5AOAA

The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-propionate bound
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
277
structure length
272
Chain Sequence
LRYPPEMPGAEVKVYKKVDNVDLKLYIYKPADWKPADRRSAIVFFFGGGWQSGSPAQFRPQCEYFAGRGMVAMAADYRVGSRHNVKVADCVADAKSAIRWVRQHAAELGVDPQKIVASGGSAGGHLAACTVMVPDLEAPEEDHTISSQANAAILFNPVLILSREGLRQDWEERLRERLGTEPKAVSPYHHIRAGLPPMIIFHGTADNTVPFETIRLFAEAMKKAGNRCELVPFEGAAHGFFNFGRGDNLAYQKTLELADEFLVEIGFLAPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Novel Thermophilic Esterase from the Planctomycetes Species, Thermogutta Terrifontis Reveals an Open Active Site due to a Minimal 'CAP' Domain.
pubmed doi rcsb
source organism Thermogutta terrifontis
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 102
structure length 272
sequence length 277
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aoaA00
3O4HA 3ZLUA 1BU8A 4G4JA 1QZ3A 3D59A 5ALKA 3STUA 4C89A 5AKIA 2WUEA 1WHTA 2H1IA 1J07A 4Y2VA 2OCKA 2Z8XA 2WJ4A 1TK3A 4IQ4A 5EHNA 3OG9A 3LS2A 1ZD3A 2WG0A 4B9EA 3R3VA 3K2IA 2W22A 2WFLA 4JH0A 2OAGA 4WFJA 5K3DA 3QITA 3B5EA 1UXOA 3O0DA 4Q3LA 5EIHA 1IUOA 5JZBA 4UHEA 3DD5A 2OGZA 3HSSA 4M0EA 3FYUA 5BWBA 1BEEA 5HK9A 2PU5A 1MU0A 2G63A 3AUKA 5ALLA 2J3QA 4WDQA 3H18A 4XX1A 4L3WA 1NX9A 5CH5A 5K3FA 2QZPA 4FNGA 2VATA 1L7RA 1XRQA 1SFRA 4HS9A 5CBKA 2G4LA 3H1AA 4DYHA 4TPKA 4OD0A 4UBOA 1YAJA 3G8YA 1L7AA 5LKAA 4FFWA 1YSCA 4Y2PA 1YAHA 5D7BA 4FNMA 2VT6A 1CFJA 4H7FA 1LBTA 1XZEA 3O4JA 1ZGCA 5K3AA 3WKDA 3WWDA 2WU3A 4DNFA 4KE6A 5CTAA 4FOLA 1FFBA 1QIDA 4TGLA 2K2QB 5ALUA 4CCWA 4F21A 4AX4A 2XB6A 1OCEA 4OU4A 1EDBA 2ACKA 1Q0RA 3SK0A 4BCDA 1T4MA 4X93A 3HXKA 3I2HA 5DNVA 5E4YA 3IULA 3WKBA 4EA6A 4EB0A 5KWJA 4Y2JA 1BCSA 4FDMA 3ESDA 2WFZA 1VOTA 3FOBA 3G9ZA 4DMKA 2B20A 4B9AA 3KWFA 5AP9A 4BVJA 3I1YA 3W9UA 1DINA 2HM7A 4M0FA 2H9YA 4U2CA 4IO0A 1YASA 3AINA 2OQVA 1CRLA 2AJLI 4HAIA 2WUDA 2PUJA 4PO3X 3BF8A 1G5FA 1GPNA 4FLMA 5FV4A 1QJ4A 3DLTA 1TRHA 2O2GA 2PL5A 5E4TA 4EY7A 2HRRA 1OILA 2QR5A 2XUJA 2E3JA 3GFFA 4Q82A 4NZZA 4UPDA 4G8CA 1JFRA 1LLFA 5CT5A 1HLGA 5ALVA 3WWPA 1VZ2A 2Y6UA 3D2AA 1JJBA 3C6XA 2C5FA 2Z5GA 5HK8A 1GPLA 1R88A 1CUWA 2J4FA 5JD6A 1ZI9A 3FCYA 3GA7A 2CEKA 1O6FA 5AI6A 5CT8A 4KRYA 3H2HA 3F96A 3EQ7A 2Y2VA 2LIPA 2I78A 5KREA 3WK9A 3M82A 2BKLA 4MWSA 2PU7A 5D3KA 2O7RA 4K5QA 2XMQA 3E3AA 2PSHA 2DHCA 4ARBA 2GBIA 1SCKA 1QIGA 1XZBA 4K6GA 5AKZA 3H19A 3DS8A 1HQDA 3G9TA 2ACEA 3W05A 1MAAA 2PSDA 3FVRA 4QDZA 1CUCA 3C8HA 5HFNA 3W9BA 1E8MA 1FFEA 4BRSA 1R3DA 1F0NA 2QXTA 3H0CA 4A16A 2XUOA 2PKYX 3C6BA 5A2GA 3MUNA 2XMSA 1QE3A 2PBLA 1XLVA 5CH3A 4KE9A 5FP0A 4P08A 5IVDA 5A7HA 3SWWA 3AFIA 3QYJA 2OGSA 2B4KA 2X76A 4UFPA 4BAZA 1TAHA 3R3XA 2QS9A 5A7GA 3WWEA 3PUIA 2IITA 2OCGA 1MX1A 1QO9A 2WIGA 5SYMA 1XZMA 5I7UA 3WYDA 3UUFA 5A7FA 4QDXA 5CXUA 2QOEA 1JU4A 5BWCA 1TCCA 1JJFA 3IBTA 1UFOA 4W9RA 5T4EA 4FTWA 1DQZA 3O9MA 4BVKA 4XVCA 1CUAA 1XRNA 4WY8A 4AZ0A 3CCCA 4V2IA 3F8SA 4X97A 4BVLA 5FUMA 3WKCA 5D6OA 4EZIA 1EX9A 1CUBA 1MNAA 4UBLA 3QVMA 1ODSA 1QTRA 4YPVA 4HRYA 3ZPXA 2OGTA 3DOIA 6YASA 2VJAA 3I6YA 1SCIA 1TCAA 5FOQA 4KAAA 2ECFA 3BXPA 5K3BA 1TKRA 1TIBA 5AM4A 5ALJA 1DWQA 5AJHA 2VQ6A 3OC0A 3ILSA 4EY6A 1A7UA 4B7ZA 2HFKA 3JYHA 4QWWA 1DTEA 1BN6A 1QONA 1XZGA 1LPBB 1P0PA 3IUJA 1H2YA 3WKEA 5H3HA 5EHZA 1DQYA 2HHAA 3D4LA 1F8UA 4Y2QA 4ARAA 1G42A 3G9XA 3VJKA 4DNOA 3IURA 5AKYA 5EHXA 2WHPA 2JBWA 2VJDA 1DT3A 1WM1A 2EDAA 1W6RA 1EB9A 3HEAA 4AXBA 3RLIA 4QLOA 4J0CA 2JGIA 3WZLA 1UWCA 1W4LA 3I28A 5BV7A 3I2GA 3QBJA 2WTNA 4OCZA 5CT6A 2BFNA 2BUBA 3KOOA 4Y2YA 3I6MA 4HXFB 4MWTA 3E0XA 1R4ZA 2Y6VA 1UT6A 1ACJA 3C6ZA 2WIJA 2VJBA 4GW3A 3WIOA 5AK5A 3FSGD 3DOHA 4B84A 1XQYA 3PI6A 4H7KA 1XRPA 5JD4A 1XQXA 1EH5A 1LBSA 4I19A 4PSCA 2WUFA 4QWMA 2R8BA 1QIHA 1IZ8A 2WFLB 1CUJA 1SC9A 5A62A 3FWHA 4GWLA 4RPCA 5CMLA 3PDCA 1JKMA 1Y7IA 5AIBA 4X7BA 3F9CA 5T4FA 2X5XA 5AI8A 1Q83A 2BUAA 2O2IA 1EB8A 2JEYA 3OOSA 4CG1A 2WIFA 4I4CA 4C4XA 1C7IA 1EXWA 1VKHA 1CEXA 2VEOA 2WJ6A 4L0CA 4C6HA 5AM2A 3S2ZA 2RIPA 4XIIA 1KU0A 3HLKA 4C4YA 3UUEA 2PUHA 2VAVA 3HI4A 3C5WP 3G0GA 4GI1A 4WJLA 3W06A 2WM2A 4HXEB 4X71A 4W1PA 4BCBA 2HA5A 5JAOA 3D2CA 2PSJA 4TVKA 3TGLA 4UHCA 2QM0A 5JARA 4S0XA 1MT3A 2PSFA 5J3JA 2XQKA 1JJIA 5I8PA 3V1LA 4QA9A 5ESRA 1YB7A 2JIDA 4FFVA 4LXIA 5HQ3B 1E5TA 4BP9A 4QDUA 4ZI5A 1VLQA 1CUDA 1EVEA 4Q1VA 1CQZA 1JMYA 2VTVA 5K5EA 3IUNA 1P0IA 2HA3A 1AURA 4B81A 1UK6A 1QIJA 4DIUA 2BJHA 1VXOA 4K6KA 5C8ZA 1UZAA 1YB6A 2RAUA 4JEIA 1GT6A 1THTA 2ZJFA 4DMFA 5LKRA 5DWDA 3WL8A 4ZRDA 3HJUA 2Q0XA 5AKGA 5ALFA 1DX4A 1UOQA 1SCQA 3VJMA 2B61A 5T4HA 4YASA 1ZJ4A 5AOCA 3G9UA 2OLEA 1S8OA 1PV1A 3R41A 1WB4A 3I6ZA 1B41A 5AK4A 1CUXA 4X00A 4ZV9A 4J03A 4UHDA 1OXMA 4Y2XA 1K8QA 4IHAA 2I03A 1A88A 3WL6A 4B0OA 4KACA 5K3CA 4MEAA 1N1MA 1F6WA 3IUQA 3H2GA 1QIMA 1KU6A 2PPLA 4CCYB 4JYPA 3DJYA 2WU4A 3SC2A 5JD5A 1IMJA 4N8DA 3WZMA 1CUGA 3HZOA 4DSZA 1GZ7A 1XZCA 1XQVA 1J06A 1EDEA 3CXUA 1VJ5A 3TRDA 1P0QA 4I3FA 3VVMA 3R3ZA 2JGLA 1CQWA 3QZUA 2YYSA 1BROA 4Q3OA 1QIEA 4W1RA 5JIBA 3DYIA 4GHWA 3BE8A 5AKEA 5T4BA 4BAGA 3I2IA 3DCNA 1UOOA 4G8BA 5EFZA 2IX9A 5HF6A 2V98A 3FNBA 3RKSA 2FX5A 4GECA 4BTVA 2GBGA 4UUQA 3IB3A 1MPXA 5DYTA 1THGA 