4V38A

Apo-structure of alpha2,3-sialyltransferase variant 1 from pasteurella dagmatis
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
388
structure length
388
Chain Sequence
SKTITIYLDHASLPTLNQLMHFTKESEDKETARIFGFSRFKLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTMEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SIALYLTRANSFERASE
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
total genus 132
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v38A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v38A01
2IY7A 2IY8A 4V39A 2EX0A 4V3BA 2C84A 4R83A 2IIQA 4V3CA 2C83A 4R84A 2ZWIA 2EX1A 2Z4TA 2IHJA 2IHKA 2II6A 4V2UA 2ILVA 2IHZA 2IIBA 4V38A 4R9VA 3S44A
chains in the Genus database with same CATH superfamily
3C6YA 4WAUA 1O08A 4B9EA 1DU4A 1RMYA 3SLRA 3RYIA 4BY9E 4IQ4A 1C0KA 5EMMA 1ONBA 3BDVA 2ZB7A 3MIZA 2Y3IA 1FFBA 3LW7A 3R8XA 1C50A 4JL5A 3VPCA 1UZMA 4MO2A 3T4UA 1G2QA 2CW5A 1CF2O 1P5FA 3RVKA 3UC9A 4R05A 3FLAA 1IC6A 1XZJA 1PJLA 1RBZA 4TVKA 2KJQA 4KLZA 2AVDA 1HDXA 1Z0AA 3G0HA 4ZOCA 4EFMA 1R50A 1XDDA 2AG6A 3C14C 3QWBA 1XPOA 1GPLA 1P5RA 4K9KA 3EC7A 4G89A 1QP0A 1Q0UA 4PZZA 1CW2B 1DE0A 1LRJA 2OV1A 2PG3A 3PP8A 4DF3A 3KXPA 5JZ9A 4TRNA 5EQJB 1GCGA 3OQ1A 1Q5PA 3OSZA 5ALKA 3TE7A 5C8YF 3A3OA 4W82A 1NM5C 1QHXA 2E2WA 3C5CA 1IWOA 5HCNA 5JYEA 3D6TB 4EY5A 2IUYA 2VPZA 4OUKX 2A67A 1PSZA 1G21B 1HT0A 4Q9IA 4DV5B 5JWOA 4YGYA 2VRBA 1A9ZA 1R00A 1TLFA 2IFTA 2QT1A 4XX0B 1H4TA 1S89A 4Y2XA 5CMLA 4BBAA 2PRYA 2ZRNA 2FQXA 3HYCA 2W6JD 1WMEA 1PK9A 4PPYA 1G8SA 1P0IA 1RYMA 3JRWA 3D8NA 1LLDA 3KEOA 4V0OA 3I9KA 5A2GA 1EIWA 4CI9A 1D07A 4F85A 2A0FA 4WK0B 3EA0A 1NBIA 2YZKA 2Q4BA 2LNDA 3FHJA 4WACA 5EHQA 2EJWA 1OA1A 3PJEA 3LVQE 3QVOA 4FCWA 5JEDA 1NG9A 1SEPA 1N2XA 3GRPA 3JTEA 1OWMA 2H7CA 1DIRA 3LGAA 1HNWB 3ELWA 1R16A 4HGZA 4NE2A 1OPXA 4RDCA 1EFPB 1XKQA 1ZOLA 4LI3X 3O92A 3OF5A 4OB7A 4QTTB 5AI9A 3SPXA 3BFVA 5K0TA 2IDMA 4JI4B 2QL7A 5BN1A 3Q2IA 1VIVA 3ND8A 2NXEA 3KSMA 3NIDB 3C4VA 2JLUA 1TA4A 3NWOA 2F3PA 4A23A 1Y3FE 4E07A 1CS0B 2Q3FA 3P9QA 3R0VA 3KKLA 5E6RB 5U1PA 1KMIY 4U6QA 2GRAA 4BX8A 5AOAA 1HLGA 4ND6A 3RTEA 1LZKA 3SZRA 1N7GA 1UK6A 3W4KA 4GGMX 4NPCA 4PBSA 5HJEA 4XVUA 1J9GA 3KKPA 1HLPA 1TKCA 1M6YA 2ZDGA 4P98A 5AESA 5ECYA 2B4KA 3VR3A 3GLQA 2BCGY 2EFCB 4HDSA 3S8MA 5BV2P 3KAPA 3ZYZA 3N3AC 1SD2A 2AOUA 3P94A 3KXIA 2LIVA 2YJ4A 1AGRA 1RFGE 2GFIA 4HNQA 4PSVA 2Z09A 2GPNA 1RT9A 4P4LA 3VR5D 3U49A 1PR0A 2GSDA 3BMQA 2OECA 2V7PA 2ZT6A 4FZVA 1R0SA 3BMOB 1GPAA 2YWBA 4AY2A 3QPCA 2AJBA 3OT5A 4LMPA 5TSDA 1K6IA 4BO2A 1HLFA 2OHGA 5CT5A 4QFMA 4B80A 3NJRA 2G7MC 2WF8A 1I1OA 1Z2CA 1Z56C 4FONA 1D6JA 3U7FB 2I6SA 2R86A 1IBLB 5L7TA 2XMSA 1LBIA 1Y1KE 2V3VA 2I1LA 1U2QA 1DCMA 3NG1A 1E3LA 1X0VA 1TTQB 1SK8A 3IVMA 2WTEA 3OCJA 3UUGA 4QBTA 4A36A 2B6NA 2Q6LA 3GEMA 3EFOA 3O8QB 4PX3A 4YP6A 5T5QA 1FYEA 4HY3A 4PCUA 2SNIE 4BGVA 2IEDA 5FBHA 5I7VA 3EB9A 3ZK8A 3LL4A 1T2DA 1MB9A 2BUCA 3DZBA 3R6GA 4MNTA 4OGFA 5ENVA 4ATNA 1PFVA 4UNRA 3N76A 1P6QA 2J5BA 1AS3A 1GY8A 2PAAA 3OE5A 1ZM3A 4JITA 4EGQA 1BWPA 2WKPA 3WYAA 3O1HB 5J2UA 1BE6A 4CU5A 3RSHA 3W5IA 5DCWA 4PY2A 3WLEA 1UAAA 4IKOA 2XUZA 1J97A 2BJWA 2IHZA 1P2GA 4KAJA 4TVOA 3UG7A 5LP6A 1XWIA 2JIZD 3W7VA 4CMIA 3Q7PA 3R7NA 3W1WA 4RVFA 4EPRA 4AF6A 3NYQA 3PNLA 4ENRA 5D84A 1D5CA 1SPBS 5CTAA 1PJQA 5IHPA 1L1RA 4YPVA 3GY0A 1PWXA 3H2YA 3W5DA 3S27A 3CLKA 3HQ4O 1WNFA 4BVHA 3KD3A 1R8YA 3ZY3A 1D2AA 3H8WA 3T7EA 1NVKA 4KI0A 1M1YB 1XCOA 4EZIA 2HBZA 5JC8A 1ZDMA 5KWIA 2CLOB 4M22A 2HYDA 5FO1A 1IXSB 3U4GA 2C7GA 1TUBA 1Y8ZA 4KPGA 4DR7B 2YL2A 2KX7A 1KRHA 4ZP1A 1IN4A 1MU0A 1CQIB 4PSAA 4D99A 4U2GA 3MAGA 1IBCA 4Z1MD 2Q0HA 3MTEA 4C0LA 5JZSA 2Z9CA 2GASA 3KO8A 4UU7A 3OA2A 3CKMA 1K8YB 4FMCB 3CM0A 4FFMA 4HLUC 1VYUA 4H7FA 4M9UA 3QLJA 3RQSA 3QHPA 1V35A 2I29A 1MH9A 3PC6A 4LXGA 4QBFA 3DBHB 3IUQA 4JJGA 2FPKA 2G1KA 3I2HA 3NM6B 2WJIA 2YHUA 4GT1A 2IYWA 2NUTA 1C3JA 1SWWA 3NKLA 3KQSA 4XIGS 1Z4OA 3VSEA 4MVJG 4MRSA 3ACBA 3D8SA 2OV6A 2UVPA 1NM5A 1VGQA 4A2WA 3D6MA 2MCFA 1XA4A 4IS3A 3F6SA 3PSHA 4LHZA 5L9AA 4P53A 3F3SA 1W5EA 4IRXA 4LOIA 3L49A 3BQNB 3A1TA 3JQBA 2JIMA 3SP1A 4P4NA 2HLPA 5JMPA 4B44A 3N7AA 4AAYA 4Q9AA 3TTSA 4C87A 1UMCB 3EJWA 3IS3A 3IHWA 4R9UC 5C1PA 5EIEA 2I1VB 4IW3B 2C31A 2R7NA 2WINI 4H3HB 3X2SA 5GADl 3VVMA 4G1CA 2JJMA 4CMEA 1AKTA 4D9JA 1CRQA 1BXGA 1V9CA 2PV0A 2ZAOA 1T9HA 2Z2KA 4TV8F 1JA9A 2YY7A 4H6XA 1WQ3A 4HNRA 1HORA 2FWBA 5AIBA 2A2ZA 1L8OA 1OFHA 2G08A 3CVVA 4LTMA 3ESZA 5ITZA 4GZ3A 1RM3A 1CR4A 4MRAA 2GBLC 4L73A 4YALA 2WAAA 4Q02A 2VDUE 3MINB 5MFZA 2K6GA 5E8JA 2B0JA 2F3SA 4CUJA 1E2DA 2WFLA 3SY8A 5INTA 1VE5A 2JATA 1NQ5A 3OZCA 2ZRFA 3BXGA 4UNIA 3KQUA 3KG2A 4ZU3A 4OQNA 4CW7A 4JVLA 3HFSA 3QYJA 3U7JA 4EQ6B 1RI4A 4UAUA 1P1CA 1PO7A 3GRCA 4QQKA 4EG8A 4E3WA 1I3CA 4M6WB 4QJBA 2APJA 5KHAA 4OQFA 3DLBA 5IKEA 5LZ2A 1U1FA 1WKBA 2PZKA 5LQSA 4DL9A 4GBMA 4IIUA 1IEQA 3FIUA 3M7IA 3SX2A 4B09A 5EWMA 2AFIB 1JFLA 2ZIGA 2Z8YA 3VISA 4DDVA 3FHOA 2XUHA 2AIRA 2Y99A 1GGNA 2XD4A 3GFSA 4GUAA 1VTKA 4CKEB 3T6KA 3CVXA 3TZBA 5KPJA 1YJCA 2DQYA 2WDZA 2HA6A 3TBHA 4DDMA 2X9LA 3CUVA 3LX6A 4MAMA 2DHDA 3ZWKA 1WZEA 6CHYA 2FA9A 1GPUA 3G82C 