1SBYA

Alcohol dehydrogenase from drosophila lebanonensis complexed with nad+ and 2,2,2-trifluoroethanol at 1.1 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.1-A crystal structure of D. lebanonensis ADH complexed with NAD+ and 2,2,2-trifluoroethanol
rcsb
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase
total genus 93
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sbyA00
2UUPA 3TFOA 4F46A 4J7XA 4DMLA 3NT5A 3PIIA 2YQ5A 5TGDA 3UH1A 2NUAA 4EEXA 1H6BA 3RU7A 2YY7A 1LSJA 2EP7A 3JYNA 4XYGA 5DZSA 4WCDA 1ID1A 3KYDB 4HY3A 3EW7A 3P7MA 4Q3AA 2SCUA 1G6KA 4DQVA 4E31A 5CEEA 4EI2A 4XQ9A 1W4ZA 3DFUA 3EDMA 3LLSA 3SJUA 2X9VA 4R51A 5IZCA 3H3FA 2DBQA 2FZWA 2D0IA 2X1HA 3AUTA 2IXBA 3ZNQA 4MO2A 4Q9NA 1ZIDA 5A9TA 4UREA 3T4XA 3FD8A 1ZXLA 3HNPA 5FI3A 1BTOA 3NUGA 1QV6A 4Z9XA 4S1VA 3PP8A 1T4BA 3DAFA 1B3BA 2B37A 4BNXA 3A06A 4BNHA 3BHMA 1EDZA 3DO5A 2DC1A 2VHZA 3M6IA 1KY4A 4Z0PA 1F12A 3PXXA 3PEFA 3VH4A 3U4HA 1LRLA 1P1IA 4R16A 1BG6A 4HNGA 3JV7A 1U4OA 3DTTA 1Y8QA 3MJVA 1OFGA 1O94A 4JQCA 3HG7A 3S2GA 2ET6A 3QWBA 3SVTA 5CAEA 3RJ5A 1M66A 4J49A 3GUCA 4E12A 4BO7A 3G1TA 4D44A 2O2SA 4IDDA 1N2SA 1P0CA 2Q1UA 3IIEA 3IDSA 1H2HA 3RUFA 1SMKA 4YAKA 3GPDG 5KVCA 1T2EA 1LDYA 1NYTA 2NACA 5MDHA 5CP8A 1HYGA 1C14A 2J5RA 4LCJA 2C20A 2FP4A 1P45A 5A9SA 1VJ0A 2GO1A 3D1LA 1DC5A 3PZBA 3BAZA 1VKOA 2R6JA 2E82A 3JQFC 4BO1A 3DZHA 1AUPA 1VE9A 2Q50A 1C1XA 1AE1A 5K6AA 1QLHA 3AUSA 2RAFA 1UXHA 3F3SA 3GVXA 1Y8RA 1U5CA 3WQRA 4A27A 1U3WA 3V1UA 1C0LA 2DM6A 4NBUA 3HSKA 4KTVE 1J5PA 2PKRA 4UVGA 2CSUA 4BO9A 3NJ4A 3RC2A 2OBYA 2QZ9A 1UDBA 5AXAA 3KTDA 4MDHA 1CQJA 1GUYA 1V3UA 4WNIA 2OO5A 4HNHA 2A94A 3IP3A 3DBLA 4B7UA 2R2GA 3RKRA 1MG5A 4L4SA 2CF5A 1UAYA 2ZTUA 3U5TA 4WGGA 3JQ8A 1K89A 2C2XA 3U3XA 3OFSA 1SCUA 4IDGA 4G5HA 2AHRA 4E2WA 4CLRA 2E48A 4ZQBA 5CEJA 4R1NA 5JCJD 4WLNA 3EVTA 3WGGA 1PGQA 1YH3A 4YDRA 1HDYA 4Q3EA 1P9LA 1KEWA 3KZVA 4QXMA 4CMBA 5IF3A 2YQ4A 3C3XA 3KB6A 2VUTA 3TPCA 2Z5LA 4P38A 1V8BA 3GGPA 1DIAA 2DPHA 3ORFA 2O3RA 4R54A 2VNSA 5EIOA 1BXKA 3ENNA 1LXCA 1BWSA 3MWDB 4BQPA 4PZCA 4CQMB 3CUKA 4YPOA 5T67A 1R12A 1YL6A 1BMDA 1ISIA 3NTOA 1SB9A 3RUAA 3WR5A 1R0SA 3DZBA 3JYQA 4Q3CA 4KMSA 1B3RA 4KUGA 1JAYA 4ZJUA 1YB5A 1A7KA 1DHRA 1PZGA 3WNVA 3FR8A 1JTVA 3SC6A 3H5RA 1VL8A 3ZU4A 2ZKLA 4MVJD 2IXAA 5JC8A 4IPTA 1JA9A 3QP9A 4UEOA 4IBOA 3BTVA 5C7LO 3JCZA 3OQ6A 3WSVA 1GQ2A 1DOHA 2EGHA 5BNTA 3CE6A 3BMQA 4DPKA 1M6WA 4ZD6A 3HN2A 2PLAA 3FHLA 1UUFA 3D3EA 4CLRB 1JVBA 5BSEA 1U8XX 4GWKA 4FCCA 1ZEJA 2QG4A 3ONEA 1U1IA 1X1TA 4JROA 9LDTA 5F1PA 4RQTA 1CETA 2LDBA 3I1JA 2ZQYA 5TS3A 4E21A 2OZPA 4ZICA 1WAMA 3WYEA 4BO3A 1O0SA 3DMTA 3QVOA 4CMCA 5I7FA 2GZ3A 3RROA 4BNTA 1DFHA 4RDHA 1ZJYA 4D0RA 1NQAO 2VUUA 4A5OA 1CYDA 1E0DA 1MC5A 4QO7A 4E32A 4R1UA 1UH5A 3N58A 5EERA 3TWOA 2Q2WA 3WB9A 2CF6A 4GAEA 4DVJA 1PQUA 3WDSA 3KRTA 3NAQA 5JYDA 5L7WA 1HYEA 3IOYA 5T6BA 1ONPA 5DF1A 4KUEA 2GGSA 5CG2A 3IS3A 3WIDA 5L4LA 2WTBA 9LDBA 2PKQP 4YACA 3M2PA 5L7TA 4RGBA 3WSWA 1LDMA 4E5PA 3LT0A 4J0FA 1JAXA 5ADHA 1RJWA 5TNXA 2NM0A 4EZBA 4IMRA 3PDJA 4L8VA 2JAHA 3UCXA 1ISMA 5I7VA 3BMCB 4MJLA 4LRSB 1LC0A 2PZKA 1C0IA 4IQ0A 5LDGA 3EGOA 1EK5A 1U2GA 1UAGA 3BXXA 1I01A 4WUVA 2Y1DA 2JFGA 5KIAA 2X5KO 2ZJ0A 3HDQA 1V35A 5I8ZA 1PR3A 2RHRA 4KUHA 3OQBA 4RVUA 4B79A 2I76A 4XR4A 3Q11A 3GUYA 2YV3A 2QQ5A 3GNSA 2FWMX 1LC3A 2C82A 2Q1SA 2OXIA 2HUNA 1G0NA 4BNIA 3AFMA 5F21A 1YKFA 2Y1FA 1HE5A 4O63O 3ZHYA 3CIFA 4RVFA 1E6UA 2RH8A 4U8GA 4TRNA 4GX2A 4U0JA 2NNLD 3TSCA 2D2IA 4D3FA 3FNEA 3Q6IA 4CMAA 5TRTA 1OC4A 2P9GA 1ZSYA 4WCFB 4CL8A 4PLYA 3UN1A 5BQFA 1FMCA 2F1KA 5AVOA 1E6WA 4QEDA 1QV7A 4FFLA 2Y67A 1OC2A 1UZNA 1YQGA 1L1FA 5B1YA 1KETA 3DONA 4H7PA 3K92A 3ON5A 4NU6A 3HFGA 4BGVA 5GZ3A 4CV3A 4W7IA 3DOCA 3LF2A 3IP1A 3QHAA 2CUKA 4IQGA 4JJIA 3O9ZA 1X15A 3JD2A 2DBRA 1K6JA 4HADA 4GLLA 1C3VA 1LSOA 1TLTA 3Q3CA 3VPFA 1LLUA 3H5NA 1XYGA 3KVOA 4AJOA 3WFJA 4DBZA 3D64A 3GEMA 3F1LA 4NR0A 4ZRNA 3ZWNA 4PN3A 2ZTMA 2X6TA 4CM9D 5JDCA 1DO8A 5C7OO 1VKNA 3L4BA 1KC1A 4MVJP 1Y5MA 1UDAA 1T26A 4FC7A 2DVMA 2JD1A 1KBZA 3NDJA 3NJ8A 4YA6A 1E7YA 1OOEA 5U4QA 4RPJA 3PHHA 4Z9FA 5HBRA 4FR5A 4D46A 3JYPA 4NH4A 3V1YA 3VPHA 1YOVB 1TI7A 3GHYA 3JQCA 4GI2A 1E5QA 2VWGA 5JS6A 2B5VA 4K1LA 3IKVA 4AJ2A 4DC0A 1QP8A 4RPKA 1QYWA 2VWQA 2VT2A 4J0EA 4PFJA 1I2ZA 2D5CA 1D1SA 3DQPA 3RUCA 2PGLA 3QWIA 4Z9YA 1H2BA 4UVEA 2NTVA 1DJNA 3B20A 2G5CA 1UJMA 3WGOA 1XA0A 1N9GB 3GF4A 4HV4A 2WJPA 1EE2A 2QHXA 4YXFA 2BGLA 4IZHA 4I9HA 3O26A 4XYMA 3GG2A 4BO4A 1SBYA 4C4OA 1MV8A 2JHFA 1NAIA 3N74A 3O03A 1GYQA 1O8CA 3H6KA 4RVHA 4OAQA 1N7HA 3NYWA 4E5NA 1GR0A 2WWRA 4YT8A 4AJIA 5JAMA 3RAJA 2P9CA 3E5MA 4UUMA 3VPSA 4IJVA 3QVSA 4NFYA 4ZQGA 4DQXA 4Q3DA 3GMSA 1LU9A 3OJEA 3BMOA 3DAPA 3GC6A 2I9PA 4GMGA 3NDIA 4DQUA 3ASVA 2OOSA 1ZUD1 1YL5A 2EG9A 3GEGA 4QTZA 1ULUA 3WGYA 2OGUA 3KSZO 3FWZA 2AEMA 5TC4A 4RPGA 4EUEA 1DIBA 3RUEA 2IRWA 4ND3A 3ZV5A 4AICA 4WCFA 1W0CA 5JAIA 1HZZA 2BF7A 3B1KA 4IDBA 4OGWA 2XAAA 5JO9A 1WXDA 2TMGA 1EFKA 1N8KA 2YV1A 2C07A 3DZGA 3GH3A 4BNZA 4OJNA 4CL3A 4EW6A 3CH6A 5ER6A 1P44A 3PWKA 5ES3A 1TT7A 1LQTA 3MCVA 2PGDA 2UUOA 5KWEA 1HWYA 3MJ4A 2VHXA 3PLRA 