1IUPA 4GLBA 4WY5A 3G0BA 4E46A 3R40A 4LXGA 2DHEA 1VA4A 2HA4A 4W1QA 3FYTA 4H7DA 5JZSA 5BOVA 2JGFA 5KBYA 1N5RA 3CCBA 3STTA 1XLUA 5LZ8A 3BIXA 4HRXA 1G4HA 1QGED 1WCYA 5JATA 4QZVA 1QLWA 3CN7A 5CW2A 3QMVA 4AO7A 3PF8A 5AI9A 5IVIA 5HKAA 2ROQA 3T4UA 5AM3A 2HL6A 1H22A 4H7JA 5ALMA 3TJMA 4FWBA 2O2HA 4FLEA 5ALOA 1AZWA 3BL8A 1RYYA 3VKFA 3WK7A 4OB7A 4RE6A 2B9VA 5DJ5A 3AIMA 3AZPA 2XUKA 1CPYA 1CUFA 2PX6A 2AJ8A 4G9EA 5AM5A 4N5IX 4X90A 4KE7A 5C81A 1ZIXA 1H2XA 5SYNA 2G5PA 4QEKA 3IUMA 2QJRA 2C0PA 2WIKA 4IH4A 1JI3A 2QVBA 3FLAA 2J3DA 4B80A 4RE5A 5JANA 1GGVA 3KSRA 4PF1A 5FXMA 3I1IA 5E4JA 4X6YA 4DM7A 5K3FB 3I2JA 2XQJA 2JGEA 4KRXA 1AX9A 5LLSA 4IH1A 7YASA 1XFDA 4J0KA 4Q34A 2ZJ7A 1EA5A 3C8DA 1QFSA 1DWPA 3DDUA 2YH2A 1XZJA 1BS9A 5ALWA 4AN0A 4OSEA 3EBLA 4J0HA 2OXEA 1ZICA 3WLAA 4KE8A 2ZYSA 3W04A 5ALHA 1WB5A 2Z3WA 5YASA 4NMWA 4GEGA 5IVKA 4PV7A 1DT5A 4OPMA 4DNPA 2XMGA 2CBGA 1VE6A 1HBJA 2WHRA 1H23A 1XZAA 2ZSIA 4Y7DA 2ES4A 4F60A 2BUCA 1AKNA 1LPNA 1GPKA 2ZJ6A 3PUHA 2NW6A 2WIDA 2GYWA 5ALPA 1CIJA 3ZWQA 4GBGA 5EIAA 1ZI6A 1XZIA 4ZGBA 1JU3A 1ISPA 1VXRA 3ESBA 1A8UA 1E89A 1WHSA 2WUGA 3D0KA 2FUKA 1K63A 1TQHA 1XKTA 3GELA 3G02A 3IDAA 3EIOA 3Q0TA 4EUSA 5LIPA 5LZ9A 5HF5A 1B6GA 4OYLA 2YXPX 1IZ7A 2XMDA 1ZD4A 5ALQA 4X6XA 1IUNA 3ZLVA 3S8YA 3O4GA 4H7IA 5HCUA 1KEZA 4EY8A 3H04A 3DKKA 4P9NA 2Y1KA 3B12A 2XUIA 1G66A 3O4IA 1MX5A 5ALYA 2XUAA 1QTIA 5HKBA 4DLNA 4DTCA 4UBJA 2D5LA 2WG1A 4ZWNA 2PSEA 3B3QA 1AC5A 1XQWA 4JNCA 2XT0A 5LZ2A 3PF9A 1O6GA 5HF8A 2IIVA 4INZA 3C43A 4J0IA 4FLFA 3D7RA 5KWIA 5ALXA 1X2BA 3WIBA 4B6GA 2HIHA 1MNQA 4MQMA 5IH7A 3WWOA 4BE9A 1QIIA 5FDFA 2V96A 5JZ9A 3DQZA 3AIOA 3P2MA 1T2NA 1LPOA 3O9VA 4RGYA 2HU8A 1U2EA 4U2GA 3ZI7A 4BAUA 2QJWA 2QMQA 3WA7A 5CH8A 3NUZA 4H18A 4J0GA 3EF3A 1MX9A 1WPRA 1MO2A 3FYUB 1CUUA 2WLSA 3R0VA 3BJRA 4OYYA 4B85A 3QPDA 2VT7A 4DNQA 4J3JA 4Y2TA 4Q05A 2EDCA 1HDEA 1X70A 2BGNA 1GXSA 1HKHA 3H17A 1ZGBA 4QDTA 1WOMA 4MYSA 1LZLA 3WA6A 1Z68A 1EK1A 4B0PA 2XUFA 3A2NA 5DTIA 4MYDA 2J4CA 3H2KA 4YK7A 1YS1X 2WQZA 4BB0A 3QPCA 3V1MA 5CXXA 3IVMA 2JEZA 4MXDA 2H7YA 3G7NA 4H7EA 3L1HA 3C5VA 1E8DA 1GQRA 1QIKA 2DQYA 4DGQA 3W2TA 2HU5A 4C87A 1XRRA 3JW8A 5AI0A 4OB8A 5LZ5A 3NWOA 3HYSA 2HA7A 3VJLA 2VA9A 1LGYA 2HA0A 1Y7HA 2V9ZA 5AKKA 2CKMA 5AKLA 1F0PA 3ZLTA 2XLCA 3H1BA 5AM1A 1ORWA 2C4HA 1JMKC 1AUOA 1ETHA 1J1IA 4CG3A 4DMCA 3GZJA 4AO8A 5C8XA 2AJDA 4E11A 1QIFA 4G1FA 2W6CX 3AJAA 1BE0A 5K3EA 5EGNA 4K6HA 4CCYA 2GBCA 5FLKA 3A2LA 4H77A 2XMCA 3ESCA 4G5XA 2RI6A 3RM3A 4JUIA 2DQZA 1FSSA 2OQIA 4WFKA 3K9BA 5FPPA 2XQFA 1LPPA 2AJCA 5JYCA 5DYWA 2C5GA 2CB9A 4G8DA 1C7JA 1U4NA 1VE7A 2GZSA 3CN9A 5LZ4A 1CUEA 2CUTA 2ZVDA 1ORVA 2ZYHA 5E2IA 1W1IA 1ZI8A 2I3DA 5HFAA 3AZQA 2HA2A 3ZV7A 4GDMA 3MGAA 5AM0A 3OPMA 2HFJA 1CVLA 1EINA 1MN6A 2WHQA 4AB1A 4UFNA 1M33A 5ISMA 2XUHA 3LIPA 4X6UA 4J0DA 3IIIA 4LXHA 3VXKA 4UHHA 2ZYIA 3STYA 3FVTA 1XRLA 2WKWA 4G4GA 4B83A 3OM8A 4BCCA 4WDRA 3DL4A 4CG2A 3C6YA 1HL7A 3A2MA 4LKOA 1AGYA 2FJPA 2D0DA 2OCIA 2DR0A 3U0VA 4X95A 4KR0A 1H2WA 5D3ZA 2P8SA 4FHZA 1FFCA 1CUSA 2AXEA 4U2EA 5JALA 3FLEA 4QLAA 5ALZA 1ODTC 5JAPA 3AIKA 1K4YA 5EIEA 3F98A 1YR2A 3AILA 4UHFA 3WKAA 4N5HX 5AOAA 4YX9A 4D9JA 3OURA 3DEAA 1VZ3A 4UHBA 2XE4A 1R9NA 3V48A 4U2FA 3WK5A 2QXUA 1LPAB 4OU5A 3RARA 4BZZA 4X92A 4E14A 4A23A 5AO9A 1SOMA 3BDIA 2VAXA 2PM8A 3LP5A 1RP1A 2VSQA 4W63A 2BCEA 3DL7A 3F67A 3ED1A 3HC7A 3N0TA 5I9IA 2JGJA 4J7AA 4U2BA 1H2ZA 5DNWA 5ALEA 5FKJA 3WMRA 2AJBA 2QTBA 5C8VA 1FFAA 1CLEA 2Z3ZA 4MJ3A 4RNCA 2DFPA 1JT2A 5ALTA 3PE6A 5JAUA 2I3ZA 3T52A 4B82A 3VVLA 4C88A 3WI7A 3M81A 3E4DA 5JASA 1EK2A 3FAKA 1FJ2A 3PFCA 4Y2UA 4UBNA 1W52X 4OB6A 4QE3A 3A6ZA 4BDSA 4M0MA 1CUHA 2CJPA 2RGUA 3VDXA 1VA5A 4LHEA 1E8NA 3AZOA 2XDWA 4Q3KA 4Y2SA 2XI4A 1ZD2P 3FCXA 4X85A 4XWGA 4Y2RA 4CFSA 5LZ7A 2HADA 2XMBA 4BTLA 4EY4A 1XZLA 5AIAA 3V9AA 4CI9A 2QUAA 2Y2UA 3PFBA 1GKKA 4UBIA 1K6EA 1UKCA 2C58A 1UKBA 3GBSA 1YA8A 4BE4A 1QOZA 4E15A 2V97A 4BBZA 4CIBA 1XRMA 5CURA 3FLBA 4F5ZA 4ROTA 3KD2A 3HABA 2BGRA 2XQIA 2WFMA 1BEZA 4A5SA 3PICA 1CUVA 5AKJA 3I2KA 3WL7A 2HA6A 3G0CA 1AMNA 3STWA 4BC1A 3WJ1A 5CT9A 3HACA 4AZ3A 3DNMA 1A8SA 3ANSA 3L1IA 4F0JA 1DWOA 2WILA 1LPSA 5EHQA 4O08A 4EBBA 5DNUA 2CZQA 1K5PA 1IVYA 3D3NA 4JYMA 3H2JA 5ALSA 3A70A 4ZXFA 2GYUA 3STVA 5EI5A 3SX4A 3BDVA 3H2IA 1BRTA 2QUBA 5CRIA 1LNSA 1YS2X 1D07A 2OPHA 5DLPA 1PFQA 3BIWA 2XMZA 4ETWA 4FBMA 4P92A 4H7HA 1GQSA 4X3CA 1BN7A 1Y37A 3FSGA 4ITVA 2VJCA 1W75A 4PW0A 1LZKA 5A6VA 5A71A 3QMMA 1XROA 2DSNA 1EDDA 2GBFA 2WJ3A 2GYVA 4Y9SA 5LYYA 2UZ0A 2ONCA 3WL5A 3WWCA 3BWXA 2HU7A 3EQ8A 4NVRA 3QH4A 1CUIA 3FBWA 5DTJA 3R3YA 5AOBA 2ORYA 2RHWA 3KXPA 3WQHA 1QO7A 4N8EA 5LP1A 4KAJA 4OUKX 1NU8A 1WPXA 3X3HA 3L1JA 3D5EA 1UKAA 1CR6A 3ESAA 3Q8WA 4XJVA 1X2EA 3DYVA 4GXNA 1MTZA 1XZKA 3WYNA 4C4ZA 2HRQA 2WTMA 3M3DA 1Q0ZA 4WCVA 3N2ZB 2ZYRA 2XUGA 1J2EA 1N5MA 1CUYA 4ZREA 1YA4A 1C4XA 3VISA 3I2FA 1AQLA 1UK8A 4FKBA 1MAHA 4KYVA 5AKHA 1BCRA 3IA2A 3V1NA 4G9GA 4C01A 1R50A 2DHDA 3O95A 1XKLA 3LIIA 2DCMA 4KAFA 3C70A 2G5TA 4BATA 4CIAA 5AK3A 3LLCA 5JADA 1A8QA 1ZIYA 4FBLA 3WK4A 1EVQA 2WSLA 3HRHA 2QT9A 3GUUA 4PNZA 3G0IA 5FPQA 4AMYA 3BJMA 1U8EA 3WK8A 5F4ZA 1CV2A 1EHYA 3QM1A 2ZSHA 3KWJA 4L72A 1XZDA 3E1GA 