4RXUA 1FFHA 1KL7A 1SKMA 1RYYA 3PDJA 3PLAE 3X1MA 5KYWB 1P2DA 3ETJA 4IG9A 4S1TA 4TVBA 2EU8A 1A9XB 1XCMA 2JASA 2OB2A 4FOSA 2WMDA 5D3KA 3AYZB 4JSRA 3RODA 3VRHA 4I50F 2XLCA 4UC0A 1JJFA 2AE2A 4A27A 1ZNZA 4NBKA 1MCZA 5FV4A 5CDUA 2Q0XA 1O6FA 3M4NA 1S2IA 1BC5A 2I6GA 3QKSB 4NMMA 4QDTA 2H2FA 3EVTA 4LTNA 3GXBA 5K0NA 5K6AC 4IJQA 2QRMA 1PJCA 2QWXA 1AHNA 5JWHA 1TKAA 3N0RA 5BVHB 2IZ7A 4LYAA 4GI5A 3GT0A 3SQXA 3VTAA 3ZYCA 1USKA 3EDMA 1XTTA 3ZJ5A 1QR2A 4MR7B 5TMEA 3RANA 2X6QA 4W8GA 3TDMA 1P5ZB 4RV9A 1CR0A 1XALA 4UM9B 1DMSA 1FA9A 2PBZA 3AJ9A 4CCYB 2PT6A 2QRGA 3TTYA 1AKUA 2WJAA 1QH8A 1T0PA 3T4XA 4CUKA 4DV1B 4WLNA 1ZBQA 4AKGA 2VWQA 4DLNA 5MN5A 4P8RA 5TT1A 2AFRA 3U3RA 1E5LA 3QXJA 1YCHA 2AQ8A 1A1SA 4BBZA 2PX4A 3JAKB 1AIPA 3LT2A 4TSKA 1V8BA 4YH1A 5FWYA 4OQLA 4QYIA 5EXDA 2FWNA 3FI9A 2GAIA 1GPYA 3N8HA 3VZRA 3GFFA 1B8VA 1F9EA 1DX6A 5KC8A 2G9UA 1B6RA 1M0SA 3SQNA 2GI4A 4ZJYA 3HH8A 1TA0A 1NOJA 5EMNA 1F4LA 2JFZA 4G97A 1YS4A 1ACLA 1BTOA 4DLXA 2RJOA 1EGHA 3LXMA 4EDHA 1L5MA 1X1BA 2EZ9A 1WUKS 2COEA 2PLFA 2NU6A 2QZJA 4G0XA 4HLUA 1QZXA 4QA9A 5HDBB 3VPFA 1PFGA 4B6SA 4B7XA 4E70A 1MG5A 4LFCB 5A5GA 4B17A 2R68A 2VKTA 3MAAC 4FFDA 4O33A 2YWXA 3PCXA 1CWUA 3VR3D 4OSPA 4TTPA 2WHQA 3FYSA 1LPPA 4HDKB 4DYVA 2O48X 3VR0A 4Z4IA 4C07A 2CVOA 3AV3A 3Q3CA 2QW0X 1UINA 1S8AA 3BA1A 4MGZR 4TM8A 4EHBA 5AVXA 4M4SA 5EMKA 3WAJA 2GH1A 1RJ9A 2H0RA 3E61A 4L9AA 3WFJA 3E4DA 4F4DA 1DARA 3DE1X 1IMJA 3AOEC 3DQZA 2FR8C 1JB1A 3CUUA 4Y67A 5TGTA 1KYQA 3LY9A 3H9UA 4K9RA 3GW8A 4RYDA 1YULA 2YN2A 3AF1A 3DE4X 3M3PA 4QOJA 2FPMA 2B98A 3D2AA 5LYJA 1HE8B 2VHYA 2GEKA 2H5EA 5KEIA 1JXAA 1EJBA 3JWEA 4R5HA 4CTNA 1N0VC 2WIGA 4HTFB 5FTMA 3NEPX 1NT2A 2ZSJA 2LBPA 2C3YA 2EEZA 1RWKA 3ROFA 4K8OA 3W34A 3PCRB 5KMGA 5L51A 1GNTA 1HDIA 5DOVA 2Z3VA 4JAVC 3OTIA 2ZAIA 4OSOA 1M72A 2J3EA 3RNOA 1RC8A 3VPAA 1LDNA 4UQOA 1B73A 3TIVA 5GAJA 4D4GA 1ST3A 4HZUB 2GBLA 2L82A 3AUTA 3TLAA 1N78A 2PGJA 3QYAA 4KCGA 5CFQA 5KQGA 1UT8A 5H82A 2FN9A 1DP4A 4RF2A 4JEHA 4YK7A 3K4PA 4QPDA 5IT4A 3NALA 3C3PA 1F3LA 3Q3VA 5F98A 2ZLBA 2J5XA 1KXJA 4WQMA 5JNRA 2IDJA 5JY6A 3DFZA 1RIFA 3PVZA 3SWWA 1YZGA 2P65A 4J1TA 4DGSA 1C3OB 2WUFA 1B43A 1FL9A 4CLOB 2IODA 2GJKA 1A9SA 1G38A 1VXOA 5TXGA 3G0DA 1V6AA 4Y30A 1X8KA 1XF1A 3O5AA 4FSXA 3UK0A 2AMJA 1P0MA 3H8VA 4AJNA 3F5QA 3O83A 5HJ7A 4QO7A 1FVFA 1JFRA 1UWLA 1G19A 1ZD2P 2VG8A 3FA2A 2AXPA 2CHEA 2NZVG 4G63A 4I6JA 4QQFA 1RLMA 4XWWA 2B4TO 2I6UA 5DBIA 1DL5A 2F3TA 4ML3A 3ILXA 2NU8B 1GRVA 1SBHA 1Y37A 4F5YA 3R7AA 2VJMA 1ZESA 4Q7JB 3W7AA 4DV6B 3K8QA 2MDTA 5K0ZA 2OPBA 4YS6A 5LQNA 4MKIA 1MNAA 2H1FA 2VUUA 1EUZA 3T7KA 4DRXA 5I4KA 1A97A 3TCKA 1CR6A 3EDYA 3ZR4B 1WZ2A 1G64A 5AKJA 2ZM5A 4M0CA 4E33A 5EGNA 1VBFA 2DFKB 1T15A 3PR1A 3X1JA 4K03A 1CDOA 1Q6ZA 3IOMA 4WBNF 3PHIA 1IY8A 4DAOA 1X14A 3JZIA 3MHPA 4OHUA 3RRYA 3R9WA 4S12A 2CJXA 2CWDA 4GFDA 2C1ZA 4KMSA 1R4ZA 2C5GA 3PFNA 5TPZA 3N2IA 13PKA 1ZWKA 2BLLA 2EGUA 1EK1A 2PZLA 4W63A 4E4RA 5IM4F 2PX8A 4HFNA 2O8NA 2ZCUA 5DW3A 3SC6A 2W43A 1FX0B 4JJ6A 3TCNA 4GF5A 5HM8A 2HRZA 1W44A 2H1HA 2Q1XA 4J7AA 4TPKA 1TYDE 1VA5A 4PVDA 4CCAA 1Y7HA 1BKDR 3D3WA 3KUKA 3TOSA 4IOMA 4RZIA 1RRCA 4FR5A 1DTEA 1M5TA 4RK5A 4MKFA 4CTJA 1HQYE 2EFJA 1PFYA 2R8PA 3NZEA 3P2OA 4LJ8A 4U8GA 3UIEA 2CXPA 3OEEA 3PL5A 3BIWA 4Z53A 4EKGA 1O7JA 2WICA 5A3VA 4F5ZA 1OB5A 3WIDA 4MS4B 5AI0A 3K15A 1LA2A 4RZUA 3U56A 3ND5A 4N54A 3AKZA 3PJFA 3ZW8A 3UHAA 2OXTA 1UEJA 4J16A 2GXSA 2YV4A 1B2LA 3AEQB 2ZRLA 4MLCA 4ZDWA 5T4BA 2ZTSA 2XITA 3EXIA 5IDYA 3ISTA 5BSTA 3DD1A 2P2GA 1OA0A 1CVLA 3CX3A 2TMDA 4BNVA 2JLZA 1MP0A 1IEVA 2AW5A 5EY5B 5DNUA 2C4VA 2FSHA 4GC9A 1NVEA 1QOZA 2HV9A 1Y1TA 3BHMA 3N07A 5HFJA 4AL4A 2I4OA 2Q5HA 2B30A 4H3SA 1ISMA 1U0TA 3WYFA 3H3FA 1XPUA 5JATA 4EP1A 3BOSA 4KB5A 3PGLA 3RAEC 1W4ZA 3QRWA 1PEKE 2R751 3V8EA 4MRRA 3DT6A 3A4IA 4O3MA 2NM0A 1EI9A 1VMKA 4RFSA 3TOVA 3UWPA 1ND6A 4MLDA 1Y1RA 1YZLA 4BN5A 1G20B 1MJNA 2DMRA 1LBTA 1MO2A 3RBZA 4EB6A 3AWDA 3CTPA 2Z2JA 2VQFB 3ITKA 1QYWA 2QQEA 1NQTA 3AOEA 2FR8A 3IAS6 5C4GB 3S2UA 4Q01A 1L5OA 4WUTA 2G5PA 2OQRA 1XAGA 2QRQA 3T7DA 1LV7A 1DMRA 5LZ9A 1BE8A 4PCVA 4Z3KA 2AL7A 2GZHA 2W37A 5K0JA 1ZMOA 4IIHA 3TLMA 2CVZA 2YFQA 2R79A 3TZ6A 3A1UA 1MX9A 1P77A 3RUFA 3RW9A 3EAGA 3T15A 1IRXA 4QYWA 4LK3A 2V6BA 2G5CA 3R44A 1Z4JA 1SOAA 1VBMA 2I8LA 5F12A 4XR9A 3ZH9B 1MJ5A 4QGBA 3DOEA 3L02A 2SBTA 4R8MA 5AP9A 4E2XA 4E88A 8GPBA 4QZVA 3IB6A 1J56A 1JVNA 1XJWA 3P9CA 1Q50A 1CQPA 1IXYA 3DXFA 3DT9A 4AURA 2XWJI 3FDXA 4JBGA 3KXLA 3LC1O 2Q27A 2XNJA 1Z25A 2J3JA 2JFGA 3CUEF 4NNOA 3H2JA 4M9CA 1VIYA 4S3MA 4BMXA 1VJ0A 4HAVA 1VXRA 1ZH0A 2H1SA 1OBHA 2NNLD 3CZ5A 3NHMA 4YV2A 3OO0A 3WNZA 2W2VA 1Y3BE 2CT8A 4NCBA 3A6PC 1CB0A 5CNMA 3R9IA 5FL3A 4EARA 3LBYA 4O02B 2C84A 1YL6A 1ESZA 1YKSA 3D0OA 4HDCA 4UNPA 4C2UA 1JH8A 3AG5A 2W4MA 4F3CA 1KI8A 3HL0A 5BN3A 4JIGA 3LE8A 3MNFA 4IFEA 5BSGA 5ALZA 5KYUB 3CA8A 3KTAA 2CBZA 1H2ZA 3RWMB 3WLAA 4OGLA 3JVDA 4DMRA 2ZSBA 4KNWA 1J20A 3S2FA 1GTVA 4U8HA 5ALYA 2R47A 3H9JA 3EHEA 3K1TA 3DFIA 2ZIEA 4GR4A 1NMXA 4NTZA 3D7KA 4ZAFA 1ZCJA 1Y9JA 2P9ZA 3LAWA 5B3JA 3KKEA 1A69A 1TM5E 4M9RA 3U62A 4O2AF 1AKYA 3BXHA 1F4PA 1J90A 1NSTA 3V33A 2C03A 4FVTA 1NRIA 3G5LA 