ2C 2XUGA 2YVAA 1E92A 9LDTA 4L27A 4J0DA 2JG3A 4P38A 3AKDA 1ONSA 2OV3A 3WRYA 3GLHB 1FX0A 5CT4A 2INGX 1PF7E 2PT6A 3L5OA 4HNSA 4ME6A 4BNWA 3ICPA 4WN9A 4B46A 1C0PA 4K6KA 1WKBA 4QQRA 1D3AA 2GUGA 4IVQA 3TSCA 1D5WA 2CLSA 3ZKAA 3JTMA 1SBNE 2HCRA 2XBMA 2ID9A 3ZCPA 3Q7EA 4TKMA 1V64A 4M1KA 3ADCA 4CKBB 3TVYA 2A1UA 4M1TA 3MBOA 3KJEA 2QYTA 3BVPA 1NLUA 2YUKA 2RB4A 1O77A 1BN7A 5ES4B 5ICCA 4KQ9A 1GRCA 1IWPB 4U5XA 3E9QA 2X1VA 2I2AA 4L4YA 4BWGA 1Q11A 4MRPA 1HRZA 5SZIA 4UHEA 3PU6A 1XL1A 2IJGX 2WIDA 3RGGA 1V63A 3HKEB 4FYJA 4RCYA 1OQAA 1SXJC 1E8NA 4JSRA 4C6SA 1R50A 1KMMA 3DOHA 4LWQA 5KKAA 3DKKA 4CEIB 3LUPA 4PYKA 2J9YB 4EY8A 1CVIA 2AN9A 2QUIA 1JB1A 3NC1C 3EBOA 2Y1DA 4P7KA 5DE3A 3ZDBA 1LNZA 1HSOA 3U3JA 2VP6A 3QF4A 2FE1A 3Q11A 4PPFA 3O95A 1XKTA 1O9GA 1QBGA 2IBMA 4JVSB 3AKZA 1KI7A 3FR7A 1ZQ1A 4OFWA 3RUEA 1Z0KA 1ZQ9A 2QVBA 3M33A 3H1TA 4R84A 3ZH9B 1X7ZB 4TT8A 4AB1A 4FZRA 4TWJA 4C22A 3ES9A 3ER6A 3HADA 3RS3A 3MG9A 3R23A 4S1VA 1N2EA 3G7UA 3F90A 1AUPA 1R0BA 4NR0A 1J56A 3N5KA 2Z3ZA 1JHPA 1KZ1A 2FSIA 2VBIA 4QPDA 1TZ2A 1YZVA 2BE7A 2PLAA 4BQRA 3CINA 3G5LA 1OZFA 3I1YA 1OXTA 5JE8A 3S1AB 4FINA 1LQTA 1J2JA 1O9BA 3PHIA 4UD2A 2KB0A 2XMDA 3I2FA 4CFYA 4XIFA 4BUCA 4BO2A 3FHLA 1GU1A 3H05A 1VG9B 4JVMA 1Y9DA 3KEGA 1BMFD 3DMNA 2V74B 3TK1A 1X7YA 5DTIA 1ZBQA 3II6X 4FEEA 1E2FA 1NW9B 4R8RA 4F4JA 3ZJ4A 1KFCB 3OEHD 4K2HA 4O2BA 1JJVA 4RLQA 4CG3A 4UNIA 5G1NA 3VOBA 5ITZB 1A5AB 1V5IA 2E6KA 2GA9A 2WJIA 4EG4A 3O3NB 3FYUB 1G20E 3AP3A 1V4BA 1L0BA 4JROA 4AP6A 4ZCMA 2HYIC 4EF5A 4AWBA 4QATA 4A0HA 3AM4A 3HMQA 4XFDA 1D2HA 3E18A 4UZSA 2Y6UA 3THXB 3OJCA 4BNFA 1M74A 3RAEC 2PANA 3KYCB 3EF0A 4N3NA 1DI0A 4EG6A 2BC9A 2YFHA 4JB2A 4UCWA 1AS3A 1ECFA 1I1OA 2EF0A 4GZ6A 4CMEC 1YZYA 2CJXA 1XDDA 2D1QA 2QIPA 3BXEA 3N7UA 4JS0A 4UM7A 1TD9A 3ZXSA 7GPBA 2V59A 3LW8A 3PI6A 4AJOA 1A0OA 3QSGA 2WJ4A 4JI1B 4B84A 4CTMA 2Z2KA 2DQKA 4ZVKA 4EP1A 2I3BA 4KACA 3MWKA 2Q3DA 2HLPA 2GO1A 3ZHXA 1EUDA 1EEHA 1UFOA 3K5WA 3EMVA 3LE8A 3LY9A 5FLEX 2KE5A 3V7YA 1QZXA 5B30A 3GLIB 3HLYA 3H1FA 5KSWB 1IU9A 4ZZ1A 3BF8A 5LUBA 1M75A 2VAWA 3I92A 4MA5A 4B4UA 4QUEA 4MVJF 2ZYGA 2BJWA 4UHJA 4Q1FA 3GN2A 5DCUA 1KDZA 5J43A 1QZTA 3OCJA 1P4SA 2FNAA 1RZVA 4M89A 1E7SA 3OZIA 1HT1E 4EQ6B 2IGBA 3M6AA 2YJ5A 3CLRD 4GOLD 2BHNA 4MHSA 1W76A 3ETHA 2CNNA 4HAOA 3TG8A 4EY4A 4XARA 4O1MA 2I8CA 3EYAA 4YRAA 1W73A 1XCGB 3AHDA 5EA2A 1PGQA 2V45A 3SKXA 4IDHA 1OLSA 1I3CA 3TZKA 2QTWB 2HTFA 3QKWA 4FJ1A 1R74A 2C58A 3INRA 1OF1A 1Z7WA 3AB3A 4MEBA 3DBIA 1S3SA 3SEQA 4RSHA 2OENG 1KZ4A 5IH3A 3A25A 5LQRA 1TGVA 3VKGA 1EFRD 1ILEA 1A8SA 3L8HA 2DTDA 5A03A 2VHTA 1ZHOA 1GKKA 3ZU6A 1KXJA 1XQ1A 3FLAA 5JZBA 5B1DA 3V3TA 4L15A 2FEXA 4TV9F 5H68A 5EWMA 2IZOA 1U7UA 2X1MA 4KSBA 3RO7A 3QNUA 3HJGA 1ZDMA 5FBHA 1ST3A 3PQ4A 1EDEA 3TLXA 1VKOA 4DMRA 4B3MB 2CLOB 3DMGA 3PC8C 3VDNB 5IAAA 4XWKA 1O94A 5DYGA 2UZAA 5CD9A 4BNVA 4FMCF 1B6SA 4FKZA 5DLDA 1JUDA 3GV0A 1T0HB 3IE0A 4MIEA 1SIBE 2FCRA 3TQCA 5JQGA 2OD7A 5FNVF 2PX4A 8AT1A 4YCLA 4DHEA 2JCBA 2VZ0A 4MK4A 1PVDA 3KJIA 2HBZA 1QHSA 1RYEA 2B6HA 3HCDA 4WBNA 3KUXA 4RPHA 2BEJA 2DH6A 3D2LA 4ZXPA 4JKYA 5TVGA 2C97A 5GV7A 1VMKA 3NAQA 3TTVA 4ND3A 3TLBA 2JKVA 3PFNA 4ARZB 5F9HA 1XU7A 2DR0A 3KUUA 3ROMA 4EKNB 3EPJA 3E9ZA 1TQ2A 2HYDA 5BWCA 3LZ6A 1AQNA 3WIVA 5AM3A 3GEPA 2FY8A 5ENVA 3UB4A 3O73A 3VV3A 1WNFA 1K86A 1M73E 5GONA 4CGZA 4FTWA 2R48A 3K6SB 3ADOA 2GTPA 4YCJA 5JOQA 4YO7A 1RAGA 3NNDA 1ECBA 4N48A 5B6JA 1I51A 4AZ3A 1Y7HA 2WJWA 5HJ2A 4MQFA 3JQFC 1ZFNA 2G09A 2Y8EA 1G8AA 4MUMA 4RQUA 1CQIA 1EWRA 1Q3KA 2O20A 4ZIRA 3QP9A 4HNVA 5KPJA 3ESDA 4BFVA 2WIKA 1ZVMA 1P4RA 2VTBB 2RJNA 1QOZA 1HT2E 2C3OA 3BXHA 4QJ3A 1HFKA 1ZM7A 5ECYA 4HGYA 2QSJA 4E3ZA 3AFHA 4CPDA 1YJBA 2MDTA 4XSHA 5FQOA 1ZCZA 1KI9A 3WS7A 3OCYA 1T91A 1AABA 1S96A 2BEVB 2R7KA 4MKFA 1EHIA 3CF4G 2CXNA 5CP8A 5BNIA 3RQSA 4QD3A 3FPGA 1TM5E 5H80A 3HK2A 3EVGA 1RBZA 3SS8A 4GKJB 1ESNA 3SVLA 2VP4A 2ZI9A 1IIBA 2YQ4A 2ATXA 4RWZA 5TJHA 3OA2A 3WMGA 3R44A 4H4EA 4HNQA 4Q4AA 2RG1A 1D6MA 1T6BY 4IDBA 4XWAA 5EJIA 4TZ0A 4FEYA 2IXFA 5JDIC 1AXEA 1FQOA 4YJ2B 5KX5F 1HEYA 1L7MA 1C9YA 2QV7A 1E2BA 2TMYA 5IM4F 4Q82A 3SLGA 1MOQA 5B4VA 2QL6A 1T9GS 1MIOA 2RCNA 2XZTA 3FTQA 1GV1A 3EGXA 2DKNA 4YJFB 1AO0A 1TC1A 3OPNA 1NJ8A 4F85A 2IPOA 4LRUA 3KT3A 4ZOQI 2AOTB 1PEDA 2Q5HA 2VNHA 3EG5A 1OX4A 4UDXX 4QOFA 3ZI0A 2YWDA 2RDMA 2DT5A 1XWIA 3BRWD 4IMPA 1I3OA 2H1HA 4YUVA 1ODSA 1NWHA 1XMVA 1ZAKA 4UZFA 3OZGA 4EY5A 1JJAA 3NANA 4A82A 4Z5XA 1JQJC 4JI6B 4ZO4A 1Y7PA 3IS3A 4OGFA 5CX1B 2ZCUA 1F1JA 4DRXB 4HCJA 2QY6A 3D31A 2ZJYA 1CB7A 5A0TA 3W4JA 2OBNA 1QC5A 3F9CA 5IHXA 3N2YA 3FNBA 4DSAA 4ZEOA 5KPDA 4F1KA 2EKZA 3WDMA 4QFCA 4PO3X 3DBHA 4PG6A 1P91A 1E3JA 2ZBUA 2ZRLA 3GH3A 3OBBA 1O0CA 3DPUA 1H93A 4XX0B 