1I01A

Crystal structure of beta-ketoacyl [acyl carrier protein] reductase from e. coli.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
241
structure length
228
Chain Sequence
MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNANLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of beta-ketoacyl-[acyl carrier protein] reductase from Escherichia coli: negative cooperativity and its structural basis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords BETA-KETOACYL [ACP] REDUCTASE
total genus 82
structure length 228
sequence length 241
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2001-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i01A00
1Q0LA 4FFRA 1T4DA 4BO6A 4BNLA 4J1NA 4ZVVA 4DPLA 3ONEA 4HX5A 1U4OA 2PV7A 3GC6A 3UAGA 5H81A 1ZKMA 5GY7A 3UCXA 2PY6A 4DUPA 4HBGA 5F3RA 4N5NA 3BMOA 3WJ7A 4HP8A 3GEMA 5BSFA 2EW8A 2X23A 3ITDA 3DFZA 4BGIA 4IDBA 4EUFA 1X0XA 2PZMA 3KSDO 3DZFA 2EP7A 3V8BA 3FPLA 1E1KA 1FDSA 1X1EA 5AXDA 4TKMA 2C29D 2NQTA 3JQ9C 1X13A 4FB5A 4MIEA 2DKNA 2P2SA 2VTDA 3KXDA 1ZK3A 4NG5A 5DN9A 4YJDA 3ZGYA 2EEZA 3V1YA 3OEWA 3OICA 5A1TA 5JAMA 1Y5MA 3HUDA 4YJHA 4CL3A 3DEYX 2IE0A 5G0WA 3PDUA 4JK3A 1HF3A 4YJFA 4XRGA 2PD3A 3GH3A 1ADGA 4O6VA 1LLDA 1MA0A 4M54A 3K6JA 4FIZA 4XIJA 4B4UA 1P3DA 2FY8A 2OFPA 1AXGA 3UH1A 1LLQA 1PZEA 3P19A 5KKAA 1UXHA 4P4LA 1T2AA 4UEJA 1ZK2A 3QWAA 3S2FA 2VNSA 2GGSA 4GSKA 1K5HA 1ZMTA 3NTRA 1AHHA 1LC0A 1G1AA 2YJZA 1E7MA 1GY8A 1HXHA 3QQPA 2YFHA 3JQAA 2R6JA 4RV9A 1N1EA 3DDNA 5EL0A 1YQXA 1PZGA 4ID9A 1VLLA 3ZU3A 4E13A 1LDMA 3AY3A 1HYEA 4EYEA 5CG1A 2WDZA 4QFCA 1OAAA 3OIDA 9LDBA 4K6CA 3U4DA 1IULA 3HFGA 3VZQA 2FSVA 1C14A 3WSVA 1R4NA 1E7SA 3BMCA 3PFWO 3QVTA 4URFA 2D0IA 4JN6B 1WXDA 5JAZA 4PLGA 1YBAA 2LDXA 4CM8A 5JXWA 5JSFA 1MV8A 4YRBA 2QRLA 3RUAA 3SLKA 3GFBA 2CSUA 1EUDA 4GWGA 3H5RA 2DAPA 3DZKA 3FF4A 4RVDA 3RVDA 4IJUA 3HSKA 3G17A 2QYSA 2VUUA 3JQDA 4J43A 4CM6A 5MDHA 1YOVB 3S55A 4TQGA 1NPTO 3PYXA 4TMFA 4BUCA 1EVYA 1PJLA 3ROKA 3WMXA 4UUPA 3S8MA 2CFCA 3WS7A 1AXEA 3LK7A 3JD4A 4F45A 2PD4A 2X7HA 4E5KA 3BHIA 2R2GA 3U49A 3MOGA 3KLPX 3U3XA 4DVJA 3DHNA 3PHJA 3KUXA 3EY4A 3CMMA 4L73A 3E5RA 4GLOA 4HY3A 4ZA2A 4CQLA 4BNWA 2P4QA 3NDJA 1DIBA 5C37A 2OHXA 2YHIB 4LN1A 4A10A 3JQ7A 4IIUA 2RIRA 4M86A 3K30A 3GN2A 3RD5A 5TJ9A 3ZNPA 3FR8A 4XKJA 3C7DB 4GAEA 1R4NB 3BMCB 2NTNA 4CR6A 2B4RO 1DDOA 1PJ3A 1U7HA 2Q1TA 2FR0A 1QV6A 2O2YA 3IAHA 4UAGA 5JAQA 3HHPA 1B14A 1TXGA 2AMFA 2X58A 4A73A 1K3TA 4BQPA 5T57A 3OMLA 3JYNA 2EG9A 4PFJA 1GAEO 5KVSA 1P1KA 1YKFA 3G49A 4QECA 2NVBA 1NPDA 4HNGA 2O50A 5BQFA 2EXXA 4MVJD 2GDZA 1UP7A 3OEYA 3TZHA 4FGWA 3ZH2A 3LT0A 1Y9EA 3N7UA 3E9QA 3KOUA 3C7AA 1E7RA 4GSLA 2PH3A 2HK8A 1IY8A 1GPJA 3ZWMA 1IYZA 2V6GA 2HCTA 1GYQA 1E3JA 4M1QA 2V7PA 1EUCA 1Q0QA 4BO4A 5JDIA 4LMRA 4TWRA 3FNEA 4UEKA 4Z3KA 4J2OA 1PJ2A 1RM4A 2EERA 2UAGA 4AJEA 5TRTA 5IXYA 1ZUD1 1GCUA 2C7VA 2Z5LA 3W4KA 2OOSA 3JQ8B 3DBHB 1ZXBA 3DC2A 4GI2A 4RPLA 3H5AA 3U09A 4BNIA 3BTOA 1NVMB 4JIGA 1KC1A 4DBVO 4FFOA 2E82A 2H63A 2YHIA 3BZUA 3Q1LA 1YL7A 4CODB 3ORFA 4YJGB 2FSSA 3COSA 4Y98A 4CJXA 3PJFA 3I3OA 2IXAA 2QZZA 1P9LA 1FJHA 4IDEA 4J7CA 4B4VA 1WNTA 3GZNB 4U6SA 1F0YA 3NT4A 4NH4A 5CDGA 2RHRA 3AU9A 4W7IA 3ZN2A 1WDKA 4MVJE 5FWNA 4I9UA 1YDEA 1B0AA 4QT0A 4WLOA 3D64A 4CUKA 3SJUA 3DBRA 5ER6A 1E3WA 2F00A 4EEZA 4KP7A 1F17A 2P5UA 2YZ7A 4OIMA 5B4VA 1YJQA 3F1LA 3AOEA 4CR7A 3TQHA 1SBYA 1PJTA 3MTGA 4MDHA 1NASA 2WD7B 4NHEA 4M49A 1SO8A 1ZXLA 1GV0A 2BHLA 3IS3A 2ZJ1A 4BGVA 3ZW8A 4ALMA 4CM8B 1Y81A 4IS2A 2HMUA 4MVJF 3ZWVA 3E9MA 2HMSA 3FWNA 4JLWA 4WEQA 2C2XA 2VNAA 5KJ1A 5L9AA 1EUZA 3PZBA 4DQVA 2PR2A 4RF4A 4KOAA 4HFNA 4S3MA 4ZHSA 3V2GA 3ABIA 1ENOA 5F5NA 3NGLA 5DULA 4J0FA 2C20A 3SJ7A 3U0BA 3UKOA 2Y0EA 5G4KA 1AN9A 1AHIA 3KTDA 2EKLA 3HN7A 4FOOA 4MINA 2X9NA 4CLRA 2Y0CA 3PJGA 3JCZA 4ALJA 4E30A 2EGHA 4NFSA 3QA9A 2B69A 4R3WA 4TRJA 5TJHA 4QO7A 1C1DA 1Y6JA 5KWEA 2IEDA 4FFPA 2AQIA 2NWQA 3AU8A 4XEHA 4TSKA 2Q2QA 2Z1MA 2CF6A 3HDHA 3IJRA 1T1SA 3ENKA 3CIFA 1FMCA 4XGIA 3TDKA 4BO5A 1YQGA 4DA9A 4EJ0A 4P4GA 3GEGA 1PIWA 3R1IA 5ITWA 3HG7A 1UXKA 3E1KA 1LDNA 3IL2A 1I3NA 2HJRA 3D3WB 4PIVA 1CQJA 4NMHA 3T4XA 1JN0A 2GZ2A 3G1TA 2AG8A 2O7SA 1MP0A 2JFFA 5BNFA 3L77A 3OSUA 5G2OA 5HA5A 4MKRA 1I3MA 4RO0A 4NIMA 4B3JA 1LQUA 3IC5A 5F1PA 4EDFA 4MJLA 5J23A 3CTMA 4R3NA 1PZFA 2Q2WA 3RASA 1DAPA 4MP3A 3QWIA 4QUKA 4CM4A 1JW9B 1NVGA 2D5AA 2WD8A 2GD1O 1E5QA 4YAKA 2BH9A 1SEPA 1U1IA 2ZTUA 4L4XA 2ZB3A 1WDMA 1BGVA 1XDWA 3I5MA 2I99A 5JFOA 4W4TA 1NWCA 1EBUA 4D42A 2X22A 1U2DA 1HLDA 2CVOA 3WLEA 4RZHA 1J5PA 1HTBA 3BTVA 1N92A 1ML3A 2ZJ0A 1YWGO 4TVOA 4RORA 4BO8A 2I76A 3DBRB 3JYLA 2YV3A 4MIOA 1YRLA 1CEQA 1B8VA 3U4CA 2JAHA 1WZIA 9LDTA 2O48X 5DF1A 4Z0HO 4DBZA 5CHEA 1E3LA 3ZWBA 1F12A 4BNGA 1E7QA 5A9RA 3JQFC 3KEQA 4E5PA 1VI2A 4DIFA 2J5RA 4MPDA 5FI3A 2C59A 3CZMA 2WYWA 1I0ZA 1VL0A 1TI7A 1H2BA 2Q2VA 4D79A 1DBVO 1N1GA 3FTPA 4AJHA 4RQUA 4JP3A 2AEMA 3KZVA 3DQPA 4IJVA 3UF0A 3HDJA 2Q45A 3ROMA 4KDFA 2W2LA 1VJ1A 2CDBA 4PG4A 4N5MA 3L4SO 1B16A 3H5NA 1IZ9A 1KERA 3ONDA 1I32A 2AQ8A 4WCFC 1PJCA 4IM7A 3ZV3A 2DBVO 3E9NA 3PPIA 1QG6A 1UP4A 4FS3A 3G3EA 3GVCA 2X6TA 5I7VA 4WCFA 2A9FA 