1LPPA

Analogs of reaction intermediates identify a unique substrate binding site in candida rugosa lipase
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Analogs of reaction intermediates identify a unique substrate binding site in Candida rugosa lipase.
pubmed doi rcsb
source organism Candida rugosa
molecule tags Hydrolase
molecule keywords LIPASE
total genus 193
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lppA00
3NWOA 3M82A 4MQLA 1ISPA 1L7AA 4I3FA 4UHEA 2H1IA 3H04A 4QDTA 4J7AA 3SX4A 5HQ3B 5BOVA 1HPLA 2Y6VA 5E4JA 2OAEA 1QIKA 4AZ3A 3PDCA 5DNUA 1AC5A 5HF6A 2ECFA 2XUPA 3K9BA 4BTVA 4EZIA 4K6KA 4B0OA 5JALA 5AM0A 1AX9A 5AKKA 4EB0A 1QIMA 1BROA 2J4FA 4G4JA 4K6HA 1P0MA 4L0CA 5AK5A 3GUUA 4QDZA 5AJHA 4PW0A 2OLEA 1G42A 4INZA 2PU5A 3DLTA 4J0JA 1T2NA 1LNSA 3WL6A 2DHEA 1MU0A 4FBLA 4AB1A 1RWQA 3QMMA 3DOHA 5DJ5A 1CUAA 3M83A 3C5WP 4ZRDA 2OCKA 2NW6A 4DLNA 3VJLA 1CUEA 4B9AA 5ALQA 4BP9A 1VOTA 4RPCA 2E3JA 4B82A 4KYVA 1CUHA 4M0EA 3STXA 1ODCA 4ZV9A 5AM3A 1DX6A 3O4GA 4N5HX 4G9GA 1IUOA 2DQYA 1ODTC 2Y6UA 1R88A 1LPPA 3QYJA 1XRMA 1C7JA 4HZGA 4MJ3A 2G5PA 4OD0A 3VXKA 3MUNA 1EK1A 5ALDA 2GBIA 4X6UA 1XZLA 2QR5A 3O9VA 1EXWA 2WM2A 4CG1A 4LYEA 4U2BA 4BDTA 3CXUA 2JGIA 4H18A 4I19A 2Z8ZA 2WHPA 4UHDA 3WK8A 2WUEA 4X93A 4HXFB 4IHAA 1Y7IA 3WWPA 2WFLA 2C5GA 2VAXA 1IUNA 1VE6A 3W9BA 3I2GA 3KWJA 4A16A 4FKBA 4BCBA 4KE9A 4C6HA 3RKSA 1CEXA 5E2IA 1EB9A 4IH9A 4CI9A 4YPVA 4U2EA 1WOMA 3IA2A 4LHEA 3C5VA 3DCNA 1NU8A 1EB8A 5AI8A 3DS8A 1SCKA 1UOQA 1QIDA 2C5FA 4UHFA 3HXKA 2XB6A 5CRIA 4YK7A 4BVKA 1WB5A 2HA0A 5EI5A 2H7YA 5SYNA 3T4UA 1YASA 1IZ8A 2Z8XA 5BV7A 1H22A 5KBYA 5DLPA 3V9AA 5K5EA 4KJXA 3E4DA 3U0VA 4IQ4A 4NVRA 5I7UA 1GT6A 1AQLA 4CIAA 2OGSA 2DR0A 4J03A 2RIPA 5HFAA 1GQSA 2B61A 1EVQA 3ZLTA 2FUKA 1XRQA 1SCQA 2P8SA 4MWTA 4JEIA 1CUIA 4B9EA 5AIBA 1HKHA 5LZ8A 5ALYA 5D3ZA 4PV7A 2VATA 4BE4A 1F6WA 2HFKA 1MNAA 4ROTA 3V1KA 2O2GA 5AI9A 3V48A 3WI7A 2XMGA 3BE8A 3I2FA 2D0DA 3RM3A 3W06A 4K2AA 3G7NA 1QIEA 1MT3A 5JASA 3O4JA 1BCRA 1S8OA 3AIKA 1ZIXA 5A7GA 1OXMA 1CV2A 1ORWA 4HAIA 5AM5A 1XQXA 3TGLA 2XT0A 1DWPA 2ACEA 2JGMA 1AGYA 1ACJA 4JUIA 2ZJ6A 1W6RA 4U2DA 1K4YA 4D9JA 4DNQA 4FNGA 1DWQA 2QM0A 2XUKA 4AMZA 5ALKA 1XZHA 5JAOA 1W4LA 4B81A 1BEEA 2BCEA 2K2QB 1ACLA 4Y2YA 3QVMA 4MEAA 4DGQA 5HK8A 1VXRA 1XQYA 1MJ5A 3G0DA 4QEKA 5KWJA 3EBLA 3BJMA 1AZWA 5K3AA 5JZBA 1IZ7A 3RK4A 1LBSA 2J3DA 4H7DA 3FYUB 3QPDA 4HRYA 1ZIYA 4C4YA 1FFDA 1BN6A 2XUFA 3CCBA 3LIIA 4E14A 5HK9A 3Q0TA 3BDIA 3ICVA 4OYLA 2OCIA 4KE7A 4FWBA 2HA5A 3IVMA 4H77A 3FLEA 5AI6A 5LZ7A 4EHBA 1ETHA 1MAHA 2O2IA 3VJMA 4IH4A 2Z3ZA 2FJPA 2ZVDA 4U2CA 2JF0A 5J3JA 4DNOA 3W9UA 1G5FA 2ORYA 1XRPA 4B0PA 4BP8A 2QUAA 2PKYX 4KAFA 1HDEA 1R9NA 2QT9A 4BZZA 1TCAA 3GFFA 5C8ZA 2OPHA 3C43A 3AZOA 4GEGA 3ZLVA 2RGUA 1J07A 1UOOA 1W1IA 1VZ3A 2XMZA 4DMKA 2CBGA 4BVLA 3VVMA 2GYUA 2QVBA 1UKCA 5ALMA 2DHCA 3OPMA 4RGYA 4X85A 4E11A 3KD2A 3H0CA 3I1YA 3ESDA 5HFNA 1WM1A 4G5XA 3FOBA 2QXUA 2Q0XA 2C58A 3NGMA 5JD5A 5EHZA 1EDBA 2XUHA 1W75A 3C6ZA 1CUJA 5ALOA 1H2XA 5CT4A 4HXEB 4FOLA 1TIBA 3R3YA 1K6EA 3DL7A 1E8NA 2QOEA 4OU4A 1O6GA 5A7FA 5JADA 3G8YA 5ALTA 5CT6A 2G4LA 4DMHA 1BS9A 3R0VA 4H7HA 4XJVA 2HM7A 4QDUA 4AO7A 2XQJA 5CH3A 1EDEA 4UHHA 4BE9A 4PNZA 4HVTA 1ZI6A 1O6FA 5CMLA 3WKDA 1ZD3A 2HA6A 1KU0A 1ZD5A 5A2GA 1XFDA 4AN1A 2J4CA 4F21A 4FNMA 3L1HA 4Y7DA 5EHXA 4Y2TA 4L3WA 3PUIA 2VQ6A 5AP9A 4LXHA 5FKJA 4X92A 1CFJA 1G4HA 4UBKA 1YA4A 4G4IA 5AKGA 3TEJA 5AI4A 4UBIA 3VVLA 1UKBA 4W1RA 4Y2UA 4FTWA 3JW8A 2C7BA 4UFNA 1JU3A 1K8QA 5LKRA 3PFCA 1XKTA 1DWOA 4A5SA 1B41A 4WFJA 1IMJA 3C6YA 4J0CA 1VKHA 1HQDA 2ROQA 2XMQA 4CCYB 2XI4A 1GZ7A 1GXSA 5DNVA 1FFBA 4Q3LA 3QPAA 3HZOA 5A71A 4FFWA 3FCYA 1F0PA 5KWIA 5C8XA 4H7IA 3H19A 3GROA 3QMVA 1FSSA 1PV1A 2OXEA 2HHAA 1VA5A 3WK5A 3HJUA 1MTZA 4X3CA 5AM1A 3IULA 4X00A 2FX5A 2PSDA 3MUOA 4YASA 4AN0A 3WA6A 3FWHA 4EA6A 3IUJA 4JH0A 5AKZA 3QPCA 4Q1VA 5ALGA 3WJ1A 3VDXA 3E0XA 1CUVA 1ZGBA 4XIIA 2XMRA 1BE0A 4QLAA 3D5EA 1ZI9A 3AZPA 4GWLA 5JATA 2WG0A 3IUQA 4WCVA 1DT5A 3DNMA 3QM1A 4N5IX 3LS2A 3OC0A 3FVTA 4GECA 4CG3A 2WIJA 2BGNA 4QZVA 1M33A 4B83A 3DD5A 1R50A 5CW2A 2V9ZA 3D3NA 5CXUA 1TCBA 1XLWA 2VAVA 2QUBA 2BAGA 4J0KA 5K3FA 4V2IA 1EX9A 2BKLA 3Q8WA 5ALPA 1TRHA 1DINA 1XZBA 3BL8A 5ALFA 3WWCA 2WHPB 3JYHA 4B84A 5DYWA 5BWBA 5LLSA 3VISA 2HADA 2AJCA 2VT6A 2BUBA 5JAPA 1FFCA 4FLMA 4X97A 1E89A 4C89A 1CIJA 1XRRA 1AKNA 2BJHA 2JGKA 1C4XA 3AIOA 1CUUA 5C81A 1FFEA 4LKOA 3ESAA 5AK6A 4QDOA 3WKBA 1VJ5A 3DYIA 3FYUA 3DQZA 3DL4A 3F9CA 4GLBA 5D3KA 4AO6A 3W05A 5KREA 5AK4A 4L72A 3CN9A 2XLBA 1WHSA 3KOOA 3FLBA 4U2GA 1YS1X 1A8QA 4UHCA 5JYCA 5A7HA 3SC2A 4FFVA 5YASA 3A6ZA 2DHDA 5HCUA 2CZQA 3KXPA 1ZD4A 3R40A 1IVYA 4Y2SA 3FSGD 4KACA 2WIKA 3A70A 1A88A 3KDAA 1LPAB 5AO9A 2O7RA 2ZYIA 2PU7A 5LZ2A 5HF5A 1XZEA 4IH1A 3N0TA 1A8SA 1E8MA 5FUMA 4IO0A 1SFRA 4G8CA 4BAZA 4WJLA 5JAUA 3AZQA 1CLEA 3STWA 4UFPA 2X8BA 3F67A 3WKCA 4CG2A 2HRQA 2ZJ7A 1X70A 3DKRA 4Y2JA 3FNBA 4HXGA 1OILA 1XRLA 3WYDA 4M0FA 4OUKX 3R3ZA 3MVEA 2BFNA 4AMYA 5HKAA 4N8DA 3WLAA 3B5EA 3DKKA 4EY6A 2GBCA 1QIIA 4WDQA 1MO2A 4C88A 4K6GA 1LPMA 1ZI8A 2X76A 1IUPA 4J0HA 3WL8A 3EF3A 3AFIA 