1I01A

Crystal structure of beta-ketoacyl [acyl carrier protein] reductase from e. coli.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
241
structure length
228
Chain Sequence
MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNANLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-KETOACYL [ACP] REDUCTASE
publication title Structure of beta-ketoacyl-[acyl carrier protein] reductase from Escherichia coli: negative cooperativity and its structural basis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 82
structure length 228
sequence length 241
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2001-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i01A00
1R66A 1LDYA 2HK9A 1NBOA 1DC3A 2Z95A 5BSGA 4DIOA 4F45A 1MV8A 1P1IA 3PGXA 3VH2A 5IF3A 2G1UA 5MGBA 1D1TA 3RU7A 1PGOA 1PJLA 1E6WA 3NT2A 5AXBA 1V6AA 5CDUA 1FXSA 4NFSA 4AJ1A 4UULA 1F8FA 4PFJA 3UCEA 4CR7A 3ZU3A 1E92A 4RL6A 3RBXA 2ZCUA 3DBHB 4DBVO 5GZ6A 1KVRA 5U1PA 3BYZA 3IDSA 4XB2A 5DF1A 2I5PO 3UVEA 4ITUA 3ZWMA 3NTRA 4DQUA 2OHXA 4FW8A 1ULSA 3E5MA 3I9OA 2NU7A 4X54A 1PL7A 3OJFA 3I23A 3RFVA 5F1KA 1LDBA 4PG7A 1R4NA 1SPXA 3DHYA 1KBZA 2O48X 4CMIB 4FOSA 4EGFA 3WBBA 3EAGA 4J91A 4K6FA 3TZQA 2ILTA 3LC7O 4CV0A 4ZHSA 1K5HA 2VUTA 1HEUA 3PXXA 4KOAA 4EUHA 4EJ0A 4FFOA 2Q2VA 2NWQA 4ZN6A 3JQBA 3GT0A 2G76A 3ZU5A 2YHIB 2J5QA 1MFZA 4FGWA 1LLQA 1NPYA 5EJ2A 4NZ9A 3GRPA 4Z0HO 3X2FA 1PZFA 3JTMA 4BQRA 1WLYA 1V0JA 3JQAD 4CODB 3BMQA 1ML3A 3LZ6A 3D3WB 3RSHA 1SO8A 4CMEA 4MIEA 5A5EA 1WXDA 3P5SA 4OQYA 4YCAA 3WGZA 1RPNA 5CHEA 1LQTA 5TJHA 5JDCA 4S1VA 4PLTA 1EK6A 1HXHA 1MUUA 4PLVA 4R41A 1EFKA 4CUJA 2WJPA 2OBNA 3LT1A 1V8BA 4IDFA 3OH8A 4D44A 3KSUA 1BHSA 4CLHA 4JQCA 3AU9A 5JYDA 1I3LA 1Q0QA 3F6YA 3JQ8A 4ZRMA 4D7AA 1B15A 3U4IA 5JCJD 2ZYGA 1EE2A 3INGA 3JQGA 4Q3DA 5TIIA 1PX0A 1JKIA 1M66A 3GG2A 1YE3A 1X7DA 3WYBA 2HQ1A 2YHUA 1C0KA 2PKQO 3ENKA 4J0EA 4MKZA 2X23A 4I9UA 4FN4A 4I8XA 4R16A 1T1RA 5G0SA 4GLOA 4N54A 2B4RO 4P4GA 2ZB8A 3VH4A 3GF4A 1IZ0A 1DRVA 3GAFA 1S7CA 3A1NA 3ZWNA 3K2BA 1NWHA 5G4KA 4BO9A 1ENPA 3I9LA 4B3JA 2C07A 2O3TA 4I9NA 2AQHA 2D59A 1M2WA 1UAYA 2J3IA 3KLPX 4XR4A 2PKRA 3VHRA 4NK5A 3INRA 3ROQA 1QV6A 4IPTA 4Q3AA 5H82A 4PG5A 4N5NA 4AVYA 3P2YA 3ZW9A 4IGFA 4TWRA 4YWJA 1R4MA 3O03A 1YJ8A 4GSLA 4O0LA 4YPOA 2DLDA 3F5QA 2CF5A 1Q7BA 3OEWA 5CDTA 4E2ZA 4PLPA 3G49A 1YONA 3TOXA 3AK4A 4AJPA 3INTA 2AEFA 3KOUA 4DL9A 1P1FA 4YJGA 2QQ5A 1DJQA 3KETA 1BTOA 3NAQA 1NVGA 1L1FA 2P4HX 4J7CA 4NPCA 4E32A 3WJAA 4DQXA 2IEDA 1KY4A 3AUAA 3AY6A 4D3SA 3OQ6A 4NU5A 4CM6A 1GADO 3EK2A 4TVOA 3S8MA 4CUKA 1RM5A 1XR3A 2F00A 1KIFA 3NDJA 4L9RA 3T7CA 3QWFA 1QSGA 2BMAA 1LRJA 1PJ4A 5LDHA 3OJ0A 1NHWA 1Y6JA 4ZGWA 3JD4A 4MVJH 3MEQA 3ETEA 4JJFA 4YVFA 3CUKA 1Q2XA 4RGBA 4CLDA 4NMHA 2GZ2A 4ZQHA 3MCVA 4G5HA 2VRCD 4J0FA 4BNGA 1O0SA 1UZMA 2Q4EA 4M49A 5I7SA 3MZ0A 3I1JA 3KRTA 2VWQA 2VTDA 3MTJA 1MFPA 4J2HA 3ASVA 3OP4A 4JK3A 2OGUA 4GGPA 5L53A 1QLHA 3LC2O 2O2SA 1IE3A 4IIUA 1SOWA 1UDCA 2NV6A 1GZ6A 1KEWA 2B83A 4U7WA 4JLWA 2ZQZA 1LDMA 2J8ZA 2WE8A 1TI7A 2W2KB 2X22A 3HE3A 4Z9YA 1OMOA 2VT2A 3RJ5A 2HJSA 1PGJA 1LA2A 4M86A 4U8GA 1E3WB 3E5RA 3WJ7A 1OZAA 3ANLA 3ZWWA 1ZCJA 4AFNA 2RAFA 4OGWA 5A06A 1XKQA 4UREA 1Z75A 7MDHA 1VJTA 5IDWA 4D3FA 4GKVA 5BNTA 4NG5A 4YQYA 4UUPA 2GZ1A 2C2YA 1DIHA 3EHEA 3M1LA 2Y1OA 4KQXA 5T8KC 5HBRA 1VL0A 1JN0A 1K0UA 2OP1A 1PZHA 3RUDA 4B4WA 2EG9A 3A28A 4J7UA 5H83A 3AUUA 5JO9A 3TWOA 4XQ9A 2CZCA 1V9LA 1LJ8A 4TVBA 3AJRA 4BNJA 2BI8A 2J3JA 5AXAA 3HN2A 2C7VA 4WEQA 1LXCA 1HKUA 2FPPA 3C24A 2O3UA 3HG7A 3UXYA 1F8GA 4DIFA 5HM8A 2DC1A 2J5KA 3PQFA 4W82A 1I3NA 2PD4A 4RVHA 3IMFA 2OXIA 3WG9A 4J4TA 1F17A 1UZLA 2QX7A 2GN9A 4RQUA 3U5TA 2X9VA 1D1SA 4PZDA 3JD1A 3UCXA 2ZK7A 5MDHA 2HMUA 4CJXA 3DOOA 1GQ2A 3STHA 4Z9XA 2GN4A 5F5LA 3LT2A 1XHLA 1W73A 2C5AA 3R1IA 4QEDA 4XYEA 2HSDA 1GU7A 5KVCA 2RIRA 4DWVA 5CDSA 2C82A 4QQRA 2CNBA 3RUHA 2BF7A 3MJCA 3GPDG 2J3KA 1U28A 3KV3O 3SX2A 3ZU2A 4CMCA 4HNGA 5GY7A 3H2SA 5DBFA 4L4RA 4PIVA 2EGGA 2BGMA 4BNXA 4CMIA 1NASA 1U2GA 4XWYA 5COQA 4ZU3A 3V1YA 3WMWA 2X86A 1HLPA 1KVTA 5EINA 3BTOA 5BNIA 1Z45A 4BKUA 2X4GA 1E6EA 3BTUA 3OEYA 4NQZA 1KEVA 3AW9A 4L4SA 1T25A 3PFWO 4IDBA 1A5ZA 3UH1A 1EVZA 2EEZA 3GEDA 3MOIA 5IJZA 2RBEA 4JBIA 3BMNB 3OECA 5TRTA 3KUXA 4XRGA 2D1YA 1MXFA 3TQHA 1YQDA 3D3WA 4OXKA 1PWXA 5TJ9A 3K6JA 3QHAA 4NFYA 1LQUA 3BIOA 4LK3A 3WGQA 4RZIA 1AHIA 5JE8A 2GZ3A 2IDZA 2D3TA 4WLNA 4ZQEA 1X0VA 2DBVO 3I6QA 3QP9A 4LRSB 2DM6A 1N7HA 4I9HA 4DQVA 1OFGA 1H9BA 2E6UX 2EKLA 4II3A 1UP6A 3NUGA 3IUPA 1PS8A 2F1KA 2HMVA 3DHNA 4WLVA 3JD0A 4N18A 1EVYA 4KDFA 2Y0CA 3H9JA 5DNAA 3ZU4A 1GR0A 5BSHA 4BKRA 4I1IA 1J6UA 2P2SA 5TLSA 3GK3A 3ADPA 3Q2KA 3O8QB 3W8FA 1E5LA 4K9DA 1YRLA 1IYZA 4BOYA 4PG6A 3TZKA 1O95A 3RU9A 1UUFA 4EDFA 3DDNA 2OO5A 3PEFA 1LTHR 2IYPA 4CM9D 1UP4A 1CETA 1YB1A 4HV4A 3ORFA 5FF9A 2X0IA 3SLKA 3FWNA 2DFDA 4FFPA 1ZEMA 5THKA 2P91A 4CV1A 3O9ZA 5JBIA 1EFLA 3PIIA 5L7WA 3TRIA 5KJFA 1U4SA 5THQA 1ZXLA 2D8AA 3GNTA 4EUEA 2HRZA 1IZ9A 2FRDA 1BSVA 4ID9A 3MJVA 3RC9A 1LC0A 2QIOA 4OOEA 4PLHA 2VRBA 3NT5A 4YA6A 4BUCA 3ZWXA 2FOIA 2D2IA 1SNYA 2HO5A 1ISFA 4JXKA 3PYMA 1ONOA 2BHLA 5ICSA 2AQ8A 3OF2A 4B3HA 