1RXSA 2PS0A 1YNSA 4BNDA 2XUAA 3UA3A 3FUXA 4UBJA 2JFNA 3LQRA 3PGMA 2J0UB 4BS9A 3L0DA 2AJTA 4LYGA 1QYCA 4CNQA 1R37A 4M1YA 2WMOB 1MQSA 3S1AB 1UPUA 2M1XA 1R5OA 2CXNA 4CN9A 2JZCA 2WYOA 5C8ZA 4MROA 4TT8A 4LZJA 1V1JA 1O6ZA 1FP4A 1UT5A 1NJ2A 2OQIA 1GN8A 2QNBA 2W71A 2ZOSA 5IKPA 3QSYA 2J1LA 3CVYA 4YCAA 3QBVA 5L95A 4YJFA 2WIFA 3EVFA 3V4OA 1J39A 1NI5A 1V4NA 2UZ3A 1B8PA 3HBFA 3WBBA 2ODPA 5EFOA 3ROGA 1HL3A 4O4IF 4MRMA 1P8AA 2IEGA 1PEYA 3B1VA 5EHGA 3ZH2A 5FTWA 4LF5B 2FX5A 3B1FA 3RD5A 5KVQA 4PYOA 1L5LA 1ODFA 3PFIA 4XEUA 3GJSA 4ZI5A 1KK0A 1WXQA 2NYUA 3KJQA 4JQOA 1QO7A 3B3FA 2J9XB 4JJ4A 4RY0A 1VCMA 1YZFA 1AXRA 3ZGXA 2KSQA 2WYWA 1BNCA 1YI0A 3PXBA 5ESXA 4WA8A 1JFSA 3CVWA 5I4IA 4XCVA 4CJXA 1DKUA 1Z39A 1QTRA 2RHWA 3P45A 3STUA 3N2ZB 1KQPA 3MJ4A 4RMNA 4E6PA 1WU7A 3LTNC 2H1RA 2YMLA 3A1VA 3IUEA 2BLNA 2XDQB 1J2TA 3QVTA 2PMCA 1E61A 1C1XB 1WHSB 3F46A 2VT3A 2BFCA 2CVPA 3I1JA 3IT3A 2HAEA 2IDZA 1N92A 5IK2A 2W8ZA 1XIVA 5FUVA 1CD5A 3VKFA 5HFAA 1E20A 4JYBA 5BSMA 1SEVA 4ZYZA 1FTYA 3GLHA 1G7SA 4PLVA 1CZKA 3QUQA 1P7ZA 2GBFA 1B42A 1WCWA 3ZDCA 4REQB 3A9SA 2NUPB 4LJLA 3DV2A 2BFFB 2OCPA 3CKKA 5ALGA 3BZUA 3DGEC 5EE0A 2Q5JA 4CLDA 1QIHA 3P9NA 1G0NA 3R23A 5F4ZA 4ILEA 2GYVA 3MGGA 5JNWA 2ID7A 3UK2A 3IPYA 3O93A 3ZV4A 3HXMA 1OV4A 2QJOA 1ENOA 4G24A 2HHJA 5DBFA 4HYYA 1G2OA 3G2HA 3TNLA 3COYA 3KALA 3JASB 3IALA 4MV8A 1IJEA 2I03A 5KSWB 5KNDH 2YH2A 5A03A 1KZ7B 2HA0A 2EBWA 4EKIA 2V7UA 2WQ7A 1BWSA 1S3SA 1IQPA 2WM2A 1TT5B 1QFSA 2O6LA 1O94A 2WPNA 1SQ5A 4MJXA 3WP1B 1YDEA 3FZYA 2IXTA 2YMPA 1NVVR 1AV7A 4JQZA 1GG5A 3PFBA 5ADVA 5LJIA 3EZNA 4PXSA 2GD6A 4MWBA 5TPZD 3AHCA 1XNRB 5G0SA 2C9CA 2JAWA 4GX5A 3X1YA 2F1KA 3E3NA 4XD7A 3PITA 5AM5A 3S5UA 1YB5A 4BQOA 3L4SO 3QENA 5EPUA 2QOEA 3U5ZB 5E9AA 4OMUA 1GGKA 8ABPA 3WRWA 3MCZA 4K40A 4BE4A 5CFMA 3V32A 821PA 1KI2A 3I09A 1RPNA 1T29A 2WTAA 2YJZA 2QVCA 1T5DX 3R2JA 4LNUA 2P3LA 5JVDF 1E0JA 1N0UA 3UV3A 4U7WA 5K2OA 2FTKE 1RQXA 4FQ8A 4EJSB 2X4IA 4RK1A 4EKYA 1NBHA 1QHHB 1UJ5A 3KK0A 4TTIA 2QIPA 1JDJA 4IDAA 3C8HA 5DGXA 4RYLA 4BL5A 4FUQA 1JMYA 1XU9A 2GK6A 2RI1A 4MQBA 5JI3E 3EGDB 3IV6A 3OEED 5CNJA 2XCTB 4FNAA 3EULA 3LNCA 1TCVA 2RGGA 3EQ2A 1Q74A 3B82A 4S1WA 1V43A 3QPWA 4OHMA 4N8SA 4HNTA 2OM6A 3HPQA 2FSFA 4KE9A 4D4LA 1ADFA 3IQGX 5HOEA 3OWXA 1T2VA 3OBBA 3R3JA 3PQ3A 4TVSA 2ZIFA 1VPWA 3QKRA 3BTOA 3I2FA 4A8TA 4BLWA 2FX3A 1QGAA 2OFXA 3NHSA 1JHUA 3I64A 4JHLA 4RE6A 1C1DA 2P1RA 1AXEA 2PZJA 1ORTA 2YXPX 2ZAGA 3O4GA 4YAWA 4A10A 4X6YA 1T3TA 3OKAA 4QQRA 4BZWA 1DUSA 3EG5A 1DIHA 4N6OA 3S0JA 4PLHA 3W79A 3ZCQA 4ENPA 2FZCA 2W2XA 5DNVA 2PJRA 2NMVA 1T35A 5TQ0A 2VLIA 2C7QA 1EB9A 4H15A 3EPHA 3ABIA 4PAGA 5FBQB 3GGPA 2PIAA 3A2MA 1NXWA 3MOIA 1OPRA 4GAEA 3RSSA 3DE6X 1QVVA 2QD3A 2XVAA 1YCGA 2ID8A 1N0IA 3A4YA 2GCEA 1QGUA 1Q0QA 1MOPA 3CRQA 1R8QA 3NGXA 3D7LA 1SAYA 2I4IA 3OLQA 3PHGA 3E1GA 2AFHB 4XSGA 3TX6A 3VYRB 3IKMB 1CNFA 1LS1A 4GVLA 1D1SA 2HU7A 2QSYA 3HKBA 4IFIA 2CHVA 1O3YA 2KB0A 2AJLI 3OIYA 4O29A 3VC7A 4I55B 3ZI7A 4IDNA 4B76A 4EUHA 5C1BA 2I0FA 2A0YA 4ITRC 4JLAA 4UVHA 4MR8A 5GY7A 5KTMA 1B16A 3LBHA 4B4VA 4BGEA 4HGQA 3TD6A 5T6MA 3TFQA 4U5XA 4YREA 1T36A 2FPGA 2AMLA 3WYDA 4E5PA 2P9FA 4DGQA 3D4OA 2HLNA 3KUUA 4X61A 4BLPA 1E5DA 4UUOA 1CZRA 4N65A 2PFSA 4AMBA 4DSAA 1U0EA 4JOQA 1QG0A 3VJRA 1OFUX 1OZGA 2QEQA 4FEGA 1A2KC 1X7ZA 2I7DA 3LGSA 1ST2A 1M2HA 2H2IA 1YE5A 2C20A 3EG9B 4FMPA 4JJZA 4PC6A 4QDKA 4TLMB 1MIHA 4WT7A 4ZVTA 4PN7A 1SUBA 2Y1EA 2YWEA 3NXKA 3Q15C 5BRAA 1K1EA 1DBRA 4HZIA 1NV8A 3S29A 1J09A 1Q12A 3KCNA 3RFTA 4ALKA 3NVKI 4AWXA 2IBSA 2R7MA 5KREA 5A4DA 5BYJA 4PPNA 3CC8A 3EY9A 1YQWA 4Q4JB 3RC7A 2RIPA 4FHCA 3OIGA 1I33A 3PNKA 2Z2IA 3UHPA 2KLBA 4GG1A 4AQYB 4RKFA 2YX1A 3KLNA 3P19A 4RJIA 2QKYA 4UVDA 4CKXA 3QG5A 3X1ZA 1IMOA 2YNMA 5DKFA 3RFUA 4B75A 4UM8B 4CKWB 5JBIA 3K2IA 1MGOA 3GNLA 2W8BA 2O0KA 3H7IA 3R1IA 1RJFA 1SUPA 2F43A 3GR6A 5A4KA 4I8XA 3TWOA 1FLDA 1L7VC 4I1SA 2W2TA 3HCRA 3Q88A 2QTLA 3ELUA 5DHRA 3ESDA 3SJCA 3H99A 1LK5A 1SVMA 4GP7A 4RTOA 3K70D 3JQ7A 3R5TA 4P84A 1RKQA 1KF0A 3NANA 4NCKA 1QOQB 3O8OA 4G0NA 4RUKA 1NL3A 5EIOA 3OQMA 1FJGB 4KBYA 3WGGA 4BAZA 1Y4ZA 5C4IA 4M1QA 1KYZA 1ZHOA 1CJUC 3I23A 1T9DA 3CRRA 1UK9A 2CV1A 2NU7B 3EIUA 5AK6A 1SUDA 5K5EA 5LNK6 3HSKA 2UYYA 1F5NA 2YS7A 2MSCB 2A5DA 3CX6A 3MJVA 4N40A 3DHWC 5F9MA 3FOEC 3NC1C 3VPBA 4J91A 1LC0A 7GPBA 5AVUA 4KV7A 4OUDA 1GARA 4RD4A 1K7EB 1DO8A 1FNBA 4R6WA 4H0NA 5FP0A 3LPLA 2CD9A 3COZA 1JEYA 1L7AA 2IXEA 3BJZA 3H8SA 4MW9A 3UJ6A 2QRVB 2JFFA 4OHKA 1U8CB 2AJDA 4GE0A 3TZKA 4DQ0A 2F8MA 2I7VA 1SBCA 2RC5A 4TV8A 1IDN1 1RTTA 1G8PA 2WJ6A 1ZW1A 4K3VA 1X7XB 4HWPA 3FKQA 5D5QA 2HQRA 4DCCA 4EPXA 3HFRA 5DM4A 2PGXA 3IUSA 4B34A 1X1QA 5CYGA 1WTCA 1FTGA 1Z4PX 1NPDA 1NVGA 1N7IA 1OFIA 5D3MA 1KIAA 4DLKA 1EVQA 4WLEA 1O8CA 3CW8X 5DEIA 1Z6YA 2WSMA 4DDTA 3WLSA 3KVYA 4A3SA 4MWEA 4EYEA 4EVQA 2ZG6A 5KIAA 1C2YA 1T5BA 3W6ZA 4YRKA 4Y3UA 3JQDA 1UBLS 4ZOLB 1CJKC 1DAGA 3AKEA 1LDBA 4RC9A 5KOJB 4YI5A 2DAPA 2GDZA 1U8YA 4KOAA 1IBKB 3ENWA 3H0KA 2D2IA 3AHIA 2XT9A 4F86A 2BDUA 5IK2D 5JLJA 4E31A 5A7FA 5JJLA 2GJ9A 1IQRA 1P1KA 4RGQA 3V8MA 4YHHB 2OBNA 1YACA 4EG0A 3AY6A 1B26A 4KMMA 5A9SB 3ONFA 5G4KA 1NXSA 1N9GA 