4V38A

Apo-structure of alpha2,3-sialyltransferase variant 1 from pasteurella dagmatis
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
388
structure length
388
Chain Sequence
SKTITIYLDHASLPTLNQLMHFTKESEDKETARIFGFSRFKLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTMEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALYLTRANSFERASE
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
molecule tags Transferase
total genus 132
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v38A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v38A01
4R9VA 2IHKA 2II6A 2ZWIA 2EX0A 2IY8A 2C83A 4R83A 2Z4TA 4V39A 2IIQA 2IIBA 4V2UA 2IHJA 4R84A 2C84A 2ILVA 2EX1A 4V3CA 2IHZA 4V38A 3S44A 2IY7A 4V3BA
chains in the Genus database with same CATH superfamily
1T2VA 1R4NB 4TTIA 5ALDA 4I1PA 3VKVA 4YV7A 5L40A 3R7NA 3AETB 1CETA 4I9NA 1JHXA 1EFPA 2VT2A 4CM5A 5AW1A 1YDWA 2O0JA 2WF8A 3HVRA 1KMHB 2P9CA 1WETA 2V9ZA 1V4VA 5I7HA 3VAZA 4K46A 4FS3A 1WZNA 2Z30A 3HU2A 1LS6A 4JQSA 4EVRA 4FHDA 1RBYA 1ECLA 4WKNA 4KX3A 4OJQA 5DYTA 1ZJYA 1G5PA 1E2DA 2CKMA 2W37A 2I1LA 1L7XA 3DOOA 1YD7A 3X1DA 4OATA 1LBQA 5TPWB 2F8LA 5JASA 3PR2B 4WK4B 4XGRA 5DHSA 4IMRA 1MX1A 1EE9A 4RK5A 3W4JA 4AF7A 1YNOA 1NPTO 3ASYA 2FUKA 4Q1EA 3UHFA 3ZI4A 3C7AA 1A9XA 1MRNA 1BX3A 1UQRA 4RF2A 3HK2A 5TMEA 4J3JA 4LNUA 3IMEA 1N2OA 4DLVA 2IY8A 5EJ8A 5TDHA 3VTZA 4XGIA 2A57A 2C3PA 2QSYA 3IE2A 4IX1A 3UWKA 4PC6A 2Z8ZA 3N6VA 4YUAA 5FP0A 2QP4A 3JS5A 5DWDA 1SB8A 3EGDB 4NU5A 1S4QA 3AKEA 3NBKA 5FT9A 4KKXB 4RY8A 3ACCA 1UC5B 2O50A 4N5LA 2EW2A 5FPHA 3KD3A 1C2YA 5I9LA 2GKSA 4Q7QA 3P9PA 4UPDA 2I1VB 3T0IA 5J23A 3TZHA 1U0SY 3KOUA 2YXBA 2AI2A 2IPXA 3CRMA 3KHSA 2WC1A 4LRXA 4MRRA 3U56A 2AJBA 1S6YA 2ORYA 4WY2A 2ATVA 4OIMA 4JLNA 3RWOA 1L8QA 2VHVA 2I6GA 4E2YA 1N6HA 2Q0SA 2O06A 5JHGB 2D2IA 1BD4A 2D3WA 2O3JA 4KO2S 3R24A 4OK5A 1ZK3A 2X9LA 3OIDA 4FVTA 4KAAA 4MMXB 4CMBA 4Q9DA 1DU4A 3VYVA 2IKQA 1NW7A 3ED5A 3U5TA 3BM5A 4O1HA 3CLHA 1SRQA 4XIFA 2CN1A 1XVLA 4MWBA 3ZZ1A 4BWYA 4QXAA 5LYYA 4ZRNA 3PHGA 3HVHA 4RSHA 3TOVA 2G25A 2Q3DA 3IH5A 5MN4A 4YHHB 2WP0A 3FNQA 2QLBA 2I4IA 2IL1A 3CE6A 2JFXA 3FI9A 3EF1A 3P9QA 3R76A 4DMCA 3EK2A 4EHAA 3U5ZB 2NU6A 3FOAA 3KPUA 3BIXA 1UP6A 3BMCA 4LE2A 3RSGA 5K3FA 2WOOA 5B7GA 2HIMA 2VKTA 5AW7A 3VMMA 5LVAA 2HRQA 1HM5A 4MIEA 5T6MA 3LY5A 4MKRA 2AT1A 3F97A 3NBAA 4WDQA 5SV2A 1UDWA 2JGIA 4CM8B 1E96A 3H11A 3GNSA 1N6IA 3OIYA 4LK2A 3UKDA 3HYLA 4EX6A 1K6JA 4EFMA 1NBAA 3GGOA 3LOQA 3ND8A 4HTAA 5B3JC 3BCHA 1J8QA 4D42A 2ZBEA 2FB9A 1UANA 2Q6IA 2A88A 3DVSX 2X5JO 3NFRA 4YBRA 4J4BA 3T8YA 3VDNB 5C37A 2NNLD 5K3EA 1VIVA 1DLJA 3WLJA 3KSMA 2AOVA 1QYIA 3IUSA 3LQFA 4C0QC 3WAJA 1II0A 1QRRA 2BBTA 5FTLA 1A04A 2JFOA 3SWWA 2DTDA 2D4AA 4QUEA 1M75A 5BMVA 2B0JA 4YJ2A 3N6XA 121PA 1GGMA 1NNSA 2CC2A 3N7TA 4FPXA 2Z2KA 4XSVA 1RI1A 3CT4A 4XDHA 2ZKIA 4DPKA 4CF7A 1P7CA 4HR7A 4CEJA 1Z4OA 5FOVA 2XXAA 4LF9B 1QP8A 1VIAA 2Q0XA 3DL0A 3D8HA 1I4WA 3PR3A 1XFDA 1Z6YA 4WKOA 3RAPR 3TAXA 3W8DA 3U16A 1B0AA 3X43A 3FTFA 5FI3A 2J0UB 1PLKA 1ZISA 3QWFA 3EQ2A 4WESB 1FC0A 3AM3A 4ETMA 3DL7A 3O8NA 5EMMA 3OUTA 4PSKA 3RF6A 5LMCA 1X6VA 3GLFB 1U1GA 3BEOA 2FN4A 3HWRA 3JAKB 4QNMA 1G6OA 4O63O 4EPWA 3F3MA 1Z47A 2EGGA 1GHTA 3WYAA 9ABPA 3C8DA 1V6AA 1ZR2A 1R0WA 4RTLA 4WECA 2F8SA 5LNK6 1KMQA 3IP9A 4CVNA 2EF0A 4QYIA 3MIZA 4MMZB 1E77A 1Z36A 1UZAA 4F5ZA 5LDDC 3A36A 1PP4A 3K8QA 4N5MA 4WUTA 1DKQA 3SJBA 2VSQA 3C3XA 3DE6X 3E61A 4GR4A 4BGVA 4DMMA 3OJFA 4EPTA 3TAUA 1IQPA 3MYYA 3CRQA 4EATA 4BFVA 4MZDA 3FKJA 2G6BA 3C6XA 2ZBRA 5ANRB 1J21A 1MC5A 2A5JA 4GKVA 4JUCA 5LOVB 3RC2A 3RU7A 3WLSA 3TB6A 1C9MA 4M60A 5LDHA 4ZDWA 5B4TA 5LBUA 3O4JA 1JR4A 5JAPA 3LKBA 3ZWCA 4UMFA 2UYYA 4ZQCB 2QTBA 2FJPA 3CURA 3KJZA 1MB2A 3E3NA 4BJ5A 1PLJA 5HUHA 3CUWA 3EIUA 4DV0B 4UEJA 3KB8A 4JI8B 2HEIA 1T35A 1UXHA 3VOBA 1LXCA 1YE5A 2WU1A 3GEIA 4PG4A 4GI5A 1NR1A 5D87A 2ZYVX 3CRW1 4HAOA 3LA8A 4KG7A 5GIOE 1QP0A 1Y7IA 3KTFA 3BWXA 4EO7A 2XCQA 4HDCA 1SXIA 2L19A 3JQFA 1NU8A 3GROA 1A82A 2BGIA 4RACA 4FOTA 4I1VA 5LSAA 1EUQA 3ZG6A 1T9BA 1EZ1A 4Q4DA 1V0JA 3PQEA 4X7MA 2RSLA 3P8ZA 2K2QB 1MABA 1ZXBA 3HUEA 3M83A 4RQUA 3KFLA 5DLYA 2XODA 4MW6A 3WGGA 5IVPA 4IOLA 4ENTA 2CMKA 2ODAA 3P9IA 4RDCA 4FD2A 2HU7A 1KAOA 4DJ5X 4RO0A 2OQ2A 5JCJD 4ACBA 2R3SA 1T6ZA 2FWBA 2IEBA 3OZUA 3R7AA 1DBSA 4BBJA 3PDWA 4OHOA 3WNCA 3FMOB 1BYIA 4JJKA 3VR4D 1ACMA 4FDVA 2NZ8A 2I2FA 1UJMA 1ZH8A 3I42A 5KHAA 2CXTA 1L7EA 3U4QA 1Z38A 4GBGA 1AKRA 2R6JA 2QI9C 4LDPA 4X1IA 1IY2A 3H9GA 2PL3A 4QJ5A 1R18A 4WZAA 4X00A 3TCKA 3ZZTA 4XX1A 1DS6A 2NUBA 2WKPA 1B6RA 1ZVKA 3PNPA 4JLSA 6ABPA 1L4UA 1Y4SA 1KO8A 1ZIDA 3H8VA 2OE2A 1M2NA 3JXEA 5CJ2A 5EUQB 4L0MA 2XTNA 4YDSA 1U3DA 4WA7A 4GWGA 1J33A 2RH5A 1V7QA 3PX3A 3ZX5A 4HN9A 4U7GA 3WIEA 2IU0A 2JEZA 1FS4A 2H06A 2WWIA 1KOLA 4FNMA 1KYYA 2QAIA 3NV7A 3R3WA 4ZO8A 1YK1A 4O6VA 4NV0A 4P80A 3ZCUA 4HL6A 3QU5A 2GVZC 2JJQA 4RM2A 4V03A 3VAAA 1BHQ1 4PCVA 1DNPA 1NXWA 1L8OA 2J3EA 4IZHA 4Y1RA 2IW1A 3BHJA 3L07A 3DB2A 3O9MA 4UUAA 4YONB 4ZVKA 3SR4A 3M5CA 1JEDA 2Y3IA 1MQ9A 1B8VA 3JASA 4MS3B 4HNHA 2PNJA 3QTBA 4I2VA 3TN7A 5FOQA 2EL9A 4R2IA 4EB0A 5TX7A 3CIFA 1NQUA 1USIA 4RAQA 3DEKA 