5FOSA 3EIOA 5HRAA 1BE8A 1HMYA 3JQ9A 4CTJA 2R8RA 4YCCA 3NV7A 1MG0A 3S7ZA 5IDWA 4AJLA 1K2WA 4QOGA 3CGWA 3G0BA 4EEZA 3PQ3A 3O84A 3Q9NA 3QE4A 5F12A 4E70A 3ECSA 1IQPA 1U2DA 1UPUA 2Q0HA 2QAGB 4H60A 4CRWB 2P9EA 4UDYX 4PPQA 1OGYA 5EJAA 1ZNXA 3H0KA 4RK1A 2XDWA 1ESZA 2XDAA 3IQHX 3QJYA 4H1TA 4YRSA 4WXEA 2B2NA 2ORYA 4P3NA 5DBFA 1Y6FA 4M7PA 4QFDA 4XJXA 5AHXA 3CKKA 3UB3A 3WRYC 3AIOA 4EA6A 4JUDX 4YJGA 1N32B 3O82A 2OXRA 1HSMA 4TGLA 3AGPA 1V16A 2R47A 3OJXA 2M1ZA 1PEKE 4GZ5A 1JR3E 3TW8A 3FUWA 4QL3A 1OXVA 1BEZA 3DDHA 1PR2A 3G5MA 1IUKA 2PJDA 3CNOA 4HDSB 2I2WA 4LI3X 1L5FA 4FMPA 4Q4CA 1P2FA 2F2TA 3QPDA 4CLRA 3CVVA 3EPLA 2C5SA 2X15A 2HSWA 1Z4OA 2IHUA 3DA8A 2CBGA 2VYQA 3IP5A 3ND8A 4NU0A 3VV2A 5A05A 1P2TA 2B35A 1ZR4A 2Q99A 3STWA 4HSEA 1FNCA 5HVNA 2H5EA 1MX5A 3NC0C 1UJ6A 3CXUA 5ENZA 3RU7A 2XUDA 1WDWB 3WJ2A 5BN1A 2N1MA 4B83A 3R9XA 2V6FA 5JXHA 3R7SA 1N0VC 1N8NA 2GASA 5DZSA 2IZ1A 2FWRA 3NHJA 1CD5A 3BA6A 4ZI2A 1S89A 4F45A 1WRBA 4PLHA 1HT0A 1TEHA 3L0YA 4WJZA 5GM1A 3ZWVA 2BM1A 3HXQA 3ZDRA 1SQFA 4KQEA 2J5KA 1PJ8A 2N9UA 1JMKC 2IKSA 2XWPA 3JXEA 3KC2A 4V0NA 3AO0B 1Z8FA 4P32A 5I7FA 3N7AA 4F12A 3PQCA 3KKMA 4C14A 2JVIA 4EI9A 1T5HX 4LC0A 4QBFA 1S9DA 1LTHR 1YR2A 3EGCA 1NJ6A 1DFGA 1FYEA 2IT1A 4KMMA 4JJKA 2VZ9A 2OQ2A 1F1BA 2NX2A 1G1MA 2HRCA 1U3VA 3JAWA 1B1AA 1DT5A 1KI1A 2WOOA 1ZOLA 3EC1A 1E2HA 2XBUA 3JWHA 4J1NA 4WKGA 4KXMA 1DKQA 1LJUA 2JJ2A 2HL6A 3CZ5A 1WMSA 2Y0CA 3OFJA 3Q8KA 1HY3A 3RAJA 4PAWA 3UJ9A 1JV2B 3B3AA 3L0BA 4LVCA 4TKVB 4X62B 4OHYA 3LQ1A 5KYXB 4AN0A 1C4OA 4Q9HA 3HNRA 2XR1A 2GMWA 1QHXA 3OOYA 3QVOA 5EE0A 4D3DA 1XRNA 2A4KA 2WW8A 3WQQA 3CH5A 5A06A 3FMPB 1ONBA 1T2DA 3B1WA 4OYLA 1WDMA 1YDFA 3WLAA 1NZFA 4D26A 5ALIA 4FFBA 1DIAA 2HK6A 5EZYA 3USZA 3MW8A 3GDFA 3B8HA 1CB0A 3IRVA 3UT5B 3QJ5A 4A0FA 3N74A 2PPVA 2CT8A 5L3ZA 4KH1A 1XEWY 1KOJA 2JGNA 5CBPA 2QNRA 2WUDA 3GT3A 5JCJA 2YN0A 1WQ4A 2O6HA 4JUCA 2OXIA 3U4MA 2JD2A 3KKPA 4JI2B 2ZKLA 2WQ6A 4NZNA 2PE5A 2G83A 1BWPA 3TVTA 5A9TA 4J0JA 2O4CA 3G2LA 1XZLA 1I5OA 3OI7A 4PIPA 3KQHA 1S7CA 3H6HA 1GU7A 5FIUA 3RK1A 1DJQA 1G20B 1OREA 3BMOB 3M1IA 4PLWA 3EQ7A 2XUJA 5LYYA 4W7HA 2AYZA 5DHQA 1KPIA 5KO2A 4XCXA 1RZRD 3E2PA 1U8CB 5HW0A 2X41A 6LDHA 1VIVA 1JEQB 4AL4A 2E4ZA 1Z39A 2HF7A 1P9RA 2FX2A 3HR8A 5GZ3A 5J2UA 1OCEA 3EMBA 3O8LA 2BP7B 4H3VA 3WYCA 4AKSA 4C0BA 4GKBA 2IU0A 2PNJA 2HOQA 4CDMA 1SBCA 5IVHA 1ECCA 2VJKA 4KYTA 5DN6A 2F67A 3FCSB 5CGQB 4J3JA 1Z6TA 3K92A 5GP1A 2H4JA 1PD1A 3MILA 4U2KA 1Z25A 1Z4MA 2HMSA 1GZVA 3PX7A 1DEXA 1A82A 3HA5A 4K0KB 1BJTA 2DBVO 3T4PA 3PUIA 4IJ6A 1EUCA 3BE6A 4C2AA 3VZRA 4DADA 2YY5A 2LWIA 1OH5A 3PQ7A 1P73A 2G4VA 2M6SA 3WV4A 2Y1XA 3W2TA 3WZ2A 5FPKA 2J08A 2YHIB 4PBRA 5JBQA 4YAUA 5C52B 1T8YA 2GSDA 5EERA 1YE8A 2NXCA 3TGLA 5IDVA 4F46A 1CDZA 3KWLA 1I2BA 3FNEA 4YP0A 1KZHA 3UAWA 4OQQA 3RVMA 1NV8A 1XZJA 2J6BA 4BN0A 4KWCA 1JHRA 2JK0A 2QQGA 4W9NC 5PNTA 4TTSA 4GKAA 1RWQA 2OESA 4IX1A 3HDGA 2CLCX 5KHLB 3AONB 3X1XA 5JSHA 1C1YA 1ZXBA 1QP7A 1RKUA 1GQ2A 1N6PA 4Y30A 5HGJA 2QN2A 3DDSA 1XWFA 2WPDD 3IPRA 4P4NA 3SOZA 5MN6A 4M4SA 3KLPX 2VK2A 5JAMA 2NP7A 1YJ8A 2WAYA 3GEGA 2C77A 2XWBF 3RU3A 1DU4A 1E4YA 1O94C 3TWOA 4TKUA 3WAJA 2XNCA 1GAXA 1UBCA 1B3RA 3IVAA 4XGQA 4YEDA 1YDMA 3UMFA 3D81A 3N59A 3T1QA 5CVTA 3NONA 1XEFA 1J8YF 3QVLA 3TCXB 1XF9A 4UNRA 4YAGA 3W7VA 1ZIOA 1AHHA 2HNKA 2A1IA 4DR4B 1UBEA 1T5OA 1WPRA 1N0UA 4H7JA 1NBME 1AX9A 4GSKA 4GFDA 1SXJD 4RHCA 1F7VA 2IP4A 4BNIA 3A11A 4LQLA 3CWQA 4YAIA 2CK3A 1KYQA 3W79A 1G21A 3O8BA 1Q17A 2Z2JA 2FX5A 3HBLA 5CURA 3S70A 1IG0A 3DAYA 4YMWA 1L4BA 2B8JA 3KFVA 1YA8A 3JZAA 1DARA 4UEQA 3TR0A 5LOVF 1IZ8A 3PJDA 1JI0A 2CF6A 3VO9A 1AKQA 3B82A 1D09A 1HQKA 3BMQA 2AJTA 2YQ5A 1Q2XA 3A9VA 4FD2A 1NY5A 1PK8A 4YAWA 5MGBA 2CC2A 1QHHA 2FPGA 5B2EA 3KAQA 2D1FA 3QXCA 5AK6A 1HE4A 1L8LA 5BOSA 5K0EA 1T24A 2X3FA 3K16A 4YT2A 4ND2A 1WMDA 5DF1A 1EEXB 3R3ZA 4INZA 1ST2A 5TMPA 1UWCA 2F3QA 3SVZA 4OBXA 4D9IA 1P1BA 5AVKA 5CXQA 1OB5A 2C82A 1X1QA 2FRVA 1M2FA 4O4LF 1IOVA 4L3WA 4ZN6A 4S3MA 2JFWA 2CNBA 3K9QO 4P34A 1T9AA 4PYIA 4X1YA 5DK6A 1PFWA 5LM3A 1NKTA 2B6NA 3UAOA 1CX9B 1XMPA 3H75A 4FVTA 2YWGA 3LS2A 4W5JA 3RWOA 3HBAA 2EDCA 2XXJA 3ZS9A 2ZIVB 4DN6A 1M2OA 4C04A 3D8RA 4HMQA 3V48A 1BXRB 4P4SB 1OFIA 1QH9A 2AJLI 3QLTA 1UOPA 4LSWA 4YJ3A 5D1NA 2XDQA 4OQLA 4R9SA 4ZQFA 4E3WA 1TZBA 4HH0A 1IB6A 1YRYE 3QLVA 5IDQA 3ICOA 1YONA 2QF7A 3BIJA 1XE3A 2VVTA 3EIFA 3G0GA 1RHRA 2BMFA 2QVGA 2O0KA 4ZO8A 4HNHA 4LJYA 1LZKA 1R0SA 2GS9A 3R8XA 3LQYA 2A3NA 3AGQA 2UYHA 3VNUA 1CEYA 3TS1A 3TEFA 1GR1A 4YLEA 3RU2A 5EXPA 3IQZA 2ZUEA 4IOLA 3KZXA 2F8SA 3HUFA 2D1RA 2I4TA 1GUFA 2WJ6A 4JI3B 4YCNA 2XTAA 1FSFA 1KAOA 1YZTA 3PEVA 4UW9A 2GCOB 4R1LA 3A6DA 4XQGA 5KMGA 2XA1A 4LHYA 1JSCA 2ZSJA 1E62A 2CFSA 1IJEA 