4HSGA

Crystal structure of human prmt3 in complex with an allosteric inhibitor (prmt3- ktd)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
298
Chain Sequence
b'YGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKSLTVTLTLNNSTQTYGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRMT3 protein
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Exploiting an allosteric binding site of PRMT3 yields potent and selective inhibitors.
pubmed doi rcsb
total genus 93
structure length 298
sequence length 304
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4hsgA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4hsgA01
2ZIFA 4RTNA 2BM9A 2CL5A 4LWOA 2QY6A 3BGIA 2PT9A 2I6GA 4HGZA 5DLYA 4DQ0A 3BGVA 3G2MA 3VSEA 2V7EA 1HNNA 1X1BA 2XVMA 2ZBRA 3DULA 4HH4A 1SG9A 5EVJA 5ICGA 1X1CA 1DUSA 2BR3A 3BGDA 3SSNA 3UJCA 2IBTA 4X1OA 2FYTA 3CJRA 3OU2A 2O06A 3EVEA 3CC8A 2XYRA 1RJGA 5DTRA 3TFWA 3A25A 2OKCA 1YB2A 4AX8A 2B25A 3OZSA 3HTXA 4YV0A 3FUWA 3TOSA 1U2ZA 5K0EA 2IDJA 5E9JA 1ZGJA 2FK8A 1R6AA 3FRHA 5FHRA 1RI4A 2O07A 5FQNA 1MJFA 2P7HA 5FADA 5K0LA 1VL5A 1FBNA 3JWJA 3P2EA 4PONA 3A27A 4ZTBA 3FTCA 1RJDA 2NXCA 1QAMA 1XXLA 1P1BA 3G5TA 3F4KA 3ELWA 4HTFB 1Y8CA 1KP9A 3NJRA 5EMKA 3KQOA 4P7FA 5JR3A 3ERCA 5EHIA 4E2ZA 2UYCA 2PXCA 1XTPA 5DRTA 3KPVA 4PNEA 5IH3A 1KPIA 3BKWA 4KW7A 4A6DA 4RVGA 4BLVA 3M6VA 5CVEA 2OBFA 5EIFA 2EFJA 4E30A 1G38A 3QOXA 1VQ1A 4EQZA 3LKZA 4R05A 1TPYA 1R8XA 1T43A 3DMHA 4E2WA 3KR1A 1NW8A 5E2AA 3CJQA 5G02A 4Y2HA 2EJTA 1XCLA 1WZNA 5LQAA 1L3CA 3P8ZA 3R3HA 4IWNA 2OO3A 2ZZNA 1QAQA 3LL7A 5CM2Z 4R8RA 1F3LA 3UJAA 3TKAA 5DX0A 2CWWA 3EVFA 1N7IA 3ID6C 4QTTB 3GRYA 4ATNA 2ZULA 3SM3A 3GWZA 3BUSA 2C7OA 5EEHA 1SQGA 2Z6UA 3ORHA 4AUKA 3TMAA 3HVIA 3GIWA 5K03A 2NNWB 2GB4A 5E9QA 5EZSA 1KHHA 2HTEA 3JWGA 2O05A 3SX0A 3HA3A 4EKGA 1XCJA 3P71T 4AZSA 4YV2A 4RTLA 3LBYA 4XUDA 3LCUA 4RTOA 3IYLW 3PT9A 1AF7A 2R3SA 3HNRA 5K0JA 4P7JA 2YTZA 4QTUB 4GEKA 3PS9A 4QVKA 3C6KA 3UJ9A 5LSAA 5U4XA 1P1CA 1JG1A 2FRXA 2OB2A 3BWMA 3A7EA 4H0NA 4RTPA 5DM4A 3FTDA 5HIKA 1WS6A 2AOTB 3THSA 3U81A 4DZRA 3KR9A 2AZTA 2IFTA 3OE4A 1PRYA 1WY7A 4B17A 4QQNA 2YUIA 2DPMA 1O54A 3SXJA 4PYOA 4GQBA 3KPYA 3PFGA 4YUVA 3NVKI 1P91A 2GS9A 2ONYA 3HVJA 4GOLD 3T7RA 3VYWA 4BLUA 4YMHA 2UZ4A 3P2KA 4RTRA 2JG3A 3NDJA 1RI1A 3GCZA 2YQZA 4KDCA 5P8WA 5HFJA 4OX9Y 1XJ5A 1HMYA 5F2KA 1YFJA 4E32A 5CVJA 4CTKA 5K0BA 3MHTA 1BHJA 3T7TA 3A4TA 5DX1A 1SQFA 4ER3A 3MAGA 1RI3A 4K6MA 4CKBA 4EMSA 3FTFA 1NBIA 1BOOA 3FPGA 9MHTA 5FTWA 3UJBA 4C04A 3GRZA 1XDSA 1AV6A 5GIPE 4X61A 1B42A 2N47A 5E9WA 2AOUB 2HR1A 3PX2A 1QANA 5EQJB 2QE6A 3FUTA 4C07A 2IIPA 5CVUA 5CD1A 4C08A 1L9KA 4HRAA 5GM2A 4M37A 3D2LA 2F8LA 2BZGA 3EEYA 2PX4A 1IM8A 2P3QA 4R8SA 5F2NA 4YUYA 2I9KA 3LCCA 1SKMA 4RVHA 1JQEA 2JHPA 3TPZA 1L3IA 3FPJA 5EIWA 2G71A 3BXOA 4GBED 4GOOD 3TRKA 2FCAA 2ZW9A 3O4FA 4PIPA 3AXTA 2AVNA 3G8AA 5DM1A 3WSTA 1YZ3A 2VDWA 3UJDA 2IH4A 2BH2A 2P1DA 1QZZA 5HEKA 3GXOA 3DP7A 4RTKA 5EMLA 5K0GA 4F84A 2FHPA 5K8VA 5EGSA 5ERGB 1VP3A 2XYQA 2BR5A 3HA7A 2H11A 5T64A 3VC1A 3FUVA 1AQIA 1NW5A 3I5UA 1N7JA 3NDIA 4PIMA 5D1HA 4AZWA 4C06A 4GUAA 5LQJA 4AZTA 3A26A 5FULA 2PV0A 5KQSA 2NXNA 4MHTA 3OU7A 4RVFA 3KQVA 4FSDA 2ZZMA 3I58A 4RWZA 3MB5A 4O29A 3DUWA 3KR2A 4OBXA 3ELDA 3LCVB 1D2GA 3KQPA 3M33A 2PLWA 3HVKA 4PYQA 4IV0A 2PX8A 3CJTA 5BXYA 2QRVB 5LQUA 2P8JA 1NKVA 3EMBA 3KU1A 1JSZA 3SGLA 1G8SA 4CWAA 1FJXA 2VP3A 3P9IA 3UBTA 3DR5A 3KQSA 5LQNA 3NVMB 1D2HA 1D2CA 3GNLA 5LQCA 1ZG3A 4OQDA 1EQAA 4QQKA 4Y30A 2PXAA 5E1DA 3MQ2A 4HG2A 3HCDA 3QOWA 4E33A 4C05A 3FRIA 3NTVA 4OBWA 1DL5A 3P2IA 4OA5A 2NYUA 3OU6A 4RVDA 1ZHFA 3GGDA 3FTEA 2NP6A 2G1PA 3EMDA 1FP1D 3G7UA 3OZTA 5ICEA 3I9FA 2P35A 2PSSA 2UYQA 2VS1A 3V97A 2IH5A 3BKXA 2AS0A 3HA5A 2GA9A 2P40A 3HP7A 5DX8A 2AVDA 3MERA 3ME5A 1JSXA 4WVLA 4X63A 3UWPA 4G56A 3CKKA 4CKEA 5FHQA 4GC5A 2ZCJA 5KS2A 2KW5A 5FQOA 3ANXA 4PINA 4YUZA 4QDKA 3RIEA 2B2CA 3PFHA 1I4WA 2HMYB 2P41A 4IV8A 4RSRA 2XBMA 4PCAA 1L3BA 4BY9E 4FGZA 5FWDA 4EVIA 4DF3A 2JJQA 1EAMA 1NV9A 4PYJA 2JH9A 2PT6A 3G5LA 5K0NA 3FYCA 1O9GA 3R24A 5HOQA 4ER5A 5CIYA 1BKYA 3EVCA 4QVGA 3EPPA 4MWZA 5K05A 1M0EA 2CMGA 3AWIA 5IKMA 4QPNA 4BP1A 2JHCA 3FYDA 1O9HA 3BWYA 3FPHA 2ZWVA 3FZGA 3R9XB 3PB3A 2WA1A 3X0DA 5DM0A 5E8JA 5E1MA 2IGTA 3SSOA 4XCXA 1NW6A 1JR4A 4OA8A 3HCFA 3KQYA 2DULA 5K09A 1SUSA 3KQMA 2OXTA 1WXXA 2PKWA 4ER0A 1JQ3A 3P9NA 5HIMA 1G6Q1 3REOA 2ADMA 4R6XA 3CBGA 5E1BA 5EZQA 1JG4A 2I62A 2K4MA 1WXWA 3V8VA 2IPXA 1EG2A 1H1DA 4GF5A 5EMMA 1X19A 2G70A 5HIIA 2AN4A 3ELUA 2ZIGA 3UZUA 2C7QA 5KQRA 3NW9A 2JHAA 3SSMA 2PGXA 3DXYA 3KKZA 4V0RA 5B1SA 4GOND 3HVHA 1R74A 1PJZA 4R6WA 5DSXA 5EG5A 2FK7A 2EG5A 4RTMA 2B9EA 1NBHA 1P39A 3HEMA 4F85A 4P58A 2XYVA 5DPMA 2HNKA 3PX3A 3GRVA 3QV2A 3KQWA 4QDJA 3MCTA 5FWAA 2E5WA 4XUCA 4PYMA 5CUQA 4E2YA 4DCGA 3P97A 2AOUA 3ER8A 5DM2A 2CKDA 2IH2A 3LHDA 1F38A 4RYLA 3FPFA 2ORED 3NWEA 3UA4A 1VLMA 4KIGA 2ZSUA 5CVVA 1JQDA 3C3YA 4FT2A 3TLJA 5ICCA 4PGHA 1YUBA 3OFKA 2ZZKA 3KPUA 4HGYA 3P9KA 3RODA 2VDUE 4NECA 4RV9A 5JUWA 2A14A 2Y1XA 3B3JA 3GO4A 3OCJA 2GH1A 4RTSA 3C6MA 2FPOA 4CKCA 3Q87B 4PGGA 2PWPA 3VC2A 1TW2A 2G8NA 5BP7A 1JG2A 2R6ZA 3LECA 