4V38A

Apo-structure of alpha2,3-sialyltransferase variant 1 from pasteurella dagmatis
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
388
structure length
388
Chain Sequence
b'SKTITIYLDHASLPTLNQLMHFTKESEDKETARIFGFSRFKLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTMEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALYLTRANSFERASE
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
molecule tags Transferase
total genus 132
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v38A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v38A01
2EX0A 4V2UA 2C83A 2EX1A 2II6A 2ILVA 4V38A 4R9VA 2IY8A 3S44A 2Z4TA 2IY7A 4R84A 4V39A 2C84A 2ZWIA 4V3CA 4R83A 2IHJA 2IHKA 2IHZA 2IIQA 4V3BA 2IIBA
chains in the Genus database with same CATH superfamily
4GC9A 4TRMA 2FQXA 1RFGE 3EF0A 4FKBA 4HBGA 4BP1A 4Z4CA 2ZJYA 2GCOA 3PNMA 2BUAA 3OLXA 2JB9A 1XPOA 7REQA 5JAPA 3DMGA 1GPLA 2F1HA 1KNQA 1QIMA 3G2NA 3ZUGA 5ALUA 3WQSB 1Y1KE 1L4BA 4B3TB 4TMZA 1ILEA 5CVCA 4BCCA 2F9MA 2REBA 5JC8A 4HD8A 3MSXA 2G9RA 3FTNA 4XX0A 4PN7A 1WU8A 1BDIA 1K8QA 2D2IA 2JFHA 2P40A 2QZ4A 3IAEA 4G37A 1RI1A 3U7FB 4DG8A 4JYBA 4K8RB 1R66A 3UW1A 1HPLA 3WGGA 3L9WA 3VA7A 4H0NA 1MB2A 1ZOLA 2JBHA 1I4LD 2IHZA 3QUQA 4R1UA 4AL4A 1LEHA 4OYYA 4DQLA 1CR1A 1W85B 3K16A 5DISB 3VHLB 2X14A 1CWUA 1TPYA 1JDSA 4MQMA 3P9CA 3RVOA 3L4JA 4HN2A 1K5GA 4PBRA 5JPIA 2XUIA 2YOFA 1K6MA 1T5SA 3VYUB 2XMDA 2FY8A 4LUCA 3TQQA 1A0OA 3LBFA 1J06A 1ENZA 3VR5D 5E6RB 2UZ4A 4FBGA 2A9QA 4CKBA 3M82A 3QKUA 4HS4A 4CKWB 2H2AA 5B3LA 2BGGA 1ZH2A 2H4JA 3UXMA 4EG4A 1G4AE 5CD1A 3A4VA 1A9RA 4FINA 5F5NA 4GQAA 3P2EA 2GUGA 3T52A 5JISA 1MRZA 1CDDA 4F1WA 3FGPA 1V4BA 4JT9A 2RCYA 4BQRA 4X63A 1NUAA 3DKIA 1BJTA 3FZQA 3EXAA 3ZJYA 2R9VA 4PX9A 1WP4A 3AY3A 3RVRA 2FZLA 1YR3A 4IQFA 2AG1A 3DEHA 3OCXA 4JFAA 4E3WA 3S4YA 4H2DA 2IHUA 4B4OA 4B4DA 4CF4A 3A6DA 9GPBA 5B7NA 3PHLA 4DR2B 3OZ7A 4YI3A 2Y0CA 4NH0A 3FUTA 1EJ2A 1QLWA 1DEOA 4BX0A 4YV0A 4L6AA 1IN5A 3W04A 4TKVA 2Y2UA 2CVPA 3AF6A 1AUVA 2W48A 3QJYA 1D4AA 3G68A 2D5CA 5AK6A 1NNSA 3ROPA 4EG6A 2H4HA 3FE2A 2VYVA 3LUKA 3DF9A 3PRYA 4KYVA 4LJKA 3T5AA 4J0JA 3A9WA 4Q3KA 4RNDB 5DXFA 3K2IA 4XX0B 3NH6A 3ZXYA 3NRBA 4C22A 3NETA 3ILSA 4Q0MA 5CA1A 4BV2A 1WPGA 2QN6A 1PLJA 4M9UA 4Q9LA 4BNNA 1KNXA 4G2NA 1R6DA 5P21A 1P8JA 4GYYA 4HWRA 4KIJA 4RVSA 4E51A 3GRAA 1GTJ1 1K98A 3NNNA 3CZPA 5A3RA 2JFVA 1Q95A 3V8PA 3ZCXA 2AXPA 1U2DC 4RTLA 4EX6A 1ISJA 4ER5A 2R00A 1BFKA 3BORA 2Z58A 3OJEA 4UQLA 2GTIA 2XCSB 2C2GA 3W06A 2ZUFA 3KZOA 5DM0A 1U0BB 2BZ0A 3E3AA 3ZCRA 4CV1A 1A88A 3ACCA 1WTAA 2AA3A 4BP8A 1I3NA 3Q2KA 2NIPA 2SKEA 3PD1A 5G0UA 3WK6A 4CKBB 3H05A 3HJNA 2BONA 2ZETA 4CM9D 4BP3A 4IR7A 4D25A 1NX9A 1DL5A 3ES9A 3IB3A 3KC2A 1C81A 2IIQA 4RZUA 5K8LA 4QTYA 1E3EA 1FFEA 3CFYA 3UBTA 4GU5A 1D7OA 1K92A 4GLBA 2ZB7A 1ZKDA 3PQ5A 4TT8A 3ZK9A 5TARA 3V4FA 2G88A 4M54A 4QUBA 1K08A 4ZVLA 4DMMA 1I14A 1OXBB 3HSKA 1WZUA 1QTQA 1N9KA 1WB5A 4XUGB 5FLXA 2Y67A 1GA6A 1J21A 3OESA 5DHFA 4NYMQ 3D8TA 4RETA 2ZBFA 1Z4IA 1WCIA 2VHYA 2OCLA 3F9CA 4RSMA 4AJNA 3HJFA 1QC5A 1RP1A 1KYTA 4AKEA 3M3PA 4R83A 1OX6A 5KTPA 3W34A 2CF5A 5J2UB 2XYHA 1EDZA 1T0IA 3BB3A 5KCMA 3T0FA 4EX7A 4N5DA 1O3YA 2ZCVA 1JH9A 3IEVA 4GPZA 3KLNA 5EIFA 1ZU5A 2V1XA 1KQFA 5CU7A 3UCFA 4M76B 2BGJA 1IVSA 2WABA 2ETXA 2QTNA 1JQJC 1GKUB 1U8FO 1YCHA 3Q3HA 5G02A 2NX2A 1IY2A 1U0FA 1Z62A 3DFUA 3WWEA 3EXEA 3SE0A 3JQ9A 3PF9A 4LKOA 3ZCPA 4RCVA 5FD8A 1HMYA 2GKOA 4NESA 3KSDO 3SKXA 3TB4A 3ZGNA 4F5YA 4ALLA 3I5UA 2G4VA 4GWKA 4V0KA 4AJJA 1QGAA 2ZRNA 2AIRA 4FYJA 4D3XA 4F6RA 2I4OA 1Y3HA 3WNVA 2BEKA 1VLVA 2V03A 4WGFA 3CUVA 4MITA 4G25A 1A9TA 2QAGB 1XTQA 2EJCA 4GXTA 3HEAA 1OGJA 1OI7A 4FE7A 2DCMA 3CR3C 1EGQA 3EEYA 3RSGA 2HEGA 4CR8A 4D3FA 3QFSA 4M83A 3O26A 3EIQA 1TO2E 2CCGA 1Z7BA 1JIIA 2VNAA 2BMAA 4YJDA 1K3UB 3C6MA 5KVAA 3QFTA 2VJPA 2YS7A 4XQEA 3ZWPA 4PFKA 2IDJA 1QAMA 1U1IA 4RQTA 4C4AA 4G5QA 3NHPA 2OHOA 2JVJA 3DBOB 2YHAA 5EL0A 1LNSA 3HMQA 4JR2A 1MGPA 1J0EA 3PC8A 1CB7A 4AJPA 4MUHA 4PRLA 1CUWA 2O3JA 2B7CA 4ARBA 1F2UA 4C7VA 1GSAA 1XXHA 1QRRA 1XROA 2ZEJA 2HWKA 3QGMA 3SBDA 4GBED 5F3RA 2XMQA 3RYHB 2GEDA 3BILA 3CUTA 1NW5A 3QVJA 5CM9C 2W8BB 3UXYA 3KSBC 4JH0A 3ZGZA 1VBKA 1Z4QA 4NX2A 3QPUA 5EIOA 2QB5A 4I55F 3Q0IA 5T8KC 3BWXA 3RV4A 4K0RA 2JAUA 3E5NA 3SHOA 1JXMA 1S7GA 4P81A 1II8A 5M5BA 1U5CA 1U6JA 4GXRA 1VQ1A 2NM0A 3BEDA 4QVIA 2DQKA 1T9GR 3AKEA 5H59A 1AM4D 3X1DA 5FTMA 3WSTA 2X0DA 3CRRA 2Y4NA 3GEHA 3ICOA 3G3EA 3QHAA 3BD7A 4U6SA 5CP8A 3LLUA 4JOCA 3S2GA 5B64A 3M5WA 2SECE 1GOTA 2FN7A 2J31A 2ETVA 3CH6A 3QIVA 1JFLA 1YJBA 2GK6A 1ACMA 2GKGA 1Z07A 3A0UA 1W96A 1UWVA 3VPXA 5BYKA 1DEHA 3W5AA 3H7AA 4F6RB 2WP0A 4EY6A 1AXRA 1KY2A 1LLCA 1IN7A 3U49A 4PZAA 4QQKA 4RELA 3DT9A 1MO2A 2GJAA 3ICVA 4KH1A 5AKGA 3W2EA 2PO7A 3FG9A 1LPOA 1EVQA 3EF3A 3EZ6A 3PPYA 2FQYA 3DNPA 5H5JA 3FM9A 3HU5A 1IMOA 3LP6A 5JE8A 1YDGA 2YDXA 3LHSA 3LE8A 4QX6A 5CIYA 5DE3A 3IE2A 4BJ6A 1Q15A 4B3JA 1JQAA 2O50A 3LLSA 4RPIA 5FI1B 4EITA 4R2IA 4TTTS 1GFZA 2JLAA 4XX1A 1XWIA 3AEUA 5BMVA 1K4KA 5FOSA 3JQFA 4Q3AA 4HMPA 6ABPA 3PVCA 3QE0A 1OZAA 3ANMA 3PDJA 1S8NA 4R01A 4S1VA 3TZBA 4BC1A 1GXSB 1X8JA 1CZLA 5FBKA 4D41A 