1SBYA

Alcohol dehydrogenase from drosophila lebanonensis complexed with nad+ and 2,2,2-trifluoroethanol at 1.1 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase
publication title 1.1-A crystal structure of D. lebanonensis ADH complexed with NAD+ and 2,2,2-trifluoroethanol
rcsb
total genus 93
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sbyA00
4ND2A 4CMGA 1UXGA 1P31A 4FGSA 4BKRA 4Z6KA 3S1LA 1CWUA 2X1HA 1HDXA 3CINA 3PJDA 2H1SA 4YT4A 4XYGA 4XKJA 2GGSA 2P4HX 1GV1A 2UUPA 3BTUA 1MB4A 2JAPA 4FS3A 1WWKA 1LSUA 4I08A 5ER6A 1UXHA 5DCWA 4B7CA 3IS3A 1FDTA 1NXQA 2GDZA 2VNSA 2GN6A 4D43A 1ZVMA 2OL4A 1IYZA 4CQMB 1FDUA 3F5QA 4FJ1A 4NPCA 1BXZA 4J90A 1KVRA 1OZAA 3KYDA 3CZRA 1GADO 4L74A 5EQDA 2W98A 5KWEA 1EMDA 3AU8A 4DLAA 5EIOA 5AVOA 4W6ZA 1Y9AA 3E5MA 3GUYA 4CLHA 4CMKA 2HMWA 1LRLA 1P9LA 1ADFA 2C07A 4HX5A 3QVTA 1FXSA 2OBNA 4NZ9A 4DA9A 3NT5A 1E3IA 2GN4A 3ZH2A 1CDOA 1LDEA 3GVXA 3H5AA 5FYDA 2IZZA 5IAAA 4ZN6A 4XYLA 4DWVA 1FMCA 4BNKA 2CFCA 1T2DA 4WGGA 3U09A 3VC7A 4TRNA 4PLHA 3VVBA 1K5HA 2Q1UA 2J3IA 2PNFA 5G2OA 2GN8A 4FJ0A 1S7CA 2X0RA 4RDHA 4GSKA 2O3UA 3JQDA 4U6SA 3JQ8A 2I3AA 2NU8A 1PZFA 5HM8A 5F1KA 5CDTA 3ZV3A 3TF5A 4IDAA 1SC6A 3WBFA 3RUEA 4DQVA 5I9NA 3JYLA 3DZJA 4IBOA 1E92A 3G79A 4AL4A 5BNFA 2CDBA 2W90A 2A94A 2FHSA 2P9EA 5B12A 5JC8A 1Z7EA 4U6QA 3FWNA 1GQQA 2VT2A 4CODB 4N18A 2X58A 3I6QA 3WYCA 2JFHA 4IS2A 4WUVA 3L6OO 1NAHA 1K6JA 4RORA 4BNMA 4JBGA 1LDGA 2IE0A 2EERA 2GASA 1ZZEA 3EUWA 3ZWPA 4A27A 4J7XA 1LU9A 4BNZA 1GCUA 2HDHA 5KKAA 2YFQA 3D0OA 3H6KA 2GZ2A 1CJCA 3LT1A 5ICSA 1YQDA 4CLXA 4BOYA 1W4ZA 5DDIP 3KETA 4WCFB 4YJFB 3C8MA 4Q9NA 1GUYA 3JV7A 4BMSA 5DN9A 4NIMA 1QXSA 5JAZA 5GY7A 4BKUA 2X9VA 5CDUA 1OI7A 1F12A 3LVFO 1DIGA 1EQUA 3JQAA 1U8FO 1DDOA 3TPCA 1CQIA 1NP3A 4EDFA 1E0DA 4AJJA 1ZK4A 3WWYA 3B1JA 1SEPA 4W9NC 4BNLA 4XEHA 3GEDA 1ZMTA 4DC0A 3LQFA 4R69A 2DM6A 1NFFA 5C7OO 4ROSA 4TRRA 3VPHA 3HDQA 4ZQGA 3GY0A 1PJBA 2GF2A 4OQYA 1N8KA 1GCOA 3GOHA 5L7WA 1GYRA 4CUKA 1EUZA 3O03A 3DDNA 4AJIA 3QWHA 4L4RA 4XX0A 2NVUA 3E1KA 1QLHA 3GDGA 5JAMA 3FR7A 2I3GA 1MXHA 1YXMA 4YBZA 3DAPA 3OH8A 1SB9A 3LC1O 3RUIA 2HQ1A 4XGNA 4BGUA 1H5QA 4D41A 2O3TA 2O4CA 1V9LA 1YO6A 3K9QO 4TVBA 3FI9A 1O0SA 5ITWA 1R16A 5DP2A 4DTIA 4J43A 2UAGA 4IM7A 4BNGA 2B4RO 3GVCA 4WCDA 1HKUA 1LSOA 4BVAA 3INGA 1C1XB 4Q3DA 4JGBA 5B4VA 3AFNA 3WJAA 4D0RA 5F21A 1IOLA 5JNLA 5K0ZA 3HN2A 1I30A 1GDHA 1YOVA 3LC7O 4W4TA 3KSZO 4D45A 3DQPA 2VHYA 3AU9A 4QO8A 5JCJD 4KZPA 3H3FA 3QWAA 4LCEA 5A05A 4XYBA 2P9CA 4C7KA 2DFDA 3LK7A 1WZIA 3JYPA 1IE3A 3WLEA 3PVZA 5T64A 3LSYA 3TZCA 3UH1A 1JVSA 5BR7A 3IC5A 2QRKA 1SBYA 4PIVA 3TSCA 4CL3A 1YJ8A 2B83A 2D8AA 1N1GA 4F3YA 2Q1WA 4XD2A 1O5IA 2F1KA 3NRCA 3DO5A 4E3ZA 2EG9A 5H81A 5THQA 2QRLA 4B3HA 5A5FA 3HQ4O 2ZCUA 2QQ5A 1DIHA 4CMBA 1J6UA 1Q0QA 2O2SA 3MJVA 1B3RA 5B37A 4DLBA 4YRBA 2VCYA 2XPCA 3TDKA 3OSUA 3BHIA 2IODA 2W2KB 3JQBC 1DC5A 2WJPA 2VN8A 3D64A 4GVXA 1QLJA 1FDVA 2W2LA 2YUTA 1C0KA 3A28A 3UOGA 4CLRA 3DFUA 1XA0A 3V8BA 4BO4A 3VAZA 3QW2A 3ON5A 4WE3A 1GEEA 1O95A 2CDCA 2PGJA 3SEFA 1ORRA 2I99A 4A73A 1YBVA 1OC2A 2X8LA 1ULSA 5JC1A 2Q45A 4ESOA 4YJDA 1Y8QB 1I2BA 4FC7A 3WQRA 4YAGA 3E03A 1U2GA 4BO8A 4DPKA 2HKIA 2I65A 3AUAA 1ENPA 5ER9A 3WGYA 4Y8VA 2YZ7A 4XA8A 5L7YA 1Q1NA 3AK4A 5DZSA 3PGXA 4M1QA 4X54A 3OIDA 4NNJA 4BO5A 4PZDA 4CJXA 4J1QA 5EN4A 2WDZA 2X0JA 1OBFO 3K30A 1D1SA 1C1DA 1HWYA 3TL3A 4ND4A 5CDYA 3GMDA 2H6EA 2W8ZA 1A9ZA 4Z3DA 4RPHA 2C2YA 3AOEA 4ALMA 1U5AA 4E5NA 3DL2A 4R01A 1HZJA 1JKIA 3QIVA 1UH5A 4R3NA 1AXGA 1DFIA 1PEDA 2DC1A 4HUJA 4HP8A 3O38A 2WSBA 4G5HA 3U4HA 1CF2O 1H2BA 1BDBA 2TMDA 1XU9A 1SOWA 3GZNA 3PIIA 4OOEA 3VH1A 3F1LA 3NDRA 3QJ5A 1S6YA 3JQCA 1Y8RA 1XKQA 2XXJA 4CM8B 3BMCB 1H6BA 1E6EA 3IP3A 3INRA 3PJEA 4UVHA 3RBXA 4DBVO 4ILKA 4J4HA 3GNTA 4CUZA 3L4BA 5I7VA 5AXBA 2B0JA 1MGOA 4U7WA 3TN7A 3SX2A 4XQCA 4ALNA 3KB6A 4OM8A 3KVOA 2OORA 3DBVO 3GN2A 1GYPA 2UDPA 1DBVO 1QV6A 2RHCA 3PLNA 2CVQA 1BXGB 4M87A 3MJ4A 4DIOA 1U3WA 1P33A 1LLCA 5BSHA 3HJAA 4EI2A 3DBRB 4Q3NA 5G4KA 5JY1A 1E6UA 3DHEA 3EGOA 2NM0A 4MVJE 2VOEA 1MG5A 1E1KA 2VRCD 3EZYA 2DU8A 3H3JA 3IIEA 3KYCA 4GGPA 3GRPA 4M89A 3IKVA 4BGIA 3ST7A 3ADPA 1ISGA 2BFOA 3GNQA 4PGFA 4AICA 5TLSA 1P0FA 2HLPA 2C2XA 1Z6ZA 3KYBA 4U5QA 2HJRA 2BFMA 3RI3A 5IZCA 3QWFA 1K3TA 4UVIA 5ES3A 5G0TA 3U4CA 4INAA 4XDZA 4EJMA 3D4NA 2EGHA 1JW9B 2C7VA 5EQFA 3GC6A 4HNHA 5KVCA 4AJHA 2A9FA 2O2YA 3C3XA 4ND1A 3ZHZA 4AJNA 5CEFA 4BMNA 4GX2A 1W8DA 2IRWA 1VRWA 2J5QA 2J6IA 3F46A 1DC4A 1B16A 4RPGA 5KCZA 5BT9A 3VOSA 2DTDA 3L07A 2AHRA 2WWRA 5IDQA 2B69A 3G0OA 3ZV4A 2BFAA 1PR3A 1WXDA 4G65A 1DFHA 4YCAA 4YVFA 5JFOA 1AXEA 5CP8A 1QYWA 3QRWA 1E3WB 4YRAA 1V3TA 1NYTA 4ONEA 3L6EA 1VM6A 3W6ZA 4YQZA 4BNYA 4UREA 4J3FA 3SXPA 4DPLA 1OC4A 4WASA 3ICPA 3WYEA 5C5IA 3OQ1A 2VUUA 3DEYX 4J2HA 1X14A 1D8AA 3U4DA 3E9NA 5KKCA 5COAA 1YQGA 4XGIA 4DC1A 5A9SA 4FDAA 3HSKA 5KTKA 1YWGO 1FF9A 2DAPA 4YAJA 1UAGA 4CM4B 4NU6A 2VYNA 2YYYA 4O0LA 1JWBB 4MIOA 1RM3A 4FIZA 4LISA 4BQRA 5T67A 4ZRMA 5DNAA 1R0KA 2ZYAA 5L4SA 3MJTA 4AJ4A 3ZWYA 3DOOA 4Z9YA 3PK0A 1GU7A 2YDXA 4HBGA 4BO1A 1QYXA 3C1TA 3K2BA 4K26A 4NJMB 2RAFA 4KTTE 