4HSGA

Crystal structure of human prmt3 in complex with an allosteric inhibitor (prmt3- ktd)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
298
Chain Sequence
b'YGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKSLTVTLTLNNSTQTYGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRMT3 protein
publication title Exploiting an allosteric binding site of PRMT3 yields potent and selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 298
sequence length 304
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4hsgA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4hsgA01
5ERGB 4BLWA 2C7OA 2AN3A 2B9EA 3UWPA 1L1EA 1WG8A 3LDUA 2XVAA 1BHJA 3GDHA 4PYQA 3GWZA 5DXAA 1XCJA 3UJ6A 3FPHA 1I4WA 3I53A 3I5UA 3DLCA 3V8VA 1X1DA 5DX1A 2ZSUA 4LWPA 2Y1WA 4M36A 3B3GA 1JG4A 3KR2A 2AOTB 4M38A 5EC8A 5FCDA 4RVFA 4RX1A 1L3IA 3D2LA 3EVZA 4IWNA 3NJRA 3VC1A 1N7IA 4MWZA 4DF3A 5K09A 5K05A 2V7EA 4HSGA 1X1AA 5E1OA 3T0IA 2UYOA 4YUVA 1VIDA 2QYOA 3E23A 4B17A 5G02A 1F38A 4RWZA 3UJ7A 1JSXA 4X60A 3MHTA 1N2XA 4M37A 3IHTA 1D2HA 4AZVA 2CKDA 3KPJA 4P58A 5DRYA 3EEOA 2AN5A 3FTFA 2AVNA 3EMDA 2DULA 5K8VA 1YZHA 3CVOA 3LKZA 5EG5A 2P8JA 5D1NA 4DCGA 1AQJA 3KPWA 1R18A 1FP2A 1RI2A 3UJBA 4CWAA 2P7IA 3EVGA 1XVAA 3AXSA 3V97A 4PONA 3UA4A 3SXJA 1EIZA 4FT4A 2JJQA 3T7SA 3ER8A 1G6Q1 2G72A 4KW7A 5EHIA 3HEMA 5FA8A 4F84A 4U7TB 2WA1A 5P8WA 2ZZKA 4HC4A 3FYDA 3M6VA 5FTWA 3O31A 3LL7A 5CVEA 5KYGA 5EIWA 2IDKA 5GIOE 4LWOA 1NT2A 1NW3A 3OPNA 5K0JA 2BR5A 1INLA 1G8AA 2JHAA 2PWYA 2B25A 3LPMA 1FBNA 3GRRA 5EIFA 4YMGA 3HCFA 1BOOA 1R74A 4M7RA 1SUSA 3R3HA 3M6XA 5IKMA 3FRHA 1FJXA 1HNNA 1L3CA 1SQFA 2ZTHA 5DTMA 3TKAA 3NWEA 1L3BA 1IXKA 1WY7A 4PYLA 5EHGA 3KU1A 3P2IA 3JWJA 2OXTA 3NVKI 3K6RA 3PFHA 4YV1A 3BKXA 2FYTA 2C7PA 4YUXA 4C08A 3X0DA 1P91A 2CMGA 3B7PA 3OFKA 4FS8A 4EK9A 3P9CA 1F3LA 2GB4A 1XXLA 2ADMA 1XDZA 3FPJA 4YV0A 4KVZA 1HMYA 1SVUA 3DMGA 3ELWA 5HEKA 2FPOA 2I9KA 2GH1A 1JQEA 4ER7A 3KQPA 5K0FA 3G88A 4KIFA 5E8RA 1ZG3A 2NYUA 2PX5A 1YUBA 5E2AA 4MHTA 1RJDA 3JWIA 1SUIA 1R6AA 4EVIA 3KPVA 3TLJA 4V0RA 2IH2A 3BXOA 4QDKA 1VPTA 2JH8A 2AZTA 3DTNA 4RVHA 2OBFA 4O29A 3HVHA 3FPEA 3I58A 3CGGA 3T7TA 2NNWB 2VDVE 5CUQA 5CD1A 4RTJA 2XBMA 4KDCA 1O54A 2GAFA 4IV8A 3MB5A 5HIJA 3HCEA 4BLUA 2DPMA 2ZVJA 2YXLA 4KRGA 3LDGA 5LQCA 4GUAA 3GGDA 4UOEA 5BP7A 1JG2A 1O9HA 2ZIGA 3OZSA 4NECA 1BC5A 3Q7EA 5FQOA 1FP1D 2O05A 3G7UA 1QAQA 1WXWA 3A25A 3OCJA 4CKBA 3HP7A 3EVEA 4P7JA 5CVVA 4OBXA 4DCMA 1NW8A 4FP9A 1B42A 4E2XA 3OZTA 1PRYA 4RTQA 4DM3A 4MQ4A 3P2KA 3BWCA 2AOVA 4KIGA 4RVGA 3BGVA 3R24A 2YXDA 1JTEA 3RIEA 1V39A 5M5BA 2O07A 2ZULA 3P97A 5DM1A 5E8JA 2B2CA 1QANA 3CKKA 3SX0A 2UYQA 2NP6A 2ONZA 1YFJA 4X63A 3NW9A 1OR8A 2YTZA 3G8AA 4LECA 5FA5A 3DLIA 2AOTA 4HG2A 5DLYA 1UFKA 2O57A 3OU6A 4E33A 2FK8A 4Z2YA 4BLVA 4HH4A 5EEGA 2NXCA 5HILA 2G8NA 3HCBA 3VSEA 1JR4A 3HCAA 2Z6UA 3B3FA 1XDSA 3EVFA 4KWCA 5FHQA 3TQSA 3LGAA 5EZSA 4POOA 4PIPA 4RTKA 2PT9A 1ORIA 2YQZA 3UJ8A 3BGDA 3ER9A 4QQNA 3SM3A 4RTLA 1ZHFA 4GOLD 5BXYA 3GNLA 5ICGA 2PX4A 3KR9A 5MHTA 3OFJA 3KQVA 4RTMA 4CTKA 5CIYA 3KR0A 1XDUA 1Y8CA 4E2WA 5DT2A 2FK7A 2ZIEA 5EMJA 3I64A 3E05A 1EG2A 3UZUA 1KPIA 3ELYA 3THSA 3DXZA 1G55A 3HNRA 3RW9A 1MJFA 3HVIA 4CTJA 3G2MA 3IV6A 3UFBA 2PWPA 4FR0A 3MCTA 4P7FA 3BWYA 3BKWA 3JWHA 3MCZA 3ANXA 2C7QA 1T43A 3L8DA 1EQAA 4IV0A 4DQ0A 2IBTA 1L9KA 3REOA 2AOUB 2IFTA 3LHDA 3O7WA 1VQ1A 2FHPA 4AX8A 4G56A 5GWXA 5ICFA 3LDFA 5KQSA 2KW5A 3LCVB 2H11A 1NV9A 4GC5A 4AZTA 4CKEA 5GINE 2ZWVA 2IBSA 3M6UA 2HV9A 3OU2A 1KP9A 2PXCA 2EJUA 2IGTA 4LG1A 3FUWA 2IIPA 3VYWA 2PX8A 4IKPA 2YR0A 3A26A 2XYRA 1G8SA 4MIKA 2Z6QA 3FUVA 3P9IA 3P9NA 3SGLA 2QRVB 2AVDA 3B3JA 2JHCA 4RTOA 5HZMA 4OQEA 5HOQA 1IY9A 4XUCA 3LBYA 1NBHA 1P1CA 3MTIA 4K6MA 5B1SA 3MQ2A 3BWBA 4HGZA 1SG9A 2R3SA 2ZBQA 2PVCA 4R05A 4MTLA 4E2ZA 5LQKA 4PGGA 4ER5A 2UYHA 1QZZA 3EGIA 3DXXA 3G2PA 3LCCA 1R00A 3SR4A 4R8RA 2FCAA 4YUZA 1JG3A 5DWQA 3A4TA 2PXAA 4HRAA 3G2OA 2AN4A 2V74B 2PT6A 3ORHA 1DCTA 2HTEA 5DTQA 3PS9A 3TKYA 1H1DA 2R6ZA 2P7HA 1YZ3A 3A7EA 5F2NA 2AS0A 2OKCA 3DULA 1XJ5A 2ZZMA 3C6KA 3FUXA 2G1PA 5EZQA 3SSNA 1MHTA 3BT7A 4QTTB 4E70A 2P3LA 4GC9A 3PTAA 3LBFA 3THRA 2YX1A 3HCDA 5DTRA 3B5IA 3NVMB 4FSXA 3FTCA 4C4AA 4RTRA 5K03A 2P1DA 1UIRA 2ERCA 3M33A 3P2EA 1KXZA 3AXTA 4HGYA 4PCAA 2B78A 1ZGAA 3TRKA 3PB3A 8MHTA 5HIIA 4YMHA 2BH2A 1RI4A 2AOWA 3C0KA 3CC8A 5IH3A 3HM2A 4U7PB 5DM0A 2YUIA 5LQRA 3MERA 3LECA 2HNKA 2NXNA 3EVDA 2JHPA 3KQTA 1IM8A 3BZBA 5KS2A 1PJZA 1X19A 1XTPA 2OZVA 3ELDA 3GU3A 4EQZA 3FTEA 1JTFA 5EKUA 5HIKA 4OA8A 4X1OA 1TPYA 2BM8A 2LD4A 5K0CA 1U2ZA 3KHKA 3I9FA 4E2YA 3GIWA 4PIMA 9MHTA 5LR6A 3R6TA 1YF3A 4RYLA 5H02A 4QPNA 4XUEA 2IP2A 2NXEA 3DP7A 5E1DA 3TM5A 3TR6A 4DA4A 5F2OA 2I6GA 4GBED 3IEIA 5K01A 5KQRA 4RTNA 2PSSA 1VP3A 3BUSA 3HA3A 4GOOD 1YB2A 3CCFA 4RTSA 1KYZA 2I62A 2NP7A 1X1BA 1WS6A 3IYLW 2P41A 2ONYA 1KHHA 2OY0A 3KR1A 4V0QA 3HTXA 2ZCJA 3GRVA 4ATNA 2HMYB 1G38A 1QAOA 3AJDA 5LQAA 5EMKA 1KPGA 5EMMA 2G71A 3NDIA 2WA2A 4PYJA 3OZRA 2BM9A 4QDJA 1AQIA 2P3QA 1KR5A 5LQNA 1Q0SA 2AOXA 3TM4A 4GEKA 4QPPA 5FUBA 3G2QA 2O06A 2P35A 3OE5A 1DL5A 5DSTA 1NE2A 1NV8A 3K0BA 3PVCA 1VP9A 4PGHA 4XUDA 