1LPPA

Analogs of reaction intermediates identify a unique substrate binding site in candida rugosa lipase
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords LIPASE
publication title Analogs of reaction intermediates identify a unique substrate binding site in Candida rugosa lipase.
pubmed doi rcsb
source organism Candida rugosa
total genus 193
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lppA00
1CUUA 1DX6A 5AM0A 3I2IA 3C6ZA 3WL7A 1K5PA 4FLMA 5CBKA 4OU4A 2QR5A 1XKLA 4F60A 5AK5A 2EDAA 1CUCA 4PQEA 3NOXA 1Y7HA 4B85A 1E5TA 1P0QA 2XI4A 1F6WA 1H2YA 4FMPA 1N5RA 4AO7A 5EFZA 5ALKA 3K6KA 2GBFA 2GYVA 4IHAA 1E8MA 5K3FB 3G0DA 5AI9A 3HC7A 4F0JA 4LYDA 5D3KA 4ARBA 2D0DA 1GQRA 4Q05A 5T4HA 2XMZA 3PF9A 3WWEA 1ZI6A 4W1SA 3T52A 5K3FA 3BDIA 3OM8A 2V96A 5CT5A 2CUTA 1ORVA 2JGKA 1WOMA 1LPPA 4UBLA 1CUHA 4JYPA 4X00A 1BCRA 1IMJA 2JGMA 2WJ4A 4OSEA 1HQDA 3PFBA 4LHEA 3R3VA 1UK7A 3H2GA 1DU4A 1XZJA 4WDQA 4EY5A 3S2ZA 3WKAA 1YB7A 2RGUA 4Y7DA 4XIIA 2DHCA 5T4EA 2I3ZA 3G0CA 2XUFA 2JGLA 2V97A 1O6GA 1YS2X 3FYUA 2QMQA 3BIWA 3F97A 1XZGA 4C6HA 1AURA 1EDBA 4G9EA 3G0BA 4FWBA 4X6YA 3PF8A 1EDEA 2HU8A 3DL7A 1A8UA 3FLBA 2WIKA 1DQYA 2GZSA 2OGZA 2XMGA 3EQ9A 2PL5A 1BRTA 6YASA 4G4IA 3G02A 2H7CA 2HFJA 3N2ZB 4WY8A 4L72A 3KD2A 3DKRA 3QMVA 1CUYA 1JMYA 1QJ4A 1S8OA 4MQLA 2DCMA 2DSNA 1QONA 3RKSA 1CUEA 4C01A 5LZ2A 2OCLA 4L3WA 5FPQA 1TIBA 1CFJA 2CB9A 3ZV7A 5A62A 4W9RA 3QZUA 1LGYA 3A70A 4MEBA 2CBGA 4P08A 5AM3A 1T2NA 4W1QA 4GWLA 3EQ7A 5AKLA 4CIBA 4S0XA 3DOHA 4Q3KA 4BYMA 3VJMA 2OGTA 4ZREA 1MO2A 1W1IA 1DWQA 4BTVA 1ZGCA 3OURA 2PSFA 2WM2A 5IH7A 2R11A 3F98A 3PICA 3W9UA 4C4XA 4B0PA 5T4BA 4AB1A 1MX5A 3C70A 4Y2XA 3E0XA 3WKEA 1TQHA 2XLBA 5E4YA 2OXEA 3JW8A 1UWCA 2QT9A 5EHXA 2XQJA 3DYVA 5AIAA 1QIGA 4CG1A 2D5LA 1A7UA 4W1PA 2JEZA 1SCIA 1XLWA 4BVJA 2OAEA 3KWFA 5ALEA 4BP8A 4X97A 2Y6VA 1QLWA 4X90A 2P8SA 5JD5A 1X2BA 1MT3A 1XZAA 2G5TA 3AZPA 3R3XA 4FNMA 4DTCA 2LIPA 1DINA 2H9YA 2XB6A 4P93A 4ZI5A 2PBLA 4BCDA 5LZ7A 2JBWA 1AGYA 3STUA 2HA0A 3H0CA 4DSZA 4Y2YA 5AKHA 3DS8A 5JAUA 2Z8XA 1E66A 4Q34A 4GBGA 3WKCA 3WA7A 1MX1A 1CEXA 3WL5A 4BRZA 5AOCA 2HFKA 4DM7A 1FFBA 4B80A 4WJLA 1XQVA 1Q0ZA 3F67A 4BC1A 1BEZA 1Q84A 3VDXA 5AKEA 5BOVA 4DNQA 1CR6A 3MVEA 1YS1X 3O4GA 1TKRA 4FHZA 1YB6A 2I03A 5HKAA 1QIMA 2Y2VA 4QDTA 3R3ZA 5AKZA 3NWOA 1TK3A 4F5ZA 2ZYHA 2VJAA 4PSDA 5SYNA 4Y2QA 5I7UA 3W05A 4N5HX 3H1AA 3HJUA 2Y6UA 3O4IA 4WY5A 3ICWA 3D7RA 5AK4A 3A2LA 2ES4A 5IVKA 2Y1KA 3G0GA 4G8DA 1QIHA 4EUSA 4BRSA 3FWHA 1JFRA 4BE4A 2PVSA 4BBZA 2BUCA 1JT2A 2GYUA 4E15A 3R3YA 1SFRA 5BWBA 5KBYA 2V98A 2ZJ6A 4DMFA 1BE0A 1CV2A 4X91A 3I6ZA 4K5QA 1CUIA 4IH4A 4AX4A 4X6XA 4XJVA 2H7YA 5AI4A 4IH1A 1E8DA 3HZOA 4FTWA 1CQWA 3D3NA 1EB9A 2E3JA 1YR2A 5FP0A 3R0VA 1ZICA 2ONCA 3DKKA 2HRRA 5AK6A 2AJCA 1OXMA 5HQ3B 1ODTC 4B82A 4E14A 1UOPA 4J0CA 3WJ1A 2O2GA 4WDRA 3I6MA 5BWCA 3RK4A 5CW2A 5JATA 1U8EA 2HIHA 5YASA 4HRYA 3UMJA 3LS2A 5LZ5A 1QFMA 2I78A 5HQ3A 4QDUA 3OG9A 1SC9A 2QOEA 4KAJA 5AK3A 1J2EA 1VA4A 3ZPXA 3D4LA 3I2GA 4FKBA 2X76A 3SWWA 1YA8A 4X85A 4H7HA 5FXMA 2EDCA 1F8UA 5JD6A 4B9AA 1MX9A 3FYTA 2B20A 2ZYSA 4M0MA 5AP9A 1MAAA 1U65A 1A8QA 2DQZA 5CMLA 5K3BA 5C7YA 3I1YA 4ZRDA 5HF6A 4UHBA 3RLIA 5HF9A 4H7JA 3WK4A 1TCBA 2AXEA 1WB5A 3QPCA 1EVQA 3D2BA 1B6GA 4ITVA 5FDFA 3OTQA 3V1KA 4RE6A 1QIKA 2OCGA 3KXPA 3V48A 4QEKA 2YH2A 1ZD3A 2HRQA 3G7NA 5ALHA 5JIBA 5ALMA 4A5SA 1C4XA 1GT6A 1QTRA 3G0IA 3HLKA 5HKBA 5EHZA 3IUJA 1O6FA 4HS9A 4FLFA 1LLFA 3CN7A 1LPNA 2JGFA 3V1NA 2V9ZA 1DT3A 4DMKA 2O2IA 4HTAA 4E11A 2C4HA 3ESDA 1R1DA 4OYLA 5CT8A 1UKAA 2HA6A 3W06A 4HRXA 2ACEA 1AMNA 4Y2RA 2QM0A 2XUOA 4FDMA 1XZFA 5AKXA 4X93A 4HXGA 5A7FA 5CT9A 2WG0A 1R9MA 1EI9A 1R3DA 3ICVA 2VEOA 5K3DA 4ZXFA 2WHRA 4CI9A 1XZMA 3WL8A 3STVA 2WU3A 1BU8A 4DNPA 1CUXA 4BP9A 2XMCA 3C87A 3WL6A 3BXPA 3QVMA 4KE7A 2WJ6A 3WYNA 1XZHA 5EHNA 3G9TA 2BFNA 1P0IA 1VXRA 2QJRA 1H23A 1BN7A 4Y2TA 3O9VA 4PSCA 1F0PA 2RI6A 4Y2JA 2CZQA 1YCDA 5ALOA 4OCZA 3AFIA 4OUKX 2VSQA 3NGMA 4YPVA 1G66A 5JARA 4I4CA 2ZJFA 4BZZA 5ALJA 1N5MA 1DT5A 2HA5A 3Q0TA 2BAGA 5JZSA 3ANTA 1SCKA 1XRMA 3AILA 2XQIA 4BATA 2XQGA 2HU7A 2Y2UA 2WG1A 1T4MA 1XQWA 1J06A 1XZLA 3B5EA 5A7HA 4G9GA 3KOOA 1UFOA 1VZ2A 4M0EA 2GZRA 3HACA 4BCBA 5A2GA 1CQZA 4G1FA 1W75A 3O0DA 4B0OA 4FBLA 4UBIA 1J1IA 4J7AA 3FCYA 3R41A 1QE3A 4KACA 3HYSA 4GI1A 3O95A 1XRNA 2DFPA 1M33A 1ZI9A 1UT6A 4UUQA 3V1MA 1FFCA 4DIUA 1UXOA 1XZIA 1K8QA 1Z68A 5AM5A 1W6RA 3FYUB 3T4UA 1P0MA 1EH5A 3WYDA 1ORWA 4QLOA 2WG2A 5ALIA 4H18A 2OCIA 4RE5A 3R3WA 1Y7IA 3R40A 4LXIA 2VJBA 4UBOA 1GPNA 3I2JA 4GECA 3B3QA 4I3FA 4DNOA 3C5VA 1EINA 1WPXA 1TCCA 2HA2A 2HU5A 2K2QB 1YAHA 4UHCA 2ZYRA 1VZ3A 1ZD2P 3AUKA 2DQYA 4FFWA 1HBJA 4G4GA 5IVDA 1Q83A 4IH9A 4IQ4A 1X2EA 5H3HA 3VJKA 4KEAA 4BVLA 1VA5A 4H7FA 4U2CA 5ALTA 4UHFA 3DEAA 4GLBA 3FAKA 1U2EA 3D59A 4O08A 2XQKA 1MPXA 1QO7A 3C6YA 3TEJA 2AJ8A 4ARAA 2X8BA 2XUKA 2XUDA 4UBNA 3QM1A 3VVLA 3RARA 3C6XA 3BIXA 2WIGA 3DNMA 3ZI7A 3PI6A 5E4JA 2JEYA 3EIOA 1QIDA 1F0NA 1XRLA 4TVKA 1J07A 2XUIA 5EIAA 3U0VA 4J3JA 1BS9A 4INZA 3KDAA 5A71A 1CUJA 4DMHA 3E3AA 2J4FA 5ALNA 3FVTA 2QKYA 1E89A 4DGQA 3C5WP 3DLTA 1VE7A 4AMYA 3WKDA 1E8NA 