3ANYB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and (r)-2-amino-1-propanol
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How coenzyme B12-dependent ethanolamine ammonia-lyase deals with both enantiomers of 2-amino-1-propanol as substrates: structure-based rationalization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Ethanolamine ammonia-lyase heavy chain
total genus 71
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3anyB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3anyB02
3ABSB 3ABRB 3ABOB 3AO0B 3ANYB 3ABQB
chains in the Genus database with same CATH superfamily
4XSGA 4FWBA 3TQSA 4H4CA 3C3PA 5G41A 4C4ZA 2Y4OA 2ZVPX 3QVGA 4ERNA 3G13A 5KB3A 3B38A 3P9YA 5L7YA 1B1CA 1YUMA 3ZUGA 1AF4A 1P29A 2QP4A 1MC1A 1XQ9A 1H23A 3LNTA 2FMUA 3CWCA 1AT1A 4MVXA 4TRJA 5LBTA 1P5HA 1ZI8A 5J2TB 4KXYA 2WU8A 3RF7A 3WLLA 4DB2A 2D5BA 2AQHA 1FRQA 1RPNA 3PD0A 1VPTA 5KZMB 2DBRA 1XU7A 5FI3A 1W6UA 4FGZA 2JJQA 2XUJA 4LDRA 5ALEA 4BGUA 3ADBA 2I6FA 2UYHA 4CL3A 3U4DA 1N5DA 3VHXB 1QBKC 2YHSA 3WADA 1XZQA 4UQOA 1ZNYA 3F7OA 1SHJA 4C01A 1ZM3A 4RHXA 4HO1X 3CZMA 4JMPA 3HKCA 4LVOA 1EESA 1DKRA 2R6JA 5I8ZA 1F0PA 3GJRA 4N8EA 4X7MA 4IJUA 3CH7A 3RASA 1Q19A 3L7JA 1YRAA 3DKRA 1FDWA 1WMBA 3JD4A 4JGIA 5DE3A 1WU8A 4MV5A 5CB4B 5LP1A 3QUCA 3PBKA 1QBGA 3F1KA 1A4IA 3E0QA 4AW9A 2CHVA 3RS7A 1A5ZA 4V0LA 4QPZA 4ZAWA 5DFAA 2E82A 3N1UA 2R8YA 4F7DA 3CCFA 2XLCA 3QWAA 3EPPA 1FXSA 5C1PA 3KG2A 1CY4A 1MOPA 1V9LA 2XXAB 4Y6GB 3AI7A 1F9AA 5BUSA 1N78A 3GCGA 2UKDA 3TB4A 1U80A 3LW7A 1BCRA 4V02A 1I80A 4MGKR 1J9GA 2SICE 1DXQA 1ZOLA 4ENSA 2Z09A 5CXXA 1B8PA 4KDRA 2MMCA 2GEBA 1Q0TA 3ZY4A 1XXLA 3BFVA 2XT6A 4EQ6A 5COQA 3SJUA 2G72A 1NR1A 2Q5LA 3DPSA 3VNUA 4YT8A 4M7PA 3T7JA 2AGVA 1KBQA 3TKLA 3NBQA 1CVLA 1PGJA 2PTGA 3WKEA 3ZZMA 2R8EA 1OTYA 1Y7HA 2OHGA 1EVEA 2NSYA 3I34X 3RNLA 5H83A 1Z37A 4LHVA 1SVOA 2Q4EA 1NJ8A 1DXYA 1WUIS 1GZ6A 2IJGX 4I7EA 4JUCA 4TRRA 1YR7A 5DGIA 5HFAA 1ZY2A 2H4WA 4BS9A 4HEQA 1AQIA 4UU7A 5IDYA 4MPRA 1G291 3KLOA 2BFDA 2Y9PB 2WTAA 3HHEA 4CQJA 1PQUA 2VHEA 4EPVA 3O8QB 2OCYC 1U2DA 4RZIA 3RS9A 5L3VA 4YHHB 4HDNB 1GRNA 1IULA 4WNAB 1CR4A 5DCLA 5B1DA 3RSQA 3SVLA 1RWBA 4ZARA 4R3UC 4UE3S 2QHXA 1TTPB 2V9ZA 3DL4A 3NDRA 4QGBA 1SELA 4CETA 3PVZA 1A97A 3H0CA 4X24A 2W00A 4C7KA 2G63A 1CX9B 3H5OA 5DGXA 4DUPA 3I2YX 1ZJ6A 2H3HA 5MFPA 3R0JA 2OM6A 3G9UA 4Q1EA 3IQWA 3RQSA 1RKXA 5L3QA 4S1OA 3CNQS 5C5IA 2VQSA 4CJXA 5K6AC 2BFCB 3E81A 2VPQA 2FWAA 3HYCA 4G09A 4UHBA 3C87A 3LC7O 1ENZA 1GZDA 2CEKA 4X0EA 3ZXIA 3FAZA 4OIFA 4Y1GA 4Y9SA 1EEHA 3AILA 1MABB 1T1EA 1PEYA 1XMPA 1ZK4A 4URWR 4ZOBA 1H0RA 1I4LD 3D5EA 1F2UB 1G6OA 3GO4A 1HFJA 2DUWA 4JLMA 4URUR 4WEQA 4LRWA 3LCMA 4BPRA 3A4IA 3EF1A 1TQHA 3KQLA 1JPJA 2C8JA 4L3VA 3TLKA 4HAIA 3FVWA 4W7HA 4EJFA 2DBQA 3V46A 3PNKA 2Q8PA 2K87A 4BP8A 2QGFA 3E3AA 4GLOA 2FPGB 2AN9A 2VT3A 1CIJA 2XWQA 4ALMA 1PS0A 4OQFA 4PAQA 1B23P 1WUTA 1Z08A 5C3UA 3B6KA 2ZZKA 3KBBA 5HKKD 5HOEA 2BMEA 4MA4A 3SOZA 1KEVA 2D5CA 5IEJA 3KTAB 5B1SA 3EPKA 2XADA 3AERB 3DHWC 1P0QA 1W85B 3R0IA 1E0KA 2I67A 2O8NA 4LXXA 2H63A 4LJ8A 4LWZA 4RQUA 3KJZA 1I6KA 1WB9A 2MU1A 4CDMA 1N5LA 1SOWA 3PPXA 4QLAA 5JWHA 4KRFA 3BMCB 1KEWA 4F9GA 2Q5HA 1NYLA 3UFXA 2O0LA 2BI7A 2HU7A 2UZ1B 1I7PA 1XCOA 3IAS6 1NWCA 4RK7A 1G8YA 4RQTA 1NXSA 5AJXA 1B26A 3E15A 3WZMA 4C78A 2R8XA 4RS4A 4C7VA 4F8JA 2QN2A 3I8SA 5GONB 3D6HA 2WD7A 3IPAA 1QUFA 1RM3A 2QL5A 4I36A 2H1LA 3BKWA 3FSGD 3HKEA 4F96A 1ZVQA 4Z0TA 2G08A 1UF9A 3DMNA 1NIJA 1PUXA 1IY9A 1C7EA 1NL3A 2AV6A 3NC1C 4HR7A 4NFYA 1UJCA 2BT4A 5GINE 2A9JA 3FTEA 4I5GA 3BTVA 5C3MA 4U5QA 3QM1A 3AHEA 2PUTA 3FCCA 3F3KA 4QEKA 1H2BA 5K0NA 1WMFA 4K81B 4AX4A 1I9GA 3T9BA 1MZVA 2CFTA 2CDBA 3N0RA 4N3AA 3EEBA 4YC7A 3HXOA 3TUIC 1FU4A 4YIKA 4WLVA 5IUKC 1CYDA 2YRFA 3MT8A 4WXEA 4BMSA 3BRWD 1H2HA 3CLVA 2WB2A 1SBTA 2RGEA 1A8QA 2A78A 3IH5A 4OHVA 3R7WB 4YYZA 4KQCA 3TOVA 2JGFA 1G2IA 1RI2A 3R41A 1KRWA 1JU9A 4YJDA 2QUKA 5T3YA 4YCJA 4QG3A 2QI9F 1BS2A 4CKYA 2AE1A 2H1OA 3HCOA 4JFRA 1X8JA 2QAIA 2DUUA 3W2EA 2PX2A 3ZY2A 4CPDA 1P3Y1 3PNQA 2Y0PA 5EE0A 3O2SB 4CKBA 1OIVA 4AZWA 2NIPA 3TVDA 4ZZ2A 4S12A 3NWEA 1NXOA 3FYUA 3V5NA 3DHYA 1OZFA 1NASA 1VJRA 3JQGA 1BCRB 1Y5LA 1TF2A 2C8KA 4Q9DA 2NXWA 2FFRA 3MAAC 5IG2A 4OHXA 5GZ3A 1H4SA 3G23A 1HOXA 1TF7A 4FMCF 4BLUA 3JSXA 1CQZA 1U0LA 2CMGA 2OXEA 3QFHA 4IZ6A 5AJWA 4OI1A 2J7PA 1K89A 4RVNA 1NHNA 1Y4UA 2F00A 4NABA 4GWKA 4PHTA 4V0QA 3ER8A 3QU4A 2XMPA 5M34A 4WZBE 1OYWA 3WGHA 3HVUA 2HYDA 3LDFA 3PXEA 3RI3A 1KZYC 2ENUA 4OUDA 4CR8A 4IIJB 2I1VB 1QE0A 2FN8A 1X9IA 2HDOA 2HREA 3PDUA 4LZJA 2OBFA 5FPSA 1L1FA 4EPXA 1ZHFA 2VHQA 4II7A 2WVGA 4J8PA 1X3LA 1JTVA 1W35A 3GLGB 4BMVA 1Z4LA 1PJ2A 1NLYA 2A9KA 3OC6A 4BJ1A 3H5WA 2B92A 4F97A 5THQA 5AT1A 1SOVA 2Q3MA 1RWMA 1D1SA 2IEZA 4K3VA 4MGZR 4AXBA 3R7FA 4MR7A 3TQCA 5CJJA 3RB8A 1H05A 3CISA 5FWAA 4BJ3A 5IMBA 5JPCA 2W6IA 3TVTA 4AM8A 2NX2A 3F73A 4QOIA 4TMZA 2GT1A 2ZJYA 3A8TA 1UWKA 3SF8A 1IQ0A 3H5NA 1NW7A 1EP1B 2HSGA 4KVAA 1EWTA 2Q6LA 4UKDA 4RE6A 2QRMA 1ZKDA 5T41A 3GUCA 4R51A 4UEKA 1UP6A 4BTEA 3NGLA 4WACA 3FCSB 1MHTA 4RBNA 2R2GA 1NJ6A 1TJPB 4QYSA 2WMOB 2IV7A 1KYYA 2OVBA 3RNOA 