1LSSA 1KC1A 2HMWA 1I30A 3Q3CA 4IDDA 4U6QA 4CM4A 3OA0A 2FHSA 3D0OA 2VTEA 4Q39A 3CSDA 3ZHXA 2VWGA 3UHAA 4MIOA 1CWUA 3AI3A 1PIWA 1GUFA 3GEGA 4O63O 2NU8A 4CMJA 4K26A 1ZSYA 4PLYA 3DFUA 3GC6A 4DPLA 3AM4A 2NNLD 3EZLA 2NVWA 1K3TA 1EUDA 1T2FA 4TRJA 3KEQA 4IIVA 3D5QA 1ADBA 3ZV6A 3AM3A 3RVDA 1U7HA 4PVDA 2BKAA 5AXCA 1NVMB 1PQPA 3GRKA 5TGDA 4AJOA 2O4UX 4CPDA 2NU9A 2VN8A 3SJ7A 5JMWA 3FBGA 4CV2A 4D0RA 4Z3DA 3TFOA 4W7HA 4UUNA 4LW8A 1T2CA 4BL5A 4YJFB 3D7LA 3K31A 1E7WA 5AOVA 3ANNA 1U1IA 1ISMA 3LT0A 1KOLA 2X58A 4ALNA 1A4IA 4FJ2A 3DONA 4CMKA 1E1KA 1P1JA 3CZRA 4BNTA 3AFMA 4IY1A 2WD8A 4BNVA 3DZKA 1NNUA 2EW8A 4JGBA 3RFXA 3GZNA 5C7IO 4C7JA 3RROA 4WASA 1FF9A 1TA4A 3ZZNA 1J4AA 3BA1A 2NQ8A 4BNYA 3BMCB 3L9WA 1IULA 4L74A 2W2KA 3GA0A 4BO8A 5F1PA 1C0LA 1QORA 3GVIA 1NAHA 1LNQA 2C0CA 3PHJA 4JBHA 3WMXA 4YAGA 1KERA 4B7XA 1IL0A 1R0KA 1Z82A 3NYWA 4R5HA 1JVSA 2X8LA 4K1LA 1GY8A 1P0CA 2JAPA 4RLSA 2R00A 2OUIA 1ZSVA 3G1TA 3QSGA 5DBIA 2JCVA 3S2EA 4PZCA 3DO5A 3GEMA 3PFFA 4IJKA 4M8SA 3UCFA 3Q6IA 3ZHYA 3CMCO 1X13A 1WZIA 3KLMX 3O38A 4TRNA 1SMKA 3MOGA 5KOIA 2JD2A 4GSKA 4E2XA 2D5AA 1W8DA 1X1EA 3M6IA 4AJ2A 1NVTA 2R2GA 4P38A 3KTDA 5BSFA 3ROMA 1I3MA 4RPHA 3O4RA 5IXSA 4J2OA 5K6AA 4PLFA 3UFXA 1C1DA 4F46A 4OJNA 2E48A 2AG5A 1PGPA 1D7OA 2G0TA 4XYLA 2FSSA 4ND1A 2ZTMA 1HYHA 4RF2A 3WIDA 1VSVA 4J90A 1D3AA 2BLLA 4PVCA 3M1AA 1BXZA 1I32A 2P5UA 5AQ1A 1XSEA 1B26A 2WTBA 5EPOA 4Q3BA 3HSKA 1E1MA 3E9QA 1I5RA 2Y99A 3Q1LA 4J6FA 3N58A 3WFJA 1ORRA 1SAYA 4UVEA 1HSZA 2I76A 4EZBA 5KJ6A 3OBBA 2O3SA 2DKNA 2NTVA 4MJLA 1I10A 1ZK0A 2EIHA 4XYBA 1JAXA 3JQ7A 1E7RA 3HUDA 1GYRA 4M55A 1GCUA 3DR3A 3VPGA 2FN7A 1PGQA 3ICPA 4ALKA 3DZGA 4YRBA 3R3JA 3PHGA 4WK6A 3JQEA 4MKXA 4FC6A 4GMGA 1QV7A 4CLOB 2P9GA 1U8XX 3KYCA 3UF0A 4WEOA 4WNIA 2PH3A 2Y67A 2H63A 3E8XA 4IQ8A 4PRKA 1YB5A 4MIYA 2O50A 4INAA 5T57A 4BS9A 4E5MA 3H5AA 1R15A 3BMNA 1N8KA 3KYDB 3DC2A 3OETA 2ZJ1A 3NJ8A 1O94A 4MVJA 1ZH8A 5JCXA 2PGJA 4N5MA 4OO3A 2NQTA 4W9NA 5GZ3A 3H5RA 1HDYA 3E48A 5JPIA 2B37A 4FFRA 5DN9A 5G0UA 2B69A 3GHYA 3Q0EA 2AEMA 4CMGA 5FWNA 3CZMA 3RD5A 2C5EA 4K28A 3RJ9A 3LDHA 1ZVMA 6LDHA 2EXXA 4R1SA 1YOVB 5L95A 1WWKA 2ZJ0A 3ITKA 1KY5A 2GF2A 3FI9A 2BI7A 3W1VA 3C7AA 2I99A 4FQ8A 4HFJA 4MINA 3QWIA 4Y8VA 5L3ZA 1L7DA 2Z1MA 3D64A 1QXSA 3MJSA 4D79A 2V65A 5FFFA 4XGNA 1GV0A 2I3AA 1EVJA 2TMGA 4GH5A 1T2DA 1P1KA 1MG0A 4GWKA 3DBRA 3T4EA 3B1JA 5KNLA 3TZCA 4AJ4A 3ZW8A 3I3OA 4E2YA 2PA3A 4DYVA 2I67A 3G17A 1GV1A 7ADHA 2Y1FA 2PTGA 5LDGA 1P3DA 2CDAA 3IL2A 2YW9A 4E5KA 1Y8RB 3WX0A 4OKIA 2YV1A 4PGFA 3E82A 3W4KA 5ENDA 3FPLA 2ZATA 2HU2A 3L4BC 3NT4A 2DBRA 2EJWA 3D3EA 1N2SA 5KKCA 2B4QA 4BO5A 3RIHA 1U3UA 4XB1A 4GX5A 4R01A 3V2UA 3JQ9A 1GL3A 1R37A 1XU9A 3ZNOA 3RCBA 4BKPA 4DRYA 3KHUA 2YQ5A 1GFSA 3BTSA 3K92A 4Z3KA 4Q9NA 3U4HA 2GN6A 1UXHA 3I9KA 2GPTA 3SC4A 4WUVA 1DIAA 3RC1A 4MKRA 3LYLA 3NTQA 2O23A 3VAZA 3KBOA 4O1MA 1DLIA 2PNFA 1VJ0A 3K96A 4ALJA 1M67A 3AUSA 1EBUA 3VC7A 2X0JA 3SXPA 4ESOA 3NRCA 1IB6A 1IPEA 3EZYA 3T7EA 4BMVA 1N7GA 2GLXA 4EJMA 2PD3A 2DQ4A 2WYVA 2VYNA 1BW9B 1ENYA 1G0NA 2AE2A 3V1TC 2DTDA 4XJSA 5HS6A 5JY1A 5CP8A 3JV7A 1R0LA 4W7IA 2BGLA 3GR6A 2Q1WA 3BZUA 1EDZA 2WM3A 3AM5A 4IMPA 4BGVA 1E1NA 1C1XB 3K8ZA 3UAGA 1JVBA 4RJTA 4XQCA 3WNQA 5A4DA 2B0JA 3PZBA 3ZWBA 1PJBA 3GY0A 4YJHB 1ZK1A 4YJFA 4EEZA 4MP6A 3ZCXA 2GCGA 4XRRA 3DB2A 4LN1A 1NTOA 3QQPA 4E31A 5G0WA 1HETA 1TVEA 1DHRA 3L6OO 3DZIA 4A7PA 4DVJA 4HFMA 3JQCA 1CYDA 3R6DA 4MVJD 3ONEA 3AUTA 4S3MA 4AG3A 5HTOA 2P9CA 3COSA 4RVGA 1YL5A 1KETA 3GLQA 2ZTLA 3FCOA 3LLSA 4JJIA 4OIMA 4XA8A 1SEVA 2SCUA 1VJ1A 1B16A 3BXXA 3I9NA 2NVBA 2DVMA 3G0OA 3TPCA 4GX0A 1TT5B 4ZQFA 1UAGA 1PWZA 3PQDA 1XYGA 3R0IA 3PGJA 4HY3A 4DUPA 1EK5A 1UDAA 3AU8A 2C59A 1MC5A 3ZNQA 1EUZA 2DBZA 1OAAA 1ZW1A 3QVTA 3UW3A 2FP4A 3CE6A 2A94A 1TB4A 3JYOA 4UUOA 2EGHA 3P2OA 3N74A 3TN7A 5CPBA 1ZFNA 2ET6A 5C37A 1NAIA 1HDGO 3C1OA 1KEPA 2JFGA 4RZHA 3GMDA 2NADA 1OOEA 5B4VA 4Y6RA 3TL3A 1NFRA 2PWZA 3DBLA 2ZTUA 3LK7A 1SZJG 4BNZA 4A03A 1B2LA 1MLDA 2Q2QA 2Q2WA 4JN6B 1PS9A 4R1NA 3RBZA 3BHIA 1OBFO 4OYRA 1ZKMA 1H2BA 4IINA 1UXGA 3HB4X 1GD1O 4FD3A 4NJMA 3VKUA 3TFQA 1PR9A 2HK7A 4E33A 1GCOA 1BXGB 1P0FA 4YXFA 1U8FO 1FJHA 3FRJA 1SBYA 1OI7A 1XGKA 4RF4A 3FR7A 3OJOA 2ZB7A 3CKYA 3VPXA 3FNEA 4C4OA 3OMLA 4CMAA 5C5IA 3WR5A 4WCFA 4J16A 3M2PA 1P33A 3F5SA 2G82A 5COAA 2XAAA 2NTNA 4HADA 3AFNA 2ZKLA 3L4SO 3B70A 1B0AA 3D4PA 3K30A 4NBTA 3VPSA 5JMPA 4LRTB 3WXBA 1RYDA 1LLUA 4DPMA 1HE2A 3OA2A 1Y7TA 2JD1A 3NGXA 5G0VA 5IDYA 2DTXA 5G2OA 4DLBA 3LC1O 2PLAA 4KTTE 3WQSB 3HQ4O 2DBQA 5DBGA 1KVSA 2E82A 3DMYA 2VWHA 4UEKA 5JXWA 3WYEA 3D1LA 5ADHA 3U09A 1M76A 4NK4A 3JQFC 4QXMA 2OP0A 3D4OA 2EKPA 3WGYA 3L6EA 3EVTA 3GVCA 2VYND 2ZB3A 2DAPA 3GPIA 3DOCA 4AJHA 3I6IA 4KWIA 5TT0A 1H6BA 1E5QA 4BHTA 3WGOA 3ZV4A 1KVQA 1MXHA 4CLOA 1H2HA 4LMPA 5DCWA 1QYXA 4QUKA 2GGSA 4HBGA 4A5OA 4LMRA 1DC4A 1LRKA 3FN4A 1YL6A 3HDJA 4P4LA 2HJRA 4WKGA 1NR1A 1MX3A 3WNVA 1IY8A 3AOEA 2NVUB 4R4JA 4BGIA 4CQMB 2EP5A 3WQQA 3VH1A 5KWEA 4PZEA 1ID1A 1D4FA 1U2DA 3W8DA 2WEKA 2Y93A 3A06A 3CIFA 1FDVA 3ST7A 1DXYA 4YJDA 4D0SA 4IBOA 3ZH2A 4DC0A 4MP8A 5FI3A 3AY3A 3ZNNA 3LLVA 4RVUA 4IDEA 1Y8QA 1V35A 1K6XA 1SEPA 