5AOAA

The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-propionate bound
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
277
structure length
272
Chain Sequence
LRYPPEMPGAEVKVYKKVDNVDLKLYIYKPADWKPADRRSAIVFFFGGGWQSGSPAQFRPQCEYFAGRGMVAMAADYRVGSRHNVKVADCVADAKSAIRWVRQHAAELGVDPQKIVASGGSAGGHLAACTVMVPDLEAPEEDHTISSQANAAILFNPVLILSREGLRQDWEERLRERLGTEPKAVSPYHHIRAGLPPMIIFHGTADNTVPFETIRLFAEAMKKAGNRCELVPFEGAAHGFFNFGRGDNLAYQKTLELADEFLVEIGFLAPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Novel Thermophilic Esterase from the Planctomycetes Species, Thermogutta Terrifontis Reveals an Open Active Site due to a Minimal 'CAP' Domain.
pubmed doi rcsb
source organism Thermogutta terrifontis
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 102
structure length 272
sequence length 277
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5aoaA00
4X85A 2QT9A 2LIPA 2WM2A 3H18A 1RYYA 1E8DA 4UFNA 3BL8A 1U8EA 5ISMA 1B6GA 2PSHA 1XLWA 5JAOA 3T52A 1E8MA 3IIIA 2DQZA 5BWCA 3OOSA 2QOEA 2XMGA 5ALRA 4QDTA 2XUFA 3ZWQA 2DFPA 5AI5A 1ZI8A 5HQ3B 4AN0A 1ZD4A 3WL8A 4PQEA 1GKKA 1DQZA 1EHYA 4K6HA 3G9TA 4X90A 1H2ZA 4KAFA 2GZSA 1R4ZA 1EH5A 5K3BA 4B7ZA 4KACA 1C7IA 1WPRA 3WZLA 2ZJFA 2H7CA 3IUQA 4QDZA 3AZQA 4KE8A 5AKYA 3CN7A 4AZ3A 1WB4A 2HM7A 3QYJA 4QWMA 4ITVA 2X76A 1XZAA 2XUIA 4S0XA 1X2EA 4LXHA 5AO9A 4Q1VA 4L0CA 4G1FA 4L72A 3TGLA 3V1NA 2C58A 4W1SA 4QA9A 2Z5GA 1Y7HA 3HEAA 3V1LA 4X6UA 4DTCA 5JATA 3I6ZA 4UUQA 4QDUA 2PPLA 3WKDA 4G4JA 2V98A 4NS4A 3W05A 1XZHA 1JU3A 5F4ZA 3DQZA 1J07A 1JI3A 1USWA 3SK0A 4QE3A 1AMNA 4N8EA 1SCIA 3C6ZA 3IUJA 4BRSA 5A6VA 3ESAA 5EHQA 5ALXA 1UOQA 1R1DA 4P08A 1F6WA 2XT0A 3EBLA 3D2BA 3KWJA 1ZJ4A 4ZGBA 1DT5A 5EIEA 5AK4A 4UPDA 2VQ6A 4W1QA 4KYVA 4QNNA 3F96A 3R3VA 3VJMA 2ONCA 2PSJA 4GHWA 1YAHA 4Y2PA 1YA4A 3W9BA 3SC2A 3WWDA 5KREA 3V1MA 4EY5A 4J7AA 4W9RA 4UBNA 3C5VA 3I28A 2AJ8A 1ZGCA 1TCBA 3WYDA 4H35A 5AK3A 4EZIA 3QMMA 4MEAA 5CW2A 3F98A 4WY5A 1YR2A 3RM3A 2OGTA 4KE6A 4LYEA 5ALMA 2QS9A 3R3XA 5JAUA 2EDAA 2XMSA 1ACJA 1GPLA 4Y2RA 4C87A 2PUJA 3DL7A 4MWTA 2RI6A 5I8PA 3WIBA 4BCBA 3OM8A 5IVDA 4OB8A 4GEGA 1YA8A 1YASA 3WL7A 2OCLA 5ALNA 3NGMA 1JKMA 5AM3A 5JANA 2QVBA 4BBZA 2I03A 2ORYA 5AKZA 1XQYA 2BGNA 3QZUA 3DNMA 4PV7A 1U4NA 3HSSA 1TRHA 2Q0XA 1MX9A 1HLGA 4AO6A 3HACA 3B5EA 3FSGA 2YXPX 4DSAA 2DR0A 5ALUA 5K5EA 3G0CA 1OXMA 3SX4A 4K6KA 4ZI5A 3QMVA 1Q84A 3WWEA 3ICWA 4J0JA 4Q34A 3K6KA 4PNZA 1WOMA 2XMQA 4GECA 3QITA 3E0XA 5IKXA 1XQXA 1UKBA 2FJPA 3JW8A 4B82A 3BJMA 3HYSA 3C45A 3O95A 2D0DA 1DQYA 2ECFA 5AJHA 2Y1KA 2HA0A 1TKRA 2Y6UA 2B9VA 1CUHA 1W6RA 3NOXA 1H2XA 4MXDA 2WLSA 3WKBA 1J06A 2BJHA 2O2GA 4JH0A 3IURA 2RAUA 2Z8XA 1E66A 2VAVA 1B41A 5KWIA 3STUA 4F0JA 1CEXA 1YS1X 1EVEA 3KWFA 2QTBA 4ARBA 3A6ZA 1BEZA 5BV7A 4B9AA 5JYCA 5AKIA 3BDVA 3G8YA 2VJAA 1UK6A 4J0HA 1CQWA 2VJBA 1Y7IA 1EK1A 5C81A 2WSLA 3IULA 1BRTA 2RIPA 3PICA 1Z68A 2PL5A 3F8SA 1FFCA 4DLNA 3K9BA 1UK7A 3OG9A 3WK9A 4G4IA 4FKBA 2O2IA 5CTAA 2JGMA 2CB9A 4GI1A 5ALTA 3C43A 4I19A 3OTQA 4KR0A 3DD5A 4X7BA 3VJLA 3PI6A 3WL5A 1WM1A 3I2GA 3H19A 3FNBA 2K2QB 3VKFA 3WL6A 5ALSA 3FLBA 1YSCA 1W52X 4GWLA 3FCYA 1EB8A 5JIBA 1LPBB 1CV2A 4KE7A 4FLEA 4E11A 2ACEA 2JGIA 3ZI7A 1E8NA 1ODTC 4UHCA 2XUOA 1N8SA 1F0PA 5ALHA 4MQLA 2PKYX 4XWGA 2B4KA 5IVHA 5LKRA 1PFQA 3D3NA 2PU5A 4FDMA 4EA6A 1GT6A 1THTA 2CEKA 4CG3A 2OGZA 3H2GA 3IBTA 4FHZA 2XI4A 5HZGA 5CT9A 1IZ7A 5HK9A 1XKLA 3H04A 5JD4A 4UHHA 4BAUA 2H7XA 4Y2YA 3G9ZA 4JYPA 2WKWA 2OG1A 3CN9A 4H7IA 4E46A 3R3WA 1S8OA 2EEPA 4J0DA 1TCAA 1IZ8A 2OGSA 4OSEA 2HDWA 4H77A 2WIJA 4IH4A 3R40A 5ALZA 3VISA 1VZ3A 1G66A 5AOAA 1LGYA 3PF9A 5ALDA 1EVQA 1DU4A 4UBOA 4DMCA 2WIKA 2WJ6A 3WZMA 2EDCA 3U0VA 1AURA 3LS2A 5ALWA 5AI9A 2QR5A 1AX9A 1A7UA 1XLUA 4BC1A 1CUYA 2QJRA 5AHXA 5AICA 4E14A 4DMHA 4HXFB 4PO3X 2JGEA 3VVMA 4EUSA 2XUHA 1U2EA 2WHPA 5ALJA 1ODSA 4ZV9A 4BVKA 1D07A 1W76A 4C88A 4UFPA 3AINA 1CRLA 5T4BA 5AH0A 7YASA 2BUAA 4DIUA 3O4IA 2HU5A 2NW6A 1RP1A 1QIGA 5ALEA 1EINA 4AO8A 4X91A 1UFOA 1XZEA 2WTNA 3H17A 3HZOA 1YB6A 3AUKA 4HVTA 3AZPA 1U65A 4H7JA 5LZ5A 2BKLA 2ZYSA 3STXA 2C5GA 3K2IA 4P9NA 4BAZA 1IVYA 4JEIA 5C8XA 2P8SA 1E5TA 1CUJA 1XZBA 1CUSA 2I3ZA 1H22A 3BF8A 1AQLA 2FX5A 4AN1A 5FXMA 3TJMA 4CIBA 1MAAA 4MJ3A 3G0DA 5LLSA 4B81A 5AI0A 1P0IA 4UHFA 4FNGA 5A71A 3RKSA 5AM1A 1HQDA 1GQSA 1LPSA 5AKEA 3ED1A 5K3CA 1CUDA 3B12A 3WLAA 4AMYA 1K63A 2VT6A 1J1IA 5ALYA 5JAPA 4B85A 5FPQA 1ZI6A 4DMFA 3L1HA 1L7QA 3H0CA 3G9XA 3EIOA 5E2IA 1PJAA 1UK8A 3WA6A 4F60A 3UUEA 1WB5A 2WUFA 1XROA 4PF1A 1Q83A 1XRRA 4ZRDA 2OXEA 1DTEA 3O9VA 2W6CX 1JMYA 4P93A 5YASA 4CCYB 1SOMA 4WDQA 5CMLA 2GBIA 1LPMA 1FFEA 2OCGA 2XQKA 3L1IA 2XLCA 4U2FA 1XZFA 5ALGA 3ZLTA 3STTA 1P0MA 4B6GA 4YASA 4X94A 1QJ4A 1ETHA 1HL7A 1JFRA 3D4LA 4Y2VA 5AIBA 4OYLA 2XE4A 1XZCA 1XZIA 2RHWA 2WFLA 5EHNA 5FV4A 5D6OA 4WFIA 3FSGD 2BAGA 3WIOA 3G0BA 4DNFA 3DJYA 1UWCA 4NZZA 3EQ9A 1CVLA 3G0GA 1XRNA 5AI4A 4DNQA 5AK5A 2XLBA 1SCQA 2GBGA 2O7VA 5FP0A 2C0PA 3MVEA 3I2JA 5C7YA 4Y9SA 2VF2A 1MNAA 4CFSA 2WTMA 1IUNA 1ZICA 2XMZA 2DCMA 4JNCA 4C4ZA 4BE4A 3BIWA 1H23A 2XUAA 3WWOA 4C01A 1LLFA 2UZ0A 3W2TA 4B0PA 1XRQA 3DKKA 1GPNA 3DOHA 1LPAB 4B80A 1A8UA 1AZWA 1UKAA 3QMWA 2HFKA 