1EBBA 2R79A 1WL8A 2F8LA 3FWKA 3QFCA 3QVKA 1N6IA 4BZZA 1J2TA 1WKCA 1XZCA 3E7WA 1F2UB 5E3IA 4O2BB 3ADDA 3A4LA 3QBDA 1MPXA 1C9YA 2DPYA 3BFPA 4MRMA 1PEYA 4UHFA 1ISGA 2P35A 3OCZA 4ON9A 2HF8A 2G9UA 3O3CA 4R81A 1CYEA 4CF7A 1P45A 3H0KA 5F2EA 1G7TA 1NVGA 3BD8A 5JNTA 1BU8A 5EUBA 5JSUA 1TM5E 2WAXA 2AS0A 3MCZA 3RHFA 2QXUA 2HFKA 4L9WA 4YMLA 1DV1A 3FUUA 2K87A 4M36A 1VSVA 4JXJA 2PUBA 2M6RA 3MELA 1O6CA 4G5XA 4U7WA 1HOTA 3LI2A 1Z4KA 3AP1A 4I4CA 1WB9A 4BZXA 2IS6A 3CF2A 3GVPA 4ENSA 1A82A 1RMQA 1XNRB 1NVVQ 3EC1A 5D3ZA 5ALDA 4KIGA 1FRFS 2OORA 3BERA 1C3OB 4HAWA 3W9BA 4CUKA 4BBZA 2DPXA 2ZXUA 4ZI7F 2OXCA 1YVUA 4MW5A 1B6GA 1RQLA 1NY5A 3VR6D 3KHUA 1UBEA 4W9MC 3F6YA 3V7YA 3WGHA 1G3IA 1N8NA 4B80A 3VV2A 4E46A 4BC0A 3QNUA 5DYGA 1RWBA 2ZJ3A 3KD3A 3COJA 3C4JA 2AX3A 2FW9A 3QIAA 2I3ZA 4LXUA 5AW9A 1FY2A 2F6RA 3UK6A 3NXKA 2N46A 4XM2A 3F47A 3RNOA 1X0XA 1EUDA 1A9YA 2QG9A 3ITDA 4KQCA 3WTCA 4C0AC 1K1EA 3CUEF 4LYJA 4C6SA 2O7QA 4RTNA 1RI5A 2R4TA 3SNKA 3NTQA 2B4KA 4RMJA 2W2QA 4X95A 3RGGA 3TIVA 3AEUB 1Q1ZA 2M6LA 4YCCA 2P8SA 2VHTA 3P2OA 4ETWA 2CJFA 3NEAA 3IQDB 4XCQA 5C9ZA 3CRQA 3PTAA 1AGYA 2IBSA 1HDOA 1I7PA 5CT9A 1XZAA 2Q2QA 2VSNA 5BV2P 5IAAA 1P1KA 3VZRA 3EGEA 4ZTUB 1VIDA 4HDSB 1VE5A 4LXGA 1LRJA 4CXMA 1A2BA 3FNFA 4JQSA 3TXAA 1OXXK 1FZTA 3IJEB 3IPXA 3NUGA 3NTRA 4FGSA 2V65A 3GUCA 1TQ4A 4MI1A 1RZ3A 1ZMOA 5FWYB 3QVOA 3PT9A 1C0IA 5C35A 2VYND 5TQ2B 1JXQA 2X9LA 2AR0A 2BMDA 2ZRPA 3NTXA 3NFRA 4DUYB 4NC9A 4QJIA 1CJCA 2QJWA 1TK2A 3I8SA 3PLRA 5GJWC 1JGTA 1KJYA 1XZKA 2ZR9A 4BV3A 2GD0A 4P5DA 5I7RA 1JNYA 1Y4SA 3E5RA 1MO4A 3GH1A 4O0MA 4RPCA 4MW6A 4OK5A 3C3YA 2WKRA 2NSYA 3Q2OA 3AF1A 1OT5A 2BOVA 2LBPA 1V3UA 2W83A 1E94E 1XQVA 4FHZA 2IYYA 3M89A 2Z43A 2OCGA 3KPVA 4WLNA 2OILA 3KR1A 3RHTA 1SN7A 3PQ7A 3WMWA 4E13A 3E9MA 3FTQA 2E82A 4M7PA 4UNPA 2AQKA 2BKEA 2XXAB 4PSVA 4MUKA 5KWEA 4OHKA 1ESEA 2NUAB 3R9XB 2QZJA 5DLDA 1JYFA 2GZDA 2HPAA 1JJFA 1WMDA 2JAPA 2MINB 1CDEA 2VH1A 3FR7A 3R20A 3RROA 3QV2A 1GZSA 5ALLA 4X8MA 3O8RA 4J4BA 5TB5A 2H7CA 4KI7A 2JGMA 1H8ED 4MWTA 4B76A 5L6MB 2H08A 3GLTA 2VP0A 3FPAA 2OBXA 4RV5A 3BWCA 4PHHA 1YBHA 3QQ5A 2PLRA 4RD0A 1SVMA 3DFIA 4ALKA 3ZTTA 1X19A 3G0CA 4MRNA 1OD6A 2GMWA 4R84A 5IFKA 1FFYA 4CLXA 3VTAA 3NNDA 1HSOA 5JROA 1EVKA 4RTQA 3E03A 3LO8A 4BDSA 1LF5A 1RKBA 3IS3A 1EP1B 4YMVA 1HDEA 3GGPA 4I5GA 4GWGA 3HN7A 3U1TA 1WRBA 3T5TA 2AGVA 1DOHA 1WCXA 1ZD2P 4ZIRB 4HMOA 1SZJG 1PSWA 2OAGA 1ESZA 4DIFA 1YDEA 1U3WA 4JJGA 5BV8A 4GI3A 3C8ZA 4NFSA 2OCIA 1K3TA 4BLSA 4EJ6A 1DRWA 4MDEA 3SKVA 3NTOA 1KK1A 1VYTA 1Z18A 2E4ZA 5L6LB 7MHTA 2FSUA 3V00A 5KQLA 5FKJA 1H2YA 3ANYB 3HCCA 3I4FA 3GROA 4JB8A 1EEXB 1KR2A 5K0TA 3GPLA 3MSCA 3Q3CA 5BRJA 1FTNA 5EJ2A 4OHVA 2R2GA 5A9TA 1EWYA 3DZGA 1AF7A 1GAWA 3LBYA 2ZSAA 5KTOA 1QG0A 1DXHA 4UHDA 4L8FA 3CSUA 1YJCA 4KQ1A 2OMKA 3NPAA 3V1LA 1MV5A 4K2HA 3G85A 3OPQA 3UJ7A 1CEQA 2IY9A 1BYIA 3IVGA 1S2DA 1YJ8A 5CPFA 1MH9A 3VTKA 4CQMD 4Q16A 4WOJA 4XSHA 3PFIA 1E89A 2QVLA 1M1YB 3W3AD 5BR8B 1WXQA 1V6CA 3QA3E 3I92A 3N07A 4TLAA 3RTAA 3ZNQA 2X13A 4IGKA 5FAKA 4HAIA 2IH2A 4CMHA 1LDBA 3B8EA 1SEVA 3EVAA 4I1YA 4MV5A 4XUCA 4E3ZA 2AC7A 3JWGA 2CXOA 4IVNA 1O9BA 4BJ1A 1KZ4A 4JBIA 1P33A 4I8XA 1PQUA 3PC6A 2RKOA 4K6OA 1H6DA 4QFBA 1ZK3A 2CJWB 2RMKA 2ZB4A 3ZJ5A 3GLRA 5EPEA 2AXNA 1XWFA 5LNK6 5MGNA 2DE0X 2Q62A 4QODA 4RF3A 2ZZKA 4R3NA 2YZ2A 2C61A 4JMLA 2MHCA 3JZIA 1NW9B 3EF1A 2QY6A 1E3DA 1LSJA 2AKYA 3FF4A 3CT4A 1KEKA 5IM4A 3WI7A 3UT6A 3VO8A 4DCOA 1X7WB 1SBQA 3K6RA 1LLQA 3CR8A 3HZOA 2AOWA 2PTGA 2VXBA 3LRPA 1FYDA 2ZRCA 3EZ9A 1DAEA 1TUEA 4W6QA 4ROTA 3SLKA 2PUHA 1W0KA 3HBMA 1IEQA 4HEQA 1XALA 3UAXA 5CB6A 4S04A 4C87A 4DIBA 5C5EA 1JQ5A 2QTHA 2JJ1D 4OHMA 2QM8A 3PDIA 4DXDA 5AVWA 4NZPA 4JVLA 3KTAA 1PYGA 3I52A 4FCCA 4YRRA 5DYNA 3UO8B 5IZCA 4LK2A 3AUXA 2QUHA 4XM1A 1FQOA 1QRSA 1EESA 1P4SA 2Y68A 4C0KA 4OGLA 4P7GA 1RHKA 5EY5B 2WAMA 3TIIA 2ZE5A 4WA8A 2R00C 4PHCA 3CJRA 1L9XA 2GI4A 2P1DA 2ZR8A 3ZD9A 1WXWA 2BLLA 2IU0A 1BEZA 1EB9A 2WHPA 3RWOA 4BO8A 5KNDD 4IHKA 2WIBA 1JMKC 4ZEVA 4BFUA 4HSGA 4YJ3A 4JCCA 4AWAA 3L0BA 1D3AA 4U2KA 4RBNA 1ZLXA 3C3DA 4NXNB 4EY5A 3TVTA 5K8UA 1RQ7A 3H0CA 1R27A 3MWDB 4DM3A 4ZFNA 5IASA 1V7PC 3PLNA 5IDQA 4N41A 1ZISA 1G66A 3EDMA 1ULBA 3CX4A 4O6VA 2YVKA 4FP9A 4S1OA 4UEWA 1KYXA 1IM2A 1W0JD 4M46A 5A62A 4DLYA 1WP9A 1XLVA 1IHYA 1Z0KA 2FN8A 1NW3A 3PGLA 3N2GA 4XXHA 3V34A 2Y2VA 3WIOA 1Y63A 5DEIA 2Y1KA 3BXOA 4AY3A 4OUDB 5JMOA 5A3QA 1F38A 3BQ9A 4QGBA 3NORA 4FW9A 1ACLA 4ZO6A 3NHZA 2VRCD 3A2NA 3EZ2A 1FUIA 4DYHA 1JL3A 2EERA 2CFOA 3EDRA 4MCHA 5JMWA 5K0BA 1L7QA 3L1UA 2D0IA 2Q6IA 3PX2A 1PJ8A 2QN3A 3WKCA 2UVPA 3SYLA 1I6KA 2IIVA 2YYYA 3B7GA 1NOJA 3E7XA 3G0GA 1U2PA 4I1UA 4HGRA 1LTHR 4P8RA 3QX9A 3TYXA 4EELA 4D8VA 5JXIA 1KKMA 1RKVA 4QJ3A 2X19A 4G0YA 1K68A 2Z0MA 1PWEA 2AN1A 2O8NA 2WVJA 1LPAB 4QUHA 2LD4A 2GB4A 1Z75A 4DIKA 1P2GA 1PGJA 2X5NA 5JI2E 3MEQA 4UEQA 4KO8A 2WJIA 3JAMA 4D9MA 2NQTA 2JCSA 1JFVA 2P1RA 1EINA 4UDNA 1BOFA 5TVGA 2FUKA 2WIFA 2BE7A 3OICA 1RRGA 2ZUBA 3KTAB 2Y76A 3JQ9C 3TCXB 3IXMA 1OUMA 3NU1A 4Q1FA 5BR7A 4AP6A 2PQ2A 4JVOA 2PQ0A 1V35A 2BR3A 4WIAA 5ALEA 2I6TA 3W1EA 3UBMA 1YS6A 3BDAA 4LC1A 5DBOA 4DA7A 1PT8A 2AZTA 1MO5A 