1SBYA

Alcohol dehydrogenase from drosophila lebanonensis complexed with nad+ and 2,2,2-trifluoroethanol at 1.1 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
254
structure length
254
Chain Sequence
b'MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
publication title 1.1-A crystal structure of D. lebanonensis ADH complexed with NAD+ and 2,2,2-trifluoroethanol
rcsb
molecule tags Oxidoreductase
total genus 93
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sbyA00
1E7RA 4JBHA 1O6ZA 4PLGA 3LK7A 3JQ9A 4TRMA 3EDMA 1PTJA 2CD9A 4RVSA 4AJ1A 3CPSA 1ZIDA 1NFRA 5KKCA 1I33A 3IDSA 4ROSA 5JFOA 3F46A 3IUSA 1SBYA 1JW9B 3NGXA 3VH1A 3ZW9A 2F1KA 1ZVMA 4Z0PA 1P3DA 3RWBA 1BHSA 4JX8A 3SC4A 2P5UA 2NVWA 1P74A 4A26A 3WB9A 2FOIA 3VC7A 3U4IA 3L6OO 4ND1A 1IPEA 3HWRA 2VOEA 3FNEA 1VRWA 4K28A 3D64A 3KHUA 3JTMA 3GRPA 5L7TA 2EW2A 3CE6A 4E0BA 4EJMA 4CM4B 5G2OA 3DTTA 3PP8A 2LDBA 3QP9A 2CSUA 2YHIB 4AJLA 1SNYA 3H5NA 4B4WA 4R3WA 2HMTA 1C1DA 5JYEA 1LDNA 4IJKA 3V2UA 4OYRA 2G0TA 2POQX 2FPIA 5TIIA 1GPDG 1LDYA 3QIVA 3WTBA 3CSDA 5C7IO 2X4GA 4MVJA 4FGWA 3NJ4A 1OI7A 4ZQGA 2A35A 5JW6A 1K6IA 1U7TA 5CPFA 1UXGA 1B14A 3JQAD 4NBTA 4TKLA 1I01A 2OP0A 3V1YA 1LU9A 4LISA 2C2XA 1VJ1A 4CQMA 2AEMA 3OEWA 4Z0TA 1ZK1A 3BMCB 3UICA 1A9ZA 4RDIA 3JSAA 4HADA 4TKMA 1KIFA 2ZB4A 2UDPA 4NIMA 2IDZA 1YQDA 2JAPA 3ETEA 1J4AA 5DNAA 3ZWMA 1MUUA 4L4SA 3U0BA 2QRKA 3WS7A 4I1IA 4OSPA 4NR0A 1DOHA 1EE9A 1P1IA 1EBUA 4GWKA 4GX5A 4Q3DA 4Q3CA 4UREA 3GGPA 3MJSA 4FPXA 1P77A 4JBIA 2RHRA 2NVBA 2A92A 3E9QA 4BMVA 5JNLA 4D45A 3S55A 3ZV4A 3WYEA 3H9JA 1NTOA 1HE5A 2CNBA 1Q1NA 1Q7GA 2PLAA 2Y1FA 1XDWA 3T7CA 4CMJA 1E3IA 5A4DA 3ZWOA 1KC1A 2DFVA 2NU9A 4MVJH 1GUYA 1N9GB 3GZNA 4YT4A 1IZ9A 5IXSA 4E2XA 3L6EA 5CHEA 4YJGA 3WGGA 5A5EA 1PJQA 4CM9A 3GVIA 3VVBA 2HJRA 4WLNA 4YRBA 3D3WA 2YY7A 4TZKA 1C1XA 1WMAA 1VL0A 2P5YA 3ASVA 2O23A 1AN9A 4WCDA 1RKXA 1Y8QA 3W6UA 3QVSA 1OMOA 3H6KA 5DDIP 4R68A 3V5NA 4BNKA 3ZHBA 2AEFA 3OQ6A 4PN3A 2JJYA 1LC3A 4WLVA 4J0FA 1P45A 3UOGA 5B4TA 3VOSA 3LSYA 2W2KA 5THKA 4KTTE 1LLUA 1Y8RA 2RIRA 4NFYA 3RFTA 3OETA 1OC4A 1HYEA 3WGTA 4WCFC 1PIWA 1D1SA 3ZV5A 4DMMA 3MTJA 1X13A 3OF2A 1YL5A 2O3UA 3RI3A 4RF4A 4R1NA 4I9NA 2BGMA 4LVUA 3C7CB 3DR3A 1DIGA 4GVLA 1SMKA 1V3TA 3HZZA 4BMNA 1GU7A 1N2SA 3RIHA 4DREA 2FPPA 3ETDA 4RPJA 5DOZA 1UXIA 3W4IA 4Q3EA 1AUPA 5CDSA 1RM5A 4YDRA 1T4BA 5HRUA 3K6JA 4MDHA 4O0LA 4D42A 3UGKA 5JAZA 5A3VA 5H83A 3PDUA 3GGOA 3P2OA 2VT2A 1BRMA 2PKQP 3RAJA 6ADHA 4Y6PA 2EJWA 1EDZA 2PGLA 4BO4A 1JWAB 3QWFA 4UVIA 1HE2A 1PJSA 4NFSA 1UJMA 3PJDA 3WIDA 5JO0A 3UH1A 4FJ2A 1GPJA 3TSCA 1F8GA 4EUFA 2YQ5A 3L07A 4UULA 4JJFA 3ZHZA 4B4UA 4YPOA 4CMAA 4D46A 1FK8A 1L7EA 5IDWA 2C54A 1N92A 1PJBA 2AG8A 3HUDA 3TL3A 3ENNA 1NPTO 2ZTLA 4J1TA 3ZWWA 2EW8A 4WCFB 4BHTA 2HMWA 4B7UA 4FB5A 1FMCA 4GGOA 1IUKA 2VNSA 4J7UA 4YAEA 2I6TA 3X2FA 1BSVA 4BO3A 5KWEA 3KV3O 1PL7A 1PZFA 3NYWA 4I5GA 4BKPA 3ZW8A 2NTVA 3BIOA 1V3UA 2VHVA 2QYTA 2IZ0A 5F21A 4PCVA 1T26A 3F5SA 2X5OA 3DMTC 4QXMA 2DC1A 1BG6A 2GZ3A 2VZ0A 4EEXA 3BZUA 5IF3A 2X5JO 4NJOA 3JD3A 1GQ2A 4QQRA 4BNMA 3U62A 4NBVA 5KVVA 3JQ8B 3P19A 1PZHA 3AUTA 1Y5RA 4RPHA 1QLJA 5DOVA 2WE8A 3DB2A 3IUPA 3TNLA 5A9SB 3NKLA 4IXTA 3JYQA 2JHGA 2FR0A 1KVQA 3NTQA 5KJFA 3IS3A 4CM8A 4BB6A 4D79A 2D4AA 2CF6A 3G49A 4CLRB 4FR5A 1K2WA 3QQPA 1Q7CA 1PQUA 3A4VA 4KQXA 3IQDB 1M67A 3GH3A 2O2SA 2X0RA 2BHLA 2V6BA 3M2TA 3DL2A 4ZVVA 2ZJ0A 3KB6A 1OC2A 1O95A 3JYLA 3WQSB 2I5PO 4N54A 5A1TA 4NFHA 1DHTA 3I23A 4IDCA 3VKUA 3ORFA 4X54A 4BQRA 4WECA 1WDMA 2OO5A 3KETA 2NWQA 3H9QA 1M6WA 1UXJA 3ADPA 3UCEA 1KYQA 4XB2A 5BSFA 5JY1A 2C20A 2EG9A 2O3TA 3NDIA 4UVGA 3TFQA 2D8AA 4IJUA 5EINA 2D59A 2HSDA 3GDOA 3VZRA 3GNSA 2CVOA 2I3GA 2FZEA 3WLEA 3D4NA 1E3WB 1QRRA 2NQTA 2PZJA 2X8LA 3ENKA 5KCZA 3GK3A 4BO9A 4IS3A 3CTMA 1YOVB 4BNWA 2X22A 3WR5A 1G0NA 1DJQA 4QECA 1BVRA 1AXEA 2PFGA 2Q4BA 2OGUA 4CV0A 4GPD1 2GCGA 2ZQZA 3H7AA 4I8XA 3HB4X 4OAQA 4IXWA 2P9CA 3PXXA 3ONDA 2EEZA 2Z5LA 3I9KA 3QY9A 2YDYA 3DC2A 5EQDA 5I8ZA 1ONPA 3JQDA 3C1AA 4QO8A 5AOVA 4CM7A 1YL6A 4D7AA 2EERA 5L4SA 3EVNA 1Y9EA 3HFGA 3F5QA 3OA0A 3PHHA 5TX7A 3WGHA 4PIVA 4ALNA 4AJJA 1QR6A 2B0JA 3TN7A 4MP8A 4RF3A 1XLTA 5BR7A 2VRCA 1ISJA 4OO3A 1P0FA 1HDYA 3KXDA 3QWAA 2XF8A 2Y1OA 3PWZA 2WEKA 1ENOA 1GADO 1LJ8A 2HUNA 1XG5A 3DO5A 4OOFA 4H15A 5JDCA 3EHEA 5JO9A 1GEEA 4Z3KA 1B2LA 3KTDA 4AJPA 3LT1A 5CG2A 4OMUA 2CFCA 1ZEJA 