1E3QA 2WSYB 3KT3A 4DR4B 1SU6A 1TT5B 3C7CB 3OLQA 3ECSA 3IUQA 3AC0A 4GKBA 1H1DA 2AH5A 2NYUA 3KFVA 3CLRD 1GQSA 2V98A 4OHUA 4E2ZA 5I3CA 3T7CA 5JSZA 1REQB 4KNYA 1SCQA 2CXQA 3OZEA 1KDZA 1EX9A 3MPOA 3NFYA 3TQ6A 4R9VA 5JHHB 1ONSA 2CO9A 3ZE9A 1RS0A 1FDVA 1M2GA 4R8KA 3UHPA 1O9GA 2GUGA 2O06A 1UZUA 2WBLC 1XN1A 2PZAA 3CC8A 1OLOA 2NUPA 1MGOA 3VDMA 1Z5ZA 4V2IA 4TM7A 1ULBA 2JIZD 5K51A 4BDTA 3OAAD 5EP4A 4B85A 4Y8VA 4CGYA 4D4IA 2BFAA 3VVCA 2HO5A 1TO6A 4BO7A 4QT4A 4X62B 4TQUS 4H7KA 3BMQA 4OXNA 3ZIUA 5EFOA 2YYAA 3K9QO 2P3LA 1ZWKA 3E7DA 1WTAA 1TYZA 1HDIA 2QRPA 3NHUA 1XFAA 4CMKA 3VDXA 1KF0A 3K2BA 1BVYF 3FGZA 1IWOA 1UR5A 1ESEA 4KKVA 2Z2JA 3O8NA 1FQJA 4UW9A 1M6EX 5LFAA 4M6WA 1W6RA 4OLJA 4DIBA 3JQ9A 3HEAA 3PL1A 4MHSA 3LA6A 2XKKA 1I33A 2X0IA 1HORA 1NMZA 1Z5GA 1OYVA 1QVRA 4MLDA 3PFBA 4WECA 3SR0A 1M2VA 1QMPA 4CE6A 5JASA 3EPJA 5CAEA 4I9HA 4QBKA 1L5GB 1D09A 1XBTA 1IBLB 3FM9A 1V4VA 3OY7A 3T7DA 3BJEA 3CGWA 3N53A 4MUHA 1PUJA 2NVUB 3P19A 2WT4A 3PX7A 5FWYB 1IHPA 5B6IA 5J2TA 2BFBA 4FUQA 4COOA 4BGDA 3QBTA 5K8TA 4RIFA 2FSVC 4WV3A 1CE8B 1VJTA 3O3OB 3RAPR 3OPQA 4EITA 4AB1A 2F4VB 3HB1A 3LQYA 3QV1A 3DUFA 4XB2A 2PEZA 4PPGA 1T34A 2HU5A 3SYTA 4IZIA 4J1NA 1LRKA 3R5TA 4ZXFA 4D9EA 1VLZA 1BDBA 1G8PA 1W30A 3JYOA 5AXAA 2YH2A 3K5IA 3ASZA 1F4LA 5IM4A 1CNMA 1QRSA 1KAGA 2VDUE 2W6JD 3AONB 3TSZA 1L9XA 2V6MA 3MRSA 1A5SB 1JJVA 3QBEA 3TMMA 4GXQA 3GLUA 4NYIQ 2IE0A 1XRNA 1JQJC 4YQYA 1IAQA 5C46F 2OBLA 3DE2X 4IO1A 5KPDA 4HG2A 5ECGC 4EARA 5L4LA 1JHZA 2ST1A 2OBBA 4AU1A 3ADDA 1SXJA 3HWSA 4Y60C 3BL6A 4ZQIA 1OHHD 2EL7A 2HZBA 3GJ7A 2PT5A 1Q0UA 3Q0EA 3LUDA 5HCUA 2RBKA 2O9JA 4WW0A 4XUDA 1B14A 2N1MA 1NBEA 1YS9A 4HT3B 1U90A 3E22A 1HRKA 4FMCB 2P4EA 3JZMA 1ZQ9A 3ZWOA 2YFYA 1D2GA 4LGCA 1NXVA 3MF4A 3BWEA 3B8HA 4PWZA 3BGSA 2P8SA 3AF5A 3P9SA 4OHBA 2C9ZA 3H86A 2VZ8A 3M6AA 2CXNA 3AKDA 4QUAA 4B4VA 4FB5A 1I32A 3EEQA 4XFJA 3RUEA 4PTZA 2ACVA 3DE6X 3RFXA 3ODPA 2V8OA 5JH7A 4PBSA 1G59A 3ZQ4A 1KI1A 2AHRA 1DC7A 1MO4A 3BJRA 3DVQX 2BE7A 1E2NA 3NH9A 4N18A 1TUGA 4UDXX 4M4SA 2PLFA 3SHTA 3NOXA 1O4WA 1XQYA 3TFWA 2CB0A 5AHXA 3OIUA 1S02A 1Z68A 4QFDA 2HPVA 1QJ4A 3AIOA 3VVLA 2PX5A 1C41A 3EY4A 3LCUA 4QAQA 5LQKA 1MT3A 3LWZA 5IS2A 1U3VA 4YRFA 1ZK2A 1E3DA 3LDHA 1Z0SA 2G76A 2IPNA 1FRFS 2GNPA 3GIWA 1QKKA 3AESB 1OI2A 1PSZA 2JLRA 2HF2A 1DUVG 4MR9A 5AXCA 3HSYA 1QK5A 5AOVA 1RAFA 3ONEA 2LVBA 1A9TA 2X1LA 1ZPDA 2JVIA 5AVQA 2OCLA 1JB9A 3ITEA 4ZT6A 5DM70 2H1SA 2D0PB 2Y1XA 4X6LA 3UAXA 1S7GA 1YS1X 1O94A 1NR7A 2DHCA 4US2R 1CFZA 2VK4A 4KZKA 3BDIA 3DVLA 1AXGA 4KWEA 3O95A 4GVPA 3GVIA 5IJXA 1Z38A 1U0FA 3EFOB 1R6TA 2B8TA 4D9KA 5IULC 1OH5A 3EH1A 3PUHA 1JQLB 1Z4IA 4C04A 1KYIA 1PQYA 4AJLA 4B17A 2EJTA 5A03A 3QMPA 2JEZA 5A3JA 1FNSA 1OW3B 1J0XO 3SGLA 1X39A 1AZLA 3V2GA 1SXQA 1AGNA 1BA2A 5CJ2A 2PMEA 2XMQA 3F5MA 1C81A 3O7MA 3T34A 2DCUA 3V2HA 4OKIA 4YRQA 4JEIA 5LWQA 1L7PA 1HRZA 1CS0A 3NEPX 4WLUA 1XFDA 1ZW6A 5TF0A 1BHO1 2OBXA 1XWWA 3OA2A 4LWPA 4EKEA 2BF7A 1KBOA 1Z8FA 2HBRA 2ZRLA 4UDOA 4F6LA 4XYLA 1IRXA 1Z7YA 4K6KA 4PG6A 1FYXA 2HGZA 2WWXA 3OLXA 2H2WA 1YZYA 4M1TA 3VR3D 5IBPA 1QVZA 1ZW1A 2R6HA 3W8NA 2DBZA 1ULTA 3N7UA 2LEFA 2AFHB 3PITA 3RC2A 3SIXA 2K4MA 3PHHA 3IQXA 4FYYA 4DIOA 1LK5A 2HUPA 2AJLI 3Q40A 4FZ5A 2XZOA 3BD6A 1NKTA 1U3DA 1B3BA 4HSEA 3WLQA 4M7OA 2HMYB 1U81A 3PLRA 1Z6AA 1O4XB 4IEFB 3WYAA 3I42A 2JHCA 4L5BA 4MTLA 3P9CA 2E7ZA 1M2EA 1QK4A 1XF9A 2GPSA 3TLZA 1IBMB 3IBCA 3TG2A 1YA6A 1QRDA 4Q3OA 3WSWA 3R5FA 2AG0A 1EEXB 2EJCA 2IOFK 2EKPA 3K5HA 4O1MA 3P9ZA 2EZ4A 2HA3A 3IPLA 1JNYA 4ZCPA 4OI0A 1EFLA 1TMOA 1V1MA 3OLCX 4EEXA 2AA3A 4MP6A 4PFSA 1SCKA 4WFKA 1G60A 1WXXA 2QN8A 2PFKA 3ONVA 4OMUA 1GQ2A 1JZTA 2JFNA 5IT5A 1NLZA 1AK1A 2GEVA 1I36A 1KH1A 1U2TA 4WDQA 5J2UB 4CLHA 3DLBA 1R4AA 3LUGA 3D7SA 3EEFA 4BX2A 1KO1A 3WGTA 4LZZA 2Z8ZA 2FEKA 2E4ZA 3CF4G 2ANCA 5DBHX 4B6OA 2H8KA 3L5KA 3ONWA 2XDAA 4NBUA 4UHDA 3LUKA 3NUGA 5ALZA 1XKQA 2BFNA 2Z0MA 2XVXA 1YRWA 1U7HA 3ETLA 2OB2A 3OOHA 5LBIA 3RC7A 1E7WA 3ZKWA 4DWWA 1U5AA 1L3BA 1YS2X 4CN9A 2TMGA 1QRRA 2ADOA 3OF2A 2ZXFA 4ARUA 1WCWA 2D1SA 2Y71A 4K1XA 2RH9B 1XELA 2XQFA 1ESZA 3GZNA 5SY9A 3QI7A 1HEIA 2PU5A 1LX7A 3LX4A 3TL3A 3UMGA 2JVKA 3BIXA 1NT2A 3DA8A 3E5NA 3KUDA 2D5LA 3PPIA 3TIXB 1NW3A 1NPYA 1WSWA 4IUCS 2O8EB 2WJZB 4KGZA 4NNUA 3UXMA 5L45A 1Z2OX 3FSJX 3PX2A 2GZRA 3A1DA 4N5MA 5IU6A 2GFQA 3AFOA 5FUYA 2FMFA 3MJ4A 1TCUA 2V4UA 4DM4A 3LK6A 1DIHA 4MP8A 4HTAA 2F43A 5DM0A 3V8NA 5KNDA 2EARA 5CFRA 1KQFA 1V11A 2R8ZA 3K2QA 4RMNA 5HBGA 2FW6A 5EYPB 5K8JB 4AT1A 3HVRA 1CJKC 3OE7D 3BWDD 3G5MA 3LVBA 3FFWA 3H2GA 1Y3DE 1U94A 2J4CA 2W98A 3FPKA 4JASB 4OL0A 3UBTA 4JYAB 4C7BA 4M1QA 3E9EA 1PT6A 2W2XA 2QS9A 4KEAA 1RM5A 1ZUNA 1OOEA 4BV9A 2B1IA 3LT0A 3LQQA 3GA0A 3HRIA 4YH1A 1FEZA 3A3YA 3C8DA 2FE4A 4GI1A 3KWLA 4NCAA 3AI1A 2X23A 1X15A 1F7UA 4LJRA 4TKVA 4QBGB 3IT3A 3WGIA 1ZN9A 1N8NA 4FE4A 1KPHA 4IZOA 1KKMA 4YX9A 5J3JA 2ZRJA 2C42A 3UMBA 4ZCLA 1IN8A 1ZIOA 4J7CA 1RQPA 1I30A 2JJ2D 4H6WA 5JCJA 1FS6A 5HDQA 4YUVA 4F3NA 1GPBA 1NWHA 5F2NA 2IV3A 1Q74A 2B1GA 3M9LA 1P62B 1OC2A 1OX5A 3LV8A 1SUWA 4WI1A 4P80A 4F7WA 2O8BB 1KO5A 1L7RA 2JFQA 1LTQA 5DASA 4HWSA 5DRTA 1R4MB 1QYWA 1H22A 