4V38A

Apo-structure of alpha2,3-sialyltransferase variant 1 from pasteurella dagmatis
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
388
structure length
388
Chain Sequence
SKTITIYLDHASLPTLNQLMHFTKESEDKETARIFGFSRFKLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTMEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
molecule tags Transferase
molecule keywords SIALYLTRANSFERASE
total genus 132
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v38A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v38A01
2IHZA 2IY8A 4V3CA 4R9VA 2EX0A 2IIBA 2ILVA 4V39A 4V3BA 4R83A 2Z4TA 2IHJA 2IY7A 2II6A 4R84A 2C83A 2C84A 2ZWIA 2IIQA 4V38A 2EX1A 2IHKA 3S44A 4V2UA
chains in the Genus database with same CATH superfamily
3FPCA 1AUPA 2HK8A 1FLVA 1NY5A 2NAFA 2VNSA 2Y9PB 4TKVA 1DTSA 5EPEA 5K7SA 2MU1A 3QLEA 4Z8YA 1OXMA 3OETA 2CUZA 3AI2A 2YNMD 3RADC 4JJGA 5E4YA 3GLFA 1PJBA 1Q7GA 3NKFA 3WNBA 3IB6A 3IPYA 1XV5A 2XV1A 3C6BA 3ETJA 4W7HA 3UMGA 721PA 2UUCB 2V97A 3CRVA 3HJRA 4PZPA 3HWRA 5JJIA 5EWJB 3CZCA 2GAFA 5L7YA 1PUIA 4JT4A 1ZJ6A 4TVOA 1ZP6A 4LY9A 4CM4B 4PZUA 5DX1A 3IPCA 3OZRA 3CX3A 4R71A 2NTYC 4MW1A 2BGNA 1LBIA 4XPIA 3I39X 3MIIA 4MA5A 3FCAA 3PUWA 1MEEA 2PKYX 1O6ZA 3VTAA 1O6BA 4E22A 4Q9NA 1CX9B 4FFLA 4X61A 4C0HA 4RXTA 3QPDA 3NDJA 4AURA 1XAJA 3SXUA 1WOMA 2Z2XA 3BGDA 1EVKA 2GSWA 2XJ4A 4LK2A 4GBMA 3DQZA 5E9WA 3AKYA 821PA 3MAJA 1VIYA 2O7NA 3H42B 3EDQA 3WKBA 4ARSA 3ANLA 1HUQA 5BV0A 3GLFE 4J90A 3TIXB 4P84A 3WI7A 3CQ9A 5HILA 2AJCA 3NVAA 2X0DA 5A5FA 2NSLA 3WMRA 4DBLC 2FV8A 2N46A 3QVWA 4B0PA 4OLAA 4LDNA 2GERA 1N2GA 3BL6A 1HL7A 1QHIA 1S2LA 2ZR7A 3N2KA 1XQ9A 4GZLA 4BZPA 4ZZ1A 3SVLA 1PI3A 1XU9A 4W5QA 2ORVA 3FKQA 1PEKE 5E6SA 2YS7A 4DCUA 3HFGA 1BYIA 3T5DA 5BURA 1PJ8A 3I9FA 1BWRA 2XZOA 4O2BF 1IMJA 4HHEA 2DWOA 4NFSA 4CF4A 2Y1LA 3HYRA 4CGYA 1MQSA 4MVJI 1RM4A 2EARA 3ZQUA 3DV9A 4ZANA 5HR5A 5LZ4A 1ZISA 2WMYA 3IELA 4Q7JB 5EI5A 3QWFA 5LLTA 2EJBA 1W88A 5ALYA 2F48A 4M49A 4EH1A 4P0PB 3UW1A 1JLRA 2J45A 4DZTA 1YBAA 1ZW1A 3D9QX 3L1JA 4LN1A 4N9QA 3TD9A 4ZTZB 3THYA 2AA3A 3TFQA 5JCPA 3E2PA 3NKVA 2WSIA 4B81A 1SZJG 2E4ZA 5DNWA 2Q6LA 1YZHA 1ZO8A 3O26A 1Q91A 4UQOA 1FX1A 3ZI7A 1Z45A 4EO9A 3E3NA 1JKXA 3JAKA 3UFXA 5F2NA 3EQZA 1QCDA 1SUCA 1PR1A 4WIAA 2XPCA 3KQNA 4AS1A 3VAZA 3HM2A 3NWOA 5ALQA 3EQ8A 4B6FA 4TQ9A 2VDNB 1GITA 2X9VA 3IQWA 5JH7B 1XZNA 3U0BA 1QH8B 4B6PA 2C3PA 2OYRA 5KI6A 4I5IA 4DKJA 1SRRA 3ET4A 2R7LA 3AR2A 4YC7A 1DBIA 4Q12A 4B8YA 2QX4A 1CRQA 3TOXA 5FL7A 1GGVA 2ORED 1B4DA 4JI7B 2Z98A 2DHRA 1UQTA 1B8NA 5HS6A 3TRIA 121PA 2B34A 2QTVB 4EFMA 1T8YA 2EEZA 3L0SA 1GU0A 2DOKA 2ZPTX 2FLVA 3NJ8A 4FDLA 4KL8S 4WZ6A 4YAFA 5BQ5A 2ILTA 1KYIA 3FVQA 2RHWA 2IZ0A 2QD5A 2UKDA 4KE6A 1D1PA 2CXQA 2QAIA 4NNPA 1X6VA 2A35A 2BKLA 1M2GA 1ZINA 2QNBA 1N2HA 2PMBA 4HEA1 4JJEA 4QJ3A 2Z09A 2OUKA 5IWCA 1RYYA 2YZGA 5AJXA 4CJXA 4B7UA 1P91A 2TS1A 4YA6A 2G72A 2ZR9A 2HH9A 1M6YA 1R0SA 5EP3A 3F47A 3TIVA 4HXGA 3DAYA 1J42A 3WIUA 3CVXA 4KLCA 2BYTA 1I51A 5CXSA 2D7CA 3DOUA 2BTOA 4L6AA 2X41A 1UXIA 1Z06A 2IYTA 1L9KA 2W6CX 1ORIA 1ZNYA 3GV0A 3H1TA 3Q5DA 3ZCSA 2IBSA 2B8NA 1HA3A 2P8SA 4KO8A 2ET6A 2F3PA 2QL6A 4CLRB 4NARA 1I4DD 1RAFA 3RVMA 2H17A 5T4BA 1I9CA 3R7NA 3F7TA 5EMMA 3WLAA 4IPTA 2WKWA 1UFKA 2NYVA 3LWNA 4IOMA 1Y6RA 3UB4A 1P5RA 2BP7A 1IQRA 3P8ZA 1P61B 2R44A 4JSTA 1ICEA 1MQAA 2ZTMA 3OPXA 2PV7A 2I9PA 4FJ0A 2VQSA 1R9MA 3NOVA 4GOLD 4RV5A 4G5QA 2W00A 4OQZA 5B55A 3JSXA 4IDAA 2V45A 1C14A 3RJ9A 1W1UA 1SZPA 1WCWA 5FOXA 3V1KA 1WZIA 3WJAA 2AS0A 1NMEA 5FR1A 1L7XA 3NHWA 3W5DA 3H16A 4IGAA 3KOOA 1KK1A 4JKYA 2VHZA 5BV7A 3D7SA 3OKCA 1YZ3A 1H6BA 3F8TA 3O3MB 2C88A 3DD5A 4FW9A 3NBUA 4QGAA 2H2FA 4Q4DA 4ER5A 5CCDA 4H3VA 1KPHA 4TLAA 2FI1A 2VHTA 3AF5A 3DDCA 4KXFB 2A5DA 1SVKA 1AHNA 4OF4A 1W36D 4AP6A 4TL7A 2G08A 3AV3A 1KRHA 3SU8A 3BB4A 1IL0A 3FMIA 3L40A 2NYUA 4IXTA 1Y7TA 4UMEA 4CF6A 1QC5A 5HBRA 1FQOA 2HRDA 2W37A 3CRRA 1NV9A 3P9IA 4HUJA 4DQVA 4P4GA 4TT3D 3L1KA 4GOOD 3VR4H 4ZI7A 3BAZA 1V48A 5HW0A 2PD6A 3T1TA 1T3ZA 3W04A 2O2GA 4FKZA 4YRSA 1UBUS 2PTHA 4LJ7A 4DM4A 1CHNA 2HMVA 3OUUA 5DLDA 1PKEA 4J1TA 1MVLA 1OGJA 4LOLA 4QICA 3T7RA 4M8SA 3B3GA 2XB9A 5EOVA 4Q05A 5HFAA 2PIAA 2M6KA 1YQDA 2BOVA 3LQ2A 2AZMA 3NQ41 2EXXA 5ECYA 5CYOA 1U04A 2XNJA 3RGWS 3ZOKA 1Y3HA 3ZDRA 4BP8A 1KO7A 3QKSB 2HA3A 1HZJA 1UMBB 1KEZA 3ZXSA 3BKWA 4MKRA 4FYWA 1U80A 3HSSA 4HEA6 4LKRA 4PE5B 3ELBA 2GFQA 1CVRA 3K94A 3ER9A 3SE7A 2WJ3A 2X9NA 3P2IA 4DA7A 1G2QA 4KUEA 4JI4B 3RVKA 1XGKA 3EVCA 3BD8A 3Q88A 1VCIA 4I50F 1PYGA 2CFIA 3G1WA 1L5HA 1ODCA 3B52X 3NBQA 3NYRA 4EJSA 3TR5A 1VC2A 2FR8A 3FPAA 1CYDA 3SQXA 4FILA 4RSMA 4O2RA 5ALKA 3ZLVA 2Q1WA 3H87A 2ZE7A 3RIHA 4TVKA 4FGUA 3RSZA 3V7FA 4CF5A 1BQ4A 1MAAA 2EKQA 4RVHA 1KRXA 4NR0A 1FP7A 4E7PA 3L4JA 1Q0TA 1W59A 1VECA 1RQLA 3CSDA 3IAFA 3H11B 4PTLA 2GOYA 4OOEA 1EVIA 4X1OA 5LIPA 1BROA 2VSOA 1YZNA 2Q4DA 2FE1A 3ADCA 3MGCA 3B9RA 4G0UA 1CQXA 3KVNA 3TMKA 1ZRNA 5CX1A 1BE6A 1ZYUA 1GTMA 2GILA 2QDKA 4MTCA 4EUEA 5HX7A 2J9YB 2MINB 4LJRA 1AXEA 1E61A 1WUKS 3NKLA 1ML3A 3NEJA 3WP1B 1FS5A 2IYXA 4HDAA 1OH6A 3U31A 4OHKA 3I8XA 3ZE9A 4YJ3A 5ESWA 3P4UA 5H02A 1X2BA 5K05A 4LF8B 3VDNB 