1CQZA 4X71A 1XZMA 4EUSA 5JIBA 3B12A 3D0KA 3I2JA 4Y9SA 1WHTA 1BRTA 3WK6A 3X3HA 1QO7A 2HFJA 2HU5A 1XZJA 2VJCA 3ED1A 2AJBA 1J2EA 1Q0RA 1R1DA 4ZREA 5EIHA 1JMKC 5HKBA 1U4NA 4Y2QA 1TQHA 3R3WA 2ONCA 4J0DA 3AILA 2WFLB 1FFAA 1P0QA 5T4BA 5ALJA 5EHQA 2B9VA 3G9TA 3M3DA 1BEZA 1LZKA 2C0PA 2Y1KA 3HI4A 5C7YA 4ARBA 1YSCA 2CKMA 1UFOA 1MX5A 3G0IA 3FBWA 1EK2A 4FHZA 3L1IA 1PFQA 3S8YA 1LBTA 1MAAA 4UPDA 5AOBA 1CUCA 3H2IA 3PF9A 4X90A 1E8DA 4RE5A 2WU4A 1A8UA 2JGJA 1H2ZA 4G8DA 1N5RA 3H2HA 3ANSA 2OAGA 4C4ZA 1YAHA 5JD6A 1CUYA 3WQHA 2IIVA 5EIAA 3I6MA 4UFOA 2ZJFA 1WCYA 5D6OA 2JEYA 1QIGA 4C4XA 1WB6A 4P9NA 2WLSA 4J0IA 1Q83A 3GA7A 1NU6A 4B80A 3RLIA 1JJFA 5DTJA 5ALEA 1CR6A 1GKLA 1YAJA 2HU7A 5JZSA 5FPQA 3K2IA 1RP1A 2B4KA 2C4HA 1YCDA 3A2MA 3RARA 3STYA 1TAHA 2XQGA 1QFSA 1JT2A 1UK9A 4QA9A 4Y2PA 2OGZA 5ALUA 4F5ZA 5JZ9A 5CBKA 4A23A 3D4LA 3C45A 3KSRA 3KWFA 4S0XA 2V98A 4HRXA 4BDSA 1CPYA 2ZSIA 2I03A 2W22A 3S2ZA 4KRYA 4Q34A 3QITA 4Q82A 1GPNA 2HA7A 1X2BA 1C7IA 2CEKA 3AUKA 2YYSA 4BVJA 1Q0ZA 4TPKA 3WK9A 3PUHA 3PF8A 3H2GA 5AKYA 2Y2VA 4PO3X 3FYTA 5FLKA 2PSHA 4QWMA 4BRSA 3OOSA 1JJBA 4DNPA 4WY5A 2HU8A 3D2AA 2ES4A 3ZWQA 2QJWA 3EQ7A 2WUFA 1CUSA 4WFIA 1LPNA 3OURA 4MEBA 2YASA 4H7EA 1EVEA 3WJ2A 3I2KA 5CT8A 1CUFA 1AURA 4DTCA 3WYNA 3FAKA 3GELA 1BU8A 1RYYA 4G8BA 4X94A 3WIOA 2WJ3A 4YX9A 2FJ0A 1WPRA 4WDRA 1QTRA 5DYYA 1Y37A 2I3ZA 2WIDA 5HF8A 3TJMA 4LXGA 5AIAA 1UT6A 2WJ6A 1E5TA 5JAHA 4AQDA 3FLAA 5ALRA 4ARAA 1R4ZA 2OCLA 2VF2A 4O08A 5AKLA 1DQYA 3QMWA 3H1AA 2RONA 5AKXA 1JI3A 1YR2A 5FRDA 3WWOA 4L9AA 4Q3OA 4EY8A 3STTA 3I2HA 3G9XA 3HLKA 4Q05A 1LZLA 2JBWA 5FOQA 1YA8A 3I28A 3C8DA 1EINA 4OPMA 4ZGBA 2GBFA 2PPLA 2XMCA 3T52A 1CUZA 2ACKA 3WK7A 4BCCA 3WKEA 5AKIA 2WSLA 4QWWA 1CRLA 1UZAA 2WKWA 4LYDA 5DNWA 5K3EA 2OGTA 3W04A 3O0DA 4BBZA 4GXNA 4Z49A 4KE8A 1GPKA 2WJ4A 2EDCA 2H7CA 2CB9A 4N8SA 2AJLI 1BCSA 4H7JA 2W6CX 1LPOA 1E66A 1XZAA 5IVHA 1U65A 4PF1A 4I4CA 5AKJA 2JGLA 2UZ0A 1D07A 4KR0A 1AMNA 3A2NA 4X95A 5ALSA 3BJRA 1UXOA 1CUGA 3HC7A 3NUZA 3SWWA 1XZCA 1EI9A 2ZYHA 1VLQA 1JJIA 1EDDA 3ESCA 2QZPA 1VZ2A 4H35A 1UK6A 4OYYA 5T4EA 1FJ2A 4GBGA 2VT7A 3BIWA 3QZUA 5H3HA 3IURA 5DTIA 5EGNA 3U1TA 2BUAA 4BATA 4Q3KA 3FCXA 1UOPA 1JU4A 2X5XA 5AI0A 1QIJA 4QDXA 3WIBA 3H1BA 4W9RA 3PICA 3MGAA 4DMFA 1XZFA 2XDWA 2RI6A 1JKMA 3WWEA 5ESRA 5ALXA 5K3FB 5IH7A 2IX9A 1QONA 2PL5A 2Z5GA 1QJ4A 2XUGA 2WQZA 3E3AA 3HSSA 2GBGA 4PSUA 2YXPX 2PSFA 4QE3A 3DJYA 3C6BA 3NOXA 3OTQA 2J3QA 3GZJA 1QIFA 2XQFA 2ZSHA 2WG2A 2OCGA 5ALHA 2CMFA 3W2TA 4DSZA 4DNFA 2JEZA 5CH5A 5IKXA 2I78A 5ALZA 4ETWA 1GPLA 3I2IA 1MNQA 3ILSA 4W1PA 1TKRA 3AJAA 4KAJA 4ZXFA 4XVCA 4ITVA 5HQ3A 3PI6A 2WHRA 2C0QA 3IUMA 1P0PA 4X6YA 4P92A 4GW3A 2AJ8A 2VJBA 4LIPD 4OU5A 4EBBA 3LIPA 1W76A 1HL7A 3BWXA 5CXXA 4KEAA 1UK7A 2WG1A 4HS9A 1YB6A 4PSDA 4BC0A 3PFBA 3E1GA 3WZMA 1YB7A 4AXBA 3BF8A 3DYVA 4DM7A 4B85A 1UK8A 2JGEA 5AICA 1VXOA 2GYVA 2Z3WA 4B6GA 1EH5A 2AXEA 4MXDA 4GHWA 4UBLA 2PUHA 1ORVA 2XMDA 5LZ9A 3UUFA 4NZZA 2G5TA 5IVDA 2DCMA 3LLCA 3FYUC 2V96A 5AM2A 3O4IA 4FMPA 2QMQA 1H2WA 1WPXA 4PQEA 1THTA 2O2HA 3L1JA 5T4FA 2HA2A 2GZSA 2OG1A 3IIIA 4H7FA 5ISMA 3IDAA 1TCCA 2QTBA 5AOAA 2G63A 4UHBA 1ZJ4A 4RNCA 4E15A 3LP5A 5FPPA 2OQVA 7YASA 5ALLA 3G02A 1HLGA 4FLFA 1QGED 2EDAA 3HYSA 1J1IA 1HBJA 5K3CA 4WFKA 5CTAA 4U2FA 3EQ9A 4UBMA 5K3DA 1MX1A 3H17A 4G9EA 4FLEA 4AZ0A 4E46A 3WL5A 3P2MA 2VEOA 4OB7A 1AUOA 2DQZA 4BAUA 4F0JA 2XMSA 2XUJA 3B3QA 3V1LA 5HF9A 3C70A 4PSCA 1EA5A 4DSAA 1QOZA 3CN7A 3ICWA 1VE7A 4XX1A 5CT9A 4CCYA 4JNCA 4X7BA 2R11A 2O7VA 3R3XA 2XUQA 3STVA 1XZKA 3BF7A 1T4MA 1CQWA 4C01A 3VKFA 5JARA 2ZYSA 3PE6A 1P0IA 1THGA 3G0BA 2WIFA 4TGLA 4H0CA 2XMBA 3D2BA 1LPBB 1QIHA 1W52X 1I6WA 4OB6A 2PX6A 1N8SA 1J06A 4TVKA 4Y2VA 3WWDA 1CUWA 2V97A 4BCDA 4NMWA 1K5PA 1CVLA 1U2EA 1ODSA 1USWA 4DMCA 5FP0A 3ESBA 4MYSA 2JIDA 2BUCA 2VJDA 1ZGCA 4LXIA 5AOCA 1YS2X 2HL6A 3DDUA 2QXTA 4BYMA 1K63A 3IBTA 3F98A 5ALNA 1N1MA 2H7XA 5AK3A 4UBNA 2BGRA 4ZV7A 3YASA 1DQZA 3VJKA 5A6VA 5FV4A 1QZ3A 4UBJA 4CIBA 1TK3A 2XUDA 5AM4A 5DYTA 3EIOA 4CFSA 5EHNA 3HABA 4C87A 3EQ8A 3V1MA 1R3DA 3ZPXA 4J3JA 2VJAA 5FDFA 4FBMA 4BZWA 4F60A 5ALIA 4CCWA 5LKAA 4W1QA 2OQIA 5CH8A 3WL7A 4OSEA 3QH4A 1XZIA 3SK0A 5F4ZA 5FXMA 1CUDA 4ZWNA 3O4HA 3FVRA 1JMYA 1L7RA 4Y2RA 2CJPA 3G9UA 5IVIA 1UWCA 5C8VA 2JGFA 4AX4A 4BAGA 3DOIA 1LPSA 1XZDA 2EEPA 2RHTA 1XZGA 3H18A 2XUIA 3STUA 1N5MA 2HRRA 3R3UA 5JD4A 4GDMA 1ZOIA 4WY8A 1GKKA 2WUGA 2HIHA 3DEAA 4W1SA 1OCEA 6YASA 2Y2UA 3M81A 1QO9A 1Q84A 2D5LA 2WFZA 1KU6A 1DT3A 2R8BA 2VSQA 3R3VA 4OCZA 1XLUA 3TRDA 2VTVA 5T4HA 2QRUA 1QTIA 3GBSA 4KAAA 3ZV7A 3V1NA 2IITA 3G9ZA 5DWDA 5LZ4A 4MQMA 4N8EA 4MYDA 5A62A 3OG9A 2WTNA 3BDVA 1BN7A 3F8SA 2HA4A 4DIUA 2VA9A 4BB0A 2RHWA 1MPXA 2HDWA 2PM8A 1XROA 5CURA 5ALVA 4P08A 1H2YA 3BIXA 3WK4A 5HZGA 2YH2A 4K5QA 1MN6A 3R41A 1JFRA 1R9MA 5LZ5A 5IVKA 2CUTA 4J0GA 1SOMA 4KE6A 3IB3A 4EY4A 1XRNA 2B20A 4GI1A 3UUEA 2DFPA 3QBJA 2PVSA 1F0NA 2PSJA 5AH0A 2LIPA 4M0MA 5E4YA 3D59A 3LCRA 1GGVA 2HA3A 2QS9A 4G1FA 1XQWA 1G66A 3OM8A 2PBLA 3WKAA 3BXPA 3I1IA 3G0CA 1SCIA 5AKHA 2WU3A 5JANA 5LP1A 4X6XA 1CUXA 3H2JA 2QKYA 4QLOA 1MX9A 3HRHA 1B6GA 2XLCA 3ZLUA 2RAUA 2WUDA 