2XUPA 3UMJA 2YASA 2C0QA 1NU6A 3NGMA 4PSUA 4BRZA 3GROA 3RK4A 3K6KA 1EI9A 5DYYA 5HF9A 4H35A 1TCBA 4MEBA 2WHPB 3DKRA 3TEJA 2C7BA 1ZOIA 3D2BA 3G0DA 4AO6A 4L9AA 4BC0A 5AHXA 5FRDA 2X8BA 3F97A 2JF0A 4UFOA 4FMPA 1E66A 1UK9A 1UOPA 5AI5A 1XZHA 3V1KA 3KDAA 3R3UA 2BAGA 5JAHA 4HXGA 3WK6A 3NOXA 2OAEA 1W76A 4X94A 5C7YA 4DMHA 1PJAA 4LYEA 1FFDA 4LIPD 1ODCA 5AH0A 4H0CA 5AICA 3M83A 3QPAA 1L7QA 4Z49A 3YASA 4AMZA 3LCRA 2H7CA 3QMWA 4BDTA 3WJ2A 3C45A 1ACLA 4QNNA 5AK6A 5IKXA 1GKLA 4EY5A 3U1TA 4W1SA 5ALGA 4KEAA 2GZRA 3JWEA 4EHBA 2QKYA 2PVSA 4NS4A 4BZWA 2HDWA 2H7XA 4QDOA 3ICWA 4X91A 1MJ5A 1USWA 4PQEA 1E3QA 2JGMA 2O7VA 1ZJ5A 4PSDA 1DU4A 3MVEA 4DSAA 4HTAA 2EEPA 3OTQA 1N8SA 5CT4A 2OCLA 3BF7A 5ALNA 1XLWA 3STXA 4UBMA 1P0MA 1HPLA 4P93A 2OG1A 4HZGA 3ICVA 2XUQA 3MUOA 4MQLA 2FJ0A 5ALDA 1R9MA 2JGKA 1RWQA 3C87A 4N8SA 5AI4A 5IVHA 5ALIA 2Z8ZA 2XMRA 4UBKA 4HVTA 4IH9A 2XUDA 1DX6A 4AN1A 4AQDA 2R11A 1R1DA 2CMFA 1XZFA 2VF2A 3FYUC 4WFIA 5HZGA 2RHTA 2XQGA 3R3WA 3ANTA 1CUZA 1ZD5A 5AKXA 2WG2A 4G4IA 5HQ3A 1U65A 5ALRA 1I6WA 4ZV7A 1WB6A 4K2AA 2QRUA 4LYDA 1UK7A 1Q84A 4J0JA 4KJXA 2XLBA 2RONA 4BP8A 1LPMA 4BYMA 1QFMA 3EQ9A 1YCDA 4U2DA
chains in the Genus database with same CATH superfamily
3T3GA 4GX0A 4M1TA 3RE1A 1OLXB 2YJ4A 3ZLUA 4C7KA 1BU8A 1ECBA 3T3PB 5H4GA 1NVMB 1VJGA 5JQWA 4IIUA 3FF1A 1W36D 2A0FA 3D59A 3EXIA 3JD2A 3W6ZA 4OI0A 4DTIA 3GVPA 3AF1A 4HAWA 5FYQA 1F3LA 3RB8A 5AKIA 3C3MA 4WJKB 2PR2A 3LH5A 3NHWA 3WDLA 4DSTA 3M5CA 5KYTA 5CX1B 3TQTA 5F12A 2H1IA 3B1VA 1OB2A 2YYZA 4Z4CA 5JT1A 5AVYA 2A58A 5CJ2A 4X1OA 3AY3A 1YULA 2IF2A 3PQ7A 2WJ4A 2FW9A 4BJ5A 1ENZA 1FU4A 2NLOA 1SBNE 1JZTA 1AGPA 3QJGA 5JFTA 3OP4A 2QNIA 5BSUA 4FIZA 3OG9A 4BYGA 1X1TA 5A5EA 2FFQA 2QW8A 3KYIB 3CRRA 4TLAA 3L5KA 4EPXA 2BN4A 2PWBA 2FSUA 3C8ZA 3H13A 1SIUA 4KLCA 1IG0A 3J80A 1N9GB 5AVXA 2HSGA 2UVPA 4TLEA 3WGMA 3AHDA 4MDYA 3L2OB 3OE7A 1P72A 1ZS9A 3CONA 4JROA 4PLCA 5HE8A 3WGGA 3L01A 4JH0A 4MYCA 1JEQA 4FQ7A 5D87A 4DV1B 5K3DA 1LTKA 3SEZA 3QITA 3B5EA 3PIRA 4V39A 3O0DA 1DC7A 2VRNA 4HSEA 1UPFA 2HIAA 4MVYA 3TKLA 4JCCA 4BNWA 3PXEA 1UAYA 3E5RA 3PJDA 5F2KA 4J8PA 1V4VA 2D74A 3DBRB 5ECYA 1KSGA 2AWNA 1O97C 2HSZA 1N6NA 3V2UA 4UTZA 4AI6A 4QHTA 4F91B 2AB0A 3DD5A 2OGZA 1PWXA 4M0EA 4RXUA 2ZUFA 1CJCA 1G0OA 5FLXA 4CCAA 1PDWA 3FYUA 1G2PA 5LP6A 1T6YA 2O8CA 3ROXA 3SYLA 3W9YA 3UY4A 1L8AA 3I9NA 5IXSA 3BCSA 3BB1A 3MELA 3I34X 3HB0A 1T0IA 2F43B 4MGYR 2HGZA 2VJNA 1RPJA 3G13A 4MICA 4XX1A 1R74A 1DEHA 3TEMA 4FMDF 4O2LA 1W5EA 1J99A 4MARA 2PD4A 3AL2A 5K3FA 4NBTA 1H2HA 3EXFB 5JV5A 4I9NA 4N3NA 4YQEA 5JO9A 2BI4A 1SC4A 1Z5NA 4HDAA 1H85A 3JYNA 1HE4A 2CLLB 1M8KA 3X1DA 2HMYB 2YVLA 1U2ZA 3RTCA 3DHNA 4HNRA 3X43A 1SFRA 4M87A 3JVIA 2C9BA 2YWGA 3PK0A 3IBFA 3S3TA 3AJRA 4IJ5A 3GT4A 1XCMA 3L84A 5IK2A 4IL5A 3CJRA 4GMDA 4C22A 5JYEA 5LKAA 4BWGA 1EWVA 2QVCA 1HDRA 4Y2PA 2ID8A 4D74A 2YIDA 2J85A 1C7FA 5D7BA 2EQAA 1EFDN 3EQ2A 3LA8A 1NI4B 3QOFA 4ENRA 2IYOA 3QXCA 5A5DA 1QNLA 1BFUA 2FPXA 1ODLA 2F3UA 2VT6A 5LUBA 3SSNA 3KKMA 4ZC8A 3V6MA 3MJRA 2HF8A 1XZEA 3JR7A 3O4JA 3QX8A 5A1JA 3ZK7A 3WWDA 3BILA 2PKRA 2V7WA 3NHPA 1G41A 1B7GO 4OQYA 5AJXA 5EJ4A 5BYKA 1W6UA 2X0DA 3S2YA 1EX1A 4DNFA 3PPVA 1PFUA 1DELA 1CE8B 2FN4A 1AKMA 1VC2A 3OJCA 3QGMA 4AZWA 1OX6A 4CLOB 4YHBA 5B58C 1HT3A 4DRXB 1IAVA 1UMKA 3KVNA 4OMCA 4FOLA 3GLGB 2PUDA 3R7BA 2DE0X 4HDNA 3CX3A 5HTKA 4YUYA 2OKCA 2PVPA 3V7NA 4TGLA 1U90A 5ALUA 2BFAA 3SQWA 2R00A 1VI2A 3AP1A 3THXA 1DC4A 2W83A 4HDQB 4EHKA 3BC1A 2G0AA 3I5XA 2XB6A 1OCEA 3ORRA 5TQ0B 2XEDA 4OU4A 5K3SA 2Y93A 1Q0RA 5C35A 2VYQA 3GLHA 1ESMA 1Z36A 3ZHVA 4KQ2A 5CFMA 1P5HA 3EGXB 4P33A 3EUFA 2YWJA 4GH5A 3CKYA 4BLWA 1YCGA 2Y1DA 3QVXA 1E1QA 1QCDA 4LYHA 4W5WA 4YP9A 5UKDA 3ZJ5A 3FPGA 1LF0A 4RLQA 4WEQA 2FMTA 5H5JA 3GEEA 2Q62A 3JD3A 4JB8A 4JYBA 1QE5A 2W2MA 1NJ6A 4Y2HA 4Q9LA 1OLXA 3QPBA 1XD2A 2OZLA 4C1BA 1E4VA 1BCSA 1XAIA 1Y3HA 4Y9UA 1XDGA 4EHAA 1KS9A 1SZDA 1FTGA 2ZIVB 3OT4A 2WFZA 2OP1A 4KXYA 5JLJA 4WCFC 3NXSA 3TB6A 1EUCB 1SQSA 2FWIA 2NTJA 4TWBA 5LDHA 1RQ7A 2AH5A 2VP3A 3T15A 5BORA 2AA3A 5KNDD 3ROEA 4RL4A 2DFVA 3E7DA 3DDZX 3HCAA 4HFMA 5JBNA 1Y6FA 3OKFA 1LCIA 4EW1A 1IEXA 5K7SA 2OB1A 5TEWA 3NNNA 4U2CA 4QFMA 4IO0A 3FTQA 3E7XA 3G3EA 3L0SA 4OKIA 1DUSA 1T9GS 3PFNA 121PA 2QRJA 3RF7A 4Z54A 5LM3A 1SXQA 1CRLA 1E4EA 1T9HA 1KO1A 3CZQA 4MWZA 5CA0F 4JI4B 3OF2A 2WUDA 2ARKA 3O26A 1DIGA 1KWKA 3BF8A 2IVZA 2OECA 4OA8A 2P9YA 1YUMA 1GPNA 2LR0A 2OQ2A 1X7YB 1AQIA 1Y1PA 2P9HA 3NIDB 5TPZD 5FV4A 3Q7QA 5EMNA 5BNWA 1QJ4A 1ZN7A 2SECE 1TRHA 2PL1A 4QU9A 1NAHA 2ZBGA 3UJ9A 5E4TA 1VDMA 3FDXA 4W5QA 2HRRA 1IAQA 1OILA 3GPBA 2QTRA 4RMNA 2Z2XA 4WQMA 2HHHB 5JNLA 4RO0A 5CYPA 1H2BA 2YWFA 3QK7A 5B58T 4UPDA 1F2UA 1R0WA 1YZ3A 3B3FA 1P31A 4Q7JB 4LF7B 4L08A 3CRVA 4ITUA 4BX8A 1GPJA 4RMJA 1E3MA 2C7GA 1HLFA 3KSMA 3OLYA 4M7RA 3IUYA 2CJWA 2GGSA 3B2QA 4RFSB 5IAKA 1VZ2A 2AXNA 2Y6UA 2GRAA 1QFXA 1IHDA 4KXWA 1DV1A 2H8GA 3I6BA 3MOGA 5C34B 5BYAA 3C6XA 3TUJC 4RVCA 1OHHD 1EUCA 1HDXA 1W30A 3BGVA 4MLCA 3ZWBA 1XG5A 5AD1A 1E77A 1JG6A 4UVGA 4XD7A 5JMWA 1N2JA 4B4OA 1B8UA 1HUQA 4G5OA 1Z0JA 3MWDB 3PGJA 3F4LA 1ZI9A 4K1LA 4MV4A 1XRSB 4V0LA 5JD6A 4RIEA 4JJEA 1UBOS 3LAWA 1D2RA 3BJEA 4G0XA 3FZYA 5AI6A 4ZU1X 