5E2BA 2CMHA 3G89A 3MTEA 4CXMA 2UZ4A 4OX9Y 2C7RA 1P39A 2VDUE 3GXOA 4F85A 5JR3A 5GM1A 2VS1A 2E5WA 1UWVA 2UYCA 3R9XB 5GOZA 4P7GA 4BY9E 4E30A 2NXJA 1Q0TA 5E1BA 2AOUA 2ZBRA 3QV2A 2PY6A 5FHRA 1M0EA 3SSMA 4AZSA 2XYQA 2EFJA 3R0QA 4C04A 3C6MA 5T64A 2B3TA 5EVJA 1WXXA 2VDWA 5FWDA 3FPGA 4QVGA 5CVJA 1VBFA 2BR3A 2P40A 4AUKA 3A27A 5T67A 3FTDA 2I7CA 3HCCA 2ZWAA 4GF5A 2OYRA 4X61A 1Z3CA 3NWBA 1ZGJA 3NTVA 4Y2HA 4RVDA 3TPZA 1D2CA 3U81A 5FADA 1VLMA 2EX4A 2N47A 3ID6C 5EOVA 3FUTA 4ER3A 3KQWA 3FRIA 5K0NA 2ZIFA 1R8YA 2QRVA 4R6WA 1JQDA 4C07A 2Y1XA 4PYMA 5LSAA 5HIMA 4GOMD 1QAMA 4HTFB 4PYKA 2CL5A 2IH4A 3BGIA 3E7PA 3C3PA 3NDJA 4C05A 3KQQA 5K0BA 2QM3A 1AV6A 2WK1A 2PLWA 3AY0A 2GLUA 1AF7A 1ORHA 3EGVA 5K0GA 2JG3A 3AWIA 3S68A 3CJTA 4R8SA 4R6XA 3EVAA 3UJAA 1ZKDA 3EMBA 2ORED 3HVKA 4YUYA 1R8XA 3GRYA 5FWAA 4PWYA 3LCUA 3KPYA 3QOXA 2OO3A 2PV0A 3O4FA 1SKMA 2Q41A 3RODA 1M6YA 5C0OE 5T6BA 1XCLA 4PYNA 5EKXA 3HVJA 2QE6A 4ISCA 3H2BA 3VC2A 4RTPA 5DX8A 3FZGA 3M6WA 5LQUA 1FPQA 4EKGA 2EJTA 2PJDA 3P9KA 3EEYA 1BKYA 4RSRA 4BP3A 3FYCA 4FT2A 2H1RA 5F2KA 3UBTA 4X41A 1RI3A 2OB2A 4GQBA 3KKZA 4OBWA 5DPMA 5CCBA 1JG1A 2ZBPA 4A6EA 4E32A 3DXYA 1DUSA 5CVUA 5DRTA 4DKJA 1NKVA 1VE3A 3EPPA 4DMGA 2PX2A 4DZRA 4C03A 2HWKA 3PX2A 4KDRA 3DH0A 5DXJA 5DSXA 1KIAA 2EG5A 3UJDA 4L7VA 4WXHA 5K0EA 1TW2A 4JXJA 2ZZNA 4YUWA 4AZWA 3M70A 1VL5A 3PX3A 3FUUA 4PCLA 5EEHA 5CCXA 2PKWA 1NW7A 3HA5A 3EGEA 3LKDA 2AR0A 3G5TA 1X1CA 2BR4A 4FZVA 1I1NA 3ELUA 4Y30A 2ZW9A 3DOUA 2IDJA 5E1MA 1NW6A 2GPYA 3P8ZA 5GP1A 5CVDA 1KYWA 5DM4A 3PLAE 2ZLBA 3DMFA 3UJCA 2K4MA 2ZFUA 3UA3A 3EVCA 1RI5A 3ME5A 2O0LA 3F4KA 5U4XA 4OQDA 2XYVA 3KQOA 2PGXA 3G5LA 1O9GA 5C1IA 3UJ9A 2JH9A 3P71T 3M4XA 4H0NA 3EVBA 3KQMA 5FQNA 2VP3A 3GRZA 3JWGA 3SSOA 4PYIA 5E9JA 4WVLA 3A7DA 3DR5A 4GOND 3TFWA 4BP1A 4YV2A 5EGSA 3ERCA 3WSTA 4PNEA 4A6DA 4QVKA 2GS9A 4C06A 4XCXA 2F8LA 3CJQA 3LSTA 2VZ9A 3GCZA 4OA5A 2YVLA 4QQKA 2G70A 4RV9A 3OE4A 5K0LA 5CM2Z 3E8SA 1JQ3A 3TMAA 4E31A 3C3YA 2IPXA 1M6EX 1WZNA 3CBGA 5E9WA 5DX0A 3BWMA 3KQSA 4CKCA 3G8BA 4PINA 7MHTA 3NMUF 3DMHA 4EMSA 1RJEA 3CJRA 1KPHA 4ER0A 5BW4A 2XVMA 1QYRA 3PT9A 1N7JA 4FSDA 3T7RA 1ZQ9A 2GA9A 5EQJB 5HFJA 10MHA 5LQJA 2OPBA 5ICCA 3TOSA 1JSZA 3GRUA 5EPEA 4F86A 5BW5A 1YFLA 2QY6A 3PFGA 5FULA 1EAMA 1P1BA 3HA7A 2CWWA 1D2GA 3DUWA 2H00A 3KPUA 5D1HA 1NBIA 2A14A 3QOWA 3SVZA 2BZGA 4P7KA 5JUWA 4FGZA 1RJGA 2IH5A 5DM2A 1RJFA 3OU7A 1EJ0A 5GM2A 1G60A 2PXXA 3FPFA 3LX6A 3GO4A 2P3OA 3Q87B 5KVAA 1TW3A 3SMQA 5EMLA 1I9GA 4HTFA 2YXEA 3MAGA 1NW5A 4ER6A 4EKIA 2PBFA 3B89A 1EJ6A 2ESRA 3MGGA 4PYOA 5E9QA 5ICEA 2FRXA 1RI1A 1SQGA 4ZTBA 2Z6AA 5C9ZA 3GJYA 2HR1A 4QTUB 5GIPE 3KQYA 2OB1A
chains in the Genus database with same CATH superfamily
5BN5B 2XA2A 3KEMA 4OJKA 3LDUA 3HHPA 2GPWA 3JQAB 3WLLA 1QF9A 3VZDA 5MDHA 2OK7A 2VCYA 4ID9A 3GWZA 5DNAA 1E7WA 3RHSA 3E2PA 5BT9A 1AS3A 1E9RA 3QITA 2BKLA 3DLCA 4L85A 5LBUA 3E03A 4KBGA 1F8GA 3V7FA 4LWPA 4F45A 1NUSA 2FUNB 4RW0A 3OVMA 4B7ZA 1WCYA 2P9QA 3GJ3A 2JFYA 1N7IA 3PUHA 2EP5A 2V7EA 1S1MA 3SDZA 1MC4A 1SIWA 2HBRA 4LTNA 1YQGA 4JL8A 3TIGA 3PCTA 2NQ2C 1LC3A 4LYYA 5JZOA 3TNYA 3DB1A 3ANTA 5IXSA 2QM8A 4M37A 1T25A 3IHTA 1RRPA 3SJBA 4AXXA 5IF3A 2QTNA 1NF2A 2QW0X 2W2QA 3K0KA 5DRYA 4G3XA 4KRYA 2BLNA 4QU9A 3R7FA 3WP1B 4DN6A 1FSZA 2IYYA 4OU5A 5F7ZA 4HB4A 5DBGA 1S8FA 1AU9A 5DHTA 1P1RA 3UTDA 2H7XA 4LPKA 4KK4A 3AXSA 2YHSA 4P5PA 3L01A 4GKAA 3SIRA 3SXJA 3R41A 5K6RA 3O26A 3N2EA 4FT4A 4JITA 4YJDA 3R9IA 1Q22A 1I7LA 4YIKA 2CCJA 3OA0A 4JOSA 4Z0TA 4B6SA 4MA5A 5FUQA 4FN4A 4LHVA 1GADO 1L6IA 3HDYA 5FPYA 3SPXA 3IPCA 1C7QA 2F00A 3O38A 1TJ5A 4QDZA 1Z73A 4LOLA 5IM4A 2C77A 3LBAA 5TLSA 5HF9A 5KSZA 2W5UA 5C8YA 1B23P 1YVDA 4JJGA 4EP1A 4NJEA 5A6VA 4HHEA 1IN1A 3H5NA 2O50A 1AG9A 2PG3A 4G9GA 3VHXA 2HSDA 3PFWO 4D3ZA 4NF2A 1I3CA 4G0OA 2ZRQA 3QWHA 1W25A 4ZN6A 1GARA 1SKQA 1VSBA 1GCUA 2OBNA 2OG2A 3KX2A 3GUZA 4KB5A 4TWRA 3QEAZ 3VPGA 3K09A 1TXGA 2WSBA 3OIGA 3OQPA 1SO8A 4WNAA 5DE3A 1XVIA 1ZJYA 4YV0A 5KC8A 2XZDA 2I9KA 3D8TA 2VJMA 1GL9B 3WHIA 2DJIA 2P5YA 4F5YA 2HIMA 3T8YA 2I1VB 3W5VA 3RTDA 1B43A 2A5LA 1X7XA 3W7VA 2XYPA 2M6KA 4WJLA 4ND4A 2IH2A 1HKHA 4A6XA 1N2ZA 4BNMA 3BTUA 2VDVE 3BS4A 3JD3A 1RLIA 5ALZA 3RWBA 2G63A 2XBMA 1EFRD 2OO7A 4MSUA 3M1IA 2GAFA 1EK1A 1BS2A 1MAHA 1GL7A 2F1RA 2PUVA 2VKQA 2ZRFA 4YJGB 1STOA 5F1KA 4BLUA 4B73A 4CV1A 1PTKA 5GOTA 4GUAA 2ZRIA 3R5FA 4OI4A 5B4TA 4WOCA 1PU2A 2GFHA 5B3KA 3N8HA 3ZQKA 5LYJA 3EZNA 1DEKA 2JLQA 2GD1O 4D7AA 3T3GA 2H85A 4LRYA 3A0RB 3QG5A 4YMIA 2YIVX 2B98A 2PT5A 3G68A 3IOEA 3QU5A 2BFEB 3PC2A 1KNXA 4NJMA 2XRMA 4BFCA 3QPAA 2Y2VA 3BFVA 1NUAA 3AYXB 1E5XA 2A9PA 2YYZA 4PSUA 1GZUA 2RGNC 2JIZA 4KCGA 2YJNA 1V39A 3FPCA 2DWCA 3GT7A 1AVTA 3QXXA 1DEHA 1QANA 1MABA 2CHVA 3RFCA 4LTMA 1EX1A 1NBAA 4YDRA 1AKTA 1BH6A 1ZW6A 2GRAA 3OFND 3TZCA 4X63A 3H2KA 4KBYA 5FA5A 1JV2B 4KH0A 4ZZ2A 3ROKA 1N2CA 2BFNA 1NRXA 2FR8A 5AKXA 1NPDA 1N1EA 1RE1A 2Q3EA 3DT6A 4X1KB 3BMQB 4BUJA 3QJGA 3TG8A 1NUTA 1DRVA 1QCCA 2QSYA 1A9QA 4CF6A 2ZWIA 3HCBA 2XOEA 1MB4A 4BIMA 5CH5A 2Z6UA 1CFZA 3EVFA 4MV9A 4S2EA 4ALIA 3AI2A 5TQ0A 4AJNA 2PWAA 2VNHA 3INNA 4FONA 4MZDA 3C3DA 1FRNA 3K94A 2XBLA 4OMUA 4QQNA 