3C3XA 2VT2A 1UZLA 1QLHA 3TZ6A 5L4SA 4H7PA 3R3JA 1SPXA 2QG4A 3A14A 2BI8A 4M89A 3ASUA 5COBA 5THKA 1WW8A 4XYGA 3RUCA 3AI3A 3LU1A 4A7PA 5CDTA 3DOJA 4R01A 1NFFA 2RBEA 2IZZA 4XWYA 4PZCA 2D8AA 4LMPA 3DONA 5IZCA 2DU8A 1DJNA 3TPCA 2R00A 2ZB8A 4CQMD 3GG2A 1K89A 3W1VA 5AXBA 5L7WA 2B37A 2JHGA 4UVEA 2IEBA 3IP1A 4RGBA 2PD6A 5T64A 4NK4A 3UCFA 3OM9A 5IAAA 2CVZA 1DIHA 4FC6A 5LDHA 1LLCA 3HWRA 1P31A 1KVTA 3DMYA 4U5QA 3PWSA 4JBIA 1HYHA 3PJDA 1HDZA 5IZCC 5FYDA 4XB1A 4IUYA 4OXNA 4FQ8A 1ID1A 1HEUA 1FF9A 1P77A 3AOEC 2HDHA 2Y1GA 3WGZA 1GPDG 1C0IA 2DUUA 4PVDA 4IXTA 3JQEA 1GFSA 3VZSA 3NAQA 4ALNA 2BFMA 2O2SA 4CMCA 1LRLA 3ADPA 1RKXA 4NDNE 1DIGA 4YT5A 2DTEA 3TFQA 1N2SA 4OSOA 3ZZNA 4YJFB 1O0SA 2O4UX 5A4DA 1PTJA 5CEJA 2NU8A 1F06A 3RC2A 4YJHB 4E2WA 1SZJG 1UZMA 4OO3A 2FRDA 3T7EA 4AJ2A 3KYDA 1R12A 4O1MA 2NU7A 4IQ8A 3Q6IA 1B8PA 1O6ZA 4J1SA 4UUMA 3BIOA 1B2LA 4GGOA 1T2DA 1EE2A 4AJJA 4CV3A 3DBHA 2ZYDA 1HE4A 5FI5A 4YB8A 3SLGA 1DB3A 4GVLA 1B26A 3SXPA 5DDIP 1ZJZA 3W4JA 1NP3A 2WJPA 3GG9A 3I9OA 3KV3O 4BNHA 1IE3A 1NHGA 3ZDFA 3ICCA 3Q9UA 3GRPA 4ND1A 3FBTA 3A28A 4D43A 2HAEA 4RVUA 1SEVA 4UUOA 2Y1DA 4LVUA 3VZPA 3BMQB 1E3SA 3GPDG 1U3UA 1E0DA 4W7HA 4J9VA 2WEKA 1OMOA 1T24A 2F1KA 4MOWA 4WLEA 1MFZA 3GN1A 1UDCA 3H6KA 3ON5A 4JNKA 4OXYA 5GZ3A 3RKRA 3WYCA 1P33A 3KVOA 4CMAA 3OF2A 1X1TA 3AY6A 1PL8A 1ZSNA 7ADHA 1GZ6A 1XA0A 1PGJA 5JAIA 2NUAA 4MVJI 2DVMA 4XYMA 3G79A 3OJOA 5JMPA 5ITVA 5JLAA 3BTSA 4M87A 3PEFA 5HBRA 1D1TA 4XR9A 3RJ9A 5A06A 5CPFA 3PHGA 1R4MB 4CMBA 3E82A 4HFRA 1PGNA 2B83A 5IZ4A 2AEFA 1JDJA 4R54A 4JX8A 4II2A 4YCAA 5G4LA 1O8CA 1NR7A 4P4NA 1KY4A 2JFGA 2FR1A 3WGTA 3WR5A 3PQFA 1P1FA 1Z7BA 5F21A 2Q50A 4W99A 1V8BA 4FCCA 2JL1A 3DHYA 1E3WB 4JXKA 3WQQA 1V9LA 1GV1A 3GVPA 4CQMB 4FBGA 2DPHA 1V0JA 4R5MA 3IUPA 1JKFA 1C1DB 3LZ6A 2O4CA 3TRIA 1Z74A 3WSWA 2X5OA 1H6BA 3H65A 1UR5A 5JO9A 3RI3A 2FR8A 3QE3A 4CMKA 1C1XA 3M2PA 3I9LA 1PEDA 3IUSA 3O9ZA 3EC7A 4YA6A 1SMKA 4CPDA 2ILTA 1R0LA 4J7XA 1QYCA 1E6WA 2YY7A 3JYPA 3LDHA 2X1HA 3O26A 4S1VA 2UUPA 4BNUA 4BNKA 4FN4A 3MJTA 4BMVA 5L53A 4UUNA 3QW2A 5A02A 3GGGA 3I9KA 5EPOA 1OC2A 2A35A 2VWQA 1MC4A 2I66A 1KOLA 4W9NA 4N7RA 1BDMA 4QXMA 1V6AA 5I8ZA 2D59A 3UICA 1KBZA 1T2FA 1I36A 1DSSG 3X2FA 4IQGA 1PGPA 4PLYA 4Z9XA 4HUJA 1LSJA 2DM6A 3NYWA 2PGLA 3VHRA 1DFIA 4IJKA 1DRVA 1ENZA 3WLFA 2IYOA 4LISA 4D0RA 5KJ6A 4D46A 2JCVA 4HFJA 3A06A 1LJ8A 3H8VA 5BR7A 4UVGA 4Z3DA 3LC1O 2Y05A 3PI7A 3MWEB 5A9SB 5EIOA 4FOSA 4FGSA 3BYZA 4RVGA 4L8VA 3ANMA 2DFVA 2I5PO 3NDRA 3EW7A 4J2HA 2HMWA 2FMUA 1F8FA 2QHXA 2J3IA 2CY0A 5A9SA 1PS0A 2EW2A 3HNPA 4DGSA 4AJNA 2IZ1A 4I8XA 3UUWA 1PQUA 2EP5A 3B20A 2A4KA 5DCUA 2JD0A 3BHJA 1NVTA 3I52A 5DP2A 4WLVA 5A03A 1XIVA 3B1FA 3HB4X 1HDRA 3NTQA 4ZQFA 3PTZA 3PWKA 2O7QA 5GMOA 1UH5A 4CMIA 1X7GA 4AFNA 2PH5A 1KS9A 1UXIA 4DMMA 4CM4B 1LDYA 5HWSA 4R9RA 4U0JA 5A3VA 4YQYA 1SCUA 2X5JO 3K8ZA 4Z0TA 2NVUB 1MB4A 1E3IA 2IYPA 2EGGA 4D41A 5I9MA 2G0TA 2B36A 3DOOA 2OP0A 1M6WA 4P8RA 1A9YA 3F5SA 4AJPA 1D1SA 3DAPA 4FFLA 3JQGB 3ZWCA 5B37A 2NTJA 3QVWA 4J90A 1QSGA 2EWMA 1A71A 1XELA 2NTVA 4B8ZA 4WASA 3F1KA 3RBVA 1A27A 1XYGA 1I8TA 5L7YA 4GX1A 4C7JA 1NAHA 4CLXA 4DLBA 3JQAD 3AJRA 3D7LA 4CL8A 2E6UX 4WUVA 4DREA 4GKVA 3VPXA 1AUPA 4LCJA 5KNLA 3KM0A 3ITKA 1RYDA 2ZTLA 3U9LA 3TOZA 4JJGA 3A4VA 1ARZA 4J91A 4B7XA 4HADA 4I5EA 1TT5B 5AQ1A 4IDFA 1NAIA 4CV1A 4XYBA 3W6UA 3W8EA 1DFHA 3VC7A 1ISIA 2JCYA 4RDHA 4XCVA 4AG3A 3TZQA 1U28A 1IPFA 2P5YA 3FWZA 3K73O 3PHIA 1W6UA 2C82A 4J4HA 3V1UA 5HTOA 1PJ4A 1E1MA 1I2ZA 1M75A 2P9GA 3HE3A 3PIIA 3PYLA 5GZ6A 2X0RA 3B1JA 4YYZA 1GTMA 3GGPA 3OP4A 1KEUA 3QJ5A 2PNFA 4PLFA 3A1NA 2CDAA 3TZCA 4G81A 4BL5A 1GYPA 5A3JA 4NFHA 1RPNA 2EKPA 4GPD1 2QRKA 2HMVA 4BHTA 3DBLA 2DQ4A 4IZIA 1PR9A 4PCVA 2DFDA 4TZKA 3W8DA 2V6MA 4G5HA 3VTFA 3OA0A 3VKVA 4RLHA 1SB8A 3M6IA 5A05A 1B3RA 2RCYA 5IN4A 4CM1A 1WWKA 1R0KA 3TSCA 4ZJUA 1GEEA 1YVEI 4I9HA 4GWKA 4JP2A 2BKAA 4GBJA 1EVZA 1TLTA 3C7CB 1ISGA 1HDGO 3JQCA 3RROA 3GT0A 1I30A 3ADOA 3R6DA 1ADBA 3LF1A 4ALKA 4CMEC 4Y6PA 1ENPA 1P1HA 2FZWA 3D5QA 4PLCA 3U62A 1JKIA 4HFMA 2EIHA 4MIYA 1X15A 4IY1A 4JQCA 3ASVA 3S2IA 3VH2A 3WGYA 4ZGWA 1U9JA 5ADHA 4K6FA 3S2GA 4NBVA 4DIBA 5LC1A 3D4PA 4WEOA 1UDBA 3NTOA 1SB9A 3BMOB 4ZQBA 1HL3A 4OAQA 1SNYA 5C7LO 4A2CA 2UYYA 5B4TA 5CAEA 3JQAB 3NJ8A 3I83A 5COQA 3LQFA 2Q99A 3ZNNA 4QTZA 3DBVO 3I6QA 1Y5RA 2Y0DA 1T26A 2BD0A 1ADCA 4YBZA 3HFSA 4BMNA 1CRWG 2Y99A 3K9QO 1N9GB 2VWHA 2ZB7A 3O8QA 4N54A 4AICA 3CE6A 1HDCA 1LDEA 4TKLA 4JBGA 1BXGA 3I9JA 1TT7A 5T67A 3VH1A 4WPGA 4H16A 5TT0A 4G65A 4R9SA 1I3LA 3F4BA 4OXKA 3E03A 4RVSA 4YWJA 5GZ1A 2VWGA 2Y1CA 1GYRA 3CINA 1EVJA 4XX0A 3ROQA 2HU2A 1JWBB 3TF5A 3INTA 4CMJA 4J49A 1ZZEA 1KYQA 4CM7A 3PXXA 2J6IA 4RVHA 1ZEMA 1YH3A 2C07A 3GNQA 2YQ4A 3DHEA 2HMTA 5TGDA 1KIFA 4JJIA 4BB6A 3SC4A 2B4TO 3PDJA 3V1TC 2GCGA 1H93A 1VM6A 4YDRA 4EUEA 4OH1A 3GVIA 1LRKA 4B3IA 1HDYA 3FBGA 2P9CA 3KYDB 1HE3A 1IL0A 3ZV4A 5JC8A 1YL5A 3OFSA 3FNHA 2ZKLA 4R4JA 4YAEA 4B7UA 3BXXA 2JCXA 3TFOA 1V3VA 3GR6A 4OOFA 4E2XA 6ADHA 3EZLA 1S6YA 1K0UA 3CH6A 4E0BA 3F9IA 3K31A 1HT0A 1NNUA 2CF5A 4I1IA 4AVYA 4J4BA 3N58A 1BVUA 4BV9A 3DFUA 2X9VA 4DL9A 1Y8RA 4R1UA 1Y7TA 4AJKA 1ZNQO 1BXZA 