5EG5A 4NC9A 4UDNA 5H1YA 3M8KA 3V8BA 1P8JA 5MDHA 4RTKA 4W9NC 1E1CB 1P5JA 1QF9A 2CF6A 4K0KB 3O95A 2HWWA 2WHPA 2E4WA 3M0EA 4NKRA 4O2BB 5EHZA 4N1AA 2QM0A 1FC0A 4EW6A 2HJVA 3UYLA 5IJ9B 4W9RA 4N0DA 3VI4B 1T1GA 4C14A 2HSWA 2R85A 3KU1A 5DHSA 4Z4EA 3VSCA 1Z12A 3PQDA 4FUTA 3BXZA 4EELA 4OM7A 4ZCRA 1BH2A 1I4WA 3JQEA 1M0WA 4JJ7A 4I50A 3EIOA 4KXWA 3KKNA 1FNCA 1N1EA 3I9V1 4TS1A 4OHBA 4MQ5A 4FLEA 5IYZB 1O94D 4U9IS 1W76A 5ALJA 1B8OA 1OSNA 1DXOA 4RIEA 5D00A 5HQ3B 4Z9AA 2AOWA 3GP5A 4LWPA 1XE3A 3EVGA 2GN0A 4KR0A 1CULC 4BC1A 2PLAA 1KBZA 5AKIA 3WQQA 3E9EA 1Z8HA 3T94A 2ADOA 2ZIUB 2PX0A 2ZWAA 4BXOA 2YXBA 1R3DA 2P0EA 4XD7D 1N8KA 3KPJA 3LVBA 3KQPA 3RUIA 2PRJA 3AM3A 4H4DA 1FLNA 1UMBB 5DF1A 5TJ9A 5F2NA 5HDQA 3D1LA 5J5CA 4AC9A 5LXTA 2QNIA 5CEEA 3R7BA 2Z9DA 3BE5A 1U0GA 3DAFA 1EFVA 4M8SA 1WCIA 2H92A 4GMHA 4J0QA 3DLIA 1CQXA 1PJAA 4JP1A 3W78A 4F45A 2PWZA 2VAVA 1I7DA 2C07A 2IZZA 3B70A 3OPQA 3SMVA 2EFDB 3E7WA 4JI3B 2E4YA 2I4NA 4N82A 1L6RA 4LSWA 3RYHA 3SLKA 3B7GA 5C3MA 3ZVMA 1UANA 2AR7A 1GFIA 1ODIA 4ENWA 1RI5A 4F5WA 1QIGA 5IABA 3UXYA 5F2KA 4B71A 2O3RA 3AHDA 1U5BA 2J45A 1VDMA 3K1AB 3IV7A 5BOSA 5H16A 4HH3C 4G0MA 1K8RA 5DNWA 4CM8A 1I7SB 1SCAA 3DKPA 3EY4A 4MS1B 1OVMA 3HA5A 1BYIA 4ZRNA 3TW8B 1DOZA 3BQMB 3UT6A 4D96A 4ZI7B 5FAKA 1A8SA 3HZOA 2XUFA 4FLFA 3WLOA 2ZIZA 3FYUB 4TUYB 3PGVA 4UE6A 4WCFA 2I91A 3FPCA 3HY4A 3G5AA 1FUKA 2BKVA 1JJAA 2PUJA 4JIMA 4WLUA 3CPJB 1V6SA 4P7JA 2C4WA 1UPBA 3LIIA 1K27A 4CKCA 4BNKA 3B6IA 2LGJA 4D2IA 2ZBVA 3LO8A 2G06A 2PA3A 4ZZ0A 5J4YA 2D2EA 1D2MA 1NW5A 1S2DA 3GJXC 4GLJA 7REQA 2K7FA 1JR3A 1TW3A 4GP9A 4I8IA 4HDRA 3UAYA 2XZOA 1NVXQ 2F9LA 3Q3EA 3CISA 4IV0A 2WIKA 3REOA 4W1RA 4EEXA 2VXOA 1JI3A 1YA6A 5FUYA 4JENA 4BASA 2YQ5A 1TECE 1VRCA 3CG4A 3V3TA 4KOEC 3ZIUA 4RULA 1QHNA 4WZAE 4QWWA 4EHKA 4MR9B 1KQNA 1CJCA 1Z7YA 2FPIA 3VO2A 3TXAA 1YK1A 2IVZA 5JY1A 4OGWA 1JLLB 1OZHA 5KJFA 4FIZA 2AA3A 2FW7A 3GC6A 5AT1A 2XZPA 3EPLA 3ZUGA 4NYMQ 3BT7A 1UBCA 1Y5LA 3OP1A 2D5IA 3LZCA 3NX4A 4X6UA 1KJZA 2WUGA 3TNFA 5HE8A 3LDFA 1P9WA 3F96A 4XH9B 4A73A 3G2OA 1ML4A 1IBMB 1I24A 2FOXA 4G1EB 1WSDA 3N8IA 3OCYA 3BG5A 4RORA 5F1YA 2GWRA 4HQFA 5ITVA 1W35A 3T7JA 4FK8A 4EFNA 2JD0A 5JZVA 4AP9A 1MC8A 4B9AA 1I5OA 2I99A 3IJ5A 4Q48A 4R2LA 3DZHA 1LNQA 3K73O 4O59O 3IPLA 1ZIYA 4YDSA 4Q3NA 3ONDA 4GLFA 4C3ZA 3R9XB 1ZI9A 2BFBB 1V8PA 4NEGA 4AJIA 1MF7A 1S96A 2BGIA 3N8NA 1E4EA 1U7UA 2YNMD 2ZE6A 3O1LA 4JGGA 4LE1A 3WRYC 1F51E 3DBRA 3KOUA 1QM5A 1OGIA 2DFTA 2H4WA 4RQAA 4S24A 1W29A 4BX0A 2GJSA 3MD9A 4CEJA 4TLAA 1S6YA 1D03A 3B3QA 4L8FA 4W9NA 4FYKA 1C3EA 5FJIA 1RRKA 3WO0A 4NPHA 5CHYA 4OFBA 1KETA 4BO7A 2BEKA 1W4BA 4JR0A 4TS3A 4KAAA 1U4SA 2BTQB 1X86B 1BX0A 1W4LA 3N6XA 1YRHA 1J07A 3MT7A 4ECEA 4DDHA 4DSTA 4DR2B 4OD0A 1DRJA 4MQEA 1KDZA 1TYZA 3KXKA 4DZRA 1B0AA 1W1WA 4X8OA 2VRWA 1G55A 3T52A 4HQRA 2BR3A 4BO4A 1JG4A 2B8NA 2J3KA 3EGXA 1Y3DE 1KYYA 1YSCA 1TL7C 1ZJJA 2AEEA 3DBOB 3EVCA 5DYWA 3TSZA 3L1VA 4CQMA 4C7OB 4JASB 5IM4A 1EM8B 3UW1A 1FX1A 1KH2A 3AJ8A 3BGIA 1P6XA 4QPJC 1FFGA 2VAWA 4OQDA 2O2CA 2WUWE 1R0XA 3CX4A 3QX8A 3ZI0A 4ZGGA 4JBWA 3C8MA 4UE2A 1E8MA 1PUXA 2VDWA 4F8JA 4YV7A 2A9VA 3OCUA 2CKMA 4P5PA 4DUGA 5EZYF 2D5LA 2PH1A 3GEPA 2O8CB 1EUQA 2GKOA 3RABA 1K2VN 3ENZA 3U48A 4UULA 1QH9A 3CE9A 5B1SA 5C18A 3FTNA 1Z75A 3OQPA 3PX3A 4XRRA 2OK7A 2NYAA 2ZYDA 3V48A 4PWZA 3ZY4A 1PS0A 2ORIA 1U9YA 4UEWA 4AKIA 3JVUA 3GQBA 2R8BA 3WR5A 4ZIRA 4OA5A 2FMHA 1OW3B 2FFHA 2GD1O 1Y8RB 2DBRA 1JG2A 3I4FA 5B1HA 4HAYA 4YV0A 4FKMA 4V38A 2PUTA 3LT1A 1B0PA 2Q6OA 2QTVB 3B6JA 3JZFA 3SIRA 5A6SA 1D4OA 3ZDXB 1GZ7A 2EBHX 4HC4A 4KNVA 2R1VB 4MYSA 1K3TA 1WUJS 3HCEA 3HYTA 3QLVC 3RS7A 3IBTA 3LC0A 1DG9A 5M29A 5F2OA 1KYWA 1BCRA 1JS1X 1Y3AA 2QMUA 2XNKA 2ZJ7A 3BK7A 1PYGA 3DNPA 3DQQA 3OQIA 2DBQA 4M99A 1YRLA 2EGGA 2R8RA 2ZT8A 2DBZA 1FXSA 2C95A 3CEMA 2QG4A 3PNMA 2W2KA 5DP2A 4CF7A 4ABTA 5L45A 2IH5A 1MX3A 4LOJA 1P2FA 3EF0A 3K6JA 2FUNB 1J4AA 1YB7A 2R8ZA 1L3CA 4NCHA 1Y4AE 5CURA 4H2DA 1W5AA 1J5EB 3FPGA 2VJCA 2B78A 4I4TB 3SU8A 3QBTA 1EE9A 1ODSA 3W6PA 1YZKA 2GZ1A 5KYGA 3DF9A 4M8LA 3NM4A 3ZOZA 3AR2A 1YRYE 4EVIA 2Q3MA 1KDOA 2C3OA 3DS8A 3R3VA 4HGYA 3U6KA 1OYOA 4QRHA 3ZU4A 4DV4B 5D5PA 4BFZA 5CLJA 4RM2A 2P2YA 3HJTA 4DEXA 2FEAA 3D6VA 2QQ5A 1E2IA 1HG1A 2GZMA 5TV2A 1UC4B 1QE5A 1YB6A 3WMFA 3MILA 3ETLA 2AKEA 4MRVA 4ARVA 4LQDA 2IT1A 4QARA 4N3CA 4DBLC 3R3UA 4C0JA 2F1OA 3DVLA 3MSXA 3QU4A 4FYJA 4QBIA 4P2GA 1E1YA 1C8BA 2PNFA 4PYIA 5K3AA 3RASA 2V0CA 3U7QA 4D0LB 4EMTA 2RBEA 3GVXA 3WI7A 3VC1A 5AM3A 3N2GA 3OCZA 1GGMA 4JI0B 4BB0A 1X1RA 2CLLB 2X5OA 5K3OA 5IEJA 2CVQA 4GSLA 3C98A 4MKGA 2WLSA 4BKUA 5EUCA 5B1DA 3VFDA 3WGUA 2AB0A 3BS4A 3H5WA 5EXTA 5C9ZA 4GOKA 4NVRA 3ZXIA 1MXFA 2DBVO 2HA4A 1HUQA 2IPAB 1XN1A 4ZREA 3DVAA 1U99A 4WZBA 3ZQ6A 1V47A 1QVWA 2ZI4A 1FJ2A 1VG9B 2C9MA 1REQA 4I2VA 5CDGA 3HP4A 1IXKA 5AKZA 3L06A 3ROXA 4XA8A 2PUEA 2IHJA 3GJ8A 2NWQA 2JIDA 5EQTA 4PTYA 1SOMA 4X8LA 4TLDA 3QXSA 3MMNA 2CUTA 1J0EA 1QK4A 1KNXA 2GBCA 2Y0DA 4IX9A 4X1IA 5DBGA 3RTDA 2WAOA 3I34X 3V8VA 3WRYA 4L2IB 4YRGA 5C52B 3UGTA 1WX1A 4G4SP 4PRZA 2X2PA 2BBOA 5BRJA 1JDZA 3Q3IA 1H1LB 1I9GA 4WECA 5A9TA 5ABPA 2CV2A 3NDPA 1JAXA 2NXCA 4ZAVA 