2JAHA 3B70A 1E1KA 4LMRA 4YAKA 5C5IA 5KJCA 3A1NA 3HN2A 3GG2A 1Q7BA 3PQFA 1RJWA 5IZCA 1JKIA 1T2EA 3RJ9A 1NASA 1QSGA 1KVSA 5IDYA 1B7GO 3JQEA 5L3ZA 1MC5A 3RUFA 1C0KA 3NTOA 2AMFA 2AQHA 2E48A 2W8ZA 1WPQA 1WAMA 2I67A 4IJWA 2PGDA 2CUKA 2R00A 3BA1A 1XEAA 4I5DA 5F1OA 4CV3A 2ZATA 4QSMA 2GN4A 2HLPA 4OIMA 2O7QA 4PG7A 4W82A 5JDIC 2X7HA 2V6FA 2BFOA 4ZU3A 4TMFA 1GL3A 3HADA 4KOAA 3GN2A 4C4OA 3T7EA 4XYMA 1N7HA 4MIOA 4BQPA 4NBWA 1T2FA 1JAXA 4C7JA 3PJFA 4BVAA 2P4QA 2PH3A 4E6PA 1YB5A 2GSDA 3G0OA 1AGNA 4NDNE 4NPCA 4CMIB 3GVHA 3VZSA 1JN0A 1WNTA 4F46A 2OZPA 2G1UA 3GA0A 4JNKA 1LQUA 4RV9A 2PR2A 4R51A 3KBOA 1S6YA 1HKUA 1KS9A 4CLXA 4M87A 1E6UA 2FR1A 4CQLA 3QVWA 4U0JA 4OHUA 3MEQA 4ND5A 1NP3A 3FF4A 2WM3A 1MG0A 3GT0A 3JQAB 3SEFA 3LQFA 4QX6A 4MO2A 4OKIA 5TQVA 1U8XX 3WFIA 2D5CA 1B26A 1SPXA 3E5MA 2PNFA 4IDGA 5K6AA 2GUGA 1C3VA 1I2CA 1V35A 2VYVD 4IDDA 4XYEA 2IYOA 3ANLA 4E13A 5JAQA 3U4CA 4JK3A 3KVOA 3L6DA 3Q9NA 3DBLA 4H16A 1J0XO 1EVIA 3VTFA 3L9XA 4BNLA 2QIOA 4Y67A 4N7RA 2WYVA 3JD2A 3ZN2A 3WXBA 1PL8A 4DXHA 3O4RA 2WYUA 4WE3A 1TA4A 1X7DA 3U3XA 2WD8A 2Q2WA 3E18A 2A4KA 3WGOA 1IULA 1KEVA 4NK4A 4PLCA 2Y68A 3BTOA 2H5LA 2O3RA 2WD7A 4IGEA 3TRIA 1DFHA 3RVDA 1ZK0A 3KLPX 1E1LA 1LTHR 2E82A 5G0VA 2NM0A 2GN6A 3KM0A 3BMNB 4BO0A 1VSUA 1RPNA 2Q1TA 3O8QB 3EZYA 4YAJA 1YJ8A 4FQ8A 2BFAA 2DAPA 4CUKA 4QTZA 5TT1A 3DHNA 2Y1CA 2VNAA 1YBVA 4FSHA 1PGOA 1BGVA 4CLHA 1HF3A 1OZAA 3OHSX 1MXFA 1R0KA 1U9JA 2E37A 3GGGA 2UYYA 3CH6A 1NX6A 5I9LA 1DC4A 3AK4A 3WGQA 3NT4A 3VZPA 4AJHA 2NQ8A 3LLSA 5CDTA 1VL6A 3ZWCA 3EGOA 3RC1A 5DULA 4QT0A 3DOJA 3CUKA 3HB5X 1Z74A 3I9LA 1HDCA 4A2CA 5EIOA 3ZWPA 3GUCA 2FWMX 1N1EA 1T2CA 3U49A 1DLIA 4GI2A 4YT5A 5B1YA 4FFRA 3A9WA 1DO8A 3BMOB 4W9NA 4UUMA 3QHAA 3WJ7A 4CR6A 4YAIA 1JQBA 1R37A 4BMSA 3G17A 3Q0EA 1SB8A 4ND3A 1CDOA 4JIGA 4KP7A 3FSRA 4WNCA 2X58A 3JQFA 4HKTA 3KLMX 4B3JA 4YR9A 1D4FA 2YV3A 4NH4A 3PGXA 4HFRA 4UVDA 4XQEA 5A3JA 2C2YA 5I7EA 4FS3A 1E5QA 2OMEA 3SJ7A 1R66A 3DBHA 3ROKA 1CIVA 4TZTA 3OICA 3AOEA 3OJLA 5EQFA 1F14A 2C59A 1PGNA 1PGQA 2CDCA 2V6GA 4FIZA 4AL4A 5C7LO 4XQGA 2X5KO 4ZN6A 2Y05A 3N58A 2C5EA 2Q49A 1O8CA 3S1LA 1HDGO 5JMWA 2HQ1A 1LSSA 5JCJD 1R15A 4ZRNA 1LDBA 3ZDFA 4Z0HO 4N5NA 4J2HA 3RU7A 3IKVA 4DLAA 2PWZA 4OH1A 3QV1A 2NACA 5G4LA 1UAYA 2O3SA 2HMSA 1UDBA 4LRSB 1QYVA 2RBEA 3HNPA 1YXMA 1B8PA 2GYYA 3H2ZA 4CMEC 2UVDA 4XRGA 1XELA 4DC1A 3S2GA 3PQEA 4J49A 1XKQA 1RM4A 3OJEA 4R9SA 1NR7A 4I5FA 4RVDA 3DBVO 1H6CA 3Q11A 5JS6A 4PVDA 4CV1A 5L45A 5IJZA 4YVFA 1BW9A 1VJTA 1H9BA 3I52A 3ZNNA 1EVYA 2VTDA 4JN6B 4H7PA 5KVQA 3QA9A 3PTZA 5I9NA 4YJHB 1WLYA 1P33A 1HETA 1H2HA 1XU9A 5L4NA 1UP6A 1B3RA 2VWPA 4U6QA 5LDGA 3OIGA 4ZD6A 4J43A 1JVBA 4D43A 4HFJA 1DIAA 1DIBA 3H2SA 3GMDA 3HFSA 5CDUA 2O4UX 3FBTA 2QZ9A 3JD1A 3V8BA 3VDRA 2JCXA 2EF1A 5JMPA 4R41A 2AE2A 4QO7A 5BSGA 4YB8A 2RAFA 1F12A 3CIFA 1VLLA 2B5WA 1YS4A 3ZU5A 5CAEA 1M2WA 1D3AA 1WMBA 3PYMA 4ZQFA 4YYZA 3RQSA 4N18A 3CMCO 1WVGA 4RVFA 2BMAA 2PKRA 5T8KA 2HDHA 3DZFA 4BOYA 1ZZEA 2ZYAA 3W4KA 1U3TA 3TOZA 1NXQA 3OFSA 3AM5A 2YQ4A 4FGSA 5F1KA 4E5KA 4R1TA 5I7VA 4GLLA 3UXYA 4ILKA 2JFHA 2VN8A 2G17A 9LDBA 3MJVA 2NSDA 3PI7A 4E2YA 4J7XA 2PZLA 1NFQA 2V7PA 5TT0A 4W99A 3WJAA 5KJEA 3FTNA 1ZSNA 1MX3A 1K0UA 1T25A 4YTEA 3ZV6A 3GZNB 5ITWA 1ISIA 3FTPA 1MFPA 2AE1A 2HAEA 2I9PA 2Q2VA 3DZKA 4GX2A 1KERA 2H6EA 4WEOA 2AG5A 3LT4A 4DYVA 3AI2A 3Q3CA 1I0ZA 4IZIA 4YJGB 5C37A 1YONA 4KUGA 1KEPA 1MGOA 3L4BA 4D3SA 4IQGA 4CM6A 2CY0A 3C24A 3R3SA 1LEHA 1WXDA 5C7OO 1J6UA 3D3WB 1QORA 3CZRA 1EK6A 1RM3A 2O2YA 3WMXA 3NAQA 1C1XB 4Q3NA 3D1LA 1B16A 1NAHA 3A28A 2DT5A 2DPGA 2HK9A 1EUZA 4XD2A 1PU2A 1NAIA 5TJHA 3TZQA 3GZ4A 1XHLA 1WZEA 3AY7A 1Y8QB 1KEWA 2HRBA 3W4JA 1DAOA 4E4YA 1RM0A 5ENDA 3WFJA 4GSKA 4GLOA 4RPGA 4PLZA 4A5OA 3EC7A 2X9GA 1HTBA 2GASA 4OJNA 3PHGA 2BI7A 4JLWA 5FEUA 1DFIA 3OBBA 1ZMOA 2UAGA 2W2KB 5A04A 1O94A 4ZQHA 3KSDO 1Y8RB 3SX2A 1X7GA 1ZXLA 3RC7A 4AJKA 3UHAA 4J1NA 4PLVA 4XGNA 1PQWA 4GMGA 5T57A 3PJGA 4MJLA 1EUDA 1ZK4A 4BB5A 3PGJA 1DXYA 3PDJA 3S2IA 4WLOA 4E2ZA 1H2BA 4B8ZA 2G82A 4IJVA 1LBEA 2W90A 4FBGA 2VOJA 3ETGA 1OFGA 4P22A 3OEYA 3RU9A 3FI9A 4MVJP 4PRLA 3WSWA 1Q0HA 2DQ4A 3RBZA 1TVEA 1ZJYA 2YZ7A 3KEOA 1OAAA 3DZHA 4DBVO 1NQOA 1PS9A 4BNXA 4HP8A 4R01A 3GFGA 3LT2A 2HKIA 2GD1O 1V8BA 2GRAA 4R4JA 2EKQA 1V6AA 4U6SA 1PR9A 2QRLA 5L9AA 3ANNA 3FNFA 2HRZA 5CFZA 1YBAA 2EKPA 3EUWA 4YJFB 1EZ4A 2AA3A 3VH2A 4R1SA 