1IN6A 2C2KA 4JJAA 4DUPA 3F9RA 3Q3VA 1U0GA 3QYAA 4BFZA 4L4RA 1DIHA 5HDBB 1UZUA 4YRTA 2J8ZA 2I7XA 3CLTC 3DD1A 4KITB 2GRUA 1QP4A 1JNXX 1FRVA 3C8DA 2GYUA 2OO5A 4LXGA 4YT5A 5AK4A 2O7QA 2FK7A 4MW5A 4AF6A 2NVUA 4I08A 2WFLA 4RA9A 2WJ3A 4WLUA 3UZUA 3PPYA 1USKA 2EBHX 1KQFA 4H3KB 4AMBA 4IIJB 1MJFA 4L95C 4FE3A 2KLHA 2QV7A 1L5LA 2PWPA 3GPDG 3S81A 1RU3A 2COUA 2R6JA 2YDYA 3DAPA 1RBMA 5BVGB 4YECA 1T43A 5CYOA 1C1XA 2GMWA 4IVRA 3SS8A 5ALEA 1R6VA 1IDOA 3RC1A 5DGCA 3LDAA 3BXFA 3P2MA 1XQWA 4ZDJA 1UINA 3BEDA 3MUNA 4S3MA 3FNEA 2XBUA 2ZWVA 1R9JA 3EGXB 3GUVA 1V5IA 3TCKA 3IRUA 3B3QA 1N3BA 1P4AA 2PLRA 3CU5A 5AK6A 3ONVA 1Z6QA 1E98A 4JJ8A 3B53X 5MN5A 3I61A 3FMIA 1DWOA 1SUCA 5C3UA 2DY0A 3DMPA 1WL8A 2XA1A 5CFMA 5J23A 3ZHYA 1QYDA 2ISQA 3ESBA 2P9JA 3KJEA 2GEFA 3M81A 5IWCA 3KKKA 3LC0A 1P2DA 2H4JA 3ZWNA 3SGLA 2QRVB 4CKXA 2EZ4A 4ZT5A 2AKEA 1CUYA 3AB7A 4H3HB 1LVUA 1F4LA 2P5TB 2Q49A 5SY4A 1HNWB 4DTCA 4NBKA 2XYGA 4U7JA 2EERA 3RIGA 1GDTA 3EUAA 2RJNA 4JLUA 3BWBA 4LE0A 1LVGA 4ZODA 1WEHA 1Z7WA 3DLHA 3EWAA 4MTLA 3MELA 4ESVA 1HDZA 3IIJA 3OE1A 5DJ5A 5FLYA 4TT8A 3PXBA 3VGPA 3NH6A 1NHGA 4KMSA 1LDBA 4XD2A 3LS2A 5DNVA 3W5BA 3RVSA 2P2LA 4D74A 4F9EA 3GJRA 5F2NA 1JR6A 3FFWA 4GPEA 3I2JA 4AQYB 1DQYA 1G3MA 1RM0A 4Q4DA 3VZSA 3GV0A 3L7AA 3CR8A 3ZIUA 1N2OA 4HAXA 3FVWA 4IGFA 4GC9A 4UHDA 1X70A 4DOMA 3ICCA 4EG4A 4AM8A 3PTAA 1RJ9B 1TM7E 1EK2A 1SG6A 2ZPTX 5ALSA 1YGYA 3B5IA 4O2BB 3ST7A 4ZYXA 3PKIA 5K03A 2XNSA 4JUDX 4DC1A 1NVKA 3HBNA 1UBUS 1T8SA 4H77A 5CAEB 4P4LA 3D6VA 3ADDA 2P9HA 4Q82A 3QKSB 2OAQ1 1KYYA 1VBMA 3LIPA 1EFCA 3CRVA 4NMWA 4TVBA 2QUZA 3LECA 3AHJA 4NFYA 4PC3A 1MW8X 3PUIA 2MIIA 2OZVA 1LLDA 2LIVA 2AW5A 3UPUA 1CNMA 1G21B 2X19A 4M6WA 5KINB 1TCVA 2DBRA 5A1JA 1GUFA 1W2HA 2EWMA 3GIWA 1TLFA 2DEUA 1GO2A 3W3AA 4E22A 3JU3A 4LVOA 3DOFA 4YRPA 3U3ZA 4HXEB 3OZVA 4A3SA 1E1DA 2QVBA 4HX5A 5IFLA 1NAIA 2ORWA 3QPBA 4JJEA 4TTTS 3BE8A 4UJ3A 2XD9A 3L4BA 2SKDA 1YQDA 3PL1A 3KDPA 1VZ3A 1NULA 2XITA 2WAAA 4MLPA 3RT7A 3EMKA 1ZJZA 5FL3A 4LXIA 4M7OA 1ZUHA 1K63A 1U1GA 2AFIA 4R1PA 5H70A 2LWIA 5JO9A 1ACMA 1WW2A 2FMTA 1Z34A 3FSGA 5BNWA 3NDIA 2R86A 1DIBA 2VT3A 3CN9A 2MR6A 4L5BA 1R5BA 2Z3VA 3AF2A 3VR2D 2XODA 3PE3A 2P6PA 3QWIA 3X2SA 2B5VA 2EF1A 1BDIA 1A50B 1VP9A 4LV8B 1E4YA 3K0HA 4KQ9A 4X54A 3HYCA 4KXLA 1P39A 2NUTA 5JR3A 1ZVQA 2HK8A 4URZR 3TW4A 5HUJA 1H4SA 4FW9A 4EG8A 3GFGA 1X9IA 1EP2B 1HRKA 2FN7A 1YZQA 1DT5A 5KU1A 3O3MB 3A58B 3EG5A 4LRTB 1SEPA 2G9VA 3BORA 3SEZA 3NUZA 4QOFA 4U6QA 3LAWA 1UJ2A 3I76A 3FDJA 4NZOA 2IXDA 1Y81A 4XX0B 4Q48A 1T5DX 5TMBA 1BKSB 1XAHA 3R76A 3OURA 5JXGA 2R79A 3TOVA 2C04A 3TQRA 1ONPA 1C3LA 1T26A 2WR8A 3OJLA 4JY7A 5BN4A 4BE4A 3E82A 5LP6A 3A9TA 1XLUA 1Z2PX 4FFSA 1V11A 2DFDA 5IJ9A 1GGVA 1CQZA 1Z25A 2ZIFA 3ZWCA 1W88B 3ZI7A 4Z1MA 4C3UA 2FW8A 5B12A 5A03A 2OZLB 3QEOA 5D85A 2XPCA 4P0QB 3FFTA 4KV9A 4UHBA 1Y3DE 1ORHA 4L07A 4M89A 4UREA 4E09A 3DT8A 4B82A 4R6XA 2JAXA 2JC3A 2G06A 2X0KA 4DBLC 1JLMA 4DJTA 1OFUX 2O2GA 3B6IA 2R2AA 2KM1A 4CETA 4RF4A 3ZCTA 4EPVA 2H0AA 3ML1A 4GECA 4JC8A 5T6BA 5LMZA 2JLWA 4HNSA 4UCFA 4V1CA 2ENUA 1XCOA 5G40A 1AH2A 3A06A 1XRQA 3BJEA 3WQBA 3ICPA 1XKQA 4BBJA 3GJ8A 1GR0A 3UJPA 3U4MA 1EVJA 3T5MA 1YDFA 5C18A 4LRWA 1P74A 1HE2A 3M4YA 3R9KA 4R8LA 5TT0A 1FVOA 2H5EA 1U2RA 4E32A 5I7SA 4GYJA 4BO6A 5EE5B 4D41A 1ZAYA 1DAFA 4UTOA 5EJMA 2W6MA 2CEKA 1US8A 1FXUA 5FBVB 1PR2A 5FOWA 3LF2A 3PE6A 4MW1A 1DEXA 2P9GA 2FWIA 3QV1A 2QN1A 3ORSA 4LJSA 2FP4B 2W22A 2ZZNA 3BD6A 1TRHA 3SY8A 1VL5A 2J85A 4X1YA 4NU6A 4ENRA 3QMMA 1P9LA 3HVUA 3VTAA 4I9FA 3FCOA 2Z57A 3X1JA 3P0EA 2Z2IA 4MUGA 2BFFA 4RS4A 4D6XA 3IOMA 3KJZA 4PTLA 5I7RA 5L3SB 2I7DA 4O4IF 4NX2A 4C21A 4ZDIA 3EF0A 2Q4TA 3PFKA 3EQZA 2AMFA 3MT0A 2A5FA 2IPOA 5HTKA 2YW2A 4F9TA 3CSDA 3EVCA 4I1IA 2X3FA 4MWCA 3REGA 2RD2A 3H5WA 1AHHA 3QXJA 2DETA 3HH8A 4BMSA 2AQ8A 1I3OA 3BGSA 1NSYA 3GY0A 1YJ5A 5D51S 3H6GA 2AN1A 2WE8A 4HDQB 4N7JA 1CQJB 4YP5A 2CDNA 3GCGA 3WJ2A 1A4IA 2H7CA 2RH9B 1UKVY 2WD8A 3FYHA 5DHFA 4FFPA 4D9BA 3WJ7A 5JJ5A 2IOQA 4UDOA 3Q7RA 3UPTA 1P5HA 3W1VA 3KAKA 3I8SA 4D4GA 2XE8A 3B9RA 1GNVA 3G13A 4WJKB 2H2AA 2ZR8A 3CB2A 3QEJA 4RHUA 1OKKD 2CXNA 2X4LA 3P4UA 1GA6A 2XMBA 3TEJA 1Z7GA 5LIPA 2CF6A 4TLBA 1IPEA 4AJHA 3VHRA 2B92A 4CKCA 1DG9A 3RUPA 5M29A 2F59A 1BQ4A 4G4SP 1PNVA 2WYIA 2BY4A 4JCOA 4AECA 1CRQA 5KQLA 1SMKA 3TEMA 3KXLA 2JBAB 4Q12A 3JQAD 4FSDA 2ZUWA 4JI5B 3AJRA 4I9NA 1ABEA 3IQXA 3KLOA 4WCFA 5EPEA 5A4MS 3ZLBA 1LSOA 4L2IB 3RRXA 2XRYA 1NZFA 4GI3A 3JY6A 4WK4B 4LF7B 2IC5A 3KPUA 4HX2A 1EK0A 1HTWA 1OXUA 3AI7A 1M6VA 4NBNA 4TQ9A 5G41A 4C14A 1GTJ1 1YCDA 1PYGA 4DCJA 4LJ5A 3AL0C 3EQ2A 4EJFA 2R8BA 1M2JA 1YB6A 3WJAA 3QLVA 1X74A 2E6UX 1IQPA 1PWXA 4HB0A 4BJ5A 1ML4A 1UZLA 2P3OA 1R8JA 3UAYA 2QL5A 1GN8A 3GVPA 4NHEA 2Q29A 3C45A 2NSJA 3CUSA 5IVKA 3IUBA 2JVIA 2BEVA 5A9RA 5I6DA 3Q8WA 4QTXA 2ZVQX 2HXGA 3UUFA 1GWNA 1P44A 3DEHA 3PQ5A 5FPQA 4Z4CA 1EESA 2Q1XA 1ZD9A 1ADGA 1OBVA 2XE6A 3NNDA 1H05A 3PQ6A 3TVYA 5LOVF 1Z0IA 2JI6A 3I01M 1ZOLA 1SQGA 2NG1A 1B6SA 1J22A 1NUPA 1TYCA 1ECLA 2NV0A 2AJDA 2Q3FA 1X1TA 3ANNA 3BCSA 3GJYA 4FD3A 4YRDA 1GQOA 1XKXA 3KTAB 3S1AA 2IYTA 1J8QA 1RYYA 5BW8A 2QR2A 1CY8A 1NG1A 1QOPB 2R68A 2FMKA 