1GAJA 1N1MA 2G4LA 1YNOA 2APJA 2WNHA 4I2NA 4UM7A 4QGSA 5K0SA 1D07A 4MB6A 2I4TA 4UUAA 2XH8A 4PBTA 1BQ4A 2DPMA 3GCWA 3JAWB 4L15A 3GDOA 1YE3A 1EFHA 1QG6A 3OX3A 3QI7A 4BP9A 4DCTA 1KYIA 4YJ3B 2AJLI 1M8KA 2QM0A 4M0CA 2GHIA 3KSMA 4B43A 1BE1A 4M60A 4MUFA 3AM4A 4POOA 3TECE 3X1XA 4BGVA 2OXFA 2P5UA 4QU5A 2CK3A 3HU1A 3OE5A 4QXOA 4O1IA 4PTYA 2XNKA 3AR8A 3EIHA 3FGOA 4KSCA 3TGWA 3IJ5A 4FLFA 1RHUA 4Z8XA 3G02A 1XLUA 1CR4A 3WA6A 1ISSA 3HBNA 1LBEA 4J91A 2RC6A 2WF8A 1O87A 2X4LA 4J94A 1VL6A 4L9RA 3PC8C 4PLPA 3X1ZA 4M9XA 3ZV4A 1CQWA 1VMDA 1V9LA 2JGKA 3JQPA 1U0NA 2I54A 3UJCA 2C4VA 4BB6A 3T7IA 1OU4A 2WMNB 1D6NA 3NHBA 1BHJA 1XDWA 3BXZA 4FONA 1COZA 1VYHA 5TR9A 4D96A 4GMKA 4LN1A 5CEFA 3QVSA 5ADVA 2ZWAA 2I3AA 4DG9A 3BMXA 1RZRD 4NAVA 1YFLA 1FDVA 1Z28A 3G2QA 2WIAA 4MGKR 3BDIA 3UANA 1Q3KA 3NBKA 5K03A 2NMVA 2HLDD 1EIWA 4H9GA 1ODJA 5B3KA 4A6EA 1G19A 2RGYA 2QRPA 4ID3A 2AHRA 3EC2A 4NZ9A 4YK7A 1IHOA 4TLBA 3SLRA 5HEKA 4CFYA 4DEXA 1Y3FE 3G9TA 3F3YA 4LYEA 4FEEA 2JI6A 2GCNA 2WD8A 2C2BA 3ZDQA 1BS1A 4NONA 1BO6A 4KU4A 4YUVA 3QU4A 4BO4A 5I8PA 1LLDA 2AXQA 1YZLA 2DLNA 2JI9A 1F51E 2VWPA 3NRCA 3Q7EA 3HADA 4IHJA 4KWHA 1TEZA 5BSHA 1F17A 1ZBQA 3ODPA 1SXPA 4QJ4A 3V7UA 3D5QA 4JLMA 1QPGA 4PLGA 4AMYA 3LPDA 3PI6A 3JQ6A 4FDVA 4BGDA 1BDJA 2JLYA 1WUTA 1VCMA 2IZ1A 3KOWA 1QCZA 1DJLA 3KXKA 3NJ8A 4GM1A 4F97A 2JD0A 1NXWA 1D0SA 2D59A 3RC2A 1QUFA 4KFUA 4Q9DA 5FAXA 3T5MA 4PM4A 4CT5A 5AHKA 4ZP1A 4E5VA 5IVPA 2I3DA 4B87A 3U16A 5FUBA 2K7FA 3L46A 4CZ2A 2CZGA 3L02A 3S68A 4MV7A 5KWJA 4CT0A 4KKXB 5DYTA 1YSCA 3EGCA 3TTYA 3UZUA 4NPHA 4RK1A 1C1DA 3KWLA 3T1TA 3JQFC 3ZWMA 1N5KA 2HU8A 3CG4A 5AICA 4ZODA 1UAGA 2QQFA 1SRRA 2ZJAA 3GNSA 1BWPA 4FFNA 4MI3A 4BLQA 4EYOA 1C2YA 2P3SA 1DLJA 2XUFA 3EGWA 4ZQHA 5LA6F 4EGQA 5E6SA 4QLBA 3EQ7A 2RHMA 1U7OA 3K35A 4BV8A 3ZLTA 1TIKA 2I6FA 4FOLA 2AG0A 5J23A 2WPDD 1EX1A 1S3IA 4BHTA 1JXAA 3BSFA 4IIUA 3OOWA 2OB1A 1R16A 4LVCA 3WIEA 1I24A 1X6VA 1A7AA 3WVNA 5AXCA 4WESB 4QICA 2C88A 3IEKA 2II6A 4LJ4A 2OUIA 1RHJA 4ZAYA 4ZI7B 3NBUA 3PNSA 4AZ0B 4J3FA 2PS1A 3CLRD 1M10A 1OHHA 1UMBA 2AXEA 3BPSA 1VMIA 4I4TA 3RUFA 1X94A 5IH7A 4MUIA 3UMJA 2G67A 4IDAA 4DLBA 2R25B 2LCIA 1AMOA 3N0TA 3NVMB 3U9SA 4EHBA 4F5EA 3HKDA 3R24A 3DOOA 3U0BA 3QXSA 4EUFA 2FWPA 1LDNA 5I48A 2OORC 2EJBA 4M0DA 2F4VB 1SC1A 2VDQB 2CVOA 2YC4C 3C1AA 1XX6A 3DH0A 3A6FA 1GD1O 1E9RA 4WY5A 3LS2A 4YRMA 4B3GA 5HFAA 5CDUA 4HQ0A 4BVEA 4HVLA 3QMMA 4OEHA 1H1DA 2CLMB 2YUTA 3O4FA 2O5CA 1MT3A 2V6JA 1OYYA 4CQMB 3KOUA 3ZDAA 5CDYA 1YGYA 4JYMA 2JEOA 3KKOA 4BO2A 4DUGA 1F8XA 1P3DA 3TQRA 5HQTA 3B2QA 4RMNA 2VA9A 4IFIA 3MAGA 4JR0A 4KBYA 3KVRA 2JRCA 4IM7A 3RDPA 4FQ8A 2Q3LA 5LQNA 3ROFA 4ERNA 3DZDA 4R31A 1ZVKA 1PUXA 1QIIA 5F3WB 3A0RB 1A76A 3ENNA 1P9WA 2J08A 4MSUA 5AP9A 4EEKA 1JWLA 3VI4B 2B7LA 4DZRA 1E2FA 3F9RA 4FI3F 5E6SB 2FR0A 3GMTA 5DXJA 2YVQA 3KETA 4FUTA 4A1OA 1WETA 3R0IA 1YDWA 1HTWA 1PJ3A 1TCAA 4QXMA 3AY7A 3HGQA 3AP2A 4JSYA 4OREX 4B3DA 1EUQA 3PZBA 2XYGA 1PFKA 3E18A 3MTBA 1AHIA 2VHJA 4YP0A 3GHHA 4ND6A 5CA0A 4ZO9A 5B4VA 2PJUA 4NBNA 3LKDA 3KJQA 1TDJA 3U4GA 5LIPA 1KDTA 1ZJZA 1P17A 3NYQA 1ZM2A 4LA4A 3RADC 3CX3A 1VJRA 4ZZ0A 3GRVA 3PX3A 5CNIA 4ER6A 3OFSA 1L8XA 2J4DA 3LSTA 1N6HA 4AT1A 2B69A 3HKDB 1R9MA 4EW1A 4JB2A 3WKAA 1A69A 3IOYA 5G1PA 2FLKA 3IKMB 4P36A 3A9TA 1HY3A 4NBWA 4B17A 3VOTA 2NP6A 1XTVA 4GI7A 2WPNA 4RAOA 3T0IA 1FBTA 4AZSA 3GPBA 1DKPA 3N0WA 1L4UA 2EGUA 2JI4A 3I9NA 3O8QA 4JEHA 1TU0A 4EYEA 3JWJA 4NAHA 1PK8A 3GLHB 3GPCA 1DO8A 2VK4A 2XA1A 4WNIA 3RUEA 2XB6A 3ZC3A 1ULHA 1NONA 5CB4B 1F2DA 5B1SA 3S2SA 1ZIYA 2B8JA 3N2KB 1KH1A 2IXBA 4DJEC 2Q9AA 1XCOA 2I3BA 3I1IA 4FQ5A 4QD3A 4WLOA 4C7KA 4EMSA 5IPFA 3ECAA 2ET6A 1WLSA 2X2FA 3H2ZA 4OSPA 4BJ3A 5KYKA 1IM8A 5EP2A 3NVAA 4XPIB 4HNTA 4QHTA 3VM6A 4POAA 5F21A 1Y81A 1EA7A 3ZIAA 1RFLA 4E5UA 2VP4A 4DPKA 3NHMA 3Q88A 4W5TA 1FU7A 1B8VA 3L1KA 4TS9A 4DIEA 2RH4A 4NV1A 2ZJ7A 1PQYA 1MJFA 2XJ9A 7AT1A 4PQFA 4B9AA 3COYA 5AOVA 3ADPA 3TS1A 5CLJA 1LX6A 1EHCA 1Q0PA 2FFBA 2ZUUA 4K7JA 2QAJA 5DLPA 3DAYA 4BX8A 2X6TA 3GT4A 4GOND 2GHRA 1ADCA 1LPPA 2I03A 3ZV3A 2VJNA 1HRKA 3NGXA 1C8VB 5AW3A 2F3UA 1FBNA 1FLDA 5LKRA 1AGXA 1D8AA 2ID4A 1QJ4A 5EP3A 4LCBA 3ZE9A 1EP9A 2AVDA 2H5EA 5LQJA 1E4YA 1EFVA 3W5BA 2DUUA 3OTGA 1ZP6A 3CXUA 4R7GA 5HQ3B 4V03A 5J47A 3GLIB 5TS2A 2H1FA 1IC6A 2Y1LA 2PH3A 2WVGA 3FROA 3LWDA 3AVQA 4B6FA 1D0VA 3FPLA 3UWKA 5ARBA 2OCPA 3HKEA 5B2ZA 4EJ0A 2P2ZA 5KTKA 1U0LA 3Q8KA 1T8UA 3PYLA 1ZA2A 4C4TA 1T8TA 3PUHA 4ITRC 4QYWA 4EBFA 1NZFA 4C7BA 3IAXA 4M53A 1V43A 1ST3A 5GJVC 3O8QB 1JW9B 4K9NA 3K0EA 2O2YA 1I3CA 2ZE8A 3T41A 5EHGA 1GAXA 3DKPA 3F8TA 3HBLA 1PNRA 1NWCA 4FYYA 1DAMA 2XR1A 3HNOA 3HP1A 4FZ3A 4N9WA 4RY8A 4WL0A 4RIIA 3RNLA 4TVKA 3ZKAA 5A71A 2QX4A 4B34A 2JFBA 1AXEA 1EGAA 2XCIA 5IWCA 1SK8A 3NWBA 2F43A 4O59O 5TE9A 5EUMA 4NMXB 4JUDX 5JCJA 4G5SA 3NHKA 4Z7OB 5C8ZA 4ZO8A 2HXGA 5BYBA 3DULA 2CSUA 4KMRA 4M0MA 1MIOA 1LPSA 3NVDA 5EZYF 1ZXBA 4NYJQ 1P31A 2ZS7A 3BTVA 4BE4A 1SCBA 2J85A 1GPJA 1W5EA 5KWVA 4CLOB 4BKUA 4AVYA 4OCZA 1DAFA 3UT0A 1UK7A 2ZJ4A 3CNEA 4DR4B 4I50B 5LPNA 2RHTA 4MV4A 1Y8AA 2PYZA 4WSOA 1A7UA 1YIDA 3TMAA 3HZHA 2I3GA 3S7ZA 1EEHA 2VH5R 1M72A 4RW0A 5EJGA 4AUNA 