1QYVA 3K73O 2D5CA 4E13A 1YH3A 4WLEA 1KERA 1DHTA 2HJSA 1R6DA 1P1KA 2O50A 3CE6A 3WDSA 4DVJA 3TNLA 2EKPA 4WECA 3VH4A 4J1NA 1Q0LA 3FR8A 1ZK0A 1DIAA 3PRJA 3DHYA 3M1LA 5I8ZA 1WZEA 2XOXA 4WLVA 2NQ8A 3I52A 1GZ6A 4OQZA 1CYDA 1NVGA 1O8CA 3I83A 2DPHA 2IYPA 1JAXA 1B26A 4WKGA 3BYZA 3JD2A 1TI7A 3RBVA 4RVHA 4XB1A 3UAGA 3R1IA 2Y1EA 2PD6A 3H9GA 2O7SA 5DBGA 3CSDA 1T25A 2OP1A 4GX0A 4NFSA 3RUAA 1PQWA 1KIFA 2PR2A 2X86A 3A06A 1ZSYA 3PWZA 2VZ0A 1X1EA 1TLTA 3GG2A 4MIEA 3PFWO 3I3OA 4MVJF 4OAQA 4BUCA 5CG2A 3ONFA 3IP1A 1OOEA 3HWRA 5K9ZA 3BMOA 1I24A 1I36A 1U3UA 2DKNA 5I9MA 5JSFA 4LVUA 3JQEA 1VKNA 4PFJA 4R68A 3ZWNA 5FWNA 2PKQP 3L6DA 2FY8A 3WSVA 4PVCA 4UAGA 3RC7A 5BNIA 1Y81A 4NK4A 4Z3KA 1ONOA 4YJGA 1KEPA 3E6AA 3NYWA 3D3WB 2FN7A 4WLOA 1JN0A 1N9GB 4Y67A 1Z73A 4M8SA 2V7PA 4BNNA 3V1UA 1AHIA 1X0XA 1YL6A 2E49A 4BO0A 4B4OA 2IZ0A 3CPSA 3LYLA 1XEAA 4CM3A 3FN4A 3GNSA 2C5EA 2IEDA 5A02A 2CF6A 1M6WA 1P77A 4GWGA 3M2PA 3H4VA 3U9LA 3FBGA 3HFSA 5IJZA 2VHVA 2ZTLA 3GAZA 1I33A 1SB8A 2GR9A 2PGDA 2Y67A 4HFRA 1RKXA 1AE1A 2WE7A 4XGKA 4OMUA 4IZHA 3AI3A 5A5EA 2JD1A 1F14A 2BF7A 3B20A 3BTOA 3I1JA 1I2ZA 4PG4A 4CV2A 3Q2IA 2E82A 4L4XA 3JQAB 3JQBA 2A4KA 4MVJH 1R4MA 1PL8A 4OH1A 1QYDA 4QFCA 4PG5A 3ZW9A 1VI2A 2P5YA 2F00A 4BNHA 1D7OA 4YQYA 3WGOA 9LDBA 5BSEA 5DOZA 2BHLA 2BGMA 4UEKA 3F1KA 1SZJG 2VHXA 2J5KA 3NUGA 3KLMX 2B4QA 3VH2A 1GQYA 1B8VA 2EKQA 5CDGA 3O26A 2GZ1A 3BHMA 1YS4A 3DBLA 4IQ0A 4PLWA 4OKIA 5DCUA 4A7PA 4YACA 4ZRNA 1GPDG 5EERA 5T5QA 1YB4A 3DBHA 1HLDA 1WVGA 4OGWA 4RLSA 3KHUA 1XU7A 2CDAA 2C7GA 3MTGA 3FHLA 3AOGA 1FK8A 3DZHA 2IXAA 4XB2A 3KO8A 3T7CA 1ENYA 4B79A 4IXWA 3H9JA 4JBIA 2WD7A 3ZWAA 1LDBA 2YHIA 2I76A 2Z95A 4KUHA 4F46A 4IDEA 1Y5RA 4LK3A 3KOUA 1RPNA 3I9JA 3I4FA 3RSHA 1E7WA 3MTJA 4W82A 1EBFA 3PPIA 1M6HA 4CV3A 4O5OA 2BGKA 3JQAD 4NQZA 1Q7BA 1YOVB 2O3SA 4E2XA 3TZKA 1ZO8A 1XYGA 4B4VA 4WCFC 2FPIA 1BG6A 1V6AA 1KC3A 1KEWA 4J91A 2O3RA 1ISMA 5HBRA 1E7RA 3E9QA 3B6ZA 1U1IA 5CFZA 4EW6A 1DHRA 1JLLA 1MLDA 2WEKA 2RH4A 3IOYA 3WNQA 3X2FA 1DRVA 4NFYA 2BELA 2OXIA 4BHTA 1G6KA 1U3VA 3FBTA 4J9UE 2AEMA 3RVDA 1NQAO 2WE8A 3GGPA 5EMHA 1XR3A 2JFFA 4YRDA 2HMTA 3EYWA 2YQ5A 5IZCC 3JQ7A 3O8QA 5KVQA 1E7QA 2Z1NA 5U9CA 2VNAA 4Y9DA 2PLAA 5JLAA 2O4UX 3IMFA 1AN9A 1H6CA 1SAYA 3FWZA 4E0BA 3INTA 3ZWOA 3L77A 3WTCA 2ZB8A 3FPCA 2E48A 4XCVA 4CLRB 5LDHA 5B4TA 1P45A 3AM3A 4TKLA 1XIVA 4NR0A 4CR6A 2I6TA 1K6IA 2G82A 1ISFA 3EZLA 4RPJA 3FNEA 1HF3A 2ZTMA 3S2IA 2CZCA 2O3QA 5C3MA 2C54A 3EC7A 4DQXA 4CMIA 3QWBA 1GY8A 1N5DA 4L73A 4MPDA 3JD4A 5TF4A 4E2WA 4EUEA 3AJRA 5ILGA 4CL8A 1T2FA 1TA4A 1HETA 2PV7A 3JTMA 4UUNA 2QX7A 1R4NA 1DC3A 1E3JA 4Z9FA 1O6ZA 3W4JA 1H9BA 2UYYA 4B3IA 2B36A 5DCYA 1BW9A 1C1DB 1KYQA 3C7AA 3RWBA 1AGNA 3QQPA 1U4OA 3CZMA 1ENOA 2NTVA 3C7CB 4RJTA 3W8FA 3NDIA 1T4DA 1XWFA 1BSVA 2FMUA 4L75A 4RVGA 2DT5A 2W2LD 4TVOA 2AEJA 4XJSA 1LC0A 2EKLA 2JD0A 4B4UA 3U3XA 3WG9A 1U2DA 1LA2A 4CMCA 4OHUA 5A3VA 3ASUA 1I8TA 4OXNA 1Y8RB 4J6FA 2BI7A 1JWAB 3RFVA 3H7AA 3F5SA 4XDYA 2PTGA 5JDCC 3UCXA 3VKUA 4NH4A 3EVNA 3TOXA 1YDEA 4H16A 3PZBA 1I3NA 3FCOA 4K28A 1P1FA 1SO8A 4IDBA 4BNJA 3EMKA 5CEJA 4CLOA 1PTJA 3DB2A 4PLPA 3RUCA 4IIVA 1ZCJA 3WIDA 4E5YA 1Y7TA 4YAEA 1LDYA 4CUJA 3LDHA 4JBHA 1F06A 4A0SA 1B7GO 3V1YA 2FP4A 1T2EA 4NMHA 4B4WA 1ZK1A 5G4KB 1H6AA 2R2GA 5A9RA 1NHWA 3JYQA 2NVWA 1EE9A 4WEOA 4O6VA 5G4LA 1DOHA 1EK5A 1NQOA 3KYCB 1DXYA 4J2OA 2G1UA 3IDSA 4XWYA 3OECA 4DPMA 2ZCVA 3C85A 3TZQA 4WNIA 3NT4A 3BMNA 3ONEA 4ID9A 2NLOA 2D0IA 1FJHA 4R41A 3WWZA 4JCOA 4ZU3A 3SC4A 2DBVO 1Q2XA 3CUKA 2FR0A 4L8VA 1GUZA 3ANNA 1ULUA 4L4SA 2XAAA 3RU9A 1TT5A 4IJVA 4DIBA 3H65A 4DRYA 3LLVA 5IDXA 2C20A 2JJYA 4JQCA 1WMBA 2Q3EA 2HCTA 1YGYA 2NV6A 4BL5A 4DIFA 5IFLA 4YWJA 5KJ1A 4YJHB 3PYLA 4WJZA 2LDBA 1NAIA 3I23A 3ZZNA 1P74A 4CMEC 3M2TA 5T6BA 5JO9A 4TKMA 5MGBA 4FOSA 1TB4A 4TSKA 4JX8A 4FW8A 4KUEA 1XGKA 2Y99A 4HFMA 1QV7A 2Y0EA 3HDJA 1GAEO 1L7DA 1XDWA 4RF4A 2OO5A 4WOJA 4MVJM 4CM7A 5IDYA 4IINA 1SCUA 2YV3A 3LT2A 1N1EA 3OM9A 2PD3A 4ND5A 3AWDA 4QUKA 2JCYA 3VZSA 3RROA 2EJWA 1HYGA 3HDYA 4JJGA 1GD1O 3PP8A 5B1YA 2GD1O 3ETGA 2VYVA 3L9XA 2Y93A 5AOVA 5TNXA 3TFOA 4BKPA 3TOZA 3C24A 5JBIA 2DUWA 4D3DA 4BNUA 3GAFA 1PS9A 1G1AA 3HDHA 3NTQA 4URFA 3PEFA 5IDWA 4OSPA 4TZKA 3WNVA 1PJ3A 4GL4A 2O7QA 3JQ6A 2Q46A 3QE3A 2GERA 3VZRA 3NDJA 4Q3CA 1I3KA 4N7RA 5G0WA 4DGSA 4M55A 2YQ4A 5HWSA 4FN4A 1UAYA 2X0IA 3NEPX 4XJTA 3UW3A 1LDMA 1W6UA 5TS3A 4BNWA 5TRTA 1XQ6A 2VQ3A 4OSOA 1ENZA 4NK5A 1E1LA 1HSOA 4EJ0A 3KRTA 4KP7A 1Q7GA 3ZU2A 1WNTA 1A5ZA 4KOAA 4R1NA 3H5RA 4BGEA 5L51A 4RQTA 4E2YA 4DXHA 2YHUA 3RIHA 2VHZA 1C0PA 1PJ4A 4Z0TA 2QIOA 3C1AA 4OYRA 2CMDA 1J49A 1H6DA 3QWIA 5BSGA 5I8WA 1E1MA 1TXGA 3GDOA 4KQWA 1PJQA 4ZICA 3QVOA 2DVMA 4KQXA 1GPJA 2A35A 5L3ZA 4DMLA 4D3FA 1YB5A 3OJEA 3WSWA 4YXFA 5EESA 3ZN2A 1IPFA 1TT7A 7MDHA 2J3HA 4IDGA 5BNTA 2EXXA 4O59O 3NV9A 4QTZA 1ZEMA 3MJEA 2AQKA 1QG6A 4DBZA 1LSSA 4Z0HO 2VYND 3GFGA 4RDIA 4XIYA 4XQ9A 3MCVA 5ICMA 1PU2A 2EF1A 2P91A 3HB5X 3I5MA 4Q3BA 3RKRA 5F5LA 5ITVA 3QSGA 4WK6A 4HY3A 3O9ZA 1B3BA 4FFOA 2GN9A 1UUFA 4ITUA 4RVFA 2V6BA 5HTOA 2NTNA 5ILOA 1C0IA 4J4TA 1I32A 3WGTA 1GR0A 3PDJA 1KVUA 1LSJA 