1I01A

Crystal structure of beta-ketoacyl [acyl carrier protein] reductase from e. coli.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
241
structure length
228
Chain Sequence
b'MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNANLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-KETOACYL [ACP] REDUCTASE
publication title Structure of beta-ketoacyl-[acyl carrier protein] reductase from Escherichia coli: negative cooperativity and its structural basis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 82
structure length 228
sequence length 241
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2001-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i01A00
4G5HA 3F6YA 2QG4A 1WAMA 4GKVA 2J3JA 4UVGA 2EG9A 4OM8A 5DF1A 2HMVA 4J0EA 2GZ1A 1Q7CA 2RHRA 2PKQP 1ZW1A 3UH1A 4GX0A 4CR6A 1ZMTA 2Y0EA 1U7TA 2A9FA 4FN4A 4OSPA 3DAPA 1JTVA 5THKA 4YRAA 3W8EA 4YYZA 1WMAA 1ML3A 2IZZA 1UDAA 3I4FA 1YONA 1U3WA 2DBZA 2NNLD 2BKAA 1Q2XA 3H9GA 2FY8A 3LLVA 5HS6A 1Y7TA 3HHPA 3GHYA 2I99A 1EFLA 4U7WA 5K0ZA 4KMSA 3QA9A 3B6ZA 2G1UA 3PIIA 4LRTB 4HX5A 4TVOA 2GD1O 5HBRA 2GN9A 3M1AA 4OYRA 3QE3A 2E4AA 2DAPA 2WTBA 4UAGA 1R4NA 5FEUA 4BIIA 4W99A 4PG8A 4D0SA 4L76A 2QX7A 4RLHA 3BMOB 2DUWA 2WE8A 2RCYA 5KJ1A 3UF0A 3ANNA 1E1LA 4X54A 4Q3AA 4Z9FA 2Y68A 5TC4A 3MJEA 5CEEA 2AE1A 4CMHA 1ZVMA 1YGYA 4BNHA 3I6QA 4NZ9A 5B4TA 2RH4A 3NYWA 4CMBA 2EKQA 1IZ0A 5JAMA 4FD3A 1D1TA 4AG3A 3JQFA 3PWSA 2H1SA 5A5FA 3GGGA 4MKXA 1A71A 1OOEA 2DFVA 5JDCC 4GGOA 2VYVD 4BGIA 3I4CA 3ZW9A 4IXWA 1P0CA 3I9MA 3O03A 3FN4A 2PZKA 3DTYA 4WLNA 4K1LA 2NU9A 4J4BA 5U1PA 1EUZA 4R1NA 1LXCA 1LLQA 1BXZA 4AVYA 4U6SA 5C5IA 5JDCA 3LF1A 2WE7A 1JA9A 4QFCA 4CV3A 2ZB8A 3LT4A 4AL4A 2VRCD 1HZJA 1G0OA 4WLVA 5T8KA 1SO8A 1BSVA 4M86A 3MJSA 3TDKA 5G2OA 1GD1O 1IOLA 4U0KA 2AHRA 4Z0TA 2FRDA 4IIVA 1KERA 4E5KA 3K5PA 3QV1A 3WBBA 1B8PA 3HFGA 4ZGWA 3KZVA 2VHYA 1T2DA 2D3TA 8ADHA 2QRJA 3QHAA 3QJ5A 3WGQA 4ZQBA 2C5EA 1K2WA 1XSEA 1UUFA 4YDRA 1GPJA 5FF9A 1X1EA 4BO2A 3KXDA 1NPDA 2DTEA 2OOSA 1PL6A 4E2ZA 4KDEA 3KSUA 1PSDA 4BNTA 4RPKA 3DAFA 1Y8RB 4D46A 4GVXA 1X13A 3MJTA 4TZKA 1D4FA 4TWRA 2X5OA 3B1KA 3HZZA 1QMGA 5AQ1A 4J91A 4PRKA 3WWYA 4BNNA 1F17A 1EEHA 1TEHA 4DQUA 4R54A 1Z75A 2SCUA 3BA1A 4YAEA 3QP9A 1E92A 3MTGA 2DBVO 4F3YA 3QWFA 1AGNA 3G3EA 3WR5A 5G0VA 2C7GA 1ISIA 3ZGYA 4BNIA 4PLYA 5I9NA 3E18A 4WLUA 1YL6A 5DP1A 1DC6A 1PZEA 3D5TA 1A7AA 3WGZA 4GQAA 4GX2A 3PFWO 2FN7A 4OQZA 4LCEA 2HDHA 4UEJA 1EK6A 3JYNA 2EEZA 1SEPA 4BB5A 4D3SA 1ONPA 1F06A 5IN4A 3PLRA 1YRLA 2C2YA 4CM5A 4RL6A 2FZWA 1XIVA 1Y8QB 3U9LA 5BT9A 3H6KA 3ROQA 1O95A 4YT2A 1X7DA 3RUIA 2NM0A 4QFDA 3WXBA 4B3IA 1LX6A 4CMGA 4EBFA 3VHRA 4ZA2A 5IXYA 1ZIDA 4TRJA 2AEFA 4FR5A 1SOWA 3DC2A 1BDBA 2E49A 4GLOA 4CR8A 4RF4A 3PXXA 1LTHR 3GGPA 3RFTA 3ZN2A 1J5PA 4IJVA 3TQHA 3PWZA 3BMNB 2RHCA 4RF2A 3QVSA 4OKIA 3PRJA 4A5OA 1I2CA 2GZ2A 3QIVA 3U5TA 3F9IA 1SB9A 1LLCA 1B15A 1GUZA 1NPYA 3OSUA 1XLTA 3FNEA 4E6PA 5JXWA 3SLGA 3PQDA 5BQFA 3DAGA 3IKVA 1U3VA 3E82A 4IIUA 3K30A 3NT2A 1UAYA 3WGHA 5JLAA 4YJHB 1ENPA 2FSSA 2I65A 2QYTA 3H9UA 1Z74A 3INTA 4AJJA 3ZWAA 5ENDA 1DBVO 1VJ0A 4ZICA 5A9SB 2O2YA 3NGXA 4ZN6A 2AG8A 3CH6A 3ZU5A 3A1NA 3IDSA 1LC0A 2VUTA 4IQGA 1GPDG 1CQJA 2UUPA 5L9AA 1PR3A 3WG9A 1UP6A 4BNWA 4MVJG 1X1TA 3F4LA 1NPTO 1DIAA 1IULA 3ORFA 3WBFA 4FFLA 1OI7A 3DB2A 4L73A 4EGFA 5CEFA 4R51A 2YHUA 2O50A 2QZZA 3K2EA 3DFUA 5HWSA 2UAGA 4Q3CA 4MVJM 3GEGA 4GX5A 1I10A 3OECA 3WSVA 4NU5A 1X0VA 1ENZA 1ISFA 1Y8QA 4RZIA 3IAHA 4GAEA 4TKLA 3BTSA 1D7OA 2CF6A 4I08A 4J3FA 1H6CA 2W2KB 4G65A 2E48A 3ZWNA 3OIDA 1DEHA 4QQRA 4CMEC 4J9VA 3WTCA 5L4NA 4BNUA 5CEJA 4AJPA 1JDJA 3GHHA 1P1HA 4A03A 2Y1DA 2C2XA 3OBBA 4CMJA 2NV6A 2JHFA 3CEAA 1CWUA 5BR7A 4YBZA 2NSDA 2Q2VA 3BMNA 2X0JA 4HNGA 3VPFA 3IOYA 1PR9A 3V5NA 2C29D 1VPDA 3RJ5A 3EVTA 4AJLA 4DC1A 5CP8A 1I2ZA 4XQGA 4UREA 2LDBA 1CF2O 3E9NA 4GSLA 3UOGA 5L40A 4GWKA 4MJLA 4BB6A 3C85A 1X0XA 3M6IA 5F5NA 3UICA 1I3MA 4JNKA 5ES3A 4B7CA 2FHSA 2Z1MA 3KSDO 4JROA 4NBRA 3GAFA 2VYNA 3NAQA 4QUKA 4BNLA 5A9SA 4YCAA 3HADA 4YACA 3DBLB 4GKBA 3ITKA 3RC2A 1O8CA 3S2GA 4J7XA 1HDYA 4KWIA 4Q9NA 1T24A 2PGLA 4DRYA 2ZCVA 1YOVB 3TNLA 2W98A 2OUIA 2X8LA 4LVCA 4OHUA 4PLHA 4CM9A 4MVJA 4O5OA 1RM0A 1E3JA 4BNJA 3JD0A 2YHIA 1DIHA 4XGIA 3S2IA 3TFQA 1GAEO 4OJNA 3RUEA 1PGPA 4Y6RA 5L7TA 1ZKMA 3WIDA 4B3HA 4RVDA 3Q11A 1YL7A 3MWEB 1PS0A 3H65A 5IZ4A 4CR7A 3LC2O 2V65A 1V35A 4HP8A 1FDVA 1LDBA 2Q50A 2V7PA 3I23A 4ND2A 3VDRA 1AXEA 2W2KA 4BNYA 1TT7A 4C7KA 3ZHXA 2DPHA 3AU8A 3CPSA 4QECA 1QG6A 3DO5A 1JKFA 3R1IA 1ENYA 1HE4A 3ON5A 4XDZA 2EP7A 4XCVA 4O1MA 1MV8A 1XGKA 3RC1A 3PHLA 5EINA 4WCDA 4CLRB 3D1LA 4WPGA 4B79A 1HDZA 4K9DA 4U8GA 3I52A 1AUPA 3D0OA 3DZIA 3SBOA 2ZKLA 1MFZA 1GYQA 3DOCA 1KY5A 3OIGA 1DHRA 4YB8A 4ESOA 3ICPA 4J1QA 3FD8A 4W4TA 5EQDA 4WNCA 2H6EA 4N5NA 3ZWCA 3WWZA 1BHSA 4FW8A 3OEYA 4CQLA 4WKGA 1YBMA 2B5VA 2A92A 2ZTUA 2NWQA 4RGBA 4JXKA 4K28A 1HRDA 1DXYA 5LCXA 3CKYA 2OXIA 4AFNA 2GLXA 3DBLA 3NGLA 2Q3EA 1QR6A 4JBGA 1B16A 5I8ZA 3WFIA 4HKTA 2YV2A 3QWBA 2VZ8A 1NQAO 5JFOA 1LDYA 2VTEA 4XR9A 5ADHA 2D0IA 3A28A 4CQMB 1HYGA 1QRRA 3JQ8B 1ZK2A 2PY6A 4HXYA 1PJTA 2Y1EA 3K9QO 2IEDA 