4UFOA 5ALIA 3STYA 4H7DA 4RPCA 3WKCA 4FFVA 4J0CA 1FJ2A 1R9NA 1EXWA 2WFMA 4QEKA 4CG1A 4Q3KA 2HA6A 3D0KA 3O4GA 3ICVA 4BCCA 2HIHA 1F0NA 1CUZA 3BJRA 2Y2VA 4ZREA 2VJDA 5LYYA 2H7YA 5HQ3A 4FOLA 3R41A 1ZD5A 2WFLB 5EHXA 3NUZA 4BE9A 4V2IA 2VSQA 4AB1A 3GA7A 5A2GA 2Z3WA 1CUVA 1QZ3A 2RONA 3LLCA 1MN6A 5HKBA 2B61A 1MAHA 3FYUA 1PV1A 2XMDA 3M81A 2HA2A 2J4CA 3D2AA 3WK7A 5CT4A 2ZYRA 4BYMA 2PX6A 3WA7A 1SFRA 1MTZA 3WWPA 5E4JA 3E3AA 2V9ZA 1C4XA 3O4HA 4X6XA 5FOQA 4QWWA 3DL4A 3VJKA 5D3KA 2ZJ6A 5JAHA 5JZSA 5DJ5A 1ORVA 2XUKA 3R3YA 1H2YA 2W22A 2AJDA 4J3JA 3F97A 4X00A 5DLPA 3FWHA 4MQMA 1GKLA 2G63A 1CFJA 1X2BA 4W1RA 3HC7A 2WJ3A 1P0QA 3I1IA 3I2HA 2HRRA 3IA2A 5LIPA 3AJAA 1CIJA 5AM5A 2OQVA 2BCEA 4H7EA 3YASA 3G0IA 1LZLA 5JARA 5JALA 5CURA 3I2FA 2ZJ7A 3DKRA 1MX1A 4AXBA 1TK3A 3W04A 4CCYA 2WHQA 1T4MA 5A62A 2WJ4A 2XDWA 5CH3A 1IMJA 3W9UA 1OCEA 1F8UA 5EFZA 3HLKA 2J4FA 2RGUA 1XRLA 1LNSA 5ALFA 2OCIA 1C7JA 3A2MA 3FVTA 5K3EA 5AKXA 2HA4A 3CXUA 3FLAA 4OU5A 2QUAA 2JGJA 4I3FA 2I3DA 1QO9A 4FBMA 1A88A 2XUDA 5D7BA 3WI7A 4Z49A 1AUOA 2WU4A 1LPNA 1VE7A 2WG1A 1MX5A 5K3DA 2X8BA 1EX9A 3G9UA 1W1IA 3WJ1A 2XUGA 2C4HA 4K6GA 3VXKA 3QPDA 1WHTA 4MWSA 2OQIA 4INZA 2G5PA 1XRMA 4UBIA 3EF3A 2XUQA 2HU7A 1JJIA 3H1BA 3FYTA 3VDXA 5CXXA 3DEAA 4LXGA 3Q8WA 2HHAA 1NU8A 1A8SA 1KU6A 3V1KA 1AKNA 2BGRA 5C8ZA 3D7RA 4OYYA 5AOBA 4HZGA 2C7BA 4DYHA 1DWQA 2HFJA 1DX4A 4BRZA 1FFAA 5IVKA 4BATA 3BIXA 4WDRA 3WMRA 4QDXA 4Y2TA 3GBSA 1YCDA 5HK8A 1YAJA 1JJBA 2PSFA 4H7HA 4OUKX 4D9JA 2D5LA 1NX9A 1K5PA 4Q3LA 5CT6A 3P2MA 1VA5A 1CQZA 1DWPA 4UHEA 5LZ7A 3DOIA 4B84A 1CUIA 3H2JA 2XMBA 3D2CA 2VEOA 3HXKA 1R88A 4XIIA 1VA4A 2OAGA 3WWCA 3AZOA 3PUIA 2IIVA 2QXTA 3FOBA 4LYDA 4AX4A 1JJFA 5FRDA 4JYMA 3ESCA 2WHRA 1CUWA 1BN7A 3FYUC 3UUFA 2IX9A 1ISPA 4RE5A 5HFAA 5I7UA 1QIMA 4L3WA 2GBFA 2WUDA 1A8QA 3LCRA 1QGED 3OC0A 1EDDA 2XQFA 4X3CA 1VE6A 2DHEA 1ZJ5A 3BXPA 2PSEA 4DM7A 5JZ9A 1QIDA 5AKJA 1UOOA 2VT7A 2CZQA 3JWEA 4A5SA 2WUEA 4G8BA 2E3JA 4B9EA 2GBCA 5ESRA 5BOVA 4Y2SA 4G9GA 1G4HA 4FFWA 4UHBA 1K4YA 2RHTA 3E1GA 2HL6A 1R9MA 2I78A 4A23A 1CUBA 2FJ0A 3O0DA 5CH5A 1Q0RA 4K5QA 4IH9A 4GBGA 1ODCA 4DSZA 1HBJA 1ACLA 4KAJA 3GELA 4U2BA 1O6GA 3ILSA 3KSRA 1QLWA 2BUBA 4UBMA 2XQGA 4XVCA 4HRXA 1LPOA 4EB0A 4BTVA 5DNWA 3EQ8A 1HKHA 1MO2A 2PU7A 2BFNA 2FUKA 1DT3A 1XLVA 4WFKA 5AK6A 5T4HA 3I2IA 2JGLA 1GGVA 4X95A 4ZXFA 4U2EA 4Y7DA 4L9AA 4RGYA 3M83A 4PW0A 2C5FA 4BVLA 4U2CA 4JUIA 3X3HA 3PUHA 5AI6A 2BUCA 5J3JA 2WIFA 1XQWA 4DNOA 4W63A 4Q3OA 1W75A 2WG2A 2VTVA 3BWXA 2C0QA 2DHDA 1W4LA 1QTIA 5FKJA 2QKYA 5AKKA 2XMRA 4N8DA 1XZLA 5E4YA 3I6YA 3ANTA 3I1YA 3I2KA 3M82A 3ZLVA 1MNQA 1VKHA 1CPYA 1ZOIA 4CIAA 4BP8A 5ALQA 2V96A 2OAEA 1I6WA 3LIIA 1GZ7A 1JU4A 3M3DA 4HXEB 4J0KA 5T4FA 4H18A 2JBWA 5T4EA 3TRDA 3C70A 1T2NA 4GDMA 1THGA 4RNCA 1P0PA 1HPLA 3MUOA 1BCSA 4LIPD 5I9IA 3IDAA 1VXRA 4Y2JA 2ZSHA 1ZIYA 4F5ZA 4YPVA 4QDOA 5EGNA 1ZD3A 4A16A 1EI9A 1K8QA 1QIIA 1L7AA 4M0FA 2O2HA 3GUUA 3QPAA 4LKOA 4C89A 4J0IA 3HABA 4ROTA 4FMPA 4GW3A 5LZ2A 3FBWA 2HU8A 4EBBA 3BF7A 5DYYA 4UBKA 3VVLA 2AJBA 3V48A 4GLBA 3QVMA 5KBYA 4IHAA 3IUNA 2JEZA 5D3ZA 3C8DA 3FVRA 4U2DA 4KE9A 1CUAA 2XQIA 4DMKA 4BZWA 5JD6A 1MT3A 1TCCA 3WK4A 1MJ5A 4BP9A 3PF8A 2GYUA 3R3ZA 2CJPA 5DNUA 5FUMA 2VJCA 4HAIA 4EHBA 2Z3ZA 4DGQA 3BDIA 4FBLA 1QE3A 2JGKA 1FFBA 3RARA 1CR6A 2R8BA 2OPHA 4MYDA 3ZLUA 2Y6VA 2B20A 3O4JA 1VJ5A 4ARAA 1AGYA 1TIBA 4OB7A 2OCKA 2GZRA 4AMZA 5AP9A 5EI5A 2ROQA 1CUCA 2PM8A 2WHPB 1QO7A 3EQ7A 4KRYA 3F9CA 5LKAA 3W06A 4LHEA 2CBGA 5AKGA 3HJUA 1O6FA 1GXSA 5IH7A 3D5EA 4EY7A 1UOPA 5A7FA 4AZ0A 1K6EA 3WK5A 3PFCA 3IUMA 1QONA 4N5HX 2H1IA 2YYSA 4FLMA 3STVA 4CG2A 4OPMA 5C8VA 4EY6A 5ALPA 2AJCA 2WIGA 2HADA 4Y2UA 5LZ9A 4PSUA 3IB3A 3C87A 5CH8A 1N1MA 5JADA 2WU3A 5DYWA 5DTJA 1EK2A 2QZPA 4P92A 5DTIA 4WFJA 5AM2A 1BROA 4FLFA 2QJWA 1XFDA 4BVJA 4J0GA 3I6MA 4X92A 4U2GA 2G4LA 2PSDA 5ALLA 1CUUA 4G8DA 3ZV7A 1CUXA 4H7KA 2O7RA 3HRHA 3QBJA 1QFMA 4HS9A 5CBKA 1XQVA 2DHCA 3FAKA 3H2IA 1TAHA 4J03A 2XB6A 1XZDA 4BZZA 4FWBA 1QIJA 5FLKA 2WFZA 3A70A 3WJ2A 4PSDA 4H0CA 1DWOA 1Y37A 1LBTA 4FTWA 1H2WA 5HF8A 4B0OA 4HTAA 1G42A 1CUFA 3ZPXA 1N5RA 3DYIA 4LXIA 5DYTA 4W1PA 1WCYA 3KDAA 4Q05A 2OLEA 5EIHA 1IUOA 2J3DA 2X5XA 3E4DA 1NU6A 1QIKA 2H9YA 4EY8A 4MYSA 3KXPA 4ZWNA 3DYVA 1KU0A 2PUHA 3MGAA 5AKLA 2JF0A 2QRUA 3G7NA 1ZI9A 3CCBA 1J2EA 3KD2A 4UBJA 1M33A 2IITA 4CI9A 5DNVA 1BU8A 2XQJA 1GPKA 2CMFA 1QIHA 2WQZA 2JEYA 4M0EA 5AM0A 4M0MA 3A2NA 1EDEA 4Q82A 1L7RA 3PE6A 1N5MA 4BDSA 3RLIA 3C5WP 4G5XA 3OPMA 4G8CA 4BDTA 2VATA 1KEZA 3R0VA 3WK8A 1YB7A 3F67A 1UXOA 5SYMA 2WIDA 2XUJA 3AIOA 5EIAA 1ORWA 4KJXA 4NVRA 2YASA 1UZAA 3IVMA 5AKHA 4TPKA 5AIAA 5LZ4A 1QIEA 3WYNA 3DDUA 3TEJA 3QPCA 3ANSA 3S2ZA 2Y2UA 4KRXA 4TGLA 1WHSA 2Z8ZA 1QFSA 3D59A 4QZVA 4NMWA 5AOCA 1EB9A 5IVIA 4AO7A 3C6YA 2AJLI 3JYHA 4GXNA 4C4XA 4I4CA 1WPXA 2HRQA 1SCKA 3L1JA 4OB6A 3AILA 1ZIXA 1BS9A 5JZBA 4RE6A 3STWA 1QIFA 5K3FA 1X70A 5LP1A 3N0TA 4K2AA 1VLQA 5KWJA 1UKCA 1AC5A 5K3AA 3R3UA 5EHZA 5HFNA 1MPXA 4G9EA 2GYWA 1DINA 3H1AA 2JIDA 3AIMA 1XKTA 4HRYA 3Q0TA 2QMQA 4X71A 1XZJA 4N8SA 1TQHA 1BCRA 4OU4A 3WK6A 2ES4A 1UT6A 4WJLA 5A7GA 4YK7A 1XZGA 5HCUA 1FFDA 3AFIA 1CUGA 1E89A 1RWQA 2ZYHA 1CUEA 3NWOA 2YH2A 