3BWBA 3ELYA 1NT2A 2AR0A 5C0OE 3EVZA 4PYLA 4FZVA 2EX4A 3PLAE 3DXXA 4XUEA 2NXEA 1X1DA 4KVZA 3M70A 4YUWA 2EJUA 2OY0A 1SUIA 2XVAA 5EPEA 2Y1WA 1NE2A 2PX2A 2BM8A 3P9CA 5C1IA 1FP2A 3G8BA 1ZQ9A 2ONZA 5FUBA 2BR4A 5EC8A 4KIFA 3M4XA 4E2XA 4M36A 3NWBA 3JWHA 4IKPA 2GLUA 3EGEA 2AN3A 3ER9A 4HC4A 2WA2A 2YXDA 3DMGA 5E2BA 1G55A 3TQSA 3LX6A 1UWVA 4DCMA 1YZHA 3GRUA 4PYIA 4A6EA 3CGGA 3SVZA 1KYWA 1EIZA 1L1EA 2O0LA 2ZTHA 2OYRA 1NV8A 10MHA 5CCBA 5DTMA 2PWYA 5FCDA 1FPQA 3LDFA 4U7TB 3FUUA 1XVAA 3KR0A 3R6TA 3KHKA 5LR6A 3H2BA 3G2PA 5LQKA 1X1AA 2AOXA 1OR8A 1KYZA 1RJEA 2G72A 3DLCA 3UJ6A 3EVBA 4EK9A 1SVUA 2P3OA 3HCCA 5DRYA 3TR6A 5DWQA 4DMGA 2Q41A 2P3LA 2PXXA 3B89A 4MTLA 5GOZA 3BWCA 5BW4A 5CCXA 3EVDA 2V74B 1V39A 4LG1A 4LECA 3FPEA 4FP9A 5DT2A 4EKIA 5EEGA 5HZMA 4LWPA 1JG3A 7MHTA 1R8YA 1R00A 5M5BA 3EVAA 1WG8A 2GAFA 3OPNA 5K01A 3T7SA 2QRVA 3B7PA 2ZBPA 2OB1A 4RX1A 1G60A 3IEIA 3DH0A 4JXJA 2C7RA 4HSGA 1IY9A 1ZGAA 4M38A 3RW9A 1XDZA 3AJDA 3KQTA 3M6XA 5GP1A 3HCEA 5DSTA 3LBFA 3M6WA 2PBFA 4PYNA 1JTFA 3IV6A 2YVLA 4BLWA 5FA5A 4X60A 3PVCA 2LD4A 3KPJA 2GPYA 4PCLA 2JH8A 4YV1A 3KPWA 3MTIA 2YX1A 1DCTA 2WK1A 2VZ9A 3G2OA 2PY6A 5F2OA 1UIRA 2UYOA 2PVCA 4P7KA 4ER6A 3GU3A 3CCFA 4ISCA 4PWYA 1VPTA 2ZBQA 3E23A 3DTNA 5GINE 1YFLA 2HWKA 3TM5A 1RI5A 4P7GA 3TKYA 3K0BA 2B3TA 2IDKA 4C4AA 3MCZA 3LDGA 1EJ0A 3AXSA 2QM3A 3MGGA 3OE5A 5FA8A 4FR0A 8MHTA 2H00A 4RTQA 3DMFA 3EGVA 5EKUA 4RTJA 4DKJA 3C3PA 3G88A 3MTEA 2ERCA 4Z2YA 1QAOA 4X41A 3GRRA 3HCBA 4GC9A 3UA3A 3E7PA 5T67A 4KDRA 4V0QA 1M6EX 1BC5A 1NW7A 4C03A 1G8AA 2AOVA 4KWCA 4HTFA 1JTEA 5MHTA 1KPHA 5K0FA 2PX5A 1AQJA 2NP7A 2OZVA 4WXHA 2VDVE 3T0IA 1EJ6A 1RJFA 4CTJA 2QYOA 5EOVA 5GWXA 2Z6QA 1INLA 4MQ4A 3C0KA 4AZVA 4ER7A 1ORIA 2P7IA 2PJDA 1UFKA 2ZFUA 3A7DA 3DLIA 3KQQA 3LGAA 5KVAA 4E70A 1YF3A 5DXAA 2UYHA 1RI2A 1Q0SA 2O57A 2IBSA 3B3FA 1QYRA 2H1RA 5HILA 4L7VA 5H02A 4FS8A 2AN5A 4U7PB 3DOUA 3I64A 5BW5A 4YUXA 2C7PA 3LDUA 1VP9A 3E8SA 5EKXA 5KYGA 4FT4A 3B3GA 5E1OA 5EHGA 2Z6AA 4E31A 2AOTA 3TM4A 3R0QA 1I1NA 3BZBA 3LKDA 4UOEA 3HM2A 5T6BA 3SMQA 1KIAA 2YR0A 2ZVJA 3GJYA 3CVOA 2ESRA 3FUXA 3O7WA 5GM1A 1VBFA 3UJ7A 4QPPA 3JWIA 3UJ8A 3BT7A 3B5IA 3S68A 2IP2A 4GOMD 4POOA 3EEOA 1N2XA 1VE3A 3G89A 1M6YA 1XDUA 3IHTA 1VIDA 5D1NA 3GDHA 3OFJA 5CVDA 4KRGA 3THRA 3L8DA 2I7CA 2OPBA 3NMUF 1KPGA 4CXMA 1R18A 4F86A 5DTQA 5DXJA 3OZRA 1MHTA 3PTAA 2YXEA 3LSTA 2B78A 4BP3A 4M7RA 5EMJA 2ZIEA 3LPMA 3EGIA 2NXJA 1ZKDA 3HCAA 5LQRA 5GIOE 3K6RA 2HV9A 2ZLBA 4FSXA 5C9ZA 3I53A 1Q0TA 1NW3A 4OQEA 1Z3CA 3DXZA 1ORHA 4DM3A 4DA4A 3AY0A 5ICFA 3SR4A 5K0CA 1I9GA 1KXZA 2CMHA 5E8RA 2YXLA 3UFBA 3EVGA 1KR5A 2AOWA 4YMGA 3M6UA 3Q7EA 4PYKA 3G2QA 3O31A 3E05A 1TW3A 2ZWAA 4MIKA 5HIJA 1IXKA
chains in the Genus database with same CATH superfamily
2B4TO 2EW1A 4RTNA 4U7DA 1J25A 5HKBA 1YD7A 3EMVA 1N2CB 1RYFA 4J16A 1TJ3A 2XWQA 2Z8XA 3DULA 4W8HA 5J2TA 4OY3A 2EZ9A 3FWKA 1ZGBA 2I55A 2H4ZA 3DXFA 3P27A 2EFDB 3EXIA 1UJ2A 4Q1EA 4W5HA 4X1OA 3RO7A 3UMSA 2G63A 3OU2A 1L7QA 1CUJA 3PFCA 5F98A 5D00A 1KVTA 3UHAA 1SXPA 2D4AA 3VR4A 2MSDB 3RJTA 3S27A 3IR7A 3B1ZA 1PT8A 3V9PA 1M1XB 2YMQA 2JASA 4B85A 1WB4A 4I9NA 3OFSA 2I8CA 2ZPTX 3A6FA 2FOXA 1IPEA 5AKHA 2B6NA 4EPVA 4JQZA 5A3QA 1L5QA 2A0KA 2FN3A 3CLSC 3IDSA 1R6AA 3LHSA 4O4LB 1YFLA 1H94A 1EWQA 3H5TA 1QM5A 4Z0PA 3NHMA 1SXJA 1XUOA 3IELA 3SE7A 3OQ6A 3RB8A 3O8CA 1JMYA 1FPMA 1NX9A 4ALNA 3HDHA 4ZTZB 4HGRA 3QNWA 4Y2QA 5AOAA 1SGWA 1WM1A 3LQKA 1P17A 4PQGA 1M2NA 3HSKA 2V5AA 3GYGA 1AZWA 1XV5A 2WV9A 1CFJA 3V80A 1FC0A 2CXXA 2XUHA 1SHUX 3RADC 2NNLD 4YI5A 3WKDA 2WTMA 3STXA 1G38A 1GDTA 2WPDA 1VQ1A 2OXCA 4DRXA 1R8SA 2C94A 3AX6A 3UW3A 4AUNA 1CPYA 2W93A 4Q9HA 3LLVA 1M34E 3M5PA 1V8OA 1CY8A 4M60A 5E2AA 4CG0A 7MDHA 4ARIA 1QK3A 4V3BA 3LQRA 5CMLA 5EAIA 3HRIA 3UFXB 4P4GA 2HSWA 4F93B 1YKFA 2PK3A 2YOHA 4F56A 2H7VA 4PSUA 3M81A 5EE5B 3RVRA 1QO7A 4MNTA 2D06A 2JFBA 1GCIA 4EG0A 1OXMA 1M2VA 1UPFA 5BPHA 1OUMA 4Y9TA 2ZIXA 5G1NA 4BKMA 1U5CA 3P4UA 5AK6A 1L5RA 3ROFA 4E46A 5C1DA 4ZA2A 2PWBA 5JS1A 4KJZA 3H99A 1P1FA 1B6SA 1FFXB 2GNPA 2CDAA 2IF0A 4MKXA 4EWLA 3M7IA 1I7QB 4M22A 2OL4A 1SKQA 3LCUA 2X3YA 4ZAYA 2NPFA 1RAHA 1E3JA 2Q2QA 3WK5A 1Q1QA 2W98A 1UJ5A 3C98A 4QVKA 4BFYA 1I94B 1CP2A 3RRBA 1D0SA 3AONB 3BWMA 1NQXA 3FFBA 4LJAA 4PLFA 4RGYA 5G4LA 4PIVA 1ZI9A 3FTDA 2C0QA 2OP1A 2QVYX 2AOTB 1P74A 4YLEA 5B2ZA 3RUDA 1A76A 4Y8VA 1CF9A 4AN1A 1OV6A 4F6CA 1SD2A 5HOEA 4TQGA 1RCFA 1VYUA 2E4WA 2I1WA 1OD6A 2VPPA 3QSYA 3HB0A 1FNSA 4WEQA 1UPXA 4ND6A 3QVGB 1KAQA 2VHVA 2RONA 4RY8A 5IWCA 1NQVA 2ZBFA 3T7RA 2QUZA 1B3RA 2HF8A 2O3UA 5KAMA 4EYGA 1I7PA 1RWQA 5GADl 3NC4A 1RI1A 3GCZA 2IIVA 1Q6ZA 2JVKA 4GGPA 1XMOB 2IZ1A 5EPOA 5F2KA 4E32A 1CF2O 1IRIA 2NZJA 1RWBA 4S24A 3VZSA 4V24A 4GNRA 1ESDA 4UM9D 2DUWA 4EDFA 5ALOA 2ZETA 3DTYA 7ABPA 2IYAA 2R47A 4ZZ2A 2C7GA 4PC3A 4FGWA 1PHRA 4Q6BA 4OXIA 4IAOA 4NBLA 3K3PA 2POCA 3A9WA 1B42A 2X1MA 4MRMB 3U39A 3NHZA 1X70A 4RVCA 2FN8A 1YDEA 3MWKA 4CM3A 4MEBA 1UJ6A 2VZ0A 3V8MA 3L6OO 2J0UA 4TL9A 4NARA 4KEAA 3QE4A 1H85A 2F1OA 2JHPA 2F9LA 4HH1A 4PZPA 1G17A 2UVDA 3AMVA 3H5VA 1JYSA 5EZYF 2AEFA 2D7JA 3D8UA 1CJBA 2ZRPA 1GGKA 1Y8ZA 3C8DA 3H2JA 4PZCA 1PLLA 3BAFA 4QDXA 