3WGIA 4EEZA 4YJGB 3IQDB 1GL3A 1CF2O 2FY8A 2X0NA 2Z95A 2YHUA 4BNNA 1M2WA 1PTJA 1JKJA 5L95A 1J0XO 5JY1A 1YDEA 2HDHA 1RM5A 2HMWA 5BR7A 4BO6A 3K2BA 2ZB8A 1QRRA 3ETDA 3ADOA 4W82A 4CLDA 5JBIA 3EC7A 3LC7O 2W2KA 3OJLA 4XZ3A 4U7WA 2DUWA 4MVJM 2YFHA 3GY0A 4BIIA 4GBJA 4J9UE 4OO3A 4DPMA 5HRUA 1J49A 3GA0A 1NFQA 2Y93A 2CY0A 4XIJA 4YT2A 3ROQA 2DBVO 3QY9A 1E3WA 4CV1A 4MP6A 1QYXA 2HRZA 3GFGA 1P74A 1T25A 1NWHA 2B69A 2VRBA 4N18A 3HB4X 1MXHA 3AOGA 4MIEA 3LK7A 4PRKA 1NNUA 4BNGA 5IJZA 4DL9A 3DHYA 1GZ6A 3W6UA 1DBVO 1NWCA 3MJCA 1EFLA 3AM5A 3LT1A 3U4CA 3QA9A 2ZYGA 1CJCA 4CMGA 5ENVA 1GV1A 4PG7A 3E1KA 3PIDA 2Y68A 4NBVA 1QXSA 2V7PA 5DNAA 1WNTA 4JN6B 2J3JA 3PHGA 3PDUA 2DQ4A 2FR0A 4AJPA 2A4KA 4YAJA 3JQFA 1YE3A 3AU9A 3HWRA 1SEVA 4NDNE 1JLLA 4CMEA 3ENKA 3L9XA 1PS0A 3PVZA 1N9GA 4FFNA 5B37A 2E37A 4OQZA 3BMQB 1DRWA 4ALLA 3GGGA 2DTEA 3AM4A 3RUHA 2Y0CA 3ROMA 3JQEA 4YT5A 3ZV3A 4GQAA 1NVMB 3GZNA 5AYVA 2WYUA 4BV8A 1PX0A 1YRLA 2P4QA 1OMOA 2BI8A 3H2ZA 3RC7A 3S1LA 2GN8A 4D3SA 4PLFA 1WPQA 4RQUA 1EVJA 4FW8A 1DFGA 4BNJA 4IDEA 4JJFA 3A1NA 1H9AA 2AQ8A 3DBRB 1PQPA 1UXGA 2RH4A 3SC4A 4ZA2A 5COQA 2VYNA 3JQDA 4YRAA 4YJFB 1ENYA 1NHGA 1U5AA 3RVDA 1KS9A 5DBGA 1GPDG 2BD0A 2VQ3A 4HFJA 4EDFA 2NV6A 3V5NA 3FWNA 2Q45A 3PK0A 1Z75A 4UUPA 4YTEA 2AE1A 4QECA 1HTBA 4BQRA 4DIFA 4FSHA 2HRBA 4JLWA 4B4WA 4J4HA 1CERA 2GASA 1PZEA 4XR9A 5I7SA 4CMKA 1D8AA 4N5NA 3PHLA 1LDBA 1ZNQO 2NU7A 4B8WA 4J6FA 3WQSB 5L51A 4PZEA 3WWYA 2J5QA 4J1SA 5TLSA 3IC5A 2H5LA 3WFIA 2QRJA 1BXGB 3H3JA 1I24A 2PH5A 2H9IA 5KVSA 4M86A 3OEWA 4II3A 3RFXA 3E6AA 2FMUA 4NJMA 1E7WA 4IZIA 3ZWWA 1EVYA 4YJHA 3OIFA 2YJZA 5KVQA 2VYVA 2VHVA 3CXRA 3MWEB 4XYBA 2DFVA 1NBOA 4KP7A 2YDYA 1LSSA 3OEYA 3ASUA 3Q9UA 3TOXA 4XRRA 4CM4B 5IAAA 2I99A 2A9FA 2NQ8A 1HETA 2HKIA 4OKIA 3EK2A 3JQAB 4QX6A 4U0KA 2PD3A 3DBRA 1P1HA 1KOLA 2GDZA 4IDFA 1JWBB 4RF3A 1Y5RA 1U2DA 3G1UA 5KKCA 2QRLA 4GX5A 5KKAA 1YBVA 2GSDA 4URFA 5GZ1A 2Q1WA 2YDXA 3TQHA 3H65A 1HF3A 2FPIA 3KLPX 3IUSA 4ILKA 3KYCA 4N54A 5H83A 1QYVA 4EJMA 2GYYA 2Y0EA 3AY3A 3VZPA 3K9QO 3OF2A 4FDAA 4QUKA 1O6ZA 3ST7A 4CM8A 3H9GA 1YOVA 1J6UA 1T1RA 1O5IA 2F00A 3MZ0A 4OIMA 1BDMA 3ZWOA 2QYSA 2O4CA 2V6GA 1HE4A 3E03A 1SO8A 1ML3A 1YJQA 4H16A 2E49A 4HWKA 5L9AA 1H9BA 1DIHA 2IZ1A 2YZ7A 4NG5A 5EQDA 4YT4A 3N7UA 1MXFA 1CQIA 2GNAA 3L07A 3WBBA 2GZ2A 3UGKA 4F45A 2P9EA 3JQBA 5AXDA 2W2LA 1GYPA 4GGPA 4CLEA 2WSBA 1DXYA 4P4LA 1ARZA 4BVAA 2JCYA 4GVLA 2C7VA 3AI2A 4RVSA 1Z73A 3AY6A 4D0SA 2YUTA 4NFSA 3WQQA 1GADO 3DBVO 1I8TA 2NVWA 5ENDA 3BZUA 1ADBA 4W9NA 5DOVA 1C1DA 2WD7A 5A5EA 2A35A 1DLJA 1XDWA 3OIDA 4GSKA 5G2OA 3JTMA 3WJAA 3WTBA 2IE0A 2GD1O 5JAZA 1ADFA 1ZKMA 3RBZA 3ZCXA 4ND2A 4E6PA 1EEHA 4L74A 4I8XA 5L4SA 1KC3A 2PWZA 4YJFA 4DWVA 1E92A 1Q1NA 3ZWPA 4PGFA 3IJPA 1O9BA 4CMJA 3E9MA 3JQ7A 4HBGA 1F17A 1VI2A 3CZRA 3U09A 1R6DA 3NGLA 4M55A 5THKA 3L6OO 2E4AA 3ROPA 1PEDA 4ZQFA 2ZJ1A 5JC1A 4CM8B 2UDPA 1WMAA 5JMPA 3QIVA 3SBOA 3QV1A 2JKVA 5L7YA 3DB2A 4FS3A 4BV9A 2HMUA 1Y8RB 3V2HA 4R69A 4PG4A 4KWIA 3AK4A 1WVGA 3EYWA 3INRA 5TT1A 3D4NA 4Q3NA 3P5SA 1JKFA 3I9OA 1YS4A 1F8FA 1HEUA 3DWFA 2CMDA 1GU7A 2CVQA 2O3JA 2EW2A 1U7HA 3S2IA 4DUPA 4J1NA 1U8FO 4L4RA 2OORA 2JD2A 4IUYA 1S7CA 3ZI0A 1XIVA 3D5QA 1JDJA 1FDWA 4D42A 4IDAA 3AJRA 4MPDA 3GGOA 2ZYAA 5A04A 3R0IA 4KQWA 3DMYA 4OKNA 1UP7A 4CQLA 3KYBA 3ZDFA 5T8KC 2PR2A 5JAQA 3ZW9A 3KXDA 4PVDA 3U0BA 5IG2A 5IN5A 1B16A 2JFHA 2AMFA 1T24A 3PFWO 3P2YA 4TKLA 1QYCA 4E4YA 1E3WB 3QVTA 2BI7A 4E2YA 4F6CA 1HSOA 3F5QA 2G17A 5HM8A 1XG5A 2VWHA 2ZB4A 2X5OA 3R6DA 4IY1A 4NMHA 4YAIA 2VRCD 3PYXA 1V9LA 1WZIA 3ZWAA 4BB5A 5ICSA 4TWRA 3ZWVA 5B12A 1VJ1A 4QFDA 2IEBA 4NI5A 2FN7A 3GFBA 1ISHA 1Y6JA 2HJRA 2O3QA 2EF1A 2VRCA 1E1LA 3WBFA 1LDGA 2C5EA 3TL2A 3F1KA 5U9CA 3HADA 4IGFA 5HS4A 1N92A 3WMWA 2W90A 3F5SA 5CDYA 1DPGA 3NTQA 1X1EA 3ZZNA 4ALKA 4P22A 4OH1A 1LSUA 2BGMA 4GKBA 1ISGA 1ONOA 4AJHA 1Q0LA 3JQAA 3DXFA 3M1AA 3DFZA 1CWUA 4E33A 5KJ6A 1WDMA 5A05A 1P1FA 4LSWA 5EQFA 4NBWA 3JQBC 2BRUA 4PLWA 2DBZA 3DBHB 1GQYA 4PRLA 1NFRA 2FR8A 3ITDA 2WYWA 2I66A 1BRMA 2P5YA 3GQVA 4Y8VA 3RC9A 1V3TA 2EW8A 2YYYA 3WS7A 1C1DB 3WIEA 4YAEA 4ND1A 3I6IA 4AJ4A 5KNLA 2VN8A 5AXBA 2VZ8A 5IXSA 1Q0QA 3ZWBA 4H15A 5CDUA 1ZXBA 4R5HA 3KEOA 4BNWA 1P77A 4GL4A 2A92A 4BL5A 4Y6SA 3BA1A 2JFFA 3PGJA 5A9RA 1ZK0A 1B15A 2D1YA 3TZ6A 3GVHA 2FHSA 4LGVA 1YDWA 3HZZA 4AJEA 2ZTLA 4R68A 1LX6A 3UAGA 1P31A 4E5KA 5H81A 4J9VA 4ALMA 5CDGA 2AXQA 2HO5A 4WNCA 4AG3A 4J7CA 4LMRA 3JYLA 5LDHA 4JK3A 4GLOA 1RWBA 3CZMA 4PLHA 3AUUA 3NT2A 1U4SA 4IXWA 2B4RO 3I9JA 4CM5A 1H6AA 2W4QA 4UVIA 4XQCA 2C29D 1M6HA 1UP4A 4TZKA 1UXIA 3RIHA 4TMFA 1YWGO 1EDOA 3O38A 3E5RA 2Z1MA 3I5MA 2ZCVA 4BMVA 3IJRA 4OOFA 5AQ1A 4ALIA 3Q2KA 1RPNA 1PIWA 1F0YA 2CZCA 4A10A 4FJ1A 1QKIA 4DBVO 3MJEA 4B3HA 5EL0A 3GHHA 3C24A 1H94A 3KYCB 2YW9A 2X8LA 3VVBA 4K6FA 2BGKA 2EIHA 3FTPA 1GFSA 1VLLA 4FOSA 4LVUA 1EK6A 4I9UA 1AXGA 4JBIA 3TZQA 1NXQA 3RUIA 3OECA 1KEPA 5K0ZA 3JD3A 1Y81A 2PZMA 3INGA 2G76A 4XGNA 1PJ3A 1Z6ZA 5KJEA 4MVJG 4WE3A 1V3VA 2R00C 3ETEA 4K26A 1OZAA 3C1OA 4ND5A 2JD0A 2ZYDA 3B1FA 3W1VA 2POQX 2BFPA 2P5UA 3TN7A 1GTMA 3O8QA 4LCEA 3TL3A 1SAYA 3UICA 4YR9A 4UUOA 2W2KB 