3Q5EA 3FPFA 2WINI 3ZU5A 3H9UA 1NONA 2QVZX 1L4EA 3D6JA 3VZPA 4MX8A 2F43A 3DCJA 2B7LA 3T7TA 1W4AA 3FSGA 4AKTA 3L7YA 4ZOAA 3IRUA 4TVBA 4N7BA 3HU5A 2GLUA 4X91A 3V8RA 1C0KA 1A72A 2DFVA 5FUXA 2C7VA 1U99A 1K2WA 4CPDA 4DCSA 1NBEA 1W1UA 1CDOA 2Q6VA 4EG0A 1QZZA 1CUFA 5C51B 5JALA 1OIVA 1Z5OA 4Z4GA 2H9IA 4QSHA 5H3HA 1PT5A 2WAXA 4C9BA 4RTRA 3GAMA 1YUMA 1PK7A 1QGUA 3N59A 4KTVE 3SE0A 2WTBA 3DLHA 1BAPA 4L4YA 1V2GA 2QD1A 2H59A 2NAPA 3K0KA 5EOVA 3F8TA 1RJEA 2A67A 3OEYA 2BI4A 3D4PA 1O6GA 1EP1B 3T7KA 4NMMA 3H6GA 3LYAA 3ZX4A 1ENOA 1A4UA 5E7IA 1IEWA 1E5DA 1VE7A 2Q29A 3FCXA 3CEPB 2AFHE 4X85A 4ZVRA 4F6LA 2C7GA 1QC5B 2VIIA 2G9ZA 1Z4LA 3H99A 3KKNA 1Y7LA 4JT2A 3PYLA 4RMIA 1H4QA 5LPNA 3AM1A 2J4DA 3EJWA 2VCYA 5K0SA 4C6HA 3RWMB 4MJ7A 2QJRA 1HTBA 2WU8A 4G4GA 3ICPA 3WA6A 2DPLA 4BLVA 421PA 1HEYA 2JJMA 3EB9A 2D3TA 4LISA 4M1TA 3H4IA 2ZSUA 1NF2A 2XOXA 4URVR 2YJ4A 4DR6B 3FFAA 3T5PA 1JW9B 1A0OA 1RPNA 1YR1A 3H3JA 3M89A 1BDHA 3I9FA 2PMWB 2FSVA 1V39A 3PVZA 2GPWA 2YDYA 1LVHA 3UCXA 4P83A 5SICE 4L9AA 2G36A 4M6WA 1KAEA 4LQLA 4P8RA 2ZR7A 1ONSA 2BBWA 2UZ1A 5CW2A 1YJ8A 2AXQA 1D5CA 5DK4A 5CVCA 4NXNB 3QVKA 1OTYA 3WGNA 2Q5IA 4M1KA 2HXYA 2INGX 1YB2A 4Q1CA 4CCAA 4GZLA 4ZPXA 3DYBA 2HDOA 2F62A 1E5VA 3PCXA 5CEJA 1JEOA 1SD5A 3QOXA 4W5TA 1YRQA 3SFTA 5L95A 4WOPA 2IZ7A 3W9YA 3I64A 3WL3A 1Z13A 4XWOA 1JLLB 4U2BA 3DR5A 4Z53A 4YO7A 4H4CA 3IQXA 2CD9A 2EVWX 4RMJA 4EUSA 3H97A 3T9CA 3V97A 4KI7A 4EYEA 3PE6A 1LTHR 2FEPA 3Q9UA 1IU9A 3VZBA 2ZYGA 1E9EA 2X1MA 2IQIA 1IN1A 1I6KA 4M46A 2FR0A 1NFFA 3OOSA 1KRHA 4UEQA 3ED1A 4N01A 5EGSA 5I9TA 1ZGCA 2ZGVA 3AHIA 1RBZA 2FPIA 2GBIA 1OXUA 2D2VA 2O1WA 3KDPA 2DH6A 2H1HA 1JR3E 3PEUA 5FYDA 4EY7A 4DC0A 4XD2A 4LF4B 1H1LB 3KVRA 1SHLA 1Y9DA 3F67A 3DT6A 1P75A 1CEEA 4EFLA 1R2QA 4DLNA 3U13A 3D4OA 1NMQA 1XD9A 4BNUA 2Z6AA 1P2BA 2COUA 1FDRA 1DWQA 5ELLA 4A8JA 2OC4A 3H2BA 2HMSA 4M1QA 5H16A 1J8VA 3RD5A 3LMKA 2HSEA 3WLIA 3EF3A 4L50A 1BFUA 3MTIA 1RI2A 4QGFA 1PJ2A 2GCNA 2PO5A 1N2XA 4D9MA 1L6RA 2BONA 2CNNA 4KNVA 4MICA 3QXHA 1RJGA 3GELA 4PIMA 3G2KA 3GX1A 2X3UA 1CTQA 2OHHA 4HYTA 2ZRIA 3M81A 3FTNA 3WJ2A 4TRMA 1GUYA 1QE0A 1JF8A 3RSFA 1Q2XA 2V5UA 4EQ6B 1KDYA 3RRXA 4O4HA 3AOEC 4EVQA 2BGWA 2Q1SA 4Q24A 3TDNA 5BMOA 4LC0A 5L8VA 2AOTA 4BYGA 2ZI6A 1ISIA 4Q12A 5UKDA 4K2HA 5INTA 2VQEB 4FE3A 4PEVA 5GONB 3THWA 3RVSA 4Y2QA 5K05A 4QLAA 4GZ6A 5JVDA 1KF0A 1CUSA 1Y4DE 3E5MA 2QTHA 4Z49A 4HY3A 3MM4A 2QPAA 2Q50A 4KNYA 1YBAA 3IAS6 3RFVA 5BYJA 5I9NA 1AF4A 1CUVA 4GOOD 2PPLA 3PSHA 4Y6GB 1LQTA 4GECA 3K15A 3FXAA 4HDRB 2VK1A 2OEPA 4HH1A 3AY6A 4DWJA 3RJ5A 5KTTA 5EJGA 3T5MA 5K0EA 1SC3A 4PR0A 3GW8A 1M76A 3PC6A 4Q4AA 1QAOA 4ZTUB 1SC6A 1SHUX 2AXNA 1XEAA 5K4AA 3B6IA 3SE7A 4IICA 1VFNA 4FGWA 4DT1A 2BP7B 3IQEA 4D6PA 1TC1A 1ML4A 4MQFA 1RHKA 2BF4A 2F3TA 4JIMA 1L1RA 2WAYA 3EGXA 5ERGB 4MLCA 3ZH2A 4L4UA 4D45A 2FRDA 4A6XA 4BGDA 3THXB 3MAJA 3GCGA 3PD7A 3IJ5A 3Q5GA 1JEYA 4PGFA 4KQJA 4HQLA 4ZKEA 1WTAA 3GUZA 1LLUA 3VO8A 4E32A 4EHFA 5I9MA 5BW4A 1V1MA 5DN9A 3CH7A 5DEIA 5I7UA 1YZHA 2GZMA 2XMRA 4Q82A 2XCOA 1GVHA 5E1DA 4W8HA 3EGEA 2ZRKA 5HXAA 3HBNA 3ZCRA 2Z9BA 5K6RA 3N2KB 4P58A 3CRZA 4AAYA 4UE3S 3V8EA 1YMQA 4RHCA 2Q9UA 3S2FA 2E4XA 4KQ6A 3EQ9A 4EF5A 3OA2A 2FY8A 3BQ9A 3FTDA 3IC5A 1SZDA 2ZZMA 4FGJA 3K35A 5AXDA 821PA 3DXFA 3Q8LA 3FYSA 4N3NA 3CTPA 2ALJA 2C5SA 3NKVA 4NTZA 3HB7A 2GR9A 4DPLA 4AJ1A 2H07A 4MWSA 3E7PA 4AZ0A 1CQPA 2X8WA 3L8HA 4NNOA 3K6JA 4MOWA 1KH1A 3KEQA 1Z0FA 3T9EA 1KI7A 3DGFC 3HLTA 3VPHA 4PGGA 1NZFA 1MPXA 4KXXA 4TS9A 2VNKA 2O5RA 2FOLA 4H6VA 4G0WA 3HFGA 4ZZIA 1SHZA 1P1KA 5EKDA 1TZKA 4PN7A 5LJIA 7MHTA 4FFBB 1YMVA 3L7KA 2JFQA 3SFZA 3MSCA 3A2NA 2AB0A 2C2ZA 3JQBA 4GW3A 2DHQA 2PGJA 2CMDA 4TYPA 2ZE8A 5IBRA 3KSZO 5E3IA 5J2UF 2OGZA 4Y2PA 1G18A 1Z0DA 4RD6A 2VR1A 4BVJA 2P9GA 4IUCS 3KJHA 1N2SA 4AMZA 1NMZA 1WD7A 1F20A 2JA2A 4RLFA 1OH7A 4RF5A 5BWMA 2YFKA 1OFTA 2P78A 2HK9A 3IAM6 3ANLA 4HQ6A 2JCGA 3JQ7A 3U3XA 1EFRD 3N8NA 4B85A 4C3VA 4ER5A 2YL2A 2AZDA 1CY7A 1M54A 1T9DA 5KBYA 3EDMA 6YASA 3G0BA 1GL9B 1U8FO 1W35A 1RM5A 3CEJA 4HS9A 5J1SB 4LMBA 1J70A 1USKA 4AY5A 3T3OA 5AVUA 3PG5A 1IRXA 2GHIA 2VDNB 2QLLA 1NKSA 1JEEA 1XKXA 3HCNA 1QFJA 1ZNWA 2ERYA 2W0SA 3EVCA 3L0OA 4WASA 5LLTA 1U90A 3RUCA 1QFYA 3OLQA 3S2EA 4B4UA 3TUIC 1SFRA 4FB5A 1YVUA 4I0WB 5E1BA 1TPZA 3I3SR 1OH6A 2A0YA 4BE7B 1Q19A 3EC2A 1FRQA 1YR2A 1Z7EA 4YS6A 3I28A 4D5EA 3CH5A 1N36B 1X92A 2PBRA 2V1XA 2D7DA 2CXUA 5F2NA 5DO9A 1FVFA 3N1UA 2V6IA 1V25A 2BLLA 3QKRA 1II9A 1NN0A 1PJTA 3G7UA 5AK4A 1L5RA 3MB5A 5DBOA 3D8SA 2JIDA 3GLVA 4R7TA 4MI6A 3RJMA 4NX2A 3C43A 2QWXA 2ZBVA 3BWVA 1SQGA 4H7HA 2SICE 2EQAA 1LF0A 2BCEA 3ZWAA 3CGGA 1Y80A 4A91A 3KJXA 2XUOA 2EEPA 3V46A 1VRVA 4HRXA 1LDBA 2QMHA 3O8OA 1AUXA 3G23A 3HBFA 5J63A 4CUZA 4KXWA 1MQAA 2YRFA 4EYQA 1M6HA 1P31A 2WDPA 2QD3A 1DVRA 1UM8A 4W7SA 2IYYA 4AYWA 2QM8A 1BJTA 1WMAA 1GD1O 1VA4A 3C6QA 3NPMA 3QF4B 4MAMA 2DXIA 4GPEA 2CNKA 4RS3A 3N53A 1E3JA 4EHIA 2XF2A 1EXMA 2LIVA 3Q85A 3ZWOA 1NOIA 1U6JA 3COYA 4LRSB 1LLFA 4WZBA 5BV7A 3ZD9A 1U7WA 2PA0A 1O96A 1FQOA 3ITKA 1I14A 4FLEA 1EHIA 1NJ1A 1RYDA 3LAWA 2FWPA 2LNDA 5A3JA 2HMTA 3DMNA 3BJZA 5TJ9A 1LKZA 2GPYA 3BKWA 4ZKDA 4LE0A 3PGXA 2X14A 