2REOA 4UHKA 2DRIA 2MINA 3I9FA 3B7GA 4XYEA 1NY6A 4J2TA 2J8ZA 1R0WA 4AY5A 2AEFA 2X7JA 3H9QA 1S2LA 4QSHA 1KRXA 1MAUA 1QHGA 2E5LB 4MQMA 4YRTA 1ZN7A 4BX8A 1N5DA 4Z3KA 5CB6A 3FB1A 4NRDA 1E3QA 4Q1VA 4Y6LA 3QEKA 4ENSA 3VYVA 2QUBA 3KV1A 4MYTA 3RUHA 1SIUA 3JQ9C 3QI7A 4DMKA 1RC8A 1GG5A 2V0GA 3K0EA 5CH5A 4RFSA 1N36B 1H3FA 2O7VA 3UFXA 2VAMA 1GG9A 2AXEA 2XCLA 5F33A 4YR9A 1IVSA 1KOFA 1LDGA 3GO4A 5FRDA 1A1VA 2IF0A 2J9ZB 5CEEA 1ZSYA 1ZVJA 1U2DC 2YMQA 3OQIB 3WMRA 3K5PA 1DRVA 1Q95A 1N2CA 1Z4NA 3NHLA 2NYAA 5KYWA 1WXQA 4RTKA 4JYZA 5FF9A 4O4IA 3RUAA 2E85A 1OBFO 2W6NA 3U60B 2ZTVA 1C7JA 4I4LA 5ECWA 2I3DA 4GOKA 3T3HA 4BMDA 4QGSA 1E8MA 4J03A 5C5DA 1GG8A 4CM4A 5HCUA 3E2IA 4HAUA 3C6MA 3K8YA 2C4UA 2GN0A 5EJGA 4HC4A 1ZH8A 4JASB 3OLCX 1KZ7B 1QPZA 1GLVA 1PL7A 1I7DA 3PFIA 4OLFA 1FX0B 3ZU2A 2WF6A 5CHEA 4ZYTA 2DLDA 2O0MA 3ZIAD 4JU8A 3WISA 4E6PA 4Q9JA 1EK1A 4BQOA 1HRYA 2QG4A 5CBKA 3G88A 4FYWA 4A6DA 3ZHSA 4NBNA 4HLUA 3EIHA 1XOIA 4KU4A 3D5QA 3GAMA 3AEKA 3P20A 2Z83A 1Y8QB 2B5VA 3PENA 4DQKA 5DKFA 2JI8A 3OX2A 3S8EA 1OOEA 2E4XA 5IUJC 4XB1A 3NGLA 3TTTA 3C70A 4IHJF 5C5CA 4XOIA 4ARAA 4M7RA 1MABB 4MV9A 2IZ0A 3PL1A 4J9VA 4NTZA 3Q15C 4BLSA 4URXR 5EUCA 3EXHA 5SZJA 3FX2A 3HQ4O 1JFRA 1CR2A 4E31A 1QOQB 3REGA 2A5DA 2C96A 4MI3A 2G70A 3RARA 2OO3A 3DYVA 4KJZA 2P79A 3O7MA 1IUOA 3REFA 4AQDA 3RC8A 4ALKA 4CR6A 1C0LA 5BR8B 4CLOB 4CQMD 3EY4A 2PIDA 2C9OA 2P5SA 2H06A 4U3JB 5CMLA 5G0UA 5HE8A 5J3JA 4JV5B 5J2TA 4RDCA 4MINA 3WYNA 1Q2UA 3OQHA 1NZDA 2ID8A 1XVVA 3P0JA 4P5PA 2IBTA 2WP0A 1T9KA 3E8SA 2XCQA 4GPD1 3GJ6A 3MT8A 4Q3BA 4AW9A 2HH9A 3JVDA 4OBEA 3RI3A 4ZEMA 5A6VA 2JLBA 2P6PA 5FTNA 3T9AA 4KR7A 2FMIA 2XZLA 2EP5A 1PAUA 1V47A 2X9LA 4S1WA 5HJ7A 2F7SA 5BSWA 1JFFA 3VHRA 1WCIA 2NSDA 5EP4A 3CEPB 1Z37A 1MORA 3ZYZA 4HMOA 5JRJA 1LTKA 5FEMA 5KSPA 2GD1O 2XEDA 3CH6A 3HBJA 4JB3A 1P5HA 1C7RA 3PEYA 3ABZA 3MMXA 3ANYB 2PUWA 3IT0A 3NBAA 4P84A 1GNVA 4YYZA 3A06A 3DVQX 3KV3O 3DVAA 3YASA 4MB2A 4EPTA 4RVUA 1OV6A 3DLPX 3GB9A 3GUCA 2R00A 2QJRA 4OXNA 1SZCA 5DWQA 5B36A 3U16A 1R5OA 5I8PA 1GZ5A 1Z6PA 2C95A 2NZJA 2DFDA 5LU9A 1EIWA 1YU9A 3CEMA 4URFA 5CVCA 5KQRA 5HTOA 2VUUA 3KBBA 3N9IA 3QPUA 3JVEA 4XZ3A 1X7YB 4ED9A 2H2AA 1J46A 2Q2WA 3OEEA 4M9XA 1HR0B 1JHZA 2Z8YA 3KOMA 4F04A 1RRCA 1O54A 3QKSA 1DE0A 3B2QA 5JCOC 2GRUA 4EYOA 2AH5A 2IA5A 4AMZA 1SO8A 4JLBA 3QFFA 2VK1A 4KGXA 3HU1A 2BDTA 3SSNA 1Z6QA 3C87A 2FDCA 4NENB 4RVNA 4PE5B 4BO8A 4RHEA 1LBHA 3DEIA 3H2JA 4PZ9A 1Y1LA 3WHIA 1U9YA 4J1QA 2JLCA 3SR3A 5KNDH 2DZDA 3QYPA 1YWGO 3I62A 1M1YE 3WV5A 3LF2A 5JMWA 2NUAA 5KWEA 2OSBA 2YWEA 3DFMA 3U4GA 4J0EA 1E79A 1RI2A 2O50A 4EJSA 1EXDA 3KHKA 1SOUA 4IF6A 3R7AA 3WGKA 4HUQB 3JASB 4JEIA 2B37A 3R6GA 3GFBA 5IAOA 1PR0A 3DDOA 4L6AA 1JGTA 2LE0A 1RADA 5LZ9A 1LC3A 1P77A 1NN0A 2BCGY 3UKDA 3U39A 2EGHA 3ISTA 2TYSB 4JJ4A 2BMVA 2YZKA 3IDQA 4OQDA 3UCEA 2BEKA 5AUOB 5JASA 5KVAA 3OQOA 1GQYA 5DT9A 3WLRA 2OKGA 3SEZA 2ZJ1A 3ESBA 4TLMB 4AMUA 3A2LA 1NF9A 1U81A 4P3KA 2WJ3A 4L4XA 4ZQEA 3ZJUA 4Y2XA 1LF0A 3QFCA 3D7SA 3I1IA 4G9EA 1JHDA 4DZZA 1UANA 4HZGA 4KQJA 3NWJA 1YTUA 1OMOA 4X8HA 1EE1A 5A6SA 1L3IA 2NACA 3PXCX 1P6QA 3MWEB 1M2GA 1O87A 2DFLA 3RPEA 2G63A 4EECA 5FOUA 2V7GA 1X74A 2OEPA 2ZTLA 1XP8A 3EVDA 4B73A 3AFGA 3K15A 4FHCA 2CL5A 2R8YA 4LOKA 3K05A 3SXUB 3V4ZA 3UOAB 4OXYA 3PHCA 1P44A 2GBPA 1ITZA 1TVCA 2QRPA 4TRNA 4WV3A 5HIIA 5K2MA 4C4ZA 4ER7A 3RUCA 5NLLA 3OQJA 2Q3FA 5K99A 2GN6A 1NL3A 1MVOA 4I2NA 3VSAA 1QP4A 3QXSA 4MV6A 5DW3A 2JFVA 1WX1A 3L92A 4JLJA 4ZAYA 3E53A 4RTPA 2DHCA 4A10A 4FC7A 3F1KA 4KN9S 5F77A 1USGA 2VAVA 2FSUA 1AKEA 1X8JA 2P5UA 2QRJA 3UWMA 4URVR 5DNWA 1DOHA 5JJCA 5HUQA 2N0SA 3AFNA 1E77A 3KSMA 5A9RA 4LOIA 1P1IA 4LZJA 3SIWA 1YIDA 3IOCA 1E5LA 5FO1A 4BUZA 4NS1A 4R54A 4DM3A 3OKFA 1GRNA 2PZKA 3VR5A 1VZ2A 1MB3A 2LKDA 2YC2C 5KHOC 1ESCA 3A3KA 1HEIA 2I3GA 3DE7X 3KQQA 2OD2A 4DV3B 2H59A 3EVNA 4WZAA 5DCLA 1UAGA 2OOKA 2QN9A 3EW7A 4U7DA 1ZU5A 1YL5A 3UG6A 4P92A 2WFLB 3OA0A 1KDPA 1VPTA 4JZKA 2XQGA 4MCHA 2BVNA 4RNDB 4HDOB 4RZ3A 3L4JA 2DQ4A 2OBBA 2GLUA 3VJLA 3A2KA 1R8YA 3AL2A 3LDUA 1FA9A 3EGIA 1BRTA 4IEFB 4E4YA 3T5MA 1D4ZA 1E2NA 4HNAB 5JXJA 5LWHA 1POXA 4QVIA 4JL8A 3S2GA 3HXTA 3PEFA 1NSFA 5ARCA 4IW3B 3TPFA 2F3SA 4CM9A 3HKBB 2WB4A 4GVLA 3KE8A 3AINA 4X3OA 5JZOA 4Q7KA 1QLHA 4HWSA 1EJ6A 4I50B 4WLVA 1TF7A 5BMVA 1UWVA 2PQ0A 4G1UC 2WUWE 4P36A 3DZFA 3WOVA 3EIUA 1XU4A 3HM9A 4HFNA 2MMGA 1GZ7A 4OAPA 1AURA 4CU2A 1JPNA 2ZANA 3BFXA 1V5FA 5CIYA 2JF0A 4IY1A 2O48X 1B41A 1O8BA 4BQSA 1H2XA 4K9RA 4U6QA 2P2SA 3T0FA 3W2EA 5HSGA 2D5AA 3QQ5A 4MAMA 3QX3A 1M6NA 4G81A 3E1GA 4HEA6 3D4IA 3DFIA 2GAFA 2LD4A 1TM1E 1WUKS 4PW0A 4AURA 4Z7QB 2JLQA 1ZW1A 3K7EA 4ND5A 2WP8J 3R7FA 2WHQA 1CY0A 2GCEA 1UZAA 3LBNA 2OHGA 2I7DA 3HJHA 