2WHQA 3JWEA 4BC1A 2ZYRA 4NS4A 1QFMA 4QNNA 1DU4A 1EHYA 1H23A 4JYPA 1U8EA 2WILA 3HEAA 1GQRA 3WZLA 3C8HA 3IUNA 3H2KA 2WTMA 4FDMA 4X91A 1X2EA 3FSGA 2WFMA 1F8UA 3HACA 1DX4A 2PSEA 4EY5A 4EY7A 5K3BA 1Z68A 4XWGA 5EFZA 4W63A 3O9MA 1ZD2P 4ZI5A 5D7BA 3A2LA 3I6YA 2AJDA 1XLVA 1XKLA 3WMRA 4G4GA 3WA7A 4AO8A 3K6KA 5EIEA 1DTEA 1L7QA 5AI5A 4UUQA 2XQKA 1LLFA 2PUJA 3O95A 1XQVA 2GZRA 1LGYA 3C87A 4KRXA 2H9YA 2WIGA 3D2CA 2I3DA 5CT5A 1WB4A 1CUBA 1QE3A 1E3QA 1KEZA 5SYMA 2XQIA 1Y7HA 1UKAA 1ZICA 3AINA 1NX9A 3F96A 3ANTA 1QLWA 5LIPA 3I6ZA 2DSNA 2XE4A 2QJRA 3F97A 5AHXA 4BTLA 3CCCA 5I8PA 2XUOA 4DYHA 3N2ZB 3D7RA 1A7UA 4MWSA 5I9IA 4B7ZA 5ALWA 4OB8A 4UBOA 2GYWA 4BRZA 5BWCA 4RE6A 1VA4A 4H7KA 5LYYA 5E4TA 1PJAA 3AIMA 2XUAA 4P93A 1SC9A 1ZJ5A 5AKEA 3C6XA 4HTAA 4Y2XA 4JYMA 3ZI7A 3G0GA 3UMJA
chains in the Genus database with same CATH superfamily
4BNZA 4HTFB 3A1CA 4LOLA 1T2CA 1AHIA 3OZ7A 4X62B 3RTBA 4JOBA 3OKAA 3L8EA 1JBQA 5GZ6A 1ISPA 3F5DA 5TQJA 2FZGA 3RQIA 5CFZA 1T5SA 4B7XA 1TQ8A 2DAPA 1L7AA 4R7ZA 1ULHA 2H1IA 2RAVA 4MLZA 4YJHA 3VH4A 3F3KA 3UOAB 3AH8A 4D3YA 1NGSA 1I4TD 4Q3AA 2GKGA 5COBA 3IAS6 3DQPA 2NVWA 4ZCMA 1PR4A 4KSYA 4DTIA 1DELA 3OM9A 1Z4QA 3KXLA 2AF4C 1AKTA 5LUAA 4QJIA 4U7JA 3R3HA 1TUEA 4J4HA 1QYDA 3QXSA 4KIJA 4OGGA 3ZE1B 4IZIA 5B3LA 4CKEB 1V2HE 1W9MA 3UJCA 4M83A 1NJFA 2IKSA 2H3HA 4L7VA 1UKVY 4LYJA 2XDQA 3W5DA 1KMHB 2CXTA 1V5IA 2WD7A 5LP6F 3D4BA 1J9GA 3PDCA 1GPBA 2WZDA 4U02A 4OV6B 1AC5A 5HF6A 3K9BA 3OCWA 5LOVF 1MOZA 2HREA 2P2SA 1XVIA 2X1VA 1PZNA 3D54D 1XD8A 3H2BA 4Q3DA 2DBYA 3CUVA 4FYHA 2QLTA 4K6KA 5DSXA 3TTYA 4AUNA 1N5IA 4ER0A 1JIXA 3JQBA 4HEA6 1OGYA 1MQ8B 5AM0A 1FSZA 2QWXA 3QYFA 4IJMA 3KYDB 4MPDA 5I45A 5IF9A 1TI7A 3GO4A 4V02A 3HO1A 3KOUA 2LPMA 1QB7A 4JI1B 3NU1A 5KWSA 3QOXA 4NC9A 2AOUA 5AVOA 4HNTA 1JP7A 5KSPA 2BHNA 3FWYA 2XA1A 4JYCA 4FHCA 3LLMA 3CH6A 3K7EA 2DFLA 2AFHE 3AO0B 1L4BA 4F9FA 4P4NA 1LBHA 3MUFA 4M1OA 4COKA 1TD1A 1A9QA 1C3JA 2C7GA 2OLEA 1HDIA 2H17A 1SBNE 4M1KA 3SDBA 2R00A 5JZOA 4ZK2A 3GLHE 1SELA 2HSGA 4FBLA 1RCFA 2R5NA 3M4YA 4RMJA 1I2DA 3DLAA 3OZBA 4NCKA 4Z3DA 3PA8A 2QDKA 2AW3A 2HCJB 1M1YE 2VPXA 5DJ5A 1CUAA 4ZAWA 2FX3A 2Z6UA 1CVIA 2GEJA 4IG9A 3WGHA 2F6RA 3DHNA 3DOFA 1WZ2A 2V03A 3AKCA 4LS3A 1NZJA 4NH0A 2IEBA 1RKUA 3KIPA 4FE4A 4RAOA 4X1OA 3PSAA 4DLNA 1A9RA 1MUUA 1S3SA 4QODA 4BP9A 1E58A 3BCUA 3I92A 2E21A 1RXSA 2IYRA 3UAYA 1TQ4A 2R8YA 3UYKA 4F9TA 4PN7A 3SGLA 1Q0TA 3U81A 4OLBA 2IYPA 2Q5HA 4GNKA 1IZZA 2GB4A 2VNIA 4IWXA 3SNKA 3OFND 4KYVA 4CTOA 3STXA 1ODCA 1GKIA 5EYPA 2GJ4A 1YVRA 3B1FA 3E5HA 4RTNA 1SCBA 2DERA 2YCLA 4S1TA 1PG2A 1FSGA 4EOGA 5AM3A 3MBIA 4CWAA 3GT0A 3IOEA 3PYLA 5ER9A 1QYWA 4AUMA 2GN8A 2A7XA 2CXRA 4NZNA 4XWTA 4MQUA 1LRKA 1ZK4A 2Q3LA 2P5YA 8MHTA 3LLUA 2GRAA 2Y6UA 3EIWA 4LGYA 3PGA1 3IKLA 1Z36A 1R88A 1X42A 1LPPA 3QYJA 3H65A 3TYXA 2BONA 2EL7A 4MJ3A 4CM9D 1DAIA 3ENVA 3HU1A 4ZP1A 4DNXA 3R5HA 4CQMD 4W9MC 2IW1A 1CIPA 3TRHA 4YRSA 3BORA 1PYOA 5F5XA 4CMEA 4D81A 1R9GA 1FQJA 2A30A 3B7WA 4JSTA 3CGGA 4AJPA 2I54A 4LY6A 1XZLA 2AEEA 1UR5A 1JSCA 2FSIA 3AY3A 3GRYA 4ZQGA 1Y7PA 2C4WA 2GAFA 2PUDA 1C1XA 5DCWA 1V9CA 1MG0A 1VJTA 1TJ5A 3ER6A 2WM2A 3CWCA 1E2BA 5F23A 3RKRA 4G89A 4L4UA 4AYXA 2QNBA 3P2EA 4U2BA 4JI3B 5CEEA 2OO5A 4EYGA 4C20A 3GPLA 4BJ1A 2O19A 1M72A 4XGRA 4JP8A 2QTCA 4R83A 1GPMA 1ZW1A 2PZFA 2UXCB 3L84A 5ICEA 1GJRA 4C08A 1QG4A 5LMCA 1P2TA 3AHJA 4YJGA 4XRGA 2DWOA 3LE8A 4ZMSA 1F06A 5KNBA 1ISJA 3WWPA 1RR6A 2Y71A 4NZMA 4BLUA 2C5GA 2Z5LA 3KVRA 4MWDA 3TX6A 2VAXA 1ZVKA 2YRWA 4IXNA 1O0SA 1IUNA 2AG8A 2EZ4A 3DTVB 4LQLA 3KQQA 2J6HA 4D8TA 4FGJA 4CEHA 1RQ7A 4ZVMA 4D8VA 5LJLA 4OXQA 3TINA 2GPNA 3H16A 3WLJA 1E9DA 4Y0NA 4JS0A 3F3YA 3KT8A 4BCBA 2Z4RA 3AF1A 4YIHA 4KE9A 2W6ID 4IJQA 2JZNA 3TTVA 3LYAA 3UHJA 4CMIB 2WSSA 2FP4A 5K0CA 1CEXA 1MB3A 5E2IA 3CUSA 1XYYA 4FGKA 4GZ6A 1OAOC 3RRXA 4IH9A 2QX9A 2Y1OA 4YPVA 2HWWA 4DXAA 4JLMA 2X4LA 5L40A 4ERNA 1W7AA 2WC1A 3V00A 3PTAA 2VIIA 3TIVA 3WRXA 1Z5GA 1ZK3A 4TV9A 5E7MA 4MGHA 1XJWA 3ZKAA 4N3AA 5DOVA 5FBHA 2G88A 4L3VA 5CFNA 2DETA 2C7RA 1YI0A 5FL3A 3K8YA 1QGAA 4AKTA 1WJGA 1NATA 2HD4A 2I4TA 2HIMA 4GX2A 5BN5B 2HLPA 3WGLA 1A2OA 1R4NA 3H8WA 3ZEAA 2CNNA 2ZJAA 3FJYA 1GLVA 5K0EA 3F4LA 2RGXA 1Z06A 1Z0DA 1HNNA 5AI8A 2NU6A 4FFNA 2A33A 5IH3A 4MW4A 4IZHA 2QSYA 4INAA 4LGCA 2ZWOA 5NLLA 3UUGA 5C1OA 2OHVA 5KC9A 3QSYA 5EZ5A 4MIKA 4M36A 4DJEC 1ZKMA 4BQOA 4NQZA 5HUQA 1KK2A 1GV0A 3AVPA 3CF4A 1EK5A 1A97A 2HA0A 2V6GA 4ZI7F 3HYRA 3ZD6A 4JXXA 2H7YA 1P5JA 2JH8A 3PVZA 5AW3A 3FOFC 2IH2A 3IMEA 2WRZA 1NXXA 3I9FA 4ZZIA 2P6UA 1MZPA 1ULZA 2ATIA 2H2HA 3GGPA 4IDPA 2FSVA 5TNXA 1DLIA 3L18A 4D3XA 2X1LA 5F33A 5BV7A 2TRSB 5FBVB 4K1XA 2HDOA 1ACMA 1UBUS 3AUFA 1U2GC 1QHXA 3NNDA 4ZVSA 1NVXQ 1YQQA 2H1HA 3MUEA 5JYEA 3KZVA 3S27A 1K8ZB 1YQGA 2IV7A 3AF5A 1VYTA 5HZHA 3LPLA 3LUPA 4H3KB 1F2TA 5FAXA 1KSGA 4IQ4A 4D4LA 1TW3A 3EDOA 2NV6A 2ID9A 3FROA 1GT6A 4BGEA 3RIYA 1BMQA 1QG6A 1RZUA 5JQGB 4IDQA 2MSKA 1AQLA 3IIKA 4HGNA 3SF8A 1CT9A 3PQ2A 2CMHA 3MCTA 1OSNA 2OGSA 1GPWB 1ZM9A 2COUA 3FNQA 3H9CA 3K3PA 4V1CA 3SJBA 5JQWA 3P9QA 3DBHB 4XPIB 3BHNA 2FEAA 4UAJA 2ADOA 1Q15A 2R3SA 2W2KA 1EVQA 3IALA 4ALLA 3TNDA 2CYBA 