2FWIA 1GA6A 1ID1A 2JFUA 1JBQA 1B6GA 3AYXB 5K3EA 4IMJB 4GSLA 4KK3A 1PG2A 3JSAA 3QUQA 4FFPA 2OXRA 1Q1GA 3I5UA 4Z4FA 1MJGA 1KI8A 1E6WA 3MYRA 1LLQA 1IMJA 3DT8A 3N6XA 4GUAA 2Q5OA 1ZVQA 2BLNA 3U48A 1HZJA 2QQGA 3ZVRA 2PLNA 3RAFC 3A4LA 1ZCJA 4EF6A 4D9KA 2J6BA 1TLTA 1ZRMA 1CNEA 4F4UA 3OPQA 1WXGA 3DV2A 3VNBA 1SG0A 3MRVA 3WIOA 4E5DA 4O8CA 3OSZA 1HZZA 2GCOB 1X8XA 5G3YA 2A1UA 4OL9A 5BSUA 1W36D 3UK1A 3ZWDA 4ASUD 2NU6B 3JYHA 4D80A 1YTUA 4LYYA 4DEXA 5C53B 3DWFA 3DR5A 3GCXA 1NJGA 3FF1A 2ISQA 1C1DB 2ZAOA 3M0EA 4DNXA 1J1UA 1EE9A 1JHOA 2VKTA 4RANA 2NVUB 2FFBA 2ZI6A 1SUWA 3UHOA 4LSGA 4DGQA 3I0MA 4M1SA 3H1GA 2HRBA 3WYEA 3PQ2A 2FR1A 4ROSA 4ZJPA 3IUBA 2AB0A 2Q7XA 3L6BA 5SY9A 1SUFA 1AK1A 5D3QA 3U4IA 1KORA 5C8YA 5T7BA 4I9FA 3OTIA 1QVWA 4L28A 2P2DA 4ZHQA 2ECQA 3NJ4A 4MVXA 4AC9A 1JYFA 3OEEA 2Q8PA 4IOMA 4ZI7B 4EMTA 3E5MA 3I9FA 4MW7A 2EGGA 3RRJA 5K8LA 2IXDA 3O82A 4A2PA 3X1JA 3F78A 4ESHA 3LUGA 4XEUA 2PKQP 2GBCA 4N5LA 2XV1A 3NBAA 1XZNA 4YA6A 3VOBA 3UWPA 5A06A 2FVXA 4GC5A 3HFJA 1XL0A 1UZAA 4LAFA 3PI7A 3MLAA 4JZYA 3RNLA 1YR7A 2AZDA 3F96A 3GB9A 1NULA 3CKYA 3JQEA 4Y3UA 4IV8A 1NYTA 1J5XA 5H7XA 2HQ1A 3FD8A 4NZPA 4LJSA 2BEWA 3TWOA 5A4IS 5FPKA 1Z06A 5EMHA 1RQ2A 4MUKA 2I34A 2GM3A 4PRLA 5L4NA 2XZTA 3GW8A 1SY7A 3QMWA 1VKRA 4Q4LA 3GVCA 1U0NA 3I76A 1YHYA 1F5SA 3INNA 1FY2A 2AT1A 4H0CA 4MDFA 2Q45A 4E0BA 4MWZA 1GKUB 4RLHA 2ONKA 2HAEA 3WV5A 4E2FA 1H6DA 5C34B 3PPWA 1ZXLA 4MTCA 1HDCA 1CUBA 2VQDA 3JQRA 2CDCA 1EBFA 3LWZA 2BF7A 3PB3A 4ZAXA 1TD9A 1PWEA 4BVFA 4BZQA 1JR4A 3GUZA 4LHZA 1PX0A 2X9GA 1L4KA 3AR7A 5JJ5A 2DJ5A 2PJZA 5AJWA 3ZZNA 2NYAA 2QTHA 2C4MA 4OJNA 1Z16A 5TJHA 2K4MA 3K15A 3JY6A 1EG2A 1GY8A 1PDVA 2V55B 3MWLA 5DMHA 1X19A 1VI5A 5AIBA 1S4QA 4IVRA 4DBZA 3VJMA 2CB0A 4P3PA 3RR2A 3SJ7A 1XO1A 2GRAA 1GZHB 1YRYE 3ZWBA 4MW6A 5B1SA 2GEFA 5JH7A 1R74A 2C54A 3WNQA 5L9AA 3O0TA 4AKIA 1TCAA 1E1QA 4MW2A 3AEKA 1EA5A 4RJKA 3PIIA 1Y0BA 1CJCA 3GGPA 4LGMA 4X6YA 3U40A 3OPMA 4N5HX 1EVYA 3OIYA 4M0LA 4BFTA 3CNLA 4A1OA 1NF3A 3AEQA 3QEOA 2EEPA 1H0SA 4PYMA 4QPZA 2WG0A 4K9OA 1EFCA 1T9BA 2C5EA 3ZE9A 2E21A 1A8QA 3T1TA 4X6XA 2K7FA 3ER8A 1D4OA 1ESCA 1T1RA 4H7JA 4RMHA 4WCFB 1ZINA 5FBZA 2ZBGA 3FPFA 2C4VA 5LZ9A 3G5AA 4LYHA 4W1RA 2YBEA 1ZM7A 3MAJA 2C9MA 3NDPA 5CVVA 3K1AB 3W8FA 3O4GA 2FE1A 2VPWA 4ZI5A 4FQ5A 3CNNA 3HSYA 2YJ6A 2ZDQA 3PNOA 5C8YF 2VQFB 1OU4A 4BWYA 4D0RA 1RM3A 4D74A 4KACA 4LC1A 3BJEA 5F78A 4CKCA 3KQHA 2QTCA 3M89A 5GZ3A 2XQVA 1I7SB 1TW2A 2C7BA 3WOVA 4WJZA 3OIUA 3S2EA 1H8HA 3LECA 3N74A 3WQSB 4FZVA 3CRQA 2CJFA 3ZD8A 2CE7A 2B36A 2PJUA 3K16A 2QJTA 4F60A 5HKKD 4R2MA 1FLDA 2O2IA 2QRLA 1WUIS 4I9UA 4BUJA 3WK7A 2XVAA 5EPEA 2AKAB 3VTFA 2FWPA 2VAVA 4ARZB 2C31A 5C5EA 2B8WA 3KLPX 3D7RA 2GGSA 4FWBA 4RGQA 2YWEA 2B35A 3KSBC 2EZ8A 4WCDA 1BIFA 1QX3A 1VLJA 3WGUA 1RPNA 1VE5A 4L6IA 4AXBA 3G5UA 3TSCA 4ZYZA 3MFQA 1RXUA 3OIFA 3PEFA 4GMKA 3RVJA 4RQUA 3NBMA 1F51E 3NWBA 1DAGA 5TR9A 3OKPA 3WLNA 2GR9A 2Y76A 1DRWA 1S3IA 3LD9A 4YTEA 1Z2OX 4AIRA 4A6PA 1ST2A 2I54A 3R7SA 2H8KA 3QFFA 3CGGA 2AJCA 1GTJ1 2DR2A 2ZCUA 5FI1B 3D4BA 3WB0A 2MSWA 1KIFA 1QYIA 1YL5A 2QNRA 3PFFA 1FNCA 2AUMA 1JNXX 4YRMA 2GLXA 1S1CA 2W2LA 4IDOA 4MITA 4EHHA 3MJHA 4HX2A 1Z0SA 3SS8A 5ICSA 1KYZA 1ILEA 1IZYA 2OWEA 3CX3A 4UW9A 5B37A 3UWMA 2OYCA 1RYDA 2P3LA 3RFCA 4X1IA 5DBHX 1Y4UA 3PGJA 1V39A 1OAKA 4YP5A 2BJVA 3OF3A 1UXKA 5EEGA 4Q9JA 3SC6A 4BP8A 3OICA 2GN9A 2JBAA 1J21A 1ETUA 3FIJA 4W1SA 1YL6A 1J0CA 2OFPA 3NUGA 2ZBPA 3RVLA 1G60A 1GKYA 1OFHA 3UICA 1Z45A 3RS5A 2VRBA 4G1BA 4G0UA 1NJ2A 2YJGA 3GA7A 3H9CA 3M6XA 3AJDA 4OHOA 3NGLA 4NE2A 5GP1A 4DQVA 4EF5A 1IN1A 2G9UA 1HK7A 3Q2IA 4LVOA 4QYTA 4HNUA 1C8LA 4Q1DA 4B83A 5A7HA 3F74A 3PVCA 3CLKA 3PHGA 3DLHA 1PEKE 5ALLA 4HS9A 1DP4A 1LWOA 1ULBA 3TX2A 4I3HA 5CLFA 2OOSA 3PQEA 3FYSA 3GG2A 2UVPA 2UYOA 2R5FA 2PVCA 3DBIA 3PD0A 2RCYA 3DFZA 1AU9A 1Y7HA 3WQRA 1ZUNB 4XD7D 4YT4A 3CO5A 5HM8A 1G98A 1T91A 1ZK3A 2OORA 2P6UA 4RQBA 2BCEA 1JBKA 2OA0A 1DAIA 5TPZD 2GKGA 3CEHA 3AUJB 1P7WA 2NSHA 3P4YA 1UJ4A 1RAAA 2CT8A 3DBOB 4US1R 2LCQA 3WWZA 3OE5A 4KMMA 2LRHA 1DAMA 4PSAA 1O6ZA 4OQQA 3EODA 3EGVA 3H9QA 3N8NA 2ZM5A 3X1DA 1XNQB 1XWIA 2ZTVA 3NXSA 1ZH8A 1T5LA 2Z3ZA 3LRTA 4QXOA 4HDKB 5T67A 2CV1A 3CB4A 4AJOA 4R83A 3QLEA 1KZ6A 3MYYA 4NHOA 1GWNA 3P0HA 3HNOA 5I4KA 1ZXXA 3A3OA 1CB7A 1E2LA 3U4DA 2J85A 3G0CA 3DL4A 3TBKA 1CY7A 4HEA6 1M5RA 1Z29A 4C14A 1O96B 3F6EX 4UPVA 2E6KA 3AGPA 3QU7A 2Q4BA 2IY7A 2HIGA 5GWXA 2IHUA 3V1UA 3HXOA 4TRJA 4RNCA 1Y1LA 4IIJA 5DCUA 2RD2A 4YEDA 5HRCA 4RC9A 2F3TA 5ALKA 2OG1A 4O2AA 3L8HA 3ZBUA 1Z2NX 2XUAA 4AP6A 2LKDA 4DR7B 4KC0A 2ZQYA 4G67A 2XMBA 1YS1X 5HILA 5SICE 4U7JA 3LXUX 3O4RA 4C0SA 2Z9CA 4S0ZA 2VRNA 4QTXA 5JNTA 3N70A 3RHZA 4FE3A 3MIZA 3R5KA 2TMGA 5E1OA 4A92A 8ADHA 1SQ0A 3LKDA 5CEJA 5IJXA 1MO2A 3QWIA 3B70A 4BTVA 2XADA 4J1SA 1E0AA 5KMGA 4JEHA 4EG7A 3ZDDA 4LNUB 3CVOA 2ESRA 1Y4ZA 2R751 2UZ3A 2ZRDA 3PJRA 2B8EA 1N2IA 4FYMA 1YQDA 4BYMA 1ZIOA 2BFCB 2C99A 4N5IX 4DV1B 4Z7QB 2V5UA 1Z2CA 4CF5A 1NI5A 3HYRA 5ALEA 5BOSB 4YUAA 3GJ8A 2HUNA 1BEZA 4TOIA 1NRWA 1SVLA 4HRVA 2ZM6B 3WS7A 4E6EA 3NMUF 1SOAA 2XE8A 3F97A 4A5SA 3KQUA 5UKDA 4MSUA 3PTAA 1K97A 5C52B 1FP7A 1PGNA 2Q49A 1T6BY 2PRKA 