3ANYB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and (r)-2-amino-1-propanol
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
252
Chain Sequence
b'ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine ammonia-lyase heavy chain
molecule tags Lyase
source organism Escherichia coli
publication title How coenzyme B12-dependent ethanolamine ammonia-lyase deals with both enantiomers of 2-amino-1-propanol as substrates: structure-based rationalization.
pubmed doi rcsb
total genus 71
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3anyB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3anyB02
3ANYB 3AO0B 3ABOB 3ABQB 3ABSB 3ABRB
chains in the Genus database with same CATH superfamily
1P7ZA 2ZI4A 3GBSA 3IV9A 4FZRA 3E70C 1J2JA 2NO4A 1ZRHA 4N3BA 5LLDA 3LPNA 1B15A 3PB3A 3R75A 3WISA 4JBHA 4D6XA 3V1TC 3Q5DA 1MRZA 1XJCA 4J1SA 3PTLA 4DN6A 2O2SA 3DR5A 5CGQB 3B7WA 2JARA 5FFNA 1G291 4RMIA 2W0MA 2G1UA 2IYUA 2TMYA 1W8DA 2QM8A 3ONWA 1CB0A 1U80A 2A5FA 4OLFA 4QRHA 5FPQA 4EI7A 2JVIA 3O91A 3ZV4A 4FBGA 1KQOA 4Q18A 5F1PA 4Z2AA 3CPEA 3QEKA 1PL7A 1N2HA 1PQUA 4NZYA 4FOOA 4MS1B 4C2TA 4UBMA 2MSKA 1JE1A 3Q5GA 4KQWA 4MWCA 4Q4JB 3UMGA 3UVEA 3O92A 3ANNA 1Z6PA 1GKLA 4NCXA 4QLBA 5FPKA 1GQQA 5IULC 4QU9A 3UZUA 1TD9A 1HMFA 5IKOA 4TVBA 4IXNA 4B7ZA 3OE5A 4MWEA 1AKWA 1P6QA 3T9BA 4E0BA 1G5QA 2ID7A 3WHIA 1UANA 2ZBPA 3H3JA 4A4DA 5I7FA 1T2AA 5LZ2A 5DIFA 1UXJA 4EZBA 3PIIA 1TZCA 2HJSA 1NC1A 3HDVA 4M76B 4CL8A 2VP3A 3WO0A 2CKDA 1ZDMA 5JCOC 1RHRA 4B3CA 2H2AA 5JNWA 1B4DA 2Q9CA 4BY9E 1VCIA 2DG2A 1HDXA 2WSLA 3A6ZA 3GRCA 4OYLA 4BLQA 5KNDA 3G2MA 2JLWA 1RCUA 4RVSA 1MB2A 1P3Y1 4A23A 4BAUA 1G5PA 2ZVQX 2BTQB 4OHZA 2OD9A 1R4NA 2ZWPA 3TIGA 5IVPA 5JBIA 1L5QA 5C7IO 2H31A 1KP2A 3DJYA 4MW6A 4LBZA 4XQEA 1G21E 3KJHA 4GICA 4HH4A 4YN3A 1GT6A 4FFMA 3F73A 5DGIA 4HL6A 1JBEA 2XOXA 2P9CA 1PW5A 2CW5A 3DMFA 4JLJA 1P61B 4LKRA 4P3NA 1NQUA 3A6LA 4WK6A 2PQ0A 2ZE6A 2J4CA 4Y2YA 3ZHRA 3GH3A 1JG7A 5ERYA 4OQZA 4GX5A 4MB0A 3UT5B 2BBOA 5EC8A 1L5NA 2OAQ1 4YR7A 1N9GB 1GV0A 2BE9A 1YHYA 5JECA 3E2PA 2VUIB 4HUQA 4M0PA 4RW0A 1KYQA 4YLGA 5C3MA 1IIRA 5IYZB 1T8RA 5J63A 3SHQA 1F2TA 3R9XA 1KRXA 2HK7A 3DNPA 2PBRA 3QHAA 2YUTA 1OC2A 3NBKA 1Q1BA 3KO8A 1AU9A 4S2UA 4L8GA 1J39A 2PS0A 1YL6A 4K9QA 4BUZA 2Q3BA 2E18A 1W0KA 3ZCVA 5HIAA 2HRBA 2VPIA 3EODA 4EB6A 1Q1NA 1MX5A 1T3TA 1ZN8A 3ZWYA 1XVIA 5CB6A 1AF7A 3N0XA 2QENA 1IWPB 3L7AA 5KSWB 2VXBA 1ZONA 3PEUA 1BW9A 3NWJA 4AURA 1Y3FE 2JBAB 4OYRA 1U6JA 3DBIA 2IS4A 2EP8A 4G65A 1VPDA 4DUGA 4DY4A 1MAUA 3E3NA 3CCBA 3F2IA 1ZU4A 5CNJA 1G98A 1L5MA 3SOZA 1FJHA 1U5BB 1THZA 2LGJA 4PG4A 1E0SA 3MELA 2GAOA 4ZQEA 5SICE 1OXUA 2EZ4A 2XTMA 3COVA 4NWIA 1NUPA 4DR2B 4L7QA 3L7CA 1BHSA 3AM3A 1QMPA 3C7AA 3TPCA 3KPVA 4C0BA 1ZS9A 1O6CA 2BR5A 4MVJE 4DCUA 2A0YA 2RG7A 1DCMA 2MJLA 5HIJA 1SKMA 4UC0A 1CZLA 1Q83A 3WB0A 1XDDA 2M32A 2PWYA 1IY1A 1PLJA 1M2KA 2V6GA 4F6LA 1YI1A 3EW7A 4EF5A 3KU4A 4NYJR 3FD8A 2ZJ1A 3UH0A 1YR6A 2I5PO 4MGEA 3CT4A 5CB4B 3K2IA 4I66A 3F74A 4PW0A 4GE3A 1IN4A 1QH1A 3RAGA 1J8DA 4HGZA 4TWJA 1Z2PX 3WMXA 2QU8A 2FFQA 2Y0CA 3MW8A 4FN5A 2PTHA 4H27A 4G4GA 2CLMB 3ONEA 4TXNA 3SJCA 4F4DA 1OC4A 2Q27A 4QQKA 3D3QA 4FKBA 1NY6A 4BWGA 4HPJB 4F9TA 3KXIA 1DSSG 4ZGWA 3NJ8A 1AT1A 1G2OA 1G5HA 1N2GA 1Q6ZA 3HGTA 4CIVA 4DA8A 2HU8A 3DV2A 2FFHA 4H9GA 5HGXA 3W0LB 4CTMA 1JVNA 1TJPB 1ODIA 5LBTA 1Q2UA 3OFNA 1MQSA 4GT1A 4WUVA 1SIWA 3WLTA 2PAFA 2PZEA 3EARA 1LV7A 2CGEA 2XWSA 2I78A 3KXDA 1USUA 3A9CA 4B73A 1GL7A 3IXQA 4RVOA 3ZHQA 2WIGA 4HV4A 3RVOA 1HE5A 3PR2B 1ZL2A 3B20A 3B8HA 3N0TA 4DIDA 2HHHB 1RIIA 1CIJA 1AGRA 1TM4E 2R6FA 2XDAA 4P82A 4CKBA 1ZD9A 2NTYC 4RY9A 2JI6A 3NMUF 4Q5IA 1N9GA 4UTOA 2YZGA 1XROA 3IELA 4DXDA 4MV1A 1K6XA 4EG3A 1EX6A 1ZOIA 3E7PA 1LJLA 5G4KB 1B2RA 1RXIA 4R7GA 1RCFA 1BE1A 3H8JA 3O3NB 1DBSA 4PXSA 4JEMA 2O6LA 2CUZA 3UKJA 1SVNA 2ZBVA 3HGQA 2NT3A 5G4LA 2Z2JA 3LRPA 1K8ZB 1JQJC 5LQMA 1MVNA 3R3UA 2C83A 2W2LA 2EHJA 3R9KA 4AJ9A 1SZJG 2G9ZA 2Y1GA 4YI5A 5JRJA 3VH3A 4ZCMA 2NPIA 2XUKA 5EYPB 4UBLA 3RU7A 2FP4B 4DMKA 1ISIA 1TAGA 2CVPA 4L0QA 4EYKA 5I7UA 5KVAA 3B6IA 1DJLA 3IVRA 2B4TO 4JP2A 4E07A 4C3OB 4GLOA 3WDKA 2B2XA 3ILXA 1TQ4A 4MZXA 5CX4A 4E2YA 2G9UA 2F3TA 1PGJA 1XTSA 4M86A 4UBIA 3AXTA 2D1RA 4PRYA 2Y76A 4DIEA 3EUAA 3MWEA 1RBYA 3AI2A 1PZHA 2VPQA 5FBVB 1U2EA 1GQRA 5JIBA 1IONA 3M34A 4KO2S 2YWBA 2QVGA 4IH1A 5LD2B 1JLKA 1U94A 4PLGA 2IE0A 2Z1NA 4HXEB 4IDFA 5DSZA 3BD7A 4BMSA 1HT1E 3CVXA 3RUPA 4NJMB 1AG9A 1ODSA 1ZYUA 1NDQA 5H82A 4B5LA 2EJWA 4XAQA 1I7QB 4G89A 2A4MA 2JBWA 4FB4A 1IPFA 2VDUE 3EBLA 2W4IA 5L4NA 1CUEA 1BRTA 3K53A 1XT6A 3DQPA 3M4NA 3PC2A 4CHGA 1D6NA 3HQ4O 3MNFA 2NQ2C 3A37A 3H97A 3E8XA 5H59A 4LGMA 1EP1B 5F2KA 4BQIA 5D7BA 3BQMB 5F5NA 5ESXA 2CSUA 4CIXA 3G5TA 4ECEA 1MQ8B 2DVMA 3EK2A 2QN7A 2HA7A 3QVKA 5JYDA 3QM1A 3OF5A 3MYRA 3R24A 4AKIA 2XCRB 4PZPA 2BC9A 3NX4A 4M87A 3QUSA 1XQXA 1IU9A 2ZWIA 1BD4A 1BEUB 5AUQA 3K1ZA 3F1KA 3H19A 3KTAB 4H6WA 4M38A 1UBTS 5TY0A 2R2AA 7MHTA 5HZHA 4EW3A 4EJ2A 3SIRA 1SU8A 4YC7A 3T7RA 1FMTA 4EYSA 3TI7A 4L95C 2FWAA 3MPOA 4DLWA 4UM9B 4DQDA 3BMCB 5BMVA 2SHKA 1L5RA 3HCCA 2A86A 3BMNA 5BYBA 3WI7A 3TG2A 2KPOA 2G04A 