1ONNA 4TKMA 1IPFA 2GLXA 1HT0A 1T2FA 3DZFA 4J7UA 4EJ6A 2X0IA 4DREA 1XQ1A 5A02A 3RSHA 4OXKA 3HB5X 2AQHA 3QJ5A 3L4BC 1WLYA 3KYDA 4NJOA 2NVUA 3FPCA 2Q2VA 1EUCA 2CFCA 2IODA 3DHNA 3UCEA 3LVFO 2B4TO 2EWMA 3EHEA 3RFVA 5DCWA 5I7EA 5TF4A 4KQXA 4DC1A 4Y67A 1CEQA 3V2UA 3JQGB 1Q7CA 4RCVA 5EMHA 3RWBA 2FPPA 3ONDA 3SLGA 5L53A 4S3MA 2VYVD 3WGTA 4BNMA 1DRUA 3C85A 2FPGA 5F5LA 4CQMA 1MGOA 4D41A 3DEYX 3JD1A 3FI9A 3VAZA 1KVTA 1LLQA 3T7CA 2NSDA 4CLHA 3QVXA 1CDOA 4Z0TA 1LLDA 3DZKA 3VH2A 1F8GA 1PJBA 3AU8A 3CEAA 2X5JO 3JQ6A 4OSPA 4N5MA 4R9SA 3UF0A 1I5RA 2O48X 2ILTA 5JXWA 3CTMA 2AA3A 2UAGA 1PJ2A 3FSRA 4LSMA 3GAFA 4ALJA 3I83A 1N1EA 1EE9A 4HFMA 3ZV4A 4YQZA 1JVSA 1XLTA 1I3LA 4DLAA 1WW8A 4XEHA 2IYPA 3TF5A 4B4UA 4OXYA 2HMTA 2HQ1A 1W73A 3CSDA 1KVRA 1KVUA 3V8BA 4W99A 4XQGA 1XU7A 5A9SB 4UEJA 2VUSA 5G0SA 5G0UA 4HXYA 5A3VA 3VKVA 4CQLB 1R4NA 4EBFA 4XDZA 4NQZA 4RZHA 4OYRA 4CM6A 3ZWXA 1PJQA 1EZ4A 3GZ4A 1Q0HA 2DUUA 4AL4A 1P33A 4WCFC 1PGOA 3OA0A 2IZ0A 3BTOA 3DTYA 1ZJZA 2LDXA 5IZ4A 1KEVA 3H5AA 2VHWA 4U5QA 1PS8A 3GEDA 4CV2A 5JFOA 4ID9A 1MA0A 1PZFA 5DBFA 3WGQA 1Z74A 4KOAA 4J3FA 5JMWA 4R3NA 1FK8A 1YBMA 3IUPA 2EEZA 4GSLA 4RVGA 4TZTA 2NWQA 3K6JA 3IKTA 3HHPA 4FGSA 1ZMTA 1X0XA 3OETA 1MUUA 3D0OA 4CUZA 2EV9A 2GCGA 3DZIA 3ZU2A 5IXYA 2O7QA 4JP2A 5CDTA 1B8VA 1ZK4A 3S55A 5FI5A 5DDIP 1PJLA 1HZJA 2VT3A 3DR3A 3IAHA 3OP4A 4JIGA 4WLVA 3A9WA 4YRBA 3K31A 1HDOA 2EP5A 2DLDA 1A4UA 2O4UX 3PQEA 4RF2A 4WOJA 4WLEA 5IDYA 4BGUA 1UDCA 4JP3A 4CR8A 3MJSA 1DIRA 3S2FA 4HX5A 1HDXA 2DTXA 3R3JA 3E9NA 4MVJE 4Y6PA 4B4OA 1FXSA 3TZCA 3KSDO 4XD2A 2FSSA 2YV2A 4EJ0A 3H9EO 1LJ8A 1VC2A 2B5WA 3FBTA 3I23A 4IGEA 4NU5A 3VVCA 1XSEA 2WE8A 3K2EA 3VZRA 1ZEMA 3PWSA 4UUNA 3RFTA 5TX7A 4CR7A 3LLVA 1JWAB 1UXKA 5IN4A 4WASA 2NTNA 3NGXA 3EZYA 4D7AA 1B14A 2GF2A 3PQDA 3Q2IA 3GDFA 1DB3A 3FBGA 4LN1A 5G0TA 3KOUA 3UXYA 1BGVA 3HDHA 2HK8A 4XYLA 4G2NA 4XGKA 3HE3A 5I9MA 5COBA 2QYTA 3H9JA 5U1PA 4WLOA 4XWYA 3ZU5A 2PA3A 1BW9B 1DHTA 1Z82A 1HDRA 3GVIA 3LF1A 3VH1A 5CG1A 2D4AA 2DT5A 4M49A 3COSA 4WLFA 1VM6A 1CIVA 5I9NA 1B8PA 1H93A 3SXPA 5TJHA 4JXKA 1RM4A 3ZWYA 4BNVA 2PZLA 1R4NB 2EXXA 1ZK2A 1PSDA 3GDOA 5TJ9A 3H4VA 3GOHA 1NPTO 1GQQA 3GT0A 3MOGA 1K6XA 2HK9A 3WYBA 2AW5A 2BLLA 4AJKA 3RBVA 1GCUA 1HYHA 2UV8A 4HUJA 1ISJA 3A14A 4PLPA 3H8VA 1NX6A 3ICCA 4OOEA 4NBRA 5K9ZA 1IL0A 1MG0A 2Y1OA 3VZSA 3LC1O 3SJ7A 4CLOA 5JY6A 4NJMB 2J3HA 5JDIC 2D3TA 1ZFNA 1N7GA 5CHEA 4P8RA 3ZHBA 4J90A 4IIVA 2PFGA 3AI1A 4Y6RA 1BVUA 1Y8QB 4PLTA 2XXBA 4CM4A 1DC4A 2XOXA 3WJ7A 1GZ4A 2Q46A 1P1RA 1MFZA 2GN4A 4R9RA 1GEGA 1FJHA 1GYRA 4KDEA 3VHRA 4PZDA 4MP8A 1GEEA 3UKOA 4JBGA 3WLEA 3GN2A 4PG8A 2DKNA 5F1OA 3VDQA 3F47A 4LISA 1HDGO 4MIYA 5HTOA 1GD1O 3EAGA 4G65A 3SLKA 3RC1A 2AEJA 2CD9A 1R0LA 4L4XA 4OL9A 3W4IA 2Y1GA 4RZIA 2EKPA 1HLPA 4DMMA 2PV7A 1GUZA 4BMNA 1FDVA 3QLJA 1SB8A 3WMXA 4WECA 3S8MA 1HDCA 4WPGA 3PLNA 3L4SO 4YCAA 4E5MA 2JL1A 1A71A 4IIUA 3INTA 3AUAA 3UVEA 1PJ4A 4EUFA 4KWHA 1NTOA 1IZ9A 1QMGA 2HMVA 3OA2A 3SX2A 3ZHZA 3HFSA 4B3JA 1VL0A 3K96A 2XF8A 1HXHA 1LDEA 2QX7A 3NDRA 1E3SA 2X86A 4W7HA 2FRDA 3VPGA 1GAEO 2OFPA 3E8XA 1C0KA 4E30A 5T5QA 3CKYA 4NNJA 4CM1A 4Q3BA 4NZ9A 4FD3A 3I3OA 4MKZA 3RCBA 3RBXA 3HDJA 1U9JA 1Y9AA 4ITUA 3LC2O 3KSUA 4O0LA 4ZVVA 4R1SA 3PGXA 2H63A 5ILGA 4XKJA 4XB1A 5KJ1A 4O1MA 5JDCC 4EITA 3HQ4O 2CVZA 4MVJA 3TZKA 3ZGYA 3JQ8B 1UZMA 4JBHA 4M8SA 5G0VA 3BIOA 2EKQA 1IB6A 1YVEI 3FCOA 4E5YA 4PLVA 4N5LA 4KZPA 3HDYA 2X9GA 2IZZA 2EKLA 1WZEA 2GR9A 1YB1A 3FF4A 2I65A 1ZW1A 5BSFA 1WWKA 4IXTA 5ER9A 2NQTA 4FN4A 5TSDA 2Y0DA 3TJRA 3CPSA 3ZH2A 2WDZA 3RUDA 4DA9A 2GN9A 1IHXA 4IS3A 4IDCA 2BH9A 1CRWG 5KVVA 3WICA 2GPTA 5MGBA 5BNIA 1OBFO 4NK5A 4XJSA 1SZJG 4P4GA 1HSZA 1PZHA 2DFDA 1C1XB 1LNQA 2QRKA 4BKQA 1YGYA 1J4AA 1TB4A 1XGKA 2GN6A 2JCXA 2DTDA 3OJFA 3H9UA 2PY6A 1PR9A 1Q7BA 1T2CA 2RCYA 4F6LA 4IQ8A 4L75A 4CJXA 3ZNPA 4XA8A 5FF9A 1LUAA 3OSUA 4D79A 4RPLA 3I9NA 1JN0A 4HFNA 1W6UA 4BNFA 1XEAA 3D3WA 4FJ0A 1H6CA 3RD5A 3TFQA 1Z45A 3W6ZA 4HKTA 5L3ZA 4QO8A 1D3AA 2WM3A 3TZHA 1FF9A 4AJLA 4D3DA 2AG8A 3IL2A 1RYEA 5TIIA 2FOIA 1ZZEA 4G81A 4J2OA 4BHTA 1LA2A 2X23A 3OH8A 2P4HX 3ZU3A 4E13A 3GR6A 3ULKA 1DLIA 4Z0HO 1DC6A 2QIOA 2B35A 4BNUA 3OJ0A 3AY7A 3GG9A 1IHYA 3RASA 2D59A 1ZBQA 4GX0A 4BMSA 1XU9A 4GPD1 2VCYA 4UAGA 4MP3A 1NASA 1A5ZA 2Q49A 5FYDA 1C0PA 1NVGA 1PL6A 4XYEA 4CLOB 1ZSVA 3MEQA 4ND4A 3DL2A 1ENZA 2RIRA 4CPDA 1P1KA 3QWHA 5G4KB 5A3JA 4B4VA 4IMPA 4RORA 3WXBA 1VPDA 1XCBA 2P2SA 3K5PA 4Q39A 5EN4A 1H6DA 1EBUA 4XCVA 4BGIA 1YQDA 4BS9A 5JSFA 1Q7GA 1T2AA 1ENPA 4CMHA 5AXCA 1X13A 3I9KA 1NQ5A 2J6IA 4LVCA 1BSVA 5IFLA 1I3NA 4UEKA 4WLUA 3RI3A 4K9DA 5KJFA 5GMOA 3I4CA 3BTUA 1NPYA 1QR6A 1NR1A 2CDBA 1VSUA 2ZQZA 3BHIA 2PKQO 3DZJA 1GDHA 1P1JA 3KEQA 4OQYA 1GZ3A 2C54A 1LEHA 5FFFA 2OMEA 2VZ0A 4Z6KA 3E82A 1NP3A 4EUHA 1SOVA 4WEOA 4FB5A 2EERA 2O2YA 5C3MA 1YONA 5EPOA 4Z3DA 3C1TA 1Y9EA 1PJTA 2NVUB 2NVBA 2ZK7A 3PJEA 5EINA 3X2FA 1JW9B 2P91A 4IS2A 4OXNA 4RL6A 2NLOA 4FC6A 1U7TA 2RBEA 4QQRA 4YRDA 4XX0A 5F3RA 2WD8A 3VOSA 4EYEA 4CODB 3H9QA 4YJDA 4W4TA 1Y7TA 3AI3A 3FN4A 5THQA 1T1SA 4ALNA 1E3EA 3MTGA 1YQXA 1I3KA 4FFRA 4FPXA 2TMDA 4GWGA 4DXHA 1MB4A 