4NOKA 4L5YA 2JDIA 2YJZA 1UBHS 3H19A 4LGCA 4ZU6X 3WLFA 4L6CA 1PR0A 2X4IA 3DOIA 3PXEA 1UK9A 2OV3A 3QKSB 1GV0A 1QHHB 4HGZA 3BA1A 2RC6A 3E05A 4HGOA 1VMAA 4H0NA 4CN8A 5PNTA 1MC1A 4FNAA 4HLQB 1Z22A 3BTOA 2PM8A 2ODTX 2ZPTX 3TVYA 3GLIA 5DTJA 3KETA 1XCPA 4LYYA 2HWWA 2DG2A 2WP8J 2PD6A 1YJCA 5ES3A 4U9IS 3FF4A 3OQ6A 3C16C 1NN5A 2NU9A 3FIJA 4B4OA 2C5FA 3SICE 3L4SO 1F5SA 3MMPA 4P93A 1G64A 2WD8A 4RKYA 4F45A 4PLTA 4ZV7A 5HTOA 1D6NA 3SEFA 1UOEA 1MX3A 4TV9F 1N5JA 1T8RA 3O84A 4IFIA 3OP4A 4J1QA 2B61A 2LVBA 1DL5A 1Z5VA 3OHPA 3UGTA 1Q2UA 3AGQA 4NNPA 2PLFA 5FO0A 4EMBA 1ODLA 3SHWA 1G19A 3QKIA 3P71T 1YBFA 4L5BA 4AZTA 3DA8A 2O05A 3OQPA 4NZZA 4OSOA 3R74A 3JYHA 1VSTA 2ZI9A 4WIAA 3WNQA 4C5BA 4URHA 1JEQA 1QO9A 4D4IA 3BTVA 4MS4A 3NBMA 5AHWA 1KARA 1IXYA 1Y1SA 4TROA 5LDGA 5JXIA 3NJRA 5BT9A 3RT7A 4CF5A 1EVYA 1ABBA 3ORQA 1NQOA 3H05A 1HUQA 3LW7A 3SSMA 2FN7A 2DWCA 3PIDA 3L6DA 5DYWA 3DP7A 1E2QA 2X5NA 2V7WA 4JKYA 3OJWA 4BRSA 1XDUA 1U8YA 1SRRA 5TQ0B 3TI9A 1OH5A 2NO7A 1HDOA 3NXSA 3N86A 4D79A 5BSMA 1PQWA 1QYCA 1D1SA 1TD9A 3IQIX 3MCTA 5AKLA 4DDKA 5JCPA 2WAMA 2XQGA 5KMGA 1CRQA 1OJ7A 3ZU4A 1GCGA 1Y3BE 2FOXA 4DIBA 1CEYA 5A5DA 4NBNA 3K1ZA 4GU5A 1SVNA 4MW4A 3LUHA 4YJ3B 3TIGA 3E5NA 4HQ0A 4TLMB 3AERB 1IDN1 2FXVA 4IRUB 2H9YA 3RUEA 2IYTA 2FDRA 1XR3A 3JZAA 2DH5A 4CU5A 2ZCJA 4WADA 5FUBA 3MGKA 2AL7A 3UJ7A 1N75A 3U2QA 3UC5A 3ZVNA 5B3KA 1U2QA 4WN9B 2R4QA 4PC1A 4U2GA 1T36B 4G0XA 5BORA 3HJBA 3AT1A 2C7BA 1H5UA 2C57A 2VRWA 4HI0E 3WI7A 4DYVA 3ANMA 5AMXA 5FJJA 2DF8A 2GF2A 1EUYA 4TXHA 2FW1A 4UZSA 3SS9X 3R3HA 1TGVA 5FUVA 3OQVA 1YFZA 2QNIA 3ENWA 3MWGA 4L57A 4CTMA 3JD3A 5BV8A 1CF4A 1E1CA 2LIPA 1TZ2A 4QECA 3PC2A 4C06A 2ZUFA 3DXYA 1RC8A 3AEQB 3S2GA 4FW8A 3CG0A 3NYRA 2O8DA 3HBAA 4D74A 1M5TA 3I2IA 4UQPA 5K8VA 2AA3A 1BVUA 3H86A 4TLEA 1HLFA 5JLAA 3RTEA 3ZI7A 1M2JA 4B8WA 2ADMA 4ZOLA 1OT5A 2R1TB 3JQFC 3KUCA 4ARIA 1DO2A 3K92A 4M1WA 4B3FX 3E3OA 4HG2A 2WZBA 2XGMA 1G5IA 5TB5A 2I6SA 3CX8A 1SKYB 3LDFA 5FPPA 2BSXA 3OTOB 1S7CA 3MWDB 4N7RA 1C4OA 3CINA 3D3WB 4RPCA 3TE6A 3KYCA 1ZLYA 3Q7PA 4L51A 1M1UA 3E27A 3TIFA 3K96A 4UFPA 2ZZNA 1D03A 2QM3A 1U1DA 2B1JA 4MQUA 2ZJ7A 3GP8A 3GAZA 2PZGA 3T1YB 2NQTA 4IG4A 3O31A 4YA6A 1P1IA 4ZC1A 2PX3A 4RVCA 5EJ9A 2C2MA 2QX8A 3N70A 4IF4A 1XZLA 1E79D 4B5KA 5JDCA 2VH1A 3MYRA 3M5DA 1D8TA 2Q3HA 1HTWA 1OU4A 3BXPA 5K8JB 4GLJA 4KODA 2QTCA 1SXJE 1N1DA 1XCBA 4JEUA 4K9LA 5BUZA 4FJ0A 4IDCA 1KC3A 5I01A 1FX0A 5JTTA 3T7CA 4G0VA 4N5IX 1WP9A 2OCAA 1DC4A 3FMFA 4JVOA 1AUQA 2WMDA 4MWZA 1EI9A 5JSQA 4MI9A 3TZKA 2ZSKA 3S1SA 2M6SA 2V7GA 4DIFA 3BE5A 2PUEA 2I03A 5TR9A 2WF7A 2YNMA 2ZREA 4HPJB 2VRBA 2E6KA 4PM4A 2BEWA 1UQTA 2YX1A 5BN3A 4O59O 1Y6JA 3TQRA 1PTKA 3TPFA 3MCWA 1N9GA 2IOHA 1MJGA 4QFBA 3OEHA 4M0LA 3F47A 4E1VA 2MCFA 1GEGA 5CTJA 1U7DA 3P0IA 4A6PA 1QWSA 5CT6A 5M04A 1EVQA 1R4MA 3F96A 4C87A 5LZ4A 2FW6A 1FQJA 3EFBA 2DU8A 3EXIA 5HWSA 3LRXA 1WUKS 3L7BA 1E7WA 2ID7A 3P26A 4G86A 2WQ7A 2YBEA 1FSSA 3GXBA 4L2IB 5AKJA 1BX1A 1GPAA 3SXUB 2HLHA 2V8OA 3TNYA 2BM1A 5ICSA 3O3CA 7YASA 1FRVA 3PF9A 1KVQA 1NVDA 1I7NA 2VPWA 5ALYA 1PAUA 1PFVA 5CB4B 1WHTA 4YJ2F 5E38A 3ZHOA 2MU1A 5BMVF 1TCBA 2FTKE 3I2KA 3U4GA 4C6TA 3KUUA 1UJ2A 1YI1A 2ZDGA 3FOBA 2C9OA 3MGBA 4MQEA 1KRWA 1FNBA 1VOTA 3C45A 3OPYI 4COOA 1SUBA 2CJWB 5KTYA 1YIAA 2YWBA 4QM6A 2RGEA 3R75A 3B7GA 1UPUA 2GXSA 2ZRLA 3A6ZA 4XW2A 1EWKA 4JWTA 3A1NA 4NFHA 3F5DA 2X0IA 2X13A 2XTMA 2XT0A 1B6TA 2RAVA 3WGZA 2VNIA 4DDWA 1GAJA 4AU1A 1EDEA 5H80A 3KTDA 2YVLA 3PB3A 1GR1A 1HZZC 1KJYA 2B9EA 2V3WA 5HF6A 4NONA 4RD2A 2V7BA 2OLKA 3FHCB 3NOOA 5HG0A 1EIZA 2GYWA 3YASA 4KE9A 1Z4KA 4CLOA 2OFFA 3K05A 3RG2A 2H5LA 4MK4A 1HT0A 2X22A 3EGIA 5DE3A 4EX7A 4RSMA 3IUEA 1AN9A 4UBMA 4P31A 3AK4A 5IP5A 1D2AA 3TX2A 5JXJA 2PH1A 4DPMA 3O26A 4X45A 2ZDQA 4E1BA 4W63A 2QMUA 3GWGA 3CVUA 1TVKA 5JAIA 4KHZA 4O2BA 5HFNA 5FWYA 2AC4A 1YDFA 1USUA 3I9V1 3R5TA 4JMPA 3EYAA 3T35A 2QE7D 2GT1A 3DP9A 3W6OA 2BM9A 4J43A 3WE7A 2AN5A 2CJPA 3A3PA 1Z2NX 2E4AA 2JGRA 2FSIA 3KT6A 4WKBA 5C8XA 4JI3B 4G0YA 5KNCA 3DPSA 4G56A 5CT4A 3KZVA 3OEWA 3OJXA 5JSUA 2AG1A 4GPZA 2HJSA 1JBEA 3ZHBA 1NFRA 3E81A 2AJ8A 1P7ZA 1RAGA 4B4WA 1U8EA 3QLEA 3ZJTA 4GR5A 3FUXA 2GD2A 4DA9A 4LE1A 3ZCXA 3B5EA 4Y67A 5IAGA 3E1GA 4AJOA 4ZQBA 1KOGA 2JFHA 5GV8A 2GN0A 5A0VA 3R0XA 5AHKA 1BO6A 1GAEO 1UT8A 3D6VA 3GJ7A 1F17A 1GPUA 4H2DA 1BKYA 5BSUA 1KNXA 2AFHB 1E7MA 1N2CB 1RYBA 2WLTA 3WIVA 1XXHE 4X8MA 1ITZA 2ONJA 3DMYA 4D92A 1O77A 1BW9A 4RA9B 5AXCA 4DEYA 3LC7O 4B6QA 3U3DA 4FP9A 2P7HA 1FP1D 2JCVA 4NDZA 5LFAA 3KUDA 1L5WA 3SF0A 1IEQA 2XQVA 4ZOEA 1U0HC 5D6NA 4MQMA 1S01A 4MVJA 2R2GA 1OLUB 1W34A 4JK3A 2A35A 2OESA 1AURA 2X7JA 5D5PA 3TBHA 3UT0A 4EUFA 2P79A 1W96A 2O2GA 3HU1A 5JI3E 1UF9A 5JDIC 3V34A 1KVUA 3HVKA 4XSHA 3I1JA 4M9UA 4RTQA 5ED4A 4PG8A 3O83A 4N12A 3DVLA 4J0GA 2GPSA 4OI1A 4F8JA 4WOCA 1N1GA 4HB4A 1JDZA 5KVQA 2E6UX 3NO4A 1WDLA 4ZREA 1NDQA 4NF2A 1G20E 1NUHA 5HBRA 5A9SA 1M7GA 5KWJA 1OZ0A 4HNAA 1H2FA 4DCGA 2PR2A 1OGJA 1L5QA 3EZLA 2QV7A 1AH2A 4L4SA 3EZNA 3VU9B 5FTWA 4XB6B 4I6JA 4P3PA 1M6EX 3ER6A 3F4LA 3MIIA 3MGAA 1X15A 1WMSA 4GI3A 2OCPA 1MAWA 4H3VA 3RVRA 4FYKA 3I9JA 5K8LA 4JA0A 3KNZA 3G2LA 1M8FA 4DC9A 