3E53A 1IOLA 1FTQA 4AJ2A 3ROXA 5ELXA 3HRKA 1V39A 4DMFA 3BXZA 1X7YB 3CR3C 2I6GA 3GGPA 2CLCX 1IPFA 5ANRB 3S2YA 3V4FA 1HNXB 4L2IB 1QQAA 1NONA 3JQ6A 5J59A 5E3HA 4AC9A 5L3SA 2W4QA 4JOSA 2HQ1A 1GPJA 1HRDA 1IPEA 4MRMA 4PVDA 3SJUA 1WDMA 1VBFA 3A1WA 4OAOA 1EZZA 1WEHA 3IODA 3CN7A 4ZKDA 2HXYA 3EXIB 2EZ9A 5B1IA 2PZMA 3EF3A 3HG7A 3JYQA 3OCUA 4HV4A 3EFHA 4NXNB 3WWZA 4DVGA 4ZAYA 3PSAA 3VZQA 4EY5A 4GLLA 2CD7A 1O9HA 4CL8A 3FYDA 4WOKA 2XTMA 3TRDA 4IDGA 3WGNA 3V00A 4DT1B 4Z3KA 1SRQA 4DDWA 3PXCX 4XSVA 4UQLA 1I14A 2FG5A 3KT0A 3L4BA 4YROA 1FL9A 3M3HA 4ZYWA 5DWVA 5LQKA 2IXDA 3M3DA 2IH4A 5JANA 1H9BA 2IZ1A 1USKA 1W87A 2JKYA 2YVKA 1GO2A 1MJHA 3L77A 4IO1A 1BE8A 1JRLA 4ENRA 5K5EA 1J9ZA 5JRJA 2Y05A 1I24A 1MOPA 1ZGGA 4PZEA 5JAQA 4B7XA 4F5WA 2EL9A 1AZSC 1N8NA 4H1TA 2CBZA 4LMAA 1C7ZA 1NVBA 4UXIA 4A4DA 1EFVB 3GJRA 4X54A 1T29A 1NWCA 3X1JA 1P31A 4LZOA 3TLKA 1RBYA 5ESXA 4ARBA 3OOHA 1JU9A 4KFSA 4KXLA 5ARCA 3VTKA 1RQ7A 3WWDA 5CT9A 5MDHA 1RTKA 1J0DA 3TGLA 5KREA 1YV9A 2Q62A 3AEKB 4GR5A 3U4QA 2Q41A 1FYWA 4GEKA 7YASA 2RGBA 3EPLA 2BT4A 4OKSA 1R6XA 1Z7GA 4MB2A 2F1JA 2HQRA 4C7MA 1X2EA 2WWTA 1CJBA 5COAA 4GPAA 1D2RA 3W1EA 4LYJA 4Z3OA 3ZHBA 2H16A 3ANYB 3CSUA 3KEQA 3QXCA 1K6IA 3VC1A 5JNTA 3DOIA 5I3ZA 1AZLA 1NN0A 4G8DA 5FO1A 4B3SB 3CRZA 2ECQA 3L8EA 1JSRA 3RANA 5CX4A 2O6HA 2I6XA 2JJYA 3IOCA 4Z9AA 3EFEA 3F8SA 4D9IA 4RA9B 1KC3A 2MHCA 3P9RA 4JLOA 4MGKR 3RYIA 3DH0A 1NI3A 3JAWA 4RK6A 2YXLA 1QV6A 3NH9A 4FHZA 5KWJA 3IL2A 5IUKC 5HKBA 3AV0B 3BTUA 1NW8A 5C5CA 3FWPA 1RJGA 1T3SA 1PQUA 4IOLA 4UPDA 5B58C 5AI0A 2IT1A 2ZYHA 5K4AA 4G41A 4IW3B 3WL4A 4DNPA 1VHJA 5EHGA 2GZHA 3O5AA 3H83A 3KZVA 4KIWA 3U17A 1YZKA 1VBNA 1BKDR 4MPJA 1EX7A 3CCBA 4FMCB 4OP1A 4BVGA 3EG5A 4E94A 3PXGA 1AQLA 5DRTA 3H1FA 4FKMA 2CL6X 4Y0AA 5FOSA 3K5WA 5FA8A 3X2EA 4DA4A 3SNHA 1D0SA 1HSOA 2VF4X 1JDUA 4RBNA 3UUFA 1QCZA 5ALPA 1P6XA 4CM3A 1QU3A 3F1KA 1S9HA 3F9RA 4IWYA 1VPTA 2IK8A 1W75A 4BRUA 1DLIA 4LNAA 1QLHA 2XCSB 5J5AA 1H2AS 3KEOA 1XXLA 2QGZA 4DC1A 1E7SA 5CDFA 4D02A 4F4UA 3HA2A 3C3YA 3KAKA 4QYSA 1W8DA 2AFRA 3FMOB 2AW3A 4S1OA 3O38A 1UJ6A 2Q2VA 1RM3A 1T6BY 2JIPA 2O2JA 2RGRA 3D0QA 2ISSD 2CUNA 1KU0A 1HWYA 5GZ3A 4EB8A 1G4UR 2NW6A 4W6ZA 1XZKA 2WRZA 2ZYTX 3N0RA 3P0JA 4CU5A 3VMMA 1U65A 1UP4A 2FRXA 4YTEA 1DAHA 2NZYA 3W3AA 2G9RA 1J7JA 4XD7D 5AVVA 1RWKA 1KP2A 4PBRA 4ENPA 3TVTA 2BFCA 3QSGA 4FEAA 3OO1A 2QW8A 3WRYC 1Q7BA 4KJZA 1GPWB 4JHLA 5BR1A 2H00A 4D5GA 4GC5A 3LUPA 3EVNA 3LDHA 2GWHA 5DYTA 3WHIA 4M7OA 2VF2A 4XQ0A 2KW5A 4FLEA 2P3OA 4FT2A 5IN5A 2GB4A 3S27A 4OHYA 1VI2A 1EP3B 3L0PA 3Q9NA 5CLLA 5HRAA 1IIBA 4X6LA 3DBOB 1ZBDA 3AJRA 4IHQA 4XI9A 3KHKA 5AFSA 5E6SB 1XP5A 3Q1KA 1V3UA 1W4RA 1Q1BA 3AWIA 3H9EO 1ZPDA 2W6NA 4YI3A 2O06A 1IQ0A 1ZBQA 2VDUE 3MCVA 4IIBA 4G0XA 2Q9UA 3V9PA 2G3YA 1JE1A 1KAOA 5G1OA 1UJMA 2CFSA 1PUJA 5U1PA 5KHAA 1SHLA 3KT8A 4YJ3F 1QM5A 3PA8A 4D3ZA 2GPTA 5G0TA 3GVCA 1T0IA 1O8BA 3WV4A 4TV8A 2DXIA 1MJ5A 2CL5A 3L1VA 2PT9A 2UVPA 4LHEA 4M0LA 1BRMA 4WLNA 1UXHA 4D0SA 2F8SA 1PS8A 1S3SA 3BGSA 1SIBE 1VRCA 4GXTA 1PV4A 2LGJA 3IQIX 2Q5OA 1HOXA 4I4TB 3ZZTA 5A3QA 4RMJA 3OMWA 2DPLA 4BNMA 3Q3GE 4MV3A 2Y1EA 4Z0HO 1GNQA 2NU6B 2ZZNA 1PV1A 1XNJA 2I71A 2G36A 2AB0A 2C4HA 2DQ4A 2R6GA 2QRNA 3IVRA 2ABWA 2QN1A 2X14A 1JV2B 3KL2A 5E6UA 3SOZA 2DLNA 4US2R 5FLXA 3EQ2A 2CXOA 3WYDA 1PFUA 2EIXA 1P2SA 1A9XB 1K7CA 1B6SA 1DJNA 1BXKA 1JNXX 4H59A 4OHZA 4DLSA 4EB6A 2PSFA 1QUFA 1WWKA 2M1XA 1G42A 3F1LA 3IGFA 3LF1A 3PE4A 2ATCA 3AR7A 3DZ8A 2YIVX 4K86A 5HK8A 1K6XA 1PJ2A 4KLZA 3TCXB 3MQ2A 5DN9A 1VRWA 3U26A 3BCSA 3R24A 4K6OA 2WQZA 3AQIA 4Q03A 4ZVSA 5BVHB 5JAUA 4QO7A 3K2IA 2GEJA 2W2KA 3OE4A 4UHEA 4E1VA 4IGFA 4J9VA 3BH0A 3FCYA 3O90A 2ZI7A 4UU8A 4B76A 4C3OB 2DHEA 5AI9A 5AIBA 5BUSA 2Q5CA 3P9KA 5B30A 5A1TA 3R6LA 1II8B 4UU0A 4N48A 3O7MA 5I9IA 5BN4B 2QEQA 1E4OA 4CLEA 4D9NA 5JQGB 5ALLA 5AMXA 3TD6A 4MUKA 1E7MA 1OASA 1Z8HA 3IBTA 2JFQA 4O4LA 4DLWA 3H4VA 4Q34A 1K8QA 1Q0RA 3PHIA 1RZVA 4HRVA 4W9NA 3O95A 4TSRA 5LKRA 1Z0FA 4AROA 3J81A 1A5AB 2YYZA 1JSLA 1AIPA 3JQRA 2AEFA 5DHTA 2P5YA 2XITA 3TGWA 5CMLA 4FWBA 1UAGA 3GXBA 1YZFA 4Q4AB 4WK6A 5CNIA 5KX5A 3RUCA 4HH1A 4PSCA 4C0KA 1Q0HA 4BPRA 1TJNA 3U4IA 1KAGA 4ZOQI 1IOVA 2P6NA 1BCRB 4H7KA 4B6QA 2ZDGA 2P91A 3WJ2A 2IYYA 1JKMA 3LF2A 1SKYE 5EWLA 1FW8A 5G0SA 5FNVF 2JEOA 2VT7A 2J3HA 3FRIA 3NAQA 1HKHA 1E2LA 2GEDA 2VNJA 3BZWA 1UOPA 3FGPA 1W44A 5ESRA 4MP8A 3WMFA 2NV0A 3A4YA 4UEJA 1F12A 2CFRA 5BN4A 2C7VA 3DUWA 3H0EA 4EZIA 5ENZA 4H77A 1EE9A 1UL1X 3QY9A 1P7CA 1ZNQO 4D0RA 2WF8A 3INNA 4DLYA 4AUNA 3T3OA 4ZO7A 3Q5EA 4CFSA 3ZWQA 1ABBA 3FLMA 2ZULA 3MFQA 4IICA 4ZI7B 3DTVB 5G4KA 2IS6A 3JRXA 2DFKB 3D1LA 3UT5A 3FWKA 2VKTA 2XTAA 3HU1A 4HC4A 3CEJA 1DDIA 1E2PA 4KE7A 2CXNA 3W5VA 3TDMA 5LA6F 5C4IA 4HNHA 1K7SN 1O94C 2X0IA 5FBKA 2DETA 3L0YA 1L5GB 2NPOA 1L4HA 1EFPB 4G4IA 4B9EA 1XNGA 1U0EA 4F2DA 3V1YA 4ZXPA 3WMGA 3C98A 1UWVA 3TLXA 1IB6A 3C15C 1B42A 3HUUA 3M1LA 1AO0A 1N0IA 3VR6A 2I4MA 1U3WA 3B2EA 1ZHFA 1JE0A 2A78A 1STOA 3LX8A 4IV0A 4RVDA 2CFTA 3UJ7A 4F0JA 4B31A 1BCSA 3N7AA 4K0RA 1G64A 3RC2A 5ED0A 3ADDA 2MYNA 3LLUA 1OV6A 5B6PA 3WLLA 4YHHB 1Z2DA 2PT6A 2R8ZA 4BL5A 4RKFA 1YU9A 1W2HA 2NO7A 3HJGA 