1R0YA 2JANA 3RSOA 5CD1A 4KR7A 1EZZA 1X7GA 3H2HA 1HE2A 1BWQA 1EFCA 3A4MA 6NULA 4REMA 1XZNA 2SKDA 1I36A 4NENB 4ZAVA 2H52A 4AXXA 5DBIA 1IFXA 3EQ7A 2W6ZA 2LVBA 2PJZA 2J87A 2ZRLA 1V95A 1DJPA 2BDEA 3AR7A 4L95C 4URZR 4ZOCA 3OOWA 1I51A 5E95A 3HZRA 3JQBA 1SHLA 1U31A 3WK9A 3F4KA 4YRSA 6REQA 2QE7D 3ZEIA 1NVTA 1GCIA 1P5JA 1SQ6A 2QGFA 3HEMA 4MWSA 2PU7A 2H2HA 5GADl 5HZKA 1RAEA 2BV3A 2XOXA 3C3BA 3DTVB 2PFSA 4BOYA 3QEAZ 2JD2A 1NUAA 1TAQA 2XMQA 3E3AA 4BO0A 5CVTA 2PSHA 5BSEA 1OASA 1IY9A 4PC1A 4UTOA 2ZVPX 3GUVA 3TTYA 1UBRS 1NR1A 1WBJB 4HB3A 2PZJA 3TQFA 4NAVA 3NHYA 5GV7A 1Y9DA 3HVJA 4DA8A 1Z62A 3NHLA 5G4KB 3ET4A 1GXSB 3JALB 3KE9A 5DP2A 5SZKB 2VTBB 4MB0A 4N01A 4FNAA 2IYFA 4NPAA 4FCTA 3H19A 4DS3A 1U8UA 2A7XA 1CB0A 1EBFA 1T9GR 1PLLA 1HQDA 2C88A 4IDBA 5EHIA 1I3NA 2YFKA 3EFOA 5K51A 3O4RA 4CR7A 2ZUBA 4K05A 1Z63A 3ILYA 4ZQEA 3EDMA 4QDZA 4UM9D 4M0DA 4B4WA 3EIWA 3NCHA 1CUCA 4QGHA 4X8LA 3WTBA 2FK8A 1XN4A 2Q0HA 3LUAA 1PU2A 3LY7A 4K88A 5HFNA 4F9TA 3UV7A 1RQ2A 5J2UA 3JQPA 1D8TA 5CLFA 2IFTA 3WB0A 4B35A 1IL0A 3NC4A 3TCKA 2ZIXA 1GRRA 3FSJX 2CNWD 4KN9S 4NOKA 2QJFA 3PC8A 2JAXA 1U7HA 4I50A 3BPSA 4NE7A 3S1SA 3TLYA 4JKOA 3AEUB 4K6CA 5GMOA 5KB3A 5JLAA 2Q1SA 3MCAA 2QRKA 4I1SA 1OKKD 5J2UF 4K7JA 4J9VA 2XMSA 4N9WA 3KE8A 5E7JA 4NEHB 1VHWA 1QE3A 1V39A 3GRZA 5FPYA 2C59A 1HT2E 3BMQB 4RY9A 3EMBA 3D1VA 1WUIS 3JVDA 1YRWA 1OFVA 2P77A 4ZQBA 4CM8B 4P08A 5A7HA 1ZUNA 4TS4A 2G9RA 2JAWA 3AFIA 5F5NA 2FVXA 1Z35A 1CR4A 3UFBA 5ITSA 2B4KA 1KK0A 1K08A 5FPTA 3T5MA 3N0VA 2DHRA 2EQ5A 1M66A 3PEEA 4EO9A 3LBHA 1G7TA 2WJPA 3P0IA 4FNOA 2DHQA 4FYWA 4IDNA 3BBPA 3L0ZA 4L78A 3HDVA 4AECA 3L6BA 5JWHA 4QOGA 4NE2A 1ZVJA 5TSDA 1JQBA 1OZFA 1SO8A 1NBIA 1EQUA 1P9RA 1Q15A 3U3JA 1R0CA 3OE4A 1I1OA 2J32A 3LTEA 3IYLW 4M9SA 1F5NA 5G02A 4MCIA 4EP1A 1XEXA 5B6PA 4TTAA 4GGMX 4LGYA 4EUEA 3FDIA 2QRHA 4JUFA 2C5BA 4DSNA 3AXSA 4RAQA 2W2QA 4DANA 3V33A 1J20A 1UR5A 2E4UA 5DN9A 2DWOA 5SYMA 1C50A 1XZMA 3HU2A 4TKVB 3UV6A 3VR5A 5D00A 5I7UA 3QF7A 3NI2A 4XYGA 2R97A 3HHPA 1YBVA 2ZKLA 1CYDA 1XWWA 2QOEA 4ZCPA 3ENKA 4US2R 3MCZA 4L3OA 3KOXA 1JJFA 1C2TA 1JI0A 4IGFA 3WHLA 2J67A 3ND8A 4LJRA 3VOTA 4C0WA 2D2EA 5JISA 2Z6UA 4BVKA 1UDAA 3IDFA 4Z4QA 4XVCA 1P0FA 3FRJA 3TUZC 2AC4A 2IF0A 3TSCA 5HIJA 4BUZA 1GDTA 2GB4A 4V2IA 4FYJA 5G53C 3WKCA 3V4ZA 3IUEA 4EZIA 1LW7A 4HUQA 4ZO8A 4ZK2A 1LDMA 1PDOA 1Q6ZA 3DAPA 4UE2A 2V0GA 4NMHA 4R6XA 1QQ7A 1UPCA 3CY6A 3QVMA 2QSUA 4KP7A 1WA5A 2QUHA 2DKFA 3D8RA 2FR0A 4M36A 3VPCA 3ZBTA 3ZJYA 1KVRA 4TX1A 2RB5A 4RCYA 4YPVA 4J4TA 4MV9A 1C4WA 5DGCA 3U44A 3UHPA 2REQB 1GRQA 1NW3A 2H11A 2OGTA 1QVZA 3OE1A 4HYQA 1R12A 4PX9A 4B17A 3I83A 3RUHA 4PHGA 1KQPA 2YS6A 3JZIA 3HCWA 3TLAA 5MN6A 2P4UA 2PLWA 3CH5A 1NNUA 1SCIA 3V4LA 1YQEA 1KK2A 1PFVA 1M2FA 1Q6YA 4KX5A 5AVKA 4C30A 5FOQA 1UMCA 1U3UA 4TRNA 1AUVA 3KBBA 3WRWA 1CQIA 2NPOA 1QKIA 1YZKA 2CY0A 2GJKA 1HE3A 1XC7A 2UZ3A 3IP7A 2QN7A 3LWZA 1ACMA 3ZD8A 4AMVA 3U6KA 3R7DA 3QUCA 2H06A 3OPYA 4G0MA 4EBFA 4GYKA 3V7UA 5JYBA 2JLWA 5EJGA 1SELA 2VUHB 2PT7A 2FMKA 4LW8A 2OESA 4U39A 3H5LA 2PHZA 4F04A 3R75A 4HH3C 2VF7A 4CIYA 1SG0A 4E30A 1N2CA 1CQJB 3SPXA 3L8DA 4M38A 1BMFD 1V25A 3RS8A 2HFKA 3GCDA 2A1UB 4FSXA 5ARDA 2WKRA 4JUBA 3LZCA 1LPBB 2GM9A 2ZE6A 1KZ6A 1AU9A 3EBOA 2RJ3A 3IUJA 4LRSB 2YUIA 5H8WA 4L07A 1FLAA 2EFGA 1S1CA 3GRAA 4Q6BA 3TKYA 1U2SA 1KR5A 2LXNA 5ANRB 4FJ2A 1DDIA 1UBSB 2JATA 2NUTB 3S6JA 5H3HA 1RZUA 5EHZA 1DQYA 2HHAA 3D4LA 3OH8A 2IXFA 2VK4A 5FHRA 4B75A 3UBMA 1G42A 3U7JA 5KTPA 2OXTA 2R6GA 3G9XA 2A4MA 5BPHA 1KSFX 2XODA 4PZLA 2V1XA 3TRFA 1O9BA 5FTJA 1PN3A 1FYXA 1ECFA 2VYCA 5IULC 2WHPA 1PJLA 2Q28A 2E37A 3KKZA 4N5MA 1DT3A 3MWYW 4V1CB 3HPQA 1Y1SA 1LLCA 3UAYA 4RDCA 4UEQA 4NAHA 4XYEA 4JZKA 2BR4A 4BGVA 1D2NA 1VSVA 1T3LA 2JGIA 4J0CA 5CP8A 4E5MA 1ISIA 1E79A 4ZHQB 2X42A 4I50B 3I28A 4WXMA 5BV7A 3W2EA 5JJIA 3I2GA 3QBJA 2PMBA 1GCGA 3FHOA 3KB6A 3NO4A 1VCIA 1Y1TA 2BH9A 4OCZA 1M76A 5GAJA 5K0NA 2QGZA 4IIVA 1GQYA 1R00A 1KE1A 2BFNA 3B70A 3N2GB 4H16A 1O2DA 5C31A 1YR8A 4IOKA 3KTOA 1LS6A 4QUHA 1CLUA 1M6NA 1TZCA 5DM0A 2XH8A 4B4KA 3ISTA 3NDPA 2QLFA 4ZT4A 1P17A 3T1QA 5TVGA 2ERYA 1VIDA 2AZTA 3E0XA 4GVPA 4B73A 1PJ3A 1POWA 1Q7TA 1Z45A 2PWYA 4WKOA 4WUTA 2Y6VA 3DULA 4Y0AA 5F1PA 5CB4A 2ZUSA 5BVHB 2VJBA 2R25B 1OWPA 4KOAA 3WIOA 1FIUA 2C8JA 1A5ZA 2XCOA 2KLHA 3FSGD 2ZCVA 1PG2A 3PI6A 4WPGA 5IM5A 1KZHA 1VPWA 4H7KA 2VPTA 3VU3A 1XRPA 2O2JA 3ZH9B 4EGQA 5JD4A 1GPH1 1XQXA 5A3VA 4XGNA 4I19A 3QIVA 1BX0A 3GH3A 4PSCA 5G0WA 2WUFA 4WK0B 4HEA1 1QE0A 4RVGA 4UTXA 1EWKA 1KXZA 2R8BA 1SURA 1ZSVA 1QIHA 4H9GA 2EP5A 3TQCA 1CUJA 3X44A 4CL2A 3HXLA 1E60A 4MCJA 1A5SB 4DPMA 521PA 3GRCA 1CDEA 4FR5A 4H4EA 4YCDA 1ZY2A 2I55A 3LX4A 4C4OA 1A5BB 4PANA 3RFTA 2OCAA 3IKVA 1HC7A 5AYVA 1U94A 1LU9A 2I8AA 3D7KA 1I01A 3JZAA 1CVIA 1DEXA 1FFGA 3PXCX 1T1RA 5EE3A 1Y1RA 4LJ5A 1R5NA 3L40A 4CNQA 4NCXA 2GAOA 1OAAA 2QTLA 3KKNA 4X9XA 4PO9A 5AHRA 2ZS9A 5B5SA 2WYVA 4PN3A 1E5XA 1OFTA 3O1JC 1ZC4A 3GAFA 1L8OA 3K9QO 1Q83A 4JUAA 4F5WA 2X1MA 3K9HA 4EG1A 1Q12A 4CT4B 3U7FB 3C6KA 3TLKA 4DCNA 4Q66C 4AYTA 4B48A 2UXCB 3VV2A 1XEWY 2JEYA 3NORA 5FL7D 4XW2A 1TUGA 2HSJA 2AXQA 3UMSA 1FUIA 3TZBA 5CDGA 1CY1A 3OFNA 5JEEA 3UJHA 3A8TA 4XQ0A 1C7IA 3ZXXA 1CEXA 