3OICA 3PHHA 4EYEA 4E33A 3NX4A 1V0JA 3BMOB 4PLFA 2ZTUA 1H2HA 2P5UA 4MKZA 2JHFA 2BLLA 1QORA 4YEDA 3EVTA 3Q11A 4YR9A 1GTMA 2IDZA 1JKFA 4S1VA 4CM9A 1WMAA 3Q1LA 3ITDA 4D7AA 1I2CA 3DZBA 5TT1A 2AMFA 4WCFA 4YJFA 2PD4A 4C4OA 4CQLA 2UVDA 3IJPA 3IAHA 3CMCO 2WM3A 5GZ3A 2AEFA 4WNCA 3K31A 3F4BA 6ADHA 3F3SA 2FPGA 1AUPA 3M1AA 1DEHA 3U4IA 4GBJA 1ZSNA 3U0BA 2ZB3A 1O9BA 4Y6RA 1KVQA 3QP9A 1U3TA 4II3A 4YT2A 5DULA 1LBEA 3PWSA 4J4BA 2EW2A 1U4SA 3BMQB 4PLYA 1BWSA 3HZZA 1NBOA 1YBMA 2RBEA 2WYVA 4E5MA 1KS9A 1VSUA 4W99A 3GMSA 5CPFA 2FSSA 2LDXA 4Z0PA 2OOSA 3SBOA 3W8DA 4OO3A 1YVEI 3DZKA 4PCVA 3IJRA 3P2OA 1BMDA 1R4MB 3UFXA 4L9RA 2X22A 3KTDA 4B7XA 3JYNA 5KIAA 3STHA 3AY6A 2R00C 4ZJUA 3DZFA 3WJ7A 1ZEJA 1QP8A 1OFGA 5IXSA 1LXCA 3MOIA 3VDRA 4FCCA 3WGGA 4N5LA 1Z82A 3RJ9A 1RYDA 1V35A 2QYSA 1IL0A 1ZH8A 4DUPA 2CD9A 4GLLA 2DLDA 1PJCA 5F3RA 2QZ9A 1DRWA 1DO8A 2J5RA 4OKNA 2WTBA 3KXDA 5JE8A 4NBVA 4IY1A 1R15A 3MWEB 4FFMA 2AW5A 1C1XA 4JK3A 4MIYA 1RWBA 4BO6A 4BMVA 4MKXA 3WGHA 4FJ2A 4HKTA 2PZJA 3ANLA 4A03A 1H93A 1GYQA 3BZUA 4BNFA 1O89A 2X5OA 3PXXA 3UXYA 5L4NA 2GO1A 2IYOA 5HS6A 5G0VA 2YJZA 3R6DA 3LC2O 4A2CA 2YHIB 5JY6A 1ADCA 4GH5A 1TVEA 1ZJYA 5L9AA 3E8XA 4ZQEA 2B37A 3CIFA 2ET6A 3D1LA 4IUYA 4UVEA 3UICA 5JMPA 4IZIA 1GZ4A 3FTNA 4DYVA 5HRUA 1RM5A 3G17A 4NG5A 3N58A 4E5KA 3L0DA 5FI3A 3AUTA 4CV0A 1IZ0A 4BV8A 3WX0A 1GFSA 1HDRA 1M2WA 1ZK3A 1YBAA 2V6MA 2YV2A 3H5NA 3QVSA 5ADHA 4RPKA 1IZ9A 3P2YA 1VC2A 3OBBA 4ALLA 3EK2A 3H2SA 3MWDB 4KUGA 2HK7A 5A1TA 5I7EA 4M49A 4YTEA 3ZW8A 3HUDA 3Q3CA 5H83A 2ZATA 4MP6A 2QW8A 4ZD6A 5GZ6A 4TROA 3I6IA 2V6FA 3F4LA 3RC2A 1ZKMA 5C7IO 1PS0A 4LMPA 1PJ2A 5JDCA 3DR3A 5JXWA 3ZWMA 1ISHA 4QSMA 2J3JA 4CLDA 1E3EA 3E9MA 3EY4A 1PSDA 3KYDB 2VTDA 2E6UX 2GRAA 3ROPA 5I9LA 2P9GA 3JCZA 3G1UA 3UGKA 2JCVA 3S55A 3JQ9C 3DONA 3A4VA 1FDSA 3JD3A 4LRSB 4S3MA 4PG8A 3RC9A 3ZI0A 4BO3A 3BTVA 3GVPA 1XQ1A 5BSFA 1X7GA 4NJOA 1JU9A 1W73A 1UXIA 4GX5A 3OJFA 1ZJZA 3TFQA 2VZ9A 1PIWA 2BI8A 5TGDA 4HXYA 5IN4A 3W6UA 1HSZA 2Q2VA 1UP7A 4FPXA 2OBYA 4U0KA 1UDBA 4GSLA 3TZHA 3FNFA 2WYUA 3KUXA 4PG6A 1A72A 1E77A 3T4EA 4XRRA 5J23A 1T2AA 3DTYA 3E5RA 1WPQA 1NWHA 2HSDA 3HHPA 4XYEA 3WYBA 3LF1A 3B1FA 2NU9A 2PZKA 3U5TA 4I1IA 2DTXA 4FBGA 5KNLA 3JQ8B 4DLLA 2VT3A 2IEBA 3AY7A 2D4AA 2QYTA 4CMIB 2TMGA 5GZ1A 4RLHA 2YY7A 3H9UA 3ZV5A 1X7HA 4KMSA 1R4NB 5I7SA 1VJ1A 3AW9A 3H9EO 3MJSA 4J7UA 5A4DA 4PRKA 3R0IA 3VHRA 3PJFA 4MP3A 1MUUA 4CMEA 1BW9B 2HK9A 5KJFA 1K89A 2C0CA 1Z74A 4II2A 5L95A 2XXBA 4TZTA 4CM8A 4J49A 3NT2A 3IL2A 1I0ZA 1MX3A 1VJ0A 4CLEA 4EITA 1FDWA 3MJCA 4PLVA 2B4TO 4NBRA 3ZWVA 3CEAA 4LMRA 3U49A 4R16A 5T57A 2Y1CA 2ZTVA 4KTVE 4NHEA 5JDIC 2D59A 1HRDA 3WXBA 4CR8A 1BDMA 3R3SA 2D5AA 1CEQA 2R6JA 1CQJA 4IJKA 3GF4A 4XQEA 1ML3A 4YAKA 1BXGA 4ZGWA 2J8ZA 5F1PA 3ASVA 3C1OA 4IS3A 1PGNA 2DQ4A 3IUPA 1U5CA 2FRDA 1UP4A 4P22A 1Z7BA 3GEGA 2Y1OA 2I67A 1ZXLA 4AJKA 1SNYA 3H8VA 1P3DA 3PHIA 3VDQA 2ZQZA 3VZQA 4CMAA 2BKAA 2BD0A 1I3LA 3PHGA 4W7IA 2X7HA 5KJEA 1UZMA 3I9KA 4I9NA 1NQTA 4H3VA 3E82A 4NDNE 4AVYA 1NHGA 2BH9A 3D3EA 4BB5A 1YDWA 3KSUA 1UR5A 2NACA 1HDZA 2Z5LA 2I66A 5JS6A 2NU7A 4G81A 4JXKA 4RV9A 3PTZA 1X15A 3VPXA 1DJQA 5FFFA 3AM5A 5EINA 1HE4A 4PVDA 5ENVA 4Y6SA 4BQPA 4BIIA 1P0CA 1JA9A 1GZ3A 2FR1A 2Y0CA 3SLGA 1NX6A 3WFJA 4B7UA 3ENNA 3PDUA 4WLFA 2EP7A 5DP1A 3ZNQA 3DC2A 1MXFA 4F45A 2JD2A 1V3VA 2NVUB 4OXKA 1J5PA 4O63O 1UXJA 3BMNB 4J7CA 2EGGA 4R5HA 3WGQA 4EUHA 3P5SA 5COBA 4XR4A 3RC1A 4BO2A 5FI5A 5CHEA 4E4YA 2DPGA 2CNBA 3RBZA 1ZMOA 1EQ2A 3NJ4A 1NASA 1C3VA 2X5JO 1TT5B 4O1MA 2QZZA 1A4IA 4L76A 4P4GA 1RM0A 5L53A 3WGIA 1NQ5A 1A4UA 3ZWXA 1YONA 3F47A 1E3WA 4RVSA 4Z9XA 1XG5A 4YT8A 2H9IA 1PJSA 1HYHA 2BMAA 3I9NA 1IPEA 3JSAA 4YB8A 2VWPA 3KV3O 3GRKA 4J1SA 2AQ8A 2Q99A 3HN7A 1A27A 4UUMA 5TJ9A 5B4UA 4P38A 2X0NA 1HDCA 4WEQA 3FD8A 4K1LA 3GEMA 3FSRA 4R51A 5CAEA 4RVUA 1PGPA 3ORFA 5JPIA 4D3SA 1JAYA 1N7GA 3OA2A 3FPLA 5L7TA 2BGLA 4QO7A 4PLCA 3OP4A 3JQGA 1A9YA 2NQTA 5L40A 2HO5A 1NVTA 1QYCA 3WFIA 4QECA 1UZNA 5C7LO 4RZHA 1HDYA 1LDNA 1YL5A 3FNGA 4WPGA 1NPDA 3MEQA 3GQVA 3PHJA 2ZQYA 3W8EA 1NFQA 4L0QA 4RQUA 4DMMA 1X1TA 1RYEA 1Y6JA 3RD5A 3L4SO 1YB1A 3D4PA 4R4JA 1LX6A 3RUFA 2NUAA 4OJNA 1Q7CA 5G0UA 3RU7A 4DQUA 4NJMA 3WICA 4ZQFA 1QKIA 1YQXA 1ZSVA 2OFPA 2FZEA 1EK6A 2FOIA 1U28A 5A03A 1LEHA 4QQRA 3ZCXA 1B8PA 1GV0A 2DTEA 1A7AA 1HDGO 5LCXA 3X2EA 3PQFA 1NR7A 3A14A 1T2CA 1XCBA 4RF5A 3K2EA 2ZJ0A 1ADBA 4LGVA 5A3JA 2OUIA 1ISIA 1PL6A 3DMTC 3QVWA 1U9JA 2WD8A 2ZK7A 5CEEA 3GA0A 4FSHA 4MP8A 3TWOA 1LLDA 1V8BA 4GMFA 2VUSA 3PWKA 3RAJA 3ETDA 3HNPA 3GHYA 4AG3A 1A7KA 1R0SA 1NTOA 3RUHA 3QVXA 2Y68A 3OHSX 4I9HA 4N5NA 1ADGA 2O23A 4GX1A 4D46A 3COSA 5AXCA 5TT0A 3PGJA 3PI7A 4LSMA 3NTOA 4PZCA 2R00A 5DOVA 2NADA 4R1UA 2VYVD 4HFNA 1HT0A 1Z75A 2HAEA 3BA1A 2V65A 3MOGA 4HNGA 3OQ6A 1PJLA 2G76A 4J0FA 1W0CA 5JW6A 1VSVA 5JAQA 4RO0A 4DYDA 4GGOA 1LRKA 4FD3A 4MVJP 2G17A 4Q3AA 4KDFA 1M67A 1PL7A 2EP5A 1JDJA 3HG7A 4FFPA 1VL0A 4CQMD 1HZZA 5CDSA 3GZNB 5EJ2A 1ZFNA 4ALKA 4RVDA 1IHXA 1NPTO 2CUKA 2Y1DA 2VZ8A 4XYMA 4P8RA 1BXKA 4I5FA 2C82A 4CMJA 3RJ5A 3F9IA 4OXYA 4QEDA 3D3WA 1E6WA 4TWRA 3ROQA 1N9GA 2OGUA 2YW9A 3TRIA 1ARZA 