1XPJA 4MI6A 5FL7D 1QRUA 1YKFA 3TX2A 2Z30A 2GD2A 1DX6A 2ZGVA 1NNI1 2IZ7A 3DM5A 3ZK8A 4D0GA 3QWFA 5F5LA 1SBYA 2DYKA 2KS6A 2QGFA 1OIXA 3F6RA 3KE9A 3AJ9A 4MWZA 2IYEA 3UAWA 4C0BA 4DA8A 3E9RA 4RVCA 2QOEA 3FPAA 5JD4A 3P26A 2QMHA 3RYFB 3WRYC 1C9YA 5IDWA 5AESA 2QYOA 4KQFA 5FJIA 5GMOA 3F3KA 2FB9A 2QX9A 1DAGA 2IEDA 4FIZA 2IYSA 2JGDA 1D2HA 4RETA 4Q1AA 3GZJA 1OPXA 3I1FA 2BKAA 4PLGA 5BQPA 1ZR2A 4C43A 1YNSA 4U2CA 5DWVA 4DMFA 4CGYA 2OHVA 3OTWA 1U3DA 2A0YA 2R6FA 3EHEA 1FF9A 1XN1A 3O7MA 3LUCA 1R6TA 3AIMA 5L4NA 4DCTA 5GAJA 3DE5X 1E1RD 1MB2A 4PONA 3WGKA 1MX5A 1XTTA 4QX6A 2OHXA 1K6XA 5ERYA 521PA 4X20B 3KAQA 4B71A 5JSFA 2QPTA 3ZVKA 1R0ZA 1Z6ZA 3GLUA 7YASA 1XZIA 2X22A 3TWOA 1JAHA 3GDOA 1PNOA 5JJCA 5F3WB 2O20A 1Z9BA 1HY3A 3Q6MA 4KC0A 4BQIA 1KDVA 1S96A 1PZMA 1PR3A 1EGQA 1W30A 4YXFA 3ONWA 1ZRMA 4Z51A 2DERA 2AK3A 2BE9A 1Q0ZA 4YAKA 4AJ2A 4EQ6B 2JLBA 1CJTC 2V7WA 3B9QA 5HP4A 1X13A 1AQLA 3W5UA 1VDZA 4BZZA 1PR4A 4REMA 2QP9X 5DASA 4IMIB 5JS8A 4JA0A 3EXHC 4DUYB 2ZSKA 4D0SA 1Z0JA 3A6DA 1OXKB 4IZ6A 5CNJA 4EK9A 4E15A 3O4IA 4PBRA 1AQUA 4OYHA 3RVLA 5DTIA 3B70A 2GEBA 1UBHS 1HMYA 3WGYA 4B4OA 1BZYA 2CF5A 4FX2A 4NZYA 5HEKA 4QASA 3T4UA 1XZGA 3VR6A 1GT6A 1OREA 1Z5ZA 1XROA 2BVNA 3P4YA 2WJWA 2EFEB 3AEKB 3OJFA 1CQXA 1ZG3A 1S2IA 4KXNA 5LQDA 3SYLA 3L4KA 4GSYA 2YJZA 2JNWA 3CMCO 1PR9A 3ABRB 1X9GA 2XAAA 3EWIA 3IT2A 3UXYA 4AMZA 3RIMA 4FE7A 3LQYA 1L1QA 4JKIA 1P4SA 2BP7A 3ZYCA 2B4TO 4QYTA 1I2BA 2HREA 5CXXA 1XIVA 2B2XA 1Y6RA 2KE5A 2ZSIA 3UT5A 5AUOB 3CGGA 4L8WB 2A5GA 5LUAA 1ZSVA 2YFKA 3I9V1 1S01A 3N2LA 4GVLA 2EBUA 4RF5A 2C8LA 3HCEA 4JHXA 2EJBA 1FFEA 4MYCA 1QQTA 3X43A 1V43A 3WV5A 1BWSA 1F1BA 1IY1A 1VECA 3EY4A 3EZ7A 4PO8A 1FP4B 4QDOA 2PZFA 4QBHA 4X44A 3IH5A 4R83A 1BTOA 2JH3A 1TT5B 1QAQA 1QHHA 1WXWA 1XFDA 2Q1YA 2R1VA 1QH0A 3B48A 3KSMA 2ZYTX 1DU4A 4S24A 5F52A 3EISA 4DCSA 3K6SB 5DM60 2A86A 3OPVA 1HI9A 2Y8EA 1TTPB 3QTLA 3S2SA 2HNAA 1PRYA 4N0PA 1RHKA 1L8QA 1E9AA 1GA1A 5AQ1A 2AOVA 5TPZA 4DIKA 4YQZA 4EF5A 2QU7A 3N0WA 3VO1A 2X58A 2VF4X 2B30A 1LNQA 5EJGA 5M5BA 2RHJA 2VFAA 5C1DA 4UBKA 1CR4A 2GBCA 2ISCA 2J5RA 4UTNA 5LQMA 1YFJA 1OR8A 4WJZA 1TFUA 2QAIA 1NXVA 3RVMA 4BKRA 5CFLA 2O57A 2WILA 3CTPA 3H9JA 1O94C 1XCGB 4UUNA 4G25A 1W36D 4ZRDA 4BLVA 4MQEA 1HLFA 1CR6A 3FYUA 1NM5A 5HILA 4URXR 3VSEA 2ZI6A 3H1BA 1JHRA 2Q8QA 1T4CA 2YXNA 3PT5A 5FHQA 4ZCLA 3FI0A 1QIIA 2PT9A 3NXSA 1CQIB 1ORIA 4ZCSA 2GN2A 2C7GA 2JHGA 5TQJA 2QD5A 5EGNA 5JWRA 2C2YA 4NYMQ 1KSHA 1UMCA 3R6DA 2AMJA 2Q1UA 3PDIB 1Q14A 4NWIA 2CLDX 4URWR 5AVYA 2HCRA 4LVCA 1E2BA 1WU7A 3G6WA 1D2RA 1I2DA 3HBJA 3NR2A 4WEQA 4HVTA 1UBFA 4Q15A 4CTKA 2V0GA 4J1NA 3AFNA 1XDUA 4M7WA 1E4OA 1WXHA 4XX1A 1FUIA 4FNMA 4CM7A 3M1AA 3RIYA 4D3XA 1NKSA 4AMVA 1A8HA 2CT8A 4D8WA 2QIPA 1OWOA 1TD1A 2TECE 2O7RA 1XX6A 3W0LB 1ZGHA 3NEJA 4FBMA 4ND8A 4CMIB 1IJKA 3HB0A 1R50A 3VJKA 2H2IA 2C0PA 4OY3A 1T3GA 3DLAA 1NONA 3JAKB 3NOOA 4LXXA 4HK4A 5DNUA 3T7JA 2QLBA 1UEIA 4XWYA 3BCHA 5HWSA 4G5HA 4A27A 5C37A 4BVGA 1FYEA 1X7ZB 1NV9A 4HMOA 1PEAA 1YO6A 2YZNA 2GBPA 4HQNA 3WLOA 2PFSA 3DEYX 3T3PB 4BN0A 2V6MA 1JQJC 3K9NA 4EYSA 3FNQA 3ILXA 3EGCA 1ND5A 1OYVA 1UJNA 3IR5A 4TKMA 1JDSA 2BD0A 2WYWA 2E5FA 4CQMB 3U44B 1MBZA 2Q21A 1GFSA 1HRDA 4B6FA 5IT9A 1G4UR 1RWNA 1XCPA 4KVFA 4IZIA 4NENB 2GRJA 1ES9A 4MA4A 2FSVC 1JU3A 3ADOA 3QFFA 1EDDA 2PVCA 3CRZA 4YCLA 3RVNA 2BCGY 5KYXA 2C20A 3G0OA 1JJVA 2GCOA 1M2HA 1P0PA 5DWQA 2YWJA 5EVCA 4C0LA 1YZUA 2N46A 1A8QA 3QU9A 2C99A 3DLBA 1BX0A 1AUQA 1SPBS 4IDFA 2AHOA 2XUJA 1T13A 2CL6X 3KJHA 1J0BA 3WGLA 3RU9A 2OKCA 2R47A 3DS8A 1S3GA 2PRSA 2DFPA 3WK6A 3R20A 1O3YA 3K0CA 4PU0A 4BLOA 4X97A 5KNCD 3EXIA 2BMAA 4F6RA 4D0LB 4CKZA 3NT2A 4JNCA 2QNBA 2AZDA 4CV2A 4E08A 2NQ8A 3O82A 4EG0A 1FFHA 1PZFA 3TECE 3SF0A 3E1SA 1XRNA 1AHNA 5AW2A 1R6BX 4IHJA 1X8KA 1UBEA 4B87A 5HRUA 3CLRC 1E0SA 1SKBA 1TJ3A 1DOZA 5A3JA 1U9CA 2NU6A 4EZEA 3TOZA 1QCDA 2QQEA 3HM2A 3R8CA 1YAJA 5COBA 3K1AA 4V39A 2A92A 3EVDA 1KMQA 4DV4B 3G2HA 4JT8A 2GYWA 1RWKA 2ZM6B 1KFCB 4K9RA 1CZRA 3HR4A 3QJYA 4JB2A 4Z8YA 4S04A 5DM70 3W8EA 2O2YA 3NPMA 1F12A 3D7MA 3L8CA 1CUAA 1N5LA 1OFGA 3WK8A 5JW6A 1ZICA 3U26A 3IDQA 1WDKA 4A36A 2G1AA 1Q7RA 1JSCA 3PUYA 5A4KA 2QN6A 3LWNA 4DXHA 3AZQA 4MKHA 1OA0A 1A4XA 1VCIA 2QTHA 4GBED 3X1MA 2F8SA 4D81A 2Q4RA 5FAXA 5IC5A 3VC3A 1FEZA 2EIXA 4P83A 3SNHA 3O90A 1XRLA 3CCFA 4K6CA 2NSHA 1KO1A 3ICOA 3IR6A 2XUFA 2EQBA 4OHRA 1KU6A 5DYTA 5IARA 5JVDF 4V0QA 3NANA 4Y7CA 3AUFA 3E1GA 4UU0A 5FI0B 4N0DA 4K9OA 1Y8RB 4KO8A 3X1DA 4OAPA 1QAOA 1CVRA 1I7PA 3JD1A 4I4TB 1MEEA 3CT4A 4LDJA 1PP4A 2ZUBA 4YRZA 1P7YA 2GK7A 1ZUWA 2JKYA 2P6MA 2WP0A 3JAWA 4RPCA 1GYRA 3C1UA 1L5GB 1J39A 1VPEA 3CURA 3K31A 2JATA 1D7AA 3R23A 5LVAA 1TAHA 3BERA 2QRGA 3LZDA 2CDRA 1DT3A 4P5EA 5EJFA 4BDSA 1NV8A 3MJDA 1M3SA 2BHNA 3H83A 3IDAA 4PGHA 2AJ8A 4UCXA 4Y6OA 3WOVA 4AMUA 4OX9Y 2PKCA 3FVQA 5C7YA 1ZJ6A 2DY1A 3RYHB 1QXSA 2HQRA 2ISSD 1JLKA 4OIMA 3H2YA 2BSAA 3RC2A 2P2YA 3DTTA 3I1YA 4G0XA 1AMOA 4HYEA 1SOVA 1UJBA 1KOLA 1JKMA 3ZZTA 1MA3A 1NG9A 2GZMA 2MYNA 3B9BA 4EHLA 3NOVA 4NHOA 4MUFA 1JX6A 2I22A 1KYVA 3AP2A 1ZUNB 5AVJA 2B6NA 2V6JA 2VDWA 4X6XA 4QVGA 3AEUB 5E7IA 1KI6B 3QVGA 3ZE8A 4TQUS 1EDBA 2UDPA 