4F21A 3KOOA 1CLEA 5CXUA 2CKMA 4AQDA 5HF5A 3U1TA 4WCVA 4IO0A 3O9MA 4BCDA 5JASA 2HA3A 4Y2QA 3QM1A 3FLEA 1YS2X 3S8YA 1VZ2A 2ZSIA 3DS8A 1G5FA 4X97A 2HA7A 4BTLA 1XZMA 1MU0A 5K3FB 4OCZA 5CRIA 1JT2A 5CT5A 5BWBA 1GQRA 2DQYA 1LBSA 5DWDA 1SC9A 3C6BA 4UHDA 3N2ZB 4O08A 4OD0A 3GZJA 3C6XA 4TVKA 1R50A 2QUBA 5ALOA 5JD5A 1EDBA 3LIPA 4G4GA 1BE0A 2QM0A 5ALVA 3SWWA 6YASA 2DSNA 4WY8A 3MUNA 1Q0ZA 2J3QA 1QOZA 1HDEA 4BB0A 3CCCA 1LPPA 2HA5A 2XUPA 3LP5A 5HF9A 3G02A 2WILA 5H3HA 1VXOA 4YX9A 1DX6A 3AIKA 2PVSA 2WUGA 4BC0A 1BN6A 4QLAA 3HI4A 3PFBA 4ZV7A 4DNPA 3GFFA 1ZGBA 3A2LA 2GYVA 4BAGA 3V9AA 1E3QA 5FDFA 4CCWA 4KAAA 5HF6A 3RK4A 5SYNA 4IQ4A 4FNMA 4N5IX 2R11A 3B3QA 1FSSA 1QTRA 3T4UA 1ZD2P 4X6YA 3WKEA 4ETWA 1XZKA 3H2KA 5ALKA 3WQHA 3PDCA 1XRPA 2ZYIA 2VA9A 2CUTA 4XJVA 4KEAA 5AM4A 4PSCA 5LZ8A 2WG0A 4B83A 3ESBA 3C8HA 3BE8A 3OURA 4Y2XA 2ACKA 4H7FA 3ESDA 1BEEA 5CT8A 3GROA 1LZKA 4E15A 1UK9A 4EY4A 4HXGA 2XMCA 3UMJA 5A7HA 2AXEA 4MEBA 4XX1A 1OILA 3FCXA 2PBLA 4UBLA 2QXUA 1EA5A 3DLTA 2ZVDA 2VAXA 3QH4A 3H2HA 1JMKC 4QLOA 3FYUB 3WKAA 5FPPA 2G5TA 3DCNA 4C6HA 1VOTA 1WB6A 4C4YA 5HKAA 2V97A 2JGFA 5E4TA 1R3DA 4IH1A 5AI8A 1IUPA 4X93A
chains in the Genus database with same CATH superfamily
5IH3A 4ARUA 3JYLA 4X85A 4DIOA 2QT9A 3T3NA 2ZWPA 3A6GA 3W8DA 1RWWA 3QE4A 1GUYA 3H18A 3MJDA 1NNSA 5J1SB 2ZIZA 2P3QA 3QX3A 1RYYA 3L4BC 4TWAA 1F14A 3AJRA 2VLBA 4DA6A 2C8VA 1YJ8A 4M54A 1U8EA 4LDQA 5ISMA 1B6GA 4PZLA 4V02A 3PLRA 1RQPA 2IEYA 4GGOA 3AR2A 1XLWA 1JTFA 2JGDA 1QYRA 3T52A 2R5WA 5JAOA 2P1ZA 2I54A 1QYDA 3WLNA 2A9JA 3PI7A 2ZUVA 4FFLA 4L6IA 3E15A 3QK7A 1EG7A 1U81A 3OJOA 1KJJA 4HI0E 2ZUEA 3N05A 1SY7A 1XU9A 2G4CA 2QOEA 1JQJC 4AG5A 1WE2A 5E0KB 5KIAA 4LJ9A 1DHTA 2Y05A 4D82A 5JXWA 4QDTA 5L6LB 3QSGA 2XXJA 3AF6A 2FFHA 1X13A 4PC1A 5AI5A 4GDFA 3N39C 2JS7A 2OD7A 3CRMA 3RODA 1EFAA 4F2HA 3ESRA 4MRMA 4TT8A 3AJ9A 3M0EA 4HQ0A 4KQ1A 4G07A 1E1NA 2I8CA 4NMXB 1NW7A 5T8KC 3T4EA 3UJAA 1RRMA 2OVFA 1GKKA 4BKPA 1G6Q1 2LWIA 1DQZA 3KJIA 4HHEA 4K6HA 2VQEB 2P9QA 1RM3A 2WWWA 1V45E 4KAFA 5K45A 3IIMA 1GR0A 3NIFB 2GZSA 4OL9A 4YJ3F 1U0GA 2W6JD 1RLJA 3KSBC 2YHIA 3AU8A 5IKMA 3CX7A 3O2SB 4B7ZA 4GVPA 3QFFA 4PR3A 4DGSA 4KACA 2XVZA 1OBFO 2XYRA 2V5AA 1MT0A 4ZO6A 3X43A 2CNBA 4CU5A 2LKCA 1ORRA 2B1JA 2H7CA 3AOEC 3IUQA 1SEVA 1N5OX 3A25A 4QFDA 5KJEA 5DBGA 5TMDA 3VPHA 1B0PA 2ST1A 1Q1EA 1PYDA 2YWDA 3MMZA 1QYCA 4N7MA 1R18A 4QJIA 2ZWVA 3HXLA 1FNMA 4D4JA 3VAZA 1REQB 2H11A 2HK7A 3DZGA 3RSQA 3L43A 1K8ZB 5LP6C 1PFYA 1S5PA 3DOJA 4ZJYA 1MA3A 1V2GA 1XZAA 2QTZA 2D2FA 5GZ3A 4DV6B 1HI9A 2D0IA 1HT1E 2C42A 4FZ3A 4S0XA 5BPHA 5CFPA 4CM1A 4XW2A 4N4AA 1X2EA 1ZOSA 1SU6A 2C9YA 4D4GA 2WKPA 3JQAA 4WESB 1UMBB 3TEMA 2AKEA 1NY5A 2DOKA 2QRVA 5AO9A 3V4VB 3GLIA 4F3TA 2XDAA 4L0CA 3B1YA 3O8BA 3Q7EA 3KOYA 4PTYA 4L72A 3EFHA 3R3HA 1USIA 1Y8RB 4W99A 3V1NA 4H59A 1QANA 1F7VA 1F48A 1LSJA 1JA1A 1A9RA 1YKGA 2CJWA 3ZJTA 4EEKA 3N2GB 2FZWA 1JQ3A 4FDUA 4YGXB 5JTUA 3N0VA 2CLFB 1O6BA 1QYVA 3I6ZA 1RYDA 4X54A 5C8VA 2ZIWB 1ADYA 1L8AA 3IPXA 3NLLA 1PP4A 3H3JA 4M2LA 1K2VN 4MK4A 1IWPB 4UUQA 3TLAA 4BLRA 4AY6A 3SCZA 1C80A 3PXUA 3TW4A 2Z8YA 4RENA 2V98A 1MPTA 3BTOA 4JB8A 3DGFC 2EBWA 3TTSA 1L1EA 3W05A 3EODA 4MR8A 4GPD1 1OKKA 2ARKA 1J2TA 2RHCA 2COUA 2YMPA 5CA0A 1P33A 1LBIA 4P5DA 1VLZA 1LTHR 2FQQA 2PHZA 4TYPA 2WMDA 3UAOA 3M4YA 4GIBA 1NW3A 4LOAA 3NT5A 1ICEA 3EJ6A 4W5HA 1KP9A 5JT1A 2FN4A 4CM8B 4YAKA 6CHYA 1MOQA 3RV4A 4GM4A 4QRIA 5AJVB 2Q5JA 3DCIA 3VNBA 1D4OA 4URZR 3HBFA 1WV0A 5CLHA 2O8FA 5EMNA 1RMQA 1V25A 5B2ZA 1DXOA 4MVJG 3GCDA 1KJIA 1SCIA 4X1KA 4YP1A 2VTBA 3EMVA 2VRCD 5AW4A 2GBPA 2ZJ0A 4B6RA 4BNMA 3RI3A 2RGWA 4CF5A 2C4MA 5JXJA 2R6CA 4MV4A 4WJKB 4YCDA 5ALXA 4R1NA 3TGWA 5JCOA 2BR5A 1A0OA 5AUNB 1LLCA 4MZXA 4O0MA 3O8RA 1N2JA 2A9QA 3VNSA 4JI5B 3RVMA 5D5PA 1MH1A 1KETA 2XT0A 3BMNB 1FRZA 2AMFA 3CINA 3D2BA 3IEXA 3UF0A 5C7LO 3B1WA 3RAEC 3EPRA 1DCTA 2QD1A 2CXUA 2VXYA 4HGOA 3RROA 3UKDA 1H8EA 2QL9A 3CYFA 4AJKA 1X7WB 4MHSA 5E3HA 1UMKA 4WBNB 1Z47A 2DWOA 4ZGBA 4PNHA 4WA8A 5GZ1A 5J2UF 4DLYA 4DJAA 3KVYA 2PXCA 3ZKAA 4NCAA 4KHZA 2ZUTA 3A05A 5JWHA 5BVHA 3C2QA 2XTMA 2R6DA 1RPZA 4BO7A 1ZS9A 4QNNA 2OHGA 2Q5FA 3LZCA 2GHQA 1I0LA 2G9RA 1HFEL 4AVYA 5J4HA 3QI2A 2B82A 5LC1A 2GEJA 2EFEB 1ZN7A 1B8OA 1FFXB 1CZKA 2FSGA 2VP3A 4ZZ3A 4HN2A 3W8RA 3VPGA 4G4SO 1PRYA 1JHUA 1LC3A 1TPZA 2IXTA 4LHSA 2AOVA 2I80A 4D0SA 1VCOA 1OW3B 1XCLA 2BP7A 2JLQA 3KQYA 4MR7B 5IC4A 1FUUA 4KWTA 3M8KA 3SI7A 2FZKA 4CGZA 5D3QA 5IT0A 3G8CA 4GBMA 4CT4B 2UZ1B 4EY5A 4R0VA 2I1WA 2EJBA 3AY7A 1GPDG 5FF9A 3D54D 3KDPA 3W1VA 4PLGA 4LOHA 1IZ0A 2AXNA 5F64A 4IHJF 3VR4A 1IIRA 3LOQA 1OC4A 1Y9DA 4UUPA 4RO0A 3SKYA 1AMOA 3TPCA 5B53A 1TTTA 1F38A 5CXQA 2MU1A 1QGDA 3QMMA 4MEAA 5CW2A 3O26A 4JBIA 2Q27A 1DFHA 1U1CA 4H4DA 1E62A 3LE8A 2VJKA 1U4SA 3ZG6A 1JHAA 1GEEA 1GGJA 2ZXFA 3JQFC 4PLCA 4NBNA 1FDTA 1DDOA 1PT5A 2QS9A 3V5NA 4DJDC 4EJ6A 4OX9B 1MQ8B 4EVSA 1QF6A 1EM8A 4LNHA 1Z0IA 4DA9A 1EFPA 1WDMA 1AE1A 4ND3A 3EXFA 3A9WA 1GPLA 2HJHA 2OESA 1Z4OA 3BXXA 5KC8A 1KPGA 1W5TA 5HIJA 4ZKDA 4I5IA 2AF4C 4RD4A 4MWTA 2ZR8A 2EJTA 2AL7A 5DGXA 2RAFA 1ICIA 2HDHA 1YJXA 2Y0CA 2CHQA 3PVSA 2EIXA 1LK5A 1ND5A 4DC9A 1UWLA 2ZJZA 2H0QA 3BMOA 3CC8A 2HCRA 3I6QA 