5AOAA

The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-propionate bound
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
277
structure length
272
Chain Sequence
LRYPPEMPGAEVKVYKKVDNVDLKLYIYKPADWKPADRRSAIVFFFGGGWQSGSPAQFRPQCEYFAGRGMVAMAADYRVGSRHNVKVADCVADAKSAIRWVRQHAAELGVDPQKIVASGGSAGGHLAACTVMVPDLEAPEEDHTISSQANAAILFNPVLILSREGLRQDWEERLRERLGTEPKAVSPYHHIRAGLPPMIIFHGTADNTVPFETIRLFAEAMKKAGNRCELVPFEGAAHGFFNFGRGDNLAYQKTLELADEFLVEIGFLAPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ESTERASE
publication title The Structure of a Novel Thermophilic Esterase from the Planctomycetes Species, Thermogutta Terrifontis Reveals an Open Active Site due to a Minimal 'CAP' Domain.
pubmed doi rcsb
source organism Thermogutta terrifontis
total genus 102
structure length 272
sequence length 277
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aoaA00
3A2MA 2BUCA 2BGRA 2VTVA 2OAEA 4Q3KA 3C6ZA 4A23A 2C5FA 3WK5A 2RI6A 4DYHA 1AURA 1XRMA 4QWMA 1N1MA 4Y2TA 4FHZA 3C70A 2JIDA 2QOEA 1EDDA 2VEOA 4E46A 1XZBA 4WDRA 1JMYA 1G5FA 4EBBA 4B6GA 2G63A 4X92A 1ETHA 5KBYA 3A70A 3FYUC 1TIBA 4WFJA 4Z49A 1R9NA 2BFNA 4DMKA 4B81A 3FLAA 1KU6A 4BDSA 2XUGA 4TPKA 3VJKA 5H3HA 1AQLA 1L7RA 2K2QB 3DL7A 5KWJA 3AILA 3C5WP 3G9UA 3C6BA 1CVLA 4BC1A 5JALA 1NU8A 2XQGA 1LNSA 3EQ8A 2ACEA 1XQYA 3STTA 4MYDA 4H7DA 1XRRA 1LBSA 1YASA 4OYYA 1WHTA 2C0QA 2BGNA 4FLFA 4O08A 2HA3A 4NS4A 3WWDA 4E11A 1KU0A 4CG1A 2Y2VA 4MWTA 3D0KA 4TGLA 3H2HA 1QLWA 4BC0A 4ZREA 1DQZA 4UHEA 4Q3OA 4YX9A 3WWCA 3HLKA 4UBNA 2FJ0A 3C45A 3ZV7A 4DM7A 2FUKA 4H7EA 5CH8A 5CT8A 3C5VA 1VZ2A 2AJBA 5AJHA 3EBLA 4W9RA 1F8UA 3I2IA 4G8DA 4U2DA 1K8QA 3HACA 4X93A 3TJMA 5AM2A 5EGNA 4B9EA 1GKLA 2JGMA 3AZPA 3IIIA 1CUXA 3R41A 2OCIA 1AGYA 3CN7A 3C8HA 4QLAA 3F9CA 3FWHA 3ZLUA 1XRQA 1KEZA 5HF5A 4WCVA 1F6WA 1PV1A 2QXTA 3LIPA 4OSEA 1LPAB 1AC5A 2DSNA 4BP8A 5C8ZA 3FLEA 3PUIA 3YASA 2H7CA 1XZDA 2WHQA 4DNPA 5SYNA 4WDQA 2EEPA 4N5IX 1MNQA 2HA6A 1JKMA 2VJAA 5FXMA 3BJRA 1SCKA 1T2NA 1EX9A 4BB0A 2H7XA 4UBLA 4BATA 1ORWA 2JBWA 1XRLA 5HF8A 3WL8A 3VJLA 1GT6A 3WA6A 1BS9A 4W1PA 4UFPA 5EHXA 4DTCA 3NGMA 5D7BA 3AIKA 4UBIA 4KE9A 1YS2X 4UFNA 4AMYA 5CRIA 3W06A 3DOIA 3DJYA 1QIKA 3H1AA 4FTWA 2VJBA 4H7KA 4L0CA 4ZWNA 4JEIA 5LZ9A 5FKJA 4H7JA 1O6FA 1UK9A 4MJ3A 5T4FA 4BBZA 4AN1A 4QEKA 4OB7A 4DMFA 3A2LA 1R50A 3ILSA 3C6XA 2ZJ6A 2JGIA 2B4KA 1WB4A 4U2CA 4EHBA 4FBMA 2WTMA 5AKKA 1ZJ5A 2QXUA 1HKHA 4BTVA 3H2IA 4N8SA 2C4HA 5IVKA 1CUYA 4LKOA 2Z5GA 5F4ZA 2OCKA 3H04A 3KD2A 1MX5A 5FPPA 4J03A 4B80A 2I3ZA 1CPYA 5A71A 4G4JA 3LLCA 5CXUA 3ICWA 1LLFA 2QUAA 3FVTA 1XZEA 2ZYRA 5JIBA 2LIPA 1C4XA 1XQXA 1QFSA 1E8MA 1XZJA 1R1DA 2HA2A 1UKBA 1BRTA 4G8CA 4DNOA 5LZ5A 4INZA 4X97A 2XMZA 1QTIA 2W6CX 5YASA 5ALYA 1G42A 1YB6A 4LXIA 2OGSA 1USWA 2HHAA 3O0DA 3C87A 1IUPA 4ZV7A 4A16A 1A8SA 1G66A 1N8SA 5AM4A 4J3JA 4HS9A 4QDTA 1H2ZA 3SC2A 3OM8A 3TEJA 5K3BA 1LPMA 1YA4A 2Z8ZA 3MGAA 1TRHA 1MX9A 4L9AA 4QZVA 3CCCA 5ALPA 4YK7A 3W05A 4UHCA 3PDCA 4GI1A 1UKCA 1TAHA 3FSGD 4KJXA 2O7RA 2H9YA 2HDWA 1XLUA 2WUDA 1G4HA 2ACKA 4W1RA 4BCBA 2IIVA 2XT0A 3WL6A 4IQ4A 1QIJA 5ALLA 4I4CA 5AK3A 3G0BA 5JATA 3DEAA 5LP1A 4Y2YA 4G4GA 3R3ZA 1JFRA 5AKLA 1JJBA 4WFKA 1XQWA 1LZLA 1I6WA 3G02A 4D9JA 2VATA 5ALXA 1HBJA 3M83A 1XLWA 2IX9A 3EF3A 3ESAA 2XE4A 2XMQA 3IUJA 3WKBA 3C8DA 1L7QA 4YASA 5C7YA 3VVLA 5AKEA 4Q34A 3AZOA 4AN0A 3DQZA 4ZI5A 3U0VA 1ZI8A 1CR6A 1JT2A 1H2YA 1F0NA 1H23A 3HXKA 2WUEA 5LZ7A 1GZ7A 1FSSA 4ARAA 2RAUA 2XMDA 2PSHA 3QMWA 2VJCA 4Y2VA 2V97A 1Y7HA 1EA5A 5K3AA 1SOMA 1XRNA 3STXA 1MX1A 2BAGA 3R3YA 1NX9A 5JD6A 1T4MA 3L1IA 4UHFA 5CH3A 4Q82A 5AP9A 1BCSA 1CV2A 4WFIA 1QO7A 1XZMA 5EIAA 4NVRA 2BJHA 5CXXA 5D6OA 4AO6A 4QNNA 3WIOA 2O2HA 2VA9A 2WFZA 3HC7A 2XUJA 4J0IA 2JGLA 4HTAA 4RNCA 5AI6A 3SX4A 3L1HA 2WM2A 3H2GA 4EUSA 2CZQA 2WU3A 2QZPA 5ALHA 1CUBA 3WJ2A 2VJDA 4B84A 3T4UA 1UOQA 4C4ZA 2XB6A 3LP5A 3R0VA 4FOLA 4KR0A 4KACA 4UFOA 4UBJA 4LXGA 4G9GA 5JAPA 2VAXA 3STUA 1C7JA 1QIDA 4BCCA 3D3NA 4I3FA 4CI9A 1ZIYA 4DSAA 5ALOA 4I19A 3EQ9A 1PFQA 2XUKA 1GPNA 5AM3A 3AFIA 3DKRA 4L3WA 1WB5A 2HA7A 4RPCA 1UK8A 2RIPA 2OCLA 5FRDA 1BE0A 3QPAA 1OILA 2DHEA 2QVBA 3IVMA 1XQVA 4B0PA 2PU5A 2JGKA 2OAGA 3V1NA 4OCZA 4EY7A 2G5TA 3QM1A 4P9NA 3ESBA 4X3CA 4UUQA 1E5TA 5ALRA 3WZLA 3AUKA 1CUGA 1ZD5A 4BZWA 2H1IA 4OUKX 4G4IA 4QE3A 5AI9A 3GELA 5CBKA 5JAOA 4C88A 4XX1A 2WHRA 3EIOA 4AZ0A 2BKLA 5LZ8A 1FJ2A 4GDMA 4XWGA 3NOXA 1K4YA 1K5PA 2DR0A 3ZWQA 5AIAA 4Y9SA 5ALDA 1JU3A 1YAHA 1YSCA 5DTJA 3GFFA 4KAFA 2Y6UA 3LS2A 2X8BA 2CEKA 3HYSA 2PSDA 4BVJA 5HF9A 3B12A 4CIBA 2WIKA 1HLGA 2Z3ZA 3I28A 3DNMA 3PI6A 4M0FA 1ZD4A 5FLKA 4QDXA 3RARA 1BEZA 1R9MA 3AJAA 2CB9A 4C4XA 2NW6A 1Y7IA 4J0GA 1QJ4A 4DNFA 4DIUA 4K2AA 5T4HA 5AKYA 1ZICA 3DCNA 3LCRA 1ZOIA 1C7IA 1LPPA 4FDMA 4G1FA 3ZPXA 1XZAA 5I8PA 4KAAA 4WJLA 2PSEA 5AKIA 2CJPA 4B9AA 1ACJA 4MWSA 1QIMA 3PUHA 4DSZA 3E1GA 4OU4A 5AK4A 3AZQA 3JWEA 2HA0A 3E4DA 1TCBA 3OG9A 3R3XA 4JH0A 2EDCA 2PUHA 3WK8A 2G5PA 3WWEA 2QT9A 1QIEA 1XLVA 3TGLA 1A8UA 1DINA 4UBMA 2WFLB 5JARA 5JZSA 1L7AA 3I1IA 3DDUA 5JAHA 4CCYA 1M33A 4KE6A 1VE6A 3UUEA 1LGYA 3I6MA 3BIWA 2V96A 3IBTA 2YXPX 3K2IA 5AKGA 1W6RA 3HEAA 3R3WA 3G0IA 1UZAA 4X6UA 5AKXA 