3ANYB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and (r)-2-amino-1-propanol
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ethanolamine ammonia-lyase heavy chain
publication title How coenzyme B12-dependent ethanolamine ammonia-lyase deals with both enantiomers of 2-amino-1-propanol as substrates: structure-based rationalization.
pubmed doi rcsb
source organism Escherichia coli
total genus 71
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3anyB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3anyB02
3ABSB 3AO0B 3ABOB 3ABRB 3ANYB 3ABQB
chains in the Genus database with same CATH superfamily
7MDHA 4CLXA 3ETGA 4IIJF 4K3UA 1RM5A 1DZ3A 2REQB 4HD8A 5FXMA 2JGNA 1SCKA 3STHA 2JHPA 4FDLA 4NJEB 2QAGA 1LLCA 5IKEA 1C1YA 4G8JA 4TXJA 1ZOIA 5F98A 4O4JB 1F4PA 1XDGA 2VEDA 3MJVA 4CMJA 3EOAI 3DYBA 3KBBA 1DC5A 4RWZA 4MR9B 2WT4A 4BUJA 1DMRA 2CVZA 4FNMA 5LYJA 4R7ZA 3K2QA 2EAUA 3WRYA 5I9BA 4NYJQ 4ZPJA 5I3ZA 5LD2C 2X4LA 4MDYA 1YB5A 3RODA 1TVEA 4G81A 3T5PA 2AG1A 3DAPA 4IAOA 4C30A 3VISA 5JSHA 1MO3A 4HFJA 3NTQA 2DEUA 3B6ZA 3DBLB 4WZZA 1UEXC 5REQB 3AKYA 2BR3A 2IODA 1E1DA 3AZOA 2EX4A 2GNOA 3QEAZ 4KNWA 2GX6A 2E0IA 3JALB 1LBHA 3LL4A 2HWKA 3FPGA 4EA8A 1QHXA 3K6RA 4UM9B 1EDZA 1KHTA 1CUUA 4FPXA 3O8QB 2DM6A 4B3JA 1TKBA 3AGPA 1B0AA 1VTKA 4M53A 3GN1A 2BGIA 2Y1EA 4D9FA 2QW0X 2AN3A 2QTBA 1UMCA 5COAA 4XYLA 3BJZA 5CB8A 4P31A 3UANA 3UJHA 1M74A 3WYCA 2GT1A 2OORC 4Y18A 3UN1A 3DBIA 4D92A 1G21A 4DGQA 1KP9A 2FTKE 2NUTA 1ZXBA 1PQYA 1OYYA 3JY6A 1E58A 3K6JA 5JCOA 4QYIA 4X7PA 4EF4A 5JD5A 4FLMA 5AOCA 4GPAA 1UJCA 2R68A 1SQGA 3BKXA 3E5HA 3R5JA 5EHIA 4OQPA 3RFXA 1SXJD 1WA5A 2RC6A 4RVSA 2QI9C 2ZIGA 4U7JA 2BGNA 1ZD4A 5HBRA 4ETNA 4B3MB 2HRCA 1LSSA 3O3CA 1A4RA 3OKPA 5E0KB 3GJ3A 3AR8A 3DE4X 1LSJA 5TQ0B 2CNWD 3SHQA 2Z95A 4DSOA 2WWTA 3QMPA 2PXAA 5T3YA 2VHJA 2PLWA 3EFOA 4TYMA 3ZY4A 4BZXA 1GAXA 1NBMA 3F96A 1B4DA 1E9SA 4A6XA 4DJTA 4QPDA 4DKXA 5LU9A 4TYWA 4HPJB 3WAJA 1DBRA 1I3NA 1S01A 3AHGA 4JU9A 3IRVA 1AZLA 1ZL2A 2EQ5A 1A8PA 3QJYA 4JDUA 4CL8A 2GPSA 1N8NA 4QXMA 3KX2A 4FS3A 5L4NA 3THYA 4ZTZB 5I5GA 2JGDB 5TQ2A 2I2CA 1UADA 5A7GA 4J91A 4CV3A 2FEKA 5DASA 4B7AA 1XO1A 4BX9A 2H59A 2ZVQX 3V97A 2CMDA 3SWWA 4XVCA 5JI3E 3B48A 1K5PA 4ZOQI 4ATNA 4K9MA 1GXSB 3B9RA 4DT1B 2FX5A 1JH9A 1QIIA 5CLQA 1T36A 5C37A 3CNEA 4REMA 3EDOA 1B8PA 1YJ5A 2WQZA 1ZFNA 2JI7A 5FL7D 5SZKB 1FU4A 4U2EA 1TD9A 5AW4A 4TZ0A 2FSHA 2WM2A 4OO3A 1W0JA 2Q4DA 4WOCA 1HDXA 2X6QA 4DARA 1QUFA 2BLLA 2IEDA 4J16C 1PEKE 1XZHA 4L50A 3TFWA 5I4BA 4HGRA 1YFJA 1YS6A 1GNVA 1R0ZA 2WU3A 3GLQA 1B23P 4YUWA 1TCVA 3JQ8B 1WTAA 1P0IA 3HXQA 3WRXA 4BXOB 4TPKA 5E3JA 2EJVA 5KDOA 3K6SA 1L5SA 3IMGA 1DDIA 4LMBA 4QPJC 1FYDA 2LW7A 3BAZA 4E6EA 4NVRA 4EG7A 3H2BA 5MF6A 2FW9A 3G2IA 4HYEA 4PFQA 5C1BA 2A1TS 1ZL0A 3EGVA 4P53A 1DNPA 1U7WA 4R01A 2W70A 3T3GA 3I5MA 1EU1A 1UJ2A 4KRGA 4LMAA 4Z0HO 3EWSA 3LKBA 4GZMA 4W8GA 4E4RA 5JV5A 3M0EA 3EE6A 3SQWA 3L7CA 3C3PA 2MYTA 1GKLA 3KYBA 1M33A 1GZSA 3EA5A 1MNQA 1RJDA 4JMLA 4TMFA 3ET5A 1MQAA 2C4KA 4WX2B 3U5TA 3DE1X 3SF8A 2AFRA 4IOLA 1CBUA 2A0KA 4X6XA 1GL3A 3FETA 3QELB 2HUNA 1JKJA 3EZ2A 2XXAB 2PJZA 4RNCA 1QVRA 2YJ3A 4Y2TA 1T6YA 3PD1A 4EB0A 1XFDA 2ZWAA 5AVKA 2XCTB 1R0RE 1DS6A 2QUKA 2Z5FA 4ED9A 3WI7A 1E3JA 2PGIA 4KWHA 1BN6A 4MJXA 3PQ8A 3SYTA 121PA 1YZGA 2XYPA 3MEQA 1HDGO 2OHOA 4RA6B 3U61B 1JQLB 1O0SA 3RDPA 5HF8A 2BELA 5ADVA 3SX4A 4B4VA 5JO9A 5FWXB 5FFNA 6REQA 2EJWA 3P4UA 2CJWA 1MF7A 5I4IA 1DWPA 1U3CA 3DLCA 3H9BA 3FPBA 2VYVD 4G0MA 4NK5A 4L78A 1SPXA 2JLXA 1H9CA 1D0SA 1ONNA 2AG6A 3PSAA 3LPNA 3WADA 4YCSA 1YASA 1Q0PA 2C29D 2PX2A 3H9EO 3LUFA 1DKLA 4EH1A 2ZUFA 2IXGA 5PNTA 3WWOA 4HAUA 4TUYA 4BAGA 1BEZA 4DG9A 1NFRA 5CPBA 3K94A 3DPUA 3LKVA 2O1SA 4W6QA 1TF2A 1UMBB 2AFIA 2NT4A 3KHSA 4WOKA 3UGQA 2HXYA 2E3JA 4NS4A 4ECAA 1JDUA 3QYJA 4RJKA 4BGVA 2QBYA 1JJFA 5L4LA 1ZC4A 1BE6A 5CXQA 1XZMA 1W52X 4G37A 1JEQA 1U7UA 1KEUA 4INAA 3CZ9A 4JNKA 4QBGB 2C2KA 3IAM1 2NXNA 5EQFA 5BSFA 2ZZNA 3EVCA 4KMMA 4TQ9A 2FFRA 5HK9A 5KZMB 1JDNA 3GFTA 1UOEA 4RVNA 4Y2QA 3RC9A 1G8YA 4KPEC 4TV8F 1QX3A 3HBJA 3HDHA 1FXSA 3IEUA 3PC3A 4DWVA 1N36B 5B7GA 1PL8A 5IZCA 1YDFA 4ZYTA 3RC8A 4IJWA 4LVCA 1YHNA 2VHUA 3UNXA 4IH4A 1A9OA 2QPOA 1AD2A 3L1KA 4RQBA 4NHOA 4FM9A 3QI7A 2HMVA 1GG5A 3KFVA 1ZLXA 2X8AA 6ADHA 2XTMA 5BMVB 5JG7A 4EW3A 4GSYA 4R5HA 2ETVA 3FPLA 1XPJA 1FFHA 2WWXA 3BB3A 1R6XA 1B6TA 5DRYA 4F46A 1PO7A 4M0EA 5HFNA 4C7KA 1KJJA 2OQVA 1PFVA 1GNSA 3ADBA 2Y9PB 1U0LA 2JIRA 1U8UA 3DCIA 2YHIA 4FNGA 4RPIA 3NBYC 1JR2A 2RTUA 3Q8KA 5KYKA 3SGLA 2BZGA 1S2MA 2QVCA 4RW0A 1HMFA 4FLFA 4YS6A 3BRSA 2BEUB 2ATXA 4M9CA 3IKLA 2G1KA 4UTZA 5DHAA 4AJKA 4EYOA 4FYVA 5CM9C 4ZMRA 4ZTUB 3JQGB 1UZMA 2P9CA 1V6AA 2P4EA 4DBVO 3AUJB 4PYIA 4NS1A 4IUDS 1VKRA 4B1FA 1C1XA 1G1MA 1PTJA 5EMLA 1X1AA 3KQVA 4N9WA 4V0QA 5EJ9A 3ZLBA 1J97A 4JLMA 4R83A 3U4MA 4ZXPA 4UOZA 1P5RA 2XB9A 2GEKA 3GY0A 3P2MA 5LMCA 5THXA 1SKMA 4QUEA 4D4JA 4ZHQA 1Q7RA 1GLNA 1SIWA 1T4CA 1Y4DE 3C98A 4MW0A 4ZICA 3EGXA 1CCWA 3OH8A 4H7JA 1J2RA 3AXSA 3AFGA 1JUDA 3G17A 4GOKA 1ND6A 4W1SA 3LRPA 1EX7A 1KEPA 3ZHOA 2JA1A 2PZJA 4JLDA 1H5NA 2XPCA 5B1IA 2LIVA 1BVUA 