4RAOA 4RSRA 2VL7A 1OU0A 3ZHXA 3IO5A 5AW5A 1WQ1R 3U3RA 3WNVA 1MXHA 1L5HB 1PJRA 2VHWA 4WZAB 3A9TA 4P22A 5T41A 1G6HA 1TYZA 4WAUA 3TE6A 5AM2A 3O90A 2P5SA 2G9UA 4K8OA 4EDFA 2XYRA 4JZYA 1RKXA 1C8LA 1GL9B 2JCYA 2JFGA 2WSYB 3E4CA 2PBRA 1N1DA 3V3TA 2IOYA 4C4YA 3UJCA 3PDIA 3VR3D 1XTPA 1WXDA 2GLTA 1XB2A 3CX7A 3HI4A 5EIBC 4J75A 3WLFA 4FS3A 4UU8A 3IQIX 3LP8A 3NM5A 3BWEA 3FJYA 2WV9A 4XVQA 3IODA 3TD9A 3GO4A 4GSYA 4L3VA 4PS0A 3RYFB 2PYZA 1HE1C 2WM2A 2ZRAA 3GFBA 4HXEB 1OR8A 3VR6H 1M8PA 1WUHS 1VPDA 4MHTA 4HS4A 2ZIWB 4W1PA 1N7IA 4XX0A 3P9SA 4RCZA 4A73A 4OLHA 2HA5A 4BLPA 2FMUA 5K1ZA 5KQSA 4P3XA 1GVNB 2ZT6A 4CLRA 2E4WA 3PPXA 2NU7B 4HWOA 1D04A 1IPEA 2YJ5A 1ATIA 4RGQA 1MT3A 4J1NA 1F8YA 3GRVA 4S0XA 2PSFA 1S02A 1E59A 4R5HA 1NE7A 5EWLB 2XQKA 1JJIA 5I8PA 3R7NA 3PHBE 5ESRA 1YB7A 3V1LA 4YV2A 5KQGA 1NT2A 2B36A 5HQ3B 2D7JA 3KQOA 4UUBA 5L45A 1AO0A 3KKEA 4F1JA 5CK4A 4XD7D 5LOVF 4DR2B 1TA4A 2HJVA 2JJ8A 2O6HA 4P80A 1I4OA 2JGRA 2ENUA 3QBDA 4YAFA 5EXSA 1CUDA 5MF6A 2WF8A 1SB9A 5REQA 5I5EA 3WX0A 4KUEA 3ZXSA 3AQIA 1CQZA 4X8OA 4P3KA 5BR1A 5K5EA 2ODBA 2CXOA 4ETIA 1PGPA 3IUNA 1I6MA 1Y6ZA 1WXWA 2J5KA 2FVYA 4WLNA 1IVNA 4DR3B 1T4BA 1QGZA 2WP8J 3INRA 1UWKA 4FFLA 1AURA 4M37A 2V7BA 3D1LA 3I4LA 4NHEA 3P2KA 3HN6A 2BFMA 4JVNA 1UJ2A 5FR1A 3ZZUA 4ESHA 4GKVA 5DM4A 5LPNA 1U0RA 3KR9A 1EVLA 3QUQA 1ZL0A 2B8NA 2OMKA 3IIEA 1HTTA 1RI5A 2GR9A 4QECA 2ZR9A 2RJNA 4MWOA 5NULA 3ZLBA 4OMFG 4D4GA 2RAUA 4F1WA 7AT1A 2ZJFA 4PZDA 3TL2A 1R4NA 5LKRA 2GEUA 1AKQA 5DWDA 1SRRA 2CJWB 2JAPA 2AKEA 1J1UA 4CR6A 4QVIA 5AKGA 2BCGY 2AOUA 2G25A 4HDSB 3K0AB 5ALFA 3VSCA 5IWAB 1YZHA 1RLTA 4K03A 5BN1A 2QAGA 3VJMA 3ZIAD 5A3RA 4ZA2A 5KQPA 1JNYA 1KMIY 4H6WA 4QASA 5ICFA 5KC9A 1ID8A 1ZJ4A 2AT1A 4OAOA 5EESA 5D5QA 5AOCA 3NBAA 3G9UA 5ENVA 5KIAA 2WWYA 4IIJA 3WL3A 1ADGA 2ZATA 1PV1A 4M1KA 1IWBB 5FX2A 3OSZA 4LHZA 4QNMA 3WSTA 2BTQA 2H5IA 1QP4A 2QTHA 4F4CA 4BS9A 4EMSA 4MCHA 5LQKA 2HXYA 1XHLA 3GJSA 4WWHA 3QEOA 3EK2A 3GRPA 2PZ8A 2HRCA 2Y0DA 4QUIA 2BCJQ 1NFQA 2HNBA 4NU5A 3R7WB 4CIVA 4UHDA 2RSLA 2EERA 4OL0A 4Y2XA 5CGZA 1RNLA 3TOSA 3W5JA 1SKBA 1WMSA 2A9RA 1P4HA 1KQNA 3T4PA 4AKEA 3WL6A 3COPA 4XUEA 4V0NA 1QFYA 2HZBA 2W37A 3OCVA 4KACA 5EZQA 4LXTA 1CY8A 3HXOA 1SU7A 3ROGA 2I4IA 2ZBUA 5J5VA 3B6JA 1Y7TA 1O95A 1KORA 3OOYA 1F6WA 3IUQA 4N0MA 1L9XA 3H2GA 1F60A 2DQSA 5K4HA 2QI9F 3M34A 1KU6A 1L3BA 3HFRA 2RGCA 3HLTA 1KI4A 3IQHX 3JCZA 3OD5A 4LV5B 4WY2A 3PLAE 3GRKA 3UJ6A 3MPUA 1VE9A 1IOLA 1O96A 1VB5A 2WU4A 1BRMA 2YYYA 4GPTA 1IMJA 1EUDA 2FU5C 2XADA 5EJ2A 3KQNA 4BY9E 3CX8A 3S81A 4WZ6A 4Q1AA 4ZAFA 2YW9A 1RZ3A 2AEJA 2ZIUB 1HETA 1L5OA 3UK0A 4D5GA 2Z3VA 1GZ7A 1WP4A 1XVVA 2PKQP 1MIOA 2NTEA 3KRTA 3L8GA 5FOWA 1XQVA 3KQSA 5BQFA 3CGGA 1EDEA 1Z4KA 3BULA 3KUUA 3RJZA 3TRDA 4M7OA 1GAXA 2ZJ0A 3O8QB 4LX0A 4QU0A 1OT3A 1TVEA 4YMIA 3I5UA 3ZU2A 4PVCA 5GOTA 1JHYA 1CQWA 3QZUA 4IHJF 2HF2A 1A5AB 3GGSA 4UD6A 1BROA 3DFMA 5BW6B 5E8JA 4ANFA 3TFOA 4HQ6A 3MRVA 2XRFA 1PNOA 1TCUA 1ATZA 2E49A 2I5PO 2ZRQA 4PC2A 2PANA 5JIBA 2HMAA 5AKEA 1I4WA 4JVMA 5BUCA 2QW0X 2FHSA 4C6RA 3H2BA 1ZM4A 3EPJA 1VMKA 3H5NA 3ZWOA 4HPJB 3ABOB 4AJ2A 1E9CA 2H4ZA 1MVNA 3AVWA 4DLYA 3DLBA 2BKUA 3E5MA 3IDQA 3CF4G 3ORQA 3PITA 2VK1A 4KXVA 2OB2A 3PFKA 3PQFA 3NRBA 4LCBA 2NZXA 3WB2A 5JYDA 2NVUA 1RSZA 2NQ8A 1MGOA 1PHPA 2Q5EA 5FT9A 2NSDA 3CRQA 1TMKA 2IX9A 2P68A 3UJ7A 2ZBFA 2Q3MA 2HF7A 3MGCA 4KRGA 4FQ5A 2D7CA 1VYUA 4GECA 4QPNA 2FZLA 3BHNA 2FUNB 4ID3A 1TJPB 4PPQA 4L5JA 5AJYA 3V2HA 2H85A 2JFZA 1J0DA 1UFKA 5E1BA 2PUEA 3WDKA 5FD8A 3U3MA 1XNHA 2IUTA 1JUDA 2I2FA 1EWTA 4E46A 4TT3A 1GHTA 1C3OB 5B1IA 3V4FA 4PO8A 4ER3A 2D1TA 3FUVA 1YDGA 1VA4A 4W1QA 4YDSA 1ECCA 1HMYA 1YVUA 3FYTA 4H7DA 1Y7PA 4PBSA 3WMFA 5JZSA 5DWVA 4NZMA 1W1WA 1N5RA 3CCBA 4MUFA 3ICQB 4EA7A 2LCIA 3F3YA 2OBNA 4ZAYA 3BIXA 4MTLA 2WJAA 4LVNA 1R8SA 2RIRA 5JSYA 3UG6A 3ZX5A 1WKVA 2EKLA 2R7MA 3W6UA 5A03A 1NM5A 2I66A 4NTZA 4S1TA 4DOMA 2EX4A 5HWSA 1RQXA 1YOBA 1O94C 3A0RB 2XPCA 4E4RA 3O9ZA 3CZMA 5EUQB 3RD5A 4TYQA 3AI7A 3T54A 3OQNA 3A1WA 2QP3A 4CR8A 2CDBA 1N6LA 2X22A 1H6AA 4MKXA 1T2UA 3NIGB 3F9IA 4PCLA 1LJLA 5IBQA 3SFTA 2YXNA 5G40A 5AVVA 5HKAA 3RSLA 4AS1A 5DX1A 3PYXA 1AKEA 1KZGB 3OSUA 1K27A 1R4NB 4P31A 2QHXA 1U7DA 4D9KA 5KYYB 3E3NA 1YQUA 1A2QA 3WXMA 4N6NA 2XB8A 4TVSA 1YQXA 1ZC3A 4KWTA 3WMWA 2BONA 2BZ1A 4BV8A 4JKIA 4RF4A 2G09A 3MS4A 1FUEA 1GZ5A 3BEOA 4RE6A 4FGSA 2IUUA 5L3QA 2Q7OE 1GFSA 2YRXA 3JS5A 4EYKA 2XUKA 1TF2A 4I81A 3FBTA 4N3GA 5BOSB 1N6PA 3PTLA 3AR8A 4IIJB 2AJ8A 1LD3A 1C0LA 3B9PA 4G9EA 3L4KA 1XDDA 4IF6A 4BQSA 4DXDA 4XH9B 4RVFA 1JIJA 1C0EA 2Q3DA 4IMPA 5HMLA 4DREA 2XZTA 2JBAA 2CMGA 1H2XA 3ZTYA 4DWVA 3IUMA 5C1OA 1WD7A 1JKXA 2ZRGA 4RMHA 1XTJA 3KQQA 3MB5A 2QJRA 4AKHA 1GPUA 4YREA 1IPFA 2WIKA 5TC4A 4DWWA 4Q1CA 2D0PB 3FLAA 2XF8A 4C3OB 2E48A 5ARBA 4B80A 3LPLA 5IMBA 5C1DA 1Q20A 3TTUA 4QM7A 9ABPA 3FPEA 4BLVA 2Q45A 2EARA 3KSRA 3KKOA 3LPNA 6AT1A 2GT1A 2J3EA 4N7RA 3I1IA 4IDOA 2G80A 1SKMA 2W43A 1T26A 5JXIA 1P7YA 2OXCA 4DV7B 1YKSA 3HFJA 3MT8A 2WE7A 4BO8A 2MYPA 3UJPA 3IXMA 1Q0SA 3AW8A 3D6HA 3MQ4A 3PIDA 1LVGA 5LLSA 3TJRA 5B3LA 5CLIA 4LJAA 7YASA 2BYTA 5T5QA 1DFHA 4XSGA 3BUSA 1ZAKA 3ICOA 3K9WA 2XBMA 1LSOA 4KVFA 3CUWA 5H1YA 2ZFUA 4CN9A 