3S7TA 3NETA 1I51A 3LQ1A 1DTSA 2R7LA 3HFSA 4XASA 5EWLB 3HU3A 1F5NA 5AOBA 4PAQA 1GKIA 3PG5A 4B3IA 3W9YA 1EWKA 1NC3A 5LOVB 1QCDA 2CHVA 3OE1A 2P2YA 2NU7B 1FSPA 1MLDA 1E6KA 4WY8A 3ZTTA 4YRIA 4KAAA 2RHHA 2FWMX 2BRUC 2ZTSA 3ZDYB 4WNCA 2CNBA 4QEZA 1IHDA 1YULA 2XUOA 1H2YA 4I4NA 4JBYA 4ZOAA 4XWGA 4HVLA 4JELA 2JBHA 3KFXA 5WRFA 1RWOA 4BQOA 4MIKA 3DONA 4IEEA 5CLHA 5DLEA 3UPTA 1JNYA 3GJ5A 4DJJA 1W52X 3O38A 4WBNA 1XMSA 5KQMA 1G63A 1UKZA 3II6X 1C50A 3ZWMA 4AF7A 5A9SB 2DFDA 2QPTA 2CGEA 1L4GA 3TH5A 3LYUA 4P38A 1V6AA 2XVZA 5ENDA 2HCJB 2IL1A 2BFWA 3K0FB 4J0QA 1XDWA 3TLGB 1NDQA 4YRAA 1G8JA 4UQLA 2QM7A 3AHGA 1VYVA 3B6EA 4ZAGA 5K8IA 1FLAA 1D0VA 3H9GA 5GV8A 4JI3B 3D8HA 1X7ZB 2HRRA 3ORYA 2VDMB 4DV2B 3LY7A 3AILA 3VHLB 4AO7A 2HFKA 4URVR 3GLHE 3R2JA 4Q15A 4BB0A 3VNQA 1N25A 2HLHA 1BX1A 2XPCA 3LY8A 2V3CC 2O07A 1M0WA 1UXOA 2P7HA 4UVGA 4C7BA 4HDOB 4N5DA 4EJSA 4Q9DA 2VPTA 2XOEA 2IV3A 2NO5A 3H17A 1KO8A 2VP9A 3SHQA 1M5TA 3BJIC 3WAGA 1K9VF 4YMVA 4GX5A 1NZFA 4W8GA 2CYBA 2ZRCA 3KJGA 1SZDA 4N49A 1U4SA 1MJHA 3ORFA 3KPVA 1NXOA 5JAUA 5KO2A 5LA6A 1B8NA 1RC1A 3N8HA 1VYHA 3RAPR 3HSSA 2PRYA 1H6AA 3EPJA 4OSEA 1QKJA 1XZBA 2B8TA 5ITZA 5CVEA 3DCJA 2ZRQA 2JLCA 5EHZA 2HN9A 3MJFA 2B6HA 1Y5MA 2CHFA 3QOXA 1E7RA 1VIYA 4MRPA 1MVLA 2R86A 1GTSA 2RAUA 4E2WA 1K7CA 2B1IA 3KKKA 1O95D 4MWBA 1QMPA 4PO3X 3DMTC 2PQMA 5CYPA 3NANA 2PRIA 2YZ2A 3BBLA 3FAKA 4JLBA 2ZZNA 2H2AA 4RPCA 1DJOA 4WW0A 2DFTA 1E1KA 4IDGA 5KJCA 1OYVA 4DCNA 1JHPA 3TFOA 2JD1A 5IK2D 1PSWA 2A9JA 4J0FA 1FFBA 3GEDA 5L95A 3D54D 3ABQB 4LV5B 1KDYA 5K7SA 3K9FC 1WMSA 4GLFA 2IEYA 4GPBA 1M1YB 4HEQA 2GT1A 3IOCA 4AZSA 4B6GA 4ZK2A 4F91B 1ES9A 4BN5A 2PWAA 16PKA 2MSCB 3L7LA 3OMLA 3PIRA 4L02A 4RHUA 4WFIA 1XHEA 4PAOA 1GQOA 4WESA 4RIFA 4HVCA 2YTZA 1S8FA 2GDZA 1PE0A 2ZUBA 1OVMA 2YASA 5LBTA 1P1CA 2Q9CA 4ZP1A 4E5YA 1NQ5A 3BL8A 3OLZA 3B8EA 1Z47A 3LDHA 1ZITA 5EXTA 1WY7A 2VH2A 4B17A 4MKRA 4P3OA 3PL5A 5LLDA 4QDZA 3KVVA 4ZU3A 2WKQA 3QKIA 1HFJA 4KR0A 4DB4A 3PUYA 2VQ3A 2JK0A 3AJ9A 2GS9A 1R5BA 2R96A 2Q1WA 4EKNB 4P4TA 4F3TA 3D8RA 1KK0A 4M76B 2G36A 2VDLB 4LDPA 4GMGA 1XJ5A 2ODWA 4MHOA 3U3OA 4CTKA 4NK5A 5REQA 5J3JA 1GZ7A 2HXYA 2WJ3A 5KNDH 4B44A 3FE2A 4V1CI 2W4IA 4JYAB 1E7YA 1AA9A 1PGJA 1BOOA 3CLRC 5CB0A 3EIUA 3T99A 2WSSA 3MNFA 4C04A 1II8A 1LNQA 1RWKA 3AJ8A 3KB6A 3LCMA 2C8LA 5ECDA 4BNDA 4EB6A 4RVUA 5BR1A 4LF9B 4QC2A 3FJOA 4KYUA 1QQ5A 2GERA 3ICPA 1H1LB 2X19A 3DCIA 3H9EO 1YMVA 3IO3A 4LS3A 4C3VA 4D42A 5FV4A 1D2RA 1KU0A 1MDBA 3DVLA 2GUWA 4PX9A 1M0TA 1IBKB 4J07A 4U6SA 3DPIA 4FB4A 2P3QA 4ZEVA 2JDIA 4HBGA 1MFZA 4MMYB 1SVWA 4LF8B 3V2IA 5LLTA 5C31A 3ET5A 1SHTX 2SHKA 3TNFA 2ZW9A 1NF9A 3EXHB 2HA7A 5FOUA 1QMGA 1U0BB 4MUFA 3WSTA 4ON9A 4WTOA 3UT5B 2P4QA 3COJA 2YJ3A 3O9ZA 1ADFA 4CIWA 1O57A 2ATEA 2FHPA 4AW9A 4DPKA 1T36A 1ODCA 1YHZA 5JZBA 2ID9A 4G2NA 3O84A 4GI7A 3PEWA 2QRJA 3FHOA 2CK3D 4HDNA 3DKVA 3PXCX 1SBNE 3QY0A 2MR5A 2Z2ZA 1Q1BA 4M3NA 1QSGA 4XX1A 1O94A 4BKOA 1GAXA 1XELA 4ALMA 3IQZA 5IARA 2Q4DA 2O9JA 2WYVA 4IL5A 3DQZA 5EJAA 3DTVB 4YECA 3S1AB 3SOZA 2GHIA 3BHJA 2ZJ5A 3DUWA 3ELDA 3H87A 3VVCA 1DBQA 2B99A 3K32A 3FX2A 4YRTA 3IMFA 2P8JA 2JGMA 4LHVA 5IT0A 4LGCA 4DWVA 2G4LA 5AKKA 3DNFA 3NCTA 3CUTA 3MPOA 1B8UA 1BD3A 2IYWA 4N40A 3R1IA 3DHVA 2IWHA 1Y6ZA 2H4XA 2XQKA 3V9AA 2ERXA 5KHAA 1WMAA 2WYIA 1AUOA 3SKXA 1JEEA 2GCEA 1CDDA 4QJ3A 3O4HA 2YHBA 3C39A 1SBHA 5TGTA 4DXAA 4LMPA 1X2BA 4Z3OA 5JDIC 4MDHA 3GLHB 2AQIA 5KTSA 1MTZA 2DTXA 1IC6A 1RP1A 6AT1A 4OP1A 3SJAA 3M34A 2X9QA 3TPCA 1JH9A 4OSOA 1WQ1R 4XD7A 3AHFA 4Z9XA 1J20A 1JQLB 2HDNB 2JIQA 2WTEA 2UYQA 2Z5VA 3EDMA 3RIXA 4FYIA 2OBXA 2GAOA 5JSZB 5IFKA 3Q6NA 2PAFA 1IN6A 3MJCA 1GPDG 3T1QA 5BVHB 3Q2KA 5K3SA 2W48A 4TTQA 3FSGA 5BT8A 1H5QA 2R8XA 4O5AA 4ASUA 3LNTA 1YR1A 2DR0A 3OOSA 5CH8A 4XGIA 1U28C 1AKEA 1I4WA 3B48A 5DXFA 2VTBB 4KN8A 1TIPA 5FUWA 1S01A 5DTEA 3ZXUB 4B7AA 1LI7A 4JC4A 1WKVA 1Y5NA 4FGZA 1QXSA 3OE7D 3LP6A 4DF3A 5IEJA 4AT1A 3NIGB 1ULAA 2KX7A 4E4TA 3IIMA 3AUYA 1FFYA 1KRWA 3W9SA 3C4QA 4JX9A 1YS9A 1AS2A 4P31A 3SDZA 1S2NA 1YE3A 1EDOA 2Z98A 4MS1A 5JEDA 2ATIA 4DCCA 1RABA 4RA9A 1WHSA 1RLTA 1L4EA 2J9RA 4HZGA 4LBYA 3G2IA 4J3NA 3NKVA 1U8TA 2G17A 3A1EA 2H3HA 2O3JA 3L7IA 1EVLA 3N2LA 4WXMA 3SHVA 1EUQA 2C5SA 3JR3A 1NM5A 1EFTA 4X00A 1HO3A 2ZS7A 3H8SA 4I66A 4FWIB 2EV9A 2OHVA 4UU0A 3T1OA 2BUAA 2GETA 3D2CA 2CNOA 1WXWA 4NCNA 3ZJYA 1LZKA 3AFIA 4QUKA 1MV5A 2PKRA 5CJPA 4Z99A 5H9WA 1SR8A 2KSQA 2Z4SA 2ZIGA 1ORRA 2HA6A 2IHYA 1D5CA 2JAPA 8ATCA 1GPJA 2XWPA 3S0JA 2I7VA 2P65A 2P3SA 3HVHA 5HA5A 3ZLUA 4JJ7A 1JDJA 3ONNA 4WN9B 1RKBA 1TM4E 2B83A 4ENWA 2YOFA 4JI0B 1PZFA 1XZFA 3H5RA 1N6OA 1T4GA 1TNDA 2XYVA 5DPMA 5DWVA 3DAYA 2KM1A 1KDZA 1VSTA 3UHFA 2DFLA 5BNFA 2QBYA 4RY9A 1JA9A 4I1SA 4X93A 3D2AA 2LPMA 3CZ4A 1TGVA 4WI1A 1TM3E 5SYMA 5LMNB 1FBTA 5HZHA 4BEWA 1E2BA 1PO7A 4OREX 2JJ1D 3VPAA 3JQFA 2PS1A 4KO4S 4U6QA 5FNVA 1ESZA 5C32A 2PANA 4MAMA 4XQEA 3WL8A 2HXGA 1WZ2A 1J2RA 2UZ1B 4NZ9A 1O0BA 3G2NA 1FYEA 1XD8A 3NONA 4KWEA 4BNNA 3MT9A 3GJ3A 2QTBA 3CEAA 4IUYA 5JD4A 3OCJA 1M73E 4RH1A 1H0HA 1CRPA 4B3DA 3VKGA 2I1QA 5T57A 1MC4A 2PZLA 5E2IA 2FPWA 4GXQA 3U49A 1U2GA 1GTZA 4YPOA 3B6JA 1ENYA 1UCFA 4LVUA 4QG3A 5HBRA 