2YWDA 2BOVA 3ZLTA 1JLLA 1L7MA 2XRMA 1UQTA 1KQNA 2WVAA 1WV0A 4E32A 3MM4A 5K6TA 1R5NA 2FWJA 1GCGA 4S1PA 2CFCA 1Q7EA 2V7WA 3GLTA 4E2WA 2QX6A 1ZL0A 1ZU5A 2GWHA 2YOGA 4M9QA 4BZQA 1CUIA 5B36A 5DB4A 3UV3A 4FE3A 1MD9A 1WEHA 2C29D 2ZCVA 3CEAA 3UOGA 4XIGS 1IPFA 4R2JA 4B9EA 4CW7A 3HXOA 4BVBA 2DG2A 2QL9A 5KHOC 2H06A 1WETA 2HSJA 2JLQA 4EITA 1FRNA 4HKTA 4DZRA 4UKDA 5LQJA 1JLSA 4IL5A 2PKQO 3OQMA 3GJ8A 1EP3B 3HNOA 2IUFA 1E9CA 1F6WA 1IHDA 2RGCA 4BXOA 4IIDA 4KGVA 3WJAA 2REQA 1XZ8A 1U1GA 4EVQA 3GP5A 3U7JA 1CY7A 2QZJA 3GG9A 1K08A 1KIFA 2FPGB 3HMKA 4L27A 5EL0A 3DXYA 3WZ2A 4DRYA 5BWOA 3U56A 1ID1A 1PDVA 3R23A 1PNRA 2G09A 2O2GA 3FUTA 3MQ2A 1V16A 3BWVA 1V9SA 4CEIB 1JLMA 2J8ZA 3K32A 4NAVA 2RGGA 3I2FA 2CHUA 2N9UA 3OJEA 4LY9A 3TAXA 3V4ZA 4BX9A 1H0RA 2XW6A 3AYXB 3MYYA 4DGSA 4LXTA 4DEVA 4P0PB 4NHOA 3UJ9A 1R4MA 1N1EA 1NBOA 2QL5A 3NBYC 3NUQA 3P0HA 4R9VA 1DKNA 3G7NA 3EGEA 3TUZC 1RYHA 1KDTA 1Y4ZA 3JXEA 4IDEA 5ECWA 4DCVA 5CG1A 2XOXA 1H8HD 2YY7A 3O4JA 1RYZA 3K0AB 1QX4A 1S8OA 2IOQA 4DT1B 2YN4A 3KVOA 2FA9A 1MORA 3BMOA 4LVOA 4LZPA 2G9VA 1CV2A 3VR6H 3TQHA 1NLZA 3ZCVA 1D2MA 3VR2A 1GZHB 4FDLA 1V6AA 4LV5B 4YEDA 1N5KA 2LKDA 4MS3A 4L02A 1OI7A 3AJ9A 5DWQA 1P5ZB 3L6OO 1OFUA 4C14A 3MWFA 5IN4A 2X19A 5CHYA 4D9EA 1NFFA 2VYVA 3PRYA 5EMJA 2ZJ6A 3OLVA 4JUIA 1W6RA 3FPJA 4U2DA 2H48A 4D96A 3ABOB 4BJ5A 1PR0A 1HYQA 2PA3A 2XYRA 4OKSA 1IVNA 4MUKA 3HUTA 1G5IA 1M74A 3QVSA 3K92A 4FNGA 1I1NA 4IXDA 4QU8A 1C0LA 1S2MA 1TAQA 3TQFA 3WQRA 4AMZA 5CFLA 4FR5A 4I6GA 2PX0A 3T5CA 5B30A 2XE6A 1EFUA 4KLRA 1ACLA 2NUTB 4Q1FA 1CCWA 1TVEA 2JAOA 3QVMA 1GUDA 4JR0A 3SCZA 4ZOBA 1Q95A 3ROGA 3CVYA 3LUFA 1YQUA 4HDAA 2FW7A 4OJKA 3VAYA 3P19A 1E9SA 3L07A 1W4RA 4ESOA 4P35A 4WLUA 3TSAA 2XRFA 1MJ5A 1BXRA 5B37A 3O75A 1QRAA 2CD9A 1ZUHA 3OA0A 1IXYA 2FMHA 3TFOA 3KZXA 1M2NA 1D4FA 1XMIA 1DP4A 2FFBA 2ZPUA 2ZSFA 3LHDA 4I8IA 1JWLA 2QPAA 2AQKA 4Y1GA 2P2ZA 3AY6A 2OFWA 3NHJA 4AMUA 4WXEA 3GT4A 2IT1A 4B3MB 3DZDA 4K05A 1XVVA 3VFDA 3WXMA 1VHWA 2QM3A 4R2XA 1Z7YA 2PNFA 3DT9A 2O8FB 4PEVA 1T0HB 3G2LA 3OD1A 4ZVRA 4DA8A 1Y1PA 1Y4AE 2DF8A 3N0XA 4EHHA 1YZYA 5HK9A 1E64A 2PMFA 3DDZX 2WA2A 3FKSD 3RTGA 4HN2A 3ICVA 1DEKA 4IXMA 1G38A 3E22A 2D00A 4DDWA 4FWBA 5F73A 4AYWA 5DBHX 1E2PA 7REQB 1SXHA 4WFQA 4WCFB 2X9LA 1PD0A 1T3SA 1E0KA 1R0LA 3G7SA 3IXQA 4D9CA 3FLEA 1M2GA 1WSDA 1DV2A 5C34B 1F12A 1QGZA 5LZ7A 4E5YA 4YDQA 2O5EA 4JIGA 3OKCA 1WSBA 3NDJA 3OCCA 3I58A 3EXFA 2QAGC 2JF0A 1FNSA 1P17A 2J5RA 4IHJB 3SEAA 1LVGA 1O97D 1QC5A 4EHKA 3TNYA 1SD1A 4E70A 1G5FA 3AUTA 3BRQA 5D00A 1ZU4A 3THWA 1XRPA 4LY3A 4LOIA 1V3UA 2J30A 3I12A 4MICA 3I01A 4JVOA 2JK0A 3HDVA 3PHCA 4PCVA 5BQOA 4F8JA 2GILA 2FWRA 1JSZA 2G1KA 2PLAA 2F1RA 1E2FA 4LRUA 3ZCSA 3KXKA 1LDMA 4BIIA 1XTJA 3AHFA 1PFGA 3PQDA 6ABPA 1Q74A 4BZZA 4JT2A 2R60A 3OO0A 5CVEA 3VR3D 2DT5A 2OPHA 1JHUA 2R00C 4IZOA 3C43A 4GEGA 4BU0A 1KQ3A 3SDSA 1Z16A 1H9BA 4FYMA 4V0MA 1BD4A 4U1RA 5ICFA 4OHWA 1F6BA 2ICAA 1QFYA 1JFTA 5DT9A 4L9WA 4OVKA 3RWOA 1VSQA 4GL2A 4UM5A 3GEGA 2VPYA 3U7IA 3ZWPA 3Q7TA 1SUCA 3T54A 2ZU6A 2CSUA 2QU7A 3C5EA 4HQLA 3TL2A 4BVHA 2VYFA 5K03A 1JW9B 4XUDA 3RJMA 3BMCB 2MSEB 3PB3A 3V9PA 2A9VA 4RGYA 4E11A 1AQJA 4CKXA 3GC6A 5IMBA 2A6PA 2D2IA 4KXMA 3OZFA 2FZVA 1QHHA 1VG8A 2H16A 3LQFA 5KYGA 2E2WA 2IELA 4L5AA 1Y6GA 1WM1A 1KWGA 3QKUA 4A8HA 5LMZA 3FOBA 3UMSA 5H3CA 3IO5A 1Z82A 3OLCX 3ZE7A 3GGDA 4LVUA 3U13A 2ATXA 1P45A 3Q40A 4BO4A 3V3KA 3M33A 1OR8A 1O57A 3LCJA 1XZPA 3ZGNA 1LSSA 4BUCA 1E60A 4RY2A 1M1NA 4XSVA 3LY8A 1WO8A 2PAAA 1RYFA 4BQQA 1NVFA 4O2BB 3C6ZA 4EW6A 4JQZA 5EEGA 4Q4HB 1HQKA 4WH0A 4TKVB 1Z47A 1BDJA 2IYAA 1N33B 5DEOA 1J8QA 5DXJA 5GZ1A 1TIBA 3R3YA 3EUEA 4X63A 5EC8A 1G8SA 1K6EA 3DL7A 4EYSA 3S81A 4WT7A 1KYWA 1E8NA 3D4IA 2FW1A 3T3MB 4CKWB 4OXYA 3DPIA 1XCBA 5IP5A 1YQWA 2QAGB 3SEZA 4Z8XA 1IY0A 3CW9A 3GJ6A 1KDPA 5CDGA 5FQOA 4H4CA 1BE6A 3PGVA 4ZQCB 4BJ3A 5I7SA 1G5QA 4ZD6A 5FAKA 1GA4A 1W59A 2WYWA 1VIVA 3R0VA 3KJHA 2A7QA 3BRWA 3IQFA 4NTZA 4PX3A 1J22A 4POOA 3R6DA 4IIVA 2FDXA 4UPEA 2FKNA 1N3BA 1Q1BA 3L6UA 2FSSA 2HC9A 2I2FA 4QDUA 2A0FA 2VBCA 3A9UA 4MWCA 5JVDA 4OP1A 4AO7A 2OCAA 4QHYA 2WU1A 3IP8A 4IHJF 3AWDA 3K9HA 2BGUA 4BE9A 4WTOA 1XN1A 4RJIA 3WYAA 2WWHA 4F9EA 5KO2A 1NLYA 3GUHA 4HVTA 3EFEA 1XNJA 4BY9E 3NDIA 2PK3A 3DT8A 3MS2A 1OY1A 4KQGA 4B6FA 3JALA 3LPMA 1FP7A 1ZD3A 2BH9A 2HI0A 3BB1A 3KX2A 2JIZD 1I4EB 5DN6D 5K0ZA 3KKOA 4I9FA 3HCRA 1E4OA 3NT2A 4OSOA 4R7GA 1YGYA 3A1SA 3PEUA 4HO1X 2NU8A 4MQEA 4AD8A 4DLVA 1XFDA 1R6BX 1XZQA 1DBSA 1EEXB 3WQQA 5K0TA 4BFVA 2Q8QA 4M37A 2PRYA 4BO9A 4DLRA 3FHTA 2PH7A 2XD4A 2IS2A 1LEHA 3U60B 3I30X 4CMAA 1QQBA 1R4MB 2V7EA 3BL6A 4B8YA 4XD7A 3AM4A 3SVTA 1J33A 3R7SA 4TMFA 2JG3A 5M04A 2WSIA 4LE0A 3UMRA 3UBTA 4PIPA 1JA0A 1DOHA 4FSHA 4DR2B 4PTLA 3AL0C 4RD4A 3ND9A 3DAGA 3IIJA 4Y2TA 5BWNA 3T3OA 4A8JA 3PUIA 3D4OA 3KTAA 4KO2S 1BYUA 1T24A 2QPOA 3FZEA 1ZUWA 3FB4A 1A96A 2QYSA 5AMXA 3T4PA 3LZCA 4PLGA 2A1TS 4HYEA 1EM6A 2SBTA 3AFGA 2XNCA 5BR7A 3LC1O 4WVLA 4REQA 2GPYA 2QJFA 2BI8A 1L5LA 3UNXA 4AU1A 4UE3S 1EBUA 4TV9B 3DMTA 3A9VA 3AXTA 1ZLXA 1IQPA 1L9KA 5G4KB 4UREA 2VJOA 4QOJA 3WLLA 1Q11A 3NBMA 3O0TA 5AI4A 4B4OA 3VVLA 1RTKA 4ZVNA 4W1RA 3EFHA 