3UCXA 4BUCA 1GZ6A 3NT2A 2GR9A 1LUAA 2WJPA 3D5TA 2Q1WA 4ND2A 1ZEMA 4TWRA 1HYGA 1R12A 2B4TO 3PVZA 2WSBA 3SLKA 3GPIA 4BO6A 1GYPA 1HLPA 5CPBA 3DONA 1PJTA 3F4BA 1E92A 1IPFA 2DBQA 3BAZA 1E77A 1H6DA 3JQGA 3PHLA 2XPCA 3ANMA 2YW9A 3TZ6A 2D3TA 4RQTA 4NBUA 1XWFA 3PIIA 3AFMA 1MP0A 4I5EA 4XZ3A 3Q1LA 3TDKA 4N5MA 4Q39A 4E2WA 9LDTA 3ZWXA 1I3KA 5HS4A 3A06A 1B3BA 3LU1A 1SO8A 2Q3EA 1T1RA 3B1JA 2J3HA 4FW8A 1E3EA 1A9YA 4Z3DA 4HV4A 2VHYA 2NU6A 1A5ZA 5ER6A 4J9VA 2X0NA 3NT5A 4UEJA 4EYEA 4ZQBA 3KZVA 1X1TA 3GHHA 4M55A 5TRTA 3PWKA 4FC6A 1PJ4A 4FC7A 1SEVA 4CL8A 2ZCVA 2YFQA 3Q2IA 3WGZA 1ISMA 1AHIA 3GUYA 5ES3A 5G0UA 1E6EA 4FFNA 5CEEA 3LC2O 1U2DA 1PS0A 1U1IA 3LZ6A 2OBYA 3AOGA 3GVXA 3SXPA 4PRKA 4MP6A 2RHCA 3BMQA 4CM8B 1I10A 4EUHA 4BO7A 4WGGA 3OMLA 4MP3A 2VUSA 1P9LA 4AJNA 3W6ZA 2Y0EA 3TJRA 3KOUA 3I4FA 2JD0A 4QEDA 5AXAA 5T5QA 1QMGA 2JD2A 1YRLA 2IRWA 1IL0A 1EVJA 8ADHA 2BH9A 4MVJD 3UKOA 4W7HA 1V9LA 1TXGA 1GZ4A 3EVTA 3RSHA 2OXIA 5HS6A 3AY3A 3K96A 3H9UA 3N74A 5JDCC 4DVJA 1EEHA 2GO1A 1LNQA 3HDYA 3KYDB 4PG5A 3ITDA 3FPCA 2BFMA 4CQMD 2QX7A 2AW5A 5THQA 3RD5A 4A10A 3ZNPA 3EK2A 3VDQA 4WKGA 1PJ2A 3WWYA 1Q0QA 4DL9A 5L95A 3WTCA 2PD4A 2HMVA 3ZZNA 4R5MA 4U8GA 1RWBA 5IZCC 2VUTA 3PFFA 4G81A 1H6AA 4GKBA 4MIYA 3RJ5A 3H3FA 4UAGA 2BFPA 1A4IA 1CRWG 4BNGA 1FDWA 1GD1O 4M54A 4CM1A 1EMDA 1C0PA 1HEUA 3VPHA 3V2GA 2R00C 2NNLD 3DAFA 3KYCA 3PPIA 3GEDA 4B3IA 5DP1A 3MJEA 1LDEA 2EWMA 1DC6A 4O59O 3PYLA 1E7YA 1QV6A 1E3SA 1HWYA 1SB9A 1W4ZA 1UDCA 1HZJA 4OOEA 5T67A 4FJ0A 1I30A 1I32A 3EAGA 1XGKA 3UW3A 4NMHA 3DFZA 1Z73A 3DQPA 5TS3A 3WYBA 2HCTA 4CUJA 4IINA 1R16A 4XDYA 1HDZA 3QVXA 4JXKA 3STHA 2X6TA 2B4QA 3KEQA 4E33A 4B7XA 5EERA 3DHYA 2IZZA 3RC9A 7ADHA 1E3LA 5KJ1A 1HZZA 2Q45A 2VWGA 3RKRA 3TZCA 4JJIA 4QFDA 4CM9D 3M6IA 2FSSA 4DQVA 4ESOA 4ALJA 3DBRA 2P9EA 1KETA 2FSVA 2NADA 5ENVA 2E49A 2NU8A 3ZU3A 3DAGA 1HSZA 4PLWA 5JBIA 1K5HA 4HUJA 3DEYX 1EUCA 4XIJA 4D3FA 2VQ3A 1HDOA 1HE3A 5JC1A 1QYDA 4AJIA 2ZQYA 4IDAA 3GY0A 1KVRA 1UXHA 3JYOA 1KVUA 3WICA 2P68A 1XU7A 2QW8A 4A73A 4CMGA 4CLEA 5JSFA 3BTVA 3VPSA 4AG3A 1UH5A 4K6CA 3H5RA 3MOIA 1YQGA 4D3DA 1RYDA 1P1FA 4L4XA 2FPGA 3I5MA 3NGLA 4CMCA 4D41A 3FNGA 2J3IA 3HG7A 4IY1A 4S3MA 3ULKA 1U5AA 2J3KA 1QYCA 1Y7TA 4ONEA 3AWDA 5IN4A 1EK5A 2BLLA 5GZ1A 2VCYA 4U0KA 4J4HA 3WLFA 2QG4A 5A02A 4L74A 1LLQA 3S2FA 4GQAA 4KTVE 3NDJA 4FOSA 5EPOA 1NWHA 4L75A 4RL6A 1A7KA 1PEDA 4II3A 4YRDA 4EJ0A 1JTVA 1UXKA 4TVBA 3F4LA 5A9SA 4IUYA 1U5CA 1V3VA 3PHIA 1O9BA 3QWIA 3WBBA 1MFZA 4R5HA 4L8VA 2PY6A 3C3XA 1NR1A 2E4AA 4BKQA 5BNTA 5KIAA 1A4UA 3ONFA 3TL2A 4JQCA 4CLRA 1GUFA 4RLHA 4IMRA 2O48X 4NQZA 1N5DA 1P1KA 2B83A 1YJQA 2DKNA 3PIDA 4LVCA 1ADGA 5G0SA 3FD8A 4M49A 1Z7EA 4CQLB 1FDTA 1IZ0A 3K31A 3NV9A 5LC1A 5GMOA 3I4CA 4J9UE 4A7PA 5U9CA 2HMUA 4URFA 3C8MA 3SJUA 4CV2A 3VPFA 4XYLA 4ZQEA 1E3JA 4RVUA 1UUFA 5KKAA 4J2OA 3K30A 5GZ6A 2QZZA 3WSVA 1ZFNA 1NWCA 4HBGA 1F06A 2EXXA 4PG4A 3QWHA 2QQ5A 4AJOA 3DBLB 1JA9A 3PZBA 1OBFO 4W9NC 5IXYA 3DZIA 1LSJA 4R16A 3LLVA 1XSEA 4NJMB 3CINA 2BGKA 2OL4A 4PZCA 3N7UA 3WX0A 1TEHA 3OQ1A 1UZMA 4RQUA 3M1LA 2NVUA 1MC4A 1YGYA 3G79A 4DPLA 4CR8A 3M2PA 4P38A 4MOWA 1GV1A 1EBFA 1U3WA 2WD7B 4P4GA 4BV8A 1XCBA 4YJDA 3VH3A 4C7KA 3HJAA 1F17A 3QWBA 1ZNQO 5G4KA 4DLLA 1ADCA 4NBRA 4YCAA 3NX4A 3LVFO 4E12A 1SOVA 3OH8A 2X9VA 1EE2A 1GY8A 2EIHA 3VH4A 1I8TA 1MLDA 3ADOA 3RUDA 4Z9XA 4E32A 1BXKA 2X0JA 1C0IA 5IN5A 1NM5A 3F47A 4LW8A 5L7WA 1YBMA 3GG9A 1Y81A 4NU5A 3A14A 4FFLA 2ZTVA 1P0CA 1NBOA 3I9NA 3BHIA 4L73A 1KY4A 1LLCA 1LLDA 4BO8A 3ZH2A 2J8ZA 3CEAA 1JKFA 4HFNA 4WLFA 1K3TA 1D7OA 4WPGA 3AUAA 4DPMA 5ITVA 3INRA 4RO0A 1VE9A 3ZI0A 5CEJA 3TF5A 5J23A 4P4NA 1DIRA 3JD4A 3GOHA 2JHFA 3ABIA 1ZK2A 2WMDA 4II2A 2YV1A 3DTYA 5T6BA 1R4NA 3I9JA 4BV9A 3RFVA 3GC6A 2PD6A 4DGSA 3FR8A 1BVUA 3HN7A 1J49A 2DUUA 4XGKA 3F9IA 3AU8A 3DZGA 4IZHA 1HE4A 1Z82A 2PK3A 3KRTA 3FR7A 4EZBA 2DBVO 3GRKA 4YBZA 1AHHA 4D0SA 5JPIA 3I3OA 4PLTA 3C7AA 1VM6A 2F00A 4J7CA 2XXJA 1YDEA 1PZEA 2P91A 3GPDG 3H4VA 3GVPA 3MCVA 2GZ1A 4GX0A 4XYGA 3ZV3A 3VPXA 1I3LA 5HBRA 1CEQA 4L4RA 3JQ9C 3I9MA 4WOJA 5DBIA 3RUEA 3OECA 5TGDA 3V1TC 3FRJA 4XR9A 2BI8A 2DPHA 1ISGA 3JCZA 5JY6A 1K89A 3JQCA 4M89A 3WNQA 4LN1A 4GH5A 5TJ9A 1IE3A 4IIVA 3UVEA 5IDQA 2FR8A 3P7MA 5JC8A 4KMSA 3ICPA 5COBA 1FDUA 3ROPA 2Y0DA 3LC1O 4DIFA 4OXKA 5T8KC 3WNVA 5CDYA 2DBZA 1KEUA 2JCYA 1E1NA 4BO2A 4Y98A 3IP3A 5JAMA 5K0ZA 4O63O 1GUZA 5BNIA 