1DNPA 3GJSA 5KC9A 3SZLA 4YRPA 1T1GA 5DGTA 5D00A 2W93A 3PRHA 2ABWA 1QNFA 1J1IA 1R50A 3OY7A 2FLWA 2QY9A 2C29D 1F06A 2WAOA 4DNQA 3WLIA 2VHJA 3RSZA 1MGOA 1NN1A 3B6KA 2IP4A 3BB1A 4C0WA 4EUSA 5J23A 4MDFA 2QTNA 1U8XX 1Z18A 2O48X 3GVIA 3ITNA 4A6EA 4N8EA 2V54A 3N07A 1RXVA 4B3MB 5ESWA 4KQEA 1Z12A 4KL8S 2M6LA 5B12A 2CE7A 4Q3DA 3V6MA 1QCZA 2VA9A 5A4MS 3KSBC 3DLBA 3E53A 2JCGA 2W6ZA 5AICA 5KB3A 4PFKA 5LQNA 5AMXA 5IDXA 3R6LA 1EPUA 2Y1EA 4FS3A 3N2NA 4IHKA 5JJIA 3U16A 3TLGA 3U39A 3LQ2A 4WFIA 3GLIB 1THMA 1GADO 3D6HA 4MI9A 3U2BC 2GLXA 3GO4A 4D74A 2YHAA 3NZEA 4MRSA 5DOZA 2JLQA 3DMTC 4K81B 2M6SA 3I30X 1WLSA 4YCBA 2QDXA 3D3NA 4OQQA 1A72A 4YDQA 2BCJQ 3NHBA 4BFLA 4XSHA 3JQEA 4OLJA 1C8BA 1BU5A 1E6WA 1UP6A 3TKAA 5DBFA 4CL3A 5F7XA 1CB7A 2GEUA 2V98A 5DZSA 2J46A 4QO7A 1IBLB 1E3MA 4QGFA 2DSTA 4KOEC 1YO6A 1X6VA 4QDOA 1WCYA 3OE1A 3FPKA 1A95A 2OORA 1JAXA 1TVEA 3LUAA 4TV8A 5AW5A 5HKKA 2BIFA 3I9KA 2M9MA 2OOKA 3A3NA 3CGWA 1Y5MA 2X5OA 4K2AA 4BAZA 5FDFA 3PJRA 4YV0A 2C1ZA 3OO1A 1JU4A 5KWJA 1D5CA 3QOFA 3JQGB 1H4VB 4LK3A 1JQLB 4PAGA 4AG5A 5JO0A 2B1GA 2W48A 2J9GA 1BS1A 2ZJ0A 4D57A 3EQ2A 2W6PA 1OFVA 5JNRA 3NWPA 2CXSA 2H85A 5LQAA 1IBMB 4L16A 2RBEA 4GP9A 3Q12A 1L6RA 4UMVA 4YGYA 3T0FA 3JYHA 2F48A 3STWA 2GN8A 2V7EA 4I5GA 1CSEE 4KMRA 2JAOA 1DAGA 4BJHB 3K9BA 1MKYA 1QQ7A 4OREX 3K70B 5JD3A 4N47A 1E9DA 2H8GA 3MJEA 1W5EA 3HVIA 1BKYA 4G1MB 1NUAA 5CEFA 2IH2A 3LXXA 3OCCA 1IRIA 1X87A 2XH8A 3D3EA 2YHBA 3NPAA 1U2SA 5DGHA 1MR3F 3HFGA 3W3AA 2XAAA 4OFXA 4XI9A 2I1WA 2XUQA 3EZ2A 1JJIA 4D9CA 4Q1VA 3S5UA 4RKWA 2ZT7A 2GZAA 3GLTA 1LPOA 1BYUA 1YBAA 5HDBB 1AZSC 5LMNB 3ZK8A 4ZC1A 1H2AS 4Y6GB 2HU2A 4GWKA 4MS4A 3NC1C 4NK5A 3CMMA 3D4LA 1VG0B 3D8TA 3ROMA 4J4BA 3BE6A 2GXQA 4HTFB 2HWWA 4UEWA 4B3BA 1E2EA 1DIGA 5F76A 3FDXA 3EG9B 4U7FA 5TX7A 4FKMA 4UMDA 2O52A 3PG5A 3KJZA 5JLJA 1J0CA 1UBKS 1EIWA 2IUEA 2I33A 4FS8A 1L5SA 5KI6A 5BW4A 2JH9A 4GBJA 2PYIA 4HI0E 4KBGA 3OM0A 4DR6B 2GHQA 1ZMTA 4O4LB 4UMEA 1MO3A 1X14A 5LDGA 1GPKA 3OCYA 2H5LA 2YWJA 1J99A 1GPYA 2NZXA 2QNRA 2VPYA 1Y3HA 5E4TA 1MOZA 4BATA 2WFAA 1EM6A 1PR6A 2A7QA 3QWHA 4YQFA 4L6IA 1NM5C 1P2GA 5CH5A 1QP8A 1JEYB 3QW4B 2NTNA 1J20A 1H9CA 1K5GA 1Y4ZA 1KEUA 4H1UA 1W88B 4G1VA 4HVCA 1Y8ZA 4RXMA 4HS4A 5E3HA 3Q3CA 4DABA 1VL5A 3U56A 2O23A 1DEXA 2R5FA 2WC1A 3C1AA 3R8XA 3LQQA 3TL6A 4M7RA 5LSAA 1PS9A 4PLFA 1XNJA 1QZXA 1JU9A 4FYPA 3ZU4A 4AZVA 2IHTA 1V25A 2C5HA 3SZ3A 1KWKA 2GYYA 1DQRA 2Z2KA 4PLHA 4CR7A 1Y3CE 2A9KA 4GGOA 5DRTA 4AROA 2O1SA 4W8OA 2FW7A 1QXSA 2WILA 3ZCSA 3OC0A 4KQIA 2WTAA 2ZJAA 3CUVA 3ANMA 3TI9A 1MHTA 5FWYB 2QK4A 4IILA 5H4HA 2WD8A 4XEUA 1DAMA 2CO9A 1K3TA 3P9IA 5T57A 3O4RA 4TL6A 1L4NA 1X7XA 3CKLA 5G2OA 4CQLB 4ZJYA 5BSMA 3N7AA 5CR9A 4GI7A 3FNRA 3G8BA 3H6GA 3RAFC 2QQFA 2Q28A 3PUHA 1FLAA 5K03A 4ZCRA 3TSAA 1OIWA 4JQZA 2WVHA 3LZCA 2WMOB 1IXSB 4G5RA 1ENZA 2AD5A 2HSDA 3KTAA 2ZATA 3CF2A 5JS2A 2JLBA 4UHDA 5D6OA 1RM5A 3FYUA 1FSZA 2TMKA 1NHMA 1KO8A 3LWNA 2ACWA 3NNDA 1LU9A 4BMXA 1OLUB 1TCBA 4MUFA 3B13B 4R51A 2EG9A 4QBTA 2HLDA 1ABFA 2XT6A 4X1IA 3GP3A 4RXTA 4B7CA 3A1NA 3NNNA 5A7FA 2F7SA 1UC9A 3OFSA 2PU5A 4LDJA 4R8LA 2A5GA 2Q1XA 2DUJA 4XVHA 3F7OA 1VIMA 4ZQFA 3AETB 2VOEA 1SH7A 1NXXA 4QR9A 1L7RA 3ASYA 3RYHA 4EQZA 3CZ5A 3AM1A 5DHTA 1E3JA 1DAIA 1DBRA 1Y9DA 2EKQA 3AF0A 3BBLA 3QF4A 5FEMA 5KC8A 5JDIA 2WNSA 3JYQA 1XEXA 5CITA 4HMPA 4MS4B 4BE4A 1CHNA 1UMKA 4IW3B 5D86A 1CEYA 2EL7A 1ZMRA 5A5VA 1RHMA 5BWCA 3IAAA 4KPGA 3ABQB 2FR8C 3ZLTA 3LRXA 2OLKA 2J4FA 3TTWA 4PZLA 2G7ZA 2XNCA 4XD7D 2VNJA 3EVGA 4D98A 2Q1SA 3TDMA 1UDRA 1I3OA 3OCWA 2OCDA 1T2VA 3BDAA 4OQEA 2HB6A 3U13A 2RGAA 3UT0A 1OKKD 3HTXA 2JIOA 3A3KA 2KW5A 1ZW1A 2CEKA 5L3RA 3A4NA 3ZZ0A 1I01A 4E31A 4Q4LA 1EUDB 1WV1A 2C04A 3U6KA 5FBKA 1WZ6A 3PFNA 3EPKA 4G0WA 2HQOA 5E6UB 3EHEA 3N5KA 1J49A 3DXYA 4JZYA 2ROQA 3RVBA 1RI2A 4CKYA 3QVOA 4XX0B 2PMFA 4EUWA 2QW1A 5K51A 3WKBA 3MFYA 1KK3A 4MRAA 4OXKA 3H4MA 4XXHA 3DGFC 5FPTA 3JQQA 3LCJA 4Y9UA 5IPFA 2L19A 4TUYA 4O63O 3H86A 3GLHB 4F5DA 2VJQA 5F2NA 3FGZA 4C4ZA 5DN9A 3NETA 8LDHA 2GBLA 4JS0A 3QXHA 5D84A 5CT4A 3K9FC 2P5YA 2JI9A 4L5AA 4IGAA 2PXAA 3SR3A 3L1JA 2VJOA 4I9HA 2CNLA 2E1RA 2PKWA 3TTSA 1PJTA 4QGBA 1GM5A 3OCVA 1YRWA 1ETHA 4C2AA 3OTQA 4PZDA 1PL8A 3U0BA 4AJ1A 1HDGO 4LHVA 2Q1UA 3TOCA 2IEIA 4KXQA 1MW9X 3IOYA 5AI5A 3C7TA 4POOA 1EGQA 1OXKB 3DTTA 4NG4A 5KMGB 3EOZA 5E7JA 4D3DA 4RD0A 1OAOA 3B89A 4NNPA 2IP1A 1N2CA 2W42A 5BN5A 1WUYA 1FTSA 2X8LA 2XECA 1U8CB 2FE1A 2GJ4A 1E9BA 3FCYA 3EZ7A 3KOYA 5J2TA 3PCTA 5BN4B 3V6LA 2CN1A 5F23A 2H5EA 3EXHC 3OC6A 5ICMA 2OY0A 2PAAA 2QG4A 1NVTA 3UICA 3FTDA 4PG8A 3UY4A 4EITA 1HKUA 2X0FA 2I2FA 4MWZA 4RHEA 4HEA6 3ZH2A 1HDOA 2JL1A 1A9RA 3L7NA 1EU1A 4RD4A 1BU8A 1DPGA 1VE6A 4LTNA 1W5FA 4R71A 2V9CA 2VFAA 1RE0A 3FXAA 2CBZA 2V7BA 1Y34E 2OHXA 2R7MA 3G88A 3KUKA 5LUAA 1XRMA 5COQA 2CLFB 5A3VA 3RRMA 3G0DA 4ESVA 2YR0A 1JPNA 3K4PA 3EWAA 2PT7A 4RACA 2ODBA 4YAGA 4ICIA 1TKRA 4JR1A 3SHFA 2JFQA 4LTDA 5IT0A 2W11A 1Q22A 3T5PA 3ORQA 1ZCZA 3D8NA 1DWUA 1VLQA 1XX6A 3WBBA 2PZBA 1B00A 3ROQA 3VOAA 4P3YA 5CLFA 9MHTA 2PNFA 3CWQA 4FNGA 4MO9A 4XJTA 4JLMA 5KNDD 4PPNA 1HZJA 3OX4A 4BFXA 3AERA 3CKKA 5COAA 2P4HX 4J0GA 2NUPB 2G4LA 