2WIDA 1A8QA 4FKBA 1UOPA 1UOOA 3I2KA 4OB8A 3WK7A 3G0DA 4PW0A 5CT4A 1ZIXA 4LYDA 5AM1A 1RWQA 2HU7A 1CIJA 3QBJA 5K3DA 2D5LA 2WFMA 2WIGA 4G8BA 4Q3LA 1VOTA 5EIEA 2JF0A 5FOQA 1CQWA 3WQHA 2Y2UA 1IZ7A 5JZ9A 1W1IA 5JANA 4JNCA 5E4JA 3A6ZA 5A7HA 1F0PA 3WZMA 1E89A 3FYUA 3RLIA 4AO8A 4X94A 1JI3A 1VZ3A 2CUTA 3EQ7A 1X70A 1R4ZA 1DWOA 2ECFA 2EDAA 4Y2PA 3BWXA 4JUIA 1XZCA 2DQYA 2DCMA 2WFLA 4EY6A 3HABA 1MAAA 5LKAA 1XZHA 1SFRA 3QPCA 2B61A 3PFCA 4HRYA 5I7UA 3BIXA 3WKDA 2GZSA 4XIIA 4Q05A 1S8OA 4H7HA 1W52X 3WLAA 3MVEA 1IUNA 3BJMA 5J3JA 5IVDA 5CH5A 3FBWA 4HRXA 2ONCA 2QJWA 2I78A 4IH9A 3W2TA 2OGTA 3D4LA 4ARBA 1LBTA 1Q0RA 1Q0ZA 7YASA 1LPOA 1VA5A 3CXUA 3WWPA 1ODCA 4B0OA 1E66A 4N8DA 5LLSA 4AB1A 4N8EA 2HADA 1JU4A 2I03A 1UT6A 3AIOA 2HRRA 4QDZA 4Q1VA 1LPSA 3KDAA 4BAZA 3DD5A 5DJ5A 3ESDA 3OURA 3RK4A 5KREA 4FNMA 3O4IA 3QMMA 2ES4A 2ORYA 2WG1A 4BZZA 2QKYA 1E8NA 3I6YA 2PSFA 4L72A 3G9ZA 4UHDA 4OU5A 2VSQA 2FX5A 2WIFA 4BE9A 4ITVA 4C01A 4Y2XA 3BL8A 5AM0A 3U1TA 1CLEA 1Z68A 3I6ZA 2QR5A 4H35A 5HZGA 4BRZA 2W22A 1GKKA 4BYMA 5ALGA 4OPMA 2J4FA 3VISA 1P0QA 3D2CA 5AKHA 2ZSHA 3I2JA 4J0KA 4DGQA 1UWCA 2WG0A 4H7IA 3Q0TA 1PJAA 1CUVA 1YB7A 3D5EA 2HL6A 4HZGA 3D7RA 2I3DA 3WL5A 1IUOA 1JMKC 1EDBA 3WJ1A 1BEEA 4M0EA 2IITA 2AJCA 3O4GA 1QIIA 4HAIA 2Y1KA 5DTIA 1ORVA 3BE8A 5CURA 2UZ0A 1XZIA 1TCAA 3H2KA 4PSCA 4Y2JA 5E2IA 4H77A 5DYTA 2AXEA 4CG3A 1AX9A 1H2XA 1YS1X 1MPXA 3D2BA 4PSDA 2WIJA 3B5EA 3N0TA 3FVRA 4AMZA 5JADA 4LIPD 3W9BA 2OQVA 4S0XA 4V2IA 4KE8A 1QIGA 3V9AA 2PKYX 1FFEA 4BVLA 2FJPA 3FAKA 3QVMA 5AI5A 2OLEA 2ZJ7A 5AOAA 1XZLA 1U4NA 5HQ3B 2BUAA 2VAVA 4BCDA 4CCWA 2QS9A 1ZD3A 4AXBA 1J07A 1J2EA 4Y2QA 2XQFA 4BDTA 1QO9A 4K5QA 4HXGA 4DNQA 1QIHA 5ALWA 2WHPA 3UUFA 3ANSA 2XDWA 1CUEA 3NWOA 3DLTA 5HKBA 5AOCA 3M81A 2JGJA 3V1LA 2PSJA 4HXFB 2AJLI 1XZGA 4K6GA 4X85A 3F96A 1AKNA 3VDXA 2WG2A 2BCEA 1HQDA 3W9UA 1WB6A 3O95A 1RP1A 1IVYA 2XUPA 2GZRA 3N2ZB 3H1BA 1MAHA 5KWIA 1AMNA 1XZFA 3FSGA 1FFCA 1H22A 3WYDA 2DQZA 3F8SA 1WM1A 3SK0A 1QZ3A 4FLMA 1CUDA 2XLCA 2C58A 1XKLA 5HFAA 2YYSA 5HQ3A 3QZUA 4M0MA 2HU8A 3IDAA 1THGA 2OCGA 3FCXA 3G9XA 3PF9A 5DYWA 4QLOA 2R8BA 5AK6A 4P08A 4MEAA 3Q8WA 3UMJA 2VF2A 5T4EA 5JD4A 3GBSA 4PF1A 3WWOA 4J0JA 4A5SA 2P8SA 2OPHA 1CUZA 4B82A 5ALTA 1VJ5A 1P0MA 2PVSA 2HA5A 5ALEA 4B83A 5BOVA 1ODTC 3ZI7A 5LKRA 2WJ6A 4FLEA 4GEGA 5HKAA 3ZLVA 3S2ZA 4UPDA 5JYCA 1E8DA 1IZ8A 2HRQA 2OQIA 3X3HA 3A2NA 5A7GA 4DMCA 1CUCA 5ALIA 5ALNA 2PL5A 2DHDA 1QTRA 1ACLA 2QTBA 1QOZA 1SC9A 1W75A 2GBFA 5HF6A 4MQLA 4FMPA 3AINA 4TVKA 5IH7A 3WK6A 1HPLA 5FPQA 3WK4A 4EB0A 5LZ4A 5AHXA 3PF8A 4W1SA 4FBLA 5DNVA 5JASA 1E3QA 1P0IA 2PU7A 3QMVA 2V98A 3LIIA 3E3AA 2WJ4A 4K6HA 3VJMA 3DYVA 5CT6A 5ALMA 5A2GA 4FFVA 4X6XA 4P93A 3L1JA 2XQIA 4EY5A 2BUBA 4C4YA 5D3KA 5JZBA 1DT5A 4J0DA 5IVHA 4K6KA 1TQHA 1CQZA 3STVA 5C8XA 2WKWA 2AJDA 1QONA 1SCQA 4FWBA 1DT3A 5T4BA 3I2FA 3M82A 3BDVA 4AQDA 3FOBA 1MU0A 2XUOA 5LZ2A 1B6GA 1Y37A 1CEXA 4X91A 1WPRA 3GROA 1EK2A 1GPKA 4CCYB 3H2JA 3G7NA 1LZKA 1P0PA 2OXEA 3QH4A 3WYNA 3PFBA 3FLBA 4ZRDA 1ODSA 5E4TA 4IHAA 5ALQA 3VVMA 1ZJ4A 2WU4A 3O9VA 3WL7A 5CW2A 4J0HA 1YAJA 2E3JA 1XKTA 4EA6A 4X71A 4OYLA 4DMHA 2WQZA 1UXOA 2GBIA 2ZYHA 2WUGA 3I2HA 2XMGA 4UBKA 3VXKA 4BVKA 3T52A 3DS8A 1GGVA 4XJVA 3WIBA 1BCRA 1DX4A 1U2EA 3FYUB 4BTLA 2J4CA 4W1QA 5HFNA 1GQRA 3ZLTA 3DYIA 4U2FA 1VXRA 2XUQA 1EDEA 2B20A 3P2MA 1SCIA 4PSUA 1R3DA 2VT6A 3CN9A 1QE3A 1UK7A 1XRPA 1BN7A 4G5XA 4BRSA 2XUDA 1O6GA 2V9ZA 2X76A 5A6VA 2R11A 2Z8XA 4E15A 5K5EA 1VLQA 5FUMA 4N5HX 2PPLA 5C81A 2G4LA 4GW3A 1B41A 1BROA 3F98A 4EZIA 4JYPA 2GYWA 4AX4A 1Q84A 3CCBA 4KRYA 3OPMA 4HVTA 5DWDA 5AH0A 5BV7A 4GBGA 1ZI6A 4G9EA 2PBLA 3WKAA 3HI4A 2HU5A 3KSRA 3V1KA 4ZV9A 1GPLA 1K6EA 1H2WA 5AKZA 1BU8A 2XUIA 2XLBA 3C6YA 5AICA 5IKXA 3ICVA 1MT3A 5K3FB 3H19A 4ETWA 4FFWA 4H7FA 4MXDA 5AO9A 5HK9A 2O2IA 4RGYA 5EIHA 4F60A 2QRUA 6YASA 1Q83A 1OCEA 5I9IA 2XUHA 1ZGBA 2WLSA 2RHTA 2XUFA 1ZD2P 5EFZA 4J0CA 3QYJA 2X5XA 4PO3X 1BN6A 1U65A 3IUQA 1FFDA 2JEYA 3HJUA 4LXHA 4IO0A 1DWQA 3FCYA 2B9VA 4KYVA 2JGEA 5LYYA 1EH5A 2CMFA 5DLPA 4F5ZA 1OXMA 3GZJA 3KWFA 5AOBA 3RKSA 3I1YA 1J1IA 2ZJFA 4AZ3A 4Y2UA 3DOHA 4GWLA 4AO7A 4NMWA 3TRDA 1WPXA 1EI9A 2O2GA 4CG2A 3BF8A 1D07A 1X2BA 3IUNA 2HIHA 2RGUA 2XUAA 5K3FA 3RM3A 1CUAA 3KWJA 4C6HA 5EI5A 2CBGA 5AKJA 1ZGCA 2RONA 5C8VA 4BP9A 2QM0A 5K3EA 5ESRA 2XQJA 4KRXA 1MN6A 2WJ3A 1TKRA 2HFJA 4BE4A 4LYEA 2ZSIA 1DTEA 1MTZA 1R88A 5AK5A 1DQYA 2VT7A 3HRHA 1WOMA 2J3QA 2WILA 3G9TA 4PNZA 2HM7A 3PE6A 3IA2A 2XMCA 4HXEB 2Q0XA 1HDEA 3AIMA 1ZI9A 4RE6A 2WUFA 1CUWA 1HL7A 4KE7A 2YH2A 3R3UA 1NU6A 4JYMA 1WHSA 1WCYA 5CMLA 3ED1A 4ZXFA 1W76A 5AI8A 3R40A 4QDUA 5EHQA 2QMQA 3BF7A 2GBGA 2XMSA 4GHWA 3SWWA 3M3DA 1EB8A 2WHPB 1EINA 4X90A 4EY8A 5AIBA 2DFPA 1EB9A 4Y7DA 3VKFA 1A7UA 1X2EA 2YASA 3ESCA 4MEBA 4PV7A 1CUJA 2CKMA 3MUNA 5ALUA 1CUSA 1AUOA 4UBOA 5BWCA 2C0PA 4UHHA 2HFKA 3K9BA 4C89A 1UKAA 1XFDA 4ROTA 3OC0A 2RHWA 2PM8A 5A62A 2JGFA 4X00A 1QIFA 3H17A 5CT9A 1XROA 1VKHA 3D59A 4Y2RA 1QGED 1VE7A 4GXNA 1W4LA 1FFBA 5EHNA 3D2AA 4F21A 1UK6A 4GLBA 4H0CA 3G0CA 3V48A 2GBCA 1EVQA 1EHYA 3O4JA 5IVIA 4CIAA 4X7BA 4CFSA 4X95A 1CRLA 2C5GA 5DNWA 1A88A 4U2GA 2O7VA 4LHEA 4H18A 5ALFA 3KOOA 3W04A 2VQ6A 2JEZA 