2VRCD 3GMSA 2NLOA 3O38A 3ONEA 3VTZA 3U5TA 1K6XA 5I7FA 1WP4A 4YA6A 3D0OA 1Z75A 4EBFA 4E5YA 4QFCA 4PG6A 3WBFA 2ZCUA 2C7GA 1BXGA 1R4MA 4F6LA 4W4TA 2AXQA 7MDHA 1SAYA 5K9ZA 2VYNA 3RBXA 3E48A 3ZWYA 1BW9B 1M76A 4E5PA 4XQ9A 1H94A 3GEMA 1EFLA 2H1SA 3W8DA 4HX5A 4KWHA 5DBGA 1YB1A 1CWUA 3I9OA 3JQAA 3QJ5A 2IEDA 5DN9A 1Z45A 4BKUA 3UAGA 3L4BC 4K6FA 4CR7A 3MTGA 2FHSA 4PZDA 1ZH8A 3WYCA 1MB4A 1VL8A 1GAEO 4RPKA 5FWNA 3FPLA 1TT5A 1XYGA 3TFOA 1EDOA 1KVTA 2HK7A 3SVTA 2QYSA 3BYZA 4IDEA 4DUPA 1B0AA 5TSDA 3INTA 4E30A 2O7SA 2GPTA 2ZB7A 1EQUA 3RKUA 1NPDA 1DRUA 3IP1A 1GDHA 5EN4A 1ARZA 5HA5A 1JAYA 1G1AA 3JYNA 1E6WA 5AXBA 1LDMA 4XYBA 1VKNA 3T4XA 4CMKA 2I66A 3TPCA 2XOXA 4DQUA 4MVJM 1HT0A 4TSKA 1H93A 1NQAO 4GWGA 4JBGA 3ASUA 4IGFA 4JP2A 2WDZA 1BWSA 2X23A 3K2EA 4J91A 5A9TA 3SLGA 3HDQA 4EI2A 5A06A 1ZW1A 4ND4A 4RF2A 2NTNA 3E9NA 3E6AA 4CLOA 4ZJUA 1DB3A 1HSOA 1C1DB 3MJCA 4DYDA 4FFMA 2C82A 2YUTA 3TQHA 3B6ZA 3PFWO 1D8AA 4OKNA 4PLFA 3WOHA 3RC2A 4LSWA 5DT9A 2OOSA 3R6DA 3ZCXA 1DDOA 4HNHA 1JLLA 1WWKA 1X0XA 4DIBA 4CQMB 5B4UA 2EHDA 2B4RO 4W6ZA 5B37A 4PLHA 2AQIA 2PZMA 4KZPA 5KOIA 4UEKA 3LDHA 1Y6JA 4ZICA 4FOOA 5KJ6A 1GZ3A 2Y66A 3HE3A 1RYEA 3PWSA 2VHWA 2PZKA 1W73A 3BTSA 3BHJA 3HSKA 1QLHA 3QE3A 3R3JA 1P1RA 3FHLA 5ICMA 4FFPA 4DBZA 4ZHSA 1T1SA 4XGIA 4KUEA 1DBVO 4HNGA 1A7AA 1HRDA 1HL3A 3DOOA 4UUNA 4ZA2A 3T4EA 1U8FO 3B20A 3OP4A 3K73O 3OJ0A 4UVHA 5BT9A 1ORRA 5KTKA 1NVTA 4EJ6A 2ILTA 4AJEA 1GTMA 3F1LA 1B8UA 3JV7A 4ZGWA 2JCVA 3KSZO 4WLUA 5HTOA 5AXDA 4Y6RA 2FMUA 1ML3A 1IHYA 2B5VA 2ZJ1A 3I1JA 1CETA 2JD1A 4KDEA 4U7WA 3E03A 5IAAA 1W0CA 1QXSA 2IEBA 5U1PA 2Q46A 2TMDA 3TZHA 1U7HA 2GLXA 4F45A 4CL3A 3AUSA 1GYRA 2WWRA 2Y1EA 4EUEA 2IXAA 2EGHA 3L77A 4FDAA 1X14A 3DZJA 2PGJA 4J16A 1WW8A 4PG8A 5EMHA 3ZHXA 2QRJA 1ULUA 4DTIA 3ROQA 1LQTA 5A03A 1ENZA 1ZUD1 1X7HA 2YV2A 4L0QA 1PJLA 4ID9A 2CDAA 2NU7A 4XR4A 1VI2A 3WQRA 2VYND 1R0LA 4MINA 3C1TA 4LGVA 4EEZA 3MWEB 3Q9UA 4YJHA 3JQ7A 5A05A 2J3JA 2OORA 4NNJA 3PQDA 4BNVA 3JQGB 2D2IA 2HO5A 3ON5A 4K1LA 1ADBA 1PSDA 3E8XA 2GGSA 2I65A 1ONOA 2AQ8A 3VZQA 4GKVA 5A9RA 5TF4A 1R6DA 5COQA 2ZKLA 3RUCA 4CMBA 2VTEA 2D1YA 3VKVA 4I08A 2FZWA 2EJVA 1UP4A 2C5AA 1HDRA 2UUOA 1LA2A 4RZHA 1YH3A 4B4VA 4TQGA 5ILGA 4AJ4A 3H3JA 1B8VA 4GMFA 1H9AA 5DCUA 4ALIA 1VC2A 2ET6A 4J1QA 2FY8A 4BNNA 1I2BA 1I3MA 1H0KA 4KWIA 4DA9A 2NV6A 4CMHA 3DDNA 3WGYA 2IYPA 1ONNA 2R2GA 4XB1A 2J5RA 4CMEA 4BNJA 3G1TA 4N5LA 2DVMA 1S7CA 4CM4A 1N8KA 4IM7A 2YHIA 3DWFA 4K26A 1LRLA 5JE8A 3BMQB 4BNFA 3KUXA 3ZU2A 2Y93A 2CVQA 4KQWA 2FN7A 4WEQA 2C07A 3LC7O 4ZRMA 2DTEA 1N1GA 1NQTA 4XRRA 1LX6A 4OXNA 2H63A 4F6CA 1HYHA 2VZ9A 8LDHA 3DHEA 4Q3AA 4DIOA 1W6UA 3IMFA 2Q50A 2QHXA 2UV8A 3JQBA 4U5QA 3UCFA 4RVGA 2O4CA 1H5QA 3IJPA 4A03A 1ZO8A 3AI3A 2OBNA 3PK0A 1YE3A 4MKZA 4AFNA 4J6FA 3MJ4A 4GBJA 2JFGA 4DC0A 2OP1A 5A5FA 2C7VA 3BMCA 5EL0A 3G3EA 1I2ZA 2VT3A 3AM3A 5BSEA 1ADFA 1T2DA 5U4QA 4FFOA 1F0YA 1WDKA 1BTOA 1LSOA 4MVJE 4BNUA 3TOXA 4J0EA 1TI7A 4GGPA 1GYQA 4TROA 1X1EA 1K6JA 4B3HA 4EDFA 4Q3BA 1QP8A 3FCOA 4LK3A 2D5AA 3U09A 3F1KA 3ZHYA 1Q2XA 2B35A 3WIEA 2ZYDA 2PKQO 1E7QA 4FD3A 3K8ZA 3KYCB 1KOLA 1X0VA 2IXBA 3E82A 4DPKA 1CYDA 3AU9A 2RH4A 2WYWA 3AUUA 5FF9A 3D7LA 1KBZA 3AM4A 4RZIA 1E5LA 1LSUA 2O50A 3LF2A 2ZB3A 1N9GA 3AFNA 4XA8A 5DF1A 4L9RA 1PJCA 4CJXA 5KVCA 1QV7A 2W4QA 3DFUA 3CMMA 1PR3A 5DZSA 3PLRA 4M8SA 4MVJF 4CPDA 1A27A 3H8VA 1U3UA 4YQYA 5G0WA 3BXXA 3DAPA 4YXFA 5GZ3A 1DIHA 4Z6KA 4TRJA 2A9FA 3IKTA 1LI4A 5TNXA 1PWZA 4JROA 3K92A 3OJFA 4YJFA 4LSMA 4RF5A 3MWDB 3DBRB 3WWZA 2FRDA 4PLYA 4RORA 4R3NA 3MJTA 3I83A 5F3RA 2BRUA 1MV8A 5DCWA 5JYDA 2BELA 4YWJA 4XWYA 2H9IA 1UAGA 4QUKA 1UDAA 1MXHA 3WMWA 4EW6A 5CEFA 1YKFA 3ZWAA 5IDXA 2C0CA 4JCOA 4WOKA 4XX0A 4OQZA 3KSUA 4R54A 3D3EA 3CKYA 4MKRA 2BKAA 4GVXA 5CP8A 3PYXA 1B15A 1I24A 1XQ1A 5CG1A 3FBGA 3PHJA 3RROA 1XA0A 2XAAA 1X15A 2B37A 3RBVA 2DLDA 4CUZA 4E31A 2YJZA 4P4LA 4OSOA 1D1TA 4JP3A 2J5QA 4S1VA 1E7MA 1FJHA 4CODB 4CM5A 2GN8A 2W98A 3UN1A 1Y9AA 3WDSA 4BIIA 3S8MA 4XKJA 3MOGA 5B12A 4NHEA 2VWQA 4IBOA 3ZWVA 4RCVA 1FF9A 2YHUA 1GQYA 1NVMB 1JWBB 2V65A 2DBRA 4RLSA 3TZKA 3KYBA 4TRRA 2XXBA 2OHXA 3UFXA 4O6VA 2W2LA 3DXFA 4Y9DA 1GCUA 5AQ1A 3SBOA 1CQIA 1NPYA 2R6JA 4MKXA 2Q1UA 4KUHA 4D0RA 3QSGA 1FDVA 1ZSVA 3GHYA 4NU6A 4B7CA 2YDXA 2DTDA 1NQ5A 3FNHA 4AJ2A 1DRWA 4NG5A 2ZIZA 3ZWBA 1XQ6A 5CDGA 4ITUA 1M75A 4HWKA 5H82A 1O5IA 3H9GA 3L0DA 4EITA 1XR3A 2ZYGA 