4IV8A 4YI5A 4HLDA 1NUAA 1VKNA 2N47A 3KBBA 4Y7DA 4GMHA 4WKOA 1BVHA 3W6ZA 2FSSA 3DFZA 1TKCA 3WRXC 1QGUB 4K87A 1GPLA 5EKXA 2XECA 4CV3A 4K1XA 1B1CA 5HRUA 1TRKA 2W2OA 3TO5A 4AZWA 4YQZA 1QYVA 4M1SA 4KCGA 3ZBTA 4BCCA 2I33A 4E4YA 1IHYA 2LR0A 2O0MA 4BGIA 1HFKA 4DCVA 5IJ9A 3OZCA 3VO9A 4G1MB 4IH1A 1GKIA 4YIHA 3TTXA 1P7VA 5HA5A 3KKMA 1PR4A 5IYZA 1CUAA 3KZXA 5C7OO 3PNVA 1DAMA 4BO5A 5FI1B 1Q16A 5HE8A 4LPKA 1E20A 2VKQA 3K0AB 1N2ZA 4WAUA 5HDBB 4ZP1A 1DBWA 4I1YA 4P4TA 2OAP1 1DWUA 4EFLA 4TS9A 4U63A 3V8QA 3WWOA 1CE8A 3NOXA 4JLJA 4LYAA 2WE8A 4U2KA 1COZA 2QMYA 1TYBE 1GN9A 1T34A 4TT3A 4L9WA 1RPTA 4RY8A 3GFPA 3SNKA 1ISRA 3RRMA 3V3KA 3ZCXA 2B83A 4UTPA 5A3VA 1M8KA 4KXUA 5AW9A 5JAZA 5KSYA 2PMEA 3QVVA 1DCTA 4C6RA 1GT6A 2PX8A 3NBKA 3OKFA 2NG1A 4O2AF 4OK5A 1WCIA 5TPZA 4M38A 4EVSA 1ZCZA 5KCMA 4J3FA 2CHQA 3O8QB 3PFFA 4HZUA 4DRYA 2ZJBA 3NTUA 4ZGGA 3VPAA 2Y4NA 1T15A 2QTVA 3DE2X 3BWYA 1TU0A 1ULSA 3ZK7A 3PTAA 2CMDA 3FNHA 3VU3A 4E5YA 3W3AD 3HGTA 2P3QA 2JLCA 1K68A 5JYEA 2B69A 4XEHA 1V0JA 3MWKA 3D4PA 3DXYA 3DAOA 2GUWA 1FYVA 4HEJA 5ADHA 4B6SA 4DNQA 3WNQA 1N3IA 2AK2A 3RUEA 2HJRA 2QW0X 5ESDA 5AVQA 2JLYA 3UATA 1C9JA 2RGDA 3I5AA 4Q6BA 2V55B 3NTXA 3E18A 3HN7A 1SJ9A 4P31A 3G59A 3G68A 4UAVA 1CRZA 2WLSA 4AU1A 3AXTA 3AJDA 4JKIA 3UFXB 4UBJA 5D3MA 1H05A 3N2EA 3D6HA 4FI3C 1KFCB 1PIWA 1CT9A 3I83A 4MVCA 1X1TA 3RFCA 4EW2A 4FNAA 3QX8A 4HG2A 4PQFA 4YP6A 4MEBA 2RBGA 3CNBA 1E8MA 1E1CB 4IEFB 1NVKA 3E5RA 3VU1A 3A0UA 5C8YA 4ZVTA 5C52B 3ILYA 3TQQA 3MELA 5FT9A 4RL6A 2J87A 1W48A 3RS7A 3SLKA 3TDNA 2OP1A 1SVSA 4J7AA 1AS0A 3QFRA 1E9EA 3BVPA 1RXYA 3F96A 5EKDA 3RYIB 4C14A 4JI8B 1B73A 1HDYA 4C2UA 4JLDA 1BW9A 1UDCA 3OE7A 2PKQO 4KGZA 3D2AA 3KC2A 1DUIA 5DULA 4UNQA 1F4PA 3D02A 2NO1A 3W2GA 1RCUA 1PT8A 3ANXA 4J94A 3N28A 4JLKA 4Q47A 3TTVA 3ZCQA 4I5GA 3QITA 3GA7A 3NDBB 4YAKA 1WEKA 1UF9A 1W2GA 1WPRA 1YULA 3TRJA 3WLFA 1Z5GA 4IJWA 4CN9A 3KSMA 4UM8B 4QYIA 2O8BA 3HYNA 1AT1A 1FK8A 4ER7A 1UKYA 3H0CA 3QKWA 3E35A 3JQFA 3M5CA 5A0FA 3W4KA 4YH1A 3JD2A 5KNCD 3HCBA 1KO8A 2BTQB 4K8OA 5I3CA 3RLFA 2XVYA 3T1HB 1IDN1 2E48A 5GTDA 3WGIA 2FWMX 5EMLA 3H2SA 2E4VA 1ZD4A 1U9IA 4HGNA 5I9SA 1BDJA 1NHGA 3QG1A 4H1WA 1DKPA 1KEEB 1Z7YA 2QRUA 3TBHA 4HY3A 2ARKA 4TSFA 4PGAA 4XB6B 5JSKA 1IY0A 3L3BA 1LPOA 1JIUA 2C4WA 2ZP1A 2FQWA 3T3EA 3OLZA 4YJ2F 3X43A 2MR5A 3FVVA 4FI3F 2GJ8A 4FONA 3VISA 3IDFA 3ER6A 4NYIR 1OX5A 3N7TA 3L18A 4N6GA 2RHMA 5FA5A 2I2FA 3RIXA 3AY6A 3TX2A 2VP4A 3F3KA 2OGZA 3PUZA 4GC9A 3MM4A 3FPEA 3U1VA 2I54A 1GZVA 4ZVRA 4MV4A 5A9TA 4TLLB 5I4CA 4EJSB 2VF5X 3QXJA 1L1RA 2MSDB 2TMDA 2FGJA 4RQTA 5K6AC 3K9CA 4FC7A 4KYTA 4TRNA 3SX4A 3U3ZA 3ESCA 4QUAA 3WNCA 4YQFA 5A9SA 2J3JA 4DWVA 4Y1RA 4HD8A 4U7HA 2H1RA 2OXTA 3RSSA 4M54A 4WJKB 3NEPX 2OO7A 1NDQA 2PGLA 3DEJA 2Q0XA 1KEKA 1W35A 1KR5A 3I12A 1PR6A 4DVJA 1A7AA 1EWRA 3OIFA 4HLQB 5IAJA 2AEEA 1BQ3A 1U0BB 1UOQA 3Q7RA 1LC3A 1LPAB 2ZQYA 1TF7A 2ZWIA 3SS9X 3STVA 2I66A 3TBKA 5SV2A 4YUYA 5EWLB 4Q9AA 3VR4A 1NW5A 1ZJYA 3BREA 4K88A 4OIFA 1F6WA 4EBBA 3PRJA 1XBTA 4IVPA 3IERA 4P58A 2EJTA 1E6LA 1JTVA 5B2ZA 4P36A 3GVIA 2GNPA 2HEIA 4JJZA 4HXEB 4RK7A 2H1FA 5EZYA 4MGIR 4OGKA 3ZHRA 3P94A 4M1TA 2CHGA 3CVUA 3GWZA 2GXSA 2D2IA 3BL8A 3GOQA 2C8JA 3ZEIA 5HM6A 5LZ5A 5LLDA 5H80A 3CC8A 1LW7A 2R6FA 2D5BA 2Z5GA 4BFVA 3SD7A 4ZC8A 4PZAA 2QIOA 3KKPA 1GV0A 3O1HB 3E61A 1DTWA 3R3XA 4WBNA 4D97A 2CXRA 3GUCA 3C24A 3S68A 3IAM1 5L4LA 1O89A 1Q7EA 3IA7A 4EY7A 1DJPA 2JFOA 2OD9A 2JZCA 3SKVA 1NQUA 2H4FA 1TZMA 2I3DA 4MS3B 3BRWD 5ARDA 2C78A 1IYZA 1YA4A 1PWXA 4IIYA 3YASA 4ZOBA 1W94A 1NR7A 1XUOA 2JLWA 3EOZA 5L95A 3U09A 2GKGA 1EHIA 1ZH6A 2JL1A 3DCNA 3QUAA 4Y30A 1NU8A 2HYDA 3CNNA 4HAOA 4ZT7A 2GF2A 4MUHA 3UXMA 6ADHA 3QE0A 3OAAA 2NT3A 5KWIA 4CZ2A 2PZBA 4QU5A 3TNLA 3RBZA 4EB6B 1QR6A 1TF5A 4D9GA 5DT2A 2EF1A 2J0EA 2J48A 3EOAI 3EYAA 3H3FA 3UUEA 1P0FA 3HXKA 4QWMA 1ZJJA 3CB4A 2HIMA 2LCIA 3ZN2A 4BC1A 1G2IA 3I8OA 2J7KA 2BZSA 3ML1A 1I4EB 4RSRA 3OEEA 3BDIA 4GICA 4NWIA 1GAEO 4C3UA 3VC3A 1OH5A 2HKIA 2HNAA 5DXJA 1DMRA 2Q7DA 2CVHA 2GDZA 1XN1A 1XMOB 3Q98A 1R27A 4XTCS 3BMNA 3PHCA 3MK31 1A7KA 3PDUA 2DQKA 1TTPB 1H0RA 2YZNA 1ZM2A 2GRJA 4TTQA 3IIMA 1QHGA 3L4EA 3GRZA 4PIPA 4WI1A 2XXJA 2Z2YA 3K1JA 4FXOA 3TSOA 5B7NA 5EQJB 4H1UA 4DR5B 3ZCVA 3WNVA 4YRMA 3CWQA 1Y3CE 3EMDA 3GDFA 5GONF 1FF9A 4MV0A 4CETA 2C9DA 3PFGA 5IEBA 1POXA 4JYZA 1N32B 3FTCA 4UUNA 1ETUA 3L6OO 2X0JA 1OU4A 2Q2WA 2Q1XA 2FJPA 4BUJA 1I5RA 5JZMA 3BWDD 1GSAA 1JG7A 3C87A 4HFJA 2AMLA 3DAHA 3WMEA 4HAXA 2AZXA 4B5KA 4A0HA 3IOYA 2WW8A 1L4YA 1SUFA 5LDDC 3BXXA 4H3SA 2GBIA 2NZJA 3VR0A 3II6X 1MG0A 2AXQA 1GZUA 1LPBB 3A3OA 3B82A 3IDOA 4NZMA 1TO1E 2C8VA 3KFLA 1K97A 5EJ9A 4ZIRB 1QYIA 2QTWB 3WJ7A 1MA0A 3O0TA 4J0GA 3UJDA 4IUDS 3WWYA 1PZNA 3ZWNA 2RB4A 4MYDA 3LJKA 1KI7A 4F93B 3Q41A 3MLEA 1IIRA 2XB4A 3ONWA 2H4YA 4U6SA 3LYAA 3K0SA 1KVSA 1WMEA 1P1CA 2CNBA 3EMBA 4CV1A 4ER6A 5JLJA 1RIFA 1U2TA 4MZXA 3N59A 3PU6A 1U8UA 2V7WA 3ZGZA 2AR7A 1FW6A 1Z47A 1FDOA 1UADA 2XRYA 1V4VA 1WV0A 4WXHA 5E4FA 3WVNA 1DKQA 5CDSA 3QKUA 1TYAE 3IIEA 5L3QA 4B2PA 2IUTA 5F1YA 4NCNA 2IYFA 1TC1A 1XZBA 3U39A 4TYQA 4UPVA 3A7DA 3O4GA 4XRRA 3NIBA 2HXSA 4LXGA 1Q0UA 2CJFA 1YVRA 