2RCYA 2VUTA 1MG0A 5JCXA 2X23A 3OEWA 2P68A 4M86A 4GWKA 4RZIA 1MA0A 4R1TA 4EUFA 4JNKA 1ZNQO 3AM4A 4N5MA 3JD0A 1I3MA 3SLKA 1KY5A 4R54A 1E3LA 1EE2A 4H15A 4R9RA 3UF0A 2IXBA 1N7HA 2Q1SA 4A26A 4CQLB 2QRJA 3NKLA 4JN6B 3ROKA 3WOHA 1LJ8A 1MFPA 4KWHA 4LCJA 1P1RA 4EBFA 3VTZA 5TC4A 3DAGA 4GKBA 3KSDO 1YRLA 2JAHA 1I01A 4QXMA 3UHAA 1E5QA 2G0TA 1VPDA 1EEHA 4UULA 4E6PA 3MZ0A 3SC6A 4RPLA 2CY0A 1M75A 4LW8A 4MINA 4MJLA 4Q3EA 1QRRA 4F6LA 4J0EA 3KBOA 5T8KC 2JFGA 1CIVA 3N7UA 2EHDA 2YFHA 3ZU4A 5CG1A 1B14A 1PZHA 3K96A 1ZW1A 4K6CA 4R1SA 3JQ9A 1K6XA 5IXYA 2X4GA 2NWQA 2C5AA 3NTRA 2SCUA 3V5NA 5MDHA 3PFFA 1VL6A 4J9VA 4J1TA 2NU6A 3WGZA 4BNXA 5IG2A 1PQUA 2Q2QA 5KVSA 1VL8A 1JKJA 3OJLA 1DAPA 5DBIA 4FC6A 2JL1A 4CM9D 3GZ4A 3SJUA 4P4NA 2X5KO 3TQHA 2ZKLA 1T26A 2AE1A 4N54A 3TJRA 1IHYA 5KJ6A 1EZ4A 3D4OA 3WLFA 1UP6A 4FFRA 1SOVA 2PFGA 4JP3A 3DFZA 2GYYA 3ANMA 2PK3A 5K6AA 1KEUA 3V1TC 2DBQA 1T1RA 4RGBA 3O4RA 4E32A 5DBFA 3JYOA 3KEQA 3C7DB 3D7LA 1MV8A 3I9LA 3DMYA 4HV4A 4I8XA 1AHHA 1Q0HA 3Q2KA 8LDHA 3ICCA 4JJIA 3I4CA 2HU2A 1E3SA 3JQFC 4MVJI 3DWFA 4PLZA 5A9SB 4GKVA 4IDCA 3GN1A 3KZVA 3GGOA 4HADA 1BRMA 2XF8A 1Z45A 1BGVA 1GQ2A 3K6JA 4R3WA 3W1VA 3OFSA 1WP4A 2EEZA 1WAMA 1IB6A 1HE2A 3W4IA 4CQMA 3OQBA 2B35A 3QA9A 1T4BA 3PJGA 5BQFA 2GPTA 3PYMA 5CPBA 5JDIA 4IGEA 4UEOA 2FR8A 1M76A 4UUOA 5U1PA 1I5RA 3S2EA 3AUSA 2D3TA 2O48X 1YE3A 2PZLA 3Q6IA 4PG7A 4Q39A 4IDFA 5TX7A 4EEXA 2GUGA 3E48A 1DIBA 1U7TA 3IQDB 1WW8A 3B70A 2YV1A 4IGFA 2W4QA 4D44A 1T1SA 1ID1A 2RIRA 1JQBA 3AI2A 4BV9A 1JTVA 2H63A 1BHSA 3B1KA 2X9GA 3ZWWA 1NM5A 3VPSA 3LU1A 2QG4A 1EUCA 4U8GA 2PKRA 5LDGA 4R9SA 3V2UA 3P19A 5EPOA 3BTSA 1KC1A 3NAQA 1PS8A 5KVVA 3DOCA 2BRUA 2NSDA 3ENKA 3PQEA 4HFJA 4WLNA 4MO2A 5AQ1A 1GL3A 2HK8A 4OIMA 2CVZA 3SVTA 3VTFA 4XZ3A 3I9MA 1SPXA 2EWMA 4LSWA 5A06A 5JYDA 1PGOA 1UZLA 4GQAA 4F6CA 5HS4A 4TQGA 3ZNPA 2A92A 4DL9A 5EL0A 2GZ3A 1EFKA 3PIDA 3RUDA 4H7PA 1NVMB 2RHRA 4LN1A 3PHLA 2JCXA 4XQGA 1VKOA 3UKOA 3GPDG 3ABIA 3HFGA 3OA0A 5AXAA 3ZWBA 3FNHA 1NR1A 1GUFA 3ZDFA 3OETA 2Q2WA 4C7JA 5FEUA 2C29D 3LT0A 3P7MA 4IPTA 1G0OA 3HB4X 1EVYA 3AI1A 2JHGA 3OJOA 4IQ8A 4KDEA 5KOIA 6LDHA 1PGQA 4PRLA 1BVUA 1L7EA 2JKVA 1DAOA 1F8GA 3EAGA 2NTJA 2PGLA 4QX6A 3HE3A 3ZU3A 4AFNA 3L9WA 4R5MA 4M54A 4IMPA 5U4QA 3UN1A 1LLUA 4JP2A 9LDTA 4PLTA 1VJTA 3DXFA 3GUCA 1MFZA 1UXKA 3GK3A 1HXHA 4YJGB 3QV1A 4I5EA 2Y1FA 1A71A 2Q1TA 2D1YA 3HADA 2ZB7A 3GLQA 3NJ8A 2DBZA 2VWHA 4E21A 4NBWA 2NVBA 3ZNOA 2UV8A 3FTPA 4GLOA 5G0SA 5TJHA 5JCJA 1MC5A 3WB9A 2P2SA 1KETA 1ZK2A 3ZV6A 2C59A 4WLUA 3GR6A 1DLJA 4MKRA 1E7SA 2E4AA 1XHLA 2QHXA 3DZGA 3OMLA 4UUPA 4D42A 1X13A 4B8ZA 3K5PA 2OMEA 7ADHA 3S2FA 1LRJA 1PX0A 5TSDA 1UDCA 1D1TA 4IJUA 4MOWA 2NNLD 3DHNA 1R66A 3GT0A 3Q9UA 3R3JA 3QLJA 4OOFA 5A04A 3RCBA 4LRTB 1MP0A 3LT4A 1BTOA 1CERA 4CM6A 4RL6A 3A9WA 2OHXA 1LUAA 1P44A 4I5DA 3ZHBA 4BO7A 4YA6A 3DMTA 1DRUA 3DBLB 4Y6PA 1YKFA 1ISJA 2ZYDA 4W7HA 2O3JA 3KM0A 2YDYA 3AY3A 1N92A 3WQSB 4IIUA 1LQUA 4I5GA 5DF1A 3K8ZA 1IULA 4UVGA 4YPOA 4ZHSA 3LLSA 4YJHA 2GNAA 3DBHB 3S8MA 1PQPA 2VTEA 2Y05A 3PZRA 1O94A 1WLYA 4PN3A 1RM4A 1V3UA 4RF3A 2Q4EA 4YDRA 1EVJA 1OMOA 3TL2A 1YL7A 1NWCA 3CKYA 3IUSA 1HLPA 1OAAA 3GFBA 5JMWA 1U8XX 4E2ZA 1PZGA 4BS9A 1KVSA 1KEVA 2WD7B 4YAIA 2B5WA 3EHEA 1LQTA 1ZXBA 4QT0A 3GDFA 3GVIA 4MVJD 2PWZA 3H9QA 3KEOA 3UCEA 1PR9A 4KWIA 1IUKA 4BKQA 5L45A 5F1OA 1K0UA 3D5TA 3M6IA 5H82A 4IMRA 2GLXA 2PKQO 3AUUA 3SJ7A 3RFXA 2VWGA 3DAFA 1TEHA 1C14A 1NPYA 3ZU5A 2FWMX 4TMFA 3T4XA 3ZHYA 4BNVA 4AJ1A 4D79A 1EUDA 3UUWA 1WDKA 3WQQA 1PWXA 4AJLA 3KLPX 2AQIA 2W2KA 3JQGB 4RCVA 4CM5A 1HDOA 3RFTA 5THKA 1Y9EA 1MC4A 4EEZA 4YYZA 4EJ6A 1DB3A 1ZBQA 4AJ2A 2EW8A 1R12A 2PA3A 3ETEA 1SEVA 4P4LA 2PY6A 5A9TA 3G1TA 3ROMA 2AXQA 2PH3A 2HRZA 3JQ7B 3O8QB 3V2GA 1X7DA 3BHJA 1E5LA 4WOKA 4B8WA 4IXTA 1HE5A 3PLRA 3GGGA 3ZWCA 1R0LA 1LC3A 1H0KA 4NFHA 1Y8QA 5JAIA 4AJOA 4E12A 2UUOA 1VE9A 3CTMA 5ENDA 4B3JA 1HE3A 3T7EA 3ADOA 1B0AA 1M66A 3N74A 1D4FA 1Y5MA 2CSUA 2HMSA 4UEJA 4K9DA 5COQA 1PGJA 1H9AA 5JO0A 4NBUA 4GI2A 1G0NA 3K92A 5F5NA 3G3EA 3D5QA 4XR9A 4DREA 4GPD1 1Y1PA 2ZB4A 3RQSA 2CVOA 5LC1A 5L4LA 2HRBA 1NNUA 4W9NA 4ZVVA 5T8KA 2VRBA 1UJMA 5IN5A 2ZJ1A 1DC6A 2FZWA 1ZUD1 2VWQA 4PLGA 1KOLA 4E30A 5K6AC 5IZ4A 2AA3A 1EFLA 1EDZA 1KY4A 1P1JA 4YT5A 1JVBA 4ZQBA 2AG5A 3WMWA 2VRCA 5TQVA 4FGWA 2HMVA 1QR6A 3GG9A 2V6GA 4IDDA 3BAZA 2X6TA 3BXXA 4CMHA 4OL9A 1LI4A 2Y66A 3GHHA 3ZNNA 2EIHA 1H94A 3G49A 3NGXA 4JROA 4ZA2A 1B2LA 5IF3A 1VLLA 4GAEA 4ALJA 2D2IA 2GCGA 4FFLA 3Q9NA 3VPFA 4TRMA 2DBRA 4ZQHA 1LTHR 2EV9A 4TRJA 4RF2A 4BGVA 3BMCA 3ZGYA 1HEUA 1GEGA 1E7YA 4FQ8A 2WMDA 1LNQA 4NU5A 4JJFA 5DT9A 4IJWA 4FR5A 3WMXA 1U7HA 4E5PA 2Q50A 3AFMA 2Y0DA 2DUUA 2Q49A 1WDLA 4CV1A 3CMMA 4BNTA 2H5LA 2PZMA 3CH6A 3WIEA 4MDHA 2IZ1A 5I7FA 4PZEA 3DOJA 1R37A 4AJEA 1QMGA 4K6FA 4GMGA 1J0XO 1HYEA 1QSGA 3WR5A 2G5CA 2Y1GA 5TIIA 1F8FA 4U0JA 2ZYGA 1PWZA 3WS7A 3OF2A 3ONDA 2E37A 3BIOA 3DBRA 1CRWG 3VVCA 1C0LA 4MVJA 2WYWA 4Y98A 3DTTA 3E18A 3JQFA 1HL3A 1UDAA 4A10A 3V2HA 4A5OA 4QFDA 3UCFA 1P1IA 1ONNA 3VH3A 3LZ6A 1E7MA 3PQDA 1ONPA 1DJNA 4CLOB 1KBZA 4NI5A 4CR7A 4CPDA 3WBBA 2HMUA 3W4KA 3BMQA 1X0VA 