3GT3A 5HJ5A 1BWQA 4JI8B 1K89A 5I9MA 2VHVA 2O8EA 1X1DA 3HKDA 3W8DA 1ZNWA 3ILHA 2GA8A 3EVZA 2X5XA 1XFAA 4FW8A 5CIWA 4X71A 5FYQA 4DWWA 2I3ZA 1EFHA 4BNGA 4BEJA 4O59O 1U3DA 2OMKA 1DQYA 2ZR7A 1CUFA 3I42A 5E7QA 1GZVA 1NT4A 2YCLA 3AGQA 4L22A 5CA1F 1FXSA 2P3LA 3JU3A 4OUDB 4BX0A 5K7SA 3WXBA 2QAGC 2QORA 4TS4A 5A04A 1J9GA 2DBYA 3HDYA 3KT0A 1H2RS 1MG5A 1PTJA 2BKAA 4LJSA 4JBXA 1J0XO 4XX0A 2OA0A 2LZ0A 1T9KA 3RK4A 3TLAA 4Z7JA 1IN7A 1L7AA 1KEVA 4C43A 4E88A 1Y6FA 1M1XB 2MOKA 5DHFA 4TUYB 3DDOA 3PGJA 1YACA 3O26A 1SCKA 2I62A 3VHXA 4BYMA 4KO8A 3ANLA 2W6IA 2ARKA 2KE5A 1SCQA 2ZPUA 4L76A 1ITZA 1TZJA 3L6CA 3ZOKA 2VNHA 3W04A 1N6IA 4HVLA 4RA9A 1OZFA 3MWDA 3W9BA 2OPHA 1D2MA 2WNHA 2GYUA 2FQ1A 1R15A 3E9RA 4Y2GA 3I45A 3TVTA 4LOAA 1QP0A 5NULA 4GOMD 3VYVA 3LT1A 3RFCA 4S1WA 1U9IC 5FUMA 2GARA 2J6CA 4N4AA 5SY9A 3SZGA 3JATA 5G0VA 4RVHA 4R1SA 3JZFA 1KFJB 4LN1A 2Y4NA 3UNXA 1I10A 3TJRA 3VSCA 1EFCA 1EZZA 1FDWA 2COEA 4H35A 3KJXA 3LUHA 2A1UA 3AH8A 4OHPA 1MDFA 1PQWA 4Q3LA 5A4KA 1M3SA 2OHHA 4HQFA 4NU0A 4RVNA 5G1NA 4MPTA 2NSLA 5C35A 1RC1A 2YYSA 1LPNA 1Q0UA 1VPLA 3E35A 4NP6A 3HU5A 5LZ7A 2P9ZA 5AI0A 3RVLA 2XQFA 2Z8YM 1QRSA 1DTWA 2IOFA 2D1SA 4FGZA 3RYHB 1FXWA 1RJWA 3O4HA 4L2IA 5EJ4A 4DDWA 3VZPA 1HWYA 5CPFA 2G17A 1W5SA 1J3XA 4Z99A 4I4TA 2P11A 4R1QA 5F4BA 2B36A 1E7MA 5FL7A 1N8TA 1Y1SA 3D2BA 3LLMA 3M89A 3I72A 3AR9A 4KR3A 4M4SA 5B7QA 2EVWX 4OJYA 3Q3JB 2R6GA 3K6SA 4FOTA 3PEVA 2YY5A 3OT1A 4E03A 3DG9A 3Q7EA 4Q9LA 4U9UA 1G66A 5EIEA 1AO0A 4YO7A 2O8BB 4OHXA 1WX1A 2BL4A 4GVXA 2WT4A 3AFGA 2HZ7A 1KDYA 5B4UA 4QT4A 2NTJA 3LTEA 1F7UA 4WW0A 1L7MA 1MT0A 1NPYA 2XB8A 2JFYA 4XTRA 1ECBA 3GFPA 3U9SA 5DYTA 4C7JA 1DQNA 1Z8HA 3ENZA 3L0CA 1KI9A 1E1CA 1L8LA 5G02A 5JH7F 3GCDA 1J46A 1RU3A 2PPLA 3GJ8A 3ORYA 2ZR8A 5CGZA 2AOTB 1KGDA 4MR9B 4YACA 2GPTA 4WZBE 4RZIA 4V1CB 4ENVA 3HLTA 3EVAA 2NGRA 5D87A 1NSFA 3NBUA 3UHAA 2C5LA 2ET6A 2VQDA 2X58A 2RK4A 3REQA 4I5DA 2HRDA 5DN6A 1PVDA 2G67A 4MHOA 5U1PA 3VR4A 1QE5A 1YASA 3EYWA 4DRZA 4L15A 2BFDB 4HWGA 1FMFA 2IS6A 3IQIX 1WVGA 5TPZA 1SCDA 3H9JA 3X3HA 3C3EA 2H48A 3WB1A 4H08A 4KZPA 4BJ3A 4PPGA 5B2ZA 1MXHA 2PL3A 2XPCA 1HQKA 1MQAA 1V71A 3FMGA 1K06A 3H9CA 3KELA 3OZXA 4IX1A 4DDKA 1U0BB 4R9RA 3NKVA 4AI6A 2RK6A 3BG5A 3NHRA 1IOWA 4KUGA 3VU9B 3ZDZB 1LLCA 3J80A 3O8QB 3HYTA 2B6NA 2BMDA 1X86B 2AI1A 2JLAA 4IDOA 2PZLA 1FFCA 3K09A 3KVNA 3NANA 3W7AA 1SGWA 1N2CB 4PHHA 3CVJA 4A0FA 2C7QA 4MPPA 1N36B 3IDSA 2GDJA 2FMUA 5FPSA 4CMBA 2A7XA 2JDID 1TEHA 4WD3A 2GB4A 2I4TA 3NNSA 3ZNPA 4C4YA 2YV1A 2RAPA 1LPSA 1E2BA 4Q0MA 2ZJBA 1JPVA 3TB6A 4P0PB 2QL5A 2D1YA 4QNRA 1I2CA 1TYZA 4O2BA 2PKEA 1Z33A 1BVUA 1U2DA 2HMUA 2IYVA 3OX1A 1JLMA 2FDCA 2H1SA 1C30B 1P2DA 4K9MA 4K88A 4CKXA 1GTRA 1QKJA 4V1CI 2IFTA 4NE9A 1P1HA 3OZIA 3FW1A 3K5HA 1XEXB 2F3UA 3IAS6 1JEQB 2I67A 1EP2B 4N5DA 3QUTA 3KBOA 5EKUA 2VYCA 3IQHX 3SS9X 4LX0A 1TT5A 2AQIA 1R8QA 3DLTA 3R5KA 4G1FA 1U9IA 5JBQA 1E8NA 3OQHA 2DUWA 2IZ5A 3WY9A 4DKXA 3LWDA 4LYAA 4ZU3A 2VK8A 1V3UA 2W2OA 1AHNA 3LDUA 1VI2A 5K20A 4BMOB 1YBFA 1I2ZA 4XLLA 1XFDA 2ZJ3A 3GRFA 1EB9A 1MJNA 4N5HX 4AX4A 1M6NA 4L5IA 4RHXA 4ZZ0A 4HJXA 1K7SN 2HSZA 3N2LA 1CT9A 3V8MA 5G0TA 3G9TA 1R0YA 3A32A 3VNQA 4U7JA 2ANCA 2XMSA 2ZWAA 4GZ5A 3ZV7A 4YRCA 4CF6A 3KOXA 3ZE6A 5JC8A 2GCOA 3UHOA 1NTOA 3OJWA 3W5SA 3COPA 4IGIA 5DHRA 1VJTA 2C97A 3SLGA 3V33A 4ER5A 4F85A 4RH3A 1QLWA 1U1IA 1RM4A 2VATA 3E05A 4TKVB 1A9XB 2F3RA 2DFDA 5DNDA 4AMYA 4JGGA 3X1ZA 1L8QA 3MMSA 4BQQA 2WJIA 4RWZA 3ZKAA 1X77A 3UUEA 3A06A 5A6SA 4XOIA 2VYVD 4LF7B 4PZ9A 1RRKA 3MTBA 3NTVA 1EP9A 3F71A 3NGXA 1CQJB 1B3RA 5A3QA 2QTVA 4R81A 2BZ1A 2ID4A 4PHFA 1CP3A 3OMWA 2WSYB 2VO1A 4QU5A 1Y1QA 4XA8A 2VHCA 4CLOB 1RVDA 2BBWA 4JQCA 1NNEA 3SYRA 4MWOA 1ZIXA 5FX2A 1E99A 2WHPB 3UB4A 4JMLA 4YXFA 2BEVB 2CLKB 3O6VA 1R6XA 1A04A 2PUJA 3EIQA 1SU7A 4B9EA 3HN6A 2OVBA 1OA0A 5ECWA 3X1YA 2G40A 1VI6A 4KK4A 4B46A 1RAIA 2V8OA 3MG9A 3S55A 3PQ3A 4GLFA 4DG9A 3DDSA 3QSGA 5CT6A 4JODA 5P21A 4DJAA 2D00A 1JSCA 2OYRA 2QNIA 3BJEA 4PBSA 4AIIA 3VKHA 1U9ZA 3JCZA 3MINB 4EYQA 3KS9A 5BQOA 4RORA 3IUMA 3HJBA 4YRJA 3ZXIA 2RHLA 4HHEA 4PN7A 1QLHA 2MTBA 5CH3A 1SUEA 2ORYA 3MGKA 4A92A 1EK0A 4YK7A 5FXMA 1T4BA 4KDEA 4OHBA 3A2NA 3EGIA 4IVRA 3P26A 1IYZA 4WPGA 2C0CA 1P0FA 2NO5A 3OZGA 4IG9A 1YIDA 4HBGA 4B2YA 1ZITA 3LD9A 4JA2A 4ZEXA 2IU6A 4E51A 1MABA 2QUZA 1PX2A 2ETXA 2FOIA 3OQVA 4UOEA 3N2EA 5E9AA 4OBWA 3AB7A 4H1VA 1C4WA 2D7LA 5JH7B 3KL2A 4KWIA 2ZGVA 2VK2A 4PIVA 3ZHBA 5J43A 1LWOA 1DU4A 3B3QA 1G9TA 3V4VB 4AT1A 2RHTA 5B1EA 1SUWA 2I6XA 4GW3A 2WHXA 1DARA 1PT9A 2CHEA 2VSYA 3CG0A 4IRUB 4KNWA 5HE8A 1SOVA 4LNHA 3NWBA 3RRNA 5AK6A 1CQXA 5TNXA 3GJ3A 1KH3A 3V4FA 4ZKDA 3JQRA 1H3FA 4H6PA 4Q9KA 1UFRA 2BR4A 2IHZA 3T6KA 3UUFA 4YMHA 4KW7A 4ZOLB 3JW8A 3GUZA 3AIKA 1M74A 5EQDA 3WLQA 3PDWA 2YV3A 3W1WA 2C2HA 2ZRMA 3D1VA 3VVBA 5TQVA 3SHOA 4JLVA 2GBLC 1VL6A 1TJ5A 5E38A 5AOVA 1E8DA 4OI2A 5ERXA 1BHO1 2FGJA 4JQOA 3ZCRA 4JHLA 1ZGCA 2VDJA 4QXRA 4GQBA 5JSFA 4CTNA 4R31A 4Q3KA 1Z16A 3F6SA 3AEYA 4WKOA 1E6KA 2HZBA 1Z0FA 2PU7A 4TMKA 1IAQA 3W8RA 3ZV3A 4EVSA 3I3OA 4LYYA 3IKJA 1JMVA 3C3PA 4HLDA 5FL3A 1L4HA 4ENPA 3ZR4B 2C58A 2QI9C 3IS3A 1R9GA 1OTYA 3T3IA 4LRXA 