2CWWA 4RL4A 4Y2UA 2FUCA 1P2FA 3HN7A 1TRKA 4R6XA 4WLFA 4HG2A 1Z6ZA 4ARUA 3JW8A 4PLHA 3D8RA 1ZMTA 4HGOA 4IJ5A 1PSWA 3E35A 4LAFA 4AY6A 1HMPA 4R0MA 1C0PA 1PT5A 3QOWA 4C76A 3ZU3A 4BKOA 2GH1A 1GTVA 2BKXA 2JJYA 4JJ8A 4ZT3A 1UP6A 1XKTA 2A78A 2FVXA 1QZZA 1T3HA 3NJ8A 1QK5A 2OPBA 3QWIA 5IBRA 4BYGA 1L4EA 1M6WA 1UMDA 2Y0DA 821PA 3CS3A 1T9DA 2D62A 3IIMA 4HRAA 3OQ1A 4IEIA 3C6YA 1P61B 2IDMA 3VDMA 4J0CA 3A1WA 5GJWC 1ZXLA 2F9MA 3CF0A 3HKDA 5BORA 3OBIA 3L3BA 1SHLA 3RRNA 1KZ9A 4ZANA 2ZT8A 5L95A 3JY6A 1DRWA 1UBMS 3B13B 3ZWCA 1XHFA 4DV1B 1FFBA 4KWHA 5CDFA 2VUIB 3QU9A 4Q3LA 4RESA 4WK6A 3RROA 3K9NA 4K6OA 3HZOA 5A71A 4IGKA 3VYVA 1WR8A 1GZ3A 3X1JA 1F2TB 1TLFA 4C78A 2XCOA 2ZBEA 4PY2A 4UUAA 5EHGA 5C1DA 1VYVA 5E7QA 5KYUA 4MZDA 1UCFA 4NX2A 1NVVQ 5IZCC 2ZPTX 4GWKA 2VF7A 2GN2A 4JVSB 2IWHA 3VNAA 3ZWOA 4Z4GA 3DOOA 4DF3A 3DEYX 1PV1A 1LC0A 5GJVC 2BSAA 4V03A 1U5BB 3E5RA 1T35A 2FVYA 2W58A 1CR0A 3LECA 4KVFA 2HHAA 5A6SA 2E5FA 5I4IA 1FNCA 3LVFO 4PHHA 2PUGA 1RLJA 3NFRA 5FO1A 3GAMA 1M1ZA 1TXGA 5HR5A 1IJFA 3LNCA 2ZBUA 3M6UA 3FSJX 1U3TA 3W34A 3BQ9A 3HHEA 2QGNA 3CZQA 1BYIA 1OYVA 2QL7A 1OJ7A 4XEHA 1NYRA 3BKWA 3U4DA 2IS6A 4O4JB 4DR4B 3WA6A 4LBYA 3FPAA 1RVV1 3FWHA 2BFBB 1CHNA 1E2HA 2QLNA 3AB7A 1K97A 3P9YA 4KOAA 2M6SA 4R2LA 3JQAA 1QVZA 4JH0A 4QXRA 3S44A 3MXOA 3SXUA 4RTLA 1D6JA 4DANA 1U02A 3L7OA 1UPFA 3NKVA 4NMHA 1YVUA 4JKYA 1FDVA 2AFIA 2E37A 2ZKIA 3PNKA 5E4FA 3QUQA 4MMXB 3T7IA 3WGYA 3P9XA 1VCNA 3AFHA 1UDXA 3E0XA 1OBFO 1ZGBA 1PR5A 4O4LA 3RYIA 1JN0A 1TJPB 3SZ3A 2FZ5A 3O92A 1II8B 4DJAA 3H1GA 3UXEA 4JI0B 1QRRA 1XFAA 3HZRA 4BL5A 1UDRA 1PFWA 2C9ZA 3OJLA 2DVMA 2GZDA 2G9NA 1SO8A 4G65A 5H68A 2WT4A 1ZI9A 3DFKA 1VMAA 3ICEA 4RAQA 1HFKA 1QHNA 1ODJA 1UBFA 5LPNA 3IKJA 1TW2A 1XMSA 1P4HA 3F7MA 1CF9A 1TAUA 3B53X 1W0KD 5L4SA 2CL5A 1JZTA 3KFVA 4JOCA 4M53A 3DNMA 4OXIA 3QM1A 2WU8A 4EYOA 2ZTMA 4ETNA 3GD7A 1E2LA 1DXHA 3OC0A 4YRZA 1P7ZA 4F4IA 1HFWA 3WBFA 1Z0FA 4XB1A 3OKFA 4D46A 2WIJA 1MOPA 2BGNA 3F71A 1JIKA 3U44A 4W8GA 4G0OA 3EH2A 3NGLA 4B83A 1NXPA 4LDZA 1O95C 1R50A 3UB4A 5KYTA 3LX5A 1GYPA 1Z5OA 3RD5A 4G67A 2ZGVA 3IA7A 5SY6A 1JVSA 5KPDA 3GZNB 1V96A 3PUXA 4O4HF 1TCBA 1XCPA 4FC6A 1QPZA 1Z39A 3KT3A 2P6RA 2XXAA 4OLAA 4Q4JB 3ZUGA 1BXZA 2VK1A 4ZQIA 3AESA 4MDEA 5CVDA 2O0KA 2CF5A 1PK8A 1NRXA 1YVDA 2ZE8A 4IKOA 2OORA 3RIMA 5CEFA 4GOOD 5ARBA 4EPRA 4AJEA 1W35A 2HBYA 2O3UA 2WWXA 1NSYA 3FGNA 1TRHA 1XZBA 3KE8A 3OA2A 1H0SA 3HLYA 3PIRA 4JL8A 1U5CA 3ANLA 2WV7A 3GWGA 1N57A 4BFSA 3LY5A 2WHPB 3MMSA 5C4MA 2NUTA 2PKEA 1QQAA 1GNQA 2OV3A 4LWOA 2POQX 1A9YA 2MTBA 5DYWA 3U4MA 1T9GS 3OIYA 1C8VB 4GXTA 2HADA 4QU9A 5TMBA 3SIXA 3MT8A 3V4LA 3VAAA 5AUPB 2BUBA 2X8AA 4TSRA 5DMXA 5HKKD 1NKSA 1YZKA 4XDYA 4P1ZA 3ASVA 1FX0A 5K99A 1JVBA 4UAGA 2BJHA 4J0FA 1C4XA 2G40A 2ERYA 5BQ5A 3TIXB 4ICIA 1J24A 1GU0A 1XC7A 4LJLA 3I53A 2EHJA 3VX3A 1NC1A 1JLKA 5B7NA 1FZQA 1J8FA 5B6IA 5FWNA 3MWJA 2EIXA 3E9EA 4AECA 5HIKA 3WKBA 3DMYA 3NIGB 4RCZA 1EP9A 2ECQA 3BXEA 3FZNA 5J9FA 3TW6A 2J32A 3ZZUA 2L69A 1Z8NA 1LS1A 4LSMA 5KVVA 5IX8A 2NYVA 4FFBB 4EL0A 1UEJA 2ZIXB 2AVDA 2QYOA 1BFKA 3CHYA 3DG9A 4LMPA 1NNEA 2Z83A 5K0BA 4QUEA 1A77A 1V5WA 2Q8PA 3IR7A 1V1RA 4D4MA 5BPHA 4RPIA 4L74A 3CGWA 5KREA 3GJTA 4RYLA 2YMQA 2O6LA 3KEMA 3EJWA 1GM5A 4LCBA 4L72A 1RMTA 3QVWA 4IDCA 3KZMA 4CLEA 1Y4DE 3KOOA 4A8JB 2A84A 4EF4A 3FLBA 4EBFA 2HMWA 1ANKA 1RPAA 1YS1X 3OT1A 3IAS1 2R6AA 5IKOA 3E3LA 1DUVG 3D43A 5U4QA 4ZYTA 3NORA 5DHQA 2VT2A 9GPBA 3SC2A 2WKRA 3DMGA 2HLNA 4FFVA 4IAOA 3OE1A 2DHDA 1WW8A 3IBSA 1PNQA 3O84A 2CZQA 2WVJA 3IPLA 3KWMA 3PI7A 4Y6OA 4C03A 3BIFA 3ONNA 1ZD4A 2VCHA 4XA8A 1ONOA 1ICIA 4MUYA 1CQPA 4CKZA 5IRCD 2VEDA 2BFWA 4I5DA 4Y2SA 5E7JA 1YQXA 4RXMA 4EMSA 1AGXA 3EOZA 1G6KA 2NXNA 4DLBA 2WIKA 4LF7B 2C3OA 3KDAA 3WDLA 1LPAB 3N7AA 4EPXA 721PA 4EM6A 3KSZO 3ANYB 5I3CA 4XVRA 5LZ2A 2P3SA 3OIGA 1BJTA 4FKZA 5DHPA 5LKRA 2XV1A 4IH1A 4JI5B 2QVXX 1W8IA 1KK0A 3LDGA 3N0TA 1Z8DA 4D9MA 1E8MA 3CXRA 4ND5A 4YVFA 1VJDA 5E1MA 4MQBA 4R98A 1I3OA 3FFBA 3JPYA 3FCAA 3OECA 1SFRA 5G1OA 1SKBA 3RGGA 4GRAA 2E55A 4BAZA 5K05A 2MHCA 1NN5A 1CNEA 4YPOA 5JNVA 4I36A 1XF9A 3QKRA 4XXHA 2GLTA 1JYFA 2W7TA 2E82A 3G2KA 4PNHA 4EUFA 1KI7A 3F67A 3SZMA 1FLVA 3OJOA 1HY3A 1IHYA 2PYDA 2Z2KA 3WKCA 1OGJA 1ZGGA 2C96A 2YV2A 3FJ1A 3LBIA 1I30A 3KQKA 2PVPA 3DKRA 4UNIA 1L7PA 4QOGA 4Q4AA 3VH3A 2RHCA 2ANBA 1OE0A 1Z7GA 1IB0A 1I94B 4WBXC 3DF7A 4HXGA 4Z3KA 3J81k 3PJGA 2QQGA 2V8BA 3GLVA 1PUJA 5LOVA 1VC2A 2UVPA 4OUKX 1HEYA 5TQ0A 2OB1A 3R3ZA 1N2GA 3C3JA 3RYHB 3L7JA 1NBMA 3MVEA 5HFJA 1ULUA 3JYNA 1J9EA 4M89A 3FDZA 3BB4A 1SQFA 5AHWA 1AOXA 4N8DA 4AMYA 1US8B 2H11A 2OWDA 3LSTA 3OCVA 3IT0A 4XW2A 2ODBA 4MEJA 2OC9A 2NUBA 1DJPA 2JAPA 2HJVA 2BFEA 2PGNA 2H0AA 3B5EA 4N82A 4EY6A 1B00A 2WQ6A 1QIIA 3LHIA 1ORRA 3I09A 3KZKA 2CLSA 4U6SA 1ZHOA 1GNTA 1USGA 1ISIA 1EMDA 3FETA 1LPMA 1ZI8A 2X76A 4MCJA 4X45A 4XQEA 1UJ2A 2ZYTX 4LOJA 5CCBA 9MHTA 1J8YF 6AT1A 3ZYZA 5D3MA 2ZG6A 2LVBA 1CQZA 2XTMA 4X71A 4C4OA 1XVAA 4CF7A 1MJNA 3ETGA 3NTRA 4REOA 1A4XA 3ICQB 1PJ2A 1NBEA 3DZHA 1M8GA 3PXCX 3VGJA 4NG4A 2F1OA 1KWKA 1WHTA 2P9QA 4AJ4A 3WK6A 2DBQA 2JAHA 4QBIA 1QFJA 1QO7A 1P9LA 2BGTA 7MDHA 5K4GA 