4LBWA 3WNDA 1PNVA 2YDXA 5DYNA 3RVOA 2HCTA 1SK8A 2AN4A 4XA8A 2BGNA 4EF6A 3K70C 2NM0A 5D8DA 5LUAA 3JRXA 4MVYA 4UDXX 1K7EB 4H7PA 3NIGB 5JAHA 3BH7A 5K0GA 1OTHA 3OD1A 5LQCA 4US1R 1UKBA 3PKIA 4EGCB 2JJ2A 3HSKA 2AEJA 2C8JA 4EABA 1P9LA 4I1OA 4JY7A 1D4AA 2W4QA 3I6QA 3W3AD 2LV8A 3NNDA 5HZKA 3TKLA 3ZHTA 4IMIB 3KQYA 1XRNA 3LKZA 2ST1A 1UWCA 3DZKA 3LX6A 4B3XA 3VPSA 1D6MA 1DTEA 1APBA 1RKQA 4ZQFA 1UBMS 2GCPA 2JLSA 2ZIZA 3KELA 1KXJA 4Y30A 4A2CA 5LMUB 3IE0A 4FDLA 4TLBA 2JRCA 1G3IA 2BFCA 1VTKA 4X93A 2AE2A 1FOEB 5DLEA 4PHCA 3PLAE 1V3VA 4YXWA 4HKTA 4BMVA 3BGOS 2OCGA 1KWGA 1ST2A 5TEVA 1W46A 2WU3A 2GN1A 5AIBA 2O5CA 1LBSA 3GLHE 3FYUC 3EC7A 4Z4EA 2PRKA 3P0FA 2FRDC 2YINC 3B36A 2G0AA 4LWOA 3HP7A 5A7HA 5EPOA 3UJCA 2VSNA 4PLYA 5REQA 1NJ8A 3LY7A 2HQSA 4LDZA 3ZDDA 1K0FA 1NI4B 1B16A 1M67A 4H1VA 4LWQA 4OUDA 4XWKA 3SC4A 1QGYA 1QGED 1P0PA 2G06A 4HFMA 4CKZA 1OZGA 4RVSA 2BRUA 4TGLA 4W7HA 2DCUA 3PC8C 3QUBA 4U3JA 2I67A 4PSCA 4JX9A 2FZWA 4KPUB 2CV2A 1EX7A 2HKIA 3M9XA 2HBQA 3VVMA 3UK0A 3TDMA 1EIWA 3M2PA 3DBIA 3NS7A 1ZAYA 5CCDA 4BPBA 1O94C 2H4YA 2XMBA 1AN0A 4UCWA 5L3QB 1HKUA 2PKWA 3AF1A 3CVJA 3BVPA 3EIQA 1TUBA 3IYLW 1ULZA 3NWJA 4FGLA 3NU1A 4QREA 4NBSA 3SQDA 5L4NA 1G1MA 4H15A 3TFWA 2C5AA 2Q4TA 2JIBA 2PZFA 1T4CA 2A9JA 2JHAA 3M5PA 3BOSA 3ZHQA 1XZFA 1P33A 2QLNA 1HDRA 3FZGA 4ZAZA 4XPIB 3S8MA 1NG1A 3TBFA 2DBRA 3PZRA 3S70A 1KMNA 3HZZA 1OFIA 3MT0A 4ZO9A 2NVUB 1W85A 3W05A 3PQCA 3TD2A 4TMTA 1NOJA 1A9PA 3HPQA 3G1WA 3LM8A 5JQGB 1GTSA 2A86A 1RLIA 2NZ2A 4D4HA 1Q83A 1AQJA 4BO0A 5JUWA 4HAUA 2EKDA 4DEVA 1F4PA 3P5BA 3NEYA 4I4TF 3N7AA 3C8HA 5DNDA 5GGXA 2MINB 1WVMA 4LYHA 1H2YA 2GK7A 1Y0BA 2J59A 2Z3WA 1FP2A 2IJGX 4DLUA 4WK0B 4C0LA 5A5GA 5EHGA 1RI3A 4CQLA 1N32B 4IHQA 1CUAA 1NN1A 2O8VA 3CVOA 3UJPA 2WUGA 4YX9A 3NAQA 4DRXB 4PHTA 2E4UA 2MT9A 2BBSA 1ES9A 2VYVD 1TJ4A 3AR2A 4TTSA 1PE0A 3GRYA 3VU3A 2FPPA 3KJGA 4NZ9A 3D8RA 1CS0A 1M1YE 1XP8A 4GWKA 2PK3A 3ER8A 2P91A 4PYRA 4W7IA 2GBGA 5EKUA 2IZ5A 3UPDA 1YJQA 2H2HA 2H1LA 3HQ4O 2DFLA 3PHJA 4BRWA 5HRCA 4K1XA 2GZ2A 2YN0A 4RD1A 3UMSA 1Q5PA 4JROA 4NJEB 3BF8A 4FXPA 3U3ZA 4AJ2A 5HJ7A 3WMWA 1R50A 2V65A 2GPAA 2FYTA 2I4NA 3GJXC 3LK6A 4QDXA 1GL6A 3R5FA 3HCCA 4GBMA 2EF1A 4R5HA 3K9LA 4YAKA 4Z54A 2II6A 5AM3A 3KT0A 1XRPA 4IM7A 4TKLA 1RHJA 3ZWMA 4GOKA 2QAGB 1YSCA 5AM5A 2AN3A 1U94A 3QVOA 4TMKA 4CNBA 2CWDA 2EC5A 1D2EA 4DYHA 2X19A 1PJ3A 1NE7A 3FUCA 5JAZA 1B73A 1RXUA 2Z5FA 3LUPA 3O82A 3L8YA 2Q4BA 1J0BA 3PXUA 4XIYA 1XEXB 2DSTA 3LFUA 3WRYA 4F0JA 2ON6A 3DMPA 1KI8A 2H00A 2PSSA 4CM3A 4DM3A 4YCSA 4AKHA 1E7QA 4M1YA 1DAEA 4YC7A 1XCGB 3LNCA 4LYEA 2YOGA 4M0PA 1UM9A 2REBA 4YRMA 4F6RA 2AG0A 2PVSA 1ILWA 4OREX 4X24A 2YWRA 1RMTA 2WIDA 3GF4A 3EA5A 1DIOB 1IOLA 5A3QA 3PPXA 4JUAA 2OXRA 4JODA 1E98A 2EL7A 4IGEA 1KJQA 3B3FA 3EZYA 2B3DA 1PJBA 3D7RA 3TRKA 3FVVA 2PRSA 5T4BA 1C8VB 4GOMD 3DQZA 1W6UA 2OFWA 3NRBA 3K2QA 3ZV5A 4MYTA 4ENUA 3EH2A 2DFTA 4E0BA 1Y1TA 1G6Q1 1JHAA 2C4HA 2QUJA 2IYSA 2CNBA 4KVZA 4L85A 4OO3A 1GYRA 4IIJA 1JT2A 1RYHA 2GZHA 2FP4B 3C3EA 5IVIA 2FZLA 2GTHA 5BVHB 2YYYA 2A0KA 4KPEC 1T26A 4IS2A 2LWIA 3NLLA 1EP3B 3BGSA 2PIDA 2UYOA 1U0EA 1NWCA 3CF4A 1T0IA 4F9GA 1QGZA 2HCFA 2CE2X 1ZMXA 2V03A 3KXPA 4XCQA 3HY4A 1LZLA 4M76B 4LN1A 4AN0A 2OOKA 3MJRA 3D5TA 4ISCA 2L42A 4LHYA 1EQAA 5JCOC 1T2EA 3PRKE 1IJEA 5IHPA 2Z5VA 4F5EA 4RX1A 3HCEA 1E6CA 4P33A 2PMFA 3V8MA 4HWPA 1D3AA 4DMGA 1JR3D 3W3ZB 2PANA 3GCWA 4BMOB 4MRAA 2X8AA 3WGLA 2PGAA 3SNHA 1GQOA 4CHGA 3UJ6A 4KR0A 2FHPA 4S1PA 1ZR4A 2FMIA 1XDWA 2H7CA 4G01B 4HEJA 2ODEA 3SC2B 5EFOA 4U9HS 5KB3A 4P3NA 4BFTA 5LQRA 3LY9A 2NSDA 4GDMA 3DFZA 4ETIA 2FUG1 3ONWA 3MWLA 1SXHA 1ZH6A 4Q1AA 5DHAA 5C3UA 2OT3B 4NULA 5SYNA 3T94A 3C3KA 3LUCA 4GLLA 1XPRA 3S68A 4QPCA 2ZWAA 1GA4A 4I9GA 1UPTA 5L3VA 3U6BA 4KFCA 3OF2A 4UBOA 3GP5A 2Q7OE 3OQ1A 3HKBB 5KX5A 1DC8A 3VSCA 3KQLA 4M36A 3ZOZA 1XEWY 1M34B 5IAJA 3KB1A 4B2PA 3AVVA 4N9QA 2EKBA 1JNXX 4ALMA 5BSKA 4KBFA 4ZVVA 1MP0A 1HI9A 1M10A 1V16B 4GSLA 4RTSA 1US8A 1A2QA 3G2PA 1I0IA 4H1HA 1Z88A 4YK7A 1XP5A 5CFNA 3JWEA 3Q9SA 1VHDA 1ZXLA 5C52B 3AFNA 3AOGA 3QJ5A 1Z0AA 5CNKA 2C00A 2OBFA 5EJ4A 3USES 2Q99A 4BU0A 4TL7A 2DHDA 1ZFNA 3CE9A 3QFHA 3BHMA 5CDHA 3E9YA 4O4JF 3UJ3X 4W5NA 4TYQA 3OIUA 2C4WA 3U62A 1DMRA 3F6PA 3QU7A 3V8QA 2YW2A 1B6SA 4HDMB 5J3JA 4HDKA 1SGWA 5C5DA 3A26A 1T9GR 2YBDA 3WXMA 3U60B 1B8NA 5LB4A 1QP7A 3EIEA 2OB2A 3Q3CA 3ZW8A 2WJZB 4HK4A 4KVAA 5GPBA 4AZ3A 4RA6B 2V6GA 2XNJA 1EGAA 1O97C 5AOVA 5AXBA 1C0PA 1Q0LA 3QU4A 1MOQA 4H6XA 1UFVA 4EZIA 5HYVA 1K89A 1R4NA 1X1SA 3WV5A 4F1JA 1PTJA 3AG5A 3DV0B 4ARCA 3AETA 4Y2TA 1KJIA 2NVBA 1PZNA 3HWX1 2C5HA 4OB6A 3NOXA 1SA0B 2I4LA 4LG1A 1IN4A 3N0XA 4EA6A 2ZTHA 5EQDA 4UAUA 1KMHA 2REXB 5DNUA 4JOCA 3AILA 3HJNA 3K9NA 3GC6A 2VF2A 3MUNA 4OKIA 4XE5A 4OQFA 3ZKAA 2I2BA 4IHAA 1BWSA 1CQXA 3L4BA 3Q8XB 5JCJA 2PUCA 2BR3A 1V96A 4QUKA 3IVCA 4HNUA 4AKGA 2IOFK 1ZHHA 4TX1A 5P21A 5TPWA 3D8BA 3JQ9C 5JV5A 3T3NA 1X7HA 2D1YA 3D2LA 4JITA 3VR4A 1XCMA 3FFTA 1HL3A 2HRRA 2CWWA 3O92A 1NPYA 1Y81A 2P5UA 3GRUA 5EAIA 1SMKA 1YKSA 1IBCA 4FZ5A 2OQVA 1JHPA 3SMVA 1NYRA 1KSFX 1UJ4A 5ULLA 2P1ZA 1KGSA 3TGWA 2WT8A 5ALQA 4AUNA 1ORHA 3Q12A 3BRQA 1GYQA 4Q6WA 1RDFA 