2Y1LA 4R3UC 1KTIA 1REQA 5K2MA 3NIFB 1Z7WA 5JHGB 5AW3A 3HO6A 3VM6A 4YUWA 3TSAA 2A59A 2HRQA 1PNOA 1SUIA 2XHEA 3KKQA 5A9RA 3VA7A 1C0EA 4PPQA 4Z4EA 1KSFX 1J1ZA 3PZBA 3H16A 4JC5A 1QPGA 3CVJA 3NHAA 4R9SA 1GTMA 3VX3A 5KBYA 5B58T 3K35A 4CM5A 1S0UA 2Q2OA 2VZEA 4Y0VA 4XEHA 4YJ3A 5CXUA 1TF5A 1DC4A 4C2AA 2JFFA 1KZYC 4HMPA 2MYPA 4LHEA 4ARBA 3HH8A 1X74A 1RADA 3P9SA 4MR9B 1R2QA 4LCEA 3IOBA 4P3XA 4PFKA 4CM9A 3R0XA 1LDEA 1J2TA 3QU5A 2ZRIA 1FA9A 2OR3A 3BH0A 3S55A 3JARA 2F3QA 5DNCA 1SC4A 2YMLA 5AJYA 3MZ0A 4XUGB 1Y3HA 1NV8A 3EF3A 5C1OA 1IIRA 2COUA 5CXSA 5AW1A 1Q84A 1V35A 2JJ2A 3GDFA 2HO5A 3KR0A 4H4CA 4NU5A 4ZOLF 3RIGA 4B43A 1AMOA 5FWXA 1GUFA 2G72A 2WHYA 1PL8A 2V7XA 4D9EA 3FPSA 2EFYA 1FUIA 1YJXA 2OESA 5GOZA 2VYFA 3T5MA 3BWCA 4EL0A 3RYCA 1EBUA 1U3CA 1Z3IX 4X7BA 2RDMA 3RGGA 4YDHB 4C7OB 7MHTA 3L1KA 6Q21A 1Y3CE 1NIJA 5KNCH 5BV8A 3DF9A 3NBQA 2YBDA 5KVQA 1SHJA 4W1QA 5BMOA 4JUBA 2PUDA 2GPNA 2XCSB 1X0VA 1CJTC 3BDAA 4IDFA 2DYKA 2I8AA 2FPUA 1M6VA 4L6AA 4GLOA 2VYCA 1A04A 1JTFA 3QA3E 4QBGB 4K6KA 4DTIA 5EIBC 5AM2A 1FTYA 1H0RA 4BLWA 2F67A 3TG2A 2VTBA 2V58A 3NV9A 2AW5A 3KPJA 3L0PA 1AIPA 4OHRA 4O0LA 3NFYA 3B9PA 1P4GA 4TKZA 4WEOA 2E4ZA 1DCTA 1PKXA 1ZD5A 1DEKA 2UXCB 3EUEA 1E3DA 4NBUA 4C78A 2YRXA 4DG9A 4UHFA 4F11A 1T4CA 3GU3A 3JD3A 4L8FA 1ISJA 4GZ5A 3UCEA 4CI0B 2C9OA 1MMFB 2R8BA 5GGYA 2YY5A 3HRKA 4JFRA 4YRJA 2VJAA 5BW6B 1Z8FA 1LGYA 4MVJG 1U3UA 2DG2A 1E66A 4KQ2A 3UY4A 4RA9B 2WMDA 2JHGA 4BRSA 2P9JA 2X0KA 2PU5A 1EJ0A 2VP5A 2PH7A 2VJYA 3H2KA 3MT8A 3RYFA 1F2VA 3H1FA 1I01A 5JCOA 2PL5A 3RROA 1ZU5A 5F35A 1P3DA 2XA2A 2PQ0A 1Z2AA 3KFLA 2SICE 1E3LA 1K2WA 1NJ1A 4L5CA 4ND3A 5B2EA 1BWRA 3PU6A 3FOZA 1JPJA 1Y48E 2QR2A 4HMQA 4Y7DA 3DQPA 5GZ6A 1TEZA 3WBJA 2QZ4A 1V37A 2HDWA 1TDJA 4NG5A 2MCFA 4XYEA 4EATA 4NJEB 5ADVA 3T1VA 3AZQA 3DZFA 2WU4A 2FUG1 4FPXA 5AVYA 3CV3A 2W11A 4INAA 1YBAA 2BBTA 4QBIA 1SMKA 4QOFA 2RGBA 1F60A 4TT3A 5G1PA 5F33A 2FOLA 3VJLA 1QG2A 4C5AA 1Y42X 4E07A 5FR2A 2O57A 3FSGD 1QYRA 1CY1A 3ZJ5A 2ZU6A 3B1JA 3K31A 4LX0A 2EW2A 4U7PB 3Q9SA 3UWDA 1EI9A 1IB6A 2R4TA 1D7OA 1DOHA 3OA2A 1LI5A 1DQNA 3C7CB 3QYJA 3GLFB 1ZGZA 2CBXA 1MG5A 3AR2A 4GP9A 1L4UA 4BFLA 4GKAA 4Q02A 4WL0A 5HJ2A 5L3SB 2ZJZA 5IVPA 1PBNA 4IDHA 1TT5A 1ENPA 3FUXA 4BS9A 5HBGA 1HEYA 3E81A 4UD6A 3VR0A 5FH9A 2FZVA 5EGNA 3BH7A 4N18A 4HP8A 1QHHA 4H3HB 4Q4JA 4EY6A 4RLSA 1LDMA 3G89A 4YRDA 1RYZA 1LBIA 2J0SA 1KYVA 1VIDA 2WTXA 3X2SA 3D7SA 3PUJA 1YZQA 1YRHA 2P79A 1ZS9A 4KQ9A 4QDUA 1EVEA 2FRVA 2R6CA 1O9BA 2X8AA 3C5WP 4H2DA 5EJEA 3AKEA 3JCZA 4C88A 3VR3D 1C3OB 5KTYA 1T5BA 2B78A 5J2UA 3T54A 5EMJA 2J3QA 4IHQA 1DLIA 2YH2A 221PA 2A0YA 2YYSA 3GEGA 4M87A 1JR2A 3TQQA 4O02B 1NP7A 4PBSA 3C3AA 4TLBA 4INOA 1AC5A 1U6IA 1BYUA 1U6KA 4ZOLB 3VPHA 2ZI5A 5BSEA 5HZKA 2G6TA 5PGMA 2C88A 1W6RA 2BTEA 4EJ6A 3ROTA 1GD1O 3WLMA 4H6PA 3NHLA 4DLKA 3JARB 3X1MA 2EG9A 4GZ3A 4X90A 3DE3X 3PT5A 1KOLA 2ZSDA 1P19A 2R7KA 1UXGA 4OBBA 3EPHA 4A0QA 1Z7GA 4LN1A 2VPZA 2PMWB 2O7RA 2FH5B 3ANLA 3IODA 3UOAB 4LF5B 1ZRNA 1V9SA 2P9ZA 3FETA 3DEIA 2I6GA 2RK6A 2ZXEA 3SFTA 3Q11A 4HH4A 1E9BA 3V4PB 3WGQA 3WMGA 5B7NA 2Q6TA 3KEFA 3DV0B 2IBTA 3R76A 5AVTA 7GPBA 2D5BA 1U8CB 4GMHA 5BNTA 1VIAA 2CJYA 2G5PA 3DOCA 2OCXA 3KIPA 2VPXA 5TV2A 2RHGB 1QIGA 4B75A 1DFGA 1KAEA 2YHAA 3HTXA 2CLLB 1UC4B 4LWZA 3OPYA 5A1TA 2EL9A 1KY3A 2IYUA 5IPFA 4AJKA 1PJCA 5AESA 3FNGA 1ZW1A 2XQIA 1R66A 3HYNA 2NQTA 2YYZA 5LC1A 4BNJA 4DSNA 1IOVA 3AM4A 1RJDA 2ZPUA 5JW6A 3L7CA 3HKCA 4UMEA 2Y66A 1RPJA 3ELWA 3H42B 4MPPA 4YAGA 2XA1A 3IQWA 2W2TA 2OAQ1 1R6XA 4YJHB 3SXUB 2IZ0A 1FDSA 3I8XA 3OEWA 1ULUA 2QTFA 2C4WA 4EX6A 4LV6A 5CCDA 4DV3B 2OQ2A 5JC8A 5B12A 2W00A 3A1UA 5KYKA 4EJ0A 3U4MA 3Q6IA 1Z5GA 4XYGA 3PENA 2P6NA 2CFRA 9ABPA 1BCSA 1ICEA 2A1TS 4G0WA 1A5SB 2QGZA 1WQ3A 2JATA 3WXBA 1CTQA 1QUFA 3LKZA 2PX0A 3IRVA 1TPYA 1ZGCA 3DMHA 3TG8A 2WE7A 3DD5A 1QGED 3WGOA 1DKNA 3AUTA 4EGAA 3R41A 4MQFB 1ECBA 4I5DA 1LPSA 2IPAB 1HPLA 3MM4A 4KE9A 4L51A 1A7JA 3RC7A 4AS3A 2IYNA 4CN8A 2J59A 2NUTA 1TUEA 5EFZA 4Y6LA 1LNSA 2TYSB 3V7FA 4EA7A 4YDQA 2CLSA 1YI8A 3IBGA 4JVSB 2YMMA 4HK4A 2WUWE 2NZWA 3UMRA 3EZGA 4F2DA 4EKYA 2GYUA 1P6XA 2Z6UA 3I04A 4NXNB 1BMQA 4PZLA 4OV6B 3KP1A 1Y3AA 5HUHA 1NVAA 2X4LA 3BXGA 3KB1A 1VECA 1I3KA 1Z5ZA 3JWGA 3SX0A 1P81A 1ZA2A 5HX7A 1GCOA 3OTHA 3AL2A 4BWFB 4N9WA 1AQJA 4UUNA 1FYXA 2XOKD 3PFIA 4EYQA 1OIWA 2BMJA 1RMYA 1T3GA 3HNRA 4D9CA 2YV1A 5KNCA 1ZUD1 3BRWD 2OE2A 3KU4A 1IJFA 2F3PA 2IXTA 2P5YA 3F1KA 4H0NA 4RVSA 1HXHA 2QTWB 3A14A 4EUSA 5L3QA 4RTPA 4L57A 4C1NA 2MHCA 2GLTA 4KBFA 5G0WA 2QX9A 4ARAA 3AFMA 4ENQA 1SQ6A 3WYDA 1RU3A 5FPYA 1A9PA 4K5QA 4ZFNA 4TV8A 4CV1A 1UBFA 2VNKA 13PKA 1IYZA 4NDZA 1CQWA 1JZQA 4OSPA 4BLUA 1SCDA 1EJBA 3Q15C 4MWCA 4BVJA 1XWWA 3AI7A 3IEPA 1R1DA 2PQ2A 1ZN8A 4M9QA 4D44A 5JNUA 4BJ3A 2OUIA 3BILA 1ADCA 4QECA 3M2TA 1KOGA 4YAWA 5DX1A 1V41E 3WJAA 4HVAA 1US8B 3GJXC 3OLQA 2O52A 1GXSA 4K6MA 3STTA 4Q3OA 4QPCA 2YN0A 3D9QX 4L75A 2XWBF 1E2IA 4H27A 1ZJYA 2VEDA 1F2TB 3KYIB 1T5SA 1V16B 4W9MC 3IBYA 1GL6A 1EMDA 1R4NB 1TTQB 3R3ZA 4G84A 3T94A 2AA3A 3ZI4A 5BMVA 1VRWA 5D8DA 4WK2B 3SYMA 4C6TA 1TAQA 2IOHA 1AHPA 2FTKE 1A4RA 3BK1A 3EEYA 3QELA 3ZQ6A 4FNMA 5EIOA 2HA2A 2AE2A 