4QPDA 4REMA 4TLEA 4Q3DA 4DV7B 5I5GA 1XZMA 2WTBA 1W4AA 1OGJA 1FFWA 5AXBA 4AY3A 1WE2A 1K75A 2X2OA 4X1IA 4BO5A 1PJTA 1NOKA 5JWOA 1XUOA 3M1YA 3UXHA 4ABYA 2INGX 1TZ2A 2JA1A 3WQBA 5ICGA 1ODLA 4JEMA 2G9ZA 2R79A 3TBHA 3UHFA 1H8HD 2H1HA 2V55B 3JASB 4YRBA 4X3OA 3GLIE 4AMUA 2WUEA 1SU8A 1LSSA 1UXJA 2F43B 1P6UA 2KPOA 2MTBA 2YDXA 5JTTA 3Q8MA 2FSHA 3KDAA 3BFJA 4S2UA 4WUVA 3DT6A 3GG2A 2E1RA 5C2JB 1AZTA 3TF5A 2EBWA 3E3OA 3D7NA 1ZO8A 5JAUA 1P4AA 1V35A 3L40A 5AJZA 4E2YA 1U7TA 4H27A 1N6OA 1TFRA 2D3WA 2DKOA 2ZKIA 4PLPA 3W5SA 3ZHVA 2DF8A 2NUAA 1UBTS 2ZB8A 3WG9A 4C4PA 1S3FA 4GPD1 1WXLA 2ZVDA 1BG6A 4GOKA 4P08A 4P82A 3CHYA 3KSAC 3UHJA 2DKFA 1TT5A 1DEKA 4MUKA 3BX1A 3S70A 2Q7OE 1Z47A 4Y1RA 3ES9A 1CY7A 2CE7A 5EGNA 3W05A 5IPFA 4L5YA 3KPVA 3RRBA 1N3IA 3N07A 4FCTA 3JQBC 3GN2A 4OCZA 5JMOA 2VH1A 2GAAA 4RKWA 3ZZ1A 4U2FA 1IVNA 3DE0X 3X1ZA 5JAPA 2E85A 2WM3A 3INYA 4UTZA 2EX0A 5AKHA 1TIPA 3AHDA 2I03A 3JALA 5BSRA 3BMXA 4RTRA 1V95A 2O5EA 4CL0A 3WL3A 3T9AA 3BF8A 1KZ1A 2NZVG 5C5EA 1VMDA 2HMAA 3FB4A 3WO1A 4HGQA 2Q2NA 4J7UA 1N0IA 4Q4HB 3FTCA 2EG5A 1UMKA 1WIWA 2Z2ZA 1DHTA 5SYNA 5IABA 1L9KA 3JSAA 4TT8A 4WN9B 3N5KA 2NQ2C 3WIOA 5KOHB 4Q21A 4NOMA 2C3UA 1CJVC 1W19A 3B5JA 1PWXA 1CCWA 1S8OA 5D6OA 5H1YA 4LPSA 4BFXA 1JAIA 2OB1A 4PIVA 5AM1A 1VSUA 1ZN8A 2QRKA 3AB8A 4HWOA 3VISA 2WJ3A 2P1ZA 5F3DA 1DJLA 5K0LA 1GT6A 4US0R 4D4HA 2BSQA 3D0OA 3KNZA 1WCIB 5B6PA 2GD0A 3NKVA 1YB5A 3TUJC 1TEZA 1XDGA 4RJLA 1FXWF 3C85A 4U7WA 1KFKB 1X87A 5CIWA 2UXDB 4RENA 2BMFA 4HYQA 4EPYA 3KSUA 2CVFA 3R5KA 5D84A 1U28C 1ZBQA 1IBCA 3IIMA 5E8RA 1CK4A 1JH9A 3RJMA 1N92A 2GK4A 3DTTA 5ALOA 4JNKA 4LJ7A 5DTJA 4LK3A 3RWMB 5KTPA 1JG3A 1S3IA 3AHCA 1FDSA 4KPGA 3QP9A 4N7BA 8ADHA 3MYYA 3EN0A 3CLTC 2QXUA 4BWVA 4YJHA 1V45E 2D4HA 4OPMA 2OXCA 1NBOA 2V97A 2Y4NA 3ADOA 3PUIA 3IAXA 4BV3A 5J43A 2IUEA 2H59A 3IC5A 2P65A 3CSSA 2HM7A 4EGSA 2RHLA 2VHCA 2VHYA 3HR4A 2HAEA 4ZQFA 4HQLA 5DYWA 3UF0A 2UXCB 3OE5A 3I2KA 5BQPA 1CIPA 3BIOA 4EKGA 4IW3B 1KNQA 3KVYA 2FR0A 1MB4A 2J31A 2YMPA 4I4TB 4FFSA 3AR4A 3T99A 5I4IA 1JHPA 3NAMA 2B61A 3NUZA 4ZMSA 4IF4A 5KINB 4NG5A 1P4SA 2Z6VA 4IEIA 4KOAA 1HL7A 1PDOA 2CC2A 1XHEA 4LYDA 4EG4A 1JQAA 4DE5A 3UKDA 2IUTA 3QU5A 3ZYCA 1M34E 1TO1E 4MUJA 2SKDA 4Q01A 4AJ9A 1EQ2A 1E3MA 4KXMA 1J33A 3AJRA 1AV7A 2ZR0A 4RTSA 3ID6C 2GPAA 1C14A 2C29D 3VR6D 5BSFA 3N2GA 4Q7QA 1WHSB 2D5AA 1MQAA 4GMDA 2VP3A 1T0JB 2Y0BA 4XLZA 1WMAA 4WXPA 1ISIA 1Q95A 1EM8A 4FYVA 1CERA 3JU3A 4P9NA 4PSUA 2ZWMA 1A4RA 1HDCA 4DA0A 3VPXA 5JQGA 1HWYA 2YFQA 4QFBA 2QRJA 2VA9A 2XHEA 1ZX1A 1Q14A 8LDHA 4GL2A 4MR9B 3D6AA 1M74A 5H4HA 3T7TA 5K01A 4DA7A 3UGKA 3E84A 1SBQA 1YVDA 1QP0A 2HBZA 2PCJA 5AM5A 3WYCA 2O23A 1GAQA 1VFPA 3H9QA 2WSLA 1EBUA 1X92A 2BM0A 5TT1A 2AFVA 2XB4A 2F3RA 2IZ0A 3Q7PA 1U8YA 1CB7A 1RLMA 4G89A 4HAVA 2YY6A 4HDOB 4LV5B 4OFXA 1N9KA 2WM8A 4HLCA 3TI7A 5HZMA 3D3QA 4LRYA 4DJAA 6Q21A 5KJFA 5FO1A 1ISFA 2CYAA 1GQQA 4J6FA 3WNCA 4CM5A 2R3SA 1L3IA 3DBRA 4FYPA 2MR5A 2XWJI 3DM5A 1YDWA 2ZI5A 2J6IA 1WPXA 3D7LA 2B6HA 2W8ZA 3ND9A 2FP4B 3VNSA 4FHFA 1GG9A 5EHXA 4A1FA 4QPPA 5FDFA 3C7DB 5BN3A 4D8WA 1XVAA 2HGSA 4MQFB 2GN6A 3GFVA 4GZ6A 4QICA 5EKDA 1Z5OA 2XOXA 2ZBUA 3SC2A 2FFBA 2BZ0A 1K1EA 2ZJOA 3PXBA 4JMLA 4N82A 4QPCA 3UWSA 3U5TA 3IE1A 2IFTA 4G1BA 2V3CC 1V2HE 2WSBA 4JELA 5J59A 4ZTBA 2NTYC 3C8UA 3NQ41 3B70A 2SCUA 4IUBS 5AKIA 4DR3B 5DNDA 3D8TA 3L7YA 4IGAA 2FH5B 4MS1B 2BEKA 3NR2A 5LLTA 4FLMA 4O8CA 1L4LA 4JYMA 5FL7D 1EXVA 2XYPA 3BH6A 1S9HA 4DLUA 1Z5WA 1JLRA 4P81A 1BC5A 1L7XA 4Q4JA 1Y3CE 1EK0A 2Q28A 3NT4A 4IQ0A 3HDTA 4MUGA 4MQ4A 4O4JB 3LHKA 3FKSD 1CJSA 1Y82A 5LZ9A 3ZLBA 2Z43A 4JL6A 3H87A 1GKIA 2NAFA 5FADA 4CM6A 4MGEA 5J47A 4PC7A 5ALNA 4C1BA 4DUZB 3VKGA 4ZMBA 3L0SA 3O94A 4I9UA 3I30X 4NYJQ 4PO9A 5A6VA 5DMHA 4X1OA 4WJLA 4UFOA 4NIMA 4YRCA 4AMVA 1C4WA 2V0CA 1QTRA 4TS1A 5IKMA 3MOGA 4YJKA 3AW8A 2CSUA 2VXBA 1ZK0A 4HQKA 1P2BA 4Y2SA 4CG1A 4EHAA 1G7SA 1T8YA 2J30A 3F3SA 3IEXA 4IDBA 3OM0A 1YR6A 5DEOA 1O58A 2C3YA 2QYOA 3C74A 1FFHA 4CCYA 2J48A 2YIVX 4PHCA 421PA 1JHDA 1IEQA 1JL3A 1IBRA 2QK4A 2DUJA 1W1WA 1UPAA 2D13A 2VFAA 5BVGB 4NENA 2Z57A 1N4AA 1NDQA 1RP1A 1QCYA 1EAMA 2XH8A 1KYWA 1G8JA 2VVTA 3GJ4A 4L72A 3K70B 2A5FA 2UYOA 3OBIA 2GRUA 3GPBA 3MTIA 2VDNB 3Q5DA 3S3TA 3C4VA 3T41A 1Q0LA 4TV8B 4DCPA 1WVMA 5TB5A 2QR5A 3C6YA 5GWXA 4YRKA 1YK0A 3GBSA 5LLDA 1JEYB 3FSEA 2V9CA 2FPIA 4NXNB 5J4YA 2HYIC 4JJAA 1KEPA 1LBEA 3R6GA 4O2RA 2J59A 4CWAA 3N8DA 2Y1EA 4IH9A 2X0EA 1HOTA 1SKBA 4ZANA 4B81A 4DZRA 2FGKA 2FMKA 2ZI6A 4QYIB 4TPKA 3TMAA 4D82A 5IZCC 1A8UA 1ZJZA 2FZ4A 2FV8A 4CIVA 5FL3A 5IRCD 5DNYB 1OWNA 4NMMA 1MO5A 4OU5A 1L8ZA 5G0SA 2XEXA 5ALDA 4IEEA 2E6KA 4ITVA 3S0JA 4PZYA 5CA1F 4WMLA 2IYVA 4QPNA 5GP1A 4LC0A 2ZI3A 1EUZA 5FOUA 3VJRA 3ZBUA 5KNDD 4M1YA 2RKOA 2E5LB 1QQ7A 3ND6A 3ZWQA 2QRNA 2ORED 4XDHA 4HNHA 3O3CA 2ZAYA 3KKOA 2PBFA 4WNIA 1OV6A 1IOLA 1YKSA 2H2GA 4PLWA 3MLEA 4P92A 4RZ2A 2PUDA 3NMUF 2JARA 3L8EA 1B41A 1WCV1 2W6OA 3OEHA 2RAVA 1SXJE 2XNDD 4J0JA 1YOBA 4AKIA 1I51A 2H1WA 1F4PA 3KKEA 2PVCA 4TS4A 1Z5VA 5K3CA 4UC0A 4Y2GA 1YK1A 1Q11A 2BR5A 3PR2B 5FR2A 1H3NA 2HWXA 2O8DB 2BY4A 2WK1A 4MJ7A 5LA6F 3T5GA 2BMJA 4BECA 4NOJA 1P74A 