4JH0A 2XMSA 1XROA 5ALGA 1VXOA 3I2FA 5ESRA 2XUGA 4U2GA 1FFDA 3IURA 3VISA 1CUZA 2RHWA 2RHTA 4C87A 1G42A 1QIFA 5CT6A 2PUJA 4P92A 4E46A 4IO0A 5IVHA 1L7QA 4DMCA 3GA7A 2VAVA 4PF1A 4AO6A 3QPDA 2VJCA 4BAZA 2JIDA 1ZI8A 3TJMA 2WFZA 3A2NA 1MNQA 4HZGA 2CEKA 2DHEA 5AM2A 2X5XA 4J03A 3B12A 4MYSA 4BE9A 1QTIA 4KJXA 3ANSA 1WHTA 5CRIA 1CUGA 1THGA 4WFIA 3H2IA 2QXUA 2OG1A 5DNUA 4J0IA 2FJ0A 3STXA 4GEGA 3DCNA 2QRUA 1I6WA 2O2HA 1QZ3A 1IUOA 1GQSA 3RM3A 4B83A 4LKOA 5CH3A 3QITA 5FUMA 5C81A 5FLKA 3VJLA 4FLEA 4H77A 3GELA 5IVIA 3DYIA 1SCQA 3M82A 3D5EA 5ALFA 3H1BA 4XWGA 2J4CA 5LIPA 3QMMA 4H0CA 4BB0A 2B9VA 3E1GA 5AI8A 1MJ5A 2O7VA 3FSGA 1EXWA 1IVYA 1CRLA 1R50A 1AZWA 1WB6A 3FLAA 5BV7A 3EQ8A 4GXNA 1EVEA 2BKLA 5E2IA 1RYYA 4QWWA 3BWXA 5ALUA 5DNVA 3WIOA 1JMKC 4K6GA 1Q0RA 4U2BA 5CXUA 3DOIA 4EY6A 3FVRA 2VATA 4H7DA 1X70A 3F9CA 4Q3LA 2I3DA 4G8CA 1C7IA 3IA2A 1CUSA 5JZBA 3C45A 3Q8WA 1GZ7A 5FRDA 4KE9A 2IX9A 5DYWA 4N8EA 2Z5GA 1UK8A 4QDXA 5LZ4A 3FCXA 4NZZA 4HAIA 2GYWA 5LLSA 2OPHA 3O4JA 3IIIA 2IITA 4Y2PA 5ALRA 2QUBA 1XZBA 5JALA 2ACKA 4KE6A 4H7KA 1JI3A 1JJFA 3BJMA 3PDCA 4K6KA 3I28A 1CUBA 3QYJA 2VA9A 4X94A 4EY8A 2AJLI 1MU0A 4C89A 1UK6A 1ODSA 2WIDA 2VAXA 1CLEA 4HVTA 1H2WA 2BUBA 5AOBA 5JAHA 2OGSA 2B4KA 4B7ZA 1XZKA 4PW0A 4FNGA 1W4LA 2Z3WA 2XUQA 4AZ3A 1XLUA 5IKXA 1H2XA 5JD4A 4OB8A 3STTA 3L1HA 4A16A 4CCWA 3ESCA 2PU5A 3D0KA 1TRHA 1ETHA 4LXHA 3H2HA 3I2HA 3MUOA 4MQMA 4H7EA 1WM1A 4UPDA 3FBWA 4LIPD 4QZVA 5FOQA 5I8PA 1R88A 1KEZA 5CTAA 1G5FA 1LZLA 5ALQA 5AKYA 2XQFA 2R8BA 4CCYA 3WK9A 4A23A 4D9JA 5HCUA 1JJIA 2OAGA 3IUNA 2XMBA 1AX9A 5FPPA 1D07A 4G4JA 3V9AA 4PNZA 3MGAA 3M81A 3OC0A 4XX1A 1MN6A 2H1IA 3FYUC 2XMRA 1IUNA 2RIPA 3UUEA 2PSEA 4CIAA 1TAHA 2OQIA 4ZV7A 1EK1A 5DYYA 4B84A 2RAUA 2WUFA 1XZDA 3A2MA 4KR0A 1IUPA 4EBBA 4UFPA 3E4DA 5EGNA 5LZ8A 3G9UA 3G9ZA 4KAAA 5JAOA 4B6GA 3WZMA 4C4YA 3ED1A 4LYEA 4V2IA 4G8BA 4U2DA 3TRDA 1EK2A 5DLPA 3OPMA 4OYYA 4OD0A 5JASA 4MXDA 3PUHA 4NS4A 5LKAA 3PE6A 2ZSIA 2WUEA 3H18A 3A6ZA 4EA6A 3FLEA 3NUZA 2QTBA 1K4YA 3CXUA 4ZWNA 1ZD5A 2AJDA 5DTIA 4Y2SA 3K2IA 5AKJA 4F21A 2FJPA 4KRXA 1TCAA 4EZIA 4JYMA 1CVLA 2C58A 4MEAA 2O7RA 3IDAA 3H04A 2XMQA 3ILSA 5EIHA 1ZIXA 4ETWA 2W6CX 2WFLA 1QO9A 1RWQA 4EY4A 4WFJA 4CFSA 1FSSA 2B61A 3L1JA 5HZGA 3H17A 4K6HA 5JANA 5LYYA 4BTLA 4DSAA 2ZSHA 1ZD4A 4H7IA 1BROA 3ZLUA 3GZJA 4NMWA 3QH4A 3GROA 4Y9SA 5AJHA 1WHSA 1P0PA 1XQXA 1UKCA 3X3HA 2HM7A 2C7BA 1PV1A 3LLCA 4AN1A 2Z3ZA 5DTJA 5AIBA 2XE4A 4OPMA 1H2ZA 1YSCA 1WCYA 2OQVA 2QJWA 2UZ0A 2J3QA 2JF0A 2RONA 4X6UA 3GFFA 3QPAA 4C88A 3ESBA 2JGJA 1DWPA 5K3CA 1CUWA 5AM4A 3WWDA 4EHBA 1EB8A 1L7AA 2PM8A 5HFNA 2Q0XA 5ALVA 3C8HA 3AIOA 1AUOA 4J0KA 5HFAA 5CH8A 4RNCA 2HA3A 5ALXA 3W2TA 1A88A 3S8YA 3SX4A 2PKYX 1LPOA 3IVMA 4QA9A 2BCEA 5ALZA 4G5XA 5J3JA 1QGED 1GPKA 5D7BA 2QUAA 3BL8A 5EI5A 3BF7A 2VF2A 2GBGA 5CXXA 2ZVDA 1UOQA 2YXPX 1LPSA 4WFKA 2VJDA 3KWJA 3O4HA 5LP1A 1SOMA 1XFDA 1LZKA 3BJRA 1U4NA 1H22A 2C0QA 2YYSA 1E3QA 4BAUA 5CH5A 3HSSA 4N5IX 2PX6A 5SYMA 3WWOA 4JEIA 1HPLA 3HI4A 4H35A 2WU4A 3WKBA 5A6VA 2WUGA 5DYTA 1VLQA 2WQZA 3D2CA 2EEPA 4I19A 1LPAB 3WI7A 4QDZA 4KAFA 2HA4A 2WHPB 2H7XA 4WCVA 2WKWA 4K2AA 1VJ5A 3F8SA 4UBJA 4MWSA 3QBJA 1XQYA 1XLVA 2C5FA 4Q1VA 1BEEA 2XUHA 5KWJA 1R9NA 4W1RA 4HXFB 5ALWA 4AMZA 2VQ6A 3EF3A 5EHQA 1ACLA 1L7RA 2WILA 5LZ9A 2WJ3A 3IB3A 3WMRA 2WHPA 3JWEA 3L1IA 2VT6A 5AOAA 3QMWA 4BZWA 2PSHA 1A8SA 4CG3A 4J0GA 4W63A 5AH0A 1WPRA 1C7JA 1UZAA 3V1LA 3IUMA 4UFNA 4CG2A 3VKFA 3DQZA 1QIJA 1VKHA 4KYVA 2BGRA 4J0HA 1W52X 1W76A 2NW6A 3LIIA 2HA7A 3HABA 1LNSA 1BCSA 1GKLA 5T4FA 2ZJ7A 3STYA 1ZJ4A 3I1IA 2PSDA 1ISPA 1OILA 2ECFA 3M3DA 1DX4A 2QVBA 3PFCA 3VXKA 4N8DA 1FFAA 3WQHA 4BDSA 4J0JA 3AZOA 1NX9A 2C0PA 4Y2VA 3DD5A 2XT0A 1AQLA 4TGLA 4UFOA 5JAPA 4YK7A 2XUAA 4ROTA 4J0DA 2XUPA 5DWDA 4LXGA 3H2JA 1USWA 4QNNA 5AI5A 5ALSA 3K9BA 3JYHA 3WK5A 2Z8ZA 2GBIA 4U2EA 1GKKA 3STWA 3HXKA 1EDDA 1AKNA 1JU3A 1N1MA 5HK9A 1DTEA 2PU7A 1YA4A 5AI0A 1THTA 5AKGA 3I2KA 1QIEA 2AJBA 4C4ZA 4EY7A 1JU4A 4N8SA 1XZEA 1BN6A 4UHEA 4BVKA 2WLSA 1HKHA 1LPBB 4Y2UA 2G5PA 3ZLVA 4UBMA 4XVCA 1JJBA 4X92A 1XRPA 1ACJA 1QIIA 3FOBA 2XUJA 1HL7A 3AINA 2WUDA 3R3UA 4DYHA 2PSJA 3LIPA 1EHYA 5A7GA 4PV7A 1GGVA 4X71A 1R4ZA 1YAJA 1NU6A 3C43A 3WWCA 5KWIA 3WK7A 1WB4A 4Q82A 3O9MA 4DNFA 4UHHA 4FBMA 5AM1A 2HADA 4X7BA 2HDWA 1RP1A 5K3AA 4YASA 4JNCA 5LKRA 5I9IA 1XRQA 4KRYA 3AIMA 5JZ9A 5AHXA 1KU0A 4UHDA 4B81A 1KU6A 3CCCA 1VOTA 1XRRA 2QXTA 1ZIYA 5ALLA 2CKMA 4OU5A 4QLAA 5AO9A 5FKJA 5ALYA 3AJAA 4B9EA 4GDMA 3WK6A 4Q3OA 3GUUA 5C8ZA 2BGNA 3W04A 3SK0A 5HF8A 1IZ8A 3WZLA 1IZ7A 3WWPA 4AXBA 4EB0A 3DJYA 4AO8A 2HL6A 2WTNA 4AZ0A 2PPLA 5HK8A 1MTZA 4L9AA 2GBCA 1FJ2A 1ZOIA 7YASA 1HDEA 3FNBA 5JADA 5EIEA 1ZGBA 4KE8A 5E4TA 4FOLA 2WFMA 3LP5A 4PO3X 3ESAA 1K6EA 4BC0A 2CMFA 1YASA 1VE6A 4M0FA 5ALPA 1G4HA 4ZV9A 3PUIA 3H19A 1GPLA 5HF5A 1PFQA 3IUQA 2QS9A 2XLCA 2OLEA 2W22A 1LBTA 1LBSA 2JGIA 2CJPA 1AC5A 1NU8A 2QZPA 1MNAA 4X3CA 4MWTA 5K3EA 3AZQA 3WLAA 3P2MA 3N0TA 1Y37A 4AN0A 1MAHA 4CCYB 1PJAA 3U1TA 3KSRA 4U2FA 2VT7A 5DJ5A 2IIVA 2PUHA 3IBTA 1CUFA 3VVMA 1LPMA 5ISMA 4QWMA 2J3DA 2WIJA 4BDTA 1CUAA 3BF8A 5AI6A 1OCEA 2BJHA 1DWOA 2HHAA 