2P5UA 1EVJA 1HSZA 3RKRA 1W8DA 1P31A 1UZNA 1DO8A 2OBYA 2IE0A 3EMKA 2BGMA 3GG9A 3AJRA 3RUHA 1RM3A 4E12A 2FSVA 3O9ZA 2X0IA 2R00C 4LISA 3OJLA 2C82A 3DZBA 4DQVA 4FPXA 3ZWYA 1DPGA 3CSDA 2NU7A 2DBRA 4BKPA 1SNYA 1Z6ZA 3FBGA 2B4QA 2VCYA 5IAAA 4YJFA 1NWCA 2JJYA 1YBAA 1C0LA 3IL2A 2AQHA 3GNTA 1YO6A 3TSCA 1C0IA 2R00A 1KS9A 4PG5A 4TRMA 4E2YA 5FI5A 1UH5A 1EE2A 4IJWA 3C1AA 4P4LA 5JS6A 3MOGA 4CM4B 4BQPA 4ZU3A 3RI3A 1CYDA 5K9ZA 3DHYA 2YFQA 2VZ9A 1DIRA 3AW9A 1KOLA 1JWAB 1JWBB 4OOFA 2Y67A 4IY1A 4CMAA 4DLLA 3GZ4A 1KEUA 2IDZA 3EDMA 2GRAA 5TIIA 4QT0A 2HKIA 3E03A 4GPD1 4RORA 2B37A 4FFMA 4FCCA 2JCYA 1PL7A 2C0CA 2VRCA 1U9JA 3W8DA 3B1FA 1JLLA 4RDHA 4RV9A 4WECA 2BELA 3WOHA 3CTMA 4BNXA 4EITA 2CMDA 2HUNA 4BMVA 2YJZA 4D43A 3H9EO 1BRMA 1ULUA 3PVZA 1NVGA 1R66A 4ND4A 3HNPA 3GN2A 4FFNA 4K6FA 3WGGA 3JQ8A 4CQMA 1YVEI 2O48X 4JP2A 3G79A 4OXKA 3Q9UA 3A9WA 2CDAA 1R0SA 3JYPA 3KOUA 1LSUA 4H3VA 4MVJH 4W7IA 4JQCA 3H9JA 4UVEA 4LK3A 1IZ9A 1IYZA 3LC7O 4IQ0A 3WQRA 4CM1A 3LLSA 3WSWA 1NQOA 5A3JA 1E7MA 4B3JA 3ETGA 1I30A 2JKVA 4YA6A 1ZCJA 3UCXA 4K26A 4J4TA 4WLFA 1N1EA 2CDBA 3FHLA 3T7EA 4XYEA 5C7LO 5JC1A 3U4DA 1DSSG 1LQTA 1T2AA 1WZIA 2GN4A 2G5CA 2G82A 4BO9A 1SAYA 3JYLA 1LDEA 3D5QA 4Z9XA 2GASA 5JE8A 4D79A 1SBYA 4BNZA 4BGVA 2ET6A 3MOIA 3KYDB 3ZH2A 2CD9A 1K6XA 1ZJYA 3FBTA 4NNJA 4B4VA 3LC1O 1CERA 2YUTA 2O3UA 4CM4A 3CIFA 3NTOA 5F21A 1T4BA 3X2FA 1N9GA 2DU8A 3FR7A 2Y99A 5A04A 2JD0A 2VNAA 1F12A 2VN8A 4AJ1A 4PLGA 1ZSYA 3BMQA 4XIJA 4BMNA 5A1TA 3UUWA 5B12A 4ND1A 4FC6A 3ITDA 4PLVA 2JHGA 3WQSB 1K89A 4XRRA 4Z0HO 1NAHA 3WLEA 5TLSA 2D4AA 5B37A 2EP5A 5FI3A 3ONFA 4R01A 4IS3A 1P1JA 4I8XA 1HTBA 3OQBA 4MVJE 3GLQA 1XWFA 4PLFA 1I3KA 2ZB7A 1P1RA 4A27A 3WICA 4RJTA 1A4IA 2DTXA 1GQQA 2IXAA 1JKIA 1XQ6A 2DVMA 4R69A 1UXJA 2Q45A 2D59A 3JQ9A 3L4BA 4DMMA 2WYWA 4GBJA 4ZRNA 2BLLA 2B4TO 4J9UE 4EEXA 4ZQHA 4A73A 5JYDA 3PJFA 4HBGA 1I8TA 3P2YA 5BSEA 1GYPA 1CETA 4OXYA 4FJ1A 5T5QA 3ENKA 2RAFA 4D45A 3FR8A 3GVCA 2YDXA 5A06A 4BL5A 1LDMA 3F46A 4HADA 1LNQA 4UEKA 1YQGA 2JCVA 3FWNA 2VZ0A 3QSGA 3C8MA 2AEJA 2AQIA 3QVOA 4XRGA 2X5JO 3OM9A 4NFHA 4YQYA 3BTUA 1ONNA 5IJZA 4MIYA 5L4LA 3DTTA 3WX0A 4UUOA 3R0IA 2Y1FA 4A2CA 3C1OA 5JY1A 4PVDA 3S55A 3I9LA 1LSJA 3ONDA 4NIMA 1N92A 3FNHA 2RIRA 3KYDA 4NPCA 4LVUA 2PTGA 5C7IO 5CDSA 3MWDB 1E7SA 2PA3A 3WGOA 1ZMOA 2BMAA 1PJ2A 4N5MA 4HWKA 4FIZA 2GN6A 3ICCA 2EF1A 4RDIA 4EEZA 4WE3A 4E4YA 4E32A 2O3QA 1B26A 1QSGA 5KKCA 3UKOA 3ZNPA 4ONEA 3KM0A 5JCXA 3FTPA 4BOYA 3VH3A 2PWZA 4NK5A 4WUVA 1NHWA 5ER9A 1ZK3A 5HA5A 4B4OA 5BSFA 3SJUA 4RF3A 1EQUA 2BI7A 3IUSA 3JQFC 1P45A 5KOIA 2WM3A 5HS4A 2FOIA 4AJ2A 3CXRA 2NACA 3FPLA 4RPGA 3EZYA 3QVTA 4XQ9A 3P5SA 1OFGA 2H5LA 3UVEA 3V1YA 1H0KA 1XHLA 2P9EA 3WMWA 3LYLA 2W90A 3JQAD 3GDOA 3FSRA 5COAA 3SC4A 2EV9A 4J43A 1HE5A 3VPSA 3VAZA 5L53A 4D41A 2PH5A 1G1AA 4E33A 4RVFA 4CLOB 1MA0A 2X6TA 5C37A 2FR0A 4IINA 3UFXA 1PJCA 1GCOA 1NR1A 1YWGO 5T8KC 3MZ0A 2HMTA 4IDGA 4WGGA 1QV7A 3MJ4A 3H5AA 5JBIA 3H3FA 1NWHA 3R3JA 4DPMA 4Y67A 4EUFA 1BVRA 2JCXA 5TRTA 1SCUA 3N7UA 5TT1A 5L7WA 1T1SA 4GSKA 3OH8A 2JFFA 2XOXA 5IZCA 3T4XA 5AXDA 3RC7A 2OO5A 4HFRA 5GMOA 3TFOA 4XX0A 5EJ2A 3GN1A 4O59O 4XWYA 3VKVA 5KVQA 4CODB 4MP8A 3T7CA 1EQ2A 1HEUA 1A72A 1QKIA 3GUYA 3D4NA 2OP1A 5GY7A 3VZSA 4OOEA 4AJEA 3S8MA 4LN1A 4CM7A 3HE3A 1QYXA 3VVCA 1NVMB 2PFGA 5JY6A 4W6ZA 4DA9A 5F1PA 4CLXA 1JN0A 3F5QA 5MGBA 5AXBA 4NH4A 3BHIA 4IJKA 4Y98A 4Y9DA 1JW9B 1WMBA 3VVBA 4N18A 1JAYA 3JQ7A 3TRIA 3GVXA 3HG7A 3U0BA 2YW9A 4N5LA 1Y6JA 3AM3A 3GOHA 3ZHZA 3KSZO 1SPXA 4IDDA 5TF4A 3ZU4A 4ZRMA 5KVVA 3WNVA 2F00A 1ARZA 4I5DA 1N8KA 4JJFA 4E5PA 3QVWA 2P68A 5IXSA 1SB8A 2YYYA 1X7HA 4MKRA 3Q0EA 5IDYA 1Y5RA 3EHEA 3LK7A 5I7SA 1YS4A 1PGJA 5G0TA 3STHA 3TL2A 5A03A 2O7SA 4CLOA 4ALKA 1DHTA 4DYVA 2W2LA 4I5FA 2HU2A 4YAIA 3F3SA 4TMFA 3V1TC 3D3WB 2J5QA 4IDAA 4BQRA 4DTIA 5IFLA 3OFSA 1LSOA 5EERA 3S2FA 2VWPA 3HB4X 1UDBA 1UJMA 5G4KB 3KBOA 4MINA 3VZQA 4BMSA 2B4RO 2X5KO 3K6JA 4PRLA 4EJ0A 5JSFA 3IUPA 4XYBA 1X7GA 3HDQA 1Z7BA 4JJGA 2CDCA 1ORRA 5B1YA 3SVTA 3RU9A 1NBOA 4Q3BA 4FS3A 1E7RA 4ALIA 5ER6A 1Y5MA 2YQ4A 2VHVA 3CE6A 2HK7A 3D3EA 1KVTA 3EC7A 3O8QA 4NQZA 5JMPA 2JL1A 2WSBA 5FFFA 4DIFA 1DJQA 3TPCA 2TMGA 4Y6PA 1ZFNA 1ZUD1 3U3XA 1H2BA 3KEQA 4C4OA 1SOVA 1EMDA 3U4HA 4J2HA 4MOWA 3AM5A 4BKRA 4XYLA 1ZXBA 3NX4A 1RWBA 1U5AA 3DXFA 1YQDA 4HFMA 1M67A 2EERA 3PGJA 5H81A 4HV4A 2NTJA 1E1MA 3ZWOA 1X15A 2HQ1A 1KYQA 2HRBA 3PTZA 2NTNA 4DIOA 3DZHA 1PQUA 2EXXA 4D44A 1U4SA 5CPBA 3T4EA 3P19A 1IHXA 1KVRA 1YDEA 2D5CA 3PHGA 4RZHA 2GO1A 2OP0A 2O2SA 5IN5A 3B20A 4IQ8A 1GEGA 4GGPA 1NAIA 3DMTA 3JYQA 4CJXA 1T25A 1WW8A 2PKQO 4A26A 4YJDA 2I3GA 3ZNNA 3CMCO 1C1DA 1PZGA 1H9AA 4WEQA 3ZDFA 3GFBA 4L9RA 2QRLA 4W7HA 4HY3A 1WDKA 3AU9A 3O38A 2YHIB 3GK3A 1Z45A 2PLAA 3D3WA 3DL2A 4KP7A 4FFRA 2HK8A 2GPTA 4IGFA 2G17A 3DHEA 4GI2A 1CDOA 3JQGB 3RUCA 1HE2A 4XQCA 5G4KA 1NNUA 3C7DB 2Y1CA 3ONEA 2XXJA 3W4JA 1O6ZA 4ZVVA 5JCJA 5KVSA 1J4AA 1YQXA 5TJ9A 1VL6A 1QXSA 3L6OO 4Z3KA 1M75A 2NUAA 4U0JA 3H7AA 5ICSA 4GLLA 2EJVA 3OP4A 3IJPA 3ASVA 3W1VA 3VH4A 5DT9A 1VLLA 1PJ4A 4NFYA 1GL3A 2OHXA 1AHIA 2ZQYA 1ISGA 2NVUB 4J49A 4BV8A 2FR1A 1YXMA 1HYHA 3KLMX 2GDZA 1YB1A 1E7QA 1QORA 