4HRVA 2PXCA 4LI0A 1JECA 1JE0A 2P2CA 1KXZA 1DOHA 1GZ3A 2YNMD 2ZJ7A 3JWEA 3GH1A 4OQNA 3E0XA 3ETCA 1BXGB 4Y98A 5EZYF 3A6FA 1I7DA 2WLSA 4YYEA 4RWZA 3WGGA 4B3BA 2CBGA 2DLNA 1XMSA 3PL5A 3FYHA 2XA2A 5D1HA 3OKAA 1MIOB 1N75A 2ET6A 5IXYA 1BAPA 3AFNA 2OHVA 1E3LA 4R2KA 4RFSB 3LLSA 1TYCA 3W9BA 1DCMA 3LPDA 3ON5A 1F60A 2FJUA 4NX2A 4ZEWA 3VHLB 1BZYA 3W8RA 1N2BA 2Q1UA 1RWQA 1VXRA 1ZSYA 5EXEA 2KB0A 4EI8A 1RC8A 1MB0A 1CUZA 1MJGA 3NHAA 3D4BA 3SQOA 3WICA 3LQ1A 4LF7B 3N8HA 1MB9A 4IJVA 1L1QA 4GZ5A 1DL5A 1UMBB 2WZCA 1RCFA 4M9XA 3PYXA 3TMYA 4GGOA 4ZC8A 1SUDA 4IDQA 4C4XA 4CMEA 1ZNZA 3TLXA 4QC2A 3PKJA 5DV9A 1JQKA 5BOVA 4G2TA 1OSNA 4QOJA 2RBGA 4JQOA 5DBFA 5AW2A 3LL4A 4HWPA 4M1WA 2DFPA 2Y1OA 4XVHA 1ST3A 4DDHA 3FDFA 4Q3KA 1E66A 1WZ6A 2J5XA 3D8BA 4IUDS 4QUDA 3SHQA 1U4NA 3FPBA 4ZAFA 1K0FA 3UM9A 3O91A 4R9NA 1XZCA 5BMOA 3BK1A 1QUEA 3IKTA 1Q1AA 3JVVA 1E6KA 2M6SA 3HQ4O 1PYDA 2I3BA 3EXFA 5K3FA 2H29A 2RJNA 4GXRA 3RC9A 3RT1A 1MRZA 3FZYA 3PHBE 4RA6A 1BVHA 2GETA 2FWNA 3MOSA 3RVNA 3O7WA 3SAJA 4RVDA 2DWUA 4C3UA 3F74A 4UAUA 1IJEA 1XTPA 2QE6A 1DDOA 2REQA 3PC6A 1SUIA 5LD2B 4DWOA 4FFRA 5IN4A 5DPMA 5IAJA 1ZH0A 2Q9CA 1L5HB 1OXVA 1RMYA 5B2EA 2XOEA 4RQAA 2NZWA 3TXXA 4JIGA 1N2CA 4RM2A 3WKDA 2ZT7A 1QCCA 4L4XA 4FMPA 4KR6A 1UDWA 3CLSC 2AFHE 2PWPA 2C7BA 2Z9DA 3RJ5A 3EBLA 4LJ9A 3TZCA 2CSXA 5EP1A 1FF9A 3KV1A 1F06A 4JLWA 1DUIA 3D3JA 2I34A 4J9UE 3ZH2A 2O8CB 1A04A 2P5TB 1HK7A 2XRYA 4TSKA 3QWIA 4Y6RA 4JI6B 3F9IA 3AQIA 4CHGA 2FWIA 3MLAA 4KYVA 2VEDA 4Q9LA 4XCQA 2O2ZA 3DCJA 4H7DA 1CKTA 2I99A 4EW1A 1SN7A 5IUNC 3ZVRA 2PGJA 2W6ID 1UL1X 4Q9HA 3M9XA 1C0PA 4UM9D 2GM9A 4CIXA 1Q7GA 1WMDA 2VP5A 1VL5A 5T5QA 1J47A 1Q1ZA 3F7MA 4FLEA 1A50B 1WLSA 4DT1A 1TLTA 4Q4CA 2P9TA 3KWJA 3S8MA 2YWGA 2ZBQA 5C1BA 1ZOIA 1JKXA 1BHQ1 1KTVA 1ZS9A 2GA8A 1AO3A 2D62A 1IEWA 2GHRA 2E55A 4LI3X 4NPHA 1TECE 1IXRC 2QTMA 2X5KO 3R3VA 3EZ2A 5KOHA 7REQA 2J4DA 5B64A 2B4RO 2OYSA 3B6ZA 1NAIA 3OHMA 1T2VA 4MQBA 4J7XA 2Z6QA 1B2RA 4WY8A 1R0XA 1SQ5A 4M99A 3V1UA 2FUCA 4GR5A 3MW8A 2XVZA 3UB3A 3A4MA 5DTEA 3HP7A 1A1SA 5PGMA 4DAEA 1U0JA 3DAYA 2REBA 3H18A 1JBQA 1HY3A 2PFGA 4MW2A 5A9SA 2GS9A 3MTAA 4B3CA 3CNOA 1LPMA 4V0ME 3BHIA 1P4RA 4PRZA 4UU8A 2R66A 5KQPA 4AKHA 5DTQA 4ARVA 4QDXA 2D6FA 3F9CA 1YI1A 4URYR 4OMCA 4CU2A 1TKRA 2OHJA 3SLKA 1NVGA 3CVVA 3JVUA 4KG7A 4URFA 1A2KC 1CDEA 3DOJA 3K1YA 4GLLA 1NR5A 1ZUHA 3PEFA 4EKIA 1DAMA 3KT8A 1KKUA 1L4BA 4H16A 3OM9A 2VIIA 4XJTA 2VJDA 5KVAA 3MINA 1CNFA 1LZLA 4V24A 1XA4A 4B4WA 4DCOA 4F2WA 1SCIA 3FCYA 3FPSA 2DBYA 1ECCA 3U3XA 5BSWA 1PR3A 1E1RA 1SG6A 2WJ6A 1A1VA 1CUJA 3CNEA 5TC4A 3TSWA 1LDNA 2WHRA 1GZ7A 3H4IA 1X7DA 4KQGA 3KAKA 5IJ9B 5LMZA 3W5AA 3VOSA 4DR6B 4LX0A 4PONA 4ZYLA 4MV6A 2GPBA 3JV7A 1DQYA 2V6BA 4KWCA 1OX6A 5CFZA 1XVIA 3AETB 3JVEA 4RFSA 4YT5A 1UBEA 2GN0A 2XA9A 3F90A 4LN1A 3UAYA 4W5OA 2JIDA 4S0ZA 3A9RA 4DSZA 4BB0A 5BN3B 3O8OA 3OD1A 2XF2A 5HP4A 2XZPA 1FUIA 4UFNA 3TTSA 3FBWA 2JBAB 2O7QA 3ANXA 4MS4B 5K05A 2BJVA 1KIFA 1MVNA 4LHZA 3JARA 3L6OO 2PD3A 4KK3A 1QXSA 3G49A 3E5HA 2X9QA 2V7EA 4PC1A 4QOHA 1A95A 4DIFA 4MW6A 4D2IA 1POWA 1T9HA 3D3WB 5EXDA 1H2EA 5CA0F 1GZVA 4NAHA 4N0PA 2VQ3A 3EIHA 3KHKA 1KZHA 4GFDA 4GWLA 4A16A 1XV5A 1ZMOA 1K4YA 1I6MA 4P32A 2ZYVX 4F72A 1JHXA 1G5RA 1KJ9A 2GD6A 3P0JA 1X1AA 2W0SA 4LGVA 4O1IA 4UD2A 1IPFA 3GEIA 2OL4A 4OHKA 3BTUA 2ZB4A 5T4FA 1PHRA 1I2ZA 2YWEA 4Z86A 1GTG1 2VWPA 2VUUA 4JJ6A 1L8LA 5TNXA 4HQRA 4KE8A 5DXFA 5HKKA 1T26A 3M81A 2R4UA 5ICEA 4Q37A 2ZR8A 4LBYA 4XVUA 1R00A 5B1HA 5CMLA 3ZOKA 3NOVA 4G9EA 2ONKA 3HB5X 3KOUA 3ER9A 2JLZA 4RH0A 2O57A 4NNJA 3MEQA 1QGDA 4YFYA 2DPMA 2PS0A 3GNQA 3ZS8A 2D8AA 2XDQA 1SB9A 1IN5A 3FKJA 3IMCA 3DFZA 4E0BA 4KH1A 2DT8A 4A2WA 5AVVA 3PJRA 3MQ2A 2NYVA 3HMQA 3A1TA 3D6MA 3JD3A 3TSYA 4E33A 1PRYA 3EQ7A 4F9EA 1ZA2A 1E3WB 5CLJA 3BBPA 1Z6YA 2OORC 4IGKA 2OESA 3WTBA 3EQ8A 1IY1A 2WE7A 3IIJA 4NV3A 2E89A 2R7AA 2A0YA 4ZRMA 2XV1A 4XX0B 4DYDA 1C2TA 2VR1A 2PGIA 3VHRA 1XAHA 3L2OB 4NTZA 4KLNA 4TWRA 5AW4A 3FG9A 1F3LA 1V2GA 4LISA 4QDOA 5D01A 3WWCA 4C0AC 4H1WA 1V41E 4IIJF 2DG2A 3ZDAA 1HGXA 2QMUA 4UE6A 1ECJA 5CX1A 4EUNA 1E3WA 4LVUA 2CNKA 2NYAA 2Z1MA 3AF0A 2XKAA 4G65A 4NHOA 4M8IA 3M5PA 4TMYA 4WBXC 2IOYA 5T57A 2R60A 1Q50A 1PR1A 4RD1A 1T4CB 1XNJA 2JH3A 1SWVA 1VM6A 1WUHS 3VBEA 1S1MA 5K7SA 1UFQA 1EUDB 4I0WB 2MT9A 1OQAA 4GR9A 4KE9A 4JP3A 2I2AA 2D0OB 2AMLA 2ZIGA 1DG3A 3IS3A 4IQGA 4AURA 4CI0B 2H9IA 2AXNA 1B93A 5P8WA 3BL5A 1ZL2A 4QO8A 5AI0A 1N77A 2VDLB 1YJCA 2AQKA 1TJYA 3KDSE 2C31A 4ZREA 4DIKA 4AQYB 4LNAA 1JDBC 3NH6A 4Q3NA 4C2UA 3E7PA 4QOSA 2I22A 1O95A 1XWIA 1B8UA 4KACA 1N2OA 4FD2A 4O4LB 5EWLB 2OXTA 1NXXA 1O5TA 5EE5B 4Q7JB 1ZGHA 1PN3A 2O7SA 1QGOA 1XA3A 4RABA 4WCFB 1JILA 1ODKA 3ISVA 3KZKA 4FVTA 3RG2A 4BFLA 4DARA 1TC1A 2E4AA 4C05A 2ZREA 3PWTA 1NX9A 2PK3A 3AYZB 3H7AA 1VJ0A 3AJ8A 3C3XA 3MELA 5KKAA 4CMGA 3U9TA 1UBHS 1IY8A 2VUIB 4QVIA 4ZVLA 3BXZA 2Q3HA 1BMFD 4CTOA 1RLUA 4YRGA 2NPFA 4KAFA 1URPA 2W2OA 2HXSA 1U28A 1WDLA 3D0RA 3PQEA 2R68A 4J0FA 5KKCA 4P3XA 1FMTA 2OHFA 2XYVA 2GQ0A 5IASA 3LT4A 4OKNA 3DLIA 4YPVA 4E5SA 1AHPA 1DDIA 1L4GA 3T3NA 2HTFA 4F2GA 5L6MB 3KKKA 1BN6A 1G7CA 4LXTA 1CR2A 4NATA 5E9QA 2CNLA 