3TOXA 1ZIDA 2RHCA 1UUFA 4GH5A 4FR5A 5H82A 3WTCA 5TF4A 2AQHA 3F46A 2CZCA 2VOJA 5JNLA 3GAZA 4GL4A 3WX0A 4CMHA 3HADA 1I24A 5I7EA 2C5AA 5KCZA 3OIGA 4NI5A 3FI9A 5IG2A 3DAFA 2Y68A 3RUDA 3K2BA 1LXCA 3KSUA 3AI2A 1GCOA 3L0DA 2ZCUA 3PRJA 5C5IA 2PKQO 1O89A 1QR6A 2V6BA 1XQ6A 1Y9AA 4XQGA 5TT1A 4PRLA 3PWZA 3TNLA 1IHYA 4BO3A 2OUIA 4GMGA 3KYCA 1VRWA 2DBRA 3JQBC 4H15A 2GNAA 1JLLA 3WYEA 1HDXA 3ZU5A 1LU9A 4U0KA 4L75A 3AFNA 4TVBA 4YT2A 4IXWA 5A9TA 2O3SA 4Y6SA 4YRAA 3BHMA 4YACA 3RUIA 1MGOA 1TT5A 5JMWA 3UCEA 2VRCA 4OQYA 1ADFA 1UP6A 3GUYA 1SOVA 4XD2A 3PFFA 4IGFA 4I5DA 3PGJA 4ZQEA 1KEPA 3HDYA 4BVAA 4ZRMA 1G0OA 4A03A 1XCBA 1B8UA 3E18A 4CLEA 4FC7A 4IQ0A 2PTGA 3I4FA 3ICPA 1H2HA 3RBXA 5F1OA 2O3JA 1Q0HA 1DAOA 3MCVA 1HSZA 2GO1A 2NV6A 4D44A 1FDVA 3AUSA 3MJEA 2PZLA 3RJ5A 1VKOA 3INGA 4B4OA 3QLJA 4ZU3A 1YE3A 3H3FA 2VHWA 1F14A 2OXIA 4DIOA 5G4KB 4DC1A 2HUNA 3NDIA 4ESOA 3JSAA 3VPSA 1VJTA 1IPEA 1EQ2A 2G17A 1QORA 3H9EO 3L6DA 4D3DA 1MXHA 4BGUA 1QLJA 1YL6A 3WQRA 4DWVA 1R66A 1ZFNA 1VSUA 2W2KA 1A72A 3QY9A 4N5LA 2HLPA 1X14A 3W6ZA 3H9JA 4IINA 3IQDB 2ET6A 1SAYA 1VKNA 1TA4A 2FPGA 4R69A 1A4IA 1HKUA 1EVIA 1PS8A 1Z6ZA 1GQYA 3MJSA 3TN7A 2NU6A 4EUHA 3VVCA 3JQ7B 1ONOA 4PLHA 3BA1A 3Q9NA 4NU6A 1PWXA 2W90A 4PZDA 1EQUA 5B4UA 3TL2A 1GADO 4F6LA 1HWYA 3ZW9A 1Y1PA 4AJLA 1MUUA 3NV9A 5FF9A 2FZEA 2A94A 1PWZA 3ANLA 2IODA 3ZU2A 4LK3A 1UXJA 5IDQA 2BF7A 1EEHA 2WWRA 3EYWA 1VSVA 4J0EA 4DPKA 1BXGB 4IIVA 4OSPA 3B6ZA 5EESA 4Z0PA 2X5KO 4KZPA 3L9WA 5IDYA 2XOXA 3RUHA 4DPMA 3LT4A 5ENDA 4ZQGA 3GK3A 4JCOA 4EZBA 4YPOA 1WZEA 3FNGA 5HRUA 3ETEA 3FPCA 3KETA 5L40A 1HZZA 2D4AA 3AW9A 3PQDA 4OQZA 4LW8A 5HS4A 4HNHA 5I7SA 3KYCB 5CDYA 4GQAA 3RFXA 3GA0A 1K2WA 4XDYA 2Q46A 5ILGA 1G6KA 2FN7A 3WGGA 1E7YA 1OFGA 3BAZA 3IOYA 1VPDA 1NX6A 4M55A 3OHSX 1M66A 2AE1A 3AUAA 4L4SA 2Y1OA 2ZTVA 3PP8A 2Y1EA 5KVCA 8LDHA 4E6PA 1W73A 2I67A 3GVXA 5CPBA 5T8KA 2NNLD 2WSBA 4E2YA 2DBQA 4Q9NA 3RUEA 4E5YA 2O3RA 3QWBA 2HK9A 1DRUA 2VYVA 5LCXA 5ER9A 1CDOA 1I01A 3AM4A 4CLOA 5EINA 2AA3A 1NFQA 5T5QA 1CF2O 4XYEA 3CEAA 4LSWA 2GN6A 3JQ6A 3GUCA 3CZRA 5KVVA 3WB9A 2C0CA 5FEUA 2V6FA 1NQ5A 3NX4A 4FJ1A 4IMPA 1JAYA 1P1RA 1MC5A 2JD1A 2O3UA 3VPHA 3WJAA 5JBIA 2C54A 3W4IA 3JQFA 1NQTA 1ULSA 1LQTA 2DUWA 3V2UA 3D4OA 3Q2IA 1QV7A 1KEVA 2CDCA 5H83A 5JDIC 1H6AA 5DOZA 3JD2A 4OOEA 3IDSA 3ENNA 2W2LD 1NQAO 1DJQA 5DNAA 2YDYA 3L4BC 1R0SA 1UDAA 1F8GA 2ZATA 3KB6A 4OGWA 3ZWOA 1KEWA 4XR4A 4E32A 1ZEJA 1EDOA 1DHTA 2FPIA 4DTIA 3RFVA 2WE7A 2BFPA 2W2KB 2ZYGA 4GX0A 4R1TA 1DO8A 3H9QA 4CR8A 2GR9A 3IKVA 3LYLA 4MO2A 1M76A 3VDRA 1IHXA 1L7EA 2XXBA 3PHLA 4U8GA 2GLXA 1GR0A 2VZ9A 1EDZA 2VWPA 3PIDA 2H5LA 1HRDA 2CD9A 2CMDA 3FSRA 4R41A 3W8FA 2J5KA 1P74A 3KYBA 2AW5A 4E2ZA 5L4LA 2W8ZA 3WWYA 5TLSA 3LT1A 3RBZA 2E4AA 2Z1NA 4MVJP 5U4QA 1P0CA 2OO5A 3NRCA 3HZZA 3O8QB 4BNNA 1LA2A 3LC7O 4FW8A 4K28A 1ULUA 1KVRA 1E1LA 1Q2XA 4E5NA 2VTEA 4Y9DA 3H9GA 3GQVA 3EHEA 4R1SA 2DBZA 2WTBA 4LVCA 4ZQHA 1O95A 1DHRA 2I3AA 1RJWA 3Q2KA 4XB2A 1T2EA 5L7TA 1C0LA 1CERA 1YB1A 3ZNQA 1R4MA 3C8MA 4QO8A 4ALLA 4WECA 2BMAA 1KVUA 4PG7A 3PLRA 3CSDA 5BT9A 3GAFA 4EEXA 1YO6A 3HQ4O 1XQ1A 2NVUA 7MDHA 1JWAB 3CKYA 3GZ4A 3ZWYA 2ZQYA 3P2OA 3PGXA 4OMUA 4J4TA 5A5FA 5CDSA 1N8KA 3GFGA 4ZRNA 3I9MA 1WLYA 1HZJA 5JYDA 3KBOA 4Q3BA 4P22A 2DTDA 1DIAA 1ZMOA 5K0ZA 1X7HA 2RAFA 4Z9YA 1TVEA 1BVRA 2WD7A 1YJ8A 1BHSA 1ZCJA 5T8KC 1EFLA 1VL6A 2CNBA 1VE9A 3ZNOA 3Q3CA 4CM5A 3R0IA 3O4RA 1UZNA 1Z73A 1NQOA 1Z45A 2Q3EA 4L74A 1HYGA 4K1LA 1JA9A 4H3VA 1WAMA 2WMDA 4MP8A 4U7WA 4CQMA 4NBTA 3ANNA 1UXGA 4OYRA 3DZBA 1N9GA 1V35A 1MG0A 1Z82A 3H7AA 4QX6A 1U3WA 1V3TA 2VUTA 4KUEA 2O3TA 3GHYA 3HB5X 4EBFA 1B7GO 4NBWA 1NYTA 1Y8QA 4DLAA 4AL4A 3D4NA 3KSZO 3ZWPA 4ZD6A 1XHLA 3OBBA 4U6QA 1FDTA 3ZWNA 4NNJA 2V65A 5ICMA 2ZYAA 2PK3A 2NACA 3UHAA 2H9IA 1I2BA 2PGDA 2VUSA 4LGVA 3WMWA 5ILOA 3SBOA 4PLWA 4WCDA 1A7KA 3EGOA 5JDCC 3U4HA 1W0CA 1YQDA 3HDQA 5JCXA 5JPIA 1MXFA 3F4LA 2QYTA 1GUFA 3WXBA 5COAA 3BMNB 3KRTA 4RF2A 2BI7A 3SEFA 5JC1A 4UVIA 4R68A 4WJZA 1ZO8A 2GERA 3E6AA 3OQ6A 5THQA 1P44A 3GF4A 3KLMX 4KUHA 2X0IA 4K26A 1FDWA 1R16A 5C3MA 4YRDA 3FN4A 5AVOA 3DMTC 4JROA 2JJYA 4PLTA 4BNZA 2GF2A 3K5PA 2HSDA 1LEHA 4FJ2A 1LUAA 1UAGA 4WKGA 4IDAA 4NJMB 5KJEA 2EJWA 5TX7A 4CLDA 3N74A 1M6HA 2X8LA 4OKNA 5EERA 1W4ZA 1LC3A 1U3TA 4WLUA 3QRWA 1P1IA 3ROPA 3V5NA 1WDLA 1TB4A 5EMHA 3H4VA 4D0SA 1XEAA 4R51A 1N5DA 3AY7A 5BSGA 2FWMX 4OJNA 4RDIA 3ZHZA 2PKQP 4CM9A 1O94A 2J5QA 2NM0A 1ZVMA 4DC0A 2PKRA 1TEHA 3INRA 2YDXA 2RH4A 1B15A 1NTOA 3DR3A 1JAXA 2X9GA 3GMDA 4II3A 2YUTA 3ZI0A 4Q39A 4Y67A 4RF3A 1GQ2A 5F1KA 1WMBA 3UN1A 1EZ4A 4YR9A 3P5SA 1LBEA 1U8FO 2J3HA 1E5LA 2YYYA 1CQIA 1D4FA 1A5ZA 2PGJA 2G5CA 1S7CA 3GHHA 3F5QA 5FFFA 1OBFO 2FPPA 1GUZA 3QWHA 2DLDA 1XWFA 2G1UA 1IUKA 3ZHYA 4UVHA 4YVFA 3VPFA 4E33A 4YT8A 3AUTA 1PL6A 3OQ1A 2UVDA 3MJVA 3V2HA 2AXQA 4ROSA 3JYQA 3ONFA 1A9ZA 3WYBA 1L1FA 2X86A 3CXRA 5JDCA 1QYDA 3ETGA 3EMKA 1GEGA 1QYVA 4F46A 3AM5A 2EKQA 2EF1A 4TZTA 5IFLA 4XQCA 1ONNA 4J1TA 5IXSA 3TZKA 2JHFA 5ENVA 1PJQA 1C3VA 2O3QA 4FFMA 4WOJA 4BKQA 3QHAA 3B70A 2QX7A 5KVQA 2OL4A 1LX6A 4BNMA 5TC4A 1O9BA 4E5MA 4XJTA 1PGOA 1YGYA 4W6ZA 2VN8A 1RYEA 4E31A 4MKXA 4A0SA 2AG5A 