3EVFA 3DNPA 2COUA 5JC8A 1Z5PA 3FWPA 2YZKA 4QYIB 1ABBA 4ZYWA 1L4BA 4EHLA 3V8NA 2H9AA 4Q12A 4DFDA 2R1VB 2DUWA 1OB5A 5IS2A 4P86A 2OV1A 2F48A 3HUEA 3EBLA 1XU9A 2WQ7A 2OXEA 1ZICA 5IRCD 2GCEA 2GOYA 2XXBA 5KKNB 1L5FA 4KE8A 1AK1A 2XRZA 2DY0A 1BHSA 3L92A 4OI4A 3LVFO 3UWSA 3NHKA 3OZEA 5CIYA 1X15A 1MP0A 1PZEA 2ECQA 4NMWA 3VYVA 4EMTA 4J1QA 3ZIAA 3LQ2A 4MWGA 4ZCTA 1EUYA 3TXXA 4YS6A 4FDTA 3BK7A 1HEUA 2CLDX 5KX5F 4PV7A 3RGWS 2F1RA 1DT5A 3REQA 2V5VA 3RYFA 2XMGA 1GFZA 1WXXA 2B92A 2OM2A 4M1WA 3N8DA 3T38A 3LT0A 1H65A 4LPKA 2X4IA 1UDBA 1DFIA 3EXEB 1HG0A 1BQ3A 3PR1A 4RELA 3ESYA 4Q1FA 5LMUB 5BSWA 3T9AA 1WMAA 1XZAA 2ZSIA 2D54A 4H3HB 3WJ7A 2KMLA 4J2OA 1PVOA 4P4LA 1YR7A 1JPJA 1R0ZA 1ZONA 3SMQA 4F6RA 5C7IO 1HDGO 4JBNA 1Q14A 2CJXA 4M88A 4OHRA 2G08A 2V74B 3TE7A 1WSWA 2QM3A 3PUHA 4YJ2B 4DRZA 1I0LA 2Z5VA 4MS1A 3I61A 2NW6A 2WIDA 3T5BA 3E8XA 4L5CA 2GYWA 2W6JA 3JD4A 2WJHA 3GRRA 4D9CA 2VT2A 4TTPA 5ALPA 4BNHA 5B7GA 2PWZA 5KTSA 1Q2UA 5G1NA 3ZGZA 2RGNC 2ORVA 3H86A 4DLRA 4EJ2A 1HFEL 1OWNA 1CDZA 1XN1A 2ZSEA 3GLTA 1VJCA 1Z2PX 2XYHA 4E88A 1ZI6A 2CVHA 5L3RA 2DWQA 3FPFA 4C4PA 3RVDA 3GFGA 4NNPA 2OPBA 1NXSA 2B4QA 3WRYC 3KQVA 4PZEA 4I0WB 1NNSA 1X74A 3AH8A 1B0AA 3K8OE 5DK6A 4AL4A 3CZ9A 1WHSA 2M6SA 3VI3B 4Y7CA 2PT5A 3MBKA 5FFMA 4W9NC 4XWYA 2AJTA 4LF9B 2I7CA 3SZOA 1UH5A 5LWQA 2XAAA 1I30A 1CG6A 2V7PA 2QRZA 4IV8A 4P7FA 3QNWA 5FWNA 5KJFA 3CEMA 5KJ6A 1O08A 3GK3A 3IDAA 3EIOA 3B6KA 1JEDA 3HR8A 3DZIA 4EUSA 4Q9DA 4MH0R 4Z9YA 4CM4B 4B79A 4CXMA 1B6GA 1PZXA 1TI7A 3KOUA 5EP2A 4ZT6A 1GTSA 2XMDA 4B3MB 2XXAB 1J2YA 2P4QA 2F1HA 5ALQA 2IOFK 3O4GA 4H7IA 2VH2A 3L9XA 3L9WA 4MK4A 5HCUA 3TD6A 5H7XA 5IU6A 3W1VA 4A7PA 3PFGA 3AFMA 3B12A 3A14A 3PQEA 3W2IA 1RKUA 3WV4A 4ZFNA 1RAAA 4AUEA 2EW2A 2XYQA 4S0ZA 3H5RA 1MX5A 4HGQA 2C95A 4C0KA 3COVA 3BWDD 2VRCA 4MQUA 1L3IA 5BMVB 5CA1F 4B3FX 5HKBA 4DLNA 1NKSA 3B1JA 2G28A 1EZ4A 1RM4A 3HQ4O 5I45A 1CY0A 1KDVA 3R8XA 1RAFA 3RAPR 4AROA 1NUUA 4HMPA 4AKTA 2WG1A 3U9TA 1E3TA 1TZKA 1YVPA 4UOEA 1K6MA 3JY6A 1PSWA 3QX7A 5CVEA 3ABSB 4RKFA 3CC8A 2BFPA 3ZBPA 4KX3A 1W0KA 1LKZA 4DIBA 1SULA 4FINA 4NZOA 1GTMA 3K15A 2UYOA 1XR3A 3FNQA 2BDUA 2ZTVA 3GZNA 1U3FA 3PF9A 4MP8A 1EWRA 5HF8A 3PUVA 3RBZA 2JB9A 4Z9AA 2OWEA 3MAJA 2ZDHA 3BRQA 3C43A 3R6LA 4QARA 4LGMA 4X41A 5BN4B 1MT0A 5ALXA 4HNTA 1RPTA 1X2BA 3TF5A 1XAHA 1QGDA 4G0UA 1HTBA 4RD4A 1E9FA 1QVAA 2HIHA 4MW2A 5MN5A 3Q9LA 1TLLA 3TZCA 1SVNA 5BW5A 3W5SA 3OUTA 1NMSA 2ZXFA 4D3DA 5AUOB 2ENWA 1BTOA 4QBFA 1L6IA 1QIIA 3DZDA 2V96A 4FONA 2YQ4A 3REOA 2PO7A 5JZ9A 3FFWA 1B42A 4JCOA 5FNVF 3BMCA 1ABFA 4KN5A 1I6LA 1XALA 4MYUA 3AIOA 4DCMA 4R2IA 3DLHA 1N2HA 3KFLA 4LYYA 4PX3A 5F21A 4OQEA 3THXB 4RABA 5B1SA 3DVRX 2WZDA 1HV8A 4D92A 2VP9A 3RK0A 3ZI7A 4BAUA 2ZCJA 1O3YA 4RGBA 5DFAA 2UU9B 3TRIA 4UD2A 2KPOA 4NZPA 3KETA 1PUIA 1RWWA 3OFSA 1Z88A 4OJKA 5IHPA 3TIVA 4J4HA 2JVIA 4AURA 2AL7A 4ACAA 1WX1A 3KZ1E 3HBAA 3PC7A 4MV3A 4RADA 5HRUA 4JENA 4IPTA 1IB0A 1M0TA 3FI9A 3UXHA 2BJWA 3GWZA 4JI6B 5GVSA 3T1HB 4P0PB 4DLVA 4UTPA 5IKMA 4OLAA 3A7DA 4CU2A 4NOJA 1E0KA 3DGEC 3H75A 1P1KA 5EERA 3I1FA 3FYUB 3TMAA 2FPRA 2WLSA 3KYJB 3LU1A 2VKQA 3R0VA 1WBDA 4AZ0B 3QPDA 2VT7A 1S1MA 3KB1A 4DNQA 2AVNA 1L5VA 1D4OA 1DB3A 1P9NA 2C4VA 4KW7A 1BDJA 3UYLA 3K70B 3BKWA 1VKZA 2G67A 1ZGBA 1IIRA 4MYSA 4QDTA 2BEKA 5FYDA 1Z68A 1IXSB 3W0LB 3WA6A 3WYGA 1V8OA 3IEKA 4YTEA 1SBTA 1WO8A 4PCAA 4RULA 1P9LA 2HQOA 3DBVO 1ZCFA 4I4TB 4DJJA 5A9SA 3A2NA 1LDYA 3K4PA 3IVCA 2OFWA 5HBRA 1E1LA 1WDKA 5C8YF 4K3UA 1QFZA 1SOWA 2V7UA 1DJNA 4YK7A 1PR9A 4AY4A 3GGOA 1Z4PX 2WQZA 1PAUA 1XXHE 2XSZA 1L7NA 10MHA 2Q8NA 4KSYA 5ELXA 2DC1A 4L8FA 2J08A 3Q85A 2VSFA 3V1MA 1US8B 5EE1A 2YUTA 1NF9A 2FEMA 4GMXA 4RV5A 4YCSA 3REGA 3UHFA 3DE3X 2QN9A 4EECA 2GZHA 3OETA 5F1YA 1HMPA 3G7NA 4H7EA 4ZOLF 3A27A 1KKUA 1E8DA 1CZLA 3E9DA 2Y1XA 2A92A 2DBZA 3B6ZA 4BQFA 3GLFA 5HHTA 4AN4A 1G9TA 4XWWA 1W2GA 4XCXA 2HU5A 1KK3A 1S4QA 3T5DA 3AETB 5KTMA 5KCMA 2R7AA 3PZBA 4UDNA 1ICEA 5CNMA 3ANMA 3IFSA 2WUVA 5AI0A 2VRWA 1SCBA 3IO3A 2RK3A 1ZA1A 5JC1A 1Q95A 4LXYA 3PC4A 1H9BA 1KZ1A 4YDQA 2JKVA 3KEQA 4JVOA 1WZNA 1B76A 4A91A 3BA6A 3MMSA 2VWQA 4UJ3A 1TM2A 4MHSA 2HA0A 4MAAA 2V9ZA 5GONB 3MLEA 1VIYA 4YT8A 1ZM7A 1JXAA 2CKMA 3ROZA 2Q9CA 3NVMB 3AOEC 1IG3A 2I6QA 2K2WA 2PKXA 3PXAA 4NE9A 4O4HF 1BHJA 1G19A 3LDUA 3RV3A 1L7MA 1N2IA 3DHWC 4L1KA 4CI0B 1M1YE 4NBKA 2XLCA 3H1BA 3H8JA 3V8PA 1ISHA 5IC6A 3TLJA 4RPJA 5DULA 1R5OA 3AVOA 1TAUA 1ORWA 1U0OC 1ZX1A 1UM9B 1Z5UA 3PXUA 3UPDA 3EWNA 4F3YA 4AQ7A 4D25A 1AUOA 2ZAOA 4GBED 4B6OA 1FP2A 3QPUA 1ORHA 1I24A 1NUSA 3H7AA 4NG4A 1Z6PA 2GESA 3AWDA 3DAHA 2YR0A 3P45A 1UPBA 2ZPUA 3KKQA 3K2QA 4P0TA 4NF2A 4NV0A 4YRZA 5CA1B 5BRAA 4DMCA 4YR7A 3SKYA 1ONBA 5HKKA 4NFHA 1FDSA 5FV7A 4Y18A 4EF4A 2P9CA 5KKCA 1OBVA 4BX3A 1N6OA 1A9YA 2A9JA 2AJDA 2WSMA 3PB3A 3UKJA 5BQ5A 3MHTA 1ODJA 4DC0A 3E03A 4G1FA 3QU5A 1WVIA 3GV0A 5JZOA 3AJAA 1VSBA 1DOHA 4XGKA 3EPKA 4K6HA 4UUAA 4ZI7A 1FRQA 2GQ0A 2R8PA 2GBCA 3RSHA 5FLKA 1R64A 4DC9A 1ZM2A 2CZCA 2O0JA 2J09A 3B3JA 4R2XA 4B1FA 1RRCA 3I39X 3ESCA 1I10A 4CT5A 4A3SA 1U1GA 2G3YA 4WA8A 3LY5A 4MJ7A 1X6VA 2XCUA 4AG3A 1HE5A 1JSLA 4RQBA 3QWBA 1DXHA 3G2JA 1E3EA 1TYEB 2ZLBA 2NADA 2DQZA 3FA2A 3F8TA 5HRCA 2OQIA 