2AQIA 3G79A 4PG6A 1JU9A 1E7SA 1S6YA 2C0CA 2BHLA 4FJ2A 4BGEA 1U3VA 2UVDA 2ZTVA 3TDKA 8ADHA 2B83A 4BO0A 1DEHA 3DHEA 3FRJA 2Y99A 3LT4A 3L6EA 4P4NA 1I36A 2BFMA 1AHHA 3T7EA 1RYDA 4CMIB 1I3MA 2X22A 3F9IA 3OICA 3KO8A 4JJGA 1LLCA 5IDQA 4YBZA 2I6TA 3G49A 4J4BA 4D45A 5A06A 2GZ1A 4NFHA 3B70A 3PHIA 3QQPA 4RVDA 2ZCUA 3VDRA 4AFNA 2H6EA 3JQ9C 4I5EA 3ZWMA 1ZK1A 3NX4A 1K2WA 3UFXA 2PNFA 4JCOA 4M54A 3GAZA 1ADGA 4ZU3A 3ZWCA 1QORA 4YB8A 3PPIA 4MVJH 1KVSA 1DDOA 4CR6A 5K6AC 4LMPA 3TOZA 1BHSA 1PGPA 3NEPX 1TEHA 3V1TC 1TVEA 3IMFA 1GCOA 4MKXA 3RU9A 5CDSA 1XWFA 4UULA 3PJGA 3HN7A 4M87A 3PJFA 2X0JA 5C7IO 2PGJA 3UHAA 3P19A 4E2ZA 3BYZA 1A7AA 2EGGA 5B4VA 4R41A 3LQFA 1X7HA 4BO2A 1GV0A 4R4JA 5C37A 2IYOA 4RLHA 1QYDA 5T57A 1SPXA 3AFNA 2WEKA 1E1NA 1TA4A 3KETA 3JD4A 3UOGA 1YL7A 1N1GA 3F46A 4IJKA 2B36A 4IJWA 2NU8A 3WGHA 1E3JA 2W2LD 5DCUA 5CPFA 5JW6A 3PTZA 3W4KA 2PK3A 3F4BA 3M1LA 5KOIA 1DC3A 4LW8A 4W9NC 2O3TA 1DAOA 2D8AA 3K8ZA 4PLCA 1UP6A 3ITKA 2AQKA 4YEDA 4AJJA 1HRDA 3Q0EA 5KCZA 8LDHA 3EZLA 3JQ7B 4K28A 4ZQEA 2Q4EA 2J8ZA 1E7MA 2Z1NA 3H2SA 3KV3O 3DBHA 3E18A 1ENOA 1LQUA 2OHXA 4HFRA 3ZV6A 1QG6A 4DYDA 5I9LA 1RKXA 1B7GO 4YJHB 1I2CA 1WMBA 2C7GA 2HMSA 2HLPA 5ITWA 1XR3A 3AOEC 1I30A 5J23A 3KBOA 2O23A 1E7QA 1E1KA 1V0JA 4PIVA 3GN1A 4RF5A 3S2EA 3TRIA 4XRGA 2VNAA 4GMFA 1M75A 3ADPA 4MKRA 2PD6A 2O7SA 1BXZA 1XKQA 1AHIA 1OAAA 1K3TA 4BNKA 4J1TA 4MIOA 5GZ6A 1DFIA 3JQ9A 3LSYA 2V6BA 3FNFA 3GMDA 5BT9A 5DN9A 3ZN2A 4CMEC 6LDHA 4INAA 4A0SA 3FNGA 3O8QB 1E6EA 2XXJA 4WEQA 2JJYA 1B2LA 3EUWA 3ANMA 2QZZA 4IJUA 3CINA 2Q99A 4A03A 1UR5A 1U28A 2GERA 3K30A 1E3IA 3BHJA 1TT5A 1ULSA 4II2A 4XB2A 1LI4A 1YJ8A 1TXGA 4J2HA 1YBAA 1U3UA 3PZRA 4A73A 1PL8A 3BMOB 3GVCA 5KJCA 2NU9A 4NBTA 2X9NA 4FFPA 1AXEA 2O3UA 1KERA 2WMDA 1B0AA 4MINA 3ROKA 2D5AA 3PRJA 2ZB3A 3L6DA 3K73O 2PTGA 1QSGA 2IDZA 2Y1CA 1EUZA 3I9LA 4I9NA 1ZH8A 3KHUA 5BNFA 3GNQA 2GUGA 1U3TA 3NKLA 1PL7A 5JYEA 5A5FA 1X7DA 4I5FA 4RO0A 2E6UX 1UXJA 1XELA 2C59A 3JYOA 2BMAA 2H1SA 3NRCA 5ITVA 2BFAA 2X0RA 3AWDA 1E77A 1FDSA 4W6ZA 3DBLB 2V6FA 3H7AA 1X0VA 1KVQA 1XHLA 2P68A 4NPCA 2V6MA 4U6QA 3GPIA 4RJTA 2PZJA 4BKOA 4L76A 1I0ZA 5JE8A 1RM0A 2BELA 2DU8A 7ADHA 1E1MA 1MC4A 4RV9A 1R4MA 1GPJA 4BKRA 4BUCA 2Y66A 4ESOA 4ZRMA 3I4FA 3U49A 3R1IA 4A2CA 1BW9A 1PGNA 4DYVA 5L4NA 1X7GA 2HU2A 1GUFA 4BKUA 1LRJA 3NTRA 4GKVA 4RF4A 4DIOA 2CNBA 1ZMOA 4JX8A 4WOKA 4XJTA 5H82A 4CUJA 3QWFA 1DRVA 4PLZA 5BSHA 4I1IA 1HL3A 3GDGA 1EBFA 3FPLA 2C5AA 3LU1A 4WK6A 5L40A 3BTSA 1HKUA 4ROSA 3OJOA 4J43A 3W4JA 4DLBA 3OMLA 4YQYA 4TVBA 1NPDA 1OI7A 3L0DA 1A27A 1ISFA 3D4PA 4Y98A 4TRJA 3AOEA 5A4DA 2GRAA 5B4TA 1DJQA 1IULA 3ANLA 2ZB7A 2I3AA 4QT0A 4GVXA 1SOWA 3PWZA 2V65A 3L9WA 5CFZA 3PYLA 1R0KA 3DAGA 4RDIA 5BSGA 4BO8A 4DRYA 4R5MA 4YWJA 3PJDA 1PS9A 1HLDA 2PD4A 7MDHA 4EGFA 3ONFA 1VL6A 1G0OA 1KYQA 4FFOA 4D43A 1YO6A 3C8MA 3F4LA 2PH3A 3EMKA 3VPXA 1ZK3A 3VTZA 4B7CA 2OUIA 1L7DA 1ZCJA 3KLMX 4XGIA 3D4OA 3ZHXA 2VOJA 3LYLA 3PQFA 3RQSA 2G82A 1R4MB 3PHJA 5F1KA 1UZLA 4A26A 3PYMA 1NVTA 3FTNA 3QSGA 4N7RA 3WX0A 5L45A 4MVJI 4J4TA 3QWAA 5A1TA 2Y1EA 1NR7A 3AW9A 3NT4A 4CM3A 2ZATA 4OSOA 4L0QA 3NV9A 3JSAA 4YYZA 2C2YA 3F6YA 4K6CA 5JPIA 4C7KA 3OIGA 5DP1A 1R15A 4NK4A 2X7HA 3QW2A 5B4UA 1PQWA 1YB4A 3LDHA 1WDKA 5LCXA 5FEUA 1PJSA 4XIYA 4KTTE 1A4IA 3FR7A 1K5HA 1IYZA 5G0WA 3U4DA 4B8ZA 3GRPA 4O5OA 4BB6A 4DIBA 5GY7A 4CV0A 2AE2A 4DTIA 4E2XA 1W8DA 1E7RA 1M67A 1NQTA 3AM3A 5LC1A 1JKIA 1NM5A 4M1QA 1AGNA 3GLQA 3WWZA 5DT9A 4BOYA 4WKGA 1PWXA 1VRWA 1QLJA 2HCTA 1HDZA 5ICMA 3C1AA 2WE7A 3CMCO 1KEUA 3D5TA 3UCFA 4E3ZA 3MTJA 1TT5B 3ZW8A 2OP1A 3DMTC 1PU2A 2VYND 2X58A 2YHIB 3EY4A 1KY5A 4F3YA 1SEPA 2EJVA 5EESA 4J16A 1R16A 3HUDA 1IY8A 3CMMA 3PI7A 4X54A 4CMIA 4TROA 5AOVA 4Y9DA 3WOHA 4ZGWA 3A28A 1V6AA 1ORRA 3G0OA 3GK3A 4Z3KA 5DP2A 2OL4A 4TRRA 3W8EA 5JCJA 4ZHSA 3VZQA 4XQEA 3WYCA 4LK3A 3W8FA 1R37A 4IINA 3B6ZA 1SNYA 2Q4BA 1X14A 1L7EA 4R01A 4AJNA 4HP8A 2VWPA 4U6SA 1B8UA 3OHSX 1NQOA 4FGWA 3VC7A 4DLLA 3ZNOA 5HA5A 4RPHA 3W8DA 4R3WA 4A7PA 1A72A 5JCXA 3SEFA 5JDIA 4YJGA 4AJ1A 1O95A 2HJSA 2JHGA 3OBBA 1PWZA 1ZO8A 3RJ9A 1NAHA 2DPGA 5HS6A 4CQMD 3JQAD 1IZ0A 1H0KA 2G1UA 4I08A 5F5NA 1D1TA 3C7DB 4OHUA 1HE3A 4FFMA 1KIFA 1FDTA 1D7OA 4OM8A 1IUKA 3GNTA 5CEFA 5G4LA 4TRMA 3U4IA 5TQVA 1Y1PA 5DOZA 4ZN6A 1F14A 1IE3A 2FSVA 1GY8A 4R1TA 4YVFA 1A9ZA 3Q9NA 4QFCA 1NFFA 4JNKA 4GX1A 4OMUA 3O4RA 3FNHA 1B26A 2QW8A 1T4DA 3MJTA 1BDBA 2YFQA 1R66A 3A4VA 1MX3A 2BKAA 4B7XA 3U9LA 2UYYA 4PG5A 4MOWA 3VKUA 3VTFA 4MVJF 4M89A 1ZSNA 3G17A 2JCVA 4O59O 5A03A 2HSDA 1I33A 2R00A 3PFFA 1WDLA 3WNQA 2Y05A 3WTCA 5JNLA 2NTJA 4CM7A 1E5LA 4DPLA 3ABIA 5FWNA 2O3SA 3D7LA 1NHWA 2Q3EA 1EVIA 3DOJA 4O6VA 3WG9A 2EHDA 2VHYA 3WGZA 2OBNA 3HJAA 5JLAA 2YHIA 1SC6A 4NIMA 3DOOA 2HAEA 4C7JA 3T4EA 1LDNA 4L73A 4FIZA 3OM9A 3E9QA 1MLDA 2IEDA 3I9MA 2I5PO 1G1AA 3C7CB 4TQGA 4DGSA 4PVCA 1I32A 1DSSG 6ADHA 3C7AA 4L9RA 4UVHA 4BKPA 4CLXA 3KUXA 2NADA 1EQUA 2Q1TA 4FBGA 4I5GA 3VH3A 1A9YA 4JGBA 2B0JA 4AVYA 1PJCA 1PGJA 2DAPA 4LRTB 2WYVA 4UVDA 2HK7A 3U62A 5DULA 1Z7EA 4B3IA 5IZCC 5CPBA 1K6IA 3MOIA 2W8ZA 3E48A 1ADCA 5DBIA 1IPEA 1RM3A 5KTKA 1P0FA 3ANNA 3QVWA 