2PZLA 5I8ZA 4E0BA 4BO2A 1IHXA 1B3RA 3BTVA 3H2ZA 3EGOA 2H9IA 1WMAA 2ZYAA 1F06A 3WTCA 2EERA 4LSMA 2BGKA 4EBFA 3KYBA 1F12A 1B8UA 4YT5A 3IP1A 1ISHA 3C3XA 1T24A 5DT9A 1RWBA 4NBRA 1CIVA 3V1UA 5A9SB 3P19A 1I0ZA 2Y05A 4OAQA 4FS3A 1ZK3A 4RVDA 3TOZA 4DPKA 1PU2A 2WYUA 1VPDA 1Y8RA 3EC7A 1Y1PA 4HNHA 1ONNA 1GAEO 3NV9A 3VDQA 3ON5A 1HWYA 3W6UA 1QYVA 3DL2A 3HHPA 5G0TA 5JS6A 3WWYA 3GVXA 5ER6A 1VRWA 5EMHA 2UV8A 1DPGA 2PR2A 4DIBA 1SB8A 4LCJA 1P9LA 1YJQA 2CDCA 4OH1A 1Y81A 2Z1NA 1WDMA 5GMOA 1XG5A 4EITA 3NEPX 4M87A 4BB5A 3E18A 1LBEA 3QV1A 4CM3A 2CDBA 3DBHA 5L7YA 2EP7A 3PHIA 1EDOA 2Y66A 3DFZA 4RDIA 1FDWA 3RASA 4BO6A 1Z6ZA 2E4AA 1PJCA 1BMDA 4EJ6A 5B4UA 1GUZA 1O6ZA 4WLEA 4E5NA 2JFHA 1UDBA 3W6ZA 1O5IA 1Q0HA 4HFNA 4P4NA 3V2GA 1NQOA 4CL8A 2IZ1A 4JBGA 4BO1A 4FJ1A 3WQRA 1HYGA 3F3SA 2VHZA 4CQLB 3PWKA 4UEJA 4Y98A 4RV9A 3BAZA 3IOYA 3C7DB 1C1XA 3ONFA 4BNFA 5JSFA 5KVSA 1JTVA 4QO8A 1CRWG 2YHIA 2CF6A 1ISIA 2FMUA 4WOKA 3FNGA 1QG6A 6ADHA 4NNJA 1B8VA 1O8CA 4QFCA 1U5CA 4DA9A 5A3VA 1WPQA 5JDIC 4IJUA 4I5GA 3I52A 5ILGA 2JKVA 3ROKA 1GTMA 2NACA 3IJRA 2GNAA 4W4TA 4CLRB 1ZBQA 2Y1CA 1FK8A 5IAAA 4TKLA 4YYZA 3VPHA 1R12A 2PZKA 3JD3A 3WGGA 3ZV3A 3JQAB 5I9LA 4UUMA 3RBVA 2DU8A 3RC2A 2VHVA 2ZQYA 3WTBA 3NKLA 4OSOA 3RKUA 1HYEA 1I3KA 2HKIA 2CMDA 3WS7A 3HFSA 1TT5A 4IM7A 5EIOA 2VHWA 2JCXA 5BSEA 1GEGA 5KKAA 3DTTA 4GL4A 5CDGA 1YB4A 2R6JA 3CH6A 1BGVA 3UOGA 5LC1A 3ETGA 2P68A 4R5MA 4MVJM 3MTGA 1DIGA 4UVGA 3JYLA 3NDRA 4ND4A 4BV9A 1H6DA 3KSDO 4J7XA 4ND3A 3H3FA 4CM8B 4FIZA 1EUCA 5ILOA 2GSDA 4OKNA 4URFA 5COBA 5KVQA 3WSVA 5HS4A 3O26A 3DMTC 4FC7A 4QECA 8LDHA 1ISJA 1ISGA 3A9WA 3JQFA 2HAEA 1M6WA 4ALLA 4YBZA 2IZZA 2UAGA 5ICMA 1MG5A 1N5DA 4E4YA 2QZZA 5ITVA 4J4HA 4HWKA 4BNNA 3L6DA 5L4LA 4IZIA 4NJOA 1CQIA 3U62A 3ICCA 3MJEA 1XCBA 1LC3A 3PVZA 5DDIP 5K0ZA 5K9ZA 1UH5A 3I83A 1DO8A 4K6CA 4Z0PA 1NXQA 2AMFA 1A9ZA 4OL9A 1YDEA 2BFMA 2X0RA 2DT5A 5DZSA 5LCXA 3SBOA 2VYVA 4UAGA 2LDXA 3AWDA 4JP2A 1J0XO 2O3JA 1I33A 4A2CA 4DXHA 4O5OA 2W4QA 3WICA 1VC2A 4OOFA 3C85A 4OXYA 1E1LA 3H9EO 2X1HA 4RPLA 1JWAB 2Z5LA 1R0SA 4HX5A 1VSUA 2PD6A 4J1NA 2RCYA 3QRWA 1CEQA 4ZJUA 3RUFA 1U9JA 2P9EA 5CPFA 4PRLA 3ABIA 1ZNQO 5EN4A 5B1YA 3ZWAA 5IZ4A 4P8RA 3CTMA 3ITDA 3QIVA 2C54A 2GASA 1PZGA 2PKQP 4GVLA 2W2LA 3ANMA 4FSHA 4BNKA 4R9RA 1A71A 2O3RA 3LF2A 4CM5A 5AYVA 1ADGA 3HB5X 3V5NA 1Z73A 3QA9A 1E3EA 5T8KA 1JU9A 1J5PA 5KIAA 2QYTA 2B36A 3NDIA 4JIGA 1YBVA 1CQJA 5CEJA 1D8AA 1X14A 3GG9A 5JY6A 1SC6A 2IE0A 4E5YA 1W0CA 5TX7A 4QT0A 1PJTA 4GPD1 1C0IA 1KS9A 1AUPA 2NVUA 3A14A 4OSPA 3DOJA 1JLLA 1M75A 1PR3A 3RWBA 4YRDA 2EV9A 1B7GO 1DB3A 1DSSG 3PLNA 3WYCA 3H6KA 1J49A 2QYSA 1ONPA 1XDWA 2Y68A 4B7UA 2Y0DA 4GVXA 5A1TA 3BMQB 4BGEA 1ADCA 1Q0LA 3BMOB 4FBGA 2J3HA 2YUTA 1E3WA 1YH3A 2I66A 4HP8A 4I08A 4NHEA 4Y6PA 3GN2A 4A27A 1U3WA 1R6DA 1IHYA 1HDRA 3TZHA 4Z0TA 1PGNA 5T5QA 2X9NA 3ENNA 4EW6A 3GH3A 5U4QA 3HDYA 4DBZA 1ZMOA 5KJ1A 2VOJA 3AI1A 1HSOA 5EESA 1UJMA 1XELA 4RF5A 4FCCA 3FBTA 4IXWA 3DHEA 4TROA 2H6EA 2YDYA 3NX4A 2PGDA 3GNSA 5CAEA 4BIIA 4RLHA 3IJPA 2XXJA 4WLUA 4BO0A 3ONDA 4MVJP 4FJ0A 4Y67A 3JQGB 1MGOA 3H9UA 3H7AA 4BNUA 1W4ZA 3RQSA 4YAKA 5A5FA 2I3GA 3MJTA 4B4UA 5TS3A 3CPSA 2VOEA 5CG1A 1UXIA 3GAZA 2GUGA 3JQBC 4L76A 4UVHA 5I7FA 2CFCA 1GZ3A 4XDZA 2OFPA 3UUWA 4AJLA 3ZGYA 3F1KA 4A73A 4R54A 3MWEB 5JDIA 4UVIA 2GN8A 5JAZA 2AW5A 2UVDA 4RDHA 2O3QA 4XYGA 4CMEC 1ULUA 2FPGA 3Q11A 4L75A 2X7HA 2VYVD 5FYDA 3OJEA 3IIEA 3ADOA 5F5NA 4TKMA 4RORA 2PFGA 2HLPA 2QHXA 3IC5A 1VKNA 3VPFA 5C3MA 3PIDA 3OICA 2WDZA 3P7MA 2OORA 1WDKA 2VQ3A 1R4MB 4IDCA 4XDYA 1HDOA 1XQ6A 5JAIA 3OJLA 1TEHA 3DZFA 1B8PA 5BNFA 5L45A 3ZHZA 2YYYA 5DULA 1T4DA 2JAHA 5H81A 4TRMA 4QO7A 1DEHA 1WZEA 3F1LA 1YGYA 1HDZA 4RQTA 4AJNA 4PN3A 5CEEA 2W2LD 4YJGB 5JLAA 4YB8A 1EQ2A 1DJNA 1U4OA 3F9IA 3S1LA 1NQAO 4B3IA 3L77A 1VM6A 3PLRA 3TDKA 1E7QA 4MOWA 1E6UA 3GVHA 4OXNA 3DMTA 1JAYA 2DTEA 4B8ZA 2H1SA 1FDTA 1PQUA 2NU6A 2VUUA 3RUCA 4BV8A 2UUOA 5JC8A 3U9LA 2V6MA 3HJAA 3TF5A 5L4NA 3FR8A 3X2EA 3ZWPA 3OIFA 3IQDB 4N7RA 3DZJA 2QRJA 5L4SA 4R3NA 3HNPA 1Y5RA 4BB6A 4CUZA 5I9NA 2VNAA 4BKOA 4HUJA 1DFIA 3SJUA 1DRUA 1DAPA 3W4IA 4M1QA 5IFLA 1YVEI 4PLZA 3IP3A 2NTJA 2VZ0A 2CD9A 3Q9NA 4DLLA 1HE3A 2QZ9A 3WLEA 1U3VA 3PQEA 4RO0A 4H7PA 3I4FA 3PZRA 2UDPA 4YT2A 2OOSA 3GDOA 3KB6A 5BR7A 5A9RA 4CR8A 2JFFA 3JYQA 2V7PA 4J3FA 5DOZA 4U6SA 2GERA 3AOGA 1I24A 4Q3CA 2WSBA 5HA5A 1E77A 2EWMA 4YR9A 4WGGA 2IODA 1P77A 2CVQA 3O8QA 1BWSA 4ALMA 5A03A 3WWZA 3E6AA 2QRLA 2BH9A 4XIYA 4M54A 2P4QA 3K2EA 1A72A 2JD0A 1QKIA 2FZWA 3G1UA 4NBUA 4GQAA 1AXEA 5TT1A 4KTVE 4PLWA 4KUEA 4MVJI 1JWBB 1ZXBA 3VDRA 4B4OA 3DTYA 3OM9A 1ZEJA 4R69A 4DLAA 1WAMA 3DQPA 1F0YA 5I9MA 4BO4A 4FOOA 1C0PA 2Y1DA 1C14A 3CMMA 4CM1A 5GZ1A 1LX6A 4B8WA 2WMDA 4BMSA 3QVOA 4ND2A 1I2CA 1N1EA 2XF8A 2JJYA 4OQZA 3NTOA 2VHYA 3L9XA 5JFOA 3PP8A 1GPJA 1EMDA 1E7SA 4L0QA 4R9SA 1BG6A 4GX2A 3RUEA 4CMBA 1H93A 1GZ4A 2AQIA 3GN1A 4DC1A 4II2A 4L73A 1ENOA 5CFZA 1K89A 2DPGA 3SVTA 4KQWA 5L7TA 3PI7A 3WLFA 1BVRA 1Y9EA 4RVFA 1KYQA 4HFRA 9LDBA 4HXYA 4IS3A 3EUWA 4R1UA 1ZJZA 3ZWVA 4IXTA 2YDXA 4CLEA 1LLCA 3HWRA 1TT7A 4IZHA 3TNLA 2D5CA 3HFGA 1S6YA 3NGLA 2FR1A 2RH4A 1BVUA 3VTZA 3VVCA 1NWCA 