1MX1A 4M1YA 1R0YA 4S24A 4DG5A 1SAYA 2D1SA 2GVDC 4A91A 4PO9A 3PTLA 4D4MA 3FRHA 4AF8A 1P33A 1JQBA 1TI7A 2XF8A 3RIGA 3MYYA 3WDMA 3AYZB 2ZYRA 4OAPA 3KYIB 3M9LA 5CXUA 1I3KA 1FRVA 2W2LA 3QVGB 4RIFA 1K7EB 1SQGA 4G5YA 1VBKA 4II3A 3S40A 2L82A 1CBUA 2HN9A 2IPNA 3K2EA 2C7GA 3R6WA 1U4SA 3UXEA 4BO6A 5IKPA 1MFZA 3KYDB 4IFIA 3SYMA 4L07A 5E3JA 1PF7E 3D6UA 1GRRA 1XTUA 4OD0A 3P32A 2AFVA 3FTNA 2EBFX 3BYZA 2GBPA 3DV0B 4Y2SA 1RYFA 1T4BA 4I5DA 4TYPA 2FOIA 1V1RA 5M7EA 1X80B 5A4FS 2W6OA 5E95A 3NBXX 3FPLA 1V95A 4RKRA 4Y6PA 1JKFA 3R5TA 4KYIB 3WZMA 1AKWA 4MIKA 2BGMA 3AIKA 2CKDA 3D81A 1QH8A 1BC5A 1YASA 1JIQA 1U4NA 2QGFA 4PAGA 2RHLA 4XIGS 3DXZA 4BQPA 4ZJZA 1U8TA 5LYJB 1ECBA 4RPHA 3MJSA 3K9BA 4YAUA 4RO0A 1BQEA 1OA0A 3LUCA 3ODGA 2RHCA 5KKNB 3BWCA 3DZIA 4FZ5A 4LXHA 1N57A 1PDWA 2VK8A 1C7IA 2F9FA 2K7FA 2VDLB 4MDEA 5IDYA 3AVTA 2UYHA 2BKVA 4BZQA 1MF7A 2DBZA 1KMHB 2XUDA 4MDYA 3TOZA 2VH5R 4BNTA 2G67A 1A8QA 1EVLA 5C3MA 2JFNA 4AJHA 4DPKA 2X1VA 1IEXA 3HZRA 4G86A 3EGIA 3BJMA 5AJVB 2YY6A 2OBYA 3DEIA 5JV5A 4X65B 1SKMA 3THOA 2YHBA 2B6HA 2LTAA 2XGOA 2LZ0A 4PNHA 2OOSA 1W6UA 3OX4A 3G2IA 1NVXQ 2VSQA 1TLFA 3WDSA 3WLMA 5AM3A 4R8RA 1IQPA 5A4AA 1AO3A 1DTEA 3I92A 2VDPB 1Z0SA 1EFAA 3L9XA 3DO8A 1U7XA 2DEUA 3SKXA 1IH8A 3QLVC 5FH9A 1G9XA 5CIWA 3EXG1 1DFGA 3OZVA 2JGLA 4HAUA 1XCGB 4EECA 3QNWA 3A2MA 3EDCA 3O8DA 3GJSA 2QUZA 1RMTA 4RIHA 2HF8A 4EY8A 1UC5B 2Q8QA 5CH3A 5KOHA 4XSGA 2VCYA 2C03A 2WAXA 3N70A 4MEJA 1JEYB 3E3MA 3L49A 5IAOA 1RAEA 1Z7WA 5BVGB 1NRXA 4ISCA 5ALZA 3T94A 3UHFA 1SPBS 3TLYA 4MARA 2ZTVA 2PSHA 2NUAB 4UJ5A 2CNKA 3V4LA 1E18A 1OBVA 3VU0A 5DFAA 1OWOA 1JFLA 3AM5A 4R0VA 3UC9A 2ZE5A 1J23A 4K9LA 3ZU4A 2AZTA 5IJ0A 2Q99A 1K4MA 2HCFA 3Q3VA 4MRAA 1ZMBA 3TAXA 2AG0A 4B2LA 6CHYA 3L8FA 5BV2P 2JFXA 2IPMA 5DP2A 4RPCA 1DKRA 2MSLA 1FU7A 2R47A 3AUFA 4IIUA 4MH0R 3M33A 4ZZ0A 3JQDA 5GAJA 2VP0A 1R4MB 4INOA 1P1JA 2VJBA 4Y6SA 3ABOB 5CB6A 3AHEA 3GD7A 1ZWKA 4ZV7A 3OPYB 4MCHA 3GQBA 3CINA 3LNTA 4QD3A 2VCHA 3TTUA 3U7IA 3Q8KA 1JH9A 3QHPA 3ABIA 4UE3S 2ZRAA 1B2RA 2AMVA 3FI0A 1NUTA 1GSOA 1J1UA 1OLSB 3FG9A 2IIQA 2G88A 1SCUA 3M6LA 5FOWA 4A5OA 4K1LA 4N8EA 4EIWA 2HCTA 4IWXA 2LCFA 2G4VA 3NETA 4MWTA 3B6IA 2W0MA 3R7LA 3UT0A 3GG2A 2REXB 4HSEA 4ZIRA 2H4HA 2HGSA 1KXJA 1W5TA 1SK8A 1KS9A 1QNLA 1T2UA 1TEXA 1JLLA 3GF4A 3HNOA 3KG2A 1GG9A 3L0OA 3VR5A 5FWYA 2OFXA 2AFIB 3QENA 4J3JA 2MINA 4LRXA 4UXHA 5B6IA 2CKMA 4JLVA 2GN6A 2PLAA 3B6ZA 3E03A 4UCQA 5IDQA 2J9RA 2DFDA 3UYLA 1JEQB 5CX1B 3BQNB 1JQ5A 3EQ7A 2PUCA 2FAXA 2FUG6 2VPWA 4F38A 4LCBA 5C5DA 4LOKA 1TO2E 3CVJA 3GN1A 2XDYA 3ESAA 4CTOA 4H7JA 4LVNA 1KQGA 4N9WA 4EA9A 5CT6A 1IE3A 3OT1A 3VHLB 2ZVPX 5LP6B 1CIJA 5LP6A 1ZGBA 2NUTB 3D8UA 4MRPA 1WS6A 1LFDB 2OCYC 2OXEA 2DR0A 2FF7A 2VP6A 3COSA 1Z5UA 1U8FO 3H9QA 3UJCA 5DNEA 4OQYA 3RT9A 5A4DA 5C80A 3RJ5A 1QXSA 3P45A 3WHLA 3T5AA 2NX2A 2FUEA 1ZH0A 4Y6LA 4DZRA 5BP7A 1S7GA 1W5FA 3FF4A 4H27A 2IHVA 4Z0PA 4ESOA 2MSCB 2A9VA 3LRPA 4UFNA 4JQSA 2J0UB 4JP1A 5L3RA 5BWBA 5CA1A 3TIIA 1L8AA 3G88A 1G41A 1T5HX 3OZTA 2RKWA 4NS4A 2GFHA 1HNZB 2HL6A 3PL1A 1ZJ5A 4YRKA 3DQPA 1HL3A 4PONA 1VMDA 4OJNA 3QW2A 1O5TA 2BE7A 3DDUA 1E6MA 1P77A 5FAKA 1S3IA 3X2SA 5JSUA 3EDMA 1NXOA 1TZJA 4HVTA 4CMIB 3MCTA 3THXB 1UMCB 4QYXA 4L8LA 1AA6A 3H6GA 5CB8A 1ADYA 2X3UA 4F5DA 1U2SA 4F45A 2HWYA 3F5SA 1XQXA 3R20A 1QVRA 1MOQA 2I3GA 3BZBA 4M0DA 4DY6A 4G9BA 4HJRA 3PKIA 2NACA 4JI3B 2C07A 2DTXA 4CMGA 1EESA 5F3RA 3U6BA 1IHUA 3MVEA 3D0OA 3N07A 1SO8A 3VAYA 2P6UA 3ZE8A 1Z8FA 1DT5A 3EYWA 2NQ2C 1NVMB 3T9AA 4AUKA 1BD4A 2CXXA 5CK5A 4FHCA 2A3RA 1RI3A 3C7AA 1NMSA 2GZ1A 3HKEB 4QHTA 2WUFA 4ZWNA 3WWEA 4JUIA 3IAEA 3COPA 4ZTBA 4WBNB 5JAIA 1ISHA 3FMFA 4CPDA 4S12A 5KSZA 3CF2A 4D0GA 1UOOA 2GD6A 1FFXA 1WXEA 4MKIA 3ND5A 4WCFA 2PRJA 4Y7CA 2NO0A 1PKXA 2V0GA 1X7HA 1U6JA 2H1VA 1HRKA 4WINA 2FUKA 2GH1A 3R77A 4JOCA 1AB6A 1BWQA 4COKA 5AQ1A 2B4TO 1GR0A 1W0CA 3ESRA 3L06A 3KD3A 5LQJA 1U1FA 4UVEA 5YASA 4H35A 1FQKA 3LM8A 5F5LA 4AG3A 5EIBC 3QU7A 1DCFA 3AKCA 5BOSB 2JJ8A 3A70A 2GT1A 1T5OA 2R1VA 3HBMA 4ESEA 1JHPA 2I7XA 3ETDA 1SQFA 2BVNA 1AQIA 4Q3CA 3ZW7A 1OE0A 3C85A 3EEFA 2J9XB 4HZGA 1GGJA 5A6VA 2B9VA 1Y6GA 2D6FA 1CEEA 3LDAA 1Z17A 2CLFB 2XBMA 1KDTA 1BW9B 3G0OA 1K1EA 1S7CA 1NBIA 3RVBA 1WB9A 1JXQA 1IHOA 3PQ5A 1Y82A 2VYCA 5K2OA 3AR3A 3U2QA 3GWGA 3CVOA 5A9SB 3VU9B 4MPRA 5IAGA 4ZYYA 1Y1TA 4MOWA 5ICEA 3OICA 2O19A 2XGMA 5T3YA 1RC0A 5CT8A 4M60A 2IXTA 1A4RA 4OQMA 1UANA 1HYQA 2QV0A 2NVUB 5JCOC 3UMYA 2GCEA 3W6OA 1P7PA 4RC9A 1ODJA 1P4SA 1ZCFA 2JS7A 2OO3A 3VYWA 5LOVF 1MIOA 1MFPA 2BMDA 2JFUA 2ODBA 4JGIA 3PR1A 4U1RA 3EY9A 2BMEA 1TCAA 2ZR8A 4OJYA 3FYTA 1OFUX 4V0ME 4XM0A 3W2TA 2HHLA 3NH6A 1GXSB 5AOVA 5HQJA 4WMLA 3U5ZB 2GRAA 1AGYA 1C0KA 2EJWA 3CS3A 2Y0PA 3D5TA 4LYGA 4RK0A 4JD5A 4C0LA 3U44A 1YQQA 1DHTA 2AFHA 3R6GA 2R68A 4PY2A 5BSEA 5HMLA 1MO2A 3K09A 7MHTA 1WULS 3BXFA 3HR7A 3WBFA 4PN3A 2LVBA 4UC0A 5FUYA 2VN8A 3DV0A 3VUFA 3PNSA 1RHRA 5F2EA 2DWCA 1MTZA 4JVNA 3SC2B 1JX6A 2FDRA 3CIFA 3MCUA 4RACA 3GFBA 2VOJA 1MRNA 3O8QA 4UTOA 5FULA 1UKCA 3UXHA 2E4YA 2ZJ4A 2JPDA 3H04A 1CUCA 3B53X 4IZIA 4BFTA 3KTOA 1OLXB 4FX2A 4REQA 2VPIA 2HJVA 3COYA 2HF7A 4OYHA 1LFAA 3MZ0A 4WW0A 