3H2ZA 2P4QA 4BNIA 3S2GA 1EBUA 5KJCA 3IKTA 4NBTA 1F17A 4XRGA 1DSSG 1DPGA 2EJVA 2X9NA 4MVJG 3TZ6A 2GSDA 3I9OA 2AQHA 4ND3A 5AYVA 1CETA 1RJWA 3DZIA 2PH5A 5GMOA 2I9PA 4E31A 4BO9A 4FFNA 3ULKA 3RASA 2OP0A 3A1NA 4ALIA 4IQGA 2FSVA 4J16A 2DFVA 1ZIDA 3OJ0A 4FOOA 1EVZA 3GH3A 2J3KA 3OIFA 5HA5A 1N2SA 3GPIA 1XSEA 2POQX 1NFRA 3LF2A 2CF5A 4JLWA 5C37A 2AE2A 5JYEA 1I10A 1EVIA 4CM1A 3AOEC 4D0SA 4I9UA 1DIRA 3FF4A 4BKOA 2BFPA 1B15A 2Z1MA 3EDMA 1J4AA 2RH8A 5FF9A 3RKUA 1F0YA 3OIGA 3Q0EA 3VPGA 2VHWA 2B5VA 3PYXA 4AJPA 3OEYA 1PJTA 1HTBA 1E1NA 4EZBA 2AG8A 1B8UA 4EGFA 1XELA 1L1FA 2VOJA 2ZIZA 3QHAA 4BB6A 3QY9A 3U62A 4JIGA 3WTBA 4XIJA 4HWKA 2HUNA 3EW7A 1DLIA 5AXDA 1P1HA 2ILTA 1K2WA 3F6YA 3L4BC 1PZEA 1D3AA 3ZHXA 2FPPA 1IY8A 3CXRA 1T24A 1KVTA 1BVRA 1XLTA 1YJQA 4GVLA 1DFGA 2Q4BA 2OZPA 3FRJA 3ITKA 4G2NA 4CM4A 8ADHA 4FB5A 1WDMA 4UVDA 3VKVA 1LLQA 1EDOA 4LVCA 3JD1A 3VZPA 1SMKA 3NGLA 3GVHA 2I5PO 3UVEA
chains in the Genus database with same CATH superfamily
2WU0A 5A5GA 5LN1A 4F2DA 4C5AA 2J3EA 5IKMA 1CWUA 2WSSA 3T9DA 3BB3A 4NPAA 4QTYA 3WLAA 5LQDA 4KMRA 4OHPA 4XYGA 1EJBA 2P4HX 5CJJA 4XVQA 1VDMA 2UUPA 4EA6A 2NPIA 4NENB 4D9CA 5FKJA 5DHUA 1RTKA 4EO4A 1N3LA 1TFUA 1KR5A 2X15A 2IYFA 5DCWA 4OLHA 1D4ZA 3F2VA 1FDTA 3R44A 2RBKA 4C2UA 2Z04A 1WCYA 2VNSA 4FJ1A 1Y4DE 2PLRA 1PJ8A 4J90A 1FJXA 5ENZA 3KYDA 3CE9A 1OH7A 1PVOA 1G64A 2YWJA 4RKWA 4ZYYA 1OE0A 1KO1A 2QKYA 2ZI6A 5CBPA 1KZYC 4MR9B 2AB0A 3FYHA 5EIOA 5CFOA 4B6QA 3JAMA 3CT6A 1Y9AA 3E5MA 4M7OA 4ARCA 3VAAA 2IDKA 4P5DA 4NESA 3CM0A 1X8JA 3ND6A 1P9LA 4U7HA 4C2AA 5JJKA 4TMXA 1EWQA 3D54D 1G63A 2XBMA 2XBLA 3TRFA 1RXWA 3TSYA 2PA0A 3MWGA 3Q0IA 3OX3A 3DC7A 3AM1A 1F4VA 5BR4A 5IHPA 2W11A 3THWB 3H5AA 4BJ1A 2RHGB 1PWHA 2IPOA 2XMGA 1LBQA 1KYWA 5AI9A 3B6MA 5KOJB 5KX5F 4LFAB 4DWVA 3A2KA 1EHCA 1T9BA 1FMCA 4GOND 5TQ0A 1MAHA 4M0LA 1L7AA 4B9EA 4BMCA 2UVQA 3LY9A 3VC7A 4BTEA 4NYIR 4LS3A 3VVBA 4AZ0B 2Q1UA 4IDPA 1MMFB 4ZAVA 3UUFA 2WJIA 3U60B 1IHOA 2WYIA 1S7CA 3KTFA 4RDHA 2O3UA 2WWHA 4X90A 4PYOA 3ADCA 2QMYA 3TMKA 1KKLA 3IA7A 2ZI4A 4JP5A 5FTNA 3IEMA 1DJPA 1N34B 1U31A 3GUZA 4TXNA 4B87A 3LWBA 1SQ6A 3WBFA 4DQVA 4ND6A 1WW3A 2WINI 3D4LA 3DZJA 2QVBA 3JYLA 3MMZA 1XLVA 4IF4A 1E5XA 1OBHA 4GPTA 1O8BA 4AL4A 3TTWA 1F7UA 1I7PA 4W6QA 3P32A 4OFWA 2Q9UA 3KQWA 5DGCA 1KFJB 5IAOA 2CFTA 1AMOA 4DSOA 1QQBA 5C80A 1NBWB 1GQQA 1WKVA 3E5HA 4G09A 4I50B 5K3FA 3RV3A 2WV7A 3DEIA 2JFHA 3WYCA 1C41A 1IXZA 4QVIA 2PHZA 1K6JA 3I42A 1EXMA 2EERA 2IE0A 5KTSA 1HH4A 1U7XA 1W44A 4FUTA 4H7KA 1JB9A 4J7XA 4JSRA 1SXHA 4LY6A 3WYNA 1AUOA 2J30A 1R3DA 2UUAB 2QJWA 1P2BA 2HDHA 2R6R1 2DQZA 5KKAA 3HM2A 3A1VA 3O95A 4CIAA 1V6CA 4PO8A 3D0OA 3G7SA 4WZAB 4NZNA 1J2JA 3W5JA 3MOSA 5ICSA 6Q21A 1UIMA 5CB4B 3M49A 5B2FA 4U1RA 3F7OA 2BMJA 3KETA 2V7BA 3C8MA 5EHIA 3IJ5A 1YFJA 1O2DA 1JAZA 1NSYA 3ZWQA 1FMTA 1V11B 3WIUA 4BMSA 3JV7A 3VTAA 3IESA 4E1VA 4U00A 2WM9B 2BTQB 3CWZA 1QXSA 3LLMA 4LTNA 4UQPA 5DYIA 2FEOA 4K9SA 2ANBA 4Z1MD 2HQOA 1DIGA 4A0QA 1W85B 3TPCA 1NRJB 4KE8A 5EJFA 1VIDA 1CQIA 2X8JA 5AH0A 3L06A 4ZO4A 3VPAA 4AP6A 3B1WA 4XUDA 4B83A 3WWYA 5IRCD 3ADDA 3B1JA 1T5OA 4Q4JA 1Z34A 3C70A 4EBBA 2WKSA 3BGSA 3A1SA 3LQFA 1V2HE 4R69A 3FSEA 1E1DA 2JCGA 2QE6A 3VPHA 3IOEA 3PR3A 4N5DA 3PUVA 5FYQA 1VJGA 5JVDB 3WP1B 2GF2A 5EXDA 3H8WA 3R5SA 4OQYA 4RK6A 1Y7PA 1PNOA 3UPUA 1C8BA 1XXLA 5FUBA 3NV7A 1EUZA 2ORWA 5IBQA 3VC3A 4MYHA 1Z4JA 2QK4A 1R8JA 3FWPA 2I3GA 4B3MB 4N7BA 1YXMA 1HLGA 3C3WA 3DAPA 1SB9A 4Y2TA 1OIVA 4G0PA 5J2UB 2FSHA 3DGFC 3BRQA 1ZOOA 3UB2A 1YMUA 2XZTA 1T5HX 4CCWA 1ZQ1A 5AJYA 2M6LA 5FTMA 2RC5A 2UAGA 3PFBA 3Q7PA 1J1IA 3AVTA 2GD0A 3ZUPA 4UMDA 3KYIB 1KEEB 1NRWA 3W5SA 2ZAOA 3CYFA 3HXLA 4PSUA 5K0NA 5EE9A 1GKLA 4K3UA 4JGBA 5FTKA 1T9GS 5LBUA 3WQHA 1CY2A 2BUAA 2G7MC 1LW6E 3KVNA 3PGLA 4LNAA 4YJKA 2PN1A 1Z37A 3V34A 4BEBA 4M9RA 3VYVA 1NYRA 5K0ZA 3SYNA 3ETHA 3AU9A 4M7RA 3RS2A 4XYBA 4LYEA 3DWGA 3LK7A 4S1OA 2QW1A 1WZIA 4B40A 1JFTA 3A37A 3TZCA 2FETA 5BR7A 3FNBA 1L7QA 3IC5A 4NCIA 3PNPA 3D7RA 3NYRA 1PRYA 4PIVA 2WU4A 3D59A 2JJ1A 1ECCA 3FSGA 3HXQA 1Q44A 2D8AA 5EJAA 5HZHA 4NSNA 4XD2A 2AR9A 4JYCA 2F1KA 3NRCA 1ZNYA 1HEYA 2C9BA 2GF0A 2EG9A 3QTLA 5EJ8A 1PN3A 1S9HA 1LNZA 1X7XB 1KIAA 4O1IA 1XZPA 4TTTS 1M6VA 2WWFA 3DAYA 2A78A 2IYEA 3IKMB 5JSYA 3KHTA 1DIHA 2XA2A 4HWTA 2R44A 1JFRA 3VU3A 5JNLA 1B3RA 2G8NA 2JH3A 5B37A 1EUDB 5H7XA 4KPUA 2XRYA 2FDRA 3E7XA 3BHIA 1VPEA 2BE7A 2W2KB 3CEHA 2YTZA 3KVVA 4MYRA 3SZUA 3D64A 2XTJA 4GS5A 4MRMB 1DPFA 1FDVA 1RAFA 3CCCA 2QSZA 3QU4A 4I55B 3UOGA 4CLRA 1YB7A 1G7CA 1BE6A 1XA0A 5GM1A 4AROA 5K8TA 3KQKA 3T06B 4ZAYA 3H8JA 4X97A 4UHDA 4AX4A 4DCJA 5AM4A 1J0AA 4BFVA 3ENVA 1ORRA 3UG6A 4PZAA 4D9NA 1AKQA 4A73A 1YBVA 2H2DA 2X8LA 1RHMA 2J9YB 1FLVA 4LZOA 1ULSA 5FTJA 2PRYA 5FQNA 3A25A 4UKDA 4ESOA 3ZXUB 2A8YA 3Q8KA 1P5HA 2XVYA 4YAGA 3L41A 3R9IA 3DVLA 2D5LA 3HJBA 2O1SA 3EPRA 3QTTA 4PCAA 4BO8A 1PYDA 4CKBB 4UHHA 1VBNA 2AC2A 1IIRA 1DX9A 3FYUB 1QH9A 1GPH1 2FA9A 2C99A 4FOPA 3SHWA 1FP4B 5IX8A 4LRXA 1JPJA 4WKNA 2I2AA 3X1ZA 4BXOB 5DZSA 1W88B 4IEEA 4NNJA 3KPYA 2D7DA 4ENTA 1PV4A 4A9AA 3HKDB 1ZHHA 2FZ5A 1N5LA 2X0JA 5LUBA 5FWYB 4EMSA 3K30A 2A3NA 