4H4DA 1EE2A 2QEQA 1OTYA 1UBTS 5HS4A 4WLUA 4JSRA 4J0HA 4FXOA 4D43A 1K06A 2CLLB 3KTDA 5AHXA 4DLXA 2QENA 3T0GA 2HJVA 1Y7IA 2XUZA 1ZNQO 4RENA 5CVEA 2FEPA 3PEFA 2P4SA 2XT0A 4P9NA 4DLTA 5HP4A 3SXPA 2IY7A 2O3UA 3GLQA 4Q4HA 3GVXA 3KXDA 4B7AA 3VR4D 2QD4A 5TQVA 2FXVA 3PWKA 4G6ZA 3DQQA 2W2TA 2FLWA 1Q1AA 4GOKA 5BR1A 3ETLA 3I73A 1SVLA 4K28A 4YHBA 4R0VA 1UPTA 4XJXA 5HF5A 4BMXA 5AM2A 2HWYA 5IZCC 3P9KA 1R8QA 2RBKA 4PX2A 2HEIA 5J1TB 4X97A 5JZOA 4HLQB 5BSKA 2VBIA 2XVYA 2O8CB 5TT0A 3PEWA 1P3JA 2Q4TA 4PC6A 1HYBA 1UBOS 2B1RA 3SX0A 3MBOA 3G2JA 3KT0A 3VNAA 2H4XA 5JBIA 5C4MA 3L7OA 4ZGBA 2P6UA 4QVKA 4YDRA 4I1IA 2ADOA 4F46A 1NW4A 1EXMA 3T54A 2TMDA 1M2FA 3BJIC 2E2WA 2NO6A 1JR3A 4AI6A 2HQOA 3THSA 3HRHA 3AR4A 4G4JA 4P1ZA 2CHGA 3VU9B 2F43B 3E15A 1VLZA 1JPNA 2IPXA 4R0NA 4WKCA 1KAGA 4E2FA 3K8YA 4HWOA 3QPDA 3Q15C 1JHPA 3EMVA 4KVFA 2V6BA 1KZ1A 1YRWA 2Q2VA 4XH9B 1NSTA 1NFFA 3LPLA 3NV7A 3UHAA 3VSBA 3WB9A 3S55A 3KSRA 4PLHA 3W05A 4IW3B 3LHIA 4ND3A 2NUBA 4G0ZA 4MR7A 2RGRA 3DHWC 1I7DA 3FSGD 5A4MS 1HE1C 2FG6C 1SD1A 1KVQA 1PR3A 1WS6A 2WIJA 2X8JB 1RI4A 1UBLS 2A5LA 2XX3A 1E1KA 3UICA 3WK4A 3EPPA 1APBA 4JXKA 1THZA 3PCTA 4UM9B 1EFAA 1USGA 1CS0B 2H52A 4L75A 4RABA 2QRNA 3G9UA 4WJKB 3ANSA 5B7GA 2H1LA 4C3ZA 3FSRA 4KZKA 1T9GS 1VIAA 2DPHA 3AM3A 4N3AA 4OK6A 3CW8X 4EKGA 1KYZA 1SNYA 2C5BA 1W5FA 1K9SA 2DPLA 3QWHA 4LMAA 4TTVA 4TYNA 4ND4A 1NUTA 2H1RA 3SC3A 2IV2X 1UFOA 2OSVA 1J0DA 1JILA 3HL4A 1O95D 1XA3A 2CL5A 2E85A 3EQ8A 2GBCA 3ERCA 1NYQA 1U1EA 5CAEB 3RWMB 2IF2A 1NZDA 3ULKA 2GM9A 4MGYR 4C89A 2Z2YA 1OC4A 4G41A 3V4PB 3WAKA 3QKRA 2ZLBA 3GWZA 4PQGA 1KMHA 1TC2A 3VDXA 4EVQA 1YFZA 1DRUA 3VZDA 1CQPA 3PQ2A 2FWAA 4KQ9A 5K0JA 1NLMA 1YUMA 4C0SA 3WXMA 1MF7A 5KTSA 5C8XA 1W94A 4H7IA 1N5DA 2VOJA 3OHMA 1UT5A 1ESMA 2AYXA 5ITWA 1IHXA 2HSGA 4UVDA 3HZZA 4BNVA 2BFFB 1NT2A 2IS4A 3T61A 4ZJZA 2QN9A 5TVKA 5CDHA 4QA9A 1J1UA 3I12A 1RXVA 2CT8A 1B0AA 1YV9A 1H2XA 3AESB 3GDHA 3SLGA 1B93A 4KXLA 4OHFA 2G63A 4GKKB 5MHTA 5G0TA 1XTKA 4LWPA 5C4IA 1N7IA 1NN3A 3DD1A 4IJUA 1P6UA 5A4AA 1Q1EA 4GFDA 2JIZD 3H2GA 2AOTB 3O84A 2FCRA 3BM5A 3OY7A 4GSKA 3SGLA 3TW8A 2FJUA 1SQ5A 4XVUA 3A06A 5JIBA 3K9NA 1MT0A 3LBNA 3UUEA 1Z3CA 4ZICA 1Y6GA 1V4NA 3G0HA 1DG3A 1N0IA 3TOZA 3GP5A 4GZ3A 4DZZA 3L7LA 4HNQA 1PZNA 4IL5A 4QLOA 1D9ZA 2IY8A 4IGEA 4RK6A 5DNCA 4G0NA 4I1PA 3UGJA 2J9XB 4TMXA 4XB6B 1KDYA 4AYTA 1WR8A 4AJOA 3DQZA 3ZS8A 1JAZA 1FQWA 3V5NA 1GUAA 1RJFA 1SVNA 1TKRA 2FPWA 3COVA 4B6GA 3QFRA 4B71A 1X7DA 2XTNA 1QHSA 3CM0A 1VA4A 5IANA 2LNDA 1MTZA 5EJ9A 2J7KA 1N7JA 3NB0A 3WL3A 4JN6B 5EHQA 5DI9A 2Q8PA 5JFOA 2A1UA 1CQZA 1UDRA 1ZOIA 3MILA 4CMAA 1ZVMA 3GWGA 4PLYA 5DCUA 1Z5GA 1XMJA 4XVRA 5DI3A 1Y7LA 4RHFA 1T6YA 1BDMA 2RDMA 5GIOE 3COSA 3FLMA 3OEHA 4RNCA 1H2BA 4UOZA 3B1YA 2B4YA 4TVBA 4Y9DA 3ICQB 3VDMA 2HSDA 1E9SA 3B3GA 3W6NA 2ZSHA 5M3BA 1K88A 4QECA 4IMRA 1YZYA 4WBNF 1NNI1 4PPQA 4JLAA 5LD2C 3VU8A 2WT9A 4LVNA 3THYB 4XGRA 4FX5A 2F8MA 1YB4A 3HCWA 1COWD 3GL9A 2I2WA 5I7EA 4X92A 1FYVA 3V4VB 1QVWA 3KQTA 3SIRA 3PNVA 4D02A 2ZI5A 3DE5X 1IWBB 1PR6A 3VO9A 2CEKA 1QMGA 4RJLA 5C1IA 2DUMA 1KI9A 1UKBA 3MOGA 2PKWA 1L5LA 4ERXA 4IIHA 2CNBA 3DVAA 2WJ4A 4FCWA 3QPCA 2ACVA 3W4KA 1DAGA 2ZB2A 4UBJA 4HWKA 1SK9A 2Z95A 2XWPA 2JIOA 3G9XA 4M22A 2X5OA 3R8XA 4D9FA 4HNVA 2WKSA 3SR4A 2HA5A 3K20A 2YQ4A 5EIHA 5B7PA 1D6SA 2W5UA 2Z08A 3ZJ4A 4BECA 4EYGA 1W30A 1HEYA 3F5FA 4NULA 4A2PA 1NQUA 4TT3A 2VUUA 3IUMA 3Q5GA 3ESZA 3G0DA 2ZK7A 2EQ5A 4DLPA 4MVJP 4R9SA 1JG2A 2V5VA 1GQYA 4QBTA 1R4MA 5GQSA 1PSZA 3EASA 2GFQA 2NLOA 2WF5A 3QHQA 2PSHA 5SZHB 1PW5A 3TLMA 1EVJA 2A1UB 4RSRA 4F4IA 1KAQA 4FS8A 1E20A 2F48A 2ODNA 2XF8A 4HTAA 4JOBA 1L4HA 5DI3B 3IC5A 1WEKA 2QD5A 1H2EA 3GJQA 4G36A 1L7EA 5DTJA 2ZOSA 1S3FA 1AQLA 2GSWA 3DV9A 2VUHB 1NC3A 4MS3A 2ZT7A 5BNFA 3ZEIA 3EZNA 3ZHZA 1JIKA 2ZUTA 4Z0HO 4NR0A 2IHJA 3FDIA 1ZUWA 3TW0A 3TBFA 4UEJA 2ZG6A 1WQ4A 1YB1A 3DLPX 1QFZA 1DC7A 2WSSA 2XAAA 4J49A 5CT4A 1DTEA 1M6EX 4KTVE 3MTAA 3RRYA 3IDZA 1XZJA 5EE9A 3HI4A 4CVNA 1NN0A 1O94D 2KQUA 2X0FA 1G8MA 1OFHA 4Q4DA 4DDUA 1NBIA 1OXTA 3RVDA 3VJLA 4DC0A 1T2NA 3PHIA 4U2BA 5EKDA 1UADA 3HA3A 3ND5A 1YVRA 3SSOA 2RGUA 4GE3A 3BK1A 2BZ1A 4ZQFA 2AV6A 3D3WA 2EJTA 2X8BA 2AD1A 3DVAB 3H83A 2W00A 2OZEA 2J5BA 5FCDA 1QS0B 2OAQ1 3Q98A 4EUHA 4Z2YA 1MEJA 3A4IA 3QFHA 4PR3A 5EXTA 3B3AA 4A0RA 2IS2A 3HJUA 4CR6A 3LNCA 3O8OB 3AHCA 3ONWA 2YWCA 3EYWA 4KJZA 2XGJA 4QYIA 5B1EA 1MABB 4NLLA 2X2EA 4DMCA 4EJSB 5ALVA 2BEJA 2H8GA 4Z1MA 3OZAA 3PPVA 1G8FA 4FS3A 3K4HA 3K9CA 2DFNA 3R3XA 3WAJA 3KT6A 2JCVA 5CM8B 4QPJC 2PANA 3LECA 5FH9A 2VYFA 5HM8A 1ORVA 2JAXA 3W7VA 4YGXB 4D4MA 1V7QA 4CE6A 2JBAA 5G41A 3Q40A 1Y37A 1HFWA 4EAAA 3Q6IA 5JADA 1W5SA 3J81k 1HT1E 3B89A 3FTEA 1TQDA 1JQ3A 3A9UA 4L73A 3UYKA 2I91A 3RRZA 3F98A 4FGLA 3ZDBA 4MS3B 1PGPA 1BGWA 2QM7A 3I9JA 1QVRA 3K2BA 4G8BA 3FBGA 4DQXA 1HUQA 1VCHA 4R7TA 1YR1A 1SAYA 4W99A 3KQVA 3R5JA 3U3DA 5BW8A 1NNEA 1XC7A 1P29A 5B55A 5AT1A 1O9GA 4YPFA 3IBTA 1F7UA 2G76A 4CTKA 5KYYA 4E32A 2ZIZA 4ZCMA 1DRVA 4CLHA 3I6MA 3C87A 2BE9A 5FYDA 4MXDA 2I2DA 2GCEA 5JMTA 1WOMA 4QPNA 2YWRA 1N2SA 4D9JA 1DC6A 1O77A 1ZQ9A 3VYWA 2Q50A 2EHDA 3AR7A 1TF2A 3PQDA 4H7EA 1MCZA 3CONA 4I6EA 