3AFNA 4J90A 3JD4A 3WGTA 2VHXA 3GMSA 4NU6A 5DZSA 1LEHA 1M76A 1PJQA 1UXGA 4AJNA 4D42A 1O5IA 1DFIA 4PLPA 1R37A 5I7FA 1YE3A 4HFJA 4Y6SA 3R6DA 3VPGA 4XR4A 2X7HA 4OQYA 4LRSB 3W8FA 2GN8A 4CQLB 4EI2A 3NTQA 3GZNA 3WYCA 3NRCA 3WYBA 5CAEA 1UZMA 2B5WA 3OHSX 2Q46A 2Q49A 3ZHBA 5CG1A 4KQWA 5JO9A 2NQ8A 2Y1OA 3EY4A 1BXGB 3ZU2A 4CUZA 3OA0A 4L0QA 4D3FA 1P1IA 3VTFA 1W6UA 4CM6A 2QIOA 4BGUA 3VKUA 4P8RA 2ZTVA 3EZLA 2PGDA 2W8ZA 4UULA 3AWDA 4W82A 1Z7EA 3PDUA 3D4OA 1B7GO 4BO8A 4L74A 1VKNA 2NADA 4EUHA 3K92A 4YAJA 2Y93A 4KUGA 3OJ0A 2C54A 3PZRA 5ILGA 1DDOA 4YTEA 4ZQGA 5BSGA 2HMSA 3AY7A 3PYMA 3QRWA 3ZV6A 3L07A 1EBUA 1AXGA 2AEMA 3JQGA 2GZ3A 4BNMA 3SLKA 5I9MA 4AICA 2BHLA 4PLCA 3FNFA 1CRWG 3WMXA 3X2EA 5TX7A 2VHWA 1I2BA 2DM6A 3AI3A 4GMFA 4CUKA 6LDHA 4MP6A 4Q3NA 1MGOA 3FI9A 1HLDA 5I9LA 3KO8A 1MG5A 4TZTA 2OORA 4PZCA 4YPOA 1OMOA 1PS9A 4OKNA 4YJFB 1LJ8A 4IUYA 4XIYA 3GRPA 3DOJA 3G1UA 4F46A 4WOKA 3ANLA 4ND5A 2QQ5A 3JQDA 3NDJA 2NVUA 1AHHA 3UN1A 3WB9A 1QLJA 4RVSA 3F1KA 2GUGA 4MO2A 4P22A 3QWHA 3PJEA 5DBIA 3WFJA 3NT5A 4Z6KA 1F14A 4URFA 4P38A 4FOOA 4NBUA 4DLBA 4B7UA 2JFGA 1LUAA 2DFDA 3GPDG 1N2SA 3PP8A 2GSDA 4PFJA 3DZFA 3FTNA 5G0WA 3PHHA 2PZJA 1BG6A 4KZPA 1EK5A 4NR0A 3Q2KA 3DZGA 4NDNE 2X9NA 3NJ4A 1EUCA 3AK4A 3AOEA 3TL3A 4DMLA 4NI5A 1GUYA 3I83A 1BXGA 2P2SA 1E3IA 2EIHA 3OF2A 3C24A 4Q3EA 3F47A 3V8BA 2ZTLA 5GZ3A 1DFGA 4OMUA 5JYEA 1B8UA 1HETA 2ZJ0A 3JTMA 3CMMA 4WLOA 1GY8A 3BIOA 1K3TA 4EJMA 1DC4A 5DCYA 3Q6IA 3KYBA 5IDWA 4PLTA 3DMYA 3PLNA 3RD5A 3ZWPA 1K5HA 4XDYA 3VDQA 4BNGA 4YWJA 2H9IA 3W4IA 4RPLA 1GR0A 1M6HA 4NBVA 4U6QA 3AY3A 4IXTA 4EZBA 1NYTA 2HSDA 1ADGA 3WJAA 3KB6A 4B8WA 1EBFA 2XPCA 2HO5A 3HN2A 3JQ6A 4J0FA 4CUJA 2IZ0A 1QLHA 4FC7A 4ALLA 5JNLA 1NFFA 1KBZA 2GNAA 1LRLA 2ZJ1A 3JQBC 4PGFA 1PX0A 1HDOA 1FDSA 1SZJG 1P44A 4TSKA 5JMWA 1O9BA 2B0JA 2X0RA 2VQ3A 1U8FO 3PYLA 2PH3A 3NTRA 1HXHA 1WVGA 1A4UA 1LDGA 2AE2A 5LC1A 4YJGB 4CM8B 5EIOA 3AOGA 1E3EA 3JD2A 2Y1GA 1N1GA 3COSA 1YB4A 3IJRA 1T4DA 3ZNOA 3FPCA 1MC4A 5GZ6A 1C1XB 2TMDA 2IRWA 3JQBA 2ZQZA 4BHTA 1FDWA 4WJZA 4AJIA 1KEPA 1PJBA 1W4ZA 1WDMA 3SC6A 3WGYA 3KETA 1UDCA 3U49A 2FMUA 2VYVA 2Z5LA 1TB4A 1PL8A 1A5ZA 2CNBA 2OGUA 2V6MA 3D4PA 1N9GB 1R0KA 2R6JA 5K6AA 5BNFA 3K73O 1M66A 2A35A 4CL8A 5JAIA 3BMQB 4NJOA 4RLSA 3NUGA 1QP8A 2HMWA 4JBHA 3TF5A 1DB3A 3JCZA 2JD2A 2NTVA 5DCWA 3L6DA 3PGXA 4IZHA 3VPHA 4ALJA 3GDFA 3LVFO 1O94A 3FNGA 4FDAA 1WXDA 3E6AA 1FK8A 1MFPA 3AFMA 4MPDA 3QLJA 3NV9A 1GDHA 1TVEA 3DBRA 3ASUA 3HWRA 1L7DA 3BXXA 4M87A 5DN9A 5KIAA 1OC2A 2YZ7A 1U1IA 3L4SO 4R4JA 1E6EA 1H6DA 4E5YA 4GH5A 1F8FA 4JIGA 1HE3A 1DC5A 4BV9A 3I9JA 2POQX 1RM4A 3BMCA 4R3NA 4MVJF 1E6UA 2BFMA 2GF2A 1KC3A 3GF4A 5C7OO 4UVHA 4BKQA 3GEDA 4IDCA 1FDTA 4LSWA 4TRNA 1BWSA 1VC2A 5L3ZA 4AJOA 1LA2A 4S3MA 1T2CA 4FFPA 2PV7A 4KTVE 4L8VA 3KV3O 1KEWA 3JV7A 4YXFA 2ZYGA 3ST7A 3WJ7A 3BTVA 1IPEA 4CL3A 5U9CA 3HUDA 4Z0PA 1T2FA 3EGOA 3RVDA 4DWVA 1ULSA 1V3TA 1PJ3A 3ANMA 3ZWMA 3G49A 1GADO 3OICA 5JAZA 1U2GA 1GZ3A 2J5KA 4YJGA 4CM8A 3FRJA 4QXMA 1NFQA 1J49A 1NASA 3L6EA 3FCOA 3K2BA 3RAJA 5G0SA 1LQUA 3LDHA 5DNAA 1F8GA 1NFRA 4TKMA 2E6UX 2VWGA 1C1XA 1OBFO 1HDGO 4BO3A 1D3AA 2QHXA 3S1LA 4E2XA 4YR9A 1VL0A 4J1SA 2PK3A 3O26A 1YH3A 2RBEA 1PGNA 2Q4BA 1P0FA 5AXAA 2Q2WA 3RUDA 2AMFA 1PU2A 2AXQA 4ZQFA 1K6JA 2HCTA 4BO5A 2OMEA 3PWKA 4JCOA 3WDSA 4NG5A 1U7HA 2EWMA 2VYND 3RBZA 3RBXA 4E5MA 1ZSNA 1NQ5A 2Y66A 3CUKA 3TWOA 3JQ9C 3L4BC 1VSVA 3P2OA 1P3DA 3EW7A 2NU8A 2J5RA 3TJRA 3ZHYA 1CJCA 5DDIP 3AY6A 5AYVA 1I0ZA 3D7LA 4LSMA 3DBHA 7MDHA 1QYCA 2HLPA 5JPIA 1FXSA 2VUUA 2D1YA 4CLHA 2Q1TA 1H2HA 1LU9A 2O4UX 4CMIB 2UUOA 1FDUA 1E6WA 3MCVA 4MVJD 5JC8A 1A27A 1GEEA 3GFGA 5CG2A 4IBOA 1P74A 3ZWVA 3Q9NA 1BXKA 3GY0A 4D3DA 4FJ0A 2X9VA 4M49A 3GVHA 1NR7A 3B70A 4H16A 4B8ZA 3DQPA 1Q0LA 3QY9A 4MVJP 3LU1A 1NP3A 4R1UA 2LDXA 5G4LA 1YB5A 2ZK7A 3H2SA 1VKOA 3LQFA 3EVNA 3DOOA 2CF5A 2DKNA 2FPPA 2P91A 3RBVA 1GV1A 1WNTA 1LC3A 4Q3DA 5KTKA 1B8VA 5T57A 1MP0A 2Q1SA 4XJTA 3JQEA 4E13A 1DFHA 1CQIA 3DWFA 1WLYA 2GR9A 4XYMA 1DRUA 5T64A 2IYPA 4FSHA 1LI4A 1P1KA 4HUJA 3AI1A 3GUCA 2F1KA 3H2ZA 2X1HA 3TZ6A 1RKXA 6ADHA 3QQPA 5KNLA 1H6BA 3SJ7A 2P9CA 2AQKA 3I6IA 1LSSA 4EYEA 5A9RA 2VHZA 5DOVA 4IS2A 1PJSA 1H9BA 4UUNA 5A05A 5TNXA 3BHMA 1ID1A 5GZ1A 2C07A 1ISMA 4PCVA 1LLUA 2WYVA 4Q39A 1DRWA 3OJOA 2EW2A 2J3HA 3LT1A 4QX6A 5DCUA 3KRTA 1JQBA 3E9QA 2BFOA 2Q4EA 1QYWA 4ROSA 2AG5A 2ZATA 4JLWA 3H9QA 5AVOA 3UHAA 1MG0A 2I76A 3JQ7B 1IUKA 4PZEA 4QSMA 5A9TA 3TZHA 4L4RA 4A10A 1ZK1A 1YBVA 2FPGA 3DFZA 3JYOA 3R3SA 1PZFA 1T1RA 1DLJA 1VRWA 1EVIA 4PG6A 4PLZA 4CMIA 1WP4A 1UP7A 3CZMA 3M1LA 4JX8A 4J4HA 3ROMA 4II2A 1VL8A 4J16A 1HT0A 3W6ZA 1JVSA 5KKAA 4F6CA 3ETEA 1R4MB 3I1JA 1R0LA 1RM5A 4LW8A 3RJ9A 3OQ6A 3HSKA 3TZQA 3U4IA 4DYDA 1J0XO 4K6CA 4BS9A 3RASA 1Y81A 3GG2A 1TLTA 4NHEA 5HTOA 2GYYA 2QZ9A 3MTJA 1E5LA 5DOZA 4BO1A 4YVFA 5CDUA 5IG2A 3E5MA 3VPXA 1UZLA 3KEOA 4JJIA 1NM5A 2EGHA 3PJDA 4HFNA 4KUHA 4PZDA 5BNIA 1B3RA 4H7PA 1PZHA 4Z3DA 4I9HA 5IZCC 4WASA 2ZYDA 3BAZA 5BNTA 3N74A 1HKUA 3NT4A 4MKZA 4OIMA 4E21A 3OIFA 1RPNA 3TZCA 1RJWA 3AM4A 4XB2A 1DC3A 2QW8A 5T6BA 4OH1A 2O3RA 3QW2A 4IGEA 1E77A 5L4SA 2R2GA 1IE3A 4YAKA 2JD1A 3E9MA 3LZ6A 