1KPGA 3ND6A 1TRHA 4H77A 3YASA 3DZKA 4AVYA 3K0FA 1G5PA 5CU7A 4W4TA 1DC7A 5E4JA 4O2AA 2R1TB 3KDAA 3OJWA 3IAEA 4IJ6A 4MVJA 4QUHA 4DHEA 4X0EA 1DAIA 2ES4A 5BXQC 2ISQA 4FCVA 3ZV3A 3G5TA 4FSDA 3ZY2A 2JAPA 4LRXA 3JATA 3JQCA 3WMGA 2CHUA 3HS3A 3HZZA 1GIAA 4NYJR 3H8JA 1YUBA 1AX9A 2JGJA 1JR3D 1HE4A 1XR3A 3GRFA 4H27A 4EY7A 3KBOA 1QO9A 3ESXA 3BFJA 3SAJA 3T5PA 2A84A 2C96A 3H9EO 2RH4A 4G25A 4E2WA 1U63A 3H4VA 1WD5A 2JI7A 2AT1A 4HDQB 4RLSA 1BFKA 4BLRA 1L5QA 1W6UA 1Z6AA 1I3KA 4C78A 3FVRA 5JCPA 3LX4A 4KXNA 5GJCA 1JGTA 2YHAA 4G65A 3Q7TA 4WY5A 4O4IA 3ZHSA 1O6CA 4JP2A 4K46A 4OGGA 4QHYA 2P9EA 4RM3A 2PX3A 3K31A 4B5KA 1V8ZA 4IZIA 1DKLA 1G3RA 1UH5A 4DBZA 3OUZA 1YZHA 3FVTA 4TXLA 2AH5A 2JIRA 1JQ5A 3K9CA 1QAQA 2VP4A 2RCYA 1HEIA 2D5AA 4CEHA 2RHLA 1L8LA 2BMEA 5CTJA 3RRFA 2WW8A 2IZ1A 3RTAA 2YBEA 4MMYB 2MTBA 4UUPA 4ZVLA 1OJ7A 2FRVA 2ZCVA 2J46A 1AB6A 1M6WA 4TL6A 3TKAA 5L3SA 2IY9A 2O2YA 4GMFA 5LKRA 3D3QA 2HSJA 4UZSA 2VS1A 2ID9A 4WOPA 1KSFX 2EGHA 3CXRA 2EWMA 3UBTA 5I3CA 5GVSA 3HJHA 4HDNA 4HWKA 5AVSA 5JH7B 1NLFA 4QGGA 3QLVA 4GGOA 2FE1A 2XNSA 3GVIA 3HRKA 4OJTA 4WKGA 5ALTA 4Z9XA 5BR1A 2WTMA 4YXFA 1Q84A 2PN1A 3NYRA 5CYPA 3K0AA 3NATA 4Z7QB 4L7VA 3RIMA 4G8DA 2G1UA 1H2FA 5FHRA 3TI9A 3UQYS 5BNIA 4AZ0B 5JXJA 1QRAA 1Y7IA 4QPPA 4RJLA 4RBNA 4DILA 4C6TB 2ATEA 1L5HA 1CRWG 2Q7OE 4UNSA 3D7MA 3S7TA 3A4NA 4DIUA 1DBWA 1SHKA 4U2CA 3GNSA 1H69A 3RTBA 2BFPA 1TIPA 4LG1A 4UTVA 2VXYA 2WZBA 3KYDA 5KVSA 2R84A 3VHQA 2GM4A 1KFKB 3RV4A 3TINA 1QHFA 1FFXB 4DTCA 5L3QB 1WCYA 2H18A 1XD2A 3KE9A 3UH1A 1UK7A 1SCQA 3PEFA 4QTXA 3BUSA 5JAHA 3FOZA 3W8RA 4IIYA 2PBFA 2GO7A 4N0PA 3LC2O 4FR2A 5I5GA 3WVNA 3OPYI 1VDZA 2M98A 1DADA 1P6UA 1PZNA 1S02A 3HLYA 4FDLA 4NJOA 4YECA 1FFWA 2LIPA 1PV2A 1RP7A 4KL8S 3GBPA 4CQMD 2HH9A 3DZFA 3I45A 3KJIA 3I8XA 1MX5A 3EGIA 3OQHA 4O4JB 2R11A 2XF8A 5DIZA 4FZ3A 3ECCA 1NLMA 4IQ0A 4YRJA 2QN2A 3QF4B 5JVDA 1CK4A 2ZWPA 4DUGD 4M37A 1SELA 5CGQB 5HGJA 3UO8B 2CZQA 1CQJB 2ZJYA 3H5NA 3VPDA 4V03A 4CPDA 2AK3A 4A91A 4LFBB 2D8AA 2RGNA 4KDFA 3AFNA 5B5SA 5JJCA 3TG2A 4FFOA 1XTPA 2C8VA 2PT7A 3BMCA 3H2HA 3R6TA 4XB6B 5DX1A 2JFWA 4LUCA 1AO3A 1MQ8B 1YDFA 2FZVA 4OBXA 2H7VA 4TL9A 5FEMA 1RIIA 3N2LA 4ID9A 4RXMA 3B3JA 1BW9A 1TI7A 5LZ8A 2IIBA 2NIPA 2FV8A 2ZBFA 4R1QA 2ZYIA 3EXHC 2EZ4A 1N4DA 3PE4A 4LRSB 4ZCLA 3WXBA 4Q1CA 4KIWA 4PO8A 1O5TA 2GD0A 3B9BA 2E18A 4LC1A 1EA5A 2V6FA 3AJEA 4Y0AA 3MTIA 4E6EA 2WILA 1DPGA 4JX8A 1FNNA 1Q1NA 2CXRA 2XB2A 1V5IA 4HYTA 4N76A 2W7TA 4JJFA 1ZY2A 4NBNA 3D31A 3LPMA 3U61B 3NV7A 1MW8X 3E5HA 4XKJA 3TVYA 4DQLA 5DXAA 3TSYA 5HJ5A 3I92A 3PPXA 4XJXA 1FU7A 1UODA 4LI0A 5EP2A 5CDFE 3A9TA 4G9BA 1GKLA 3LZ6A 2CC2A 3TIFA 1E4VA 1O0BA 4B4DA 1K88A 1Q11A 1T8RA 4OOEA 5C7LO 5ER9A 2H2GA 1UPFA 3OWHA 2C2HA 1C0LA 1ICIA 1ZCBA 2FWPA 3AIOA 5CLGA 5FI3A 1D2CA 3VPGA 5JS6A 1MTZA 1RWNA 2DY0A 4U2FA 4GX1A 1V1RB 3I9LA 4E03A 3WWEA 3OFSA 2R4QA 2WNSA 3EMVA 4PU0A 2VYNA 3TOXA 4NQZA 4ZCPA 3RFVA 2IIVA 4NJEB 1F8XA 4Q9DA 1QGDA 2G36A 4C3UA 4G67A 3HCPA 3EBOA 1L8AA 1RAGA 1A7UA 4J4TA 4TWIA 4J0FA 1H2AS 4GW3A 3IMCA 4BLOA 5A0VA 4IUYA 1NVMB 2DCUA 2OV4A 3MRTA 3PA8A 5J63A 3ZBPA 5IANA 3L0CA 3O8LA 4R69A 3EN0A 5CAEA 1T26A 4BNWA 3EWIA 3GK3A 3O0DA 1DC3A 4G01B 4U9UA 2B3TA 1NKTA 4XQ9A 3VBEA 2QJTA 2EFEB 1HURA 2X0RA 3NMUF 4Q12A 4OEHA 1KHTA 4DLAA 1BMDA 5EJEA 1P91A 4RGBA 4GVXA 3MWFA 4AS1A 4GLOA 4PLWA 3UAVA 2FZWA 1O0CA 1E4YA 1MHPA 3PD0A 4MIYA 2XYPA 4YT2A 5DWDA 4Z4HA 1U7DA 2AOXA 1E4OA 1T1EA 1UP4A 2WKRA 2YXNA 2KE5A 1FVHA 4C03A 1FSPA 3IH5A 2RONA 2I76A 5FWXA 5KNDA 5REQA 3VU9B 3P0IA 3PI7A 1LEHA 3K0BA 3A2NA 3SBDA 5GJVC 3STWA 2HCRA 5BN5A 4ZQBA 2LCQA 2GCIA 1E9EA 1GPNA 1ZQ9A 2WF9A 3NBAA 3IP5A 2FHSA 3U7HB 5HG0A 5I7OA 2OLEA 2V03A 4YAGA 1YWGO 1XZNA 3IAM6 4XGKA 2EYQA 1OB2A 4F3YA 3KEMA 3PEEA 4MVJD 3HJUA 5K0GA 5EGSA 1F6BA 4KR7A 4CRWB 3HXPA 3KQNA 3LUGA 4AJKA 5M04A 4IIDA 3I30X 1KO8A 1ZICA 3BWCA 3DXZA 3ORRA 4PE5B 3WFIA 621PA 5IHXA 4D56A 1RPTA 4O4LB 2ZUEA 1NVWQ 1AVTA 3AR3A 3EXFB 1YDHA 1Z2EA 3DHEA 8AT1A 1DCTA 4LE0A 4QOGA 2CXXA 4FMCF 5LOVB 5JW6A 1WP9A 4Y2RA 1BGWA 1KDRA 3BD9A 1FP1D 4KK3A 2ONKA 3Q0TA 2GVDC 2NSDA 4M76B 4FBGA 3HL4A 5I8PA 1WG8A 4ESEA 3LV8A 2WYIA 5EWJB 1WL8A 4REMA 6AT1A 4JWTA 5FB3A 2XBUA 3GPIA 4NSNA 1M1NB 2GDJA 4G1FA 1SFRA 4ODIA 3KHSA 1XDZA 3G5MA 1EEXB 1IJKA 3PR3A 3LNTA 3M4YA 4NE7A 1R8JA 4WLOA 3U4DA 5J4LA 3KOZA 1ZNXA 1TF7A 1B3BA 3X1KA 1JNXX 1TMOA 3H1PA 4EO7A 2DRIA 4RVUA 3QX3A 2PRSA 3LPAA 1FMCA 2XE7A 4EF6A 2WYHA 5M2QA 2C59A 2VDJA 3RUHA 1PS9A 4L4XA 1NBWB 1NTOA 5A7HA 4BTLA 4PAOA 5EHIA 1FDVA 1EMDA 3VR6H 2GK4A 1UBEA 3IEKA 5DTQA 4QLOA 3NO4A 4U6NA 5A1TA 9GPBA 1GUAA 3LFHA 4MW5A 3ZWOA 3EW9A 1BJKA 2UXCB 2AF3C 2HQSA 3OKCA 1N5LA 4L8YA 3D7SA 4GBJA 1JLSA 1EA7A 1EZ4A 1JXQA 1IULA 1HRKA 1ZI6A 2IOFK 2JAXA 4N5IX 2RGXA 5AW3A 2F8LA 4L57A 5JSZB 1GNQA 3WLLA 2YWGA 3WGOA 2J67A 4WZAB 1N6KA 4Y1EA 5AVRA 4IJKA 2QVYX 4RDIA 2CE2X 4B6GA 3CBQA 3PXCX 5EP4A 2OUKA 2GR9A 3HZRA 4HK4A 1AD2A 2D7CA 2HA7A 3ZHZA 2NADA 2VOJA 2JL1A 3I01A 3NBKA 1PGQA 3EUWA 4J2HA 1ZUNA 3DB1A 1A9PA 4DMLA 1X2BA 3ZCRA 1EVEA 3GVCA 1JFFB 2DJ5A 4OFXA 1FNMA 3NXSA 4TMZA 4H1WA 5KYVA 1XTUA 3EQ7A 4L4SA 5AIAA 3JVVA 1VSVA 2Q5OA 4X8MA 3T7SA 