2IIBA 4PHFA 3VH3A 3RS3A 4WKBA 3ZCSA 1I3MA 4UVEA 4DEXA 2DWQA 3TF5A 4MARA 1M2WA 4AJ9A 1AD2A 5ESWA 1NA5A 4JWTA 2YV3A 3G23A 2R4UA 5EXPA 4ZKEA 3ZE7A 5FXMA 4ASUD 1IB0A 4CLHA 5HIMA 1JG6A 4OQLA 3T7AA 3QUTA 1QAMA 1EJ2A 2COKA 2FSGA 3NDJA 1GGMA 4G81A 1N78A 2CJYA 2X2PA 1IAQA 1DKPA 3CLTD 3ZGLA 1X7WA 4IICA 3WLTA 5I9BA 1YHNA 2RHCA 3IEKA 3W2HA 3UO8B 2V7VA 3UJAA 5BSEA 1YHZA 1YDGA 2YCBA 2ZATA 2ZSAA 5HJEA 1DI0A 2FFHA 3MWJA 4I55F 2WHXA 1Z6GA 3FZQA 3K7EA 1X7DA 4TLDA 3M6FA 4NULA 4N0QA 1N9ZA 2OO3A 5CT6A 4PZ9A 5TQ2A 3AUKA 3U6BA 1PZNA 5EJ2A 4XGRA 3RJTA 3VR3A 2D6FA 1NVFA 3PJFA 4C4YA 3N70A 4CW7A 1CRWG 4IZHA 1E2LA 4KFSA 2DG2A 3HNOA 4GWGA 4EFKA 4K2AA 4G84A 4CQLA 4QU8A 2DLDA 1NLYA 4A6EA 3U61B 1FLNA 3IAEA 3EDCA 1Q7CA 2Z56A 4CGZA 1ITZA 1JHDA 5CURA 3Q5DA 1FTNA 4DZRA 2QE7D 2OBLA 3PX2A 1XMPA 2BHLA 1LS1A 1ZK1A 2RHBA 3AH8A 5CGQB 1AT1A 2YHIB 3PNBA 3LWDA 1EI9A 1R5JA 1Y3FE 2CBZA 3PUKA 3SLRA 2FZLA 2I1LA 1KI3A 2D2VA 1JQAA 4F21A 4TKVB 5HGXA 5DGDA 3RV3A 5JHHB 3LWBA 2QBYA 3FUUA 3R5TA 2PKWA 4RKEA 3RUCA 4B3BA 2PL3A 1XB2A 4FZVA 3MT9A 1I2CA 4IRXA 4MPRA 4Q9JA 2I3DA 1AUOA 3V4VB 3CCBA 4WI1A 4ZZIA 2A30A 3AL3A 4QQRA 3CUWA 4XVUA 1KBOA 1GT91 3QKRB 5LP6F 5A3QA 2DPGA 1GQQA 4OTZA 4OQDA 3WTCA 2NYAA 4CMBA 4YXWA 4U39A 2Y66A 4HLUA 3ZDEA 4MW7A 4S0XA 1RQRA 1FMTA 1DX9A 2H54A 3NC0C 2F1OA 3C7AA 4N1AA 5FTMA 3KOMA 1TLLA 3CPSA 1TA0A 3TJRA 1CZHA 5BNIA 3DKRA 1RPJA 1AXGA 2JFFA 5JALA 1FP6A 3PA8A 3DBHA 2C0QA 2EFHB 3QX9A 5HJ7A 3IALA 4DR4B 2Z4RA 2J3HA 4TT3D 1WHTB 4NYMR 1WMEA 3KT3A 2JGNA 3LZCA 4FNGA 1NAHA 5DHPA 3RVDA 1A9YA 1L4BA 3FYSA 1KFKB 4TTAA 1SXGA 2PZBA 4H1WA 4KWIA 4IDDA 5F23A 1NPYA 2IPXA 3SHOA 4UTRA 1QGZA 2Q99A 5LJLA 4ONEA 4GMXA 4RAOA 4H7PA 4RHTA 4AN1A 4XGNA 5DK4A 1QR2A 4XYGA 1OI2A 2I65A 2YWEA 4ZO9A 2XF2A 3OFSA 1N7JA 1U99A 5EFZA 3EULA 4NAVA 4YCNA 5CH3A 5HFJA 1MGOA 2G4LA 2X9QA 5LQJA 2F9LA 2WAXA 4FLFA 3UM9A 1K8ZB 3VBEA 4A0SA 1FQJA 4YJ2B 1RXVA 5H82A 1QQBA 3WJ1A 5E6UB 1FJGB 2VHVA 4K05A 3IDSA 3TJMA 2GWRA 1T4GA 1D2GA 3UKJA 3VZBA 4DNOA 9ABPA 4JMLA 4QARA 4GKBA 1P61B 1KS2A 4L16A 4Q4JB 1VHJA 3AUXA 3T9AA 4RHCA 5C52B 4ARIA 1ZDMA 5ESXA 2I03A 5HCNA 1LBHA 4HAVA 2H8KA 1MF7A 3KTOA 4LSZA 1TW3A 1OX4A 1CRZA 1SXJB 3AESA 3HP1A 5AD1A 1NVWQ 3EG9A 3KLPX 3CG4A 4TV9A 2PSEA 1Y37A 1Q3HA 3VTZA 4B7XA 1K0FA 5E9QA 5MN4A 4UHHA 3ZNQA 2FPPB 1H3EA 4IFTA 1Q50A 1YH3A 2Z6AA 3N53A 4X66B 3O93A 1U8CB 3BRWA 4QU0A 1UXIA 4BO2A 2D1FA 2D5CA 2XECA 3ILSA 4Q39A 2Y1GA 2FA9A 5ERGB 2VJLA 3VO9A 2AN3A 5DLQC 5A4DA 2FEMA 4DLUA 3N7TA 2PYDA 2X9LA 2ZITA 5K1ZA 3LUGA 2DPXA 4Z9BA 3VKUA 4D80A 1JUDA 2WIBA 5KKNB 2WNSA 3MWYW 2ZAYA 1ST3A 3B20A 4KDEA 4U7GA 2V1XA 4M38A 1M7HA 1JXAA 2KHZA 2Z2ZA 1RYNA 3D2LA 3VC1A 3VR1A 5ITWA 1J0DA 3UMMA 4OEHA 4FHEA 1OV4A 4J1QA 2IUUA 2CSUA 1TTTA 4JB3A 2HA0A 1KBQA 4R1TA 3TXAA 5GJBA 2C82A 2AYXA 2RBEA 1FPMA 5KTKA 1N5OX 2FSPA 4IDOA 1JSXA 5JMWA 3T0GA 4CRWB 3UAVA 4KYIB 4R3NA 3VR5D 4ARBA 3CZRA 4L6AA 1UK9A 2SKEA 1VLJA 2ZPAA 3EMDA 3FTQA 1O96A 3JV7A 4TV8F 4A03A 1JDNA 5B53A 4JUAA 2G67A 3VGJA 2SICE 1Q0UA 3STVA 3BCRA 2AH5A 4UQPA 5AKHA 3FNHA 4P54A 4CR7A 1BDBA 1JECA 1EFVA 3RTCA 1P62B 2JJQA 4X00A 3WY9A 3ZTYA 3FKSD 2QMYA 4YTEA 4UOZA 3CKYA 3HJCA 4R1SA 3F3SA 1N9GB 2MSEB 4HC4A 3EIUA 5EJEA 2BJWA 1DRJA 3LWZA 1YJAA 1X8JA 1E0KA 4IH9A 5CLHA 3WMGA 4YLYA 5BN3A 5KYGA 3LP5A 2DSTA 5JY1A 1A8IA 1VYVA 1MX3A 2PNFA 3AFGA 3BFXA 4RKYA 2BR5A 4QDXA 1G8AA 2PWYA 4N5DA 3MJ4A 3L77A 4GAEA 5EIFA 4CNQA 3WKAA 2IU0A 4NMMA 4CKEB 2HSGA 5CK5A 2WZQA 1MHPA 3L7KA 3R3HA 1N5JA 1W0JD 3H5OA 3W2FA 3WQRA 1SQFA 3ZCXA 5IZCA 4M8IA 4MI3A 3S28A 2Q1WA 1PEKE 1WY7A 2XMZA 2O2SA 3L6DA 2BOVA 1YBFA 3OPXA 2RI0A 4AF8A 4KGZA 4OJNA 2WE7A 5LPNA 1Z22A 1NC3A 3CCCA 4K6HA 4Z7NB 4DRZA 1P91A 1ZITA 3L0CA 3ZE9A 4QEDA 4ZJZA 2J6BA 4LC0A 1F3LA 2GB4A 2WT8A 4J0HA 2VTBB 3I6BA 1L7XA 4WFIA 3PRKE 2IUTA 1YT5A 1RP7A 3NTRA 2FPOA 2FX3A 2QT1A 5B6PA 3EMVA 1TX4B 2C83A 2WYOA 1HL7A 4LYHA 2Z04A 3QTBA 2WQ6A 4MXDA 4DVJA 4ER7A 2BL4A 3B6ZA 1V1RB 2EV9A 1IOLA 4KIFA 5I8ZA 4EG7A 5IT5A 2YZGA 4JL5A 4UUAA 4EYQA 3DAOA 3S1SA 4OKNA 4UBIA 4YDHB 1THZA 4UULA 5IN5A 3RC7A 4XDYA 5DK6A 3KPVA 1AKRA 4V0NA 3NTQA 1D07A 2QTVA 5EESA 4F3KA 3BXOA 3U48A 5DBHX 1OT5A 4QUJA 1LY1A 1BN6A 4G4SO 3S44A 3HVHA 3DEJA 3I58A 3MBIA 4EPXA 2P6RA 3CKMA 5CUQA 4QQ8A 2HFKA 3DZKA 2XCTB 5KTRA 1OXVA 1ZA1A 5DGHA 3TD2A 1B1AA 3VNBA 5G3ZA 2R00C 2W2PA 4ZDWA 2M6RA 1FY2A 2FUG6 3OC6A 4BHTA 1Z35A 4PLZA 1K3TA 1RKVA 5IAAA 1NJ1A 5KJFA 3VPDA 4D4IA 1ZIPA 1MOPA 1L7BA 2IHTA 2XX3A 4KE7A 1OLXA 4QDUA 3G7UA 4D4LA 4IDBA 5B3JC 1JR3D 4YRFA 4BX2A 4G85A 2WWYA 5K7SA 5EIXA 4YFVA 4JASB 1LNZA 2Z83A 3DDNA 3G9TA 4DBZA 1QF6A 1VSTA 2PGAA 4NMXB 3RNOA 2ZE6A 2PUCA 1DC8A 5ESDA 4Y2VA 2PUFA 2BFMA 5FJJA 2POQX 3UEOA 3L7OA 1JDBB 1MKYA 4U00A 2OM2A 5EN4A 2W4QA 1KK1A 4EMBA 1SPXA 2V6BA 2RAPA 4AC9A 1W44A 2W6ID 3C8MA 2Q4DA 2B2CA 2M98A 1II0A 5EKDA 2OCKA 3MBOA 1G19A 2INGX 1NYTA 1V3UA 2ONZA 2CFSA 1JIJA 1ZM9A 3UWMA 1XHFA 4D8TA 3N5KA 1J4AA 1AQ6A 3EOZA 1UEJA 5FO0A 4X5OA 5F7JA 2DR0A 4MCJA 4XPZA 1OH8A 3AF1A 3L05A 4EZBA 1YBMA 3T12A 3K9WA 4IDHA 4AYWA 4DV3B 2R5NA 2GZ2A 4BCDA 2LR0A 3GQBB 5PGMA 3HCAA 2SBTA 3T1OA 4D92A 1XMIA 5K3FA 3K2EA 3O4GA 4PIPA 1OX6A 1WF3A 