1ZJ5A 1QFSA 4L0CA 3F96A 2XDWA 3C8DA 3EBLA 3G9XA 2WHQA 3SC2A 1FFEA 1UKBA 5D3ZA 3WK8A 4UBKA 4OB7A 1CUDA 3CN9A 3HEAA 3TGLA 3YASA 1CUVA 1N8SA 1ODCA 5FV4A 4RPCA 3GBSA 5JYCA 2G63A 3WIBA 2JGEA 3I6YA 5CT4A 3FSGD 3AIKA 1UOOA 3WA6A 4PSUA 4MJ3A 2VTVA 4QDOA 3D2AA 5C8XA 2DHDA 3BE8A 1CIJA 2ORYA 2XMDA 1XKTA 4Z49A 3OOSA 1DQZA 1B41A 3ZWQA 4JUIA 2DR0A 4AQDA 4HXEB 4BAGA 3ZLTA 2WSLA 3H2KA 1HLGA 1EX9A 2G4LA 1JKMA 2WIFA 3BDVA 4QE3A 3LCRA 5C8VA 3DDUA 3WJ2A 2YASA 5AKIA 5K5EA 4GW3A 1UK9A 3G8YA 3UUFA 3HRHA 2C5GA 4ZGBA 1GXSA 1K63A 4P9NA 5F4ZA 3DL4A 4MYDA 2OCKA 2ZYIA 4NVRA 3CCBA 4RGYA 2WFLB 4GHWA 5ALDA 5AKKA 3C6BA 2BUAA 3M83A 5KREA 4BCCA 3IULA 5AICA 3W9BA 1XZCA 2ROQA 1CPYA 2FX5A 1QOZA 4OB6A 4DLNA 1EA5A 2WTMA 5D6OA 4TPKA 2FUKA 3MUNA 5DNWA 4YX9A 4FFVA 5CURA 4X95A
chains in the Genus database with same CATH superfamily
3LUDA 2Y0DA 2FG5A 4XIJA 5AW9A 1Q3KA 1E2PA 2AN9A 1Z2AA 4Q7EA 1QHYA 2PLWA 1DX6A 3BWEA 1E7RA 3ZHTA 4C20A 4LRXA 2F3PA 2QP3A 3I2IA 3PXAA 2YYAA 4HAUA 3Q40A 3SMQA 4FLMA 2QSYA 5CD9A 2BONA 4IX1A 2O06A 2LCQA 5F76A 2M98A 1G20B 4KR9A 3ZCTA 4CMBA 3DBLB 1J39A 1XKLA 4HBGA 4QUHA 2GRAA 3T8YA 4F60A 4MGHA 2P0AA 3W8NA 4BECA 3R0XA 1ZCAA 3PEVA 4OO3A 4B2YA 1F2DA 4KYTA 1VLMA 5H3LA 3DMTC 2QMZA 2ANCA 2YWDA 4W7HA 1U0FA 2YTZA 3GP3A 3MT9A 4C05A 1OV6A 2CNWD 1COWD 1J2RA 3HYRA 5FFMA 4BN5A 2AFHA 3O4VA 4N01A 1E3DA 5BUSA 3DW3X 4LNUB 1P0QA 3KXIA 1L7NA 1RZRA 1T29A 4J29A 1O97D 3ABIA 4Q1DA 4DY6A 3EMDA 4BEBA 4D8WA 5CLLA 3P2EA 4O29A 5CCEA 5DBGA 1E1MA 3L5KA 3OMXA 3EQZA 1HTWA 3II6X 5ALKA 5J2UF 3FNQA 1VB3A 1NJGA 2GYVA 4EHKA 3AI1A 5LU8A 4D9MA 1QF7A 1IK4A 2ZG6A 1NZFA 4RQUA 2GEDA 4MUNA 2PT7A 4JVNA 5DM2A 1ZKDA 1ZNZA 3KEQA 3RVKA 1HQCA 4OHMA 2QVXX 1XD2A 3GJTA 1NVVQ 5KJCA 3IAAA 1TZKA 5K3FB 4FXOA 4ICIA 4F0JA 2XIQA 4QRIA 1XTUA 2P67A 4RS4A 3UENA 2JLYA 4BB9A 4IEEA 4REQA 2GBLC 1FFWA 1BXRB 1KPIA 3USZA 1NVVR 3QFFA 1JFVA 1USKA 3VHLB 3SBOA 3VPCA 3RRJA 3D81A 3IR6A 5IT5A 1MB9A 2H00A 3VR5H 2D0DA 4W8GA 5C5IA 2AZ4A 2FWIA 2WM9B 1OFUX 3KT0A 2IKQA 2J3KA 3BSFA 1JYFA 3PF9A 5FOVA 4P86A 1HDCA 2HGSA 1HFEL 1ZI6A 3EOZA 3ZZ1A 3T52A 4PAOA 5B2EA 1DV1A 2F3SA 2HSJA 2YZGA 4ZMSA 1VL0A 1RM4A 3WBBA 4CHGA 4EGSA 2NU9A 2B78A 3HEMA 2P9CA 2J7KA 1UZUA 1G3UA 3NGXA 2C98A 4LZLA 1CHDA 3UK2A 4RJTA 4OX9Y 1XR3A 1MDFA 1QE5A 2QP9X 2B0CA 2CE2X 1ENOA 3W1VA 2X7JA 4IOMA 3N39C 1SRRA 4GE3A 4C76A 1YBHA 2IEDA 3DR5A 1TJ5A 3DFZA 3N8NA 2VJMB 4UBLA 1SXQA 4X00A 4G1EB 4NHOA 1KQOA 4NMLA 1PT8A 4O4HA 5AJTA 5F2OA 1QH1B 2WJ4A 3ZK8A 4DYVA 3U6KA 4Z53A 3NOOA 3GH1A 3CUUA 5LA6F 4KSBA 1WSWA 1UAAA 3G17A 1PEKE 4ND8B 1HQDA 2PSSA 2A1IA 4TTAA 3ZQ4A 3NBFA 1WVGA 3DCYA 1P5ZB 3LSTA 4JQYA 1DHRA 1XZJA 3U31A 4BX0A 2JBAB 4FQ8A 3S2ZA 1TTQB 1E60A 2X9LA 1YB7A 3DTVA 4X84A 4Y7DA 4I4NA 1KI9A 2HLDA 2R5NA 2Y05A 2I3ZA 2P5SA 2X58A 4LC1A 4YRNA 3CLSC 4P1ZA 4PFKA 3B9QA 3GGOA 3ZU6A 4AUMA 4YR7A 3IO5A 4BV3A 2XEDA 4Z4IA 2FK8A 2JGLA 1G4AE 1ULBA 2V97A 3TMYA 1L7OA 2PGIA 3A6DA 3WGOA 2G4CA 1MQAA 2J07A 2B3DA 2H48A 2XNHA 1VJTA 2Q7XA 4ZT6A 1BJKA 2QMQA 3DM9B 4CV2A 1IYZA 4Q4LA 4TLEA 1RJWA 1WDWB 2X9VA 3N2KA 4YA6A 4BQFA 4OLAA 3SN6A 2VHVA 2YW2A 3IPCA 2F8SA 1N8TA 1OD6A 3ANXA 4MJ7A 3UMSA 1J24A 1PTJC 2GD2A 1IM2A 2HZ7A 1Y4ZA 3HWX1 1IDN1 4L3VA 1X39A 4NENA 3ZKWB 1T9BA 1TL7C 3LSYA 3MYRA 3WC4A 5SYAA 1D2NA 1TD9A 2IXEA 2QV7A 1W0JD 4C6HA 2VNJA 2W42A 4JQCA 4D6XA 1Y48E 5JBIA 2G77B 1GNVA 3M5PA 1UC9A 4G9EA 4W5RA 4JR1A 4FWBA 4ZO6A 1LRKA 2JLCA 2BISA 5BVHB 3B1VA 3EH1A 5EL0A 3DE0X 3NYIA 3EFEA 1A8UA 1JQEA 5KU7A 4G89A 2WIKA 3LDAA 4NE7A 4QT0A 2GZSA 2XMGA 5KEIA 2E82A 1IY8A 5KOJA 2CWDA 1FE8A 4HNTA 2IJGX 1P91A 3JQEA 2C8LA 3EG9B 3MLEA 3AW9A 4UU1A 1GU7A 1RC0A 2HFJA 3GEDA 1E3JA 3M5WA 3TRJA 4WY8A 5IEBA 2D2VA 3TCNA 4A73A 4LY9A 3CPEA 1G38A 3CO5A 3KD2A 1E1NA 1CS0A 4FGWA 1NXOA 3ITNA 4OI1A 3C1AA 1Q50A 4BMSA 3QMVA 4GUAA 2FZ4A 1NYRA 3ONFA 3IVGA 4BO9A 3OY2A 4JJKA 4L16A 4A03A 2O4UX 2P3OA 4L9WA 4CM9D 1JMYA 4EVRA 1S8OA 2HQRA 3AR7A 2Y1OA 3MTQA 3L4SO 2WQ6A 2G7MC 3DP9A 3KNZA 4RIHA 3CF6R 5KYWB 5K0NA 3TNDA 3IV7A 3M6MD 1D2MA 1NUTA 1RM5A 3RS0A 3A6PC 3SLKA 3AV0B 1NQUA 4LQLA 4AJ1A 5E6RA 3JQFA 2A1TS 2EJTA 1J97A 4QICA 3SZOA 4RV9A 5GP1A 4JJGA 4QYWA 3ZX4A 4OA8A 4F9GA 1M3SA 2ARKA 5F3WB 4UC0A 1QDEA 3N2LA 2FWJA 4KNWA 1VIYA 2X7XA 1ZK1A 3EIFA 3AJEA 1M6HA 2FH5B 3C1OA 3KAJA 4JKOA 4JLAA 4P08A 4CR7A 2YDYA 2ZDQA 4H6XA 1KS9A 4Z0TA 2EV9A 2C3OA 1S2GA 3EQ7A 4GWLA 2O3JA 2AR0A 3DOHA 1V2GA 4Q3KA 1L5VA 4JBIA 4NCJA 1GRNA 3VJMA 1K7SN 4MUEA 1O54A 4MGZR 4KPYA 2FEKA 4GG1A 4RORA 1R6UA 3RAFC 2O8DB 3VNVA 1MO2A 2V55B 4MV3A 3VR5A 1QM5A 3GLFE 1V8FA 4QBGB 3IILA 4CMJA 2MIIA 2DPHA 1ZPDA 1TK9A 1I2CA 3DP7A 4ZVMA 4BTVA 2JIRA 3N5KA 1U7UA 4IKPA 4ETMA 5IH7A 1E9EA 3CH7A 3LZ6A 2ON6A 1KIAA 3KQHA 2ZYWX 2R11A 4Q16A 5A04A 3F6RA 2A9FA 4LMAA 3VBEA 3F98A 2QL6A 4D9KA 2FW8A 3PICA 3VR3A 3Q2KA 4DA9A 1NVGA 1RJFA 3TFWA 3TLEA 2BF7A 3INNA 2J32A 1XDUA 9LDBA 1TQ6A 4BQEA 4ILKA 4QUKA 4BQOA 5JCOA 5TE9A 1PQPA 3DE1X 2XLBA 1F4VA 4RH0A 1UWCA 4C2TA 3FCAA 4YYEA 1UMBB 4HRAA 1VG1A 1PUIA 2I7VA 2IEAA 4JKIA 4MWEA 2D5LA 5CDFE 1A7UA 4HWGA 5CFQA 3LDUA 3H7IA 3EDRA 1EEHA 4YUAA 3NORA 3KKKA 1N9ZA 1XLWA 4G5SA 3K6JA 2W8BA 3K5WA 