3WNBA 1RHMA 2X0NA 3D1JA 4X24A 5DTEA 2BEUA 2WRZA 3H4IA 3Q1LA 2C7VA 4UFOA 1Y6JA 5CVUA 4IJUA 1I5EA 1QCDA 2LTAA 1WZCA 4O4HB 4JYCA 2HN9A 2BWJA 4HF7A 1OBOA 4KE7A 5DB4A 1C81A 1WPRA 2JVJA 3PD1A 1G60A 2QD1A 1L7DA 2D4HA 1TK2A 4EFKA 2WSLA 1MVOA 3GD7A 4ZICA 3KPWA 2IJGX 2XNHA 1EM6A 5EJ9A 4ZI2A 2OMEA 4L5BA 1ENPA 4LY3A 3U3JA 2FR0A 4IIFA 1MDFA 4OHCA 3GOQA 4UXHA 5L6LB 1VHLA 3FPEA 1MABA 4KLNA 4K6CA 1K6XA 4RD6A 3IDQA 4S1PA 1AE1A 3DE2X 3P7MA 4Q1BA 2I87A 2NVWA 4Q47A 4EA9A 1ZC3A 5KOHA 1DNPA 1NZJA 2HHAA 1P5HA 1Z4MA 5B53A 1Z5UA 1U8ZA 3HBNA 2ANCA 5AHWA 4Y2GA 2X2OA 2ADMA 4XYMA 2QM3A 1L5FA 3HLTA 1EFKA 1NUUA 2OCDA 2IYXA 4FXPA 4LCEA 3GARA 5AW9A 2JFOA 3FFTA 3QY0A 2IV3A 4WERA 4UVIA 4YEDA 4OXRA 4FGJA 3TNDA 1JEQB 1CHNA 3CXUA 4IDEA 1QIIA 3I2KA 5AW6A 1OT5A 2WWHA 3SYMA 4YX9A 1S2GA 1M2FA 2ZSAA 2Q3HA 3MM4A 4YWJA 2M9MA 1QZUA 4ESOA 1OWPA 1QIEA 4XE5A 4C7XA 1U1IA 2MHCA 3DDCA 3GFOA 2PX6A 3HCAA 3Q7RA 3GDGA 3QE0A 2YFKA 4MCJA 4MPDA 4MVWA 1GHTA 5IZCA 3EPJA 1XOIA 1DX4A 1KBQA 1Z7BA 4LOKA 1GR1A 5E9JA 4AECA 5ES4B 5ALLA 4ZJUA 4P32A 5F1KA 3M1LA 1F2UB 1ZOPA 4OMFG 3TRHA 4CDMA 4OQMA 1YIDA 1QS0A 4HVAA 4KFRA 1TVKA 4MP8A 4WN9A 1EHIA 1SRQA 1JVSA 3SYRA 3UQZA 1RHUA 3A4VA 3NIGB 3V4ZA 3VHRA 4EVSA 1T9CA 1BAPA 3IDAA 1DHRA 3DWGA 2V4ZA 2VDLB 4GWGA 2BW0A 1TLLA 2WG2A 1RE0A 3C5WP 5K0FA 4HMOA 5EYPA 3DBLA 1ADCA 2XVMA 3WKAA 3T3MB 4TRMA 1Z38A 5F78A 3ROQA 3AI7A 3T5MA 5HF6A 2VYND 3JVEA 3LUFA 3EGOA 2FH5B 4HAOA 2HBQA 4W5JA 3O38A 2BZ0A 4AP6A 5KINB 1CUJA 4RKEA 5NULA 4ZCTA 2VSXA 3Q5EA 2P3SA 1GU1A 1PV4A 2Y4NA 1U0BB 3G2LA 2VHZA 2GUWA 1EUDA 2VAXA 3CLUD 3KVVA 3DHNA 3VX3A 3X3HA 2XRMA 1RCFA 1TEVA 3J81A 1S5PA 1NVVQ 4NBVA 1PQ4A 4OHZA 4Y2SA 2FLWA 1QHIA 1XHFA 3RVRA 3GAFA 4BMNA 1QNFA 1JEEA 1EXDA 1RNLA 3OEYA 5I45A 2A5LA 1EK6A 4C7BA 5EIBC 9ATCA 4F71A 2I6XA 5E6UA 2ATVA 3ZXSA 3TF5A 3AVPA 2PH5A 2REQA 3IRVA 3IBCA 1ZGHA 3PEWA 5G3ZA 1A88A 2WAMA 3WS7A 1U0OC 1RM5A 4BKOA 4BQSA 1MAUA 1FFCA 1ORVA 1E1DA 1PWHA 2BONA 2HGZA 5DI3A 5FI0B 5F1OA 2WE8A 3R7FA 3LT5A 1XZFA 1A5ZA 3T1VA 3V4FA 2YOHA 3EWSA 5KNDD 5LUAA 2NT4A 2M1ZA 3TEJA 2J07A 4HADA 4LGYA 4Q3BA 5IN4A 2ZI7A 3O7WA 2C7RA 3DLHA 2Z08A 4BVKA 3KKOA 2A14A 4QGHA 3B2QA 1J70A 1J0XO 1DEXA 1N2CE 1QCCA 4QUKA 3UKOA 2ZATA 4WEQA 2ZUTA 1KVTA 4EGSA 4R9SA 2Z9BA 5I7EA 4MP3A 1X3SA 5J4KA 1WDTA 2AN3A 3ZI4A 5CBPA 4ZO8A 4BNXA 4KK4A 1V96A 4NAUA 2GTHA 4FCCA 1D7OA 1RWWA 2XZTA 3HR8A 4E5DA 2QL5A 3L7MA 2AG8A 2BR4A 1N2EA 3CZ9A 1XDSA 3OF3A 1XTVA 4L3VA 5JJKA 1E18A 3BXOA 1P9NA 2PD6A 4Z51A 3GUVA 3RWBA 1F2DA 2W70A 1CZUA 2PS3A 2IP4A 2Y1DA 3W4JA 4XGIA 3WAKA 5IVPA 1T13A 1D6SA 5EEHA 3GLGB 1SG9A 2A0KA 1Q0PA 1YUMA 4AB1A 2ABWA 1P31A 1H0HA 4F3NA 5BSRA 4NZZA 5IAAA 1G5RA 3FUWA 4MKZA 4Z54A 4DY4A 5MHTA 2FGKA 2I3GA 3F4LA 3GIWA 3TR5A 3V2HA 4ARZA 5SZHB 4IO0A 4QODA 3IA7A 1IOZA 3ENKA 5EIWA 4XVRA 2BAGA 4PG6A 3HN6A 1IUNA 3MTAA 4WNCA 1PD1A 5EZYA 4PNEA 1ZSVA 3JARB 3Q6MA 4XX1A 3GFRA 2O0LA 3W2HA 1LXCA 3THYA 4O5OA 2JJQA 3PEVA 4NL4H 2C8KA 1Z37A 1W8IA 2FPPB 3EE6A 3K5HA 3MWLA 5LKAA 3RUCA 2EDCA 3OJCA 3UM9A 4E14A 2YKGA 5ADHA 1E60A 1WO8A 3GP3A 4TTSA 1MTOA 5I8WA 1RXCA 3PXGA 2ZSIA 1EWTA 1ZVJA 1C9YA 2J8ZA 3QKWA 1J6UA 3DMRA 4XWGA 1UM9B 3KR0A 1QBGA 3RHTA 2A7XA 1GTZA 4OPMA 1G42A 6REQB 1NY5A 3GQVA 2JGDB 3PGA1 1PKXA 4HQ0A 1KJ9A 5MGBA 3FY4A 1TDJA 1Y6FA 2E5FA 5CM2Z 3DFFA 1GTJ1 4IEFB 3RGWS 3EX7C 4KFSA 1FE8A 2V3CC 2WNIA 3U3XA 5C4MA 2NGRA 3W05A 1XRSB 1KIFA 4PHFA 2GYYA 3CONA 3DOJA 1BZYA 1V2HE 3HO6A 4LY0A 3I5XA 1Z08A 2IYRA 4HCJA 2X14A 1C0PA 1ZGZA 4HVTA 2DPLA 3NOXA 4LZLA 5JZBA 1FSSA 1NRXA 2I34A 4UUNA 4KPFC 3P2JA 1YFJA 4Q9KA 3U17A 2NV6A 4HBGA 1EZZA 3RU2A 4CIAA 2V6MA 5JWRA 2XBMA 1XNHA 2YWDA 1DEHA 5BNTA 1CE8A 2WHYA 3BORA 4LHXA 5JPCA 1U9IC 2BMVA 1GEGA 2XGSA 3O3NB 1M2JA 1Y9DA 2GZ3A 2JCSA 3IE0A 4M7WA 4PZEA 4RPCA 2ZYHA 1U1GA 3KSAC 5JJIA 3IO3A 4RKWA 5GONB 1T1IA 3HCWA 5I48A 1GSHA 2FEMA 2FPLA 1P74A 3GRRA 4EW1A 4F93B 4DRYA 1JR4A 4O2RA 4DA7A 4P35A 2IE0A 1S0UA 3A14A 1XMQB 1Q7RA 1IVYA 2XV1A 1I2MA 5B57C 1SIUA 3ZTYA 3H65A 4XEHA 5EE1A 3L05A 3GB9A 1IIBA 4RAOA 5SY6A 1Q17A 2HADA 2W42A 4YN3A 2VF2A 3D3NA 1YC5A 1ECFA 2JDIA 3AW8A 3DB2A 2EKQA 4HDMB 5LQJA 3I32A 4XTCS 2ZZMA 1Q20A 3C85A 1JBQA 3CVOA 2EX4A 1KMNA 4L0MA 2I71A 2M6RA 1DS6A 1K7XB 1K7YA 1RLJA 2CUZA 2JIQA 4NMHA 5E2IA 1IONA 3U0BA 1OVGA 1URPA 4FMBB 5AKEA 1S8FA 5K3FA 3WMXA 4KIGA 3AZPA 4YRQA 4QNNA 4QULA 3ZPXA 3IODA 2R6FA 4MB6A 3G2IA 4MCIA 4BV9A 1DWQA 4V1CB 1G6HA 2HF8A 4IWXA 3ZZTA 2VTBA 1DO0A 3A3PA 1SOUA 1ZZEA 3KU4A 3V9AA 1OH5A 2EATA 3UTCA 2Y68A 4FS8A 4EYSA 2E5LB 2ZVPX 1ZUIA 1YOVB 3HRIA 3M6FA 3OP4A 3LCCA 5LQUA 1GUFA 1BXZA 2L42A 3V97A 1OH8A 2H8GA 1II8B 5ITSA 3ZEAA 5F7ZA 1SUEA 2M6KA 5FLKA 1KJ8A 3MT8A 5E0KB 3F98A 3S2SA 1D3AA 1GJRA 4UAVA 4RA9B 4RZSA 5GGYA 2Q29A 1CC1S 1RAIA 3PUYA 2OCGA 3UWDA 1BVHA 3F6RA 1LBSA 4CBVA 1SU7A 1S8OA 2YASA 2GB4A 1UC8A 3FCSB 3R0QA 4TV9B 5T67A 3ZLVA 2OQVA 3KJGA 3NBYC 4D3FA 1JYEA 3TD9A 1RJGA 4EG7A 1J8FA 4DNQA 3KQMA 1Y6GA 1E9FA 5FBRB 2QROA 2Q6KA 4LHWA 2JARA 4Q4HA 2YJ6A 4G1VA 1YR8A 2CLEB 2QX6A 5FI1B 4GWKA 3UVEA 3SJAA 3MA0A 3IP1A 3F2VA 3SYLA 2PMDA 3V55A 2ATXA 3OKPA 2JH3A 3GYBA 3RRJA 4W9MC 4A6EA 4B85A 4ARBA 3OOYA 1Y9AA 5H4HA 