5IMBA 1UXJA 1WXIA 4AVYA 1HK7A 3EGDA 5EQJB 2EV9A 4RM3A 4P7FA 4LYFA 4LSMA 3I37X 1U8UA 1QDLB 3ICCA 1VLJA 1Y33E 3WKAA 4YUWA 2WIAA 2GWRA 1FUEA 2EX1A 3CZ9A 2IYVA 1QH0A 2O4CA 3QVXA 4QOFA 5CFZA 2ONZA 5IXSA 2CVHA 4JLOA 2HOQA 1WXFA 2XRFA 3L7AA 1QDEA 2XMZA 4REQB 4AN1A 2YUIA 2ACEA 1Z28A 3ANNA 1YZUA 4CT5A 3BGWA 2WA2A 3HVIA 2HSGA 3TR5A 1ZUIA 5SY9A 2ECOA 1B2RA 4M7PA 2BM8A 3DYVA 3CEMA 2O7NA 3E22B 3NT2A 4DIOA 5BPFA 5DBEX 3V2HA 2I76A 3B9BA 1KL7A 1TCUA 2PD4A 3BFJA 1A96A 3KXIA 3NHYA 3HS3A 3OOHA 2A9OA 3C5WP 5A2QA 4JBYA 4RDXA 1Y8AA 1ZSVA 2DBVO 3VH3A 5I8WA 1UINA 2WE8A 1RWNA 2BKEA 3R3XA 4ZT7A 3PI6A 1O5IA 4NE2A 5JTUA 2VA8A 3IAXA 2JI6A 1J2UA 1MAAA 2YNMC 2R8BA 2OTCA 3HY3A 3L0YA 4JB2A 2QRHA 3OQJA 4EBBA 3HB1A 3UH0A 1AM4D 3T3DA 3LCVB 2VDOB 1I9CA 3RFXA 3RUFA 4DIUA 1XTPA 1ZZGA 4C0WA 3WLHA 3ORYA 5J4VA 4S24A 3IUNA 4PC3A 4HYYA 4PLFA 3OETA 3R7FA 4D3FA 5BVGB 1QJ4A 3GPBA 1S8OA 1G291 3WWCA 3QWAA 3KRTA 2FPXA 1VE3A 1JE0A 1QM5A 2QRMA 2J9YB 4NCKA 3RT9A 1E69A 2Y6UA 4JELA 3W3AH 2NWQA 2YQ5A 2I6FA 3D7KA 4CM8A 3OESA 3DL2A 5FQNA 1PJCA 4I4IA 5BV2P 1FRZA 1QOQB 1P6XA 2MMCA 2NT4A 4JASB 4P54A 1L7QA 5GGYA 3VH1A 2IEGA 2VAMA 4Y9RA 5EY5B 2FLVA 4FT2A 3VOSA 4W8GA 4TQ9A 2PDAA 3QI2A 4XB2A 5CW1A 5A04A 1JIIA 1VSBA 1Z2EA 3T4UA 3Q2IA 3KE8A 4LZOA 4ZZ1A 2XBLA 1HQYE 3FN4A 3UK6A 4CLHA 1RKUA 3F6YA 2WJ3A 2C04A 1IM2A 2HREA 3NTQA 4WCFC 4HTFB 3QMVA 4UTPA 2XGSA 4EAQA 5LLDA 5I7OA 3IB3A 5CR9A 1DB3A 5DJ5A 5F21A 2B98A 3WS7A 4HJXA 4WOJA 2W5UA 4WK6A 1U3VA 4EENA 3GDHA 2XWJI 1PYOA 3HGMA 5FORA 3HMKA 3N74A 4V0RA 5FNVB 5AI4A 1XYGA 3W6UA 1MB4A 2OOSA 3CLRD 2IX9A 1CCWA 2OCYC 4LTDA 4MQ6A 3T52A 1L5HB 4AY2A 1KI6B 4CMKA 1UDAA 3ZZUA 3EG9B 4H7FA 2J0UA 2FZKA 4L78A 3GLKA 4Z0PA 1R5BA 4BXOB 1ZNQO 2QGZA 4WESA 4PLPA 5K7SA 4V0MA 5CNIA 3RIYA 5ALRA 2CVOA 1AMOA 3NIBA 4OPMA 3GLFA 4A15A 1H2AS 3Q4GA 3C39A 3JAKA 1Z6XA 4L5CA 4Q03A 3RQIA 4D7AA 1Z4IA 4Z7OB 2P2NA 4W5OA 2W2MA 3WDLA 2CCJA 4PO3X 1VGRA 5JISA 3KQMA 3ZZMA 1JSRA 3TRJA 1FSZA 4TZ0A 4K81B 1P61B 4PGHA 1WUHS 1KIMA 3S55A 3OO1A 5EIFA 3PCRB 4OXKA 4RAOA 1PNRA 4MDFA 3C7TA 5GVSA 5IF3A 1GG9A 1L8LA 4RXUA 2H17A 2Q3FA 1VPVA 3JQAB 1LF5A 3OPQA 4D8UA 5H4HA 5FHRA 2XGGA 1P6UA 2FEWB 2VBCA 5ALGA 2H11A 2PV0A 4CG2A 5HVNA 4GM0A 5LOVA 2MDTA 4UUNA 5ELMA 5KOJB 2CV0A 2A9RA 4LRUA 1PX0A 1TNDA 3CJQA 1DJLA 3MBOA 1L4YA 4DUZB 3R20A 3U37A 4LF7B 3L1JA 1XTTA 1WEHA 2XB9A 3IQFA 5BW6B 4D0SA 2FJUA 2Q5OA 1SBYA 3ZTWA 2AKAB 2A30A 3B2EA 3GAAA 3JTEA 4ZQIA 5KVSA 3OFKA 4DOMA 4WERA 1GAWA 1VLVA 3PFWO 4TWIA 4LVUA 5K0FA 2OD7A 2XV1A 5CDGA 3U7JA 1JUDA 5C80A 3CRNA 2R6GA 4CI9A 3U44B 2EIXA 2O8EA 1DIGA 1IOVA 3NANA 2PH5A 4KFSA 1XZCA 4N82A 1VZ2A 1TM4E 1OIWA 1FP7A 1UKZA 3DEAA 1T3LA 1W7AA 3UWSA 2BAGA 2W6ID 1R5JA 2AWNA 5G4LA 3KAJA 4MUNA 4Y9DA 1XOIA 3A2KA 4S1TA 1YA8A 4LUCA 3P2YA 5E3JA 4FCWA 1AX9A 3SEZA 4DWWA 4U6NA 1V8BA 4K8RB 3KLPX 2OZLB 3G9TA 3LGXA 5ALMA 3UMGA 4YYEA 3PJGA 4KJZA 2KSQA 4S1VA 1K4KA 3A6EA 3I9OA 3VI3B 3LDGA 4WFQA 3FGPA 3KT8A 1ZOLA 4S0XA 2VDQB 5FI1B 4FWTA 3AR9A 5B53A 3H5OA 3EAFA 5JANA 2G5GX 1WXDA 4Z1MA 1X94A 2BPOA 3FFWA 4UHBA 3C24A 4RNCA 1FDTA 2EZ4A 1QMGA 3A1CA 1I51A 1KI2A 5KUTA 1L2TA 3R5JA 5BSFA 1DKUA 1U2SA 3HZOA 4P3XA 2JGEA 4CQMB 3OQOA 1VJGA 3TGLA 3GA5A 1AUVA 3PITA 2JFUA 3FMVA 2NZXA 3I01M 2HBRA 1QV6A 4CG3A 3G0HA 3UBTA 4EVIA 3KEOA 4HXFB 4PLZA 1HGXA 1Y3IA 4ZK2A 2WKRA 2FW7A 4ZYLA 2HJGA 4YFVA 3HI6A 2J7PD 2XUIA 5ITVA 1Q3HA 3WVNA 5LKAA 3ABRB 3HDHA 5L6MB 4ZHQB 1LBEA 2HF7A 5CDFA 3X2SA 3F7MA 1UL1X 4ZV4A 5HHTA 1Q20A 2FZVA 4XPZA 3MPUA 5HS4A 2J4FA 1NBHA 2HJRA 2DETA 1SVMA 4N65A 2ODPA 1ST3A 2IGBA 3P0JA 4WCVA 1R9MA 1QXSA 1ULHA 3LP6A 3VR2D 3R8FA 1RIIA 2JLYA 2DEUA 2RHJA 3BWEA 4QEDA 3ONNA 2Q3JA 4P7BA 2QW1A 4DIDA 3NEJA 4MS3A 4BVBA 3RAFC 5DHTA 3A6LA 4B83A 5CEFA 1NC1A 1PJ4A 3K7EA 3PDCA 5J1TB 3EMDA 1L4LA 3UJNA 1PI3A 5B2ZA 5IZCC 3L0IB 2BI8A 1IBLB 2G17A 3LBYA 4F5DA 2VHYA 1EFCA 1XLVA 1BVHA 4TT8A 4OM7A 3VC2A 1VIDA 5FTNA 3KQWA 4AJPA 4EELA 4EKGA 3QLUA 2P9YA 2BHRA 2P35A 2J4CA 4RL4A 1ANKA 3SQLA 3OZ7A 1B74A 1G20B 2QBYB 2FPMA 5L7WA 4UTOA 4K9MA 1O0CA 4DL9A 1JI3A 1F06A 4Q1FA 5FPQA 4JEMA 2R60A 3CF0A 4B2LA 2CE7A 3LTNC 2NPIA 4E3ZA 4YMIA 1QIMA 4CKBB 2A1UB 4OXXA 2GSDA 2X4GA 1Z5WA 5LCXA 1SCAA 5CVUA 5BSGA 1G8KA 4WRRA 4K9NA 2VSFA 1OA1A 1OWOA 4HX5A 1SXJD 1NLZA 4U0JA 1Q1EA 3T06B 2WHPB 1CERA 5FO1A 2QLMA 5K3SA 4LDJA 4L8VA 4UXJA 1XPOA 4WAUA 4PCLA 2FPSA 1QC5A 2EWWA 3UUFA 3O0DA 3D5QA 4O2BF 4FX2A 4J2HA 5DBFA 1B1AA 1ESEA 2G9UA 2J6HA 1Q0SA 1LDGA 2BRUC 2DZDA 5FWAA 5H83A 4AJKA 2G08A 4JZYA 4BQEA 4IVRA 5A6VA 1JAHA 1S8FA 5B7NA 2W2TA 4EUEA 4QQKA 2G9RA 2QP9X 1Y9ZA 2DWOA 2I2CA 2VUUA 4PFSA 5CX1B 3ZI0A 2G28A 1G66A 3BH0A 1I7PA 4INOA 4RWEA 1SOMA 1CD5A 3HC7A 2GZDA 1M2KA 3KTOA 2XMQA 3I0MA 3KQQA 3D9QX 3WRVA 1F3LA 4EARA 4Z4FA 4KO3S 2OHFA 2HM7A 3MNFA 1F8XA 1MX5A 4PAQA 1AGRA 3FPGA 4QPPA 2Q5FA 1YV9A 3DT8A 3A11A 4RIGA 4MWOA 1L5VA 1EFRA 3GFBA 1IN8A 3QTLA 4MHTA 1E1RD 2HV8A 2J3DA 3EFEA 3O4RA 4Q05A 3GLHB 3T0GA 4JYBA 3QFTA 4CEHB 3VGPA 2JI4A 3II6X 1N57A 2Y05A 2PH3A 1O9BA 1ZWKA 1CJSA 3D0KA 3ZJ4A 4EW1A 2ZJ2A 4AIIA 4DV6B 4C4YA 2VDPB 4XSGA 2IE0A 3U0VA 1YJAA 2MSKA 2PLRA 4JJEA 3A2LA 1G1AA 3JQAD 4O0LA 1P4JA 4ZT4A 1F0KA 