5ALKA 3O4HA 3HZOA 2WTNA 3KXPA 5AI0A 4OB6A 2ROQA 3H18A 2J3DA 5A7FA 3HSSA 1GXSA 4Y2SA 3V1MA 2D0DA 3BDIA 1YR2A 3K6KA 4DLNA 4QWWA 1U8EA 1EXWA 3O9MA 1UFOA 4C87A 3S8YA 2Y6VA 1FFAA 1LPBB 2XQKA 2ZYSA 3E0XA 4KEAA 3H0CA 3F67A 2QUBA 1JJIA 2AJ8A 2QJRA 1EVEA 2OG1A 4QDOA 4PQEA 4BAUA 3JW8A 5ALJA 1RYYA 5K3CA 1N5RA 4E14A 3ANTA 2DHCA 5LIPA 2C7BA 3WMRA 2PX6A 3DL4A 2HA4A 5ALVA 3DKKA 3NUZA 1MO2A 1YCDA 2H7YA 1THTA 1ISPA 1CUUA 4NZZA 5CTAA 5ISMA 1CUHA 1EK1A 1JJFA 3WK9A 3IULA 4FNGA 3WA7A 4OD0A 4IH1A 2XI4A 4U2EA 2XMRA 1TCCA 2WSLA 2ZVDA 5HCUA 3JYHA 3WKEA 5HK8A 3C43A 2PUJA 1MNAA 5ALZA 5FV4A 3B3QA 4IH4A 4ZGBA 4MQMA 3IURA 1XZKA 2GYUA 3G8YA 4XVCA 4W63A 3BXPA 3QITA 4QA9A 5DYYA 1DU4A 1QFMA 1LPNA 4UHBA 3STWA 5SYMA 5AM5A 1CUFA 2Z3WA 4MYSA 3G0GA 4F0JA 4WY8A 3GA7A 2GYVA 1CUIA 1VXOA 3OTQA 4B7ZA 1AZWA 4KAJA 5ALSA 3WI7A 4BAGA 3GUUA 3FNBA 1DWPA 5DNUA 4X6YA 3IUMA 3MUOA 3QPDA 5EHZA 5D3ZA 5BWBA 1CFJA 5AI4A 1MJ5A 4EY4A 3F97A 3IB3A 1YA8A 5CT5A 4U2BA 4WY5A 3WKCA 2OGZA 4B85A 1GQSA 5JD5A 2ZYIA 3PICA 1K63A 5FP0A 5JAUA 2XMBA 3R3VA 4P92A 4J7AA 5E4YA 3STYA 3OOSA 1DX6A 1TK3A 3FYTA 1N5MA 5FDFA 4GECA 4RE5A 3I2GA 1J06A 4YPVA 1IMJA 1VA4A
chains in the Genus database with same CATH superfamily
4S1PA 5B7PA 1FXSA 1PNQA 2BGRA 2VTVA 2ZXUA 2H65A 2ZRLA 3JAMA 1ZU5A 5CFNA 2C5FA 2ZIWB 2RI6A 4YUXA 1MO3A 2P7IA 3GIDA 4J3NA 4FJ2A 1UIRA 2DPYA 2XA2A 3DE7X 1QKJA 1RPNA 1AURA 1U0NA 2X0NA 3CRVA 3WMFA 4GX2A 3TCNA 1I9GA 4BQNA 5KZMB 3K9FC 4NU0A 1VRVA 2VH1A 3AUSA 1N1MA 3BBLA 4Z0NA 3C70A 2JIDA 1U6IA 4OK3A 1PWXA 2CL5A 3F7MA 5CR9A 1RADA 1JEQA 3WDKA 5DGTA 4E46A 4WDRA 4UEQA 2EFEB 1QRUA 2OT3B 5K2MA 3TTYA 4CT4B 2D1SA 3LH5A 3H5WA 3UFXB 1DFGA 1POXA 4Z1MD 4EBBA 4B6GA 4KN8A 2O5EA 1Z3IX 3LO8A 3GAZA 4FJ0A 5IM5A 2WJWA 1FS5A 2OYRA 3TO5A 5IYZA 3GEMA 1MR3F 2OLJA 4WFJA 1HYEA 4Z49A 1OLSA 4IKEA 1V25A 2E2WA 1L5LA 4EF5A 3SJAA 1Y4DE 3Q2KA 3KQQA 3OZTA 3UGKA 3FNIA 3HXLA 5EHIA 3FLAA 1E7RA 3V4LA 1ZL0A 3WLNA 2VDLB 3EBOA 1TO6A 3FTDA 4TPKA 5DBGA 2ECPA 4M9RA 4R0NA 3Q11A 2AZDA 3SEQA 1AQLA 4YUVA 2W37A 3DV0B 3I6BA 2QMOA 3PGLA 4PYLA 2COEA 4M49A 4DGSA 1SA0A 2OBXA 3KKMA 1I3CA 1OWMA 1U0SY 2A9QA 3MF4A 1EA7A 3D6MA 4MB2A 1L4YA 3ZXUB 1Y3IA 2GN4A 4QEDA 5IT0A 2MSNA 5A3VA 2PGNA 3CTMA 1V0JA 1PNTA 1W29A 4ITRC 4P86A 1RTTA 4ESEA 3PFNA 4KU4A 4EL5A 4EAQA 4OSPA 1WPGA 1S4QA 2B7CA 3A8TA 2HDOA 2PS0A 3OEWA 3LHFA 1DBIA 1E98A 5J2TA 3HZZA 1PG0A 1Y80A 4RJTA 2HF2A 5DIFA 5H1YA 1PUXA 3FKQA 1QCDA 2WV7A 1XQYA 2YXNA 4LRQA 1FYFA 1YI1A 4JT4A 4R6WA 5BN3B 4FR5A 3UJ9A 4AS1A 2GBPA 4TWBA 1HDGO 3DAHA 1OXKB 3U0BA 3T5MA 3K70B 3DAGA 1K4KA 1NMZA 1PT8A 2DUJA 2IW1A 2NX2A 4MP3A 1YASA 1DAMA 1WHTA 2XB9A 2PZLA 3K20A 5ARCA 4DRXA 1FRQA 5JNTA 4FLFA 4O08A 3L01A 4IICA 3OCCA 4PHHA 1YQEA 1FXWA 5EHGA 2V65A 3IP6A 5H0IA 4MTLA 3SEFA 1QAMA 2JI4A 3ROXA 4NAUA 2VDQB 4G1BA 4I4TB 1E1CB 4Z1OA 1FZTA 3SE7A 5AW5A 3PNLA 5HIJA 4MWTA 2P9BA 5ED0A 3H2HA 4QYSA 2BHNA 2K5UA 3U3JA 3OX1A 3HPRA 2ILVA 4BC0A 3LUGA 1C9JA 1G3IA 4GI2A 4NBTA 4YX9A 2FSHA 4L2IB 1M54A 1C0KA 2UVDA 5KWEA 3PC8A 3SEZA 3CNOA 5E2AA 1WMFA 4C6RA 3ZHQA 5E7IA 3HLKA 3K1AB 3UFXA 4KWTA 1YTLA 3EUFA 5GOZA 3ZXIA 2P2ZA 3R3HA 4TMYA 1VM6A 1E3WB 1PWYE 2JAXA 2XCLA 4HPWA 4KW7A 4EG1A 5K45A 3PYLA 1PRYA 4UUMA 3EIUA 3FUVA 1II8B 1Q7GA 1EZZA 1TMGE 4C3VA 4JVOA 4ER6A 5J2UF 3DMHA 4NBKA 3L1KA 4NZPA 4E5SA 3GMDA 2AJBA 1XCMA 4NU8X 1DC5A 1SBTA 1XMXA 3OZEA 1S02A 3I52A 4WZAB 1PQYA 4C4AA 1QHIA 4W9RA 1DDGA 4L4YA 4Q4AB 3UAGA 3NTOA 2DRIA 2B0JA 2B98A 4TWRA 1YJCA 3DV0A 3MS2A 5IPFA 1YI0A 1ATZA 1C9KA 1SIUA 3QWIA 2A7QA 4HDAA 4TWZA 4XZ3A 4CNBA 5EGNA 4B9EA 2C9YA 8ADHA 5BSWA 3PUXA 2GPBA 4BV9A 1K88A 1XL1A 1Y81A 4OY3A 4D25A 1NSFA 1YDGA 1CR1A 1V11B 1G20E 2JGMA 2W93A 4L28A 5SV2A 2IEYA 4B48A 2KLBA 5GJVC 2EKLA 3LE8A 2R6ZA 4HFNA 3RJMA 1NLZA 4EPTA 2WVHA 2YC4C 4CM3A 2C5LA 3CN7A 4HLCA 3P45A 5DVZA 2PZ8A 3P0IA 4MV9A 3F9CA 3FWHA 3ZLUA 3AI7A 2PXHA 4EO4A 1KRXA 2G1UA 1T6ZA 3RBXA 4ZPJA 4YP1A 1QU3A 1J56A 1NYTA 1R2QA 3QX8A 4GE0A 5BN3A 4C7OB 3BORA 1KEZA 1L5QA 5FUBA 3IOMA 4WCVA 2WWYA 4RZIA 2ID7A 5JV5A 4Q3NA 5PNTA 1O8CA 3TXAA 1GZDA 4DVGA 1UPBA 4YV7A 4ZI7B 2I91A 1C80A 3IV6A 4LZLA 5DWVA 1NJ6A 1LTKA 2B1IA 5K1ZA 3ZWAA 1PT6A 4W7HA 4WLVA 4BP8A 5AVJA 2XKKA 4LW8A 2YJ6A 3VPFA 4LOIA 1N5JA 2FRVA 3TQQA 2NAFA 2JAOA 4HNVA 2IYEA 3LMKA 1CF9A 1Q3KA 2FMIA 4G56A 4I4TA 4BKMA 1GUAA 2H7CA 2ZU6A 4C4SA 3B20A 3WGNA 1TYDE 2CCJA 2GRUA 3B8EA 2RGNC 5TXGA 4MZDA 1Q6YA 3TAUA 4DNPA 1YJXA 2NPIA 3CM0A 1UL1X 1KJ8A 1MNQA 1PUJA 2FKNA 2PEZA 2FZ5A 3H2ZA 2HA6A 1JKMA 2UZIR 5FV7A 4EG0A 4UTPA 1FW6A 2Q3HA 4HGRA 4R1PA 4RZHA 3B53X 1SJ9A 4MCIA 2XD9A 1SCKA 3FETA 3K2BA 1KMMA 1T2NA 3FA2A 1ADFA 3B7PA 4QQRA 2B35A 3K1AA 3GCGA 2ZRHA 2E1PA 3GUHA 4YIKA 3C7AA 4YA6A 1R0YA 2Z2XA 2H7XA 1NKVA 4MDYA 1E3WA 4J43A 1O6CA 3VSCA 5DSXA 1T0IA 1II8A 1D1QA 4DEYA 1T2FA 2IZ5A 5IUKC 2MU1A 4N47A 1V5IA 4O1IA 3T4PA 4CIXA 4AZWA 4L6IA 1KFJB 3PS9A 4HGNA 5HF8A 3TMKA 1KMIY 4AWXA 5CCEA 5HIAA 2MSEB 2IZ6A 1XDBA 4RK4A 4WZAA 2X2OA 2XE8A 3ADPA 3W6PA 1E92A 5BT8A 4KNYA 3IP7A 1QYCA 4KDRA 1NWHA 5TV2A 1SKYE 1K3TA 3CE9A 4PCLA 4BIMA 3IEXA 5D7BA 4MZXA 1PJZA 4KE9A 1CJMA 1V2GA 1X7WB 3NCTA 4UFNA 1V11A 5J40A 2C59A 3IUSA 5BSRA 2V03A 4Q9NA 1D2EA 5D1NA 2H2IA 