1DJNA 3DMYA 1VSVA 1G0OA 2VRBA 4PGFA 2VYVA 5DP2A 1CJCA 1GQQA 4HY3A 3U9LA 2BF7A 4YAGA 5K6AC 4WCFA 3GNTA 1YB4A 4YEDA 4BGUA 1NNUA 3EMKA 3KYDA 1P31A 4H3VA 5GY7A 3O9ZA 4RPLA 3IIEA 4GSLA 3V1UA 1U2GA 2I76A 3NJ8A 2Y1GA 3HQ4O 4BNHA 2GERA 3EY4A 1I3NA 3GDFA 2PV7A 4ALKA 4YRAA 3CXRA 3Q2KA 3QRWA 4R69A 2B69A 5F5LA 1JVSA 3AY6A 3GNQA 1ZCJA 2G76A 2LDXA 2RH8A 1YWGO 4NK5A 1TT7A 2NVUB 3ZU4A 1XIVA 3QVTA 4MIEA 3LYLA 5TC4A 3VPGA 2UUPA 2Y1DA 1OOEA 4A27A 4ALLA 4XQCA 3JQ8A 4XJSA 1CERA 2X86A 5IFLA 3W8FA 5B4VA 4G2NA 3ICCA 4B4OA 4YT8A 4MVJG 3C85A 4G5HA 5G4KB 1U3VA 5DCYA 4BO1A 1MA0A 2J6IA 2X9NA 4A0SA 5MGBA 3KO8A 3QW2A 3UF0A 4NI5A 3E9MA 5T64A 3GDGA 4AICA 4I9HA 4LMPA 1DEHA 1LRJA 1P1HA 3AI1A 4CM3A 4JJGA 1A72A 1H6BA 2Q1SA 1QKIA 4PZEA 1ZKMA 4BO5A 4INAA 4BNZA 4D44A 2BGLA 1GV0A 3DOCA 2J5KA 3GR6A 3GAZA 5JXWA 1QYWA 5JAIA 1DFGA 4B79A 1F8FA 5ADHA 2YYYA 1SCUA 3OIDA 3R0IA 4EGFA 1YO6A 4FJ1A 4OL9A 4BGEA 1C14A 2ZTMA 3NDRA 3BHMA 2Q2QA 4XJTA 3K2BA 2VZ8A 4GAEA 2PTGA 1TB4A 1E3WA 3P5SA 1R4NB 2A94A 4IPTA 1UZNA 4RGBA 4BS9A 4YACA 1Q0LA 2EP7A 4G65A 1YOVA 1JU9A 3D5QA 1HDXA 3RASA 5G0TA 1HXHA 3L4SO 4GX1A 1L1FA 5F5NA 3OM9A 3GF4A 3JQFC 4XEHA 3DMTA 2GN9A 3FN4A 2P2SA 2VHZA 3SC6A 5FI5A 2DFDA 2NTJA 2DTXA 5JCXA 4OM8A 4M86A 1BDBA 3D4PA 3OA2A 1TLTA 2AEJA 3AOEC 1DC3A 3R1IA 5I7SA 5EESA 4E5MA 5EJ2A 1BMDA 1LC0A 1CQJA 2CVZA 4NZ9A 1LRKA 3QLJA 2P4HX 3IL2A 4Z9YA 1NVGA 4PVCA 3D4OA 5JCJA 4PFJA 3U4HA 3OJOA 4DWVA 2IE0A 2O3JA 5I9MA 4HXYA 4MPDA 4AVYA 1UZLA 2AHRA 1ULSA 4K9DA 3NUGA 4W7IA 2X0IA 3P2YA 2AQKA 4MVJI 1T24A 1PX0A 2HJSA 2ZK7A 3QVOA 4OQYA 4PLPA 4UUOA 1DRVA 2E6UX 5COAA 3O03A 2IZ1A 4FN4A 1BXZA 1E7WA 5IG2A 3VVCA 1O89A 4J3FA 3PEFA 3JQ6A 4WK6A 2W2LD 1ZXBA 2DM6A 4O5OA 4HFMA 4J1SA 1VJ0A 2CMDA 3G1UA 4J4BA 4FCCA 2OFPA 1IOLA 2Z95A 5L51A 1NYTA 2Q99A 3AW9A 1A71A 3W8EA 4E5NA 4BNYA 1M6HA 1C0LA 1EQ2A 2ZB8A 4XIYA 3NRCA 3LT0A 3FWNA 1BXGB 1FDSA 1R4MB 5FI3A 2D0IA 4UUPA 1QYXA 5L7YA 2I3AA 4TRNA 4L76A 1E7SA 2HK8A 1ID1A 1ZK3A 2CZCA 3F3SA 1GCOA 3H9EO 3HDJA 3INGA 1U4SA 3NEPX 4RVHA 4XCVA 4Y8VA 5ER9A 1SEPA 3ROMA 4LCJA 4I9UA 1U28A 3HHPA 4BL5A 5LCXA 4BKOA 4IQ8A 5HM8A 1TT5B 4YQZA 1W8DA 2DUWA 4JGBA 3CZMA 4OGWA 2DU8A 4BNTA 1P1JA 1WZIA 2FP4A 3DBHB 3HDHA 4NJMA 1NHWA 1ZMTA 2WE7A 5FFFA 2P9GA 5HWSA 1SC6A 2V6MA 4Q9NA 2Y99A 3GLQA 4TVOA 5L4LA 4F3YA 4WNIA 1Z6ZA 2C29D 1WDLA 5C3MA 1JKJA 2O3QA 2Q4EA 4E3ZA 1GFSA 2PH5A 1NHGA 3I6IA 1LXCA 4IDBA 4IMPA 5F1PA 1G6KA 3B1FA 3AJRA 1O0SA 3RUIA 4RJTA 4CMIA 1ISFA 3L9WA 5BNFA 3ZNQA 4E21A 2JL1A 1YL7A 3ZWNA 1N7GA 2ZTUA 5FYDA 3IAHA 1PS8A 1L7DA 3O26A 3K9QO 4OXYA 3GQVA 3LF1A 3ITKA 2EV9A 5MDHA 1EVZA 1CF2O 2VHXA 4DMLA 4CLOB 3B1KA 4R1UA 4CLDA 2PD3A 2GDZA 1DPGA 1MG5A 2JFFA 5DBFA 3V2HA 3JYPA 5LDHA 1Y1PA 5TLSA 4M1QA 4XDZA 3COSA 4LCEA 1EFKA 2Z1MA 4BGVA 3F6YA 4Z9FA 5ICSA 5H81A 1PGPA 1ZSYA 1DSSG 3ZNOA 4WUVA 3EYWA 5BQFA 1KY5A 1DHRA 4RDHA 1SZJG 3C7DB 3MZ0A 3W1VA 3E5RA 1PJ3A 3M1AA 1DAPA 1GR0A 2VWHA 5JLAA 3RCBA 3VAZA 2PA3A 2Y0CA 3X2EA 3RUHA 5JDIA 1T2AA 3H65A 4WJZA 3UUWA 1PWXA 5AYVA 3GN1A 5AXCA 4O1MA 1I36A 2GF2A 1YDWA 2Z1NA 4R9RA 3WG9A 1M66A 2I99A 1DC5A 3I6QA 4DQXA 3OSUA 2EP5A 2JKVA 2BD0A 2VUUA 2B36A 2WTBA 4DLBA 1AE1A 4B8WA 1BDMA 1IHXA 3K5PA 2NUAA 3BMNA 1P44A 1I5RA 3O8QA 5I8WA 1QG6A 3BTUA 1PL6A 1T4DA 2GZ2A 2IODA 2X1HA 3E1KA 4ALMA 2EKLA 3GAFA 6LDHA 1ENYA 1Z7BA 1U4OA 2CDBA 4IS2A 3RFXA 3IJRA 5IZ4A 2RCYA 5BSHA 3IC5A 1FXSA 5AVOA 3H5AA 3GEGA 2G5CA 2SCUA 1VKOA 1GEGA 1NFFA 2CF5A 3PLNA 3VHRA 4DRYA 2EGGA 1SOWA 3ST7A 3EW7A 3Q6IA 5KVSA 4WLEA 3C1OA 3IOYA 3PZRA 5L40A 4P8RA 1ISHA 1PQPA 1ENPA 3GFBA 1JDJA 1VPDA 4UVEA 3JD0A 2Y67A 3WQQA 4KDFA 4UEOA 1R0SA 1DLJA 4IQ0A 1E1MA 1IB6A 1V0JA 3TWOA 5KNLA 1ZBQA 4YT2A 1HLDA 3RUAA 1ZJZA 1PZGA 4LRTB 4J90A 5ILOA 1E0DA 3S2EA 3EZLA 1J5PA 2TMGA 1IY8A 1UP7A 3DZBA 3GVCA 3NTRA 3BMOA 1IYZA 4BNIA 2YFHA 4WASA 4J4TA 1UR5A 1YVEI 1AXGA 3FWZA 3WGIA 1Y5MA 1KC3A 3JQBC 2OUIA 3JQ7B 4BGIA 3PRJA 3PJEA 3OIFA 1LDGA 1PGJA 3OQBA 4GL4A 4Y6SA 3U4DA 2HU2A 4IIUA 2GNAA 4IDFA 5L53A 3ZGYA 1YQXA 4BKRA
chains in the Genus database with same CATH superfamily