2G0TA 2X4GA 1EVZA 5T64A 1E3LA 2RHCA 5T8KA 3DDNA 2CDCA 1YXMA 4YAGA 4FOOA 1M76A 1Z7BA 5DCYA 3JQGA 5EJ2A 2J3KA 1FDUA 3WLFA 3B1JA 3UW3A 2CVOA 1N5DA 2VZ9A 1Q2XA 2J5KA 2EJWA 4J91A 2B4QA 2J3IA 3M2TA 3I6QA 1T2DA 3Q1LA 2VTEA 3QRWA 1LRKA 1VJTA 2FR1A 2NU6A 4ONEA 3D3WB 4GH5A 1I10A 3GVPA 4KDFA 2AEFA 2WD7B 3LZ6A 1DIGA 1O89A 5COAA 3L77A 3TNLA 5C5IA 4FQ8A 3P2OA 4I5DA 3GZNB 1DAPA 1MP0A 4BNLA 5HWSA 1LBEA 5TT0A 1F06A 1EUDA 2O50A 2ZIZA 3BMCA 3GRKA 5JO0A 3UUWA 1IOLA 4QSMA 3X2EA 4CM9A 4ZQHA 5IDXA 4PLGA 1ZVMA 4TSKA 3OQ1A 2CDAA 2JAPA 3BMNA 4RLSA 2BFOA 3JD0A 4J1QA 3KM0A 3STHA 1AN9A 1I2BA 1MFPA 3DC2A 1D4FA 1LTHR 4H3VA 1WP4A 1XQ6A 1BVRA 4TVOA 5I8WA 2W98A 1EQ2A 2Q2QA 5G4KA 2I3GA 1H5QA 5IDWA 2AG5A 3I52A 1VSVA 4BNYA 4IM7A 3ICPA 1JQBA 5ILOA 3QE3A 2VTDA 3EVNA 4NHEA 4WJZA 3V2GA 1P3DA 1BXGA 1HE2A 4CUKA 2FZEA 3ZNNA 3G3EA 3ETGA 3LT2A 4GGOA 1K0UA 4BO5A 1EMDA 2VOEA 2OP0A 3RKUA 2XPCA 3R3SA 4E0BA 4PCVA 2I67A 3BMNB 4XDYA
chains in the Genus database with same CATH superfamily
1MAAA 4F21A 1JA0A 1JLKA 2UUPA 1Y0BA 4G2TA 4XW2A 3ILXA 3T06B 2Z6VA 2OYCA 4JBYA 4BE4A 3SWWA 4F46A 5J2UB 4J7XA 1O77A 4R6XA 3D7KA 2V7QD 4EQ6B 3U0VA 4ER5A 1CVLA 3H87A 3UK6A 2JLUA 2NUAA 1NBAA 1H6BA 3FUWA 3RU7A 3VYVA 1MJGM 3C14C 5DZSA 1J0BA 3A1WA 3ZU6A 3C16C 3KJFA 1ID1A 3MMZA 3SICE 1GL9B 4CGZA 4BMDA 3H2HA 3L7YA 4L27A 2JFVA 4L4UA 4XQ9A 4EI2A 1GITA 2ZUFA 3LLSA 2X9VA 3THXA 2NXCA 3AUXA 3H3FA 5LKAA 3A4MA 2H0AA 2XVYA 3OU6A 3OFJA 4XH9B 5E3HA 2X1HA 4AY2A 1JSLA 3ZNQA 4C01A 5KWSA 4C4RA 3ELUA 1ZIDA 4EGSA 1RPAA 1TM7E 2C5GA 5LXTA 3H75A 1H3FA 3OZVA 4DDVA 3GJZA 3NUGA 4TUYA 1JALA 1LQ2A 2VHEA 1CV2A 4N7MA 1HZZC 3UQYS 2BZ0A 3DAFA 4FHGA 2X3FA 4YXWA 4AF8A 3OT5A 4BLPA 4BNXA 4DIEA 1NW8A 2CLOB 1WHTB 1G8GA 2DC1A 3M6IA 3KJQA 3QX9A 3NTXA 2DR3A 3VA7A 5CA1A 3A3KA 3PXXA 3PEFA 2GO7A 4ACAA 2R1UA 3PS9A 2Z8YM 3EARA 3JV7A 4LBZA 3N8NA 5A7HA 2WPDA 5IAGA 4V1CB 2PM8A 3FE2A 4M99A 5IT4A 1Y8QA 2CXHA 3TMAA 5JZOA 2QVZX 4HATA 3EBLA 4NYMQ 1OA1A 1TEVA 1EXWA 1JSRA 4D8TA 4Q4LA 2AR0A 2ORVA 2ET6A 3DMFA 1N3BA 5CXUA 3TG2A 3VAYA 1FPMA 2J59A 1JFTA 1M66A 4OMDA 3GUCA 1S4QA 5HSGA 2QQGA 2G5GX 1QPBA 4BO7A 3G1TA 3UUFA 1N2SA 4A3SA 5HCUA 2VUHB 3IDSA 5BXYA 5KVCA 2JBAB 3GPDG 3LWNA 5ERYA 1THMA 1ML4A 2X15A 1U3GA 3IBCA 3SEZA 5K0JA 1RE1A 3K1TA 4ECAA 5BYAA 4FXOA 3MQ2A 3MPOA 4HWSA 4TXJA 2C20A 1XLUA 3EZNA 3O91A 2YMQA 3QUQA 2YASA 4MV9A 2A5JA 4GR9A 4ZHQF 3TQRA 3KDAA 2XYVA 4U2EA 4B9AA 4OBBA 2GO1A 1LTKA 3D1LA 3P9QA 3T5CA 3PZBA 3VNRA 4F6RA 3BAZA 1VKOA 4HVAA 5DTRA 5BV8A 2WNHA 3L7JA 4WH0A 4YS6A 3ZZ0A 3UJ6A 1VE9A 2Q50A 2ZFUA 4GGMX 3S1AA 5AW3A 1XQYA 1PK7A 2HJWA 3F3SA 4LHZA 3WI7A 4L72A 4FDVA 1Y8RA 5TY0A 1UOOA 3C4VA 1T5TA 1U3WA 3V1UA 1NU8A 2DM6A 2XDYA 4NBUA 1SZDA 1VDZA 3SCZA 1EVQA 4GYKA 4C6SA 4HNVA 3JRXA 3FMFA 3VDXA 1QS0B 2GEKA 1QX3A 2POCA 3GJTA 1SHKA 3NJ4A 3DSRA 3UBTA 3RC2A 3GT7A 2OBYA 3DXYA 5LZ8A 2VJDA 3KC2A 4MDHA 4C87A 1N33B 1XVLA 3VYRB 4BFCA 2OFFA 2XTMA 4RU1A 4Y2VA 2A67A 1RRFA 5NULA 1BS2A 4HNHA 2A94A 4BP8A 1DMRA 4OATA 3T3OA 1KY3A 2JK0A 3AKYA 3BILA 1MG5A 4YH1A 1WVIA 2CF5A 4ZVQA 2IBMA 3SAJA 2VG8A 1UAYA 3RIMA 3U5TA 4B4DA 5KEIA 4UDNA 5B30A 4WKPA 1RJGA 1E58A 3JZAA 2ZI3A 1BAPA 4QYXA 2PS0A 2TMKA 2VQ6A 4WXMA 3A8TA 2J09A 1G8PA 1NT4A 1RU3A 4J3JA 3U3XA 4G5HA 4J0HA 1ZVVA 2E48A 4ZQBA 4OLAA 4R1NA 3IKLA 4IEEA 1Q6YA 4PYKA 3WGGA 2H3HA 1M1NB 3LE8A 3L05A 2IS6A 3UK0A 1RAEA 4YDRA 1AD2A 2H29A 3FJYA 1P9LA 2MJLA 3KZVA 4Q3EA 2FG5A 2QB5A 4DJFC 4URYR 2P5TB 3FKSD 3W3AH 4CMBA 5IF3A 2YQ4A 1ORVA 3VYSB 1E20A 4MI3A 2OV8A 2R4UA 3KB6A 5CH3A 1NIPA 3U44A 1K4MA 1VB5A 2AFHB 1F3OA 3ZOZA 3C48A 4R54A 1RQGA 4ECEA 1C1YA 3IP6A 4Q9KA 4EEKA 2VNSA 2BEUB 4ZGGA 2PT7A 4LF4B 2OYSA 3NBAA 1LXCA 1MQAA 4KC0A 4ZMSA 1BWSA 3I0NA 3G89A 3MWDB 4JLBA 4Y2UA 2FLWA 1CNMA 1GLVA 3CJTA 3FHCB 3ORFA 5T67A 3BFJA 1ISIA 2VAWA 1CU1A 1FFEA 3DZBA 4CEIB 2JLVA 2ZBQA 2PYDA 1AKTA 3H1TA 3L1UA 3OJXA 5ELMA 2W2XA 1JHZA 2Z2KA 3Q5GA 3V48A 1MH9A 1PZGA 1VCMA 2O8NA 1AKWA 5REQA 1LPBB 2XVZA 3NBUA 3PX3A 4M0KA 3DMDA 3FR8A 2V03A 3WNVA 2F9MA 3L8DA 5JCPA 5JH7F 2RGYA 1FB5A 1VL8A 3P9SA 1OH5A 2ZKLA 4R8KA 2CNKA 2ZAGA 1F1JA 2FB9A 4H3SA 1NYLA 2CUNA 1DQSA 4MUFA 1E63A 2LXNA 2NGRA 3WSVA 1K6MA 1NUTA 3FDZB 3SJAA 3H9CA 1DOHA 4AROA 5C5CA 4Z4FA 2VR1A 1VRVA 1L7AA 3LKBA 3LLCA 3KTAB 3F3KA 4CU2A 4K9NA 1JG7A 2B4AA 2O8FA 2QTWB 4RA6A 3HN2A 4FGKA 1ODFA 2QX6A 2V7QA 3FHLA 4LI3X 4DCUA 4B09A 4H31A 5HQ3A 2XKBA 5BSEA 1U8XX 3GWGA 3EA5A 4GWKA 4XPIB 3AX6A 1ZEJA 3JTEA 5LYYA 2QG4A 3HHEA 1U1IA 1X1TA 2UZAA 4G86A 4B35A 5IT9A 5F1PA 3OFKA 4RQTA 4XB6B 2ONJA 1HQDA 1A5AB 2LDBA 2BEKA 4H60A 4MAAA 4B47A 5I4IA 3AVYA 2OZPA 1DKRA 1FUUA 1QIEA 1YGPA 4LXYA 4CMCA 2GD6A 2GZ3A 3X2SA 4BCDA 1TJPB 2W2OA 1Z08A 5JZVA 1KAHA 2DKOA 2C9YA 4QUIA 3D9QX 4MVWA 4A5OA 1CYDA 5A7GA 1Y6GA 1RWPA 1K8XB 4IEIA 1UH5A 4IG9A 2WJYA 1U7PA 2IU4A 1CLEA 1T1IA 1PDVA 3C6XA 5DEOA 1S8NA 1EP1B 2N9UA 1U2ZA 4NNPA 4A15A 5C53B 2VTKA 2XOKA 3G0DA 3ZE8A 3NAQA 5JYDA 2B8JA 3VNQA 3DGEC 2LIVA 4Y2SA 5U4XA 3WK8A 4DLVA 5T6BA 1KZ9A 1ONPA 1QVVA 2ISCA 3FAZA 4BAUA 3IS3A 9LDBA 1GT91 2XVMA 2HLHA 3H5OA 2EFGA 3W3AD 2XEXA 4DC0A 2DWOA 1RVDA 1FFXA 3K0CC 5CRIA 3AKDA 3PC4A 