3QIVA 3DO5A 2E37A 4UULA 1HETA 3H2SA 4F3YA 4Q3AA 2Q4EA 4LCEA 3ZHXA 3U4IA 3L4BA 4BO2A 1R15A 3OA2A 3DZIA 4TRNA 5MGBA 3NT2A 1E1NA 5U1PA 4MVJH 2I65A 1JKJA 2EV9A 2JAPA 4I5FA 4PG8A 3G0OA 1C1XB 3UVEA 1DC6A 2BGKA 3ZWAA 1H5QA 3LF2A 2Z95A 3DB2A 4NJMA 3I23A 1PQPA 1BMDA 8ADHA 2Y1FA 4O0LA 4GVXA 1J6UA 4RL6A 2D2IA 3VVBA 2HQ1A 1AGNA 4AJIA 1PU2A 4KWHA 4ZN6A 1KETA 4WOKA 2BGLA 4WCFB 4XDZA 5I8WA 3WFJA 1I5RA 3NGXA 3MJ4A 5L4NA 1NHWA 2Q49A 3VH4A 3DWFA 1UJMA 1BWSA 3H2ZA 2BLLA 4ONEA 3PK0A 4DYVA 2Y93A 4LRTB 5DCYA 2D3TA 5HS6A 3T7CA 3UOGA 4XJSA 1BW9B 2VHVA 1KY5A 1NPYA 1IZ0A 1RM3A 4GKBA 1GQQA 4BKOA 3MWDB 2P91A 3C1TA 4BMSA 4C7KA 1PGQA 1KC3A 2QRJA 1N7GA 2YFQA 1R6DA 4FFNA 1BW9A 2G76A 4IJWA 4BB5A 6LDHA 4L0QA 4DLLA 4PLPA 3EVTA 2GN9A 1YBVA 1DEHA 3C1AA 4Y6RA 1GDHA 4YAGA 3PQEA 3S1LA 1CETA 1DIRA 4AJ1A 1CIVA 2AQKA 2PZJA 4HV4A 1N7HA 4N18A 4CM3A 5BNIA 4DRYA 4ND5A 3WGHA 1CYDA 2HO5A 1ZSYA 2B4QA 3WGOA 4AJOA 1PJBA 2J3KA 2P4HX 1E7WA 5AXAA 1ZK4A 1ENYA 2IXBA 1OC4A 3WDSA 3QSGA 4BKRA 5BNTA 1KVSA 4EJMA 3G1UA 3OETA 1V3UA 4UVDA 2EHDA 4UREA 5JS6A 5TS3A 2GUGA 4RQTA 3GDFA 4BQRA 4EJ6A 4Q3CA 2B5WA 3AI1A 3JD0A 1QKIA 2UDPA 1LSUA 1H94A 2PFGA 3RC1A 5TNXA 3BTUA 3F3SA 3H3JA 1NXQA 2FP4A 3I4CA 3JQGA 5CEEA 2YHUA 3JD1A 3ULKA 1H0KA 4E12A 4QFDA 3S2EA 5TSDA 1J49A 4TRRA 2C5EA 4XQEA 3RC7A 4BV8A 4RF5A 2OZPA 1EMDA 4BNYA 3PHHA 1DC4A 1OOEA 1U4SA 4Q3NA 3RKUA 4L4RA 3C1OA 3RCBA 2VHYA 4CV0A 5I7FA 1ISMA 1BXKA 4RVFA 5IJZA 2HJSA 5KJCA 3EZYA 2Q4BA 2VHXA 5A5EA 5JCJD 4X54A 2NU9A 4WLNA 4M8SA 3P2YA 3K92A 1PQWA 1ZH8A 1LDBA 4CUZA 1LDGA 1YS4A 2BGMA 3VKUA 1J0XO 3RU7A 5IDXA 3E8XA 5JO0A 2OBNA 4GMFA 1EK6A 4NU5A 1OZAA 1XU9A 3I9NA 3PZRA 1WVGA 3WNVA 2VYNA 2VYVD 5AYVA 4RZIA 2J3JA 1ISHA 4EW6A 1Z75A 4BNXA 2POQX 3KEOA 5G0VA 2HK7A 1QP8A 3ZV5A 1D3AA 4E3ZA 1BDBA 1LI4A 1IOLA 2WM3A 5DOVA 4BOYA 2IDZA 2ZTMA 1J4AA 3FTNA 1HDOA 1HE5A 2Y67A 4OM8A 4O63O 4J7UA 2UV8A 1C0PA 4WLFA 3RUFA 5BSEA 3K2EA 1QYWA 1UAYA 5K6AC 1ZK0A 4Q3EA 1ZBQA 5B12A 4W9NC 2UUOA 1PR3A 1A7AA 3CUKA 1Q7BA 3WGIA 5KIAA 5TQVA 2NADA 1JVBA 3WGQA 1I10A 4Y8VA 4MKZA 2JKVA 1QYXA 1WMAA 2D1YA 2DT5A 5JW6A 3D3WA 2HKIA 1PZHA 1WP4A 5LDGA 3FCOA 4E21A 4A27A 3SVTA 4YXFA 2X0NA 2TMGA 4EITA 2OBYA 3ST7A 5EJ2A 5L51A 4CLHA 2BRUA 4XGNA 2GN8A 1Q1NA 1T25A 3BMQA 4R5HA 2FHSA 3MTJA 1O5IA 1RWBA 2H1SA 3AUUA 3PVZA 5EN4A 4W82A 5G0SA 5JY1A 4DYDA 1YB5A 4B3HA 3ZWXA 3IMFA 4KQWA 1T4BA 2DC1A 4ND3A 5F5LA 1U3VA 1ORRA 3LC2O 1PSDA 1PS9A 4YQZA 1QMGA 1D7OA 2GZ1A 3GDGA 3RU9A 3X2EA 3AM3A 2VRBA 3RAJA 1Q7CA 2ZQZA 3UFXA 4CV2A 3VPGA 1FK8A 2I3GA 4OL9A 3Q11A 4BKPA 4TROA 3GNTA 1BTOA 1P1JA 5DT9A 1QRRA 2FOIA 3M1AA 4QEDA 4YTEA 5CP8A 4INAA 4DXHA 4JJFA 3TJRA 3E48A 2Y66A 4A5OA 1I2CA 4NFYA 3WOHA 2TMDA 2P68A 2VQ3A 2I6TA 5ICSA 1H9BA 5HM8A 4KMSA 2QZ9A 2GPTA 3DZGA 3OJEA 1NBOA 4MVJA 2RH8A 4B8WA 2VHZA 4WGGA 3AOGA 3GVHA 2XAAA 3C85A 2NLOA 2A92A 3JQBA 2YV2A 3FHLA 2OGUA 2VRCD 4JBHA 3VZRA 3FR7A 1BG6A 4D3SA 2VCYA 3RWBA 3WG9A 2AHRA 3GY0A 4IBOA 4P38A 3MOIA 4NK5A 4L9RA 4DMLA 3FRJA 5CFZA 5I9NA 3DZHA 4EI2A 1U2GA 4NQZA 1IB6A 3ETDA 2GZ3A 4FDAA 3RC9A 3MEQA 5DBIA 3A9WA 4UEOA 4K9DA 2NVWA 1A4UA 1I33A 3I6IA 5DZSA 5T6BA 3BMNA 1XSEA 3D1LA 3NUGA 1LNQA 3K96A 4KUGA 4BO7A 3AK4A 1NFRA 3WTBA 2E48A 2D5CA 4JGBA 1U8XX 1HSOA 4FD3A 5JYEA 5G0UA 3IJPA 1RM5A 3QWFA 3DZJA 1CWUA 1XG5A 1PJSA 4FJ0A 4YAIA 2H6EA 4J6FA 1LSOA 3GPIA 2X4GA 4I5GA 3RSHA 3SX2A 3H9UA 2OP1A 4WE3A 1XU7A 4KTTE 1DPGA 4CMGA 1ZSVA 3EDMA 3EUWA 1T1RA 3DTTA 4D7AA 4FSHA 3GOHA 2PZKA 3ZU4A 3WICA 1P0FA 2J8ZA 4Z9FA 3KO8A 4J3FA 3DMTA 4J16A 4XGKA 3WIDA 2QW8A 4PRKA 1HLPA 3NT5A 4AJ4A 3ZWWA 4GLLA 2GSDA 4IDCA 4J1QA 3LLVA 4IS3A 3QVXA 4HXYA 3L07A 1XR3A 1ISFA 3O38A 2GYYA 3NJ4A 2QQ5A 5CG2A 5JY6A 3JD3A 2BFAA 1GL3A 4NZ9A 3WWZA 4RCVA 3E5MA 5AOVA 3QP9A 3EK2A 4PZEA 4NBRA 4RPJA 4BNFA 4YAJA 5IDWA 1MG5A 2PA3A 2ZB4A 4NPCA 5CDUA 1XGKA 4IMRA 1CJCA 5L3ZA 2GASA 4PGFA 1ISJA 1B3BA 2Q1WA 2XPCA 3GMSA 1P45A 4B79A 4IZHA 4MVJM 3OIFA 3OH8A 1T2CA 1KVQA 2OMEA 3OQBA 2SCUA 2WYUA 3OJLA 3C24A 4RLSA 1YB4A 1HE2A 2E49A 2G82A 2YW9A 2ZK7A 4DQUA 3EAGA 5C7OO 5JE8A 3UGKA 3TL3A 4BS9A 2W4QA 1EK5A 2AEJA 5JCJA 3I1JA 1ZW1A 3D0OA 4WK6A 3VTZA 1QXSA 4OKIA 2P9EA 2OORA 1E6UA 4O5OA 5IF3A 1RM0A 1EBFA 3FD8A 2WE8A 2B5VA 2X0JA 3SC6A 3JYOA 2IRWA 2XF8A 1XLTA 1YOVA 3GZNA 4D45A 1JVSA 3R3SA 1FDUA 4NJOA 4QSMA 1K6XA 1M2WA 2JFHA 3F6YA 3NKLA 3DOCA 5C7IO 3HJAA 3DBLB 4KDEA 4A26A 1GU7A 4B7CA 1NM5A 5KJFA 4PLVA 3U5TA 2CUKA 2B0JA 2VYND 3GGOA 3L9XA 4R1NA 4BO0A 3GEDA 3DL2A 5K6AA 3O03A 1VC2A 3WFIA 2YV1A 1OI7A 4Z6KA 3IP3A 3UXYA 2GN4A 4NR0A 1BSVA 3LT2A 1Q7GA 3JQ8A 1FXSA 3FNFA 1LTHR 3PLNA 4MP6A 1E77A 3WQSB 2VOEA 1WPQA 1EE9A 4IGEA 5KOIA 1NR1A 4IDGA 4DQXA 2ZCVA 3JV7A 3AFMA 4BNVA 3VH3A 4B4WA 4BO1A 1U5CA 5DBGA 4XA8A 2CVQA 4E4YA 3D3EA 1DFGA 4ND4A 4BNTA 3MJCA 5KTKA 4I08A 2AE2A 3OJ0A 1W8DA 3RFTA 2IZ0A 4XIYA 4PVCA 3EVNA 3VDQA 1PL7A 4ALIA 3ZHBA 1MLDA 3STHA 3F47A 5I9LA 1L7DA 4EGFA 3VOSA 4F6CA 3IKTA 3NEPX 3QV1A 5DBFA 4CUJA 1GD1O 3LLSA 2GRAA 4GX5A 3IIEA 1AE1A 5BSHA 2R00C 4XQ9A 1MX3A 1PX0A 3RQSA 1X7DA 4YT4A 5B1YA 3M2TA 3CPSA 4GX2A 4ZICA 3ZCXA 1DLIA 4FPXA 4IPTA 1E6EA 1JQBA 2I9PA 3LVFO 1JU9A 4BGEA 3VAZA 1DC3A 1I3KA 3JQ9A 1SC6A 4GGPA 