5EZYA 4ZMBA 2HNBA 1RLIA 2C77A 3MXOA 2HO4A 4GP6A 2I8AA 4E30A 2JFYA 4H6VA 1J2YA 5AM3A 3BK2A 2OFPA 2ORYA 1DEXA 1CZUA 1VMAA 1B74A 1NL3A 4R2KA 4C03A 2BGNA 4EIWA 4OLAA 1RTTA 2FW9A 1G6KA 3LHFA 3SBXA 5ICFA 3ZZNA 3H84A 3KETA 1WEHA 1ZN8A 3CMCO 1FVXA 4JGGA 3FPJA 4RVHA 4J16C 1F7UA 1T1RA 2OM2A 1IJFA 4MQUA 3B5EA 1ZIDA 4DCCA 1BO6A 1NV9A 4EYSA 4NEHB 2YXPX 3SFTA 3S99A 3DONA 4BB6A 2W2MA 2XSZA 1PR2A 2WW8A 2O0HA 3K2BA 3PHBE 4G86A 2XDQA 1OFUX 3MWLA 1KRXA 2Q2NA 1XMPA 2XYHA 3O3NB 5ALUA 5K5EA 1FNNA 5L3QA 1SBZA 2AS0A 3GFRA 3E53A 3Q8KA 1GJRA 3TINA 4K6KA 4IJ6A 4N0DA 2P69A 1ZBDA 2PKRA 4GL4A 4ZI5A 3UK1A 2CLIB 2VPZA 3QMVA 4RSGA 1Q84A 1J99A 5ER9A 4RLSA 4YRLA 4F86A 2W00A 3QFCA 1CF9A 3PC8C 1W87A 1BDHA 5DM1A 4II7A 4YJ2F 5A5GA 2O9JA 2KX7A 5IZCA 4RM2A 4POAA 1GZUA 2BFOA 2QD5A 1FOEB 5IW8A 1B2LA 4CV3A 3H9BA 1WOMA 2Y0EA 1ZD9A 6AT1A 3E9MA 1ISRA 3UANA 1DPGA 2O19A 2GS9A 5T41A 4MMXB 4OOFA 4R1QA 1PD0A 3HYSA 3ZHRA 3O95A 5HMLA 2ECFA 1DQYA 4G65A 4WAUA 1DAFA 3N2NA 3A6PC 2ZBVA 3ZHVA 3HV2A 1Q1BA 1EZ4A 2FRDA 1KFCB 3BRWD 1IXSB 3T3IA 3T5AA 5IUNC 2J9FA 1BGXT 4C4RA 3E18A 2B9VA 1R16A 2FR1A 2PNJA 3EMBA 5KNDH 5BVGA 3JVVA 5HWSA 1WMSA 1HOTA 2ZRCA 3AWDA 3RJ5A 1E2QA 3TD6A 1EXVA 2R7MA 2REBA 3A3OA 1E2NA 2D8MA 4HZUA 4GEKA 2WLSA 4MXDA 1G60A 2WF6A 1SUFA 1DEOA 3S29A 4CMAA 2E4VA 3AUYA 1FRVA 2O2GA 1QE0A 3E9QA 4RZ3A 2PA0A 1EVYA 2WU1A 3DGEC 3Q11A 4G6ZA 4HPXB 3QENA 3ETNA 4JH0A 4L6AA 4MV1A 1UAYA 3JAWB 3BRQA 2UYOA 2IYWA 1E66A 5IG2A 1T8TA 2G77B 3ZGLA 1D6SA 4X7MA 3D3KA 4FR2A 2DPGA 3ZZMA 4D4LA 4IKEA 3TMKA 4BY9E 2QTVA 3PQ7A 2X4GA 2NU9A 1SPXA 1ZJ6A 2AI3A 3IUYA 3KB6A 4WGFA 2PRJA 2BH9A 3URMA 1QGUA 4DVGA 5AKIA 5A04A 3BDVA 3QELB 2DKFA 2BF7A 1AKQA 3G8YA 2PS9A 3Q1KA 5F4BA 3B60A 3C3AA 5JOQA 4ZYLA 1Q74A 2VJBA 1XVIA 1BOFA 3KYCA 1BVYF 3Q7QA 4IRUB 1C9NA 3S70A 3NWEA 3P9IA 3A6DA 2PMDA 4G1EB 4RHFA 3EEBA 2FSHA 3PICA 1W85A 3A3NA 1CEYA 2PRZA 3VYSB 1QOPB 3P0FA 4F1KA 2A5FA 1KP3A 2AMLA 4LK2A 3DXYA 4NHEA 1KS2A 2ZSEA 1EK6A 2OZVA 1FFGA 2W2LA 4J1TA 1Z13A 4FYKA 1CDOA 1PR3A 2BGIA 2QW8A 4NHOA 3SR0A 4OM8A 1J70A 1UBEA 4D9FA 1LSUA 4I9NA 2Q9UA 2JHPA 3GI1A 4IL5A 3PIDA 4QGHA 3CLRD 4G4IA 4FKBA 4ZODA 4A0QA 4E03A 5DHQA 1WXXA 2HMSA 3GIWA 1A1VA 2CHEA 4KLZA 4D80A 3EUEA 2JGMA 1J0EA 4CYMA 2EKBA 3FMIA 1NNUA 3HJTA 4WESA 2IU0A 3C43A 3PEEA 4J7CA 5GQSA 1GL6A 4PZEA 4BMXA 2Z9DA 3CF4G 4GWKA 3DD5A 3GLIE 5BXYA 1DTWA 5CVEA 3ZTWA 1BH2A 4TMKA 1BE8A 4XGNA 3F9RA 2D6FA 2EX0A 4CLEA 3QF4B 3A31A 1OYWA 1PTJC 3OEHA 2HK6A 3DBRB 1UZNA 4LVOA 1R5JA 3EEQA 3K0FA 3QLTA 4WEQA 2I6TA 5FBHA 1SVWA 1POWA 2OHIA 1LW6E 5BPFA 5DX1A 1ZZEA 3KQKA 3AEUB 1R8XA 1JGTA 1W52X 2N47A 3I6BA 4GWLA 4MROA 4MGHA 2WF8A 4Z8YA 3DDWA 1EB8A 3CURA 4EDHA 4DR3B 1TZBA 1V5GA 3R4VA 1LPBB 3EBOA 4ZQIA 3OF2A 3PUZA 3QU4A 5AHWA 4CMCA 4CMKA 4MJXA 4DEYA 3E03A 4Q5IA 1V16B 3B6KA 4CDGA 4Y8VA 3NEYA 4M0CA 3ZWBA 7ADHA 3ZI7A 4PXYA 1ODTC 4UATA 5DE3A 1OQAA 1L4FA 2HB6A 2P2LA 2XVXA 3HA7A 2XUOA 1JSRA 3UK7A 2VVTA 2DPMA 3K4PA 4NSNA 3W7BA 2C9OA 5CA0B 5JWRA 1UPXA 1I8TA 2YHSA 3GBVA 4JA0A 3ZCXA 2MSWA 3ZY3A 5CEFA 2N46A 2C7VA 1JAXA 4NY1A 4LOJA 4BQRA 3FZNA 4NNOA 2BDEA 1OWPA 4TXHA 1ZAKA 4XQEA 3X1WA 4FDMA 3VV2A 4AROA 4BJ1A 5HUHA 2LV8A 1T0PA 1N5IA 1GT6A 3R6DA 2NPOA 4FQ8A 4II2A 1THTA 4OHVA 2CEKA 5JNTA 1YU6A 4CG3A 1ARZA 1QNFA 2W2NA 3SHVA 9LDBA 3IELA 1JYSA 1XF9A 4FHZA 4G26A 4HBZA 3AF0A 1C9YA 3ONFA 2PZKA 2HPHA 2OECA 4N0MA 4L78A 4BMCA 4ES6A 4RTQA 3LU1A 1E3DA 1QZZA 1EIWA 2EV9A 4BAUA 4OFXA 3OPYB 1Z5WA 3D6UA 4Q1FA 1HZJA 3RSSA 4YXFA 4NX2A 2P2ZA 1X1CA 4HBGA 2RIRA 3I04A 3LUAA 2HHCA 3H9JA 4JA2A 1QG4A 4O29A 4P3KA 5BSGA 4IJUA 2NZ2A 1DQNA 1F8XA 1J23A 2JI7A 1TCAA 3IQFA 4I4TF 4E4RA 1FZQA 4QNMA 1ZGHA 2O57A 4OM7A 1Q91A 5T6MA 4W6ZA 2W90A 3CTPA 1VP9A 2P78A 4MGEA 1MC8A 3JD0A 3O4FA 4N3NA 1R27A 2HDWA 2NNLD 1Y7TA 4P2GA 1M6VA 4HNAA 4BNVA 2A4KA 2HSEA 3GZNA 3K7EA 2QQEA 4FSXA 1GSAA 1X8KA 3ZDRA 3BFKA 5HOQA 2YWJA 3D4NA 4IH4A 1Y4ZA 2ZSBA 1OAAA 1O0CA 4JQYA 5KDLA 3OZVA 3P2KA 4YRQA 2RGNC 4MGYR 1BCRB 3GUYA 1KJWA 1Z2EA 4OYRA 3RW9A 1KORA 2CUNA 2PANA 5T64A 4OP3A 1ANKA 3QKUA 4QUHA 1LGYA 3ZUPA 2BGKA 2JLAA 1SKYB 1EVQA 3KEFA 2A8YA 1DU4A 3KKPA 3QKSA 2WJ6A 3UMRA 3HI6A 2AD5A 2EDCA 1A72A 3R7NA 1AURA 3GRPA 1EUCB 4DOMA 5K05A 4YH1A 2FSFA 3JWPA 5AI9A 2QQ5A 2QR5A 4EG4A 1N92A 2AOXA 5M29A 4PN7A 1AX9A 1BXGA 3LXRA 2P5SA 4MICA 2Y4NA 4LZZA 5EKDA 4HUJA 2H1CA 3TLGA 2A1IA 3DFIA 4DMHA 4REMA 3LLVA 3PWZA 4YAUA 4J6EA 2IU3A 1FMLA 2I7VA 2JGAA 1WA5A 3BIFA 5BWNA 5ICCA 3GEBA 3TFWA 2QX9A 4K9PA 3PRJA 3KQNA 3V7YA 2X86A 1Q3TA 1DFIA 4YJHA 2OYCA 1VCMA 2AGVA 2P27A 2GA9A 2WM3A 3U5TA 3W4KA 2V03A 1KAHA 4ZV9A 2QL7A 1W59A 2QYTA 2VP6A 3OE7A 1RAHA 1ISSA 4K9QA 4M38A 5JNWA 4C88A 3L79A 3GGJA 4GRIA 2ENUA 4FYJA 5FNZA 5IPFA 7YASA 2VAPA 4NECA 4NNPA 4R1UA 3QJGA 3G2PA 1QFXA 4OQQA 1U2QA 4YA6A 3IR5A 2PUAA 1VB5A 3PPYA 4LY9A 5FQNA 1MIOA 4E22A 1LVHA 3IDZA 5FO1A 1F9AA 1TIKA 3JD3A 1T0UA 1ZJJA 3N74A 1BMFD 1XTKA 3NIBA 4YQZA 2LIVA 2JCBA 2GEDA 2JGNA 2XNKA 4TQ9A 1UBRS 1T1JA 2YVAA 1P1CA 2J0QA 1NYTA 4YMTA 2DR2A 1YRAA 2AMYA 3SP1A 4Z7NB 4Y6SA 3NBXX 4RHCA 4PX9A 1YB6A 3OTHA 4NOKA 2GPJA 4ZEMA 4CM3A 3J80A 3ODGA 2P2NA 2XF8A 3IAM1 2GAAA 1U65A 2FMXA 1A9TA 2J41A 4E2ZA 3RYCB 1AK9A 1D4FA 3R6TA 1QF9A 