5G1NA 1WBDA 4JI4B 2FFJA 2RFLA 4QUHA 5TPWB 4CQMD 3FIJA 1KQOA 3WYDA 4OQNA 2XXBA 4A0QA 1E9BA 4DADA 5J47A 1T0UA 1UDRA 4EELA 1BD3A 4NZZA 1XRPA 5IJ0B 5CHEA 1H23A 1V1MB 1EG2A 1RE0A 3SFZA 3M5WA 4CCAA 3KU4A 1HDIA 5IYZF 1H2BA 2YY7A 1RYHA 1ZY2A 2ZYAA 3WA7A 2C7QA 2XKJE 4NBTA 4TS9A 5ECGC 1OROA 2JD2A 3CPJB 4C88A 3K8OE 3L8DA 1GTRA 2E89A 1DXHA 1RQ2A 2WUWE 4AG5A 1RLTA 3PQ2A 2VRWA 1LKZA 1VC2A 1B0ZA 3KDSE 3LHDA 3TIFA 4F91B 1E7YA 4MKFA 3SX2A 4A2WA 1FFAA 1F0KA 2H92A 1BQEA 2XCUA 3IIEA 4XIGS 4AT1A 4XIYA 4LRSB 3QEBZ 2BSQA 4DQDA 3PPWA 2VDMB 2QJOA 1F9EA 2ZQ5A 1A7KA 3PHIA 2J6HA 4JCCA 4KJZA 4CEIB 2F1JA 1NX9A 2PX8A 4MW2A 1S2OA 1H8HD 3DSRA 1KI1A 4MIKA 2OLKA 2CHUA 5KOYA 1V26A 4OLBA 3V3TA 4UE3S 5JU6A 3EDMA 4C4OA 2CJPA 1K9VF 2Q5LA 3UXHA 3UT0A 1BE6A 2R3SA 1IK4A 1GU7A 2IYAA 3BH7A 4HNAA 4R05A 3VU9A 4E7OA 4KOEC 1S8NA 4YRBA 1VI5A 4ZVPA 5ALTA 3DXXA 1K5GA 3OECA 1RQGA 2VA8A 3FE2A 4AIRA 1JG3A 3VU0A 3MS2A 4RPHA 3HL4A 4Y2RA 1A2BA 1COWD 1NOKA 4KGXA 1MB3A 3GFRA 4CG2A 5KTSA 2XY4A 3D8SA 3T15A 2VPPA 4MVXA 3RF7A 5K0TA 4I1UA 2FPXA 4EAQA 1N7HA 5CIYA 3D3WA 1T1EA 4A1FA 2IPLA 1EFPA 1KO4A 4QOSA 5B57C 1MX9A 3FUXA 1RM3A 4RIIA 2ATXA 4ITVA 4LKOA 3RT9A 1CUBA 2JI4A 2CKMA 1UMDA 5JWOA 4MJ7A 2Q1SA 3IEVA 2OTCA 3HFGA 4TTSA 1TCAA 4CM3A 4CNBA 1GTSA 2YX1A 1JI3A 3KB8A 3DE2X 1XVTA 3IBYA 4MWBA 5E6RB 4HDKA 2WMYA 1K2VN 1P1HA 1IOVA 1I33A 2JKVA 2XCOA 4M0EA 4XPIB 4RYDA 4L0DA 2FDCA 3CZ9A 1N2CE 3AETA 3NKFA 1ZZGA 1AKWA 1DBIA 121PA 2P67A 2HNKA 1V0JA 3UAXA 2C9OA 2JHPA 2RGGA 2PZKA 3ZCRA 1QIHA 5B2FA 1R6XA 3IODA 1WTCA 2FSVA 5KX5A 3KSZO 5B3AA 3R5SA 1WP9A 2OFPA 2LD4A 1QTQA 2VDPB 4KSBA 3SS7X 4G0YA 4NH4A 4X8LA 5H02A 3TEFA 1B26A 3WL8A 3ZLJA 1BKDR 2PN1A 1TD9A 5TVKA 3FA2A 3IB6A 4C3VA 3LNTA 1J1IA 3H1TA 3DUFB 2NU9B 5LNK1 1E1CA 1AMUA 3DF9A 1EFRA 5IDYA 1KZGB 1VP3A 2RK6A 3V34A 5C4GB 3HA3A 3O95A 1WSAA 3Q9NA 5EZYA 5MFZA 5BO5A 3WA6A 4U3JB 3AUTA 4TGLA 1DAEA 1AKEA 4JT4A 2BGIA 1M1XB 4ZHQA 2NLOA 3E48A 2PBRA 3H42B 3VX4A 1AHPA 4RPJA 2D3WA 5LQAA 5ADHA 4PHHA 4J4BA 3NXKA 5E0KB 1EVZA 2G7ZA 4EB3A 3C3MA 3RVJA 2IT1A 2P3QA 3AIIA 4S2UA 2ERXA 2BFBB 4QBTA 4XZ3A 5LZ8A 2OV1A 3K1TA 2AOXA 4EATA 1GZHB 1VDMA 1W0KD 1KZYC 3BB4A 4L8YA 5FUBA 2QN9A 2W2MA 5DSTA 1O4VA 2PS0A 1M0SA 5DF1A 3U7RA 1CZNA 3DV2A 1NVEA 2C7RA 4LOKA 2V9ZA 4H1TA 1JJBA 4Y2SA 5DFAA 4HV4A 3R9XB 3PQFA 3RT1A 2WSSD 4MAMA 3GAFA 3CUUA 1Z7BA 3OQIA 4OFZA 5EHZA 1BDMA 4PC6A 2FRDA 3SSMA 3B2NA 4AG3A 2OAP1 1IM5A 4IHJF 1G5FA 4OJQA 2W8BA 3LT1A 4RZIA 4QXAA 1SC3A 5EPUA 2YC2C 2FX2A 3H5VA 4IJQA 3DVAB 5CT9A 1DBPA 3VOAA 3SVLA 4DRXB 2A0FA 4MV8A 4O08A 4RLHA 1I6LA 4D3DA 3MS4A 4ME6A 1BN7A 1ZK0A 3QI7A 1D2CA 1IWPB 2IU4A 3KQWA 4ZMBA 1CZKA 2Q4EA 2I66A 3AFIA 5EI5A 3SZOA 2RGWA 2HH9A 3EXG2 4Z5XA 3T3NA 1B15A 2X0FA 2GEKA 1GXSA 3DC2A 3B52X 1GDHA 2OGUA 3H65A 4J0KA 2E4YA 3QRWA 3BTOA 1B8PA 1ID1A 2R4QA 3CX6A 3LX8A 3SFVA 3X1WA 3P9XA 3QXHA 5HQ3B 2XUGA 4UHCA 4W1PA 5K0BA 4HZUA 4IXMA 2H2DA 3E84A 3AWIA 1DC4A 1T5HX 3S68A 1QO0D 4AU1A 1MG5A 3S2GA 2PGOA 3EVAA 4X95A 1VSUA 4XA8A 1Z2AA 4F3TA 2HAEA 3LBNA 1AS0A 1WZ2A 1QDEA 3RARA 5DI3B 1TIKA 1SUAA 4MWTA 5LDGA 1QYIA 3F96A 5TB5A 1NBME 1QU2A 2Y93A 1EEXB 1DELA 4KEAA 6ADHA 1KSJA 3PQ8A 1S7CA 2BI8A 5AK3A 1B41A 3W90A 2GTPA 3QNWA 4P3NA 3NNSA 2EEZA 1ESZA 2R8EA 3F5SA 1X0XA 5CEJA 3N2NA 3LRPA 1WV1A 1VJGA 3F7MA 4JLDA 1QZ3A 2KX7A 3BIJA 3DV9A 4LY0A 1M2OB 1QG2A 3OE7D 2XT9A 4DIOA 1PR6A 3KWLA 3PUVA 2RBGA 4RD3A 4UU7A 3RS4A 2XMGA 1CDEA 1A4RA 4LMRA 4L5CA 3GCXA 4A1OA 3ZIAA 4ZZ3A 2R48A 3UUWA 3L4SO 5FD8A 5K3BA 4F5EA 1XMQB 1A69A 2WYVA 3E4DA 4FXOA 4TM7A 4F2WA 2WTMA 2D00A 2H9YA 3DBIA 4H0CA 1Z07A 3E53A 4ZQIA 4IO0A 4TUYB 1ZNXA 1UMBB 1QS0A 4INPA 3RK0A 3Q8KA 1EIWA 1RRKA 2EEPA 2I71A 1C1DB 4QTYA 1FQOA 2GKOA 3IESA 4PNPA 2ZSEA 4GVXA 4M9ZA 2R6CA 4MMZB 2VHZA 2H48A 1OBCA 2NIPA 2ZIWB 4JBGA 3CBQA 4U2FA 3AVUA 4MGHA 1JVBA 2BR4A 3FHJA 4LVNA 3OKPA 1NURA 3K0AA 2IL1A 1L5KA 4LCJA 5J4YA 1VRVA 2ZBGA 4OK5A 2XNJA 5BWCA 1QNLA 5SYAA 3T7CA 1YR3A 5JAIA 1VL8A 1GUAA 3X1XA 3Q7SA 2O0LA 4IKOA 5U4XA 1UT5A 3WNVA 3U3DA 3R7SA 1XR3A 4TL7A 3EFOB 2QDKA 5KWJA 1S6YA 3PPVA 1GUBA 4OHMA 1RKQA 1DUVG 3PUJA 1AOXA 4JYZA 4G1UC 2D0DA 3A7DA 2H4FA 2ZE7A 3WV4A 3FNBA 2R9VA 1R8QA 2EBFX 3B78A 4A6DA 2GS9A 4WZZA 4DGQA 3S6JA 2K7FA 4K5QA 4KUHA 4D6YA 1OGJA 3VZPA 4MVJF 1SXJD 1JHQA 3B1FA 2WU1A 1SC6A 5AVSA 4OVKA 2WUEA 1CUUA 1GQYA 1WABA 5A9TA 4B5LA 1JI0A 1YZVA 1EEHA 2D74A 2VDQB 3CLRD 3KAPA 4FFOA 4TLAA 2NUAB 4ALLA 4EWLA 1I1QB 4AS3A 3UGTA 5T57A 2C03A 3G8CA 5FNVB 4D0NA 2O8EB 4RIFA 1K8YB 1NN0A 2FDRA 1GLNA 4JOQA 1ZYUA 4B6QA 2HHHB 4Z53A 4BCBA 4KXFB 3KFXA 1CUWA 1NQUA 2C4TA 2AFVA 3K2BA 1TUBB 2W2LD 2W93A 5EJ6A 1UXKA 4UXIA 3B36A 4TTVA 2DGDA 1K6IA 1UKZA 1XNGA 1ZN2A 2JANA 4RY2A 3HPRA 1IVYA 1OU4A 1EAMA 4ZCPA 3HGTA 3DUWA 1KZ4A 4GWKA 2UAGA 3T0FA 2X15A 2D2FA 2WC1A 1P4RA 1P2SA 2X1HA 3EA0A 3Q2KA 5I9IA 4LAFA 4RFVA 1K68A 1XZFA 4RQTA 2DT5A 1C9NA 2P2ZA 3I01A 2CMFA 2EZTA 3CFYA 1LBQA 2ZIXA 3NWPA 3FPFA 1AGPA 2ZRMA 2YJ3A 3F6BX 2BKEA 3MWDB 1FMLA 1FE8A 4LZPA 3LPAA 2G09A 1ISFA 2RGDA 2ZB3A 1R0LA 2A3NA 2CLLB 3STWA 4BGVA 2UVQA 1BVYF 2DJ5A 2PFKA 3DC7A 4LDPA 4HQKA 1BU5A 2BEKA 4LDZA 4IVPA 4RK5A 4YB8A 1AKMA 2OQIA 3L0OA 