9GPBA 1AHPA 1CR4A 1PW7A 1B0ZA 2IQIA 2VWGA 4LY0A 4B3IA 2H2AA 3KOXA 3IVRA 4DY6A 4QRIA 1DRKA 2GPWA 4UTZA 2BKEA 1EE2A 2QRPA 3H1AA 3I4CA 4BNTA 5F9HA 1ZVMA 2P3OA 2PDAA 1ESZA 2R1VB 3WMWA 4RSMA 4CM6A 2FV8A 4GI5A 1V7PC 3PWSA 2QL7A 3I4LA 1D8TA 3I23A 4JEIA 5FCDA 1UFKA 2ZQZA 3NIDB 5K99A 5LZ9A 3CNLA 3I3SR 4H7JA 2HDNB 2ZEJA 5FKJA 2YY7A 1EK0A 3N86A 5T4FA 4MJ3A 4RLSA 4LF5B 3VPBA 4JR2A 5FWXA 1HH4A 5LQCA 2FMTA 1ZX1A 1CZNA 4NDZA 4AN1A 4QEKA 4ZI7A 1BQ4A 1L4EA 2AG6A 2G0NA 2W00A 1NUHA 4K9SA 4LV5B 4UOEA 4UULA 1OB2A 1R50A 2XGSA 3AX6A 1KAMA 2IDZA 3N0WA 1US8B 4GOMD 3ROGA 4G07A 2PMCA 1AUVA 3K9HA 3Q3EA 1SCDA 3A05A 4R7GA 2F4VB 1L9XA 2B0CA 5DLQC 2ZBPA 4Q3DA 4FMDB 2O54A 5B53A 1QGUB 2W2OA 2Y8EA 4MVJP 4F2PA 1WB4A 3GLUA 2WWWA 4EHBA 4QGSA 3GR6A 3LDAA 1BNCA 4F46A 3SHOA 4JGIA 2ZUWA 1GSOA 5EKDA 2HN9A 2OCYC 4FBMA 1UBCA 3K9LA 1L7VC 1TA4A 3KR0A 4N54A 2KM1A 3E1KA 3ETCA 4P4SB 4X84A 1O7JA 4LQ4A 5SYAA 3RAJA 1U0BB 2CJYA 3JD1A 4U7GA 4WV3A 2Z5GA 4HAVA 1E4EA 2G28A 3S8EA 3SY8A 3RHFA 3H04A 3KD2A 1VYTA 2GK4A 2Z3VA 3JQGB 1CJKC 1W48A 2B37A 2IYVA 2D2FA 3AL3A 1CP3A 3AR8A 4DMRA 1N57A 3T0FA 1JECA 3RO7A 3JAWA 1L4FA 4JK3A 4TSKA 3GU3A 2D59A 1E0KA 4GLJA 3LT0A 1E1QD 2TMGA 4TV8B 5DV9A 5KNCD 3CU5A 3HL0A 4JI0B 2CHQA 2ZTMA 2BGUA 3MSXA 4EYOA 4POOA 2VHTA 1TYEB 1LLFA 1AN0A 3QEMA 3OA0A 4JP5A 3IXQA 1E5XA 3ZBPA 4TYYA 2VLIA 5C4GB 2QUAA 3FVTA 2UXDB 1XZEA 4KQEA 4EJ2A 4G85A 2P1ZA 2JAWA 5JO9A 2JGDB 3JQCA 1T4GA 2F1OA 2AFHE 2CSUA 1MDBA 3N07A 2VYNA 1XP5A 5E1DA 3SJCA 4CEJB 4G3XA 2EATA 4PIMA 1PR6A 2IGBA 3MHPA 4QBIA 3RSLA 3LYHA 2ZU0C 5KVQA 4G1VA 2Z95A 4FNAA 4R40A 5HOEA 1X42A 1NN0A 1YR9A 2AX4A 4F06A 1R1DA 1SOWA 3EXAA 3UMCA 1Z2CA 2JLZA 1BRTA 1GPMA 2EIXA 4ND6A 3K4QA 2R1VA 1NLYA 1SD5A 4AKEA 1H3FA 2GEUA 1WG8A 1UBKS 5LZ5A 5KKCA 5DN6D 1ORTA 4X97A 4OQLA 4W6ZA 4YONB 1MBZA 5DNAA 1QTIA 5A9RA 3E18A 2IC5A 1G42A 3DEKA 4MRRA 1YB6A 4C2AA 1SQ0A 1QRTA 1MV8A 3INRA 4HVCA 3H9EO 2AFVA 4LQCA 3N2LA 3GIWA 5E6SB 3ZVNA 1M0EA 1US8A 5KQRA 5C2JB 2J9YB 2JRCA 3H8SA 2XCQA 3IRUA 1OJLA 4IMRA 4HQ6A 4JB0A 3AVPA 2QE7D 3TCKA 1QGUA 1A8SA 5FUQA 1C14A 2X8AA 4HS9A 4QDTA 1H2ZA 1WLYA 4FQ8A 3GX1A 2QUZA 4P3KA 4M1KA 4RKWA 1ESEA 1PWEA 2EBWA 4KBGA 5K3BA 4R1OA 3QBEA 4LVOA 3TUIC 1ZN2A 4P4NA 4CT5A 2BGJA 2YWEA 1ESCA 3DXYA 3K2QA 4G4SP 3KLNA 2XE7A 1YA4A 3HHEA 4G09A 1YR7A 4KZPA 4P4SA 1KS2A 3QBVA 1CNEA 3ZH9B 1PGPA 1TNDA 1TRHA 1U8YA 1FE8A 1TU4A 3BSSA 3P26A 3S99A 2XWBF 2ZZMA 3T95A 2G5CA 4MI9A 5ALPA 2X2EA 4JCCA 4YK7A 3SOPA 3JQGA 1Z7YA 5EP2A 2CUZA 2I2XB 2WYUA 3PDCA 4UHCA 3WDMA 4EGAA 3WV4A 1SVNA 2H9IA 3H1GA 3NORA 1RHJA 1TAHA 3OJ0A 2WR8A 3QOWA 4WKCA 2R7LA 1DOAA 3ZS9A 3IEMA 3FSGD 3F8TA 1FBTA 2QLLA 1X8KA 2WUDA 4IZOA 4TV8A 1E2LA 1G4HA 4E21A 5KTOA 5LQRA 1WDTA 3HN2A 2GARA 2C2GA 2JI9A 2JLCA 2WAYA 5ALLA 3REQB 4MUNA 1EG2A 1DO2A 1QNFA 2HLDD 1GGFA 3G0BA 3I0MA 4GZMA 1O5IA 2V9PA 1KI8A 3LUCA 5FNZA 4Q18A 3GN2A 1HG0A 1GTG1 2FX2A 5G1PA 3CF2A 2E4AA 2BE9A 3U3KA 1T5SA 2W58A 3ZU6A 4CEJA 2C9DA 2NO1A 4F9TA 3R3ZA 1E6UA 3ZD7A 1RE0A 3MOSA 3UUWA 2JL1A 3OWHA 4MIYA 4EUEA 3HFSA 3NHPA 3RIGA 3AJ9A 2WAXA 1BH6A 1GUDA 1OT5A 3THXB 1P2VA 3D1JA 4UJ3A 2XUZA 4PWZA 2VK4A 1I6WA 3ZW9A 3G02A 2BEWB 3LNCA 4URYR 1KL7A 5D00A 1YVPA 3RVOA 5AFSA 2CT8A 2EYUA 5KX5F 2A4MA 1V8PA 2OP1A 1SKAA 1BA3A 3EBPA 1NR7A 3LSTA 3TF5A 2F62A 2QNIA 1I6KA 4PZ0A 2GF9A 5EZYF 4K7JA 3UFBA 2HOQA 2PL3A 1BE6A 3PEUA 1P3Y1 3GPLA 1K6IA 3G6KA 3HJTA 2JK0A 2CLMB 1DEOA 1EFLA 2UYYA 4IEFB 1UZNA 2HO5A 3GL9A 5E6SA 5ENVA 1MJGA 2O5RA 2Q4BA 3U48A 2P1DA 1XEWY 1U9JA 5FAXA 4A3SA 1S5PA 1ZK0A 2IHTA 4MVJF 4Q93A 4HWGA 3IUJA 4HWOA 4ZYVA 1V5FA 3RSZA 1NVTA 1LDGA 2QT0A 4UTOA 4HWPA 4F5DA 1O57A 1UPXA 1XXHA 4G41A 4YRJA 4X45A 3DEZA 3N75A 2JLSA 3PPXA 4R9VA 3J81A 2FPSA 1WW3A 1BKDR 2TYSB 4HL6A 3D8TA 3JCZA 4MP6A 1EU1A 3WBBA 2MTBA 3A3YA 2WQ6A 1QQTA 4XEHA 1SXJB 2Z1DA 3LPMA 1QO0D 1E64A 2HNBA 4U7TB 4U7FA 4RMJA 5HQTA 5IDQA 2EV9A 2Y92A 4OHOA 1ZMRA 4EZBA 2IEDA 2VCHA 4AN0A 2HSJA 5K0EA 1RWMA 1OX4B 1E5DA 4QG7A 1C1DA 4QUBA 1WXHA 1U8AA 2IE0A 2Z1NA 4L08A 4P84A 4XGKA 4CZ2A 4DIEA 1AUQA 2PJDA 1PWHA 1ICEA 4EVRA 1AB6A 2P77A 2PL9A 2X8WA 3ENKA 4YT8A 2FZCA 1YV9A 1KS9A 1P1BA 3O2NA 4LFCB 1VMDA 5E1BA 1Z83A 2E9SA 3BK1A 1NGSA 3RE1A 3ADCA 3AI1A 2J9GA 3CRZA 1FSSA 3BD7A 3BWMA 4YAUA 5AW4A 1P9RA 4ARAA 2RAUA 4LXXA 1UFQA 4ES6A 5JQGA 2G5GX 4KHZA 1SVIA 3IOEA 4GF5A 3RUDA 1N0HA 3HB9A 2WF9A 4FKMA 3H1FA 4J1SA 4DCJA 4BMDA 2BFBB 2JVIA 4U9UA 2GH1A 5ILQA 4FSXA 4XCXA 4X60A 3OT4A 1NA5A 2GYYA 4JFAA 1MX1A 2FFAA 5KWSA 3B6MA 5B57C 3R24A 4KQ2A 1E99A 2AH5A 4NV3A 4X1OA 1NLMA 1T4MA 2Z8YM 3L1IA 4YQFA 3GA5A 1I13A 1E62A 1SWVA 2Q0SA 3EFOB 4UHFA 5FPTA 4ZANA 3S28A 2JLYA 2P0EA 3IBSA 2PA3A 4Q82A 1AMUA 1JWAB 4GNRA 3L7NA 3ZTWA 2HBZA 2BEWA 1GAEO 3IV9A 1OREA 4RMNA 1Z07A 3QE3A 5CGQB 1S01A 2E6KA 4NV1A 4XWOA 1GQFA 3MJTA 4X66B 2OV4A 3FGZA 4S1OA 1BEUB 2P2GA 4X54A 3UMBA 1SQ5A 4EHJA 2NN3C 4ZCTA 2QU8A 4PLPA 2GWHA 4FD2A 3OKCA 5CLHA 2ZVJA 4AO6A 4B8YA 1JGTA 3IKLA 3WIOA 1F20A 2G9UA 4G37A 4Q1FA 4F2GA 2B7BA 1H8EA 1I6LA 3G2LA 2AR0A 3OO1A 3HC7A 4J8PA 3VZCA 1LX6A 1MX3A 4J0IA 2BE7A 2JGLA 4RNCA 5EXDA 3VKUA 4CJXA 4MJLA 1XOIA 2VHYA 1RBZA 2AF4C 2MINB 2ZLBA 3EA5A 1V6AA 4KN5A 4R51A 5DTRA 2CZQA 5TGZA 3AR7A 