1B2LA 1Q1GA 1X7YA 3QUBA 4ZCSA 3IAS6 3OESA 4F84A 4CTNA 2LNDA 1T6XA 3TNJA 2LGJA 3F3KA 1FTGA 3X1ZA 4HDKB 3K0BA 2P8SA 2YYZA 3KB8A 1XZAA 1G8GA 4U0KA 1V4BA 2VK2A 5E9JA 2ZRIA 3AVQA 5UKDA 3M9XA 1E5LA 2Z6QA 2QTVB 1YJCA 1WXWA 4MHTA 1QBKC 2AEMA 4ZI5A 4HQKA 3D02A 1XPOA 3DDWA 1ZRHA 4FC7A 5TX7A 1DX9A 1E98A 2WTAA 2BRUA 2J5BA 3ZCVA 3N9IA 2CXPA 4P58A 4WVLA 4YN3A 2WFAA 5C8YB 3KQLA 1ULTA 3BK1A 3FFXA 2OP1A 3SICE 4D4KA 4BNFA 3BGVA 5LZ7A 2NNLD 3AP3A 3P2KA 4YJGA 2H06A 4CMEC 2D7CA 2LDBA 3R5FA 5FOUA 4F45A 2B21A 3H0CA 4NONA 4R1NA 1N2EA 1PR9A 1JAZA 2WRZA 3ETHA 4NHEA 1PP4A 3NG1A 1RI3A 4Y0AA 4LF8B 4R1PA 5GONF 4D57A 3G88A 2GN8A 3DS8A 4DR7B 1VG9B 3WGQA 3DDCA 4URXR 2JDIA 1FYXA 1TMYA 5FBKA 4J07A 1H9BA 1AKVA 1EFLA 2WY2D 5LOVB 3NJ8A 3OP4A 4MB0A 4IHJA 3R2JA 1T2EA 4JGIA 5C52B 2BFWA 2R4UA 2FWPA 1NRIA 2QTWB 1V48A 4U63A 4ZVTA 3TIFA 4W5NA 2IVFA 2OO5A 2Z6VA 3OZDA 3PE3A 4LOJA 1P4SA 4NZ9A 4Z8XA 5L6LB 5DNCA 2FAXA 1YQ9A 1TYEB 3H99A 4DF3A 2I9PA 4NATA 1H5UA 3H0EA 4NZOA 2RJ3A 3F67A 2GOYA 4OI0A 3Q15C 2VOJA 4DC0A 4AMBA 3CKLA 3R8XA 1BEZA 4EHHA 3V7UA 2QG4A 1JI0A 5GPBA 3MQFA 2EZ4A 5AKEA 3KHTA 4DNQA 2OQVA 4K6OA 3E18A 3ZDXB 4JNKA 2HOQA 3TD6A 3VJRA 1FLVA 3AUTA 4KMOA 1TKRA 7REQB 4QUIA 5DSTA 2ATCA 2C5HA 5DRTA 1AXGA 5AHRA 4X8HA 4AG3A 3E7WA 1YJ5A 4BNLA 1SZJG 4MUAA 3VYTB 1Q2UA 3CUEF 2PUBA 2G06A 2ZBVA 3ZDYB 4AC9A 2ZCVA 1TK3A 1B8NA 4BKOA 1R00A 3FOCA 2ZYHA 4RS3A 1I7NA 4MVJM 4RGQA 5JNTA 2CV0A 3HR7A 2O8FB 3D4NA 1IBKB 1NBMA 1U2DA 3WISA 4B3HA 2W0MA 5ULLA 3I9FA 4MR8A 5B4TA 1SXJE 3NYRA 3W05A 1CRWG 4DA8A 5DV9A 4F93B 3C3EA 3H1AA 1CETA 1RXUA 1LTKA 4J2OA 5DIZA 3ZE6A 1Z45A 1HE3A 4S04A 1ITZA 2Y6UA 3EPRA 2JD2A 2Q1XA 2WJWA 2ZZNA 2EGUA 4PLVA 4ZDJA 3EJ6A 4KFUA 5AK4A 3QVXA 4YR9A 5C1PA 3A2LA 5H0IA 2GB4A 2ES4A 3LCMA 4MCAA 3K2QA 4URYR 3CO0S 5AW8A 2QGFA 1OH6A 3TUIC 3PGVA 3ZOZA 2IZZA 2CCGA 2TMGA 1R4NA 1Y7LA 2ODNA 4PHHA 1M1YE 1E5DA 2O3UA 4BO7A 4OQQA 2QZ9A 3QBDA 3LLVA 4JJIA 4BRSA 4HFJA 4EUSA 4ENQA 4H4DA 5DEIA 3O8RA 3ZI0A 2NO0A 3ASZA 5EUQB 2D0IA 3RGWS 4B45A 4E32A 4G25A 1W73A 4BE4A 3B48A 5K8CA 1T8WA 4X1IA 621PA 4LJ8A 2J8ZA 1SEPA 2TMYA 3VR1A 3AEZA 1CB0A 5GJCA 4TRMA 4JHXA 3CF4G 2OCBA 4CLHA 1MC8A 2Q5QA 1K8YB 2ECQA 2V98A 4CMAA 4UPVA 5HRUA 3JD4A 2ZJ6A 1X42A 3K09A 5A5DA 1W87A 4NJMA 3WLEA 4Y67A 1SUFA 1Z8DA 1YRAA 3VA7A 3OZAA 3C7KA 1GA6A 1NNI1 1ZGGA 3NBYC 5FAXA 2AMLA 3I6ZA 4MUMA 2IZ0A 4QT4A 1J25A 1CUIA 2IF2A 1R12A 3JVIA 4G09A 4JP2A 4B3RB 3NH9A 1SCUA 5HKKD 1NVXQ 1A72A 1J2UA 3NJ4A 3SDBA 4V1CA 3B9RA 4XJVA 2H7YA 5EXDA 5HILA 1PNVA 1ZJ6A 5D2CA 6ABPA 2A58A 2E7ZA 2X19A 4KIGA 5C7OO 4GMHA 5AI4A 5FQOA 5B36A 3IP8A 1E8DA 5DBIA 2ZWAA 1NQXA 4DCOA 1O94D 2OORC 2O5EA 1WKVA 1CQWA 5EQTA 4F38A 2FPMA 4AJJA 2CUKA 4M2LA 1OBVA 3IO3A 3HFRA 4S0ZA 3VU1A 1HMYA 1KYXA 4F2DA 4CGZA 2ERYA 5KX5A 3VDMA 4LDAA 2G70A 2V65A 3LRPA 1KGDA 2COKA 4K9NA 1K7FB 3X43A 1GLGA 2C7OA 1JS1X 3R0VA 1XVAA 4DV4B 2W2LA 4J1TC 5DZSA 5AK6A 1TDJA 2QU7A 4L6IA 1J8MF 2C4TA 2LZ0A 3B1XA 4ACBA 4AMUA 4DRXA 1RPZA 2IYTA 1S2MA 2HJWA 2F1JA 3RYFB 2LWIA 3OX3A 1JR6A 2AR9A 3R77A 3LBNA 4ZFNA 2O2SA 3VTAA 3MHTA 3BHNA 4RF4A 4WLFA 2DY1A 4J0CA 2I4OA 3FZEA 4KSYA 4RFSA 1KHHA 5I9BA 5KOHB 2O2GA 3DPIA 4NICA 4ZI7F 2Z5VA 3I6MA 1A76A 1RCFA 1PS8A 1RSZA 3HBFA 4I2VA 4FYMA 4EI7A 3ZXYA 3JYLA 1CR4A 1N2CE 3MWKA 3OCYA 5K0CA 3OECA 1I8TA 3N0XA 3HEBA 4ARZB 1ZR2A 4M1SA 1CD5A 2F48A 4LE0A 4Y0VA 1RWXA 1MV8A 4MUHA 4WKBA 3SC2B 2ZJ0A 3G68A 2GKOA 3LUPA 3PXCX 1M0WA 1YMQA 5DM60 4HRYA 4Q3AA 5D5QA 3T9EA 1QFMA 4NMMA 2I78A 3KVVA 1O8BA 2ECPA 2KMLA 2ZUTA 3GGJA 3M6AA 3C3DA 5HQ3A 4F3YA 1W5FA 1W4AA 4TOIA 4UTOA 2LKDA 5AK3A 1YNSA 2FX2A 1JDZA 1QB7A 2AWNA 4C29A 4HB4A 2BGGA 1TT5A 2CL6X 5SZJA 1B26A 3I2GA 2BOVA 1GU1A 3S99A 1YA8A 4H7HA 2P2YA 2EDCA 5I5GA 3GN2A 3OLCX 5GAJA 5JD6A 1HDZA 2QMHA 1PL0A 1YZLA 4B9AA 3K32A 3FYTA 1A3CA 4DMGA 4I8XA 3FDFA 3IEIA 3O2NA 4HNSA 4DM4A 4E70A 2ZUFA 2FN3A 1QF6A 4QSMA 4XIFA 1FU4A 1WSBA 4OOFA 1EESA 3M5DA 1K92A 4BNTA 2O54A 1U65A 2F67A 2YMMA 5LQSA 3RU3A 1A8QA 2YVQA 2G9UA 1N6KA 3BJEA 5KAMA 3GMTA 4BMDA 4EYEA 4X62B 3VO8A 4OHYA 5C7YA 1G9TA 4ZRDA 5A05A 2YXBA 1E1RD 4CQMD 3BREA 2XNSA 2DGDA 3LPNA 1HFKA 4W6ZA 2HRDA 1NOIA 4UHBA 3TX6A 5HF9A 3DXZA 1P9RA 1TCBA 3MWDB 4MHOA 5EZYF 3O9ZA 1PQUA 3FVVA 2OBYA 2V58A 5JCJD 3D6UA 3LF1A 1I2BA 2XTMA 1EVQA 1YI0A 2BEVA 5FBQB 5MF6A 1RPTA 4L8VA 5FDFA 1Z13A 2IKSA 2O8NA 2Z2ZA 4OYRA 3CLHA 4L6CA 3V1KA 4GC9A 4D4JA 1I1NA 2I5PO 3NNSA 4OXKA 1QIKA 1FIUA 3V48A 1IK6A 1QC5B 4WWHA 2ZVQX 1U1EA 1FUEA 3PRYA 3Q7IA 4RZIA 5DGXA 1RKQA 5IC5A 2Q5EA 3CNHA 3DAOA 1EIZA 3N8DA 3NM5A 4WNCA 4ZHQF 5ALHA 3NANA 3PZBA 5JIBA 3IBYA 4XB2A 3SJUA 4TL8A 1O95D 3NKVA 1KQPA 5ALMA 3W8FA 3BAZA 1QR2A 5AVQA 5LLTA 5DOVA 2JLUA 2M1XA 3FTFA 4IOKA 1Z37A 1QTRA 2XIJA 2BI4A 1Y8RB 3JR7A 3OA0A 3G0IA 3WDMA 4R83A 4WFQA 5GWXA 3WBFA 4GOJA 2ZUUA 3E5MA 4RKWA 4C2UA 2P5TB 3TFQA 1FJHA 1V8OA 5EHZA 2PWAA 3G7SA 1AKMA 2ZI3A 1PBNA 2IHJA 3CN7A 4JAVC 1TUBB 2IYYA 2CXUA 2V7QD 4HT3B 3GD5A 5JAIA 1BE8A 2ZAIA 4I7EA 3TOCA 1KTIA 3SJ7A 2OHHA 5KNBH 2F1HA 1DT3A 1VL1A 1GD1O 2WVHA 3AM3A 1SN7A 4LGCA 3V7YA 3EXAA 4GGMX 5L7YA 1KYQA 2X0NA 4O2BB 4DHWA 4KOEC 2JAQA 4E11A 2C4HA 5IT4A 1MQ9A 1T24A 