2G76A 4KTTE 1R6DA 4M89A 2BRUA 5TQVA 2FZEA 3Q2IA 1ZK4A 4G2NA 4D7AA 3JQCA 3WTBA 1G0NA 2P5YA 3B1JA 2BF7A 5CDYA 3G17A 4E0BA 3FWZA 1EVYA 1E1NA 4DUPA 3O8QB 2V6FA 4H15A 1XG5A 5LDHA 3DDNA 1O89A 2X0NA 4E31A 2HK9A 2VWHA 3ZZNA 4O6VA 3RUAA 1NVTA 3KTDA 3BTOA 3IMFA 1UP4A 2CUKA 1HSOA 4KOAA 3ADOA 3VZPA 1YDWA 3ZU3A 3GQVA 1ZXLA 1ZK0A 1ZEMA 1Q0HA 3RC9A 4CQMD 1LLDA 1A9YA 1HL3A 1LDNA 5F1KA 1EDZA 4OSOA 9LDBA 1K6IA 3AUSA 1HDXA 2OBNA 1XR3A 4DPLA 3PK0A 2D8AA 4UEOA 2IZ1A 4DBZA 1R4MA 4GMGA 4IDFA 2ZIZA 1L7EA 1XA0A 2XAAA 2Y05A 5A4DA 1C0PA 3GR6A 4GWGA 3NJ8A 1KVQA 2PD3A 5I7EA 4XEHA 3BMOA 4NBTA 3EYWA 5EESA 1EZ4A 1JKJA 4XYGA 1C1DB 1YJ8A 1VJ1A 1ZBQA 4HNHA 2V6GA 1AE1A 4PIVA 4R9RA 1E0DA 3DZKA 1LRKA 3V2UA 1YL5A 5KJ6A 2WEKA 4CMKA 3VH2A 1GV0A 1ZO8A 3WLFA 4M8SA 1IL0A 3ZI0A 1IHYA 4WCFB 1PGOA 1E5QA 4BNFA 3VZRA 3CINA 1KC1A 4BNVA 3H3JA 1WWKA 2I5PO 1XYGA 3WYEA 4R3WA 3E8XA 1FMCA 4IJUA 1E3WB 2A94A 1PQPA 1XU9A 1U2DA 1BMDA 1Y9EA 3IP1A 3NDRA 3JSAA 1I33A 4RVUA 1IB6A 4PG4A 1IY8A 4E30A 5T67A 5L51A 5EL0A 2WYUA 1AN9A 2DPGA 2O7QA 3RIHA 1U4OA 2PD4A 1P77A 1KETA 4CV1A 1UXIA 2AA3A 1R12A 2WWRA 1EDOA 4IMRA 1TXGA 2PNFA 3O4RA 5TSDA 4BNKA 3GAZA 2BGLA 3NKLA 3F5SA 2IYOA 1MB4A 4XB1A 2J3IA 4N7RA 3L9XA 1I24A 1CEQA 4LGVA 1GYRA 5DBFA 3GZNB 5J23A 3DMTC 2YV3A 1P9LA 1PQWA 4ILKA 4GVLA 2DTDA 3PZBA 3RKUA 4KQXA 4FGSA 1B2LA 2I67A 3GH3A 3LT0A 3DR3A 3PYXA 7ADHA 3A4VA 3PJGA 3UXYA 4AJKA 3RFXA 5JW6A 1ZZEA 3HDJA 4U5QA 1O0SA 3TN7A 1H94A 5IDXA 4CLEA 5BSHA 3KHUA 5DBGA 4E3ZA 2VT3A 3FF4A 1PWZA 3KUXA 4ZHSA 2YV1A 4WCFC 1Y8RA 4IDEA 4RQUA 4D0RA 3ABIA 2Q99A 2JAPA 3AUUA 3SX2A 4UVIA 1ADFA 1LBEA 4R9SA 5A5EA 5HM8A 4YQZA 4IMPA 4CV0A 1BGVA 2YY7A 4I9NA 1GQ2A 4ZQEA 2EW8A 1PEDA 4PLWA 5ILOA 1NQTA 4IZIA 1M2WA 4PVCA 4YAGA 1MXFA 1TA4A 5G0UA 4WCFA 1JAXA 1MLDA 2CZCA 3I9KA 4A0SA 4E5NA 1DIBA 1U8XX 3E5RA 3I3OA 5EQFA 2C5AA 2VOEA 2Z95A 4I5GA 3DONA 1NXQA 1V8BA 2C59A 2C7VA 2I3AA 4O0LA 3RFVA 1FF9A 1N7GA 4IDBA 4KUEA 1XDWA 5B4UA 1E3WA 2VT2A 3D64A 1BW9B 1DOHA 4R5HA 3GNSA 3U09A 2EJWA 2DT5A 5F5LA 2BGKA 3RU7A 3ZWXA 4XJSA 1N5DA 1JU9A 3MEQA 4J2OA 3WS7A 2X9GA 3GPIA 3S2EA 3L9WA 5IF3A 2Q1UA 5AOVA 1Y1PA 1PIWA 4DIBA 2BI8A 4RPHA 5THQA 1K0UA 4QTZA 3GA0A 1GUFA 2FP4A 3HFSA 3TOXA 2BFPA 5LDGA 1DRVA 1I5RA 3N58A 4GL4A 1L1FA 4L4XA 2UYYA 4PG7A 4N54A 1DAOA 1XQ1A 4OAQA 1VE9A 1QYDA 2O3SA 1ADBA 3K8ZA 1KEVA 4B4UA 4MIOA 3LSYA 1HYEA 4AJHA 2P9GA 1WPQA 2ZYAA 4RPJA 5HRUA 1I32A 3ZNQA 4YEDA 3KLPX 1TT5B 5TJHA 3RROA 2X22A 4CMEA 1I01A 2EGGA 4BKUA 2J3KA 3ZW8A 2Y0DA 2V6BA 3RWBA 1KVSA 1UAGA 3PQEA 4JP3A 2IEBA 4YT4A 5TGDA 3W4KA 1EUDA 2OZPA 2WJPA 3V2HA 3IC5A 5CFZA 3I9NA 5A3VA 2DC1A 1GZ4A 3EAGA 3GMDA 5C3MA 3IIEA 4YJHA 2NLOA 1ISJA 1ISHA 2I9PA 3DEYX 5ENVA 1UXKA 4ZD6A 1I3LA 3L0DA 4M55A 2B69A 2VWQA 4QO8A 4XGKA 5H82A 1PWXA 3VH1A 4R5MA 1E7YA 4NMHA 4G81A 1KIFA 2ZTMA 3ULKA 1DLIA 1YJQA 4JGBA 3P7MA 2E82A 3BYZA 4II3A 1BVUA 2E37A 3LF2A 5IDQA 1U3TA 1D1SA 1R16A 2HMUA 2CVQA 3K96A 5DP2A 2QYSA 1GTMA 4XQEA 1EVZA 1Q0QA 2HAEA 3OQ1A 1BW9A 4R1SA 3DZJA 5A02A 2VUSA 1Q7GA 4EJ6A 4DVJA 4XZ3A 3LT2A 1S7CA 2Q1WA 3JQAB 1Q7BA 3PHJA 5KJFA 2X4GA 1MUUA 2AW5A 2AQ8A 2GGSA 1E7WA 4KWHA 4EW6A 5TS3A 1XEAA 3AOEC 3PHIA 3PEFA 4FJ2A 1G6KA 4L4SA 4BO6A 3GEMA 3EK2A 4B7XA 1DAPA 2JFHA 1X14A 4AJ4A 2ZB4A 5MDHA 3NDIA 2HJSA 4QO7A 1NHGA 4F45A 4NFSA 2PGJA 3IKTA 3I5MA 4C7JA 1FJHA 4RCVA 3DHNA 3OETA 4J7UA 1E1KA 5FWNA 5I7VA 3HJAA 1T2EA 2O3TA 5ITWA 2VNSA 2HRZA 5DULA 4WLEA 3UW3A 1Z82A 1GQYA 1RYDA 4BO4A 2ZCUA 4IPTA 3KVOA 4RQTA 4DC0A 2EHDA 1OAAA 2Z1NA 3A14A 3GDGA 4M54A 2GERA 1TT5A 4YRDA 1VJTA 4DXHA 3DBRB 3V1UA 1HF3A 2B35A 2UV8A 2VRBA 3ETDA 3JD3A 4LCJA 1QYVA 4ALMA 1A7KA 2PZLA 5FYDA 2XF8A 4LMPA 2W2LD 3BMCB 4RVHA 1Z73A 3ZCXA 1W73A 1YKFA 4YRBA 3GC6A 3DBVO 1ZH8A 2CY0A 1WZEA 3GNQA 3WGIA 4J7CA 3U4CA 3C3XA 4CMCA 1B3BA 1BTOA 3PFFA 4R41A 3RUFA 1H93A 4ITUA 3ZV3A 3HDHA 2YFHA 1IPFA 1J6UA 4NK4A 2IXBA 1EFKA 2A4KA 2X23A 3GRKA 3QWIA 4R1TA 2DUUA 3HN7A 1GU7A 1Q1NA 1SEVA 1YOVA 1ENOA 3IP3A 4NBWA 4OO3A 4R68A 5EPOA 3QVXA 1PJLA 3RQSA 3H5RA 3K31A 2WD7B 5KCZA 4DGSA 3TOZA 3GGOA 1HDRA 4P4GA 1XCBA 2I6TA 3JD1A 1OC4A 2J8ZA 1KY4A 2DLDA 3AUTA 4FGWA 5F3RA 3ROPA 5K6AC 3JQAA 1C14A 3M2PA 4OGWA 1TI7A 4BVAA 3KYCB 2H63A 2C20A 1EE9A 4FFOA 4RF5A 3C7CB 2UVDA 3RSHA 3IS3A 2RH8A 3BZUA 3INRA 2D5AA 4A7PA 3HQ4O 3VOSA 1H5QA 4TROA 4E2WA 4PN3A 3ZWWA 1F0YA 1PS8A 1ZEJA 4J1TA 4CV2A 4DQXA 1DJNA 4MIEA 1DIGA 3C1TA 4EDFA 2FWMX 1ZJZA 1VI2A 3ENNA 4B4WA 2BH9A 3L77A 3AUAA 2BFAA 4CLRA 3MJVA 2YQ5A 3UGKA 1XELA 2I66A 4P4NA 1M6WA 4BO0A 2D2IA 4INAA 3OMLA 4CM3A 1SC6A 3E1KA 5CPFA 2EKLA 1V9LA 2O23A 4MP3A 5CHEA 4Z9YA 4BKOA 2OL4A 2VTDA 1UR5A 1XU7A 2PR2A 3G0OA 4I5EA 3PI7A 5JDIC 1E3SA 1HDCA 2CSUA 3DBHB 4F6LA 3ZWBA 5ITVA 4UUMA 4ALNA 2O4CA 4JBIA 4TQGA 3Q1LA 9LDTA 3IQDB 5KWEA 1PTJA 1V6AA 2W4QA 4WEOA 1B14A 1BDMA 2O3JA 4EUEA 2BD0A 5TT0A 5COBA 3NEPX 5JDIA 1V3UA 1W0CA 3GT0A 1U28A 3PIDA 4YT8A 5JCJD 2CFCA 1GFSA 2NVBA 3V2GA 2DQ4A 1GZ6A 3OJFA 1B0AA 1OZAA 4WNIA 1LRJA 3UCEA 3HDYA 4XGNA 5L95A 1NTOA 4UUPA 5H83A 4QEDA 4M1QA 2QRKA 2P4HX 2YDYA 4LMRA 2GCGA 1T26A 4W9NC 2CVZA 3ADPA 1MX3A 4NJMB 5L45A 3F4BA 4JN6B 2WD7A 2NQTA 2PD6A 5F1OA 2NVWA 3WQQA 4YT5A 1HZZA 2NU6A 