4I5GA 2CVPA 4J7UA 5AQ1A 4DUZB 1SVSA 2G82A 2Y2VA 3M9LA 5BWBA 4MYSA 1EBFA 1KDTA 2BKEA 4MQ5A 1X13A 1KETA 3BHMA 3GRYA 5DP2A 4ZVOA 4AJKA 4DJDC 1LX6A 1PZXA 4HDNA 3DT9A 3JQGA 2X6TA 3HHEA 4QXPA 2OCAA 4B8YA 4PHHA 4CEHA 2R7MA 2QTFA 4KYUA 3F6PA 1CF2O 1YZNA 3T7DA 3BWVA 1BX0A 1X1CA 4G4SO 4E21A 5F9FA 1EXVA 1QANA 2NYVA 3QLVC 4JOQA 4TYPA 4OI0A 2F59A 1A9ZA 1B6GA 2FPXA 2G76A 3CR3C 4CL3A 1E66A 2ZI4A 5K51A 3O92A 2IXTA 1HE2A 1N57A 2VZEA 1T3ZA 2R6JA 2RG7A 3F27D 2PX0A 1L4UA 2YC4C 2ZQZA 4UCXA 3AJEA 3E15A 1KARA 3HEAA 4YRZA 1MIOB 5KIAA 3IAM6 3OE1A 1ZI8A 5DMHA 1IN7A 4FT2A 2VPPA 4RFVA 3RJ5A 4ETNA 5A3QA 2CNDA 3DMYA 3BGDA 5DXFA 1XPUA 3K72B 1BW9A 1TM3E 3GEMA 3FGOA 4GOOD 3T9CA 5EQFA 3JPWA 4KZPA 1PR4A 3RIEA 2PT5A 1DRJA 3FJOA 3V46A 4I4TA 1XTJA 4XCVA 1E94E 2PH1A 4QG7A 5BUCA 3GLGE 4OMDA 4JJGA 3IMFA 2FMHA 1QK4A 3N6VA 1T2NA 2ZWVA 2FRDC 3NBZC 4GXNA 2RC6A 5ALFA 3I76A 2ZBFA 4FS8A 1H23A 4WRRA 3DV2A 1S5PA 1B00A 3CKMA 1MG5A 1MB0A 1U3GA 2W8BB 3O0DA 1U7ZA 1JBKA 2ZAYA 2NG1A 2C1ZA 3SZGA 1X94A 5GPBA 2G1JA 1ZW6A 3L7DA 5J4VA 2FEKA 4K9PA 3PQ2A 4RMNA 4XWTA 1LVHA 4FN5A 3NM9A 2FVYA 4H7DA 3MFYA 1QPBA 5DX0A 3AESA 3RVRA 3ZDYB 4NOJA 1H2ZA 3HV2A 3HE3A 1OT3A 3NU1A 1CFJA 3MLEA 4OAOA 4JFAA 1SHZA 3RU9A 4CV3A 4EFLA 1U2SA 4EPVA 3BGVA 4R31A 1XZHA 2YX1A 3HCFA 5GWXA 3QFTA 1E7JA 1SCUB 3G8AA 4KWEA 4XYBA 3PRJA 3A36A 3GBSA 5A3VA 1ZOOA 1X80A 2JFUA 1Q0QA 1NURA 3PF9A 3WLEA 3JR7A 3QFRA 3IVRA 5EIAA 4K40A 4Z2YA 4AMBA 1W36C 3VNAA 5LPNA 7MDHA 4C0WA 1ZIYA 2Z9DA 3HZRA 4FMDF 2CDCA 4US0R 4R1OA 4E7PA 3QLJA 4MLPA 4RTQA 3H5NA 4LXUA 4C5CA 4YJGB 1O94D 3NM4A 2Z56A 4NBVA 3DZJA 2VWHA 3ZTYA 2RC5A 4NZPA 1O4VA 4LX0A 3C7TA 4S12A 5ALTA 1L4EA 3MJRA 4AF8A 3PD0A 4HUTA 3M5CA 6CHYA 2OORA 4YCSA 3AVOA 3IP3A 3P0FA 5C1BA 1VSQA 2CVFA 3MM4A 4HLUC 1X0VA 5IJ0B 1PKEA 5G3ZA 3L84A 4FLEA 5HFNA 1G60A 1NIJA 3HVRA 1YIAA 3G5AA 3CZAA 5A5VA 5JDCC 1NF3A 2VYCA 3KSDO 3WGQA 4MUBA 3L6BA 2NU9A 3TJZA 5DO9A 4G07A 4EYEA 4M9ZA 1ZK1A 1C7ZA 2WWRA 5AHOA 5H5JA 1RQGA 3R9IA 3O3MB 1J7KA 1VYVA 1W52X 4F3RA 3IXMA 3VO2A 2O8CA 1K8YB 5LNK6 2J07A 2ZAOA 1JAIA 4AS2A 2ZTUA 1ZA1A 1CJTC 4C7VA 4LCJA 3HGMA 3AVPA 3FSRA 3RIYA 5EXDA 2YUTA 2QPTA 5TQ2A 2AXNA 3LV8A 1TVMA 3A1CA 2JCVA 5F1OA 4RLHA 3FPKA 4KIWA 4DC9A 3S99A 1H1TA 2FG7C 3BE4A 5CXSA 2XKKA 3NYWA 4O4HA 3KXKA 1ZRMA 1NOJA 3ODGA 1WDTA 3N2ZB 3ZWWA 2A1TR 1PLKA 3WWOA 1JALA 5B1IA 3ZTWA 1U31A 2XHZA 1ONPA 3G6KA 5LMCA 1DCTA 3F2IA 2L18A 2Z2IA 3KR2A 1YS6A 4J16A 1Q0ZA 5L53A 1ISGA 1G6KA 1KFKB 1U1GA 3NFYA 4I4CA 2H7XA 3EH2A 5JZMA 1KIMA 3OTQA 4O4JA 3M70A 4WKBA 2J3JA 4AYWA 2BAGA 2WK1A 5I47A 5FBQB 5DTJA 4OK6A 5ICGA 3KJXA 2R00C 2VPWA 3KQLA 1Z0JA 3BWXA 2Q4DA 2RHRA 2R1TB 1WNTA 4LS3A 5EHNA 2AOWA 3KB2A 1JDPA 2YNMA 3GJZA 1Z17A 4Z51A 1FIUA 1GCAA 2IPNA 5JMOA 4Y9SA 1MQSA 2V6JA 5KZMB 4AQYB 1HKUA 1U3UA 1FDOA 1EDZA 2AC7A 3EW9A 4CN8A 4HH1A 4IVPA 4EFMA 3PG5A 4Z54A 4X8MA 1E0KA 1FTSA 2W6JD 3I2HA 4AROA 4TL7A 3T5GA 2BUCA 2GBGA 1ZMBA 3L93A 3SHFA 4YPVA 4MX8A 3TDNA 3WE7A 4GRIA 2Q6VA 4JY7A 3EISA 5IAEA 2OZLB 4YP5A 4F60A 3B89A 3RAFC 2HJVA 2EOAA 3HNOA 5DISB 5FBLB 2BISA 1YFJA 2PMFA 2ZS7A 1H3NA 3LYUA 1P72A 4HH4A 3OURA 4MHOA 1IN5A 1EFDN 4QDTA 2YULA 4NAUA 1CIPA 5KYVA 4EJSC 1DRUA 4MIKA 4E5VA 4A2WA 1JVBA 3UK7A 1VG0B 2OHOA 4FEGA 1G64A 1TKCA 1ACMA 5HZHA 3E70C 1E7QA 2L0XA 4HLCA 2PJZA 3W4KA 1G8HA 4NECA 3UBTA 3SXJA 2QQFA 4D0GA 4MULA 1Z26A 5DTQA 1J0BA 4B4WA 2B8TA 2JGFA 5EHGA 4B7AA 4FM9A 2OXTA 1BIFA 3CTPA 1VHDA 4KG7A 4EK9A 2R7NA 5J58A 4OQMA 2DLCX 1F06A 1GNPA 1Z2DA 2AZXA 5K3BA 5TPWB 1M0EA 5GJVC 4WVLA 2DOKA 3TQIA 3KKLA 2JFGA 1XDSA 3PYLA 1VQ1A 1ZG3A 4MP6A 2F48A 1TRKA 1SIOA 3DBOB 3EZ2A 1UBNA 3H2YA 4N7BA 4ZAXA 2QMQA 3REQB 1ZD8A 5HE9A 1GHTA 5JPIA 3NJ8A 1OZHA 2FW7A 3AUKA 3SXPA 1C41A 4XB6B 1LY1A 3SBEA 2R1VA 1EINA 3Q3IA 3RJZA 1DVRA 4D8TA 1ARZA 5G41A 4A8JA 2B8WA 2RHJA 2I55A 1WG8A 4I55A 2YWHA 3RKSA 5ULLA 2BE9A 2IK8A 2FEOA 2VDJA 4LBVA 3MQ4A 3ZJVA 4BB9A 1FFXA 4IWYA 4D6PA 2RGWA 1P19A 1E1CA 2C42A 3F9RA 3JR3A 4EELA 3PNYA 2BDUA 1J0CA 4I0WB 4EABA 1XVIA 3AR9A 5E6SA 5FJIA 1VJ5A 3OPQA 4RO0A 5A4JA 3AFOA 221PA 3VX3A 4R1QA 2WAMA 3OF2A 3MIZA 2DUNA 2ZJOA 1C4WA 5IK2A 3D3EA 1GDDA 1X19A 1KI4A 4L5JA 4FYXA 5DFAA 4JJAA 5C1OA 4UTPA 4FB4A 1VIAA 5GGYA 4ZI7A 3RVOA 1SB8A 1EH5A 5LQCA 4BECA 5JD5A 2O7QA 5DLYA 1RW4A 2P9YA 4ZVPA 3C3CA 4HNGA 1U8YA 5C0OE 3UAYA 1JR6A 5B7GA 1V8BA 3G89A 3H8VA 4M1OA 4G89A 1KMCA 3W6ZA 2YY6A 3ZNPA 4KKVA 2UZ0A 1G5PA 3DPIA 3H1AA 1U2PA 3GOHA 3LO8A 1D8AA 3CSDA 3QG5A 2HQOA 3UWKA 3P2EA 3C5CA 3S44A 4DXAA 1QIDA 1U28C 3DS8A 3ZR4B 4Y2TA 1SULA 2HT6A 2VSXA 1EAYA 4FFSA 1JIUA 5C1IA 2G8NA 4KVZA 1CUBA 4GDMA 3B20A 3LGSA 1CIVA 4Y2YA 1VSTA 2HB6A 1Y4UA 1XLTA 3PSHA 2RGXA 3RFCA 2GK3A 4H7HA 4ETIA 1MJGA 3KWMA 2BFDA 2Q6KA 1XEXA 