1R1DA 2ZAOA 3K8OE 3PJFA 3GNTA 4HXYA 1FP1D 5I9SA 1TYDE 3W06A 3EE6A 4HRXA 4MVWA 1M75A 1SM4A 3DZCA 4X20A 3ITEA 3JD3A 4L95C 4GKKB 3QELB 3SR4A 4FDMA 4YXWD 4DUYB 1PLKA 3AG5A 4W5HA 4DJAA 4RK6A 4LBYA 1F2UA 3ROKA 1NV8A 5CT9A 1MG5A 3ZIAA 3ZJUA 1NR1A 3MSCA 5DX8A 3IUYA 4EGFA 3RUDA 3AI7A 1KEVA 5K2MA 4HVCA 1E7SA 3EUFA 1ZOOA 5IC4A 4K28A 3PWTA 4MW5A 3C6MA 5K3DA 4ZXFA 3PUVA 3W6NA 5FUVA 5FA5A 2GQ0A 5D86A 5IZCC 3H42B 1Y5IA 3FNEA 3LMKA 3SS8A 2OKGA 4IAOA 4PZUA 4WD3A 2O8EA 5DNEA 5HZKA 3UEOA 2GMWA 3DFKA 1G0NA 1SCDA 4DNPA 1BU8A 1FXSA 4M83A 3AONB 3AHDA 3HKEB 1MW8X 4YC7A 3LM8A 1A04A 4QPPA 5IDVA 1SVMA 3WL6A 3GRRA 3AY6A 4BTEA 2WZBA 1P7CA 2ZRCA 5F12A 3HBMA 3HZRA 5CNIA 4CG0A 2TS1A 5KJ6A 2XRMA 3O8NA 3UK0A 1AMOA 2OLKA 5DM70 3R7FA 2IYPA 2QJRA 3LQQA 5BV8A 2OC9A 4G3XA 2DECA 2ZDGA 1BN7A 1IN1A 3PFKA 3MJHA 1KERA 2ET6A 4XUCA 3K1AB 4PSKA 2OP0A 3I4LA 1Z2PX 3ZWYA 1VHLA 3AFIA 3PKZA 4RTQA 1GA1A 1IWBB 4OUKX 2GDZA 4IF6A 5A3SA 1D7AA 3TTXA 2H4YA 3D0RA 4AS1A 2YHSA 3L8HA 3BT7A 3E9YA 1DELA 2E49A 2P6PA 4ZVLA 1EEXB 1ZMOA 4RPGA 5IWCA 4I4CA 1X3SA 5IK2A 3RYHB 4CR6A 3AFHA 1MIOB 1SRQA 3OJXA 2C96A 1MR3F 4P84A 2HPAA 3M6UA 3Q72A 4YRFA 3NC0C 3O82A 3GMDA 5ALJA 4TUYB 2HA5A 4CKBA 3KFLA 4ZYVA 2PMBA 2BFOA 2QD4A 3MGGA 1P2SA 1ECJA 1YD7A 2VHZA 3S1AA 4PNEA 3F9IA 4KU4A 1N36B 2RIRA 2IYQA 5DGTA 2R60A 1EVIA 1SCKA 1N2XA 5B3JC 2AT1A 3BAFA 4GVLA 3LF2A 4JXKA 2HJVA 4JJ8A 1DRUA 4RJLA 3ZWNA 3FVWA 3H11B 5CP8A 4IYJA 1SUAA 3VGJA 2XQIA 1XCOA 4N7RA 5EJEA 4YH1A 2VHCA 1MO6A 2QN7A 2UZIR 1FW6A 3R7AA 4BHTA 2VDWA 2Q6TA 3UQYS 2RAFA 1UQTA 5ARDA 4MUXA 1Y3FE 3L8DA 4W99A 3TW8B 5AMXA 4BXOA 1P6UA 1J06A 2LE0A 2V0GA 2PRYA 1J56A 1JR3D 4MPPA 1T5OA 5EERA 4ZU3A 3FKQA 4IS2A 1C1DA 1UFOA 1VZ2A 2J5XA 2X8LA 3AOEA 3OOHA 1G3MA 3GJZA 4FX5A 4KKVA 4OAPA 4GMDA 4O4HF 5A2GA 2C5LA 3GA0A 1L4MA 4U5XA 5BQ3A 2FPKA 3KR1A 1CQZA 3PNVA 4QDKA 4URUR 4G1FA 1H5QA 1I1OA 2UKDA 1Z38A 3A1WA 3LWNA 1H0RA 4N9WA 4P7FA 1XC7A 4UBIA 4R40A 1XHLA 4LY0A 3RPEA 1EU1A 1VGQA 4LY3A 3ZHCA 2VYVD 4EX7A 1MPTA 2DBRA 3HVHA 1HT3A 2BH9A 3TLCA 2HWYA 4KNYA 2Q3FA 3GLIE 2Z04A 4LJLA 1V5FA 4TYMA 3GCDA 4LTDA 4PLCA 1N0UA 2O2XA 1KJQA 3QE3A 3SHWA 1G3IA 2X4IA 3A4VA 4UATA 1M33A 4ADSG 3Q9LA 2Q5LA 4RIIA 3FYSA 4PGHA 5JE8A 3K1TA 1XYVA 3OZBA 4UUQA 3V1MA 3CUKA 2HUNA 1ZIDA 2RC5A 3PC2A 2F8TA 3UHAA 1YB4A 5JEDA 1TVEA 4DABA 4AAYA 3GCWA 2WWRA 1J22A 1BOFA 4AL4A 4F6LA 2C2GA 16PKA 5KNBA 4HX9A 2V3VA 2PH3A 1DAKA 3N5CA 2VCEA 3P45A 4I5DA 2IRWA 4PZLA 4HDCA 3V4ZA 4FT4A 4B87A 4CIVA 2Q0QA 5ELLA 3TKYA 1A9TA 1EE9A 1BFDA 3IDQA 4NU0A 4RA6B 5HKLA 3WYDA 5L45A 1GAQA 1A7KA 3FNGA 1TC1A 1XTTA 4CEHB 2HQBA 4PYLA 1BH2A 1Y8QA 1U9CA 3EB9A 4N6GA 3SM3A 2OCIA 2H29A 3HVRA 2JIMA 3TDKA 4OBWA 1UF9A 3R3WA 1Z06A 2Q1YA 3R40A 5CPBA 4RLFA 4RGBA 4MP8A 4UHKA 1DWUA 2AVDA 5IDXA 2VJBA 2H9IA 1LX6A 1GPNA 5F33A 3ES9A 2PT9A 3ANMA 3EEIA 1DAEA 3ZTYA 4ZP1A 2JATA 1GQOA 2PZLA 7MHTA 1FY2A 3ZBTA 4DNOA 5D5HA 5KYKA 4EQ6B 1TCCA 4HN4B 4LFCB 1XEWX 1GZ5A 4BZXA 2ZI7A 5BSFA 2WU1A 4TLAA 3DZBA 2K2QB 1Q77A 2ZYRA 5D7NA 1RRVA 2QORA 5B53A 3K1JA 5LYJB 3WRXA 2JI6A 4Q3DA 3GZNA 1GGEA 1NQAO 4HB0A 3AUKA 4QFBA 1SD1A 3CF0A 5FOXA 2SCUA 3ZZ0A 2WJJA 4YIKA 1IIRA 2ZAGA 4UUBA 1NT4A 1SKYE 2P65A 4EOGA 1XRSB 2Q4TA 1P31A 4IQ4A 4C1BA 5K03A 4O4LA 4EPRA 4K8RB 3DVSX 2CHFA 2PFKA 3LYUA 1X2EA 3DCJA 5TEVA 4BPRA 1T43A 4DLPA 2XXAA 2XYVA 1CQJB 3F6EX 4YQFA 4LJ4A 1RS0A 3ZWWA 3I9LA 4KEAA 1SXHA 1V1MB 3PUJA 5F4BA 3VTKA 4ZDIA 1UUFA 3G1UA 1Z83A 4BX2A 4BVLA 1Y4AE 1Z5WA 4ZQFA 5TQ2B 3UAZA 5HUQA 4U2CA 1E63A 1ODIA 2CY0A 1ZWKA 3D59A 3KC2A 2C5EA 3AYXB 1M2FA 4TN5A 1DKLA 3C1TA 4BVAA 4C03A 3T5BA 1NUUA 2ZGVA 1HEIA 3KYDB 2PFGA 1DJNA 3QKSA 3VHXA 4CV0A 1FQWA 1QO7A 2QZSA 4HNQA 4B3IA 1YXMA 1ORDA 1DFHA 2HZBA 3TEJA 5BXQC 4BB6A 5A0TA 5FHRA 3I53A 1XDBA 2XUKA 4HQOA 3GFTA 3RS2A 2XUDA 3GLRA 1I7LA 1NVBA 3OVMA 4RYDA 4HF7A 4A6DA 4ER6A 4DLAA 3QM1A 3GRFA 1BXGB 4IVQA 3RARA 5JYDA 4D3XA 2QRZA 2ZITA 3LUKA 5JQWA 5G41A 4M1KA 1FPMA 2JEYA 4E2YA 5K6AA 3ZHQA 1EWTA 1F0NA 3FGNA 2Q7DA 1XRLA 1PZGA 1P5FA 1PBTA 1QYDA 1F2TB 1Z3IX 2XSZA 3AVPA 2DVMA 2FEPA 1QZUA 3DF9A 3O93A 4IO1A 4Z3DA 4MVJE 4NEGA 5LDDC 4ZCMA 2Q41A 4G63A 3DEZA 2ERXA 5CFPA 4K6FA 3EGXB 3V1YA 1CUJA 1XTRA 2YOGA 3RVNA 1Z73A 4H2DA 4DMHA 3E3AA 2EQ5A 2W6MA 1YR6A 2QL5A 1F0KA 2JIBA 3FUUA 1O89A 1YE3A 2W2VA 5ALNA 1UXHA 5IC6A 1KMHB 1HH4A 1XEAA 2IOYA 4MEJA 4R2JA 1GZ4A 1E89A 4DGQA 1OB5A 1W47A 4LSGA 3VR6D 3UV3A 3OQ1A 3G5UA 4O4IA 4GL4A 4UEWA 2VKQA 2IK8A 1U02A 1N2SA 2OK8A 2Q9CA 3OU7A 1E8NA 1PR6A 2ZTHA 1PHRA 1KY5A 1S6YA 2X8JB 1XROA 2XMSA 3H5WA 4M0KA 3GT4A 1VXOA 3I04A 2VWHA 2CLIB 5CYOA 4BP1A 1A71A 1C9JA 1DIGA 2NIPA 4U2GA 2GM9A 1J7JA 1K7EB 3R7SA 5ADUS 1FFDA 4G0WA 2QU8A 3IPAA 2RHWA 1E1CB 1DTWA 4C87A 2GZDA 1OXTA 3UQZA 2ZIZA 4DANA 3W3AH 3E1KA 2PMFA 1UJNA 4F72A 3P4YA 4JVOA 3OUUA 4P92A 2ID4A 3KLNA 3NDPA 4YCMA 2QQEA 4FE4A 4LI3X 3RW9A 3VU9A 3JRWA 5CLJA 2A78A 1GVNB 5CX1A 2Y0EA 2XE8A 5DEOA 4K9KA 2FW0A 5TNXA 3CVXA 1FS4A 4UNNA 3ZY5A 4Q7MB 3B1YA 3WLRA 4HDMA 1EFAA 4XX0B 4L0DA 4IVRA 2D00A 4MUJA 5DLEA 1L5NA 4Q9LA 4BV2A 2DWQA 5EWMB 3IMGA 2JJ2D 2JIDA 4B6EA 5C1DA 1BQ3A 2N1BA 3K05A 4XJTA 1ZI8A 2BDEA 4JB0A 5L4LA 1XUOA 1Y1QA 