4GBED 2D1RA 2WLSA 4KODA 3PC7A 3ZGNA 1EUDB 3K4PA 3L7AA 2ZSBA 3MLBA 3A1SA 3OOHA 1FVFA 4IKOA 1ELOA 2X8BA 5DEOA 2P4HX 5K3BA 1E2HA 1SUBA 2I78A 5DTJA 4QIHA 2YJ5A 4FI3C 4DR3B 1XSEA 3BS4A 5EGSA 4GLBA 4ZKEA 3CPHA 3DUFA 4RF4A 1EHIA 4EENA 5JSKA 2ZRNA 5AK5A 1SVKA 3HA7A 4KFRA 3GVHA 2FAXA 3FUVA 1RYBA 1CE8B 2GJAA 2H08A 4KXFB 4Q19A 3CVXA 2CHGA 3HJFA 2P6MA 3Q0IA 3IRUA 1XMVA 1TU4A 1KMQA 2D2FA 3RI3A 2DR3A 3P26A 4FSDA 2J0VA 3C4JA 3O73A 2VBFA 3BMNA 3PI6A 1BS9A 4J0IA 3RSLA 2PLWA 3RS9A 5B3LA 4AJHA 1P31A 4IX1A 1D5WA 3B20A 4MP6A 3U5ZB 1SOVA 1FRZA 1ZX1A 3C45A 4EUNA 4HB4A 4HD8A 5H83A 5BYJA 2PUAA 1BG6A 1M2KA 3NVMB 1MC8A 2XD4A 3ST7A 4JAVC 1UWKA 1K8RA 3L6EA 5EJ9A 1HKUA 2IEAA 1W5BA 2WUDA 4HN4B 3T5GA 3V6MA 4NNOA 1EG7A 1EQAA 4FHDA 1SKYE 3NEAA 3SWWA 4RHYA 1UEJA 1R8JA 1X13A 2P4EA 2P90A 1O4WA 4MRNA 4JLVA 2HREA 2DJIA 3RS3A 2IOYA 2NYUA 3U3RA 5KNDA 2W70A 3R7FA 4IGAA 4IGFA 3ISTA 1DEOA 1ZOIA 1E0KA 1EDZA 1FP1D 4ESOA 4FBGA 1KMHA 2CC2A 2Y4NA 4C4PA 2II6A 2A5YB 4JNKA 1U98A 1FMJA 1QKIA 1Z8DA 2VS1A 3DZCA 4M8LA 1UOPA 4R54A 3SZGA 3IQIX 5DX8A 3E4CA 2NZYA 3WB1A 3A1FA 3I3OA 3UGKA 2AK2A 3FDJA 1UPBA 1IQPA 3LGSA 3F9IA 4JJFA 2LP4Y 3HKBA 3IC5A 3SHOA 1M7BA 1T9ZA 4H7PA 3NQ41 2B2CA 1D2EA 1NVFA 1XZDA 2FRDC 2GASA 3R3XA 4NONA 4CHTA 2O2EA 1KZGB 2HF9A 1CJVC 2PEYA 3USZA 3U7FB 2OV3A 1OGYA 3ZYCA 3HADA 1K68A 4GDFA 3UATA 4TQ9A 3TAHA 2GZRA 2HA3A 3CPJB 4GX1A 3OOEA 3P9XA 4MVYA 2D5CA 1L4BA 1YQGA 3LVBA 4I6JA 2GHTA 1N34B 3OO0A 2VHCA 1KH1A 3ZHCA 4MUEA 4CV0A 4KQCA 3VH1A 4BO1A 1QHYA 2IPNA 3QVWA 3X0DA 3M1YA 2VHEA 3ZHVA 5DW3A 5K6TA 1I2BA 3KQYA 2VWHA 2F1HA 4REOA 1PNRA 1XMPA 4CLHA 2OXTA 5HIMA 3H9UA 4F92B 3FIUA 3E03A 4FX5A 5E1BA 2J41A 2ZBUA 2DWCA 4AWXA 2I62A 1UPUA 4FOOA 5C4IA 1AUPA 1G8KA 2IPXA 2JFXA 4FD3A 3NDBB 1RR6A 4OLAA 2G70A 1AV7A 2EFCB 1A7AA 2BMEA 2HCFA 3G7NA 4N01A 1PFUA 1V43A 4AJ1A 3C3CA 1Q95A 2H07A 2G9RA 1HBJA 2WSYB 3DXYA 4KXXA 1NWCA 1ZM3A 5HTKA 1M2HA 5A9TA 4TTTS 3Q7QA 1DZIA 2ONJA 1DX6A 3DFFA 3DS8A 2I03A 5M3BA 2O5EA 1ZMOA 3OKAA 3H65A 4FOPA 3FDXA 4YWHA 3SICE 3WFJA 1KFBB 3QV2A 4EPXA 1NVVQ 3KD2A 1RJWA 4TN5A 2E5WA 1O77A 4GLLA 2JGDB 1SNYA 1GL9B 4GI2A 4LXQA 4DCGA 2AOUA 2HGZA 3A9TA 1BDJA 4YJGB 4K9DA 4LXUA 5DM2A 5IC6A 5IW8A 3VMMA 2I2FA 4PGAA 5FX2A 4HYTA 1YC5A 1EBBA 3INTA 1IPHA 3VZCA 1A82A 2J87A 2R97A 4FFWA 5FLKA 3C3YA 3PJDA 5TJ9A 2CJWB 2GX6A 3OETA 1YUBA 4XZ3A 5AM0A 2E4AA 3NEJA 4UM5A 1ZMXA 3ZGZA 2SCUA 2WKWA 4D56A 2GH1A 3L18A 5B4VA 3E70C 1G20B 2XA9A 3C6MA 3IP3A 5IAKA 2C4TA 2OGWA 5AW9A 3V8PA 3G9UA 4JI8B 4WK6A 5CDSA 4BRUA 4ITVA 2QEQA 3E1SA 1DI0A 3O26A 1RM5A 1QH8A 3G6KA 4DMRA 3ZDAA 1WL8A 2Q3DA 4KPUA 4LXHA 4WXRA 1Q15A 2HJSA 4FILA 1F4PA 3RCBA 3TLYA 3ZE0B 4LF6B 6GPBA 2YHIA 4IVNA 4RM2A 2ZRMA 4LGVA 1QVRA 1Z39A 1GZSA 3L9XA 1XMJA 2WHXA 2HBZA 3N7AA 1HSOA 3SC2B 4BLPA 3I09A 4HZUB 5CB4F 1A9XA 1KJJA 2BKXA 2BM8A 5C1IA 4QT4A 4QAQA 5EKTA 2QTZA 5EHNA 1X80B 4NENA 4GX2A 3YASA 1WSAA 4G36A 4B87A 4BFWA 4G25A 1ZH6A 3O8QB 2DU8A 4HNQA 1I3LA 2HI0A 3GAFA 2GNOA 2Z95A 1RPAA 4IZIA 1P9WA 1A7UA 1QZUA 2H48A 4EB3A 2I6XA 2IHNA 3CXRA 1D4ZA 3PUIA 2OYSA 4J29A 2I67A 3LX6A 3GLGA 1YZHA 4MYUA 3LXMA 4NBRA 3W1WA 4F7DA 1KYWA 5G0UA 2P67A 5J4VA 4JT9A 4I5FA 3AINA 5DTMA 3ITEA 4N6GA 3QEBZ 4Q9AA 4TV9B 4OU4A 1DAOA 3I9MA 4JZKA 5KYXB 3W2GA 1ZSYA 2XUDA 5IJAA 5EUCA 4B3SB 3AOEC 2IP4A 5DRYA 4UBOA 2UKDA 4ZICA 5BW4A 1KK3A 5CCXA 1S02A 5ALHA 4LYGA 2IUEA 5DT2A 1KJYA 1EGVB 1LTHR 1XHFA 3BN3A 3QWFA 5HZMA 4FP9A 4YMIA 4MLCA 3ZS8A 4CL0A 3J81A 2CZGA 5IJWA 1P73A 3IP1A 3MWEA 4TLDA 2RGNA 1HQYE 4EHNA 3ZE2B 1P9OA 1WULS 2CMFA 1TL7C 2IEBA 3W3ZB 2QLLA 3G0IA 3FA2A 2C7RA 1W1UA 3H8WA 2C42A 4EAQA 3PXDA 1ZJZA 1CP3A 3GR6A 4CDMA 3L04A 2EKDA 3WXMA 1Q3TA 1U7ZA 3IV6A 2BJHA 6PFKA 5FA5A 5TIIA 3EASA 2PXHA 2GPYA 4ZDWA 4PQEA 2O2SA 3K4HA 4ACBA 2VP4A 1PLJA 2VZ9A 1SVIA 1UDXA 1VMAA 2AV6A 2LDXA 3D0RA 4PRYA 4URWR 5CH5A 5HF9A 1SKAA 1TCUA 2PYZA 2X8WA 4PLYA 4YH1A 3TX6A 3QWAA 3HJGA 1C2TA 2HSEA 1D07A 1R9GA 2IVZA 3OH8A 4IG9A 2ZBQA 4PWYA 5FTKA 4BNWA 2VT6A 4G81A 2FDCA 1KEWA 2B92A 4WWHA 1JYEA 2WYUA 1W30A 3OZAA 2RI1A 4DA8A 4Z2AA 1UDWA 3RU7A 4TTIA 4DBLE 4JSRA 4KYIB 4PM4A 1UWLA 4FR0A 2PV7A 4JMPA 9GPBA 5M7EA 3K1TA 3VAAA 4MGEA 2J33A 4W9NC 3WR5A 2G1UA 1UAGA 3OX3A 5EIEA 1V8DA 5TEVA 4OQPA 1SBQA 2B1QA 4KDRA 4FJ0A 1UC8A 1HX7A 1YK1A 5KC8A 4IDDA 2W6ZA 3LHKA 2ZWOA 4R1QA 2QYHA 1YRWA 3F3YA 4KWCA 4WBSA 1RXEA 5JQGF 1WPRA 5K3DA 3MUNA 4RJIA 3RU3A 4ECAA 4TYNA 4YJDA 4M55A 1JKFA 5LIRA 3PDJA 1BA3A 5DLPA 1Q2XA 1E94E 1RD4A 1WCV1 2ZJ4A 3A9CA 3LLCA 4FDLA 2EKQA 4WOPA 2OO5A 1P4RA 2FZCA 1KKMA 4LPSA 1Y7TA 2C2KA 4AZVA 4RA6B 2P7IA 2CL0X 1EFPB 3I0NA 3LGAA 3KQQA 4TMVA 5C7LO 2FSVA 3DO5A 4LQ4A 4ZQFA 2PMEA 4KO2S 4CM4A 4NPCA 4V3CA 4JKYA 3T5CA 1E32A 4Z4IA 4RJTA 1QCYA 4KRXA 2ZAIA 4RHEA 4TVKA 4DMUB 4IGEA 1GLVA 1DEAA 1PJ2A 3BG5A 2IXGA 3IVCA 5LDDC 1EVQA 1Z75A 3KJNA 1BKSB 3PNYA 3COSA 4X1YA 3B7WA 1UMCB 3IDQA 5JJBA 3EF1A 2JGEA 1QG0A 3BZBA 3GNQA 3JQ9A 5EXEA 1RNLA 3AY7A 3HM2A 1YNOA 3Q3JB 4B8WA 5IYZA 2E7ZA 1NMXA 1J8QA 5GM1A 3I34X 2O1XA 3JQ7B 4DKXA 5IM4F 2YN2A 2EL7A 4XM2A 4A36A 2VJMB 3VR6A 1NRIA 4OM8A 1ECGA 3FJ1A 4RK5A 1M6YA 4KQMA 3A11A 2OEPA 2ZJ8A 5TPWB 3H04A 3C1AA 3C8HA 4Q3NA 