4NBWA 5IM4A 3AFIA 3ETNA 3VXKA 1MEJA 3P7MA 4MUHA 4RANA 1H1LB 4WV3A 3FNHA 5CDHA 2BY4A 3FNFA 4QOEA 1X7ZB 4MVJF 2IPXA 2Y1FA 5INTA 2ZSEA 1JDVA 3HXQA 4Z4EA 1IC6A 4GPAA 4X41A 4V2IA 5IC4A 1N78A 1JTEA 2A4KA 1F5NA 2PM8A 4RQTA 5AVJA 4EJMA 1JEAA 1T13A 2V3WA 3OVMA 2X9NA 3UHPA 1OAOC 4O4JA 1XDGA 2EKBA 3I6YA 4JJFA 2Z08A 4BVFA 4X60A 2HA3A 1TK3A 4KUHA 4FQ8A 1KK0A 1L7DA 1GPDG 4YAUA 1OX6A 1TX4B 2GT1A 5GM2A 2NVUA 3ZJVA 2ZIZA 4TYNA 2B35A 3EGEA 3UMMA 2I29A 3O8NA 3S4YA 4L4RA 3RHSA 3EH2A 4K03A 3TXXA 1RYZA 4ZT3A 3QWAA 2O59A 2G1PA 3U3JA 3C24A 3WAGA 3VU8A 2HGZA 1GDTA 4LS3A 4YYEA 1FYFA 4C07A 2DCUA 4PZZA 4FFWA 2HDZA 3EIUA 4WK4B 2BEWB 1AZLA 1O03A 3KPWA 1ODCA 2XQVA 3EQ8A 1JEQA 4XFKA 2BGMA 4O2AF 1A8IA 1MABB 1MB9A 2X6RA 1HFEL 3BXGA 1MGPA 1ZK0A 3ICPA 3LWBA 4PCVA 4TLMB 3TMYA 1EX1A 5AO9A 2PMEA 3C8DA 3FUCA 2TMGA 1Z08A 5EJ9A 3I2IA 5F52A 1R8JA 4LZLA 3GBVA 4OO3A 3IVCA 3KZCA 3L6OO 4GPTA 4MLPA 4RF2A 4RVUA 5DE3A 5ALMA 5EHGA 2VJNA 1RXWA 2QL6A 4KN8A 1PJ2A 3VAAA 1P33A 4Q7QA 1JSXA 3WKAA 5JASA 1KYVA 3KV3O 5IF3A 3AL2A 3PWZA 4WY5A 3V8PA 2F64A 2J6HA 4M9RA 2BGIA 1RKBA 1E64A 3KKPA 1YB5A 1K0FA 1YU9A 2RC6A 1I5EA 2RHBA 4W5QA 1NZDA 3DUFB 4MR9A 2FHSA 3ETHA 2GSWA 1Q7CA 4QT0A 4DLXA 3K1AA 5DI3A 1KO7A 5A71A 2XZDA 3ZY4A 3LP6A 4EI9A 1JDBC 2GVZC 4Y7CA 1ULAA 1P17A 3LS2A 1RQ7A 4MRPA 3V4OA 3BIXA 3BSFA 4C6SA 1D9XA 1T5HX 1WEKA 2JLCA 3G79A 5JDIC 4KP7A 5LWQA 4G0OA 1DT3A 1RRPA 3GJZA 5ALXA 2GAJA 2ISCA 5L3QA 4F8EA 2GX6A 1W44A 3QTLA 1X7WB 3ZGLA 3K70C 4D8TA 2YW9A 3LUKA 4LXYA 1YZYA 4WLFA 4LRQA 2NTEA 1CQJA 2H54A 4H15A 4A0RA 2QD1A 5K3SA 2QKYA 1QGOA 2O19A 4MUKA 4A2PA 1OOEA 1K5DA 4B4DA 1PDWA 2I7TA 1U9CA 2WKQA 4E2WA 2PUBA 3C5EA 2GO7A 3EYAA 4E7OA 3TTYA 1SXQA 4XARA 1PNTA 2GZ1A 5A4JA 3JVDA 1ISPA 1G6Q1 1GAXA 3QU7A 4R1LA 1MO4A 2NU7B 4X45A 4Q3OA 3ZGNA 5CT8A 1NXOA 1XEFA 4Z3KA 1JJFA 3NJ4A 4FYXA 3ER9A 1DKRA 6YASA 4F5WA 4MJXA 3AVUA 2QRNA 3MBOA 2P3SA 2FW8A 1XDUA 721PA 3D3KA 4CV1A 2O8FB 4NH4A 2QRUA 1QQAA 4F97A 2Q5LA 5HHTA 2P1ZA 3D3WB 3LYUA 4HWTA 4EUKA 4I9GA 5DU2A 1W47A 2AA3A 4BO5A 2JGKA 1E1KA 4Q4DA 4U3JA 1OYOA 1HRKA 2X4IA 3LQ4A 4HRXA 3QI2A 3R0VA 5BVGB 5IMSA 2F8SA 2VLIA 4XCQA 1Z5NA 5LIPA 1H94A 2B8WA 1I0ZA 1SBCA 1H2XA 3G13A 3TLBA 1CY7A 2YXNA 1M54A 3IQWA 3K9LA 4HDAA 2X14A 3JRXA 2IHBA 1NTRA 1HYQA 2CXHA 3OQMA 3MXOA 4PX3A 5AW9A 3NWOA 1K9SA 2QBYA 3C7DB 2OAP1 4ZVSA 1DS6A 3GRRA 4WKPA 5TQ0A 4AM8A 3KB6A 3CN7A 3OUZA 5FUQA 2C4WA 2PKQO 1QB8A 1U31A 4ND8B 2MSCB 4YO8A 4RULA 1LBQA 1R64A 1MPXA 2JD2A 3OPNA 4RPIA 3TE7A 1Y6QA 1J23A 1C3LA 3AF6A 3DL0A 5DRYA 2Z0MA 1R5NA 2QIOA 1MPTA 2D62A 1N0HA 2XYHA 2VBIA 1F6WA 2IUSA 3CEPB 1BXZA 1SC3A 4EW6A 2C9BA 5LP6C 3RSQA 4TV8F 3VO9A 1TLFA 2AI3A 2JJ2D 3W1EA 1GLGA 5EMHA 3CZRA 1ILWA 3OQIA 2JVKA 3WBJA 2I9KA 2L2QA 3ZEIA 4BGVA 1IH8A 1IIBA 1R8XA 3DFIA 3QUCA 4PFJA 5I4KA 3BWVA 2G1AA 2OMEA 3HP1A 1U3WA 3U6BA 1FQWA 4MTCA 4F2DA 3DE7X 1DQSA 1ZC3A 3I5UA 4CKWA 3M82A 4EBBA 1TMGE 5JAHA 1E2GA 1QDUA 4TSRA 3PA8A 2ZI7A 2PX8A 4J6FA 2XADA 4NBTA 1JWLA 5KX5B 2OC9A 1E9SA 1ACJA 2Y1LA 3EWIA 5IJWA 4JYZA 3K1AB 1EM8A 2HLNA 3KKMA 5DI3B 3M2PA 2V6IA 3OECA 3KUUA 4FZVA 3DDHA 4FT2A 1H8EA 1Q3HA 5CNIA 2IOHA 4ROSA 4C6TB 1SVSA 1E7SA 4FC7A 3HUDA 5HRUA 2HRRA 3DHWC 1OZHA 3RI3A 5A7HA 3VJLA 2G63A 2J3MA 3LNCA 4UM7A 1W4RA 5JPIA 3IQZA 2F3SA 2PH7A 2V7GA 1R12A 2ZUCA 4G36A 5EGSA 3B53X 3THWA 4GDMA 5A9RA 1SA0A 2ID9A 5B6JA 3ZD6A 1NQ5A 1Y9EA 5HQ3B 1NSYA 3S1AB 2ZSFA 2VSOA 5JYEA 4S35A 2O2XA 4P31A 4R3UC 3NVDA 1ISRA 5AD1A 1H2ZA 4BKRA 3Q7IA 2Q21A 4YV2A 5J4YA 4ZO6A 4JI3B 4CHTA 3WKDA 1BDHA 2FSVA 1ZM3A 2X8WA 3NTQA 3CE6A 4LYFA 4MJLA 5E1MA 4EX7A 4F38A 4EG8A 2IY7A 4YJ2F 4H77A 3WDLA 2GN4A 3Q6NA 4GKVA 2C98A 3OZFA 4INJA 1IHOA 4DARA 4RNCA 1DDIA 3GCWA 1O6FA 5E8RA 4GVLA 1A88A 1I6WA 3VYTB 3LV8A 4W7SA 4YUWA 3UXEA 4NESA 3D3WA 2H2HA 3JVVA 1OPXA 1XN1A 5ALWA 5GV8A 2B2CA 1XRQA 5IVIA 3KHSA 1A77A 3O21A 1FDSA 3PQ4A 2L42A 4EGQA 1VSTA 3D4NA 4IXWA 3U7RA 3IPLA 2DQ4A 2UYCA 2O2YA 3FCAA 3G49A 1PJSA 2GN1A 1J8VA 2C2ZA 4D9KA 1RMYA 2C8JA 1M2GA 1TUBB 4K9DA 1DXQA 3FY4A 4C4XA 4JGIA 3EZ6A 2HEGA 2IY8A 4EGCB 5DN6D 2V7XA 3WTCA 4YJ2A 3DAPA 1RYMA 1X9HA 2HCRA 3UN1A 1WIWA 4YRIA 2GHRA 4YP0A 3LBFA 3TRIA 5L4LA 1VMDA 4BFUA 1DJOA 3W4KA 1ZNXA 2LEFA 1BOFA 3RSOA 2XDWA 3DMYA 1BQ4A 2EIXA 3PC4A 4FSDA 4BBZA 5KQRA 1P4AA 4HFJA 1V5GA 3U4IA 1ISGA 3PPVA 2EGHA 1WSAA 4BV3A 1D4ZA 4O29A 3CH7A 1LZKA 2PUEA 1E0JA 2R8OA 2WJ6A 1HDZA 1PQPA 2HXYA 5EI5A 1ZD3A 1GIAA 3RC3A 3VV2A 5L9AA 1VKHA 1S6YA 4IDGA 5EP4A 1YOVB 3C5WP 3SIXA 1B6RA 4MMZB 3E03A 1C3XA 1CF4A 1MEOA 3RVDA 2PUDA 4I4NA 4TTSA 3OOWA 5CK4A 4F04A 1AKTA 2CS1A 1O9HA 3T35A 4B6FA 1BO6A 2YWEA 2EFYA 5KWEA 1RKUA 3DDZX 3MF4A 5DYWA 2VF5X 3W5JA 1A5TA 3CEMA 4ETIA 4NENA 3VA7A 1YULA 4IJWA 1FP4A 4D3XA 1M6WA 5FAKA 4HDOB 3WJ1A 2BF7A 3STYA 1LSJA 1OXSC 1RLMA 1TZBA 2AR7A 3GMSA 1Y9ZA 4N03A 5D3MB 5TS3A 1WBDA 5IH7A 4NI5A 5C2JB 4BNNA 4ESEA 4KAAA 4ENWA 4C04A 2HA5A 4P54A 3S0JA 1VXRA 4JAVC 2ST1A 4ENRA 2HDOA 3L82B 2X19A 4GR5A 4B33A 3LBAA 4C0JA 5LA6B 4BO1A 5B7PA 2Z5GA 3T1HB 1MU0A 5HQ3A 3R2JA 1UXIA 1VRVA 2Z1MA 1F9EA 4DCMA 2JATA 2TS1A 5HNKA 3GEMA 3F6YA 4DMLA 1EK5A 3BDIA 1TZMA 4PLPA 4J9VA 1RJDA 3AV0B 5HBRA 5EJ8A 4PLWA 4RELA 