1MAWA 2PJUA 2RBKA 1NR7A 1EVYA 3C4VA 5I5GA 2A6PA 5DXJA 1OV6A 1YJCA 2XQFA 3NHJA 3SSOA 2FLVA 2I6SA 5FO0A 5G0SA 5JYCA 1DNPA 3MM4A 4M53A 5DYWA 3FR8A 5EQTA 5FHQA 3T7TA 3N53A 4YAUA 4G8DA 3ENVA 4PQRA 1S2OA 5KSWB 4IXTA 1A96A 2IU6A 3OOJA 3FGZA 3L6DA 3LI2A 4O2BB 4MKFA 1VE7A 5TT0A 5C52B 1ZLXA 4YJ3B 2GZSA 4ISCA 3LOPA 4UDXX 5ELMA 5AFSA 4PYIA 2ISCA 5M5BA 4E5UA 1P5FA 1TA9A 2I2WA 5GJVC 1AUQA 3HP4A 3MTGA 4LXXA 4QAJA 1MZPA 3P2YA 3SCZA 3NM6B 3K20A 3GDGA 1W1IA 4X5OA 3UO8B 4DVGA 4WLFA 2I3DA 3K0BA 5HFAA 4OXKA 2FXVA 1DXOA 2QLBA 4MO9A 2CFCA 3ZCUA 1E7MA 4L28A 2HA2A 1A9QA 3I9MA 3A6LA 1FXUA 1IZ0A 4LBZA 5E2BA 4A82A 2OMEA 3FYDA 1LSJA 5DZSA 2LD4A 3HBFA 3G5MA 3H2ZA 3HCRA 3BJIC 1TJNA 4M1EA 2XSZD 3OPMA 5KYKA 2XKBA 4Y9DA 3G7UA 1LRJA 1MN6A 1Q1AA 4PR0A 4AB1A 1K3TA 2NM0A 3HNPA 1X1SA 3PA6A 2P1RA 1M33A 3Q5DA 4GBJA 4MS4B 5B1EA 1UUFA 3ECCA 4X6UA 5F51A 1UQTA 1SXGA 2I4LA 3LBYA 4BUCA 4J0DA 3KD3A 3RT1A 3O7WA 2CNWA 1XA0A 1JDNA 2WVHA 3V2IA 4K46A 1V6CA 2IEIA 3GH1A 3BD6A 4IWNA 2FG7C 4UHHA 2ZYIA 4MJLA 3SEQA 4KGZA 3FVTA 3GYBA 5H0IA 4XIYA 3STYA 3UAGA 1M7HA 3LWDA 3O84A 2JIZD 4G4GA 1Z8NA 1FDVA 3DGFC 3KAPA 4TRRA 4WDRA 4IYJA 3GZTB 5LJIA 1LRLA 2E9SA 3QVUA 3GEMA 1PG0A 5AUQA 2XWBF 3A6PC 1HL7A 3QI2A 2FJPA 4Q02A 4F8EA 1B26A 4ZV4A 4BVHA 4Q47A 3FKJA 4KDRA 1XWIA 1A7KA 1PR2A 2VUIB 1ZW1A 3OIWA 4HNAA 4OUDA 3MINA 3TTSA 1EKXA 3UAWA 5D51S 3ZGXA 2VDWB 4JL8A 3VO2A 5DM70 4HN9A 2I8LA 1GG9A 2NU7A 1QGYA 1X9HA 3S8MA 1GL6A 2P8SA 4D97A 1RIFA 1TGVA 2I6GA 1W85B 3SJUA 2EFYA 1YZFA 3PRYA 4HVCA 2AXEA 1XP5A 4JC4A 4U2EA 4ZTZB 4OP1A 3FLEA 1OC2A 5CDTA 3HJCA 2PYDA 4WASA 3RVOA 5JAPA 1G38A 3TBKA 1JGTA 2A5YB 3A4TA 3AIKA 5EIEA 1ZKDA 4ZVTA 2C9DA 3F98A 3TLMA 1SK8A 2HCRA 5JY1A 4B2PA 5KNCA 3OZRA 4A27A 1GDDA 3U7GA 5FNVA 3DCJA 4UHFA 5KSPA 1SQFA 4F4HA 4TWIA 2WICA 1IN7A 3N9IA 2FSVA 4Q21A 2ZK7A 1BJKA 3OZIA 3MC1A 4WHMA 4AF6A 3NHFA 1OUMA 1DP4A 1KEEB 4LNAA 4FDUA 4UHBA 1UJ4A 1Y5NA 2EX0A 1EHCA 2XE4A 2ZUWA 3FCSB 2G1PA 4CLRB 4QJ5A 2QLMA 2J5RA 2A3RA 3C24A 3DF7A 3QYAA 1PV2A 4U2FA 2FYTA 4WKGA 2CNLA 4XOUA 3SQMA 4IDPA 4JBXA 1JG1A 4X92A 3ENZA 4A23A 1P2TA 4BVAA 3DCYA 2Q8PA 3F8WA 3FCUB 4R1SA 4DLXA 4JT9A 2MCFA 1SOMA 1RABA 5ED0A 1RRKA 4JT2A 2DU8A 4BZXA 1OHHA 4XPIA 1KJZA 2C2OA 2JA1A 4O8ZA 1W88B 2W7TA 3DEHA 4ZRNA 1UJ5A 4YMUA 2HO5A 4AUNA 2FLKA 4FEEA 1ZJYA 1HYBA 3N58A 4YT5A 5ITZB 5I9IA 3CSSA 2ZITA 1Z7EA 4FEGA 4J7AA 4A92A 3B9RA 1QU3A 4WJZA 2JFUA 5IDYA 1OXVA 1H2ZA 3ZUPA 1QANA 4M55A 5D01A 3V4RA 1OAOA 1IM5A 2R6R1 1JZSA 2GJ9A 2VPXA 2JFHA 4JI7B 4I55B 2EJWA 2OG2A 1E62A 1DRJA 3WMRA 3ZC3A 4CMAA 5IF3A 1J0AA 621PA 1FJXA 1LV8A 2DKNA 2Q99A 3COWA 4U2KA 4U9HS 3V6LA 3CTPA 2OY0A 2WVAA 4TUYF 4Z6KA 3GT7A 1JTEA 2Z3ZA 4CV2A 2LCFA 3PGXA 3ZD6A 2GWHA 5KTTA 1L4EA 3W1EA 5ALTA 2JLUA 3EIHA 2EVWX 4HY3A 4R2LA 2ECOA 1KWGA 1GT91 3MJ4A 4RK1A 4W99A 2R4TA 4BQEA 3BWMA 4XCVA 3NRCA 4W8GA 2GCPA 2ZRBA 3W77A 4I08A 3WI7A 4O1MA 4BGIA 1JWAB 1U02A 3BSSA 3E4DA 4RH3A 3CRW1 5JASA 3RQSA 3U13A 1UQUA 1HT1E 1S01A 4FZ3A 2AR9A 2VC2B 2GAAA 1UJNA 1QYWA 3KSZO 1YRYE 2N47A 3KLPX 3MWKA 4H3VA 4TTRA 2FG5A 1U9ZA 4XVRA 4Q4CA 4AJPA 5K9ZA 5DBEX 1QG2A 2MOKA 3HBMA 2DM6A 3NTLA 2DTDA 2ZIGA 3HJBA 2ISQA 3PNQA 4BDSA 1ZK3A 3OZAA 3LXMA 1BCRB 2F62A 3ZVMA 3WP0A 4D3FA 2O8BB 1RJEA 2CJPA 4IXNA 2RGUA 3IH5A 1REQB 4ZZ1A 4R9RA 1VA5A 2FWRA 2MYUA 1ZOLA 4K9PA 2CLMB 2HT1A 1V9CA 1Z7WA 3BOSA 4IVNA 3L0BA 4XASA 3RRBA 1E8NA 1RYDA 1XHEA 4DCSA 1U81A 4ZDKA 1ZHOA 5FLYA 1NF8A 2ODWA 2JFNA 5IAJA 1DTWB 3UGTA 2XDWA 4ZHQF 4YMTA 1JPNA 1CERA 4NL4H 1NQTA 1TT7A 1TEVA 3MYYA 1ZD2P 1BKSB 5K09A 3AR3A 3TZ6A 1WD5A 4J76A 1K6JA 1KKLA 5CVCA 3PFFA 2Y76A 4IIBA 4CM3A 1Q0QA 2HADA 4JQSA 4YO8A 1DQSA 4BTLA 4E1AA 3TDMA 3VHRA 3PQ4A 5A4IS 5KOYA 1NBAA 1HL3A 1SUAA 2QVLA 2Z1DA 4OAQA 2D0OB 4X8MA 2OD2A 2Y2UA 1KRXA 3VRHA 4R8LA 5JBQA 2BWJA 4MQFB 4ECAA 1C14A 4PYMA 2I7DA 4URVR 1WETA 3PKZA 4UBIA 4WNCA 2GUWA 3PPYA 2NNLD 2R84A 3HL4A 1E9EA 1GA6A 3UGQA 3ZW8A 1DE0A 2X8JB 1HDYA 2W8BB 3OOEA 1KO5A 1P1IA 1QH1B 1W36C 2FW1A 1PG5A 2JFOA 1SUEA 4Q1BA 2PRZA 1V7PC 2NUAB 1UKBA 3IBYA 4INPA 2IHYA 3D1JA 2C92A 3MTDA 4O25A 5TGZA 4EKNB 5BMOA 2OQRA 3OTIA 4BE4A 4LJ9A 4WTOA 2W6QA 4C20A 2M98A 2WU8A 2WU1A 3ER6A 4BGUA 4BTEA 1E20A 1CR2A 3IQGX 3V4PB 4PGGA 4CM9D 5CURA 3FLBA 4HDRB 2VWPA 3AF2A 1X39A 3Q3IA 4NRDA 1MO4A 1XNGA 3H83A 4AJIA 1PK8A 3ES9A 3L1UA 3HABA 3TW4A 5DBOA 3IMKA 4GQBA 1Q7EA 3WHPA 4ZVSA 5JI3E 3N76A 5CX1A 5FPHA 4C04A 3ICCA 1E2KA 1ORTA 3VTKA 5JJ5A 2LRHA 3ZXUB 3UGJA 4O4IA 4L22A 3TSOA 2BGRA 4TWAA 1DDOA 4YV1A 4EA8A 4RZ3A 1XK7A 2ZTLA 3WMXA 1BEZA 3A1NA 4Y6GB 1BXGB 5JXWA 1I8TA 1CUVA 2P4HX 1QDEA 2GD1O 3NZEA 5CU7A 3LUHA 1SQ0A 1BVHA 2AMFA 1N4DA 3M5DA 1O0SA 5AXDA 1AMNA 1HURA 1YL6A 1DBPA 1PFWA 2ZR0A 1OD6A 4E2YA 5DCLA 5EKSA 4UHKA 1N9GA 3STWA 4PZCA 4HN4B 1AS0A 3OQBA 3B2NA 4JDUA 4ALNA 2X0RA 3NJ8A 1LDGA 2ZI7A 2W6NA 3NYWA 4NYIR 3E3MA 1KQGA 2J1LA 3GU3A 4MROA 2QSZA 3Q0EA 2IXTA 2AZXA 3UHJA 2EWWA 4GS5A 1AIPA 1G9XA 5TGDA 5I9BA 1J2RA 1B0UA 3L1IA 2CLEB 3N2GA 4P3YA 2X0JA 4ZQFA 4DDMA 3TAUA 1U9JA 3M6WA 3D5QA 4B5KA 1Z6GA 2UYQA 2O2YA 4ECEA 2XD9A 5EHQA 1MRZA 2GTHA 3RV4A 3ND7A 4JEHA 3CV3A 3L7MA 5EE5B 2J5BA 1TTQB 3SN6A 1K5PA 1DQPA 1IVYA 1M75A 1NWHA 1VBFA 1EP9A 4OHCA 3TNJA 