2JG3A 2YNMC 2VYQA 3DFKA 1QBGA 3CF6R 4W5WA 5FORA 4Q21A 4YV2A 3IAS1 2R87A 5B2EA 4AJ9A 2G07A 1T1JA 2D5IA 1GPAA 4JP2A 3HCFA 4FLMA 3E7FA 2B8WA 3GIDA 1P2VA 3LZ6A 5DISB 1TMYA 3SJBA 1DEHA 2DTEA 2ZJ3A 1UDRA 1R00A 2TSYB 4I55F 4MI1A 3CLSC 4Q9JA 2EQBA 2XD4A 3K0AA 5F64A 3AB3A 4PANA 5FFNA 3T3DA 5A4MS 5D8DA 2O2SA 2NN3C 4HS4A 2AZDA 4X64B 1NMYA 2QMUA 2QSZA 1CV2A 3R1IA 1QVWA 4MLDA 3QPBA 5LOVB 3WK7A 4R81A 4Z5XA 1OTHA 2FCAA 3CKKA 3EDYA 2OYSA 4Z2AA 1KBQA 2Z2IA 3PWZA 1TVCA 3TRKA 1CUUA 3FAKA 2AE1A 2Z08A 4Q7KA 1X86B 4QSHA 1E63A 1M9NA 3TWOA 4EATA 4CF7A 4GKJB 3D6VA 3HKBA 3IX7A 1FPMA 1U28C 1HE3A 1R7RA 1HE1C 1RW4A 4GGPA 2R7AA 5H7XA 3O3OB 2VTBA 3IJ5A 4D41A 1DV1A 1MBZA 2C7OA 3CGWA 5DCLA 5DHFA 1YSCA 2VRCD 2VP2A 2A8YA 3DZFA 3LVRE 4MW7A 2VBFA 1CUYA 1XTTA 2I62A 2XZTA 3LDFA 3PC8A 3MBKA 3NHKA 4DCPA 3MNFA 1WAMA 1B0PA 4FP9A 3E9NA 4OUKX 4LSGA 4YMSA 5I5GA 5HZMA 1EFVA 1IXSB 1EXWA 2B8EA 4FIDA 4GVXA 3AR8A 4FNOA 3I28A 2UXDB 4JX8A 1ZR2A 1F4VA 2QVYX 3FGOA 4DLNA 3QYAA 4PC7A 3K9GA 3ND7A 4MKFA 1RLTA 2Z6QA 2C9CA 2GM4A 4NABA 3DWEX 3DDHA 3ZEAA 2YWCA 3AWDA 2YFKA 4BTLA 5A2QA 1WBDA 1Z4KA 4O2AA 3H8JA 4EL5A 5CD1A 3ADOA 1N7IA 3QKRA 4M1EA 3TXYA 5I7HA 2ZM5A 3UWMA 5FUQA 1JDVA 3VC2A 3WAGA 3PQDA 1U8CB 3STHA 4R1PA 1NQAO 1K3TA 4MUGA 3OZDA 4LX0A 3IAS6 4Y0NA 4DIKA 3THXA 4B3GA 2O8EB 1XRNA 4LXYA 3PX3A 2DFVA 4PAQA 4M8IA 1CDZA 4X92A 1OB2A 3HA5A 2R8PA 3KR9A 4N5LA 4C4PA 2F3UA 5C1OA 3EUAA 1UK9A 3EZNA 1KIFA 2X4DA 2ZVQX 2E1PA 3OPMA 4WESA 1MNQA 1X94A 2RH8A 5DM1A 1TJPB 2FZEA 1YRQA 3K0FA 5KSPA 4U00A 3DLAA 1F8XA 1WW2A 1RFGE 3OLVA 2G1JA 2ODQA 3LXXA 3LX6A 4KBGA 4MRSA 5C1IA 4EHNA 2QIPA 4C7JA 3VTZA 2DT8A 2Y71A 4QOHA 3WA6A 4JI0B 2PMDA 2REQA 1J2YA 1CUFA 1UQRA 1VHLA 2J3IA 2Q4OA 4WBSA 4AJPA 1X7YA 4KNWA 1YONA 4JKOA 2HLHA 4MVJH 5BNTA 2C0CA 2X9LA 3PD0A 4UULA 1YOBA 3AG5A 4J9UE 5ULLA 2P9TA 2VHVA 2VG8A 3PHLA 1FFBA 5GONA 3U3DA 1OB5A 3T3NA 1IBLB 1X13A 1LSOA 1N2BA 1ZU5A 4MKZA 1UDWA 3WYNA 5LL6P 4TXNA 1DC7A 1V11A 1NDUA 4P22A 3FYUC 4JAVC 4U0KA 4ZI2A 1M2VA 1B6RA 1FQJA 1IATA 1Q77A 1GV1A 1Z4IA 2C2BA 3NHYA 1QMGA 5I9BA 4KX5A 2JI4A 2WSBA 5DNVA 2A5JA 2I65A 4L5BA 1C80A 1GY8A 4RZHA 1E4EA 4PLFA 2ZR0A 3QP9A 4CQMB 2LXNA 5BRAA 1D2NA 3AXSA 3DT8A 4NSNA 8MHTA 3OAAD 1YRWA 1G21A 1PR9A 4RIIA 1ST2A 1LBEA 1SIWA 1BGXT 4QM7A 1TAGA 3VSAA 3CLVA 4EGAA 1K8YB 4OM7A 3CT4A 5JTTA 3V4RA 5K0TA 4NDNE 1Z0JA 4AY5A 2IYEA 2JB9A 1TK9A 4YMTA 5A3RA 5F7OA 1LS1A 2PYZA 3PI7A 5DW3A 4XTRA 1U28A 1SCUB 4G84A 1HLDA 2E4WA 3R7WA 2F3RA 1OLSA 1R50A 2HFKA 1BXGA 2K4MA 2VIIA 4AO6A 1L5RA 4HK4A 4LBVA 5GJBA 3HB4X 2OMEA 2Q8PA 2JEYA 3EXHA 3ZGXA 4G0PA 4M8NE 3K6SB 1UJBA 3LQQA 1OREA 3L05A 4R4JA 4B4OA 3JCZA 3K8OE 4BEBA 3U5TA 5ITWA 3RE1A 1CUJA 3E9RA 4LSZA 4GSYA 3K1ZA 4UOZA 2FPLA 1J06A 1G98A 1KZ7B 3LC2O 4H4EA 4QFDA 1QCYA 1KSFX 3BL5A 3DUFA 5G2OA 4DDMA 5CA1B 1P6QA 4L5JA 1F0NA 3IT0A 1Q1EA 3DVSX 5ECWA 4K6GA 4RVNA 4L5AA 3CX6A 3MERA 4XIYA 3RTAA 4DBLE 3KUXA 3IUJA 5AM4A 2XQIA 4LJLA 5IMBA 1TMKA 3O91A 1KOLA 4F6LA 5HJ7A 2HHCA 2QI9F 4I4CA 3JQ7B 3GEDA 4L50A 4ZYTA 1XCLA 3HRHA 3L8HA 4K05A 4EYEA 3U3MA 4Z4EA 2Q07A 1YE5A 2D5CA 3P0RA 5ICSA 5I7EA 1JSZA 2ZCUA 4R40A 5CFOA 3E2MA 1OTYA 2GGSA 4N7JA 4Q3BA 2VAXA 2B4YA 5C53B 4DNFA 1G59A 4L8GA 1XPUA 1T0BA 1KNXA 3Q40A 5LA6A 1QU2A 3KAPA 1KEPA 1Y8RA 4XB1A 5K6RA 2YL2A 2YYAA 4MX8A 1ELOA 2VT2A 3BGOS 3AT1A 4D42A 2IC5A 1R6VA 5CT5A 1M3SA 3IBFA 2F3QA 2A59A 2QTFA 2CB9A 5HUJA 2FX5A 1NZJA 2ECPA 3LY9A 3STWA 1DAGA 3FDXA 4L8WB 2PU7A 2BFWA 1QF9A 2WHQA 1B41A 2Q50A 3NP9A 2BDEA 5EIAA 2PT7A 2WOJA 1Y1PA 3QHQA 4GBGA 1DAPA 2BTQA 4R6WA 4ERNA 5U9CA 2ZW9A 3PD1A 4MMZB 2VVTA 4W1PA 3WLQA 1QVVA 4F2HA 5CEEA 3FB4A 2QJTA 2OSBA 4MRVA 3F5FA 1UCFA 1G8MA 1HX7A 3OJEA 1EDDA 2YRFA 3I0MA 4GRIA 3CZPA 3ZLTA 4B3TB 4BLWA 4H1VA 2J9FA 1DKMA 4CM9D 1KMHA 2DHQA 1XWFA 4BNFA 3ZLJA 1ZA2A 3LUBA 2C57A 5ICMA 4K6FA 1HLGA 1QKIA 4DRZA 1DHRA 3TXXA 5I7AA 2XDAA 3UAGA 4NBKA 4RPLA 2H3EA 2IS1A 3LKBA 2D59A 1P1BA 2BBSA 3L1UA 2FW7A 1TIKA 2ZYGA 1J2TA 3HA3A 2HA6A 3FXAA 5FTNA 3L04A 1KYXA 4Q93A 4H7DA 4B75A 1Z4PX 2ZYAA 3WDKA 1HY3A 1JJAA 1QIHA 3ROGA 3ASVA 5DLEA 1QPBA 4G56A 1NR5A 5IVKA 1L5SA 3P2JA 5JVDF 5JEEA 2RJOA 3ED5A 3K8QA 3ZWXA 1R10A 4FE4A 1B3BA 3H99A 2FP4A 3ZZ0A 2F1HA 2JK1A 3EGOA 1GFZA 2QN8A 3GLUA 3WYCA 4ZHSA 1KZ9A 1VB3A 5KUTA 5AKYA 2O2HA 1Q0QA 4YAGA 3MWDB 1K7FB 4LXTA 3MAGA 3PC6A 2J3MA 3QV2A 4Z1MA 4OQNA 3IUNA 4A82A 4BGVA 2F9MA 5D3QA 1NVGA 3CLRC 1JVSA 3N74A 3LUHA 2EX1A 5DE3A 4CT4B 3CWCA 1URPA 2ZZMA 3FNFA 1M0WA 3SC3A 4N03A 4BGUA 4Q02A 4NAVA 3L5KA 4ENSA 2H5EA 3PFWO 4TWZA 2HT1A 1L7NA 4L57A 3HSYA 4IKEA 1OI3A 1N6PA 1LBQA 1E5TA 4PSAA 1WZ2A 1EGQA 1P1HA 1X0XA 3B20A 5LZ9A 1O94D 1UBMS 5CG2A 2VFAA 2P11A 3FSJX 3W6NA 3LPCA 4QOIA 2BM8A 3H19A 2CZGA 1RRKA 1NF3A 1SUDA 3FFTA 4HB0A 1WCV1 4L0DA 4W5RA 3TZ6A 1W6RA 3K9WA 1XQ1A 2JLRA 1P1IA 2Z58A 1UOEA 2OKGA 4Y1GA 3R9XA 3OLXA 4G1UC 4KODA 2JA2A 2WJZB 4X85A 5EC8A 4C20A 1T0UA 3FPHA 3SM3A 4HAWA 3N2YA 4JWTA 2WF6A 3G6WA 1EWYA 5GVRA 4OI0A 4URVR 3JD3A 1JTEA 2R4TA 3QUQA 2AFHE 1R9JA 3T9BA 4Z3DA 4MGYR 2NVOA 3U80A 1SOUA 1WXFA 3AJEA 3U0VA 1RJFA 3S6JA 4DTIA 3VHXB 1W96A 1RAGA 1M1NA 2B5OA 4RX1A 4MKGA 1N25A 3AQ4A 3B7PA 2X4LA 5DGTA 