1MOZA 2E4XA 4J94A 1F8XA 4C4XA 3MUNA 1VE6A 2O7VA 4QOSA 5BURA 1EUDB 1VRCA 3BMCB 3GRZA 4IQ0A 1X70A 5B1DA 2QD1A 1U2GA 5L3SB 3BXXA 3GJ0A 4PY2A 2PQ6A 2ZJ0A 4HAUA 5ALJA 3PXBA 4EG7A 2NUTB 2B1QA 3IAEA 2PQMA 3V4ZA 2HIGA 3BL6A 1JSCA 2I76A 1VLQA 4XR4A 5AVVA 2IUUA 1FP2A 2H2GA 2HN9A 2QQ5A 1A9RA 3ECCA 4QGFA 2OXIA 3A4LA 1P0PA 1NONA 1EQAA 2XYQA 3H8WA 4BNIA 2RGNA 2VAPA 2ZSBA 2B1RA 4WBXC 5A3RA 4OXQA 1JQEA 1ZPDA 2Y1FA 3QYJA 1B0UA 3WB1A 3UC9A 2JB9A 1UMKA 3K5WA 3QXXA 5IEJA 1E6UA 1GGFA 4RQBA 3K53A 4DXDA 5KO2A 3K70C 1IRXA 3C4QA 1VQ1A 2NU7B 3CUUA 1VPVA 4ZV7A 4D3FA 4R1MA 2IDKA 3AIOA 3E61A 4AMYA 2FZGA 3UYLA 3G13A 1ZSYA 4I4LA 4Y2JA 4EABA 4IIGA 3JXEA 1QOPB 3NKFA 5AVOA 1JHAA 2D00A 3EZ2A 5FPQA 4URXR 1QV7A 5F5XA 4M1YA 3I8SA 2AXPA 2NV2B 2HSEA 2WR8A 4GOJA 1KETA 4NENB 4S3MA 3H5VA 4E2FA 5HUJA 3SPXA 2ZIWB 3TBKA 4D8XA 5C1PA 1WKVA 5GZ3A 1FY2A 2ZVPX 3LF2A 1EIZA 1TYAE 2YNMA 3GMTA 3QFHA 3IEUA 4IQGA 2HDWA 3O9ZA 2VKTA 1S0UA 3JD2A 1TF5A 1MDFA 1YV9A 1K6JA 2A0XA 2DBRA 2QRVB 3ANTA 3EB9A 3ITNA 3Q3CA 4GLLA 4D9BA 4AJOA 1XYGA 2CDNA 4NOMA 5JJKA 4F8YA 1UBLS 3BCSA 3VKFA 1M1UA 5JT1A 3F1LA 4HGNA 4ZRNA 1L8OA 5IT0A 2ZTMA 2X6TA 3PC8C 4I1SA 4ZEXA 2YS6A 2RHOA 1M6NA 3JRWA 3L4BA 2XYHA 1C2YA 2H7XA 2XY4A 3NM5A 3OE4A 4U00A 4ZMBA 2HHHB 1FX0A 1Y5MA 2EWVA 4DV2B 3FYCA 3K1ZA 2HDOA 4JOSA 5FPTA 1KBZA 1E4EA 5DV9A 4M1MA 3PFHA 1S3FA 5U4QA 4EATA 4CDGA 1Z6XA 5THXA 4TLMB 4TLEA 1OXKB 2RBKA 4EECA 1NI5A 1USWA 4HXEB 4MKHA 4K0KB 1G42A 1TI7A 1AUOA 1E5QA 4GI2A 4XUDA 4TVSA 1A97A 2B5VA 2QJOA 4ZKDA 3WO1A 1ZNXA 1QP8A 4L28A 4QAQA 3TAHA 1QYWA 2VWQA 3CISA 4FGUA 4J0EA 4JLNA 4PFJA 2D5CA 2Y8EA 4RESA 4ZYYA 4Y2XA 1D1SA 3NVDA 3TIIA 1LW7A 3QWIA 4OX9B 1UKBA 1XK6A 4Z9YA 4J29A 4UVEA 5GVRA 3B20A 4KLCA 1ZH6A 4O4IB 1RHMA 1XA0A 2ZG6A 3TGLA 3AESB 4BC1A 4ZAWA 5I4BA 3VAAA 1JH9A 2JGDB 1NYQA 4HUTA 5I01A 4QLOA 4YXFA 3I9FA 4IZHA 5C34B 1G9SA 2R7LA 3ED1A 2EFDB 3KKZA 3O26A 4HQFA 4I9HA 4XYMA 3ISJA 3A36A 3OIYA 4H7JA 3LNCA 3WIUA 4BGDA 3GBPA 3DKRA 2YS7A 2VJMA 3O4IA 3QJGA 5EJ8A 4L8LA 1O8CA 4YQFA 3H6KA 3GLIE 5K6RA 1XMJA 1FFBA 4MICA 4QVGA 1GR0A 2O07A 2XAUA 4N6NA 3G7NA 3WLAA 5JAMA 2WWYA 2IPLA 4RD2A 2XLBA 3LQ4A 5K7SA 1M2JA 1QG4A 3AERB 4PM4A 4DQXA 2ZGVA 5CIYA 2EFJA 1N1DA 1EFHA 1N9ZA 2QYHA 3GMSA 3NEJA 5BWMA 4JMLA 1Y8CA 1DI0A 3PICA 4K03A 4A2QA 4DQUA 2UZ3A 2ZT5A 4D4LA 4KU4A 2OOSA 3ZJUA 1DXQA 4FD2A 4HGYA 5GIPE 2RGWA 4Y1RA 1NP7A 3IQWA 3B7PA 2EFHB 3C5EA 4WD3A 1T5BA 5DYWA 3RJMA 3W79A 4C5AA 1I2MA 1OX6A 2GBLA 2I6FA 2PBZA 3GEGA 1ULUA 1JTFA 4EX7A 1JR3E 1SKYB 2OGUA 3KSZO 4ZRDA 4EUNA 1YCFA 5ULLA 3F6SA 4CFSA 3IMCA 3RUEA 5CXXA 1IHPA 4JEMA 2AHOA 2IEYA 4O4IF 1ONSA 3ESYA 1L5HA 1OU4A 2FUG1 4QAJA 3B1KA 4OGWA 2LKDA 1ZJJA 1WXDA 2REOA 4HI0E 1BQ4A 1YRQA 3DZGA 1PV1A 4K9OA 2Q5JA 3BKXA 3P9XA 1ZIPA 1XP5A 1X6VA 3FDJA 4POAA 3JAMA 3TRDA 1MD9A 3TNJA 3PPYA 3D02A 2D0PB 3HJBA 3PWKA 1E79D 1TT7A 4OHOA 3IODA 5ES3A 3MCVA 4ZC8A 5KWEA 1QU2A 1Z25A 1W46A 3UGJA 4WW0A 5EKUA 5K3FA 1Z2EA 2FUEA 2VHXA 3WGIA 2JAQA 3K2QA 3CVXA 1RACA 4XM0A 2REQB 4N03A 3BT7A 1M2OA 4YJGB 1RYZA 1V6SA 1GL3A 1WUTA 2CZQA 2Q5QA 1ZUIA 3ANSA 1E61A 1LK0A 4LE2A 5JY1A 4LE1A 4BTLA 4FTWA 3HL4A 5AHXA 1X80B 3EXG2 2I29A 1ECCA 4YP1A 1A2OA 1T6NA 2ZB8A 2ODWA 3ADOA 4CLDA 1XXHA 4X24A 3I2YX 4KVAA 1PBTA 4QQNA 4EPTA 5K3OA 3LC7O 4OBEA 1E98A 4KRFA 2ZM5A 4IJMA 1CR4A 2CKMA 4U7WA 2Q7DA 2DUWA 3CUVA 2YFHA 4IVNA 2IT1A 4J9UE 3AKZA 4DPMA 2PPVA 3ZE2B 3GA0A 1UWCA 3KD2A 3FLBA 1QRTA 4LWPA 5AHRA 2O2XA 3GFQA 4YT2A 3ROQA 2ZR9A 4ZVMA 3NWBA 3PKJA 1M74A 2B2NA 2FH5B 2WIGA 3QY9A 4M4SA 3HDGA 3PI6A 1QYXA 3KQVA 3VC2A 4KFCA 1D7AA 4J3NA 1VIMA 1V26A 4MLDA 4LV6A 2GUWA 3WK5A 1NVKA 2G9NA 3HB4X 2J32A 3UWOA 4BNGA 1QFSA 3N2LA 4DL9A 3BIJA 4DMGA 2DHDA 1U2TA 1DBRA 2YXEA 3FOAA 3W6UA 4GEGA 1XZFA 3QA9A 2ZYGA 4CMGA 1UDRA 3M89A 1P2TA 5LU8A 1WBBA 16PKA 4NBVA 2RGAA 1STOA 4CWAA 4HTAA 3H1FA 3A9RA 3PDUA 3HB0A 3NALA 2V7VA 3VBEA 1YE3A 3A3YA 4J7AA 1Y1SA 1YZUA 3AU9A 3Q7EA 3THOA 1PWEA 3AUJB 1JLLA 4NDNE 1KSFX 2IOQA 4I4TA 3TIVA 4C76A 1CDEA 1V11B 1W1UA 3PVZA 1N9GA 1PK8A 4O4LA 4O2BF 1NJ1A 4OQZA 2OQRA 2V9ZA 5TVGA 2A88A 3BGWA 2TS1A 1AM4D 1DRWA 4RZ2A 3EXAA 1JKJB 4ALLA 5LQSA 2BL4A 3JQEA 1LNSA 3CNNA 1VL1A 3PDWA 3SZRA 3ZV3A 1X80A 2C4WA 1NVMB 4GQAA 4BV8A 2WYUA 1YB6A 3WAGA 3LY7A 3H2ZA 4MWCA 1RCFA 4RH0A 3S1LA 4AK9A 2QXUA 1WPQA 4I3HA 1ZJ4A 1FNSA 1ISPA 1DFGA 4FW8A 4BNJA 3A1NA 2XE4A 3DBRB 4MYHA 2OB2A 2OV1A 2BKUA 2RH4A 5JS1A 3D5EA 1E2LA 3LAWA 4ZA2A 2KM1A 2ZTSA 1C7IA 1JQLB 1TIPA 3W5UA 3L0IB 1FVXA 4C4YA 2BCJQ 3RVDA 2D0DA 2XCUA 1F4PA 4GUAA 1NJSA 2NV6A 2WAOA 3H5LA 1HNXB 2Q45A 5IVKA 1Z75A 3LW7A 4MROA 3CT6A 5ICCA 2FSUA 3WV5A 5I4CA 4OP1A 2AE1A 3ZXIA 1KDYA 4QECA 4BQRA 1E59A 1KZ6A 4LNHA 2HRBA 1THZA 3IUMA 5HGJA 1FZQA 3OFND 1PG5A 1GP2A 1PZEA 1EA5A 2FKAA 3PQ2A 3MXOA 1IRIA 1D8AA 4F5DA 3PHLA 1M8KA 1ZNQO 4B8WA 3NKVA 1FNBA 4F8EA 3I0ZA 4UD2A 4MKGA 1MC8A 3DT8A 5AJZA 5TLSA 3IC5A 4JXXA 1CUYA 3OPYA 3SZOA 4Y1GA 2QRJA 4JLAA 3H3JA 4U9UA 5IMSA 3D2BA 2I2AA 2XVAA 2ZI6A 4II3A 3RFXA 3IX7A 5KVSA 2XZTA 1T9KA 2C03A 1FYEA 3IBTA 2FMUA 2W6JD 4NJMA 1EVYA 3KSRA 5EIWA 5HHTA 2Z6UA 2DPLA 2WU4A 3ILSA 2YRWA 2FETA 3MWEB 4QYMA 4R05A 1WG8A 