2PWZA 4KTVE 1SOWA 2WYVA 3HN2A 1XKQA 2HRZA 4LRSB 1K6JA 4O59O 1E3EA 2VZ0A 5ES3A 1DRWA 3ZV6A 2QIOA 1EFKA 1MFPA 3WIEA 1VJ0A 2Q1SA 4G2NA 4L76A 4WNIA 1LSSA 1DC5A 3AWDA 4C4OA 5A04A 1NWHA 4NBUA 4XRRA 4CM9D 2B35A 2Q1UA 2VT3A 3QVSA 3L6OO 4CMEA 2NSDA 1U7TA 3GRKA 5IN5A 4HKTA 5K9ZA 1D8AA 3WBBA 4D3FA 2W98A 4LSMA 5TIIA 5G0TA 2VZ8A 2BELA 1ONPA 1GUYA 3DAGA 4PN3A 1YBMA 2EJVA 2JD2A 3KHUA 1Y8RB 3RIHA 1X0VA 4OHUA 1JTVA 1ZK1A 2PLAA 2ZIZA 4J9UE 3DXFA 4KQXA 3LSYA 4BKUA 4RPHA 4CLRB 3QVOA 4CLOB 4ND2A 4KWIA 2YQ5A 5EQDA 5KKCA 4QQRA 5DCWA 4RJTA 2NQ8A 4YJGA 5L45A 5CEFA 1YDWA 1G0NA 1DLJA 1K6IA 3T4EA 4Q3DA 1ZJYA 1U5AA 3M1LA 1GZ3A 3GDOA 4BIIA 3OECA 3P7MA 3Q0EA 4PG5A 5L95A 5AXCA 1E92A 3PYMA 3TWOA 4I9NA 4BNJA 4ITUA 3D5TA 1BRMA 1DOHA 1H6CA 3B1KA 3GNSA 4RPKA 1M67A 4WNCA 3JTMA 4YEDA 3DTYA 1LRJA 3WBFA 1LLUA 4BO9A 4CMIB 4XZ3A 4XYLA 5DP1A 4PLZA 1GZ4A 3WNQA 3UW3A 2LDBA 1Z7EA 3OJFA 1YONA 4MVJG 4CQLB 2BFOA 2DPGA 1DXYA 2HRBA 2C2YA 5EQFA 4IDDA 1YXMA 4RPGA 1Y8QB 1VL8A 2C7GA 2XXJA 2O23A 4HWKA 3L6EA 5U9CA 4ILKA 1H6DA 2DTXA 4R16A 1R37A 3CMCO 3MZ0A 1H9AA 3PJEA 4TRMA 4PG6A 1C0KA 3GLQA
chains in the Genus database with same CATH superfamily
1RQ7A 3G9ZA 3R20A 2OXRA 1E61A 3W05A 1W87A 3EVCA 3LW7A 5BXQC 2UYOA 1ZONA 5CFPA 7ABPA 1EIZA 1L5MA 4OTZA 1IONA 2CFTA 4FVTA 1O8BA 4QHYA 4HX5A 4M3NA 4HNTA 4PC6A 4L78A 1ZKMA 4G67A 4B3BA 5EKUA 5EJGA 2PY6A 3TRFA 2X1MA 4HBGA 4N5NA 3WJ7A 1F1BA 4NVRA 2V0NA 4FR0A 1IVNA 3AFHA 1X0XA 1SH7A 3A6GA 3H1EA 4ZEOA 1QHSA 4ZO4A 2PAAA 3V8BA 3FPLA 2OCPA 1E2IA 4RMNA 5JEDA 1X1EA 2RJ3A 5A4JA 3UEOA 4RH3A 3OQNA 4Y2RA 1Z2OX 4FB5A 2HF9A 2P2SA 1E0SA 5DN9A 3ZGYA 5KSWB 3OICA 5JAMA 1KIAA 1TMGE 3PC7A 1I1QB 1SCBA 2FPKA 3RS3A 3RHFA 4D0GA 4X8HA 1YQTA 3BXFA 4A6PA 5EWLA 1G3IA 1ZQ9A 2QMUA 4H1UA 3UB4A 4J0DA 2DWCA 1LLDA 4EVIA 2PGXA 3K6JA 1N6LA 5REQA 1XKLA 4JR0A 3I04A 2QVZX 2FMHA 3H19A 3IPYA 3P19A 5KKAA 4P4LA 1T2AA 2LWIA 3FPGA 1H1TA 3TVTA 4BN5A 1ZK2A 3WI7A 4F97A 5H4GA 2FCAA 2I8AA 3A32A 4H6XA 3BIXA 3S2FA 5JV5A 1QFMA 4PGGA 4GSKA 2EQ5A 2XA9A 2YZKA 4PCAA 1PG5A 3QW4B 4RACA 5LYJA 1AHHA 1LC0A 1Y4SA 2H1VA 3CH5A 3NNSA 4DCPA 4EKEA 1TECE 3JQAA 5FWDA 3NWOA 3MMSA 5EL0A 2Z5VA 5BYJA 5FNZA 2F9LA 2R44A 3AF0A 1VLLA 2JFYA 2N42A 2VSNA 1OAKA 3ANTA 3HYCA 4HNQA 3ZU3A 3K94A 3MGKA 5CG1A 4CIWA 1J0DA 3HCEA 2NTYC 3GWZA 3U4DA 1IULA 2FSVA 1C14A 4ZV9A 4URHA 1OF1A 1IM5A 2R7AA 4N5HX 2X0DA 4N03A 3AJ9A 2PSJA 1DI0A 3DMHA 2Y92A 4PPNA 4UJ3A 3WRXA 2ODEA 4KX5A 4Y6GB 3QVTA 5TQ2B 4BZZA 3ZDQA 4BPBA 2AXNA 1WXDA 2I34A 1G8GA 1EWQA 4DCVA 1JBKA 3K9FC 2WIFA 5ECGC 4UHBA 3ROGA 5JSFA 1R5BA 1J00A 1MV8A 2CE7A 3D6UA 3NYQA 4OHVA 4YRBA 2C4VA 4DXDA 3VHXB 2E0IA 1CUJA 1TMYA 2AGVA 2A9RA 3CR7A 2CSUA 1EUDA 3GFBA 3I2HA 3H5RA 4KO3S 5LZ4A 1AOXA 1ZNXA 3HSKA 1MDFA 4JITA 1H9CA 3JQDA 3RW9A 1U8YA 3I0ZA 2PTHA 3QPBA 3S55A 4CM6A 2FF7A 4HYEA 2FG5A 3RSCA 4UXIA 4BUCA 1PJLA 4ZK6A 4UUPA 3W9UA 4Q7KA 3WS7A 4AD8A 1COWA 5K7SA 2DJIA 3JD4A 2NV0A 3RT1A 2X7HA 4DM4A 5IH3A 3PDIB 2R2GA 3KHTA 2HC9A 1JIVA 2RK6A 4B46A 3U3XA 2H54A 2JJ1D 3KUXA 2XV1A 4ZPJA 2GN1A 4IX9A 4C1BA 2LRHA 2OESA 4EGSA 4ZGGA 3GJSA 4AG6A 1IDOA 2PL3A 3E5RA 4GLOA 4KPUB 4MV8A 2QRUA 4QGAA 4LF6B 4CKZA 1ODCA 2CCKA 1DEAA 4Q1FA 4ZDKA 3O2NA 3QJGA 1W1WA 2XJ9A 2ZI7A 5C8YA 2Z57A 4Q9HA 3SICE 4AZVA 4MWOA 5JSHA 4BYGA 3KQQA 1WEKA 2HHCA 1JKMA 1PJ8A 1ZOPA 2Q3MA 3CZ9A 4PSVA 1DQRA 1QOPB 3FH0A 2QVXX 3VR5A 4GQBA 2Q5FA 4IWYA 1G60A 3ENQA 4HGOA 4CQJA 1PJ3A 4JU8A 3TLJA 3S0JA 2W6OA 5IVPA 4UAGA 2MCFA 1UK6A 4ETMA 1GKYA 5I47A 2ZBFA 4LY3A 2ENUA 4HAVA 1GZ5A 2X58A 4IHJA 2BBWA 5EPEA 5IRCD 1XU4A 2HRQA 3JWPA 1YHNA 3R0JA 4A8PA 3AF4A 3DDUA 2ZXUA 1L5VA 1R50A 2RGUA 5FHQA 2PX0A 1GAEO 1OFTA 1JEYA 1CE8B 2LV8A 3MFYA 5KWSA 4YI3A 1CUHA 3DHVA 4V0KA 4GYYA 2JJ1A 5BW8A 1NW4A 4HNGA 3VNUA 5BQFA 4BVEA 3KD2A 1M33A 4BVBA 2C03A 4MVJD 5DLQC 2K5UA 3BCHA 3IIIA 3TZHA 1DV1A 1DTWB 1REQA 2R1VB 3LT0A 1NMYA 2IUYA 2VAMA 4MW4A 1B8OA 2QJRA 2TRSB 4OJKA 4TKUA 5CM2Z 2ZZMA 2CYBA 1Z06A 2QZ4A 1GYQA 2P6NA 1E3JA 4NNOA 2V7PA 1Q0QA 1IY9A 5L6MB 2OKCA 4TWRA 3TTSA 5LL6P 2GCNA 5J5AA 1RM4A 1U1DA 8AT1A 2HF2A 3ICVA 5TRTA 3UWKA 5IXYA 4MRPA 1GCUA 2G4CA 3OC0A 2QTRA 3W4KA 3CVVA 4HB0A 3K72B 4WXEA 4K6OA 3TRHA 1P2BA 3V1KA 5IX8A 3JQ8B 1ZXBA 3DC2A 3EQ7A 1CZOA 3H5AA 3VSEA 1TGVA 4D98A 1RQXA 5AJTA 4QQFA 1KC1A 3PA6A 4Q93A 3IB6A 4DV3B 3BHNA 4FFOA 1KE2A 2YHIA 1FBTA 1UBNA 3Q85A 1I51A 2GXUA 2WUGA 5EZQA 5H5JA 2P4SA 4CU5A 4QTYA 3RSSA 1JH9A 3DDCA 1KSHA 2FSSA 3PC8C 1ZM3A 3DZCA 3PJFA 3WBJA 5KYGA 3U4GA 5E9WA 4ZVMA 2X7XA 3ECCA 2Q5EA 4LY6A 4B3XA 3EVFA 3MMXA 2BGIA 4BFVA 4A2WA 5D3ZA 5CDGA 2II6A 1WDKA 2CBGA 1C3EA 2GS9A 4MVJE 4X00A 3SMQA 5FWNA 4I9UA 1ZR4A 3LXXA 1YDEA 4WLOA 2I2XB 1H4TA 3WYFA 1JHUA 4BFSA 1EWRA 4AMGA 3FPKA 4YJ2A 1XA3A 4V3CA 3OO0A 1G21A 1Q21A 3F9RA 3KKNA 1SBNE 3MD9A 3ZVKA 1P7ZA 2FPPB 1HT2E 2AOUB 3F1LA 1A5BB 1DUIA 2RAPA 3AOEA 3GP3A 1ORVA 3HMKA 4K9RA 2XYQA 4EIWA 3K0CC 5DM70 4NHEA 2P3QA 1FS6A 2HA0A 2QNIA 2J48A 3OKAA 4M49A 2RJNA 3RK1A 3QBTA 2YNMC 4URXR 4BGVA 3IS3A 2O54A 2H16A 2FETA 4M6WA 1VMKA 3MIZA 4Y0NA 4CM8B 2Q6KA 1J8FA 1S2MA 2HMUA 3TTVA 3DLIA 3AHEA 1XTKA 3OZGA 3ZWVA 2ZYWX 4WEQA 5FUXA 3VGPA 4Z4IA 5SICE 1OLOA 2H0AA 4BVFA 3W78A 