4QUJA 3K4QA 2Z2IA 4UTOA 5TT0A 2JJ2A 3L7NA 3RRMA 3VUFA 4BAZA 4JEIA 3BDAA 3PRYA 3T3GA 1G5RA 2QB5A 2C1ZA 2FF7A 2OV2A 4KFUA 5TB5A 1XZBA 5B6JA 2IHTA 1CUSA 2R84A 3IP7A 3LUHA 2CMHA 1H22A 1WD5A 2W2TA 2AEEA 3BF8A 4M8KA 4E07A 3FN4A 2PBRA 2IYSA 1Q12A 2GZHA 1OXUA 4KRGA 3LBYA 3ODPA 4UZSA 4CIBA 3A6FA 5AW6A 4BLOA 1H9AA 1XJ0A 1YUNA 3VKGA 2BFFB 3G0DA 3I5UA 5CGZA 4K9NA 1C3XA 4ILEA 4DDKA 5CM2Z 2NYUA 1YHZA 1TGYA 2A14A 3OA2A 3U80A 1LDMA 5AM1A 2P9HA 3O1HB 2Y92A 3UNXA 1FNDA 2P0AA 5AKEA 1M8FA 5FHRA 4CF4A 1A9QA 2EP8A 2PS0A 4DWVA 1AKUA 1KS9A 4A6XA 1OE0A 4RTOA 1GCAA 1MEOA 5K8UA 1CUDA 2A86A 1ID1A 3CPSA 3D6JA 3K09A 1SHTX 1VLHA 4RZXA 4U0JA 4Q01A 3SF8A 4AJ1A 3IPCA 3WLAA 1SHZA 4ZGGA 1TB4A 3TZQA 4LXYA 4LCJA 3PVZA 4FSHA 2ETXA 3TL3A 5JAPA 9LDTA 1I3MA 2W58A 2Z6AA 4ASUA 1Q22A 4PFSA 2ZIAA 3L1HA 3WZ2A 2WNSA 1KJNA 2N0SA 3BK1A 2M9MA 2Y27A 2QA5A 1G8JA 3G9XA 1U2GA 2QUKA 2V9CA 5E2IA 3BCUA 3GW8A 5K0NA 4BVGA 4DLXA 4FFBA 1P2BA 4K0RA 3ECCA 4QHYA 1R0LA 3WA6A 1XTQA 1QK4A 1WB5A 1YBMA 5D85A 1AIPA 3EGIA 3BSFA 4OQXA 3NYRA 4EYOA 1CJKC 4UTRA 4KGXA 2EARA 3N2KB 4AY4A 3PC2A 1JLKA 1WR8A 1GUFA 1EFVA 3BGSA 1XRRA 4AAYA 1R5BA 1MW9X 1GNSA 1UPFA 1RJ9B 4X7RA 4OL0A 2VOJA 4M8NE 2Z8YM 5FBZA 3DLCA 3FKSD 3PL1A 2W6CX 4MKZA 4OXQA 4Q1DA 4TV9F 3SR4A 2QHXA 1E1RA 5F73A 1AKRA 1CQPA 3OPNA 3X1ZA 1M0EA 1KMCA 5CHYA 4OUDA 4KXFB 3VNRA 5G4KB 4K9KA 2WK1A 5D86A 2QTTA 1D03A 1KMQA 5E7JA 4ZU6X 3M49A 1SG6A 3BC1A 4INAA 1EPUA 3N70A 3O73A 5JSZB 1TT5A 1N1DA 2CFIA 3MQ2A 4HYTA 5CMLA 4H15A 1R7RA 2EJVA 4QGSA 4R3NA 4JLPA 5M7EA 4XX0B 3RTBA 1W49A 4MUEA 3WS7A 2YCLA 3ZGZA 1XZFA 1S7CA 1G5HA 2B30A 3OJWA 5ALGA 1A97A 3T61A 1FUIA 3BJEA 4D0LB 2VYCA 1Z2PX 1GU0A 1Z6YA 2BKEA 1C1XA 1F60A 2EHJA 2D4AA 2J59A 2ZKIA 3HLTA 3BJIC 4X94A 1ETHA 4MS3A 1JFRA 1EU1A 1ZOPA 1B8VA 3N87A 4YIKA 2DSTA 3CWZA 2XE4A 4OYLA 5AIBA 1ZNWA 4AKSA 5EXXA 3ELWA 1NVMB 3ETLA 4BQIA 1XZIA 4HAYA 2WFLA 5SYAA 4GD3Q 2B8EA 2X1HA 4HN4B 5G53C 2B8JA 3SDSA 3TG8A 4LJ8A 2PBFA 4URWR 4WFIA 2YL2A 3FBGA 3KKMA 1Z4QA 2V74B 3IQGX 1R37A 1JQ5A 2XYVA 1CNMA 4AKGA 1JDTA 3WIOA 4KQ6A 1YR1A 4K2HA 4DNFA 1YBVA 2VJNA 4J2OA 2ODPA 2ZRBA 1D1QA 2BIFA 3DF9A 1FU8A 1UMCB 3L4KA 3WNDA 1F8GA 2GBGA 1UJ5A 5FP0A 2BMEA 3C3WA 3K0CC 4KMRA 3I2JA 3HS3A 4Z4EA 3HEBA 3HSKA 4Q1EA 5EP3A 3PGLA 2VF2A 2ZSKA 3OF3A 1MNAA 4WXYB 2HSZA 2JARA 4RL4A 3PEFA 3REFA 4JI2B 2XCQA 4OX9Y 1G41A 4BO0A 5CJ2A 1CY2A 1TW3A 1VECA 1W2GA 1ZVQA 1XL0A 4CFSA 3L46A 3ZQUA 2XMZA 4UUAA 2WUWE 4C4ZA 4Y6GB 4BE4A 2H4HA 1E3WA 3BKWA 1AKYA 4W8HA 1UBUS 3RQSA 5DW0A 3QSYA 3ENZA 3HYCA 3RC7A 5IKEA 1NSFA 1GFWA 3DW3X 4HGQA 1WDLA 4AG3A 3O1LA 4TWZA 4WKPA 4NARA 1UP7A 3WGIA 4OLHA 3W2TA 3DKKA 4QU8A 2A94A 4OXRA 1LVUA 4ZP1A 3MIZA 4REOA 1JXMA 2GJSA 4ZVKA 5F3WB 1BH6A 1JIQA 2HWWA 3UFXB 4RJLA 3AR5A 4UFOA 1UBCA 3STYA 4BQSA 2KMLA 1I1OA 1ZCZA 1T10A 4H7DA 2QMEA 3PIIA 4QBIA 4FFVA 4ZVRA 2Q2VA 5BQ5A 3ZDFA 3CVOA 4NOMA 4R5MA 4B17A 1QWOA 4KSYA 4OHOA 1FJ2A 5E1BA 3IJRA 2QTCA 2ZBFA 4HS4A 4WK2B 2ZYAA 3AR9A 3A7DA 2OBBA 4A0HA 2W9XA 1EXWA 2JRLA 3FMPB 2HIGA 3D5QA 4QEKA 5JV5A 4MP6A 3D0KA 3JVUA 4NE7A 4HQLA 3IJEB 3O4GA 4U63A 4B47A 4E7PA 4MJLA 4EVRA 2V7QD 4EGJA 5LU8A 2CNWD 3NVDA 3PUWA 1YZ3A 1GRNA 3B7WA 3Q3IA 3SOZA 3JWGA 5JAMA 2UUCB 3HXOA 2QVXX 3BD8A 4JUDX 4INPA 4QIHA 3VTKA 2Y2VA 1X42A 4JU8A 4ZRNA 2AV6A 2V1XA 1V4VA 2X42A 1GG2A 3NDRA 3OCCA 4HWTA 4X20B 2YFQA 1Z73A 5DNDA 4ZHQA 3TR0A 3S6JA 1ULUA 2H8GA 1OFUA 1ZQ9A 2A0YA 2H6EA 3MBOA 4FOLA 3ROMA 2ET6A 3QJ5A 3PG5A 2MIIA 3V4ZA 1NKTA 1B2RA 1XF1A 4PBTA 4K1LA 2BGUA 4US2R 4FOOA 3KYDA 1C3OA 2WFLB 1QP7A 2XGOA 5L53A 1V5FA 1KO8A 1G9XA 2XNDA 3W7VA 2VSQA 2ZRFA 3ND9A 3D7MA 4KIFA 5A2GA 3V8NA 1TAUA 5FBRB 1CUVA 1MW8X 1NVFA 2RONA 2ZWOA 4FHGA 5HKBA 2CVOA 4FW8A 2YVUA 3LLSA 2B61A 1MAHA 4XQ0A 5DZSA 5AJXA 3TZLA 4EA9A 4UM7A 5KDOA 4FGUA 2UVDA 2XMDA 1PJSA 2DPXA 2AKYA 4BNJA 2GHTA 2HF9A 3KALA 3KVRA 1PR1A 2E87A 4XEUA 3LKVA 2H51A 1OXKB 1Y8CA 1K7FB 2WM9B 3WK7A 4YJ3A 4HGRA 6GPBA 5HM8A 5JBNA 3E84A 4QU5A 1BWSA 3MUEA 5EQDA 3INGA 5DLDA 2V5VA 3HL4A 2E0IA 3LDAA 3PRHA 4JL6A 1SFRA 1UR5A 4BYMA 5IZ4A 3WA7A 4CLRA 3MINB 4UVHA 2IVFA 4TXNA 3WWPA 3DMFA 1PQUA 1X1AA 5E4JA 2ZYTX 3E2IA 1GZDA 2NAFA 3CW9A 1IRIA 5DU2A 3W5SA 3HYLA 1ZKMA 4WH0A 2IT1A 4F7WA 4C43A 4MW5A 4G36A 3ZWKA 1R0BA 2NYAA 3DAPA 2B36A 3HU1A 4P4UA 1JLHA 3JWJA 4G5HA 1IJKA 1GM5A 1UWKA 1XJ5A 3U1BA 1K7YA 4DV0B 1RXUA 4D6YA 3AF4A 3DBIA 3F6SA 3FROA 1WY7A 5K03A 2H92A 2GJ8A 1GZ5A 5FO0A 4B4KA 4MLPA 3CW8X 4C3OB 2JJQA 3H2YA 3AGPA 3KOZA 3FRHA 3NIWA 1WW2A 3ADPA 1YH3A 4Z1MD 4TVOA 3SM3A 4INJA 1SVMA 3S28A 3CVUA 2ZAOA 3GBPA 2FUNB 5DLPA 5B3JA 4AKHA 4JI3B 1W5SA 4XAQA 1FXSA 1FLNA 4MQMA 1UWVA 4PAQA 3I83A 4RIGA 3PQFA 5IUKC 3W6PA 5EOVA 5EE1A 2J07A 2R97A 4W1RA 2O2EA 5F5XA 5KJCA 1YR9A 3ZZTA 4MR8B 1PJ3A 2OAQ1 5H80A 1T4DA 5AVOA 621PA 2F8MA 3KHSA 3DUFA 5F3RA 2RCNA 3V32A 4D56A 5BORA 3AVOA 2QSYA 4M1TA 3VV3A 1JVBA 1Q1QA 2DAPA 4BFYA 5IDXA 2BCEA 2YXDA 4N9WA 3ND5A 2DETA 4RZ2A 3V4LA 3G6KA 3YASA 5G4LA 2EF1A 1RI5A 5A06A 2DUMA 3VUEA 3C6MA 5KTKA 1VSBA 1G17A 3HM2A 3KVNA 5JARA 3B2EA 1EDZA 1ADFA 2OG2A 4TKUA 2JG3A 4COOA 2O1WA 5AVKA 5KTRA 2O0MA 2XCLA 2YJ6A 4ESOA 2ZJ7A 5LD2C 3N5KA 5EUMA 1NUPA 2GKSA 4AXBA 1TK3A 1ZHFA 4CCYA 2ZBPA 1ZEMA 