2RHBA 3JPWA 1JLLA 1TZCA 2OZEA 3ZLJA 3VKGA 5FADA 4DADA 3ZE2B 2XKKA 5AM4A 4RPIA 1VKNA 1GM5A 3SU8A 1IAVA 3SK0A 2J3KA 5KQRA 2ZYUX 1R0RE 4QU5A 1EEHA 2XE7A 3N28A 5KCMA 2V9PA 2Y1EA 5T5QA 3WHIA 4KL8S 1H3NA 1CUUA 2H1RA 1Y8RB 5GZ1A 1OLXB 2A5DA 2O2IA 4INAA 4G26A 4AMVA 3E82A 3SS8A 4LJSA 3E9DA 2H5EA 3LSYA 1K7SN 1UKAA 2WMOB 4MW5A 4MV1A 4YMWA 3EPHA 4R16A 1GA6A 2RBGA 2R8PA 5LXTA 2XYGA 2XWSA 4LYJA 4QTUB 1SUEA 4EHDA 1CFZA 1G42A 1QO7A 1VL5A 3HHEA 3V1YA 1WUJS 2R5WA 4N7JA 4ND5A 2FMUA 4KQ9A 5IAKA 4AWBA 2QN2A 1VXOA 2AOUB 2G82A 5LXTF 3X2EA 3RS9A 3ZQJA 1S0UA 4Y2YA 1Z83A 3PJFA 1NJ6A 2CXRA 1L4KA 4NHOA 2YWGA 3JSAA 3FPKA 1E5XA 1AC5A 3WRYC 3EX7C 3S6JA 3VYWA 4I14A 2RDMA 1Z2OX 4Q34A 3WYFA 3H83A 3CCFA 4X3CA 4DNXA 3NYWA 3W90A 1P1CA 2E21A 4JH0A 4D96A 1GWNA 3OCCA 3HDGA 2OENG 2R8OA 4KDRA 3K30A 4CT4B 4KPFC 4QUBA 4XFJA 1XTSA 4JSRA 5DNWA 4EQ6A 5IAAA 1QNFA 4A0GA 3CG4A 2RKBA 5AO9A 3VQTA 4XUEA 5IEJA 3FVRA 1OXSC 3WGQA 4RTOA 3MK31 3BB3A 4CQMD 3A6PC 1RJDA 3N2NA 4H08A 5GONA 3SZMA 2BOVA 1NLMA 2BL4A 3BICA 1HA3A 2KX7A 1BIFA 4Q9LA 3R7BA 3L92A 1GYPA 3OCZA 4C2BA 4BNWA 2EGHA 1DIBA 1PCXA 2GKOA 4IDDA 4IZ6A 4M0MA 4OH1A 4F7DA 4P0PB 2A8YA 4HDRA 5HBGA 1VKRA 3M49A 2Z08A 3O2JA 2E0IA 1XL0A 4BVHA 4M1OA 2Q1XA 3CKLA 3U6KA 2BSQA 1R6UA 4UBJA 4I81A 2VXCA 3F8WA 4QOEA 4JD5A 3GD5A 3RSQA 1OPRA 4BMCA 3Q8KA 1M0EA 5HFAA 3ZUGA 2CHGA 1A95A 1E7SA 2Q62A 1JH9A 1MRZA 4ZYZA 2HBZA 5B1DA 1J23A 2LCQA 3R0VA 2BP7A 4BQOA 5AD1A 3B6EA 3HB9A 3L7DA 4PBRA 4M38A 3GFFA 4UBKA 4KX5A 2IIBA 2P3LA 4IXWA 1Z12A 2YYSA 1R00A 2MR6A 2WIFA 2RGGA 3COPA 3V1UA 4DSTA 4F8YA 4YUXA 2Q41A 2V6BA 1E60A 1KJNA 4RKWA 3R5SA 4Z9YA 2CDAA 3WK4A 1F48A 4J1TA 1JILA 2TYSB 3GDOA 4HQOA 4RHFA 1L4GA 3VR1A 3C7CB 4ICIA 2KBFA 4GWLA 4CN9A 3KLMX 4JYPA 3KTAB 1K5GA 5LD2C 1PSZA 1KYWA 4YR9A 1OW3B 1A9TA 4RNDB 3N2KA 1QKJA 2AJLI 1CNFA 2CUNA 1E2MA 2WV9A 2GNAA 1XCOA 3OBIA 2JKYA 3OIVA 4ERNA 5IC4A 4F21A 4CDNA 1I4TD 3K09C 3LQQA 5JNRA 1DG3A 1ZOIA 1THMA 4O4LB 5HGXA 4PPQA 1KK3A 5ENDA 4WBNB 2IK8A 3HXQA 1T5IA 3EY9A 3WK7A 1F0PA 4LY6A 1FLVA 2XADA 1MO3A 3PLRA 4EJMA 1KEVA 1QPGA 3EHDA 3NM6B 3TECE 1E2PA 4XQ0A 4C7XA 1BCSB 1RXSA 4RIHA 2VDWB 1SC1A 3R6DA 2FJ0A 4EWLA 4YT8A 4GOND 4EG5A 1U0OC 2HIAA 5CA0B 1JA9A 1Y6GA 2FMHA 1V8FA 1ADBA 4QFDA 3PPIA 1G9TA 3DTTA 3JZIA 3HEAA 1NQ5A 1P8JA 4J0FA 5HR5A 1JQDA 1PS8A 3SSNA 4EH1A 2ID8A 3E0XA 5LP6F 1EX6A 4Q9NA 5CT9A 3SQXA 1PJZA 4L08A 2J5XA 4FFBA 1V45E 3PLNA 4QNNA 4J0CA 5F4ZA 2J9RA 1TCAA 2C42A 1YGYA 3MUOA 1SU6A 2ABWA 1E62A 1LBHA 4IDHA 3W2EA 1U3TA 1R8SA 3AG6A 1E1MA 4MR8B 1QVZA 5DXFA 2VK4A 4R3WA 4YAJA 5KCZA 1EVEA 2UUOA 5CUQA 4MAAA 2ZRQA 1AVTA 2RHMA 3FVWA 1NU6A 3JZFA 5I7AA 3D6NB 2QJWA 2JLVA 1R27A 1V1JA 4V1CB 3H7IA 4HNVA 2XVYA 3BCUA 5AVQA 1ENPA 2J3QA 4GX5A 4V24A 1IEVA 1KK2A 2HC9A 4PYMA 2IKSA 3ZBUA 5BP7A 5J4HA 1YACA 3WGOA 1C3JA 3ERCA 2R2AA 1YBMA 4GICA 2NXCA 3USCS 2W6ZA 4X1OA 1V6CA 5ITSA 3KJIA 4B74A 2RGYA 2H92A 1IM5A 2Y0BA 1OA0A 4I19A 1R12A 4P4TA 2XI4A 2HA5A 1K3TA 2R6FA 1JPNA 1QRTA 1HQKA 2A6PA 2C4MA 3UAGA 3UFXB 3ZS9A 3G7NA 4CM1A 3GPLA 4MUGA 3H18A 4OX9B 3N2IA 3SR3A 1J90A 5AOAA 2FSHA 1PKEA 1U1IA 3FDZB 3F1LA 1RLTA 4GG1A 4KPGA 1WUIS 1DPGA 2O7SA 2OVFA 3HH8A 3K9HA 2D2FA 2FXIA 2FW9A 1B00A 3OWOA 3V32A 4CCYB 4EG3A 5JWRA 5AW4A 6LDHA 1FDWA 4DANA 4ESVA 4Z9BA 4R2LA 1UMBB 2P4EA 2QGNA 1M0TA 3DZGA 1E0JA 5SZIA 1VA5A 4NEHB 2XX3A 2JFFA 4W6ZA 2HR1A 4GKKB 2YV2A 1JKIA 1Z2AA 3LT4A 1JA0A 1E79A 1F4VA 3NR2A 3QOFA 4PO8A 2CCKA 2ATIA 2J5KA 1U2EA 3CU5A 3DR3A 5F9MA 3P0RA 3GRAA 1QTIA 2OL4A 4AURA 3VXKA 1W1WA 4XWGA 4ZAXA 3D6FA 3O8DA 4B6SA 2ZITA 1CNEA 2RD2A 1U9JA 3D2CA 4HCJA 3S4YA 4IINA 1L7PA 2XIQA 1BJKA 4G5HA 3COWA 3AHJA 3NJ4A 2VDLB 4UJ3A 2JGKA 4JOSA 4P4SB 5EWMB 1X1EA 1HZJA 1W5SA 4Q4JB 4AG6A 2IGTA 3PE3A 5BYKA 2QZZA 1IIBA 2YJGA 3OY2A 4B6EA 3IALA 1MDBA 4YT4A 4YLYA 3EPPA 5G1PA 3QF4A 1NQAO 2Q4DA 3UZUA 5DX8A 1IC6A 4BFLA 2VK8A 4ZJUA 5AESA 2P8SA 3SD7A 1DEOA 3IPCA 4MV8A 4ZMBA 1FJXA 4NICA 2ZDHA 3UQYS 4YVFA 4RZ2A 2M1ZA 4ZU3A 1JN0A 3F3KA 4B45A 4UAGA 2XQKA 1ZM9A 4M9XA 3H16A 2IP1A 1N92A 4P22A 1R66A 4JHXA 3KWMA 2QAJA 5K09A 1ZCAA 3AFIA 2J6IA 3O38A 4FMCB 1N78A 4YCMA 1Z82A 4NBKA 3LQ1A 1II8B 1O8CA 2MYNA 3KR1A 4MVCA 3QKSA 2WTAA 1QHHA 1PK9A 1QHNA 2EGUA 3L1HA 3ZYZA 4DLAA 1DBIA 2D5BA 4YMSA 1MENA 3ET4A 3HU3A 3P0EA 4BMYA 1EAMA 3EZ2A 1Q1BA 1G9SA 3AV3A 3C48A 3PBKA 4Q39A 3OLZA 4ZGBA 1DOAA 3KKPA 3CS3A 1V1RB 4MXDA 4XKJA 5TPZD 2ZAGA 4R3UC 2HJVA 4MV4A 3I58A 4KIJA 4RSGA 1ZCJA 4BNJA 4LFBB 1DG9A 2BLNA 2QZPA 3WSVA 1FF9A 3C5HA 4IJWA 4BNDB 1V7PC 3IDSA 4JQYA 4RJIA 3VYRB 3OKFA 1JLMA 1OVGA 4OA8A 1CV2A 2WABA 4CR7A 4B8ZA 3INGA 4WGGA 1CZUA 2JLCA 3EXG1 3ACBA 1MKYA 3G8BA 3IR5A 3C3AA 1WOYA 3OCUA 1MCZA 2QY6A 1MBZA 2H65A 3LUBA 3R3UA 4FBGA 4GPAA 4IRXA 3U4IA 4B2IA 2CDBA 1VBFA 4ZXFA 4BX8A 2O2ZA 2P5SA 4QPZA 4NBUA 3KJNA 2Z2IA 4DMLA 5FL7D 4PN3A 3IR7A 2REQB 5CLIA 1WCXA 1F6BA 1EVZA 1NXTA 4PYKA 3IL2A 1JP7A 5D6OA 2QD2A 4CT0A 4ZT2A 1PGNA 1A1VA 1X1AA 4I1RA 2QRUA 3OX1A 4KEAA 1SQ0A 4R8RA 3GRKA 4BO3A 3H5VA 1WV1A 3L43A 2VF5X 3LSTA 3AR3A 2FK7A 2TMKA 1TUGA 2WU4A 3TFOA 2WM2A 2H4FA 2QE7A 1RAFA 3K0CA 4C7JA 1R6TA 5HKAA 1UC4B 2P2CA 5B1SA 3KAKA 3TDKA 4ZYTA 4BN0A 4NLLA 