2XMBA 3IUYA 2X0DA 1I5EA 4DL9A 5LZ2A 1XLWA 3W6PA 1PE0A 1EA5A 2HMSA 4OA8A 1B6GA 3UCEA 4CMBA 3RBVA 3KXDA 4ENWA 3FNBA 1MB9A 3FLBA 8GPBA 3VKHA 5KEIA 4L3VA 2ZYAA 2Q99A 2NZ2A 2PT6A 1NXVA 4D98A 4FQ7A 1NMZA 1M83A 1Z2AA 4D0RA 3EGDA 3AYXB 4LF9B 2CJFA 1U8AA 1DFHA 4F8JA 2FKNA 1GZ4A 3RCBA 3RVRA 5KB3A 3VV2A 2H1VA 1NU8A 1SKQA 4E14A 4ND8A 2JI4A 2O3TA 2X7XA 3UK1A 3G2KA 3EW9A 3EXG1 1WBDA 2O2DA 1K92A 3H16A 3MUFA 3IR5A 4RZSA 1X7XA 4DCPA 4OP2A 4D96A 5DYGA 6PFKA 1Z7EA 2JFXA 3ZW7A 3NHLA 2J9ZB 4LAFA 5DCLA 4LF4B 3F73A 2CKMA 4H18A 821PA 1AMOA 4H17A 2YY7A 3O8CA 1SCIA 5IKPA 3RO7A 4C6HA 2VPPA 2PWZA 5DYYA 3Q3VA 1ZHFA 5B1YA 3KSZO 1ZGAA 3DCYA 1KH2A 3EIFA 3WLSA 3K0BA 2IITA 5T67A 4HT3B 4M1QA 1N8SA 2YJ4A 4LKRA 5G0SA 3U0BA 4CM7A 1HQYE 2NIPA 4YUYA 3DLBA 4AQYB 2PYIA 5P8WA 4B6SA 1UP6A 2CGEA 4DS3A 2GK3A 3YASA 2JHGA 2QTTA 5EXDA 5KHLB 3ZG6A 2ZB8A 3X1WA 4Y9RA 3WA6A 1KY3A 2ZJ1A 5JBIA 1FVHA 4D9JA 3QPCA 1EVYA 2Q07A 3QG5A 3CLSC 4UATA 3RVDA 1II9A 3QUQA 4I55F 4CM4B 3IIMA 2COUA 3MIIA 3NYIA 1A5ZA 2RMKA 3PBKA 4L75A 3ZCUA 4OREX 4DTCA 4YCCA 5HX7A 3KIPA 4FKBA 2Z1MA 3DOEA 4ZAVA 5KJEA 2NNWB 3W6UA 4ZGWA 2WT8A 2BH9A 2EOAA 2Z5GA 4LNHA 3NWOA 4BLSA 3V5NA 2I3BA 5LLTA 1AK1A 4FX5A 5EC8A 4ZYZA 1MAWA 5ILOA 4ACBA 4FW8A 2QAIA 4U63A 5JDCC 3H3XA 5CFMA 1D1PA 4K87A 3EHDA 4B17A 1HRZA 4B34A 5CA1B 5T4EA 1MENA 1J9ZA 3MERA 1V4VA 1DXOA 4WESB 1GITA 1HSZA 4KXWA 1CQZA 1RADA 1ZU5A 4Z9AA 5E8JA 4N7MA 4OJQA 2GDJA 2GBLA 4V0LA 2YUIA 3C3CA 5HPYB 1M1YA 5K03A 4L9WA 4C2TA 4J8PA 2P2GA 3JQ7A 1R5BA 1A7AA 1E6KA 2DPYA 3A4TA 4PAGA 5L9AA 2WMNB 2XEDA 3R20A 4QTTB 1L4YA 4Z1OA 1MB3A 4RD0A 5CLHA 3D3JA 3Q7RA 1DJQA 5FUBA 5HZKA 4WZBE 1P7VA 3UB2A 5CD9A 1GGKA 1TUGA 4B73A 2FSGA 1YCGA 2HQ1A 1UWLA 2Z2JA 3BIOA 4GLLA 4R0NA 1OI2A 2DUUA 3IBSA 1CS0B 2JD2A 2SBTA 2X6TA 2YC2C 2VHXA 1PX0A 3H4IA 4HAXA 5HTKA 3WGGA 4X71A 1XU7A 4DBZA 1IUNA 3C3EA 1ORHA 4UD2A 5DOZA 5IM5A 1IXKA 1NJ8A 1R4MA 4US2R 1QFMA 1CIPA 2VTBB 2ALJA 5C4GB 3OPQA 3ZWPA 1O5TA 1BXGA 2BGMA 4TTQA 4YDQA 4W5OA 1L1QA 2Q0QA 4HEA1 2R1TB 3CH5A 1OWMA 1UBNA 5TF0A 1SCUB 10MHA 3A9SA 3EDMA 1NI4B 1Z0UA 1QGOA 1U0OC 3SMQA 1U9IA 5FJJA 1YZVA 2X86A 3NP7A 3W1VA 3D02A 3AHCA 3MMNA 4B6JA 4GSKA 3KXIA 1NSTA 4ZP1A 1GTMA 3DOCA 2O2CA 2ZIFA 2PO7A 1EFLA 5AI4A 4X20A 3KQKA 4LF8B 2Q1XA 5IDVA 1I94B 3OT5A 3D3EA 1RD4A 3BK7A 3P1JA 2W2LA 4OOFA 2ADFA 1ZJYA 2REOA 2XTAA 5EVJA 3DJYA 4KDFA 4Z0TA 1Q50A 3G13A 1A5BB 4Z4QA 4GPBA 4BYMA 2F8TA 2F3QA 3QE2A 1FYXA 3ORHA 1N5KA 2X15A 3I6QA 2QTCA 3EFHA 4C7XA 2J7PD 5CJPA 3JQAB 3H2IA 5BQ5A 3CN9A 2HXSA 5BQXA 2GCPA 2PX3A 4H1WA 3FW1A 1PS9A 5B1EA 1P4HA 3F1LA 3W04A 1CQIA 4EY6A 5HQ3A 2IZ0A 3B89A 1WMSA 4UNPA 1ZJ4A 1U2QA 4JXXA 1RP7A 3CLTC 4CGYA 3MTAA 4QGHA 2BM1A 2DY0A 5EG5A 4NECA 3M6LA 2XCSB 2GLXA 3K72B 1T9KA 4MO2A 1FY2A 3Q8LA 2GK6A 4FD2A 4R7GA 2GK4A 1TAQA 3HY3A 1A9SA 3MNFA 4IHQA 4ER7A 3KQHA 3DL7A 2X5XA 4XCVA 4F9EA 1DWUA 2AFVA 3EXG2 4COKA 4O3MA 4OGFA 1BN7A 2QRKA 3FXAA 3SIWA 3QWIA 1Y9JA 1C3LA 4HRAA 4R1QA 4DWWA 4DR2B 4ZC8A 1XJ5A 1SUEA 1YBVA 2JGKA 2QTVB 3BA6A 3ONNA 4G4IA 7YASA 3OECA 1EFVA 3ZD6A 3ICVA 1MEJA 3RSGA 1NXOA 4DMCA 4TWJA 1YQTA 2Q9AA 3BXOA 3Q41A 4YQYA 4EFLA 4BVKA 2FUKA 5IVPA 3T9EA 4BOYA 2Q29A 1F0NA 4X7RA 6Q21A 1GYQA 3T3EA 2PMFA 2DKNA 2YXBA 2ZSFA 3KSDO 3IDZA 5CTAA 5FPTA 3WIDA 4JJIA 4KPUB 5JFOA 4BO7A 3IUMA 4KLAA 3KEOA 2Q6LA 1U2EA 1OJ7A 1N2IA 4FJ1A 4EPVA 3QNMA 3ZCRA 4B35A 1OLSB 4CEHA 4D9GA 4BFXA 3DFKA 5EEHA 1RLIA 1WJGA 2B69A 4ZEXA 1XZGA 2Z1DA 3KXLA 1U1EA 2CDBA 4HDQB 5A05A 3V9AA 2OQIA 1OV4A 3JWHA 3A8TA 5CYPA 4YFYA 3INRA 2ORED 2UZIR 1F0PA 1IH8A 3W1WA 1SHLA 1UC5B 1X94A 1C9DB 3OCYA 4M8KA 1QVZA 3GIWA 3X0DA 3TI9A 1QFZA 3JZFA 4UDXX 3FOEC 3F8TA 4XB2A 4XW2A 1TYEB 1QG2A 4RTPA 1MC4A 4JJFA 4PVDA 3RKUA 3QYAA 4GOXA 4MR9A 3EY9A 2XUFA 3LZDA 2ZYTX 4MPRA 4OBWA 5E4JA 5EWLA 1U81A 3GLFE 4QZVA 5F73A 1B42A 4NONA 1J5NA 3KEFA 3Q5GA 4KN9S 2C4NA 4XFJA 3T1OA 4LW8A 5KNDD 4YEDA 1M1XB 4YJ2F 3FFBA 4F4UA 2IIVA 1I2ZA 1WXLA 3DBLA 5REQA 4DV7B 1TM7E 3PJEA 1X2BA 1H93A 3GGDA 4C3UA 1R0SA 3VDMA 1OF1A 2J3EA 1WNTA 4HKTA 4HAWA 2E1RA 4MB6A 1QGED 2V6BA 3I5YA 5DHRA 1FK8A 2PR2A 2QR2A 1KR2A 1Z0ZA 3IRUA 1Q77A 4AZ3B 2GCNA 4CZ2A 1Z5VA 2R7NA 3X43A 1SVKA 2DCUA 2XT0A 1NXQA 3AVQA 4KO2S 4DCMA 4L0CA 5GV7A 5JBQA 2W6JA 2M98A 3EGOA 3L46A 3A6FA 1IHDA 2FN3A 2NV2B 5DNAA 5EFZA 4Z51A 3OT1B 5JS2A 1AGXA 2EZ4A 2C9YA 4Y6QA 1LGYA 1W4AA 5I51A 1L2TA 3G79A 5IUKC 2OILA 2W2PA 2FN8A 3PJGA 4BQFA 5IDWA 3W9UA 5ECWA 2HC9A 1TPYA 1K4YA 3W7VA 2CLFB 2OAP1 3KT6A 2ZQZA 1UAYA 2OYCA 1KMHA 2D0DA 4CQMB 3EY4A 3VC1A 2GD2A 4MGHA 4ZO8A 1QP0A 2R7KA 2W58A 3IELA 5J4YA 4GSLA 4QIHA 3K09C 3OFKA 4XWAA 1U1IA 5F33A 6YASA 1JNXX 3I6MA 4KNYA 2QZZA 3E15A 4FFRA 1CVIA 1UCFA 1Z6GA 2D5BA 2G63A 2NAPA 2ZUVA 4OYYA 3JARA 4QG7A 5TQ0A 3A70A 1O58A 3UUGA 4BMVA 3EXIA 2B61A 4MICA 2J3JA 2JANA 4RZUA 3FIJA 2EDCA 1V7ZA 4J9UE 5K3BA 1XV5A 3ZK9A 1ZOOA 2WFMA 3NTXA 3SZUA 4EYSA 1HSNA 3PR2B 4KN5A 2ZJBA 5H8WA 1BD3A 3H1BA 2IS4A 4URVR 1LV8A 4C7OB 5B58T 1FDUA 4GOLD 2XMRA 1P2SA 3RF6A 3NP9A 4K2AA 5TLSA 3RTAA 4C0AC 2JI8A 2QPTA 1ZI6A 2HEIA 1XAJA 1YQGA 1E2KA 2RJ3A 4J0QA 1T13A 3V8MA 1ZINA 3STVA 3U31A 2W4QA 3VR5D 4CKWB 1GXSA 3RVSA 4DT1A 