5D5QA 4D9IA 2Y0PA 4Y9RA 2XWSA 3SX4A 1NKSA 1KFKB 2CXPA 2J9YB 4R16A 1L6RA 5DTQA 5ETJA 2O8EA 1IM2A 1DJNA 4ZYWA 1U0JA 4OMUA 3L82B 1O95A 4TTJA 5DTIA 2JGAA 2O2DA 3BXFA 3FKJA 5KU1A 1QVVA 3A4MA 3D3WA 2VDNB 4R81A 4M0MA 4EG4A 1GG2A 4IZ6A 3ROMA 3I42A 4EHFA 3NH9A 1DKOA 1XKQA 4GDMA 2I3ZA 3MJ4A 1ZKMA 1Z8HA 2X15A 4US0R 1EDDA 2QRGA 3SQNA 5HGJA 5H70A 2YFQA 4XVCA 1FXWA 5D6NA 5AM1A 2CXOA 1IDOA 4ZARA 3DD1A 4R9RA 3R7WA 1JBEA 3O8BA 1T6ZA 1FS6A 5ABPA 1WXQA 2C83A 3PXBA 2J9XB 1PK8A 3N2YA 4AM8A 1M0SA 1CETA 1UFVA 4JV5B 4HGPA 1VIVA 1V2HE 3ANTA 3M82A 5JO9A 4BASA 4EG5A 4LOIA 4AK9A 2I3GA 2JCVA 2KS6A 3PC8A 1C4XA 3ZV4A 1Z8NA 1ZY2A 3H1PA 2B30A 3Q3HA 3L6DA 4IXNA 3HKDB 4CMIB 4D7AA 3GH1A 2ZBRA 4DQ0A 5L51A 1K66A 2W2QA 1WDMA 2AKYA 2BOVA 1S2DA 4WKNA 3SSNA 2QSYA 3IOEA 4I6EA 1SU6A 4XWWA 2GXAA 1U81A 1QGOA 5THXA 3ZCUA 1MW8X 4L4SA 4GGOA 2AF3C 2Y4OA 2H29A 2XGOA 4FFSA 3O83A 3QHAA 4KHZA 4TUYA 3E3LA 1WXDA 1SH7A 4HX9A 1YB2A 4LY6A 4AX8A 3REGA 1SEPA 1CS0A 3VTAA 1GKLA 3LA8A 3FLEA 4UBMA 1YCDA 1XQ6A 3OQVA 5CFNA 3QLVC 1ODLA 2O5VA 4PSKA 4OHZA 5K0LA 1GCUA 1RJ9A 2AMLA 1L5NA 2EF1A 3G0HA 2R1TB 1Q83A 4TXNA 4R2LA 1AUXA 2WTBA 1J8DA 1QV7A 4RFSA 5DK6A 5JR3A 5EMKA 2XI4A 2XMGA 2P2GA 2QN3A 3H19A 2ZQ5A 1J8YF 2EFEB 4MVJD 4A91A 4AZ3A 2MU1A 1IPFA 3VI3B 4WLVA 3AH8A 3BMXA 3RWMB 1VL0A 4Q21A 3HCWA 3QFTA 3MSCA 2HPAA 3M6VA 4REMA 4QO7A 4OQXA 3AU8A 3U9LA 1PT5A 4IUBS 1WJGA 2BZSA 2QRPA 1T43A 4JP8A 4N7JA 1J07A 1NOKA 3LV8A 3X43A 1E9AA 1LPAB 3ECCA 1JRLA 5ALUA 5IH7A 3CJQA 1J4AA 3NLLA 3F9CA 4YP6A 3S7ZA 3WKCA 1PS9A 2W8ZA 2F8SA 4YP0A 4G0XA 1PFQA 5AXCA 4E11A 1F8YA 5LWQA 4KUGA 1KKLA 2X1LA 1L7MA 1XK7A 4IJMA 4JBNA 4YUXA 4LZOA 1F8XA 1D04A 4FZ3A 3H2YA 1HE3A 2ZE7A 4M8SA 4GI1A 3LOQA 3RV3A 1QE3A 2M6RA 4OXYA 4URXR 4TWJA 2CHQA 2Y1EA 3Q5EA 4FZJA 3RUAA 3ENWA 5DDIP 1FYWA 1R4ZA 1IJKA 2GB4A 4JLMA 5FRDA 5C4GB 4EKGA 4RACA 1K88A 1RQPA 4WJLA 4U5QA 2GTPA 2KB0A 4RTOA 4AUEA 2OZLB 4MV6A 2HK6A 2Y6VA 2G0NA 3EGDA 2H4JA 3DB1A 4GXRA 5AUPB 1CU1A 2MOKA 3IUPA 3FYTA 3ZDFA 2FRXA 1ESNA 2VP2A 2Z3WA 4DJTA 2VJOA 2IYVA 3KZVA 4IQ4A 4CQJA 2CBGA 3X1KA 1FCJA 4BKQA 1Y7IA 3C7KA 4NYJQ 4UOQA 5IJ9B 4L8VA 4NCHA 1F20A 3CE9A 1O0CA 4BBAA 3VYWA 1RC0A 1OH5A 2EARA 2YHSA 2VDRB 3ZWVA 1RZVA 4O3MA 2J5XA 4NYIR 2QN7A 2YY7A 1AKMA 1J6UA 2K5UA 2B8NA 1C0KA 4HAUA 1IWBB 5FPHA 3BDIA 1F06A 2L17A 4DC1A 1C3EA 2ID4A 4OX9Y 4BE9A 1BHJA 3QIAA 4HATA 5AJVB 3SS7X 3EPKA 2DLCX 3JATA 4BNIA 3VKFA 1YS2X 1T3ZA 4WA8A 3ZWPA 3UJBA 3V33A 1QJ4A 2QPAA 3PNSA 1GSOA 1DC6A 4FFOA 4KXVA 3IUNA 4X61A 5T3UA 3ZIAA 3HL0A 3RBAA 5LP6C 3RAEC 1LDGA 2ALJA 2CUTA 1YR8A 2DY0A 4FE7A 1C29B 1VJ1A 3PKZA 1NUQA 2F8LA 1ANKA 1T3LA 3WNCA 3CF4G 1B0ZA 1JJVA 1OXSC 2FZLA 3MUOA 2BGUA 4UTXA 3VUFA 2VPYA 3AT1A 4D81A 2DB3A 1U6JA 3GEHA 1X3SA 2ICAA 1WO8A 4Q9LA 1YB6A 1MGPA 4GXNA 4E5UA 3BQ9A 4LKOA 3BB4A 3OJCA 4LJ6A 1DOZA 3HXMA 3ABOB 3KALA 4FM9A 3HCNA 1YL7A 1A50B 1Z4NA 3R3VA 1UIMA 1UBOS 2BFFB 4WDRA 4BQQA 4CM7A 2EWWA 1JHRA 1Z73A 5DU2A 4ZANA 4NEGA 2V3WA 1AQIA 1R10A 2J5KA 2Z04A 2HBRA 5TF0A 4XARA 2D0IA 1CDOA 3UMVA 3ZX5A 2O3SA 3VMFA 4GO1A 4LGYA 3ILVA 4INJA 1EK2A 1BH6A 3DJFA 3R0VA 4FLFA 4IH1A 4MHTA 2CFTA 2Q5FA 4ILKA 4KR3A 1M54A 5ALYA 3VBEA 4D4MA 1Q17A 2FEWB 1GG9A 1SVNA 3M4JA 2XNDD 2I3DA 4BFSA 1KZ4A 3LTEA 4C5CA 1KS9A 2RHCA 1JXMA 1Y8AA 4J91A 2O5RA 3O4JA 4FFMA 3E27A 3VZPA 1P60A 4KIUA 1JPVA 2A35A 5EMNA 2CD9A 2RI6A 1JSZA 2XW6A 3QLVA 1JFSA 4CKCB 1A95A 1BGVA 3SS9X 4FHFA 2WM2A 5EJGA 3GNLA 2DCUA 1NOJA 4QQKA 4Y30A 4BX3A 2AFIA 4YQYA 5E1DA 3JQ6A 3QOWA 4WH0A 4UOZA 5CDUA 2RJOA 1L7NA 3PL1A 3I37X 3K09C 2Z3VA 4QHTA 4QJBA 3TMYA 2BFDB 1PD1A 4QUAA 3JV7A 3W6OA 4ARZA 4KUHA 3WKEA 2PS3A 2RGCA 3ZBTA 3UCXA 1JE1A 3DNMA 4RZSA 3CMCO 1JU4A 3VYVA 2DAPA 5I7FA 2JLZA 5ICEA 4ESVA 4C7MA 4D8WA 2P35A 3HLKA 4OHWA 3H1AA 5KYYA 5A71A 3RG2A 4IIFA 3JZMA 4TXHA 5CB8A 5ERXA 2DRIA 5HQJA 2HHJA 3FNBA 1G9TA 1HFWA 1HLGA 2BP7A 3QY9A 4GM4A 3TIGA 4IRUB 3SQDA 5GJCA 1WETA 4FWTA 2UUBB 5J2TF 3UOGA 2JGLA 4K9LA 5AW7A 1YZTA 4UNNA 3RYHA 4B7XA 1YONA 1DWQA 4TYPA 4NBSA 4RU1A 3TJRA 3AR4A 5KYVA 1ZUIA 3V7WA 3Q7SA 3VYRB 3ZCPA 2DECA 2C82A 2ZYHA 2P41A 4LMBA 3X3HA 1E1LA 4EPRA 4JLJA 1MP0A 1J24A 1RLJA 1ZNYA 2Q28A 1J9EA 2ZIXB 3JWPA 2O2YA 3LRXA 4J90A 3WTBA 3IP7A 4AJNA 2RCNA 4FMCB 1FFGA 2YIJA 3JTMA 2GAIA 4JODA 1WABA 3ZCVA 4W5QA 4C7KA 1Z6YA 4HLCA 4OOFA 4GWGA 4QVGA 3LIIA 4CDNA 2A0UA 2P78A 3EPPA 1BQ3A 3JYOA 4LRWA 3BRCA 2VNJA 1Z6XA 3AKDA 2RBKA 2NTEA 3JQ8A 3JQAB 4C0BA 4F9TA 1UFOA 1NVMB 3FYDA 4Y98A 4CKWB 3NTOA 2C59A 5DM0A 1WXFA 1K5GA 3SLKA 3O74A 3RK4A 2Y0CA 1PNQA 1KETA 4R1PA 4U2EA 2ZG6A 2HV8A 5BURA 4L2IB 2L0XA 1UFQA 1QGDA 1NXQA 1QKKA 2IZOA 2P4UA 1YBVA 3G59A 1CJKC 4R1TA 2BSAA 4UBKA 1ECJA 2J9ZB 1P4JA 3SR3A 4E14A 4OHKA 4MQLA 1HRKA 2P9BA 3W3AD 3KJQA 4XGRA 1E1QD 3NW9A 5H1YA 3UHPA 4EB0A 3IV7A 3MEQA 5ECWA 3VPGA 4JB8A 1FL9A 3VR6D 5DSXA 3U6BA 1A9SA 5EG5A 1PG0A 1I2DA 2FPRA 4D4JA 3TQFA 1YZGA 2VNSA 2VG8A 4ZXPA 1G21A 3JSXA 2B5OA 4LYDA 3HEAA 3GRPA 3V5NA 3MCTA 1R4MA 2CW5A 3D3QA 4FW8A 1RZ3A 5CUQA 5HCNA 3X1YA 4URFA 1HTTA 5MN4A 4KOEC 1F38A 4MINA 3T15A 1W94A 1Z0DA 5J23A 1E20A 3TB4A 4JI2B 4J0GA 2H51A 1M83A 2ZSUA 1NE7A 3N76A 2YWRA 3DBRB 1GAWA 4RV9A 3B3JA 3W3AA 1OAAA 