1CBUA 1NKTA 5CVUA 3IQGX 3LPMA 1JLLB 1W2GA 2DHEA 3MTJA 4JJFA 5DU2A 1EG7A 4JLWA 5GY7A 4YRAA 1VYHA 2WSYB 1CP3A 2EHJA 3WIUA 3HJNA 2JZCA 4MW0A 2G9NA 3VPAA 3NM6B 1E0KA 3TW0A 1U8ZA 4J03A 5F51A 1ZLXA 2VCYA 3TSYA 1N6RA 3HV2A 4ENVA 1PK8A 2I8CA 1UBKS 3L0PA 4LZPA 5IEJA 5LR6A 4KO1S 5HOQA 5DYNA 4WGFA 5CRIA 1XX6A 5K20A 2E4VA 2AEFA 2FP4A 2YJ5A 2BR3A 1NN3A 1N7IA 5C46F 2I4NA 3E9ZA 4WFIA 5FI5A 4M9XA 3A0UA 5LQUA 4G81A 2IWRA 3U81A 4E13A 4YP7A 3TTSA 2JFNA 2OG1A 1NOJA 2Q9UA 4J0IA 2FJ0A 4J91A 3K6SA 1YUMA 1DIAA 4GEGA 1NBIA 2DOKA 1XKXA 5EKSA 1NZJA 3SIWA 3DBHB 4KXFB 4LISA 1XXHA 2GHTA 4TV8A 1GV0A 1X7GA 4GOMD 4UMFA 4TMYA 4BQIA 1GQSA 3KJNA 4Z8YA 3R4CA 4KXYA 1CY2A 4B83A 2VBGA 2XADA 5HCIA 3Q4GA 4RLSA 3P9KA 4PAGA 2QE6A 3PTAA 4JLOA 1YQUA 2WINI 2YZNA 2W83A 2IYWA 4FLEA 3SY8A 3FOEC 1OLUA 3ZTTA 3WMGA 2O2DA 3MW8A 5I6DA 4RTKA 1IB6A 3V6LA 2MSLA 1QGUB 4H77A 3EGIA 4IIHA 1AF4A 1SCQA 2BIFA 5J5VA 2JS7A 3PUZA 3WOVA 5ALFA 3ZZTA 1RYZA 4XWGA 2J4CA 3QLJA 3CZQA 1FDRA 1MRZA 1FDTA 1ULAA 4YRDA 2HQ1A 3V9PA 4EO9A 2B9VA 5IYZA 2KB0A 3HN6A 3NPMA 3UTCA 3CMCO 4LGYA 1F60A 5DWQA 2H65A 4YREA 3ZV3A 3ZDEA 5AI8A 1SG9A 2VHYA 1HLFA 3D6NB 3KOYA 3I9NA 1UDAA 3RJTA 2P40A 3TEFA 4FI3C 2OGUA 4H9GA 5H80A 4MV1A 4ZHSA 2QJTA 5LB2A 1R50A 1UBEA 2NSLA 4AY4A 2IPMA 1JQLB 2GBPA 3H4TA 3PYXA 4WXPA 1AZWA 3LJKA 1FDOA 1X3LA 1VM6A 1WB6A 3FPGA 4U0JA 2YQZA 2A30A 4X1YB 4G0ZA 4ZYWA 3EQ8A 4MAFA 5ITZA 4MGIR 2XRZA 4JI0B 1RCUA 1IJKA 5EIOA 4JS0A 3TCKA 1DEKA 2BKLA 5U9CA 5E3IA 2GAJA 4FFBB 2C5AA 1ML4A 1EE2A 1OLSA 2O52A 4G07A 3OQIA 5ENDA 5H5JA 1NJ8A 3K6RA 2ZYDA 3WB2A 2JC3A 1RQPA 4INJA 2NSHA 5CR9A 3STHA 3NIDB 4O02B 4C6SA 1I3OA 1BE6A 3TZEA 3WB0A 2VVTA 4KPEC 4V0KA 3VH3A 1Q11A 1Z56C 1C7FA 1QQ5A 2HEIA 1KK1A 3I0ZA 1AE1A 1G2OA 1Q0RA 2OO7A 3BD6A 4JC8A 2VXYA 1WF3A 1Z4NA 4RTLA 2J3EA 3FCSB 3G79A 3HL0A 4ZCPA 4M87A 3UZUA 3DOIA 3ZU2A 3NOQA 1QSGA 4OBBA 4QG3A 3BEDA 2HHCA 5A5GA 2GEKA 4I0WB 3LXUX 1EBFA 3BTVA 2FSUA 4H0FA 1BFKA 4H7DA 1FFHA 1RU3A 3G59A 2XGOA 3DQPA 2Q7OE 3EXFA 4F7WA 4S1WA 2EFCB 1QQTA 4HRVA 4KI7A 3ZQJA 2P7IA 1H1LB 4G8CA 3TJZA 1C9NA 1Q20A 3FGZA 4G0XA 3LLUA 4FP9A 2WWFA 4TMZA 3HO6A 3CURA 1AS3A 1R16A 3I52A 5JDCA 2O8BB 1RKVA 1GZ7A 1AV7A 3FCEA 4HZIA 1VQ1A 3W2HA 1II0A 1CW2B 3PEUA 4UUNA 2EGHA 2GNAA 4EVQA 3W3AA 1ZRNA 3T1NA 3O2QB 2XAAA 3ZGXA 4C30A 3EVFA 3WV4A 2IX3A 3TG2A 1UZNA 3RRBA 2Q3EA 1K3TA 4UMDA 1XLTC 1U9YA 4FEGA 4ZEXA 4AYTA 5I01A 3F2VA 4RY2A 3FNIA 5D87A 1P29A 3FCXA 1CZHA 2GEVA 4M9ZA 1VBKA 5DP2A 2GNPA 1Q1BA 2FTKE 3D6MA 1SUWA 2AI3A 2ZBFA 1SZDA 3CS3A 1JSRA 221PA 4WCFC 3O4JA 5CBPB 3N6XA 4FEYA 4KQFA 2NTJA 1T9DA 3E5HA 5B55A 2FW9A 1K27A 3KLBA 1U98A 3BXEA 5D6NA 3BRQA 4Q4HB 3HDQA 4U6NA 2GCEA 5KCMA 1OYOA 2M6KA 4N39A 2L42A 1F6DA 2PMCA 4EZEA 1UPAA 4GP6A 3IXQA 1E5XA 1Y9ZA 3MUEA 3AJ9A 5K4HA 1SVUA 2RARA 3PP8A 2C2ZA 3CJTA 4KE6A 4ZO4A 3RU9A 1I94B 1E6UA 2CB0A 4RDCA 1YZYA 3C3PA 2PAAA 1OYVA 1QVVA 1TF5A 2F43A 3BJMA 2RBEA 3I09A 3PDCA 4N3NA 3SYKA 3TVYA 4G4SO 1AQIA 2E4YA 1YB2A 4AG5A 1C41A 4ZV4A 1YS9A 3RS7A 4A6EA 3F5SA 3M7IA 3QYJA 1UDWA 2C2WA 3W6UA 1OAKA 4AS3A 4Z4EA 4E21A 2X5NA 1PIWA 4ALMA 3QU9A 1HDYA 1WR8A 3QFRA 5BWLA 1BDBA 5LWQA 4Q3EA 2GZMA 4B43A 3OZSA 3UG6A 1Z6XA 3U7FB 1Y8ZA 3VC2A 1TQ2A 2CNWA 1UK6A 1COWA 1JG7A 1ODSA 2FJUA 2NACA 4FHFA 1K7XB 1NI4A 2O8VA 3BB3A 1JIXA 2OVFA 3OI7A 4RZQA 4ZOLF 2AQ8A 5FA6A 3T9AA 1CLEA 2BBOA 1OQAA 3UB2A 3AUXA 1H2WA 1ZGAA 1MJFA 3MHPA 1ZK0A 4HGOA 3DTNA 4IUDS 2QL7A 3BRSA 4NQZA 4NTZA 5AOBA 5F1KA 5JAHA 3RYCB 3GFOA 1JDJA 4TZTA 4PW0A 3R7BA 1TQDA 2B4TO 4AFNA 3H75A 1MB3A 2ZI4A 521PA 2UZ1A 3LNCA 4H59A 1YE5A 5EZ6B 4JYBA 2P9EA 1RMYA 1G2PA 3BZUA 3NHBA 4TS4A 3SYRA 4AJNA 2FMKA 1TM1E 3BC1A 4YBZA 3SQDA 4YP1A 1E0AA 3IMFA 2FE1A 2XPCA 4I3GA 5IKXA 3P27A 2EGGA 2Y71A 3QU2A 4L2IB 5KQSA 2DETA 4O63O 3G85A 3H9EO 2V9CA 4KMMA 1W2WB 5ELMA 4YAWA 3JZAA 2WF8A 3WMWA 3OD1A 4Q24A 5EWLB 5A9SA 4JBWA 4WIAA 1TRHA 1XCGB 4P35A 1HZJA 4RA9B 4RBNA 4PTLA 4MQMA 2G07A 3NBKA 2LXNA 3HPRA 2XHEA 2RHCA 3KPYA 2FI1A 1DE0A 1ORRA 4QD3A 4TQ9A 1RAIA 1M0SA 2FZEA 4H7EA 5G4KA 4CTKA 4E4TA 4EYSA 2O48X 4UPDA 2FRVA 1GQYA 1P80A 1QMPA 1V47A 3I0NA 3IAEA 4PPGA 1Z29A 4QGFA 3RS8A 4WBNB 3GUYA 4UXJA 1R88A 4ENUA 4DEYA 2PRJA 3U13A 4PX5A 3OFND 3SU8A 3WNCA 2YIVX 3EIUA 3IHLA 4DJ5X 1U1FA 2R8BA 2RGXA 3OO1A 3WK9A 2V4ZA 1NT2A 1IEVA 3NATA 3PHJA 2B0JA 4P6VF 4I50B 4ZYZA 5L8VA 1Q57A 4X1OA 2Y1EA 5EZQA 5KSPA 4WUTA 2XB8A 4YQEA 1YVPA 2V0NA 1G8MA 1QAMA 1VCNA 5FNVA 4C4SA 3OSUA 4M9SA 4JB3A 4ZA2A 3GJ3A 1WABA 3NO4A 4N76A 1KBQA 2O59A 1A8HA 1W4ZA 2D4HA 2XVAA 3IXLA 5BT8A 1SBHA 2XA9A 1FLNA 2C4NA 2C97A 2ZUBA 5ECYA 1PX2A 2NXNA 4BNDB 3WHLA 3QK7A 3AERA 1ZMXA 2BTOA 1L3CA 3C3KA 3HKCA 4W5WA 2YMQA 2C78A 1IL0A 4YJFB 3GNLA 3THYB 3R8CA 2W70A 3R1IA 1NRJB 1Z74A 2X22A 1KXZA 3MGAA 1W88B 4YUVA 3EY9A 5FQNA 2Q50A 1S2OA 3OC0A 3PPXA 3MPOA 1NW3A 2WHYA 3BFXA 5KAPA 3NWJA 3PR2B 3AL2A 3FYUC 3IR7A 3HM2A 2GHQA 4DQKA 2XMRA 2HBYA 3FZGA 4OFXA 2OZVA 1QRTA 4I9FA 5KOIA 2YIJA 3NDBB 9MHTA 2PQ6A 1JYEA 2KS6A 2Y4OA 3V6MA 1PLLA 4ZV7A 2FFBA 2HH9A 3LKVA 3V4PB 5KOYA 3IGFA 5A1JA 5JNWA 1BQEA 4V24A 2BJVA 4AWXA 4HHEA 5IBQA 3QSYA 3L8CA 1KVTA 1PKEA 2WUFA 4KR0A 1XZDA 3A2MA 