5DTMA 3UMYA 1WCWA 2QSUA 2XDWA 2AS0A 3B9PA 2A1TS 4XM1A 5TQ0A 1P7YA 2WLSA 1DC3A 2AYXA 4HNSA 4DLKA 3OEED 4P4NA 4EPXA 4EY4A 1M6WA 4HVLA 4WZBE 4JBWA 2BGRA 1W94A 1QGDA 4HP8A 4R01A 1T2AA 3T9FA 4ZMRA 5IX8A 4R2XA 1XELA 1CJTC 4YJ3A 1HDCA 2Y8EA 4H0CA 5KNBA 1CZLA 1N8NA 3AERA 4HEHA 1BMQA 1P80A 3QWIA 3WK8A 7ADHA 1RFGE 2WG1A 3EGCA 3IELA 4IDAA 3W04A 1GNPA 4ABYA 1ACJA 3DT9A 3HDJA 4I9UA 3QEOA 1M6NA 4WN9A 1Z18A 5E4YA 4C08A 1GPNA 1GCAA 1J0CA 1ODKA 4RF4A 1T36A 2ZSAA 3PUJA 4Y9UA 4JC5A 3EXAA 2GZSA 4UUQA 2IXTA 2VQ6A 2BM0A 3KYBA 3IEUA 1VMIA 4KO1S 3DHNA 3QVVA 3T7RA 3W9UA 5COQA 3GLIE 5DHUA 2EZ9A 4DHEA 5KVVA 5L53A 1HC7A 2QZSA 4PZEA 1DV2A 2DUMA 4PX2A 1L5KA 1E1LA 2HFKA 3MS2A 3UK2A 4EY6A 2J9FB 1DGQA 1AMUA 4C0AC 1QIIA 2GEVA 1XA3A 3TE7A 1YB4A 3AEQA 1CY4A 4JEHA 1ZJ4A 2GXUA 2P3OA 1MIOB 5HE8A 4C3OB 4CM9A 2XB6A 4V38A 3AXSA 2O2HA 3DS8A 4B4VA 1M9NA 5BXYA 5BR4A 2Y4NA 1LRJA 1AS3A 3LT2A 1PGQA 3A2MA 1WTCA 2R1TA 4FZ3A 2ZJBA 5CBKA 1T8UA 5CJJA 5IBPA 4DCMA 4G5RA 1RM4A 3QE0A 5C7YA 2R6HA 1OI4A 2UZ0A 2WF5A 5A6SB 2D7JA 1JFRA 1GQ2A 3MWDA 3D3WA 1EK6A 3ODGA 1U4SA 3RKUA 3TIVA 1SG0A 1OI2A 2VJLA 1C7FA 1J09A 1RZVA 2YR0A 1QE5A 3TQCA 3EOZA 4OKNA 1YKFA 1A9ZA 2NYUA 4JFRA 3B85A 4HADA 5HKKD 2QG6A 3MMNA 2VDVE 4GLFA 3L5KA 4KXVA 5EXTA 4NENB 4DDUA 4EGJA 3M9WA 2POCA 1PVOA 2XUZA 5DBIA 1NMEA 4BAGA 3EXHB 3UOAB 5LYJB 2H4HA 3L6UA 1CQJB 4QXRA 2RK6A 2WVAA 4K87A 3RROA 3LECA 1DAIA 4GMXA 1JG4A 4B33A 5KTPA 3BH6A 1UDXA 2RAUA 3I83A 4DLZA 3ZJYA 4ZI3A 4NMHA 1IZ7A 2C0CA 1A88A 1VL0A 1XD8A 2J30A 2W98A 1ILEA 5FWXB 4KP7A 1GGKA 3B6KA 4FZRA 3KHKA 1QFXA 1Y7TA 4AZSA 3F90A 1H0HA 5JT1A 4TL9A 5D2CA 5GOTA 3BILA 5FTJA 2VP4A 1L9XA 3GHHA 3CSSA 5D1HA 3ASVA 5FNZA 1E6MA 1F38A 2QYTA 2ZRPA 3B38A 2FPOA 1Y6ZA 3BGIA 1CR1A 3EZXA 1A76A 2OCKA 4RORA 1NSYA 2GTPA 2NPFA 2GXAA 4HF7A 4JQCA 2ZUBA 2RK4A 1NMXA 2FX2A 1QCDA 1Y5LA 2GFHA 1CRPA 2BDUA 4KFTA 4M83A 1I3OA 3ZHCA 5IRCD 5AW0A 5JS1A 2YFQA 4U4AA 1IWBB 4BQFA 5HM8A 1H9CA 4ND2A 4TXMA 1SWVA 1VIMA 2VYFA 3GXOA 4L2IA 3SXUA 2DWPA 1EYZA 1TLFA 1IDOA 3DE5X 4ZV9A 4D6XA 4F92B 1XALA 5CXSA 4MP3A 5KTMA 2B8EA 3DQPA 4RZXA 4TMXA 3GEMA 4L0DA 3VMFA 4X1YB 2D13A 3SHQA 3VAYA 4EA8A 4YPOA 2PCJA 3LP5A 1H66A 4IVNA 3G7SA 3GHYA 5CLHA 3TPZA 1NRXA 2PUFA 2EOAA 3IDFA 5ARBA 2CJWA 3I2JA 4RKEA 2ZS8A 2JIMA 2QJTA 3GNTA 3H65A 3D4BA 2G09A 2ZT8A 1UPAA 3HB4X 4B7AA 3P2EA 4C2AA 3X3HA 4D4MA 1D1PA 2HRCA 4FKMA 5EQFA 1NY6A 3E9EA 2BN4A 1F51E 3R4VA 1ZCBA 1E1NA 5ALPA 1PZXA 4N3GA 5IC6A 2R751 3I3OA 3EOBI 2WTXA 3OBBA 1SZCA 2GBFA 2UVDA 5FOUA 2WFLB 2XCUA 3RSSA 3AFHA 3BTUA 2ZI7A 2RGCA 4KNWA 4OGWA 2VP5A 5CIWA 5D3ZA 4C4RA 4F5YA 1MHPA 5IKEA 2YOFA 1KY3A 2A94A 4YP9A 4Y0VA 2CKDA 4M7OA 2Q3CA 4S2EA 4FYIA 5EP3A 3I6ZA 4FOSA 4CLRB 1F9EA 4EPYA 1XRQA 1FDUA 1MT0A 3V6MA 4HDAA 1CBUA 1Q91A 1T29A 4BS9A 3D7MA 4G84A 3FI0A 5J2TB 1N2BA 3L7NA 1JTFA 3A6KA 1XD2B 1ZESA 4MRVA 1KDTA 1IZZA 3PXAA 2ZULA 5E2AA 3SCZA 2RONA 2X5XA 4V1CI 1ZBDA 1U5CA 1XLUA 4V0SA 1FDIA 3TQSA 1MLDA 2VDUE 1XBTA 2FWNA 3OT4A 4IH4A 4QAJA 3OZVA 1QQ5A 5DGHA 4YN3A 3VO1A 5BQXA 3MWEB 1QYVA 2IV7A 4K6MA 3AF0A 4NEQA 1NRJB 3N8HA 4HATA 2QRPA 4A26A 4RCZA 3BRWD 3PKZA 1FDVA 3MLEA 2WMYA 4PLHA 5LOVF 1L4NA 5KQMA 4H7JA 2B69A 4KACA 2QIOA 1DHRA 3S2IA 1C1XB 2R8YA 3IDAA 4OMCA 1NF8A 1NFQA 2PMBA 1NGSA 4LV6A 3QUAA 5LZ9A 3E7FA 1JVNA 1W93A 2B7BA 3DWFA 2VZ9A 5CJPA 3UNXA 5A4IS 3NBZC 1CZNA 5AVTA 1KI4A 3GDGA 4OA5A 3ST7A 2QVLA 3D1JA 3QPVA 2BFEB 1QV7A 4BLWA 2CFSA 4KSCA 1R6XA 3AVPA 1OSNA 1I30A 2PSEA 1NURA 1YR6A 2ETXA 1C3LA 2MR5A 2QVXX 5DK6A 5EE1A 2WIJA 5BR7A 3GGDA 1YI0A 3TTSA 2QTFA 1K7FB 2AFHA 3A7EA 1N2CA 3RRNA 2CHVA 2NUPB 1YZ3A 2DPHA 1EXWA 4FFLA 5FLYA 1PF7E 1TLLA 2AUNA 1V7ZA 2I1QA 3ELWA 4IXMA 4RA9A 4JL5A 5FWDA 2FSPA 2GLTA 3B1KA 3FR7A 5I9SA 2QRKA 3RFUA 1DOZA 4ZWNA 1IHYA 3HR4A 2EKLA 3OC0A 3ZWBA 4D9BA 3VKUA 4DDMA 3HXTA 1Y5NA 5M7EA 3FH0A 2F1OA 4FFDA 4YP1A 5GADl 3GFSA 3KBBA 1GQSA 1OLUA 1PU2A 4GVPA 1F2UB 1LCIA 2AW5A 2XLBA 3ZIAD 2AG6A 1BRTA 4E46A 2PUJA 3ZD7A 4BKOA 4JLMA 4Y6QA 2VK2A 1NHWA 5FXMA 2VP9A 3WP0A 4BCBA 4E2ZA 2AIRA 3CXUA 2ZVDA 5ALVA 5J4YA 2A4KA 3D8UA 3MILA 4DE5A 3UTDA 3UTCA 1PBNA 2YRWA 4UNIA 5C8DA 5K99A 3NRJA 2GBLA 2VPXA 1U31A 4HLDA 4EKNB 5CLFA 2ZBQA 1L7BA 4RGVA 3TNLA 5F33A 3ZLUA 1P2GA 3P27A 4D02A 3VYSB 4F85A 3ZGZA 4GGOA 4N18A 1D1QA 1GFWA 2YH2A 1YB7A 5F52A 3PWTA 3VU9A 4LJLA 1N0WA 1XDGA 3ZWPA 2HT6A 4GRIA 2BGJA 3GEHA 4OI4A 1SU7A 4QT0A 1GAXA 1FXWA 1GTZA 3IPXA 4G8BA 5T57A 5FFMA 5HF9A 1UBRS 4QDKA 4EAAA 2QNBA 2W48A 4ZEVA 5JJLA 1WKVA 2FGJA 1F9AA 3H84A 4CGZA 1EA7A 1FTNA 3KR9A 4YJFB 3IVMA 2Y1GA 2ZE5A 4GE0A 1XA0A 3K1TA 1KBZA 1YVDA 1POWA 1BQEA 5EXDA 3K0AB 1GFIA 4QGBA 2FSSA 3FHOA 2ZR8A 3DZCA 3R3SA 1KAQA 1CLUA 3W2IA 4S12A 1Q0RA 2YHAA 3S0JA 3AY0A 4M99A 3GU3A 4CKYA 4FFSA 4WBXC 2GD6A 1JR3A 1T8WA 4DWOA 4XVHA 3QX3A 3K8YA 4LYGA 4MVJG 4H7KA 5TS2A 1IJBA 2JGMA 2BFPA 3DDOA 1Q0QA 4S35A 1T5OA 1PL7A 2W8ZA 3OT5A 4WWHA 1TYZA 2QRQA 2AH5A 2AI3A 2H51A 4D0LB 1HT1E 1MIHA 4OFWA 3VNAA 3HO8A 5HGJA 3M3PA 5A1JA 1UDBA 3L49A 3OICA 4F71A 5DM1A 1P6QA 2WFMA 4LXYA 4BMNA 1U7ZA 4ER6A 4DDVA 1XMOB 3L0CA 3PQDA 1OWMA 5DN6A 1RCUA 1A4XA 2YQZA 3M5WA 3ZDQA 1BJRE 3LX8A 2YJNA 1J8DA 1JHQA 4I08A 1IEXA 