8ATCA 4WNAA 2ATXA 4I9GA 1Y34E 4IZ6A 3LZDA 2GN9A 1I4DD 3F47A 3DE6X 2Z43A 1D2GA 4YRJA 3OPXA 3KQKA 1O0BA 1J09A 3IJRA 4XJXA 3STVA 4GLFA 3D43A 3L6RA 4OBXA 2IV3A 3TINA 3JU3A 3L5OA 2ONZA 3BWCA 4CEHB 4M21A 1DARA 4L16A 3HB1A 3QYPA 3BDVA 4CHGA 3I72A 1XL0A 5A6VA 1Z2CA 1KJ8A 1RJFA 1S3IA 3UVEA 1HORA 1E2JA 3QXJA 5EMHA 2OORC 4LAFA 3SJCA 1LNSA 3WLMA 3RU9A 3SIWA 2AIRA 4E5YA 2GK6A 2NUTA 3QX3A 2WAMA 3DM9B 3C39A 3EGVA 4TVBA 1UEIA 4JK3A 5DLPA 1PFQA 3BIWA 3ASZA 2UUAB 5J23A 1SXJA 1D6SA 5DEOA 4W5OA 3FDFA 2BTOA 3GEPA 5HQTA 1JU9A 1UC9A 2QSYA 1GQSA 4RTKA 4X3CA 5K8JB 4UAGA 3Q6IA 4BQOA 4C7BA 4CDMA 3HM9A 4D9BA 1B23P 1CRZA 2YY7A 4ITVA 5EIBD 3U49A 2PVCA 4TWJA 1CYEA 3BGDA 3LW7A 2HAEA 2VYFA 3AL3A 4EFDA 5KYUB 1LDNA 2WWGA 3Q9NA 4TTSA 4ARIA 1OPRA 2ZU0C 4ADSG 4Y67A 1C4OA 3ZQ4A 1RMQA 1DG9A 1FCJA 2GERA 1FZTA 3LE8A 3DZCA 3FWNA 1N6KA 1NNI1 5F7JA 2Q5CA 2OBFA 4FHGA 3TLBA 2V4MA 2GN4A 1MO5A 2WJ3A 3OU2A 3P9KA 3GFSA 1ZGZA 3H5TA 2AI2A 2JLZA 5LYYA 3W2FA 2LP4Y 4K81B 4FOOA 4PHTA 2FEXA 4FU0A 2HU7A 4YP0A 4CUKA 3ORFA 1PQYA 3MFQA 4C0XA 3ABZA 4GMHA 1YIOA 3G5AA 3Q1KA 3DEJA 4EF5A 3EJ6A 2HZ7A 4E1BA 5CD9A 1F2VA 2IHUA 3EA4A 3R3YA 2EBUA 4UEWA 5AVSA 2ORYA 3TGPA 1XE3A 4PPGA 1IZYA 4EENA 3KXPA 7GPBA 1DKRA 3QUTA 3KU1A 2ZYGA 3JQ9A 2GARA 1P1FA 2EYUA 3ELUA 5K8VA 2PEYA 3TQRA 4C3VA 4K87A 2WMYA 4HLDA 3EOZA 2ATIA 4IBOA 1WPXA 2AZ4A 1YK0A 4N1AA 1NRJB 3N7AA 1ZUNB 1TNDA 1KY2A 1CR6A 2I62A 1BD3A 1A9SA 4HPXB 3D6VA 1NP3A 1WCWA 3R5TA 4R2HA 2W11A 3H3FA 3RIEA 2JD1A 4BQRA 1RXUA 3TVYA 2POQX 5FQNA 3BWVA 1Y98A 4EATA 4GXNA 3A9RA 1NF2A 4RVHA 4XWOA 4WLEA 1RM0A 1V8FA 2YINC 3U9LA 3AJ8A 2Q4TA 4YQYA 2WTMA 1XA3A 2DT5A 3PC8C 4FS8A 5K8CA 4RUKA 3A1DA 4G26A 4JBGA 1ZH8A 2AMLA 3TSWA 4TS3A 2CL0X 1EUZA 3N2ZB 3BZUA 3ERCA 5FH9A 1J2EA 4AIIA 1N5MA 1T8SA 1BYUA 2K7ZA 4ZYZA 3ONVA 2R2GA 1QZTA 2A9FA 5CYOA 4AQYB 3DVAA 2DQ4A 1K75A 3E9RA 2X0EA 5EJIA 3H8VA 2C2WA 4IQGA 4XSVA 1WR8A 4J1TA 1J90A 5CNIA 3U3DA 2J6CA 4IOMA 1Z15A 3GX1A 4ME6A 4OY3A 1ELOA 4JT8A 5F3RA 4XYMA 1NVXQ 3DE2X 4IEIA 3IA2A 1QSGA 3GEDA 1O94D 3NVDA 4FT2A 2D0IA 3PDIB 4HGYA 4G9GA 2V4ZA 5LB2A 3V1NA 1TZBA 3ZS9A 1SOUA 3O95A 5IN4A 1XKLA 2IA5A 1MLDA 4YO7A 1T9DA 3ZKWA 1C9EA 2PXXA 5REQB 1TU3A 1WEHA 4MWEA 3VR1A 1J0CA 1Y1LA 2B0CA 1TF7A 3EZ9A 4G84A 2RGWA 3NVKI 4A0GA 3Q87B 4TYPA 1A8QA 1XU4A 1Y4AE 2AS0A 3GNQA 3UUGA 3I62A 1JDJA 3KHKA 4FBLA 1SMKA 2P2LA 3GOQA 4EG4A 3HRHA 3VH2A 4AY5A 4DIMA 2EKZA 2VK8A 2H92A 3HS3A 1GGKA 1OIXA 1DIBA 1Y9AA 5KSOA 1KH3A 4AMYA 5JCJD 3VZSA 4YAOA 3H2SA 3DW3X 5FWYA 1OGYA 1C41A 3EMDA 1FBTA 3KWJA 3M6MD 5FBZA 4L72A 4OOEA 4KGVA 2FMXA 1NLFA 1T4CA 2GF2A 4LWZA 4LX8A 5EXPA 4RA6A 4EEXA 1O9HA 2G40A 3CUKA 4MOWA 4AUMA 3EEBA 2C0QA 1NU6A 3BSYA 3A6KA 4CKWB 1HNXB 2YJGA 2CVPA 5COBA 5J9FA 2LPMA 2CNBA 2R7LA 1OU4A 3GAAA 2OXRA 4TUYB 5F2NA 2D7DA 4L7QA 5JHHB 1TKBA 3QG1A 1B8OA 1JAZA 4U8HA 4XR4A 3UJAA 1I4LD 3JALA 3V55A 2XF2A 4KDFA 3WADA 4EHJA 2AX4A 2QNBA 2J3MA 3MJHA 1UKYA 2GASA 1B14A 2GKSA 3E9CA 4K9SA 4ZVQA 3JTEA 3AT1A 3NT5A 3V8QA 3QVLA 3ZV5A 1R27A 4LOKA 3G0DA 3JQCA 4QBGB 5E7QA 2V45A 2DRIA 4AO6A 3FB1A 1G5QA 4IIGA 1E1KA 3BS4A 3DTVA 1XQ6A 4JLOA 3NRJA 4QUEA 5FRDA 3M6LA 2JS7A 1HF3A 2P62A 1DKMA 1ZD8A 2JF0A 3F97A 3PJGA 4FMPA 2VUTA 2ETXA 2ZG6A 3L7CA 2FLWA 1F8FA 3ZWCA 4D0LB 2JASA 5L95A 1XZHA 3HWSA 4MS3B 4R3UC 4YPFA 2PGLA 4HYYA 1OE0A 1OI2A 2BM0A 3C4QA 4KQMA 4Q7KA 4UM8B 4EZEA 5K0EA 4C7OA 1X7XA 1KDPA 3EPLA 4HXGA 3HJAA 2RGEA 3OLWA 2VHZA 3PPWA 3W90A 4CMIB 4NJMA 1WDTA 3F6EX 3BE4A 3IDSA 3MCTA 1VI6A 4B8WA 3D8BA 3Q72A 2BL4A 2EZ8A 2WMDA 3DWIA 4L9WA 1BDBA 1W76A 1NJSA 2MSLA 1JR3D 2ZT5A 3K8YA 4FILA 5DEIA 3L46A 3RASA 3LKDA 4PTZA 1VKRA 2YRWA 1PJAA 3QQ5A 4RY2A 5TXGA 2IYVA 3LUDA 5SV2A 4BP3A 1KYQA 2RGXA 2TS1A 3L4SO 4V03A 4L0QA 2HDHA 2Y1FA 1RRVA 3NP9A 3PCXA 2YVKA 3ZTTA 3M83A 3QPAA 4ZOEA 4B4DA 4DLKA 3HA7A 2H3HA 4Z49A 5THXA 3V7YA 1JIXA 1S8FA 2R8RA 3B51X 4TVOA 2WF9A 3TOVA 5KWVA 2G72A 3BMXA 1BXZA 3FTEA 2RBEA 4F56A 3HDTA 3QMWA 4WBNA 3N6VA 3LYLA 3L7DA 4M86A 1H9CA 1BCSB 1OAOC 3AEZA 4BDTA 2BFBA 1PEKE 1T24A 1E3JA 5A5FA 3HV0A 3D3KA 4QNNA 4CLOA 3NDBB 2HTEA 1G20A 3EN0A 3OMXA 4G1MB 4R41A 3WYEA 1A9XA 4I2NA 1LVUA 4AYWA 5IK2D 1V16B 4POAA 1KK1A 4EY3A 1HSOA 4OYRA 2CNOA 1QLHA 4EHBA 2DF8A 3W5CA 3EPHA 1VDZA 4NS4A 4GL2A 3DLIA 5A2QA 2FSPA 2QPLA 4LWOA 1KEPA 1KH1A 2GAIA 1GQQA 2HDWA 4C7JA 4CKEB 3CMCO 4Z1MA 4F8YA 4OFWA 4QUJA 4XZ3A 2N1BA 4BO9A 5E6UB 4QOFA 3AVYA 4MX8A 2ORWA 1DKPA 2R62A 3FW1A 3OQHA 1SBQA 1MOZA 2J7PD 3P2IA 4K9OA 4D99A 4BNKA 2CL6X 1JJ7A 4TKUA 4D7AA 1ORDA 4MRAA 1W36B 2RGRA 3H6KA 3K92A 4JJ6A 3J81A 1A4UA 2JGMA 4AMBA 2IPAB 3A3PA 2EG5A 3FPJA 2IY7A 3FRHA 3BD7A 2VQ3A 1WW3A 3I8OA 5DKFA 5FA5A 3UV3A 1DBRA 3PGMA 5JNTA 4EB3A 4OLBA 4ZOBA 3K53A 2Z08A 2RD2A 2QJTA 2GAFA 1BWSA 5A02A 1E96A 1VGRA 2HMWA 4MW7A 4YBZA 4F86A 3TSAA 1ESNA 4WLVA 2RKOA 2YTZA 3FJ1A 3MUEA 5LXTB 1GTL1 3GLVA 3QQPA 4LBWA 3KJNA 3B13B 5T67A 3IHKA 1P6QA 2DXIA 2PS0A 4JASB 5TMBA 1DKOA 1NDUA 2UYCA 3W1WA 4JV5B 3KTAB 3S7TA 4R0VA 1I3KA 3PNMA 4H1WA 5A5VA 1UKEA 2G83A 1SC3A 2ODPA 1ZBDA 2IHTA 5KPDA 3IMFA 4N7JA 4P93A 3CH4B 4HZGA 3ICVA 2XUQA 3MUOA 5CA1A 3MA0A 1KERA 1RRMA 3KT3A 4FDLA 1AQUA 4MQLA 3IVXA 3FCOA 3SNKA 5BNIA 4EPWA 2Z5FA 1YGPA 5K0BA 1IOWA