1T25A 4E5NA 2BDUA 3PNOA 4PSCA 5G02A 2P9BA 5P21A 3PXEA 4YDRA 5AT1A 4LF7B 4QPZA 1QZTA 2XMQA 4X91A 1Q74A 2AD1A 1Y5LA 2OP1A 2FGKA 3DGFC 3MW8A 3NIWA 1QFYA 3CRMA 4FC6A 4K6OA 4XZ3A 4X94A 1ZU4A 1T5TA 4G36A 1BG6A 1OLOA 3ABZA 4I5FA 1CYEA 3CLHA 3Q3GE 3QY9A 3G2JA 4BB0A 3MCVA 2HPZA 1PYGA 2AN9A 3I04M 1RRVA 4A0FA 2WJ3A 1MIOB 4JCOA 3G7NA 4F56A 2PRYA 2CXPA 3RFVA 1ODIA 1JWAB 2PHZA 3HV0A 4JQZA 4L8FA 4EUHA 1LQTA 1JHPA 5J47A 2HAEA 2WWWA 4JBGA 1RWWA 3MB5A 3WK4A 1P17A 3WYDA 3VNVA 3QV2A 3BIWA 2IXEA 2GD1O 5FLYA 2QTFA 1Z68A 4OXQA 3SKYA 1R6VA 3GNQA 4QXAA 4F04A 3BWXA 4YO8A 1RM4A 2FPUA 4AZTA 1ICEA 3KSMA 3NV9A 2NPOA 3UZUA 3T94A 1JLMA 3WFZA 1F2DA 1N3LA 3MQFA 4AG6A 1ZH4A 4DSZA 1V1JA 3CEHA 2BKUA 2MJLA 1TYDE 3GFOA 2JLCA 3AUKA 2MWMA 3DVLA 1RI2A 5JLAA 3T7AA 1EFRD 2YVKA 4YK7A 5TEVA 1UBKS 1T9ZA 2EKPA 2QENA 4RELA 1U0FA 2DMRA 2QOEA 5DM1A 1M2VB 2R4TA 4MAFA 3C8HA 3EF0A 5JR3A 4OJNA 3UW1A 4FR0A 3OZDA 5A4FS 4MTCA 1K5GA 4TRMA 2PZGA 4ZQHA 3ORRA 1XN4A 2ZPUA 5FWXA 3PGJA 4BLUA 1AT1A 1RHRA 4L1KA 3UJCA 4YRRA 1V3QE 1WM1A 2QVGA 5I47A 2GZ3A 2IYXA 1YJ8A 1N2BA 2CEKA 2EG5A 1I2DA 2Y0BA 3G82C 3FCOA 4IUCS 1AKWA 2CLMB 3OLQA 1Y5NA 5DGTA 2AJTA 3OLZA 3NBQA 4NPAA 4L8YA 4NFHA 4DV4B 3P5BA 5JCPA 3CVUA 1UMBA 2CHUA 4KKXB 2A33A 2NZWA 4J0JA 4NZZA 2UKDA 5KSPA 1K7XB 2B4QA 5HE9A 1XI2A 2DQKA 3EAFA 1GKUB 5ISMA 3GGSA 1C0PA 3Q3CA 4I8IA 3LCRA 5GV8A 3U2BC 4XTCS 4BLVA 3PVCA 3WLJA 3KR2A 4LXUA 4DQ0A 4E5DA 4L07A 4TKVA 2EBWA 2OA0A 1A9PA 3GLIB 2N1BA 2Y1KA 1BEEA 2QZ4A 4XJVA 4BV3A 5EIEA 4CV2A 3GYGA 1JU4A 1XNGA 5CYGA 1U98A 4K6GA 3PEEA 4ZOEA 5JASA 2DPHA 2FDXA 4PE5B 3NW9A 4WWHA 1TMGE 2HU8A 3LWBA 2HIAA 4Z3KA 2PH5A 4E1AA 2AHOA 2FPOA 2C5AA 2LVBA 2J3QA 4M88A 3THOA 3KBOA 3T7DA 2BTOA 2PS3A 3D1JA 4ARIA 1YRHA 2VNJA 2ZT5A 5K05A 3M3PA 1NRJB 1XA4A 4B3BA 1SD2A 3AR4A 1JJVA 2AK2A 2FU5C 4MMZB 4KAXA 3H04A 3LV8A 4MWBA 3ZI7A 4MQLA 3C1AA 4LDQA 3TDKA 1M2OA 1W2WB 1R16A 1TEXA 4G65A 1JHZA 2WTAA 1NLUA 2BGUA 2GF2A 3FCXA 4MULA 4BCBA 3IQDB 3H3JA 1FX0A 2BEUA 4WPGA 3E3LA 2FSPA 3BJEA 2OV3A 1XDUA 1H3EA 3OIVA 5FV7A 1OTHA 2NVUB 4HFNA 4QJ3A 1PR9A 2WNIA 2WYWA 3HA2A 4AJHA 2AQ8A 3JQGA 3TX6A 5BN5B 2B4YA 1L8XA 3H9GA 5C8XA 1I2CA 1T10A 4Q4HB 2XSZD 2HLNA 1OQAA 4ZAXA 2I71A 1T0JB 2E4WA 4KJZA 3HFRA 2Z1NA 4M83A 4TM8A 2EJTA 1YRBA 3PKIA 3T7IA 5FPQA 3AF1A 2BKXA 1GCOA 3Q3IA 2RAFA 2H0AA 2J0UA 4HQFA 4QFBA 1A82A 3IQGX 5IXJA 3I3SR 3DDOA 2WB2A 4R0MA 3FTEA 1XJWA 2OFWA 2R79A 4WOPA 2EARA 4MS1A 4KXLA 1OU0A 3DE5X 1ZIDA 2ARKA 1FTYA 2HMAA 2C5LA 3HH8A 4IUYA 1SXJB 3CVJA 1GTZA 1ESMA 1EDEA 1HT3A 4HEHA 3E8XA 3AJ9A 4HS4A 4EHNA 3F4LA 3H87A 1SBCA 4W6ZA 3QPBA 4CMIB 1TAHA 4OHBA 2V4MA 4H31A 9MHTA 4NBWA 1SC4A 2V7PA 1J09A 3B2QA 3KCNA 3L40A 4N0DA 1KAEA 5MFPA 4NV3A 3QKRB 4PAWA 3SM3A 1VCOA 4JEUA 2GSWA 4Q1AA 4ALJA 1UBJS 5JAUA 1HMAA 4XQ0A 3WXMA 2BR5A 3JR3A 1IPEA 1SWWA 1U6JA 2CYBA 2WYUA 2BBSA 2BKLA 4QX6A 4FEEA 4BNWA 4F60A 4B46A 1EK5A 3LYLA 4OUKX 2BV3A 5A4IS 3OJOA 3ZUPA 4CM9D 1YI8A 3L7AA 4N76A 4R2IA 3L0IB 1A8SA 1POXA 3GR6A 2FWAA 5CFQA 4KRFA 4MHTA 4O08A 4BQRA 3QSYA 5D6OA 4FYPA 2ERXA 1KH1A 1U2DC 4CL0A 4DGSA 3EIEA 1L4KA 3T4EA 4EYKA 4ND1A 1Z7WA 1ZG3A 4R8LA 3VU9B 4HVAA 1YJAA 3T7KA 1ORVA 1QO0D 5JPDA 2DPGA 4DEXA 1GTRA 2KB0A 4NNUA 3D43A 2ZRCA 4KFUA 5JPCA 4IIBA 1J6UA 1YZYA 1NYRA 1E6UA 3PUJA 4LZJA 4Z8XA 3NEAA 1T1EA 2XWPA 2ZE5A 3F6EX 5FADA 2JZNA 1RFGE 3O4JA 3SU8A 1M66A 3R3JA 1QS0B 3Q0TA 2BFEA 5HDBB 1JA0A 3C6ZA 4LJ7A 4YB8A 3OMXA 3S68A 3SJBA 5IN5A 4AUMA 1DUIA 2WAXA 2EKQA 3AI1A 1YD7A 3G59A 4W1RA 1FSPA 3A3YA 4IW3B 1G6OA 1K6JA 1SG9A 1O6ZA 5BVHB 4OI0A 1RPTA 4LJ5A 2FX3A 2RG1A 1HURA 4A2WA 3FSEA 3ESZA 4DNOA 2CUTA 1TAGA 3CWZA 3ZXUB 5BR8B 5CM8B 1QAQA 2AMFA 4LRWA 4YRKA 4CIXA 2VTEA 2CO9A 5CA1A 2NV0A 2P3OA 3GF4A 2Y1OA 5IDYA 3G85A 1UBFA 1DVRA 4I4IA 5AHRA 4LS3A 1QOZA 5A7HA 4BNVA 2IK8A 3WDSA 3I9LA 2PDAA 4MVJG 3CVWA 1JDJA 1NR7A 1UQRA 2A5JA 2GVZC 2GF0A 4MRSA 1RR6A 4W8HA 4PXYA 4CMHA 1FYFA 1RFLA 1LI4A 2R5FA 4FFLA 4B6GA 3U7IA 2NQ8A 3AHDA 4QDTA 4UULA 4IYJA 3IAFA 4F6CA 4IMIB 1F8UA 1PT8A 2AW3A 3O5AA 3OQNA 5CBPA 2XXAA 4V1CB 5DN6A 5C3UA 2WWYA 3FY4A 4ON9A 5JEEA 3AVYA 2BSXA 5AK0A 2ZZMA 4E0BA 5IJXA 3KOYA 4PC2A 4ZWNA 2V58A 3CE9A 4EL5A 1GGHA 5KCZA 1E3EA 3B8EA 4Y0AA 3EOZA 4GYYA 2FUG1 1Z2NX 4XUEA 5GONB 3ABOB 2VTBA 4FWBA 4CL2A 2Z8ZA 3NEYA 4PPFA 3CWCA 3IB6A 4GGOA 4R7TA 2C95A 3M83A 1B0PA 1X70A 1OGJA 2P62A 2XLBA 1JIQA 1P1JA 2NVOA 3DWIA 4RORA 1EWTA 1Z7BA 3IBGA 4XIJA 5KAPA 4LZZA 2X1MA 1M1NA 1LUAA 2P11A 5B1HA 2WC1A 1V47A 4QUBA 5DP2A 1JR3E 2CF5A 3O1JC 1QK5A 3R7WB 4A82A 4P82A 3REQA 3WK7A 3R40A 1LDGA 4LN1A 1NLZA 1ZN9A 2PX8A 1Y3DE 2DGDA 2YYYA 3BULA 4QELA 4WN3A 4B5LA 1Y1LA 2B8JA 3TSZA 5BV2P 2JATA 3I9V6 2GSDA 4MIOA 5JWOA 4TLCA 1ZUNB 2J3MA 5ECDA 1BX3A 3AVXA 3URMA 2I9KA 4J0EA 1AKRA 3N0XA 2F3UA 1AY0A 4GO1A 3FWKA 4Q1EA 3RRXA 3W5HA 2AQHA 1UKEA 3JQAA 4AF8A 4DV0B 4RF2A 4DMUB 1W47A 2ZLBA 1OBHA 3S2YA 4EPYA 1E8NA 1HPLA 4QL3A 2Q49A 4R81A 1IVYA 1CY8A 4ILKA 2ANCA 5ELLA 5BRJA 2A2ZA 2FMXA 4LBVA 3H1FA 3IPRA 1IZYA 1UKZA 3SQNA 3Q2OA 2FJUA 3V46A 2Q6KA 1X1DA 3TECE 3SPXA 1UMDB 2AW5A 2QZ9A 1MTOA 3D8RA 2B1GA 3G5UA 1NVGA 2J5XA 2PRJA 1NJ2A 1U0NA 4G1FA 1KP3A 1K4MA 3UUWA 3UOGA 