3CZRA 4CPDA 1WDLA 1UXHA 4DBVO 1A9ZA 5U4QA 3OJEA 2UDPA 4CLDA 4S1VA 1XKQA 4BO7A 3KYCA 3G1TA 3C7AA 2IODA 4WK6A 5JAQA 1ONOA 2WDZA 1RYEA 3E48A 1H6AA 2DBQA 4IM7A 3SEFA 4W9NA 4I1IA 4FBGA 1V0JA 2VOJA 4KDFA 3EUWA 2FR8A 4XD2A 1VSUA 4TVBA 4ND3A 2FPIA 4DREA 4Y8VA 1P1FA 3VC7A 2G0TA 1U3UA 1ADCA 3U62A 5COQA 1HLPA 3ZV5A 3SXPA 4DL9A 1JVBA 1KVUA 1NX6A 4XKJA 4TRRA 5KVCA 1D8AA 2B83A 4MVJI 3WIEA 4FB5A 5CDTA 1I36A 3H8VA 4RO0A 3PPIA 4WOJA 3RCBA 3AI2A 5CDGA 4O63O 3W6UA 4L75A 4BUCA 3QWAA 3PQFA 2B36A 3OA2A 1U5CA 5AXCA 4FQ8A 3M2TA 4DPKA 4FOSA 2Y0CA 1QV6A 2HJRA 2ILTA 4ID9A 2EKPA 3Q3CA 4CM9D 5I8WA 1HWYA 1VM6A 3MJCA 4OL9A 5KJEA 3VTZA 1I3NA 2XXBA 3BHJA 3ZV4A 2PKRA 4BGEA 1R4NB 3F1LA 1ZSVA 3INGA 1R15A 3WNQA 3H5NA 4OXNA 4GX1A 2JAHA 3GVIA 3HB5X 1MXHA 4R16A 4RVGA 4ZJUA 5KJCA 1S6YA 1N7HA 2P4QA 5L7YA 4UVDA 2X58A 5B4VA 4J1NA 1C3VA 2PZMA 3A06A 1GCUA 3UCFA 3ROKA 5JO0A 3TZKA 3UAGA 2Q2QA 5ICMA 4NJMA 4J6FA 4I9UA 1E3LA 1V3VA 3GVPA 4JK3A 5EMHA 3PDJA 1MC5A 1PGQA 2J6IA 2WMDA 3OEWA 1SMKA 1Y9AA 4DLAA 5EN4A 8LDHA 4XA8A 4MDHA 2CVOA 1P33A 2WD8A 1C0KA 2X86A 1CIVA 3I9OA 1ZNQO 2OFPA 3H4VA 2ZB3A
chains in the Genus database with same CATH superfamily
5FA5A 3LNTA 3T4PA 1II8A 5KS2A 1LLFA 1UOEA 2JRLA 4ZGGA 3D54D 2QG4A 1EGVB 1M2OB 1Q5PA 5FBLB 3R09A 3FI0A 4NC9A 4B76A 1VFNA 3E84A 2HB6A 1UKEA 2LBPA 2YBDA 4O02B 1J1ZA 2PKQP 5TPZA 4DADA 1IMOA 2R8OA 3F67A 1FTGA 4W5WA 1GNQA 3UH1A 3W3AH 4DSTA 3ZDCA 5JS2A 4HJRA 5LUAA 1U7TA 4JKIA 2WWXA 4YRAA 3RIYA 1XAJA 2H9YA 2X7JA 4Z7NB 3FG9A 2IZZA 3RS3A 1YONA 3LKVA 2CLDX 5FA6A 1MAHA 2VDOB 2NTEA 4XOUA 4JFAA 1NZJA 1NT4A 2XCUA 4UTVA 2FY8A 1TVMA 3IT1A 2JZNA 5JSZA 4P3PA 3C3MA 3V33A 1T2UA 1M1NB 3FYCA 4DR5B 2W5UA 2NUTA 4AC9A 3D6UA 2IE8A 2QTVB 4TL8A 3GMIA 4YJ3A 4X97A 1XXHA 1Z16A 2PANA 8ATCA 3TK1A 5G1OA 4KMSA 3D6AA 1OFHA 3RRJA 4XVRA 3D6MA 1G5RA 1PW7A 4TVOA 5GOTA 4DA8A 5LP1A 2GN9A 2IGBA 2Q9CA 2JGNA 3WGNA 4BFLA 2DAPA 2WTBA 2CXUA 4K1XA 4UAGA 5K0SA 1R4NA 3LRPA 4RGVA 3QLUC 3RUPA 4BIIA 1QG0A 1AHPA 3LHSA 5GONF 4DLXA 4PG8A 1QUFA 1RBMA 4HWOA 4KE8A 1L7NA 2JJ1D 3MTQA 4L76A 4MGEA 2FUKA 4PHCA 4D97A 4RLHA 2WE8A 3KT8A 3V8EA 1Z07A 1DX9A 1K92A 1I1QB 1KFEB 2WZQA 5CCBA 1JYEA 1OLSA 2WJIA 3CUSA 1XTQA 2R85A 3EHDA 2C2MA 1YK1A 4X54A 5DASA 3WHIA 3LH5A 2XIQA 4Z9FA 4C5AA 1G8GA 1ZUNA 4Q19A 4NV3A 4UQPA 2FSIA 5JZBA 1ZVMA 2EEPA 3AR7A 4ZEWA 1YGYA 4WL0A 3WLIA 4MW0A 4AKGA 2VP5A 2O7RA 5B4TA 1XZAA 3MGGA 2G3YA 3U37A 2WAMA 4QICA 2CKMA 2RAPA 3AFGA 2NPOA 1TGVA 1Y3HA 2A5FA 1IJFA 2Z2JA 2IK8A 3VOBA 2XITA 1IZ0A 1K98A 3IR5A 4FD3A 1X38A 3LUCA 4N39A 3RG2A 4AG3A 4IIBA 4EI8A 4LK2A 3PWSA 4LJRA 3GJ5A 1M72A 1QKJA 3HMKA 4Q9HA 4EHIA 1CULC 2VYVD 4P08A 4UOEA 2KYRA 2Q4OA 2HPHA 1UXOA 2WHXA 3FN4A 4MVWA 1V37A 2C9ZA 1DUSA 1I6LA 4BJ1A 1KMCA 2ZR9A 3BF7A 2MT9A 3EFEA 3OEED 5U1PA 3M6UA 3W3AD 3AVTA 3FHJA 4PU0A 3WYAA 2H31A 3PNOA 1WHSB 5KHAA 2JFPA 2XJ9A 3EY9A 3FUWA 1E32A 3G9XA 1BXZA 2G04A 5EE3A 5E7JA 4W5TA 4OHRA 2RHBA 1P2DA 2IEYA 1IFXA 1JBQA 3EYAA 4MQEB 4B2IA 3N6XA 1JA9A 1O94D 2FZ5A 3FPGA 5EJMA 3WGJA 2ZB8A 4O29A 5A3QA 2A59A 3RB8A 3Q8XB 5T8KA 4R05A 2K7ZA 3ZVRA 5IASA 5TGTA 4JV5B 4UU0A 5DSZA 1FUIA 2ZT7A 2PKWA 5LZ7A 2ASEA 3CZPA 4J75A 4Z0TA 2DPMA 1ZH4A 2FRDA 2WIBA 4AMGA 1H8HA 2YHSA 3K5PA 3MRXA 5JJLA 4C7XA 3HFGA 2XWBF 3PE6A 1RXUA 1Y5NA 4NOLA 2VHYA 4UHJA 4YMGA 2WTEA 2F3UA 2J6CA 2W58A 1S2LA 2E3JA 3WI7A 4YRPA 1E64A 1NBME 1ELOA 1ZL0A 2BP7B 3JZAA 2YVLA 3KSRA 1UQRA 2EDCA 4AQDA 3OM8A 1UUFA 4TYNA 3LCUA 4N7BA 1LD3A 1EK0A 1M3SA 5IYZF 1I2DA 5T41A 2R84A 3U3KA 2FSGA 4CKXA 3OIVA 1L7QA 3UHPA 1YA4A 4BO2A 4F96A 1A5BB 1NPDA 3Q41A 2OOSA 3HKBA 3IELA 3UBMA 4KDEA 5KDLA 3EDQA 1PSDA 3S44A 3CW8X 2OXEA 1APBA 4P6VF 1JQ3A 2FB9A 1ND5A 4D46A 2VXBA 1SCDA 3LL7A 1D2AA 1D4FA 1BO6A 4TWRA 3HZZA 3I42A 1QMGA 5AQ1A 4J91A 2QTAA 2F8TA 5IU6A 3WWYA 1RADA 4RMNA 1OW3B 1TLLA 3HI6A 2PYIA 3SSAA 1Q2UA 1PDVA 4BNNA 1F51E 2CZGA 2VAMA 3DP7A 3TW8B 5HKBA 121PA 1UL1X 1AC5A 3ELBA 3VPBA 4YAEA 5DRTA 1E92A 3E3LA 2DBVO 2VBFA 3MTGA 5AK6A 1ZDMA 1K97A 3OOJA 3G3EA 1Q20A 1KJIA 1Z3IX 3ER6A 4OGLA 2E4VA 1YQUA 1FNBA 3EVGA 1HE8B 4RAOA 2GF0A 3QFSA 5I51A 3TZEA 4WLUA 5JNVA 4K0KB 1DC6A 3D5TA 1A7AA 3HCOA 4GX2A 1WD5A 1X1QA 2FW1A 2P6UA 1EK6A 4MS3A 2RHOA 2EEZA 2L17A 3O4JA 3WXMA 2FEOA 2W0SA 5P8WA 1ONPA 1F06A 2GI4A 3WDLA 2GEFA 2HBRA 5H0IA 3DKVA 2HHCA 5SYMA 1JMVA 1DBSA 2ID4A 4OG2A 4DMRA 7GPBA 2H4WA 3M33A 3ETJA 4QNMA 2OO3A 2X13A 4YXWA 2NZ8A 4P5PA 1PNTA 2Y1WA 4CIVA 3H19A 5J40A 3ROQA 3IDZA 3RUIA 2NM0A 1NUAA 4FQ7A 4QFDA 1G2IA 1ZG3A 1S01A 1ABEA 2FRXA 2ZE7A 4ZA2A 2OOKA 2AGVA 5LA6B 2YZGA 4EPWA 1XRRA 4OXIA 4WADA 2ERXA 2HWKA 3QEBZ 3NHFA 2R751 1GT91 2E49A 2HEIA 2A7XA 1KHTA 3RV4A 3L8CA 2A1IA 3EEQA 3GU3A 2CLOB 2X2PA 1JQLB 5K3SA 4CR8A 3OQVA 5BR1A 4PGMA 3E3NA 1PHRA 4IJVA 3FROA 1HO3A 1C4OA 3BMNB 3QOXA 4REMA 4XVHA 1K0FA 4OKIA 3PRJA 5BWNA 3U5TA 1CRLA 5DHFA 3EGXB 3M9LA 1SB9A 1BVHA 1P3Y1 5AJXA 3CONA 2VKTA 2ZRBA 2JI8A 5BV7A 5BW4A 1NPYA 1XLTA 3FJ1A 3FNEA 2IYFA 5JXWA 3LW8A 1W36D 3DYVA 2KS6A 3IKVA 3EOBI 4ZEVA 1BQ4A 3ZDRA 1EJ6A 2FYTA 3LPNA 3NT2A 2G88A 5IJXA 3CZ4A 2P4SA 3IOEA 4FFSA 1JFFB 3TD6A 2GLUA 4LPSA 1GOTA 2Q8NA 3H9UA 3NAZA 2AW3A 2RHWA 3IR6A 4IX1A 4TYQA 3D0KA 