3G0DA 1IEVA 2FRDA 4MCHA 4EBFA 1JFTA 1XEAA 4TV8A 2IDKA 2QRVB 2OZKA 4LRXA 3CRW1 4MHTA 3KOMA 4KOEC 1T8UA 2BCGY 3PX3A 4KKXB 4M0DA 4XKJA 3UOWA 3GJZA 4ZOQI 4GVXA 1QHXA 4L22A 3D1VA 3HUDA 2LE4A 4GMGA 2JLSA 2JLCA 3FTFA 4BQRA 3UMJA 4Y2PA 3UJPA 3GRKA 4DABA 2FJPA 3A4TA 3IO3A 1KAMA 1L1EA 3K9BA 2GCNA 3CSUA 5EIFA 2J5RA 5FJJA 1MOQA 3P0FA 3RQIA 1FYWA 2AYYA 1CJBA 1OWOA 1W2HA 1WPRA 3RV3A 1W44A 3ML1A 3W04A 1CUIA 1XCPA 3S68A 1E92A 3O31A 2DTXA 4P7JA 5EPOA 3TE7A 1DOZA 1DO8A 1U8AA 4UOQA 1WZIA 4G3XA 3O26A 3MCTA 4B3DA 3W2IA 2OV6A 3SEFA 5L8VA 3L8GA 5AQEA 2VTDA 1MMFB 3PXCX 4RHTA 4YMGA 821PA 1NMSA 2GBFA 3FDZB 1XNRB 1W8DA 1JLKA 3C39A 4CMHA 4G5FA 3FBTA 1BGXT 1OTXA 4UVEA 3PUKA 4HMPA 4P84A 4G5GA 1AKEA 4YDRA 2ORVA 5T4EA 3VR1A 3NTXA 2PH7A 4BV8A 4IM7A 1EDOA 4NESA 2GFHA 2W2KB 3G0HA 2QU8A 1XCMA 2Z56A 2VPTA 2QMQA 2W6MA 1YMVA 3RSCA 2JEOA 3QX3A 5HVNA 1IK4A 4LSMA 5FA8A 4J0CA 2OD2A 3DYVA 4MVYA 1RD4A 2AI2A 2ZBRA 3LIPA 5JEDA 3A4YA 3IDFA 2G36A 4Q1DA 3AZOA 3ZGOA 3ABRB 2CXHA 3CBQA 2NTEA 3QUQA 3U61B 1Q91A 3HVHA 3C2QA 4ZOAA 1TTTA 3NHFA 3T6KA 3NKLA 2ORWA 1KJWA 1Q0RA 3ELWA 3K9FC 2REQB 2XB9A 4ER7A 5BRJA 1P75A 1HDEA 5FUWA 1M1YB 2G9QA 2FPWA 1FVHA 2OM2A 2JCBA 1YZNA 3IRUA 3M6XA 4F9FA 1F0YA 3A14A 2OWDA 4L75A 3PVCA 2BZ1A 5TQJA 2GWRA 3KC2A 1SUSA 4S1TA 4YY3B 4G5SA 2DEUA 5A7GA 5A71A 1ZGZA 4IDFA 1E0SA 1HURA 1TYAE 2JAQA 2LV8A 2ZJFA 4Q1AA 5T4HA 3WLRA 4P3PA 1E3SA 4AN0A 1LB1B 1LLDA 1ZXBA 4RY2A 5DOZA 5EIOA 3V48A 2YV5A 3DJYA 3VGPA 2UYCA 2XD4A 1PT5A 4PQGA 1RRCA 4CDRA 2CHUA 1MG5A 1UDCA 5EEHA 1J97A 3QLUA 5A04A 4BIIA 4IO0A 1U7OA 1OX4A 2A0UA 3HJCA 4RJIA 3PE6A 3A1UA 4GPBA 1IEXA 4TLBA 5F2KA 1R0SA 1ORTA 2CDRA 2EFGA 4WZBB 1Y33E 3WGKA 3QIVA 1BYUA 2AJ8A 3RYHA 5BR7A 2V03A 5JCJD 3F2IA 3ZGZA 1EX1A 4BX8A 4P3YA 1FSZA 2W37A 2DLDA 4GI7A 5TPZA 1EE2A 2HSDA 4IOMA 4IJWA 5KNBA 3IHLA 2PJRA 2IGTA 4DG8A 1RWWA 1XTKA 3C7AA 2HQ1A 1BU8A 2DFTA 1A71A 1MFPA 3E61A 3M6VA 4L9SA 1JR6A 3KQTA 4R8RA 2VP0A 3H6HA 4L6IA 4BAGA 1BE1A 1IZZA 1H85A 4OXXA 3C6QA 2WZDA 3N70A 5ALIA 1TK3A 5PNTA 4B71A 3U56A 3REQA 4CL8A 4FX2A 3MMPA 5G3YA 1N2CB 1GARA 3C6XA 5DHSA 1NE7A 3KQOA 3TW8A 1H0HA 2ZR9A 1HSNA 1SQFA 2D0DA 1M2VB 1NKVA 3GLKA 3G2LA 4UCXA 4CKEB 3JQDA 1F51E 4FI3F 4ZCRA 4E14A 5L7TA 1DQNA 3STWA 1B0AA 3NYRA 3PEVA 1S9DA 5KTTA 5JALA 3SBDA 1HX7A 2X7JA 1P18A 1BXRA 1K97A 1SGWA 4YRIA 1G63A 1QRAA 4TUYA 1YZUA 2Q9UA 3QW4B 3WYEA 4C0LA 2AX4A 5CEJA 1FRNA 1V16B 4RETA 1QIIA 4BYMA 3N5CA 1R9NA 1SXGA 2DFKB 3JZAA 4PF1A 1NP6A 4DUYB 3C0KA 1QR6A 4QXOA 5INTA 2D2IA 2ODTX 4ARBA 1GPKA 3ELDA 1K08A 2R7MA 4WN9A 1F0NA 2Q46A 3GEEA 1TA4A 2K2QB 4YLEA 1IVYA 2G04A 3EZFA 3EOBI 2D54A 9LDTA 3DUWA 4ZKEA 3BICA 4KO4S 4M55A 1J20A 1YVPA 5H3CA 2CGEA 3CSDA 2Q62A 2X4DA 3L7MA 2RDMA 1OR8A 3TH5A 2H0AA 4E15A 4WBNA 2C54A 4BO0A 1XO1A 3JQ9C 4ROTA 1FFAA 1DINA 1FNMA 2VJBA 1SPXA 3QE0A 1VYUA 2QEQA 4KZPA 4ADSG 3JWHA 3L0YA 4NDZA 1OLUA 3BEDA 1PW7A 1RYMA 4RUKA 1AU9A 2I71A 1W5SA 4HAYA 1L5RA 4YV1A 4OU4A 3LP8A 1O9HA 1G7RA 4IGEA 5J63A 4F60A 5IYZF 5DWDA 4JI2B 4PSVA 3T3OA 3T1HB 1JDZA 3MJCA 2XNHA 3NVMB 4WCDA 4E5MA 4EUEA 4YXFA 1G8HA 1DDGA 4A8JB 3LQ4A 2HXYA 2RK4A 5J1TB 4F85A 4Y18A 5FI5A 2DSNA 4OHRA 1N5IA 1F0KA 2C2HA 2WYVA 1T9KA 3C5CA 5EZ5A 4EHKA 4CEIA 1SVWA 1CY0A 3CEJA 1KMHB 2P30A 4ND8B 4DDWA 5LU9A 3FZNA 4J0DA 1EFUA 2QPAA 3N0WA 5D7NA 1XD8A 2GGSA 1RC0A 3WB0A 4A0HA 3LI2A 3A6DA 3CG0A 4II2A 3PFFA 4WSOA 5BT9A 3WRYC 4CF6A 4YJFA 4D97A 1M75A 3QMMA 5AW8A 5JS7A 4I1IA 4BMYA 4BE4A 2RGNC 4I1OA 4UQPA 3RABA 1DQPA 4OY3A 1NVVQ 3UUWA 3A6HA 3LZCA 4LQ4A 4ZJUA 4LX8A 3GMDA 2CK3A 2XY4A 5DGCA 4IUYA 4X64B 4PN3A 2X0JA 5JROA 1P0MA 2A30A 5H8WA 5D5QA 3FYDA 5B2FA 4WOKA 1STOA 4BQNA 3PDJA 3TXAA 1SK8A 3QHPA 1NAHA 1PFKA 2GARA 4GP9A 4K9KA 4QIHA 2HMWA 3I9LA 4F91B 1XMOB 4MR8B 4A36A 2W48A 3H3FA 5A0VA 4X85A 3GQBB 2C4VA 2C5SA 2ZTSA 1FOEB 1I01A 5A3VA 1UIRA 3F98A 3RM3A 3LO8A 4ZGWA 5FA5A 4C7OB 5AM2A 5E7MA 2P0EA 4AO8A 3ROTA 4LDNA 4H35A 4DLRA 5FPKA 3I5YA 2HLDA 1C5KA 3QFFA 3GRCA 4G5HA 2JNWA 1DUSA 3DC7A 5DU2A 3CNLA 3HCWA 4YJ2F 2RI1A 4PIPA 3A1VA 4X61A 5K5EA 3F6RA 1KTIA 1U3UA 2GBPA 2AEMA 4FSDA 4MQFA 1HT1E 1QF6A 3E9MA 2IYYA 5KSPA 4R0MA 1R9GA 3PEEA 2QROA 1TU4A 5IKPA 1KAHA 1LQTA 4OJYA 4LJAA 3C3EA 5BMVA 4WXMA 3EVTA 2YOFA 1UXIA 4XCVA 4ZAXA 3WE7A 3WK9A 4TTVA 3ANSA 1L4MA 3WSTA 2CBXA 1NW6A 4RK0A 3HH8A 5DNCA 2CTOA 3Q6MA 3ZHXA 2PZFA 3P4XA 2GAFA 3LSYA 3GDWA 4C0WA 3T0FA 3V7YA 5FQOA 2IEDA 4CMEC 2EOAA 2JDIA 3NHZA 1RQLA 1W5TA 4JKYA 2Y68A 4S1PA 3DTNA 1KA9H 3LRPA 1GUZA 4K9LA 3TR6A 1Y42X 3UPUA 1YC2A 4Q6WA 4R1SA 1M7GA 1IXKA 3I04A 5AO9A 3DDCA 3HYLA 2YJZA 3SR3A 2X9NA 3OFSA 3QLVA 5K4AA 3QXGA 5T4BA 2C0QA 3DHNA 1RPZA 3QLVC 4D79A 1ZD4A 1EGAA 1QU3A 3FJYA 3ZGXA 3ZD7A 1J2TA 2HK7A 1TD9A 3BMCA 1R0LA 5JC1A 4M0CA 3A9WA 2QLFA 3SFZA 3L6EA 3PWSA 1AV6A 2VK8A 3D81A 4Z4HA 4JKIA 1T3LA 2BZSA 3MXTA 1Z88A 3A9UA 2BOVA 4QXRA 4B5LA 1Y37A 1JQEA 5J2TF 3PR3A 5L3QB 3ZZNA 1NZFA 2FK7A 3JQPA 4DVJA 1I11A 3MQ4A 2JIRA 3AVWA 3DWEX 1JZSA 3G6KA 3N2YA 4QSHA 2W4MA 3AR8A 3KPYA 2JHGA 4QDJA 3TNFA 1NI4A 1QFYA 1IG0A 3DV2A 4CMCA 2ODPA 2ODBA 1VL6A 2L82A 4MUXA 3ZJVA 5B7PA 4RTNA 1MO2A 2FN3A 3HA7A 2VWHA 5B7QA 5KPJA 4I4CA 4D25A 1ORWA 