2APJA 3QW4B 4FGKA 5LLTA 4BUJA 3RNOA 2I9KA 4ZAXA 3T7CA 4ZDIA 1P17A 3ZI4A 3GGPA 1BDMA 2QZPA 3EIXA 4HR7A 2GOYA 3LY9A 1Z2AA 2VJDA 4QOGA 4D4JA 3QE2A 1PVOA 4DL9A 2ATIA 4ZCSA 3WMXA 3M6MD 3AF0A 3VU8A 1JV2B 1RI3A 2XB6A 5E7QA 3R0VA 1DTWB 1GPUA 3GLHB 3W5UA 3TGPA 3L0DA 4I99A 2AI2A 4BGVA 3GT7A 8OHMA 4PY2A 4BGUA 3LHIA 4UBJA 4PAWA 5C1PA 5LMZA 2IS2A 3OLQA 5JAPA 1OX4A 1QRDA 4TKMA 4CR6A 4E2ZA 1I2BA 3STUA 1EFTA 1C7JA 1QIDA 2QGZA 4M55A 4BE7B 2YRWA 4MVJI 4PRKA 4EJ6A 4RULA 1GV1A 4I3FA 4FINA 3MJFA 4BLUA 3GCWA 4FYMA 4RFVA 5ALOA 4P98A 4IFBA 4CFYA 2WF7A 2NLOA 2HXYA 2PZFA 2XUKA 3MK31 4L3WA 4PO8A 4JI2B 1WB5A 2HA7A 3JALB 3OCWA 1DUSA 3H2BA 4IDNA 1CQJB 1UK8A 3DAOA 4URHA 3TLEA 2JZOA 3PHIA 2OCLA 5JTUA 1SUSA 1TEVA 3NHRA 1FUUA 1BE0A 5F7OA 1M67A 2VAMA 2B8TA 1MG5A 1NNI1 2DT8A 4NC9A 1E3SA 3ZX4A 2PXCA 2YZMA 3I0NA 2XIQA 4EG8A 2QVBA 5F3DA 3N59A 3BH6A 4RVCA 4BNGA 2AWOA 4JYAB 1UFVA 2R6GA 2VDWB 2PRKA 3KAPA 3ADBA 4B8ZA 4ZOLA 3OLZA 1Z0SA 4IV5A 1T3GA 3L79A 4O2LA 5JI3E 1WPQA 4QU5A 2ZDGA 2E4WA 4FR2A 4DLAA 1D5WA 1T0HB 2AEJA 4CEIA 3A25A 1MGPA 3AIIA 2OHXA 1ZO8A 3EFOA 4GBMA 4IPTA 4EY7A 4IMPA 1NW7A 1XXLA 5EIWA 3QIAA 4BO4A 4N5NA 1SBQA 3FI9A 1S8NA 2WD7B 3QM1A 3ESBA 3GD7A 5EKTA 3TLYA 5CNIA 3NCHA 4DLZA 2H4XA 3IBGA 2TMYA 3AKCA 3WZLA 1SG0A 3JAKB 2CHGA 4HDNB 1IM2A 3REFA 3WRYA 5IULC 3FFBA 1A77A 5BQPA 4B5KA 2WD9A 2R47A 2VHWA 2GBLA 1H2AS 3KOZA 2H1IA 2QVYX 4P3OA 4PTZA 5J4VA 1NUSA 2TS1A 5A1TA 1CG6A 3H87A 3L0PA 4M7OA 4MQBA 4XCQA 1JIKA 2P9HA 1SC1A 2FQQA 3KUXA 5F21A 5AI9A 3LWZA 4YN3A 2ORIA 2MINA 4XM1A 4RY8A 4WZ6A 1ZIPA 2RH4A 2CMHA 2VHEA 3AV0B 1MZVA 2XYGA 2XV1A 1BXGB 3D4IA 2W83A 3M5WA 4EHAA 3NW9A 5FBQB 1ZD9A 3MJDA 3IPLA 1IHXA 5LZ8A 4GDMA 4O4HF 1K4YA 3ZWQA 4AJOA 4CIYA 4GSYA 2V1UA 2RGYA 2VZ9A 2IUEA 5EJIA 1E3IA 4CDGA 1NG9A 1DTWA 1L2TA 3GLHA 5D01A 4DIDA 2WY2D 4QECA 4Q4JB 1I1QB 5EUQB 1USIA 4EEZA 3GFFA 2C3YA 4IJ6A 1UBSB 4DQXA 2CY0A 1WO8A 3U09A 5P8WA 3HXQA 3AF6A 1HYBA 1ZSVA 2NOAA 3GLRA 4XR9A 3RVLA 2O8DA 2D5CA 1U04A 4B45A 4F4IA 1WSWA 3HYSA 4LY3A 2LBPA 3AM3A 4JYCA 4Y7CA 2CHUA 4LOLA 2QX4A 4JHLA 4GQIA 4DSUA 2BKVA 3B12A 5KB3A 2Q7XA 5LVAA 2C2BA 4I6GA 1QPBA 1V5WA 2YV1A 2V0GA 3AESA 2Z83A 3PIDA 2JFOA 3DBHA 1ONSA 4PCAA 5A3QA 2QGFA 1P44A 3I28A 4B3XA 4R0MA 2DJ5A 3F4BA 2H1WA 3ONVA 1ZD4A 5FLKA 3I12A 1TVCA 5B3KA 1O94A 4QO8A 2BDTA 3AC0A 3UOWA 3IHTA 4V3CA 3EGVA 2VDWA 1ZEMA 3HR8A 4UXHA 5IAEA 3BE4A 4JZKA 2CB9A 4HEA1 4MWEA 3HTXA 3H8WA 1ZGZA 5L3SB 4Y9TA 5HKKD 4DDUA 2VHCA 4MLPA 4PX2A 3S7ZA 4QTXA 4HYEA 2PKQO 3K72B 3LCVB 2Z6VA 2OP0A 3AB3A 2ZUDA 3OMXA 4EGQA 3OPNA 4PTYA 3ERCA 1T5HX 4U7HA 2PYDA 1JSLA 3MGKA 2WD7A 4LSMA 1SIBE 3FMFA 1UH5A 3OCVA 4OOEA 4QOHA 1ZICA 5AKYA 3LCRA 4P36A 1U4OA 4KK4A 1ZOIA 3VC7A 4EFKA 1N2CB 1C7IA 3JAKA 4HDNA 1JHPA 1RM0A 1SVLA 4RS4A 3TBFA 3DWFA 3ZPXA 2P9FA 4BXOB 4G5GA 3GPDG 2OFFA 2Q9AA 5I8PA 4IDAA 1IBKB 4PC2A 3NBXX 1USGA 1TEXA 1Y0BA 4KAAA 4C0SA 2DUMA 2EZUA 4E70A 4RMHA 4CEIB 5GZ3A 1IEQA 2CFCA 2PSEA 3EYWA 4TLLB 5HMMA 2PLNA 1YBAA 3F5QA 3GJ4A 5J58A 3IODA 3DWEX 4F3YA 2BH9A 3L8FA 2XRYA 4DSZA 4B1FA 3IE0A 1OC2A 2H8GA 2Z6QA 1UAYA 3GUZA 4P2GA 3V6LA 3WLRA 4DSOA 4OM8A 2RK3A 4QUDA 1QH0A 3AZQA 1FLNA 3CX7A 1XVIA 3GYBA 5FOVA 4DMUB 3TX6A 4B2IA 5JNRA 2L2QA 3R3XA 2EDCA 4HO1X 2XGMA 3EW7A 2UZ3A 2IPXA 3EXG1 4Q4JA 4NJEB 4RKQA 4INPA 4JUCA 4R0VA 1OVGA 3FPLA 3RTGA 2BZGA 1J5XA 3WWEA 4D3ZA 1O5OA 1XLVA 4OJTA 4IOJA 4M0DA 1OSNA 1A8UA 1T9GS 3F3SA 3S55A 1ULTA 1W49A 3NHMA 3OKFA 5FYQA 2XNSA 5F2OA 1RHRA 2X0KA 4PYRA 4CM8B 2WWIA 1TLTA 3OD1A 2QIPA 5JPDA 3IQWA 2XZLA 3I1IA 1A5BB 5DSTA 4QBTA 4CCYA 3ND7A 3F9IA 2Z09A 2C20A 4BP3A 3H9BA 4H1WA 2DY0A 3L7BA 3PXUA 5JPCA 5EEHA 1OI7A 3GLVA 5KAPA 4AI6A 3G1UA 3KSMA 1VJDA 2JCXA 1EJ2A 1GNLA 2B34A 3GNQA 2OV6A 3NV7A 3LVFO 4J2TA 4UVGA 4J91A 1FMFA 4B87A 2PCLA 3R3WA 1FDIA 3G0IA 3WGMA 2V7BA 4QJ3A 1HTTA 1MC8A 2NTYC 4OJQA 3Q1LA 5L3SA 1U2DA 1HYGA 4DLBA 3KQLA 1NV8A 2IXGA 2V7QD 3GFVA 3MWEB 1A8QA 3NFYA 4HMOA 4HY3A 2X19A 3ROFA 4F91B 1ZRHA 3EFEA 2C98A 3FPEA 3I2KA 4LYAA 4NE9A 1L5YA 4RVFA 1L6RA 1N6OA 2BISA 2RGWA 3WK7A 2ZJ0A 1HDIA 3V1YA 4D97A 1QE0A 5LA6F 3LXRA 3EIFA 4CIWA 1DQRA 3DHVA 1N2CA 1TU0A 4KUGA 2P3QA 5EJ7A 1OBOA 2WIGA 4IDGA 3ZYZA 4YJ3B 4Q3LA 4BXOA 1NQWA 1VOTA 2EBFX 2EX1A 4KODA 3JVEA 4PINA 4BQIA 2ZWPA 3AT1A 4MGKR 2DUNA 1PZEA 4ZARA 4BX9A 4Q9AA 2DEUA 4I1VA 1ENZA 2ZSEA 4LZJA 5TQ0B 5C8YF 4EGJA 2Q62A 1FXWF 3PNMA 4NJMB 3WQHA 1MB4A 3QVSA 1XLTA 2IDJA 2FOIA 4WERA 4Y9RA 3SS7X 2QN9A 3ZHRA 4KUEA 1TOAA 2OHFA 1IK4A 5JZ9A 2GZ2A 3SBDA 1W1IA 2I7DA 4R4JA 4QM6A 1S7GA 2G6BA 3AXTA 3C14C 3EVEA 2UYHA 3QTBA 2YBEA 3WB2A 1QX4A 3U7JA 1Q0PA 4W9NC 1KARA 3V8QA 3WZMA 4OLFA 1O6BA 4P54A 3FYUA 4MX8A 4A8JB 3KBBA 4EOGA 1NW3A 4UM9D 4PPQA 1R7RA 2BEUB 1Y1KE 3ZD9A 4FEEA 3CF4G 2OFWA 1VZ3A 4JC8A 3V1UA 2O8FB 2CXPA 3EVDA 3MWKA 3PGJA 1IYZA 3LP6A 3EQ7A 4JWTA 1AA9A 4FU0A 4DJAA 2VQFB 3IEUA 2CGEA 2P6OA 1K75A 2ECFA 4YJ2B 3VKGA 2EDAA 2X8JB 4L5IA 5JVDF 1KMQA 1WABA 1HDYA 3CKMA 2NVOA 3RYIB 5E7MA 4L4UA 3VTAA 1HR0B 4CM8A 1YONA 3VC1A 5LQMA 2EJTA 3EVAA 4I1UA 4M22A 4MV8A 3HABA 1A95A 5LKAA 4F3NA 2W2VA 3CNHA 3QPCA 3CV3A 3Q10A 1ZSNA 3LRPA 4D3YA 4Z7JA 3OFKA 3WKDA 1A4UA 2ZPTX 1NC1A 4QYTA 3VNQA 4E31A 1CRZA 1E3TA 1HZJA 1P60A 3MVEA 