5IN4A 2RH8A 4H3VA 1PL6A 1QYDA 4WLOA 3DXFA 1I2BA 3U0BA 2X9GA 3JCZA 4O59O 5B37A 1WW8A 1AN9A 3N7UA 5A02A 2WD7B 1E3LA 3DAPA 1ADFA 4U5QA 4JJGA 1DAOA 3HADA 1Z74A 1NFQA 1ZMTA 3TZ6A 3JSAA 3RUIA 1NPDA 2QW8A 2IYOA 2YZ7A 1Q1NA 2PY6A 3PHLA 2QG4A 2JCYA 2GYYA 4B4VA 3PDUA 2VRCA 3BMCA 4NBWA 1EEHA 2LDBA 1IOLA 4IS2A 1GQYA 1U3TA 4YRAA 3B20A 3BMOA 1DHTA 3GGOA 3WGIA 1VKOA 1ENZA 1RKXA 1LU9A 2NM0A 4XQGA 1Z7BA 2J5RA 2CY0A 2Q3EA 2TMDA 3WGTA 4NR0A 4IGEA 4BNLA 4RCVA 5TC4A 4BMNA 1XQ1A 4H15A 2V6FA 1JW9B 4WNCA 1NM5A 2VCYA 1CJCA 1YKFA 2YFQA 1LSUA 2C29D 3DAGA 4YTEA 2Q46A 3LVFO 4E21A 2NUAA 4L8VA 3KVOA 3S2IA 4RVSA 3GUCA 4QSMA 3H4VA 4TQGA 1QYCA 1H6AA 3QWAA 4XR9A 5EQDA 1WNTA 4G65A 1AHHA 3Q2IA 4D3DA 4XYMA 2YJZA 4WECA 4GBJA 3PJDA 1JKJA 1NYTA 1W6UA 4XJTA 5HRUA 2E37A 3PWZA 3OIDA 1NQ5A 2EKQA 1E7YA 2VT3A 4A10A 1PZEA 2PV7A 4DREA 1GPDG 4LGVA 4BKQA 2HK8A 2VHXA 4NDNE 2FWMX 1EQUA 3CINA 4NBVA 1EZ4A 1GEEA 3QY9A 4BNMA 4MO2A 4CM4B 4CM7A 5ER9A 2PK3A 3OQBA 4R1TA 4MVJF 3I9MA 4KP7A 4DYDA 3KSZO 3WFIA 2AHRA 1FDUA 1SB9A 1SOVA 3RUAA 1DC5A 4LISA 1ZIDA 5AXDA 2B4TO 1X7GA 1H94A 4I5FA 1I8TA 4ONEA 4Z6KA 4KMSA 2Q1SA 3SLGA 4U0KA 4XD2A 1L7EA 3E1KA 4BO3A 4IDGA 3IS3A 4YT8A 3PHHA 1X1TA 5KJEA 1YBMA 4YAJA 1YWGO 3KYDA 4KZPA 1UXKA 2OZPA 4YAIA 4RPGA 3B1KA 1YQXA 3IUSA 2Y1GA 2JHFA 3QJ5A 3L4BA 1ZUD1 5JC1A 1LDGA 3ZV5A 4I5EA 4ZQGA 2XXBA 1U7TA 3U49A 3OFSA 4GWGA 4OM8A 1B3BA 2HDHA 3FD8A 3QVSA 1T2EA 2VZ8A 9LDTA 1Y5MA 4PG8A 1YOVA 3C7CB 1RM0A 2CVOA 4ZA2A 1PS0A 3T4XA 1JQBA 3GZ4A 1Z7EA 3PJFA 2NLOA 1ZK2A 4RPKA 3L0DA 3GZNB 1A7KA 1PQWA 3WBFA 1K6JA 3HDHA 4DMMA 1O9BA 1PJSA 5TF4A 3I5MA 2X5KO 2CUKA 2W98A 3PYXA 2IZ0A 2EHDA 1KVUA 2AE1A 4PCVA 2NSDA 3VZSA 2BFPA 1IPFA 4FFNA 2X6TA 5L51A 1AE1A 5F3RA 2BRUA 4BNWA 4FFLA 1IUKA 2IEBA 5TNXA 4UEOA 2PZMA 1WP4A 2P5YA 5TQVA 3VOSA 3AY7A 4D42A 4WLFA 4LCEA 1UZNA 4CM9A 3U4DA 4GKBA 3GGGA 4FPXA 2GDZA 4RF3A 1BDBA 3ZNPA 4ALIA 2W90A 2X5OA 2ZIZA 2A9FA 5JW6A 3S2FA 4EUFA 5KVVA 4AJEA 1HZJA 5C7OO 4GI2A 2RHRA 2XPCA 1XIVA 1YDWA 2BFOA 2J6IA 1DOHA 4L4XA 5B12A 1C1DB 1P31A 3WB9A 1K6IA 3H8VA 3DBVO 2FY8A 5A9TA 4TZKA 2IXAA 3VVBA 2IXBA 5G4LA 5JAQA 1HE5A 1ZK4A 1HE4A 4WPGA 4DTIA 5J23A 3BHJA 4TMFA 1A7AA 5T67A 3RFTA 4TZTA 2B5VA 3WGHA 5ES3A 2EJVA 1BW9A 4JROA 2D4AA 3L07A 4D46A 1LUAA 4KUHA 4D43A 1KEUA 3HDQA 4D45A 2QRKA 3PJGA 4JCOA 3RKRA 4ILKA 3ZHBA 3QE3A 4WE3A 2R00C 1HT0A 3FWZA 2UYYA 1HF3A 3IKVA 3TL2A 3E9MA 1LI4A 2I65A 5JO0A 2AA3A 2GRAA 4YJHA 3JQ7B 4NI5A 2POQX 2WD7A 1CDOA 1N9GB 3H3JA 1DIBA 3FNFA 4J1QA 3FSRA 3FPCA 2BD0A 2Q1TA 1T4BA 5L9AA 3KZVA 2ZB4A 5K6AC 2H5LA 4G2NA 2DFVA 2WWRA 4BGUA 5I7VA 3U3XA 5T64A 1P74A 3KYCB 4YQZA 5EQFA 4E6PA 2Q4BA 3DAFA 1GUYA 3FF4A 4YT4A 4J43A 4WOJA 1H0KA 5CEFA 3GNQA 4IJWA 4GX1A 3NJ4A 1VL8A 1YS4A 3VZRA 4NH4A 3UICA 4OHUA 2O2YA 4BVAA 1I36A 5F1OA 3ZWYA 1GQQA 3JQ6A 4GLLA 4ROSA 3WIEA 5DCUA 4ZRNA 1XWFA 3JQDA 5FI5A 2YY7A 3HN7A 4R3WA 3PRJA 1QLJA 4YDRA 1X15A 2VNSA 1RJWA 1M6HA 1Y9AA 4NIMA 2HRBA 2XOXA 1PJ2A 2Q99A 3C8MA 3QWHA 4XIJA 4BNHA 4F6LA 1X7HA 2HMSA 1E3JA 3GOHA 2HMTA 4PLCA 2AQKA 1T26A 1UP7A 3H9QA 1LLDA 5AVOA 1JA9A 2VWPA 2B35A 2C7GA 3DWFA 4HKTA 4JP3A 4Q3EA 3OIGA 1XA0A 3DZHA 3ZDFA 1XU7A 1YXMA 3BHMA 3WOHA 1BXGA 4F6CA 3DBRB 4JNKA 4E12A 1A4UA 2JHGA 2RHCA 1HDCA 2PH5A 3JD2A 4YACA 1MC4A 4FDAA 1XLTA 2IRWA 1YBAA 1H6CA 5IDQA 1P44A 1T2AA 1ZSNA 1CERA 3GFBA 2GR9A 3ZN2A 3JYNA 3SEFA 4TRRA 4Y6SA 4W99A 5FEUA 3D4NA 3RAJA 2ZYDA 3W4JA 4IUYA 1LRLA 2GO1A 2W8ZA 1VE9A 2O7QA 2Y1EA 4U0JA 4W9NC 4ZICA 1NP3A 1Q7CA 3HZZA 1EE9A 2FPIA 3H5NA 4KWHA 1FMCA 2BELA 2JL1A 1F14A 3DZBA 3K5PA 1RM4A 4WJZA 4EEXA 4IJVA 1G1AA 4ZQBA 4E5PA 4MPDA 1XEAA 5KCZA 4UVDA 3E03A 3IKTA 1QYWA 5KJCA 1YQGA 4DGSA 3C1TA 2V6GA 1UR5A 3QWBA 5IZCC 1U5AA 4XQEA 2YQ4A 1AGNA 3M2TA 4I5DA 4GMFA 4XX0A 4FGSA 4QX6A 2FSVA 4KDEA 5ENVA 2AEJA 2G17A 4F3YA 1ARZA 4PLGA 4R51A 4Y9DA 1R16A 1LSOA 1R4NB 4MP3A 1I2ZA 4W6ZA 1FDSA 3PDJA 1CF2O 1N1GA 2ZCVA 3GQVA 2O4CA 1H5QA 4J4BA 1A27A 3B1FA 3ROPA 1LDEA 5CDYA 5JAMA 3Q9UA 2C20A 4CQMA 3EVNA 5B4TA 4A0SA 4RPJA 1DFGA 3PPIA 1OC2A 5F21A 4E30A 1E7MA 1O89A 3E9NA 5DOVA 3ZWOA 3PK0A 3GDGA 4A26A 1PL8A 2Q49A 4J1SA 4BQPA 3JQ9C 5HWSA 4B79A 1V3TA 1K2WA 4FB5A 3GGPA 4N5LA 4R68A 2WE7A 4IQGA 3LF1A 3VTFA 1AXGA 1DFHA 1E3IA 3GVPA 2A92A 2X5JO 2AG8A 1T1SA 4LSWA 1MA0A 4ND5A 4B7CA 3V2HA 4IQ0A 3VZPA 1P1RA 3K9QO 3LT4A 2PGLA 3GUYA 3F46A 5IN5A 4AJIA 4D41A 5A9SA 4Q3NA 1Q7GA 1HL3A 3JQ8B 4P22A 4XGIA 5I7EA 3TJRA 5A04A 1DBVO 1DLJA 1I01A 3H65A 2DUUA 1MP0A 5IXYA 3GHHA 1LEHA 3WDSA 5EERA 3UKOA 5I8WA 3RC7A 5CG2A 1PSDA 4BO7A 5EL0A 1GDHA 1EBFA 3H9GA 2FR8A 1MB4A 4XCVA 5IG2A 1GYQA 3VKVA 4M89A 4AJKA 2PZJA 2E49A 4C7KA 1TLTA 1RYEA 1QR6A 3DBLB 5DCYA 1BDMA 3B6ZA 3QLJA 3EY4A 4OMUA 1HRDA 5G4KB 3GMSA 4DMLA 1HTBA 2Q45A 4KUGA 1PTJA 3U4CA 5U9CA 3QVWA 1WDLA 4NJMB 1NR7A 4Z9FA 1V3UA 3UN1A 3IAHA 4LVUA 4XKJA 3RI3A 3FNHA 1H9AA 4YEDA 5BT9A 5JDCC 1BXKA 3K73O 4MVJG 1X0XA 2O7SA 4NFHA 2HUNA 2Y0EA 4J49A 4XZ3A 3VH3A 1WMBA 3G79A 2GD1O 3LU1A 4IDAA 4WCFB 1V3VA 3MWDB 5L40A 2C2XA 3EYWA 3PTZA 4JX8A 2CVZA 3CEAA 4H16A 1RM3A 2B5WA 4CQLA 2OMEA 1NHGA 3DEYX 4AJJA 3KEOA 1ZJYA 4CMHA 4J9VA 1NQTA 3FTPA 4O6VA 1PJQA 1E0DA 4FR5A 1TXGA 3KXDA 1PEDA 