2C2YA 5K05A 2OAP1 4FJ2A 5JD6A 2XLBA 3DT8A 3N2IA 4R1OA 3OZBA 1MN6A 1TUGA 2ZIXA 1I4OA 1R0ZA 3N58A 1FXSA 2JGRA 3PC4A 4YCDA 5G3ZA 4L16A 2EQBA 1SKQA 3AJ8A 3L1IA 4G4GA 3UJ8A 3WIUA 5A4FS 3TOCA 1RABA 3E1SA 1EVIA 2XCUA 1OFTA 1MO6A 1IOWA 4A2QA 1NW6A 2P9EA 3WYFA 2R8RA 4BFWA 4BNDB 4FK8A 2WYIA 3N6RA 4R40A 1XPRA 4NE2A 2CLOB 3B36A 1KWKA 1QYCA 1IDOA 1BJKA 1WXHA 2FSGA 4AKTA 4XWOA 4IPTA 4JITA 1AURA 4PGAA 5L7TA 5DGIA 1T34A 1Z12A 1ZGBA 1TAQA 4O8ZA 2DF8A 2C59A 1Z6QA 2HCBA 4REMA 4WOPA 3TSCA 4ZT4A 2NO4A 3UN1A 2JBAB 3PV0A 5BWLA 3MB8A 1AHPA 2BJVA 1NBHA 2E5LB 1OIVA 3TPCA 3L4KA 1NDQA 3E05A 1PJRA 2QRKA 3U3XA 5JJCA 3HR8A 2CN1A 1E1RA 1C4OA 1DIAA 3BHMA 2EX1A 3EZLA 2I7XA 4GF5A 4GX1A 4IP0A 1CUYA 1XNQB 3T5GA 1GKIA 2H5JA 5EKXA 1OE0A 1JVBA 1G98A 4LRWA 1G20A 2P9TA 1BAPA 3V2GA 1N6NA 3BRQA 4U9HS 1DC5A 2KJQA 2I2CA 5HKLA 4BX9A 2AI3A 1FMJA 3NJ4A 2F17A 1NR1A 3H5TA 1SZDA 1V41E 4F3TA 4ASUA 1ODIA 3K92A 1L7XA 1Q57A 1XNGA 2OBNA 5SZIA 4BNIA 4DLKA 2J3HA 2IHKA 1AZLA 3CZ9A 2JLVA 2H1HA 3SICE 4CF6A 3BE5A 3BRCA 1X39A 4G2TA 3SHVA 5HZGA 3GZNA 3NASA 2O2DA 2ZTMA 1HT3A 2HMVA 4R1MA 1TADA 3GZ4A 4F4CA 3RF6A 4M9CA 2PFSA 3T9FA 2HHHB 3OLVA 4NECA 2D7DA 1Z5PA 4F7DA 2Z83A 1O96A 2QDXA 1QOZA 1UOOA 2Q5QA 2XOKD 1QAQA 4C7JA 3B5IA 4TL6A 5JXGA 4N7RA 1SGWA 1KKLA 2BEVB 2XDAA 1KU0A 5A7GA 2P41A 1JLLA 1JAHA 1VLQA 4MUEA 4RQAA 4URHA 4WZ6A 5BSUA 3RYCB 5EGSA 2RH9B 4TLMB 2XQVA 4LQCA 4TGLA 4EHIA 4DWJA 1EFDN 3RU9A 4L5JA 3KKLA 3D6UA 1R0SA 1URPA 5J5VA 1BKYA 1J07A 1KYYA 4PLCA 5JZBA 5E8RA 2NXEA 5AVSA 2PHZA 3DV0B 4YASA 5F33A 4OYLA 5DSTA 3UOGA 1C0PA 3DPUA 3IMCA 1ZN9A 1UDXA 1OPXA 4NCIA 1JPJA 4ATNA 5A4DA 2F55A 5FPTA 1KEPA 4G1UC 4I1SA 4WNCA 1TF5A 4D8TA 2QE7D 1LW6E 2CDBA 1MKYA 1YC2A 4DGQA 4U3JA 2UXBB 1RWOA 3DE3X 1KF0A 4DRXA 3TLGA 1SA0B 3K70C 2OV3A 3I3SR 2Y0DA 4I0WB 5ICMA 2JVIA 1K5DA 2DTEA 1NLYA 4AMBA 1RWVA 3GC6A 1A97A 3WMEA 4M8LA 1NU6A 1U1DA 4GL4A 1G0NA 5SY6A 5L3VA 4E1VA 1KDPA 1NJ8A 1CHNA 4L50A 4OHWA 2FN9A 2JARA 3HNRA 4WECA 2DY0A 4X00A 1OTXA 5A9RA 2MSLA 2ZIEA 3VC2A 1E3LA 4L57A 1Q7CA 4Q24A 1C2TA 2AZXA 4QTZA 4IZIA 1D5CA 2I22A 1ZJJA 3DXFA 4P35A 5F52A 3UXEA 3UY4A 1JLKA 2LWIA 1PWXA 1U9ZA 2R1UA 1OT3A 2GZAA 4G89A 1DAHA 2CNOA 3GZNB 4PE5B 4DYDA 1G7SA 3EGOA 4KO1S 1FFCA 2HCRA 1UMDA 1G8YA 2A9KA 3ZXXA 4BNLA 4E31A 2AQ8A 4E94A 2OV2A 3C8UA 3HJBA 1O96B 1XUOA 5KB3A 3SEAA 2E4AA 1KJJA 2A8YA 2X3UA 1Z7YA 2X1MA 4I8IA 3R76A 1BCSB 1QK3A 4CW7A 1R74A 3CWQA 3Q2IA 1IUNA 2A33A 2O7RA 5J5CA 3KXIA 4MPDA 5BRAA 2C03A 3HJRA 1RXSA 1EK5A 5EHIA 1LRKA 5IN5A 4ESEA 4MDHA 5LQMA 3ISTA 4KR6A 3IT1A 3NAMA 4ME6A 3U40A 1IE3A 3HCOA 2RBEA 1OLUA 1JHXA 4AK9A 3K4PA 4DLSA 1MDBA 1TX4B 1Z6YA 4X91A 2AKEA 3SR0A 4MR9B 1Z68A 5CHEA 3EPKA 1SBHA 4U63A 3HZRA 3FMOB 1U3DA 5EJ6A 3ROMA 3UK2A 5DWVA 5DSZA 4OHUA 2C2ZA 5EJ4A 3S3TA 1A4UA 2YVLA 3OOYA 5FFMA 1A04A 3D8HA 2DWQA 2QMEA 4RY2A 3TW6A 3QQPA 1QM5A 2FDXA 3S1AA 5TIIA 3TLGB 1XRMA 3PXDA 1EP2B 2VKQA 1QIFA 2R6FA 3E23A 3E53A 3REGA 5KMGB 1JR4A 3WYCA 1C3JA 5JS6A 4KRXA 4ARAA 3PFNA 4X7PA 1PFWA 3NOQA 4E0BA 3W7BA 1Y6QA 2JEYA 1DQYA 1NVMB 4MQEB 3AVUA 2DQSA 4MX8A 2I6GA 4XARA 2G9VA 4MVXA 4RDHA 4PZCA 2WIGA 1FFWA 2ZUDA 3OFVA 1GCOA 1ZGHA 2AZ4A 1EK1A 2AJDA 2DWUA 2GX6A 4N5MA 4DSOA 3CIFA 1H5QA 1JDBB 1CJSA 3OBIA 2FZKA 1WQ1R 3DWGA 4O4LA 5KVCA 3OQ6A 4FFBB 4JLDA 4CCYA 1E8DA 1LKZA 3D6MA 3P32A 1LI7A 3HY6A 3EQ6A 4MJXA 4NMWA 5EJMA 3TAUA 3SYRA 4J0DA 4KO4S 3OTHA 4XW2A 4UREA 1E9DA 2X2PA 5E9QA 4EUKA 2OFXA 2QW8A 3FDXA 3OZXA 4W5JA 5C1OA 5LLSA 3OZTA 3MTQA 2WUGA 2H9AA 4F2PA 2K5UA 2G8LA 2W70A 4MUYA 1XMSA 4BQPA 2PXHA 5CXSA 2WINI 5J2UF 3QVWA 2XD9A 1JUDA 1XQWA 4BV9A 3IOCA 2GZMA 1PAUA 2FNAA 2PRSA 3TOVA 2XXJA 4DC9A 4BMNA 1C30B 4DMFA 1UBCA 1XFAA 3I3OA 3HKCA 3K8ZA 3HDGA 2POQX 4GLJA 4DBVO 4UZEA 2BHNA 3LYAA 4B1FA 3FPKA 4LYDA 4DQ0A 3I2IA 4WZBB 1JQKA 1GZHB 2H9IA 2OESA 2IKQA 2RCNA 5T41A 5HUQA 1NVDA 3WIVA 3GFFA 1OX5A 2ZWVA 3O1LA 4Y2HA 5IUKC 3BJMA 3QEKA 3OECA 3NBYC 4BFSA 3OF5A 4IIDA 1O6BA 3HHPA 4AY2A 1MB9A 3VPHA 2C00A 2HYDA 2J87A 1IAQA 3G13A 3S1AB 1A2QA 3WY9A 1BDHA 1VJGA 3WGZA 5LQUA 3B85A 3LPCA 2Y93A 3N59A 3PTZA 1WTCA 4UCQA 4WZAA 5F1OA 5BN1A 1EH5A 3WLTA 3STTA 2NTYC 2XSZA 1ND6A 3IDQA 1GTVA 3OZSA 4PCAA 4AJHA 4Q9IA 3DZ8A 5I4IA 2VWGA 2H63A 3AVTA 1M2JA 4X6YA 3JV7A 3DG9A 2ORWA 1OWMA 4QBKA 4XLLA 1P74A 3CVYA 2DB3A 5U4XA 2CVFA 3NJRA 4BCDA 4F56A 2O8BA 1GSIA 1YVEI 4RS4A 4EQZA 4I2VA 5GY7A 4WACA 1B74A 1K86A 1KYWA 4YRIA 2VDLB 2EKZA 4O4LB 5GM2A 2AW5A 4R2WA 3LKVA 5KSOA 3DHEA 1QNFA 1UXGA 5CUQA 4YAJA 5F77A 3V8NA 3IQGX 4DHWA 3SS7X 5C8VA 1XJ0A 4YQEA 1JBEA 1JKJA 3L8EA 1UK9A 3OOSA 2VDPB 1MB0A 2VAPA 3FB4A 2C5LA 3K1AA 1YAJA 3HQ4O 3PKZA 2BTQA 3SD7A 3I42A 2FSVA 3SVLA 1UXIA 1E79D 1NSYA 4X1OA 4MGIR 5HTKA 3ZKWB 1XMIA 3FUWA 2YTZA 1A72A 1PT6A 3FF1A 3HKCB 2NG1A 2XUGA 3I5XA 4ZT2A 3GX1A 3S6JA 4FB4A 4O25A 1J39A 1O9HA 1Q7GA 1ZD5A 2BEUB 3P2KA 1ZN7A 4Q66C 3ZTYA 3TVYA 2EX4A 5EESA 3U4HA 5BQXA 1IU9A 5EG5A 5D5PA 2AW3A 1UM9A 5EE5B 1TCBA 2BSAA 4YMIA 4J0IA 3R6WA 3TI9A 1EXNA 1WHSB 3E7FA 4P4NA 5EAIA 4R71A 1ZU4A 2PZLA 1Y4ZA 4ZCPA 3LG2A 1H5UA 2QR2A 4FYPA 4Q15A 1CNFA 2VDWA 1GV1A 1LD3A 4QPZA 5BN5A 1RPZA 1NYLA 4P5EA 3AUSA 5HVNA 4O2AA 1Y3BE 3FY4A 1PE0A 