3WGMA 3GJQA 4P86A 3TB6A 2AEEA 5ENDA 1UQTA 3BD9A 4AIIA 1WXEA 1NLUA 3BDIA 4RK7A 3T4UA 2MSWA 1DBVO 5KTYA 2IQ5A 3EZ7A 2O2YA 3OTOB 1F1JA 1AD2A 1KY3A 2ANBA 4FNAA 4IRMA 4YN3A 1YKGA 3GGSA 4AWBA 5C53B 3QUBA 4UCFA 3ZU5A 1YC5A 1X8JA 1GZ5A 4RCYA 1LC0A 1Q17A 1G2OA 2JAOA 3KCQA 4IQGA 4V0SA 5B5SA 2Q7DA 3A6PC 5FBKA 3CLRD 4JUDX 5DNVA 4MVJG 2VJOA 1YZKA 3ZCSA 3FOFC 1DIAA 4FLFA 3QMVA 3B7GA 1OI7A 2NO7A 5CLQA 2OHVA 5I9IA 1RJ9B 3LCCA 4R51A 2I1QA 3JZDA 1VBMA 3BREA 5SY6A 3MK31 1KZ9A 1PD0A 3DFUA 3K2EA 1T34A 2UAGA 4Q3CA 3PIRA 4C1BA 1YB7A 1I10A 2JK0A 2Q9AA 3DMPA 3H9CA 1Z38A 3O8NA 3UAOA 1VJDA 2MTBA 1X0VA 3AETA 2E4YA 1AQUA 4GP9A 4XARA 5FO0A 3WHPA 621PA 4RZIA 2AFHA 5D2CA 4D5EA 3I3SR 5BUZA 2ZI7A 3OLQA 4RHCA 3IMCA 4J3FA 5DLQC 4WOPA 2W2KB 4L1KA 4G65A 3LUKA 2HGSA 4LJYA 2G9ZA 3DVSX 4RMGA 3ZWNA 3ZHQA 3EXIB 3NM4A 3DV9A 1CX9B 2O5EA 5CEJA 2FLKA 1W85A 2IW1A 1WXIA 2CXOA 6YASA 4CEJB 2C2XA 4F6RB 3A6KA 3OBBA 2B8NA 2F43A 2GBCA 3QE2A 1P39A 2R7NA 2VPZA 2NSDA 2OG1A 3Q7EA 1XEWY 2X0JA 4MH0R 4GW3A 1H0RA 1PR9A 2H4XA 3GCXA 3OCYA 2PUHA 4B73A 2WJVA 3ZJTA 3EVTA 4OMDA 5K8CA 2OLJA 4CG3A 1OASA 3IP8A 4DE5A 2ZPAA 3NEAA 4HPJB 2ZSIA 4KK3A 4NBSA 1CF2O 3LYUA 3E9NA 1YNOA 2I1WA 3EC2A 4GSLA 1JHQA 1RRKA 4MJLA 3ZHRA 3C85A 1SC9A 3M6IA 3ZLJA 3TPZA 4I6GA 5F5NA 4JI0B 1HY3A 2P65A 4PYIA 5ES3A 4C07A 1QF7A 7MHTA 2CDNA 4F2GA 2WNHA 4KN8A 3KSDO 3N7TA 4NBRA 2QL7A 4INOA 2YH2A 4Q37A 3L6BA 1N6RA 5GJCA 3VMFA 2Q3LA 3DO6A 1P4RA 4QUKA 3VO2A 2GM5A 2BM8A 1BFKA 1BN7A 4DANA 4YJ2A 1DKPA 3HADA 2XWPA 3T61A 3C6MA 4RZ2A 1J9EA 3VJLA 3M6XA 5CVDA 1IEXA 4RE5A 1HDYA 4UATA 1SU7A 3OOYA 1NONA 4MROA 4HAIA 3PUWA 4KWIA 1F2DA 2HSEA 5EXTA 4TWJA 2FF7A 4K9RA 1R74A 1Q7EA 1S1CA 1X87A 1EU1A 2FWRA 4O2AF 4R2JA 1T91A 5D5PA 1L5LA 2CT8A 3E5NA 1VG9B 1HTTA 1SHTX 2RGAA 3NYQA 4OHUA 3HU5A 4AY5A 5DYTA 4IXMA 4ZJZA 2QUAA 1E3JA 3EEYA 4PQEA 3UZUA 2W22A 1V1RA 2YHIA 1PSZA 3L3BA 1NJ1A 2QQGA 4WRRA 3SX0A 1M2VB 5DJ5A 1T5HX 2B2XA 1Z4LA 4GR4A 1XMOB 1Z28A 3OKCA 4NEHB 4LXXA 3R75A 4WA7A 5ALNA 3RTEA 2K87A 4B43A 4B3HA 1YL7A 1FMLA 2DE0X 2EIXA 2V7WA 1A50B 4O4JA 5EE9A 2ZSKA 5K0EA 4M21A 1GU1A 2D0OB 3MC1A 4JITA 4QD3A 3UJDA 1ZNZA 4P81A 1V35A 4BVHA 3I23A 2V7PA 2IBMA 4EJ2A 1NMQA 2A5LA 5HPYB 4NMLA 4N47A 4FT2A 3NVKI 2VQSA 1JFLA 4QECA 3C8HA 3NHLA 3TMYA 3R1IA 4AZ3B 2CXSA 3OX4A 5B3KA 1Z15A 3ON5A 2W9XA 4XCVA 2ZJ3A 1JH9A 5HYVA 1E2NA 3BKXA 2OXRA 3FSEA 3PSAA 2VXCA 1VHJA 1TA0A 2IXFA 1QF9A 5ECDA 3I2YX 4U8GA 3PHCA 5K2MA 3D4BA 1KZHA 3RARA 2XSZD 3AUKA 3SJZA 2HJ9A 2ZKLA 3BSYA 3HU2A 2CBZA 5EHGA 4PN7A 1MFZA 2O0KA 3COVA 4LC9A 1W0JA 2VJQA 2XWJI 2DY1A 4CQNA 1V4NA 2O8DA 4YB8A 4ESOA 1CT9A 4Q9AA 1G6Q1 1TCUA 2CNDA 1MV5A 1Q1EA 3A4IA 3ZWCA 3A6LA 3ES9A 4IO1A 4TSFA 4FW8A 4PNEA 3FB1A 2GESA 1RJDA 3G2PA 3PT9A 1U0TA 2ZTUA 1CZNA 3FB4A 4F3RA 4F5WA 4R2LA 1NVAA 3CPJB 4HAOA 2HX1A 4BZQA 1TRKA 2EYUA 1D03A 1DUVG 2XUDA 4IVRA 1OT5A 5LCXA 1C81A 3HWWA 3NHBA 1EGQA 2OXIA 2F8LA 1QR6A 5D86A 3SJAA 2OHHA 3CV3A 5I8ZA 3WFIA 4HKTA 5FLKA 2P35A 2YV2A 1LNZA 2C31A 2ZI4A 5ALEA 4RJTA 3EX7C 3L0PA 5JFOA 2HYIC 4GZLA 1KRXA 4XR9A 3HCDA 4ZCRA 4RXMA 5DXAA 2D0IA 2WM9B 1HYGA 4LQ4A 4ZK6A 5P21A 3EOZA 4WXPA 4KVGA 3AVXA 3VZBA 2GJSA 5ES4B 1XRMA 3K9QO 2IEDA 5CIWA 5CDFE 5FNVB 2I2AA 2HY7A 3OEHD 4J1TC 4O4LB 1K2VN 2ZVQX 3GRUA 4LWPA 4EUKA 2CLEB 1DO8A 1XDGA 5LB2A 3FYDA 3M4ZA 1XA4A 3Q3GE 5FOWA 3U4QB 2AZTA 4H7EA 4KJZA 4MEAA 4E12A 1J0EA 1KI1A 3C5EA 3VR6D 3UMSA 1J9GA 3DZBA 5JD6A 4U2DA 3PTAA 3S5UA 1QQ5A 1VQ1A 3ZWYA 5FPSA 1SJ9A 3E9CA 3ZE2B 3QVGA 5HQ3A 1IBSA 1M0SA 3FBGA 4X20B 1IIRA 3DCJA 2JJYA 4I1UA 3IVRA 1C0LA 1OX4A 4K6MA 3IL2A 1I1HA 4ZHQF 3K5WA 4H7FA 2PA0A 3TSCA 3TXAA 1C0IA 4N7JA 5IBCA 1EM8B 2NXNA 1KS9A 4KMRA 3DS8A 3I37X 4QU9A 4TRMA 5I6DA 2XD4A 3MT0A 2YWGA 3ML1A 3AUFA 3AB7A 5DKFA 1L5QA 4PZPA 3A70A 4GE0A 1EE2A 2UZ3A 3TZLA 3GRAA 3FDXA 3TECE 4FCTA 5JS6A 1G5FA 1L5YA 2QXYA 5HTKA 3RI3A 2Z1DA 1BE1A 3EVBA 5DM70 4JODA 1G3MA 4JVSB 1VFPA 2WWGA 4ZGBA 4CMAA 1CY0A 2Y67A 4MW5A 4B2YA 2KSQA 1W0KD 2ZI5A 3GZ4A 4PY2A 4ZMBA 3KBBA 2GRAA 5FA8A 1NDUA 1ZOOA 5SZJA 2BZSA 3H75A 4AJJA 5TIIA 4QG7A 1U02A 4J3JA 3KKPA 4F56A 2DR2A 4ARZA 3W90A 1HOXA 4GPD1 4RORA 2HA5A 1L7XA 2B37A 2PUAA 3IDAA 4PZ0A 2VRCA 4G25A 3W8DA 1T9HA 4WQMA 5ICGA 1JLLA 4X8LA 4WECA 5FFMA 1CB0A 1CKEA 2JH9A 1SXJA 2LUOA 3CTMA 3DOHA 3B85A 4J7AA 1XRQA 2CMDA 4L4YA 4OJYA 2DCMA 3SBEA 1IXZA 3IVAA 5D3MB 1XEXB 1A7UA 2AJBA 3ZVNA 1NVGA 4BN0A 3HNPA 4K6FA 4BN5A 2WTAA 4IIJB 3X1YA 2VCEA 2YRXA 4DM7A 1KI6A 3BKWA 1VMIA 4OHBA 4GI5A 3Q9UA 4WBNB 4H3VA 1R0SA 3KOUA 1DAGA 1Z4PX 4W7IA 5AKIA 4AECA 8GPBA 3CVWA 3K4HA 1CDEA 4O4IA 2F4VB 4LK3A 3C3AA 3IAXA 3V4PB 2DWQA 1IYZA 3LC7O 2O8EB 1FSZA 4IQ0A 4CM1A 3LLSA 2FWNA 4L4ZA 4YH1A 2HF9A 1EP2B 4OHFA 1I3OA 5IXJA 3FKJA 2RAUA 1ACMA 1WEHA 5A6VA 1AO3A 2H1OA 4J4TA 1N1EA 3FHLA 1WMEA 1ICIA 1XALA 2X8BA 4U7GA 4LBVA 3A6EA 2O2EA 4W8GA 4YAOA 4UM7A 1K8QA 1DSSG 2QUKA 1RPTA 4Z9BA 3G8YA 4FNMA 3PU6A 5JQGB 4AS1A 4QXPA 1WZIA 3ICWA 2GN4A 2OCYC 2HK6A 4PQYA 5EKTA 2FEKA 2DFKB 2R25B 3EQ9A 3RGWS 3T3PB 5ITZB 2IA5A 5I4IA 2YYAA 1KWGA 4X7PA 1LDEA 3CNQS 4M98A 1Q44A 3LHFA 3CUWA 4QPPA 3ZJVA 2GM9A 3QG5A 4O4HA 4DWOA 2BM9A 5CTJA 2WPDD 1WUKS 4X62B 4OGKA 4FKZA 4HNSA 3NFRA 