1HDXA 1WVGA 1GYPA 1YL7A 2A35A 4MVJE 3D5TA 1N9GA 5TSDA 3C1AA 1NX6A 4G81A 5IDXA 1JKFA 3G3EA 2OBYA 2VZ9A 1YO6A 4FFMA 4AL4A 4NU6A 3QW2A 1ZZEA 3KO8A 4CLRA 1NFFA 1DRWA 2UUPA 2EW2A 3MJ4A 2CSUA 1EVIA 1P1HA 3JQAA 4QTZA 3JYPA 4CQMD 2AXQA 5DP1A 1P45A 1DDOA 3FTNA 4WCDA 4CLXA 3ASUA 3UGKA 3S55A 4CV3A 1C3VA 1G0OA 4WCFC 5JNLA 2YV2A 1E3SA 4AICA 1SCUA 2HCTA 1BRMA 2I6TA 2BFAA 4LVCA 3EMKA 3VZQA 1VLLA 1LDNA 2FZEA 2OL4A 3ULKA 3F4BA 2Q1UA 2DPHA 1OC4A 3F4LA 4CR6A 5C7LO 5KTKA 5JYEA 4IMRA 3A4VA 3PWSA 4TSKA 1JDJA 1HLDA 2YFHA 2YV3A 5ITWA 4J9UE 2DUWA 2WYWA 3KM0A 4J1TA 5DP2A 4CM8A 3EW7A 3F47A 4XGKA 3LSYA 4GGOA 4BNIA 8ADHA 4YAEA 3ZWCA 1UXJA 1QMGA 1Y8QB 5JCJA 2A4KA 3ETDA 3OHSX 5A3JA 2V6BA 1KC3A 1DIRA 3CXRA 3V8BA 4E3ZA 3OQ1A 1NPTO 2I9PA 3ZI0A 5IZCA 1QP8A 3GFGA 5BQFA 1G6KA 3S2GA 3QVXA 3I4CA 2G5CA 3AI2A 1N92A 3GDFA 2ZTVA 3FHLA 1VL6A 2X0NA 1A9YA 5T6BA 3LQFA 1QRRA 4CL3A 4QFDA 3WSWA 4E2WA 1VI2A 4EI2A 4ZD6A 1LSJA 1DC6A 4XEHA 3I9JA 5A05A 2FR0A 1PJ3A 3R3SA 2Q50A 4PG4A 4EYEA 3W8EA 2EF1A 3TSCA 2D0IA 3OSUA 3AOEC 1ZO8A 2VUSA 3PJEA 1B14A 1HZZA 4MDHA 3EDMA 3PYLA 4ZVVA 3SC6A 4E13A 4GAEA
chains in the Genus database with same CATH superfamily
1JQDA 3V1LA 4F1WA 2V55B 1LDYA 1U2DC 2HK9A 2MHCA 2Z95A 4PC6A 1BE0A 4HO1X 2ZE5A 4TYQA 2WICA 3T9BA 2PX2A 4F7DA 2JGIA 4HGPA 3TH5A 3VH2A 3AF5A 5IF3A 5ABPA 3D4BA 1X87A 3IMKA 4UNSA 4I81A 4PINA 1V6AA 1KJQA 3ESDA 4HDMB 2FPMA 1HBJA 1CBUA 2DLNA 3B12A 5LP6A 1WE2A 1N5IA 3FMIA 2AJBA 4IIYA 2ZCUA 5AM3A 1M2JA 3BJZA 5GZ6A 2HA0A 1A69A 1YRHA 1I3CA 3RIGA 1GPLA 5DGHA 5DF1A 2CBGA 1E2BA 3U4GA 1E61A 4DC9A 1NQXA 2YZKA 4ITUA 5JBNA 2Z9BA 3GLHB 3NTRA 2ZWIA 4YV0A 3V1MA 1XZPA 1DXOA 3MB8A 2NU7A 1TUIA 3OBIA 1IOZA 2O1EA 4K6KA 3OFVA 3PRHA 5CHYA 3ZH9B 2A3NA 3HBMA 4RH0A 4IW3B 5H1YA 5BNWA 2EKDA 3HCWA 3TQRA 1F2DA 3SEZA 3ZY4A 2O19A 1TYAE 3DHYA 1IWBB 4IG4A 4ZK2A 4TS9A 3K09A 1J9ZA 1II0A 1E2NA 4K6FA 1W49A 2FDRA 2HV8A 5KSOA 4DA4A 3WLOA 3VA7A 4DJDC 4X90A 1GZ7A 3PXXA 4OY3A 2C3YA 4X5OA 1F2UB 3TIVA 2I4LA 2GQ0A 1N9KA 2CVFA 3K35A 3QPUA 4RYLA 1PT6A 1KU6A 3GT0A 3JQBA 3BIWA 3ZU5A 4AMUA 2VF7A 1MFZA 2CXHA 1LLQA 1NPYA 2PCLA 4BQRA 3GRPA 3OX4A 4CT5A 4DSNA 4URUR 3UMMA 3PEWA 1WLYA 1EFHA 3M6XA 2Q5IA 2HU8A 5K2MA 3WXMA 2VSNA 2J45A 5T4BA 3BKXA 4F12A 1ML3A 3LZ6A 2HHLA 3D3WB 3K8QA 4S1WA 5AFSA 1SO8A 4HWGA 1WXDA 2NT3A 4B45A 1OWNA 2KX7A 5DTQA 1RPNA 4YR7A 4WXHA 4TXHA 4B0OA 5J2TA 2ENWA 4AO8A 4NAVA 5BVHA 4DABA 5TJHA 4GL2A 1VTKA 1EIZA 5EIXA 2ADFA 4ND7A 3CUYA 1F5NA 3HNOA 2XZDA 2PJDA 2L2QA 1FOEB 1DRJA 2C0PA 2A5YB 4B2YA 5IJ0A 2OBNA 3ZHQA 2CC2A 1HNZB 2I87A 1HX7A 1ORTA 1XRLA 3OH8A 3D8NA 4DWJA 1BHSA 1ZIXA 3EIWA 4CLHA 1N33B 1KL7A 1JL3A 2RC5A 3VI3B 1KRHA 4ZRMA 4JL6A 5JNVA 1W85A 5JTUA 2VR1A 3ROTA 1LNSA 3CW9A 3GIWA 5JCJD 4Q19A 3UMSA 1EE2A 1ADJA 3PSAA 3QV2A 1PX0A 3TEMA 3EPLA 4PSDA 5E6SA 3LMKA 3DDUA 1R8YA 3N8NA 4UUQA 2Q9UA 3EZ2A 3HEAA 3SHQA 2W6MA 3AJDA 3D6UA 3EGIA 1AIPA 2OLJA 4DAEA 1AU9A 2PKQO 4P53A 2BGTA 5TMEA 4MKZA 4FN4A 1GNTA 5LOVA 3AEUB 2HW8A 4EA8A 4HQKA 4FOTA 3LRXA 1J97A 3VH4A 1JR3D 4ARBA 1IZ0A 3GAFA 1T36B 3A1NA 1IZ7A 3DE4X 1NWHA 3HA3A 3U3MA 4AT1A 3OCCA 3RIMA 4Z1MA 1ODFA 2VP3A 1NOKA 4FIDA 1OPXA 2Z4SA 3V2IA 4B3JA 4BEVA 4AMGA 4OGLA 2O3TA 2AQHA 3KLPX 4GYYA 4RA9A 2PKRA 2YMMA 3UJ8A 4C0LA 5BN4A 4IPTA 8ABPA 2O6HA 4NNPA 2PANA 1NY5A 3HSSA 2C4KA 4QUBA 4AVYA 5AKJA 3ZW9A 4IGFA 2BKLA 3K9HA 4TWJA 1V5FA 2REQB 1ZG3A 4O0LA 1GCAA 2CF5A 4FE3A 5CDTA 4E2ZA 2O5CA 1XYYA 3JAKB 2ZIFA 1RBMA 2HXYA 3HR4A 4NV3A 4B3DA 1P1FA 4C07A 4YJGA 4RD3A 4F06A 2W2MA 2J5BA 1RXEA 3DCIA 3NAQA 1L1FA 1G66A 2P4HX 4I6GA 5LLSA 4AZ3A 3I1IA 4DQXA 3F7TA 2D4HA 2CNKA 3MTBA 1T4CB 2TSYB 3AY6A 5KYUA 4B8YA 2UU9B 3PXGA 4NU5A 2PXXA 5EE3A 3EK2A 4TVOA 2JH9A 3QTLA 3UK1A 2ISCA 2G83A 3S8MA 4LMBA 3GLKA 1VMEA 1RM5A 1XR3A 3HXTA 2GETA 1K3FA 4DMKA 1US8A 3AQIA 2ZIVB 3C15C 1GGNA 3T7CA 2I1VB 3A04A 1Y6QA 1Z0IA 3K9WA 3LX4A 4DZZA 4HAOA 1NQVA 1NHWA 2BJWA 4ZGWA 3O9VA 1E8NA 4H35A 3AWIA 4MVJH 4GE0A 5JWHA 3GJ8A 3EGDA 1L5NA 1Z0JA 2BONA 2CYAA 1Q2XA 4F2DA 3F49S 3KWFA 4DDHA 4EGAA 4H6XA 3FGZA 3L5KA 2A0KA 2QLLA 2Y3IA 4MVCA 3WAKA 4J0FA 2VRCD 1ORVA 2Q4EA 2YXNA 4R05A 1MZPA 3N86A 4NMWA 1FLAA 3WLIA 1DBPA 2CUNA 3MTJA 3ASVA 1QLHA 2O2SA 4OI2A 1HOTA 2G1PA 1WXWA 5CURA 3U7RA 3L8GA 3U3DA 2WM2A 4BLRA 3UJNA 4DWWA 1JEQB 4DCOA 3V8VA 2B83A 4FVTA 3VDXA 1S2MA 1KR2A 2OQIA 4AF8A 5IKPA 1YI1A 2X22A 4MDEA 3TQQA 5IYZB 1NVBA 2VF2A 1MJ5A 1YA8A 2ZG6A 5H5JA 5JNTA 3I2HA 3MCZA 4TKVB 2HJSA 1PGJA 3GJXC 4PHTA 3KQVA 4GZ5A 5AUQA 1PD1A 1IB0A 2CCKA 3TLAA 2WIGA 2GBIA 3ILXA 4LC1A 4R8MA 3TQSA 2RAFA 5J4HA 1XKQA 4IEFB 1M1YA 7MDHA 5C8YA 2Q3MA 5IDWA 1T5BA 4GKVA 2GYVA 1L4KA 3G8BA 3BL6A 1ZAKA 3DQQA 4NG5A 3JVVA 4QDUA 4UUPA 3KOYA 4Y2VA 3IAEA 3MW8A 2GRJA 5E1MA 5B3JA 2WF5A 2OV3A 1IIRA 3QJGA 3LLUA 3E9YA 1MOQA 1IBRA 4UBOA 3PDIB 1JN0A 2UVPA 2R2AA 2O52A 1K2VN 4DKXA 2BY4A 2DZDA 3DEJA 2Q8PA 3KKOA 3V4SA 5I5EA 5GADl 2ERCA 1NBAA 3KALA 4XVQA 3PRKE 2BI8A 2ODNA 3RIXA 4EYQA 3HN2A 1J7KA 1KYWA 5CCXA 1LXCA 1HKUA 1WKVA 2O3UA 3C24A 4N3BA 4DIFA 3I64A 4TQ9A 2DC1A 4Q00A 3MWYW 1GPUA 3P2MA 2SICE 1YZTA 1E6CA 1T9HA 1Z5OA 5FI0B 3S0JA 1XMJA 4PNHA 2OXIA 3WG9A 4TMYA 4DT1B 3ZQUA 4QDXA 1UPAA 1SVSA 2AFHB 