1OOEA 2NZJA 3KJEA 2ZUWA 2NWQA 1PRYA 3HO8A 4OQXA 2WSIA 3GIDA 1Z0UA 2BBTA 2VDVE 1C2TA 3U61B 1RPJA 1W0JA 1RLTA 3IB6A 1WJGA 3E3NA 1X7DA 1L5GB 4B40A 4C4YA 2BP7A 3TBHA 1JJ7A 1SIUA 1YU9A 3OKFA 4OKIA 3VH4A 3AM1A 4OXIA 1GSHA 3BGOS 1HFJA 3F71A 4A6PA 1Y1PA 2H4WA 4NCKA 1X8KA 3TGWA 1O9GA 4OHPA 1GPBA 3J7TA 2G17A 4FHDA 3SVTA 4L5IA 5JYBA 3K4HA 1N57A 4H3VA 3E2PA 2EFGA 5DLPA 5AQ1A 2VQDA 3W6PA 3KJHA 4JITA 2A9KA 1P3Y1 3R76A 2VDUE 3DMRA 1PFYA 2ZWOA 2AVNA 3H8SA 3QHQA 3GDFA 4OD0A 4OYYA 1K6XA 5DXAA 3HWRA 2V7EA 2DU8A 2NX2A 3B82A 2AQKA 3OZIA 3C3AA 3QBEA 3H18A 4D8VA 3A6ZA 5BOSA 3FLEA 3NUZA 5K0FA 3LD9A 3USCS 5JPDA 3UKDA 4EJ6A 4QYSA 4HX2A 4RK4A 1QHFA 4B4VA 1NSFA 1ZD5A 5ILQA 2H59A 5D84A 4CM9A 2OHFA 5AVXA 3ROPA 3HFSA 2PMKA 2QTFA 1ADCA 3JARA 3BTOA 3K2IA 3KYCB 5FTNA 5FYDA 2NM0A 5JSZA 2R87A 4LE2A 2NVWA 3UPTA 1I0ZA 1P5RA 1TCAA 2ORWA 1TO1E 3MGCA 4EZIA 1CVLA 3KLMX 2ZIAA 5IDQA 1L5RA 2ZRDA 5LQJA 3ZH9B 3EXIB 5HHTA 4DR5B 2QEQA 2AN4A 3IDAA 1Y5MA 3JR3A 1HYBA 3U4IA 5BW4A 1SQ0A 1WY7A 4G5RA 4IFEA 5BPFA 1NYTA 4XVQA 5J5CA 2VDOB 3LC0A 4ETWA 1XEXA 4MRMB 4RDXA 2VWQA 4R2MA 2Z58A 1M7GA 4XR9A 4B8WA 5GZ3A 1AM4D 4HEA6 3RI3A 1B43A 3CJQA 3E9EA 4NYMQ 4A3SA 1C14A 4V38A 4KQCA 3TSZA 2OY0A 2Y1LA 2B61A 3S28A 3WR5A 4JI1B 3NYQA 4KGXA 3DOUA 3CUWA 1Z4JA 1DG3A 2O7SA 3EXHA 1NZDA 4PRLA 4A9AA 1J8QA 5A4IS 2VDRB 2VPYA 4K6HA 4YS6A 2ZAMA 3DT6A 4NYMR 3ZG6A 2JFQA 4DSAA 1YS6A 2IBTA 4B6QA 3AUJB 3LVRE 2R7AA 3PI7A 2XX3A 2YICA 1N3BA 1BROA 3IDOA 4XTCS 1X6VA 3KCNA 1VDMA 3V3KA 4FSDA 4DR4B 1JILA 4JOBA 2H1FA 1ST2A 2PGAA 4BASA 2DE0X 4WTOA 3OA2A 3AEUA 4NPHA 3ZVKA 2HCBA 3SX2A 3AOGA 1WMAA 1P73A 5DF1A 3RWOA 1XNRB 1ZK3A 2ZSBA 2C7BA 3QW2A 1VJ0A 3ASYA 1RACA 2IEYA 2OV2A 4UKDA 4YRTA 3RYIB 4ND5A 1D9XA 1G20A 1DKNA 1PV1A 3LLCA 2WWYA 4IKOA 2OUKA 1V1RA 1WCXA 3PNYA 1QHHA 1EDZA 1BDJA 1VPLA 5AIBA 1TEXA 2B1IA 3MBKA 2VOEA 3L49A 4FZJA 4DY4A 2FLKA 4GUDA 3BCSA 3JVEA 3ND8A 4OJKA 2BCJQ 1ZH2A 4I6EA 2GFHA 2HCTA 2XTAA 5ED0A 2ETXA 2UZ0A 3T3DA 3QE0A 1Y0BA 2AXPA 4LNUA 3BRWD 3CF4A 1AHHA 3CSSA 4PGMA 5L51A 3C24A 1F8XA 2NG1A 2FDXA 3QKWA 4UM9D 4D0SA 1MOPA 3ZU3A 4OQZA 5K3CA 4D2IA 5IP5A 1VIMA 2D1FA 1JKJA 2PYIA 4E51A 5KNCD 1GHTA 3MMZA 5ALVA 2Q0XA 3L18A 1T8SA 5HSGA 1E3IA 2BM0A 4QQKA 4Q37A 2OHVA 1A8IA 4DLNA 3LYHA 4BKMA 3CTMA 4GZLA 4EJSC 4CWAA 4MPRA 3GLFB 3CNOA 5CH8A 4O5AA 1XP5A 3GT7A 4G2NA 5JDIA 2R1VB 3OQPA 2OBNA 1HI9A 5ALXA 1LDMA 2X14A 1GGKA 1PWYE 5EE0A 1GL6A 3W2TA 2CXHA 1PWXA 1LPOA 3EWNA 4QA9A 3H86A 3REGA 4HO1X 3QJYA 3KEFA 4UTXA 5D7BA 3QY9A 1Y1TA 1ZG3A 4LBZA 4PXYA 5CVCA 1NLFA 5LQDA 4MWGA 3BL8A 4LHVA 4EHIA 1WCIB 1TCUA 4G36A 2XT9A 3L7IA 2ICAA 2GBGA 4ITRC 1TJYA 4MKXA 3TBKA 4BNMA 2ZVDA 4MI6A 3EPKA 4TT3A 3PQ4A 3HSYA 2WJYA 3FMIA 3NV7A 3MWYW 4K6MA 1PVOA 2GHIA 2C2XA 5K45A 5M34A 2HIMA 2PLFA 4XUEA 1B6SA 2V4UA 4ZI3A 1TYZA 2VJDA 4M55A 1ESNA 3O4HA 4A5OA 3IVAA 4Y6RA 4LFBB 4L5BA 1UXIA 2E18A 2EIXA 2LW7A 3ZXUB 1H2FA 3BSWA 2PX5A 3KQMA 1NPTO 2JLWA 2YYSA 2QUZA 4PCUA 3KQPA 3K96A 4LHZA 4LQ4A 1RD4A 3HYCA 1R4MB 1QQ7A 5LXTA 1XVVA 3TSAA 4N5IX 2PX6A 2BSXA 3GCXA 1G7TA 1S3IA 3BUSA 4ZEMA 7GPBA 4YAOA 1X7XA 2EKLA 3HI4A 3ZH2A 4H35A 4ZYTA 5LIRA 1O6BA 2OM2A 4UU0A 2A9PA 1G9XA 1T5DX 2OZLA 3A58B 1S7GA 4MAAA 1QH1A 4UJ3A 1WPGA 4XVRA 3SD7A 3VBCA 2WUGA 1UQRA 3WSVA 1T15A 5DYTA 1YVDA 2HSDA 4IL5A 5C2JB 1YBMA 1HSZA 3B8HA 3KTOA 3QX9A 5F7ZA 1ZD9A 2H5JA 1GADO 2WQZA 3BQMB 2OCPA 1WB9A 3ISVA 1H6DA 1MABB 1XZNA 2GKSA 3V5NA 3B38A 4BNWA 4P4SA 1TTPB 1UDXA 2GGSA 2R5WA 4G5OA 4OBEA 5BNIA 1T91A 2JGDB 3I6QA 2H7XA 1A9SA 2QD5A 1ZWLA 4RMHA 4WCVA 3AESB 3WYBA 4EEKA 1VJ5A 3MB8A 3IQXA 4O4IF 3W0LB 3QF4A 1N4AA 1BYUA 2JLSA 1SA0A 1NVKA 2HRZA 3BRCA 3DDHA 3QBJA 5ICMA 2Q3MA 3I62A 1IBRA 4Z9BA 5LMCA 4PLHA 1D2EA 2H1SA 3OZRA 3T7SA 3K16A 4DYDA 3BTUA 1BEEA 2BGWA 2Q8QA 1OXKB 4AMZA 1MT0A 2VQ6A 3M4ZA 2HF8A 4CL2A 5I7VA 5EXSA 3Q7QA 5IJ0A 1L7RA 4L5JA 1O08A 3W5AA 2G1AA 3ZKWA 5LZ9A 3EJWA 4PIVA 5DNAA 3A26A 2QR3A 2AQIA 3HRKA 2VT6A 1J0BA 4HEA1 4KUHA 3A27A 3LT1A 4COOA 1HE2A 4B47A 1AGRA 2YN4A 3BKXA 3TK1A 2G8NA 1RMTA 3ZD8A 1VCIA 4D44A 2G9QA 5BVHA 4J0GA 3ZQ6A 5TSDA 3A3PA 3RFUA 1DC5A 3QEOA 1M0TA 1C7JA 1PJRA 4QBIA 4FK8A 5JPIA 2QRQA 2MR5A 1CJTC 4R2LA 4UFNA 3EG9A 4DQVA 4UDNA 1YDGA 1SBIA 3FFBA 1R8JA 1VKHA 4FYHA 4PC6A 4UDXX 1QV6A 3Q11A 4QU9A 3T1TA 4IKEA 2BGRA 3S7TA 3CR7A 1IXRC 3PPYA 4BEWA 4L4SA 2PLNA 2YVKA 1DPGA 3NWEA 3RUAA 1BNCA 4G65A 4RM3A 3VVCA 5HKKA 1Y5NA 2F9MA 4Q1EA 4QU5A 2NW6A 4E03A 5K0JA 4RD4A 2I6FA 4C0HA 4QARA 3W9SA 3HABA 4UD6A 2Y67A 3O0TA 1BCSA 4N47A 1P2GA 4C6TA 4E7OA 5C3MA 1JA1A 1CIVA 2XH8A 4P0QB 2DPXA 3ZWPA 1O94A 2FSVC 2JFHA 3I1IA 3HDHA 1FRVA 4UZSA 5DI3B 5AW0A 5BNWA 2F1OA 5KSWB 3FM9A 3PUWA 1NPYA 3ORFA 4DDUA 1D3AA 1WMBA 3HMQA 3NTUA 1TGYA 4F2HA 2J9FA 4E5NA 1X7WB 2Y77A 5A0FA 2IXDA 4Q9AA 3GJ8A 4GPZA 3AVXA 4BDSA 1AQ6A 4J0JA 1SKQA 1M1YB 3IJ5A 3WP1B 4MI1A 3VNSA 5FLEX 4TV8F 3EGEA 1CQIB 3M4JA 2XT0A 4QNRA 2B9EA 3OICA 3NP7A 3IIEA 3V2HA 2CK3D 4UM7A 3ASUA 3DGEC 1FC0A 1BRMA 2GCOB 3HS3A 3QOYA 2IV3A 2VJPA 1TRKA 1P3JA 3F47A 1QYRA 2HT1A 5THKA 4HSGA 2Q0SA 4E07A 4CW7A 2AH5A 5KINB 1D6MA 4C04A 3H4IA 3RS5A 5ALSA 3RVMA 4M7PA 3LWBA 1M2JA 2UZ4A 2YWRA 4RSMA 3WK5A 