3B53X 3KSDO 3ZDDA 2XNDA 1DU4A 3F1LA 2I7CA 4E7PA 2Y6VA 4KL8S 5HQ3A 3A2KA 1DIRA 2FEMA 2DP4E 2IKSA 1E62A 4XD2A 4EYQA 4M53A 3F8TA 4FDTA 4V0NA 4WH0A 2RI6A 4G81A 2J0EA 4AZSA 2FZKA 3AL0C 4RSRA 1T5BA 1S8FA 1A9RA 3DEHA 8GPBA 4EGJA 2CMKA 4YPFA 3LDUA 4X3PA 3THOA 3OAAA 1U9IA 2LIPA 4KUGA 2G88A 5DIZA 1OF1A 3UH0A 2AXPA 1J8VA 4HL6A 1RPAA 2OCDA 4PYKA 4W8OA 4HAWA 4WJKB 4CM4B 3CUVA 1D2NA 3EBPA 3CCBA 3N2ZB 5LQCA 2WI8A 1K66A 1Z6XA 1XTTA 4TQAA 4QULA 1I3LA 2A14A 5HIIA 4X5OA 2BMDA 3WIDA 4ESHA 3LLVA 3H1GA 1DC3A 5ARBA 3KD2A 4NCIA 1JB1A 3OU6A 2VAMA 3LWDA 4BO4A 1LLFA 1TM2A 1N57A 2RGNA 1SCJA 2WWTA 3IP5A 2NO1A 4FP9A 4IVPA 2AXQA 4P2BA 4BCBA 1JFFB 1NVKA 3C41J 2C0CA 3CTMA 2II6A 2IYPA 2PZKA 4OQQA 5E6UA 1GDTA 2ZS7A 1IZ9A 2O14A 1C1XB 2HB6A 4R5MA 3BDAA 4N7JA 1RMQA 4NAUA 2WMDA 2QRVA 1II9A 4HDMA 1CR1A 1SZPA 4GKVA 4LTMA 5AI9A 5DYYA 5GM2A 3BH7A 2AK2A 1SRRA 3COWA 4U2BA 4O3MA 2GI4A 2HF8A 3A36A 2AZXA 2ATEA 2V6GA 1CNEA 3H99A 1Q1QA 5CFPA 2FZVA 3D02A 3NYQA 1W1UA 1A9PA 5E6UB 3KLBA 4NYIR 1ZJYA 3SFVA 2H1RA 4FB4A 4TQ9A 5A6SB 4QM6A 4UPDA 3D8HA 2NXEA 4UTXA 3ZWNA 4CUJA 4FDVA 3ZWYA 3IQDB 3TBFA 4EY7A 5A02A 4J2HA 4TZTA 1FX1A 3REFA 4OFWA 2FZEA 1CY1A 4M86A 1NYRA 1I2AA 1IHXA 1ZRNA 1D9XA 4IIXA 1VE1A 3VI3B 1QFMA 3LNCA 4L8WB 2XQGA 1N4DA 1ACMA 3FIUA 1RI4A 2ZYAA 2EC5A 2GK3A 5B55A 2QM0A 5HILA 5IKEA 2R7NA 3AGPA 4FZJA 4WX2B 2ZE5A 5IFKA 5KTKA 3FBGA 4RFVA 3DSRA 1EFVA 1JHAA 1PG5A 3KZOA 5H7XA 4D3FA 1BDIA 3ESBA 3K30A 1SUEA 2OKGA 3L1IA 1UOEA 1MJNA 4LSGA 4PLFA 3JR7A 1NG9A 1YSCA 3OE7A 1NLMA 1WXWA 2PN1A 1F1JA 3DD5A 3NOQA 5SICE 4UTRA 5IZ4A 1JQDA 1QE3A 4WZBA 3V4LA 3F3MA 3EAFA 3A7EA 4R0NA 3VDRA 1U0EA 2G0NA 3M4JA 3SE0A 2J7KA 4IDGA 3T7SA 5EPEA 1TZMA 1TMGE 2Q6TA 2YBEA 5GAJA 2OPHA 9LDBA 5ICMA 3DE7X 4L27A 4COKA 1VI5A 3TSCA 2ZVQX 5CBKA 5GGYA 1E8NA 4LW8A 5E6RB 3S28A 5HKAA 4TLCA 1KI2A 2QE7D 4BNHA 4F04A 3NXSA 3M83A 4JC5A 4XVRA 2BHNA 1XRMA 2D2XA 4OATA 1TPZA 4AD8A 4CCWA 2RGRA 2XCIA 2B1JA 3BGWA 3VR5H 2G40A 3FPEA 4BLQA 2ZYRA 5JE8A 1H2WA 2YOGA 2Q7XA 4LJ6A 2CYCA 1CFJA 2OZLB 5ENZA 4BO1A 1A9YA 2ZI4A 3TX6A 1JHVA 3GROA 4C7JA 2C5HA 1X7ZB 2PKXA 3INNA 1UFRA 1P2VA 1S89A 1R9MA 4UMEA 5EWJA 3UJDA 5CBPB 1KI6B 5FH9A 1HDYA 5JVDF 1KC1A 5KHLB 4Q4AA 3KKQA 4HUQB 3AUYA 3W4IA 1EA7A 4CTJA 4HVCA 2O8FA 3TR5A 1WB6A 4MQEB 1EGMB 4XASA 3X1XA 1B7GO 1I3CA 2OCGA 4M54A 3NFRA 1I0LA 4ZWNA 3T0GA 4G4JA 4C6RA 1XQ1A 3JRWA 3LD9A 1GTJ1 5JO9A 2V7BA 2H4HA 3U1VA 4B40A 3EPHA 2R4QA 1VI6A 2FPOA 2W2LD 3VR5D 2WTMA 3HJFA 2B9VA 5K8LA 3A6GA 3COVA 1Y80A 3LXXA 5EHGA 4RCZA 5TMBA 4I1VA 4YK7A 5B53A 1QQBA 2QAGB 3LQ2A 4E5KA 4IJKA 1J21A 4FEGA 3Q11A 1B6RA 2NACA 2BMWA 3L0CA 2YULA 4H59A 4WZZA 5G0UA 4CLXA 4DJJA 1FP2A 5EHZA 4UVGA 2CB9A 1VRVA 3ZGNA 1M2JA 2PMWB 1Y6FA 1V8ZA 3VSAA 1S6YA 3RVBA 3CZCA 3RLIA 1RCTE 2BD0A 1KO8A 1L7QA 1KOLA 5CK5A 1PJ8A 3CR8A 4DCJA 4E5YA 1N2JA 2ZANA 3YASA 1US8B 3KHTA 4F1KA 1SUFA 1U6KA 5JFGA 3AF6A 1AKRA 4DQVA 4L0CA 4I3FA 4LYAA 3BXOA 1SZCA 3E7FA 3T1OA 4F4IA 3D3KA 3DMRA 2YQIA 2AWNA 2AUTA 2O3JA 3HI6A 3N0XA 3AEQB 3OEED 2IV2X 1BU5A 1ODJA 1GG8A 3C8HA 2RJOA 1DPFA 4NP6A 3WHLA 4YBZA 4AICA 5FTJA 1GO2A 4LNHA 4WWHA 4B8YA 3O75A 2GILA 4XIJA 3UIEA 1E1QD 1QPBA 3WAJA 1EWKA 3GP8A 4I5DA 2QGZA 4QTTB 4AZVA 5AI8A 1JJAA 2YWDA 5AVKA 3V1YA 2PL1A 2ZQZA 3C3JA 2R87A 3K6SB 2IH2A 1TTHA 1QK3A 4JNCA 2HWWA 3AJDA 1DSSG 5AUOB 4DR1B 1Z4NA 1OAOC 3KSMA 3VRHA 5KWSA 3URMA 4OM7A 3VH1A 2DWQA 1Y6ZA 2GLUA 2CD7A 3K16A 3NBZC 2ECQA 4L08A 3IAUA 3B8EA 2ZS9A 4UUQA 1J7KA 2HJVA 4ZT4A 4BLRA 1GTSA 3PGJA 1RZVA 1UZLA 2XVYA 1C3LA 1NG1A 2WUVA 1BXKA 3O03A 4M9ZA 5E6RA 4MAMA 3TZEA 5A4DA 3U5ZB 1P0CA 2Q0QA 3ONNA 1WJGA 4N1AA 1T4DA 2AOXA 1SHTX 4X6YA 2NTJA 1P1IA 1F2TA 1JXQA 2DQ4A 2QIOA 2EZTA 3M5WA 1MTOA 4CU5A 5I9NA 5K4HA 5IT0A 2HLPA 4U7DA 1MCZA 3PQFA 4MWBA 1QE5A 1ZZGA 3X1KA 4GSKA 1HSZA 3EXG2 5KS2A 1YB1A 1FVXA 4LJ5A 1P17A 1GGFA 3S2YA 3VQTA 4A0QA 4RDIA 1ZVMA 4GQAA 1JDJA 4WIAA 4C0JA 2BV3A 5IJ9A 1L6RA 1H4TA 4PHFA 2WJ4A 4XIYA 1DEXA 2G1KA 1U8TA 5FL7A 3CVUA 1PR9A 1XRRA 3WX0A 1V16A 2Q1SA 1C3OB 2QTAA 2YFKA 1KQNA 4KFUA 3EGOA 3PD1A 4M21A 4J1TC 4NONA 4E21A 3I9JA 1M2WA 4KYUA 1AZWA 2IYUA 3WLMA 4PTLA 1PKXA 1VL1A 1SM4A 2X9VA 4G1CA 4J0GA 5AJTA 4BV2A 1E4EB 2TS1A 4RV9A 5K3OA 2QLBA 1E60A 4LYYA 3VNBA 3QSGA 4AF6A 1AE1A 1MX9A 2J9RA 3PYLA 2ZSFA 3S7ZA 2AFRA 3H2JA 4G5OA 4M37A 1XD9A 2PRYA 1THZA 5BY2A 1CYEA 3A2LA 3B1WA 2XPCA 5G0VA 4RTQA 1O95C 4KPEC 3GFSA 1A7KA 3ZQKA 1QRTA 1CUVA 3PCTA 4K2HA 1O8BA 1QNLA 2QYHA 1VQ1A 4V39A 4S04A 3L8MA 4E70A 2VYNA 4GZLA 5CH8A 1HLGA 2FTKE 1IMOA 4NKRA 3FNBA 1V0JA 5FFMA 3CW9A 1C3VA 1EVQA 1FP6A 3QJGA 1RBMA 2QL7A 4HX9A 3RBVA 4BZWA 1N2CE 3DHEA 4MWDA 1FTSA 3IHKA 2WOJA 3RSZA 3P45A 3R9KA 2Q27A 4XJVA 5LU8A 3CKYA 5TJ9A 3I8OA 3D9QX 1H1LB 4MX8A 1GTRA 2B4YA 3OMXA 2C07A 1GU1A 3UJCA 2Z04A 4IHAA 2E18A 3R7DA 3V4FA 4S1VA 4ZT7A 1LK0A 1AABA 1TZCA 4EO7A 1OFIA 4KSYA 4RJ2A 4WRRA 4BEWA 4RDXA 4JI8B 3W3ZB 4RD0A 4BNLA 1M73E 2VYQA 3D4OA 1X1BA 4BNXA 5KOJA 2CLCX 3O2NA 3P2KA 5CA0B 3GFRA 3GRVA 1RZRA 1EDZA 5DO9A 4OK6A 1W7AA 1RFLA 1PNQA 5JH7F 1DX6A 3IDQA 1KGSA 2OUKA 1MAUA 1HYGA 4G8BA 3TRKA 5FF9A 3LTNC 5GVRA 4R81A 3REGA 2J3JA 4XTCS 1AX9A 5EMJA 4EMTA 3ICEA 