1IWOA 3ZKWA 1Z0DA 4IRMA 4FMBB 3A4MA 4QTUB 4A0RA 3BXGA 5LC1A 721PA 2C7OA 3HUEA 3JVEA 4IEIA 3VJLA 4O0MA 2J0SA 4X7PA 4D4HA 4DKXA 1H2YA 1KU0A 2V8OA 3K2QA 3QY9A 4DFDA 2P90A 1YTUA 3DWIA 3EAFA 3O4RA 4WXPA 1GIAA 4M36A 1P6XA 2PZLA 2VJQA 1HZZC 2DXIA 4MWGA 3W9BA 3IXMA 1IHYA 2HI0A 2JIPA 3P0IA 3QUAA 4P36A 3VJRA 2A6PA 2ZR7A 4FDAA 5EZ5A 2IXAA 5KTYA 4N0MA 3WQSB 2QTGA 2UYOA 5JYEA 1U63A 2C31A 3KZXA 2GCGA 3WADA 4UEJA 3UJ7A 2X42A 4LQCA 3K9BA 3OZAA 3R0ZA 3BD8A 4YO7A 2AC7A 3D6UA 3IPRA 1JIQA 2V1UA 2XUKA 3PDCA 4B35A 4IO1A 5KNBH 3LFUA 2HW8A 4C4SA 3GLIE 4LNHA 4IJ6A 4KGVA 3K1YA 1CS0A 2AK2A 5C46F 4JI0B 5B1HA 3U3OA 1BFDA 3F6EX 2FEXA 1XVAA 2DBYA 5IBRA 1IB6A 3FRJA 4H1VA 2B99A 4BEVA 3KUDA 2AJLI 1K9SA 2G72A 1OU0A 1XZJA 4EOGA 4O4IB 1IOZA 4ZYWA 3OQJA 1O0SA 2B36A 4LHEA 3ZQ4A 4KO1S 3UB2A 5FTWA 1Z3IX 1KJNA 5ALQA 1XRSB 2I6UA 3A9SA 4UAGA 4C7JA 3L92A 2IDKA 2C9ZA 1E3WB 3D4OA 4XOUA 4TV9F 2JHAA 3SF8A 2X2FA 4WOBA 4HDSB 2P68A 1OFHA 1SUSA 4HEJA 4GPIB 4M7PA 3TLGB 1FJXA 2FPGA 2FX5A 3DBLB 4GG1A 3WRXC 2DTDA 3U4GA 4XKJA 1NR7A 3FMOB 2EAUA 3NT5A 4BUZA 3RYCB 4CLOA 3I4LA 3LHKA 4J3JA 4FOLA 5EHGA 3UENA 3NS7A 2GTIA 4AYTA 1IIBA 1GPUA 2IU6A 4FEGA 1C0PA 1H69A 1NN5A 2D13A 2G82A 2PCJA 2WWTA 1QF7A 1FDVA 4YV1A 2FYTA 4ZI2A 2CMGA 3IT0A 3OQNA 3BC1A 1D8AA 3R7NA 1WTAA 1EDOA 1S0UA 3RUFA 2NUPB 2VPZA 1HL3A 2V0CA 3HB1A 4X7RA 3TLEA 4PC2A 3KQPA 3UMGA 4Z4EA 4L4ZA 5E8RA 4MHTA 1BEUB 4MP8A 3DE4X 5J2UA 1JEYB 2XYHA 3CE9A 1V37A 3AEQB 4MR8A 3FTNA 3QU7A 5FI3A 1HDGO 3OZEA 5SV2A 1T36B 4ZOCA 2LNDA 3REQB 6GPBA 1F6WA 2WMOB 3DTNA 1AB6A 3GL9A 5EYPB 2F1IA 3UQZA 1LI4A 2QL6A 3JARB 2B8NA 4H2DA 1G4AE 4HGOA 1Z29A 4U4AA 5ALDA 4MUKA 4BFSA 4EO7A 1F0NA 1L7OA 1V4NA 3JQ7B 3PPXA 4RKFA 4G09A 4KFRA 1W85A 3UHOA 4JENA 2VPXA 2B4YA 2DHCA 3K0FA 1NR5A 4NKRA 4UOEA 1TJNA 2JFBA 3I30X 1GZ4A 2IKQA 3OZSA 2KJQA 1ZVKA 2C3OA 2ZAMA 3MJTA 1AUPA 1Z74A 3NJ8A 1Y1PA 2IQIA 5SICE 2VXBA 3LQFA 5EWJB 4CDNA 2QRKA 1MXFA 4O2AA 3ZHOA 4G1BA 3HLKA 4KR2A 1X38A 3UGQA 3LUPA 4O5OA 5LOVB 1NGSA 3W78A 4CMAA 2JFUA 2FP3A 1L9XA 1TL7C 5IHPA 3EW7A 4AJ4A 3M5CA 3KVVA 4UM9B 5BN5A 4Q4HB 1IQUA 3VDNB 2GBLC 4DM3A 1GD1O 3JQAA 1KC3A 1PFVA 3LY7A 3ZHZA 4N40A 2RK4A 1SVNA 2DUWA 4TS1A 5K5EA 4CL8A 3S7TA 1K06A 4JJ6A 3TLKA 3W5SA 3H75A 5JE8A 4R9SA 3RVKA 2VLBA 2P75A 2P9BA 3DKKA 5ISMA 3A4IA 5DLYA 3PNYA 1PNRA 3BHIA 1QFYA 1XQ6A 1CHNA 4HQ0A 2AZMA 3VHQA 2RCYA 2X8LA 3W5HA 3URMA 3N8NA 4LYDA 3PHBE 4MW4A 3MGKA 5JO0A 2P4QA 3L1UA 1A04A 5EZSA 2HDNB 4RTKA 2BBTA 1ZOIA 1IQ0A 2FEKA 4MGZR 4A8HA 3QXSA 4UE6A 3ZLVA 2H1OA 4MV5A 5BR8B 2FY8A 4EGJA 1SRRA 2HU7A 2RJOA 1S9HA 4JEMA 3RSOA 2BBWA 3A37A 1V7ZA 1OA1A 2FSUA 1IN4A 2Y92A 1AUVA 3N0TA 4I4IA 3L6EA 1USIA 1KZHA 1Y8QB 5KNBD 2BGJA 3DOCA 4DE5A 5FLKA 5AOCA 1O5TA 3UV7A 2CNWA 4RMJA 1C8KA 1CUEA 2HQ1A 1DDGA 2HWWA 1V8FA 1DQPA 2OORC 3ILHA 2EW2A 4JU9A 1HDXA 2WVHA 3KUUA 4PX5A 3ROEA 1JDVA 1MMFB 2QRLA 3S2YA 2OAEA 1CQPA 3S8YA 4OG2A 3MCAA 1MZVA 5AKEA 3GPBA 1N1MA 1QWSA 4TVSA 3NM6B 2OQVA 1XZMA 2M32A 3DB2A 1E58A 4M9QA 1YWGO 4ARZB 2G9UA 4QRDA 3DE1X 4X6UA 5SZIA 1AK2A 2FHPA 1W4RA 5GWXA 5L4LA 4ND5A 4FBLA 2X76A 1PUIA 2Y68A 3MJCA 3NC4A 2GN9A 2AB0A 3OT1B 3S27A 4EY5A 2F62A 3AI1A 4O1IA 1LA2A 4UAJA 2PXCA 4XYBA 3R7BA 1QIEA 1H42A 3GFFA 3U13A 3IEXA 2BKXA 1X94A 3AOEC 3ETEA 3HJUA 3LH5A 5BUQA 1FW6A 2P5UA 1OSNA 1R5OA 1UEXC 2IPNA 2YJ4A 3USCS 2PLNA 3AR6A 4HWSA 2BEJA 2R84A 3W5AA 3P9IA 3NALA 2B4RO 2IXTA 4JJ7A 4Y6PA 4D5GA 5HZMA 4HI0E 5KVQA 2R5WA 4XR9A 3H05A 4NICA 2Z6VA 3UK6A 1D0IA 3UJNA 4PYRA 5FPHA 2HKIA 1E1RA 2IDMA 3N05A 2JGRA 1GZ5A 2C92A 4MYSA 1F2DA 4MWSA 3T1VA 2PX0A 2J45A 2SHKA 1CIVA 2JDID 2R7KA 2WFZA 1DAPA 1R00A 5FUXA 2VYVA 3KKQA 3SSAA 3TTSA 1I7DA 4DR6B 4HRAA 1T15A 3T5TA 1HBJA 5A4FS 3KB1A 4PZYA 1MN6A 1NU8A 3TNDA 2XRFA 1YE5A 3PS9A 1DO2A 3PX7A 3RUDA 2ET6A 3RBAA 4PZLA 5BSRA 1YFKA 1MFZA 2PTHA 3OAAA 3IA7A 4CM9D 3PD1A 1ATIA 1IUKA 2SECE 1QHXA 4YJGA 1SU7A 5IM5A 1I80A 3KVOA 1HTTA 1D4AA 1HFKA 1M0TA 2QX4A 5J63A 4B43A 3MQ4A 1VJTA 5FBZA 4MO9A 5H3CA 3THRA 4X62B 2PL1A 4GI5A 3DBVO 4NXMB 4C1NA 2Y27A 3BXEA 1VE5A 3ILYA 3NKLA 1GAWA 3EK2A 4IGIA 3RRJA 1ZC4A 3GK3A 3HXQA 2BFEA 1DE0A 1YJCA 1KK0A 2EGHA 2YINC 3II6X 2GZAA 1YR9A 3NYWA 4Z0PA 5C32A 2JGJA 4YH1A 5JDIC 5HVNA 4DQXA 4TKUB 5B1IA 3KSBC 1QZTA 2IRWA 4HRVA 4DLKA 3BZBA 3NRCA 5GVRA 1T9GR 2OWDA 2G5TA 4BVKA 4QD3A 3PVSA 3ZI4A 1ACLA 1P5ZB 4FB4A 3VDQA 2GPBA 5GADl 3OPYB 4LZAA 3FBGA 3KHKA 4Q9HA 1KY5A 3S2UA 1FUYB 1A5TA 1V16B 3N7UA 4C7KA 2R65A 3I1IA 3J7AC 4TZ0A 1NY5A 4L3WA 3RVQA 2CWDA 1EVYA 1E8DA 3JRWA 3UUGA 1QOQB 2A8YA 4X1KA 3WP0A 3BMQA 4L28A 4ABYA 5A02A 4BE7B 1SUEA 3GEMA 1TC2A 1N3LA 3IEIA 3TQFA 3WL7A 3PITA 2FUEA 4UTVA 4IIVA 4GOOD 4QJ3A 1JE1A 1LFDB 3WAKA 2HA5A 1XKLA 1Z5VA 2H29A 3K9LA 1SCAA 2AG8A 3I2KA 4U6SA 5CFZA 3WNCA 2Q0XA 4QJ5A 4ZI7F 1IY0A 2DHDA 2ODBA 1KJJA 3SN6A 4DSOA 1CYEA 2MDTA 5C8ZA 1OGIA 2B34A 1U81A 4Q37A 4BIIA 3TZBA 4XSHA 2G71A 5EPOA 3P9PA 3OO1A 1SIOA 3R1IA 4CMEA 5L3ZA 3WDKA 3WMWA 1CY2A 2EZ9A 2OSBA 3DLPX 3JTMA 1H4VB 1Q0SA 4ZAVA 3TM4A 2J3MA 4QPPA 1Q15A 2B37A 3FW1A 5C0OE 4EFNA 3GLRA 4IIJA 2O9JA 1MGPA 2FQ1A 4JC0A 3HR7A 3U80A 3WYGA 4CM8B 2F4VB 4CLXA 1H93A 3GXOA 2Z1DA 2HXSA 3C7DB 3GFQA 3VM6A 