2BVNA 1L4FA 3WGKA 3ZXYA 4BZPA 4CMAA 3PTAA 3EPKA 3A4TA 2AKAB 1LFDB 3BF8A 2L69A 1YJBA 4QXPA 2AI2A 5HE9A 4N03A 2XVZA 2PZBA 3TSOA 3K9FC 3DSRA 1GYRA 4B3MB 3ODGA 2Z2ZA 2Z8ZA 3WTBA 3B85A 2XTAA 4BEWA 3D6HA 1H0SA 3VI3B 4Z7NB 2AZ4A 1W25A 1TCBA 2H85A 3M9LA 4GYJA 5G0UA 4GX0A 5AUOB 3FCCA 3TDKA 4NU5A 5COQA 4GICA 1JDTA 3IFSA 2HJGA 3DO6A 3L8MA 4WOBA 5JNVA 3G9XA 3QVJA 4XGQA 1BA2A 1U1EA 2P1ZA 4P36A 1H6AA 4M0UA 5DZSA 3A3YA 2HIMA 2G3YA 4F72A 1YDMA 1X38A 3TS1A 4JELA 3SHVA 2R5WA 3ETDA 4G8CA 1FTNA 4Y1GA 1GPKA 1SCJA 1UFRA 4Y7DA 5AKGA 4FCTA 3SQOA 3R5XA 3I04A 1IU9A 2ZUFA 1Y5RA 4BFWA 3N58A 1OLXA 1LJUA 3HJRA 3CHYA 1J06A 1PJZA 2D13A 3JR7A 2WFZA 2H54A 2Q4OA 4LV8B 2ZPAA 2YHBA 3A6DA 1SXJA 4BVGA 3IX7A 2XCRB 2YDYA 3TR0A 3RKSA 3FPSA 1Z5WA 4U7TB 3N2YA 3H1TA 4IM7A 2X3UA 3TZEA 4P1ZA 5LQCA 3WHLA 1KQOA 4JLDA 1W2WB 2IL1A 3ORQA 4MQUA 1XV5A 1CT9A 2XI4A 4FNGA 4MDHA 3W9YA 1XTKA 2G1PA 1HG0A 2UXBB 1TUGA 1XQVA 1NW4A 2QYSA 5CG1A 1P2SA 2WWRA 3L01A 4KREA 3O75A 2OFFA 2ZPTX 4D9NA 3DBVO 2H1OA 1EFDN 3QYPA 4OM8A 5D1HA 1M2VA 2HWUA 3T5GA 5TNXA 3V4LA 1A71A 3B1JA 1GM5A 1FXUA 3P5BA 1LLCA 3S4YA 1N9KA 5EOVA 5LDDC 4KFCA 5AXAA 2YZNA 2A9JA 4GQIA 3ZOKA 1N8NA 3CNBA 1XB2A 221PA 1FNDA 3DJFA 3CKYA 3LUAA 4BFUA 3PRJA 2HCFA 2HLDA 3UAGA 1NP3A 3LDAA 4V0RA 5DMHA 2J32A 3AL3A 4M49A 2WD9A 2R00C 5A4FS 2VWHA 4Z6KA 5H8WA 2I3ZA 1JHPA 4X63A 2JGFA 4JU8A 5IAGA 3BWMA 4D8WA 4F21A 1O03A 1RWMA 2VZ8A 3U26A 4ZK2A 1U2RA 1ZG3A 2GXUA 4ND3A 4UKDA 1IL0A 1TUEA 2OAP1 3T9AA 4BE9A 1YVUA 4C6HA 5HRAA 3THWA 3AB3A 2P78A 1QYVA 4NFYA 2K4MA 1G21A 1SM4A 3OIVA 2OAEA 3GA0A 4FP9A 2I7TA 3KSUA 4O63O 5LLTA 4F12A 1Q1ZA 1QSGA 2OHHA 3A2LA 4PV7A 1F1JA 3GT7A 4IXNA 4M1MA 4PYKA 1T2AA 2C98A 3IQWA 4HN4B 2BBSA 3R5HA 3P96A 1S1MA 3R7WA 4DSZA 2GLXA 3N7TA 3VZSA 4KQXA 5C2JB 2G83A 4CG0A 5AKHA 4RVSA 3UJDA 1T25A 3B5EA 1E63A 4R51A 2XADA 1QMGA 3AKCA 3KIPA 1UDXA 1SIBE 4DXAA 4EG1A 3WADA 4MQLA 2XCQA 1CEQA 1F2VA 1KWGA 1RZUA 1Q3TA 2WV9A 5EIXA 4JT8A 4L5JA 1ZCFA 2PYDA 4RK0A 3ZD6A 1IEXA 1D1PA 1Q2XA 1JHYA 5FWAA 4DWJA 16PKA 3C24A 3SQLA 1SA0A 5LPNA 4FPXA 3TZLA 5BSFA 1HO3A 1CS0A 5KSZA 3MGBA 1KPHA 3IMFA 3PXDA 1SC4A 4YP1A 2EHJA 1EFLA 1TK9A 1YH3A 4RVCA 4EKNB 1XP5A 1UJ4A 3A27A 1ZD1A 1Q0TA 2I5PO 3AYXB 3SSAA 1EX7A 3E27A 2AUNA 1YU9A 4LKRA 3T3DA 3VH3A 2R7AA 1TQ6A 1RQPA 2ZBRA 2E4VA 1XROA 1UBRS 3O91A 3BRWA 4QOIA 5AOBA 4RD0A 5KSOA 9LDBA 5DE3A 5EHNA 1CY6A 3FFWA 5EP3A 3RHSA 1R8XA 2PZ8A 1G6Q1 1KYIA 3AIKA 3ETEA 3TN7A 2IUFA 2JDID 4M54A 3UCXA 2G40A 3GEBA 2ZR8A 1E69A 1EDOA 5FQOA 1N25A 1UWVA 3BMOA 3A1EA 3IO5A 4I55F 3ZHBA 3RC3A 4F04A 1RADA 4GR5A 6LDHA 2OKGA 3GJ3A 4HWRA 4NECA 2ZXEA 4XUEA 2F48A 3GPDG 3I6MA 3IQEA 1QP8A 3QQPA 3RIYA 2XZLA 4OIMA 4PYJA 5ERYA 1FFEA 1Z2PX 1E77A 2GPYA 2CL0X 2FZLA 4B7ZA 2PWAA 3PYMA 1AB5A 1LJ8A 3KELA 1X13A 4JODA 5F76A 5KVAA 4P4TA 3E82A 2Q49A 4LHSA 1M8GA 1K9SA 4X8HA 1UPTA 2OP0A 3J7TA 2RK6A 4V3CA 4DJEC 3O8QA 4LBVA 3CIFA 3IEPA 3FUTA 2XPCA 4Y7CA 1A50B 4RPHA 4D0NA 4GI7A 2C9YA 1DQNA 3AH8A 3D2BA 3ZJVA 1QF6A 3PB3A 4R2XA 2F59A 3ZE6A 4OLFA 4YUVA 3RH0A 1MHTA 2A1UA 1OZ0A 1YZNA 2VHEA 3HB1A 3BRSA 2DWCA 3IUNA 1R8SA 4E08A 1I3LA 3G7SA 1BCSB 3EMBA 3SLGA 5HS6A 2OHIA 4RA6B 4EB0A 3EC1A 3LK6A 3I58A 3QNMA 4YT5A 2WG0A 2HZBA 3CS3A 5EUQB 3ZGZA 3D5QA 1PJ8A 1Z5ZA 4CV3A 2R8XA 1ADJA 3O9VA 4I1RA 5H3LA 1GTSA 1M1YA 3INNA 3KBBA 5K4HA 1QQAA 2UV8A 3HWX1 1N2GA 3LL7A 3VDQA 5AYVA 3HJCA 1Z5PA 3ZWXA 1R0KA 2YYZA 3UJ9A 4ZYXA 2H07A 4UEOA 4EB8A 1CQIA 5FA6A 5AVWA 2YZMA 4GI2A 1DC4A 1ZINA 5LBIA 2VCHA 5AVTA 1C4XA 1TRKA 1V8DA 4JA0A 4OBBA 2PGIA 3TEMA 4XDHA 4BBPA 1YVEI 3DJYA 3KVNA 1RHKA 4MVJP 5J59A 1JG3A 1EFAA 1COWA 2WP0A 2I62A 3DBHA 2BGNA 2WZDA 1CRLA 3BBPA 4UBNA 3V7FA 5DP1A 5A0TA 1DZIA 2FWIA 2PRKA 2QMEA 1KZYC 2WUDA 3AESA 4G81A 1GEEA 4QHSA 5A2QA 1PSWA 5IC5A 2OQ2A 2ZJAA 4X00A 3RBXA 2H7YA 3NYWA 5CX1A 4IPTA 4NV3A 4FWTA 2I8CA 2W2NA 1EAMA 1TJ5A 4EY6A 2QBYB 3TRIA 1N6OA 2QN9A 2NACA 2PU7A 1EU1A 1NHGA 4D3DA 6Q21A 5HUQA 4PG8A 2I66A 1TGVA 2WT8A 3SFTA 2Z6UA 3AEYA 3CGWA 3ANMA 4L9WA 4MHTA 3UV6A 1WR8A 4FJ2A 1NBMA 2EFYA 1Z7WA 3NB0A 2QTHA 3SQMA 2NUAA 1GTRA 5DRYA 1DDIA 2C54A 3E0XA 4WINA 2QLNA 2CD7A 3SI7A 3BPSA 1OXTA 1SXJD 3ICQB 4HNAB 4CM6A 4MUIA 1T6BY 3ZK7A 2X5NA 3GRUA 4ND8B 4EL5A 2F8TA 5AKLA 4NLLA 3NUZA 1B6GA 1WF6A 1Y81A 3DZ8A 2EKBA 3MINA 4JEMA 4OQ4A 3BXXA 5ALMA 1O77A 1H0KA 3BXEA 3WWPA 2QUZA 1CP2A 3NPMA 4AN0A 1HF3A 1NNSA 4IJ5A 1GU7A 4ERNA 3IMGA 3KSZO 3K3PA 3UEOA 2HYIC 2OCIA 4XD2A 1IRIA 1JMKC 2H48A 2I6QA 2H2DA 4XIYA 3W77A 4DIEA 3O0TA 2ZIXB 3VGJA 1ZBDA 1UXJA 2B5VA 3CVJA 1BEEA 4M6WA 4O25A 3VPXA 4BVFA 2ID4A 1RLTA 3L7DA 2VL7A 1L1FA 3QUSA 4AY5A 4TWJA 2PUFA 2E3JA 4GC5A 2A0WA 5KJ6A 5J2TA 2VPXA 1UT6A 5LQDA 4Y2PA 2DCMA 2ZSKA 1AKRA 3PZBA 4GX2A 2VBFA 3PF8A 4CFYA 1HNZB 1X9GA 4G5HA 3GCWA 2IUEA 2EZUA 1G8MA 4X5OA 4QLAA 1B1CA 4O2BF 4KO4S 1VE6A 1KJQA 2B35A 5IN5A 2ZRHA 3HVUA 2A1IA 3DEKA 3R3XA 1GQ2A 5DYNA 1VC2A 2DB3A 1TD1A 1E3JA 1SBIA 1UDRA 3QEAZ 4GNKA 4E2ZA 4HRVA 4DKJA 3FN4A 4H60A 1J7JA 1NF3A 4GL2A 3G8YA 1GYQA 1Z16A 3D2CA 3MXTA 4LX0A 4QATA 5FBZA 1KERA 4URZR 5IYZF 3TMAA 1PJTA 1NVDA 1N2CB 3N1UA 4ZEOA 3RYFB 2FVXA 1UKBA 2H5JA 3I6QA 4DIKA 1Z15A 4M55A 1OYWA 2AI1A 2IHKA 