1KK1A 4FWTA 1CJMA 3MCZA 4HLUA 2VHVA 3KAPA 4PBRA 3G5LA 3HCOA 4D0LB 1PGNA 1WUJS 5FUXA 2XCRB 1N2EA 2G1PA 1MO3A 3QY0A 1R1DA 4O4HB 4YJ3B 4JYAB 2ZIZA 2JGDA 4ZREA 2YL2A 5T8KA 1UBCA 2BEWA 1ZZGA 3UPTA 4NCBA 2XCLA 3B85A 3N87A 3HCPA 1QGUA 3JWIA 3VZSA 1JIVA 1XTBA 2HMUA 2V1XA 3QKWA 4MHTA 1LWOA 3HYNA 4G23A 4LBVA 1IBMB 5B1IA 4UVIA 4PZCA 1ZAYA 3W7AA 5JHHB 2RMKA 1G1MA 2Q1YA 10MHA 3ENKA 1JDNA 3EXEB 2FY8A 4KWIA 4MO9A 5ALJA 4LECA 3WVNA 3K0SA 3LFHA 2GDZA 1MABB 1QG0A 2B9VA 3CF4G 2MMCA 3PCTA 1UM9A 1NE2A 3AVQA 3CLHA 4GZ3A 3M3DA 2IX3A 4Z7NB 2P7IA 2FPPA 1QCDA 2ZYGA 4IO1A 3KQMA 4LE1A 4GXQA 4M8IA 3U44B 1LK7A 1Z2CA 2Y1KA 4LYAA 3L05A 5KQPA 4RTPA 1U2DA 4UQOA 3ZDZB 1YSCA 5J47A 5FJIA 2FW8A 3RWBA 4D79A 4Q00A 2ZB2A 5M2QA 1UWKA 5BPFA 2XCUA 3EA0A 5JMWA 1E1RA 3PEVA 4PO9A 5F1PA 2AD5A 1IFXA 2DLNA 2HJSA 3FBWA 1EGAA 4H15A 1EK2A 4PC3A 3O74A 4DVJA 1Z4JA 1PUIA 3F5QA 3GFBA 3A05A 1MHPA 4AMGA 3PG5A 4I4LA 4ZAGA 1ECPA 4RQTA 1UAGA 2J7PD 3V7WA 1D0VA 1YDHA 1E8DA 2XTZA 3TUIC 1NOKA 2WU4A 2NNLD 4F5EA 2JGJA 3LPAA 1N5RA 4MVJI 3WS7A 1RAIA 4E4RA 3QTBA 1VQ1A 4FSDA 1PZEA 2ZZMA 5B2EA 1PK7A 2PGDA 1ZUD1 2VVTA 4B74A 3VPGA 4FCVA 5EWJA 1WCYA 3PGMA 1Z2AA 3UJAA 1PJ3A 4GLOA 1TIPA 1K8YB 4GBED 5EERA 3MCUA 2JBHA 1VL5A 4WADA 1Y34E 3DOEA 2VNHA 3F7TA 4OHVA 4TKUA 1TFUA 4YCLA 1WB6A 1YK1A 2OOSA 9LDBA 1Y8CA 3E3OA 4M55A 1LLCA 3VZCA 2IGTA 2GT1A 1GAEO 3CUKA 3FNEA 1NU6A 1R12A 3C4VA 4B80A 1JSLA 2FFQA 5A1TA 4DV4B 5K09A 4P0QB 4L16A 2HT1A 1IB6A 3JQFA 3T1HB 1ZOOA 5DTJA 1OTYA 3LY9A 1RNLA 1TE2A 2D1QA 2ZI4A 2C5SA 1AKMA 3AUJB 1YQEA 3NRJA 4MGYR 4OQLA 1E77A 5BMOA 2OM6A 3O2NA 3BT7A 4JGIA 4HH0A 3NC1C 1MC5A 2VRCA 1TGYA 2OZPA 4IINA 4YONB 5K20A 4LSZA 3DBHA 1IATA 2B9EA 3EC1A 4MWEA 2C4HA 1YCDA 4DLTA 1N77A 1L5KA 3RARA 3STYA 3GUVA 3OFNA 3TNJA 1QYIA 2A1UB 3LQ1A 4PRZA 2P3QA 5ITVA 1JT2A 1UK9A 2FPGA 2R8OA 3OCYA 4FGLA 3ILVA 2KM1A 3IV9A 1G3UA 2AFVA 4Y2PA 4XDHA 2QNRA 1N2HA 1NAHA 3TKYA 3T3NA 1NIJA 2H4FA 1WPQA 5EKXA 4A23A 1T36B 3QI7A 4DZZA 3IAFA 4G37A 3C45A 1ZGAA 5MN4A 2P1DA 1DBVO 4RV9A 2C9CA 3RFUA 4KXYA 3F47A 3KSRA 4WZ6A 1TJ4A 3HL0A 3S1AA 3PXGA 1P9NA 3SYLA 3VPBA 4BWYA 2P5TB 4XSHA 5KQGA 1YCFA 4HRXA 2ABWA 3L7LA 2P0YA 3ZDEA 2W22A 1SCUA 1DQNA 4D9GA 3NG1A 2DHRA 3IUYA 5ITZA 3UKOA 3TLCA 2XX3A 1WKVA 3LO8A 5BP7A 6Q21A 1W2HA 3OIFA 3QITA 3WLNA 1DGQA 4NR0A 2OV4A 4LWZA 1U7UA 5GMOA 1E1RD 3EEOA 2Z2IA 4Q3EA 2X8JA 1O96A 4LWQA 2H8GA 4DJ5X 1TNDA 2G5GX 2R5WA 4MVJD 3HBFA 2P78A 4RDCA 3RS4A 2Z2XA 2PT6A 4MVJE 2HN9A 3K9QO 5CVUA 3U40A 1Q0ZA 1WB9A 2PZGA 3WK9A 2FN8A 3EISA 1J6UA 1L4MA 2BV3A 1WDMA 1EX6A 2FQ1A 2NVUA 3H2GA 3PF8A 3UXMA 3W5SA 3WRVA 4AIIA 1JAXA 1DI0A 3VPSA 1U0LA 2WJHA 3TX2A 2PSHA 3EY4A 1KY3A 1GP2A 1SUAA 3HPQA 2NZXA 3EC2A 1C14A 2O8CB 3GFOA 1T5DX 2ZUWA 1TKAA 1JJBA 1HSZA 3PPVA 4WY5A 3T4EA 3ZI0A 1ZRSA 5K01A 2PH1A 2R4TA 1U9IC 1BDBA 4TMTA 1PJCA 3RTDA 3BOSA 4GWGA 2P0AA 2QJWA 4CT4B 1QNLA 1SPXA 1SU4A 4IDBA 3DVLA 4B4WA 3L8HA 4P7FA 1KAHA 4PGHA 4DIOA 3MTDA 5K45A 4N3GA 1M34B 4MEBA 1LC3A 3CB4A 1JWBB 1N7HA 4QPPA 1U28C 4HUJA 3LPNA 4LHWA 2DUJA 2EKLA 2BGJA 3I2KA 5CT8A 3CLSD 2VJMA 1NIPA 4M9RA 1CUFA 3H0EA 1AURA 2VP2A 4KREA 1O6ZA 1GFIA 2XYQA 4NENA 1E3SA 1A9XA 2ZBVA 1VRVA 1PQWA 1RM0A 1UXKA 1KZ4A 1ZBDA 2AL7A 4P82A 5TEVA 4ZICA 5L3VA 1KQGA 1RRCA 1D2HA 1NF9A 1NY6A 1VCHA 3ZY2A 1KYZA 4EKNB 1BU8A 3IMCA 1VPWA 1S0UA 2R7NA 1TZBA 3TTWA 5H8WA 1GPAA 3ANMA 3HY3A 2WPDA 2BEJA 3OQJA 5BXQC 1VMEA 1A7JA 2BFDB 5FLYA 1P4GA 1N8KA 1X7HA 4IIGA 5MDHA 2H2DA 3ND6A 3VZRA 1BTOA 3PEYA 2JI4A 4DWVA 3NAMA 1TUIA 1ILEA 4JI7B 4MR8A 2HBRA 2PXHA 1O1YA 2X22A 4EVRA 4WOBA 5HF8A 3R7AA 5TPZA 4DKXA 1GTL1 4BWVA 1P62B 3QFFA 1JALA 1M6VB 1UODA 3RVBA 1MAVA 2VHTA 3WIVA 4WUVA 4L78A 1FBTA 1II0A 5GONB 3AF3A 1P75A 3M2PA 2G0AA 3MZ0A 1XA4A 3L6EA 4G0PA 4M9SA 2BEWB 4JUCA 2Q49A 5TPZD 5AVUA 4BNWA 4J29A 3THWB 4M6WB 2GFIA 1R4ZA 3QWBA 2Q3HA 1YQDA 3DCIA 1VSVA 1VLMA 1N2ZA 2XWJI 4DVGA 3ZE6A 1K6IA 4Y67A 1XEFA 3RF6A 5DIZA 2BM1A 4KQHA 4O08A 2R6HA 1FBNA 1GZDA 3WSWA 1I9GA 2I0FA 4QQ8A 1K0FA 4JKOA 4DUZB 4EENA 2HEIA 3V8QA 1YJXA 2JBAB 1KZ7B 5G0SA 4R69A 1OA0A 3H1AA 1G2OA 2RONA 1VE3A 3O38A 3QVGA 5AKXA 4BOYA 3CA8A 4EO4A 4DRXA 4HL6A 4CHGA 4BNDB 1S6YA 4JGBA 1NQUA 5EPEA 4QUAA 4I81A 3LW8A 2QM8A 4K87A 4KK4A 3S68A 4M1WA 2UZIR 4NFLA 2J0EA 5J5VA 1LK5A 4E08A 2XB4A 3QK7A 4WNIA 3NVDA 3RU2A 4II3A 3THSA 3AC0A 3ZWNA 4MV0A 4QBKA 4TS1A 3TB6A 2F8SA 5GQSA 3HO8A 3CRNA 4YMSA 2IOFA 2EV9A 3VKGA 3N0RA 4M7OA 3LO5A 3I28A 4UNQA 1QHHB 4GFDA 1LBQA 2HK7A 4KCGA 4EPYA 3K05A 3ZJUA 5K0JA 4DYHA 2CK3D 4L22A 3U6BA 2X9NA 3KQNA 3ECSA 5E6SA 4ZALA 1YDFA 3Q0IA 4AXXA 1YR1A 1PFKA 4RVUA 3C4QA 1TVKA 3FHLA 4WLVA 5I4KA 1C9DB 4LXUA 2PPLA 2AOWA 3GPIA 3HSYA 1MA0A 2VP9A 4M76B 1PQUA 1W6UA 3B78A 3I04M 3Q5GA 4KIFA 4O29A 3B1JA 4AP6A 2NZ2A 3EGXB 3U6KA 3QWAA 2B0JA 1Z4PX 1E98A 1T4DA 3O1IC 1TPZA 2ATEA 4QWWA 3IERA 3NHWA 2NWQA 4M9ZA 5CM9C 4B6RA 2V55B 5HCIA 1E1CA 3HCNA 3S40A 2ZUVA 2D5IA 2C98A 2ZB3A 4UVDA 5CU7A 1IBSA 3KAKA 5IK2A 2ISQA 1E69A 3FFTA 5B58T 2OGTA 1OLUA 3B3FA 4JK3A 5REQA 1XHEA 4BBZA 4D4KA 3HNRA 5KVQA 4ZAFA 2NP7A 3JVVA 1H6AA 1ABFA 3A3PA 3PQ6A 5CNMA 3A4YA 1M8JA 3OPYA 5DH9A 3N2YA 1B6RA 2EDCA 2H7CA 1HE2A 