1IHYA 5AKGA 4MVWA 4LWZA 1OBCA 1HLPA 1VG9B 4CODB 3C16C 2MIIA 1YDWA 4J3JA 1GPUA 3FPBA 3JXEA 3HMQA 4RTNA 1CXZA 5GJVC 4KQFA 2D5LA 2X8JA 3EASA 4TWIA 1FFSA 2QN8A 3E7XA 4XUCA 3O8OA 3V00A 1HSZA 2FSSA 4UVGA 3G9QA 4DYDA 1DCTA 4DJFC 1G8YA 3R77A 4B31A 1BVYF 2PE5A 1EHIA 5MDHA 4I14A 1A7AA 1FDOA 5KYGA 2AK3A 1QRUA 4FZ3A 2I22A 2BBTA 3VBCA 3WK4A 1KEZA 1M2WA 3GZTB 1XQYA 1ZAKA 4MIKA 3RS9A 4DJEC 5DX1A 2EX4A 4O1HA 1D7AA 1L4BA 3BX1A 3LC1O 1GGHA 4R2IA 5F1KA 1XA0A 1KZ9A 4KDFA 4BNKA 5KDOA 1V4NA 2FPGA 3KSRA 4RMGA 1I36A 3WAKA 4O1IA 5AI6A 3SLRA 5AIAA 2PK3A 5AVWA 1JFFB 3EZ9A 4IH9A 1F5SA 2BM9A 1RYHA 3BJZA 3CEJA 1MOPA 3P32A 3L1HA 1SKQA 4WBXC 5CVUA 2RAUA 4AJNA 4E7PA 1YL5A 1U0NA 3QBDA 5EWMB 3WO1A 1CWUA 1JKIA 2UYYA 3CBGA 5LN1A 1FF9A 1FYWA 3G2LA 1JXAA 3N2ZB 4XDGA 3RQIA 1S1CA 3RB8A 3AT1A 3KQSA 4ZJZA 1XHEA 2XSZD 3CU5A 1NV8A 4WCFA 4NNJA 3H4TA 3L8GA 3TKLA 1GGMA 4XUGB 5K8IA 4AZ0A 2IZ6A 4PAOA 3OZBA 4AWBA 4K0KB 2XXJA 2OILA 1XMOB 5A0TA 3Q9UA 1Z2DA 1LCIA 4A6PA 1V3QE 1Z6QA 1G19A 3L8CA 5CFOA 3BWMA 1N5MA 2I1VB 4JBLA 1C2YA 3NLLA 3FHTA 3IAHA 2JF0A 2R60A 2ZI6A 5TSDA 4AF6A 2Z3VA 2AMFA 3RCBA 4R4JA 4J75A 2C9CA 5K0CA 1YONA 1QP7A 3OZEA 4UEKA 1U0SY 4N5NA 4W8HA 1V8OA 3ETDA 3GJTA 3FYHA 3KXPA 3L5KA 3B7GA 4NENB 1A8QA 3S68A 3ZJUA 2AXEA 5ALPA 2OV8A 3Q87B 2R3SA 1SKBA 1GNVA 1LK7A 2BFEA 2QD4A 4QG7A 2I7XA 3QPAA 1ZC4A 1L4EA 2DJ5A 4FBMA 2DWQA 2GRAA 3VYRB 1JR4A 3RIEA 1DC7A 4EMUA 1E9EA 3W5IA 5JARA 3T12A 2PBLA 3LL4A 4LOKA 5D8DA 4C4PA 2K87A 2QTHA 1V7CA 2KWIA 3EUFA 2E4VA 1F2TB 5ALQA 4ZAFA 4CDNA 2VDLB 4BGEA 1F4LA 4CG0A 2XKKA 1K6IA 3IBCA 3BHNA 1ZBQA 1G7SA 1ZD2P 3IPCA 3TLJA 4B81A 1N2ZA 1P6UA 1Q3TA 4IJQA 3DFUA 4LNUA 4MV6A 5ALIA 1H0RA 3VSAA 1CE8B 1WS6A 4BC0A 3A27A 5K05A 1FNMA 4MINA 1O95C 3CX6A 3KB2A 4R2XA 4XGQA 1TF5A 3SIPA 3I92A 5KQPA 1SFRA 1A5ZA 5ALZA 1AS0A 4CUZA 3N8KA 1RTKA 5LYJF 3L7IA 3FWPA 4BNVA 4L72A 4HYQA 4Y9SA 5DT2A 1U3TA 2IXFA 4Z4IA 2F8MA 1YAHA 3EG5A 3KFVA 3FJOA 3ZDAA 3U4MA 1ODJA 2LE0A 1YVEI 3ADOA 1AO3A 1P5ZB 1P8JA 1MW8X 2VWQA 2RGRA 1UEIA 3DC7A 1A9TA 3KXLA 1X2BA 2Y8EA 3D7MA 2OQIA 3ZG6A 1QZTA 2GUGA 2IHYA 3O3MB 3H1EA 1U5BA 4Q9NA 2IWRA 4EHBA 5AJZA 1UXKA 4RHTA 3WA7A 3R5JA 2SCUA 3SSMA 1SCUB 3B1XA 3G85A 3OQIB 1QX4A 3NIGB 5L3VA 4WT7A 1TPYA 1OYVA 2Y3IA 3GA5A 4EPXA 4WFKA 5A03A 5BYKA 3IBGA 4HH0A 4OKNA 1Q7RA 3LIIA 5EMLA 1JFFA 2BFBB 3C3DA 4Q1DA 5EZ6B 1LDEA 1ZJWA 1UWLA 3FVWA 3NGLA 3H3XA 5KYVA 1EVYA 2Z5VA 4INOA 2HQBA 3ZV5A 2A0KA 5LA6F 3DLIA 4JGBA 1M2OB 5H80A 4Z0HO 2GJAA 4IIJF 2J07A 2GCGA 3GT0A 1YKGA 2C5BA 3QPBA 1F8UA 5C31A 4RCYA 3UOWA 3I2KA 1DO8A 2W2NA 1SWVA 3OZ7A 4LOJA 3QV2A 4QNNA 5IDYA 1F0PA 3A26A 4OIFA 1PNQA 3GX1A 3OLCX 3LC0A 4I50A 4N9WA 2PEZA 4RKFA 1O97D 3ZU2A 1SD2A 2LY4A 1QVWA 4Y9TA 2D6FA 1E5QA 2EKPA 2WJJA 5KYWA 2QVYX 2BSAA 2WP0A 5HZGA 3RTEA 2PX6A 4HX9A 5ENVA 3UFXB 3R76A 5AJYA 2NAFA 3MGAA 2VTBA 5IHXA 1FK8A 3ZC3A 3DXXA 2VQ6A 1J0EA 3PFFA 1RLIA 3R3WA 1QVRA 4CW7A 3WFJA 4F4IA 1FXWF 2TSYB 3ACCA 5BO5A 1RMQA 1RADA 3PRKE 4LJ9A 4HDNA 2REOA 4HNGA 1DJMA 3CSSA 2WE7A 3D2CA 3NCHA 4GPIB 2YN0A 3MLBA 4JBWA 4BB5A 2WTMA 2CDNA 4XYGA 2AXQA 4DSOA 1I33A 3MAAC 2H1HA 1CP2A 3MJTA 1O94A 3LCCA 4QUAA 3CZPA 3TINA 1KO4A 2H17A 2QXYA 2IYYA 2NMVA 3NH6A 4IIHA 2Z4TA 3WGHA 2J3JA 1OGIA 2W2TA 4E4RA 4GXTA 4F86A 1HQYE 1ZAYA 2V9ZA 2E4ZA 4WOKA 2FPPA 2VIIA 4NFYA 4NV0A 3R9IA 2R44A 3OPXA 1X3LA 2MU1A 4QUEA 5FULA 1FP1D 1NI3A 1BROA 4Q47A 4A10A 3HVHA 1KFBB 1XCBA 1Z0AA 1OI2A 1DOAA 4F93B 4BVKA 1DRKA 1JTVA 3JZIA 1EWVA 1YR1A 1VJCA 4P32A 4WESB 3WJ2A 2LNDA 3PFCA 3COJA 1NMYA 2CEAA 1AHIA 1OZGA 4FYYA 3EEOA 4UTVA 3IQXA 3MT0A 3NRCA 3ZTWA 3OD1A 4WLUA 1Y5RA 5EXDA 5BUCA 1QHHA 3F5DA 1JG1A 1FYVA 4FOPA 4IPTA 4RDCA 2BLNA 7ADHA 3DDCA 4AUMA 4EFDA 2ZETA 4ISCA 3CCCA 2TYSB 4ZCLA 1E9AA 3RC1A 4DUPA 4KVGA 3LFTA 2GH1A 1EK1A 1FDRA 4ACBA 4ZYWA 2W8BA 1ECFA 5A3RA 3IC5A 4EHLA 1ESNA 2H0AA 2FSVC 2V96A 4I4CA 4L07A 3CYFA 4FX5A 4GXQA 5DKFA 1KEPA 2AMYA 2RTUA 3VUEA 2WZCA 2OFOA 4BNZA 5A5EA 3U61B 1AQYA 1CUVA 1NX9A 4GGPA 4MUGA 1ZUIA 1DC5A 1ONBA 2AOXA 1NLYA 3KYCA 5CTJA 3LW8A 3EJ6A 1EGVB 3UWPA 3EZNA 3DVAA 1M2NA 1LS6A 3D0QA 1OLXA 1BEEA 1WP9A 3HVUA 4IMJB 4F4UA 2QR5A 1QHNA 3A1UA 4W6ZA 4AJEA 3A1WA 1MHPA 1NP7A 3NP7A 2QAIA 4I3FA 4ZEOA 3URKA 1C0EA 2H18A 4I81A 3JWIA 2IF2A 4DJDC 2C7RA 1GPWB 2B8TA 5IFLA 3FWZA 1Y3DE 2ACKA 4NBSA 1HTTA 1T36A 1YS1X 1KVUA 1QFXA 1Q7BA 1ZH0A 2ZS8A 3KYBA 3N2IA 2PZFA 5DTMA 5JALA 1APBA 3HVKA 2IXDA 3P2KA 2HQ1A 2R6ZA 5EIAA 3RJ5A 3RBXA 5IJ0A 1U7XA 4YRKA 2YUKA 2NUAA 1N25A 1NY5A 3EXIA 1YK1A 2I9PA 3DE2X 2FF5A 1TM1E 3KYJB 2VZ9A 4KPUA 4WKBA 1XEWX 1HT0A 1LWNA 3N70A 3FDIA 4JSYA 1ZVVA 1V39A 1KS2A 1NZFA 3D43A 1Z4NA 2XB4A 3GOQA 3L02A 4P3PA 4PLYA 4XSVA 3U4GA 1K27A 4GOLD 4HMOA 4S1TA 5E2IA 3WL5A 1IQUA 4Y1RA 4X84A 4WZBA 4ZO8A 4TZ0A 1O57A 3BE8A 4V39A 5EHQA 1NVKA 4MKGA 3WP0A 4CG1A 3FMFA 3BOSA 2JIRA 4DS3A 4PWZA 1CS0A 4U6QA 3NALA 3FE2A 2W58A 5LOVA 4K6OA 3AVXA 2IHVA 3NVMB 4DZRA 1LX7A 1SEVA 2J9ZB 3RSHA 4ZMBA 3GLIA 1E9RA 2VAWA 2B1JA 2HSJA 1PR4A 2OT3B 3CTMA 3D4IA 5BVHA 3EFBA 4RTLA 3QX8A 3ML1A 3KT6A 4IEFB 2VTDA 2FZWA 1NQWA 4H31A 1DQPA 2YL2A 4NJMA 2I66A 1Z35A 4MJ7A 4TYPA 3U4DA 5F7OA 4LF6B 4PXYA 4HAVA 1M76A 5HYVA 3RUIA 