1D2MA 2LCIA 4CG0A 4OHXA 5JWRA 3IAHA 4IIYA 3EYAA 2QI9F 3A58B 3IJ5A 3IQWA 2C9BA 3PUZA 5EXSA 4B4UA 4BMPB 4ER6A 5SICE 4GZ6A 1UJBA 1FFYA 3M4JA 4NAUA 5FWYA 5KDLA 1U80A 1T6XA 5I5EA 2D7LA 1UXGA 1Z4OA 2LZ0A 2P2DA 2HPHA 2CFSA 1W46A 4AKEA 1W4CA 4F9FA 3TVDA 1JAZA 1S8AA 4BBPA 2H6EA 3AFNA 4YRZA 1C7FA 2ZXFA 1TUEA 4Q1CA 1GRCA 1NUPA 2NO5A 5FOXA 2IYZA 4JI6B 3A1NA 3TKYA 1GPAA 4DJAA 2LD4A 2VAVA 4REQB 2HHJA 1DTSA 1CKTA 4ZVSA 1HNXB 3QOYA 3O0DA 4A3SA 1N2XA 4YT8A 4KPUA 4M8LA 1SC6A 3BDIA 1T2VA 4WA7A 5L51A 4E4TA 2JCVA 1ZEMA 3HADA 1TRHA 4W7SA 1D09A 2IFTA 5D01A 3IHWA 3CUEF 4LSZA 1UBLS 2OE2A 3RVNA 3TTVA 4DUGD 4MW5A 2PGAA 1FYWA 3ZCTA 1ZN2A 3RVQA 3T1VA 4IDQA 4BB5A 2CXSA 4TYPA 2C54A 4AKHA 2FWIA 1SULA 3BDVA 3E8SA 4MX8A 3N7TA 4JI0B 3Q1KA 2J7KA 3FMOB 3IXQA 1W93A 2I2WA 3E81A 1SN7A 3ETLA 3I37X 1KAGA 1AXEA 2HDOA 2P0AA 5TMPA 5G0WA 3UOAB 3H83A 2GN2A 4DLNA 4RCZA 4GKBA 4MEJA 2WWRA 2WU4A 4GLBA 3TOZA 1X42A 1YR9A 3TQQA 1RQXA 3M6UA 3U13A 3QEMB 2QZSA 4TZ6A 3E4CA 2XOKD 1EGMB 1II0A 4IL5A 1BDBA 2Y0DA 2GUWA 2LRHA 3JQ9A 5DLEA 4Y98A 1I01A 3AEQA 4PO3X 2QD5A 1KDPA 3ICPA 4ZEMA 4GGMX 1P4AA 1ADCA 3A3NA 1UK8A 2HADA 2X23A 3S29A 2ANBA 3IIJA 3FZYA 1Z56C 2G7ZA 2G08A 3WDLA 1QYWA 1ULSA 1Z82A 5E7MA 3HCOA 2F4VB 1ISFA 4RTOA 1FTNA 1SU4A 1CVRA 1YRYE 2FWPA 2V96A 3DZBA 3EIOA 3MF4A 1KDZA 2CXOA 1L7BA 3TAXA 2AF3C 2VOJA 2WJVA 2C9OA 4AZ3A 2VRCD 2Q3MA 3HU2A 3BWCA 3DVAA 4KXYA 2WW8A 3BWBA 1IK6A 3ZW8A 3UFXB 3ZCQA 3TN7A 1PHPA 4CT5A 1K97A 2QTNA 4JBIA 1PL0A 4O4LB 3QENA 3OT1A 3AY6A 2R2AA 4C22A 5JXHA 4Y1RA 1C0KA 1KKLA 3EVEA 2IBTA 2IPMA 5AJXA 3WIVA 2DFPA 3AESA 4D9IA 4MDFA 4G2NA 4LSGA 4UDOA 2QLMA 3TSOA 1UDXA 1Z08A 3DDNA 5DM0A 4N5NA 1JI3A 1D07A 2MMGA 4A6DA 4EG1A 3FX2A 1V43A 1XZCA 2O2HA 4JJ6A 5LOVF 3DE2X 5H70A 3WYFA 4YP7A 5BPHA 3I09A 4P2GA 3RIGA 2GD0A 1JR6A 4CQJA 4Z54A 3TIVA 5CFRA 1G8PA 1VLVA 2J3IA 3DL2A 3WWEA 1MH9A 1VPDA 3ZZUA 4PIPA 1YZKA 5A9TA 4QVKA 3SOZA 4MV3A 5F1OA 4MYCA 1SXPA 3SHFA 1P9LA 4KXQA 5DP1A 2OYSA 4DSUA 4KUGA 5DHQA 3HO1A 4YH1A 1Z88A 3MA0A 3F6SA 4XPIB 1ZIOA 1MOZA 3WL4A 2FG7C 3Q7IA 2J33A 2YQZA 4X3CA 2O2XA 3VPFA 1BWRA 4ISCA 1GD1O 1N0VC 7MHTA 3AI7A 4DR3B 1A4IA 1AUXA 3QKTA 4ZOAA 4ZZ1A 4IDAA 2GN1A 1GN8A 5ALMA 5DMHA 2B83A 2Q5JA 2X2EA 4MIKA 2JBAB 1UZAA 2UZ0A 4NXMB 1IZ8A 3C97A 1JLRA 1QUEA 3EEIA 1EGQA 3L01A 4YRIA 4CKWA 2QL9A 1ZY2A 2P2ZA 1D6JA 1H22A 3QFTA 1XJQA 4Q3DA 3NLLA 1OZFA 4LUCA 4WBNF 2N47A 3B20A 2EP7A 5ICMA 1KA9H 2OFOA 1GU7A 2VCEA 1ISHA 3I8SA 5G1NA 4J6FA 4L57A 3U9TA 3VVCA 1CY0A 1EFAA 1RPJA 3K1YA 4JODA 1EUDA 1TQHA 1YZNA 3HE3A 1MIOA 2Z2YA 4U02A 4Z3OA 2QTRA 3IUEA 2I4OA 2BGWA 1RE1A 3BCUA 2AJCA 1VG0B 2VPZA 2LPMA 5JVDB 4FCWA 1TCCA 2YBDA 5SZJA 3ZU5A 3VKUA 3IDAA 1M6VB 1MT0A 1FRVA 2YWEA 1SUPA 3LBFA 1Z16A 1TO2E 9LDTA 3MMSA 4U0KA 2PMKA 2YJTD 1BFDA 2UYGA 4K03A 4DBLE 2CLSA 1MA3A 3D1VA 2PPVA 3PIDA 3WG9A 4B32A 2I4TA 2IUTA 2WP8J 1T6BY 4UZFA 4BO3A 3C2QA 1L1EA 1GT6A 4H6PA 2G77B 4NNOA 1KSFX 3A26A 4G5QA 3UKDA 3LCUA 3LM8A 1E1YA 1AZTA 1XYYA 4IFEA 3U3XA 3VR4A 4YV0A 5KNCA 5KWSA 3QXHA 2FRDC 3U5ZB 1S2GA 1Z33A 3A14A 4MZDA 4JFAA 5CK4A 1PLKA 4I4LA 3R3HA 1RIIA 3MMPA 3N86A 4KDEA 4MHOA 4OK6A 2C9MA 3QE4A 1T0IA 1XCBA 1FFBA 1HMEA 1DC4A 4LGMA 2QUHA 3RFUA 2FZKA 3HN6A 4JT9A 3OEEA 3MPUA 5JNVA 2A9KA 4DDHA 4IOKA 1P2UA 2A1UB 4HNRA 4JUAA 2QAGC 1P1FA 3KAJA 4YAWA 3RVKA 2BFAA 1Z37A 3ZGLA 5FWNA 1IOWA 1PGOA 1DIHA 4Y0NA 5EHZA 1CRZA 1SCAA 1VZ3A 1O3YA 3Q2IA 3PQ2A 1E1NA 3HJCA 1EMDA 2J31A 1VPVA 2W6ID 3ZZMA 3WRYC 4PSAA 3B1JA 1WV1A 4J7AA 3JZMA 1JAYA 4HP8A 4F2WA 3SR0A 1L5HA 1C4WA 1JMVA 3GGJA 3D4LA 4OFXA 3VM6A 5BWLA 4DF3A 3FLMA 1J49A 2CK3D 5HZMA 1AO0A 1FEZA 5IVIA 4S2EA 1VJ0A 1ZQ9A 4P3KA 3FM9A 4R54A 4S1OA 1Q1QA 1N6PA 2DERA 3OE4A 3JRNA 2V1UA 2FUEA 2BI8A 5T6MA 3C87A 4EI8A 2AIRA 2A59A 4N48A 1IJKA 2QGZA 5IS2A 3GLIA 4M0KA 3MBOA 4EUSA 1N6NA 1V6CA 1W5EA 2E4ZA 2HMTA 2QTGA 3OJXA 4KOEC 3TE7A 2WSIA 3TCKA 4DNPA 4ETIA 4DDTA 3E84A 2AQIA 5KYGA 2BMFA 1BVRA 1DT5A 1GTJ1 3C5EA 3QHPA 4OAOA 2AG8A 4L7VA 5HILA 2QEQA 1ISIA 3BJIC 5LB2A 3ER8A 3JSXA 2R8RA 1D1QA 1K8YB 1GDTA 4NBRA 4QBFA 3V8NA 4MQMA 3MRSA 4FLEA 3IJRA 1K4KA 5E6RA 3WICA 4KREA 1N7HA 4J1TA 4MP6A 5JCOC 3S8MA 3PFBA 1Y3BE 1Z29A 2XECA 3W0LB 5IJ9B 4IKEA 2I7XA 3QVVA 5K0NA 4PC6A 3R3XA 1FFDA 4RKWA 3BXXA 3BXEA 4WXPA 2WVJA 1XG5A 1RCFA 4XDYA 1L5RA 2D74A 3LC7O 3PV0A 5IMBA 2XDWA 1DTWA 1H4TA 3E18A 3T4PA 2W42A 3OPVA 3ZDQA 3D8UA 4NE7A 4D8WA 4BLRA 1KOFA 1KHHA 1MO2A 2C2ZA 5CLLA 2NVUA 4II2A 4Y6RA 2NO9A 2EJBA 3DLTA 4OYRA 4IXDA 3DTVB 3RU2A 2FK8A 2J9XB 2Q62A 1RHKA 2FV8A 1PEAA 5FYQA 1Y3AA 1GGVA 2JAWA 4XKJA 3X1YA 1F48A 2VDMB 4CF7A 4BN5A 1OI3A 3PVSA 4JYZA 3ZYZA 4GX0A 5JSZA 3E27A 5AI9A 1EYZA 1WEHA 3WJAA 5MN4A 2BFFB 1QR2A 1EVZA 2LDBA 2A0WA 2VHYA 4G9EA 2B4KA 4FP9A 1RQNA 4WERA 1EGVB 2JI6A 1V63A 3AIIA 3HGTA 1FW6A 1UWVA 3K3PA 4LSWA 3R0XA 1NDQA 4IGEA 3TG8A 3IQHX 1QORA 1HE5A 1PJ8A 3PJDA 4YPOA 2YUTA 2H31A 2W0SA 4FGKA 4IIJA 3KWFA 5I4CA 2DBZA 1T8SA 3G8AA 4IFIA 4L3OA 4MKHA 3O9ZA 4XA8A 4AO8A 2IXTA 5CB0A 2RG7A 3WHKA 5I8PA 2ZUWA 2D2IA 3T06B 1T5DX 3G6WA 2QMYA 4RK5A 1WF3A 3V9PA 5B3JC 4KVAA 1C1DB 1NUHA 1E3QA 3QKRA 1VKZA 1GUYA 1RCTE 1RI3A 1XMOB 4MUMA 4QQFA 2DQSA 4Q3CA 