4XIIA 1VE7A 2VWQA 3TDKA 1IATA 3A1NA 3ACBA 4FNAA 3SEZA 3V1TC 1Q0PA 3TNLA 2IHNA 2IODA 4DLPA 1XIVA 2ACEA 3I1FA 1Z4OA 3WQQA 2PT6A 4LKRA 3JQ8B 4PLCA 5HJ5A 3KETA 1EM8B 3F9RA 2N1BA 2WYIA 3DZGA 2BMAA 1YR3A 1R88A 3H97A 5DVZA 2X19A 3ROQA 2EP5A 2G5GX 4CV0A 1CEXA 4A73A 2HIMA 3DCNA 1YS4A 2Y92A 1KY4A 4GYKA 2W6PA 3MT0A 3QKTA 2YJ3A 5CUQA 3V80A 3U19A 3BCUA 5TF4A 3II6X 2B0CA 4LZLA 2VJMB 1PD0A 3M33A 1CJCA 3N39C 4LYJA 5EMNA 3C16C 5BUCA 2JI6A 3AM5A 3MS4A 4RLSA 4XYGA 3OOYA 1AGXA 1I2CA 1IXYA 4TXLA 4B9AA 4XLLA 3KEFA 5HQ3B 1YAJA 1CS0B 1NQXA 4JI4B 4LXQA 3AZPA 4O4HB 1U0BB 1Z16A 5SZKB 1JKJA 1SD1A 1KI4A 2YR0A 3KJQA 3AR3A 1ZUWA 1CUWA 4HKTA 3RU3A 3U7RA 4WAUA 1MUUA 1J0CA 2GDJA 5ESRA 4YCLA 5K9ZA 2EQBA 4X90A 2QTRA 2B3TA 1ZC4A 2QPLA 2C82A 3FROA 5DISB 4DSOA 3JAKB 3OH8A 1F6WA 4F4CA 5D85A 4KWIA 4EZIA 3SXPA 2LPMA 5E3JA 1JKJB 4Q1FA 1HSOA 4M22A 3KKPA 4DBZA 3L04A 2IP4A 3ZWCA 4D41A 3PDIB 3Q6NA 2VK1A 1MPTA 1O96A 1ZITA 4AYXA 4JU9A 4K9NA 3TEFA 4GKKB 5I7SA 2GM5A 2OFPA 2VRNA 2HPHA 3ESAA 3HDGA 1OZ0A 4KPUB 4ZO4A 3VR5A 4EAQA 3O5AA 2E5WA 5FNVB 1GRVA 3BWCA 4YRZA 4N0MA 1JFFA 1JIKA 2RGDA 3EEIA 3OWHA 4Y3UA 1H9BA 1PFUA 5TDHA 1KFJB 1NRWA 3GRYA 3OM8A 4ZD6A 1HQKA 4W99A 4BC1A 1U2QA 2NXJA 3IUEA 1IK6A 1EHCA 3EZXA 2BFWA 4B3XA 1V1JA 2GSDA 4RNCA 3U48A 3ZE7A 2FQQA 3C1UA 3DWGA 4AJKA 1YBMA 2OAGA 3FYSA 4TV9B 3VSDA 1EINA 2DSTA 1AGPA 2ZT8A 1JTEA 3VX4A 2CHFA 3X2SA 4V1CI 3D2CA 2GKGA 4DLSA 2Q4BA 3PPVA 4EJ2A 4X45A 2P9ZA 3CH5A 5H80A 4A3NA 1U7DA 3FPAA 1OXBB 2DCMA 4W1RA 3B7WA 4P34A 1BQEA 1J00A 3IR7A 4TYWA 4BVGA 3K0EA 2XCRB 5FHQA 2F17A 3GU3A 1FP1D 4L6CA 3QRWA 4ZVTA 3K35A 4OGFA 3V7FA 4N9WA 2OGTA 3AEUB 4MKGA 4I9NA 5KOJB 2QBYA 2KMLA 4OXQA 3GNLA 3GEBA 2JCVA 1H0SA 4NEHB 3V1KA 3LZ6A 2IYXA 4G01B 4NC9A 5F7JA 1YRHA 3DYIA 4BBZA 4EF5A 3K2IA 2W2KA 4IFBA 4EF6A 3CZRA 1BQ4A 3RTDA 3UFBA 2DXIA 3OP1A 3KTOA 3NB0A 3QK7A 5EQDA 1SQ6A 5TMDA 3NORA 3H13A 1X7XB 1T29A 2F8SA 1B76A 3D8NA 4AZ3B 1M8PA 4BLWA 1B16A 1JG1A 1O54A 3DLCA 3W6OA 4BKQA 4AUNA 1LBTA 4DDTA 2AW3A 1WSBA 1T4CA 1BW9B 1J2YA 3GJXC 1Z0KA 3KE8A 2X58A 3DLAA 1VKJA 2J85A 3DZCA 3GRZA 3OEHD 2MSKA 1MO3A 1VTKA 2HSZA 3CNHA 4TLMB 3TRDA 2GZHA 4ZV9A 4MYSA 4K6MA 1XVTA 3RIXA 2F3SA 1CP2A 2B3DA 2DLCX 1P61B 5AKZA 3T5MA 1T43A 4XX1A 2CCGA 3G79A 4DM3A 4WOBA 1VJCA 2NU8A 3CKMA 1AUQA 1RQXA 1LH0A 1Y81A 4XARA 4YRDA 2Q6KA 2Q29A 3DKPA 3C3AA 1S4QA 5TE9A 4E32A 1EJ0A 1CZLA 3TN7A 4U00A 2C83A 4GMXA 4D0LB 1PNTA 3IULA 1XRQA 2W7TA 1BD3A 5JLJA 3QQ5A 2RIRA 5EIHA 1ZMBA 1PJ4A 5J2UF 1CC1S 4GRIA 4HYEA 4LS3A 5E1DA 4UBJA 5JXJA 1KJZA 5B5SA 4J0IA 1FFXB 3FW1A 3NM5A 4O29A 3E3MA 5EQJB 2WSIA 5KQGA 3V8PA 1R8QA 5KOYA 3D1LA 1G6Q1 3C14C 3OZVA 1HEUA 4MMZB 1CJMA 4DHEA 3V1MA 4Q9KA 5LA6B 3T9EA 3WBJA 1LQ2A 4B45A 2I6GA 4BLVA 2HCBA 3F49S 1EP9A 3K4QA 1U63A 3CWZA 1VI2A 2YOHA 2YHIB 4MWEA 1PDVA 2GYWA 2IPMA 1DADA 4ZTUB 3DMTA 1BEEA 3UGTA 2ZULA 3AR2A 3I3SR 4P7KA 1D4OA 1EUCA 1WKBA 2JLVA 3UK7A 3UJ7A 2XIQA 3RTAA 3UMFA 2WDPA 5CXUA 3CONA 1NN3A 1V7PC 2GEUA 4O0LA 3HN2A 1OAKA 3K8OE 4I5EA 3QENA 1E20A 4GG1A 3RVPA 3SC6A 2O7VA 4GOOD 2BKVA 4EYOA 1GXSA 1OE0A 4X66B 2L2QA 3NWOA 1Q0SA 4LNUA 4C89A 4DPLA 3Q7RA 2ZAIA 4GEGA 3OIDA 2A3RA 2ZIXA 4MZXA 4BY9E 16PKA 1FTGA 1XCJA 3TJRA 1R3DA 1KI8A 1WM1A 3FJOA 4TYPA 2FKAA 3AI2A 2LIVA 1GAWA 3W8FA 5AOBA 4MRAA 4EY3A 4MQEA 1YASA 4J1SA 4NQZA 5ALYA 1GNSA 2O8FB 3HKCB 3KZCA 1RRPA 3UV6A 3HM9A 2X8WA 3TJZA 4LNUB 4WJZA 3SSMA 4DZTA 5L51A 5ESXA 3CFYA 3PQ7A 5GMOA 1N34B 2V9PA 2R44A 3CVOA 3IA7A 5FWYA 4KQJA 5EUQB 2L69A 3E27A 1JUDA 4ZCMA 1E2KA 3H9GA 3T4UA 3JYPA 3REQB 3WDKA 1XZPA 1W88B 2ODNA 1QGED 2P77A 4KHZA 1N7GA 1CZHA 3MCAA 1T9DA 4I5IA 4JSTA 4AO6A 4XYEA 1ZR4A 2QAGC 1KERA 4MA5A 2P7IA 1G3QA 4GSYA 1JKFA 1RBZA 5A1JA 3WO0A 3OX3A 4ZJPA 3P9QA 2I4MA 4X71A 3KR2A 1LBQA 1DGQA 1Y9JA 1AQUA 2VF7A 4DPMA 2I4LA 4QU9A 4RH1A 5EC8A 1S2IA 1WX1A 2YMLA 1FFXA 1U65A 2AFIA 4TVOA 4X91A 4H4EA 4CIYA 2FP4A 2F1JA 3H0EA 3IXLA 1ISJA 1M2HA 1WAMA 3IUMA 4OMFG 2H92A 3U17A 4PRLA 4AY4A 4M3NA 3LE8A 2RGGA 4L8YA 3N8GA 3STXA 1M8FA 1DNPA 2GBLC 4DEVA 2PV7A 3TD2A 2X8AA 4OJQA 3EMBA 3SK0A 3O38A 1RZUA 1TQ8A 3I2IA 4MB0A 2G9RA 4W8GA 2B7BA 4QO7A 4Q03A 1Q7CA 4RJKA 1QQTA 2H2DA 2QXTA 1J5EB 3CLUD 4MKRA 1HH4A 2ZT6A 4HTFA 4IQ8A 1VXOA 4V0OA 4ZI7B 4H7HA 1Y6RA 2HI0A 2QR2A 3WLFA 5CT4A 3D2BA 1BSVA 3HRHA 1P4JA 1BO6A 3TINA 3VR3A 3MGKA 3W7VA 1F20A 3PJEA 1WBBA 1K88A 2FR8C 1WW2A 1JI3A 3W7BA 1OPXA 3L84A 3FNRA 3K6JA 5LZ4A 2W2VA 4CIWA 2FE1A 4EIWA 1E1CA 3PPWA 1K3FA 4ZU3A 4MVJH 1NBAA 4BB6A 1JDTA 3GY0A 3PV0A 1VPWA 4K2AA 1J0DA 4A3SA 3VZBA 1VKZA 1MDBA 3PZRA 2GJSA 3LX5A 5ITVA 2FQXA 2ATIA 3RE1A 4R7ZA 2JEYA 4IJQA 4MW5A 2C77A 3TLMA 1N7IA 1QKJA 5JS2A 4D0RA 1QNFA 3F71A 1OXXK 2H0QA 4BC0A 2Y1GA 3FDXA 1Z15A 3K31A 4DMUB 3AM1A 4NODA 2RHJA 1UKEA 3WK7A 4G56A 3U7GA 1UWLA 1P7PA 4KMOA 5GJWC 4UPVA 5K2MA 3S1SA 5LYJF 4C6TA 1USUA 2EEPA 1CETA 3W1EA 1U0SY 2DMRA 4GX0A 2ZATA 2IU3A 4C03A 2VBFA 2YN0A 4YAJA 2ONCA 4GICA 2B1RA 1C8LA 5G1NA 2K7ZA 3B52X 2FEPA 3OFVA 3K2EA 2V3VA 3EIUA 5C5CA 4FZ3A 1KE2A 3NCHA 2E4WA 1XCGB 4M8LA 1GN8A 1X0VA 2UVPB 3EZYA 1MQ8B 3IE2A 4PFQA 1GVHA 2PKEA 1UBKS 4KAJA 4G4SP 2LE0A 4L3OA 2C8VA 3DOHA 4O25A 5JAQA 