3CXRA 1ZKMA 4A8HA 2X9NA 3C4QA 5G53C 5CVDA 1MX9A 1FOEB 1YV9A 4RD2A 4GM4A 4U2CA 4YJ2F 1N7IA 1R6XA 1T10A 2WDZA 4NONA 5E7QA 4JT9A 2JIQA 3LL7A 2IQ5A 3BB3A 3WP1B 3FDXA 3OJEA 4R05A 4YRCA 4L5CA 4TVSA 4GS5A 2PKWA 2V1XA 4B43A 2WU4A 3ZWNA 1CCWA 3I9V6 3HJRA 4RXUA 5MN4A 4PICA 1HNNA 1FE8A 1NX9A 4O2AB 3KYIB 4ZOLA 1S8OA 1E4EB 4RL6A 3K4QA 2YN2A 3HUEA 2JJMA 1FJXA 2VFAA 3ISJA 4JDUA 5BT8A 2GF0A 4BMVA 3TTSA 2YOFA 3O31A 1Y6ZA 2OFFA 4PG7A 2GR9A 4NVRA 4GRDA 2RKWA 1TCBA 5MDHA 4Q3AA 2PSJA 3RR2A 2CXPA 2WU0A 3BMNA 4IRXA 4D8UA 2QUHA 3H4VA 5AXAA 3AVUA 5FADA 5AKIA 2XNHA 1ZN2A 1JJIA 3IMEA 1T9DA 3GGDA 1V11A 3QWAA 4G36A 3N2EA 4DPLA 1MN6A 1HLGA 1S8AA 2VP2A 4BGVA 1YVUA 3ZCXA 2EJVA 3KWFA 4DQLA 1I01A 2B8EA 3W5AA 3H7IA 3P2KA 4HADA 1IEXA 1UDWA 1GPUA 3P4YA 4LF4B 3LHKA 2ATCA 2J3LA 3VKFA 4CTNA 3DT8A 3IEXA 4WKNA 3K0HA 2UZIR 4HEQA 3N5CA 4Y2SA 4LV8B 5ALUA 1ATZA 5KMGB 2CJFA 4ADSG 1D9XA 3N0TA 1IXZA 1EWYA 4GGMX 4N0PA 3HDYA 1YO6A 1KSGA 1GARA 3V1YA 1SU4A 1X7XB 2XF2A 3DEAA 3F3MA 1QFSA 4BO6A 4G2NA 3CJTA 2MINB 3AUTA 3AB7A 4X6LA 4B35A 3ZHTA 5D3MA 1AVTA 3ETDA 3ADDA 3AEQA 5I6DA 1CG7A 2W4IA 1RWVA 3W8FA 3ZU4A 4AKEA 2J0UB 3KYDA 4UTVA 3GLGB 1U0NA 1U2EA 1SXJE 1YUMA 1HQDA 3B6JA 4HEJA 4QRIA 4EG1A 1L1RA 3HACA 1CUZA 1LU9A 3FYCA 1VLLA 3OZCA 3UMMA 3FXAA 3THYB 3RV3A 4BYGA 2PZFA 5JECA 3JSAA 4XYMA 5M5BA 2PHZA 5DGDA 4BMCA 1CUCA 4AK9A 1GOTA 4EHBA 4B6JA 2H63A 5AKLA 4OHXA 3EXFB 4A4DA 2O8DA 3STXA 1FQKA 1Q15A 2JEOA 2ZT7A 1E6EA 3GGCA 3L18A 4RFSB 4TMZA 3K70C 4GL2A 4RZIA 1QG4A 3ED1A 4UPDA 1FMCA 1AG9A 3VAYA 1UUFA 3I83A 5CCDA 2FKNA 4NU6A 3PWTA 2FW1A 5D86A 4KXLA 1AUVA 1UWLA 3UVEA 4C3OB 1M6WA 3I5XA 1KE1A 2H7VA 1Q0LA 2CLMB 1C8BA 3E58A 1MTOA 3TNYA 5KYWB 3P4UA 1UKBA 4O4IB 4UTRA 2QTTA 2W2PA 4RFLA 3MB5A 1YZGA 3G7NA 4PC6A 3WWEA 3ZXIA 3L0PA 3F4LA 3KR9A 1VKNA 5FOXA 1NLMA 3FPBA 3ZZTA 4BP8A 3OZUA 3UWPA 2C04A 1BROA 2I03A 4HDCA 5L3SB 3SC6A 4BZPA 1PN3A 1VBFA 4QBKA 4FN4A 3QMPA 4K9QA 4LSMA 4PAQA 4HN4B 1DJLA 3QU9A 2D1YA 1GPH1 1WOYA 1XJWA 1F8UA 4QJBA 4MS1A 1TMGE 4DQUA 3JVUA 5E1BA 3BAZA 4M7OA 3GNSA 4BAUA 2K7FA 3UXMA 2GEKA 2OORC 2QMYA 3OCWA 3U61B 1W4AA 3EEQA 3SIXA 1X0XA 5TNXA 3BT7A 3LZCA 5H9WA 5IX8A 2I1LA 1SC4A 1Z75A 2DY0A 2FGKA 3SJUA 2G36A 3Q5EA 1II0A 3GGPA 3ETEA 1W44A 5EHXA 5KWIA 3MQFA 3A32A 4RPGA 1V8PA 1K06A 1OJLA 3LPAA 4UAGA 1OWLA 3CBGA 2IHTA 1T2EA 5HKOA 4TS9A 4MRVA 5L6LB 1U8TA 1IULA 1GR0A 2A5JA 2BRUA 1EPUA 1Y3IA 4HYYA 2C4TA 1BGXT 3R5TA 2GDJA 4FQ8A 5LBUA 2OV6A 3T94A 1Z4JA 2G5CA 2PRYA 3BMCA 2O0HA 2OUIA 1JG2A 3E3AA 1MPXA 1D8TA 4KPUB 5AXDA 4BE7B 1TLLA 1DG9A 1UP7A 2ZRBA 3CN7A 2IL1A 3GJYA 3KK0A 4LSGA 2PMCA 4G6ZA 4C43A 3U3XA 4XTRA 3FHCB 4C1NA 4F5EA 3V4SA 2DC1A 2RH9B 4PPGA 3IO5A 2LEFA 1UXIA 3STHA 1RI4A 1IQ0A 1VXOA 2E2WA 1XD2A 4BNGA 2WOJA 3CLSD 4I1YA 1NHGA 1VFPA 3IJ5A 3P0RA 4UHDA 3EYWA 1W2HA 3F96A 2D0OB 1O5TA 3VJRA 4RSRA 1E18A 2BHTA 2WWHA 4YROA 2R8PA 2BKVA 4IMJB 1SHTX 5BXQC 2HSEA 1UMDB 1N2IA 4H6XA 4LCEA 5IAJA 2E0IA 3PCRB 3BG5A 4P1ZA 1A9QA 4AFNA 4ESVA 1JFFB 4HZIA 2O2SA 1E63A 1B93A 1KI6A 3NI2A 4XVCA 1XA0A 5EZSA 1NR1A 3RUPA 2C84A 2FSSA 4UKDA 5SV2A 4KRXA 1FVXA 1SCIA 1HDIA 2WMYA 4RADA 1K98A 3QSYA 3W8NA 3SDSA 4BGEA 4CKZA 1HORA 3NUQA 4MW9A 3U9TA 4V0MA 4AMVA 3F78A 4D4KA 1C3EA 5I01A 1EA5A 5FYQA 2N1BA 3ZEIA 5KTOA 4NPAA 2P68A 3OPMA 5KC8A 1P5FA 1NXVA 3I09A 5EQTA 4D45A 2RIRA 3OPVA 4EYSA 3UMYA 2WV9A 1K97A 3AG5A 3MTQA 4G9GA 1P0MA 1CUAA 2NU6B 3DMPA 3FPSA 2PMBA 5K4HA 1Z8NA 1KXZA 2ODEA 3DG9A 3K6JA 4BLTA 5FXMA 3SYTA 4QM7A 4KDFA 4RD4A 4CI9A 3MD0A 3QKSB 2PL3A 1MLDA 3L7YA 4N76A 4DR6B 4JXZA 1FS5A 4UJ3A 1CP3A 1NMQA 2Q4TA 3A9WA 3UHAA 4X71A 2Y4OA 3JQDA 2C98A 4OFXA 1PW5A 5AVTA 1KFEB 2X23A 2XNSA 4URYR 4S1TA 4HD8A 4JGIA 5AUNB 1A9OA 1J9ZA 2EBFX 2EVWX 5DV9A 2P6RA 2PR7A 2WWTA 1QG6A 4RNCA 1RI3A 2ZPUA 2P1RA 2FG6C 3B3GA 2I2CA 5BY2A 1FVOA 1ZBDA 3CX3A 1ULHA 4HJXA 1T2AA 4BRUA 2LIVA 4KWIA 4CMCA 4CQMB 3T5DA 5K3EA 3A0UA 3NOQA 4NWIA 1DOAA 5EFOA 1UP4A 2Y1LA 2O2JA 1CQXA 1QRDA 2QMHA 2JI4A 4LISA 4NZMA 1JTEA 5DJ5A 4ZT6A 4I5DA 4IR7A 3TSZA 2FI1A 3DT6A 1I13A 1ISRA 2ZRDA 4BATA 1HOTA 2EHDA 2FN4A 3MMZA 4IG4A 4OCZA 2YOHA 2H65A 4F2PA 1IH8A 3A2NA 4Q00A 3VR4A 4IF4A 1KEZA 3DSRA 5BN4B 3TYXA 1M5RA 2IWRA 3FZNA 2XE8A 2YR0A 4LZOA 2Q4EA 2REBA 1SNYA 3ZZ1A 4FB5A 1XZGA 2ZLBA 3U5ZB 2TMGA 4GR4A 4CM7A 3WBJA 5DHUA 3G9XA 4LRWA 1HI9A 2J32A 2IU4A 2IYRA 5DM1A 5DX8A 1LS6A 2B1GA 4D9CA 1I1NA 1UC4B 3ZV5A 1RVDA 4YI5A 5SICE 3OOWA 1NR7A 4OVKA 4UUNA 5D7BA 1R6DA 1W36D 1BVUA 1PS8A 2GQ0A 2JHGA 3PYMA 1YJQA 4MYCA 3HY4A 1DO0A 3LAWA 4BMSA 3ETNA 5DEIA 3SWWA 3PNMA 1PFQA 4C2TA 3AJ9A 4A8JC 3DE3X 3G2QA 4ND6A 4WXRA 5TMBA 2Y71A 1NNLA 2RI6A 1PV4A 1ECGA 3MXOA 3PKJA 3TE7A 1H05A 2BGRA 5G1OA 2WM3A 1T2CA 4K9MA 4WFIA 1KKUA 1Z4PX 5DASA 1QP0A 