3GLTA 2X9QA 4H08A 4ZANA 4CKEB 4MGHA 1JJBA 3F3MA 3U5TA 1PVVA 2AI2A 2X9VA 1ZM2A 1NRIA 4M9ZA 1DXQA 1RE0A 2V9PA 2VXBA 3EGXA 1T1EA 3HBNA 4GLFA 2QK4A 4PS0A 3HKBB 4MUKA 3SIXA 4NYJQ 1GQ2A 2AZ4A 4TL7A 3STHA 2GN4A 5F5LA 5ICCA 1C1HA 1W73A 1JHUA 1XDUA 2Q5HA 5JD3A 3R1IA 1EGMB 2HSDA 5CNJA 5J1TB 4G0XA 1JKMA 2RGEA 1GDDA 2WW8A 5H3LA 1CCWA 1B76A 1ICIA 1USUA 4FX5A 5JZVA 5L8VA 4G2TA 1FYEA 3C6KA 3TTXA 2MCFA 4U9IS 2BF7A 3OTIA 2DHCA 1KEEA 1YFJA 3ZJUA 2QT1A 1O87A 2J67A 2ZRBA 5CXSA 1IOWA 1LWNA 4A0FA 2EDAA 2CMHA 3E15A 3H04A 5FLYA 1K92A 1NJFA 5CJJA 2II6A 4QXOA 1YR7A 4WGFA 5FB3A 4L4RA 4HNQA 1ZJ4A 2F43A 2NYVA 1OREA 1R0RE 2PX5A 1ECCA 3Q7PA 3EVBA 1S8NA 2GBLA 3E2MA 4XWYA 3FZNA 4JQOA 3WMWA 2FN9A 1KVTA 3OAAD 1EP2B 4OGGA 2D2EA 3H11B 4JLVA 2K7ZA 1COWD 1M0WA 2X4GA 2E5FA 3OEYA 1Y1SA 1PKEA 1X1CA 4ZYXA 4IDBA 3CLUD 2EEZA 3MOIA 1L8OA 3JAWA 4JBIA 4DDTA 2NU6B 1W4CA 4WA8A 1WPGA 5FUYA 3DMNA 2D1YA 4OXKA 2HDWA 4ZO8A 1PWXA 3PXCX 3K6JA 3STTA 3UEOA 2DHRA 4QYWA 1LQUA 1K8YB 1WKCA 1D5WA 4O4HA 4BZWA 4D4LA 1T1JA 3NCHA 5JE8A 3TZBA 2C5SA 1LBTA 2DBVO 3QP9A 4G1MB 2DM6A 3CU5A 4I9HA 4PAGA 3Q7EA 4PIMA 3L92A 4RV4A 3WL7A 4HK4A 4B1FA 3C7KA 1DMRA 3QEMA 4MW6A 4X20A 2IPOA 1YCGA 2WVAA 4M9UA 2B1JA 4ZAYA 1ZD1A 2WJJA 4TMXA 3RHTA 2YKGA 4G56A 3IP7A 3ZJ4A 1PS8A 4BJ3A 2KYRA 1TJ5A 4P3YA 3DHNA 1VPTA 4WLVA 5JCOA 4B34A 5ITZB 2GEBA 1JIIA 5HPYB 5LR6A 4QL3A 1BYIA 4YRTA 2C7QA 1Y4AE 2XYRA 4PZYA 5LZ7A 1GR0A 2NXEA 1Q1AA 3RRBA 4A6EA 2ZUFA 1E8DA 2HX1A 4QEKA 3ADPA 1P72A 5ALGA 3TLKA 4G4SO 5JEEA 2IJGX 1SVWA 1YRLA 2ZBUA 5J59A 2VK1A 3ZCSA 5AVQA 2CLKB 2ZJBA 4UCWA 3RU9A 2IT1A 2A0FA 1OFVA 1QBKC 1TLFA 3IUMA 4TQAA 1NVAA 4Y6QA 5BV0A 1JZSA 2Q8QA 1GM5A 4MYRA 4UMVA 4A1OA 5KHAA 3U5ZB 3LHFA 3T41A 4H18A 4RSRA 5THKA 4AG6A 2PUBA 4CV1A 5JQGA 4B2PA 1Z0FA 2HADA 2ZIUB 3A6DA 4MS4B 4MWDA 1JGTA 3EPKA 4RY2A 2J08A 3L6RA 3RYIA 5THQA 1ZXLA 2D8AA 4LPSA 2AZXA 5AKHA 3T3HA 1BKSB 5LVAA 5ICEA 3QLUC 3E23A 3G2HA 4OOEA 1OJ7A 1E2DA 4PLHA 1PBNA 4BB0A 3NT5A 3P9YA 4YA6A 4BUCA 4G41A 2RE8A 4TMZA 2YWCA 5KX5B 2YIDA 3LK6A 1D9XA 1EX9A 2YFKA 4JXKA 1ONOA 2BHLA 5ICSA 4B3FX 2AQ8A 4HPXB 3OF2A 4M1OA 1ES9A 3Q3CA 2IYAA 1GXSA 4IDDA 1EVEA 4A8JB 2PAFA 2E6KA 5EJ7A 5D3QA 2JCSA 2FHSA 4OQQA 2FEPA 4GZLA 5P21A 2OHFA 2BHNA 3EVZA 2XDQA 1FP1D 1KK1A 1CWUA 3HUUA 4MIOA 1YR1A 4R1MA 2VCHA 5LNK1 1GUFA 2R6AA 1PQ4A 2WUGA 1RTKA 3GEGA 5AJHA 2CLSA 4GKJB 4A9AA 4TM8A 3LUFA 4DR1B 3NANA 1J8QA 4P92A 1YS7A 1SKUA 4HQ0A 4JB8A 3FGPA 4EG1A 3GC6A 2JVIA 3OLYA 3AM4A 2H1LA 2RKBA 3G9XA 1ZESA 3U2QA 3EZLA 4LRUA 1K3TA 4MX8A 2GZRA 2ST1A 4RIHA 4TRJA 1VPVA 4KO1S 4QGBA 3KEQA 2GPJA 4RQAA 2H1CA 4B73A 1Y6RA 1JHMA 3KQTA 4AK9A 2G72A 2QJRA 1GJRA 2BKAA 3D6JA 3C4JA 2NV0A 4RIIA 1V3QE 3GFQA 1QKJA 2NU9A 4WI1A 5TGDA 3STYA 3LBNA 4UDXX 3C5HA 1MAUA 1R50A 2I78A 3COYA 1P7YA 1QB7A 2V7BA 3GDHA 4Z3DA 2AIRA 2Q4DA 4LW8A 1T2CA 1BA3A 1DBRA 4ZZ0A 4YJFB 5BQ5A 2DULA 1OILA 1D6SA 5L3SA 1QU3A 4B17A 1SXHA 5AOVA 3TSAA 5BR8B 2YYAA 1U1IA 1ISMA 2B7LA 2MMCA 3DOHA 3BJRA 2VKQA 3G1WA 2M9MA 4MPPA 5IBRA 5JS2A 5FBKA 4V0LA 4ALNA 3MBOA 2JBAB 1U1DA 3V32A 1P1JA 3X1KA 2GEFA 5BMOA 2DH6A 1HEIA 2REOA 5ALMA 1NGSA 1QPGA 1I6MA 2FSHA 2UYOA 1NNUA 1TNDA 4A8JC 2RH5A 3DPIA 3ZCVA 1JG2A 3L0BA 2ZANA 3RROA 1FF9A 4K1XA 1PYOA 4M9SA 5A6SB 1GQRA 3QNWA 1X2BA 3SM9A 3THYB 4WXRA 4NULA 4BNYA 2XOKD 1FCJA 4IICA 4L74A 4P35A 2H65A 4HNSA 4ZVNA 2WA1A 1UQRA 3TW6A 2XRYA 4D9BA 4KZKA 4QZVA 2Q3DA 1C0LA 3E2IA 3DL0A 2A7QA 1KQOA 1F1BA 1FU7A 1NAHA 1PCXA 1Z34A 2C99A 1LNQA 3HKDA 3FYUA 3H9BA 4I1VA 4OB7A 2C4UA 1IBCA 4YFVA 4A6PA 4YAGA 3W2GA 3FZQA 2ZAIA 4MR7B 3ZIAD 2ZFUA 4R5HA 4Q7MB 1OTYA 5DBEX 4IFTA 1TUBA 4E22A 3BREA 2AFHE 2OUIA 2CVHA 2ZJZA 3G1TA 3OPMA 3QSGA 5DBIA 5DSZA 5CVVA 2JCVA 3L8FA 4P5PA 5KOHB 5F9HA 4PZCA 3DO5A 4IJKA 3PFFA 3ZHYA 3CG4A 1X13A 3O38A 3ZCUA 1O95D 4L02A 5EKDA 1Y3FE 2JD2A 4Y2GA 2C94A 4E2XA 4PYNA 4AM8A 2ZIGA 3KKPA 1BFDA 3KTDA 5BSFA 3DNPA 5B7PA 5DLEA 1NXSA 2CLOB 3O4RA 3F5FA 1ZH0A 4ROTA 5IT4A 4OHOA 4A0GA 4J2OA 1R1DA 3FJOA 4XWTA 3UFXA 1U8CB 2PUTA 4I19A 3PNBA 4TLEA 3W3AH 3EULA 4R1OA 2E48A 3KG2A 5EPUA 4POAA 4PNEA 5BVGB 3COWA 2CBXA 1NV8A 3NYIA 4EI8A 5IFKA 4UXJA 3H75A 3KJXA 3SZGA 4RF2A 4TPKA 3WK7A 3KJIA 3HFRA 2VDJA 4DV2B 3M1AA 1BXZA 1I32A 1U0LA 4G9BA 3SYKA 1JA1A 2P5UA 2OK7A 1XSEA 5AQ1A 4ND8B 1ZUNA 3OX2A 2OXEA 3H2IA 4RMGA 2GPNA 3E61A 3K15A 4URHA 4DJJA 1J56A 1ZD3A 3TTYA 3HGQA 2W4MA 5DSXA 1I5RA 2I33A 3L7BA 1ORRA 2F9FA 5KJ6A 2I76A 1X80B 1E9VA 3TLEA 1SCIA 1GGFA 3RTGA 2XWSA 4MJLA 3VTKA 3O8DA 4DY6A 2M32A 4JXJA 1ZK0A 1YZ3A 1U7DA 1AUQA 2EIHA 4PCUA 4XYBA 4B40A 4D6XA 5IKEA 1AY0A 3JQ7A 4MDYA 2YV4A 4A82A 3D6HA 1UOOA 4CHTA 2ORIA 4HMOA 3VPGA 1PGQA 4Y2XA 3AFOA 3CVWA 4TTAA 4X84A 4XD7A 1K68A 5BQOA 3D7SA 2VL7A 3OKFA 3PHGA 2HLHA 3JQEA 3L40A 4WK6A 1YR2A 3T1HB 1Z8HA 1NI5A 1CJBA 3HM2A 3VR6H 1NUPA 2P9GA 3GRCA 3V34A 1MZVA 1I7NA 4WEOA 1RRPA 2PH3A 1EFPA 3B3GA 3E8XA 4IQ8A 2IDMA 4WNIA 5IC5A 4FYVA 1OH8A 1A4RA 4CGYA 1CUJA 1YB5A 2X3YA 4MIYA 4Q7JB 3Q8LA 2WUFA 1Z47A 3AF2A 3RS0A 5AVTA 3R8FA 4WESB 1MMFB 3KYDB 3DC2A 5LYJB 1MEEA 5JCXA 3NJ8A 1DX6A 4I2VA 2WZCA 1L5WA 1NG1A 3DUWA 3RVBA 3HP1A 1MAWA 4KGXA 2APJA 3LTNC 4L2IA 4ZI5A 1BDIA 2C98A 3E48A 3I5AA 