1IUNA 1TX4B 2A1TS 4UVDA 2IDMA 3O47A 4N6NA 4ZT5A 1YFKA 5IVDA 5I7WA 3T3OA 3P5BA 1T13A 2QTNA 4LVUA 3COZA 5IJXA 5I45A 3NM6B 1ZW1A 1OE0A 1CC1S 4IXTA 4QXMA 4FYXA 1T2EA 1X39A 1KE1A 2VOEA 2OB2A 3W5HA 1Q15A 3VHXB 1BMTA 3PR1A 4D9HA 3BMXA 2ONCA 4Q00A 5L3QA 1RT9A 3MWEA 1LCIA 4LX8A 3PB3A 4YAIA 4CLRA 1M5RA 1JFFB 2I78A 2C95A 4L3OA 2W42A 1SCAA 2Z43A 4EJ0A 2QAGC 4GS5A 2JFUA 4M1MA 3GJXC 4TSFD 3ODGA 3AKYA 4ARBA 3I01A 1L4HA 3CZAA 2Q5IA 2QAIA 4OO3A 1MXFA 3G0OA 3X2SA 7YASA 1AUXA 1YR8A 4RS3A 3CXUA 1VL2A 4YJ3A 1MQ9A 1PZGA 3E8SA 1ZMBA 3U3RA 5AVQA 3DVAB 3M0EA 4YHBA 4NTZA 3WYBA 3EPPA 4OHMA 4LRXA 2JLAA 4MUXA 4OXRA 1RKXA 1V7CA 3M1LA 3PUYA 5TQ0A 4W8HA 1HE8B 5EZ5A 4RQUA 1IEWA 3WBKA 4DMGA 4R8RA 2FQ1A 4YAWA 4AB1A 2WICA 3O1IC 5HJ7A 5KYUB 3SC2B 1JU4A 1XVUA 2IUFA 3MT8A 4HWKA 4QDZA 3G8DA 2A9OA 4Q1VA 1DXQA 3MMPA 5J5AA 2JKYA 2QU7A 1SIOA 1VKOA 4A8JA 2QRJA 3ZE8A 3GNLA 1HYHA 3GAFA 2P5TB 2BEUA 2DLDA 3O4IA 2UV8A 4KO2S 3A1CA 3V9PA 2O8FA 1NMEA 1JLKA 2EGGA 2B2CA 4PZPA 4ZVMA 2IVZA 4UOQA 2PSFA 4L72A 1CWUA 2ZP1A 4FONA 1ZVKA 4YJ2A 3B1WA 4KN6A 3AY3A 2X8JA 4NNOA 4D9EA 4XVRA 3R6GA 1KEPA 2IOYA 4ZT7A 4K9LA 1WEHA 4JAVC 3OLCX 1S1CA 4Y2XA 3RYIA 5LBUA 4ALJA 3TG8A 5D51S 2F8TA 1GU1A 4KO3S 2R25B 1RJ9B 4JMPA 2YVUA 4BRZA 4EX6A 2P6MA 2QQ5A 2R84A 3EMKA 3ZV5A 2QR3A 2DQ4A 2VVTA 5E2BA 1B74A 2B21A 4GKAA 3D8SA 1N75A 1P1JA 1T9GR 5CX1B 4BL5A 2ZIVB 3HDGA 3F6SA 3ZZ0A 1X74A 3M1IA 3QVWA 1JLHA 3D6JA 1RWWA 3VYRB 4PG5A 4H7IA 3Q0TA 2PJZA 1PJAA 1CUVA 2X2FA 1Z8NA 4QRDA 1YB7A 4EKEA 5MF6A 3OVMA 4WADA 2HR1A 5HHTA 3KBOA 2BWJA 1V39A 2ZRQA 1JZTA 3D7RA 1XVLA 3CWCA 4I1IA 5DW3A 1IUOA 3A3PA 3CZ9A 1JMKC 1ISRA 3CZ4A 1JSRA 3HWX1 5HS6A 4YCMA 4LGYA 2W2TA 3B2QA 2IP1A 2VQ3A 1EDBA 2WBLC 3E3LA 5CNJA 3A6LA 3GI1A 4LBYA 1ADYA 2O4UX 2OHJA 4D3SA 1ST3A 1SVKA 4P81A 2JBHA 3P9RA 1A82A 2V5UA 4MB0A 3THYB 1WKVA 1X92A 4CQJA 1RXWA 3DVAA 3PXCX 3FN4A 3K8OE 4OKIA 2P27A 4EARA 3V7YA 3DAPA 3M9WA 3E2IA 2BKAA 1WBBA 4N0QA 3RBAA 1SKQA 2AJCA 4JC5A 2GXQA 2VDNB 1UDAA 3O4GA 1OKKA 2F4NA 2FG7C 2R7MA 4PGHA 2WTAA 1NBMA 4E3WA 4F38A 3W7VA 4O4IF 2P5YA 4A91A 3DUFB 5KYUA 5CURA 3IKTA 3AQ4A 2DFTA 1LF5A 2O50A 4UUOA 3SXUB 1V16B 5IXYA 3JQ8A 3B7WA 4LECA 2NGRA 3LQFA 4QU8A 3CLTC 4MUJA 3ER9A 3O8BA 1K5DA 1KVQA 4H77A 2PGLA 3SIWA 3TR5A 4KOAA 1W85B 3COJA 5FOTA 5B58C 2IVFA 2QRVB 4FGZA 1LTQA 2ZJZA 3PT5A 2IIBA 1AX9A 4RTLA 1ENOA 1H2XA 4GZ3A 3LWNA 2EKQA 2YBDA 3N0TA 2RAFA 3T4EA 1MVNA 1Z4OA 4AMZA 2AUMA 2CCGA 4ZAVA 3D81A 3FUCA 4R7ZA 4ENTA 1ZH4A 4J1TA 4QGFA 5KNCH 3OUZA 2PZJA 4PYIA 3W79A 3TKAA 2GETA 1O95C 4B73A 3GNSA 4Y9UA 1T9BA 1H2EA 4BNKA 5SY6A 2JFNA 3PNSA 4J4BA 1EUYA 3H5OA 2I7XA 3U2QA 3NIGB 2IYSA 5EXEA 2QY9A 1RJ9A 4KE8A 4C08A 3LQYA 1QIGA 13PKA 5BNIA 1G63A 5LDDC 2O19A 4GPIB 4M1WA 1NZJA 1VCHA 2ENUA 1SQGA 2PKYX 3ENWA 4IXDA 3WYGA 2HZBA 3PXXA 3T8YA 2HQBA 2PH1A 4QJ5A 4BS9A 5EXPA 2GEFA 2E4VA 3P2JA 4QQNA 1JHDA 5CX1A 3ULKA 3HP7A 3R6WA 2OLEA 2FZWA 2ZJ7A 1XZLA 5JSZB 1Y4AE 2PLAA 2FHSA 2M1XA 2N75A 3A14A 3ZEAA 2GLTA 5A5GA 3IP3A 4GC5A 4NK4A 4RJLA 3WNQA 2J33A 1NR1A 4F72A 1K6XA 1P6XA 1F5SA 4DA7A 4XWKA 4EITA 4Y2QA 3S1LA 4BDTA 4TS4A 4TZKA 2CC2A 4Y6LA 4IO1A 1QO9A 1JPUA 2A1TR 1J2RA 1C3LA 2DTXA 3ICPA 4HXGA 4IJMA 4K5QA 2XYRA 3HO8A 2X7HA 5FA8A 5WRFA 3TSCA 1BG6A 1E2DA 1K08A 3GYGA 4NCXA 3KQHA 5ALWA 1Z8HA 1F7UA 2CVZA 2WUWE 4EYGA 3KZNA 1TTHA 4QYWA 4GM1A 4WECA 1IATA 2F1RA 3OHSX 2IW3A 1VIMA 3GEHA 3KJNA 4I1SA 4RPGA 2NT3A 5EIBC 2AJTA 2JFHA 3THYA 3LHSA 3RODA 3MBKA 3IR7A 3R5SA 1TK2A 1P7VA 1N9KA 1RRKA 1W19A 1W94A 3CR3C 3FFAA 4HTFB 3TIVA 1EFUA 4HXFB 2FDCA 2PTHA 2PWYA 7REQB 1U90A 1YR1A 2AJLI 3AWIA 3KYDA 1P33A 1ZUWA 1FFGA 1NTOA 2X7XA 3DUFA 4A2QA 1HLDA 1PYDA 2F48A 3CJQA 2ZI6A 3SXUA 5G0WA 2ZBGA 1V16A 4H60A 1SUAA 1AKNA 2QQFA 2VTEA 3JQRA 4X85A 1CQIB 3VDXA 1N0VC 4QSHA 1N36B 1HQDA 3UGTA 2QLNA 1Y48E 3NEPX 3VVCA 1W85A 1RP1A 1EGHA 4NHOA 1D6JA 1M6NA 1PBTA 2QRVA 3PA8A 2XDQB 5JZVA 4MKIA 2REBA 4YMLA 3NYRA 2V6IA 2AXNA 5J43A 1TTPB 1VPTA 3NT5A 2AZ4A 1Q0UA 2C97A 3AF2A 5EJ9A 1LLCA 1AMNA 4MYCA 3SIRA 5GM1A 4M8LA 2I3GA 1JTVA 2QG4A 5K05A 2PQ6A 4GPD1 4KPGA 3GLIB 1PFKA 1QDLB 2QRZA 3RWBA 1W87A 1KKMA 5KVAA 1PJBA 3PKJA 3WYDA 1PFVA 4YROA 2DQZA 1W46A 1NVGA 3MG9A 2XB2A 3X1YA 2VPXA 3DM9B 4C9BA 2CV2A 4UDYX 5ADVA 1Z45A 4I55F 3KOWA 2WYWA 1E6WA 3QE0A 4UASA 3ZI0A 4UHJA 1JX6A 1UKYA 4B76A 2O3TA 4N1AA 2I80A 2VP4A 3FMPB 3LXXA 4NWIA 3WRVA 5B12A 5JT1A 5LP6A 2BSQA 1VLVA 5KOJA 2P35A 4OKSA 3EGCA 5JSZA 2HMSA 2YYSA 4EMTA 3KO8A 5D2CA 4YV1A 1QR6A 1L5RA 1CDZA 3IDAA 2H1RA 3K0CC 3T3IA 1T24A 1THGA 2R44A 1IY0A 3BRWD 4P5DA 1U5AA 2OAQ1 3UMGA 4E5VA 3QE9Y 3IEVA 3M6UA 4NULA 3RKUA 2QLBA 3PF9A 4ISCA 4Q7QA 1PCXA 5EFOA 3T38A 4WK2B 3B70A 5TMEA 5JRZA 2CHVA 1OA0A 3TKYA 3UHOA 3JD2A 4MEAA 1DJMA 5BSFA 2WMYA 1UMDB 2QTRA 3N5CA 3VNAA 1CJTC 1FJXA 2O2EA 2D74A 3ICCA 3F2VA 4LBVA 2VF2A 2NAPA 5DHRA 4CDRA 5CYGA 3PTAA 2Q3MA 5JD4A 2NSLA 3PC2A 5BYKA 4C7JA 3NBFA 4PF1A 4U9HS 1IN7A 4HTFA 3PNYA 2Q29A 4J0JA 2OPHA 2JI6A 1F6BA 7REQA 1XTQA 5A4JA 5ALTA 1VJ5A 4BV8A 1XGKA 3LGXA 2XOKA 2PVSA 4P1ZA 4L95C 5ALEA 3FWYA 4R81A 1Z2DA 2GAIA 1AS3A 5TT0A 3ECAA 1M73E 1CQIA 2XIJA 3GP5A 1ZN9A 3L7CA 4EX7A 3SKVA 2IXDA 2ZQ5A 1WTAA 5C7IO 1KZYC 4FLEA 1X6VA 2AFIB 2HHCA 4G67A 