2FG6C 1K8QA 1J2JA 2CFIA 2XB9A 4K40A 2QD2A 1PZHA 1BXZA 1J0BA 4OOEA 3W6ZA 3ZWQA 1CF4A 1ISRA 1QHNA 1LKZA 3J7AC 4MV3A 5BSFA 5HIAA 1KEKA 4FX2A 1FSGA 5CDGA 4A9AA 4KI7A 4EECA 3R9WA 2EX4A 2K7ZA 4P0QB 2NMVA 2D8AA 3W8DA 2EXXA 4ENVA 4MYRA 1AS0A 1SC1A 4DCOA 4JBLA 3PUKA 1JJAA 3T5AA 3EVTA 1E1CB 3LIPA 5DULA 2PX2A 4GX0A 1ZBQA 2ZT5A 3Q3GE 3T9BA 1T9GS 1LLDA 2BGKA 1FW6A 4OGGA 1B7GO 1OT3A 3OT1A 4E12A 3S6JA 2WOOA 1YACA 3L1HA 4L0DA 3N6VA 3C3BA 3E35A 2X7HA 3LY5A 2R8ZA 3K1JA 2DBYA 1DAPA 3DW3X 3EG9B 3DAOA 1UK8A 4V1CB 1UWVA 3ZQ4A 4TYMA 3QMVA 3SVZA 3Q8KA 4NBTA 1JIQA 1GUAA 2IGBA 5JBQA 2ZYDA 1M2EA 4GPIB 2Z83A 2JFNA 4PV7A 4BJHB 3G8CA 1QO9A 4XB2A 4OU5A 1XVAA 4G41A 1QIKA 2XIJA 5LR6A 2DERA 1A71A 3L01A 4D9MA 4EB8A 2GD0A 1DCMA 3JAKA 5DBGA 2ZSIA 1C4KA 2JFVA 2NX2A 3F4BA 3IKJA 5HJ7A 3TDMA 4G9GA 1JHMA 2H4HA 4BQIA 3D8SA 1JZTA 4MLZA 5DM60 3H5NA 2Z6VA 4LWPA 1JG3A 2V6BA 5AQEA 1U9IA 3VJKA 1JS1X 1W5EA 5LZ4A 1MAVA 1FFWA 5M5BA 4R2IA 1YOVB 3L7OA 1LJLA 1PQ4A 3MQ4A 4Q3EA 2G9QA 1DWPA 1F6WA 3PQCA 4IWXA 3VSBA 3PHCA 2XRZA 1U2TA 1DPGA 3JQGB 3Q41A 3R6LA 3JVUA 1I5RA 4HOYA 4LQLA 3HCEA 3SU8A 3LBFA 3M6MD 3RFUA 1R7RA 4CG2A 2CFSA 4BO2A 5AVUA 4TM8A 3RQIA 4P3KA 4MS3A 4QKQA 4ZI7F 3G85A 3AM1A 3EFBA 4YV1A 4NBKA 3E82A 3BDVA 1JHUA 4IFBA 5CX1B 4CEHA 1FP4A 1IBCA 4M2LA 2JIDA 4G09A 4YCNA 1EGMB 3MFYA 4EFKA 5FYDA 5SY4A 4AG3A 5AVVA 5JIBA 2Q5IA 4QFBA 4AN4A 2C2WA 3DVRX 1P77A 4L15A 4E08A 3J81k 4KI0A 2W6JD 4WZAE 1MAHA 3QH4A 2PNJA 4GAEA 4KZPA 3L8EA 5CA1B 4CW7A 5AOCA 1E61A 4L16A 3EWSA 3WL7A 3L4BC 4JQCA 2Q5QA 5HRUA 2RGXA 3DMFA 4PN3A 1GA1A 2BM0A 3SMVA 4Q7KA 2QDXA 4NJMA 4B3CA 4BVLA 5L7YA 2I91A 1E98A 3DZJA 2IDZA 4HNAA 1L7EA 4QD3A 5FFFA 1PP4A 2WJWA 1TMYA 4B7UA 2JLWA 2BJWA 5DKFA 1L1FA 1BRMA 2GMWA 1A8HA 4FEGA 4PF1A 5AW8A 3N8GA 3ZBPA 4C7VA 3QXSA 1FZTA 1T10A 4INPA 1CVLA 1TE2A 2VDVE 4OGFA 3OKFA 3TR0A 1XDGA 4N8DA 5EOVA 4TTAA 1INLA 2CNNA 1W4ZA 3A9RA 3CKLA 5I8ZA 1FSFA 1AH2A 1G6OA 4FNAA 4N5MA 2FF5A 2GAJA 4Q3CA 3V8EA 3ZDXB 4ZCTA 1ECLA 1SPXA 1SWVA 1P33A 3D6AA 4E70A 1G7SA 5KKAA 4AUMA 4EVSA 2UUCB 1F17A 4RCVA 3RAGA 2Y0DA 3IAS1 3L40A 3I64A 2NIPA 4IDPA 4EBFA 1IG3A 2HMUA 3E8SA 1B8VA 4UEJA 1H4VB 4ZVLA 4GE0A 1RRFA 2E4VA 3H5OA 1LB1B 3R3WA 4TLMB 3QVMA 4HPWA 4CM6A 5LDHA 3BULA 2VI5A 3GG9A 3M3HA 3WSWA 3QUTA 4O2LA 2NACA 4MV8A 3JALB 3HA2A 2ZUTA 5H4HA 4EG1A 2E89A 3TTYA 3K92A 4M6WA 4F1JA 1EKXA 3IILA 4EA6A 3RRFA 2BEKA 2HL6A 3CM0A 1KFCB 4S1WA 5D1NA 1D2AA 3NHFA 4Y2SA 1NVTA 4B6OA 1EX6A 2Z9BA 1XJWA 2F7SA 4YP9A 1K08A 2OPBA 5KWIA 3D7NA 1O5OA 2X42A 3I45A 3GLTA 3CSDA 1Z88A 1W0CA 2EIHA 2O4CA 3MBKA 3O2QB 3T0GA 1Q1ZA 2J31A 3BQMB 2RC6A 3PC8C 1XP5A 4NESA 1WR8A 2C1EA 5ULLA 3CA8A 3KXPA 4FDTA 4YO7A 4N0EA 4A16A 3KUKA 3EGIA 2YQ5A 3EFEA 1F2DA 5TY0A 3UUGA 4G8BA 1UBLS 3HCAA 4N0MA 3CX6A 4JXXA 1LVGA 1O6CA 2H59A 3D0OA 5C51B 2HLDD 3R5JA 2X9NA 4MKZA 1DRKA 1ORHA 2ZBEA 3ZU4A 1OKKD 3ZCRA 3ZGLA 1KXZA 2IPMA 2GPWA 2CMHA 1A5ZA 5E8RA 1YAHA 3CURA 1YB5A 2NUBA 4IJ5A 2DUJA 1OXTA 4IHAA 4RY0A 3ZE1B 1U0HC 5B7GA 4YMGA 3ZEIA 5IXYA 2V7GA 5K6RA 3M6UA 3VC3A 4KPFC 2R7MA 3ABSB 3ECAA 4UCXA 5HIJA 1RDFA 1VB3A 3V2GA 3C3DA 1Z0AA 4UUOA 3FR8A 4YAJA 4DCUA 2OBNA 2ZIFA 5ALMA 3QX3A 5KX5B 5FBLB 2HA0A 3H6KA 4NU0A 4ZT4A 1VCOA 4WD3A 2DEUA 1RCUA 2V7EA 1X1BA 2PTGA 2V7PA 5AKLA 5MGBA 1J9GA 3SHFA 5ILGA 3X1WA 1KEEA 4FYKA 4JUFA 3QENA 4ERXA 4POAA 2BDEA 2ILVA 3E2PA 1LSOA 2R1VA 3EYAA 3VZDA 3FTPA 2YC4C 2AZMA 2GK6A 4UVHA 3F4LA 3OZSA 5BQOA 1NYQA 1YH3A 2WZBA 1E4VA 2PHZA 4KVFA 5CM8B 4C3UA 3WHKA 1VIMA 1NI3A 5FEMA 1HFKA 4YRNA 3E3OA 3UFXA 2AG1A 4M0UA 2WHRA 1D6SA 1AK2A 2CNWA 1OPRA 4MUAA 5CX1A 4LRQA 2EZ4A 4QUEA 2O8BA 5H82A 3TZEA 3F7MA 4OI4A 2O8DA 4P7FA 3S5JA 5LD2B 1RHMA 4D0LB 1L8QA 1DKLA 4RKRA 4ETMA 5KYWA 4G2TA 4OJMX 1FFXA 3CCCA 1I9CA 1W48A 4BNLA 1GRVA 4K8OA 4XA8A 4II2A 2QU7A 1QDEA 3WIBA 2DWOA 3IBSA 3O91A 3RTEA 3NZEA 1R8XA 2I33A 2IT1A 2P4SA 1COWD 5AVQA 4Z9BA 2Z5LA 1QP4A 1Y3IA 1SCKA 2Q3LA 4IQ0A 4RZHA 4Y2HA 4RZQA 4S1TA 4IRMA 4JJIA 1G3RA 3WNDA 4C3ZA 4XCQA 2QG6A 3BCUA 3HBAA 3F5SA 1ZIDA 3INYA 3NOQA 4CQLA 3N2KB 3KX2A 3C14C 2BMDA 3PK0A 2IYXA 1FX1A 5F5XA 5E6RA 1KI9A 3ORHA 4AUKA 1I3CA 3BHIA 5AJHA 3ZXIA 5CLGA 3G7SA 1JLLB 4QU5A 4JYZA 2C4NA 1F0YA 3AESA 1A2KC 4RCYA 2GN2A 1V3UA 3EW7A 1DIRA 1GNQA 5AI8A 3W77A 3X44A 2R3SA 1N5DA 1T2CA 3CNBA 1GUZA 1TU3A 1P0IA 1U8FO 1J7JA 4GEKA 2NAFA 5CX4A 2OB2A 2GZ3A 5D7NA 5FI3A 1MAUA 4XPIA 5HIKA 1CQJB 4MW1A 3MK31 4QA9A 3I5YA 4RYDA 2QRHA 2ZBDA 3CG0A 1VJ0A 2DPMA 3I2KA 4M1EA 1LQ2A 4PYOA 5DGCA 3ROZA 1HMPA 2BFNA 2H1SA 2Y0EA 3IHKA 3LWBA 5IAGA 4DC0A 1LD3A 1S6YA 4KVAA 2R00A 2P75A 3M1AA 4M6WB 4S2UA 3P2KA 5DYNA 3ZUPA 5I8WA 7REQB 3CWZA 4DSOA 1AHIA 4UDOA 4HWGA 4A3SA 3W1VA 2JK1A 2VXYA 4GPZA 3OQPA 1LPMA 1E1RD 2GK4A 3CFYA 5HFAA 4CKBA 4HLNA 3P0FA 4UFNA 3VO8A 2WFLA 3B7GA 4CBVA 4NCKA 1JWAB 3ZHYA 1PWYE 2BFAA 5KHLB 1BXGA 2N47A 4HQKA 5E9WA 4CGZA 3BTUA 3TB6A 3FUTA 2X5NA 1EZZA 4B33A 1UDBA 4UTOA 2WNSA 5BV2P 1ZVVA 1SPBS 2NU9A 5IG2A 2MYTA 2BEVB 5FB3A 2MINA 3E9DA 2EAUA 1F0PA 3G68A 4J43A 2PA0A 1JQEA 1JXQA 1U04A 3L0BA 1AKRA 2ZSHA 3JQBA 3QW2A 3ZXYA 2VH5R 3B52X 2FCAA 3HPQA 1T24A 3L7YA 3TRKA 3AY3A 3UJDA 3DMNA 3O93A 4Y1EA 2JA2A 3WP0A 4MVJH 3CPEA 2NYVA