4CT4B 4ZMSA 5K0BA 2WM9B 4FFRA 5DN9A 4DUYB 2B69A 3KKKA 4DEYA 4EG4A 5FWNA 3BVPA 3DEIA 3QH4A 1IM8A 1X7YA 2F9LA 5JI3E 3H4TA 3RKSA 1W19A 1G18A 2JLZA 4B4DA 2OILA 5CDFA 2C5EA 3UAZA 5F2OA 3CR8A 2H5EA 1ZN8A 2EXXA 4RH3A 3R74A 3A4NA 1UOPA 1WWKA 1UMBB 4BFTA 3O1JC 3ONNA 1I4TD 1ICEA 1K7CA 1IN8A 3FI9A 1U8AA 3KTAB 4Y8VA 5JSQA 3BGSA 1UC5B 1W34A 1L7DA 2VRWA 3W2TA 1V7CA 3FW1A 3H6GA 3IXMA 2H06A 5EIBC 4EA9A 1GV0A 1GOTA 3N2KA 1R3UA 5DHAA 3I5UA 4D81A 3V80A 1EVJA 2TMGA 4GH5A 5JARA 2WTUA 2V3WA 4UFOA 4Z54A 1OHHA 3PE4A 4PRZA 1MA3A 1ORIA 4HJXA 4MUYA 3DBRA 1YDMA 2FSUA 3B1JA 3CZ9A 5F12A 1ETUA 2CB9A 3SK0A 4AJ4A 3ZW8A 3I3OA 4ZMBA 1BX1A 2O8DA 2PA3A 1BS9A 4KE7A 1PUXA 2AMYA 2QVBA 5CX1A 2Z6UA 4OA8A 3ZLJA 4RELA 4I2NA 2CDAA 5AVUA 3FZYA 1Y8RB 3E84A 3W7BA 3WX0A 4IVNA 3BQNB 3C48A 3SFVA 5I4IA 1PN3A 1OFTA 1W36D 5KYGA 3VDMA 3ZGZA 1XU4A 1L7MA 2CCJA 1VDMA 1VIMA 1JEAA 3NT4A 1A9SA 4BX2A 3RADC 1I2DA 2DBRA 2NQ2C 2EJWA 2RKOA 4PW0A 1QHNA 4LJ9A 4HDRA 4XUCA 1EGQA 2AJLI 3QFRA 4MZDA 3V2UA 1N5OX 1TCCA 1R37A 1XU9A 1P9OA 3M3DA 3UJHA 4A15A 2XW6A 4FBLA 2Z5FA 4MMYB 3J80A 1ECGA 4IIDA 3KVNA 1ZGZA 3K92A 5IC4A 3FH0A 3R23A 1QFMA 2IHTA 4U7GA 3WHKA 3I9KA 2GPTA 3B1YA 1HFEL 3NNDA 2JGLA 3LAWA 4MKRA 2I8AA 2G88A 4G63A 3NTQA 1ZVVA 1Z5GA 2PN1A 1WB9A 1R6UA 1XRSB 1VJ0A 1T8PA 3BGIA 1YC5A 3B6KA 5D6NA 2W70A 3DE3X 2XJ9A 4FYJA 4UQOA 2A4MA 2V7QD 3EZYA 4K2HA 1I4LD 1OV4A 2OM2A 1N7GA 1W59A 1XEXB 2V0NA 4S35A 3AVVA 3U44A 1TCAA 1REQA 2Q1XA 4DFDA 1ZQ9A 2O2JA 3E35A 3GEIA 3HWX1 1BW9B 1G0NA 4OHVA 2R1UA 1TKBA 4RXMA 3V4VB 5GONA 4BJ1A 1R0LA 3MC1A 1PR6A 3M49A 1OLOA 2LKDA 1EDZA 2YWBA 3BZUA 4IMPA 4OAOA 5D86A 3ULKA 3ZJ5A 4F4HA 2J9YB 3K8ZA 3ZLVA 4GMDA 1J2RA 4RJTA 4S2UA 4FMBB 4S1TA 3WNQA 5IVIA 5A4DA 2PFSA 2YL2A 3IEIA 5E0OA 4GRIA 1QQ5A 1TTPB 2EFEB 2ZREA 2Y77A 3CEJA 1P3JA 2REXB 3E05A 3E70C 2HB6A 3GJZA 4M9QA 4UEWA 5BN3A 1W46A 1XJQA 2HRCA 3E3OA 4EEZA 5JAUA 3M8KA 2WD9A 4QUIA 1U7ZA 1C7FA 1UBTS 3LD9A 1L7BA 1C30A 2OXTA 4DSOA 2ERYA 1NUSA 2KWIA 2RB4A 3O2SB 4BMYA 4EARA 3RSQA 1TVEA 4RK0A 1DHRA 4YUYA 1XZBA 3DZIA 3GO4A 4G9GA 4PO1A 4DVJA 1RLJA 1KI9A 2R60A 2PPVA 1V4NA 1XZMA 4MVJD 3Q6NA 2BZ1A 1PDVA 1AF7A 5DM0A 2OCDA 1P4RA 3COSA 1RQRA 4GEKA 1YL5A 4FYXA 3JU3A 4RX1A 2Q5OA 1JBEA 5H3CA 1KETA 5CCEA 3W8NA 1XZGA 1G8FA 4H0NA 3RSFA 2CL0X 4DDKA 1Y6ZA 1EWTA 1KFCB 3LLSA 4BEBA 2IS4A 3PCXA 4U4AA 1SEVA 2ZZMA 1VJ1A 2QN6A 3BXXA 3OOYA 1ECPA 1PW5A 2DVMA 1IBKB 3C8UA 1OZHA 3TD6A 2G07A 2DQYA 4HY3A 4LHSA 1XYGA 2G4LA 2OB1A 1J2YA 4IVPA 3NHYA 3QVTA 1OAAA 4D02A 2UYCA 5I01A 4MVXA 3CE6A 1N7JA 1WHSB 3P2OA 4QSHA 4BZZA 3ISTA 4EPRA 5LQAA 4G85A 3A0RB 2PUFA 3A9RA 3NHJA 2R79A 2KJQA 3VU0A 1QP7A 1HDGO 1KEPA 1MV5A 2JFGA 5HJ2A 3GMDA 1IK6A 1VMAA 2RJ3A 1X8KA 3D8SA 4Y6RA 5B4VA 4HLCA 1CDZA 4M0FA 3TLGA 4XCXA 1MO6A 2DT8A 1ULBA 1NUAA 4U2KA 3WO1A 1JDBB 1TX4B 3PDCA 2AVNA 3TKYA 4Z2AA 1FFXB 1SZJG 2JEYA 3EA0A 2FUCA 1B2LA 2R65A 1BHQ1 2FOLA 4L6AA 4N6NA 4JN6B 1NXVA 1L7QA 2JW5A 1ZKMA 1VL2A 4NBKA 4XJVA 4IINA 1D09A 4PE5B 3ENVA 4NJMA 2JS7A 4G0NA 1KK0A 1CQIB 1WQ3A 1CSEE 1GCOA 2BV3A 1V43A 3LVBA 1U8YA 3OKCA 1P0FA 1PHRA 3PX2A 1U8FO 1FJHA 4ZQCB 2IWRA 4C1BA 3L8DA 4YXFA 1O3YA 3DPUA 3OTQA 3T7JA 2MSWA 4RHFA 5FT9A 2G9NA 2ZZNA 3C3WA 3FR7A 1J2UA 3K1YA 4R8LA 2AN4A 5EWLB 1UIRA 4NYIQ 4Q37A 1Q5PA 4TVSA 5IT9A 1E6KA 2NZUG 1ZOIA 3JASA 3O92A 2G9UA 3M2PA 1P73A 4QIHA 3LWNA 1H8HA 1XRRA 1S01A 4HADA 1OXUA 5AW5A 1B0AA 4UATA 3VPSA 1N32B 1RYDA 3G0HA 3OA2A 1OJLA 1Y7TA 3BE6A 2QUZA 3G9QA 3GD5A 2PLNA 2CK3A 4AXXA 1NI4B 4FONA 5LWQA 1KMHB 1A9QA 1YULA 2FFBA 3LL4A 2AJ8A 2DTXA 1KYYA 3R5FA 4JLSA 1U0NA 3CT4A 5IVDA 3LC1O 1GTZA 1FEZA 1D1QA 1RWOA 1OYWA 1STOA 2DBQA 4AMBA 3ZBTA 1UC8A 1O54A 1RKVA 4AZVA 1JXMA 3DMYA 3Q5DA 1CY4A 3LRTA 4R71A 4OLHA 5JXWA 1BHJA 5BR4A 4WKOA 1XTIA 3NMUF 2VA9A 4EFLA 4HS4A 3G89A 2BEJA 1JDBC 2OP0A 4C9BA 3D4OA 2EKPA 1EE1A 2YWXA 3L0YA 4I1RA 3SSAA 1ZGCA 2ZB3A 3CS3A 1CUYA 4HNAA 2W2NA 3OKPA 1ADYA 3PXBA 1Z5WA 5M3BA 4AJHA 2FMXA 2H29A 2Z4TA 3FJYA 4KWIA 5TT0A 1DC7A 4EHLA 4KK4A 2CWWA 3T94A 4UQLA 1G60A 3E53A 1EGAA 1MXHA 4CLOA 3NO4A 1L5MA 3L8HA 4QUKA 1Z18A 2GGSA 3BPSA 4JVLA 4LMRA 3TDNA 1WQ1R 3TG2A 1R9NA 1MB9A 3EC2A 3JXEA 4HAUA 4FCWA 2IITA 3U9SA 3E5HA 1NULA 5HIJA 3WLJA 1E3QA 1A88A 4DSUA 3MGAA 3DVAB 2XWPA 4R4JA 3EX7C 2IIBA 5HZHA 3KT3A 3SKXA 3L7CA 4PZEA 1A9OA 1D4FA 1U2DA 3RIEA 3WHIA 3ST7A 3A06A 4D8YA 4L5JA 2PEYA 1Q44A 5EY5B 4WAUA 3T4PA 2V6IA 3TW0A 3ZZ0A 3ZH2A 2O9JA 3AUXA 1P8JA 4EL0A 2OO3A 2W6ID 3OLWA 3T0FA 1VCHA 2O2DA 3DTVA 1VHJA 1QGUA 3Q7RA 1Z35A 1ZC4A 3LLVA 2WNHA 1Y8QA 1P5HA 4HYEA 1K6XA 3QY0A 1P5ZB 2PZLA 4YJ2B 3HJBA 4ZO6A 5I8ZA 5BORA 5D1NA 4U2GA 2JIZA 2ATIA 3WMGA 2QR3A 4KLZA 2A8YA 3BTVA 3GFOA 3DKPA 5CLQA 2PBLA 1N2CB 3EGOA 1O03A 2XUOA 2O8EA 4F2WA 4N47A 1D5CA 3GBSA 4GPAA 1TIPA 2EERA 2WWIA 3WTCA 3VJLA 2IDKA 5GGYA 1YHNA 1YQWA 2FSVC 1TCVA 4HYYA 4OB8A 3C3XA 5AOCA 5C35A 1RWBA 2BEVA 4X7RA 3K8YA 2PL1A 5A9SB 2WJVA 1I0ZA 1R6AA 2PSJA 4OAQA 2NZWA 5HZMA 2XUHA 7AT1A 2B3TA 2G9VA 1RRGA 2JLSA 2IYNA 4KQKA 4RVDA 3I62A 5K03A 1I7QB 1NI3A 4DZRA 1QRUA 3PPWA 4OLAA 4HNHA 1ONNA 5ALZA 1QU2A 3A3PA 1L1QA 1QGDA 1F0KA 5LP6F 1W5EA 1E1DA 2I4OA 3BRWD 4EYOA 5KSWB 1J0AA 4NOKA 4DR3B 2AR0A 1JDSA 