3L3BA 4JROA 3AJ8A 2C8LA 1VE3A 2HREA 3L7DA 3MSXA 5TS3A 1DCKA 1T4MA 4RY0A 1ZNQO 2VPXA 4DCPA 2Q6OA 2WJ4A 2XDWA 2CL5A 2C2XA 3RE1A 2Q41A 4GXQA 5DFAA 3F6YA 1OCEA 3MLBA 3UUWA 3DO6A 3VZBA 3TXAA 2RK6A 1F8UA 3HLKA 2FPSA 4YJ3B 4JIMA 5KYVA 2VRBA 2O4CA 4ANFA 3LO8A 1TXGA 2H2DA 4FFRA 1XTPA 1V9CA 2ZGVA 5ES4B 1OFVA 1E6MA 1CQXA 2POQX 4KSBA 5ALFA 2PMWB 2VCYA 3A3PA 2OCIA 2W4IA 4KTVE 3LT4A 1JLLA 4M1MA 3AHHA 1CY4A 5K3EA 3IQIX 3T1QA 3ZV5A 4ALNA 3S2FA 4PQYA 2VP9A 2HF7A 4I99A 3WADA 5I4CA 5JRZA 1T6XA 1XHLA 3FLAA 3N0WA 4OU5A 3HO6A 1TO2E 1VI6A 5CYGA 2JGJA 4KGDA 4OGKA 3U7QB 2I3DA 4D4KA 3DE5X 3EW9A 4UEOA 5TQ0A 1NIPA 1T9ZA 3D8HA 4RA9B 4TTQA 2VWGA 4EGFA 4ZK6A 1A88A 3I53A 1KFJB 4NFYA 3LPCA 3WTCA 2HN9A 3WI7A 1UDAA 3L0ZA 2F48A 2NLOA 3QUCA 4AY2A 2C7RA 4AN4A 4OUDB 4ZOEA 5G4KA 5EIBD 2OMKA 4N12A 2PMEA 9ABPA 2WE8A 3GEHA 3IMFA 4M7OA 4R98A 4FQ7A 4LK3A 4FOTA 3E9RA 1U8TA 1JUDA 3C0KA 4MHTA 2CHUA 4CM6A 2LCQA 1VKZA 3TQRA 2ZM5A 5M2QA 2VXCA 1Q7RA 1OH8A 4HAOA 4PAGA 2YC2C 5HKKD 3QPDA 2WSBA 1KFKB 1U5CA 1WHTA 1O95C 3MRXA 1CHNA 1DQSA 3PZRA 4MWSA 3MD9A 3MCTA 5JQWA 2OQIA 3LCVB 3V6MA 4UD2A 4EW2A 2IYTA 2AHRA 2G5PA 3GQBA 4RD2A 3S27A 1BHSA 3MN1A 1R5OA 1W8IA 3BZBA 4QQKA 3ZWWA 5FLXA 1NT4A 2X14A 1KAEA 4Q1BA 5H5JA 4RX1A 3QFHA 3H2SA 4NBTA 4DXHA 1R9JA 3LOUA 4RIHA 4ER5A 3TX6A 3EVGA 1SUWA 2AZ4A 3Q98A 4TRNA 2PYZA 1HG0A 3FW1A 3NHZA 3P94A 2P68A 1EP9A 2VK8A 1QVWA 4IIYA 3SQOA 4OY3A 4QEDA 1Y4AE 2IX3A 4QJBA 3AF1A 3BA6A 4GOXA 5JVDF 1U2RA 5IM5A 2FX3A 4K0KB 1VHJA 2I33A 4Q7QA 4S2UA 4CKZA 1H6CA 3O8OB 2BGRA 4QYMA 4HWSA 5DASA 4KZKA 1WV1A 4LF9B 5CFQA 2YX1A 1BKDR 3BGVA 1DWQA 1NA5A 3FTQA 3DR5A 3GFOA 4JR1A 1DX4A 1DQRA 4HATA 1N6HA 3I4FA 4OHXA 2GRAA 3R7AA 3BICA 4K6MA 4ZCSA 3Q2OA 5IVKA 3B6EA 4I0WB 4ZVQA 2DJ5A 4WDRA 3T0IA 3DVAA 3MILA 2J5XA 4QDXA 4FEAA 5AQ1A 1ZSNA 2EJUA 2XDQB 5L95A 1QBKC 2AG8A 3HN7A 1CNEA 2COEA 2O7SA 3RYTC 5CBPA 1DKRA 3DZIA 1WW8A 2XBUA 4I6EA 1YFKA 3DLPX 1NGSA 1SD2A 4Q1AA 5A4AA 3K6SB 3UAWA 2PSFA 5DDIP 5E4FA 4H7HA 1L9KA 2NZVG 4XLLA 3T1YB 1ZU4A 3L92A 1SUIA 4OK3A 3E1KA 3TDKA 1X8LA 3EUFA 3UFBA 1NUSA 1L4EA 1TOAA 2OHOA 3I34X 2F43B 3B3AA 3MWEA 4WN3A 1KQNA 3WDLA 5E7IA 1K5PA 1RYMA 1SC4A 2GT1A 4Q3LA 1MB0A 3TIFA 1KGDA 5AVJA 5HJ7A 4I81A 1E61A 1K5HA 3P2MA 1WOYA 2Z83A 3ZGXA 1KQOA 2GPAA 2O14A 1VA5A 1X6VA 1QH1B 4UHEA 5LZ7A 3HDVA 4AZVA 4PINA 1XZ8A 4L4RA 2FX2A 3H2JA 4FCWA 3UN1A 1T2DA 2YN2A 5I9BA 4ASUD 4BRZA 1Y8AA 1KWKA 1R88A 1KK0A 3DA8A 3RNOA 1A1SA 4DQDA 3EULA 1W9MA 2ZRDA 3D6HA 1T8YA 2GWRA 4RJ2A 2RGCA 4ODIA 1BKSB 2IIVA 2ZRMA 3AKCA 4RFSB 2X0EA 1N0IA 2ESRA 1WLYA 4OXIA 2QL6A 4HVCA 1N2OA 2EF0A 4LYDA 5EZYF 3TD2A 5HS4A 3LT1A 1BMDA 4IF4A 4MA0A 4TLAA 5C4MA 5MGBA 1M8KA 4GX1A 1VRWA 5KQLA 3QYFA 5DGIA 2C1XA 2WHRA 2HAEA 1ADJA 4MRVA 4JJ6A 3OFJA 521PA 1ISPA 4GOKA 1PSWA 1MGPA 2ODWA 5HFAA 3RJZA 1SN7A 1P7PA 4GM0A 4NCIA 1KZYC 2WUDA 2XBMA 4JQZA 1J90A 3T9CA 1HC7A 4Q4AA 2I4NA 2VC2B 4RK0A 3T7EA 4Q16A 3TTVA 1WXFA 3BIOA 4BFLA 3DKIA 5TS2A 4I46A 5JC1A 3ORRA 4IDDA 4OHFA 3U19A 3L6UA 4JENA 2D00A 4N3GA 3R7BA 2W93A 3UMFA 3PYLA 3T35A 1JJVA 3V80A 1VE6A 3ZCRA 3C1AA 3EXEB 3PDJA 4PM4A 4DJTA 1NF2A 3UGTA 2R1VB 4HAZA 1RTKA 4M9XA 1Z0SA 2C5LA 4Q3BA 2PSEA 2HGZA 4FINA 2QJFA 1ZM7A 2ZUDA 4JGBA 5JZ9A 1D4AA 1WUJS 2OD9A 3JPYA 3RR2A 7MDHA 1U8UA 2NUTB 2CNNA 3E1SA 2REQA 5F12A 3S5UA 4CKBA 4X60A 2A5DA 2VT7A 2CZQA 2XD4A 3DULA 3ENNA 5FI0B 5CBPB 2LE0A 4HMOA 4RA6A 4BYGA 1PLLA 5J4LA 2E3JA 2ZIGA 3OM1A 2FDXA 3KQPA 4WOPA 3LXXA 3OZDA 2NUBA 3WBFA 1J9GA 3NQ41 4Y2SA 3IT3A 3TPZA 2YY5A 2ZSUA 2Y76A 4WOCA 1GUDA 1XD9A 1Q11A 1QS0B 1U0OC 1YUMA 3O0TA 1FTYA 2Q4BA 1UFKA 1JPJA 4YRDA 1I13A 4UHJA 4EPVA 4IICA 5FHQA 4TTSA 5ANRB 3GT3A 1LTQA 3EC2A 3KIPA 1GARA 3N8IA 5BN1A 2YWEA 1JHOA 2ID8A 2NZJA 4EI8A 2NAPA 3LCMA 5ICSA 1A3CA 2Q5HA 2FZ5A 1E7SA 1RPTA 2GPWA 3QVOA 4PVCA 2HL6A 2ZB7A 2I78A 2IOQA 1IN4A 2PN1A 3PYXA 2FB9A 2FLVA 1Q0RA 2FY8A 2Q29A 2QRLA 1GTL1 1P44A 1PG2A 1HDGO 2ODAA 2P9FA 2X4DA 3OY7A 4K5QA 5A9RA 5LR6A 4Y3UA 2EL9A 2MOKA 3KO8A 3JQ6A 4N48A 1BG6A 4F3RA 4YN3A 2CB0A 1HTTA 1DOAA 4K9SA 4DSZA 3P19A 1ZK3A 3HB5X 3ZBQA 1PLKA 3U48A 5KB3A 1NURA 1ACLA 3F1KA 3LQ4A 3KZNA 4ZQEA 2GK6A 3TLCA 3FWYA 2AFHA 4HQ6A 1EAYA 4U2BA 4PE5B 1FLAA 1UBMS 1U9IC 3IHTA 2WPDA 3KSRA 5P8WA 1N5JA 1YR6A 4LXUA 3K05A 4OGGA 1YMVA 2B7CA 1DKLA 1O77A 1QLWA 2PLAA 4NJEA 3P96A 3CVWA 1RCTE 4HRXA 2WMOB 1GR1A 3OO1A 4GX2A 4EB0A 1PSZA 3QHAA 3DHNA 1OLSB 3PDWA 3PXEA 1MO2A 1N9KA 1GAJA 2BFNA 4QYWA 1ZNZA 1JHQA 4LYGA 4WZBE 2FUKA 4X65B 4I3HA 1DT3A 1GVNB 3PC7A 3PK0A 4CEIB 1HL3A 4POOA 3GFGA 1GXSB 3ASUA 1YTLA 5IN5A 1XPOA 4B76A 3E8SA 1GGVA 3BMNA 2BTOA 4U2EA 5TDHA 5IWCA 5EKUA 2JL1A 3FJOA 3VBEA 4WZZA 3W77A 3RYHA 2G76A 3OE1A 4L9AA 3PCRB 4Y7DA 1MQAA 1FQJA 2JI4A 1Z2DA 2QAGA 1H2HA 2R1ZA 3M83A 4PW0A 2AT1A 3NTQA 2FZEA 2C5FA 4BPBA 1O3YA 3VOAA 5CFMA 4L85A 4K3UA 4HDCA 1RAGA 4IS2A 3CZ5A 3PTZA 4BVLA 3RF7A 4J1TC 5LJLA 4LJKA 4WINA 1RJDA 1Q15A 2OV1A 4KUHA 3D3WA 3PWKA 1DIRA 3FKJA 4Z4IA 4OHKA 5KNDD 5JNRA 1XQWA 2K5UA 4O4LF 1DOHA 4NOJA 4F1WA 4BU1A 1UBSB 3Q1LA 4OLJA 3MLAA 2BFDB 3PNQA 4CLXA 1P5JA 2EFDB 4LECA 2GD6A 4NENB 4LHYA 2WG2A 3HP4A 3H5TA 1HUQA 4E2XA 5KTNA 1KH3A 3ETDA 3N8HA 4XXHA 1I4OA 3I30X 4MVCA 4F84A 2OXFA 1ZZGA 3BWXA 