4B47A 1MNAA 3M5DA 3W3ZB 4WKPA 1QYCA 2AXPA 3ORFA 2YNMD 4QEZA 4GU5A 5DBIA 2ECFA 3PC4A 2XB6A 3PC6A 5IHPA 2IH2A 3PC7A 1QQBA 1JG2A 4Z4HA 3TAHA 1SVMA 1C9EA 3RC3A 5CRIA 1G20B 1E61A 3C24A 4U2KA 3R24A 3AP2A 3HO6A 2WY2D 2IIBA 2RCYA 3WV4A 4AVYA 1O9BA 5I7EA 1N2CE 1JR3D 1MR3F 4K9KA 2CEAA 1T2EA 2J59A 4QEDA 2DZDA 1GG2A 1NWHA 3P0IA 2BKAA 2IXDA 3R77A 3VH2A 2NVBA 4Q9HA 2DHDA 4S3MA 4TV9B 3ABQB 3E58A 3TOXA 5ICEA 3EZYA 3EIUA 3UXHA 2F55A 3FB1A 2E5FA 4BLOA 1EDBA 5CR9A 4G26A 4JBLA 1DSSG 2YYAA 5FV4A 2C03A 1GQRA 2VP6A 3G1UA 5BYJA 1TTTA 2VPTA 2WYHA 5IPFA 4JSTA 1VKJA 5B2FA 1NM5A 1QS0A 4PX3A 4YRMA 3CXUA 1WHTB 4H3VA 2HH9A 4YA6A 4I1OA 2Q27A 2Q8NA 1XXLA 2FQXA 3B5JA 4O29A 1C4OA 4UCWA 5KCMA 3VSAA 4L6IA 4LOHA 3IA7A 2YVQA 5BVHA 3PXAA 5DFAA 1NN1A 1P4RA 4B71A 2Y3IA 3FSJX 1ZJJA 4YLEA 3R2JA 2CNOA 4A6EA 3WGVA 2GB4A 2OLJA 3VPBA 3BGOS 4RVDA 2G8LA 4ZU3A 5JNWA 3GPBA 2QN1A 4PN7A 2HQRA 4N3NA 2ZU6A 1P5JA 5HIMA 4YVFA 1YUBA 2B30A 3PPVA 1VHWA 2RSLA 2XKAA 2QD3A 3E1KA 3LPLA 4I4TB 5LN1A 1N2OA 5IYZF 2IT1A 1SNYA 4MGEA 2ZS7A 3FVVA 2AJLI 2H9YA 2IHVA 1J8FA 2OV6A 1DAKA 2VHZA 2FJ0A 3OBIA 4NQRA 3RIYA 1BMQA 4V1CA 4TYNA 4HWTA 1DIAA 1ECPA 2ZR8A 2QDXA 3K2IA 3MM4A 1MC5A 4MVJF 1T2DA 2J30A 4N47A 2SICE 4CPDA 1G5TA 1XROA 1RYEA 1QXSA 3PDUA 1KJ9A 1DXHA 3N70A 4RM3A 3TSCA 5IZCC 3D4PA 3CZ4A 4DADA 3EF1A 1ODKA 2IZOA 5KNCH 4KTTE 3VR4H 5C8YF 3QJGA 2XX3A 1IVSA 2WWIA 1VMAA 1W1UA 2X9QA 4OHOA 1SO8A 3ZCVA 4B85A 5KYYB 2VSQA 3AOGA 2DLCX 3T5TA 1XR3A 3PPIA 3ZKAA 1FYVA 1ZCBA 1CUAA 3M5WA 3T1YB 1D8TA 1UAAA 2FSVA 3K32A 4IJVA 3A9TA 3OC6A 4XOIA 4AWAA 5HWSA 4Y6PA 3DQPA 3QYFA 4CKCA 1EZ1A 3MJSA 4L7QA 1SXIA 2PRIA 3DWFA 2HBZA 2O2YA 3N8GA 2VDRB 3R7WA 3FWPA 4BEJA 5FDFA 2VTVA 4ZALA 1IEQA 4IF4A 1WB9A 3GV0A 3O75A 2OL4A 3T3NA 2G5GX 1T8UA 2Z57A 4D9KA 3IAUA 4KB5A 4PYLA 1QIHA 2B36A 5KOHB 3M6VA 5AI6A 3WYBA 2ZYWX 1ZUNA 4CKXA 4RHTA 2QE7A 3E70C 1DBWA 4K28A 5HR5A 2YWXA 1NOJA 4LTDA 3IL2A 5KBYA 1VZ2A 3ICOA 2I22A 5DCUA 1M5UA 3CNQS 4TRRA 1PTJC 5CFNA 3SXPA 2GN9A 5CBKA 1VSTA 3C5VA 4LHYA 4LWQA 2JFYA 3P71T 2HIMA 3T5AA 4M8IA 3V00A 2BTEA 4PQGA 5FL3A 5GVRA 1ADFA 5IK2D 1KNXA 3G8BA 4W7HA 4Y2XA 2H92A 3EWIA 5DK6A 3W5JA 5IW8A 3OCZA 5CXSA 3D3WA 4PBTA 2ZBEA 1XDZA 2W6OA 3U4GA 1UMDA 5H02A 1R6TA 3BXZA 4IMPA 1GPYA 2Q4BA 3KJQA 3P9YA 4UAJA 1PFYA 2O0MA 5D5PA 1V8BA 5LU8A 4CG1A 2FEWB 4QM7A 5JJIA 2QPLA 3AP3A 3KFXA 4E2ZA 4AY6A 1KY4A 4MVYA 1EX6A 3RV4A 1RKUA 3TTUA 4C7MA 4NU5A 1TCAA 2Q0HA 3RSOA 3IPAA 1TZ2A 3NAGA 2JJ2D 1ECGA 2C3UA 2FR8C 2V7UA 2XOXA 3GP3A 4PHTA 3OTGA 5AKEA 1MXFA 1J2EA 3DD5A 3DL4A 4R40A 3MWJA 1M1ZA 1CUCA 2HA2A 1GARA 1O95A 4OSOA 1D4OA 4XGNA 4GF5A 1N5LA 4N3AA 3GAFA 1PGQA 4G0YA 2XTJA 4LNUB 5CDFA 4DV5B 4JXZA 1E2GA 1A98A 3A9VA 1AUVA 4YP9A 1KO8A 2RGDA 1W6RA 2DFKB 3UJ8A 1SRQA 1UT8A 4HQ0A 4PLZA 3ORQA 4TKZA 3OF2A 4PQEA 1QM5A 1KZHA 2Q5IA 5C46F 1JFTA 2Y99A 3ND7A 3O31A 1BGVA 3SXUB 1CJCA 3ETHA 3OZCA 3K1AB 5FLKA 4BO4A 4O25A 4PXAA 1CSEE 2ZRHA 4FFDA 3K6KA 4PCVA 4UEWA 5DHUA 4TV8A 1KVTA 3CBGA 1UKYA 2OMKA 4JP1A 4UAVA 3SY8A 5DEOA 4D57A 4DE5A 1X1SA 2AXQA 2YWGA 3NVMB 4F72A 1V7QA 2DHRA 2VNHA 1JHYA 3I1YA 1BCRA 5BR1A 3FHCB 3ZU3A 2V7BA 3U4CA 3I9MA 4NXNB 4EZEA 5CJJA 3W3AD 2AUTA 1QF7A 4L51A 5DGIA 1QO9A 3ENNA 3GRRA 3ETEA 4F3KA 1A96A 1VKHA 5F3DA 4XWTA 3HYTA 2P1ZA 1T5SA 3H5OA 1XD9A 2F1JA 2FPSA 2F6RA 3O03A 3OLVA 2X76A 1TDJA 3N53A 3QEMA 1J90A 3TL2A 3FNQA 1GDDA 3LBAA 1QLJA 2PZ8A 2GTIA 5IABA 4FUTA 1EWYA 1O54A 2CUZA 2MU1A 5FB3A 4YACA 4Z2YA 2OKCA 4A8TA 2BMEA 1G2IA 1RXEA 2I80A 4EUNA 1GRRA 3EEYA 1AZSC 3HDJA 1NUAA 1W1WA 2IOHA 1KYQA 4YCJA 3VZCA 2H57A 2HYDA 5D86A 1Z0DA 5CITA 2B5WA 2Q2WA 3HHPA 3C7AA 4TMTA 4ZVTA 3SJUA 1R9JA 2GBLC 3R74A 3I2FA 4Z1MA 5T4HA 2ACWA 2Y0CA 2DHEA 1OX4B 2MSKA 3LI2A 2HA6A 3TTSA 4MQ6A 3K0AA 3L7YA 1U1GA 2P75A 4WV3A 4RXMA 2I8CA 2HWWA 2V9PA 1OXTA 3UFXA 2NP7A 3RLIA 4P7GA 1Z36A 4H9GA 2XR1A 5JD4A 2JFQA 2XZLA 3Q7TA 3WE7A 4XWGA 2WBLC 5DSTA 1SZPA 2CWWA 4X8MA 1Z5UA 4GDFA 2FPIB 3P8ZA 4RADA 5A2GA 1ZVKA 4NY1A 3DF9A 1Q3TA 2OD9A 4POOA 1WGFA 2J5QA 3O74A 3CUSA 2OHVA 3F9RA 3S2ZA 2PO5A 3PL1A 4YQFA 1YL5A 3E9EA 5LP6F 4WEOA 4Z6KA 3WXBA 4DAEA 3PC2A 4C4RA 4M60A 4DB4A 1H1TA 1Q7EA 2OSVA 2YICA 1U9IC 1ATIA 4ZT7A 1OVMA 4J3NA 2BBTA 2OBMA 1OFHA 4YXFA 1VQ1A 2OO5A 2YRQA 1Z6XA 4XPIA 2WA1A 5JYEA 2XMCA 2O8CB 4G1UC 1XNJA 4HO1X 1O89A 1Q5PA 2ZCUA 3WLQA 2O23A 3T61A 4GRDA 1GY8A 3ZQ4A 3FG9A 1FNCA 4X64B 2PWBA 1XAHA 5LZ8A 4EK9A 3CX7A 1WL8A 2DAPA 2PFSA 4JLNA 1W75A 1DJNA 2G17A 2RH5A 5EYPA 4N5HX 4MKIA 5FBRB 3ECAA 1TZBA 1XYGA 3S2GA 4AMBA 4DV3B 4DRZA 4P3NA 2GLTA 4PLPA 3I04A 1CEYA 1KAMA 1TU0A 2JBAA 3HSYA 3RHZA 3GLGA 1XALA 3PD0A 3PC8A 4Q7MB 5K0LA 3TLCA 3P26A 3NNDA 2YZKA 2GXSA 2QR3A 4LGVA 3WWCA 1JN0A 1GKYA 1SCBA 1TF5A 5IDXA 2EFYA 2EP8A 2OMEA 2VRWA 5HHTA 1QMPA 5EHQA 3RC2A 2BEKA 2KMLA 2OCDA 2WWFA 2E6OA 1OLUB 3C3KA 5K8UA 4MQEB 2EFDB 3WIBA 5BW6B 3ZHUA 1Y80A 3THWB 1PV4A 5HUHA 2I0FA 1V7PC 3PNKA 2HOQA 4FUQA 3NKLA 4D74A 3B78A 1DOZA 1QK3A 3KTFA 2W6CX 4QICA 4BPRA 1IWPB 3T7TA 1PJRA 3I6BA 1PSWA 2J87A 4ZREA 1JZTA 1KZ9A 3RRBA 2F3SA 2AR0A 5KHAA 5KPDA 3RUDA 1W2GA 1R8XA 5JJLA 1LSUA 5AYVA 1C8BA 3CKMA 1N2CA 1P2BA 1WUKS 1NUTA 1UQTA 2QORA 4JJ4A 