2YMLA 4R2KA 3AUAA 2PGLA 1UODA 2R4UA 2P9FA 1NI4A 1SUFA 3N07A 1H69A 3QMPA 2VPYA 5CB6A 1CF9A 2WOJA 5ALHA 2X1LA 3EUEA 1H4SA 5FBKA 3UMVA 4PANA 3SMQA 2R0QC 3I34X 1RYMA 1Z37A 3OLCX 2XE8A 1QGOA 3CW9A 3GI1A 5AJVB 4GM1A 2QTGA 3RT1A 3UJBA 3DFMA 4FGUA 4KPUA 4YQFA 4N03A 2J0SA 1GTJ1 1Q44A 1XNGA 2BFMA 1WDTA 2XRMA 4WNYA 2D5CA 4EZBA 1XK6A 3PWSA 1OWPA 3S29A 4K9QA 4MW1A 4TV8F 5T8KA 1IWOA 3SN6A 2GAAA 2C8VA 4DCCA 2JH3A 1M2GA 1TMKA 1KU0A 1U9IA 3K5PA 4QJ3A 5L3QA 1GLVA 3B1ZA 1MZPA 1XPUA 4AW9A 4UMDA 4RXTA 1COWD 3DDZX 4HMOA 1TUEA 3BAFA 3CKMA 3GLQA 4L6IA 4X20B 2A9VA 3NMUF 2CGEA 2GNPA 2GARA 2O7RA 2P9EA 2OCBA 3GOQA 3LCRA 1V3TA 1NXVA 2Z4SA 2Z1DA 4WKGA 3VVBA 3NOQA 1N0IA 4XPIA 4A6DA 3CKKA 3HPRA 2CLIB 2XZDA 4FIDA 4REOA 4QASA 4NC9A 4YMTA 1V9CA 1AKTA 5DTRA 3E9MA 2NVUA 5BXQC 2HQRA 2OO5A 1JFFB 2ZKLA 1NUAA 4N0PA 4W5WA 3WLRA 5JQGA 2DPGA 3HLYA 2ZIEA 2HSDA 3SKXA 3IUBA 5B30A 3FYTA 4KLZA 3OIFA 4QZVA 2WI8A 3W77A 1UBKS 4J76A 3CR3C 1A3CA 5GZ3A 2MINA 3BXXA 4FEGA 1N5OX 2QDKA 3OU2A 1JB1A 4L74A 1T15A 4FSDA 4U1RA 4PNZA 1XA4A 2Z58A 1ND5A 4LC9A 2QGFA 1G0NA 1O95A 2ODNA 1KTVA 1N7HA 3HB5X 4MGKR 2QEQA 3R7SA 4OF4A 5EQTA 3IAUA 3S5UA 4DSUA 3NM5A 4DRXA 4ENSA 2EW1A 2JA1A 2AMVA 2YVQA 4L5IA 3BRCA 1EEXB 3I72A 2EARA 4UQLA 1AQUA 2HA6A 4S1WA 1UCFA 5M2QA 3C8MA 2Y1FA 1TK3A 1G5FA 4PYQA 4ETWA 1LBIA 5ALSA 2IUSA 3PENA 1FCJA 2FGKA 4LMAA 4ARBA 1B6GA 3IEIA 1QPZA 3FWPA 4N47A 4NJEA 2WB2A 1HG0A 5JSFA 1J22A 3FKSA 2B94A 1ZU5A 3JZMA 1LDYA 2FFBA 1XDZA 3UFBA 4CEIB 5JECA 2HB6A 1PLLA 2IIVA 3MLBA 1W4RA 2XUKA 4R5MA 2Z5LA 1Z73A 2DPXA 4FYWA 4QATA 2QAGA 1JMVA 2F9MA 1C30B 5C1BA 3VV3A 1WF6A 2G63A 5JARA 1XEXA 4RVHA 4YRAA 5DB4A 1QDUA 1ZJ6A 5BNFA 5A0FA 2QVYX 4NFLA 5E4JA 2G9QA 1GNVA 3D8TA 2ZCUA 2OO3A 5GQSA 4DSZA 1QHSA 4MW0A 2XB2A 1TM2A 1XEFA 3LRTA 2PVCA 3IT3A 4FOLA 2VO1A 1HORA 4IGKA 1RM0A 4JP5A 1ZJJA 3CLUC 5DGCA 3SR0A 1GNTA 1YZQA 1X74A 4F4IA 1SKQA 4J29A 3WGJA 2IYPA 2ZJ6A 2Q4EA 3R0QA 1S2LA 2BTOA 3SZUA 1N34B 1GLGA 3LXUX 3T4EA 1SUSA 1FBTA 1V48A 2FPWA 3G9XA 3F49S 4IWYA 3MJHA 4RGQA 2V6FA 3BTSA 5HQTA 1Q84A 1FU8A 3FYUB 4NI5A 5HKLA 2JLAA 3FRHA 2AJCA 2JBHA 3E18A 5BOSB 3R44A 5DCUA 5IJZA 3Q3JB 2QX4A 1ND6A 4Q4LA 3F7OA 4GPBA 1RWVA 3TQIA 5IM4F 3ONFA 2FP4A 4G5FA 2GN8A 4PC7A 5BVHA 2C84A 2J6BA 2IS4A 2PWAA 4M0EA 4ZOBA 5JG7A 1MO2A 3BJRA 4JJIA 3VZQA 3LP8A 1Q7CA 1C7RA 4NOLA 1I7SB 1UJ6A 2XGJA 2P62A 2KLHA 1X3LA 1XU4A 5DYYA 4CG1A 1DX4A 4ZJZA 3HKEB 5AFSA 4E21A 2RJ3A 2ZYRA 3EXEB 4TKUB 5C32A 1W4BA 2OLJA 3HL4A 3N0TA 4JLVA 4U2FA 4UHDA 3RKSA 3VSAA 5IKPA 5JNWA 1QH8B 3D5EA 5K0CA 1J7KA 1JB9A 1QFZA 2WYUA 2ZAYA 2E49A 2WNIA 4YMGA 2RH9B 4R1SA 4RLQA 2DYKA 4LJ9A 5A5VA 1WPXA 4IXDA 4NBVA 5C4MA 1DKOA 3H87A 3ZHXA 1XLTC 2P69A 2POQX 1NVMB 4NU6A 1M74A 5EMLA 5J5CA 4CLXA 4FXOA 5HMMA 4UULA 5CRIA 1P2VA 2PAAA 2ODBA 3LCMA 4HH4A 4LJ5A 5F9FA 1WY7A 2F9LA 4COKA 3ME5A 4KWIA 1RLJA 3SC2A 4KOAA 3SJCA 1DIRA 1P7WA 1SQ5A 3MAGA 5JBIA 4RMHA 3WJ7A 3BL6A 1JPJA 4I9HA 1GKYA 2NO9A 4O2AF 4U8GA 1KY2A 4I9FA 1VG8A 3HSYA 4GYJA 4LV8B 1J07A 4Q7EA 5CIQA 1DEXA 4YJDA 4MPDA 1B0UA 1OD6A 4YRFA 2PSHA 5KTSA 1MEJA 2VP0A 4I66A 3JQGB 3E84A 3E7DA 1K4MA 2QHXA 3HKBA 3B2NA 1E4OA 4HMQA 2KM1A 3O8LA 4MPTA 1RWPA 1Z5PA 2C2XA 4NH0A 1M34A 3V2UA 3ZCTA 2BCGY 1SBZA 4JXKA 3TSCA 4BFCA 1EG7A 1XN4A 2VOJA 4DIEA 1EFHA 4HQNA 1V16A 1M66A 1QRSA 2X23A 4G4JA 3E2IA 3JRNA 4LRYA 5FD8A 3IIJA 1EQUA 3GARA 5EJEA 2WHQA 3E9QA 4OBEA 3D31A 1PT7A 1IUNA 1ECCA 1XVIA 4K6HA 4QO8A 3THOA 3L4KA 4UBNA 3CF4G 3TL3A 3WV4A 5F23A 1PG5A 1W5TA 1Y1LA 1DJQA 4HFJA 4UCQA 4N9WA 1OPXA 2B2NA 3TCNA 5AKYA 5C7OO 1QHYA 1YB6A 2HNKA 5KDOA 2CEKA 3UB3A 5CITA 5C9ZA 2I99A 2QR3A 2VWPA 3EWAA 4HDMA 1Q22A 1Y7HA 1Z4JA 1GZVA 4GLBA 4AECA 1DAOA 4JBHA 4ENQA 3IR6A 4OXNA 1FJGB 1L7DA 2JLWA 1W8DA 1ZZEA 3VRHA 3LZ6A 1U63A 4RA6A 3V4RA 2QTTA 2Q5JA 1Q0TA 2BISA 3OPNA 3U4HA 2ZZKA 4E7OA 1UPCA 4URFA 2VCHA 1XZMA 3OOEA 3RKRA 3L8CA 4JSYA 1CP3A 2NZJA 1GNRA 2QYSA 3KHUA 3MTGA 3MHPA 1TTHA 1U2GA 1MU0A 2V96A 3MBIA 4TXJA 5BSTA 3DV0A 1P74A 4P2BA 4FR0A 2W70A 4XUDA 1SA0A 3DD1A 2ODQA 1MAUA 3EEYA 5A06A 2KJQA 3KJEA 2OHVA 3W6ZA 4LF8B 1RE1A 4LVOA 2ZSIA 2GASA 3HDVA 4D4JA 1L0BA 1CJCA 1E3MA 3RTGA 4PZAA 2OXIA 4CF4A 2FW8A 4GX2A 1A5BB 3A1SA 3T41A 2D2XA 1OBHA 2WJWA 4M4SA 1GZHB 3RS8A 5JWOA 3PD0A 1BS9A 2WBLC 2HADA 4H4DA 2JLBA 4KH0A 4H17A 2PGIA 1QTQA 4UPEA 2JG3A 2ZRNA 3ZKWB 1A2KC 1CKEA 3JQRA 4EYOA 2Z56A 2ZB7A 4I8DA 3D64A 3RIEA 2VTEA 3TSOA 3QKUA 4PIPA 3ZHVA 4YPVA 5KNDD 1CEQA 3NYIA 1A77A 2DR3A 4WZBB 2AK2A 3I01A 4PZUA 3CPJB 5DX0A 4WKCA 3K70D 4YTEA 1Y8QB 1XPJA 1WP4A 2ZYWX 3BIWA 3FAZA 2UUBB 3G0IA 2JD1A 1AGPA 3UUEA 4Z4HA 3ETCA 2Q0HA 3NQ41 3OPMA 2I4OA 4OQXA 1ULTA 4DILA 4A0SA 3G5TA 1DKLA 4WLNA 3O8QB 3Q5DA 1GZ7A 2W00A 3H9BA 3QWBA 3ZY3A 4YRKA 4C4PA 3B60A 1SVOA 1NKTA 2J7PA 2R66A 3CLTC 3EEQA 3FNFA 4KXYA 1L5FA 5GP1A 2A92A 4D9EA 5L6LB 4WLOA 3TQOA 4REQA 3QE3A 1RHQA 4TS1A 4U5QA 1NX9A 5I5EA 1H2ZA 4FYXA 2XCSB 2IXAA 2E4YA 5IUKC 1WY5A 3GZJA 4B9EA 1EJ0A 2EJUA 5EHZA 1JVSA 1BEZA 5EZYB 3E22A 2PE5A 3A7DA 5B58C 3T9AA 3VR2A 1J0AA 3TM4A 4EKDA 2HZ7A 4G1MB 3K9FC 4LYDA 4YYZA 3BD7A 3KCNA 4D1YA 1KZ9A 1S5PA 1IATA 3CNEA 5KTRA 2HGSA 1NJFA 2JH8A 3L1VA 4LRWA 5DTQA 1KDZA