5JQWA 3Q7QA 5HE8A 1M2EA 2PR2A 4O02B 821PA 3T12A 2VTEA 4IV5A 3ZY2A 2NNLD 1TO6A 2QX7A 2WM9B 1IOVA 4OQLA 4N82A 4PXSA 2ATXA 1YRYE 2EP7A 3AM5A 2XE6A 4OV6B 4ESHA 1S1MA 1RYEA 3AEQA 3QOXA 4G97A 1B0PA 3N0RA 1HEUA 3P0RA 3V8MA 4CEHB 4KVAA 4TXHA 1G0OA 4R05A 4EENA 3RSLA 3E0XA 3I39X 4YV2A 2B99A 1R18A 4FPXA 4O2BF 3ITKA 4UVIA 5HIAA 1LVHA 2A67A 1TVCA 3AZQA 2QRMA 3R4CA 2GA8A 1M0WA 1UXOA 2PZEA 3VYRB 3M2TA 3GEDA 2GWHA 2AG8A 3M6VA 2XMSA 3OD5A 4XLTA 5F1PA 2MR6A 3R09A 4L5IA 5FL3A 1GZ6A 2ZVQX 3T5DA 2HJHA 2ID8A 2DX7A 2OP0A 3K1AB 2PXAA 1U28A 4M0PA 4NPCA 1IZZA 5CCBA 1V48A 1Z15A 5EJ5A 2GPNA 4RLQA 4CCWA 2FZ4A 2QT0A 5DOZA 5FORA 1POWA 2Z57A 4R3WA 3IV9A 3UJHA 3VV3A 1QQBA 3OPXA 4OQEA 3MBKA 2MJLA 3N5CA 1F2TA 1HO3A 4Y6QA 3ZHQA 4Z7JA 1KRWA 3ZHRA 2HKIA 1P4JA 3G79A 4N1AA 3C98A 5FA6A 1RAFA 1VJ0A 2F9LA 1J5EB 1LQ2A 3DOJA 4QG3A 1H4QA 5KIAA 1XKTA 1UPXA 3RJZA 1LBQA 2IDZA 1X9HA 4JX8A 4FXPA 3OWHA 2QTLA 2VPQA 4GBJA 4HNAB 3PUXA 3W6OA 1YS4A 3IXLA 3EEOA 2YJNA 1HE2A 4Q3CA 4AN0A 4D4JA 3HBAA 4RZXA 2B61A 3OCCA 1OH6A 2CCKA 2VJAA 2PX5A 2WG0A 4WH0A 5BN5B 5T5QA 2A3NA 4V3CA 1K7SN 3SMQA 1XJ5A 4L4UA 4X84A 3RTDA 5EZ6B 3B6IA 2JLWA 4UXJA 3UHJA 1EK6A 1QG2A 2WU8A 4NZMA 5NLLA 1GAEO 3WG9A 3M6AA 4Z9FA 3OSZA 5JBQA 3D8RA 2AJTA 5AI8A 2WF7A 4F38A 5I4KA 3HCFA 1D1SA 3RVSA 1HF3A 2P2NA 3INRA 4OL0A 3T3EA 1KL7A 3AEQB 3AQ4A 1NKTA 4GAEA 3IMEA 3OFND 1I1NA 4ARCA 1M54A 3IPLA 5CBKA 2W42A 2GPBA 1T2AA 2BELA 2QTWB 1U9CA 2W2KA 2HBZA 2B82A 4QSMA 5H7XA 2V3WA 5A5VA 2OAEA 4PRYA 1CY0A 4Q7JB 1BH6A 1Z33A 4UM5A 2H07A 1MC4A 3KR0A 1S96A 1TOAA 3HHEA 4MA0A 2O8EA 1L7MA 4UE6A 2G80A 1Z4JA 3E9CA 2W90A 2JEZA 4D4GA 4JUIA 1ZJYA 3LK6A 3MJEA 2IYXA 3ZW7A 1JIJA 1N5IA 1S01A 2JI8A 4KOAA 3MUOA 5EOVA 2CDNA 3IBCA 1T43A 3EYAA 4YJ2B 4WI1A 2ZYRA 2N47A 3IOEA 4LDQA 4OJYA 3AEKA 3SY8A 3SHFA 3H5RA 2EYUA 4KXYA 2ZM6B 5H70A 1U2TA 2QXTA 2RB4A 5AVZA 2VPIA 2UKDA 1F8UA 1AA9A 3HLTA 2G72A 3MM4A 1U8ZA 2AWOA 3D7LA 2BFPA 3W79A 1E7YA 5K3FA 4D5EA 1GUDA 2WJ3A 1F6DA 3GRPA 2Y4OA 3L9XA 3MGKA 1H6CA 4ZVNA 4F2WA 1SU4A 2LDXA 5DN6D 1T8WA 5CTJA 4Q34A 1L5YA 4K9MA 2I7CA 4OXQA 1FSGA 5IK2A 1GAQA 3PUKA 3HYTA 1I2CA 3QELA 1YB6A 3PDUA 5EQJB 1PR2A 2DBQA 3PSAA 1B15A 1OKKD 3B6EA 1UEIA 4PZUA 4C76A 5T67A 3W3ZB 1SQ6A 4QO7A 5DGXA 1TYCA 2O2HA 4RF5A 4RC9A 2PA3A 2ZSJA 1G8SA 4O8CA 2XITA 2QXYA 1JTVA 4HEA1 3SYNA 4O4JA 1PTJA 2XD4A 2XOXA 4F4FA 2Q0SA 2QSZA 3TO5A 4HXFB 5LXTB 5IBCA 2FSPA 5EJIA 1KTIA 3TQIA 4GZ5A 4DSTA 1XO1A 5JJKA 2GYUA 2R8OA 5JVDF 4B73A 4XD2A 3T7EA 5IVDA 4UTPA 3JXEA 1ZWLA 5TSDA 3VVLA 4JUAA 1K8YB 4EG8A 3DLBA 2J6IA 1E3SA 2COEA 5LFAA 1FLNA 2NAPA 3HVUA 2ZRHA 2O5RA 3TSWA 2VJMA 4UAUA 3LPMA 4QUKA 5SYNA 2OUKA 4FNMA 2Q0HA 3GVHA 4KI0A 2WYHA 3NT5A 4R9VA 2OQRA 3VSCA 4D57A 1G5FA 2B98A 4UTRA 2OYCA 1RIFA 4K03A 3GUVA 2YWFA 1MORA 3ORRA 4IDNA 4ZAZA 4B2IA 1Z8FA 3B52X 6CHYA 5T6BA 4EZEA 2ANCA 3GEMA 5EJ7A 1T1RA 1CV2A 1PJBA 1YNSA 2BMJA 4JY7A 1JN0A 3TLYA 4TMVA 3AEKB 4R6XA 2GR9A 4YC7A 2UYHA 3B9PA 3ZGYA 1E2UA 1UWKA 4MWCA 3IULA 4CKCB 4KMSA 1SXHA 5BSRA 3QLVA 5C31A 5EIWA 5K3FB 3BQMB 3IALA 5SY4A 3TPZA 2X86A 2Q3BA 2CXTA 4IJMA 5IVIA 5C8YA 3ABQB 2ID7A 1ZM7A 4UVGA 5IKPA 4AXBA 4FCVA 1T1EA 4R5MA 1CY6A 1WXGA 2FZEA 4RK5A 1WUYA 4KQIA 2BGWA 2PUGA 4C3UA 1HTBA 3FPCA 3UFXA 3EWSA 3HMKA 1Q3HA 3RRXA 4BQNA 3T3IA 3LVBA 1X77A 5LU9A 1QTIA 4RLSA 3MWLA 1IXYA 1DIBA 5CX1A 3WK5A 3KOMA 3STUA 2ZREA 1SUEA 1QDLB 2IUSA 1QHGA 2P65A 4Y0NA 6PFKA 4WXMA 3B9BA 3HVRA 2CMKA 4V0SA 2BFDB 3JARA 2E9SA 1FW8A 4CFSA 4ZYZA 4MQUA 4ZI2A 2CLCX 1XZHA 2NUTB 5DNDA 2R6HA 1NHWA 3D3KA 4ZOLA 3TLCA 3VSEA 2COUA 3U3KA 4RJIA 5LN1A 5LL6P 1QGED 5C8DA 2A7QA 3MOIA 2J3MA 1NUHA 2JLSA 2NVUA 3DC7A 1ZOSA 1J20A 1KIAA 3JALA 3NC4A 4EKIA 4OQXA 4TUYB 3FAKA 4DIUA 3BULA 1YR2A 2B36A 2VJMB 2FPPB 2RKBA 2BGLA 3HDHA 1RCUA 3OZIA 2F2TA 3IDOA 4PYMA 2DSTA 3TNDA 4X64B 4KITB 1O4VA 2JCGA 3AR9A 2H57A 1LBIA 3C45A 3VR2A 4F8JA 4QTTB 4OP1A 2ZYWX 3YASA 4UHBA 1F6BA 4WMLA 1G17A 1GPBA 2IYZA 3BE6A 2C7OA 2JCXA 2VAVA 2QKYA 3ILXA 3ZIUA 3CN7A 1ZUD1 3LFHA 4PBSA 3UUWA 4R9RA 1Z6GA 1SKYE 5D85A 3EA5A 1KZHA 1XHEA 5CBPB 3TN7A 3I0NA 2PSJA 1C9DB 4X1IA 1SCIA 4QXPA 3RVQA 1VTKA 3DMTA 4E5KA 4EKDA 4W5QA 3F0TA 1OI3A 1P2BA 4MA4A 4BGIA 5KPDA 1U7TA 4BUCA 3L8CA 3VRHA 3FDFA 4MYRA 3CINA 3K0AB 2C1EA 2P90A 1IUKA 5F73A 3N5KA 4CHTA 2YIJA 4MVJD 3EAQA 3CVWA 5HIJA 3T7JA 1ZG3A 4OYHA 1M2OB 1WA5A 1RE0A 3H17A 1Z88A 1PLLA 3EW7A 3LCVB 3P27A 3PRKE 2XUKA 3AF0A 3AJRA 3AHHA 3UFXB 3IPAA 3ZX4A 2VYNA 1P5ZB 4OXNA 1P7WA 2FW8A 3LT2A 4IH9A 5CX1B 1OCEA 1J8VA 9LDBA 1HQCA 2ECKA 3B78A 3A6KA 3R1IA 2HCJB 1Y8RB 3Q7RA 4XAQA 1WUHS 1GFWA 4JJKA 1X9GA 5AMXA 2UYCA 2VJYA 1NG9A 3DZFA 1M8JA 2C8JA 1AKMA 1R9GA 2QYOA 5AM1A 3T15A 3A1VA 2M98A 4PZEA 2JAQA 1Q0ZA 4RPLA 1RJEA 3E8SA 4J1NA 5DH9A 1WCYA 3AG6A 2NVUB 1CR6A 1W88A 2PIAA 1DI0A 3QLUA 3TM5A 4PSCA 1Q21A 2EKDA 5JQGF 3EQ9A 5A6SA 3MXTA 4NZZA 1U8TA 5C7LO 2UZIR 1K7FB 1VE9A 2OFWA 3D3JA 2F1JA 1WZIA 3RFVA 1MIHA 4XYLA 5KNBA 4S05A 4MDFA 1UZAA 1YD7A 1VKZA 1HZJA 1BMFA 2X8LA 4HX9A 4CIXA 4B3RB 2EEPA 3H2IA 4KXVA 1GG8A 1FP7A 2FI1A 2H6EA 5TPWA 3ZZ1A 2XGSA 1V6SA 3C5CA 2W2MA 5JYCA 5GPBA 3IAS6 1XXHE 2R65A 4G23A 1Z08A 1PG0A 2WQ6A 3BXHA 2ERCA 4RVOA 