3DPSA 3PFIA 3RVKA 3E3MA 2P40A 2EKBA 4KAAA 4L4UA 3TYXA 3UYKA 5JS6A 3W9SA 4JL5A 1WMFA 4UTZA 4QTYA 5EMHA 2UV8A 3O1IC 5ADVA 4K3VA 2FWBA 3C3MA 1FIUA 2M1ZA 2IUFA 1I6LA 2JBHA 3MLAA 5D84A 1TF5A 2Z1NA 5FLEX 1T8YA 3RTCA 3FBWA 4HDMA 2O14A 4LZZA 4YECA 4EJFA 4BB5A 4CNQA 3E18A 3KZXA 1P6UA 1MAHA 1M2VB 2DFTA 2R8BA 4LJ4A 5ESDA 3ZVNA 2EP7A 1XVVA 2Y66A 4AIIA 4EF6A 1FDWA 1KO1A 4P54A 3QU7A 3PD1A 2VLBA 2WKWA 1CT9A 2JGKA 4QE3A 4EJ6A 4LQ4A 5B4UA 1GUZA 2BMDA 3CTPA 3GLHA 1DBQA 4FS8A 3HU3A 2P90A 2PYIA 4WLEA 4V2IA 3T5DA 3IMEA 5CCDA 4E5NA 2HT6A 2TYSB 3LPLA 4Z7OB 2XE8A 1J23A 3LUJA 3DE5X 4GZ6A 2CUZA 3NBMA 4WY8A 1AS2A 4CKWB 3IBSA 4ZI7B 5JZSA 1E3MA 4JBGA 2GZAA 4BO1A 2JLAA 4NE9A 1V7QA 4NXMB 1KNQA 2YZNA 1LBQA 2LGJA 2OFXA 1QQ6A 3BIXA 4JT9A 1CP2A 5AKGA 3PWKA 3RTBA 5CA0B 1VBNA 4G24A 3WYDA 3V4RA 3SBXA 3DVSX 2YWDA 3BAZA 4HN9A 1NQUA 3VOAA 5FBWB 5BSVA 4TN1A 5J2TF 2K4MA 2MSEB 2PRKA 5JSFA 1B1CA 4QO8A 4I1PA 1CRWG 1OXTA 1CUHA 2CF6A 3WI7A 2QQFA 4G5QA 2W4IA 1ISIA 3CB4A 5LA6B 2X41A 1QG6A 1XCPA 4DV1B 3Q6MA 3SU8A 3TS1A 6ADHA 5DWQA 2OKGA 4CIDA 4GI3A 1LK5A 1U5CA 2C61A 3JWHA 5A3VA 4DA9A 3IR6A 1HR0B 2PQMA 5C31A 3VNRA 2PWBA 3TLBA 3UMJA 4H60A 2JKVA 4OFWA 4V1CI 2GZHA 1GTMA 3VGJA 2GNAA 4W4TA 3ZQKA 2Y1CA 3NRBA 3VR5A 5IAAA 1M6NA 3WGGA 4REQB 3PWTA 3B9PA 1TF7A 1E1RD 1ONSA 4H7HA 4I3GA 1N0IA 2VHVA 1V6CA 3OLXA 1XJ5A 2P6NA 3WTBA 1Z5PA 4OLBA 2BMEA 2QGFA 4AN1A 2DPLA 4Z5XA 2HKIA 2QPTA 1ZISA 4CEIB 2JFZA 3WS7A 3HFSA 1QJCA 5LOVF 5EJEA 2IEAA 1GGJA 1GEGA 3WGJA 4GL4A 1AZLA 2J9ZB 2VJPA 3IKMB 3QI7A 4JAVC 5MN4A 3MRXA 3UOGA 5IEBA 2BZSA 2IYYA 5LC1A 2P68A 2XCUA 3UGTA 4MVJM 1QOPB 2DR0A 1TM4E 4UVGA 4IHQA 1Q12A 2EARA 1JU4A 5CLGA 5H80A 3THOA 1DEXA 3KSDO 3LUKA 1K5PA 2QZJA 2IZ7A 2VPYA 2ZSUA 5ILOA 2GSDA 2EFYA 5COBA 4LSZA 2AI3A 3SR3A 3YASA 4Z86A 1FSFA 3DMTC 4F9EA 1TD9A 2FMHA 3RPEA 2HN9A 2V96A 1ISJA 2XQVA 3TTUA 4C3VA 2I6UA 1M6WA 1Q91A 2R751 3BH0A 2XIJA 3HY4A 4YBZA 4ZZIA 1CIJA 3TGPA 2IZZA 2UAGA 2IU4A 5CT5A 1N5DA 3DGEC 5GWXA 2C88A 2J33A 3LM8A 3CLTD 5BMVF 2ID4A 4BNNA 1YGPA 4C03A 2HWUA 4OLFA 5DMXA 3DMFA 1S96A 1Z0AA 3U56A 4NZYA 1QWOA 3ZVMA 1NW3A 2AOTA 2VAPA 1PO7A 3PVZA 2G7MC 5DDIP 3D6AA 1LX7A 5T6MA 1YJAA 2GARA 1PWHA 3IA7A 4JQZA 3HGMA 4INPA 4RANA 1DE0A 3SHVA 5I45A 1NP6A 3I83A 8MHTA 1AQ6A 1UL1X 2B1GA 1NXQA 2AMFA 1A9ZA 5D3MB 1YDEA 1K08A 3FROA 1U3DA 3K6KA 2J6BA 2O0MA 3DNMA 5B58C 2X3UA 4ZRDA 2ONYA 4G1FA 1MIOB 4X44A 2DX7A 3SBOA 4PV7A 4EKGA 2LDXA 3W3AD 3MCAA 2P9FA 3D6NB 1OKKD 1J0XO 2HK6A 2ZAGA 4JELA 1V25A 2YWFA 4KGZA 1YK1A 4A2CA 4A8PA 3H2YA 1WTAA 1UBEA 2W48A 4P7GA 4OOFA 4RSHA 1OUMA 1QTNA 4YRFA 3H9EO 3OP1A 2OV2A 3O4VA 5EMLA 2JF0A 3ZI4A 3FMOB 1JWAB 4HN2A 2AB0A 3T99A 5ALHA 4J1NA 2OCGA 4PPFA 5AT1A 1BKDR 3QE4A 1WVIA 2CL7X 2GNOA 3RUFA 4RTKA 3ENWA 1EUQA 1JDZA 1CUAA 3N07A 1T4CA 5I7EA 3Q2OA 2YVUA 4LOHA 4ZVLA 2DETA 4C01A 2JJ1A 2VT7A 5AOAA 3OPQA 1P17A 5FOSA 1ZCFA 3DUFB 4A6DA 1TDJA 4WBNA 2NZJA 1PR4A 3MT7A 1A71A 2IYLD 1TA9A 4MRSA 4S24A 4DKJA 2X42A 2EJTA 2YWHA 3WKDA 5C1BA 1P0MA 3G2IA 4XUGB 3M4ZA 1XZNA 3PGMA 4YRJA 1E3EA 4LG1A 1FUYB 2C77A 1GTSA 1IH8A 2QYTA 2LBPA 3AEQB 5DN6A 1NMXA 4LXUA 2GI4A 4KITB 4JD5A 2COKA 4R2MA 4RM3A 4RYDA 1R6BX 1N57A 4HH4A 1XYVA 3M34A 2VBIA 4QT0A 2BH2A 421PA 4RADA 1C0IA 1KS9A 1AUPA 1N2CE 3A14A 1DKOA 4OSPA 3DOJA 1C4KA 1NV9A 3MIIA 3UMFA 3VR6D 3ZK8A 2EZ9A 4LKRA 1DAKA 5A0VA 3D1JA 3EFHA 1JEQA 5BYAA 2MDTA 2I2XB 3B5JA 1OB2A 3PLNA 1RBZA 1U1FA 1J49A 2C5BA 2QYSA 3H6KA 1XDWA 2GBPA 2Y68A 3L93A 4LTNA 1ELOA 3EUAA 4IJQA 3VPDA 4B7UA 2FQQA 2VHUA 4TKVA 2IQIA 3BMQB 5B1HA 1U7XA 5A1TA 1ODIA 1XF9A 3BMOB 2YUTA 1RABA 1YH3A 2I66A 3BWBA 3ES9A 3EY9A 2HEIA 4Y6PA 2COUA 1U6IA 4HDOB 1R6DA 3RT1A 3NWJA 4KV7A 1HDRA 4OX9B 3TZHA 1TVCA 1FRNA 3NCTA 1YIAA 3SIWA 4Q4AB 4EW6A 5IASA 1CE8B 4ZAWA 4EFNA 2VOJA 1KZYC 3TOVA 4TL9A 5CW1A 3WWDA 1HSOA 2GCOA 3PDIA 5BO5A 1G3MA 4B3GA 2H6EA 1IWPB 3KHTA 3NX4A 3TDMA 2IL1A 5JNSA 2PGDA 3QBDA 3X3HA 2FZ5A 2GK6A 5CAEA 4QJBA 4RLHA 4HQFA 2P69A 2YJNA 3G68A 5T4EA 4FJ0A 3CZAA 4Y67A 3U1VA 3H7AA 4KPGA 5BSRA 1L5HB 1IY1A 1H0HA 5H16A 4OBXA 4B4UA 2JKZA 1WV1A 3CN9A 1FYXA 1ZNZA 1DJOA 2XVZA 3KR2A 2OHJA 3KOOA 3MPUA 4CKEA 2PXHA 5I7FA 3QPDA 4FMDB 1CHNA 3NP9A 4AX4A 4WADA 4XDZA 2OFPA 3WGMA 1JQJC 3T1QA 4C7MA 1ZRNA 3MTDA 4R54A 3MWEB 4UVIA 5FEMA 4KO8A 1CULC 4NX2A 3FFWA 4GYJA 2ETXA 2JAUA 3B5EA 4L5YA 2CLCX 4XYGA 3N2GB 3UFBA 4CMEC 5CITA 5J4VA 4QFMA 2BCGY 3DHWC 2VQFB 1LTKA 2H2GA 4F8JA 1JU3A 5FYDA 3OJEA 5PGMA 1SK9A 2ZPAA 2R7AA 2G1JA 4A2WA 4KMMA 5IT0A 4PX3A 3EIFA 5EP4A 1M7HA 2IPAB 2ZTHA 2WDZA 3P7MA 2BFEA 1XOIA 2Q2NA 1LQ2A 4A91A 4YCNA 1T9DA 3OZVA 2ZXEA 1R4MB 4N03A 2IOYA 5WRFA 2IUYA 2NMVA 3WVNA 2O2GA 2FGJA 3LX8A 3E7WA 1BHO1 2I03A 3OJLA 2G5TA 3IEVA 5BNFA 5L45A 1IXSB 2CFOA 4LUCA 1OGYA 1J21A 1ZVQA 2D3WA 2YYYA 3MS7A 5EUQB 2JAHA 5HCNA 4A23A 4TRMA 4AS2A 1BDHA 3DLTA 3AUFA 3HUTA 1DEHA 1WZEA 1GPBA 1YGYA 2BBTA 3ED1A 3F1LA 3FDFA 3OPYI 3PQ5A 5CEEA 5L6LB 2QG6A 2W2LD 1DRKA 3JALB 1V48A 4NARA 4GVPA 4O4HF 4TTQA 3JYHA 2Q28A 1NQAO 2O1XA 2QE7D 3C2QA 1U04A 4LS3A 4YP1A 4B3IA 1VM6A 4AS1A 3PLRA 4TQUS 1GFWA 1MH9A 3BD8A 3IEXA 4XDGA 3D6TB 1E7QA 1WB6A 1QCDA 1XAIA 4MOWA 5LXTB 2XUKA 1PQUA 4BV8A 2NU6A 4Q0MA <