4FGZA 4XD7D 4URVR 2ZI5A 4H16A 2UZ1A 4KGZA 3MYYA 3OZIA 3UH0A 3ZHTA 1N2SA 1YE3A 1LW7A 5DHUA 3WLRA 5H4GA 2AB0A 5I45A 4Q9KA 1W4LA 2D0PB 1OBHA 4LCBA 3A1TA 4OQZA 2CSUA 5LA6F 1XRSB 1XI2A 2XODA 1W2WB 2OY0A 2H4ZA 1RKXA 4FYIA 1OIWA 3SYMA 4L3OA 2IBMA 1K3TA 5B4TA 4C30A 2IXGA 2Y1FA 2YVQA 1J0AA 4TS4A 1CS0A 2DFTA 3HR4A 3ZH2A 1XD8A 2IOFK 1PJCA 4Z7OB 1V4NA 1T9CA 5E4YA 2CK3D 3ANTA 1U6IA 3ISVA 3I2KA 3M82A 4Z4CA 2QBYA 4P86A 4B3TB 2ECPA 4ZU1X 1WHTB 1B3BA 1WDKA 3ZYCA 2Q9CA 1QRSA 1MNQA 1BJTA 4WCDA 1MX3A 2HK9A 3GQBB 1HQCA 4CIAA 4C06A 4GZ5A 1HE2A 5ALQA 1Y1PA 5KSYA 3Q6NA 3I3SR 4KUGA 1BE1A 2DHQA 3MBKA 2J0UB 4YO7A 3DVSX 1YS9A 1YE5A 2MWMA 4D3XA 2FPIB 1GZ7A 3LIIA 3QV1A 1Y6ZA 1JTVA 1B16A 3G13A 2OZKA 2FCAA 2P6NA 5EPUA 2DLNA 3ZDYB 1GFZA 4D43A 4F6LA 3ZI0A 4P58A 5ERYA 5EE9A 3KK0A 1CP3A 2AYZA 2IWHA 4J0KA 4CCSA 1MJGM 2VYNA 3AERA 1XQ6A 3FR7A 2C2BA 5T4EA 3V34A 1YCFA 1ZD8A 2GPTA 2JAUA 3LF2A 3MB8A 1EXNA 3H4TA 2G67A 4WV3A 1YZGA 2PTGA 1OU4A 3DQQA 5K3SA 3MUOA 1USUA 1M83A 3IDAA 3P7MA 1W30A 1VXRA 2ZSHA 1GN8A 3B13B 1N3BA 5ILGA 4D8WA 1ZIYA 2QI9F 3F6EX 4DV7B 2WWFA 3IOYA 5EGNA 3U4DA 2QLTA 4K87A 5H7XA 3U61B 1YQWA 5DBIA 1QC5B 1QIIA 3HCDA 3QVTA 4IOLA 4EYQA 3RRNA 4KWHA 4M0FA 4L28A 4ZJPA 3QPAA 2O5VA 4HX9A 4LKOA 3SGLA 4JJ4A 2FH5B 4CT5A 2ZB2A 1VIVA 4RDHA 4S1NA 1RLMA 1UQUA 1I80A 4UQOA 4LHXA 2I2BA 1QH9A 3UG6A 2AC7A 4BUJA 2VT3A 4ZMRA 4EBBA 2ECOA 5CVVA 3O82A 4F4DA 4OFWA 2F67A 4L4UA 1W581 1NW9B 2AVDA 3A4MA 3FWPA 3L2OB 4OK5A 4YTEA 2CE2X 1SXJE 2NQTA 4Q3NA 4QXQA 5DIFA 5B1HA 3WXBA 2AJBA 3V48A 4ITRC 4OO3A 3HVIA 5BRJA 2HWYA 1ZOLA 2Q3BA 3QVMA 4D41A 2VH1A 3AF3A 4J4BA 1ZC3A 4IIXA 2DQKA 3N7UA 2GJ4A 3UENA 1VL2A 4KCGA 3ZOKA 2YQZA 5K6TA 4YT5A 3LPMA 1T5DX 3ABOB 3V1TC 3UAVA 5CB8A 4TOIA 1FW8A 2YKGA 4RTMA 2NVWA 2GMWA 2CLEB 3Q9UA 2XQIA 3II6X 4JMLA 3T7TA 5B12A 3BFJA 2QD4A 1TCCA 2G71A 1J8VA 3DOUA 3O2NA 2YNMC 4X3OA 1C3EA 3WK4A 4TVBA 4AJPA 3UBTA 3E2MA 5KX5A 4JR0A 1TUEA 1UPTA 2G25A 4G25A 1M66A 1MV8A 3H1FA 4PZDA 2GCPA 2B6NA 3UT5B 4EG1A 5MDHA 1PWXA 3WLTA 2XKJE 4R0NA 5CCXA 2FZLA 1RKVA 1W93A 3BB1A 1M2GA 2X3UA 1QE3A 4KP7A 1TW2A 4GRDA 2C03A 4PAWA 2C9DA 3FDIA 3CX6A 2XF2A 3LCJA 3K0AA 4JY7A 4LJAA 5THQA 3K1AB 1EHCA 3RARA 2ZPTX 1V11A 3S2EA 2OPHA 1T6ZA 3RG2A 2O2XA 4NLLA 3HDYA 3GLKA 4BLWA 4IQFA 1E6UA 3KYJB 1KAGA 3JALB 2O2CA 3RUCA 4CV0A 2N9UA 3OZBA 2JI6A 3VH3A 2GOYA 5GINE 1N7GA 5JU6A 5EHIA 4ARZB 2AN4A 1NVAA 3DC2A 5B3AA 4LF7B 4MUIA 2VUSA 3H4MA 1AGYA 4MYTA 4OF4A 1WU8A 3KZXA 3AL0C 3L0SA 4UREA 2OCKA 2GZRA 4J4HA 2LD4A 1QO0D 3MM4A 3CZQA 1BS2A 2DTDA 4QTYA 3Q7SA 1ZDMA 5AP9A 1A7KA 1SUDA 1YB5A 2IHYA 3K2EA 4W7HA 2WSYB 5LB4A 3VYRB 3LECA 2C5EA 4QPDA 2PM8A 2W11A 1QP8A 1QO7A 3EAGA 2HYIC 1DKNA 2W37A 4HNTA 3R74A 4QU9A 1NNI1 4OBEA 1Z6PA 3L9XA 3ZJYA 5EMHA 1RXSA 2GTPA 3GGDA 5AKGA 4DR2B 3NGXA 4WXHA 5CK5A 1DJMA 2HMWA 2R0QC 3KR9A 4YUAA 3W5AA 2QORA 1DAIA 3QPVA 1TM2A 2ZT6A 4ON9A 2WAAA 1UOPA 3KOUA 4DIEA 4EF4A 1XCGB 4DNXA 2HQOA 1VPLA 1P2SA 3JQGB 4UEQA 4CTOA 1KL7A 2H8KA 1HFWA 4RZSA 3PFCA 2IZ1A 3IUMA 3UT6A 2G07A 1ADCA 1DRKA 1OLXA 3T0GA 1TMOA 3KLBA 3TRJA 4P22A 1YJ5A 3ZBUA 1ZAYA 1EEXB 3WYFA 1FL9A 1MJFA 1XVAA 3QY9A 5CFRA 4FGKA 1HYGA 4TZ6A 2C98A 4Z9AA 4MUHA 4BU0A 1FRQA 4B8YA 2HADA 4F6RA 5K7SA 3OSUA 1K86A 2OUIA 3H9CA 3KXDA 4UU7A 2PCJA 2UYCA 3DOCA 3LBNA 5L7WA 2XWJI 3ORHA 3EDYA 3M6IA 2DUJA 5H3CA 2CGEA 2WR8A 2D5CA 3M9WA 1WDWB 1S4QA 5B58C 2QG4A 5HCIA 4DUPA 2P9YA 3NI2A 5CITA 2BKUA 1JSXA 2PGIA 4QODA 4D0RA 2B34A 5B6IA 4BX9A 3ZKWA 1BD4A 3OLWA 3OOJA 1ZGAA 3QWIA 3OM0A 4IM7A 4MGKR 1IXKA 4RVFA 3Q41A 4RVGA 5ECYA 5CDTA 4JKIA 2PL3A 3BYZA 3TLBA 5AM2A 1QV9A 4M4SA 4FLFA 3ZHSA 2XE8A 3E3LA 3UK0A 2WD8A 4C6TA 3NAQA 1NLUA 3ZNQA 4S1VA 4P7KA 2JLUA 4BVJA 3R7DA 1YJBA 1W88B 2CF6A 5BUCA 4ICIA 4J0GA 3TTWA 3QPUA 3UK2A 2QTMA 1M73E 1Z33A 3T7JA 2G4LA 4XQGA 3I45A 3KTFA 4MKHA 3BMCA 3TF5A 4ZDWA 2Y67A 3MEQA 3MJFA 3DCYA 3PYMA 3QYAA 2FE4A 2V1UA 4G8DA 1LLQA 1CQJA 4KIUA 3N7AA 1M6WA 4ARZA 2O7RA 3QPWA 4V0KA 3H7AA 3VVBA 3WIDA 3WISA 2HMTA 4D6XA 3AUFA 6Q21A 3DMHA 5I7WA 1D2RA 3Q3HA 5A02A 2NXWA 2PRIA 5I7AA 4FFDA 5CBKA 3SY8A 2BI8A 3EGCA 2FK7A 1XCBA 5TGDA 3BWVA 2UYYA 1E2MA 3AMVA 3FYHA 1CDEA 3H2IA 3I58A 3L5KA 1WUIS 2V4MA 3HKEA 4BP1A 4LGVA 1GRCA 4AJEA 3N28A 4RH3A 1VG1A 5EJ8A 4A8JA 1VL8A 3SYLA 4RKEA 4S2EA 4EZBA 4CL2A 2CXTA 5LN1A 2B5WA 2ZB3A 4LC0A 2HF2A 4HJRA 2BLNA 1C1XB 4QUBA 3MJ4A 2G9VA 2I4LA 4QSMA 1DWOA 1Y37A 3OX1A 4KXVA 4US0R 1DLJA 3ZPXA 1RPJA 3E7PA 5D84A 3HDGA 4YV7A 3DV2A 1MTOA 1JIXA 2C9ZA 4TUYF 4UNSA 4ZIRB 6ADHA 4I7EA 1MO3A 3H9GA 4RIEA 4NABA 2XB9A 4IIGA 1IYZA 1JLRA 2BFBA 4Y6OA 1Q7GA 3G68A 2BDUA 2ZRKA 3JAKB 3MWGA 1YIDA 4LOIA 4P0PB 1TUIA 3AVVA 2QEQA 5EIHA 3MAJA 4W8OA 4P5PA 4BQNA 4HFMA 4D98A 2V7BA 1BXGB 5I9MA 4YRJA 2WYOA 2NU6A 5GM1A 3QVGB 3ZIUA 4D44A 1RQ7A 1AOXA 4YHHB 4ZHSA 5CR9A 4MYSA 3KXPA 1IU9A 1OTHA 1O4VA 4R84A 1TLTA 5E6RA 4ZWNA 5ADUS 3TL6A 2YUIA 4RFVA 1N77A 1XMIA 3V1YA 4HNSA 3H5VA 4MQBA 3MGAA 3TZBA 4B3IA 4EW3A 2QRUA 5MF6A 3G7NA 4Z0NA 3R24A 2B8NA 2BHNA 3NHUA 4O5OA 1G20A 4L51A 3JTEA 4CIXA 5CEEA 3FI0A 3V4SA 2ECQA 4PS0A 5B1SA 1SWVA 2EJCA 2XQJA 3ZQJA 1GPKA 3H86A 2PT9A 3K8QA 2AK3A 1XNHA 4IIDA 1JS1X 4U9IS 2WQZA 1OLUA 1ZISA 3EDMA 3FPCA 5AJWA 4WNAB 