4FI3C 2AOVA 4JN6B 5JDCA 2E18A 4PPGA 4U9HS 2WW8A 3ZVLA 3ORSA 5CB4B 3EIHA 3OU2A 3K0EA 1BFDA 4X8HA 1UJ4A 4HPJB 2CE7A 5EJ7A 1N5LA 1PWEA 4KSCA 3U3OA 5I9LA 2EKDA 4FT2A 4UCXA 1FP4A 1U65A 2YFKA 5AKJA 4FX2A 3H8VA 2VNAA 3GBPA 1JNYA 4TTQA 1NPYA 2RCYA 1BA3A 1ML4A 1HTTA 4TRNA 3EYWA 4CU2A 2F48A 3DZGA 5KOHB 1LTQA 1R0RE 1WQ1R 2HXGA 3HP7A 2ONKA 3A3OA 5I8ZA 2M6LA 1GT91 1BVHA 2UZ1A 1VKZA 2OE2A 3HVHA 4UUMA 1ULBA 3FAZA 3SWWA 1CEEA 1XZCA 2ZAOA 2PG3A 5D86A 1QQTA 2CFRA 3NNSA 1N6NA 2NU8B 3A27A 3NBXX 2Y0PA 4C0SA 5J2UB 5IFLA 5J43A 1RZRD 2AN3A 3ZWXA 5BMVB 2QZPA 1BW9A 1GZ6A 1AV7A 4MKZA 4P0TA 4H35A 1KH1A 4KXXA 3ZD8A 3UBMA 4S04A 2BE9A 3MAAC 4GBGA 4UULA 2VTDA 3O1HB 3BIWA 4KVAA 2A4KA 5AVWA 2RK4A 3QZUA 4KDEA 3W6NA 1GQ2A 4EVIA 4ZKDA 5IM4F 1JR3E 4KR7A 1SC6A 4L8VA 1OLSB 1YS9A 5EGNA 3DFMA 3U1TA 1CZKA 1Z5ZA 3CSUA 3KPYA 1SQ5A 1JIUA 1T5OA 3R0JA 4Q37A 2YJ3A 3RTAA 3UHPA 4BNMA 4A0GA 2J48A 1X92A 2Q3EA 3AR3A 3DKVA 4Y6PA 2VUSA 4DA6A 3B3GA 3G5TA 3NOQA 3TECE 3R7DA 4C6TB 3ZZTA 3ET4A 1OMOA 4CV1A 1P1IA 2ZBRA 1FLDA 2Z4SA 3MGAA 3ZYCA 4DMFA 4LFBB 1G6HA 2DECA 1F0KA 4IS3A 2WIBA 2P2DA 3L4BA 1J8DA 1ECCA 3ADCA 3BHIA 3AEKA 3TD9A 2IX9A 4FZRA 4D97A 1QONA 3GLIA 1RQXA 4EI9A 2PL5A 3OX2A 2Z5GA 1QJ4A 2XUGA 3JD2A 4JXJA 5FTJA 1HG0A 2VCYA 3QVVA 2GZHA 3HSSA 3OQBA 3LVQE 2G06A 4BLVA 4PSUA 2G80A 3AFOA 4KAXA 2ZXUA 1JQAA 3KTAB 1EX1A 3D8SA 3LHFA 1VM6A 3DJYA 3II6X 3IKVA 4QE3A 3OTQA 4F3NA 2QBYB 1INLA 2Q9CA 3EIUA 3I0NA 1ISRA 1JQ3A 1QTNA 1NW4A 1UINA 3IX7A 4EG4A 3ZLBA 3L9XA 5FNVB 5JUWA 3JRXA 4JBHA 4NOJA 3AI1A 2WG2A 1QKIA 1MZVA 4TXLA 4EECA 5ALHA 2CMFA 2NO9A 4MW9A 2Q5OA 2W6PA 3JSAA 5ANRB 3W2TA 4J0QA 2RB4A 2XVYA 1Z22A 3CNBA 3RV4A 3K4HA 5KNCA 5IJ0A 4DR1B 3HA5A 4WK2B 5CH5A 4BVFA 3K70C 1NPDA 2V9PA 2FFHA 1GA6A 2I78A 1DDIA 2CUZA 3IRUA 3KR0A 4OJYA 5ALZA 1FDIA 4ZA2A 1UJ6A 4BO5A 4ETWA 1FXWA 3CVJA 4XGKA 1XV5A 3FNRA 1C30A 4QGFA 1Z4MA 3QEMA 1MNQA 2HCRA 2IQ5A 3UK1A 1FVXA 1RYNA 4RGBA 4J1TC 1KYVA 1GNVA 2FSFA 3DO5A 3PEEA 4YJHB 4CZ2A 1IU9A 3VR3A 4KAJA 3PD1A 4ZXFA 1P3Y1 1TK2A 4UHJA 5CPBA 5KB3A 5TIIA 4PQRA 4F93B 4LNUA 1JSXA 2QW0X 1N1GA 2HPZA 3G8BA 4YRJA 1JR4A 4BV9A 4EFKA 5CXSA 3ZGLA 4HFJA 1ELOA 2XTNA 5KKCA 3CZ4A 3DE2X 4MCIA 4X6YA 4XIJA 1P72A 1CERA 1Z4KA 2AYXA 4BFWA 5DE3A 4BEBA 1B43A 4WV3A 2NZVG 4EBBA 5JCPA 3H9BA 2PV7A 4OQDA 2JLVA 5HOEA 2OZEA 3DUFB 1XK6A 3PFKA 3QELB 4E33A 3H4MA 3R09A 1XYVA 1HOXA 1P4RA 4E5SA 1KRXA 1BQ3A 1RXCA 1UDCA 3HTXA 2FWBA 3ORYA 3LMKA 2OCPA 3GZ4A 1WL8A 1GOTA 4XGIA 2ID8A 1UDWA 2G9RA 1NMSA 5KOJA 2UAGA 2PBRA 1YB7A 3I2YX 4BRWA 4AXBA 4RVNA 2P6PA 4B8ZA 2W2LD 5DBFA 3R7WB 4B3XA 2UUPA 3DYVA 5IUNC 4IIBA 4DM7A 2CVOA 4B85A 1NXTA 2F67A 1SPBS 4QG7A 4TZTA 4PCLA 3ROFA 3PGKA 4M0UA 3ASZA 1HWYA 1ZD1A 4RV4A 4RY0A 5IDXA 2D2VA 1NASA 4Z1OA 1D2EA 1R18A 4O2BF 1ZINA 3I61A 3GGOA 5DGDA 2EBUA 4JT8A 4UBLA 3WXBA 3W8EA 5FWYA 3PJEA 4JSRA 1EE9A 1ORVA 1Z6PA 4MQ5A 1QRDA 4G1CA 4N9QA 3UO8B 1JTVA 2BFOA 1T4CB 3NVMB 1OBVA 4P53A 1TTTA 1EG2A 4NZZA 1NXVA 5IVDA 4F2DA 4GO1A 3TJRA 4K9NA 2DCMA 4G09A 3LLCA 3MAGA 1V6CA 3FYUC 5BR8B 4D8UA 5AM2A 3O4IA 5CIQA 3D5TA 1ZK1A 4U39A 3SG0A 3EARA 1OPXA 3OFSA 4YT2A 1NM5C 3AL2A 2QMQA 1TVKB 2VHWA 2ZYUX 1URPA 4ADSG 4ENSA 1WPXA 4BNVA 1CQIB 4OUDA 1JDUA 1THTA 2ZULA 3UTDA 3L1JA 4DMLA 3RASA 5MHTA 3EGXA 4DAEA 3ZDXB 4CJXA 3R5KA 4Z0NA 5ELLA 1U0GA 2QW8A 1A98A 4MV6A 1ZD8A 5JS6A 4IF4A 1TT5B 3MSCA 2GXUA 3ELYA 3IIIA 4CETA 2AFHA 2HK6A 4P5PA 3AMVA 5L3SB 3AP1A 5ISMA 1DAGA 1T5HX 1U7OA 1MKYA 2AHOA 2G63A 1IUKA 2EJVA 3BKXA 2FP3A 3QG5A 4J76A 5H80A 4GKJB 4K26A 4QO7A 5JXIA 4BFUA 3T1YB 1AZTA 1GPUA 3B3AA 1FQWA 5JWRA 5FPPA 3UAOA 3MWDA 3C3WA 1EDOA 2BBWA 3KKQA 5ALLA 7YASA 1ZJJA 3CE9A 3ROPA 5EMHA 4YCAA 4GOLD 2IUEA 2YW9A 2VHQA 2B21A 4URYR 3R6LA 1QDEA 2Y9MB 3NXSA 4RADA 1J1IA 1PL7A 1TYBE 1WXQA 4HDMB 5DULA 1B0ZA 1USUA 5K2MA 2EP8A 3WLEA 3NT5A 1B8OA 2DC1A 4EMBA 1H4TA 4OAPA 4WFKA 2FLKA 3B8HA 3L7CA 4GOMD 4QXOA 4DIKA 3DE0X 4U2FA 1HNXB 2IHVA 4ZT2A 1TYDE 1XEXB 2PY6A 3EAFA 3HFJA 3PKJA 5L45A 4QBTA 1EXNA 2VP4A 2VWPA 3LLVA 4UMFA 3TH5A 2OD2A 2RCNA 1I6KA 3RW9A 2PEYA 5DCLA 1OX5A 1KPGA 4R7TA 1KSJA 4U0JA 3SC4A 1O87A 3VYRB 3ZJ5A 2DQZA 3PXDA 1B73A 3THOA 2E5WA 2IHYA 2LW7A 2WM9B 4I66A 3M3PA 4BAUA 1DO2A 3HXPA 3T94A 5IEJA 3V1LA 5B6JA 2C42A 1F17A 3Q11A 1QG2A 4WBSA 3C70A 1L4GA 3CH4B 1OWNA 4WI1A 1UJBA 4NFYA 2JIPA 2PUVA 1QOZA 2J09A 4LJSA 2E87A 2NYAA 3HJNA 1AU9A 1X94A 1UM8A 4OIMA 3UGKA 3WLRA 3ICWA 5KC8A 3ENWA 1VE7A 4XX1A 5CT9A 2Z56A 3BRWD 2J9ZB 4TRMA 1GILA 1F4PA 1VBNA 2GNPA 4X7BA 2OGUA 2PX4A 4J16A 4F11A 3JQPA 2XE8A 1E2GA 5TSDA 1YJQA 4ZOAA 4DC1A 4DN6A 4E2ZA 3LUDA 3GN2A 2D06A 4HNGA 4Q1BA 3M70A 4C5CA 2C00A 4ZJUA 2B4YA 2YVLA 3O8NA 1DRUA 4MRAA 1DQPA 3BB3A 3BF7A 2P27A 4LGMA 1N3IA 1GG8A 1CQWA 2E1PA 3VKFA 4KMRA 3TZLA 3T34A 3A9SA 4LV8B 3E9CA 3FPFA 3ZTWA 1P0IA 1THGA 4Q66C 2WIFA 2IEAA 1EBBA 2D54A 2Q6VA 1O5TA 1PI3A 3QYAA 3V4VB 4URWR 4QOEA 4NE2A 2YQ5A 4MRNA 3B5IA 2HXYA 2XMBA 2ZAMA 1KDOA 5EHIA 3RHZA 4W5HA 4D4GA 5CLLA 2WICA 2A14A 2R1VB 1W52X 1EEHA 3JARB 3BMQB 3QUAA 4CL2A 1IRXA 1GFZA 2PX6A 3FH0A 4W7IA 4X41A 1NJSA 3T3GA 5CD9A 1FIUA 4D9IA 1DS6A 3FHJA 3WFZA 3WWDA 2QNIA 2QN1A 4TWRA 2PUFA 2X41A 3O3MB 1N6IA 