3DEHA 3L2OB 4F38A 4F3KA 5JBNA 3TL3A 3NC0C 1F6DA 1ZD8A 3LBNA 4ZYUA 3FCEA 4KUGA 4MVYA 2XA2A 4TLEA 2CFOA 5DYIA 4F6RB 3A6ZA 4U2KA 5CFZA 4PXAA 1Z62A 3IE2A 2FXIA 1AF7A 1ZMBA 4MR7A 4I0WB 4RFVA 4RKRA 2HPHA 5FTNA 2K5UA 4MK4A 1T5LA 3DAHA 2VDOB 3M34A 4YGXB 4M7OA 1CUBA 2NU9B 2A1TS 1GFZA 3UUFA 4CM3A 4DLSA 5BMOA 5CFOA 4G0VA 3U4QA 1QC5B 1V7CA 2ORED 1EDEA 4FOTA 5G0WA 2JNWA 4I3GA 2X8WA 3ZDQA 1PL7A 4EGFA 5LWHA 1VCOA 3MS2A 1SBZA 4FI3C 4S2EA 1ISFA 5SZIA 5A62A 1IK6A 4A0GA 5K0EA 1V45E 3E58A 5JDIC 4Q34A 1E59A 4ZT4A 1OKKA 1XX6A 2ZS9A 3Q6IA 4TZ0A 3AEZA 3ME5A 3C8ZA 4NZYA 1NW8A 4RMIA 5FRDA 1OI3A 3JWIA 3PC8C 4K9NA 4UAJA 4ZI7F 1JDBC 4A8JC 3B51X 1V5WA 2O2HA 5AO9A 4ZAZA 1YZ3A 4TUYF 1S9HA 4HI0E 3RKUA 1NE7A 2ZJBA 3DXYA 5BV1A 3GX1A 5CJ2A 4QKQA 1P1HA 3ESCA 3U4HA 1O58A 2AVNA 1ESMA 4R8SA 3MJFA 1YE8A 2IXFA 5CT8A 1NWCA 1U11A 3BRWD 4HDKA 3O3OB 2FSGA 3K5WA 1VSTA 2ZJOA 4WXPA 4U9HS 1W85A 2E4ZA 3C6KA 1FZQA 1DKMA 1NTRA 2PL9A 4PQFA 2DZDA 1V3VA 4PLZA 4G0YA 3CRNA 4G0OA 1TF2A 4LWQA 1BDHA 4LF6B 5E7JA 1A96A 2QTGA 2NO9A 3DF7A 2AHOA 1CG6A 4Z8XA 3LT4A 4IVQA 1HE2A 2Q4TA 2C5EA 3ETNA 3C16C 4PGMA 3FPBA 2JLRA 4BGIA 1L0BA 2FCAA 1IEWA 3MW8A 2I9PA 4PM4A 4AYTA 3GLIB 5JXGA 2FNAA 1IHOA 2BHSA 4H59A 5C5CA 2C78A 3SKYA 1SCUB 5HZKA 1AGYA 1ZHFA 1E3WA 2OZEA 1ISSA 1L9KA 1X19A 3C6ZA 4OXQA 1OFTA 1GZ5A 2JI6A 4HTFA 2YV3A 1JW9B 3CNNA 5HTOA 5A6VA 3KJHA 4GPAA 4TWAA 1OU4A 2ISCA 3LCRA 3TM4A 3O21A 1ZJ4A 1LKZA 3K6KA 2J3QA 1QXSA 5DIFA 3W8DA 3GT4A 1PJ2A 1KXZA 5K2MA 1J24A 4CT4B 4D3ZA 3EQ6A 4HZUA 3ABQB 1R4AA 3MCTA 2A6PA 3AMVA 4L0CA 1VIDA 4TWRA 4FE7A 1NUQA 3UMRA 4CETA 2TS1A 1J1UA 4XPIA 2BGJA 3DYBA 4F3TA 1YGYA 3RVOA 4BQEA 1U3VA 3G2QA 2CEKA 2AEJA 3L0SA 3A3KA 2RG7A 3H3XA 1C3OA 1POWA 3VJLA 1Y8QA 1WVMA 4D8XA 4O1IA 4G5OA 3ZC3A 5ILQA 3UF0A 1KO5A 2Y76A 3R5JA 2O3UA 5HS4A 1V5EA 3HUDA 3SQWA 2IRWA 4IHJB 3U81A 4ZHSA 1NU8A 4MIKA 3CIOA 1S7GA 1T0UA 3EZ9A 3FDJA 5LWQA 1YQTA 1ZC4A 2YXEA 1GTG1 3FSRA 4KPUB 2OE2A 5ALOA 1CDDA 2WU0A 3JV7A 4ZXFA 3U9SA 3CF0A 2YWHA 4US2R 2P8JA 1JHRA 1QWOA 4U2EA 3BWEA 3E22A 2KMLA 3GUUA 1COWD 2RKBA 3H7AA 1W47A 3UHJA 4ZO7A 3KEGA 3H84A 2OV3A 1PZEA 3ZZUA 1NMZA 4YYEA 1R0RE 3MGAA 3TZQA 2X22A 4NY1A 3MOSA 2WWWA 3KVRA 1DUIA 1R6TA 1O96B 2D62A 2TMKA 4AUMA 2RIRA 1KY2A 2VH5R 3EASA 1KPIA 5DSTA 3ZLTA 3R7SA 4OHFA 5CP8A 1W8DA 5BRNA 8LDHA 4KJXA 1A1VA 1MIOB 4L4ZA 2N1BA 1I32A 4GDMA 3RARA 1U90A 1AMOA 3OT1B 2ZXUA 2HJ9A 4B32A 1FX0A 3OHSX 3JTMA 4EHLA 4I1PA 4DCPA 2YINC 1P2UA 1R6UA 1NBMD 3FZEA 4JVOA 4P34A 5TPWA 4CV0A 2L19A 2B94A 4U3JB 1ZM7A 3NDBB 2EW2A 1ADYA 2PUDA 1RJWA 4G86A 4MARA 4RLHA 4L1KA 4KQ1A 3AUAA 4ZC1A 5HMMA 2WWIA 4JQSA 2IBTA 1VLVA 2QI9C 1B8NA 2ZI9A 3B12A 1YDWA 1SPXA 2R1ZA 2RGDA 3ET4A 3KYCA 3DV9A 3ZXXA 2F55A 1N7JA 3ADOA 1ZH2A 3HJAA 5C7OO 3F8TA 3ETGA 3OLXA 4MS4A 3FGNA 3SF8B 3WDLA 1I13A 4W7HA 3JW8A 3SZ3A 3FG9A 4G5YA 4V0ME 4WE3A 5H9WA 3AEQA 4XFDA 1JIJA 4YAEA 3HO8A 3CFYA 3MWGA 1NW9B 2O8BA 4LYFA 4Q9LA 3Q1KA 4PIVA 4E7OA 1JEJA 1RWPA 5CD9A 2HXSA 1OROA 3E0QA 5C8VA 5KWEA 3PLNA 1LD3A 3HBMA 3FHLA 1Z0ZA 2D6FA 4EVRA 3WBJA 4TN1A 4FBLA 2R6ZA 4TMFA 1I36A 4DMGA 5E8RA 1QTIA 3ONEA 1NMSA 1P7PA 2ZP1A 5G1OA 3ROZA 3SF0A 1W5SA 5GZ6A 4I4TF 5HCUA 4Q9NA 1TGYA 4DV2B 2E7ZA 2PK3A 4GECA 5BWCA 3T3NA 3W5AA 4KMOA 1WMDA 2WP8J 5K0SA 1IZ8A 3ZWBA 3OZFA 4KPEC 3N2KB 5JJ5A 2X1LA 2ZUBA 1FSZA 1RVDA 1EINA 2R6JA 3IUYA 1PR1A 1BS1A 2O8DB 1H2BA 3NBFA 5LQRA 3OX1A 2FMUA 5FQNA 4AJHA 4AZTA 2GHQA 4JBXA 1PF7E 4JV5B 2ROQA 2OCLA 4AICA 2P3QA 4G5GA 2FR1A 4L78A 2UYQA 3I3SR 1L5SA 3PK0A 5KJCA 1JSCA 4BB9A 1Q19A 4LKOA 1SRRA 4JYPA 4BLQA 4LGCA 2VH1A 2R65A 3UENA 3UH0A 4BO0A 1PQPA 1UMKA 1EK2A 4BWYA 2B8WA 2EG5A 2EF0A 4KXVA 3D59A 3TXYA 3VR5H 1G8YA 5H7XA 2C2XA 2V59A 5F3RA 3KAJA 3LX8A 1FP2A 5AHKA 4QUGA 4KFTA 2ZWMA 1TYCA 4LC0A 1H1DA 4IEEA 4UM9D 3JYOA 4GU5A 2Q4DA 1CR2A 5AJXA 1KJJA 3C1UA 1NULA 1PFQA 2XTZA 1N6HA 2V65A 1S3FA 4G1MB 1BDMA 3QELA 2YIVX 2DQSA 3ANSA 1KY4A 2CEAA 3PUZA 3ZVNA 1K5GA 1KQ3A 4EOGA 3RNLA 5CEJA 2XXBA 5KTYA 1EGMB 5CA1A 5KX5B 5DNYB 2V5AA 3BB3A 2EWWA 3GFPA 4PC3A 2MSDB 5IG2A 1KJWA 3V1NA 1OKKD 5KYUA 4IFTA 4H16A 3PNBA 4YP5A 3JWHA 3CWQA 1NMEA 3AHFA 3QVLA 5EKXA 5EJ5A 3T0IA 5LZ7A 3THSA 5G0VA 1SBQA 3OHPA 3PQ6A 1HZZC 3ILHA 2Q2WA 2DC1A 1EFCA 3ORSA 2DERA 2GS9A 4QUAA 2OLKA 1P4JA 4KQ9A 2N47A 2VOEA 1K2WA 4WZ6A 2AN1A 1V1MA 2C2WA 4CV2A 2M32A 3HO1A 1D5WA 3QU2A 2BTEA 1ZR2A 2OO5A 1ZOIA 2RAFA 2C29D 5ALPA 2ACEA 3KWFA 3FMFA 2I7XA 4WKPA 2H29A 4IDHA 3WL4A 2FG5A 2HV8A 5DN6A 4HZGA 4CQNA 3NKFA 1TO1E 4U00A 3SICE 1E58A 5CH5A 4KACA 3KFVA 2G88A 2J7PA 1W59A 4Q4AB 4OQYA 2X4DA 4AMYA 2QLLA 5MN6A 1N2HA 4XVQA 5G0TA 1COZA 4INJA 5DX8A 4PQRA 5HK9A 4KVFA 3BFXA 1H94A 3BE4A 2ZYTX 1P3DA 5HRCA 1PR9A 4MI6A 3H18A 4ROSA 4UZFA 1Q83A 1KI9A 1H3EA 1DINA 1RC1A 4FN4A 5T3YA 3IMEA 1VFPA 3D4PA 2GA8A 1JQDA 4DA6A 2ZIVB 1J8YF 2I2FA 4RPIA 2HIHA 2VHVA 5TF0A 1J0DA 2BM9A 3GEIA 1BRTA 3GH1A 5EZYB 2B92A 4LY6A 2BMDA 4IDQA 3W9BA 1VJ5A 2OZKA 5E4FA 1WS6A 1TFRA 1ZH4A 1ZZGA 4JVNA 3RYIB 1ES9A 3SVTA 3C5HA 3JXEA 4E5KA 4NS4A 4EPTA 4AF7A 4I1VA 3ORHA 5C80A 1PUIA 1Y33E 1MT3A 2WF5A 3BKWA 2E6UX 1WHSA 3SEZA 3ZD8A 3QE2A 1EYZA 2DR3A 1N57A 1M2EA 2P7HA 3LUHA 4ALIA 3ORFA