2X42A 5AK3A 3F4BA 3DMRA 5B6JA 3V9AA 4G5FA 3KOOA 1DELA 2OGWA 4U2FA 4ILKA 2P7IA 3OY2A 1FFDA 4FQ7A 4HADA 4B32A 2H59A 4DSAA 1QTRA 5LZ2A 1NVWQ 1HE5A 4JJ7A 1E2LA 1NJFA 5GOTA 4ZEXA 1SQFA 2Q5FA 3B70A 3LUHA 5FQOA 2QMQA 3TIXB 4BX2A 2Z30A 3IESA 1S2LA 4LJYA 3KIPA 4IOKA 4BE9A 1DTWA 1Z13A 2W22A 1CU1A 5U1PA 3QTLA 3ZWYA 5LVAA 1R3DA 2OZVA 1JDPA 2XDWA 1KK2A 2ZSFA 1WW3A 1F0NA 3PEUA 1ADFA 2JAHA 1U31A 3F6SA 1HETA 2QBYB 1PGQA 1VHDA 4F7WA 3ZHXA 3H19A 2GN0A 3O1JC 3BBLA 4BWGA 3H8SA 2HSEA 3T3MB 3BDVA 3SS8A 1CW2B 3NHUA 4BYMA 4PLFA 3WLQA 1HEIA 4X0EA 1J0XO 4LJ5A 2EV9A 3FBTA 2HF9A 4Q1AA 3CNNA 1TLTA 1Z6XA 5EYPA 1YOBA 3TBHA 3W8NA 5BV7A 1VXOA 2JFXA 2NW6A 3AI1A 1E0AA 1IB6A 1VI6A 1JLHA 1VL2A 4LPSA 4MLPA 4W5OA 1K2WA 2DWPA 2LE0A 4IMIB 1NI5A 4A8HA 3RUDA 3OD1A 2FMUA 1S2IA 1DNPA 1VSBA 3OQ1A 4BCBA 3M49A 2FSVC 1GZDA 2BGNA 2X7HA 1MRSA 2NZ2A 4V2IA 5FNVA 3WLLA 4HY3A 3CX8A 5K5EA 1USIA 2ES4A 2OXRA 2G25A 3PQCA 4JLBA 4TRNA 3MUFA 5TPWB 1Z4PX 3W8DA 4C0XA 2ATIA 1Q14A 1OWNA 2A5YB 2B4QA 3OHPA 1ICIA 5K2MA 1NJ5A 1SXIA 4XJTA 4EPXA 4B6PA 2V8BA 3TSYA 3DL0A 3RVPA 4XUEA 3VJMA 2EFEB 3QMPA 1CUCA 1DWQA 2LXNA 2WM3A 4NZOA 2VHQA 1V0JA 4JP1A 3DM9B 4HDAA 3THRA 4DV1B 1HKHA 1OLOA 3DL4A 3P4XA 1U8EA 4NNJA 7MDHA 4G86A 3C1TA 2IXAA 4CMIB 1UOPA 1HI9A 3MWKA 4CTJA 4O4IA 2ZE7A 1GQOA 1P1FA 3NW9A 1EVEA 3EGXA 3R3SA 4N3BA 2JH9A 5DGCA 1U5AA 4JX9A 2F64A 2IZZA 1MQ9A 4FDAA 3IHWA 2QTVA 3PITA 1NY6A 5DNYB 5CEJA 3OFKA 3M4YA 1ARZA 2NO7A 3HSYA 3QITA 3VC3A 1HNWB 2XMGA 1VPLA 2Z6VA 3UTCA 2I6SA 2G5PA 1RW4A 4NI5A 2EG5A 1ZK4A 2R1TA 5NULA 1GG9A 4B3MB 1Y8QA 3PR1A 5CR9A 2ZI3A 1ZM3A 2NV0A 4M55A 3UPUA 3TXXA 3WE7A 1E4VA 2NPIA 4PYJA 4I66A 2B2CA 2ANBA 4GQBA 2AFHE 2PCLA 5AWFC 3LC7O 2AMVA 3V2HA 1KC1A 1F20A 1YA4A 2JGDB 4RS3A 2JFWA 3C8DA 5FPQA 4NXMB 1QF6A 3IAUA 3QWBA 1MQSA 2DQZA 2YQ5A 4JC4A 4KYTA 4HQKA 1LLFA 1DX6A 1U28C 3RIXA 4E2XA 2C42A 5AOCA 1X2EA 3VC7A 3TZEA 3E22A 4OQMA 4LXIA 3WL5A 2PEYA 5EUQB 3SF0A 2QWXA 3OJ0A 4UW9A 4I3HA 2H7XA 2LUOA 3NBXX 4YRAA 4XFKA 2GLTA 2WT8A 3PJGA 3I23A 2G6TA 2HDOA 3D0KA 2P11A 1UZLA 1JHQA 4LXTA 4QELA 2AFIA 2BBTA 1D2RA 4HGNA 4QT0A 2PX4A 3P9ZA 1Y7HA 1CVRA 1EFRD 1N5OX 4J76A 1FSFA 4ND5A 4P4LA 2QIPA 3T7DA 4ENPA 1KR5A 4JJZA 1NXTA 4IWNA 1P4RA 2IOYA 4RYDA 5AK5A 4Z99A 4M9SA 1LBHA 1FLAA 3AF3A 3K73O 3FUXA 3BL8A 3ND8A 5FBQB 2AVNA 2ZB8A 3ISJA 5FNVF 3RQSA 3DBLB 1WVMA 2AC2A 2P7HA 3OX4A 1ZEMA 4QZVA 4UUNA 2I8AA 2IPLA 2LGJA 2QL6A 1VHTA 2L19A 5DMXA 3P9RA 4Z4HA 4TZKA 3K72B 5HRUA 3WQBA 2OR3A 3L7DA 5DO9A 4YX9A 1S2NA 5K8VA 4PG6A 1QB7A 2FZ5A 3IVCA 1PWYE 3EZFA 4CI9A 3C3WA 1Y8QB 3AW9A 3SC4A 4CDMA 3VPGA 3L92A 5E6UA 2BAGA 1Q92A 2ZYUX 5E1MA 5I5GA 4CEIA 2VLBA 1U7DA 1PL8A 1RCFA 2VHWA 3D4LA 4IRXA 4J2OA 3FMGA 1XBTA 4OI4A 4IF4A 2IYVA 3WB1A 1N8KA 2C4TA 4Z3KA 1KZ9A 1PW7A 4HWPA 2HU2A 2LR0A 2Q3JA 2HB6A 1DB3A 2IYLD 3LGXA 1J23A 1Z6AA 3I6IA 4LDPA 4NYMR 3BAFA 1X87A 2WB4A 4JQOA 3SU8A 3DW1X 4J9VA 1JSLA 1NNLA 3C5WP 4ENUA 1UFRA 3FSJX 1W6RA 3GD5A 3E22B 3ZWQA 1QXSA 2Q5JA 4J8PA 4EQ6B 4LF7B 2H5IA 2QGFA 2NTVA 3CF6R 1JJIA 3GJ3A 3OE7D 4LOIA 3R9KA 2RJNA 1LGYA 3PX7A 1M2VB 3FNHA 1ECFA 3HKBA 4Y2QA 2Q5OA 2ARKA 4F4UA 3R0VA 4DUZB 2HRDA 5JFGA 3O38A 1T8PA 4MJ3A 4WXRA 2IUFA 4CQJA 2XCQA 1I2BA 4HQFA 5EINA 1DXOA 1ECCA 2QMUA 1T3HA 4QDZA 3UWSA 1R8XA 4G26A 4RFLA 4AROA 5LIRA 5FL7A 4X8OA 1IK6A 2JJ2A 2Q1XA 2ROQA 1DJQA 2PUFA 2BVNA 3PE4A 4H1UA 4YJGB 5KYUA 4JT2A 5M2QA 4R68A 1HWYA 1UC5B 1EK2A 3ICEA 4KUHA 4HVTA 5C5DA 2ECQA 4JLKA 2X0EA 4I4LA 4MAMA 5D6OA 1ZFNA 2ATVA 2WWFA 5KSWB 3MFQA 5CH5A 3IMKA 5B58T 5BOVA 1IJEA 2R68A 4B4WA 3L6UA 1R6UA 2HQRA 4KFSA 4QXQA 3TZ6A 4E08A 4BVBA 3HS3A 2PH1A 5K7SA 2PUDA 1AK1A 3ZW8A 3MHTA 1BEEA 3I4CA 4HTFA 2C7VA 1PTJC 2COKA 2C9ZA 5EJAA 4RO0A 1JYEA 4HGYA 2E5FA 3EGVA 2QVXX 3JQ8A 1LC0A 3L07A 4KV7A 4OLBA 4RZSA 4MGZR 3FJYA 5DX0A 2XHEA 2A0UA 1F1BA 2AB0A 3CYFA 3GGOA 3KJXA 3NNSA 4ITUA 4TV8B 5E8JA 5F76A 1Q0UA 1D03A 3G6WA 1VCNA 4YPVA 4YR9A 2Z3VA 2D1QA 1F5NA 1T1JA 5ALRA 2GD6A 4Y6OA 4E07A 4M1OA 3D0RA 3GJ8A 2IHTA 1PNQA 3RUIA 2R11A 2HZBA 3FPSA 2OE2A 5K3SA 3AYXB 5KOIA 2ISQA 3EEFA 3TG2A 3W2HA 1E1CB 1K27A 1IDN1 1PFYA 3L0SA 2YV4A 1ULUA 4MJLA 3U3OA 3SFZA 5A5EA 5J4KA 1GZ5A 1WKBA 4OQPA 4BKQA 2B34A 3S8EA 5BURA 4Q3BA 3IUSA 4QHYA 5BWMA 3U4MA 4ETIA 1NVXQ 5JZ9A 2M1XA 5KTTA 2WTMA 5K51A 4BGEA 4Z6KA 2GF2A 1J25A 2WFMA 3H0EA 3G2HA 2NO0A 3G8DA 5BSFA 3D3QA 3QLVC 3SK0A 2GM5A 4KWTA 3C3XA 3T38A 2R8XA 3W0LB 1C3VA 4Z51A 2WV9A 2DHQA 3CXRA 1HYHA 2BHSA 5JH7B 3TW4A 3F5SA 1RT9A 4BIMA 4B2PA 4DMUB 2WZQA 3RBZA 2O2GA 2EGGA 3ZS9A 2G7MC 4S3MA 4DVGA 5A7HA 3KOZA 3FR8A 3CT6A 4DMRA 4DFDA 3AONB 2Q45A 1PF7E 1DWUA 5IH3A 4H1WA 4UPEA 4PS0A 1PFUA 3S5JA 1E2KA 4DRYA 1ZK1A 2FH5B 3MZ0A 4WN9A 1JEAA 2G9NA 3TLBA 2OB2A 1DZ3A 3H5AA 3KHTA 4Y67A 2HMYB 2VDMB 2WD7B 5D3MA 1VPWA 1GL7A 2PAAA 5CXQA 1HDYA 4PF1A 3GJ0A 4HXGA 4LQLA 4N5IX 5ALGA 1G5RA 1A9SA 3Q1KA 2P77A 3QFFA 4PU0A 5ALSA 1XEXB 3WDKA 4JUFA 2PO5A 4IQ8A 3W5IA 1FP4A 2GAJA 1OYOA 5F2NA 3L7JA 1P2UA 4BBJA 4Y9SA 1RAIA 4I50F 4EL5A 3R6LA 4HZIA 4G1VA 5JSHA 1HR0B 3ZOKA 3KG2A 4PQEA 4ABYA 2KSQA 4JR1A 1OA1A 4JQZA 2FPIA 1QNLA 1VP3A 3EIEA 3FVQA 2V4MA 4YMWA 4OOFA 2FSSA 2VQFB 1YTUA 4CMIA 3FCUB 1KORA 1QVZA 