4L75A 1IK6A 1WNTA 4JLUA 4NJMB 4JV5B 4IDNA 4GM1A 4GP9A 2GLXA 4TXLA 1YI0A 3ANMA 3WLTA 4B80A 3RU9A 1ZVKA 3K8ZA 4Q15A 3RFTA 4A2WA 5FOQA 3KU1A 2FWAA 5J5CA 5C1DA 1N6HA 1TEVA 1RNLA 4IDPA 3TE6A 5C3UA 4X6YA 4NBTA 2CJWB 1NW9B 2JBAA 2V96A 1LUAA 4IDQA 5BNIA 5JQWA 2K7ZA 2PGNA 3ORSA 4PLPA 4Z8XA 3M6XA 4DXAA 5ADUS 2QN3A 1P80A 3SX2A 3CEPB 2J5RA 2FQYA 3K92A 4NEGA 4INPA 3BMNB 1Y3AA 4QLOA 1E1QD 4DA9A 3BGWA 2R7NA 5CB4B 2VRWA 4FCVA 3JAWB 1DKNA 2DCUA 2ZUBA 1LU9A 3GX1A 4HDSA 4FZJA 4ECAA 2VHEA 2YQ5A 4HQFA 4PIVA 2EP5A 4X20A 1MVNA 3V1MA 2HMTA 4UUOA 1Q0ZA 1I3OA 2C3MA 3PUVA 4DUYB 3QKTA 3N5CA 4O2BA 3QTTA 4DMUB 2XMZA 4EW3A 4OFBA 4EA7A 3MWGA 5IXSA 4GF5A 2W90A 5JG7A 3E1KA 3DDWA 2AFHB 2BHTA 2P3SA 3SAJA 4ALMA 4EB0A 1X3SA 2YN2A 4HLUA 2YV3A 1JHZA 5E3IA 2IIBA 2HU7A 2JGKA 1EG7A 3CU5A 1KVUA 1ATIA 1GDDA 2O9JA 3AJAA 4ZVQA 5KAMA 5IG2A 4JXKA 3LBFA 1YQUA 4IJMA 4GLFA 2CNNA 3GJQA 1H5UA 4UKDA 2CL0X 3WMXA 4DCCA 1JB9A 1YAJA 2VJQA 1NQVA 3IHLA 3V8MA 2QP3A 1RM0A 3TCNA 1HE2A 3CR8A 3F6CA 1HT1E 3PHJA 6YASA 1ZONA 4RJJA 3K1TA 4UEOA 3NGXA 1H6AA 4FHEA 3IEXA 3QXXA 4CUKA 2YV4A 4ML3A 3W7BA 1DRKA 2C2ZA 2E5LB 2AKEA 4N5NA 2ERCA 2KSQA 1KGSA 2QUJA 4KPYA 2G8LA 2CDNA 1A9QA 1UZMA 2C98A 3OURA 4FZ3A 2XT6A 3BKXA 1FDVA 1T3HA 3I9JA 4GNKA 2GUGA 5M04A 3EAQA 4ZI3A 3W1VA 2AOVA 2B0CA 4V39A 3KT3A 4C07A 5CCXA 2ECOA 3AOEA 2HWKA 1M5RA 1LJUA 1M2KA 3D3KA 3KS9A 3NCTA 3V97A 2XRFA 3PQ4A 4CWAA 4F8EA 3IQFA 1KJYA 3KVVA 3N39C 4L27A 4OCZA 1XZEA 2I8AA 1FYXA 3F90A 1GL7A 3PX2A 3ZDEA 4ZZ3A 2C29D 3LK7A 4BMNA 3H7IA 3CUTA 1RJ9B 1NJ2A 2XOKD 4QASA 1XJWA 3ND8A 2Z3VA 1X9IA 2QN6A 3M6MD 3TAUA 1W5SA 1OKKD 2QD4A 4FDUA 3Q10A 1A5ZA 3O9ZA 2H0AA 3RG8A 4PYRA 4EG1A 5JT1A 4PCVA 1QIMA 1FNBA 2EDCA 3IVMA 4INZA 4P6VF 4ANFA 2QZJA 3FUVA 1ID1A 2PQ6A 4BO2A 2C92A 3A6FA 1F8YA 4GP6A 1QWSA 1NSTA 3EXHB 3LXUX 3PA6A 1FYDA 1Y6QA 5KVAA 1QRTA 2UV8A 5TNXA 3OQJA 3UH1A 1X7DA 4Z4GA 3EVZA 2YZ2A 1Q1QA 5DEOA 4BNLA 1T26A 3VX4A 2WDZA 5DYIA 2DJIA 1YB6A 1DXHA 4MJ3A 4AMGA 1V43A 2BL4A 2X5JO 4KH0A 4C1NA 3JARB 4RMGA 2RGGA 3DB1A 4QTYA 1BTOA 3GZNA 4KZPA 4NBRA 3A6ZA 3AVOA 1QF7A 2FMIA 3IMFA 3W34A 1UXJA 3AUAA 1X8JA 3AR6A 4HQRA 4OP3A 5CFMA 1NP3A 1O87A 4A15A 2VPPA 5I45A 2ST1A 4EZBA 5ERYA 1ENZA 4TKLA 4P35A 4RPKA 5A5EA 2RG1A 1E4EB 3BHNA 2WIFA 2X2EA 3SY8A 4DW8A 1JBQA 4WOPA 1CIVA 1L8XA 1Z7EA 3MILA 2VHYA 3F3MA 1YK1A 3WQRA 1KEEA 3OM0A 3QVUA 3RF7A 3RUAA 4P0QB 3Q7TA 5F3WB 1XE3A 3FBWA 1SVNA 5FLYA 5JW6A 2JEZA 4Q1VA 4V1CA 3VJRA 4MQ6A 3OESA 1H3NA 1Y5IA 4HB4A 4X93A 4QDTA 4OB7A 1U8EA 1RPZA 3H2GA 4KQCA 1RYBA 3AVYA 1GQRA 3GLQA 1KI8A 1C9EA 1XP8A 2QT0A 3H9JA 4GQAA 1NN5A 4M6WB 1WBBA 4I50B 2WIAA 4E4RA 2WSSD 1OKKA 3IVCA 5U4XA 5AJUA 4B83A 4INAA 3VKUA 5ALTA 3MT9A 1J0BA 4XGKA 5IPFA 1NJ6A 4PHGA 5KPDA 3C3CA 4IRXA 2A9FA 4MQ5A 3OCVA 5FIUA 1RMQA 3EXFB 2W0SA 3OU7A 1O77A 4BY9E 5JCZA 2I29A 1PFWA 3HYCA 4UREA 1IUNA 3BH7A 3BHIA 4BVAA 4CLRA 1GCGA 2PS3A 4H08A 4S04A 1G5IA 1K9VF 4P81A 2IGTA 4ID3A 5LUAA 2PZGA 5AW0A 4ZRNA 1SD2A 2QQ5A 4EKIA 3U7GA 4PXYA 2G0TA 1C8BA 3HKDB 5LQSA 2EW2A 2ZAGA 3L41A 2H1SA 3CUWA 4I9FA 2M2IA 5AHKA 4BBJA 3AL0C 1ZDMA 1UMKA 1Z0DA 1Z75A 4GWGA 3EH2A 1H23A 1XD8A 1G9SA 1SCAA 1N4DA 2FY8A 2I80A 2JH9A 3KZMA 3PPWA 5EJMA 5B4VA 1QRAA 2AOTA 1KJ8A 4WERA 5JIBA 1IAQA 2VDMB 4G23A 1O0SA 1D3AA 4IO0A 4CCAA 1BG6A 3KXPA 4U3JA 1QC5B 4DYDA 5D5QA 2D00A 1PTKA 1CNEA 3QFHA 3LLVA 4LOAA 4MJ7A 2FW9A 4JI1B 3N3AC 3T4UA 1T2EA 3URKA 3ZCPA 1N2EA 1O0BA 4NI5A 4HDRA 1U7OA 4J1QA 4NEHB 1KDRA 5E2BA 1J49A 4EL0A 2QJRA 5BUCA 2P4SA 3AFGA 1ISSA 2GCIA 2GEVA 2OVBA 4ZVNA 5J3JA 4BX9A 2WJVA 1Y7PA 3DW1X 1E5XA 2YZ7A 4QFBA 1H2HA 3RYFB 2OM2A 2AR9A 1CR1A 1DIAA 1TKBA 3N1UA 1RFLA 1B8UA 3QTLA 2PX0A 3SZRA 4QGSA 3GEMA 3ROTA 4OJTA 3Q1LA 3ZV3A 2V0NA 3GCDA 5DGCA 2M9MA 4JC8A 2GN1A 1WXWA 1D07A 1FS6A 4KR0A 1U9YA 1VGVA 4DIEA 2PL3A 2RBKA 2NPIA 4QOJA 5M3BA 1X70A 3BD6A 5K8TA 2H2DA 2YHIB 4L51A 5EUBA 1SG6A 2MCFA 1RKUA 2ONCA 3DSRA 3RBVA 1RBQA 1TVEA 2FJ0A 1SBYA 1BFDA 1SB9A 2A5GA 3QMWA 3UVEA 3GEGA 4OFZA 5HIAA 4C22A 1PD0A 1HDIA 4NK5A 4V3CA 4BLSA 2D8AA 2NTNA 1YHYA 2W43A 3OQHA 5FA6A 2ZU6A 3SDSA 1FFGA 4K8RB 2FRDA 1WUYA 4R05A 3U3RA 3W9YA 1VE1A 3N58A 2BKEA 1N9GA 1JG3A 1CWUA 2IZ5A 2P9HA 2WWWA 4RLHA 4EJ6A 2CSXA 3CNQS 4MWGA 3HXMA 1UK6A 1Y5RA 2ZSEA 1VRVA 3DWIA 3OZAA 1DX4A 3R5SA 3N2KB 4MK4A 4UHCA 5AVSA 4REQB 2FSPA 3JS5A 2PRSA 1QYRA 4K7JA 2G1AA 2QAJA 4B47A 3EDOA 4LTDA 3HADA 3DMNA 3IPXA 3MGAA 4K6HA 1ZD2P 3UANA 5FPKA 5CXQA 1EP9A 1ZHOA 1LDGA 4PICA 2H5JA 5IC6A 3ON5A 4FYVA 1N0HA 4B35A 2JD0A 3DAGA 3EWIA 3VJMA 3MJFA 1C30A 2YXEA 3PQFA 3IHTA 3NM4A 4H6WA 1VG0B 1YJ8A 2ZCVA 4QUBA 2C5AA 5I9MA 1WF6A 1N2OA 1UBHS 3EVTA 3M6IA 4WZZA 1E6KA 5JBNA 1BCSB 3EZ6A 4BQRA 1C8LA 1WKBA 4JVLA 2EFYA 1ONPA 2BEKA 1ORWA 5FCDA 4ASUD 1I33A 2FN9A 4HBGA 4JJFA 3QNMA 2IX9A 1QO9A 2HBZA 2ORWA 4P7FA 4X0EA 1IWOA 5FOVA 2OZPA 3AETB 5JALA 1O94A 1ZD3A 4HVAA 4OQXA 4RLFA 3WFZA 1G8AA 1MB9A 4PSUA 2WJGA 2WJ4A 1LJLA 1U2RA 1WVIA 3MMXA 4R1UA 5JCXA 2ETXA 5K0JA 2P9JA 3WGTA 1A4IA 1HMYA 4RPGA 3W5IA 3WGQA 5JADA 1A97A 5CA0F 4O4HF 1CC1S 1U0OC 3L6DA 5AK5A 2BGIA 3LBIA 1SUBA 2B35A 2FRDC 2MYUA 3JQAA 3NRBA 4JB2A 3DBHB 4IIDA 3BERA 1P8JA 4D9FA 4TXMA 1TMGE 