3U19A 3PQCA 3TZLA 3AB3A 2X7XA 5EJ5A 3MMNA 2R1TA 1HDEA 2A94A 3HKEA 4OSOA 3ZPXA 4IS2A 1T2CA 5JH7A 2QOEA 4ERNA 2HM7A 4TRNA 1ZEMA 2HMAA 4W99A 9GPBA 1JIVA 3L4JA 5FBRB 1XTTA 4B1FA 3UPUA 3ZXUB 1CZOA 4RU1A 1YMQA 5EMJA 3VDRA 4QPZA 1C9EA 1W75A 4F56A 4AY3A 1VIYA 1BHJA 3C4VA 4N7RA 1YUMA 2Q3LA 3CRQA 4JJ4A 1ZUHA 1PZGA 1HGXA 5EVJA 3SHTA 2B7BA 1V5EA 1OB2A 4M9CA 1U0GA 3VOTA 1OXVA 4AO6A 1YL7A 2J31A 1W1IA 2QUHA 3EGOA 2WKWA 1N5LA 4Z9BA 3QKWA 1VSQA 1PG5A 5BW5A 3G9UA 4G5OA 5I3CA 2IEGA 3DVAB 3TTTA 3VRHA 1BIFA 4G6ZA 3RTAA 4YA6A 4ZVMA 3UG7A 4X6UA 1JPUA 1K2VN 2FW9A 4NODA 1NRWA 3WMWA 2WD7B 3VOBA 1WXEA 4U63A 2HHLA 2HPAA 5LZ8A 2YV5A 5REQA 3WQSB 1C3JA 1KAGA 1AURA 4UBOA 1J24A 4R98A 2LUOA 2JJ2A 5IT9A 2IBSA 2AFHE 3WNCA 3OCUA 2A5LA 3SBDA 1CYEA 3E7WA 3N2YA 4XYBA 2ISQA 2NX2A 4YAFA 2GVDC 5JJ5A 2P6NA 2PLNA 1AV7A 1YC2A 4YVFA 1VECA 5FFFA 4K1XA 1A7JA 4QGSA 5A62A 2QSYA 1N4AA 4BGUA 5IXSA 2YXDA 1XCPA 2OXFA 1NU8A 1NONA 1Q5PA 1G21A 5TLSA 1FDTA 2J5XA 1NG1A 2I6GA 2O0MA 2XKJE 1NN0A 3EG9A 3FSEA 3JQ6A 3WYFA 4TVOA 4NOLA 3QA9A 1LTKA 1NQVA 3IBSA 1JFSA 5GONF 4KBYA 3IDOA 3HYLA 3IODA 4LOHA 2JGMA 5F33A 1RBQA 2IOQA 2OGZA 5BMOA 4M6WB 1QRRA 2SCUB 1ZGGA 1VLMA 1X3SA 1K99A 4Q3BA 1GRRA 2YNMC 4JK3A 3T3PB 1UK6A 2YN2A 1QYDA 3EC2A 2R00A 5C1BA 2IX3A 3K2BA 3SJZA 4E09A 3IAFA 1RXUA 2HGSA 4OXRA 2ZB8A 3AEUB 1ZQ1A 5EJ2A 5A0VA 3T4EA 4JYMA 1I1NA 1ZR4A 1E9FA 4KWHA 5TS2A 4FB5A 4NCJA 4C4OA 4YT5A 5ULLA 2JZCA 4KJXA 5DLQC 3CJTA 1D8AA 2H57A 2JGFA 3PVSA 1U4OA 4FDUA 1TDJA 4FSXA 4QSHA 2XZTA 3Q3GE 3K7EA 1N2EA 4DPMA 2FY8A 1Z0JA 2NT4A 1VQ1A 1PHRA 3C3CA 1MB4A 2GMWA 3GROA 2WPNA 2POCA 5JNSA 1PGOA 1Y0BA 3NHZA 3UHFA 3EPJA 3TLYA 2ZANA 5I5GA 2H1LA 2IOYA 3QK7A 3DTYA 4JDPA 2O7RA 2H92A 3TN7A 2DT5A 1HEYA 2J7PA 4YXWD 1NF3A 2HCJB 3I34X 4G63A 3T41A 1PNOA 1W4LA 1RYEA 2I34A 5CDGA 4Z9AA 3BE5A 4WLOA 2YIMA 4FEYA 5FNZA 2AW5A 2ZYSA 3HHPA 2KJQA 2EWWA 4N40A 1AQUA 4ID3A 4C7OB 2X42A 4D9FA 3KZKA 4NHOA 3QEBZ 3GJXC 1DXOA 2QZ9A 1EG2A 4NG5A 2CXXA 1SO8A 4ZT7A 1DOZA 3EDQA 1UOQA 1QTRA 4TZ6A 2WU4A 5C5IA 2N42A 2X0IA 3IMFA 4UBJA 4GX0A 1C3EA 4OFBA 4RSHA 3BRWA 4FDTA 3D5QA 2RJ3A 1Z5ZA 1GCOA 1ZI8A 3E6AA 3OTHA 2H3HA 5LQRA 1M33A 4R0MA 1OF1A 4KVFA 1Z2AA 4WCVA 4INAA 2FPSA 1PDOA 2VYNA 4F71A 1RACA 3B70A 3L4SO 4GEGA 1W2WB 4FP9A 2CVQA 4OY3A 3U3OA 5B5SA 3KKLA 3SI7A 1AB6A 2Y1XA 3L5OA 4V0RA 1QDEA 4CIAA 4F9EA 3PKJA 1X8LA 2MHCA 2FSPA 2RGGA 3RS8A 4DBLE 1PZEA 2WB4A 3Q7TA 1WQ4A 4PGGA 1DWQA 4OU4A 1ZIOA 3BZWA 4BASA 4OGGA 3X1KA 1K6EA 1PIWA 3A4LA 1TKAA 1L7VC 4IZIA 2JAWA 2CMHA 1MNQA 4C6RA 5L51A 4MYHA 2ZYVX 1AQJA 4I7EA 2GXSA 3N2KA 4BMNA 5SY4A 5FL7D 3DOUA 2PKQP 4OJMX 1YA8A 4YMGA 5CMLA 5BSVA 5CFMA 2BLLA 5JXGA 4M6WA 2PJDA 3B5JA 5ADHA 4U7DA 2P4UA 3A9UA 3FSGD 1Z2EA 1KPIA 4R5HA 4ZAZA 4QICA 2I7VA 3QBJA 3CNHA 3QYFA 4Z7OB 1IWBB 5TQ2A 3RTGA 4LHZA 4QM6A 2QMUA 2NW6A 3L7MA 3VHLB 2B92A 3I2HA 1U3VA 4MP6A 2DFTA 2YMLA 4DF3A 1A1SA 1VJ0A 3JQ7A 3DO8A 3A6HA 1NDUA 5JD4A 3GLHA 3P0IA 3C3AA 3DE0X 5KAPA 4R9SA 5HUQA 3A9WA 5FWNA 4JOBA 5CA0A 2PRKA 3LO8A 5I9IA 1HUQA 1KU6A 1YUNA 2QSZA 2B4RO 3X1MA 2CLEB 3T7DA 2DTXA 4F1KA 4MWTA 4Y30A 2OWDA 2J3EA 1W52X 4F9GA 4L0MA 3UKDA 2IDMA 3E9NA 1EE1A 1YNSA 1HOXA 3AFHA 3B3FA 4ME6A 2XMQA 1Q0ZA 1L4MA 5DXAA 3GQBB 1KDPA 3DWIA 1YZVA 3H84A 4C3UA 4P4UA 1NUTA 1BMFA 1ULBA 2ZIFA 2R7NA 1E7JA 1UMBA 3GJ5A 3PVZA 1F2UA 1G8AA 2R6AA 4HF7A 1XMSA 3AKDA 1AN9A 3NAZA 2EZUA 1B0UA 1Z45A 1HYBA 5GONB 3ES9A 5G0UA 4B71A 4WXHA 1IHXA 4HQNA 5IKEA 3R5FA 5CB0A 3BQNB 2WYOA 3E2MA 3R7FA 4F06A 2Z8XA 4DL9A 1OFUX 5HF5A 2UVPB 1AUOA 4CTOA 5AT1A 1D07A 2CNDA 2C82A 4UTXA 2ODPA 1XRSB 5SYAA 3WLMA 1FBNA 4L1KA 4M1SA 4PXAA 2IPLA 2O7NA 2WICA 2BKLA 2PEYA 3ET5A 1XLWA 3DEAA 3GXOA 3MAGA 4JUFA 1QHFA 4A1OA 1AMUA 1S3GA 2NUTB 2RGNC 1ML3A 5B58T 1H2BA 2EJUA 3NR2A 2J6IA 4RJLA 1GZ7A 2DHRA 4GSLA 1W4CA 3GJ6A 1EVQA 1M34E 5JSYA 2ZBGA 1IB6A 5ARCA 5HILA 3GYBA 2K2WA 3WIEA 1Z2NX 1J6UA 1T9HA 2Q3DA 4UASA 4JV5B 4RL4A 1WUTA 3CO5A 3G5LA 5GOTA 1TW3A 3OJFA 2HL6A 5DBEX 1R0XA 1SIUA 4GRDA 1VHWA 2UXCB 3FR7A 2B78A 4QREA 3V5NA 5K0SA 1MO5A 4RFVA 4R1NA 1N9ZA 3DLPX 2IUUA 1F1BA 1UXGA 1XD8A 4LVUA 3SICE 1NR5A 3DGEC 4DWVA 5HQTA 1EQAA 2GTHA 1UPAA 2VH5R 4I99A 5AM0A 3KG2A 4HUJA 1A8PA 3M6WA 5KNLA 5ICGA 1CC1S 3RU3A 2GD2A 4JVMA 1JYEA 4TV9A 1MFPA 3VAZA 3W4JA 3NOVA 3R09A 5AHOA 3TRDA 4X65B 3IR6A 1XPUA 3TMKA 3QEJA 2VK4A 4P7KA 2PSSA 1ECJA 4PC2A 3I23A 3IXMA 1GUBA 1X1CA 3DZDA 2A0WA 2VJCA 1VMIA 2YJ4A 2NZVG 3B1ZA 3GJ4A 3VI3B 1RJ9A 2JGEA 1PJQA 4GYYA 2YASA 3OIWA 3K09C 3H8VA 3G8AA 4U6SA 5JQGA 1S2OA 2CLDX 2EYQA 3FSJX 4LDZA 4UUQA 3A7EA 1U99A 1PR2A 1FLDA 2XD4A 3EF0A 1P39A 1UJ2A 2GBCA 1ZI6A 4MQBA 4AKTA 1KOGA 5JI3E 4JYAB 4XLTA 4Y6QA 1D6JA 5B1YA 2A92A 1RWBA 2R6R1 4KWTA 4M21A 4WJZA 4FCVA 5GZ6A 5IUJC 3MQFA 3GPLA 1HRZA 1QOQB 2D1QA 4PNZA 2QA5A 1C9MA 5CEEA 1ZUD1 4L7VA 4GUDA 4JVLA 1W46A 3QFRA 2X1HA 2HBZA 5BN5B 1B1AA 3AGPA 3CLKA 5ED0A 4L3OA 4JI5B 5DGCA 2FZCA 4HYEA 1Z2OX 1M2JA 4JXJA 4PS0A 2G4VA 3PHCA 2PZKA 3LZDA 1T3HA 4E30A 3W5DA 1UC5B 2EW1A 3A3PA 3DHNA 3HA5A 3HP4A 3JATB 3JWPA 3RASA 4II7A 5BSHA 1WZNA 5AJTA 2GNAA 4INPA 2VHWA 3A36A 1OT3A 2G07A 1U02A 1U8EA 1JGTA 2D5CA 5JW6A 4BOYA 4URZR 4PVDA 3D8SA 4ZT2A 