3RANA 2ET6A 2VPXA 4R6XA 4BGVA 3MOIA 5ALXA 1NBWB 3PNLA 1K6XA 4EA6A 3NDPA 1P8AA 1X6VA 4ARSA 2Q6VA 4G4GA 1C7EA 1P19A 2EZUA 2XCQA 4F06A 5JSZB 3PQ3A 1CERA 5AUOB 4KLZA 1TJ4A 3NJRA 3CIFA 2NUTB 1GTG1 3G13A 3H84A 1T4BA 3P45A 4KPYA 3QM1A 3I1YA 2JLAA 4XE5A 3FR7A 2Y99A 1GTZA 2G6BA 2JD0A 2QR3A 3I9V6 4NXMB 1F12A 3AIKA 4M3NA 2VN8A 3DMRA 3PNQA 3I4LA 5F4ZA 3THSA 3BMQA 4A91A 3SFZA 1WZ2A 4WVLA 2GSWA 3B53X 4ERNA 5CFOA 5B12A 3KQOA 6PFKA 4ND1A 2RGRA 4Y2GA 3E9DA 3RSOA 3I6BA 4Q16A 1JE1A 4MV7A 2JHGA 3TNFA 1KMIY 1SIUA 3WQSB 5LWQA 2H7CA 2RGGA 4G5GA 2IWHA 5TLSA 2DH6A 1M5RA 3BORA 3AVVA 1XZMA 4HDSA 1XO1A 2EP5A 2D4HA 4RUKA 2UYHA 1KU6A 1V8DA 2QTNA 3P0IA 4I8XA 4MVJE 4R81A 5K8IA 1XWFA 1Y3CE 2AN1A 4PLFA 1R6BX 2GEVA 4YRZA 1X39A 1P1RA 2A58A 5CHYA 3WICA 4A27A 3EZXA 4EF4A 3ZKAA 3CVOA 2HU5A 4URZR 2W70A 1A4IA 2DTXA 1GQQA 2DXIA 4ZO8A 3VI4B 1O3YA 4R69A 1F2UA 2HPAA 2FI1A 4FNGA 1JI3A 3JQ9A 3L4BA 2ROQA 2W6PA 4DMMA 2QNRA 4ZRNA 1SKQA 2B4TO 2WF7A 4J9UE 4DNQA 2NAFA 2OHGA 2Z8XA 1JAZA 1MAVA 3QPVA 4MAFA 2ZSBA 4A73A 5ALRA 5EIFA 3HLYA 2J3MA 5BSEA 4X0EA 2AUNA 4RIFA 3S40A 1A8UA 1HNXB 4XUEA 3OJXA 4OQMA 1FFCA 3B1XA 2RAFA 2WG1A 1JB9A 1L4YA 1NW6A 3IBTA 2AI1A 3GVCA 4G8CA 2YDXA 5FL7A 4EG3A 3VR0A 3U5ZB 4BL5A 5GGXA 3V3KA 3IVMA 3J7TA 1SELA 4H0CA 4HADA 1N57A 1LNQA 4US1R 5EPUA 1YQGA 4TLAA 4U7DA 1TUBA 2VZ0A 5ALFA 1W5TA 2BEVA 1T36B 2EL9A 4KCGA 4D4KA 3QVOA 4XLTA 3OM9A 1JAHA 4NFHA 4DCMA 4YCNA 1BZYA 1VJGA 3AUYA 4YQYA 1RWWA 5IJZA 3EQ2A 3GDWA 2R7KA 3H1FA 4MIYA 5BOSB 2UYCA 4UUOA 4JDPA 4L9AA 1EI9A 3TI7A 5D5QA 1FVXA 3S55A 3I9LA 4Q7QA 2F9MA 4N5HX 1SCUB 3CUTA 4MUMA 5LQMA 5MN4A 2RHLA 3UMRA 1E8MA 2D2XA 3KYDA 5L3VA 5HKOA 1SULA 2PTGA 1UODA 5BV8A 1E7SA 2RB4A 3WGOA 4JYBA 2Q0XA 4XX0B 3N59A 1R7RA 1XLVA 3AHFA 1FXUA 4HWKA 3UJ9A 3SHVA 4FIZA 3HO6A 1L7BA 4UDYX 3SXJA 3ICCA 1ZIXA 4Z7JA 1DG3A 1H1LA 4RDIA 4TKVA 2FGJA 1E1QD 2EWVA 1VJRA 3IHLA 1V4VA 2YXNA 2OZEA 1FDOA 5ESDA 3T99A 3T5CA 2QW1A 2CC2A 2GHTA 5GV7A 1R6VA 2XUJA 3LAWA 2ZIUB 3R2JA 4V3CA 3NHUA 3OU7A 2W2VA 4DCGA 2XCOA 1KYVA 2Q6IA 3BERA 1NHWA 4NK5A 1DDIA 1U7WA 4WIAA 5ER9A 3U7RA 5BYKA 1R1DA 2N46A 3HKBB 3LQ1A 5DM1A 5BSFA 3DMFA 3ELWA 3CJRA 3T4EA 4DJFC 1ZWKA 1SXHA 3KOYA 2BI7A 2I2DA 1L9KA 1P45A 1PYDA 1C8KA 1ZMXA 3WYGA 1RSZA 1BX3A 4KXNA 3PF8A 3CXRA 3ZTTA 4ETNA 3FPLA 4UUAA 3CW2A 1I9CA 3UJPA 1B6SA 4XQ9A 4EHKA 2LZ0A 2H5LA 4E7PA 3V1YA 3WMWA 1H0KA 1XHLA 3QNMA 3LYLA 4JDUA 4W7SA 4OXQA 3IVCA 4LRUA 3VBEA 1U3GA 3EOAI 3OCVA 5COAA 3SC4A 1G8FA 2CCJA 2EV9A 1HE5A 2ZIWB 4FFWA 3UK0A 4ZALA 1FMJA 2MWMA 4RA6A 3VAZA 1G4UR 3L7DA 4FEEA 3IEUA 4FFBB 4HAYA 4JJ7A 4AZ0A 1A9XB 2FSFA 5FTLA 4RVFA 4CLOB 2PNJA 4MGIR 1C7JA 1XK6A 4M1YA 3RRMA 4IINA 1JLRA 1K6MA 2HA0A 1NR1A 3O2NA 2JGMA 1XCLA 2W2NA 3MZ0A 1JPUA 4G9GA 2XUFA 4WGGA 1JGTA 1OREA 3SHQA 1I7NA 1QV7A 2ZT5A 2Q6TA 3H3FA 4G1CA 5CIYA 4AZTA 4BRWA 1N6OA 4DPMA 2NO5A 1L5WA 2P2YA 2V8BA 3CNNA 4HXGA 1ODFA 3LQKA 4U7FA 5TT1A 5JFGA 2G0NA 4ZWNA 1XZBA 5AVQA 3ZEIA 5IZCA 4ESVA 3IDOA 3UJ3X 2CXQA 2OO5A 2X0EA 5CLIA 3HZRA 1U5BB 4HFRA 4TYPA 5EJ2A 5GMOA 3VOAA 2XTAA 4R8LA 3LCJA 3ZWKA 1V7QA 4RYLA 3SJCA 3DWIA 1QKIA 3GUYA 2OB1A 2ZUWA 4I4TB 1MVNA 3SHFA 2NT3A 4ZOLB 3VZSA 4CCAA 2VK1A 3B51X 4CM7A 2V58A 3HE3A 1VE1A 4QJIA 4DNOA 5KX5A 1NVMB 1I4TD 1NN5A 2GD6A 4X1YA 2YWEA 2WQ7A 4HQ0A 1A8SA 2QN3A 2RAVA 4DA9A 5F1PA 4WMLA 1K86A 3SEZA 3FZEA 3OFND 4YCLA 4AI6A 4NH4A 2WU0A 3BHIA 5EWLB 1N2JA 3RSZA 2RCNA 4C6SA 2G40A 4Y98A 1VLVA 4B35A 2ZRGA 4OYYA 4QG3A 2C96A 2BY4A 4UPVA 1R4AA 1QHYA 3QELB 1JAYA 4N18A 2B21A 5FLYA 3JQ7A 5HDQA 5JNRA 4GICA 4KGDA 1SZCA 2PCJA 4PCLA 2OENG 3HG7A 5DM2A 1JU3A 2WKRA 3G1WA 3ND7A 4GNKA 3R9IA 1XRJA 2OCDA 2X41A 2V5UA 2UXBB 5CVTA 1GJRA 3ZHZA 4A1OA 5DYNA 5KVVA 4LRWA 3WNVA 2VF7A 4KSCA 1ARZA 3MMXA 1XL0A 1DKNA 4UPEA 1IUNA 2N0SA 3K1YA 2AOXA 3STTA 4GL2A 1G8MA 5UKDA 2BVNA 2P68A 4KVAA 2QRPA 5FBWB 2O2CA 1SB8A 1DMSA 2G9NA 4AMVA 3LK7A 3HN6A 1TQ8A 5C35A 2M2IA 1YS4A 5G0TA 4EKDA 3ENQA 2AV6A 4JKYA 1DHTA 1VHLA 4I4LA 1YU9A 4KLNA 1WM1A 2FDRA 3HDTA 3OZAA 2HU2A 1C29B 1VMDA 3E70C 1QRUA 3D3WB 4RWEA 5KQLA 4BQRA 3SICE 3B6MA 3M5DA 5BMVA 2A5YB 2R1TA 1Y7LA 3OFSA 1TKBA 4O3FA 1LSOA 1QGUB 3BEDA 3HEBA 1UDBA 2OXFA 2LRHA 2PX3A 1Z8NA 1B1CA 4OYHA 5FD8A 3VHXB 3ZWQA 5B3JC 3FVVA 3G8DA 4P2GA 2IT1A 3S81A 2C2BA 1C1YA 2D62A 3VZQA 1HTWA 3PD7A 4BMSA 4QJ3A 2QPLA 4U2GA 1TF7A 3ZLBA 4DM3A 3AZPA 3AYXB 4W5JA 2NUAB 4LNHA 2XE4A 2DSTA 3RYFA 4XYBA 3TFWA 1CBUA 3HDQA 1Z7BA 1SCBA 1UBOS 2I0FA 2CDCA 1ORRA 4N0DA 3O3OB 4PAOA 1W5FA 2DUNA 4GEKA 3RU9A 4CU2A 2DHCA 2WAYA 5DBHX 5HKKD 5TS2A 1MRZA 3ED5A 1WDWB 3Q3IA 4ALIA 2DQZA 3UJ6A 2C88A 1S2OA 1W85B 3GFRA 2QUHA 4WFJA 3MD9A 3D3EA 1U99A 4KXXA 3QOYA 3B1VA 4RH3A 2WSBA 4DIFA 5HX7A 1FSPA 2Z04A 3TPCA 2I2BA 2ZRDA 4BVBA 1J2UA 5AM1A 1Z0FA 3FOBA 1H2BA 3KEQA 2YWXA 3U61B 4OLHA 4XYLA 3DR5A 1NZDA 2IEAA 1ZXBA 3S6JA 1C5KA 2OXCA 4J0CA 3P2JA 3L7AA 1GUAA 3AG5A 4TXHA 2FTKE 4HFMA 3CEJA 1CHDA 2VHTA 1PI3A 3KFLA 1RZRA 1IBKB 2DFTA 2WTXA 3T06B 1KYQA 3WK6A 4CTNA 2CSXA 2NTNA 4DIOA 2Q3HA 4XVCA 1HM5A 3T7AA 1ZIYA 3O1LA 4JLAA 2EXXA 5CAEB 4D44A 1GNLA 4BC1A 4F86A 2WWYA 1FE8A 2CLCX 5DW3A 3FTDA 1AGRA 5IW8A 3O92A 5CM2Z 1KVRA 1GA1A 3V8RA 2OP0A 3IUNA 4DVGA 