3KZCA 5FQNA 3ZQJA 2UYCA 1AKVA 1CVLA 4WKOA 3I9MA 4L8FA 4INPA 1U2EA 4MKFA 5CR9A 1OWOA 5C7OO 3PENA 2X6RA 4X1YB 1GR1A 2B4AA 3NHFA 4XX0B 4DCUA 3KK0A 3IJPA 1U6JA 1GY8A 1J0XO 1F1JA 1F2UB 4LBWA 4RZSA 1VYUA 3N2GA 4KXVA 5FUYA 1D6SA 2VJDA 4I55A 5EZYB 1KOLA 1R16A 4C7KA 4E4YA 5JAZA 5LU8A 3AQ4A 2YV1A 3P4XA 4RY9A 2POCA 2QXTA 2WT8A 4TLBA 1FTSA 2N0SA 5ELMA 3ADKA 4HNHA 4TTRA 1ZH2A 1Z6AA 2H7XA 3AEQB 2PV0A 1N25A 4BNGA 4GGMX 3V8MA 1KKUA 3B6JA 1ZNYA 1XDGA 3AYZB 1ZD9A 5H4HA 2OB2A 2ORWA 3W3AA 4B6JA 5A6VA 1NMYA 1Q0LA 4WN9A 4ENPA 2RHHA 2G1UA 1ZISA 1TK3A 3T1NA 5T6MA 2JLSA 4NJMB 5K8UA 2XUDA 5DYTA 1DQRA 1RXIA 4B76A 4CFSA 4BO8A 2F3RA 2VDJA 3HRKA 2P79A 4OFBA 3TSOA 1FB5A 3HM2A 4INOA 5DK4A 2W2KB 3CLSC 3H6HA 5LQAA 1KYQA 4EI2A 5H9WA 3LPDA 3Q8MA 4K3UA 2VJAA 4N7RA 1JAIA 3ONWA 1BVUA 2GETA 1V25A 2CUNA 2PDAA 2D4HA 3MMZA 4FBMA 4JAVC 4R8VA 4RF3A 5FDFA 3AKDA 3K4PA 4PBSA 2B99A 3W8RA 3ELWA 2QTVB 3ZZNA 2GA9A 4E1VA 2WT9A 1Y48E 4C7VA 1Z0SA 4YRMA 2NXWA 1DJLA 4U63A 3RSHA 1WBBA 4CLRB 2CFIA 4PGAA 3OZUA 3QH4A 4GPIB 3Q8LA 1IXKA 4NFSA 2YWFA 2Q28A 5E6UA 3UENA 2OBFA 2P2NA 2AEMA 1QU3A 3ZHCA 4G4SP 2WE8A 5M34A 3O4HA 1QB8A 1JMYA 1L7RA 3SJCA 2AJTA 3G2NA 2YVAA 2O52A 2REQB 1OA1A 2IP4A 4YJ3A 1CZLA 4DCNA 1PR3A 1XBTA 4B43A 4EJ6A 1CY4A 1E0DA 1T5LA 1OXXK 2APJA 2NXJA 5BSUA 3BD8A 3DOIA 4BAGA 4MO2A 2C97A 2YN2A 1KI8A 3BH6A 1XZDA 3HJHA 3L5KA 3IB6A 4GMFA 5DBIA 2V7QA 4D3SA 5JJBA 1KQFA 3RADC 3G0HA 1B4DA 5KVSA 2EEPA 4HQRA 3IKMB 3L93A 3N74A 1GR0A 5E8RA 1LDBA 3G59A 4R8MA 3V34A 2FRDA 5I7OA 1U5BA 2Q27A 2XUIA 1WHTB 3EXEA 2QUJA 4RFLA 4B47A 4F96A 3PX2A 2HRRA 2FNAA 2P41A 1UBKS 3R3UA 1BOFA 3KLMX 3WG9A 1SMKA 3UMMA 1DUSA 1DXYA 1XB2A 1WX1A 4A92A 2X77A 4X7RA 5BWLA 3TMKA 5ENZA 1G0OA 3EDYA 3L0YA 2OZKA 1WQ4A 3JWPA 2HIHA 3NIBA 3BJEA 3PVCA 2J9XB 4RD0A 5D1NA 4UTOA 2Z43A 3R9IA 1FW6A 2ZRJA 1DXOA 1NV9A 3A1DA 4MR9B 4D7AA 4BGDA 4PRYA 1G5PA 5K6AC 2BF4A 2PGLA 1Z38A 2B8NA 2DFVA 2ZXEA 2G5CA 3L06A 1QO9A 1IBLB 1NDHA 3MCAA 1VIMA 3IP7A 3Q9UA 5J59A 3ZKWA 4C05A 1OFVA 3KVYA 4WXHA 4D9BA 1PV4A 2AFHB 3OZRA 4P7BA 4Z4HA 3KEOA 1A8HA 4C5BA 1HDGO 1PTJC 3R3VA 1P19A 1XLUA 2Q45A 3WLSA 1E9EA 4BN4A 4FYXA 3EZ9A 4JUDX 4PFSA 1IXZA 4FI3F 1QTIA 1Z3CA 2VSYA 2EGGA 3N2EA 1NZDA 3ETCA 4G6ZA 4L2IB 5IARA 4D0NA 1FJXA 3G9ZA 4AQYB 3ILYA 1RLIA 4NFHA 4BFTA 1FUIA 2D7CA 1XJCA 1P33A 1XSEA 4MQMA 1TX4B 2ECOA 3OZWA 1U90A 3H86A 1J2RA 4K9OA 1HM5A 5HJEA 2HGSA 2YQZA 3DJFA 4W5QA 3G2PA 1UDBA 4MS4B 5IAGA 1HG1A 3VTAA 5IKEA 2HRBA 3TR0A 2F17A 5JI2E 4B17A 2HKIA 4J16C 4EPTA 5A4FS 2VA9A 3P2KA 5CAEA 4G26A 1O58A 1UZLA 3L02A 3IR5A 3WTCA 3OI7A 3VR6D 4G5HA 5GZ3A 2C0CA 2QMZA 4AS1A 2PN1A 2IDKA 3TZEA 5JOQA 4HVLA 1B23P 3AR8A 5DNEA 3CPHA 3FTPA 4RH1A 3L7MA 2XF8A 2ZAGA 4B8WA 2H2GA 2MSCB 3PP8A 4HUQA 1M2EA 3BIXA 3HH8A 2YBEA 1HK7A 3CUYA 3MBOA 4GZMA 4JR1A 1DFGA 1ZA1A 5DYNA 1UBTS 5HZGA 1E2NA 4Q0MA 2R8PA 4A26A 3JYOA 1K7FB 1B6SA 3D3KA 3ND5A 3O4VA 4ALNA 1JFRA 3O7WA 4HT3B 2QN8A 1XAHA 2ZATA 4BLWA 2Q6LA 4MVXA 4GNRA 3NIFB 2CUTA 2EX4A 2P68A 1EWTA 2TSYB 3EFBA 3L0DA 4I8XA 4KBGA 4U0KA 4IUBS 4R2HA 1KEKA 1M54A 4KVGA 2G28A 2WD7B 1UKEA 2GKOA 4H6PA 5E0KB 2EVWX 3K5HA 1EUDB 3M1YA 1BU5A 3AM3A 3MTIA 3TF5A 1SKYB 3NBKA 4EY4A 1P9OA 3W4IA 5HWSA 2D0OB 4MUMA 2VTBB 2PUCA 1O4WA 3AR5A 3CX3A 3UUEA 3ZY4A 3K4QA 3TJZA 4XTRA 1O9GA 3EUAA 3RRBA 4DIMA 3IHTA 2EP7A 1S8AA 3O8QA 1KK3A 2HT6A 3KSDO 4K6FA 2R96A 2FHSA 2IUTA 3T06B 2QEQA 2Y1EA 5JD3A 1C2TA 5J5CA 4F86A 4P32A 4R1SA 3VA7A 1PIWA 5F78A 1U0JA 3GFPA 1NN0A 1QS0A 2Q50A 3GJ7A 3R5SA 5AK0A 3RUEA 1AS0A 4PINA 5JR3A 4G1FA 1MOSA 3Q5DA 3DBRA 3WKAA 4LEIA 3HV0A 1BE8A 3M5CA 3IQDB 3PA6A 4U9UA 1NBMD 5FF9A 1Z4LA 2A1UA 2R6GA 3G0CA 4YMHA 2NU7B 2WU3A 2OFPA 3HPRA 1N2XA 1SCAA 2ZAIA 4O6VA 4X6XA 5JANA 1R8JA 1CUXA 1P7VA 3OTWA 2DHQA 4RLFA 5KMGA 2OO3A 3NX4A 1BHJA 4ACBA 1U7TA 2FGJA 4K81B 3O2SB 4HWSA 1EUCB 4ZO9A 4KN9S 5BO5A 5FFFA 5BSEA 1GU1A 2HLHA 4CRWB 5MN6A 4JVNA 2RAUA 2EWWA 5DFAA 4CCSA 4KMOA 3B1YA 4NQRA 4OHPA 4BC1A 1NVUQ 3G68A 3DAYA 3UT6A 4S35A 3KALA 4LXQA 1TJNA 4P7GA 4PYRA 5FOWA 4BBPA 1JFFB 2EBHX 3TQRA 4DWJA 1R9JA 4PZ0A 1VG0B 5DHTA 1GQRA 2Q2QA 3U3MA 1UKYA 1KSHA 2JI8A 3VC7A 1PJZA 1KJ9A 1Y8QA 4P83A 3IUNA 4LJ7A 1QRUA 5C5IA 2NU9A 1W4CA 4R54A 3D4NA 4US1R 5J4LA 1NG1A 3DOJA 1X2EA 1T4BA 2X8JB 3BM5A 4I4NA 1J8VA 1UBRS 2IEIA 1ZCAA 4OUDB 3KJXA 1CZNA 2AH5A 2H4JA 1S8FA 4EIWA 1XHLA 1JEEA 2GOYA 2ORIA 4XUEA 4KN6A 1JPJA 1G1AA 3O9MA 4ZI5A 4CF5A 5HP4A 3L8FA 2DBZA 1NUHA 1QPGA 1QVWA 4Q24A 5JS7A 1NDUA 3I72A 3KKEA 4C0BA 1PLLA 1QVRA 1YJ5A 3QTLA 2CLFB 3VSEA 4LDJA 3I39X 3RSGA 1PBNA 2J3KA 1A1VA 2I91A 3V4FA 1JDTA 5ABPA 5E2BA 1Q44A 2VWHA 3K09A 2W6NA 3JZAA 4IQFA 4OQFA 2Y0CA 1WMAA 2VDNB 2IHKA 2X0KA 5AI5A 5L7TA 3KHSA 2O59A 1FL9A 5JPDA 3GPCA 1G7RA 4O0LA 2VLBA 4NICA 2OGWA 3T0FA 2EFDB 1P2SA 4F4DA 5HGXA 3TEMA 4C0WA 2ERXA 2H9YA 2WIGA 4KRXA 4YHHB 4P31A 3MTEA 1BXGB 3AR4A 3OH8A 4BO0A 4F3YA 3DZFA 1WB4A 2GNAA 1X7YA 1NWCA 4G0XA 6REQA 3I83A 4GPAA 4N7MA 3HP1A 3O1JC 2XKAA 3HZHA 5LA6A 1Y6ZA 4YNBA 3PIDA 2RAFA 4AMVA 4GI3A 1UKAA 2DLDA 3BQMB 2D1SA 1Z75A 1NX9A 1XAIA 3AVVA 3ANTA 4M99A 5BSKA 5LIPA 2GBPA 3I6ZA 2ZOSA 1E0JA 3ZTTA 3BWDD 4DUGA 5C1PA 1Z6YA 3PDJA 3KR9A