4FMCF 1SUIA 2A9PA 3MC1A 5BUQA 3P9QA 1JQDA 4PS0A 5ISMA 1Q5PA 1AF4A 1Z73A 4CEJA 2HA2A 1F1JA 3H3JA 1GKKA 1G5RA 2J3KA 4IXNA 2VWHA 4JEHA 4B7CA 2MOKA 2V4UA 4O4HA 2A94A 3NDPA 4JI5B 1E0AA 3U56A 4KXXA 5AP9A 1EFRD 2UYOA 1ZOPA 2ENUA 1RWOA 3SFZA 3RVDA 3NHAA 4AP5A 1UWCA 5FNVA 3B5IA 1AE1A 4EHLA 1GPYA 1RADA 1VLZA 1YE8A 3QYJA 2PD3A 1LVGA 1K4KA 3VDMA 3OVMA 4JL8A 2Q6VA 3KUKA 5DTMA 2AN4A 5A0TA 3PJRA 4P0TA 3RVLA 1COWD 2Z56A 3ELYA 2J0QA 4EGCB 1EJBA 3A4IA 3AY0A 5BSGA 1JG4A 1G6KA 1WQ3A 2GKSA 1N2IA 2DMRA 4QECA 1V16A 5B64A 3R9WA 2AJTA 4S1PA 1H0HA 2D0IA 3E82A 1RJEA 4ALKA 4PR3A 1ZNZA 2ODAA 2PPLA 1TD1A 1V26A 1T1RA 4HDNB 2XWSA 3UJNA 3AL3A 4XCXA 1XEWX 3AO0B 1H9AA 1E58A 4Y0VA 5C34B 1OX4B 1R6BX 1GR1A 3TFWA 4F6RA 4YWJA 1N4AA 2BGWA 4LZPA 2C96A 1LF0A 4H3HB 4X3PA 2RGXA 1DRJA 2WJHA 4FMPA 2H08A 4KAAA 4LWZA 2ID7A 1PNRA 2QZPA 1JG1A 3INTA 4OSEA 1K7XB 1ECFA 1JJIA 4OMCA 3LCMA 5FADA 1OIXA 4D74A 3VNVA 1GA4A 1QB8A 1EB9A 4Y2YA 2WWFA 1NPYA 2DP4E 2QHXA 3K20A 4KPFC 5SY4A 1P3Y1 1Y8RB 3WO1A 4CRWB 3KJZA 2FUNB 3G2HA 3WP0A 1ZM3A 4TZKA 1F8GA 4A6PA 2ZB4A 2Z4TA 3GG9A 1JR3D 1DJMA 1O97D 2PX2A 4TZ0A 2WT8A 4K81B 2GAIA 3A1NA 2GM5A 3MWLA 2NVWA 3EAFA 4RJIA 1I4OA 1OPXA 2BUAA 2BC9A 4A6DA 1O0CA 4I9GA 4BGEA 1E3LA 5JSQA 2MSWA 5CNKA 5EVCA 3TVDA 2Q2QA 2FSGA 4C5CA 2YBDA 4HN4B 3Q7SA 1K6JA 2PA0A 1UJ5A 2ON6A 2VXYA 3LKVA 4KN8A 4LJ4A 4LHVA 1AS3A 4DABA 3OCYA 5DHSA 1JFVA 1N8SA 5KS2A 5F2KA 2RC5A 5MFZA 1LJ8A 2COUA 3AM4A 3KM0A 2ZQ5A 4TV8B 2IFTA 4BFCA 1Q19A 2VF8A 5BWNA 1G6Q1 2R6JA 1M2JA 3CB2A 2BMAA 1Z6TA 5IVDA 3RS4A 4BNHA 4DHEA 1OJLA 4EJ0A 4LJSA 3EMKA 1V8FA 3DVAA 1G2PA 1XD2B 2V6MA 4G67A 5HBGA 4JQCA 1SEPA 1E1RA 3L0BA 1JR3E 4GWKA 3SBXA 3QF7A 2JLBA 1A71A 3U7EB 1U0RA 4UHBA 2G0NA 5C8YF 1PJ3A 4QYWA 3ITKA 1M6VA 2DFNA 4U7PB 3OM9A 2Z83A 3ZYZA 4C3ZA 5KJCA 5LVAA 2DUJA 4CI9A 3CRW1 2QNIA 4ZHQA 5IFKA 4XM1A 3LT5A 3ENWA 2Q6TA 2XMPA 3USZA 2VK2A 5K0EA 1P0QA 1YS7A 3QUTA 5FFMA 2PUFA 3I9LA 1QH9A 1MX5A 3AI3A 4IY1A 4L4YA 5IABA 3WADA 5D3KA 2XNHA 3SC6A 2OORC 5CFPA 2QXTA 2OCIA 2QJOA 4KIGA 5AOAA 3I2YX 4ZCTA 4FMDF 4ZEOA 3P19A 1MQ9A 4KFCA 1OXVA 1E2UA 4KQ9A 3WOHA 3MT8A 3IEPA 2R66A 1K5PA 5AM0A 3FW1A 5JFGA 1DU4A 2IHTA 4BVLA 1MJFA 1DOAA 2E4XA 5J2UB 5IXYA 5L6MB 3CLUD 4IOJA 4DIMA 1TA9A 1JJFA 1GFWA 1XEWY 1NKVA 1V11B 1FFDA 1VFPA 3IIJA 1NM5A 1R3DA 2O14A 3EE6A 4G2NA 1VSTA 4J8PA 6NULA 3FMVA 4CLDA 1XDGA 3QXGA 2WSMA 3M1IA 4O63O 3B3JA 2O3QA 1TUBA 3IBYA 4NF2A 1S0UA 3SHQA 5H5JA 4BVJA 5FNVB 3IXQA 5EFZA 1I01A 1SY7A 2F00A 1P81A 3IV9A 4GIBA 4JBIA 3ORRA 2XSZD 2IYZA 2YYSA 2DY1A 4N7BA 3R3ZA 1U2DC 1IBSA 2H52A 2X0NA 3ZY3A 3K70C 3FZEA 1XTBA 4XASA 4N65A 2VYFA 4DQUA 1ZEMA 2XQJA 1UZLA 3HL0A 4MIEA 1SC6A 2VBGA 4ZALA 1IG3A 5BPHA 4ZTUB 4JFAA 3WGZA 2CJWA 2CNLA 1P75A 2Q5EA 4NV1A 1MUUA 2Y0EA 4Y2XA 4KFRA 4KJXA 2QLNA 5EKSA 4P2GA 4BIMA 4ZAGA 3GP3A 3S8EA 1WCXA 3G2PA 2V98A 4I9NA 2W5UA 3HACA 3L8MA 4BUZA 1BOFA 1DRVA 2GAJA 1TM5E 3B12A 3MEQA 4DF3A 2CXHA 4F60A 1FDTA 1YC2A 1V1MA 2RAFA 3BSSA 3JZDA 4GBJA 4HNRA 2R60A 5CH5A 1AGXA 1AKNA 1JBKA 5CVDA 3TTTA 1CS0A 1ZNXA 3HKCB 3JALA 2JAUA 5EHZA 2JJMA 1N75A 5FPQA 2C5GA 3V4OA 1V3TA 3DL0A 3OIDA 4HR7A 2EZUA 4RDHA 2AQIA 3PV0A 2YBEA 1DINA 1EZ1A 4K2HA 2ZB7A 1XZMA 2BEWB 2CVPA 2NT4A 2Y1CA 4RD4A 4BO0A 1K98A 1DEOA 5BRNA 1M6EX 1SXJC 2PDAA 4C7OB 3UBMA 1NXWA 1WMFA 4J4BA 4K26A 5EZ5A 2HZ7A 2YX1A 3ABSB 1WV1A 3INGA 3MPOA 3S99A 2R6AA 3QOXA 1GVNB 4D8WA 2GZSA 2FYTA 2FSHA 3S1AB 5I01A 2OHJA 3K1AB 3MXOA 3QVTA 5DU2A 4OHXA 3D1VA 2ZXFA 4P9NA 4Z0TA 3WLJA 5DBEX 1UC9A 1JEOA 1X1RA 1XK7A 2OBFA 3JR3A 3ETCA 3ZK9A 2ID9A 2Z57A 2PJZA 1A8HA 1ECJA 3PF8A 5FTWA 3UJBA 3EXAA 2VR1A 3T1NA 4QRDA 4AUMA 2JH3A 3AEQB 4ZT5A 4DLAA 1L6IA 4EDHA 3V4SA 1TC2A 1LNZA 2AI1A 2N3ZA 2OBMA 4V2UA 4P82A 1KARA 2XTZA 4D8UA 1R0WA 4MV1A 1TAUA 3FFAA 4E33A 1S3GA 3T7IA 4YJGB 1EP2B 2HOQA 4M89A 1GLGA 2Q5LA 1V3QE 2XBLA 1WQ4A 1E2FA 3BQMB 3T15A 4LHWA 5T6MA 5B53A 1O2DA 1EQUA 3A1CA 2E7ZA 3CEAA 1I1QB 5EWMB 2M6LA 3WNDA 2MR6A 1LVUA 1KFEB 3DBLA 3QQPA 4FOPA 1H5NA 2A1UB 2BJVA 1SXGA 1SMKA 1WP9A 2OHGA 1LC0A 1ZN7A 1RYMA 5E2IA 3V7NA 1O8CA 5TQ2A 4GWLA 4C78A 4R7ZA 3PSHA 1GQQA 1M5UA 2RGCA 1GHTA 4JBXA 3K31A 3DFIA 4F8YA 3A7EA 3ORHA 3D5QA 2GFIA 4QYTA 5UKDA 2YW9A 2RGEA 3ZBPA 1BU8A 4MQMA 4F9EA 3CW9A 3R7AA 2IDMA 4JEMA 1U8YA 1T1EA 4G85A 1P9LA 1G5TA 2O50A 3JVIA 3LOPA 5GPBA 3CX7A 3QFSA 1OY1A 4M0FA 4BE9A 4LHSA 2JHGA 3BA6A 2O7QA 1XNRB 2PJDA 3SEAA 4DWWA 2ZRBA 3RTGA 1BO6A 2KLBA 4IQ4A 4U3JB 1G18A 1KKUA 1V41E 3SCZA 3DKPA 2DBYA 5AVOA 2H8KA 3OTQA 1PG5A 3R8FA 1RYHA 2VPXA 3OZUA 4RAOA 1N5MA 1A72A 2F7SA 3S1AA 2NO4A 3QEBZ 3D0RA 1PEAA 1NNSA 2CF5A 3BIOA 3LCVB 5J2TA 5HFJA 1KJIA 2QGNA 1EYZA 3ETLA 1Z29A 3ITDA 1KY3A 4RLQA 2J6IA 3OFJA 2BHSA 1ZG3A 5A06A 2E1RA 5HQTA 4EHKA 1J24A 3CF4G 3KLBA 1Y5LA 4B09A 2JD1A 4D4HA 1AGRA 4V0RA 5DPMA 3REOA 4DTCA 5TVGA 3EK2A 3RYCA 3OPQA 1JQKA 5BSTA 3ZHOA 3LSTA 2G1PA 1JQJC 2IZ7A 2GCNA 4R98A 5GZ6A 3ZHQA 2HK6A 3GFGA 3CYFA 3JRWA 4UBMA 2R8EA 4ZEXA 4JMPA 5ILQA 1X7GA 5EJEA 5JYCA 3MQ4A 5KB3A 4MQEB 1D1TA 4R6XA 4MW2A 1ZZEA 4BNDB 4JXXA 1FTGA 2JAXA 2JCYA 2ZBDA 5FV4A 2R7MA 3EIUA 2OCDA 3TXAA 4JYBA 2GZ2A 2MMGA 1VJTA 4UNIA 2RKOA 3TZKA 4BO3A 4LFBB 3N2NA 