5BVGA 2E5WA 1E2FA 2WVGA 3K32A 3KWJA 3PEEA 2YWRA 4IYRA 5I5EA 3UOAB 4FW8A 4YRSA 2GXQA 1L5WA 4MR9B 1A77A 1T1IA 5KNDH 3U4IA 4U1RA 5I3CA 1SOAA 1Y6QA 3HO1A 5TQVA 5LIRA 2DUMA 4L15A 4HXYA 3EGXA 2Z4TA 2OENG 5SYMA 1PWZA 1WXDA 2ZYRA 3FOBA 3GJ7A 3R3VA 4AUKA 4ZVKA 2ACVA 2ILTA 1Z13A 3C6BA 6LDHA 4LISA 2KI5A 2DOKA 4MRNA 4F46A 4YRMA 3N74A 3FLEA 2H5IA 3OWXA 4F0JA 4UTPA 3TBHA 1G8PA 1HNZB 2QRVA 3F46A 3VVMA 1XJCA 2FOLA 4NR0A 5LWQA 3EBOA 3I6ZA 3BMXA 3FH0A 1R10A 2DQKA 5CFNA 1JHPA 4YHHB 1SU8A 2EP8A 4HR7A 3THYB 1M2EA 2GD6A 1D2AA 3GLTA 2AW3A 4R8SA 1CZOA 4ERXA 4MDEA 3EDRA 3NBAA 4G1MB 4OBEA 4YUYA 4ZCTA 2H4WA 3NGMA 5EZYF 4TMKA 4Q03A 3LYAA 5TMPA 4KXUA 5AI8A 4F11A 1U7HA 1GSOA 3BJRA 2FETA 2J9GA 2IELA 4HTAA 4IX9A 5H83A 1PQ4A 5LUBA 5BVHB 4NBRA 5JZBA 1KI8A 2XAUA 1SKMA 1IZYA 4NE7A 1OZ0A 3VNVA 1Z0ZA 3C3XA 4EGCB 1U3GA 3GI1A 2ZCUA 3COWA 1YVEI 3D0KA 4FMCF 3P9KA 1TEHA 3GD5A 3S8MA 1BKYA 4MVCA 2PX3A 1GRRA 3NU1A 1G3IA 4FT2A 1Q1NA 3CNQS 2A9OA 2PVPA 2JFVA 5KQMA 1RJ9A 3KKZA 1RCUA 5M2QA 5B1EA 3BYZA 4JZKA 4KU4A 1J49A 2ZBPA 4L3OA 1UOQA 4CTNA 1U2SA 4O2BA 3ZBQA 5JCZA 1HK7A 4DA0A 3T3EA 1RLMA 5DRTA 3TUIC 3MJRA 4B3TB 3LVRE 1NVUQ 4N3AA 5CTAA 4CCSA 5CAEA 1RZVA 5JOQA 5JNLA 3QKSA 4FMDF 4KJXA 3T94A 1VL6A 5AUNB 4OAOA 4BJ6A 1QGED 3IPAA 1TW2A 4WNIA 2GK4A 4GEGA 1GY8A 1K66A 2AUNA 2EXXA 4PBTA 4GKVA 4TLCA 4TWIA 1G21A 1J0XO 3HA5A 1G7SA 5JROA 3W9YA 1ZH6A 2VPYA 2PSHA 1EP1B 1R6DA 3NC1C 2HIHA 1YJQA 3TO5A 2JJ8A 5D3MB 4DLZA 4E46A 4L75A 3CLHA 1D5CA 1L7PA 3DHWC 3TXXA 1Z4MA 5KAMA 3CQ9A 1ZMRA 1IIRA 1JPNA 5J9FA 2ASVA 4D9EA 2ST1A 1TKAA 5LZ9A 2WKWA 4D9FA 4DPLA 4FYXA 2Q8NA 4N7RA 5AWFC 2JH9A 3P71T 1W19A 1Y6ZA 4GFDA 3VR4A 4RPIA 5KNCA 2A5YB 3F4LA 2QXUA 5IJAA 2MR5A 4DLTA 5JPCA 5TEWA 5KNLA 5JVDB 2GHRA 3GAZA 3HDQA 4GMKA 4M0CA 5ARDA 4AG6A 4BP9A 4YV2A 3DL7A 1DJNA 3V1MA 4C06A 4G67A 1XZPA 1AN0A 1E3DA 1N9KA 1TU4A 2WSMA 4FQ8A 4S1VA 5IMBA 4BMNA 5IW8A 1GGEA 5C80A 3QJ5A 1CETA 1CEQA 3D7SA 1YCGA 5FRDA 3SC4A 3QFTA 5FBLB 4BTLA 4HBGA 3L8EA 5H80A 3T4EA 3ZWBA 4B79A 2JGKA 2XMCA 3I9LA 5BY2A 3H2SA 4FDMA 3KQSA 3P52A 5HF8A 1KRHA 1TTHA 2VUIB 1FSFA 3WB0A 4MEAA 1RJEA 4DDMA 5L6MB 4PAMA 1S02A 2QHXA 2F3RA 2P0YA 3KFVA 2QUJA 4RSGA 4X93A 4YMSA 1MRSA 4LYGA 2QD3A 1IG3A 1XYGA 2H9IA 3AEYA 5EQJB 5C1BA 4Z4FA 3AVWA 2Y67A 4B3JA 2BFDB 2FMXA 4G86A 4EVRA 2WB2A 4YS6A 5IASA 1U5BB 2OVFA 4IH4A 4LHYA 2PFGA 2BIFA 3OQMA 3RSGA 3LC2O 2CWWA 1Y7TA 4XX0A 1JDPA 1LQUA 4HEA1 3TCXB 3WWYA 4BN4A 4H7JA 4QICA 4YAIA 2FN4A 5INTA 2JI9A 2AR9A 2P0EA 5HZKA 1R12A 3ECCA 2OCIA 4KPYA 5GM2A 1EP9A 4KXWA 4M8KA 2OCAA 4DJ5X 3LUFA 1UBJS 3GO4A 5ALUA 4N8SA 1B6RA 1QV7A 3Q87B 3Q3HA 1I36A 1W88A 1KVUA 3DE7X 4W9NC 2VOJA 3S55A 4MVJE 1T9DA 3U9LA 1JDZA 2OZLA 3DEAA 1A8PA 1U4OA 4UUOA 4AN4A 5HUQA 2ZRGA 1ZCJA 1ZM2A 3B13B 1O58A 3B89A 1E6CA 4G1CA 1U7ZA 1K08A 5DO9A 1CUJA 2ZJ8A 5I7OA 4HQFA 4UPEA 2I4NA 1NW4A 1KIMA 2GF0A 3GDGA 3GG9A 3PNSA 4DYHA 2Q0HA 3TMKA 1ECCA 3QA3E 4IINA 4GQIA 1NOIA 5KYTA 4OREX 3U3JA 1N0WA 1T10A 1N2JA 1Y34E 2B9EA 1WG8A 3DZGA 1T5LA 4I55B 4UEOA 4P3XA 4HNUA 2W42A 4Y2XA 4HVAA 4QHYA 2QAGC 5I9NA 4BNGA 4KQXA 4QOHA 1BWRA 2ZYGA 3ROTA 5BSHA 2X5JO 4FVTA 2YV5A 1ULSA 2FGKA 1Z37A 2Y0BA 5CLGA 2F9FA 1DCKA 3BTSA 4Q3EA 3ZHSA 3QPWA 4BEJA 2B82A 3AHDA 3INGA 1RHQA 4EDFA 3VJMA 5G2OA 5WRFA 5L51A 3H8JA 3C5EA 3F74A 3DZFA 5E1OA 2MU1A 3C7TA 4BE9A 2AFHE 2VKTA 3QSGA 4ASUA 1TI7A 2A35A 3A1VA 4DM4A 1YVRA 2HPHA 2CKDA 1NF3A 1OXMA 2PH3A 3CVJA 2Q7DA 1UPCA 4G5XA 1XAJA 1U2DC 2O3JA 2ZDQA 4BB9A 5K8VA 3ZWOA 2FP4A 5D87A 1ZX1A 1H0HA 5EG5A 1XZQA 5FBWB 5AVUA 4NXNB 3LC7O 1BDJA 4EGAA 1ARZA 2NO6A 1OFVA 1T5SA 1V4VA 3VYRB 2G5PA 1Y48E 5E4FA 3O0DA 5GQSA 5L3SA 3UATA 2E4UA 2V7XA 3U5TA 2IZ5A 3V8NA 5I9LA 3M82A 3DVSX 3BIOA 3IERA 1V6SA 2P69A 4WGGA 5DWDA 4FPXA 3W8FA 1GGFA 1NQAO 1H9AA 3BL6A 3ACDA 3T61A 2CYAA 4JB0A 2W83A 4OQPA 3T35A 4YP9A 3D2AA 3DBRB 1CQJA 4G97A 4RZXA 4I5IA 4XR4A 3T3MB 4D3YA 3Q8MA 4G63A 3SICE 4KN8A 1HYGA 2WW8A 4JXXA 1P72A 3PHGA 3TIIA 4J3NA 3OTOB 1GPYA 4X6YA 3EC7A 2X8JB 3FVTA 1IYZA 5CMLA 3VPFA 3K35A 1MOSA 1SFRA 3HN7A 4KL8S 2J3LA 4MUNA 1H94A 4NG4A 4O5AA 5H3HA 5A6SB 4EGFA 3ESYA 2ODEA 3SLKA 4DT1B 1U0FA 4BVJA 1VMKA 2B7LA 4WD3A 3DE3X 1FLDA 2ARKA 1T2DA 4BKQA 3QBJA 1K7EB 4CR6A 2I34A 3IKMB 1SBHA 1SUPA 2QWXA 4O2RA 4FM9A 2ZUEA 1X92A 2JBAA 1KI7A 3CNHA 5I9MA 4WRRA 5D01A 3TL2A 1G2IA 5K0FA 2ZQYA 3V2GA 1NOJA 5AICA 3MD0A 1FC0A 3Q7QA 4YAWA 1HG1A 4L2IA 4PFKA 3HUUA 4D02A 3W3ZB 1J70A 1U8UA 3IP5A 4FS3A 3U60B 3FVVA 3HYSA 4LMAA 1KR2A 2X5KO 3L79A 2P78A 2PWZA 1NFQA 3HB4X 2HF7A 3PYLA 3QXGA 1RCFA 4I6GA 2WFMA 5G4KB 2NNWB 2XOXA 1XMVA 3N3AC 4KQEA 3S99A 2C5BA 1ZWLA 3BIXA 9ATCA 4QXQA 2VI5A 4R2IA 4KRGA 4U2GA 1YA8A 1S4MA 2FWPA 3SOPA 3GGDA 4DLWA 4F8JA 1K7FB 2XHEA 3UANA 1IULA 1R9MA 1T34A 1DKOA 3H8WA 3QVOA 4NECA 1U1EA 3CLSC 3CSSA 3ZV4A 3HWX1 1IK6A 2QL7A 2WG0A 1ULUA 2GQ0A 3BN3A 4W5RA 5K0SA 1RC8A 2CHFA 2DZDA 3VPSA 4CF7A 4DXAA 1A88A 3U2QA 5JAZA 1CY1A 1PEYA 4FP9A 1Y7LA 3L7BA 5E38A 5KMGB 3OZTA 4FWTA 1FJHA 2OCDA 1KJ9A 4W82A 1P2FA 3KTAA 4NY1A 4J3FA 4UPDA 2P9EA 3GT0A 1BYUA 5CXQA 5KO2A 4DTIA 2HGZA 2J9RA 3BGVA 1ELOA 1I2AA 2RKBA 2BUBA 4M21A 3GH3A 2CXUA 4UHFA 2FZ5A 3DR3A 3SX0A 2AE2A 1YGPA