1X42A 1VIVA 3A26A 3GLVA 4ZVQA 3VDMA 1XN1A 3FGZA 3S1SA 3TL3A 1DELA 4ND4A 1J9GA 2C0QA 3GMDA 4PPYA 2LVBA 4GDMA 1ZY2A 2CNNA 3I8SA 3LA6A 3DL2A 2CBZA 1HZJA 3AIOA 2UYOA 3QIVA 2XTZA 4R3NA 1DFIA 5TY0A 2K5UA 3TE6A 3T3OA 1X77A 1X7ZB 4DT1A 1ILEA 3NDPA 3O38A 4INJA 5T4EA 5T3UA 4ZYTA 4D4GA 1H2BA 3MINB 1BDBA 5ALKA 3UB3A 2LW7A 1XU9A 3GZNA 1TC2A 4OOEA 3FVVA 3CNBA 2CYCA 3WO1A 4BC0A 5AI0A 1YT5A 4MV6A 4YX9A 2ZM6B 1Y6QA 4G4SP 3NDRA 3OCUA 3T7KA 2XTMA 1PR6A 1Y8RA 4ZCLA 2EBUA 1CUCA 2W6OA 3GP5A 4N3AA 5EAIA 3PJEA 3INRA 4J0GA 4UVHA 3LY5A 1XQXA 3SDSA 4WBNB 3T3HA 4YCSA 3K2IA 3TSOA 1NY5A 1K7EB 1Q2UA 2WIJA 1XZGA 3ND9A 1TKCA 1MGOA 3UWSA 4KCGA 1A9TA 3N8NA 5J63A 3EULA 4XWGA 5IH3A 3S4YA 3BCSA 3VYTB 3WRVA 3R7WB 4OM8A 4M7WA 1HFJA 2BFEB 2JANA 2WKWA 2NZVG 2PSJA 3GN2A 4L5IA 4F9FA 2GKSA 3GGDA 1USUA 2CVQA 1BXGB 1S5PA 3MJ4A 1C9YA 3CUVA 1RI4A 1OV4A 1XVUA 1Y3FE 2GCIA 2WWVD 1LF0A 2AMLA 2WFMA 1WV1A 5BSHA 3HJAA 3NBQA 1Z7WA 1ZMXA 3BRWA 3DBRB 4BYMA 4OA8A 1SELA 2I6XA 4I9GA 5HG0A 2NMVA 5IW8A 3C3EA 2OGWA 2XJ4A 2VOEA 4NABA 3AB8A 1MG5A 3H3JA 3KYCA 3IIEA 4GGPA 4RETA 4YGXB 2FPSA 2YBEA 4WY5A 2VKQA 2VRNA 3JPWA 4L5YA 4A36A 1T91A 3GRPA 2NQ2C 3IKVA 4QIHA 4JJKA 2NUPB 3A58B 3SM9A 4CDGA 1MCZA 3B3GA 3UAXA 2ADFA 4JGIA 4L6AA 4B7AA 2GEUA 3CWCA 4QOEA 1Z6ZA 5KNDH 4RACA 1FFGA 1OTXA 2BFMA 2HJRA 2F9MA 4FXOA 1UMDA 2NU7B 4OHCA 2ZRHA 3HSSA 1ZAKA 4UVIA 4N3CA 3NTVA 1AZWA 3GW8A 1U8YA 3PB3A 4NAHA 4KSCA 3D4NA 3OUUA 2WOOA 2CXOA 2IP1A 2IZOA 5FTLA 1R8SA 4QM6A 8MHTA 3AYZB 1FMJA 1IB0A 1XPOA 4X91A 1RLMA 4HAOA 3I2YX 2O2YA 4ND1A 4AJNA 2J09A 1NXTA 1VB3A 3G6WA 5HJ5A 2J5QA 1ZU5A 1CP2A 1HDEA 1NX9A 2CVPA 2XUOA 3IBGA 5CX1B 4B3RB 1B16A 2FW9A 3R23A 4XI9A 4JT4A 3QKSA 4H7PA 1SGWA 1KZ4A 1VHLA 3EGVA 3OZSA 2Q6TA 1RE0A 1CZUA 2AHRA 2WWRA 3F5DA 4GXTA 4Q3KA 5H68A 1JDNA 2NTYC 1P60A 4Y2SA 4YYEA 1GRRA 1W4BA 4MRNA 1FB5A 2FQQA 3W2EA 4CCYA 1KFKB 4K9RA 4DMUB 5JFOA 4U7PB 5IANA 3KOOA 2J5XA 1V9CA 1AXEA 3I6BA 3NC1C 3ZQKA 3THXA 1DADA 4DV0B 2JLSA 4I55F 1E94E 1UAAA 3AUFA 5YASA 4YNBA 5REQA 1AGRA 1WXIA 3OQHA 4QHTA 2CVHA 3GLGA 3IE1A 2H3HA 4H3KB 3TTVA 1K66A 3ZPXA 4EMTA 2ZJYA 2CE2X 2L18A 4Z7OB 1G291 2C83A 3ELYA 3EG9B 4O5AA 3V7NA 5B6JA 2NO9A 1Z3IX 1URPA 3DE3X 4J2HA 2XUPA 1X14A 5CAEB 5GJWC 3DS8A 3EUAA 2V5AA 2G70A 2A1TR 3P96A 3DDCA 1ZWKA 3JZMA 1D6SA 5AJXA 3ILHA 5KTNA 3DV0A 3U7QB 1Y7IA 1RHQA 4XJXA 2E55A 1UJBA 1FFHA 3HSKA 4ZWNA 3V4VB 5KTKA 3ER9A 2WA2A 3CPEA 1VDZA 3PI6A 2NN3C 4FYXA 4Q24A 1NJ6A 2E21A 3T4UA 4H0CA 1ACJA 2F62A 1K2VN 2VYNA 3KJXA 2OSVA 3A3KA 5TMEA 1GA4A 1P4JA 1BU8A 1XQVA 3G13A 1P81A 4MIOA 3ZCTA 4BCBA 1NXWA 3CLUD 3PG5A 4F60A 4JI4B 3ILYA 4U9HS 4Q0MA 5AW1A 2YVQA 3EQ9A 4NECA 4F72A 2ZYAA 3MJTA 2XQKA 4GKAA 4HMPA 4Q00A 4RD6A 2FSFA 1THTA 1E2JA 1SUEA 3I39X 1KQOA 1XZHA 2X1LA 4BO1A 1W4LA 3JXEA 1Q91A 4BUJA 4K26A 2WKRA 1JL3A 2GA8A 4NJMB 1NXPA 4KQMA 2DEUA 3EA5A 4FYJA 3CVOA 5CFRA 1NI4A 2D5CA 2WAAA 2YNMA 3EZ2A 3JASB 1M72A 1YH3A 3Q3IA 4OJKA 1UPAA 1ZOSA 3C6MA 2DECA 1A7JA 1R6DA 3D6TB 3LP8A 3UO8B 4DVJA 1RXSA 3TNLA 2VCHA 2EL9A 4K9LA 1VJ5A 1TGYA 2ZZKA 2IEGA 2IEYA 3KXLA 4GYJA 4WECA 1FJ2A 3KB2A 3QPCA 3DFKA 5H80A 4DLVA 1Q0LA 3Q87B 4DRXB 1E1QD 3UXMA 3N1UA 2R3SA 1YZNA 2D1TA 4PIPA 3NHJA 4R2IA 1ACMA 4RHYA 4E7PA 1XI2A 3JVIA 5CLIA 3R8FA 3VM6A 4MV8A 1R6XA 1XJ0A 4OQZA 4I4TF 3PF9A 3PENA 4WBNF 3GJYA 4NMMA 2V97A 4LK2A 3V1NA 1YA4A 5JWRA 1XPUA 4L22A 2PRJA 3QG1A 1BN6A 4YMIA 5C8ZA 4JYZA 2QI9C 1UBEA 2O8NA 2VJNA 3GEBA 4HXEB 2Y1EA 4BU0A 2GZSA 2PD6A 3T1VA 1Z2OX 4BQQA 1VL2A 2C31A 1G20E 4UE3S 4PYJA 2GM5A 5JALA 2NZJA 2NYRA 3NM4A 2FEAA 3O9VA 4PYIA 3TIXB 3ZGZA 4AF7A 2OYRA 3RUAA 3CRNA 4B5KA 4TKZA 2NO7A 2PVSA 3HCRA 1DKQA 2X86A 1UWVA 3AEQA 3MGKA 3PWZA 1TLTA 1LPBB 2ZRMA 2CBXA 5CVDA 1SU6A 2HQBA 5AESA 4CIVA 1NI3A 4RTLA 1F8UA 1HFEL 3I3OA 4MVJF 4OAQA 2HHJA 1I2DA 3OT1B 1MDBA 3LX6A 1A7UA 1OOEA 3HWRA 3PXDA 4W1PA 2NU8B 4XWKA 4FHEA 1D1PA 3A6KA 4ZYVA 5K9ZA 5I47A 3NWBA 2AC7A 2R8RA 4QXAA 3AFGA 1ABEA 2DKNA 4G5OA 4PPNA 4DARA 4D9BA 1X92A 3NUZA 4LVUA 1KJ8A 4MAFA 4OAOA 4QUEA 2QUAA 5LA6A 3SJCA 2XDQA 3BPSA 1VKNA 4R68A 3ZWNA 2E89A 4B3XA 5LXTF 2B6NA 1Z29A 2FY8A 2JIZD 3A7EA 3L6DA 4PVCA 4TT8A 4J75A 3AEXA 5LWHA 5E4TA 4DS3A 1ONSA 3VR2A 5KSOA 4EFKA 5C1BA 4Z3KA 4QELA 1ONOA 3JAKB 3HVJA 2FZLA 4ABTA 3NYWA 4LJ7A 3RVMA 1JN0A 4UFPA 1Z73A 2CJYA 2PVPA 2V7PA 4FZ5A 1AHIA 2J0EA 4BMZA 2W22A 2AZTA 1KY3A 1QVZA 3K0CA 3ZV6A 1ZGCA 3QHQA 3FN4A 4KFRA 1UBJS 1OXXK 1JE0A 3NHBA 3P2EA 4XM2A 5HYVA 2IS4A 3AUJB 1QC5B 3H4VA 2CNDA 3AEKA 1NVEA 4DY4A 2C4WA 1QGUA 4L4YA 2ZTLA 3GAZA 4O4JB 2Q4RA 4YUXA 1SB8A 2GR9A 1EXWA 2WW8A 4AN0A 4DR7B 1R6AA 3HYTA 3UNXA 3V8MA 1MABA 3DULA 3LIIA 3PT9A 1JH8A 1VYHA 2VBFA 3H1TA 3WHIA 5IM4A 1GA6A 2TECE 2HA3A 3AI3A 1G2IA 3O31A 2OHIA 4LYJA 1F14A 4QBKA 4RJKA 5D5QA 4E1AA 1B43A 2G80A 5J40A 5AW2A 5FEMA 2P78A 3A10A 4ZT3A 4BATA 1TM2A 2H4JA 3STWA 4CV2A 5D3ZA 3IP9A 4F5YA 5IVHA 2NYUA 4WJLA 1B4DA 1XO1A 4X1IB 4L4XA 2GBLC 4QUGA 1R4MA 1GDDA 1P2SA 2H1OA 4IIJF 2KPOA 1T8SA 3ZW9A 1NVXQ 3HVKA 1FY2A 1QZ3A 4MQMA 1BEEA 3EVEA 1FA9A 3HCFA 2F00A 2ZSAA 1LB1B 3TW0A 3J81k 1CJUC 3N28A 1V39A 4JI3B 1WB4A 3AKCA 3IMKA 4FYWA 4RDXA 4YJ3A 2YZ2A 4UEKA 