1NKVA 1M9NA 3DE0X 4MUEA 1JHUA 5BSTA 1RQLA 2R60A 2XMDA 1GRNA 2WTMA 4LJYA 1J2YA 4ND5A 4NG4A 4OGLA 1KAOA 5JJBA 3ZW9A 1V9LA 2GKGA 2PMBA 1USGA 4KU4A 2WNSA 5AQEA 2HA5A 3UYKA 3NDIA 1ULZA 4G84A 1QNFA 3BA1A 4O02B 3UB4A 2XE4A 2OSBA 3FVWA 4WK0B 4DNQA 3GLFB 3B9PA 5KX5B 4G5HA 3SZLA 2J7PA 3GQBA 3ANMA 5DK4A 4LF6B 1O97C 2C2WA 1EB9A 3IVGA 3OQMA 1E6MA 1NJFA 4MYHA 4PIMA 1BE1A 4KITB 3EIHA 1QF9A 3FSGA 4FI3C 1QYVA 2FR0A 2ASEA 4OGKA 3WHPA 4TL8A 3S6JA 4E31A 5FJIA 1LVHA 1RXUA 3EF3A 3THXA 2EBFX 2ZR9A 3I28A 4FFBB 1E1KA 2I99A 4KK4A 3T7RA 1PNVA 1THZA 5F1PA 4MLDA 1JKMA 5TDHA 1DU4A 4QJIA 1N5IA 5H68A 1BTOA 4DLVA 1ZHHA 2PS0A 4BVGA 1MAAA 3HWRA 5FI3A 1FFXB 4TYQA 2QT0A 4K7JA 2A1UA 4MV7A 3J7TA 5CIWA 1KETA 1W9HA 3TZQA 4F8EA 3EC2A 3TLEA 1IPHA 5FBVB 2AFHE 3M8KA 4YQZA 1F0YA 1WU8A 4L2IB 4OYHA 1E9AA 3NM4A 3UT0A 2Z6UA 3QF4B 5A03A 3OOYA 4AAYA 4MNTA 1TI7A 3OKAA 3LOPA 1PWZA 3F4BA 4JJEA 1WOYA 4K9SA 5HKOA 5TGZA 4KSCA 4F5EA 3L84A 2MSEB 5FA6A 5ED0A 3QX7A 4H0CA 5DYTA 2JIBA 3VR3D 4B7CA 4KMRA 4MVJM 1PG5A 3RUHA 5AQ1A 5KNBA 1Z5WA 2FFBA 1ACMA 2QRGA 3FYUA 1LI7A 4TSFD 4XFDA 2QVXX 3IC5A 4ASUA 4C29A 4U9IS 5B12A 3CVXA 1Q0QA 1SUSA 2IHNA 4ZAGA 2UXDB 4X65B 8ABPA 4BNMA 3DA8A 1ZO8A 1IZ7A 3QWAA 4HLUA 4DMFA 2NU6B 2ONZA 3IQEA 2CHVA 3KALA 2C7PA 4BUZA 3V2IA 2YDXA 2QPAA 1GZVA 2PYDA 4KFTA 1HG1A 1ODJA 1HDIA 3UAZA 5F23A 1B15A 1T8WA 2IEZA 3UCFA 4KDCA 2WV7A 2B2CA 4GP7A 1DX6A 4TS4A 1T3LA 3BWDD 3JR7A 4BFVA 1JFRA 3SHWA 2OHGA 3SP1A 2GZDA 1TVCA 4UUPA 1Z0JA 3ZDDA 2HW8A 1X74A 1B0UA 1A95A 2JJ8A 1NYQA 2CF6A 3LBYA 2R6GA 2IVZA 1I6WA 4JELA 1FRNA 3AG5A 4HB4A 4BO2A 5IF9A 5IXSA 1Z6TA 1PGPA 1F8XA 1YR7A 1ITZA 2FZCA 4CTMA 4OHRA 2FRVA 2O57A 4TWAA 3FGNA 2XZPA 2XDYA 2AX3A 1WQ1R 4RACA 1GLVA 3NH6A 1CUYA 2TS1A 2BFNA 3Q88A 2O8NA 4E5YA 4TKUA 4BRZA 3BTUA 2A5YB 5IFKA 1LBSA 1QCZA 3LRXA 2WIBA 4ESEA 4LDZA 4O2BF 2VUTA 3WIOA 5K6TA 1QTRA 2LR0A 2N0SA 1KF0A 3DMHA 4HTFB 3UOWA 4AKTA 3PT9A 3ZV5A 2E4AA 3DTVA 3G88A 5GQSA 3PTAA 1RJGA 4B4KA 2Q6VA 1YRLA 3P9ZA 4LNAA 4X95A 4UU1A 3MWEB 2DUJA 2B8WA 3AXTA 2A1IA 3VDNB 4RD1A 2IA5A 1D7AA 2V7WA 2G04A 4L5JA 1NVDA 2MYPA 5C8VA 2CDCA 5CP8A 2O3SA 1MFPA 4I9UA 3ROEA 2CV0A 2VQSA 4QYWA 4BO0A 2ISQA 3RJ5A 3LUPA 4JHLA 3B1FA 4QRIA 5H3CA 5JZ9A 4M89A 3GARA 1TJ5A 1JLHA 2OB2A 2XE8A 4BV8A 3H5LA 3CRRA 2DKFA 4LJ8A 4P36A 4XIGS 1WVIA 1M0EA 4C1NA 2BRUA 4GUDA 3EMKA 1KWKA 1WB6A 4C87A 4DTIA 2C4MA 1MOQA 2OCIA 2Q9CA 4BNIA 1QANA 1R1DA 1HDEA 2AUNA 3ONFA 4LOIA 5HSGA 4D4IA 1CZHA 1YHZA 3KQPA 1NHNA 2X2PA 3OX1A 3HBLA 1A5SB 5M29A 2G9UA 2WG2A 3V34A 5FUMA 1HV8A 3PFCA 1V3TA 5IAAA 1YS7A 5BWBA 1J99A 3H2YA 3ABSB 1D9XA 4OM8A 5I9TA 1SXGA 3GRFA 3I2IA 2GCEA 3KOZA 1LW6E 1Z22A 3U3MA 4HDRB 4LZWA 4MYUA 1B43A 3CJQA 1Y3CE 1JZSA 2I67A 3P45A 1JSLA 2JAXA 2YQ4A 3AF2A 2QW1A 3GUVA 3OHMA 4O0LA 2NXWA 4OY3A 4RJ2A 4RL6A 4B6RA 3A0RB 5FPHA 1WXQA 5F76A 1Y48E 5EJ4A 3PGA1 2G4LA 2YVLA 4ITUA 3ASZA 4COOA 2FEOA 4ALNA 4FGWA 5GIOE 1CRQA 2AUMA 2QYSA 4HLCA 1K6MA 4TXHA 1D7OA 4UUAA 4BO9A 3DPIA 4KZKA 4AZ0A 4QAQA 4OIFA 1F17A 1JEJA 4YRBA 2ECQA 3SHVA 2ECKA 1QOPB 4YGYA 1N6RA 3HBFA 2NU9B 1MRNA 1Y6ZA 7AT1A 1THGA 2WFZA 3OE5A 4GL4A 4M8NE 3K0KA 2RAVA 1C9KA 4XUDA 5ALXA 3RS2A 3QE9Y 5J2UB 3E6AA 5AJYA 3NB0A 1PZNA 5KAMA 3DHNA 5KYXB 1GNRA 1IQPA 4LMRA 5A4KA 4TKLA 4CU2A 2VJQA 4YASA 3ZWKA 4A8JB 4F8YA 3AF6A 2IP1A 1GTVA 5EHGA 1ZM4A 2AG0A 2YW9A 3K05A 3GDFA 1H5QA 4K8OA 1T9GS 1BQ3A 4MQ5A 2WD7B 4YJFB 3SCZA 1QTIA 3VKVA 3GPLA 3PSHA 3T4XA 2PMWB 3V1TC 2MYUA 2PKRA 2WD9A 2UZ3A 4D0GA 3DXYA 3R6WA 4IINA 1L4NA 3NRCA 5ALPA 4LQLA 2YBEA 1FU8A 1YCHA 1WKCA 4D9EA 2FWBA 2QN7A 2B25A 2W83A 3L0YA 5K4GA 5BW5A 1WCV1 3S27A 2JA2A 1QVVA 2OESA 4J7CA 2BGKA 2ZRLA 4XASA 1PT6A 3R3ZA 2QX4A 2XQKA 1PLLA 2N1MA 1MVNA 2YR0A 5JJKA 3ADCA 3NBKA 4Z7JA 4HLNA 5CNKA 2ILTA 3NRBA 4Y1GA 4C43A 3S8YA 1OUMA 3NMUF 5KVVA 2UVDA 4UU0A 1ESCA 2H4XA 3CHYA 1NX6A 4BQOA 2AJ8A 1XEWX 1T26A 2DP4E 2Q1WA 3PENA 4PPQA 5SY4A 4WBSA 5EIWA 2XKKA 2ZW9A 4C04A 5IJWA 5K8IA 2GEBA 3MK31 3F7NA 1Q0TA 2DCMA 2WIGA 4N0PA 5KYYA 2VDNB 1LF5A 2WMDA 4RCYA 2N9UA 3DZKA 1QDEA 1SU6A 3QIAA 4HX2A 1OSNA 2C5EA 3FWZA 3WIUA 2LKCA 5D2CA 4EB6B 4RO0A 1M67A 2HLHA 4RPKA 1K8RA 5H81A 5JXJA 1ODCA 1Y98A 4ZJUA 1CY7A 1S8OA 4EJFA 5MN6A 1AF7A 1U6KA 1CZOA 2NTEA 1QHIA 2UU9B 1PJ2A 1WKBA 3ROQA 1P3DA 1XTIA 1YZQA 4C0SA 1S6YA 1XTQA 3GFPA 3K8ZA 2JL1A 4DLSA 3IDFA 2I34A 4C0WA 2W0MA 4ARBA 4EWLA 2RGRA 5KOHA 1DG1G 5FPPA 3ZV3A 3I05A 3L4SO 1JDBB 1A1SA 1SUCA 1IL0A 1GWNA 4Q9IA 1PD1A 3ZE2B 5KU7A 3OJFA 4BNXA 3FWYA 2QP4A 3B1VA 5KNBH 4PC7A 1QE3A 2NN3C 1HEIA 2BVNA 1NW3A 4XSGA 1MPXA 2I6FA 4HMPA 4LXYA 3SR3A 2RHDA 3G9ZA 2AVDA 4O4HF 4PRZA 4JA2A 1T8TA 3ZBUA 2G9NA 2BWJA 2VT2A 4IP0A 2GARA 1DO8A 3DZFA 1ZS9A 4KUHA 2Q3HA 3FVTA 4Q24A 3GLSA 3ICCA 6NULA 1R3UA 4TQAA 5GMOA 1US8A 1TQ6A 2AH5A 3OZIA 3RE1A 3UHPA 3VHQA 4V0KA 2CNDA 1ILWA 4AP5A 5A5DA 1XKQA 3DCJA 3EDRA 5B2ZA 2P4SA 3NUZA 3AZPA 2CUNA 3TW8A 3U0VA 4N0EA 3LDAA 4M3NA 4OJKA 4V3BA 3ZGOA 5I6DA 3DLIA 4J4BA 2I4LA 3EHEA 4PSKA 1VYVA 4EGFA 3HP1A 1J39A 1HTBA 4RTNA 5F7JA 1JTFA 4QHYA 4YI5A 5IDQA 2ZAYA 7REQB 4AJPA 2RKBA 2UVPB 4NRDA 5JNLA 2KSQA 1IWBB 2GM5A 3PE3A 3D4OA 4ZT4A 3KE8A 4LNUA 4Q4AB 2ONKA 3D7NA 