3BDIA 3KQWA 4MXDA 3TOXA 4JLSA 2JFWA 3UHOA 2WIBA 2Q5FA 2ZJZA 1EFAA 5DK4A 2IYEA 4GE3A 3W5SA 4C1NA 2O2ZA 3WQBA 5H5JA 2C58A 2I2FA 2HKIA 2D8MA 2J9FB 2QENA 3UWDA 3JQAB 4UTXA 3RVPA 2Z4TA 2PVSA 1P1HA 3JWIA 1JWBB 1KARA 2QP9X 1Y5RA 2XQIA 2ODEA 1CJBA 3LA6A 4NCJA 4ZAZA 5B3LA 3KWMA 1YBVA 5KKAA 3E9YA 4URFA 3R7AA 3ZHQA 5CLLA 5BXQC 2BMVA 3B52X 4C7OA 3VPBA 2Q1WA 3L7AA 1E5DA 1NATA 1Y9JA 3H65A 1XF9A 4L4ZA 1VSTA 1TVKA 4HDQB 4N7BA 1Y80A 3IUSA 4DBLE 1AQIA 4JWKA 1HMPA 1OLUA 1QYVA 3NBYC 4I3FA 2VI5A 4R9NA 3K9QO 3OF2A 1O6ZA 4CF5A 1P91A 3H9GA 3AR9A 5EXXA 2WB4A 3K7EA 4PW0A 2XD9A 4DLKA 1GN9A 2YXLA 1U5BB 3SJBA 7AT1A 4OHYA 2X14A 2QYSA 4P4SA 3RO7A 3E03A 3CONA 3MFQA 4H16A 1W9HA 1E79A 2QLBA 4HD8A 4DDKA 2IZ1A 5GM1A 3H2BA 1UFVA 1YB7A 1MXFA 1CQIA 3RAGA 3L07A 2ADOA 1VCOA 3GLHE 1LJUA 2HLNA 4GLFA 4MYTA 5E1DA 1JEAA 1P0MA 4B3DA 1LV8A 1L1QA 5AXDA 4NS1A 1W48A 2H5IA 1AF7A 2W2LA 5B6PA 1DXYA 1QZTA 3C5WP 2SKDA 2GJ8A 2NUPA 5BYBA 3BIFA 1XXHB 2FJ0A 4BVAA 3GIWA 3ZDAA 1DEKA 1XA3A 2C7VA 1EI9A 3AY6A 4H0CA 4M7RA 5EE9A 2YZ2A 5HCNA 2B25A 2X8WA 3G2LA 4JSRA 3TX6A 2G4VA 1JFSA 3R3HA 3DBVO 4RSGA 1PLKA 3MINA 2NVWA 3D8HA 4TSFA 2ZAMA 5B1SA 2ACEA 3P0IA 1BWRA 3KXIA 3MBKA 4KAXA 1E2NA 2WC1A 4ZI3A 5A2GA 1SQ5A 1Q0TA 4EYQA 3TG8A 1DBWA 3L1HA 1XDBA 1C3JA 1XDWA 2KB0A 3OIDA 3KE9A 3MRXA 4GSKA 2FPKA 2OD2A 2QN8A 1CHDA 4QYIA 3EPPA 3LXRA 2GD1O 5DNCA 3NFRA 1ADFA 3DM5A 2HPVA 4ND2A 2P9QA 1EEHA 4L74A 5TB5A 3SI7A 2QPAA 5LXTB 4FCTA 5K2MA 1YS6A 1KC3A 1S4MA 4DWVA 4X61A 1E2PA 2ZAOA 2IY7A 5KMGA 1FS6A 1KFKB 1J2JA 4IVQA 2ZYSA 3ROFA 3E9MA 3RWMB 1JIKA 3JQ7A 4JLVA 4CMJA 4HRVA 1KAOA 1R6DA 3NGLA 1FQOA 1GTJ1 2QUZA 2E4AA 3DCJA 4YO8A 3ROPA 4YMGA 4DV0B 1PEDA 2QT0A 3U40A 1BMFD 3IPRA 1UKZA 2R6HA 4C6TA 3DEZA 1KYZA 1I1QB 3QIVA 2C9CA 5BN5A 1U4NA 4GM0A 1C30A 2H4ZA 2OWEA 3DB2A 2DG2A 4AXBA 1W5FA 2HMUA 5EZYF 3C98A 4R69A 4KWIA 3H04A 4OKSA 2J0EA 4K6HA 4N76A 2JI7A 2VEOA 2D54A 4Q3NA 5IJXA 2DCMA 3I9OA 1S02A 3NRJA 1YS4A 3RHTA 4LXIA 1HEUA 4DEVA 2CMDA 1KYXA 1GU7A 2CVQA 3M0EA 2B92A 2EW2A 4IVPA 1VLJA 3S2IA 4J0JA 2O14A 4NZZA 1VGVA 5DYIA 3JARA 4IUYA 2J6CA 2CL0X 1XIVA 5D7NA 4N41A 1Y5IA 1P7YA 3OY7A 5ALIA 4D42A 1F2TB 1WULS 3FNBA 1NUQA 3GOQA 1PDOA 2P6MA 2ZI5A 4IDAA 4KPUB 4QJBA 5LOVB 3R9XA 4H6XA 3W7BA 2E5WA 3R0IA 4OKNA 4HL6A 1N25A 1ULBA 3GLFB 3KYBA 2XMGA 2I4RA 5EUBA 5T8KC 4ERNA 3BF7A 4PVDA 1WABA 5IG2A 3IHTA 4LOAA 2JFHA 1US8A 5IN5A 2KBEA 3O6VA 1CZNA 4NV1A 1AQYA 5FOVA 1E3WB 4E4YA 3QVTA 3QU7A 1Z83A 1PJ8A 5CNIA 1NBWB 1NLMA 3KOXA 1XJCA 2G17A 5HM8A 3WA6A 2ZB4A 4NMHA 2VSFA 2VC2B 2VAXA 1J0AA 2P8JA 1JWLA 3KQMA 3K1AB 4KRYA 4BB5A 5ICSA 1VJ1A 3U7EB 4NI5A 2Q3HA 3V7FA 4D4HA 3N2KA 3SFTA 1ZZGA 3WLOA 1G8AA 4EY6A 1LS6A 2PX8A 2A5GA 3BN3A 1RJDA 1Y6JA 4HDKA 1ECFA 2AYXA 4WTOA 3A3OA 3UGTA 2O3QA 1T4GA 3BGIA 4MPPA 2XUQA 3H0KA 1J8DA 4CTMA 1LDGA 4QDKA 3TL2A 1NUHA 5T4HA 4CEJB 2P0AA 1N92A 3C8UA 3KD3A 1EG7A 4IDQA 4IAOA 4ML3A 3WSTA 1GHTA 2XNJA 1DPGA 1X1EA 1Q17A 1GTVA 1LVUA 3KB2A 4R8MA 2RB5A 5AUPB 4ZCMA 3HO8A 2V4MA 3IBYA 2WRZA 3O82A 2QN9A 1GNSA 1OPRA 2WJ6A 3BK2A 3JQAA 1X38A 4MCHA 4IOLA 1QTRA 2QUAA 3S6JA 2FK7A 3CY6A 3E2PA 3U39A 2C2OA 5EQFA 1WSBA 5KS2A 3JQBC 3G8AA 5CVUA 2BRUA 1RQNA 4G5XA 1UADA 2GBGA 2P67A 3KP1A 4MW9A 4K05A 1MQSA 1M2VA 3BZBA 2XDAA 1GQYA 3DBHB 3SSNA 4DJAA 4X85A 3EGCA 3EN0A 4MW4A 2GPJA 1C9EA 2D06A 4R1OA 1BRMA 3DEAA 2OUKA 4D0GA 1YS9A 2GDJA 4GECA 4MYRA 1JR6A 3WLQA 5C4IA 4XOIA 2AFIE 1HQYE 1X1DA 5BWBA 1EUCB 3V97A 2ZR8A 3PRKE 2VN8A 2HRRA 2J4CA 5JPDA 2JA1A 2A1TS 2VZ8A 4MS3B 1Q0QA 2KPOA 2X0EA 5BUZA 4H15A 4CQNA 4I50F 4D82A 4R5HA 4YP9A 3KEOA 2GJ4A 3AR4A 5CDGA 1XDDA 4Q7QA 3BA1A 4PSKA 2HPAA 2IUYA 3QKSA 2C4MA 3QMVA 3TZ6A 1E5VA 5K8LA 1K08A 3BXHA 2FHSA 2QUHA 2OM2A 4OFXA 4W1PA 3FMPB 1X1RA 2NW6A 1GNQA 3LCCA 3NM4A 3SDZA 4IHJF 2XUKA 1K4YA 1LX6A 3PE6A 4G1MB 3IAS6 3AR2A 3VO9A 1TMGE 1ZRHA 4BRUA 2GJSA 3OKCA 5CJPA 2C5FA 1SPBS 3RYIA 5AKKA 1ZXXA 2FNAA 1C7FA 2AXQA 2CLCX 2QPLA 3QX7A 4AG3A 1JKMA 2IA5A 3HB1A 1O58A 1SXGA 5JAHA 2QRPA 4LMRA 1EINA 4M7OA 3L46A 4M8KA 4TV9A 1Z47A 1V1RA 2PYIA 3NT2A 2H8GA 1R10A 3RGGA 1YTUA 3R5FA 1RKUA 4C9BA 3R5XA 2J7PD 4Y1FA 1CY6A 4LOIA 1OVMA 1EESA 4TZKA 4URHA 4RY8A 1KI6B 1W76A 3O38A 3E5RA 1Z07A 2D7JA 2ZCVA 3RS5A 2GEDA 3DT9A 4DM7A 1GDTA 1MRNA 1YHNA 3H5IA 5EMLA 5SZHB 4ALIA 1L7QA 1ZD4A 5KNCA 2YV5A 1FVHA 4HWGA 3PT9A 1RYMA 2CZCA 4IYRA 5D3MB 3TTWA 4A10A 4OF4A 4BFTA 3EBOA 4DBVO 2XIQA 3T61A 4OJTA 3C6QA 4R31A 4B3HA 1U2RA 5EL0A 5BWCA 1CUHA 5LQMA 1GL6A 2YW9A 1W87A 4K6FA 3X1ZA 2Y1XA 4AJ9A 1QLWA 2A4MA 1GFSA 3TCXB 1DXOA 1ND5A 1AH2A 3NV7A 2GKOA 4TL7A 1YMQA 5LYJB 4KNYA 2H2DA 4FLFA 1K9VF 5KPJA 3TZQA 3CG4A 5IT5A 2PT6A 1NXQA 3EC1A 2H17A 2MMGA 2R60A 3DV9A 2PZMA 3ZCTA 1SA0B 2G76A 3BE5A 3EE6A 4MLCA 5ESDA 5JJCA 4LE0A 4NECA 2JJMA 1E1RA 1UFOA 1V3VA 3ETEA 2F43B 2LE0A 3T1TA 2JD0A 3B1FA 4BDSA 4LPSA 2YN4A 5BN3A 2BM1A 2POQX 5FL7A 4TTRA 2OCGA 2BFPA 3MWGA 3VU0A 3LQ1A 1GTMA 3TL3A 3MLEA 2Q3LA 2IIVA 2Q41A 2WZDA 3U48A 2M1ZA 4TKMA 1ONNA 2GLXA 1M54A 2XWJI 3QQ5A 4RIHA 1IJKA 4ZOEA 4EJ6A 1FJXA 3RVJA 5EP3A 2X0IA 3CPEA 2HREA 3DDZX 3FI0A 1QQTA 4ADSG 1O9HA 3M82A 4PAQA 1XVTA 3COVA 3L4BC 4MR7B 1I13A 1LLFA 3K0FB 