5HKAA 1JZQA 3B78A 4UAGA 1IN8A 1CJVC 3BB3A 5JYCA 1Q7BA 1YKFA 2XDQA 3K35A 3IFSA 3MCVA 4MVWA 4Q9IA 4WFQA 4TQAA 4IRXA 1IZ8A 2HRQA 2OQIA 2W5UA 4P3PA 3WP0A 4WRRA 3H5IA 1NQ5A 2NTVA 5ALIA 3M4YA 2Q8PA 3CSDA 1ZXLA 2PBFA 1CEYA 1UXHA 4EA7A 1Z13A 2OOSA 4G0OA 3AY0A 1I3NA 3QP9A 4HN9A 2CNBA 1ACLA 3LPAA 3WLLA 1QOZA 3L02A 1SC9A 3R8FA 2Y66A 3LAWA 1RMYA 4KXLA 2WLTA 4C43A 1U6JA 3KZXA 3WYCA 1XHEA 2G6TA 4ERXA 5JQGF 1DXOA 5FI3A 4YRBA 4XYLA 4EO9A 3FMIA 4WBXC 2AE2A 4KR3A 3Q0EA 2AKYA 2C4MA 2FEXA 5K0NA 4KK3A 3WK6A 4UVEA 3D4BA 1U3CA 4K9RA 1AQ6A 5HRUA 3KK0A 4FXPA 3UGQA 1REQA 2X0EA 1E5QA 1JPJA 1W7AA 4CQLB 4FKZA 4W1SA 3T15A 3WGUA 1H1LB 1LNQA 3ONNA 2Q4TA 3EK2A 1PD0A 3TDMA 1Q91A 3FTPA 4TTPA 1NSYA 2C1ZA 4JIGA 5DNVA 5JASA 5CXQA 1KSJA 1WU8A 2XWSA 3OBIA 5KVVA 2IODA 3QMVA 4LOAA 4UKDA 1GA1A 3LIIA 1VIYA 4ZI3A 1Z28A 2ERCA 2C7VA 1AS0A 2DQSA 4TLEA 4A10A 5U9CA 3TB4A 4KR6A 3N2IA 1UMDA 3DYVA 1M34E 4P38A 4WZBE 5CT6A 3ZGXA 3JQEA 4CKWB 1E1KA 1FP6A 1BFUA 2Q46A 2ZSKA 3PGXA 2PGAA 5KTRA 5I7OA 4OHZA 5FQNA 3TSAA 2AMVA 1SO8A 2V45A 3KKOA 3QA9A 5K8TA 1FP7A 1J97A 4J0DA 3QU7A 2FMFA 1K6MA 3MT9A 4PLFA 1CQZA 1DC3A 5C8XA 2D7JA 3DCYA 4B44A 4X3OA 3PHGA 4QUEA 3K70C 2AJDA 3SYLA 1XVTA 5TGTA 1Z47A 2HMYB 3SFVA 2XGGA 4HNSA 1MABB 1JTEA 1N2OA 2AFIA 1PJ2A 2HTEA 1DT3A 2HEGA 3G79A 3Q7PA 4QREA 2QVXX 2RI1A 4GR9A 1EWRA 3DMTC 1Z6XA 4NICA 4QHSA 2I1LA 3FDZB 1VJTA 3I5XA 2NP6A 1J99A 3A1SA 3I2FA 2O4CA 3H5NA 2V55B 4UZSA 4A15A 2GTIA 2Y4OA 5JH7F 3F4LA 3M4XA 4DR6B 2QM8A 1SOAA 2N46A 3OCYA 3CRW1 1DFIA 2OG2A 3JZIA 1M7GA 4IZHA 2AMJA 2IWHA 2ZRCA 3B60A 5DCYA 1LK0A 3U3DA 4UDXX 3EEYA 2HZ7A 4PRZA 4JV5B 1V9SA 4ZKDA 2ZCJA 3UJPA 4Z3DA 3KIPA 3P52A 1LZKA 4AWBA 3IHLA 3QH4A 3UN1A 4DR2B 3IXLA 3NATA 2XYPA 4QPPA 3Q8MA 2P90A 1M74A 1UT5A 1TEHA 3KZ1E 4I1RA 4LMPA 2Z5FA 4Z9AA 2C9CA 4JUAA 3OU6A 4K26A 5FULA 3B82A 3Q3CA 1OXSC 2NZWA 3KU4A 3KXIA 1VHQA 4IHAA 1G18A 1QGDA 2WF8A 1EBBA 2SECE 3ZDZB 4E22A 5JEEA 1J8YF 2QN6A 4QUAA 3VU3A 3L7DA 1FU4A 2CXOA 1YIDA 2L42A 3QVOA 3L7MA 4KO8A 1Z63A 2X9QA 5EMHA 2GO7A 4CQLA 4UUNA 3RRMA 2MJLA 1H1LA 1QC5B 4HYYA 4JT2A 2O8BB 4TLAA 1W8IA 4X8LA 1U0HC 1HY3A 2Y1WA 5CW2A 2BFFB 4NENB 4TMVA 2IH4A 1KR5A 5A3JA 1SXHA 1AK9A 1DLJA 2QI9F 2ZJ3A 3KSUA 2R62A 4KKVA 4LHXA 1O4WA 1IAVA 2VSNA 4N0DA 3RSFA 4ZCIA 5IJAA 1N77A 1FRZA 2ZIUB 1U3VA 4ALKA 2WQZA 1UXOA 3IJ5A 3D7KA 2JC3A 1Q1GA 3NANA 2JJ2A 2ZJ2A 4PCVA 4DPLA 3JVDA 2FSSA 2Q3JA 3RH0A 4ILKA 1QB8A 1ZGAA 2C54A 4CKWA 3I6IA 4UQPA 5F1OA 4ZKEA 1EZ1A 3NALA 3O2JA 4Y3UA 1T5DX 2AKAB 3T52A 1SU6A 4UTVA 5HPYB 3KLOA 1UBMS 3FOFC 3TLZA 4IEIA 1YRQA 1JALA 1GGVA 1QKIA 2C2OA 5DNYB 1QCCA 2FJUA 2ZRJA 2CV1A 3BULA 1GCAA 3U49A 1E9VA 1ORIA 1JA9A 5IAKA 2X77A 2J3EA 3N3BC 2CZGA 3VZRA 4BTLA 1DVRA 1WQ4A 1NBEA 2C5SA 2GLUA 3PCRB 3S27A 5GIPE 1GQRA 3DXZA 3ZLTA 1A0OA 1T4BA 1Y7LA 4H1TA 3ONDA 3G2KA 1SUEA 1BXRB 1IOVA 3KYBA 2XUQA 4O02B 3FDZA 1J21A 3AI2A 3EHDA 3UZUA 4ZREA 4CEHB 4KIUA 3VDMA 2QX8A 2BHTA 4K6OA 3MINB 4OHKA 1UK7A 4GVPA 4RV4A 1BN7A 2J0SA 1R9JA 4OI0A 2O14A 2OZLB 4JJIA 3SYKA 2A88A 2VG8A 2IHJA 3N74A 4K28A 4BRSA 1YB4A 2GUWA 2V9ZA 4MUKA 2IRWA 1U1IA 4G5QA 2RHLA 1N2EA 5DH9A 3HCNA 2R11A 3I9OA 5JCOA 3UWSA 5FNVB 4N76A 1HEYA 3LP8A 5CFMA 1G7RA 3QNMA 2H0AA 5FUMA 3AEKB 3LUJA 4I8DA 3H5TA 3U9LA 1OBHA 2PPLA 5C81A 5GONA 4GZ6A 3Q3GE 2HX1A 1XZPA 2X4LA 3OPYI 1J4AA 1AH2A 4JI5B 5JCXA 1XCPA 4YNBA 2R6HA 3QMPA 2VZLA 4EZIA 4MW9A 3VH4A 4JYPA 3UMRA 3AJRA 3E7WA 1U1GA 1Z39A 3ASVA 3BK7A 4XB1A 4XB2A 3P27A 2IPMA 4FNOA 4HVTA 4MV6A 2XYQA 2QJTA 2G07A 5DWDA 4LE1A 3OLVA 4U63A 1PVVA 4I14A 3UT5A 4AZ3B 1RWKA 3R0QA 2D3WA 5DF1A 5B6PA 3HY3A 1ZIOA 1QC5A 3E5NA 3IPAA 3GZ4A 3LG2A 2HMVA 4GBGA 4JJEA 4ED9A 1ZJJA 4Z9FA 4GQBA 4U7DA 4NXMB 2BFFA 4NENA 3KJIA 5A0TA 2V59A 4ENVA 3GLFB 3ZTTA 1AF7A 3M33A 3V1KA 2PBRA 5FWAA 4MLCA 1OXBB 4YV0A 3LM8A 3OOWA 2YFHA 4Y18A 3UMSA 1S3IA 2AN4A 4JEHA 3ZDXB 3GK3A 3O6VA 1AK2A 2A35A 1YL6A 2OD7A 2REQB 3ICVA 3WX0A 4PAMA 4ZPXA 4ENRA 5LQSA 4ZGGA 2CF5A 3RV4A 2WK1A 1PR3A 3H19A 1JNXX 1KQ3A 2J7PD 5IJ9B 2X41A 1L8QA 3GO4A 4DQUA 1T9KA 2GSDA 3L7KA 4R1LA 3BJIC 5T6BA 1U9CA 1OYYA 4FFWA 2P5UA 5TQJA 3MGBA 4G0ZA 3HE3A 2O2IA 1NQVA 5K51A 2CLCX 4RGYA 2FI1A 1L5MA 2R7AA 3G2MA 1JG1A 3PGA1 2FYTA 5EIHA 2ZIAA 4BN0A 2CNWA 1Q83A 2FDXA 1LDYA 3RBZA 1C7EA 1KMHB 4MDFA 4ZVSA 2F7SA 3TL3A 4JUDX 4MMYB 4R54A 2JGNA 5DRTA 2OXIA 3H5AA 2PGJA 2JD2A 2A67A 1P62B 1MVLA 3R5KA 3RREA 1BXRA 4ZK2A 3OOHA 2J32A 2IPOA 2XGOA 3ABRB 1HOTA 4LY6A 1GRRA 3RU9A 4KQWA 1VJ0A 1J0EA 2BBTA 2FPKA 3MINA 4WEOA 2P11A 5KU1A 5G02A 1FFDA 3W3AD 3RF6A 1VKRA 2ID8A 5LOVB 4CWAA 1BWPA 3UWOA 1UPTA 1I30A 1DWQA 2IP4A 1QFXA 2B9VA 3G2PA 1Z4MA 1W0JD 1W6UA 3QNUA 5FNVA 1K89A 3DM5A 4C3UA 4CMKA 1ZNQO 5CVUA 2CVPA 2MSWA 4BO7A 3AEKA 2GWRA 4BO9A 1YS7A 2AG5A 2QD4A 4DCNA 1UJ2A 3QGMA 4JQOA 5FTJA 5TEVA 3NLLA 4A8TA 2GN1A 2FN4A 3ZQJA 1M8KA 1FYEA 1UZMA 3D7NA 3M5CA 4F5ZA 2ERYA 2NXEA 4DB4A 4N9QA 3KWFA 1HT0A 3CUSA 4X5OA 3I1YA 2X3UA 1HLPA 2ZJFA 4AZ3A 1T1RA 3EZYA 5TF4A 2BVNA 3TR6A 2OC9A 1QK5A 5FJIA 3LQ1A 4F97A 2ECKA 2DLCX 3N6XA 4R2XA 5DM2A 3KUCA 1R18A 2A1IA 2ZT6A 5CXSA 4YYZA 3EX7C 2PS9A 2RH9B 1CY1A 3GLFA 3EPRA 1XCOA 4EPWA 3M7IA 4MMXB 3NH6A 4XQEA 3BF8A 4DR1B 2RBEA 2XNDD 4C1BA 3UW1A 1UBRS 