3I05A 3PSHA 4L85A 1H42A 5L9AA 3PZBA 3GAMA 2R8XA 4X8OA 4Y9UA 4BC1A 4BP3A 3RNLA 2EQBA 1UZUA 2IXFA 4HFNA 5T4FA 3WJ1A 4ZHSA 5K01A 1INLA 1ENOA 1T29A 2IWHA 1P7CA 1IXZA 1NUAA 2DPMA 5DULA 2ZWAA 4XLTA 2WHQA 3KJNA 5FOUA 4PU0A 1ZN8A 3ND5A 5AUOB 4DB2A 1VCNA 1QYIA 5EIAA 1GGJA 5G4KA 4DWJA 5C80A 1QBGA 3KTDA 3PXAA 4MINA 3WLJA 2X9NA 1NYLA 3O2QB 5K03A 1N2CA 3LHSA 3E7WA 4LWPA 3QYFA 2GF0A 2C7PA 3F74A 4PRZA 1C1DA 1Y6JA 2I3ZA 5C52B 4U3JB 3TI9A 2YZGA 3AU8A 4GXQA 1E0KA 1WQ3A 3W5SA 4BX2A 4Y9SA 5KWJA 1QR2A 3B78A 4QD3A 3TW0A 1M6VA 3ENKA 1H4QA 4DA9A 1YQGA 3N2NA 1XWIA 1KYWA 5IKOA 3CWQA 4DV0B 2IZOA 3GEGA 2ZBEA 1RZUA 5FRDA 3MVEA 6NULA 1LDNA 1PF7E 4G56A 3VOTA 2Q3DA 4PIVA 3TUJC 4JUAA 1JIQA 1Z47A 3T4XA 2GZ2A 1IXYA 3BXHA 1TC1A 3KAKA 3LT5A 3RYFA 3SF8B 2RJOA 1E98A 4CTOA 5HA5A 4MKRA 2BC9A 3EDCA 1I3MA 1WTAA 1LY1A 2AXPA 4WD3A 4IXNA 5IW8A 4RX1A 5JD6A 4LS3A 2VK4A 4I3GA 1FCJA 1LQUA 2C2WA 1QVAA 4GZ3A 1R0YA 2I1VB 2QJFA 2LGJA 4LWQA 4W9RA 4EDFA 4R3NA 3P20A 3UJNA 1PZFA 3SBDA 1MHPA 3DAYA 5CXUA 3C48A 6GPBA 3RASA 1DAPA 1L5FA 2VDNB 4LHVA 1HQDA 1JW9B 4IUCS 3Q87B 2RB5A 1Z2PX 4C4YA 1NVGA 2ZRQA 2GKSA 1QP4A 2WWGA 4YV1A 2BH9A 1SEPA 1WVIA 1YDGA 2ZTUA 4G1UC 4J2TA 3C6KA 1NRJB 2ZB3A 1WDMA 2AHOA 4QDKA 5EJ7A 1Y3HA 3IJ5A 1BHQ1 1WHSB 3BERA 4D42A 4H7EA 1NT2A 4KE7A 2I62A 1A1SA 1FQKA 3NH9A 5C2JB 5CFRA 1U2DA 1HLDA 1R9GA 3U2QA 2VFAA 3ZE1B 2ZXFA 4PC3A 1IZZA 1T36B 1EGAA 2E87A 3TKYA 5AI8A 2YZMA 1G291 1Q1GA 2ZJ0A 4GBGA 4BAZA 4RORA 3K5IA 4ER5A 4B6QA 1V16B 1HT1E 3H04A 3EVEA 4PZ0A 5IJAA 3Q8MA 3EG9B 1KAQA 3H1FA 4TUYF 3THOA 1SVSA 3AHHA 1B8VA 5DTQA 5F7ZA 3U4CA 5CB0A 2JH8A 1P4RA 4G9EA 4OYHA 3THXA 3IDFA 2QIPA 3ZKWA 4YAUA 1V1MA 5EJMA 3WK9A 5JATA 4P7FA 4CVNA 2XUAA 4Q05A 3O0TA 2ZR7A 3KR9A 1E3LA 4RA6B 4LNUA 1NN0A 5NULA 4NS4A 3WA6A 3JQFC 5DHTA 1DAEA 1EM8B 4FIDA 4RVNA 3O7MA 4M0FA 3KEQA 3ZX4A 4E5PA 2AOXA 1IOZA 1VI2A 2NZXA 4HDNB 4RNCA 3HA7A 4MPDA 2IOYA 3QU5A 5FI3A 4B71A 1DWOA 2V7VA 3DE7X 3TNFA 1X1DA 5LYYA 3TNDA 3QKSB 1SVOA 2FLKA 1TI7A 4UM5A 1ZY2A 4QGBA 1T9GS 3L8ZA 5DRTA 4LOHA 2AEMA 3LP8A 1PT9A 4M8IA 4IJVA 4Y6OA 2H18A 1VCOA 2Q45A 2L69A 3MTEA 4KDFA 4Z0NA 1U0NA 1X9GA 3S1AA 1MB9A 3NJRA 4DCCA 1LFDB 1ZD2P 4NE9A 2IBSA 3EQZA 1O94C 1XDUA 4HNAB 2XDQB 3LI2A 5CFQA 4DT1A 2DECA 1CQPA 1CUYA 2XRFA 4WCFC 3V1TC 4CG1A 3SGLA 4IM7A 1CFZA 1EFCA 2H29A 3E9NA 4FXOA 1QG6A 2VJLA 3G3EA 4KVZA 2X6TA 2WYOA 5I7VA 1E9RA 3F3KA 4EQ6B 2VXBA 1JLRA 3ESXA 1NC1A 3A05A 3NBZC 3SM9A 5L4SA 2FYTA 3HBNA 4H7PA 3SZLA 3MM4A 2CLLB 5AVKA 2W6ZA 1AMUA 2J9ZB 1MOQA 1ZUWA 3DEKA 1C1YA 1IMOA 2AFHA 3GFOA 2RSLA 3DDZX 3I30X 3IPLA 5EHXA 2D4HA 3ZLTA 1E2QA 3A37A 4KHPB 5JBNA 3Q9LA 2IZZA 3N7AA 4NL4H 4CEJA 1WMSA 5IZCA 2VXOA 121PA 2FHPA 3AG5A 1AQUA 4OLBA 5DSXA 5FOWA 2X3UA 3OPQA 4XASA 4NFLA 5THXA 2B1IA 4OEHA 2VDJA 3LHIA 1K89A 4S04A 3G8DA 5AXBA 4PFKA 3BA6A 2JHGA 4NYMQ 3EIUA 4JI4B 3A58B 3FYUB 3IQZA 2IEBA 2WUVA 2Y0BA 5E9QA 3V4OA 2C4MA 2G0NA 2NZ2A 1JRLA 4NK4A 1FXWF 3OM9A 2NPFA 2CVZA 1UQRA 3D54D 1YB2A 2V58A 1P31A 3M34A 3NOQA 5BN3A 4LF7B 1O9HA 5CNMA 3DMYA 2IOFK 3LC0A 4JBIA 2Q9UA 1HDZA 1JZTA 4WW0A 1D09A 1NBWB 3P9YA 3VNVA 3FDFA 1JR4A 5JI2E 3G0IA 4PO8A 3RVSA 3Q5EA 4O33A 1OBCA 3OPVA 2GJKA 1VKHA 1VIMA 3KQKA 2ZYUX 1G8AA 2HDHA 2OUKA 3HP1A 2Y1GA 3BX1A 3OOYA 1GPNA 3FUWA 3X0DA 4UU8A 1YK0A 2R97A 1TAHA 4LZJA 3H9CA 1GFSA 4PFQA 3FHTA 3LCUA 4HXEB 1M5UA 3GJTA 3ADPA 2XITA 3QYPA 3EXAA 4FX2A 3BE8A 3SM3A 1GTJ1 1ZVJA 2HRCA 1CUAA 2K2QB 2PUWA 3KXIA 3U4MA 4OQEA 1U8UA 3F6BX 1BS2A 3KAQA 4GPIB 3HDVA 4MRMA 4GC5A 1KKLA 2O4UX 1Q91A 1PTJA 3RU2A 3L0PA 4P36A 2NU8A 3S28A 1DKQA 1GPAA 2QD3A 1T5DX 3VR5D 3RVJA 2BHRA 1UWCA 2IPLA 1O54A 1SZJG 3MYRA 1HX7A 3A4YA 4K6KA 4PHGA 3TJZA 1Z5NA 4EGAA 2X8WA 1R9NA 1SU7A 1R12A 2C9BA 2NU7A 3IILA 4O1MA 4V3BA 3SBXA 5B30A 2AV6A 5JPCA 2RCNA 3IMCA 1OLXB 1KI6B 1JMYA 2P5TB 4Q9JA 1QGYA 1RKBA 2NT3A 3JZIA 4AY2A 1DB3A 4GVLA 1IBCA 5DDIP 1NP3A 1HGXA 3KV3O 4DV6B 2XMBA 3E70C 1QM5A 4O2BA 5H16A 1NHGA 3ICCA 4P4TA 4KPUA 4TV9F 1XP5A 3ZJ4A 1OR8A 1C3JA 3UAOA 4IOMA 4JP1A 1J0AA 1O0BA 3FBTA 3PQ2A 1PN3A 2FH5B 2G83A 4RY0A 4XUGB 4D43A 2HEGA 4E22A 3A31A 3RT9A 2HAEA 1JUDA 2Y1DA 3D7KA 1CT9A 3CVOA 3RVQA 3MGCA 1IBKB 3DNFA 1NJ6A 3O4GA 1FNCA 3W2IA 3U7GA 4W7HA 1OMOA 2F43B 2NZWA 5HCNA 5DGXA 4LXXA 4E94A 4EX7A 3RRZA 3ABZA 1L5GB 4OXYA 3OQVA 5GZ3A 3DCNA 3GCGA 2DERA 3KVOA 3EEIA 1AV7A 1ZUNB 3OF2A 1PI3A 2AK3A 4QPJC 1XEXB 1NVDA 1NF3A 3K35A 1C7IA 4ZI5A 2WDPA 3FG9A 4YMWA 1DCTA 4MYTA 3KJZA 1F0KA 1GZ6A 2BBSA 4ZHQF 1VDMA 5JXIA 4Z2AA 1TQ4A 1XZQA 1PGJA 2X5XA 2K4MA 4ZVNA 5J1TB 5LKRA 1FW8A 3AIKA 2QN2A 4OATA 4EABA 2WJYA 1DP4A 4XYMA 1DKRA 1NOIA 3E7DA 4KR7A 4BWVA 1E9DA 1ND5A 5DJ5A 5JLAA 4FGLA 3CW8X 2ZCJA 2B92A 3NIDB 3BUSA 3EIOA 5IAOA 4JODA 4W5QA 2RAVA 1KDOA 2FJUA 4YX9A 5A06A 2JVJA 1QE3A 3PHGA 5ETJA 3QEMA 1R4MB 1G20E 2D00A 1QF7A 2GPYA 2H5IA 3E82A 3JZFA 4HFRA 2WP0A 5DSTA 4C29A 3V7FA 2IXTA 1NMZA 1EM8A 3MBIA 4JSYA 2FX2A 3JALA 3VXKA 1JDJA 3EG5A 3U7QB 3LX8A 1O8CA 3CLRC 1FUYB 4P4NA 5CLJA 4MQLA 2JFGA 3WR5A 2GHQA 4HWPA 4EB0A 1OUMA 4AS1A 1W4LA 2O8CA 3O2SB 4JXKA 1L5LA 2ZUSA 3HJFA 1V9LA 5D3MB 3KYJB 1PCXA 1LPOA 1Y33E 4FBGA 1MEOA 4TN1A 1N5OX 1NVWQ 2AUNA 3LZ6A 2NUTB 1SC4A 4A92A 