3KQYA 3KYDA 5FO1A 1XNQB 3OOSA 2P6OA 2NVUA 1QBGA 4FMDF 4U2GA 3UCEA 2XI4A 3ZDYB 5LPNA 4P0QB 2ECQA 3NLLA 3QF4B 5C7YA 3BWBA 2QEQA 3RFVA 1DX4A 2REQA 3EXHB 1GTG1 4JBWA 3PGMA 5TF4A 3WZ2A 4D4IA 4DC1A 4YPFA 4Y67A 4NHOA 2YL2A 1AGXA 1P9WA 1XEFA 1XZQA 2J3MA 4GI1A 4GHWA 1JDNA 4RCVA 2AKEA 1A9QA 1I0LA 4GZ5A 5DNVA 5EMHA 3RWBA 5JADA 2HU5A 4L8GA 5EJIA 4DRXA 5LOVF 3Q72A 5CYFA 5L53A 3WRWA 4L5BA 3IVAA 4L4YA 4N8DA 5IYZF 1GAXA 4F3NA 1DRUA 3PFCA 3R2JA 1SY7A 3HMQA 1V16B 2PX0A 1IB0A 3DEJA 1R5NA 3GMIA 4MITA 1L8QA 2ZSJA 1BDHA 1KFEB 2DFKB 2ZSEA 3FMVA 1LLQA 3A6HA 4LV8B 4G56A 1IUNA 4QICA 1BKYA 2B9EA 2NSDA 1R27A 1Y7IA 4YRTA 5DM1A 4B2YA 2UZ4A 1G8SA 1Z4QA 1LLDA 4Z0TA 5JVDF 3KVVA 5LYJA 3VH2A 2BSQA 2WU0A 4HMOA 3H11A 3KQHA 3AU8A 3CEAA 3UJ7A 3ZY6A 2ZUEA 3A11A 3UF0A 1I5RA 1H1LA 4Q3OA 3T3PB 2PGIA 2UAGA 3FSRA 4LSMA 2IPOA 3KQKA 5AJYA 4ZT6A 1JVSA 3LFHA 1I3LA 4P92A 1PFKA 1WEHA 1WW8A 2NXNA 4RMHA 2QT9A 4X8HA 1WY7A 1WXGA 3OY2A 3WNDA 1Y3CE 1T3LA 1R4ZA 2HMTA 3MM4A 4OXYA 3EULA 4YMSA 1U2GC 1C8KA 2EGUA 1HV8A 2AKYA 2YIMA 2H1CA 1AQUA 3EZFA 5FR1A 2NP6A 4FE7A 3FMIA 3HN6A 4DABA 2H1RA 3NHFA 2CXTA 5JS2A 4CQLB 1IIRA 1YB2A 1CP3A 5DTIA 4V02A 5B7GA 1LPSA 4EA7A 2B20A 1FRNA 1PYGA 4NQZA 3EZGA 1HX7A 1UMDB 1EZ4A 2RI6A 1Q0HA 3TDMA 4ER0A 4O1IA 5E9JA 4V0KA 5FPSA 2IPAB 3C97A 2FPLA 1PGOA 3OA0A 4O4JA 1P0QA 1QIDA 3BTOA 3CLTC 1L5ZA 2LDXA 5KNBD 4ENVA 3VSBA 2WFZA 1AF4A 2OORC 2EZ8A 4FKMA 4HDRB 1Z12A 4HLQB 4UHEA 1JZQA 4HPXB 4B3CA 4MQEA 2DOKA 3HZRA 5JFOA 1MVNA 1MA0A 3MA0A 4ID9A 4JXZA 3T94A 1Z74A 4KOAA 4OHMA 3SDSA 4JL6A 5JMWA 1SUIA 2K7ZA 3HVHA 3HP1A 4KFUA 4R3NA 5DXFA 1G3QA 3L92A 3A6FA 4RVGA 1QKKA 4WN9B 1DRKA 4UM5A 2CLIB 1X2EA 3K6JA 4JJAA 4IG4A 4PPQA 5CHYA 4W5TA 4E6EA 5IJWA 4OI2A 2PX2A 2V58A 2YYAA 2ZBGA 4CUZA 1ZD9A 2AL7A 2AR7A 2CWWA 2ZRFA 3DZIA 2W2MA 4AQYB 2O7QA 3I9V6 4JP2A 2GNPA 1YS2X 3S55A 1Q1QA 4A1FA 1DCKA 3DCNA 2QXTA 2YFYA 1PK9A 3RS0A 1PJLA 1QO7A 3GBVA 1II8B 4QBKA 1QDUA 4CBVA 1KJZA 3R7WA 2ZRHA 1HDOA 3KOOA 3CZAA 3I0MA 5D86A 5ARDA 1E1YA 2O4UX 3PQEA 4MI6A 1K9SA 2VNIA 4US0R 3D3JA 3UHJA 2YIJA 3HP7A 4KSCA 4Z2YA 3TTSA 2G4CA 1VZ2A 3FSJX 1HDXA 1HYBA 2DTXA 4HX5A 4AYTA 5CA0B 4MVJE 1KKMA 3PR3A 3CXUA 1D2EA 3EXIA 2JFXA 4IDPA 5A7FA 3EC2A 1U04A 3BRCA 2WP8J 2NXJA 3DE4X 1EAYA 2B5WA 3FBTA 3H9EO 3NBZC 2WA2A 2Q3JA 3SFVA 1ODTC 3KVYA 1NVAA 1KNQA 3EJWA 4GDMA 4P82A 2KE5A 4LG1A 1P1CA 4OB7A 4WVLA 3RFTA 4EG4A 1L9KA 3GLGA 2C9BA 4I1PA 1UXKA 1AQ6A 3TLAA 3JWPA 2IITA 2G07A 2XQVA 5T4EA 2PU5A 1I14A 1ZIYA 4CEHA 5JAPA 3PC2A 2GF2A 1V5GA 4QGGA 1OXUA 3GDFA 3FBGA 3PCTA 4LN1A 4OP2A 4WDRA 3VU3A 1BGVA 1EGVB 3BREA 3T9AA 4GKKB 1I5EA 1IXKA 1XEWY 1YVDA 3JR3A 4JB0A 5EXPA 4O25A 5I9MA 1KGDA 3UT6A 4YDHB 1NL3A 1GA1A 1K06A 1L0BA 4MQEB 4WLOA 4X44A 5COBA 3HWX1 3BRWD 1HFJA 2P78A 3NHSA 2GHIA 1XLTC 3HKEB 4XWYA 5CM2Z 3GP3A 1YZLA 1DHTA 1Z82A 5LNK1 3LF1A 2DT5A 1DV2A 4LZPA 4NOLA 4DLPA 1XEWX 3EVBA 4HSEA 1Q1AA 4U9IS 5I9NA 2BTEA 4YYEA 2R86A 4JQYA 2BFBA 4INZA 3LY5A 1YR3A 4BNVA 2AUMA 5JSHA 3AC0A 5KOJB 3R7SA 1IUPA 4U7FA 3IPLA 1WXXA 2MYUA 3SS9X 2O0LA 1EJBA 1ZK2A 4GR5A 1PSDA 3GDOA 1CUXA 2PJUA 5TJ9A 1IZZA 2G5TA 4C7MA 4C0JA 3EIFA 4XVRA 2HK9A 3TSOA 4QT4A 2AW5A 4H4EA 1J8YF 4ZGBA 2OV3A 4DMHA 3EWNA 1UINA 3CKMA 5I3ZA 2HA5A 1QH1A 4P53A 3IESA 5HRAA 5KSWB 3H8VA 3D3NA 1HOXA 3W2IA 5K9ZA 4G89A 2O7NA 2QV7A 2Y1OA 3AVQA 3L0OA 3QFFA 1EK2A 1J90A 3AF3A 4KRXA 5FKJA 3SJ7A 121PA 4LSZA 5JY6A 2HA0A 5KNCD 4DWWA 4NJMB 2OFOA 1CJKC 4JEHA 1N7GA 3C41J 1CFJA 2AK2A 2G72A 4I14A 4FX5A 4IIVA 1L3CA 3AI1A 1Y63A 4FUQA 4HHEA 1UM9B 2BMDA 1R0BA 4BXOB 4CM4A 2QM8A 2ZDGA 1YFKA 3UAXA 3N8DA 4NRDA 1WW3A 4UC0A 4D8YA 1JAIA 2CMFA 1KYVA 2Q8PA 1E1CB 4ENPA 5AW0A 1O0CA 2RJNA 2YNMC 5ADVA 4AAYA 1O9GA 1IATA 2OE2A 4PZDA 1TCBA 3INNA 4MP8A 4LKRA 5DE3A 5EKTA 2FRXA 2IYXA 2QTVB 3C6YA 3GN2A 3IAM1 1S3SA 4JBGA 5F1OA 2C3OA 3T3IA 3VDQA 4CIBA 5B7QA 2F90A 5I5GA 1GCAA 1VJRA 2IU3A 1CUZA 4TKVB 5E6UB 2AEJA 1R0LA 4EHLA 1MRZA 3W4IA 3MN1A 1XJ5A 2FFJA 2EKPA 1HLPA 3EXHC 1GUZA 1ZS9A 1J07A 1FDVA 4HQRA 4MV6A 2EF0A 1IBRA 1RI5A 3SZMA 1C81A 3AG5A 1GFZA 3O8NA 1SB8A 2ANCA 2JJ1A 5LQJA 2PWBA 4DB4A 1LH0A 2QTFA 3SY8A 4WPGA 3PLNA 3L4SO 2JL1A 1NXWA 4TMKA 2DPXA 5EMKA 1EFVB 3IT1A 4LZJA 5FFMA 3INTA 4JUBA 4B5KA 1PJ4A 2COEA 2QD2A 4A8JB 1QMGA 3ECSA 3EQZA 3UB3A 3NIBA 2PLNA 3LUPA 2XF8A 1TA9A 3GGDA 1HXHA 1MZVA 1UAAA 5K3AA 4JS0A 1GGEA 1Z3CA 1LDEA 1X1AA 1O4VA 3BH7A 4IZ6A 4QRDA 3C15C 3LCRA 4U7GA 4W7HA 4YJ2A 5IKXA 1NW6A 5M29A 1PYDA 1J09A 1CULC 1TZMA 4E30A 2OMKA 3CKYA 4N8EA 1B73A 2AN1A 2XBLA 3H1AA 2PE5A 3NHWA 1UODA 3R3WA 1T13A 3NCHA 2FE4A 1UKCA 3GEPA 2KYRA 4FD3A 4LNUA 3RBXA 1Y9AA 2YWDA 4ITUA 1JXOA 5LMCA 3ZVNA 3JZDA 4R1SA 3PGXA 2H63A 4CKZA 2O8BA 5DPMA 1EFCA 1JEQA 2BMEA 2IYLD 3KHSA 5J2TF 1A8PA 1K6EA 3LXUX 2BEVA 4ZVLA 4U2DA 4BZQA 4L9SA 2QAIA 3E1SA 3ILYA 5JDCC 4EITA 1KDVA 3IKMB 1TMKA 4LXXA 1BJRE 3TZKA 2X41A 1ZGJA 3TGPA 1H1TA 1Q0RA 4M8SA 3BIOA 1HK7A 1GNPA 1EXVA 1SC3A 4LTNA 1AS3A 1LI5A 4ODIA 3KAKA 3GJ7A 1X7XB 3HLTA 3HNRA 4XLTA 3RNLA 2BGRA 2J45A 2J67A 1IWOA 4N5LA 1W5BA 3OMXA 4RHXA 1KEEA 3PD0A 3HDYA 4QBGB 4X8MA 2ZB2A 1WZEA 3R8FA 3FF4A 1NJ6A 3NHUA 1ZW1A 3SJCA 4GF5A 5BSFA