1QIKA 4R0VA 1BHJA 1GEGA 5KYXB 1NAIA 3HPQA 2DQKA 4KAJA 1EWKA 3EGDB 5FV7A 5BSVA 4C0BA 1T25A 2YNMA 2XTZA 1ATZA 3TBFA 4QYWA 1WW8A 3C16C 3K9HA 4CKEA 4YJDA 1Q7RA 2PFSA 4BZXA 1H9AA 3KXIA 3ZGVA 3ZDFA 4DSZA 1GSOA 2HIGA 2QRLA 4HDRA 4HLUA 2CLSA 3KAJA 3PEUA 5E8RA 1OWNA 3C3PA 3I45A 4B81A 3PUIA 4DR7B 2WOJA 2YHIB 3TUZC 4GYYA 2P1ZA 3RFUA 4KP7A 4FFRA 4FHFA 4XTRA 5BSTA 4IGFA 4OHYA 4GRIA 3DHEA 1CDOA 3N2ZB 5J2TA 3LUHA 1EHIA 4S05A 4GXNA 4JT2A 1XJ0A 2GM4A 2Y1CA 5MGNA 4BFZA 2CUNA 3ENVA 3QX3A 5KVSA 1J4AA 1YQXA 5T4EA 5TJ9A 1X7ZB 3KB8A 4XVQA 3L6OO 4Z3KA 2NPIA 3GUVA 1TC2A 3EUFA 2EJVA 4AYWA 2D5LA 4U63A 4QE3A 2JFNA 2YS7A 3ASVA 4U7TB 3W1VA 2OYSA 2SHKA 3IIKA 2F1RA 4MQBA 5DT9A 1H8EA 1F8XA 5DWDA 10MHA 1ZUWA 1PJ4A 1W2WB 2ZBUA 3GAMA 4I2NA 2Z6AA 2ZOSA 1DV1A 2RC6A 2V6JA 3BH7A 2PZGA 5TQVA 2CNNA 4Q34A 1H4TA 3TD9A 1L3BA 2NTYC 5DGXA 3SFTA 1WXWA 4FGKA 1NN3A 1ZL2A 3KOWA 3M4JA 3KLMX 3AQ4A 2GDZA 4MJ3A 2WKSA 3AFNA 5H5JA 2CFTA 1OAKA 3TUIC 1RLUA 4GS5A 4V38A 3WGTA 3GMSA 4BWYA 4ZXFA 2AF4C 1L5KA 5JHHB 2Q1XA 1M76A 1PJQA 4D42A 2YMLA 1PLKA 5CA0B 1RBQA 2X4LA 5I7FA 3HUUA 2O8DB 3DE6X 1UKAA 3MWKA 4Y6SA 2ZYHA 1RZUA 2B7BA 2XI4A 2X7HA 4URXR 1R5OA 4LRSB 1RR6A 3W8FA 1V6CA 1IXYA 2GN8A 4X6YA 1RWQA 1DKMA 1HNWB 3NTQA 1KOJA 1NV8A 1UBJS 1T6YA 2JFYA 3GZNA 4GR5A 5DH9A 4CDNA 3D59A 3TAXA 3NRCA 1XDUA 2WUGA 3N2EA 5EUMA 2B5WA 3EIEA 1SUSA 1USVA 2N9UA 1WCYA 1XZDA 1AX9A 2JKZA 1OU4A 3O3MB 4GMKA 2WHQA 3NB0A 1P1IA 2WMNB 1UC5B 4GU5A 1Q83A 3IGFA 3M89A 3V2IA 4BGUA 1KZ1A 1ZU4A 4M37A 2XCLA 3N86A 4OM7A 4OHPA 4ANFA 1H2WA 1YC2A 2RSLA 2X4DA 2IOFA 3EZLA 2BCEA 3GJSA 3K6RA 3LIPA 2BM1A 1J8DA 3NVMB 1C8VB 2GPWA 2W8ZA 4HNQA 4UDXX 4XDGA 4KI0A 2CL7X 3PFHA 4MV1A 1SHKA 1FDIA 2P9ZA 2HRDA 4BO8A 5LQNA 4L74A 4IGIA 4EUHA 4DA7A 3K92A 4IV8A 4U39A 4LYAA 2B20A 1X7WA 5GADl 4IH4A 3DVLA 2IPAB 1OGYA 1A9SA 1GGVA 2IUFA 4KFTA 4JGGA 4EY7A 1DDOA 4IIYA 5C9ZA 3TLEA 1SK9A 1C8BA 4ZQGA 1Z5GA 4KDRA 2QA5A 3AY7A 3HPRA 1EBUA 3WLHA 1M34B 1IZZA 2H0QA 5F7ZA 1BE6A 4GT1A 4LJ8A 4AICA 3UXEA 2BHLA 2NYAA 1G7TA 2JAXA 2QQFA 5B7GA 3KQLA 3X2EA 3VKGA 3P9KA 4MQ4A 1XPRA 5TX7A 5LLDA 1GSAA 1UPUA 1QNLA 3DOUA 4XPIA 3OLYA 2XHEA 3MAJA 1MG5A 2BJWA 2QX9A 3JATA 3QVGB 1AA9A 1VCMA 3TM5A 4OKNA 2B2CA 1LJ8A 4XIYA 4OL0A 4RELA 1LK5A 1OX4B 1J0CA 1B41A 1JEDA 2RJNA 3JQDA 4JT8A 1AHHA 2W6IA 3SC2B 2WP0A 1DARA 1RLTA 1TMGE 2REOA 3KZXA 4RVSA 2OO7A 2GUGA 3QK7A 3IAS6 1KXZA 2MYTA 1F14A 4ZYVA 1OXKB 1IOVA 3OFKA 1PQYA 1GPMA 3RS4A 3PP8A 1BVYF 2UZ0A 5H59A 2J48A 4PFJA 3FTNA 2YASA 1WSWA 1T3HA 1ZNXA 3STUA 4IILA 5FPTA 1BG6A 2PLRA 4NR0A 3BJIC 1BXRA 1U8EA 5CA1B 1VIMA 3BOSA 3BGWA 3QMWA 1ORWA 1S02A 2XBUA 3NJ4A 1BEEA 2P2LA 3TL3A 4DMLA 4NI5A 1QTQA 2QTFA 3RRNA 5KEIA 2JVKA 2C7QA 2XRMA 4MCHA 3I73A 2RKOA 1BXGA 2GWRA 4MV9A 4LTDA 1UBUS 3C5WP 4Q3EA 4HVTA 1EGHA 2CNKA 2IYUA 4TUYA 2OPBA 4RIIA 3V8BA 5K05A 1CG6A 2IVFA 4F5EA 1TD1A 3K32A 1DFGA 1WOYA 2R68A 3LTNC 1B8UA 1E9EA 3CF4A 3DCIA 3CMMA 4DQKA 4WLOA 1RQLA 1QM5A 2K2QB 3ZZMA 1Z37A 3CRZA 3Q6IA 4KAAA 5IDWA 5I9SA 4NLLA 1QK4A 4Z86A 2YIDA 3ILYA 3PDWA 3BXGA 4IVPA 3N2GB 2ZXUA 3F8SA 4ZT3A 2O0MA 4MLCA 5HIMA 1BEZA 3THWA 3KC2A 1KJWA 1MH9A 3VDQA 3ZD8A 5C34B 4FXPA 1ZY2A 3X1MA 4A8HA 1BOOA 2PDAA 3AY3A 5AOCA 3NYRA 1GZSA 2PX4A 5DO9A 1N75A 3G82C 2WUDA 4KGVA 3WJAA 4B8WA 1EBFA 1TVKA 5HUQA 4KR3A 4RHTA 2RG7A 1QLHA 1SXPA 1IUOA 5JNLA 4F8JA 5D85A 3SF8A 3R9KA 3FOCA 5BURA 4Q47A 1HDOA 1SZJG 2ACEA 3QU2A 4CT0A 5J1SB 2F3TA 2B0JA 3K7EA 5JR3A 1ZYUA 4UBIA 4FDVA 2HBZA 3NTRA 1WVGA 4RHXA 5LC1A 3TOVA 1MDFA 4OB6A 2O59A 4D9NA 2BJHA 3U3OA 3N0WA 2Y1GA 2R8RA 1QQ6A 3N87A 1GARA 1T4DA 2KBFA 4LVNA 3ZNOA 1Z47A 4PPFA 5LD2B 3L46A 3L93A 1P6QA 4RJLA 1TEVA 2RHJA 3HGQA 4DR3B 1ZA1A 2R66A 4WJZA 1DUIA 4AJIA 1W4ZA 1WDMA 3SC6A 5KTOA 3SE0A 1UDCA 3MWJA 4F5YA 1E4EB 2FMUA 1ORTA 1WX1A 1O94C 1TB4A 1PL8A 2CCKA 4Y2TA 2CNBA 1A04A 1MENA 2AWNA 2VT6A 3D4PA 3MBOA 4M9QA 1Q22A 2HW8A 2IDMA 2R6JA 3CJTA 2WIKA 3ZS9A 5BNFA 1WUIS 1G21B 2W00A 3K73O 2PGAA 3LXRA 5JJIA 2A35A 3PKZA 5F7JA 3BMQB 4YMLA 1YI1A 1QGOA 2Q6KA 1K27A 4JBHA 3TF5A 3N0VA 3LO5A 4R1PA 1N2OA 5KOHB 1KR2A 1KZYC 4YUZA 3VPHA 4FP9A 4ALJA 4AQYB 4A82A 2QLNA 3E6AA 4BMXA 1MFPA 4I8DA 4X1KA 3T1OA 4DRXB 1E6LA 3D6VA 4HDSB 2FN3A 1TVEA 1TZ2A 3HWRA 3W5SA 1RHRA 3BXXA 4HNAB 4N01A 5KIAA 3L4SO 1E6EA 1XI2A 5DIFA 1YS7A 1WG8A 3HKCB 1EXWA 5KNDA 2J0UA 1FXWF 2I2CA 4JJ6A 4IQ4A 4K0RA 4V03A 1CUHA 5KDOA 2ZUTA 3I9JA 2POQX 1RM4A 3BMCA 2H1RA 2HDOA 2I7XA 3L79A 1F2UB 2YWJA 4MVJF 4DDVA 2IXTA 3P9RA 3ZJ4A 4B3RB 2JFBA 1DT3A 3EGIA 4ILEA 3NHMA 5C7OO 2JBAA 1YTLA 2H54A 3HVJA 1JQAA 3GEDA 2D5BA 1M5UA 3W5HA 4AO8A 4AJOA 5IYZB 2V9CA 4H4DA 4N6NA 1EVKA 1N25A 4R84A 5M3BA 1FFGA 1L4EA 3FTFA 1ZZGA 4KTVE 3D6JA 2H8GA 1W9MA 4YXFA 3HB0A 2FF5A 1J5EB 4I9GA 2PS0A 4DEYA 4CL3A 4OA8A 4L9SA 4B74A 1T0HB 2A88A 2FN4A 4DWVA 2YV5A 4HWRA 1A5SB 3EXEA 2IEIA 1O6FA 1V3TA 2GJ9A 5E1OA 4MQLA 4QAQA 4YRGA 2ZZKA 1QHXA 1Z0IA 3KXLA 3OICA 2DLNA 3AESA 5JAZA 1WR8A 3JWEA 4YJGA 2GZAA 3FRJA 3TUJC 4DQDA 2BPOA 3BQ9A 1CQIB 3FYTA 1ECCA 2IS4A 4JWTA 1JQDA 4KSBA 3A0RB 1D07A 1LQUA 1V26A 4KQMA 1GU0A 4A8JA 2UVQA 3V7WA 3DL0A 2W83A 3FFTA 2E6UX 1Z6AA 2FH5B 1OBFO 3U3JA 1POWA 4BO3A 4E2XA 1T0UA 2J30A 1Z2EA 2RI0A