2IS1A 2EATA 2VTVA 1SBCA 2NZJA 3WL3A 3WZMA 3THWA 2FEOA 5E38A 1EFDN 1RT9A 1KH3A 3GLHE 2ATEA 3MS2A 4EW2A 4ZVQA 3V46A 1ECBA 2CKMA 4Y6LA 1CR6A 5IAJA 3PQ8A 5JO9A 4BRUA 3D02A 3U3DA 2WOOA 1DKOA 1C1XA 5CAEB 4POOA 2GBFA 3M2PA 3Q8KA 3DL0A 3I9LA 4PYIA 2X0KA 4JDUA 5CFLA 1R0LA 3DKIA 1QYCA 3JYPA 4S1VA 3B5JA 4HEA1 3G5AA 4UE2A 2QAGB 4BNUA 2ZI6A 2NU6B 3CISA 3JQQA 4BMVA 1U7WA 4KNYA 1L8AA 3WL5A 2WHYA 2NO7A 2IOHA 3GGGA 3Q8LA 3JASB 2A35A 2I66A 2IYWA 1KOLA 1XL0A 4UD2A 4N7RA 1BDMA 3HJBA 4Q6WA 1V6AA 2FEMA 3KVRA 5ALFA 5TR9A 4HEJA 2AR0A 2ATVA 1KBZA 4R8RA 3VHQA 1Z63A 2QLNA 1E89A 1NMXA 2I4IA 4IQGA 1PGPA 1W5BA 5LPNA 2RK3A 2DM6A 4R2WA 2WTUA 3NYWA 2HWXA 2PGLA 3G0CA 5J58A 4IJKA 5B58T 5K8JB 3KSBC 4TZ6A 1QZUA 2IYOA 1WTCA 2C58A 4D1YA 1U7PA 1A8PA 1TD1A 5LYJB 1LJ8A 1VMEA 1T5TA 3H8VA 4FZVA 2VEDA 3QVLA 2DT8A 2QTVA 3GPCA 4Z3DA 4OMFG 1GSIA 3OOHA 3P9QA 1IATA 1W47A 1L7XA 4FOSA 1YFLA 1MCZA 4MQ6A 4RVGA 4CIXA 5HZKA 3N6VA 4LHYA 3WNBA 4MWTA 2JI7A 1I9GA 4P33A 5BRJA 3EW7A 4EI7A 3WMEA 4J2HA 1SCIA 3G13A 2J3IA 2CY0A 2EHJA 4UU7A 5AESA 5JUWA 5KHOC 3PXEA 1PEKE 4MUFA 1IQRA 2PMEA 4WMLA 1S5PA 1EXNA 3EF0A 3K6KA 3SEQA 3I01M 3I39X 2A4KA 4FWTA 3RWOA 4KZKA 2HWKA 3BHJA 4F91B 2VIIA 3DUFA 1E1RA 3K0BA 4IXMA 5DP2A 5AUNB 4TYWA 1ZW6A 1B6SA 5KO2A 1O2DA 2O6HA 4Z9AA 2JAOA 3NNDA 4PPQA 2FXIA 1TVKA 2CD7A 1NVUQ 2GPWA 4TS3A 3VMFA 4ID3A 4ZWNA 3W5IA 4TPKA 4F4HA 1R9JA 3T9AA 3NTUA 4UEWA 1UXIA 1OXUA 3D8SA 4H3HB 2RIPA 3IQGX 4KFRA 5HWSA 2QDKA 3DVAA 4MWZA 2ECQA 3RIGA 1YB6A 3U7FB 2ZYVX 3CNBA 2JFOA 2X5JO 3GJ5A 1J70A 3NWBA 3JWEA 4HZUB 5HPYB 2IYPA 3RYTC 3NVDA 2EGGA 3SZMA 3DE6X 1ZCFA 3T9BA 1G8HA 2HX1A 1N0VC 4D5EA 1M6WA 3IKJA 3P45A 4PGAA 4CTNA 4IMIB 3Q12A 1D1SA 3DAPA 2COEA 1SQGA 4G5QA 2F62A 3QVWA 1RXCA 2P1ZA 3UHOA 3VX4A 3P0JA 2CXPA 5C34B 1NXWA 2WYIA 4C7JA 1NAHA 2JIRA 2R6R1 2XVMA 4PO9A 3K0KA 1T9BA 1XLTC 2BJHA 2P9QA 2I4MA 1N3BA 3AJRA 2O2EA 3JQAD 3JYHA 3P2JA 1Q22A 1SG9A 4CL8A 4UHHA 1ORDA 1VE7A 4WUVA 3DV9A 5B53A 3VPXA 3GJ3A 3VR3D 3LRXA 1Z2AA 2ZUUA 3ZS8A 3OY7A 3KVNA 3G5TA 4IOJA 2ZTLA 3ZIAA 4TTQA 3TOZA 2WUWE 4Z4CA 1M1NA 1GSAA 3A4VA 2JLBA 4D4IA 2PL5A 4FTWA 4WKOA 2B7LA 1E4EB 2OG2A 2MINB 4JA2A 1A9XB 3BGWA 2R60A 2WFAA 4DCMA 4XYBA 4A8JB 4BQIA 1A95A 4TN5A 2WICA 5JNRA 4OYLA 4EW3A 1W8IA 2PLRA 2I1QA 4IGIA 2WJHA 4UTRA 4LY9A 4EVQA 1KO1A 2GHIA 5UKDA 3ND6A 4OBEA 2HA4A 1ZN9A 3VJLA 2J9RA 4DMFA 5FAKA 1IH8A 3IP8A 2BFBB 4XDHA 5LMZA 2VTKA 2P5YA 3FWZA 3K73O 2C82A 4GI7A 4BBZA 2PDAA 2PKXA 4FWBA 3HE3A 3PYLA 1P3Y1 3ZLJA 2VJYA 1FTNA 1FVXA 2UZ1B 2X0RA 5EEHA 3VR4A 2ZBUA 3KOXA 3PR2B 1A96A 3OP4A 3I28A 3I6BA 1UEXC 2ZRNA 2JGMA 2ZBQA 4PLFA 2RI6A 2J6BA 1P4SA 3P2IA 1KK0A 5A3JA 4RHFA 4GPD1 3HZHA 4P6VF 4U2FA 2QRKA 3AEXA 2HMVA 4BHTA 3DBLA 4GP7A 5CB4F 3NS7A 1QGED 4MAMA 4QQNA 4OL0A 1XRLA 1XNHA 3I8XA 5BSTA 1T91A 3VTFA 3OA0A 3VKVA 3LUJA 5EIEA 4I55A 4PAQA 3RVBA 1C8LA 2VDKB 1SB8A 3L6BA 5FPSA 2OHHA 3B60A 5GWXA 5CIWA 4TL7A 2JPDA 3F98A 4HD8A 2I71A 1T9AA 4CM1A 2CHUA 1GPLA 2K2WA 3ER6A 1X80B 2VLIA 2W70A 3VPDA 1O9GA 2ANBA 4ENVA 5HM6A 1M2NA 3VSCA 1T4MA 3QJYA 3IAUA 4QGHA 4JP2A 3TQFA 1FDRA 3ZE6A 2BM0A 1EVZA 1E63A 1L9KA 4EPWA 2AH5A 4LXYA 2GK6A 2IW1A 3HKEB 1U2GC 3MGBA 1ISGA 1HDGO 1YKGA 3JQCA 3Q2OA 4FMCF 4OB8A 4X94A 3RROA 2Y6UA 3H4MA 1F38A 2XXAB 1BYIA 1OKKD 2WWHA 3IAFA 4CL2A 3OZCA 3DLBA 3L40A 2JZCA 1P1HA 2E18A 2JGFA 4UBOA 3AEQB 4JB0A 4MH0R 1JKIA 1DJOA 1RYBA 2YRWA 2Q3FA 3ZHUA 4IY1A 3DLCA 3ASVA 3LCRA 4JQCA 3VHLB 4DJTA 4JFRA 4E1VA 1U9JA 2ERYA 4ZGWA 5T3UA 1TAUA 2QLFA 2QRVB 5D8DA 3S2GA 2PS0A 2GBLA 5LC1A 1YJ5A 5IS2A 4JJ4A 3PVCA 4FHGA 1ZHFA 3D4PA 4LRXA 3NTOA 2V5UA 4WZBA 3UUEA 4QXOA 1HL3A 4OAQA 1QC5A 4ZVLA 5C7LO 3EMBA 2JI6A 2A0XA 4M53A 1IK6A 2UYYA 2QTBA 4ND6A 3NJ8A 2JHCA 1RBMA 2Q99A 4TLAA 2IX3A 1Y5RA 3SZRA 1ADCA 4YBZA 4MTLA 1TVCA 5SZIA 3QFTA 1CRWG 1F0PA 2F3TA 3PD1A 2ZB7A 3O8QA 4CHGA 1HDCA 3X3HA 1E1QA 5GONF 1ATIA 1Z17A 3ZV7A 2EEPA 4TKLA 3NP9A 3WFZA 1K5DA 3N75A 4GPBA 4DWOA 4DG5A 2C9MA 3DMRA 4QUIA 3LBHA 3MCAA 5T67A 3VH1A 4WPGA 3ZE7A 4G65A 3GH1A 4OXKA 4EG0A 3HSSA 4ICIA 1A77A 5A71A 4ZQIA 4EQ6A 2OFOA 2Y1CA 4L5IA 4MS1B 1GYRA 1CR2A 2V7BA 3OQPA 3GRCA 3OSZA 2FSPA 1X7WB 3CF2A 2P7IA 5FEMA 1KZHA 4D5GA 1Y7PA 5AK0A 5JH7A 4UM8B 3TF5A 3INTA 2VYFA 2Y8EA 4MSUA 2R8BA 4RABA 2PX8A 4A1OA 5JSKA 1U7UA 1MGPA 2J6IA 4HDRA 3N07A 4RVHA 2JGLA 5IUJC 2J0QA 3LBAA 3WGNA 3DHEA 5TGDA 3S1AB 2YC4C 4Y2JA 4BB6A 2C96A 3P71T 2NXEA 3QM1A 4F9EA 5B7PA 3E58A 5LP1A 2O5CA 3SPXA 1F1JA 1G2QA 1VM6A 1M83A 1Q11A 4YDRA 4EUEA 1W6RA 2G9QA 4OH1A 3EX7C 1G6Q1 3GVIA 3HGMA 4RD1A 4I50B 1PFWA 2AT1A 4CKBA 4JB8A 1HE3A 2ZSIA 1EDBA 1IL0A 1W94A 3QLUC 3QOWA 2G1AA 4JP8A 4O4LA 3VV3A 4QUJA 2R0QC 1Z29A 1VLZA 3VKWA 4LRWA 3BXXA 2JCXA 5BNZA 1RHUA 5HDBB 4OOFA 1XL1A 4XJXA 2E1PA 3HKEA 6ADHA 1MX9A 1VRVA 3I42A 1NNUA 3EIEA 4RC9A 4DM3A 1BVUA 1TZCA 2REBA 2MT9A 4BV9A 1O6FA 3BDIA 2D1FA 3IDAA 3KALA 1Y7TA 4AJKA 3D7SA 4JCCA 1ZNQO 4OQFA 2GEFA 3N87A 4TYPA 2RHCA 4H59A 3IMGA 4FR5A 4EKYA 1F8XA 4Z4HA 4GP6A 3LCVB 1OU0A 3OKFA 4BU0A 2RKWA 4N6OA 5JT1A 2AQHA 1GTG1 1A7UA 1T9GR 3B3GA 4BLUA 2IZ7A 1I24A 2VHTA 4DBLE 4QLBA 2BFDA 5CNKA 4NI5A 1XZCA 2IYNA 4X71A 2GPBA 1YCFA 5IG2A 2V96A 2WA1A 3LUDA 4CEHB 1AC5A 