4XYEA 2ZJ5A 3E5MA 4P36A 3SNHA 3N5CA 4YJGB 2FOXA 4ISBA 3IH5A 4JITA 4AJ4A 4BZQA 4CVNA 1NJFA 5HNKA 1P1BA 2FKNA 3HJHA 3F2IA 3M3PA 4ECEA 2YZ7A 3T5PA 4KQMA 4XUCA 3SLRA 4Q82A 2Q5OA 3CHYA 3IPYA 3QGMA 1N3IA 3QNUA 1WXDA 4IO1A 4K1XA 5DBOA 5IAJA 1N5MA 3QXXA 2D54A 3TO5A 3WLJA 3RLIA 1N78A 1A82A 2UKDA 1OFIA 1AU9A 4S1TA 2V8BA 1VLJA 3IEIA 4J75A 3RADC 3ESZA 2WDZA 5A0TA 1ZK2A 1J9EA 1W4RA 4MA5A 3VR6H 4O4JA 4XQ9A 1MO6A 1T15A 4XPIA 1KEZA 3KJFA 4TLDA 1ATIA 2HSGA 2VWHA 1Z4LA 3GCWA 4F9FA 3BHNA 5DGTA 3MGGA 1KH1A 1DSSG 4EMBA 4WLOA 3R9KA 1CC1S 3KQUA 4NCJA 1C9EA 2J46A 3JVDA 3P8ZA 1NJSA 1LF5A 3H3XA 1RC8A 3IUSA 3L8CA 4PNEA 3Q88A 1PV4A 4NVRA 3L8MA 1UZAA 4Q9AA 2C4TA 3NEAA 2PCLA 4IMIB 4OXXA 1BRMA 4LSWA 3VDRA 4W5RA 3PE3A 4L5AA 4BGDA 1F17A 4WOJA 5AW5A 5IDWA 3D7NA 3SJBA 4HP8A 4DLAA 1Y3CE 4GLJA 2A9PA 2ABWA 2EQAA 2FGJA 4DIBA 4YUXA 3ANSA 3C5CA 4HXYA 4JYAB 2OWEA 3SKXA 1N2BA 1PL0A 1WHSA 3QBVA 1RM5A 3UBMA 1JIVA 4QZVA 3TBHA 4NMWA 1A95A 1N75A 2C3MA 2PH7A 3IQEA 1CY1A 1GG9A 1T5HX 2AJLI 3FLMA 4R6WA 1G20E 4I4IA 5IVPA 3O03A 1QDUA 3K8OE 1RAFA 5KU7A 2VYND 3T94A 4ZO9A 1TF5A 3GV0A 4R2IA 1MZPA 2HQ1A 2HRQA 2IJGX 1SCKA 2FEKA 3K4HA 4M76B 4DHEA 1P1KA 5U4QA 3AILA 3WFZA 3G5AA 2W4MA 1KPHA 4N5MA 4XD2A 1KR2A 2QN7A 4R7TA 2PT5A 2IP1A 2P67A 3NV9A 3EIUA 4M7WA 5JYBA 3HCEA 3DTVB 4RZHA 4BFWA 1KO5A 4ZOLF 3IODA 1NI4B 5CTJA 1QIFA 4KOEC 3STWA 5KNBD 3PU6A 4K2AA 4PPNA 3P9YA 5BUQA 4HFRA 2G1JA 1JWBB 1QGAA 1N0HA 1VLQA 3K70B 4YMHA 3U09A 3LRXA 5C1PA 1NNLA 1XDSA 1OLUB 3INTA 1AC5A 3HYRA 3ZH9B 2PJZA 4MR7A 3OLVA 3VO9A 5IBCA 1HZZC 2QMOA 5EHZA 5HFNA 3ZNPA 2NZWA 1SBYA 1W25A 3KVVA 1MPXA 2V8OA 5GP1A 4ZYXA 5TVGA 2FVXA 4YJ2A 1OIXA 5EJ4A 1G3UA 3ZVMA 3OTIA 4KU4A 4G9EA 5DCUA 2NZUG 1CY6A 2IA5A 3PTAA 2RD2A 1Y42X 4FYMA 4N65A 1G1AA 1T3HA 1YQDA 2I99A 3ZOZA 1Z8HA 3H1AA 4XASA 1ESZA 3D6AA 4GNKA 5EMJA 1M74A 2BSAA 2E82A 5DCWA 4YRMA 3Q0TA 1KJ8A 2FLKA 3B52X 4ND2A 3ZV6A 5EE0A 2DQSA 1NKVA 4GMDA 1K6MA 2I6SA 1XZQA 1E2DA 3MMNA 4N8SA 2W48A 4ZPXA 4BJHB 1OASA 5EJEA 1L5MA 1IL0A 1XCMA 5EJ9A 2WAXA 3IAFA 1IHOA 1YTUA 3CT4A 1L3CA 4NF2A 3NP7A 1WXWA 3DB2A 2J48A 3Q8XB 3R0QA 3GXBA 1PEYA 4LQLA 4GSLA 4YK7A 4EPTA 1WETA 3CLVA 3KYIB 3AFIA 5HCUA 2NYRA 2EWWA 1DBQA 3ZQKA 4TKVA 5KYWA 4N41A 3SMQA 1FTWA 4U9HS 3CKYA 1XAIA 4ZAXA 4IG9A 1GGKA 2PZBA 1NSTA 4NG4A 1R6BX 3S1LA 1AK2A 4E31A 4B32A 5A4KA 4XWAA 2IXBA 2PY6A 1YRBA 2QIOA 4I5DA 3NHYA 1WUHS 4ILKA 5IAKA 4TL7A 4C0LA 2E18A 3KOOA 4G0PA 3LL7A 4MVJM 2IOFA 3OHMA 1X1QA 4ZOQI 2O2ZA 4AQDA 4ZMSA 2ZTHA 1WXQA 3S81A 4KVFA 2C2OA 2M1ZA 1G1MA 1WKCA 1Z74A 3HB7A 3O9MA 5EMMA 2OMEA 4BCDA 2DWPA 3F1LA 4Y2QA 5C0OE 4I1SA 1EWKA 4YCSA 3QM1A 2PE5A 4QELA 2A5YB 4F93B 5KTYA 2FMHA 3KPWA 3T12A 4B1FA 3KHTA 4R69A 1YS2X 4W5JA 4DLKA 2NP6A 1YZUA 1Z4NA 4NJMA 4UUNA 1NBME 2IE8A 3RIYA 3GGSA 5EJGA 1HK7A 3A1DA 3N2EA 2QPTA 1E3WB 2IPMA 3I9JA 3HADA 4MI9A 3AVQA 1WSBA 1P77A 1XZMA 2HOQA 1C9MA 2ZBRA 1NBIA 2QP9X 1B26A 1KAMA 2IIBA 5CNIA 4F2PA 1S96A 1XDUA 2PQ6A 4RTSA 4K6FA 1VYHA 4BFCA 1WG8A 2YIMA 3RTGA 1P2FA 4QXRA 1GQRA 1WXHA 3UJNA 4ZAVA 3TUJC 1H0HA 4NE2A 3TLKA 3C4QA 1LBSA 1UZUA 1SC3A 5DWDA 3WC4A 1BCSB 4DLVA 2RJ3A 4AD8A 1AHPA 2D4HA 3BMCB 5AW0A 2XZOA 1ESMA 2OPBA 4UHDA 3BH0A 3C1UA 2HBRA 2ZRPA 4C3ZA 1DC3A 5E8RA 2NX2A 3NDPA 5LMNB 2WQ7A 2AOUA 5FYQA 3GZJA 1XPRA 4O4HB 4TVKA 3B3FA 2QUBA 4WTOA 3VVCA 1NVGA 1PZHA 1SQGA 3REOA 3SF0A 4O4IA 3TCNA 1EBFA 1P4JA 2CCJA 5H0IA 2HJRA 1SELA 4YRNA 3BMXA 1DXQA 2OXIA 1D04A 3VNQA 2PVCA 2BHSA 2R1UA 3MUNA 4M89A 5DWVA 3AFHA 3I8XA 4IZIA 2IS2A 1EXMA 1QOZA 1UFVA 1YA6A 1TQ4A 1HDEA 3SKVA 3BQMB 5ITVA 1U7WA 3CW2A 1LPPA 2AF3C 4PO1A 3P52A 3W7AA 1XVTA 4AJ9A 3E9CA 1U1FA 2NXNA 1Z38A 2XUPA 3EXIA 4JBXA 2AG5A 3ON5A 1LEHA 1QRRA 4E1AA 1XQ1A 2WILA 1OXVA 2PLFA 3VZSA 1VXOA 3NM5A 4YX9A 1NYLA 3ZJUA 3OH8A 3FSEA 4V0NA 2GZAA 2GSWA 5G1PA 1QK5A 1Z83A 2PVSA 3DVRX 1XP5A 4BC0A 4CIVA 5HXAA 3ROGA 4EUHA 3S8EA 5K0SA 3MA0A 2Q0QA 2VXBA 5IS2A 1WXGA 1ZNXA 5E6SA 3UMGA 3ZE2B 4BPRA 1P1FA 3P2EA 3PXDA 4C0BA 3HWX1 3LWZA 3PC6A 3A1FA 1P7YA 4HDRA 1V6SA 4XD7A 4OMDA 4YUVA 3RQIA 3D6MA 4QUGA 1VL1A 3GFFA 3VU9A 1UKYA 1ZGBA 3A2LA 3QKWA 2GYVA 5ADWA 3RTEA 4BAGA 1ZR4A 4J0EA 5JG7A 2YMQA 4RVNA 2NU7B 3KFLA 1K1EA 2Q3DA 4XSHA 5BQOA 4CCWA 1CIVA 4PXAA 5J2TF 2OC4A 2VSYA 1IHUA 1D9XA 4XJXA 1OAOC 3DKVA 2HNKA 4B3SB 2HGSA 2QRNA 2ZFUA 4L57A 2I6GA 3HMKA 4IQ4A 3THSA 8ATCA 3PFFA 4A2PA 1FSSA 1BDIA 2WSSD 4PC6A 1QTRA 1U90A 1ZD2P 4YAOA 1IBMB 2QDXA 3FDFA 2HHHB 3FZEA 2G4VA 2E1RA 3C4JA 3PFNA 1L4HA 5ALKA 4Z5XA 1XRJA 1QHYA 2ZLBA 4V0RA 1XYGA 2BEJA 1FTSA 1MV5A 1IULA 2IL1A 3MTIA 3FSRA 2W6OA 1Z2NX 1PK9A 2VA9A 4O4LA 2FPGB 3H5IA 1XTUA 4W6QA 1NJ8A 1J8YF 3LI2A 4B4WA 3HJFA 3MTEA 5JDCC 5GONA 4GX5A 5AM4A 2IPNA 1LQUA 1U8CB 3UWMA 1GYPA 4PSCA 1NPDA 5LZ8A 1JU9A 4K03A 3ZHOA 3EGXB 1A5TA 1GTJ1 4IXMA 4B83A 2XOXA 3C8HA 3B7GA 3QEMA 1BYIA 1J0XO 3IUEA 4GE3A 1MRSA 1KBQA 1ZSYA 1QH1A 2G82A 2Q49A 4WZAA 1H05A 4Y2XA 2HCTA 4I4NA 4IWXA 1MEEA 3OPVA 4RHUA 4F9TA 2ZS7A 3M6LA 3R7LA 3EDQA 5HPYB 1KOGA 4WJZA 1ESCA 2NSHA 3ESDA 1BEEA 2XKBA 1KH2A 4IVQA 4QQFA 1KZ1A 2ODNA 2P1RA 3EPHA 2VHZA 1UK9A 4ZO8A 2OHXA 3A9UA 3KFVA 1G8KA 4EKYA 4HXGA 2OUKA 2AC4A 2WT9A 1YHNA 3U4IA 5A7HA 3OU6A 4C05A 3A1VA 3IJ5A 5HE9A 1GNTA 3DUFB