1RS0A 2JAWA 2XNDA 1FW8A 1SZJG 2GX6A 2HF2A 2J5KA 2VHXA 3F1KA 1GQYA 3KLMX 3VH2A 4BAUA 4JOSA 1PSWA 2I4IA 2O8BB 1CDDA 3WKEA 2GZ1A 4Q4LA 3RFUA 2XCSB 4N48A 2KM1A 1HA3A 1T3LA 4P98A 1QG4A 2E4VA 2XEXA 4JQYA 4R2XA 5DCUA 4LTMA 3KSAC 2ZT5A 1QOPB 3WYAA 2VZEA 4AD8A 1PBTA 2IHUA 4G1EB 1GPDG 1N6NA 1SHUX 2EJCA 4JNCA 4ZRNA 5EERA 2ZRAA 2W2XA 4ZMSA 3TAUA 1PFYA 3S5UA 2F7SA 3WRWA 4D57A 2B2XA 3TEMA 1UKAA 2YWFA 3B9QA 5A0FA 3AJ8A 5B53A 4C6SA 4QG3A 5IS2A 2WG2A 1J8DA 2OCKA 2JFBA 2P6PA 3COZA 4MQ5A 4XGRA 4EENA 1WMEA 4XB2A 4DV4B 1ENYA 1EFHA 4CN9A 1OI2A 1Z6AA 5HQTA 3ZWAA 4J0KA 4XM0A 3ECSA 3AZOA 5SYAA 4KUHA 1Y5RA 3MJRA 1JGTA 4UM8B 2DWOA 5ADVA 5CCDA 4R2MA 2HREA 3IVRA 4JEHA 1V7QA 3CC8A 4GMKA 3V4SA 4QQFA 3WAKA 4O5OA 3L0IB 1EA7A 3HABA 4QBTA 2GKGA 3OO0A 3TZKA 4KXMA 1XYGA 3A31A 4WCFC 1JSLA 2FPIA 1Z07A 3F4KA 4L08A 1NURA 1TUEA 4J91A 1GA1A 3FYTA 5JUWA 1RXEA 2BWJA 2MTBA 4RTKA 1Z26A 4JQSA 1AM4D 4R9NA 3SPXA 2Y1WA 3BD6A 3D6HA 3NNNA 1R4AA 2RE8A 2VNHA 1DZ3A 1GARA 1DHRA 1MLDA 3T3GA 2WEKA 1IWBB 2Z3ZA 1RWQA 4ZT6A 3X2FA 4F3RA 5FBVB 1XF1A 5A3SA 2O0JA 1IK6A 1Y3DE 1U3VA 3DKPA 3FBTA 4JDUA 5DSTA 5EUBA 5IYZA 1SA0B 4LHXA 1CUUA 3ZJTA 1XR3A 4YRDA 4MCJA 1NUHA 1PK7A 2HMTA 1DKUA 4MULA 3KQYA 5IZCC 3GJ6A 3JQ7A 1QGOA 3NATA 4QWWA 3NOQA 5B64A 4RZ2A 1FVHA 2QZPA 2P3OA 2VNAA 1SR8A 1YRWA 1PQ4A 2P6NA 3QPVA 1EFDN 2VDKB 1SKUA 5ALPA 4ENUA 3KJGA 3FWZA 4WZZA 3G8DA 3E4CA 3HKBA 3CRQA 3HY6A 4KFCA 4GP6A 3DO6A 4JUIA 3WTCA 2ZB8A 1O6FA 4FHFA 4HDRA 2UYQA 5FBQB 2DFKB 4AY2A 1RRGA 3VVLA 1FQWA 2VAPA 2AN3A 4BNYA 4JVNA 4HWPA 4NR0A 1L4MA 3PUYA 2HR1A 2FZ4A 3LKVA 2A9PA 3CR8A 1I94B 1IIBA 2QLLA 4RPJA 1OPRA 3VYWA 5D87A 4GU5A 1UT8A 3DWIA 3FNEA 1AV7A 2NZYA 2O8VA 3VR4H 3UPTA 1EUCB 1NBMA 2ARKA 2XMCA 3S2IA 2CZCA 4DUYB 5ALMA 1DKNA 3GJ4A 1EHYA 3MFYA 2R4TA 3T3DA 2FFBA 1KYVA 5JBQA 2YL2A 4Y0NA 2XTNA 1XFAA 2R6FA 1ZUNA 4R1PA 3ZY2A 3QWBA 2IHYA 1N5DA 1FFBA 3LPLA 4L73A 3NVDA 4UM9D 3B5JA 4E2WA 4Z53A 3DNFA 5ILGA 3ZCRA 3KCNA 1T2FA 3EEOA 2QUJA 4WDRA 2YC2C 1RQPA 4UUNA 1L5VA 1ZD9A 3CVYA 1NJ8A 4FEYA 1PG0A 3H5TA 3PGA1 5TVGA 1H9BA 1J8VA 2UYYA 4PU0A 2FCAA 2JPDA 5I8PA 2F3UA 1W5FA 4JWKA 4MTLA 5B3JA 1UQRA 4DUGA 4WFKA 1QP7A 1UKYA 1KKUA 2RGDA 4IOKA 3PHCA 3KKOA 5IT0A 2XB2A 1AGNA 1AO3A 3QQPA 3WE7A 3TXYA 3CZMA 2W48A 1C2YA 1ULTA 1JI3A 1E9SA 1CG6A 1NSFA 3BREA 3E9CA 1XWFA 1BSVA 5FNVA 3VDNB 1BXRA 1OLXB 4RVGA 3UJNA 2H2AA 2IEZA 2OVBA 5C35A 1WPXA 4MW9A 1AK9A 4KXYA 4KWEA 4FX2A 2IK8A 2X0EA 3RC8A 1XXHE 2DH5A 1NOJA 2JHPA 2Q9AA 4A6XA 3ASZA 4RZUA 3IQHX 3WG9A 1H1DA 1U2DA 2K2QB 4DCVA 3IULA 3PEVA 4MWZA 1UL1X 4K88A 4E5DA 4M21A 1KMHB 4GD3Q 1KRHA 3D8TA 4KSBA 3GXBA 4X3CA 3NHKA 1OVMA 4X7MA 2P5TB 3RFVA 5FL7D 3AHDA 3H7AA 4I1YA 4XDYA 3TZBA 3FPHA 2B30A 1JUDA 4E5UA 1I3NA 3FCOA 4Y9TA 4C08A 1N7JA 1JHAA 1DU4A 3R0QA 1P1FA 2IXGA 3STYA 4EGCB 1TQ8A 2QUHA 4HQFA 1H85A 2C0PA 5JSKA 4ZODA 3GT3A 4IIYA 4U2KA 3OUZA 1NTRA 5K0SA 1Y1RA 3O1HB 3BN3A 3RYFB 3K35A 5ALTA 1SUCA 5DTQA 1E0AA 2FVYA 1PVVA 3CT4A 5K05A 1A9XB 1VB5A 5JTTA 1Z0IA 4RTMA 4HQKA 3TQOA 2PGXA 4S1TA 1I6LA 1YE5A 3THYB 4RNDB 1T2EA 2PCJA 3D02A 3QMVA 1EG7A 2OZLA 1QCZA 3NWEA 2F1RA 5AVQA 1FZTA 3JYQA 1VHJA 1EE9A 1WLSA 2NVWA 2WJAA 4YO8A 4BB0A 5G4LA 4AI6A 4Q7LA 1EK5A 3T41A 1NQOA 1ABFA 5HIKA 4TZ6A 1O0CA 3VR3D 4M2LA 1V1RB 3RT7A 2PJZA 4XWYA 1X8XA 1X1DA 4K6HA 3T3PB 2ZCVA 3NT4A 1IQRA 2FW1A 1YDGA 3A2NA 3ONEA 3PDHA 2X40A 3KL2A 4M1ZA 1AQ6A 1FU8A 1CFZA 1QF9A 1FJHA 2AOUA 1BFKA 4H1UA 3E15A 4FZ3A 5BV8A 3U4MA 4RH1A 4LXHA 4E5VA 2FR0A 4H7HA 3RSOA 4NS4A 3ANNA 4KYTA 2GM4A 4PX5A 1LH0A 2XAAA 3QGMA 1TT5A 4DRYA 3RADC 2Q4DA 5GJCA 4D9HA 2C20A 2OCGA 2JIRA 1I4LD 4R9UC 3G89A 1YIOA 1AQLA 2H17A 1WMBA 4JQCA 5AM1A 3GGJA 4BL5A 3A6FA 1WF6A 5KJ1A 4YWJA 2BMFA 2QAGB 3PYLA 3M9WA 1Q20A 2LDBA 1NAIA 3M3PA 1VI6A 4OFBA 3ZZNA 1SUBA 4LWOA 1SIOA 3HWSA 3K1AA 3PC6A 4FSDA 3OFVA 4M6WB 4N0QA 2Y1KA 5CB6A 3C6BA 4P31A 1W0KA 3HTXA 2HA5A 1X74A 1OZFA 4RY8A 4TSKA 4KUEA 1HNZB 4HFMA 2ZYHA 3EC2A 1TAUA 2QRPA 1L7DA 1QTIA 2OO5A 3JWPA 4KE6A 4EHDA 5LU8A 1USGA 1XF9A 2AK3A 2WWTA 2Z5FA 4ON9A 4S2UA 4LYYA 3L2OB 5G3YA 4CTJA 4X64B 1DEOA 1WD5A 1TX4B 3WYDA 3ZQ6A 1KWGA 2YS6A 2BZSA 3TKAA 4P0QB 4B31A 4ZTBA 1K88A 2FE4A 4UJ3A 4IINA 1SCUA 4E03A 1R6UA 3LT2A 3DTVD 1N1EA 3OM9A 5DLPA 3SDBA 2ACWA 1X8LA 5A62A 3AWDA 1O03A 3PICA 3HDYA 2BC9A 4INZA 4JJGA 3PP8A 2P2LA 1WCIB 5DW0A 5JD3A 3WV4A 3DW1X 1IBMB 4JT9A 1BKYA 3L1JA 2WJJA 3HRHA 4BKPA 2JLRA 3UJPA 1CLEA 721PA 1L0BA 2FSGA 2D54A 5EFOA 5F7JA 4EWLA 4NF2A 2EDCA 4WXPA 1SCAA 4OSPA 3IEIA 1KXZA 1PJ3A 3RSCA 4BFYA 1IRXA 1EWRA 3JQ6A 1E69A 3OTIA 4M8KA 3BSFA 1B6SA 3L79A 5LLDA 1C9KA 4I9FA 4Q3CA 3O1IC 1KEKA 2BKXA 1VA5A 3U3OA 5G41A 2AZXA 1KZ6A 1B23P 1JNXX 2C00A 3GRVA 3FMIA 3K09A 3NEPX 1LDMA 4RWEA 5FV4A 5BMVF 1M1NA 3CJRA 1NJSA 5EQJB 1UPBA 3EZGA 1R9JA 1XQ6A 1GPWB 2VQ3A 3QYPA 3A9SA 4WOCA 2HHHB 1J2EA 2H2GA 2OAQ1 1AU9A 3KRTA 4TV9A 1D03A 3VSAA 1Q7GA 2OQRA 5BSRA 4AKTA 3FA2A 5L51A 4BGEA 3H5RA 4MVXA 4RQTA 5I5GA 1BDIA 2BKVA 2PSEA 4KOEC 3UV6A 4DXHA 2YHUA 2PRIA 1T0JB 4H7IA 4BLUA 1LK7A 2H07A 3ZVMA 1NJ1A 2R4QA 1S0UA 4YUVA 3RS0A 2XGSA 3RYIB 4MQBA 4HS4A 1U5BB 4X7PA 3TQFA 2MSCB 2PO5A 3OI7A 4TWAA 