5FULA 2Z8ZA 1N6LA 3H6HA 3PRJA 2I22A 5IYZF 3S5JA 1FFGA 2DT5A 2WKQA 2V9PA 3JQ7A 1X1RA 4JD5A 1CR2A 3LVQE 3DC7A 4WZAE 1JAHA 2JFFA 3WYEA 4JASB 2PU7A 2XBLA 4ITUA 1LK5A 3ZU5A 4PVDA 2R85A 4HX5A 4LN1A 5EIBC 3NFRA 4W9NA 4DE5A 1RXCA 4KP7A 3SOPA 5MN6A 3PKJA 2I7XA 2XRYA 5AI0A 4TSFA 2FWNA 3COZA 3ELUA 4DXAA 5CUQA 2QRGA 3OZ7A 2VF5X 2AFVA 1BX1A 4PPFA 2R8YA 4EY7A 1DAMA 4QPDA 4CMGA 2D6FA 3P26A 2OG2A 1JLSA 2OD9A 2UYHA 2FMUA 5KPDA 1HKHA 3OEHD 4Y2UA 1GCOA 2D54A 3SOZA 4KO8A 2JEOA 3ZLVA 2V3CC 1AA9A 4RJJA 4W7SA 1JYSA 1WY5A 3FG9A 4DV7B 1TLFA 1YS7A 3FOBA 2XUJA 3QLVA 1O1YA 4Y6GB 2VHEA 3NHWA 3LPAA 1SC1A 1DAIA 1VL2A 4HDKA 5A3JA 1D4AA 4DYHA 1J8YF 4HKTA 5TGDA 1XTSA 3UFXB 3OM0A 5G0TA 5A7GA 5ILOA 2WM8A 1Z7WA 2G0NA 1N2CB 1QK3A 2QTVA 3QI7A 2PZKA 1KH2A 4FWIB 3ZS9A 4B4OA 1IZZA 2XCUA 3N07A 3GVIA 4RQTA 1EGQA 1I7PA 4PTYA 4X71A 1R4ZA 1E9RA 3BGDA 5JCJA 1YAJA 5C8YA 1NU6A 2PGNA 3EWAA 1U0TA 4AW9A 2UYOA 3WK7A 4G0OA 4Q82A 5D5PA 2P77A 4TZKA 3WLNA 5CB6A 1NWCA 2AE2A 3TDNA 4GFDA 1PZNA 2X5OA 3FLMA 4AU1A 4DNFA 1RCTE 5FWXB 4G01B 1VI6A 3LZCA 3P9XA 1YQXA 4MR9A 1QGAA 3LQYA 1S3SA 1E79D 1SOWA 4FBMA 9ATCA 4G41A 1E3LA 2Q27A 1E6WA 3MCUA 1GGMA 2HADA 3AP2A 3IIKA 4FDUA 1FMLA 1O95A 2VHUA 3MB5A 3RD5A 1TUGA 4YASA 5DLQC 2H5LA 5I9IA 4PX2A 5FBLB 2JGRA 3MCVA 5JZ9A 1B8OA 3AT1A 3W5IA 5AHXA 3IPYA 4Z4QA 4TX1A 3WS7A 3I34X 3TIVA 1WXIA 1JHZA 1Y34E 3DSRA 3PJEA 3IQEA 1KP9A 3PQFA 4R1LA 2MYTA 1C4WA 1X74A 1X1BA 3ZD6A 3NWBA 3E9DA 2WU8A 5B37A 3AH8A 5T6BA 3SZRA 1GN9A 4RC9A 1P6XA 1UL1X 3CJRA 4IM7A 2GILA 4IDCA 4FZ3A 4JVSB 1Z6GA 3BORA 1T5TA 2PEZA 5ALLA 2CKMA 1LBHA 2VC2B 3N2NA 3RHFA 2DTXA 3UMMA 5AO9A 2EJUA 3LBHA 2JG3A 1AKWA 3FCOA 4K9QA 2H17A 4I1IA 1GUYA 3BXFA 2P1RA 1VSQA 2W5UA 3CB2A 4LCEA 7REQA 1TJPB 3H5NA 4D43A 4J16C 5FPHA 1RHRA 3FRIA 4YONB 4YXWA 2CVFA 4QPZA 2G04A 2ZM5A 1G6HA 1L7MA 5C8ZA 4EAQA 1Z5ZA 1V26A 5LMNB 2JCXA 3SK0A 4BJHB 5D01A 4Z4CA 3GRYA 1TUEA 4JP1A 1V96A 4EI8A 2WMNB 1OX4B 2IF0A 3EG5A 4C3VA 4P34A 3BE6A 3MQ4A 2LIVA 4EFNA 4UNRA 3D7NA 4NV1A 4B6RA 1X19A 1RFGE 2O8FA 1Z22A 2Q5HA 2QAGC 4RF5A 4OXQA 3UXMA 3SYMA 1MRSA 1Q0QA 4HNUA 3IT0A 4MWCA 1JA0A 2QPOA 3MELA 4JIMA 5BQ5A 2QYOA 3COPA 4N54A 1K98A 2P9YA 5GIPE 5IM4A 4QFMA 3E23A 2C1ZA 2W9XA 2QYTA 1P62B 3F49S 4WQMA 1V4VA 2YQ5A 4UOZA 2N9UA 3OE5A 4DKXA 5K05A 1C8KA 4IIJB 1E18A 3AUUA 3DMHA 1Z18A 4UNIA 3V80A 1F51E 1JHYA 3CLVA 3SX0A 1KKMA 2CLSA 1KQ3A 3MRXA 3R7NA 2XVZA 1HRDA 1ISSA 3IEUA 4KDEA 2VDLB 4RAQA 4OM7A 4JOCA 5TY0A 4KE8A 1YUNA 3LHSA 2D59A 1RRKA 4FOLA 5AW4A 1TO6A 1TA0A 3SQOA 1W8DA 2JIZD 3I92A 3KRTA 4QRDA 5K0TA 2VYFA 2XHZA 1SUIA 4FMCB 3UKOA 4NU6A 3ESAA 5FI1B 3P20A 1K6EA 1DHTA 1RWMA 1YASA 2CMFA 4HTFB 4BMVA 4ZIRB 4Y2HA 2YXDA 4P22A 4REOA 1R8SA 4TWAA 1M5TA 3H19A 4RHCA 1GPLA 3WAKA 1BWQA 3KWLA 4XB1A 4N0QA 1HWYA 1KMMA 1KXJA 3C5EA 3NASA 4WNAB 4G9BA 1XVIA 4BO4A 2OLEA 2UXBB 3AWIA 1FUYB 2JCYA 3LX8A 3O21A 3WO0A 4YCSA 4HYTA 2W22A 4WZBB 4IV8A 1LBTA 2KLHA 3HJBA 1YRYE 3EWIA 3HCNA 2AB0A 1IVSA 3K9WA 3G1TA 4FQ7A 2IEIA 3SZUA 1AC5A 1NU8A 2GK7A 3Q3CA 1SXJD 2E9SA 1IDOA 3P9NA 3KHKA 4MWTA 5K3EA 3WLAA 3OOEA 4V0NA 3N0TA 3EIWA 4LQCA 1Y37A 4AN0A 3FF4A 4DUPA 4E5UA 4MRAA 3P0EA 1MAHA 3JQBC 3IAHA 1KQNA 4DG8A 5CB8A 1NG9A 2CXXA 2BMWA 1CR1A 1PJAA 2DJ5A 5KDLA 3ZE8A 1E9AA 3U1TA 4MW6A 1VI2A 1ZNWA 3OX2A 1GZDA 1CUFA 1G18A 1NVEA 1X1QA 1Z5NA 3QPWA 1VRCA 5ISMA 3ZUPA 1AKUA 3CZ9A 4E30A 3KUXA 5EKUA 5BXYA 4IEFB 1NTOA 2ZT8A 3BF8A 4HLDA 3TI9A 1W9HA 4ZT4A 3ZEIA 2IFTA 3A3NA 1N3LA 3VR6H 3KEMA 4PG8A 5ADVA 5KPJA 3RYFA 1YJXA 3PCRB 2BJHA 2VRCA 2YN2A 2EBHX 3WLLA 2W6JA 3TB6A 5KOHA 4YT5A 2IZOA 1G8YA 1XRJA 3FTCA 1N8NA 4IPTA 4TVOA 1DNPA 1T3SA 2WOJA 5A5EA 4FI3F 3RROA 4B09A 2QRLA 4D3DA 1R27A 3PD0A 4JI5B 1JEJA 4D45A 4M6WA 2REBA 4I9GA 4XB6B 3J80A 3SC2A 5LSAA 4BIIA 1FFEA 3W7AA 3CW9A 3KZNA 5FL7D 3QFSA 1JQKA 2OECA 3DT9A 6REQA 2XBUA 1K3FA 3SBXA 1VJDA 1Z15A 3H1PA 1FX0B 5D3ZA 4UBKA 3WK8A 2H3EA 4UTVA 2PR7A 4CCSA 1XCLA 3GJ7A 3QVGA 3CXRA 3H9QA 5B1IA 4NYIQ 1Z4MA 4YT2A 1LVHA 5C4GB 2D8MA 1DG9A 5T5QA 3TGLA 3GXBA 2PEYA 3RVPA 5JECA 5FV4A 1E0SA 4B8YA 2RGNA 1U7DA 3JQ8B 4HUQB 1KPGA 5EKTA 4IX9A 3GBSA 4PR3A 5GM1A 4NYIR 4QO8A 5SV2A 3OHMA 3CNQS 4HYEA 4BNXA 1FBNA 2JGEA 5B6JA 3CH6A 3A7EA 5CT4A 3ZDAA 1YDMA 3AIKA 2FZVA 4TMTA 2IIBA 4K2HA 2GKGA 4PSUA 3QWIA 2QLTA 1P19A 1SR8A 3K0FA 2JFBA 5AXBA 3CISA 4F86A 5HRAA 3GRPA 1U5AA 2G1PA 3MWEA 4BVFA 1SNYA 2VDJA 5GQSA 1LBQA 4C7KA 3O8LA 3UOAB 1CIJA 1JHQA 3KKLA 1Z4LA 1CHNA 2FPGB 2CFRA 4WV3A 4IF4A 1OR8A 1E3WB 2FWRA 4AZVA 3IAUA 5JJLA 2OBMA 4BJ5A 4QLBA 1GDTA 3M6WA 2O2EA 3ROFA 3FTNA 3ZVNA 3O4FA 5E6SA 3S2IA 3K92A 2DR0A 1VLZA 4R2WA 4MMZB 4BAGA 4YMUA 2A7QA 1ZVJA 4Q47A 3GLIB 5BSWA 2ZSUA 4RVGA 1XYGA 3AV3A 3L6EA 4FSXA 4IDQA 3BDVA 4J7UA 1WUYA 2XAUA 3ZHZA 4RK0A 1HDOA 1KO5A 4UEJA 2ZE6A 2YASA 5L3RA 3MS4A 3GYGA 6Q21A 1FJXA 4CEJB 1QC5A 2KE5A 3PXDA 1A2QA 1F4LA 2YDXA 3NTOA 4PICA 3U17A 4GW3A 1QKKA 1P72A 1A7AA 1R6VA 3QFTA 3AM4A 2RHLA 3PGJA 4UASA 3AR2A 1LC3A 5FWNA 2E6UX 4PYKA 4F3KA 3TRFA 3HRHA 2WNHA 3IUBA 1GNTA 1Y8RA 4ZGBA 4AZSA 1N5LA 3PIIA 3ZGYA 2AQHA 3ML1A 1OIXA 4XYMA 2QD3A 2ZYIA 1A4UA 4MKGA 3GQBB 2B8WA 4QJBA 1QCYA 4WASA 4D98A 1JG6A 3CCBA 1QO0D