5FQOA 3R6DA 3NV9A 3QP9A 2VF4X 4L9SA 3IIJA 2BVNA 4UHHA 3O73A 3VDXA 2OFPA 3ROTA 1QVZA 2OVFA 4Y0NA 3WIVA 3EGXB 1JHAA 3RSFA 3ESXA 5DNUA 1H0KA 1QS0A 3PQ2A 4ZK2A 3FOFC 2ZROA 1X19A 5AP9A 3RK1A 3OWOA 3L0SA 2RHJA 5AJXA 1Y4SA 2QG9A 3H4VA 3IR5A 5ES3A 5JAIA 5TT0A 3HBJA 4JL8A 3TLMA 4HDMB 1YV9A 4ZI2A 1U8AA 4MAMA 5A5DA 2BRUA 2VHEA 3LVFO 3ZW7A 4BUJA 3H2KA 2Q1WA 4MCIA 5TEWA 4MV5A 4A36A 1FS4A 3O7MA 3PL5A 3UWOA 1UDAA 1GGNA 5HS6A 4EATA 1L4KA 4J7CA 4UZEA 2Q45A 1YZ3A 1MLDA 1SBYA 3KOUA 3KDSE 2Q7DA 1V1MB 1FUUA 5BMVB 3QX3A 2NSHA 2VZEA 5LB4A 1C41A 4DV6B 3TLGB 1AUQA 3CW2A 2BZ0A 4AMGA 1SBHA 1WMSA 1XZHA 2WUEA 1YXMA 2RHCA 3LLVA 3N0WA 4GR9A 4PSVA 3N86A 3UAYA 3KTDA 4YAIA 3K6RA 2W2PA 4M22A 5IKMA 2YICA 3P9QA 5CNMA 4FE4A 1SU6A 2FX5A 3KHUA 3H8WA 4LYHA 3O4IA 4B48A 2PUAA 3SR4A 1PW7A 3UMRA 1O1YA 2VPZA 3Q1KA 5ECYA 2HLHA 2CVZA 1RRGA 2A67A 4DOMA 4BVJA 5K8TA 2X1MA 2ZRGA 1MO6A 3GEBA 2I87A 5DNCA 4M0CA 4OHCA 4V1CA 4QWMA 2YRFA 1XF9A 3HMKA 4H18A 2HIGA 2WRZA 1U65A 1DX6A 1OYWA 2FUG6 4EVIA 1JT9A 2CDBA 2AC7A 1EVLA 1HM5A 1QC5B 3HL4A 2VZ8A 4MQFB 2OE2A 1TGVA 3UGJA 2I8LA 2WLTA 3AR3A 3HYNA 5K3DA 5ARDA 2R751 2FWPA 3KLPX 3OCXA 4X3CA 4EO4A 4DQ0A 1GNRA 3DM5A 3B78A 5THKA 1Y7TA 1J8YF 2ZRIA 5GP1A 1RM0A 1YGYA 1OU4A 4WK2B 2C7BA 2CWWA 4KJZA 1UJCA 3CPHA 4ZV4A 1Y6RA 2COUA 5C1OA 4JB2A 5J2UA 5IKXA 1IY8A 2QG6A 3AF4A 3PXAA 4R3NA 1KFKB 2ZSHA 4ZYYA 1KQGA 2SKCA 2WJHA 3F67A 2QT1A 5C53B 2QE7A 1G2IA 2NO7A 3IT0A 3PLAE 4MV3A 4JI4B 2YULA 4QD3A 1COWA 1LBHA 2IEYA 5LXTA 3MPUA 5DBHX 4E6PA 4NC9A 4XVQA 7YASA 4NECA 4IYRA 2AUMA 2VP9A 5ER6A 1Y1RA 1ONNA 3MT8A 1GFZA 4F0JA 2R9VA 3NVAA 4IGKA 5ENZA 3P0EA 4DMGA 1H65A 2CNWD 2V65A 2G9QA 4RDHA 4D6PA 1AXEA 3UYKA 4NFHA 4FEGA 5AYVA 4PYRA 5ER9A 3EUWA 3C7KA 2AJLI 1GTG1 4G41A 3P4YA 1UIRA 4E5NA 4UZFA 3RR2A 3G7SA 2W83A 3D2LA 4KLZA 4HGQA 3JR7A 3BS4A 3J7AC 5JC1A 2IPOA 2IVFA 3JD0A 4BMVA 1NI4A 4L9RA 3ZWMA 4LUCA 7MDHA 5FI3A 3QLJA 4Y1FA 1RXSA 1GZ6A 1QJCA 4XSGA 3MUEA 5A2GA 3U4AA 4YCNA 3DV9A 2P6UA 1G6HA 2D2VA 4AS1A 1PGPA 5CEJA 4WINA 1U0EA 4MO2A 4XYMA 521PA 3FTQA 3EFOB 1ZNYA 4B2LA 1IK4A 1LTHR 5CCDA 4O4LA 3CVYA 3CX7A 2HX1A 2IUYA 4EY4A 2XNDD 3E22A 3GFFA 4FXPA 1GR0A 4ZQGA 1K68A 4BV2A 2FPMA 1XL0A 4GH5A 1FBTA 1PVVA 1J09A 2WHYA 2GCOB 2ZIXB 3KT8A 4O0MA 3HBLA 4BQRA 3F9IA 2HT1A 4DBLC 1ZH2A 3QU4A 2A35A 3TFWA 4EG5A 4MR7A 2JCYA 3F9CA 5DTEA 2Q5QA 2FH5B 4PCLA 4C01A 4A73A 4KIWA 4YQYA 1AQ6A 1IHUA 1MV8A 1ORRA 3L0YA 2C8LA 3PI7A 3RS3A 5LFAA 1YZGA 4IDEA 1QONA 1QYVA 1ESCA 4FM9A 2WUVA 2ZSJA 5SYMA 1GXSB 1LH0A 3NG1A 3NIBA 4JH0A 3M7IA 3Q3HA 2Y1CA 2MSEB 5JQGB 3JZAA 3PNQA 4LDNA 5HUJA 2ZYAA 2QYTA 2Q3JA 4IHJA 3RVNA 4E14A 3M6MD 3PXEA 1T6YA 5D5HA 3TLKA 3GGGA 4H3KB 4R2JA 4HEJA 1VIAA 2NUBA 2PD3A 4I8IA 4P58A 2VHTA 1G2QA 1YZUA 3OURA 2W6JA 2IPNA 4RSRA 4YJFB 4O2RA 4D4KA 4Y9DA 5HRCA 3MD0A 4AP6A 2YHIA 5DMHA 1WGFA 3AM4A 4X44A 4AP5A 2RKWA 4EKYA 4TLCA 1VLVA 3CA8A 3ICCA 3RVRA 4QVGA 4RDXA 3HXTA 1PV2A 1ZIPA 2FSUA 3L6EA 1N1EA 3O3OB 5IF9A 2GZHA 2XCLA 3M6IA 3MINA 3TW8A 3V4ZA 1JVSA 1NP6A 4A6XA 1EUYA 2FMKA 2XDQA 3U44A 3L4EA 5FTNA 4JJ6A 4DQUA 3I1JA 2C03A 2QZZA 1FC0A 4EA6A 5LD2C 1JI3A 1OAAA 2RH4A 2WWTA 3L1UA 4O3FA 4UPDA 3GDFA 3C48A 3T1VA 1M6YA 4F3TA 1YHNA 4ZPXA 4FGKA 4G85A 4BO2A 2O8CB 1E4EA 2OG1A 3A1CA 2AD1A 2VDRB 4C4RA 1BXGA 3HFSA 4AX8A 1OBHA 3H42B 2G82A 4TWAA 4R8KA 3TSOA 1PNVA 2Y93A 1ZISA 2FEPA 4CLEA 2HAEA 2GF2A 1JKFA 1Y6GA 3GPIA 4IQ0A 1L5FA 3VR3D 2C7GA 5JHHB 2RHRA 2NXWA 3HG7A 2PL9A 3BK1A 4HNQA 1EFPA 2KLBA 1NI4B 4IFTA 3ROFA 3SQDA 3RJ9A 4L27A 1SUSA 2LRHA 2NN3C 1PJAA 2HMYB 4JHXA 3UBTA 2A6PA 2IQ5A 2I6QA 2F17A 3BA1A 4Q7LA 3SLKA 1Z25A 4XR4A 1XD9A 2QRMA 3HI4A 3TJZA 4COKA 3HH8A 1SUDA 4HYYA 3OQJA 5EIXA 4KO3S 4WXRA 2UU9B 5HKOA 3GP8A 2V3VA 5CYGA 4RY8A 3UB2A 4EARA 3D6VA 1R6BX 2GEJA 2FW6A 3BIOA 1Z2CA 4LVCA 4ZK6A 1Z26A 3EIOA 2Z2ZA 5F21A 5L6MB 2Z6QA 2YQIA 1E60A 3EULA 3M8KA 4G8BA 1VHDA 4KE8A 4LXIA 2NU8B 3RRZA 4B4OA 4D56A 1VL1A 4I50F 3ENNA 5IZCC 4KXFB 1QTQA 3LY7A 2LD4A 1VA5A 2AFIE 3PDJA 2DE0X 3QY9A 4HB4A 4WUTA 1T3ZA 4A03A 3HI6A 5FIUA 3VPBA 1L7PA 1SZCA 4GRAA 4ZT5A 5HVNA 1A8SA 1YR7A 2QUBA 1GT0D 3KQOA 4G86A 5AHRA 4GF5A 4FYHA 4PPQA 3T8YA 1ZK3A 3UJ7A 5HOEA 4O4HF 1NDHA 4YAEA 3P9RA 4RFSB 3FB4A 4HD8A 4JWTA 4P4LA 1CU1A 3GUYA 4IUDS 4RPKA 5TGZA 2GPBA 3SZMA 2Q6OA 1E2LA 1GFIA 2VJLA 4FYKA 1GT91 3WYCA 2C7PA 2YRWA 2DLCX 1I32A 4LY0A 1G9XA 3F4BA 2YKGA 4NABA 5KQSA 1YKFA 2YZMA 4UXJA 4ZQBA 3TM4A 1Y42X 3BSSA 1T5OA 1YZNA 2IK8A 3I52A 1IE3A 1O96A 1PI3A 1WMEA 1Y48E 1YRBA 4MVXA 1M2VA 3WGVA 5TF4A 4QAJA 4Y98A 3H8SA 4ZDKA 3CFYA 2A0UA 2OSVA 4QE3A 2P8SA 5NLLA 1UPFA 1VDMA 4IUCS 1L3CA 4ALJA 3GLFE 5J4VA 5G1OA 1IXRC 2F2TA 3DE4X 2OP0A 1B16A 1NYQA 1QIFA 2R84A 3GEIA 2VBGA 3NWEA 3VJMA 2YFHA 3U7FB 1FX1A 3LHSA 4WERA 1U0RA 1QZZA 1NMSA 4PINA 4UQPA 3H16A 3QX9A 4JELA 2CMDA 3C8MA 1BGXT 3LUFA 4KQMA 3K4HA 5BWNA 3EVDA 2XUIA 1R4MB 3I53A 3N6RA 3M3DA 2FZKA 4D8XA 5HX7A 1I24A 5JVDB 3HZZA 3V7NA 3QF4B 3WIDA 1SG6A 2FPKA 1U7UA 2A5JA 1FNCA 5D2CA 2ZT6A 4BTEA 4D9GA 3WRXC 1SD1A 5LZ5A 3D31A 2ZYDA 1XJQA 3M0EA 4CMCA 3O1LA 5KUTA 3L4BC 2FN9A 3R5HA 4FWIB 3U48A 4R05A 3WFZA 3N2GB 2Y1OA 1E0KA 1VP3A 3IAS1 1I94B 3EAGA 3IV6A 2I55A 