1E7RA 2V03A 2X3FA 1ETHA 3T3PB 2P78A 5AHRA 4DNPA 2JCGA 2ZSKA 1WCV1 2BEVA 3P9NA 1C29B 4MAFA 4MV6A 1U0GA 1ZIDA 2QBYA 4NE2A 1QIMA 3N8IA 2Q0HA 3LWDA 4ZZIA 3FHOA 5JECA 1YB7A 3IDSA 4P2GA 1H5UA 1W4LA 4XUDA 4TVSA 1W88A 1TYEB 4OSEA 1LJLA 2W2QA 3VH1A 1KH2A 1THZA 2H7XA 1ULHA 4MR7B 3SKVA 4BMDA 4UHKA 1P3DA 3QNUA 5TPZD 4NXMB 3I62A 2QU8A 2O9JA 4GOOD 3BE4A 1P74A 1XRSB 1XZHA 4HXFB 3IE1A 4YRMA 1U0EA 4BX9A 1IU9A 1KSFX 2GZHA 4OHWA 4RNDB 3HH8A 1RI4A 2IS4A 2CZGA 2XWJI 2GHRA 3D64A 1X1SA 3UJBA 2UVQA 3TEMA 4D9MA 5KTPA 3ZIAA 1DCFA 3IQEA 4E0BA 1M5UA 5F51A 3PP8A 2FQYA 2XCUA 2CSUA 4XOUA 2GDJA 2JRLA 4CKZA 1SNYA 4LZLA 4R3WA 2V4ZA 3AO0B 1NVVR 3BKWA 3OTHA 1W1WA 1FSFA 1LDNA 2P9QA 4HNUA 1A8SA 1EWTA 1I4LD 2H1LA 2HPHA 2FPIA 1NU6A 3DJYA 4OYRA 3OU7A 2WWIA 4H17A 4D0NA 3CSDA 3HNOA 4AI6A 1EHCA 1TW2A 4Q9HA 1POWA 3B1WA 5C7IO 3NJ4A 3G89A 4ZQGA 1ZN2A 1K6IA 2CMKA 2PT6A 5CPFA 3WO1A 1OU4A 1B14A 2XH8A 3Q3EA 4TKLA 4LYYA 5E3JA 5SZJA 1LU9A 5DVZA 3MWGA 1PSZA 1N6KA 3I1FA 1PFWA 3E3MA 1OTXA 2V7VA 5E7QA 5FTWA 5LA6B 2XD9A 1Z62A 3PC2A 5DNDA 1MDFA 1DTSA 2LR0A 4LXYA 1HT3A 2BRUC 3O4GA 4GI7A 1Z4LA 4RDIA 3ET5A 3F3MA 4TKMA 2XA9A 2ZB4A 3I8SA 2IYSA 2VPZA 3KU4A 2IYVA 4DA0A 2F1HA 1X8JA 4LOKA 4LRWA 5AHWA 4LNUB 3ZWMA 3WS7A 4L4SA 2CHGA 3UQZA 1QTRA 4GP6A 2GZSA 4NR0A 4OSPA 5CYPA 3W3AD 4C0JA 4FVTA 4GX5A 4Q3DA 3PEWA 4JI0B 2ZR7A 4C2BA 4PX3A 2ARKA 2GXQA 3GGPA 1B0PA 1XCOA 2AJDA 1SU6A 2CB0A 3GUHA 4FPXA 4TWJA 4A0HA 3FBWA 4HLCA 1P77A 2G08A 4EABA 4NOLA 1IK4A 2C4UA 5B58T 3WLKX 2QN7A 4ZMRA 1P4HA 1SZCA 2ZR9A 4O3FA 2RGEA 4J0GA 4LJ6A 3M4NA 4R1MA 4BFVA 1AZSC 1N5RA 2RHDA 3BH6A 4Z1MA 3UMGA 1ZVQA 5ICCA 3S55A 3D8RA 3H9JA 3ROTA 2QUIA 2Y0BA 2WQZA 1XA4A 2PLAA 1V6SA 4LI0A 1XCMA 2Y1FA 2B8NA 4MROA 4CMJA 4P80A 1R6UA 3NM5A 1R0ZA 1U6KA 2NU9A 1N9GB 2LD4A 2JIQA 2ZB2A 3GZNA 5IXSA 2WSIA 4CEIA 3IELA 2IOFA 2OCKA 1QCDA 1QOZA 5CHEA 4FX5A 2QTMA 5ESDA 1Y63A 2E0IA 5FBZA 2QE7A 3EMBA 3F2VA 5CBPA 3GVIA 5AVSA 2Q5FA 2PBZA 3QXGA 2J4FA 4WLNA 1XTRA 4IJ6A 4YRBA 1EHIA 1J0AA 3D3WA 1U2EA 3U16A 1UPUA 2UYHA 1PN3A 5KU7A 3I5AA 3NYQA 5DPMA 2XADA 1VL0A 5JWHA 4NCAA 3LY8A 1FFBA 2A1UB 3T7TA 1L6RA 1TRHA 2GS9A 3D81A 4LIPD 4I66A 4LE1A 3D8HA 1JJFA 3MT8A 1RKXA 3TW6A 5MFPA 1Y8QA 2HGSA 2D74A 5IPFA 3IQIX 4BRUA 2V0NA 5DDIP 4MCAA 1JILA 4WL0A 3C3PA 4DDKA 4EAAA 3ZHBA 3OQ6A 4TS3A 4HVLA 1DXOA 1LPPA 5B4TA 5J5CA 3EPKA 1LNSA 4D3YA 4RHYA 2RIRA 4HZUA 4UMDA 2EJUA 3UJPA 3RFTA 1U63A 1YR7A 4G1VA 4M1MA 2NAPA 1HYEA 3MMNA 4BC0A 1PIWA 1CIPA 1D1SA 3V6LA 4DMMA 2DY0A 1JFSA 5AJVB 1A3CA 3AVXA 3GLHA 4UHHA 4BVBA 4C22A 2I7DA 2O3UA 3VFDA 3VA7A 3RI3A 4E2FA 4HZIA 3GLGB 1KYWA 2C92A 4DR5B 1RQ2A 2GXSA 1FCJA 4I9NA 4BEBA 4JFRA 5B7NA 1DIGA 1XLUA 4GVLA 4I55A 1SMKA 1V3TA 2C1EA 2AZ4A 3KWLA 4X0EA 4WX2B 5IBRA 1N2SA 2D1SA 2QQEA 3OURA 4DREA 1UFQA 3VHQA 2C2WA 4YHHB 3ILXA 4Z8XA 1E2BA 1RM5A 1JDNA 1QTIA 2XQJA 2CL0X 1SQSA 5K2OA 5F7ZA 4INPA 4I46A 4D42A 2Z9DA 3P9ZA 3RYFB 4EG4A 5JAZA 3C43A 5IYZF 3RYCB 3FLAA 5FWDA 1RE0A 3SHVA 1N1MA 3K0FA 4AY5A 1XNQB 4AW9A 5C1OA 2Y27A 3PDUA 1OF1A 3ZV7A 5I3CA 4PTZA 2P75A 1P2GA 2VT2A 1BCSA 3GLTA 2C3MA 5CH3A 2GT1A 2IW3A 3EIOA 2EJWA 1EDZA 2PGLA 2QDXA 2EQ5A 3QWFA 4UVIA 4DMRA 4DV2B 5J2UB 2C2HA 1PJSA 2EJCA 1DKRA 1A9PA 2VO1A 1WEKA 4AX8A 1WZ2A 4WUTA 1UJMA 2WWXA 3PJDA 4QPDA 5B36A 3ROEA 4XH9B 3HBNA 3EISA 1NDQA 3TSCA 4CU2A 3RRFA 4L9WA 3ZHZA 2Y8EA 2D62A 3QPCA 2CT8A 4DHWA 2DCUA 3PA8A 2A88A 2QIPA 1V16A 1KQOA 1XAGA 2JF0A 1LCIA 1VXOA 2R44A 3ZDDA 1I2DA 3EFBA 5EHIA 1Z4JA 3BXOA 1MAHA 3DEAA 2WA1A 4IRUB 3EA4A 4OI4A 4PS1A 1WUHS 2HMWA 3G02A 3DDWA 4LOIA 4A6EA 2QAIA 2QAJA 4BWFB 3FMPB 1HI9A 2C9ZA 4YAEA 2BFDA 1BSVA 5JOQA 3UJHA 4RSHA 5EIEA 4ZEWA 1TCAA 3W5SA 1RYYA 3NWEA 3PVCA 1NQXA 2OHJA 1NJ8A 2QTNA 2QTBA 4QUIA 4BKPA 4DRXB 3V1LA 1XMPA 2XDWA 1IQRA 2QYTA 4B85A 1JECA 1NF2A 4POAA 3EVFA 4PCVA 1N9ZA 3UW1A 1XD8A 3FHJA 4AMYA 2X5OA 4QXMA 2DC1A 1BG6A 2GZ3A 2PMKA 5TMDA 4EEXA 1SXJC 3BZUA 2X5JO 5A0FA 4BNMA 2J3EA 1G3IA 2FG7C 3U62A 3HCDA 2KLBA 1YZTA 4G1EB 3KJXA 1Y5RA 2R86A 3HXKA 5CVTA 4UBNA 1XMVA 3UAXA 1U8AA 3R3YA 3DB2A 1UM8A 1D7AA 4CKEB 1ZC3A 3P2EA 1LPSA 2FR0A 4OJKA 2AMJA 5KJFA 4LBVA 4EL5A 4TLMB 3BWDD 4BB6A 4C88A 3G49A 2XNDD 3GXBA 5FNVB 1T1EA 4FR5A 1QO7A 1P0IA 2ZBEA 3BH0A 1PQUA 1BE0A 2B8JA 2VTVA 3B7GA 4TLAA 1KAGA 3CVWA 2W6OA 2IITA 3CUWA 2IOYA 1I6KA 4TMKA 2BHLA 3VR1A 4UU8A 4DM4A 2OENG 4FCVA 4BC1A 3L0OA 1R9NA 3EFOB 3NZEA 5E2BA 1J9GA 5EMNA 5LQCA 2XZLA 2I5PO 4N54A 5A1TA 1WF6A 3I23A 3ITEA 4IDCA 5AK5A 1FQOA 4X54A 4YUYA 4EVRA 2ECPA 3OKAA 2RG1A 2ZUCA 2OO5A 5HE9A 1MN6A 1SCUB 3H9QA 3L3BA 4FZRA 4KG7A 2HPZA 1USVA 4CGYA 4XB2A 3V8NA 4KQJA 2G4VA 4GLBA 1ANKA 3NDIA 3ZCSA 5JJKA 5JG7A 1E66A 1N6NA 1U3GA 2D8AA 2E89A 1WDWB 4HK4A 1KAMA 5EINA 