4BPBA 1X3SA 5BW4A 4Y2PA 4RU1A 4DMRA 1G7CA 1I6LA 1NLYA 4XWKA 3K5IA 1QZUA 4HSGA 4RZIA 4C88A 3RHFA 3HY6A 1KSGA 1RWNA 2P2CA 2W37A 2YRFA 3A1TA 2DWPA 4C6TB 4P33A 3ETJA 3TF5A 1E8DA 2OPBA 1IN5A 4NOKA 3GZNB 3TE6A 4NULA 2CKDA 3KM0A 4F5DA 5I9NA 1RAAA 1L5YA 3H8SA 1Q12A 3U6KA 1DKQA 4ZYWA 1QP8A 1DTEA 4R16A 2Q3EA 3QKSA 2WJHA 1AS0A 3B38A 3T1NA 3ZHXA 1FIUA 5H7XA 1GCAA 5BN4B 2X8JB 3DF7A 5KQSA 1LJUA 2G07A 1QRVA 3N2LA 1Z8FA 1IDOA 5CFPA 2HJ9A 1X7WB 4PCUA 2O6LA 1Y6GA 3STWA 2NZJA 3KQMA 5EIXA 3SYRA 1U2RA 3GBPA 5EJMA 1GZDA 1KI3A 1UP7A 1QGAA 2ZM5A 5AHWA 4E11A 1KMNA 3HFJA 2B3TA 1KQNA 3T52A 3WP0A 3HJFA 3OEHD 5JFGA 2JEOA 2QD4A 3GCGA 1O4WA 2OAGA 4IUBS 1A50B 1E79D 1CUHA 3PK0A 3IKMB 1EP9A 3U48A 4CM9A 5K0BA 4M1YA 1U5BA 3OJEA 4ZO4A 1Y7TA 4B8ZA 1HK7A 2AVNA 3GXBA 5LXTA 3K4HA 1YVDA 4YQEA 2NLOA 5EHNA 3NM5A 2HU7A 4MWGA 3TW6A 4LGYA 3JWGA 3QFRA 1SUWA 4QXQA 1PR4A 3U3ZA 5AESA 5LLDA 4S2QD 3DS8A 1VE6A 2QQGA 4UHBA 1GZ3A 2VPXA 5IKXA 3KE9A 4DJDC 3W5CA 3S0JA 3HV2A 3RVJA 1OX4A 4OMFG 2OGWA 3B82A 2PD4A 1H42A 3MTEA 4I1VA 4NMWA 4WE3A 2CL5A 2PL9A 2YMMA 1DCKA 4HZUB 3EUFA 4QASA 4RWEA 2H1OA 1NW9B 2EKBA 5CNMA 5A3RA 4JQCA 4J75A 5FI5A 4ZVQA 2HKIA 3GLGE 2Q3LA 4U7DA 4EVSA 1A9XB 3RSSA 3WIEA 4AJ9A 4EG5A 4G0PA 3V4RA 2GZKA 3OOSA 3KU1A 4EX6A 1Z47A 4MR8A 2FPIA 3M6IA 1YKGA 4FILA 4FSDA 4X63A 4A8HA 3C1TA 4IHAA 1WXWA 3LA6A 3OP1A 4G5OA 3N8IA 4AO6A 4DLXA 1EPUA 1KAQA 3QBDA 2ZI9A 4GUAA 1J22A 2UUPA 4O2RA 1QSGA 4UNQA 4F86A 4RE6A 4L85A 3U1VA 3NBFA 1QK4A 2DWOA 2NZYA 4MS3B 4RGQA 1NE7A 3C8MA 3BCSA 2C4TA 2ZRFA 5LYJF 3QBTA 3P52A 3I0MA 4PFSA 4MR7B 4U7HA 5AWFC 4J3FA 3GFSA 4Q9AA 3HZZA 3V42A 3B8HA 4YBZA 1XEXA 2O8CA 4UAGA 5JTTA 4UW9A 3L0SA 4BFZA 4YX9A 5F9HA 4RAQA 2Y92A 3THSA 5CLGA 4EENA 4N0QA 5LWQA 1CUDA 1GAWA 1SR8A 2PH3A 4V38A 1T9AA 1ABBA 4JROA 3DWEX 1E77A 2ZXEA 3KJEA 4Z4EA 2O2SA 2J9RA 1QH1B 1M6WA 3EBPA 4KYTA 3UHOA 3WKBA 1KXJA 1OAKA 3G5TA 4MMXB 4Q7KA 4ZV9A 4PLHA 1YBHA 4WCFC 2JGLA 5G3ZA 4HFRA 1TMYA 2GH1A 1VRWA 3VPDA 3ZD9A 2O1XA 1WTCA 4A8PA 5CCDA 4YT2A 1YK0A 3JPWA 4KFRA 2A35A 2UYQA 3F7OA 2FPXA 2PIAA 2Y71A 4DXDA 1QGUA 2AOTB 1PWXA 3PHLA 1KPIA 4MQEA 2Z8YM 3KEGA 5DIFA 4C0LA 3MCAA 4E5SA 2OEPA 3UV6A 3THWA 2R1UA 4YAFA 3OP4A 4K6CA 5EZSA 5KJ1A 1X7GA 2JKVA 2VNKA 1OD6A 4F7DA 1BCSB 5GADl 1FDTA 4XARA 2IPNA 3B13B 4IX1A 4E2YA 3RSZA 1E0JA 3K9QO 1ONBA 4UBKA 5JMPA 1N6HA 4PC1A 5KNCD 2RB5A 2JFZA 4ROTA 4FHCA 4WXEA 4F6LA 1HC7A 1ZMTA 2EXXA 3B12A 4IDHA 3L93A 1NU6A 4IIUA 2AXNA 1ZPDA 2IH5A 1HG0A 1M75A 4G85A 5KOIA 1GLGA 1PR6A 3W8NA 4TMKA 1IIRA 2B9VA 1UT5A 2I3GA 2RHRA 3EIQA 4IXWA 4OHWA 4IX9A 4DIKA 3JWIA 1SWVA 4NESA 4MWDA 1V11B 4D5GA 4H3HB 5KX5A 1X0XA 1SZCA 2CYCA 1PT9A 4KIFA 1JTEA 3NI2A 3IX7A 5EP2A 2K7FA 4WASA 2B21A 5ALDA 3KT8A 4I8DA 3I5AA 1QWSA 3H6KA 3HP7A 1ULHA 3CG4A 3MTGA 5H82A 5MGNA 1IWOA 2BCEA 2JJYA 2C5SA 3AM4A 4FN4A 1KO1A 3PNMA 1K7CA 4OKSA 4YI3A 3ROTA 1S4MA 2W2TA 3SEQA 3UT5B 3WMGA 1E98A 4EOGA 2QROA 1Z06A 3I2YX 4D2IA 3IIIA 1GQFA 2ROQA 4W5NA 3ONVA 2N3ZA 9ABPA 4E5PA 4AMVA 1P7ZA 1YZHA 5B6IA 1IB0A 3H6HA 3UK0A 4N41A 4NTZA 4FWTA 1AS3A 1D6SA 2OGTA 3AM5A 1NZJA 4I9HA 2IV2X 4NODA 3STXA 3REGA 1FFXA 5CDYA 2GTPA 3KOMA 1SOUA 1JLLB 3MGKA 5JXWA 1JIIA 1KQPA 4HXFB 4C9BA 1G3QA 2QJOA 4MWOA 1VBNA 5CVTA 2RGUA 4FYHA 2OCPA 3FJOA 4L2IA 1L1FA 4DV6B 3QUCA 1KQFA 1RAGA 3HUTA 3KFLA 1NNUA 1FRQA 4GZ3A 5AKKA 4JC5A 2QZPA 2NQTA 2OECA 3L7NA 5J23A 1IBCA 1Q14A 3BH0A 3A6DA 3MAAC 4PR0A 4KO4S 1TT7A 1DKUA 1Z8DA 3JQ9C 3JQBC 1N57A 2ID4A 2W2VA 3E9DA 1NNI1 3B3GA 1YVUA 3L6RA 3KLPX 4EL0A 3UAVA 4KDRA 2EU8A 1G291 2G82A 2E82A 5AVSA 2ZBPA 4B8WA 4DUZB 1CP2A 2NU6A 2FZGA 3JAKA 3WO1A 1VKOA 3JD3A 3FDZB 4FYYA 3PFGA 4DIBA 4DUGA 2YASA 1GL9B 2C77A 3Q40A 3G2PA 3WLPA 1W1IA 3U9LA 4RTJA 2D0OB 4KODA 1FW8A 1YA4A 4A0HA 2CLLB 1E4EA 1N3BA 2HXGA 1RMTA 2WVGA 4F6RB 4ENUA 3ZE1B 3UHAA 1Y4AE 1R0CA 3R1IA 2I33A 3ZE8A 1T3TA 1HFKA 2O8EA 4JXKA 1JFSA 4R31A 2O54A 1V4NA 4XYGA 3CKKA 5KMGA 3I8OA 1Y8CA 4ZO9A 3ID6C 5HS6A 3RNOA 4WY2A 3U7EB 3SE0A 2B2XA 3CH7A 1DG3A 4JP2A 4XD7A 2G8NA 2ZRBA 3ED5A 1H05A 1JBEA 13PKA 1C8LA 4KIGA 3PCXA 2BDTA 1MLDA 3GX1A 2F3TA 1U04A 2PLFA 3ISJA 1G9SA 3OTOB 1OFTA 4GXQA 2O8DA 5DNUA 2Z09A 4D7AA 1JIKA 4TUYF 1F14A 5AKYA 3AEUB 3KK0A 5DISB 2JCGA 1DAOA 2WTEA 3WZ2A 1Q2UA 2H48A 1YL6A 2NTYC 3ZN2A 2GASA 3PT5A 3ZV4A 4C3OB 3RG8A 1SZDA 4FC7A 4LHXA 1EVJA 4ALKA 1XLUA 3IQIX 4ZHQF 2HSEA 4R8SA 1EUCB 1T15A 1ZW6A 2YXDA 3CZCA 1X7YB 5KYNA 3AOEA 4CM8A 2FWMX 3N87A 4DV1B 2FW1A 3JZAA 4Q03A 1G8JA 3P0JA 5DI3A 4QTUB 1WDWB 4OQMA 2GLUA 1F4LA 2PX6A 3KAKA 1YR1A 1EJ2A 3N5KA 2XZOA 1UC8A 2XNDD 4B48A 2OM2A 3NC0C 3KTDA 1HNNA 1RAEA 4BE9A 5HJEA 1VJ5A 1HLGA 1D0IA 2Y66A 4Z3DA 1CLUA 2VH2A 4ZKEA 3UV3A 3MJHA 4RTRA 4BNNA 1L4FA 2WT9A 1QRDA 5KSYA 1SCNE 2A9PA 4PYRA 4AIIA 4E5UA 2BC9A 4N18A 1VPEA 4GI1A 4MUXA 1YZLA 4L9SA 1JWLA 3R9XB 3ILSA 1O08A 1A76A 2WPNA 3Q8MA 1ZSYA 3EA0A 5B55A 1R6UA 2CB0A 1FLNA 3CWQA 3RFCA 5K0ZA 2G5CA 2WMOB 1JJ7A 4NBUA 4ZRDA 4PSVA 4S0ZA 4JP8A 2C1EA 3HYLA 2QU8A 2DFVA 4HDRA 1WZIA 2FVYA 5AK4A 2EKLA 5A3VA 4YRAA 5GVSA 4PYOA 2WYIA 1SQ6A 3S70A 1SG0A 2IX3A 4IKPA 2E9SA 3H17A 4P4NA 3X44A 3C5WP 2O8BB 3LBNA 3F5MA 2F59A 3N2NA 3TPZA 2OV2A 4PZYA 