3A1FA 1TUEA 3T5AA 1EP3B 2V3CC 4CT5A 1YVRA 5AK4A 1O89A 1L4BA 2YUIA 1QR6A 2HL6A 1FPQA 4K40A 3GRVA 3QBDA 5TT1A 3AB8A 3PWZA 2ES4A 3FDIA 1XPOA 3K09C 1FSGA 2P62A 3EN0A 4GUAA 3T06B 4B17A 3JQBC 2DBRA 2WTXA 4H15A 4MO9A 1JLLA 2WT9A 2MR5A 5EG5A 3RLIA 1HDXA 1SKBA 3KR2A 4H1TA 4KBYA 1RVV1 4U0KA 2JDIA 3HRIA 1JHPA 1UDRA 4XFKA 4OI1A 5JHHB 3S6JA 1KQNA 5A9TA 1CRLA 4Y6SA 4DAOA 4PONA 3OFNA 4YACA 1ESCA 1KY2A 4E09A 4YDQA 1A9XA 2VRCA 4OQYA 1WXQA 3N05A 5ALKA 3MB5A 3H11B 4IUBS 4NMXB 3PFFA 2AC2A 1MRZA 2QTCA 1KEPA 1O87A 3BMXA 3I9V1 4JI1B 4TSFD 2PFKA 3A1EA 2AUTA 2QYHA 1UK9A 3E18A 4JD5A 4FC7A 3U81A 4EO9A 5K3OA 4AB1A 4U3JA 5HKKA 2CHQA 1IZ8A 2VH2A 4YUYA 2O3JA 1KI1A 3IOBA 2ZBPA 2GO1A 2PMFA 1GNVA 1M2HA 2YVLA 3RJ5A 3NNNA 4WOCA 5AM5A 2OXIA 3T34A 3H3FA 2VHWA 1F14A 4K3UA 3EF3A 1N3IA 3TR6A 4DIOA 5G4KB 3PC4A 2HUNA 5FO1A 2H5JA 1FX1A 2YJ4A 4W5HA 5G1NA 4BLWA 2JLZA 1YACA 1EQ2A 2IY8A 2D0DA 4D3DA 2B8NA 3BB4A 4ZMRA 4QDXA 1P5ZB 2AR9A 4Y2VA 1FSZA 3OZTA 2PBRA 2Q9CA 2NIPA 2Z08A 2MWMA 3M3PA 4N5LA 2HLPA 1ACLA 1X14A 3TBHA 2FWNA 3F2IA 3FKQA 3T7AA 3OC6A 3IQDB 3EPLA 2H4HA 3I0NA 2R7KA 1YJBA 1A4IA 3QUQA 4R69A 4X1YA 1EVIA 3KTAA 1PS8A 1Z6ZA 1AK9A 3A6EA 3CNNA 5E9AA 2QKYA 3MJDA 3OPYA 4PBRA 5U4XA 4PV7A 3U26A 4CDGA 2PPLA 1ONOA 2GAIA 2V1UA 4IO0A 4DFDA 3BA1A 5B58C 4WXYB 1SQ5A 3AFIA 3BQNB 1L7BA 3KJQA 3TL2A 4B75A 3NV9A 5HZMA 4EAAA 4V0RA 5JJ5A 1OHHA 3L7YA 2FZEA 5HZHA 4XPIB 4OHKA 3CB2A 1T0UA 3RE1A 2ZSFA 1EGVB 2IODA 1RD4A 5EZYF 3ZU2A 1SKYE 2KLHA 3BK7A 2WWRA 2WU3A 2XODA 3EYWA 3N6RA 4KE9A 1KMQA 4G89A 1BXGB 4D3XA 3ECSA 2B4KA 2PANA 4FYPA 4E7PA 1FMTA 4ZC8A 4F93B 3L9WA 1U0GA 5DYGA 1HE8B 4UNPA 3B12A 3DYVA 4EHDA 5AW0A 4P4SB 4UJ5A 5KSPA 1F2UB 3V8RA 2H06A 4DPMA 1VI5A 5K4HA 1OFUX 2CVFA 3CJRA 3LT4A 4U5XA 4P0PB 3EEBA 1TU3A 4CKXA 1K4KA 1VPWA 4NXNB 4C4ZA 2QUKA 4E1AA 3DQQA 1HZZA 3RFFA 1OQAA 2GBIA 3PQDA 5HS4A 5A5VA 1OIWA 3TECE 1MDBA 2QN6A 3DVRX 4WFJA 5AK5A 4DCSA 3LL4A 2ZUWA 3RFXA 3GA0A 2Q46A 4BMOB 3CF0A 4DDTA 4KPFC 1ZI8A 1PG2A 1G6KA 3GQBA 2PZGA 2R6CA 3WNCA 1U7ZA 2ZI5A 1F9EA 2VCEA 1N6RA 2XD4A 2ZYTX 5KYKA 5A0FA 4ERXA 1XLUA 3LYHA 1R27A 2R7LA 4JI2B 4EYKA 5KVCA 2WNIA 3TPFA 1W73A 2ONZA 2Z83A 3QEKA 2PQMA 4HMQA 2NNLD 1FYFA 4QRHA 3U3KA 4E5YA 3UB3A 1TYDE 3NETA 5E4FA 1Z9BA 3HGTA 4KHZA 5ER9A 1I01A 2HNKA 2VKTA 1UMBA 5DLEA 1A76A 3VJRA 3R7SA 1VXOA 2ZRMA 3WGVA 1O95D 5EINA 2AA3A 4WA8A 3RGWS 3SKXA 1A69A 1R6BX 4XYEA 2CGEA 1Z4QA 4L51A 4L5BA 2A5YB 3DNPA 1QDLB 3EXIA 3ZCQA 5KVVA 1TW3A 3WB9A 1J8DA 4EB8A 1HOXA 4I81A 2V6FA 4R81A 5JQGF 3B82A 3DL7A 1DVRA 4YUZA 3KQNA 1YHZA 4MVWA 3TK1A 4IMPA 4IVRA 4L6CA 1OYOA 1RHJA 5ENZA 1S01A 5DYNA 3VPHA 4A16A 2IIBA 5JBIA 1F4PA 3OP1A 2ZWOA 3ONVA 1JFFB 3JQFA 3OOEA 1NQTA 4O4IF 4N8EA 3WIBA 4A3SA 5KNDA 1LQTA 1ITZA 1PT8A 5DGHA 2CFOA 1IY2A 2QN1A 5IAKA 2FWBA 3V2UA 5JCZA 4DSAA 3MUNA 1KEVA 3GLFB 1H6AA 4FGJA 4UDNA 1T3LA 2OQVA 4HPJB 3TMAA 3JD2A 4F2DA 4B84A 5JS8A 1NQAO 9GPBA 3ZW7A 4OHOA 3L4BC 4AP5A 5K09A 3U16A 4KIUA 1FQJA 1EWVA 3CUYA 3BG5A 3PB3A 4P3XA 3G6WA 4OGWA 1NV9A 1U9YA 1ZEJA 5EA2A 2UUBB 1YZYA 2I4NA 4DTIA 4PR0A 2Y1KA 2W2KB 2ZYGA 4E5SA 3ESQA 3I62A 2C2KA 4Z7QB 2VBFA 2P40A 5GINE 1DO8A 2PMDA 5BSKA 1UL1X 2VDVE 4G01B 4KQ2A 2W6MA 4BXOA 4JUFA 1QJCA 4ANFA 2I6UA 1ZHOA 1IHXA 1L7EA 3DBOB 1JFSA 4U8GA 1I6MA 2GN2A 2WK1A 4K9LA 3KWLA 1ZRNA 3HY3A 1KEEA 3NOOA 3FSRA 3UMJA 5F9FA 1UKZA 4MW1A 1JHDA 2OY0A 5GPBA 5FPQA 2DQZA 1NXVA 3ENWA 2QORA 3A3KA 2QTZA 3BT7A 5CX1B 1CUFA 2FPWA 2GX6A 4HO1X 4HH1A 4CKCB 3TXAA 1KQ3A 1T6XA 4ZT4A 3UIEA 2OO5A 4WXPA 1GZVA 2FUEA 3O8QB 4Q1VA 3C15C 1LA2A 2VF4X 1RTTA 1PBNA 3CA8A 4FW8A 5CVEA 1Z4OA 3TJMA 2QTGA 3FHCB 3Q5DA 1ODIA 2QN7A 5CA0A 4KOEC 1JEQB 3PFCA 5F4ZA 1E79A 5D84A 4BP1A 4E5NA 2YJ5A 4FM9A 5A1JA 1E6MA 3MT8A 1PD0A 1LPAB 3EHEA 2DBZA 3EPPA 1DHRA 2I3AA 3NAGA 2OQRA 4KDCA 2JCGA 2IF0A 2X2OA 5B57C 1C0LA 3NTLA 3UK0A 1TQ6A 5LLDA 1DAMA 4YIHA 1KVUA 2D62A 3PLRA 4ILEA 4PG7A 2UZ4A 3CSDA 3LPCA 5BT9A 4NJEB 2VT6A 4KQJA 1E96A 1XQ1A 2BCEA 2QRVA 1D4AA 3M1IA 3LX4A 3OO1A 4TV8B 1XZAA 3ZWYA 2ECFA 3P2OA 3PGXA 4FU0A 2HIHA 2POCA 4OQXA 1Y7HA 3AETB 2BE9A 5EOVA 1L3IA 1N8KA 1P5JA 3SP1A 3AYZB 3PF9A 4M0CA 3GELA 4CF5A 4ZRNA 1J8QA 4PSUA 1BD4A 2CWWA 1WLYA 1HZJA 1AUQA 3T7RA 1R6AA 1ZMOA 5DBEX 1SUWA 3OX3A 2LTAA 4HNRA 3CZAA 3L02A 1L4UA 4H08A 2WG1A 1TVEA 1DBIA 1Z3CA 2WTEA 3U13A 1L5OA 1MC1A 2WD7A 5LIPA 4BFUA 4ER7A 4Q21A 5T8KC 2VP0A 2Q28A 1TYAE 1V43A 2RAUA 3R3YA 3F96A 2CNBA 3OEEA 4LDRA 4Q82A 4XUEA 4YS6A 1V4BA 4RFSB 1YAJA 4J0CA 4OG2A 3ZNOA 1N2CE 1SIUA 2QR5A 3AJ8A 4FK8A 3R0IA 3ANYB 1Z45A 2ZQ5A 2N9UA 2Q3EA 2PBFA 4IW3B 2JIDA 1WAMA 2Q3BA 2WMDA 4TYYA 4MP8A 1EQAA 4B47A 2BUCA 3MJRA 4V0QA 3ANNA 1UXGA 3AB3A 1V35A 5EKTA 1WBBA 1B73A 5AM2A 1U3WA 5FLEX 5JAPA 1IRIA 1HZZC 4QEZA 3HO8A 2W2PA 2YINC 3GHYA 3SZOA 4EBFA 4NBWA 7REQB 4N4AA 1S1MA 3EBPA 2IYSA 5IDVA 4AL4A 3L7LA 3D4NA 4U9HS 1NIPA 2GJAA 2DUJA 1WHSA 3PE4A 4WTOA 4EA6A 3R5FA 4P5EA 3CRZA 5CB8A 1Q17A 5JBQA 2HQSA 1ESNA 4FYHA 5FULA 5M5BA 1TEZA 2HHAA 1KDRA 2DQYA 4K7JA 4P92A 3KPUA 1I2BA 1GXSA 3CF4G 1SQSA 2H59A 2IW3A 2EP8A 2PGDA 2VUSA 1ODFA 4LGVA 3ZYCA 4F9FA 3ODPA 1G6HA 1XQYA 1YQDA 1SG0A 1UBEA 2Q8PA 3BRWA 2BHNA 1DJLA 3B48A 3BM5A 3F4LA 3QNMA 2R47A