2Q5EA 1W35A 3IDAA 2CLEB 4BXOA 1B3BA 3TE6A 1PNTA 2HIAA 4BZQA 3OF3A 1E2KA 5KJFA 5LBTA 3UWDA 4CQLA 5B7PA 3HZZA 4FLMA 4H7FA 1RD4A 3NRJA 3T3GA 3TRJA 5DXJA 4D44A 4JYMA 2AE1A 2NO1A 2YRWA 2FTKE 3FD8A 4RGQA 2NSHA 3C6BA 1WLYA 1F0PA 2J33A 3NBYC 4FR5A 5EMLA 1ACJA 4FC6A 4HOYA 4ON9A 4REOA 3ZZNA 5LD2B 1KMIY 1EMDA 4CCSA 5D8DA 1QIHA 4GBJA 3B3JA 1FFCA 1Y81A 4FI3F 4IUBS 1YAJA 1KU6A 1AA6A 1F2DA 5G4KA 1AQYA 4GR9A 1J23A 4LE2A 2E5WA 2TMKA 1AKVA 4US1R 2G9VA 3BMXA 1QQ6A 1SXHA 2VG8A 2IPAB 4EVIA 5KOIA 3T7TA 3DBLA 3KOYA 1OYYA 2VR1A 3NVAA 4YTEA 4DWJA 5L7WA 2ZJ3A 3FMVA 3IUNA 1H1LA 5BR4A 4L7QA 4ND1A 3UWSA 5BMVB 4J3NA 3AUXA 3IQEA 3FDIA 2N75A 2L69A 3R5KA 4WXYB 3S3TA 4TTTS 5AICA 4N7MA 5C4MA 3JVVA 3VPGA 2OPBA 3TLCA 2OMKA 5IEBA 3IAFA 2VF7A 4QU8A 3NGXA 1J3CA 4I1UA 4M0UA 4Y1FA 5BYKA 1KQ3A 1XVTA 3KU4A 3CG4A 4QODA 3W3ZB 4XWGA 5JNLA 3DO8A 1P60A 3DM5A 1Z7YA 2VTEA 3GZ4A 4GMKA 4D4LA 4KAJA 2EKPA 5ESRA 5LQUA 3KXPA 4PZLA 1KOGA 5FUYA 1XB2A 4GLBA 1U0OC 1TJYA 1E9FA 4P98A 5H81A 3G2HA 1YHNA 1E2PA 4B17A 3AQ4A 4GICA 4E2YA 2I33A 2R6R1 3WRWA 1QZUA 3JQGB 1K9SA 1ZICA 3JCZA 2FAXA 1JQBA 4WK0B 3LHFA 2UVQA 4R98A 4AZ0B 3OKCA 4R2KA 5AFSA 5GY7A 1TIBA 1R6TA 2ZUWA 1EE9A 3L8YA 4DRZA 3HDQA 1M3SA 3DAOA 4QGGA 4GM1A 3M6XA 3G0HA 1MA3A 1PQPA 2PM8A 1P9WA 2OCYC 4B6GA 1LWNA 3U3ZA 4EMBA 4MEJA 4DE5A 2BTOA 3M89A 2GZHA 3HFSA 4ARUA 2FWPA 5EE3A 4IJVA 1NI4A 1P1RA 4PG8A 1T9BA 2NOAA 3IQIX 4TSFD 3SZLA 3IL2A 4CMAA 1BW9B 4B47A 1L5VA 3TFOA 1N25A 5HILA 1NVBA 2AZTA 2QYHA 4RBNA 1Y9EA 3I9LA 5CH8A 4BL5A 4BEBA 4CV0A 3OG9A 4UBIA 4BNDA 3K1YA 3ESAA 1JS1X 3GJ0A 1E6WA 3TH5A 5BUZA 5JR3A 1BHQ1 2V6BA 1UJNA 3EA4A 3IO3A 1JNYA 1M8KA 1QHFA 1F38A 5IN4A 1F0NA 1TB4A 2C5AA 3E4CA 1W75A 2VP0A 3NGMA 4D4IA 3SVTA 2AI1A 1RSZA 5HUHA 3WKAA 3C1UA 3C41J 2FEMA 2Q3MA 3FCYA 1KVUA 2GILA 3B1VA 1KKMA 3IBCA 2BT4A 2DHQA 4DAOA 2X42A 4B4KA 1PHPA 1JDTA 2H4ZA 4ZAGA 4Z4GA 4JR1A 3DB2A 3QU2A 3RTAA 2YXEA 4UEKA 4ZAWA 4ZXFA 3T99A 2XMBA 1V3TA 3D6TB 3DVSX 3OPYA 4Y6RA 2FZLA 2XXAA 4YJHA 3VSBA 1KIFA 5D7NA 3BX1A 1ILWA 3I6ZA 4UUPA 1QORA 1SXJB 2WT4A 4HQOA 5JSZB 1BGWA 3DL4A 2V7QA 5CB4B 4TMVA 1C5KA 2NU7A 2X76A 5AVXA 4HV4A 1Z0UA 2OYSA 2YMPA 1WZ2A 4JYCA 1TPZA 2BKUA 3HUUA 4BLQA 1X3LA 5JROA 1W5EA 2IUTA 1M0TA 4ZRNA 4Q4LA 4LWPA 1NT4A 4OYYA 3AFIA 1OKKA 4DWOA 2WWIA 3B48A 1R5NA 3IC5A 2ZXEA 3KQWA 1WO8A 5HRUA 1FSPA 3ZXUB 2AF3C 4W1QA 1WW3A 2OSVA 1SC6A 2YZ2A 2O5RA 3RB8A 1TFUA 1KZ6A 3RS7A 3MF4A 4Q1CA 3E81A 3ZV7A 4CUKA 4YV7A 4WQMA 1ZXLA 2VDWB 3G5UA 5HG0A 3THRA 3Q6NA 2Q4OA 3GYGA 3DLHA 2PEZA 2A9PA 1KY3A 1MT0A 1VZ3A 2GF2A 3ND5A 4JLOA 2XYQA 2IX3A 2HU8A 1DKMA 1KDVA 3D7NA 4PN3A 2B4RO 3IKTA 1GWNA 3PPIA 4PSVA 4EWLA 1X2EA 4Z3OA 2R6DA 4MWEA 5ITSA 3IQFA 2C8KA 2GM5A 2HWUA 4KVAA 3WYDA 4YDHB 4W6ZA 4X1KA 2XB2A 3JW8A 2OWEA 3PHJA 4EZIA 1L6IA 1GQQA 4O6VA 1UCFA 2H4YA 2PL5A 5K0FA 1GFWA 4ZVVA 4ZD6A 1C80A 1HDGO 1NUUA 1DL5A 2B0JA 3BB4A 3K20A 4I46A 4PG5A 2XPCA 4Q3CA 2F00A 5KEIA 3PE3A 4MKHA 3EQ8A 4QHTA 3O8RA 2BRUC 2JGIA 3CBQA 3UUEA 4LMAA 3ELDA 3F8WA 1Q0RA 1YK1A 4RVSA 1DBWA 2GBLA 3SMVA 4BWVA 3KT6A 4NMXB 3IAHA 3BH7A 3L7BA 4JMLA 2I6GA 4NYIR 4PYLA 4WESA 1A5SB 3OFND 4DMUB 5K3OA 1IUPA 1TPYA 4JITA 1NU6A 4RH1A 4DG8A 2I66A 1AA9A 4FCTA 5KQSA 5L4SA 1E5VA 5DTEA 1XXHE 3VYTB 3L9XA 3CZQA 3QHQA 4L08A 2V9CA 4HUJA 2J0VA 4CV2A 1Q84A 2WHPA 3BERA 3FUXA 1DTWA 3GMIA 5CNMA 2PSHA 1WSDA 4OA8A 2PLRA 3VNQA 2BH2A 4HNTA 4KRGA 1V6AA 1U4SA 5G40A 2BZGA 2VTVA 4ZK6A 1N0IA 5GZ1A 1EJBA 4BLWA 4C0AC 1QYWA 4LOHA 4MVJA 4AF6A 3K09A 2WB2A 1I4DD 1PNOA 2Q1TA 3T3MB 1SG6A 4EH1A 4JJ8A 3QUCA 3QY0A 2WRZA 2Y0DA 1XZEA 2NO0A 4LC9A 3O38A 3ZOZA 1Y3AA 2AC2A 4OSPA 4CEJB 3LUAA 4U0JA 3DAHA 3T15A 5HFJA 3TBHA 1U2ZA 4IQGA 1E2EA 1QIGA 1N92A 3VZSA 3CB4A 5GIOE 4JOSA 4K6MA 1LQUA 4O4JB 4AIIA 3EQZA 1YUBA 3DNPA 4I8IA 4OM7A 4ALJA 1A76A 1IB0A 2BHRA 2CKDA 1JBEA 1YQXA 2CHVA 1CZUA 2R8XA 3B6IA 3W2GA 5IJZA 2R6CA 5BRJA 3PXAA 5KVQA 3VAAA 3FFWA 5EZ5A 2GGSA 1CLEA 3RWBA 4KXQA 3TX2A 1K0UA 2CLDX 3FMFA 1JXMA 4TV9A 5LYJB 3ZDAA 2YZGA 1KSHA 3LECA 1U9CA 3QFSA 2C88A 1S2MA 2JFPA 4FHEA 1T5DX 1WUJS 2V7BA 3PUXA 2X6QA 3DD5A 5DOVA 4EPWA 3BQ9A 3A6EA 2YYSA 4NHOA 5CLHA 1Z2CA 2AG6A 3FZEA 5KDLA 1XD9A 5GV8A 1D7AA 2YV5A 3GXOA 2IWHA 2ISQA 1T6YA 3IQXA 3KZCA 4RA6B 2QMUA 5LQDA 2NV6A 3UK2A 2H57A 1ZCBA 3QLUA 5FNVA 1OI2A 4CG1A 1DJOA 4DILA 4E5SA 2I67A 4EW6A 1H0RA 2G5PA 1QCYA 4A3NA 3L49A 4AJ2A 2BZ1A 4KWHA 1PHRA 2AN4A 3SIPA 1EUYA 4EFNA 1A72A 1FDVA 2BR4A 2VTKA 3KTOA 4QU9A 4RHFA 1ANKA 1ZITA 3HWWA 1WD5A 1Q19A 1WHSB 2ZITA 3KM0A 1OAOC 3LJKA 2XQIA 3PJEA 5DHTA 1K6XA 5BWOA 5FPHA 5LJIA 3ZI4A 1GSIA 3K8QA 3OY7A 2BI7A 2MR6A 3PPYA 2G0AA 3WMFA 5A71A 1M0SA 5IS2A 3OLWA 1G3RA 4PQEA 2X0EA 5JCZA 1E9EA 2BGUA 3MBIA 2DR3A 1CDEA 2XCOA 3S1LA 1VP9A 