1AUQA 1QX3A 1E1MA 3K1ZA 4CDMA 3GDOA 4KQWA 5JWOA 4RSRA 2XKJE 3ESXA 5IULC 4C4YA 4F3CA 4EZEA 4LI3X 5K3BA 2O2IA 3QVOA 2DVMA 1DKLA 1VLVA 3NKFA 2JIBA 5L3ZA 4D3FA 1EFRD 1YB5A 2BFDA 1V8DA 2L0XA 5B1SA 4G5XA 4Y2XA 7MDHA 3N87A 4IVPA 3K6SA 2PZGA 2Z43A 4O59O 1T1GA 2CLCX 2I1QA 3FYDA 4AYTA 2VDLB 3BSSA 1UMCB 2IU3A 3MJEA 3CRMA 4BWVA 1V41E 1YAJA 3MG9A 4FKBA 1QG6A 2XYRA 2WY2D 3ROEA 4YMVA 4PSCA 4OATA 1G38A 4KR3A 1Q15A 2YIDA 3GFGA 3TRJA 4XQ9A 3NJRA 3MCVA 4C89A 1KAEA 1XZBA 4WXYB 2DHQA 1U7DA 3IAM6 2YRXA 3I5MA 3TPZA 3QSGA 3LGXA 3AF6A 4GUAA 2V7WA 4C6TA 4ITUA 4RVFA 5ALLA 1CQPA 1ZA2A 2V6BA 4PWZA 4Q7MB 2NTNA 3OWXA 3OT4A 3A3YA 3UHPA 1I32A 1XNJA 3OZGA 4CBVA 5I4BA 4RK7A 5LIPA 1GR0A 1G4HA 1VHWA 3OICA 4P7JA 4EYKA 2EJBA 1DGQA 3NX4A 1V0JA 3BMOB 4DLUA 4MV5A 1H2HA 4LXTA 5EIBC 2DSTA 4ZYZA 2R66A 3SEZA 4OHYA 1S7GA 3IIIA 4YR9A 3TJZA 2GTPA 2H5IA 2CMGA 3FETA 1ZM2A 1X2EA 3RIGA 1FTGA 3ITDA 4D7AA 1E2LA 2QN3A 4GO1A 4JBWA 3HA3A 3B9PA 4KN6A 1MIOB 3TIGA 2UZ1B 2AEFA 3VNBA 2NV0A 2BFBB 3K31A 4TWIA 5EMJA 6ADHA 3I8OA 4GLJA 3D6VA 2FPGA 3ZXSA 3M6MD 3EVGA 3TNJA 3TIFA 1M2FA 5DMHA 3M1AA 1F6WA 3VGPA 1BOFA 1X7YB 1BD4A 5JECA 1VJDA 2XB8A 3ZDYB 4CL0A 3RW9A 2BEVB 4PCLA 4Y6RA 3RLIA 3A1TA 1WRBA 3NOXA 3GQBA 4II3A 3RSLA 3CUSA 4I2NA 2MYTA 3TR6A 5DULA 2FWPA 2JA1A 3O7MA 1XNRB 3G2JA 2EW2A 1U4SA 2J3DA 3OZIA 5DYYA 4CU2A 4BLVA 4PLYA 3HZZA 1P17A 1NBOA 1TM3E 1YBMA 1A50B 2G77B 2RBEA 3TAXA 4EP1A 4Z4CA 1YR7A 1M8PA 5CU7A 1XRJA 1QBKC 3U7FB 2JATA 1QYRA 1NF8A 1ODJA 3UK2A 3HKEB 3T0IA 1RMTA 1VPLA 1TNDA 2OOSA 1QO0D 1YRAA 1WY7A 3W8DA 3OPYB 4KVAA 1YVEI 2R5FA 3CW8X 4V39A 4B3TB 1SIWA 1GJRA 4C7OB 2R8XA 3PUIA 3SNHA 2O2EA 3U4QA 3IAS6 3KTDA 2UZIR 2XRMA 2H5JA 3ZX4A 3AY6A 3HKCA 4ZQCB 3QKWA 5EJIA 3REFA 5DNYB 4C7BA 2FF5A 3IVXA 2BHSA 3MB5A 1LXCA 4LNUA 3OESA 1BQ3A 1L4HA 4OQNA 4YHBA 1XJQA 3MOIA 1M2HA 4PQRA 3DEFA 2GPBA 1QH8B 3L6UA 5AI5A 3U1TA 3AJAA 3A3OA 3AI7A 1KS2A 3MRTA 3QNMA 4RTJA 2PUDA 2QPOA 2Q1XA 4DJFC 3LVBA 3GRCA 4QYSA 2P6MA 2DLDA 1PJCA 4QYMA 1DRWA 3E1SA 5GWXA 1W4AA 1TVCA 1KJNA 1O9HA 2ENWA 2XCLA 4NBVA 1CD5A 2AW5A 1C1XA 4JK3A 4QG7A 2Z8XA 1UFOA 1J06A 3T38A 3DD5A 5DX1A 1L5SA 3PXXA 3O0DA 1DI0A 1DCKA 3TXAA 4EHNA 1GGNA 1JDZA 2XRZA 2YJZA 3R6DA 4HX2A 2Q5IA 4Z8XA 1SC1A 5FWXA 2V55B 2IZ6A 1LWNA 2ZPUA 4N03A 4DF3A 4N6NA 5JS2A 2F1JA 3EXHC 4Y2UA 3RVNA 3U3RA 5JY6A 4JVLA 2VDWB 4DA7A 3U6BA 3T1TA 3E8XA 3FKSD 3NBMA 4ZQEA 4OGLA 5AVKA 3QKTA 3UTDA 2DHRA 4Z0NA 4RADA 3WRXC 3GZTB 2I6GA 2D2FA 3FTNA 2YR0A 5L3RA 4NBKA 3S28A 4W8OA 3E1GA 4MR7B 1F3LA 4NG5A 5GONB 3L0DA 3KQUA 2NYVA 1JSZA 1XZFA 2AFIE 3LXMA 1V8ZA 1M2WA 5KNBD 2ZTHA 4JJAA 4L78A 5ADHA 1B2RA 4GOLD 2IH5A 1U0BB 1YFZA 4UZEA 3AKZA 2YIMA 3OBBA 4K9MA 3EK2A 4G8JA 3PNBA 1S2GA 4C3UA 3IGFA 2Q5QA 1KJYA 5FUMA 1RQGA 3HUDA 3JAWA 4LF4B 2HFKA 2QW8A 2ONZA 3WLKX 3LOQA 4TROA 3I6IA 3CF0A 1HEIA 1SKBA 2XUIA 1SULA 4GI5A 1VOTA 1JHXA 1TYBE 4AIIA 3U56A 3GCGA 1EP1B 5JDCA 3MWLA 3DR3A 3L8FA 5HJ2A 3W2TA 2J3JA 3IO5A 3KKMA 1M5UA 2B1JA 3KYDB 3FSJX 1ETUA 2VTDA 4HS9A 3TTYA 2GRAA 2QN9A 4FWIB 5CBPB 3WGJA 3AR2A 1VG0B 3A8TA 1MX1A 4UU1A 3LUDA 2QTBA 1Z6GA 3JQ9C 3DONA 3A4VA 3LCVB 5LQSA 2OYCA 1VECA 4IIFA 1RQNA 3RC9A 4PG8A 1N6PA 3DPIA 3GVPA 6CHYA 1XQ1A 4O1HA 1C4OA 4D97A 1NI5A 1TMKA 1YI8A 3BD8A 3MD0A 4QTUB 3T9BA 5BW8A 1W73A 3H5VA 3V1MA 4GX5A 1AA9A 4PYMA 2WSLA 1II9A 2IYUA 3TFQA 2VZ9A 3LBHA 1NMSA 1HSZA 2JF0A 2PWYA 3RTGA 1ODFA 4W1SA 4DQLA 1Z15A 2DERA 2H9AA 1UDBA 5TQ0B 4GSLA 4ZHQA 4Y9RA 2ZPAA 2X14A 3KUXA 1E77A 1NOKA 1Z33A 2H4FA 2HU5A 2YV5A 4PG6A 4QL3A 3DTYA 5HZGA 1WPQA 1PLJA 2N1MA 4IV8A 3WRYC 2RGEA 3HHPA 2R86A 3LF1A 4FLFA 1NW6A 4G3XA 3TRKA 5KNLA 4I1IA 2DTXA 4UARA 1PJRA 4DLLA 1PG2A 2UXBB 1SCQA 3SFTA 4RLHA 1EZ1A 2QROA 3GYBA 3R7SA 3PVCA 5FNZA 4ZVLA 1VFPA 2Q8NA 2FWBA 5BSWA 1OFHA 4AMZA 2HRDA 1VJ1A 3MJSA 3OEHA 2VAWA 1T8WA 5EIBD 4PRKA 5A4DA 1H0RA 3WIOA 3R0IA 3PCXA 4MP3A 1CUHA 2HC9A 2C0CA 3OFNA 1U0NA 5HNKA 2P67A 2XXBA 1FE8A 2A9JA 3PC8A 3BB4A 4CM8A 1OAOA 5K3FB 3M7IA 3NT2A 4QASA 1I0ZA 1VJ0A 4F56A 4EITA 3NMUF 2MR5A 1GTRA 3I2GA 4MS1B 3MJCA 3QEKA 1UBTS 2CL5A 2A57A 3ANSA 3PDCA 3Q9SA 4QHSA 3ZWVA 2XXAA 2H00A 3Q7RA 4FMBB 4ZVSA 5T57A 4UUAA 2Y1CA 2G3YA 2ATCA 3ZY4A 3NHAA 3W3AD 1U63A 3NC0C 5J4HA 5F23A 4FI3F 3ZHTA 5DM60 3JR3A 3LW8A 2D5AA 1Q11A 3OZFA 1TJ4A 4YAKA 2J8ZA 2AN1A 2XVAA 1KKMA 1NG1A 3HCNA 2A86A 2VXBA 4FK8A 4P86A 3LRTA 3ASVA 5HEKA 4IS3A 2GWHA 1BA3A 2WIDA 4PBRA 3S81A 2FLKA 3W5UA 2JZNA 1RFLA 1U2SA 2FRDA 1UP4A 1Z7BA 1KR2A 2Y1OA 2D2EA 2ES4A 2I67A 2VF2A 4KIWA 2V54A 1S8FA 3FPEA 1ZXLA 3LCCA 3R3ZA 4RTNA 4B82A 1XRSB 2WZQA 4X45A 3K9CA 3QV2A 4R3UC 1QNLA 1TFRA 1IUOA 3IQFA 2BKAA 2BD0A 5DTMA 5FAXA 1R6TA 3TE7A 3PHGA 5KVAA 2R6HA 4W7IA 1QE0A 2F6RA 1UZMA 3I9KA 1SVNA 5D84A 4G2TA 1JIXA 2H1WA 3E82A 1MAAA 1GCAA 2QWXA 3FI0A 1G2QA 4IAOA 4MWOA 4NDNE 4UNRA 1UR5A 3VZCA 1ACLA 4Q4JB 5KYKA 2YWCA 3IDFA 1U9IC 4G81A 4JB2A 3IAEA 3AH8A 3PTZA 1CY4A 5FFFA 2C4NA 2EVWX 4DIEA 1GT91 3DDUA 1CUJA 5EFZA 1J1ZA 3A0RB 4EI9A 1P0CA 4B7UA 3WFJA 5ALIA 1ZXXA 3ENNA 2VJPA 3PDUA 1RJ9A 3ZNQA 2XLCA 3E22A 4DDKA 5IEJA 5IAGA 3DEJA 3D1JA 5HZKA 4RA9A 1J5PA 1NT2A 3BMNB 2HA6A 1IFXA 5BO5A 3DGEC 3QE2A 3KSRA<