1YE3A 1VCMA 5BWBA 1T26A 3T54A 2R25B 3L6UA 4C14A 2JFBA 3L1VA 2P9FA 4I55F 3ILYA 3NIDB 1WDWB 3K0FB 2O8EB 5H9VA 3WWZA 2VEOA 5K01A 5F2OA 4D92A 4LC0A 5JLAA 4R41A 2XVMA 3VZQA 1HFWA 1W2GA 2B8JA 4NCNA 3DE6X 4GEKA 2GM9A 4PQEA 4IV8A 2YWCA 3F1LA 3R74A 1JDBB 3LGAA 4HKTA 5KOHB 3EX7C 4J16A 2WWYA 1Q44A 3RYFA 3W3AH 5FV4A 2CC2A 1EVJA 1G41A 1U2PA 2HH9A 2M2IA 2OGTA 3L0ZA 4R2WA 4ZCPA 5BSRA 3WXMA 1C1DB 1I2BA 3ZE0B 4ZGBA 2ZIUB 4RZHA 5BRJA 4S2EA 1FTQA 5BMVF 3OPVA 3DL4A 4OGWA 4LJ4A 4NF2A 5ETJA 4YJDA 1PUJA 4KIUA 3U4CA 1O6ZA 3BFVA 3REQB 2LDBA 2X2FA 1U7ZA 5TARA 2X86A 4S04A 1X8KA 5K0LA 3R40A 4NIMA 3B6MA 1DHTA 3ZOZA 2XMPA 2MSDB 2HJGA 4NL4H 1RBZA 2CMFA 1U0HC 5EKXA 1N3YA 1U11A 5EESA 4BO6A 3TVDA 1NJ1A 1VYVA 4PIMA 1HR0B 1QU2A 1Z5WA 2OO7A 3EPLA 1UDCA 3VX3A 3OTIA 5EZQA 1SUBA 1LNQA 4PQYA 4DQVA 4WACA 1GNLA 4YJHA 3SIWA 2BKEA 3O47A 2YHIB 5J2TB 1XDWA 2JD1A 4KLCA 4HLUA 2EATA 3G1UA 4MUJA 1IXZA 2GPNA 4NAHA 3KWLA 4TT3D 1NVGA 3IE1A 1Y3AA 4RHUA 1HFJA 3CB2A 1T35A 2DY1A 1A82A 4BLOA 5CCBA 2O50A 3ROZA 3ZY2A 2O3RA 2WMDA 4I46A 3SZUA 2YIVX 1HEIA 1OV6A 2G5GX 2O2CA 1QANA 2W98A 1FTNA 3QGMA 1M1YE 1KPGA 1IZ9A 3DZCA 4BMDA 5JZVA 4PHTA 4JVOA 1QYIA 4TRJA 3IP6A 4Y3UA 3V8EA 4MW4A 5ELLA 1K4YA 3A6EA 3TGWA 1EFRA 5DVZA 3WKCA 1RFGE 2X9GA 1J00A 1L3BA 1SMKA 1UXHA 3TW4A 3AKZA 3ELWA 4ETWA 1HSMA 4XEHA 2M6KA 3AFOA 1SC4A 2Y05A 1C30A 5AKEA 3N3BC 5TC4A 4EFLA 3SJUA 2R7AA 3KTFA 3PZBA 1AZWA 2OZPA 16PKA 3NHJA 3TAUA 4EECA 4XKJA 5HDQA 2J5QA 4GQAA 4CQMD 2GERA 4HNAA 1M34A 4OOFA 4EO7A 4ITRC 4H3VA 2GD1O 1NJGA 4ZYZA 1DZIA 4QARA 1L5HB 4POAA 4BL5A 4OP2A 4C08A 2G5TA 2BFCB 3L49A 2X22A 4F5YA 3KKNA 2ZQYA 2FFBA 2IDJA 1V7ZA 3ZNOA 2QSJA 2AUTA 3RWMB 1NNSA 3I01A 5B55A 4K2HA 5U4XA 4HS9A 1DG1G 1XSEA 3DVLA 2QD5A 1J2EA 3PUIA 5CXUA 3E3OA 1B2LA 4P4NA 4ZFNA 2VEDA 2DGDA 1DC4A 3GZNB 1AA9A 1K5PA 3PWSA 4GMKA 4JJAA 5M5BA 1AZTA 1SUFA 4LGVA 4WNCA 2PSEA 4BEVA 4B3SB 3WVNA 1WTAA 4A26A 5IU6A 3KRTA 4K8OA 4FMCF 4TKMA 4X85A 3OP1A 1ORDA 2VKTA 1NHWA 2A84A 1OTXA 2AE2A 3I9JA 3C1UA 3IEPA 3U9LA 4J07A 3FBTA 1GKIA 4P4SA 3EMKA 4Z0PA 2R4QA 1ZZEA 2C59A 4MS3B 3C15C 3WGNA 2H0RA 4MI1A 5AHWA 1E1YA 5G40A 3R7SA 3QOYA 4HSEA 3A4YA 4CJXA 1EB8A 4MEBA 4B34A 3WL7A 4OX9B 3K4QA 4NCIA 5EUBA 5JADA 4JI6B 3RFXA 2YX1A 1NW7A 1IULA 2I2AA 2EFEB 5HF9A 3I6MA 2E89A 2FWBA 3ZQKA 1G3UA 5AQ1A 2HNAA 3OEED 1IVSA 1DJNA 5A02A 1UKBA 3E8SA 4H3HB 4M0MA 5CA1B 5F5LA 3TBKA 4B80A 1KIAA 5KVCA 4W7IA 5E2BA 3SK0A 5IRCD 2BI7A 1E62A 2ZK7A 1IHPA 2P2DA 2QLLA 3AKCA 3JAWB 3K3PA 1Y7LA 1VLZA 3BMQA 4FONA 3RYTC 3ZTTA 5J4LA 3BFPA 3ESYA 1X94A 4HWRA 4QXAA 2FFRA 1U4NA 1G3RA 3K0SA 4WNIA 3LSYA 3IRVA 3RNLA 3V8RA 4FGWA 2RC5A 4DQXA 2HHCA 2IIPA 5EZSA 3MT9A 4NX2A 4XWTA 5JCXA 2EFCB 4C0KA 3B82A 2X2EA 2ZRHA 4Q39A 3AP3A 3TS1A 1UINA 2EAUA 3DEZA 5I7OA 1ONSA 3MB5A 1J8FA 1K92A 2J0VA 3RRXA 4LJ7A 3QFSA 4K5QA 3W3ZB 3RAJA 5C37A 5GGXA 3QTTA 2JA1A 2JASA 4LF8B 1WSBA 2XT9A 4IUBS 3TEJA 4DJJA 2XHEA 1TE2A 3ZD7A 1YB1A 5JG7A 1Q11A 1Q91A 5DM0A 2PX3A 2FJUA 3GDHA 4RH1A 3RROA 4DA9A 4B3JA 1XRLA 3SKVA 1C4XA 5JNLA 3N3AC 3JRNA 1BQ3A 2AN5A 3EOBI 3QBEA 1TA9A 5DHPA 5K0FA 3HEBA 4IDNA 4RZSA 5EXTA 1FNNA 1UBRS 3H1AA 3LOQA 2Y68A 3E4DA 1JHMA 4NYJQ 4RIFA 3ZLJA 2O5CA 4DV3B 5CRIA 4R1PA 2A3RA 4BP9A 3OQNA 3KQKA 3KXKA 2AZTA 2PZAA 3K5PA 3DULA 4LE1A 2RMKA 3K0FA 3UAVA 2GNOA 3N6XA 3THXA 3NIFB 4YBZA 2K6GA 4Q1AA 4KIGA 3OICA 5E8JA 2EFJA 1JXQA 2CVFA 5A5GA 3CH6A 4EQ6B 1F3LA 1D4AA 5CG1A 1IRXA 1E3WA 3I6BA 5CUQA 2HYDA 2PANA 3ONNA 4ZVQA 2PRZA 2W6ID 1KR2A 3L6BA 3PPYA 2WI8A 4Q4AB 1EXNA 2FZGA 2LCFA 5AKXA 4P4SB 3U1TA 4ND3A 2YZ2A 1Q0SA 4IKOA 4AP9A 2GF0A 4EW2A 1XCGB 3F97A 3L93A 3PRYA 3HU2A 4DSTA 1P75A 2J48A 4YDHB 2WF8A 1Y6ZA 3I9MA 1NP3A 1OE0A 2O4CA 4YAJA 5EJFA 4ABYA 3G0GA 5BOSB 1PWEA 1Z3CA 1EUZA 4OQ4A 1S1MA 3PICA 3REGA 1K8QA 4G5FA 3U5TA 2EKDA 4V0LA 3GP5A 1C5KA 3P1JA 1H5UA 3AYZB 5AK4A 5HOQA 2V4ZA 4NNUA 1ZNQO 1VSVA 3GBPA 4J8PA 5DX8A 1JLLB 1SQFA 1M2VB 3DAGA 4NOJA 4NZNA 3DZIA 5LKRA 4M60A 2XRYA 2BHTA 3ABRB 2XCUA 2D8MA 1HTBA 1KMHA 1N5IA 1Z7EA 3PGKA 5DFAA 1S8OA 1X2EA 4GZ3A 4A8HA 3BT7A 3ZZTA 4D9EA 4JB3A 1UBMS 3ZWBA 4YPOA 5HM6A 2ATCA 3CF0A 2JLVA 1EUCA 5EG5A 3L92A 1NR1A 1J2RA 4ARCA 2XUHA 4HWSA 4M0KA 1YIOA 1HG0A 1GD1O 2C2WA 3UMSA 2NVUB 2JAUA 5I4BA 2BFPA 3OKPA 4HVAA 3OJEA 1SNYA 3U3KA 2V9PA 5DM60 2WTUA 1PGQA 3O8OB 3O2NA 3Q0IA 1AGYA 5AK3A 2PT9A 1KSJA 4BX3A 1UKYA 3CLUC 3W90A 1PX0A 3NM4A 3PIDA 2ZUSA 3PPXA 1F2VA 4E2ZA 2GZDA 2UZ1A 4ZREA 3K92A 3AETA 4ZVLA 1X15A 1FX0A 4A8PA 5EWLB 2NU6B 4MVJG 4D4IA 4FR0A 3ZKWB 2I0FA 1D9ZA 2XQIA 3CR8A 5EUQB 5IJAA 3U9TA 3MCUA 4IICA 4TYQA 5TVGA 2HO5A 3ZWVA 1Q15A 3D6FA 3S40A 4NXNB 3SQNA 3DT8A 4MW0A 5DW3A 4QQ8A 1NJSA 3HHEA 3O9VA 2OV3A 3I0NA 4OQDA 4P5DA 4L75A 4U8HA 4EHAA 3RBZA 2JIZD 4GP6A 3PTAA 1ZR2A 4EBFA 1KJJA 3L7BA 4JVSB 4PQRA 2BFFA 2JRCA 3PHHA 1QH8A 3ZW9A 1A9PA 2IU4A 2JGJA 4W7HA 2RAVA 2IYLD 4GR4A 3EEYA 4J6EA 2MSWA 1GCIA 1YGPA 3KZMA 3N28A 5K8JB 3BREA 5AM3A 5TPWB 4DCPA 1TJYA 4MVJM 2GN2A 2QT0A 5EFOA 1CULC 1ZY2A 3AW9A 4UNSA 5E6UA 4AIRA 5A3JA 5GZ1A 2XEXA 5CJ2A 2FOLA 3BN3A 3HXMA 2QJWA 4UUMA 2QN2A 1U0TA 3K6JA 1OBOA 3ACDA 1SN7A 2XODA 2H1IA 5JZMA 1IDN1 1H2WA 3LE8A 3MSCA 2B61A 4N5IX 5KNDH</