2HSDA 3LE8A 3GDOA 1UKYA 2CNWD 2CVOA 4NE9A 1GAQA 1LWOA 3B1XA 4B33A 2HBZA 4R0VA 3D4NA 4FIDA 1BOFA 4G4IA 2IBTA 1D0VA 1K8XB 1ST2A 1XK7A 2VJYA 3GK3A 3EXIB 4RACA 4I99A 3CTMA 4KOEC 4D4JA 5JIBA 5KNLA 1DX6A 2QP9X 2ODTX 3BBLA 1QLWA 3UYKA 3WR5A 1G0NA 1Z4PX 2EDCA 4M0FA 3MSCA 3L7MA 1NVEA 4OGFA 3HTXA 3V1MA 2P9FA 2R62A 1SXJB 2JFYA 3T7JA 3WC4A 3PFGA 3B1YA 3MCAA 1HFWA 4L72A 4M8KA 1CUVA 2I1WA 4Q7JB 1WMFA 5F2KA 1QGUB 1WA5A 2RJOA 3C70A 5DX1A 3I9KA 3QUQA 3T9DA 3QY9A 1IZZA 2PUHA 4WT7A 5I8ZA 5KB3A 3D4LA 3MQFA 1CJBA 3H2YA 5AOVA 2NAFA 5AD1A 1W25A 4YP7A 4OHBA 1QCCA 5DXFA 5JJBA 2J32A 3UWDA 2HA0A 2W2PA 4YP9A 1VGRA 4QUGA 5BO5A 4RVNA 1Y9EA 421PA 3F5QA 2PYIA 1ZLYA 1WMSA 3C7TA 4IJ5A 4PIVA 3GFSA 1MJFA 2OAGA 3UWMA 4IIXA 1EFVB 4WNAB 3ZS9A 2UUBB 1JPNA 2ZI7A 1P0FA 1N0UA 1CDDA 1I2AA 3QEOA 2Y1OA 4ZV7A 4BTLA 5YASA 3SZRA 2VDNB 3DZDA 3VSEA 2FOLA 2PANA 1Q57A 2IHZA 2HUNA 3PCXA 4EW3A 4F92B 1YK0A 1J0CA 2FWIA 2KJQA 2Y4NA 2RGWA 3EOBI 4C43A 5JDCA 2YWJA 3FX2A 2H00A 3RK4A 4Z7OB 2V3CC 1BJKA 2AVNA 4NMXB 5F2OA 1PVOA 1CUJA 1DEAA 1KOJA 3KTDA 3LT1A 3RVRA 1EG7A 4ZCMA 2LPMA 5CG2A 4IEEA 1QHFA 1TZMA 4O2LA 8GPBA 2YUIA 3DJFA 4OMUA 5KUTA 1ZEJA 4KIGA 4XJXA 5C5IA 3T12A 4EG0A 2KW5A 3OU2A 2JA1A 3ET4A 5KX5A 4AO6A 3RVBA 4QGAA 2CE2X 5IZCA 1JKIA 1OY1A 1MT3A 1NASA 4YLEA 5EIHA 3L04A 2V98A 4LGMA 1B7GO 4UHCA 1MNAA 3HU3A 4CTMA 4J0CA 1OREA 5HFAA 1DKPA 4KXLA 2AMFA 3RHZA 1JBEA 4MQMA 2W8ZA 2HYDA 3ILYA 2YICA 1A2OA 3OQMA 3U4QB 4CF3A 1Z39A 7REQA 4BDTA 3ADBA 4LMBA 2R00A 4I5DA 2Z04A 2XQVA 5I7AA 3G2KA 1QAQA 4YLGA 2BZSA 2FP4B 4R9VA 4TS4A 3IT2A 5IUNC 2B9VA 3F97A 4L8YA 4G0WA 5HE8A 4W82A 5JXHA 1T1JA 1XZMA 2UYOA 4OUDB 5ALPA 1DG1G 2Z08A 4JENA 2H0RA 4C0KA 1MH1A 3FNRA 4E5DA 1F5NA 2XRFA 4C7OA 4KOAA 2O1WA 3GN2A 2VF8A 4MQFB 4V39A 4QBGB 1D6MA 2FEPA 3NS7A 3NIDB 4U2FA 2EQBA 4C1BA 4EGCB 2NT4A 3EQ2A 4NBWA 4S35A 5J2TB 1A5AB 1KBOA 1BKYA 1VIDA 2PV0A 3GFRA 4FMPA 4QPCA 3GLFB 4C7JA 5FB3A 1CJTC 1S9HA 4BVAA 3RS0A 1DQRA 2P4QA 3T0IA 5HOQA 4MULA 3DXXA 1R3UA 4NPCA 1A98A 4G8JA 3LQ4A 2A9JA 3R3UA 4YQEA 2IZOA 2FUKA 2GEFA 2NZVG 1AGXA 1JN0A 2X2PA 3LHFA 4DLNA 4F46A 5ETJA 2BR4A 3HVKA 4CIBA 1ZD5A 2G1UA 1PHRA 2GAJA 3BZBA 5E6UB 1O8BA 3BK2A 3QG1A 4RV9A 5CFNA 3A4TA 4B73A 3WRYA 1S6YA 2ETXA 4EI9A 3Q72A 4CLXA 3MIIA 1E6UA 2FR1A 5DB4A 3QVWA 4Q7LA 4CQLA 3KBBA 4L7VA 4ND5A 2JJ1A 3F96A 4GW3A 3AR7A 2WM3A 4K81B 3IP7A 2ABWA 3RVQA 3JQAB 1J2EA 1ZCZA 4QXQA 3SEFA 3V7YA 1WMDA 2A86A 3LQFA 4MO2A 4X6YA 3ZBQA 4B44A 5KBYA 3U7FB 1U8XX 3S28A 1YDGA 2PNFA 4IDGA 1T8RA 4MEBA 5TQ2B 5KU1A 1V35A 4XYEA 4AC9A 2IYOA 3ANLA 2WABA 3NM4A 3U4CA 1MRSA 1LPMA 1FNNA 1ZOLA 2XRYA 3KVOA 4ID3A 4MI3A 4MB2A 2EFEB 1P29A 3OQNA 4H16A 1EVIA 3G9TA 3PNSA 3MOSA 5JYEA 1S2GA 1XMXA 2QMOA 4KIUA 5EJMA 3KUCA 2DLCX 4I3HA 3B51X 1AQYA 4TSFA 3OM8A 1GO2A 3H1AA 2WM2A 4DCOA 3I0ZA 3CXUA 1J9ZA 1I1NA 2O0MA 1JYFA 2XMCA 3G88A 2X14A 1XJ5A 3DE1X 1U90A 2WD8A 3E7DA 2HHAA 4NBSA 5EJ4A 1UBKS 2CNLA 2P69A 2FMKA 1Z5ZA 3NALA 4PLCA 3N2GB 2WLSA 3G85A 3BTOA 4DW8A 4F06A 4QXRA 2O3RA 3B52X 3I09A 3UXMA 3BC1A 2PN1A 3A0UA 3C48A 1DFHA 2A3RA 3CC8A 4ZVLA 5NLLA 1LTHR 3E9RA 2I4IA 4FHZA 5FCDA 5K7SA 4NZNA 2WIFA 3G5AA 1N4AA 1VSUA 1V6CA 1RPNA 2Q1TA 3CRVA 5C35A 2IKSA 2GHIA 3ICOA 2DAPA 4FQ8A 4BLUA 1T9ZA 3CSUA 1W36C 2WJ4A 3I2IA 1CUYA 5BY2A 1NBMD 2B9EA 4EK9A 2XSZA 1PW7A 2V7XA 3F98A 3M81A 3FDIA 4RK4A 1UBMS 2JGEA 4TTJA 1R0KA 4C4YA 4DADA 4KPGA 2PZBA 1R4ZA 2UYYA 3CH6A 3GGGA 3W5BA 3ZJUA 2CMHA 1P7PA 3ZKWA 1SA0A 3AK4A 3AJDA 3DG9A 3VOTA 4TXNA 2OBLA 4X91A 3KP1A 3V4LA 3AVQA 3FCUB 4FILA 4F5DA 5LJLA 4MWCA 2JLXA 1KSHA 1VI6A 4EM6A 1MRZA 4L5AA 5HUJA 4ZOEA 2ZKIA 3RC1A 3MHTA 4YXWA 1LV7A 1HDCA 3I9LA 1YE8A 2HMAA 4YBRA 621PA 4HDRA 4FR0A 1JLSA 1KRHA 1YZNA 3K0BA 4PNHA 1MORA 2OQVA 3W5CA 3DM5A 2DPXA 1N1EA 4WXHA 1T2CA 1DLIA 2BT4A 2PUTA 4P7FA 2NZJA 3T7IA 4ARIA 1HDEA 3H8WA 4FFRA 2CC2A 3A9WA 5JLJA 2F43A 4DV3B 4ZQCB 1Z56C 4YAIA 4QU9A 4NNPA 2QDKA 4ZVMA 3G17A 3NPAA 1YKGA 4JSTA 1CR6A 1SB8A 1TNDA 2M1XA 4JJ7A 4ZVSA 2WT4A 1CDOA 4DEXA 4KP7A 1U0JA 1T3HA 3IUQA 3O2NA 4L0CA 5AK6A 2O2HA 1SULA 3KLMX 4YCJA 5HIKA 1RRMA 1RTTA 2WF6A 2YV3A 4HPXB 4CG1A 2VK1A 3D6VA 5I7EA 1R88A 3IQHX 2WAYA 2XUAA 4FS3A 4R83A 1GPLA 2F8MA 1R66A 4I1SA 3OICA 2WHRA 3FYUC 4DA7A 2BFCB 3R76A 1WMEA 4YGXB 1Z22A 4AL4A 4NKRA 3PITA 3R75A 2UYQA 3N2EA 3THRA 4F71A 1JZQA 1W36B 5AJHA 4FEYA 4I36A 3SEQA 4ZN6A 3OEHD 3GBPA 4G0VA 1O8CA 2WIKA 3S1LA 2BW0A 