3WV5A 2NZJA 2OD9A 1W36B 1SKUA 4HRYA 2QMZA 2X2PA 3U60B 1Y3BE 1S4MA 3ZPXA 4O08A 2F8TA 1XLTC 3EVNA 2HUNA 2Q8QA 2WZBA 2AZTA 2WPNA 4RO0A 4HV4A 3M4ZA 4GP7A 4JC4A 2X1MA 2XA1A 4RQBA 4U8GA 4I8DA 2H31A 4P33A 1QANA 1H8HA 2EKZA 1Y5IA 3SZMA 4ZPXA 2F1HA 4TSRA 3OE1A 3D7MA 1KDVA 4EY4A 1GEEA 3A10A 1JKMA 3N8NA 4Q3LA 5FLXA 3LCVB 2OGUA 2VH5R 1MRNA 5JYCA 4LK2A 1CUEA 1OLXA 2ZIZA 2PWYA 3Q15C 4FC7A 3E22B 3ME5A 2J9FA 2VWGA 4P4NA 3V4VB 1NBHA 3KDPA 3OIWA 3OOSA 4G9BA 4ZEMA 4BTVA 3COSA 2Q49A 2HN9A 4E08A 3ZNOA 1L5WA 2IHTA 1OKKA 1XZGA 3NANA 5TARA 4PPNA 5DT9A 4DW8A 4ETWA 2N3ZA 2DR0A 2OEPA 3U7IA 4ILKA 3STYA 3K6RA 4BP3A 2SBTA 5AKYA 5I9LA 3QKRA 3VPBA 3FRHA 4M83A 1WETA 3B2EA 1QV7A 4O1HA 2PU7A 3Q8KA 2H7VA 1M3SA 3Q7IA 3CNNA 3D4NA 3E82A 4KFRA 4MKXA 1QB8A 2VO1A 2WD9A 2WG0A 3IA2A 4HF7A 4LEIA 4RHEA 5DNWA 3UGJA 3BB1A 2EQZA 4MVJP 5IK2D 2MYPA 4BNJA 3I2FA 3AUXA 3PFNA 1P2TA 1PF7E 1UBMS 1ZNWA 2QSJA 3L7IA 4HN9A 2V1UA 5F98A 2VYND 1L3CA 1T36A 2GM3A 1UBSB 1U2GA 1B43A 3IPYA 4MJLA 4RYDA 1MJ5A 4YJGA 5DWVA 4AIIA 5JJ5A 4CTMA 4LYEA 3LPLA 3WNDA 3WJ2A 4DIMA 2YWRA 1LRLA 4V0SA 4B46A 3OZWA 4DANA 4UUPA 2WKSA 3B60A 5C5DA 1L5NA 4N41A 5DEIA 3T4XA 3SJBA 3OQBA 4FDMA 3IMFA 1WUJS 3O0TA 4PO1A 2BDEA 3IAFA 4O2BB 5ALWA 3RHFA 3ZY5A 4EB8A 3TW0A 2LW7A 1SJ9A 2BHLA 3PXUA 3OPXA 1QQ6A 4X7BA 1DCKA 2I3ZA 2Q1YA 1G41A 2ZJ4A 1WXEA 1TTQB 3FFTA 5EXTA 4TS9A 1KO4A 4N47A 1KEKA 3AF1A 1DJNA 1Z6GA 5DCUA 3VBCA 4CQLB 3FI0A 1NZDA 5FCDA 4DR2B 2PZ8A 2DGDA 1SH7A 3KK0A 1BFDA 1KFEB 4ER5A 2HSEA 2H4JA 3HU5A 3LF2A 4NNPA 4EVRA 4QR9A 3CW8X 2RJ3A 5ETJA 1T6YA 2C7GA 2EJUA 1AMUA 2ID4A 2EYQA 2YS6A 2IYSA 5J23A 3LY5A 3VZQA 4B3GA 1Z07A 3RFCA 3FDJA 4YWJA 1QMGA 4D81A 3PF8A 2YIDA 2ZAOA 2E0IA 2YASA 1JSRA 2WFZA 5LXTB 1FFDA 1E7SA 4XH9B 3EDYA 1RQ2A 3UATA 4WQMA 3EXHB 3V4OA 4MYRA 1P9OA 3OETA 2C9CA 3QEJA 4ID3A 1ARZA 4HBZA 4L8GA 3EC2A 1H8EA 5D3KA 5B2ZA 1M5RA 1KYXA 2LP4Y 4C4YA 5ITWA 1EP3B 3GHHA 2P4QA 2QZJA 3VPGA 2JLYA 3V8VA 2NT4A 4NJMA 4EGFA 1ZQ1A 4M1KA 5HFJA 4QA9A 5HK8A 4BJ5A 3EK2A 4C4OA 3SQMA 2ODAA 1MT0A 1GZHB 5EIWA 1HNNA 1GVNB 4NCHA 2O1EA 4FOPA 1PR0A 1DEOA 5D5HA 1UQRA 2H65A 4RHUA 4DYHA 5I5EA 2HF9A 4OGKA 4Y2QA 4YJFB 4BFCA 2O2SA 3TZKA 4XPIA 1DBWA 2VSOA 1XNHA 4PLGA 3PEWA 1XEWY 2ZUVA 5JSZB 1NDHA 3GI1A 2FMTA 1NDUA 2CLEB 1FU7A 4GC5A 5M3BA 4KSCA 4YMUA 4PYQA 3NDIA 1TVMA 3W1VA 1GM5A 3QGMA 1EQUA 2AN3A 1EI9A 1IAVA 1ML4A 2HF7A 3ECCA 3X1MA 4TYYA 4XFDA 1R5BA 1IDN1 2NSLA 1Z6QA 2XMZA 3MSXA 4YDQA 2P0AA 2H5IA 5DX8A 2HZ7A 1YT5A 2WTEA 4QTXA 5KYGA 3S99A 5FWNA 4YRTA 4DQKA 1QHEA 3HJTA 1GGHA 1FTNA 1YFKA 1BEZA 2FR8A 3Q3GE 2XXBA 4DC1A 1EK1A 1H6DA 3EVBA 3HDHA 3ISJA 3LZDA 2BEVB 4LRSB 3DZJA 1L2TA 4FLFA 1LDYA 5DLQC 1EXWA 1V4BA 4J9VA 1H3EA 1DBPA 5EKXA 2XCQA 2GBGA 1Y4DE 1DP4A 1ESMA 2ZRMA 3MT7A 5LA6A 3F6SA 2B69A 3M6FA 1X1CA 2AMJA 2P5YA 5CH5A 4UPEA 1PLJA 3SZUA 3DDOA 2PVPA 2ZK7A 3WNVA 3EA4A 3RHSA 1QHFA 3U44B 4L78A 1EDDA 1NM5C 1K7CA 2FI1A 4OXRA 4QYTA 2D2VA 1Q5PA 2RHTA 2I1WA 2ZQYA 3H83A 5T8KA 2ZYTX 2CT8A 1PS8A 3QYAA 3OZGA 3V4RA 1RRFA 5FV4A 1BA3A 3WLPA 1JHUA 4JVOA 5E9WA 4QEDA 5EN4A 2IXAA 1X80B 3O8DA 2B2NA 1DJOA 3L46A 1I6LA 4PLVA 2V54A 1FRZA 2VPYA 3MIZA 3WOHA 3M34A 4L9RA 1R0YA 4ZTZB 3OTIA 1ULUA 1AKUA 4EG5A 1X7XA 1RQNA 2HFJA 2IXDA 2C4NA 1GGJA 1KI7A 3ASYA 4TMKA 2RHBA 2BGTA 1Y6QA 1KKLA 3VNAA 3CURA 4UHKA 4V0KA 3PC7A 4NCNA 3PC2A 4NVRA 4DHWA 5A9RA 2QJWA 2ZVJA 3BXXA 3L6UA 4B83A 5ULLA 1OVGA 4HC4A 1BOFA 4Z4GA 1MTZA 5AD1A 2XF8A 1K99A 4KNWA 4I2VA 5CLHA 3AUKA 1NVWQ 5HF6A 1YQGA 1CV2A 1VE3A 5TXGA 4UEWA 3AIIA 4YEDA 2YUKA 1BMTA 2Q50A 1HE8B 4LBWA 3RR2A 4YQFA 1V5GA 3JATA 2ZYWX 1U04A 3N0VA 5M2QA 1W4RA 3FPJA 4KW7A 3WYNA 1PG0A 5C1IA 1KQ3A 4ZO6A 4PPQA 3BSSA 4EBBA 3IB6A 4KDEA 3AEQA 4BHTA 3DAOA 2X40A 4KN9S 3BJZA 3KQPA 4CKEA 5JDIC 3B9RA 2KJQA 4KIJA 1K5GA 1RHQA 3R7WA 3K0FA 5CLQA 1VYVA 2XTMA 3K96A 1OREA 3VVBA 1FNNA 2VJLA 3HFJA 3G2QA 5FBLB 4I6JA 2I29A 4YJ3B 4G5YA 1SVKA 2I9PA 3O47A 1KE1A 3TO5A 3WGLA 3NV9A 2IBTA 4DS3A 4L07A 2WU0A 3JW8A 4LAFA 3EYAA 2VLBA 4XD7D 1XZNA 3GLGE 4CLRA 3GOHA 4DUGA 3QKWA 1V5WA 1I7NA 2Q3JA 2H2FA 2O19A 4F5EA 4BNTA 2Z4TA 1PYOA 3M9WA 3ZHUA 3DOEA 1PE0A 2QTWB 4J3NA 4YCBA 3ZWPA 1ZMTA 4GE0A 1DMSA 4YJ3A 2FQWA 5IAEA 1ZIDA 1DAKA 2D06A 2ZTMA 4ENPA 2PNFA 3FHOA 2QD5A 2ZTHA 4LJ4A 4INPA 4XDGA 4MS4A 5ADVA 1KSJA 5BR1A 3C3CA 2EATA 2NADA 3K1AA 1E1DA 3FNGA 4DJFC 3EXHA 4LJKA 1BKSB 3MJTA 5BQ3A 3TPFA 2YKGA 2PGOA 1B15A 4N39A 5JJKA 2VHWA 4Q9NA 2EBHX 2R6CA 7YASA 1W36D 2I2BA 3F27D 2G4VA 2QW8A 3R76A 4Z3DA 5HA5A 1PR6A 3TDNA 1W0JD 4KQWA 1NMQA 3BIFA 3UK2A 1H5QA 1GL3A 2H00A 3H19A 3MN1A 3P8ZA 4Q18A 2HQOA 5CM8B 3RUDA 1U0OC 1KRHA 4YGYA 4ZT5A 2L17A 3SI7A 3VAZA 5K0EA 1JP7A 1K5PA 3H4TA 4ND6A 3PJFA 3SE7A 4NCKA 1E1LA 1R10A 5KMGA 1TM4E 1RJEA 5HIJA 1CUXA 4NV0A 3P97A 1E2IA 3E18A 3KUKA 3LA8A 3N9IA 3OIGA 3RVRA 1YBAA 4BBJA 3N2GB 2GB4A 5A1TA 4PZ9A 1S1CA 3QPCA 2W6CX 4NYMQ 1DTEA 4GE3A 1BMQA 4BVEA 1AHIA 5KOIA 2ZUCA 4HQ6A 3LLUA 2C4UA 4C29A 1BFKA 2XE7A 2Z3WA 1KPGA 2QJOA 2YZMA 3ZWKA 1AB6A 3OTWA 1FLAA 4E22A 1RYHA 1ZINA 4ZVPA 5LQUA 1RYBA 3A27A 3PENA 3VYUB 4YT4A 1C8VB 1I7LA 2XCLA 4DA6A 4F3KA 4MB6A 1YRBA 5IBQA 4RF5A 1CG6A 5KSOA 2MDTA 3GJ3A 3OOJA