3IYLW 3G2QA 2YMQA 3CH5A 5AI4A 3S2SA 2XNSA 4BZXA 4RTQA 1KWGA 4TKMA 2I6TA 2RGWA 2VA9A 4W4TA 1MEOA 3STTA 2OZLA 3O2SB 3OEHA 4UFOA 1EK1A 2D1QA 4ARVA 1AQYA 1XDDA 2ZAYA 5JFOA 2LWIA 1ZRSA 5I7OA 1NXSA 3MB8A 4IYRA 1ULHA 1PZFA 4TRRA 3IVXA 1JUDA 4V1CB 3REQB 1XL1A 1KP9A 4BZWA 4FD2A 1E79D 3S55A 1G8FA 3PKZA 3UH0A 4JYAB 5EQFA 4AO7A 3BFKA 4A2PA 4RE5A 5LZ7A 3CZ9A 3EHEA 4KQFA 2BBTA 3C1TA 4WOBA 5IT0A 5A7FA 3INYA 4UCFA 3ZTTA 3UMBA 4I9UA 2PCLA 1EAYA 2XUAA 3HKEA 4CDNA 1K0FA 4XFKA 4CV0A 2QTLA 3QIAA 1H2EA 3Q85A 4NHOA 4WXPA 1XVLA 2H2HA 1Z13A 1N5DA 3PQ6A 1JT9A 5EE5B 3GLGE 3MTEA 4YQYA 4ZQHA 5IW8A 2BMWA 2HNBA 3V34A 4OI1A 1EQAA 1LQ2A 2WBLC 2Q4EA 1KI1A 2G28A 1T8TA 2X2FA 2ZSHA 3AY7A 3CZAA 3G82C 2PUHA 2NXJA 2P2SA 2A9KA 2AF3C 3LUAA 1V5WA 2KI5A 1N3YA 2ZS7A 4P3YA 1UMCA 4CKCB 2Y8EA 2WJJA 5FTJA 2OPBA 5EXDA 3IMKA 4OA5A 4TMWA 3F6RA 4UBNA 3L07A 2I1QA 3K0KA 4L3WA 4LHZA 2Q9BA 4CTKA 5I7VA 1V25A 3KPWA 3RFVA 4WZBA 5IUNC 3M2TA 3SIPA 4KFTA 4RVSA 2BMFA 3H11A 2VJKA 1KH1A 2B3DA 2L42A 4TS3A 5DMHA 5JSHA 2CHVA 1GPMA 4MINA 4DCGA 1W36B 2ZIUB 3OQVA 3JQPA 3AVXA 3U7QA 4I6EA 3FLEA 2PR7A 2FPUA 1M7BA 3C4QA 4C6HA 1JVNA 1V9LA 3NGLA 4PLZA 4Q5IA 3TRHA 2Q5QA 3L6UA 1FVOA 4I8IA 4IDCA 2I4NA 4IIJA 1EX6A 4UVDA 5L53A 5G02A 4AMYA 2SBTA 1TRHA 4KQ2A 5EYPA 2VQ6A 4JASB 3PG5A 4ZK6A 2GPWA 3OH8A 1J07A 1DWQA 3W79A 1QGOA 4XE5A 1E3TA 4LJ6A 1J39A 2CVOA 4J07A 3U7QB 3EIEA 3ZOZA 3Q6IA 1Z56C 4ITUA 5DM70 1I2BA 3MOSA 4R3NA 3G5MA 1YBHA 4DLXA 1FSFA 2V6JA 3E8SA 3ESXA 4Q82A 2R6HA 1GYQA 1JHDA 2ODWA 3G8YA 4X97A 4XXHA 1Y9JA 3BRQA 2EGUA 3MTGA 1CUZA 3B89A 1Y0BA 4RUKA 3KQWA 2H11A 2O2XA 4TMTA 1DWPA 1Z0UA 4BNXA 5JXGA 1IN8A 4FSXA 3OF5A 4IH9A 1M2OB 3ZU2A 1YVEI 2DB3A 1HTTA 4EYOA 2GBCA 1ZQ1A 2Q5HA 3FVTA 4BXOA 2R5NA 4CG1A 1ZM7A 3BAFA 4DMMA 3RR2A 1Z63A 3R8CA 3VI4B 4X91A 3VBCA 5ITZB 2VDOB 1N5IA 4EHFA 1HG0A 1ZOSA 3F4LA 1KJWA 1MDBA 5AR1A 3WWPA 2XY4A 1QO0D 3JARA 5B1YA 4R7TA 1U7PA 3AB8A 1QAQA 3KYCB 3L43A 4DLUA 4QULA 1Y98A 4X7RA 4CL3A 4RD1A 1SC3A 1G3UA 2VUHB 1UPCA 3DV2A 1G8SA 4KDRA 2WU3A 1R4ZA 4PX5A 3SYKA 4BQIA 8ADHA 4GOJA 3FHJA 4NE7A 4UAJA 4BFWA 2X40A 3GRCA 3HDJA 3UJ8A 1ULTA 3FUUA 3NHBA 4OQLA 3MA0A 5E6UB 3G9TA 4YREA 1S2GA 4CKEA 3DVQX 4PYNA 5FTMA 1ZVQA 1TQ8A 4LTMA 4YT4A 1H9CA 5IHPA 2J3EA 4R8MA 1R4AA 4E13A 2II6A 2Z8YM 3LLSA 5EJ6A 1EFRA 2WG1A 4CMEA 1DIBA 1RHKA 4HDNA 2WY2D 3UG7A 2YC4C 3IIIA 4IIHA 4QT4A 2QN2A 3KAJA 1UBGA 1QAMA 1D5CA 4TN1A 4ARIA 1JWBB 3DEYX 3QHAA 2QM0A 3FWZA 1GYRA 1R0LA 3HP1A 4TV8F 4AJJA 4MUEA 3I3SR 1Z2PX 4FSHA 1V5EA 3SQOA 2EHJA 1VPWA 1S4MA 3LGXA 1XHFA 2AL7A 1YL7A 3LBHA 3FM9A 3SHTA 1ISGA 2G9UA 2HC9A 3D2LA 4TTAA 4AZTA 5JPIA 4YMUA 1LBTA 1JR2A 4JP5A 4A73A 3W5BA 3KOWA 3D3QA 5KU7A 4MNTA 1AK1A 4Z9FA 4GBED 3ACCA 2ZYWX 2FPGA 1SZDA 4ZO6A 3GZTB 4DJ5X 2H2WA 3QX3A 2C84A 1A0OA 1E1CA 3G5LA 1YR7A 4G5RA 5FWXB 4KWEA 4UEKA 1H8HD 2ZXUA 1WB6A 1Z15A 3UKOA 4N5DA 4OU4A 1N77A 3C41J 1WW8A 3ABZA 2ADMA 3VPCA 5JBQA 4M1QA 1XA4A 5CR9A 1Z0KA 2R4UA 2YV5A 1C4WA 1DC5A 1G3QA 2NPFA 3UHAA 5HIJA 3ZCTA 4QBIA 3D1JA 3QX9A 3ZWOA 2XXAA 2XMSA 2Z1MA 4HLNA 1HK7A 2O2ZA 2XYQA 4J0IA 3K1AA 1E5QA 3Q8WA 4N3GA 2A86A 2GSDA 5EEHA 3DPSA 1YACA 4EDFA 3J81k 2ONKA 2OCAA 5JD3A 3GVXA 1ZESA 1ZK1A 3WGUA 1PG2A 1A9ZA 3K6RA 4ZT2A 2V7QD 3D6NB 3MN1A 5SYAA 2HSEA 1VJRA 4YV1A 1TL7C 3UA3A 1GPUA 1T5TA 4ARZA 5ICCA 3IKJA 3ZGYA 3VPSA 1GM5A 2BEUA 2BFBA 4ZJUA 1A8IA 4PXSA 1JVBA 1W8IA 1ZN8A 2OCPA 3VH3A 1F0KA 4NCKA 4RF2A 3G0CA 3Q6NA 5HGXA 4W5OA 3NTRA 5JZSA 4I1OA 2BFEA 3ELWA 3JZFA 4FE7A 1L1QA 1R1DA 1W30A 4H0NA 3GZJA 4ID9A 4CF3A 5LZ2A 3ZY5A 1MU0A 4YBRA 4KMRA 4Z53A 3GB9A 5TQ2B 2VYNA 4JU9A 5KNDA 2L19A 3EGDA 3PC3A 4B45A 1Y7LA 2JJ2A 4IXWA 2ZSFA 3U16A 1G55A 3SHOA 2BM9A 4ZFNA 2H51A 2VRBA 1F06A 1J8MF 2NSDA 3GDWA 4IXDA 4DEXA 4QREA 4BDTA 1CXZA 4YRDA 3AVQA 4Z0NA 1EK5A 3KWFA 5K4HA 3BD9A 4OK3A 5GJWC 3HY3A 1Y4DE 3VOSA 1JJBA 1TCCA 2HYIC 1XTQA 1FDRA 1SH7A 4IKOA 2PG3A 5EA2A 4MGZR 4OGGA 4ZCRA 4Z7NB 1YHNA 4G24A 3SIXA 2FSFA 2PX4A 3GFVA 2ZREA 3AFNA 3DMRA 3HBJA 2EOAA 1G20E 3QTBA 4QODA 3IPAA 4K9DA 4MS4A 3RTCA 3U4DA 3I4CA 1LRKA 2IIPA 3QLUA 3UGKA 3NALA 3BFJA 1NJ1A 3KQYA 3ND9A 4H60A 3B1JA 4WNAA 2FQ1A 3BIXA 2OWDA 2RI0A 5BNWA 2CT8A 3EVFA 2HEGA 4JNCA 2C0PA 4U2GA 9ABPA 5AVJA 2OO5A 2QUBA 3HDVA 3C3JA 3IR5A 4NYJQ 4ZAZA 16PKA 1LNQA 4Q3EA 2XZPA 2ZAMA 3D4LA 4YP0A 2PE5A 1J9GA 1VCHA 1VSVA 2OQVA 3RRNA 3LL4A 4ZOCA 1EWVA 4ENVA 4QUDA 3GLKA 3SIWA 1CF2O 1EUDA 2VJPA 2PN1A 3K9FC 2G1KA 1CVIA 1RAAA 1ZOOA 4JITA 3NX4A 1S02A 1XVAA 2V9PA 2YWBA 2VAMA 4OHBA 4UBLA 3KOZA 2GCOB 3D64A 4ZI5A 2WAAA 3EZXA 1C7JA 3VR2A 3QE2A 2ZVJA 2IYPA 1GTZA 4MVJE 1EXVA 1KJNA 1PW5A 2YOFA 5ELLA 3TL3A 5L4NA 3IH5A 5FBZA 4L28A 3CW8X 3WL3A 4A0RA 4MVJP 3Q8MA 1CFJA 3OC6A 4BBZA 5C5IA 2VTKA 4UE6A 1L4KA 4HATA 1OMOA 2R1TB 2P9YA 3HEMA 3V4PB 4KREA 3OLYA 5COQA 2VHCA 1GNLA 4ALJA 2D13A 3GGJA 1FVHA 3QBVA 4O3MA 3N2GA 4L16A 3RVOA 2GBGA 3BSYA 2AG8A 3KOMA 1FU4A 1BMDA 3O9VA 3NLLA 4UHHA 3EBLA 3E0XA 3HLYA 3T7KA 1Y8ZA 1DIRA 4LF4B 2HDOA 4QUGA 1NQ5A 3I9MA 3TOSA 3C74A 1QORA 3RVQA 3LW8A 1KYWA 4LVUA 2A9QA 5I51A 3LUDA 1M83A 2X8WA 4PNZA 3NWPA 3IRUA 4GZMA 1C4XA 2D3TA 4X62B 2VPZA 5KDLA 4RD6A 5A7GA 3OFKA 1QONA 2JI7A 5A4JA