3KDAA 3OZFA 3HXPA 5TF0A 3H97A 3OAAA 4B9AA 3K70D 1A77A 4K1LA 4WVFA 3TZEA 4BMNA 1XTKA 2CDRA 1RS0A 2Q2VA 4BFZA 4TTVA 4E5MA 1N77A 2Q3LA 5TR9A 3EOAI 3ROQA 2L19A 3JV7A 4IUDS 3KKNA 2FW8A 3IA2A 3VNVA 2CXQA 3IIIA 5CHYA 3TAUA 5K0JA 2YDXA 3QBDA 3JYNA 1EFLA 3B53X 1HRDA 1NXTA 1QAOA 3ABQB 2VH1A 4B7CA 1FRFS 2ZSEA 1YBFA 4MLZA 2OAGA 5BSTA 2V4MA 2EGGA 3MTIA 4GZ3A 4LJ7A 4OHZA 3SF8A 2ES4A 1LF5A 2JGRA 3U17A 4D4JA 3KLMX 1T0IA 1UAAA 3IUSA 2IYVA 5DM2A 4BNUA 4QUHA 1MC1A 1NVXQ 1P0IA 3DXFA 4OM8A 3SYNA 5AI9A 1A9RA 1DIRA 1RP1A 4I55B 4WXHA 5CFLA 1CJUC 1BCRA 3BHIA 3U48A 3HKCA 4CQNA 3FOEC 4ZALA 3VSCA 5I7UA 5K3SA 1WD7A 3RSZA 3JAMA 1MFZA 1SRQA 2V6IA 5E9AA 3ENWA 3ZY4A 1RWOA 3AVTA 3ZV4A 3EPHA 2JGDB 1ONOA 3WA6A 5KX5A 3N75A 4QXOA 1QWOA 5IM4A 1VTKA 2PJUA 4RKQA 3E3NA 1LRKA 1FBNA 1L9XA 1QGED 1T25A 2ZJ2A 3A8TA 3C8UA 4I50F 4XXHA 3TCKA 1RR6A 4QDZA 1UOEA 5DSZA 3VI3B 4AC9A 3H2HA 2LZ0A 3VJKA 3ESXA 3RQIA 3HB5X 2H92A 3K94A 1UXKA 4J0KA 3DWIA 4QYXA 5E38A 3D8TA 2C9CA 1F8YA 1U0SY 3RYHA 5B6PA 1YRHA 3AUUA 4GWGA 5AIBA 1SBYA 3SNKA 1HGXA 2A1TS 3IHWA 1YI1A 1PG0A 1VE6A 3RRXA 4D8YA 1GSHA 2IYPA 2KI5A 3FHJA 4FFVA 1IY8A 4QC2A 1UPCA 4Y2PA 3Q9SA 4GWKA 3IULA 1TLTA 3DCNA 1NQOA 2VBCA 1HF3A 4FIZA 3VU1A 5M29A 1TVEA 3KEMA 3EH1A 3PC3A 3EGVA 2ZUCA 4EB6B 3I5MA 4BEVA 3IUQA 4F21A 4D25A 2QTVB 3JALA 1OPXA 3O3OB 2BKAA 3JAKA 4KYIB 4PPYA 2B99A 3CUUA 3M4YA 3T5BA 4DQVA 4YFVA 2WWYA 1KQFA 3OY2A 2C2WA 4A73A 3E9MA 4FPXA 3KWJA 4PQGA 4YXWD 4CL8A 3SZMA 4GQIA 4YV1A 5I7EA 5IW8A 2RE8A 2EYUA 1TFRA 3FOBA 4M1SA 3FMIA 4JJ6A 2C3UA 2RHMA 2OQVA 2PD6A 5BUQA 3IEKA 4I8XA 3L40A 1G8PA 1Y7LA 2BY4A 2EC5A 2YXBA 3PP8A 1J20A 2G08A 2ZTHA 4HLNA 4NBSA 2XUQA 2YWBA 1ZH6A 2X22A 4F5ZA 5A02A 1CQWA 5ES3A 5JNTA 2Y2UA 1RWXA 2UZ4A 3D3WB 3UT0A 5E7MA 3UTCA 4FFPA 3E9NA 1LRJA 1A97A 1J1ZA 3VNSA 4BFLA 2O7SA 3GH1A 1TAQA 4RJ2A 2ZJAA 5DHAA 3STUA 1BX3A 3B38A 5GJBA 2QYSA 4GLFA 2OWDA 1AUQA 4ZOLB 1E1YA 3O03A 2WTUA 4FP9A 2VPYA 3A1WA 3CJRA 3IOYA 3ND7A 4G0YA 5JSUA 4L0QA 3DGEC 1UODA 4Z7OB 2XTNA 2VBGA 3MBKA 1E1DA 5ERGB 1CRQA 1I5RA 1VBKA 3OP1A 2ZJ5A 2B92A 2PX2A 3GR6A 2QX8A 2O3JA 4X6YA 1PJQA 1P33A 2W6QA 3ZU5A 1ZGJA 1CJBA 2H2GA 1XLUA 4CT0A 3F7MA 5K8LA 1L5HB 4A2CA 1WVGA 1AK1A 1V11B 4BLRA 4Z4EA 1FP2A 3MC1A 3Q41A 3U7RA 4PVDA 1A4XA 2OE2A 5AP9A 4RGVA 3Q3CA 4CF4A 5CB8A 4B3JA 1UM9A 1CJKC 1WSBA 1Y5MA 1GY8A 1ZUNB 2E55A 1XSEA 2Y4NA 4FLFA 4IV8A 4JX8A 1SCKA 2XLCA 2COUA 1G5FA 3K9BA 3PDWA 3LC2O 4J2OA 1VJ1A 1SAYA 1EFTA 2GSWA 4QNRA 4RA9B 5K0NA 3FSJX 3W4IA 5IT0A 1CJCA 3C6QA 4F56A 1QE0A 2Z9BA 4AY6A 1NYTA 2I99A 1YR6A 4OMCA 3HS3A 4II2A 3CO5A 3GK3A 1C9JA 1Z2PX 4OXKA 4BPBA 3MHTA 3IIMA 4U9UA 4ACBA 4ENWA 2W2QA 3PPVA 2RSLA 2JC3A 3PIIA 3DOCA 3UG7A 4HQFA 5IYZB 4PYRA 1Y1KE 1RFGE 5A9SB 1GD1O 1K89A 1VCMA 1RLTA 3LIIA 3UXHA 1ZOPA 1LSJA 4HAYA 4EFDA 5KINB 1X1EA 3AEZA 4TLCA 3KUDA 2ZBQA 5TEVA 5E7IA 3DQPA 3I9KA 4CZ2A 1I24A 4R1PA 2QVCA 1D07A 5BWNA 3FR8A 4TOIA 2ETXA 2QI9F 1Q6YA 2ZWOA 5DGTA 3JZIA 3SQMA 3IDFA 5REQA 5J1SB 4II7A 1WUTA 2AFHA 2WDPA 5CFOA 1P9OA 1DEKA 2Q2QA 1JKMA 2YVLA 4BZZA 4YRFA 2VOJA 3L0OA 4M38A 3U81A 1DSSG 2C4NA 3PE6A 3WHPA 4LMPA 3BWEA 4BLVA 3LA6A 4E7OA 5JY6A 4XDHA 2QLFA 1J5PA 5KTYA 1SZPA 2FVXA 2SECE 1URPA 3E6AA 5HMLA 4KUGA 5CDFA 2MSWA 1X7GA 4EGFA 3SSMA 3UGQA 2NO5A 3W2IA 5ILGA 1LCIA 2A88A 5AQEA 5HNKA 2AJCA 3SN6A 3PXDA 1NJGA 4TMYA 5LLSA 2UUBB 4G84A 1N1MA 2YW9A 5F7XA 3TL2A 5JD6A 2QGNA 3PUWA 4LXYA 2P1ZA 5IK2D 5E4JA 1JLLA 1SVIA 4NCJA 4G8DA 2IHBA 4MPRA 3NTVA 3QVGA 3E5HA 4Z1MD 1JIVA 1ZOIA 2OV2A 1GPYA 3D0OA 2PYZA 4MUKA 2DWQA 1RIFA 1HTBA 4WD3A 1WIWA 2JARA 3FPCA 3ZCTA 3MGGA 4RF3A 1O9HA 3Q87B 2DHRA 3KTAA 1EGVB 1V5GA 3SR4A 3W9UA 1QTQA 1UKVY 4HS9A 2JJ8A 4MV7A 2AWNA 5KHAA 1UXHA 5IKEA 3CURA 1MBZA 4KXNA 1YI0A 4JP2A 5C18A 4DEYA 2GK6A 4J07A 3OX4A 4N12A 2BM0A 2II6A 3U62A 1FMJA 1E3TA 2ZR7A 2PRSA 2GBLC 2GM3A 3L41A 2BL4A 4Y2RA 5E7JA 1KR5A 1D1PA 4OXRA 1CJVC 2IFTA 5TT0A 2NT4A 1P4AA 2Y67A 3LLMA 2CB9A 2VJCA 1EM6A 3R3VA 4X45A 3LC7O 5I9SA 1FC0A 1IN8A 1Y8RA 2SKDA 3GW8A 3LNTA 4R2WA 1TW3A 1DX4A 3A9CA 5JEDA 5BN5B 4OQNA 3WQSB 4ZODA 5FEUA 2JJ1A 1E89A 3GZNA 4E15A 3JVIA 2FFBA 2Z6VA 1E7RA 4BU0A 1L7EA 1XXHB 3O8OB 2L2QA 4BE4A 1Z8HA 3KSZO 3TIIA 1L5QA 5DH9A 3N6RA 1QDEA 3K09C 4N6OA 4QYIA 1CUVA 3G2NA 1T0PA 4HDKB 3ZHZA 2BIFA 4NABA 2NXJA 1DP4A 5GOTA 4A9AA 3CF2A 3W06A 4FSDA 3L77A 4RHUA 5K3FA 3DE1X 4LRSB 4G4GA 2B3DA 2IELA 2PUEA 2DFKB 4HLQB 4M9UA 1T13A 3C3WA 1KQGA 2IPMA 3SC2B 4ENPA 5FR1A 5HJEA 2OCKA 3G9TA 2G72A 4XQ9A 4MHTA 3LX4A 4K6FA 2VJMA 2DF8A 1XZIA 2Q29A 4I3HA 2XE7A 3BQMB 3PFWO 3U13A 1O6FA 3QVJA 3B6ZA 4CQJA 3EQ6A 3K35A 4WOCA 3E22A 2QDKA 3B1XA 1VRCA 5H3HA 3B51X 2EZ8A 5GADl 5EJ9A 1P18A 4UNSA 3IBSA 4G5RA 4QTYA 2O54A 1HE3A 4PQFA 1KAQA 5B53A 4MSUA 