1AGNA 1T3HA 3EG9A 4GR9A 1LI5A 4QJBA 4Y7DA 3SNHA 2DFLA 3VPSA 1LY1A 3SC4A 1IEWA 1WSWA 2P65A 4Y3UA 1Q1NA 1T1GA 1UFKA 1XZBA 4C21A 3HB5X 1TECE 1ZSVA 2BONA 3TQHA 4CIBA 3DBOB 2DSNA 1DC8A 2XZTA 3GL9A 2Q3JA 4WKCA 4YT4A 1QRSA 4YDHB 2J4CA 3QXXA 4F4HA 4P81A 2VNSA 1MV8A 2B78A 4K9DA 4I1SA 2NU9A 5DWVA 4E7OA 3FPFA 3IP9A 3K2BA 4Y8VA 4E1BA 3CLUC 2VLIA 1CV2A 2HGZA 2BFDB 5J2UA 1QYXA 2F90A 3ETDA 5C8DA 4RZHA 1E2PA 2PKQP 1L5MA 1MQ9A 1WKVA 2Q4OA 1CU1A 3A10A 3HR8A 3PE4A 1T2NA 5FTWA 2C7RA 4ND4A 2QRZA 1RLOA 1ZGZA 4A8JA 3BDAA 4Q9DA 5DE3A 1QIFA 2OG2A 1ORIA 3IDOA 1K75A 2WFAA 2XKBA 5DBHX 4MVJE 4NCBA 2ZI4A 4RK1A 1SMKA 1O2DA 3PHJA 5A9SB 2CV2A 3TIXB 4ZQEA 5JJ5A 5A2QA 2RGCA 4PPYA 3CEPB 3S81A 1IJFA 1IG0A 3UIEA 1YCDA 1EM8B 2KI5A 4K46A 1DAIA 1FP4B 1VYTA 3EMBA 4W9RA 5K3AA 1F20A 1HI9A 1WD5A 2ZJ4A 1KORA 1H69A 4HUQB 2VJOA 2UUCB 3HTXA 1KI4A 3UV7A 2Q5EA 2ZVJA 2D5AA 1A69A 1SRRA 3QM1A 2ZT8A 3A06A 4P83A 4RIGA 4TGLA 2ICAA 3LBHA 3CFYA 5EWMA 5LQSA 4M0PA 5TMEA 3OZVA 3PFIA 3ED1A 3PEYA 2OQRA 2B37A 1U28A 2B4RO 4R0VA 1E7JA 1SXQA 4RK0A 1E7RA 3DAYA 1W87A 4X7MA 2AC7A 2PXHA 3RT9A 1OXKB 1WPQA 1KY2A 2AEEA 1NLFA 2I5PO 3GBSA 4DMGA 7GPBA 1FFGA 3QMMA 5CHYA 3TW4A 2L17A 1RXSA 1XVTA 3GRAA 3TZLA 4Q9JA 2QNRA 4NZNA 4BYGA 3WGHA 2X4DA 2X2FA 1ADGA 3IP8A 4RZXA 4J1TC 4EB6A 1F2UA 3JU3A 5HNKA 4YRJA 5EJEA 3ZHTA 2JFUA 2VUHB 5ALVA 1LH0A 2X22A 2GZSA 5MDHA 1RTKA 3I3OA 4ZV7A 4RXUA 2WJWA 1W0KA 3Q3JB 1TYCA 4PLFA 4WXHA 3SZ3A 2PX4A 5L3SB 3M2TA 1EVQA 1JE0A 3I01M 4Q0MA 3PHCA 5AXDA 2EZ8A 2IOYA 3UJAA 4YR7A 4ZHSA 1C0LA 3E48A 4B3RB 3ZVNA 3FIUA 4FMCF 4KN6A 4S24A 5A3QA 1DUSA 4M98A 2G80A 2WAMA 621PA 2O2GA 3CUVA 3GCDA 2ONJA 1TVKB 4CTKA 1KL7A 3ASUA 3NBUA 2YXPX 2KE5A 5AK3A 3PDWA 4YAIA 2R44A 3LGAA 1N5RA 3N7UA 3L7OA 1WPRA 5F51A 4PNHA 3RTCA 1QAMA 3QA9A 3CJTA 2B7LA 3DKKA 1MX1A 1VRCA 3E9RA 1A9ZA 1VHQA 4LX0A 1H6BA 4NARA 3EXHA 3FUUA 2X5OA 1QB8A 4YP6A 2JFFA 1IN6A 4Q1FA 4XSHA 2ZBFA 5DULA 2ORVA 2IF2A 3L2OB 2XGJA 3NAZA 2NU7B 4Z49A 2CZQA 2PKWA 4JUIA 3OQIB 1XC7A 4YGXB 3WZLA 3BGWA 4KV7A 3FKSD 4R1TA 2VF2A 3EPPA 1P9RA 3I9NA 4F2HA 1OKKD 3FMGA 3K9NA 3ZTYA 1ACJA 1JQEA 1V7CA 4QNRA 4B31A 5J3JA 1SJ9A 5K0EA 4G4GA 4HVTA 2PA3A 5KTTA 2J9GA 1I3OA 1O5OA 2X9LA 3TTYA 4AD8A 3L6OO 4RMGA 4EA6A 2HJRA 4RMJA 1E0KA 5K3OA 4U9HS 3SYLA 4ZODA 2AEFA 4CMGA 4WNIA 4K5QA 3MQ2A 1H8ED 4QEKA 4XQ9A 1X15A 7REQA 1WXDA 1GHTA 2UVPA 1EP1B 5I7OA 1TM1E 1OXBB 2FEXA 1E9RA 4M1TA 4Q4AA 5LPNA 1V2HE 1Y3HA 3FZNA 5B58C 1G41A 4WOJA 3UYLA 3HR7A 2WP0A 4YMWA 3KS9A 5FUXA 2FMHA 3M81A 2CVFA 4ZIRB 3G5LA 5BN3B 3MWDA 4U2FA 2QWXA 4YAGA 5LNK1 3GFFA 3KJFA 3NAMA 3U4QA 3WNVA 3VVBA 3G9QA 2QRHA 2J6IA 3QVGB 5CEJA 4R51A 3ROPA 1XTBA 3GZNA 2V1XA 5LQUA 2O20A 2PTGA 3DUFA 4X44A 5EINA 3R5FA 4MRMB 2DWQA 4PYNA 3IILA 1PD0A 1QR6A 4GQIA 3NONA 2P8JA 3DZGA 3CQ9A 1QRTA 3TXAA 2F3PA 4X45A 2Y1GA 4WXMA 4KI0A 1BX1A 1L4EA 3MFQA 2X8JA 4KIUA 1PGJA 1YJXA 4GYWA 1JA9A 4J94A 4U3JB 1F12A 1WSDA 1X7WA 5CX4A 5AXAA 5ARBA 4WJZA 5ENVA 3VNUA 1W49A 4HDAA 2QM0A 3L0DA 4RDHA 1SURA 1J20A 1P31A 2VUUA 3T41A 2NUAB 4AW9A 1R12A 2XYQA 1M6YA 2P9JA 3HCAA 3PNBA 3WQBA 4ZT5A 4AQDA 1GNPA 1NM5C 3HNPA 4TWRA 3ZZNA 2C4WA 5EGNA 4BBAA 3VJLA 2D8MA 1HR0B 2J4DA 4NCNA 1PW7A 2BIFA 1C9JA 1A27A 1G3MA 1PX2A 2WFLB 2FMIA 1OFUA 3SNKA 2YWCA 3O2NA 3QVMA 3O8LA 4L22A 4UJ5A 3ILVA 4BWVA 1ECJA 2VZ9A 1YHYA 4G5RA 1JR4A 2JDID 1A8UA 1XL1A 2C00A 3DE6X 2XAAA 4JQYA 5CURA 2JRLA 4R9VA 4XX1A 5CCXA 4YJGB 4WFKA 3HY4A 3PL5A 3MVEA 3OO1A 2HFJA 1FA9A 4O2AF 2QSJA 2V45A 4UM8B 3OESA 4BZPA 1ZONA 1WEKA 2C4HA 4MCAA 5FLXA 2QA5A 1I51A 3ER9A 3CNHA 3OJWA 1U90A 2SKDA 2YIVX 3DNPA 1DKRA 1Z39A 5JCJD 1Z74A 3WLHA 3FR8A 2HRZA 5CLFA 4GYKA 4X5OA 1N33B 2OENG 4HGZA 4MP3A 3ZJUA 1SCDA 1AJEA 2IHBA 4RF4A 1RRPA 2QLTA 4UVHA 4DLAA 3DLAA 4QXPA 1AQUA 3QQ5A 3I9FA 3GGOA 4ZTBA 3RUPA 3U6BA 3O2SB 2GXQA 4P7BA 1FDWA 2E2WA 2BISA 2ZPTX 1TXGA 4Q4DA 4RULA 2XUOA 4DM4A 1M0SA 1AURA 1NBIA 1ADJA 3FLAA 3NWEA 3E3OA 2EDAA 4KCGA 1M0WA 4TL6A 2QGFA 3VC3A 2KJQA 4C4TA 2FSVC 5BSGA 5K0CA 1NTRA 4TL9A 1AHNA 1N3YA 1OASA 4JXJA 2ES4A 2QMUA 3D0RA 4NZ9A 4W9NA 5T4FA 3BUSA 2R96A 3IE0A 2V6MA 4LECA 4NCAA 4MW9A 3IUNA 1CUBA 1V45E 4F3NA 1VLHA 4TT3D 1U7XA 4H0NA 4ZI7A 1I24A 2ESRA 4NBLA 4UMVA 3KKZA 2WDZA 4R98A 1KO4A 4JNCA 3V1KA 1H65A 2R5WA 4URWR 1SELA 1E2FA 4YLGA 1FTSA 1ZMBA 3HU3A 5IUNC 3O4GA 4NYMR 5LZ5A 3TCXB 4WBXC 4EF5A 4QQ8A 1MHPA 2F1IA 1CRWG 2DT8A 3P5SA 2IIQA 1B93A 4KQKA 3PQ4A 3ZJYA 1FFWA 1T5HX 1BWQA 2BCGY 5AUNB 2I76A 3KQSA 4RA9B 1O77A 5J4KA 4BL5A 4G23A 5KJCA 3FYTA 1FXWA 1NXXA 4K86A 5FWAA 3T54A 4LJLA 3BT7A 1AHHA 2HSWA 4PW0A 3UH1A 2PRSA 4X8LA 3JXEA 3ZQUA 2IY8A 3IEIA 3EWNA 3HK2A 4CCAA 1LC3A 3CLSD 3HYRA 3L7JA 4H27A 2X8LA 3PX2A 3KUDA 2DH5A 1U3GA 4V2IA 2XITA 1VFNA 3TK1A 3C1OA 3IUQA 1U1CA 3PZRA 4D1YA 4QTYA 1D04A 1BMFD 2X5KO 1BCSA 4AJ4A 2OM6A 4DBLC 4DPLA 4TZTA 3P9SA 4QDJA 1Y8ZA 2OZPA 1JAIA 1TB4A 1HFJA 1MKYA 2PS1A 2QX6A 2ZTHA 4PLCA 3V48A 3QE0A 2D0IA 3KKKA 3C3BA 3VO9A 4EITA 4EVIA 5J4VA 3RW9A 3HCRA 3F27D 4JB8A 1ZN8A 1E7YA 2LY4A 3OX3A 4L76A 3VI4B 4OK5A 5FUYA 1NJSA 4TXLA 1EHYA 4DPMA 1D4AA 3NIDB 3ESBA 1DQYA 1NYTA 2CFTA 3FZEA 3GNLA 3HKCB 1YOBA 3T5BA 1EP2B 5HMLA 2C3PA 3MUN