1M0WA 2GASA 2P2CA 2AN9A 3B1KA 1X2BA 2R66A 1GQ2A 4X1YB 3M1AA 5E8RA 4ZQBA 1CERA 2HIHA 2REQA 2IPNA 1I9CA 2GJAA 2RGUA 7AT1A 5M7EA 1Z7WA 4QVIA 2HNKA 3W8EA 1B0PA 3CT6A 5DHFA 1UP7A 5IJ9A 5B2FA 4OGGA 1PO7A 1U8UA 3EN0A 1SHLA 3QNWA 1CUAA 5EI5A 2CBGA 2Z4TA 4WASA 1PGJA 2RJOA 1ZGCA 1XTJA 4OXNA 4X7RA 2RONA 1NVVQ 2IYQA 5EP1A 4AJEA 3LZDA 2YZNA 4OATA 1TVKB 3E1SA 3D3JA 3CW9A 4IIJB 5C34B 5IABA 4PHCA 4QT0A 2XQJA 4DC9A 4EPRA 1OWOA 2OECA 3O3MB 2TRSB 1Z06A 2C4TA 2JH8A 2WJ3A 4N7RA 2NO4A 3DGEC 4QQKA 2I4NA 2VFAA 3A4IA 3OESA 1H4QA 4CF3A 3EJWA 3KLPX 3DV2A 5HKLA 1JZSA 5EIOA 3RG8A 4YT2A 2Y1GA 2IDKA 1R88A 3A1WA 3PVSA 4N5MA 5BV2P 3WIEA 5FAKA 4MR9B 3W5DA 1XSEA 5HCNA 1SU8A 1WOMA 3A06A 2J3QA 3BZWA 3BGIA 3G9TA 2DT5A 4LJ7A 2OBFA 1U31A 2QTLA 3PE6A 3P1JA 5CM9C 3I9V6 3OP4A 3RTCA 1KEUA 1R15A 2ID4A 1F51E 4HB0A 4B09A 2QN1A 2Y71A 4IWXA 1HDEA 2CLKB 1CZOA 4JVNA 1ZI9A 2A6PA 3D64A 1XI2A 1W30A 4RE6A 3VHQA 1OXUA 1VYVA 3MD9A 4OP2A 3BRQA 1RMTA 2IA5A 4WXYB 2EYQA 3PCXA 3DW3X 1JR2A 1NQAO 3R3UA 3X0DA 3CLRC 3PC7A 5DB4A 4ZN6A 3OZFA 3IIEA 1HOXA 1T9ZA 4EB6B 3T1HB 2CXUA 1Y6FA 2XJ4A 3T7RA 5GINE 4HDRB 1XA0A 2NV2B 3R40A 2QZ4A 3LT4A 5EHQA 2ZYAA 3UK1A 5KOHB 1S3GA 3B36A 3BF7A 5FHQA 1A4RA 3RADC 1F9EA 1OWPA 3O8CA 2V0CA 3RK1A 4JHXA 1C3JA 5EIFA 2QRLA 1YZGA 4REOA 3HLYA 3C2QA 4J9UE 4QLBA 3SWWA 1CF4A 3BREA 3Q85A 4E88A 1GXSB 1UR5A 2D1QA 4X90A 4YLEA 3TN7A 3MGGA 5JTTA 1WCIA 1EB9A 3ZY4A 4A9AA 2RJ3A 3N8IA 3VBCA 4L8WB 3VR5D 4M86A 4KFRA 4OXXA 1DLIA 2FMUA 2DP4E 5KIAA 3ESCA 2P9TA 2LPMA 4MEBA 4X1YA 3VX4A 1CUJA 2CKMA 3GOQA 2OE2A 1KQOA 1KYZA 1SM4A 2QENA 3DL0A 2TSYB 4TT3A 5JUWA 5BV0A 3ZVMA 1LC3A 1D2MA 2C0PA 3G5MA 3CGGA 4OI1A 1FS6A 4C89A 1J5EB 1Q19A 1UKAA 3HKDB 4GOLD 5ER6A 1C5KA 1G4UR 4GMHA 3OC0A 2GVZC 2G77B 3QXHA 1KYIA 4R84A 2DCUA 4MGYR 2J6HA 1AXRA 2OR3A 2OWDA 3DF7A 1KEWA 3HBAA 5C37A 2JCYA 3EE6A 3E35A 1TVKA 2HBYA 3KYCB 3DHYA 5ABPA 3QLUA 2VDJA 1ZFNA 5ICSA 1OU0A 1KH1A 4FOSA 2VHXA 1LUAA 1UBJS 2EOAA 3ZZTA 4MKHA 1VE7A 1ZHOA 4JLMA 3INYA 4TXLA 4GXNA 3OE7A 2FUNB 5DHUA 1TM2A 2FRDC 2RG1A 1ADGA 4NPAA 1NBHA 2QNBA 3DZIA 5BVHA 2ZZKA 4MR9A 3KAKA 4V38A 3TUJC 2GK6A 2CJXA 3N70A 3RK0A 2ZJ5A 4EG4A 3NJ8A 3QG1A 2C2ZA 4GC9A 5I48A 3V48A 1GM5A 8LDHA 1KSFX 2NTEA 3GQVA 1JHOA 1YT5A 1TT5B 1MC1A 4PEVA 3TRJA 3ZGLA 2CWWA 2Q3LA 1UJ5A 2Z9CA 5BRNA 3CQ9A 2WSSA 3V8VA 3FSRA 3C15C 1CZHA 1F5NA 5IVIA 4CIAA 1AUPA 4CFSA 4LBWA 1CKEA 1EUCA 5L7TA 1HEIA 4MWCA 3V2GA 3NHYA 3C5EA 3KDSE 2CJWB 3SJUA 2IZOA 3Q15C 3K31A 3OU7A 4U2GA 1HDCA 3IOYA 5DNWA 4TN1A 3RU2A 4H18A 3UT0A 3KOOA 2OHHA 5BMOA 5FTLA 4P7KA 4HDRA 2LCFA 1OGIA 1TQ2A 1Y4UA 4NYJR 4D4IA 3C39A 5KOHA 3T1YB 5AI0A 4RBNA 2PH3A 1PZNA 1LRKA 3AQIA 4P4LA 2B1GA 3HB7A 5DLYA 1SUBA 1I7PA 2RH5A 2YZ2A 1XTTA 4AN4A 3DEHA 4D9IA 1HKUA 1V2HE 1GXSA 1UXGA 4DC0A 4GG1A 3PL1A 4F56A 1B4DA 1WVGA 2Q6KA 3NYIA 3DE1X 4DV4B 2C07A 3PITA 4GKVA 4XQ0A 1SQFA 4DIOA 1ZP6A 2HIAA 3MM4A 3PKIA 1SUCA 3FRIA 3KEOA 4BZQA 1MXHA 3KUDA 1IRXA 2V5AA 2AC7A 1QXSA 4QWWA 1EIZA 1U8EA 1H2RS 4I50A 1EXWA 5KTPA 2BLNA 2VDPB 4DC1A 4MH0R 2O8DB 1R8XA 1QZUA 4P0QB 3TIGA 2VPTA 3CLTD 4WZAE 2NO0A 3RSOA 3LPLA 3AXSA 4IUDS 3WRYC 1G8SA 5E6RB 4Q1DA 3S8YA 3B1VA 3L82B 1LPBB 2NVWA 2GBLC 2XQKA 4FS8A 4JLWA 3FIJA 3KYCA 4U7JA 4RM3A 5GOTA 4BBPA 1RI2A 3ZGVA 4KEAA 1RQPA 3SYNA 4LMBA 4BLQA 1LDMA 3W2FA 1OI3A 1NMQA 2A5LA 2QJRA 1EVEA 3LBFA 4GOXA 4LF9B 4QDOA 3WYFA 2VP0A 3S6JA 1YI8A 4H3HB 4AY3A 2O7NA 5ALJA 3KQKA 4FZ5A 1DRVA 4RZUA 5K3CA 1G21B 3ER6A 4ZYLA 2FR0A 3TMAA 1OWNA 4E14A 2ZR9A 4KQIA 1AY0A 3N9IA 5CB8A 4J4TA 3U13A 4X1KB 3WMRA 4BIIA 2PX6A 5B6JA 2JFFA 4X20A 2XCSB 2JI7A 3WRWA 2IHUA 1ZM4A 1OLOA 1TT5A 1D2NA 1Z5PA 2HA4A 3DB1A 1NI3A 5DN9A 3UM9A 1ZCFA 1JBEA 1KDOA 4TKVB 3HA2A 3AJDA 4XASA 5J3JA 1XWFA 2YNMD 1MO2A 3E2PA 3C8MA 8AT1A 1THTA 2X8LA 4CLEA 1ISPA 1BXZA 2CJWA 1CUUA 3GW8A 4NZZA 5CTAA 3UCFA 3EQ6A 2F90A 3EZNA 5A9SB 5MGNA 4WI1A 2IP2A 3RVSA 2K2WA 1EK1A 1JHMA 1JJFA 2XCUA 1DKMA 4TOIA 4Z9YA 3WB0A 3WK9A 1Z0FA 4D4HA 4O1MA 1RQNA 4K8OA 1AD2A 1GNVA 1F6DA 4OD0A 4R9SA 3ZHUA 4Q6WA 5FD8A 1SCJA 1SCBA 4S2UA 3C3CA 1Y1LA 4I5IA 2CXQA 2X13A 1RQLA 1ATIA 1PR0A 1U28A 3DWIA 2DWPA 3H0KA 3N2EA 2GPYA 2IIQA 2SKCA 4N0PA 4BLTA 5L6LB 5D5QA 1O94C 4XCVA 1KY2A 4Z6KA 1PG2A 3Q3VA 4CLDA 2I1WA 2J85A 1UQTA 1XTUA 4OQZA 4QVGA 3JV7A 4F2HA 1WZ2A 5HCUA 2GAAA 1XHFA 1BMDA 5A3SA 3C43A 2ZI7A 2P9GA 4OMUA 1XN1A 3ZZMA 5JLJA 4RD1A 3U6BA 4W5OA 4EYQA 4BO5A 4EVSA 1CY6A 1P4AA 4Y6OA 4ND7A 4FHCA 5AXDA 2WTEA 4M1ZA 1ISSA 1ZISA 4QHYA 4HWTA 4GGMX 3EF1A 5LXTF 3T1VA 4ZGBA 4A0HA 2GYUA 3G8YA 3KQOA 2G1AA 5AOVA 4EYEA 4YCLA 2GR9A 2X5KO 2IZ0A 1YFLA 1U2PA 2GEBA 4QA9A 5E6RA 1MQSA 4UCFA 3ZXXA 4EBFA 4UHBA 3STWA 2ZYTX 1G3MA 5F1KA 5SYMA 5F1YA 4LRYA 4EFDA 1CUFA 3GLGB 3TJRA 1WP4A 3LKZA 4KZKA 2ZBUA 4ZU6X 2P2LA 2GXUA 4UUBA 2YIVX 3GA7A 1JWBB 4EMSA 3LL7A 4KPFC 5LMNB 2GYVA 2E37A 3DVSX 4LJSA 4KBYA 1I4EB 1VXOA 1P2UA 3ZCRA 3PD7A 1TUEA 3ZOZA 3KU1A 3WLPA 5B3JC 2WJIA 3ORRA 1KHTA 3IUPA 3KR9A 3TZLA 4JITA 3GUUA 3DDZX 2ZUBA 3P0EA 2M32A 1G3UA 4MVJM 1D5CA 1J23A 1DWPA 1P80A 2O57A 4NJOA 4NEHB 1K92A 4RCYA 2XRMA 4KIJA 3IUMA 1BZYA 5A9TA 3MUOA 5GIOE 3ZIAA 2BP7B 3EXG2 4KQHA 2WKRA 4NCKA 3ZU2A 4TKVA 1CFJA 4L9WA 4YMTA 4PBRA 4BNZA 4G6ZA 4UMVA 5AI4A