2B4KA 4FHGA 3RGWS 4HKTA 4OQEA 1L5OA 1WHTB 2Y92A 1RMQA 1DCKA 2EL7A 3PV0A 5B3JC 2N42A 4OXXA 1N9GB 1TZMA 1A8PA 3B5JA 3MGKA 4FYPA 2X5XA 4ZEVA 2A67A 1XBTA 1UJ2A 1T8RA 4GOND 1XNQB 2O2IA 3RV4A 1P4GA 3FDZB 1UF9A 3MELA 3ROFA 2YZMA 4LJLA 4PYMA 1N2ZA 4V1CB 3TDMA 4PZYA 5HQTA 1AMNA 1H66A 1T4CA 1H42A 1P8JA 1V9LA 4UTZA 3MXTA 1N6RA 5KYYB 3WYBA 1EFPB 1DC4A 2HBYA 2D8AA 1SBZA 3H1EA 1R88A 3Q98A 4H0CA 1G0NA 2ZI5A 4QLAA 3UHJA 2K6GA 5JS2A 4BU1A 4HMPA 3UK0A 3G0DA 3S1SA 5KVVA 1G6Q1 3N2NA 4DIDA 5BVHA 4DKJA 1AJEA 3IDOA 5BR7A 3KLOA 1Z5UA 1UK6A 1CUGA 5TQJA 1YOVB 5LOVA 4R9VA 2A5YB 2Y9MB 4TTIA 1GSAA 2XQKA 4XM0A 3CC8A 4XJTA 4Q02A 3MWDA 1D2NA 4MQ6A 1DC7A 1UBKS 2VNJA 1N3YA 1F9EA 3A2MA 3GAZA 1IM2A 4R0NA 2NT3A 3U7JA 3R3HA 2RK4A 3W9BA 1MV8A 2A86A 2QR5A 2ZZKA 1ISFA 1MEJA 5C2JB 1HFEL 2BTQB 1BHJA 2QW1A 4TZ6A 2CMGA 2GLTA 2GOYA 3A1VA 3P0EA 3C8ZA 1VKZA 4HHEA 4WEOA 4WZZA 5EIFA 3GRKA 4NK4A 4BRZA 1VCOA 5BSVA 1N7GA 4O4LA 1LBIA 1RJGA 1ZGBA 2V9ZA 5ITVA 1CF9A 4ILEA 1IFXA 4HXEB 4F7DA 2QNIA 1B0ZA 2XNDA 1S0UA 2ZSKA 5CFNA 1G5TA 2NAFA 5K0LA 2W4MA 2JATA 4PQYA 4IV0A 2I34A 1H5QA 4OYHA 1KYVA 2C00A 3NW9A 3TZQA 2YHUA 3ZUGA 1NVVR 1OXBB 2QUAA 5DW0A 3IDZA 3WHKA 3N3AC 4NE9A 1J1UA 3EZGA 3S28A 3L01A 3ZW7A 2VBFA 4X64B 4LOLA 4F4HA 4XIJA 3WMXA 2ZVDA 5FHQA 4F93B 3OECA 1RZUA 4AZWA 1EJ2A 3EGDB 4AU1A 4FYMA 3HRHA 4Y2GA 1WSAA 1CZNA 1B8VA 1FB5A 4DLXA 4IVNA 4K46A 2VSOA 1P74A 4WLUA 2RHCA 1FLAA 2VHZA 4DCNA 2IEGA 2FSPA 2O1EA 1AM4D 1WUHS 4C20A 1ORWA 3NX4A 1UPBA 2FWNA 3B78A 3HCEA 5CVVA 2WU3A 4U00A 4E88A 4PAMA 2YVKA 2WWVD 4FZJA 5HKAA 1GLGA 1TUBA 3DBRA 4AJ1A 2YVUA 4EHAA 1UOOA 4K28A 1LLUA 2QRMA 4ZJZA 1PL0A 2R9VA 2JFZA 2PRZA 4RPLA 3JWIA 3O9MA 5AUPB 1M7GA 2FWJA 2OO5A 1ADYA 1RTKA 1T3TA 2PK3A 2WIGA 3KFXA 4H7PA 4YMHA 3OZ7A 4CM3A 5ICMA 5FKJA 4S1OA 4BKQA 4OQZA 1CY2A 4C5AA 3CPJB 4ZCSA 2G9UA 1TTTA 4OY3A 3ZGXA 2A2ZA 1RHKA 1H1LB 2PL9A 4UTOA 3VVLA 4BMYA 4D1YA 1V96A 3LA8A 1M6HA 2PBZA 3IUMA 3JQRA 4IZIA 4O0MA 4O2AF 5FTMA 4FBLA 3T3PB 3H84A 3I6MA 2WJPA 4LXXA 3CEHA 2G7ZA 2VDNB 4BV9A 1PFUA 4EW2A 5B3KA 2AS0A 1C9DB 4HQNA 3K0FA 1YU6A 4J0CA 3DZGA 4U0KA 4ZEXA 2ZBVA 1ZM2A 3ROKA 1MW8X 1YR3A 5IAGA 2GPWA 3S29A 5B57C 1SUPA 5LMNB 4X8OA 4QXMA 3OJLA 4NXNB 1C8VB 1KF0A 3G1WA 4GQBA 3WXMA 3PLNA 1U3TA 4ZI3A 4AIRA 3QU4A 2O7RA 3GIDA 4JVNA 1GRVA 1NNUA 3ZWXA 1IQRA 3CMCO 2FXVA 3B70A 2IS2A 2AEMA 1JLMA 3NM5A 1V8FA 4DJ5X 1NC3A 2I6SA 3TKLA 1CKEA 2RBGA 2EZ9A 2DCMA 3TM4A 1WXHA 4D98A 4EG3A 3NDJA 4B8ZA 4KITB 3QVMA 5BNZA 2QU8A 4JBYA 4WJKB 3V7FA 1N2CE 1VMAA 1JKJA 4HG2A 3OCVA 5AUQA 5CCBA 1E9SA 2I65A 3V7NA 2GH1A 4BHTA 2XKAA 3LTNC 1A4IA 4W82A 1T2VA 3T1HB 4NNUA 4UFPA 3IAS1 3BK7A 5TARA 2JIZD 1SCDA 1J90A 2PCLA 3RSLA 1C81A 2B94A 2VRBA 1I4TD 4HDMB 4PGFA 2PLFA 5KYUA 2GCIA 4E5YA 1R37A 3ADBA 4N49A 1A8IA 1T15A 2HN9A 3BEDA 4FGWA 4IYJA 1GYQA 4L72A 1TTHA 5F35A 5L7TA 3JD4A 3TQTA 5JD3A 1YZLA 3HBNA 4Y2QA 1YS2X 1BKSB 2H16A 2IW1A 2VYNA 4WERA 3EUFA 4HDQB 1RM5A 2I6QA 4IEEA 3PXGA 3RKUA 3TG2A 3D6VA 1R00A 4Z9FA 4ZIRB 3P94A 4H6PA 2O5EA 2GVDC 3IALA 4KP7A 4EHIA 5B4UA 1H4SA 4E0BA 4IHJA 2PXHA 1FFWA 3QY9A 2IYXA 1M34A 1DMRA 3H4MA 4L74A 4QDKA 4DLRA 2G4LA 2HU2A 2JFOA 3Q3VA 1QONA 3R3YA 2J4FA 3DTVA 4BNDB 3ZQUA 1K7EB 4GSLA 2YHSA 3OUUA 4DY6A 4COKA 3ZCQA 3OUZA 4KJXA 3VR4D 4W9MC 2QHXA 2VAXA 3AR2A 1EQAA 1WB6A 2WIJA 3RHSA 4XFJA 1YC5A 4C2UA 3WDKA 1ZVKA 3EAGA 5BVGB 5FT9A 5I9NA 4QQFA 3U0BA 4NCKA 3OM1A 2IHNA 1QRSA 2CZCA 1LH0A 1RXCA 1VRVA 2FPLA 2Q6OA 2VXCA 1DKOA 3MT0A 3FTFA 3OH8A 1OAAA 1OXKB 4R6XA 3T5PA 2F8LA 3LDAA 2RH5A 4Z0NA 5CG2A 2WBLC 5ADVA 2C7VA 4L5AA 3H11B 2XT6A 4LY0A 5DBIA 3RYCA 3WL6A 1WY5A 1Z0FA 1PLLA 4JODA 3C24A 3A58B 2PMEA 3UZUA 3UMGA 3GFOA 3R7WA 1EESA 5IKOA 1JTFA 1QVVA 1YAHA 3PQDA 2OV1A 4M37A 4RPCA 4GPZA 5K0ZA 3NJRA 5TE9A 4JK3A 1M2VA 1TKBA 3IHTA 3I53A 5C80A 3NHSA 1E0DA 3H2SA 2GNAA 3B8EA 5CIQA 4BKMA 2VUSA 1CQJA 1G17A 3JQAB 1OFTA 3EHEA 1H2EA 3O90A 4IJ5A 4C3UA 4YPFA 1EB8A 3EVAA 3LQQA 1MEOA 3QHPA 2OB2A 4G4IA 5FL7A 5C8ZA 1BD4A 3DTNA 3H5RA 1I94B 1WB4A 3QI2A 3AYZB 4WKPA 3DXYA 2WD8A 1TJ5A 4HAVA 3GG2A 2PS0A 4X93A 5HZKA 1MJFA 4LVOA 1K7XB 1YVPA 3K9GA 4ARBA 4WLFA 1NXPA 2HJGA 4JQOA 4RE5A 1HDOA 1IBSA 1TYAE 3GCZA 3NKLA 3C1AA 3K73O 4ISCA 3P5BA 1VIYA 4P93A 4UBKA 4RKWA 4TV8A 4X1KB 4XVHA 1MRSA 1E9VA 1N6IA 3P5SA 4HWOA 3BK1A 4I14A 4OHPA 2IOFK 4QO8A 2P9HA 3VDRA 3L0IB 2DPMA 2JK1A 5TQ0A 4PFJA 1FZTA 4ZU6X 1Q7GA 1V1MB 1PX0A 5CU7A 1XIVA 1EYZA 4HYQA 1NG1A 2EWVA 2RJOA 1P2VA 3GRZA 3IA7A 2E87A 5FD8A 1J97A 1NE7A 3BIOA 5GJWC 4J0HA 1ESMA 3OSUA 3OLYA 2H1LA 1RLJA 2AHOA 4MO2A 4H3HB 2CSXA 5DNAA 5HIKA 2ECFA 1YKGA 2PFKA 3TLYA 4N39A 3OZEA 4W5WA 1K08A 1ZGCA 2KLBA 5TRTA 3CLVA 3D2AA 4WWHA 2OM2A 1PP4A 4RKRA 4LGYA 1M54A 1DUSA 4Y6GB 5TJ9A 2OFXA 4E4RA