2D7CA 3IELA 3THWA 2X41A 1DX9A 2NSHA 2P4EA 1TECE 3KBBA 5A03A 3ZGXA 3EMDA 3UMCA 5KX5A 4HDKA 1P19A 1EJ6A 2RHJA 4M2LA 2QV0A 3STVA 4CM5A 2G6BA 4AO7A 3T4UA 1VDMA 3DMTC 5FHRA 2O5VA 2XRMA 3MA0A 3JYHA 1P1IA 4JENA 1OGIA 1TYBE 5L7WA 1NJSA 1L1QA 3I2JA 2BJWA 3QEJA 2XT9A 3W8EA 3H86A 4KPUA 4UBMA 1ZW1A 4IDOA 1E1QA 3ZVRA 3DV2A 5KOHA 2R60A 4RTSA 3SYMA 4X66B 4J0EA 3QYJA 4LZNA 1TKBA 1XMXA 5AVJA 3UH1A 4DJJA 3UJAA 3WJ1A 3VPAA 4EGCB 1RD4A 4CG2A 1G38A 3KYCA 2X77A 1XJQA 1PG5A 4WBSA 621PA 5TEWA 5KINB 3WFIA 5AVQA 4Q21A 2CNLA 1XL1A 2PQMA 4L3WA 2BDUA 4WN9B 3ZVLA 1P8AA 1YKFA 5AVOA 5AJYA 4RIHA 4TLLB 2QNIA 3M6WA 1YWGO 4KRGA 1MD9A 3JPYA 4K9OA 1BWRA 3N2LA 1QBGA 1KS2A 3VDQA 4B3BA 1M66A 3QYPA 2HIAA 1YULA 3WL4A 1XQ9A 1VHQA 4NRDA 4E4YA 3WSVA 1FW6A 3H5NA 3W3AH 3VI3B 2H7VA 4HT3B 2BKVA 1KFCB 1YA8A 3CZ5A 2EWMA 2JIMA 1YBFA 3ME5A 1E69A 3QLUC 2R8ZA 3AHGA 4QU0A 1V7ZA 2Y1GA 2H0AA 4AQYB 2WZCA 2BGKA 1OH8A 1QGUA 1NOKA 1PL0A 1Z2DA 2WJYA 4QYXA 3C7KA 5K4HA 1W29A 4V1CA 3KQHA 3OQIB 2J6BA 3R3ZA 1P9NA 2V8OA 1G4HA 1P44A 1EM8A 1U2GA 3GP8A 3RO7A 2I76A 1XKXA 3JPWA 4TSFA 4FOSA 3CW9A 4Q1VA 1H2ZA 1JDNA 1XD8A 4H6WA 2O1WA 4XVQA 3DTNA 1R6XA 4PYIA 5FWXB 3TQOA 1M6VB 2C97A 4MICA 5BNIA 4Y1EA 3GCGA 1QE5A 1L0BA 3WRVA 2AF3C 3L6EA 2IXDA 1OA0A 4F9EA 1K97A 3KELA 1PLKA 1Q11A 2H2FA 2EX0A 4YVFA 3T06B 1KTVA 2NU8A 1P81A 2CV2A 2FMFA 4HFJA 1J90A 2J3JA 5KVQA 5D84A 1MFPA 4MV9A 3RI3A 3E3LA 3MNFA 3FZYA 1F4PA 1OC2A 1E1LA 3KFVA 1FFGA 2BFEA 1S3SA 4INZA 4URFA 5HBRA 3SEFA 3TTVA 5INTA 3A3YA 1J49A 4W9NA 1H1LA 1QV7A 1KP2A 3ZCUA 5I7FA 4EWLA 1LV7A 2OHVA 3ONVA 4PQRA 1ESDA 5ILGA 1G16A 2G09A 1IPEA 5GONF 3VOAA 5LZ5A 1U5BB 3LBHA 4N0MA 5BYAA 2IYWA 4HGPA 4N5NA 4LSZA 2M1ZA 4J75A 1MX1A 4RH1A 1X74A 4QYMA 5IKOA 3RCBA 3EXFA 3RW9A 3WJAA 4CKEA 1QKJA 5KX5F 5KOYA 1UDCA 4QARA 4DCCA 3QG5A 3OX2A 4RV4A 3ZGLA 1XZMA 3OLYA 1Z56C 4NDNE 3AC0A 4EY7A 4F92B 2EYQA 1ZIPA 2WWRA 1E2NA 3PE6A 2OCBA 4AN4A 1E2MA 4FYVA 2D0PB 4DIOA 5KNDH 5KWIA 5LMCA 3RFUA 4ZVRA 3F8WA 2CD9A 4C7MA 4RFVA 1NRWA 1AOXA 1ZJ5A 3RIMA 2MYPA 1JKXA 1YDFA 1YR8A 3CB2A 5KOJA 1N8SA 1NBEA 5EIEA 2OVBA 4W8GA 3AIKA 3C41J 2FZWA 3CUKA 3GQBB 2I29A 4UBOA 4M1TA 1SRQA 2H0RA 4GYJA 1ZYUA 4H18A 3EMBA 2XQIA 4GWLA 1E62A 1F1JA 3A1WA 3FOBA 2H11A 4NNPA 4WY8A 2AN3A 2IF0A 3OPYI 1T9CA 1B0ZA 1CD5A 5GJBA 5FUWA 3HVJA 5EVCA 1RHQA 4PAOA 3TOSA 3FB1A 3CX7A 1KRXA 1CF2O 3CEPB 2RGCA 3D9QX 4I6GA 4GI1A 2XZOA 3EFOA 4GKAA 4U7HA 3K0KA 3WNZA 1JVNA 4O1HA 2QLFA 3MS4A 3AERB 3I30X 2XNJA 3OUZA 4MTLA 1O2DA 1A7JA 2CDAA 2ODTX 1R12A 3G2MA 3HB4X 2NU8B 2C57A 4BMSA 1YZVA 2GF0A 5HHTA 1P72A 1T5TA 3AVPA 1XVAA 2C8VA 2FRDA 1SBNE 3N9IA 1DTSA 1ELOA 1QE0A 2FKAA 3RE1A 3D1LA 4C0WA 3PQ6A 2OZKA 1G18A 3OH8A 4YRLA 3X1WA 5I7HA 3INGA 3F49S 1V8OA 3O9VA 3ZE6A 2YYZA 2P1ZA 3AWIA 4XJVA 2HBRA 2IYQA 2L2QA 5DHSA 3DZJA 3FGNA 5MN5A 1SXJD 4LOKA 3RKRA 4LX8A 1JHOA 2WF6A 4C7OB 3PUWA 5LJIA 4OKNA 1R2QA 1AB6A 1MG0A 1M5TA 3IO5A 5JS8A 3HG7A 4JBHA 1PZGA 1CJTC 3JASB 3PXAA 4CM6A 1A4XA 1R15A 4HC4A 4PGGA 4BE7B 3NATA 1C7QA 4ZRMA 3BKXA 4F3CA 4MVJI 4YP6A 1OAKA 3PPXA 2VNSA 1R9NA 2ADFA 1ULAA 1OX4B 1UODA 2JCBA 4E11A 1MC1A 3UNXA 2E18A 4YJFB 5BQ5A 4IUYA 2NT4A 4BNWA 2ZI4A 2YW9A 2AK2A 1ZN2A 4N39A 4JBYA 4LYFA 3UG6A 1YMQA 3AFGA 3ELDA 4A4DA 3C3AA 4ZREA 3VH1A 5A3VA 1DADA 3P1JA 4YB8A 5ILQA 2DFVA 5LWHA 1SVIA 4M1MA 4Z49A 3KAQA 1BSVA 3BJRA 4YACA 3UAWA 3GT3A 4CODB 2QLMA 5A0VA 4K3UA 4IVPA 2Y0BA 4M37A 3RUCA 4RM2A 3DDOA 4ZT6A 3B7PA 3ZZUA 4B47A 4BRZA 4B6JA 1Q7TA 1H2FA 4JDPA 4UE3S 3WGMA 4EJFA 3CCCA 1P7PA 1BVHA 2PQ6A 4L2IA 3DCNA 4G9GA 3T9CA 3HO6A 3L4BA 5I9SA 1N1GA 5ALQA 1GIAA 4UTOA 1DCKA 2CVHA 4LNUA 5AD1A 2LIPA 2Z2XA 3G8CA 3TCNA 4D7AA 4D97A 2RBGA 4ZO4A 4RHYA 1QZXA 2PFKA 4C2BA 1AE1A 3WLFA 4GGOA 2QG4A 4LWOA 1XZPA 1AKQA 3UAGA 1LBSA 1PKXA 5KQMA 4LJRA 2YJ5A 4YREA 3ZK8A 1KDOA 2VC2B 4B82A 2BBWA 2H06A 3B9QA 1NOIA 1VL8A 2QF7A 2BKXA 1JHVA 1FNBA 3AFMA 4YN3A 3RR2A 1JPUA 5FYQA 2TSYB 1CF9A 2DC1A 4LGMA 3IKLA 3N76A 2WSBA 1GR1A 3LXMA 1RC0A 3WGQA 3BGOS 3MS7A 5HFJA 2VTBA 1L7PA 2ILVA 3REFA 3HH8A 3V6MA 2JIPA 3GDGA 1T24A 1NDHA 4AZ3A 1OWLA 2VP2A 1HORA 2HADA 2RAPA 2UZ1A 3B1VA 3IILA 4GVXA 4I14A 3FWZA 2WOJA 3H3FA 3VC1A 4ETNA 4DA9A 1VMEA 1H8HA 1CR2A 1II9A 3PT5A 3KQQA 2ZRMA 1AZSC 3SS9X 4E4TA 5FDFA 2FKNA 3C0KA 1BA2A 5DTEA 1R64A 2A1TS 3QU9A 3I2YX 1VG1A 3UWDA 8LDHA 1B2LA 4Q3LA 3EFHA 1YC5A 3BG5A 2B4TO 2N42A 1PT7A 4YUWA 1Z37A 2I6XA 1Y5NA 2FPKA 1WMAA 5ARCA 2M9MA 4ARVA 5L3SB 1GL6A 1M34A 1OFVA 1ZMXA 3GGDA 1L2TA 1T3LA 2NPOA 2VCEA 3V3KA 3NOVA 3WO1A 3JQGB 2C9YA 4H3VA 2ZDQA 3TTTA 2WNSA 4HRVA 3VJRA 1OH7A 1AHHA 1G4UR 1ZK2A 4L2IB 3EQZA 3ADOA 4EPRA 3IH5A 2HN9A 4D9IA 1YKSA 3N2NA 3FNGA 3FKSD 2DU8A 5ED0A 3JW8A 4XJSA 4LNUB 1OROA 1VGVA 1U2EA 2QUKA 2IWHA 4EGAA 4DR3B 2BM8A 4GR9A 3TLAA 2XZDA 2I34A 3RTGA 3VAZA 2VRNA 2JATA 1CZKA 1G6OA 2E4YA 4C4RA 3KYDB 1MAHA 4IAOA 4LE1A 3KDPA 3GVCA 3E27A 2VF4X 1HFKA 3LIIA 4UHKA 4B84A 3GNQA 3HLKA 6REQB 1V3TA 3P2MA 2BFAA 4BBPA 1FNSA 1NVAA 4PNEA 3TKAA 3PUJA 1AJEA 2D5IA 1P5HA 2XYQA 5AKJA 1MH1A 3AFNA 2V7VA 4CV0A 4IHAA 2B8NA 5ALPA 1V8FA 4B31A 4PHTA 3U7QA 3W6UA 1AZWA 2X6QA 4PZYA 1X15A 4Z5XA 1XRRA 4QKQA 4KYUA 5JDIA 1JF8A 1SBZA 4KWEA 3KCNA