3ONNA 5C46F 5I51A 1XDZA 3W0LB 3HKDA 5JCJD 1R6TA 4DGQA 3TRFA 2FF7A 2AC4A 1M10A 5I9SA 4QD3A 3ZDFA 5AVRA 3BSYA 1Q0UA 2REQA 1JEJA 2X2EA 1V8DA 1SIBE 3E58A 1R6VA 3IKVA 4OH1A 4L28A 2P0EA 2NACA 2XMPA 3UTCA 2YHAA 2O3SA 2BMDA 2HMSA 1UDBA 4RQBA 2VFAA 2WSSA 3HNPA 3I9FA 2IYUA 3W9SA 1B8PA 3H2ZA 4BFCA 4BTEA 1RFGE 4CMEC 4XRGA 5L3VA 5M2QA 2XDQA 1L5HB 1W5SA 3GIDA 1QIHA 4J49A 1FNDA 1RM4A 4IGAA 4REQB 4U3JA 3QLVC 2HA7A 4ASUD 1I7LA 1Z36A 1CR1A 5E6RB 1X77A 1E6KA 1H6CA 1YMVA 4PVDA 5L45A 3C8UA 4DIUA 5IJZA 2NV0A 3MS2A 4YVFA 5L3SB 2WFMA 4R9NA 3TIIA 1FMLA 3ZHOA 3UXEA 3OHPA 4XX1A 3LSTA 1BWPA 5JXGA 4HAOA 2F7SA 3PUKA 4JELA 2Q6TA 3IKJA 3CZQA 1EWKA 3JVDA 1SK9A 1C1YA 3WK5A 5L6LB 2IU4A 2I7CA 4ER7A 3KSAC 4NEHB 4OQNA 3N3AC 4KYUA 3DDCA 2QVLA 2YWFA 4DCCA 1GZ7A 4GPEA 4IOMA 1V1RA 4J43A 2ERYA 2EATA 4PQGA 4JLDA 4Z4HA 4D2IA 3G8BA 3HFSA 4FE4A 4I50F 4Q21A 5BSVA 2R8EA 4C20A 2CGEA 1SCAA 2OCIA 3U3OA 4G2TA 2QZ9A 2R66A 2GMWA 3FYUB 3JD1A 3L8EA 4CT0A 1VP9A 4JEMA 1Q22A 4EY8A 3VSCA 4BP1A 1SUEA 3VV2A 1T29A 2Q41A 3FHTA 4M0MA 1F12A 4POOA 1VLLA 1GKYA 4RHCA 4OVKA 3R8FA 1KGDA 4P3KA 4FT4A 1RHMA 3KPJA 2A2ZA 4KNVA 5CAEA 4BNXA 3U3RA 4BX2A 1C80A 1SRQA 2VVTA 4H9GA 2E2WA 3DLPX 2PKRA 1DCKA 4OY3A 2HDHA 2OZLB 1RKBA 5EMJA 3LX4A 2GAOA 3NOXA 1EP3B 3M4JA 5HZHA 3PR2B 1LNZA 1H9CA 4BMZA 2CLDX 4FGSA 3RTGA 3LVBA 1U1GA 4HRVA 4R1TA 2P27A 2JLRA 4GLLA 1GIAA 3UXYA 2J4CA 2RMKA 3HZHA 3MJVA 1W48A 3PI7A 5JS1A 2J59A 4J7XA 2WLTA 1N1DA 1NFQA 2V7PA 3HABA 2A7XA 4JVOA 4W99A 5TT0A 4DEYA 2J6BA 4MGKR 5KO2A 5C53B 2WTAA 1HNXB 4BBPA 1K0UA 4ZANA 4UM9B 4N3BA 1VP3A 1KJQA 3TTUA 3VR5A 1WHSA 5H0IA 2HIHA 3FTPA 1MFPA 1JAIA 3H18A 1DQNA 4GX2A 1AQIA 1I14A 1YIOA 4QARA 4AULA 4F4CA 3VRHA 1MGOA 3W5UA 1U2PA 1PI3A 4RZ3A 2IV3A 3B13B 4CM6A 1KTVA 1GA4A 4D3SA 1T3TA 3CEPB 2YS7A 1G64A 1VJCA 3OIWA 4B9AA 3H05A 1DWOA 3IAUA 4PZYA 3C41J 3CZRA 4RV4A 5I4CA 4ECEA 3NXKA 1OR8A 1C1XB 1E9BA 1SC4A 1VSBA 1B16A 3QKIA 4LPKA 4YCBA 3ZGXA 2JIZA 2DPGA 2FRDC 2HK9A 2TECE 5FWYB 3FKSD 1PU2A 4Y18A 3TZQA 3OT4A 1ZC4A 3E4CA 2FUCA 3AY7A 1X1CA 2HRBA 1TA0A 4OUKX 3W4JA 5KWSA 2NUTA 1SKYE 1GSOA 3WFJA 4BDSA 1P1BA 2PL1A 2QJOA 2XYHA 2X9LA 1BFDA 1IOWA 2E1PA 3ZZTA 4OHPA 3AKZA 4IGKA 1HTBA 5G3ZA 5EKSA 3V7UA 3IIMA 4JLWA 3NEYA 3L0SA 1GZUA 1ZMOA 3OBBA 5EZYA 2Q7DA 4LZWA 5CDHA 1L7AA 3ZZMA 2FW8A 2P9BA 4FI3C 4F5WA 5JNSA 3RC7A 4AJKA 4BAZA 2X1VA 5AVVA 3GGJA 5EE1A 4LQDA 1QF6A 4G8DA 1ISPA 2PLRA 5EQJB 2D1RA 3PJGA 1EUDA 5A6VA 1FFCA 4C3ZA 5IM4F 1JHUA 2VDMB 2RAPA 2IYEA 1E4EA 2P1RA 4UD6A 4WLOA 3VZBA 1GPYA 4DG5A 2APJA 2YZGA 1XTVA 4XW2A 1RXIA 4IJVA 3SX0A 4Q9JA 5H4GA 2PUVA 3G2MA 4FBGA 1Y0BA 3IEVA 1WLSA 3U9TA 3OEYA 1KBQA 5KNDH 3TZLA 1Q5PA 2QSYA 3QFRA 3INYA 3ZEIA 2R97A 4H1HA 2RJ3A 4OHZA 1Q0HA 1P3JA 4EZIA 1F4LA 3BRWA 1ZJYA 2YZ7A 2ZI3A 3ECSA 3IBSA 1MQAA 3DZHA 5HF5A 1GPWB 1YU9A 1UFRA 1NMQA 4R2HA 4HP8A 1FMTA 2Q3JA 2QMHA 3L8ZA 3O9MA 4R01A 4TKVB 3S1AB 3OE7A 1FS6A 2AOXA 3GFGA 3DYIA 4FT2A 5LLDA 3V9PA 1LZLA 2GD1O 5F3DA 1EXDA 2Z98A 3V7NA 2WJ6A 1J2YA 1XVIA 1N2OA 3MCZA 4EQZA 3HCOA 1U3CA 5I9IA 1IPHA 3DCJA 2HRZA 2X8AA 4X45A 1ZGJA 3EUWA 4YJFB 3NIBA 4PC3A 4R1SA 3OFJA 3UCXA 5JWRA 1GFIA 1K92A 3LLUA 2ACVA 4BUCA 1V96A 4K8OA 4TWRA 2ORED 2ZSHA 1E1RA 4ND2A 5EUBA 3UJAA 1UJ2A 3NDPA 4AXXA 1H1LB 1L5YA 2LWIA 1T5DX 2YNMA 5BVHB 1M1UA 3E9YA 5BN4A 5K6RA 4E1BA 4YV2A 3SLKA 3E2PA 1UBUS 3MWEA 4HDAA 3CM0A 4NU0A 2JS7A 1ZUHA 5CA0F 3TQOA 1WS6A 1XNJA 2IPLA 5CPBA 3EXHC 4XWTA 5CNIA 1H2XA 3JWPA 5KNCA 1OH7A 3BAZA 3WRXC 3VR2A 3IUNA 2JFPA 1P7WA 1OV6A 4YMVA 2XJ9A 1G20B 1TMYA 2GHTA 4HB3A 1T5OA 1NN5A 4XE5A 1Z6PA 4CHGA 1E3DA 1L1RA 2MSKA 3UOAB 3IRUA 2QTGA 3MT7A 4U9UA 4ZREA 4RTSA 2P6MA 5CITA 2A9OA 2ZYHA 3Q98A 2X3YA 3IAEA 3A06A 1MQ8B 3LUJA 3LU1A 1SO8A 1GQOA 5AR1A 1LF0A 3U1BA 1KZ7B 1PR4A 1QRAA 3B1JA 3M9WA 5I7UA 4TZ0A 1XN4A 3G0BA 1YQWA 2I80A 4QLAA 2BY4A 2QTLA 3T06B 4RH0A 1KFCB 1SD5A 3BA6A 5TGTA 3OUUA 4F6RA 4YRZA 2AMLA 4N39A 4EHKA 5JYBA 5DGIA 2K2QB 3DEJA 5LSAA 4NECA 1RAEA 3PWKA 4NEQA 4GOKA 1Y1TA 3UFXB 3AZQA 4LBYA 1RXUA 2H5EA 4X20A 4HSEA 5AJZA 3TR0A 3WGZA 3STYA 2C4KA 5CEEA 3HR4A 2OBYA 2OVFA 3AOGA 4RW0A 1VDMA 4CM8B 1ZMRA 2B1RA 3E9DA 4MP3A 4S24A 4HB4A 2X77A 2C8JA 2G9UA 4R2LA 4OQFA 3ZPXA 7MHTA 4QYSA 4KFCA 1W0JA 2JD0A 3Q8XB 4HAUA 2AB0A 4JXZA 4LYDA 5CK4A 1SIOA 4FLFA 1JJ7A 2PMDA 1EFPB 5E7JA 3LI2A 4GE0A 2LW7A 3QFSA 1IL0A 3GJ0A 1RZRA 1TLFA 2X19A 4B6JA 5FOQA 1JHQA 1Q17A 4X1KA 3R9XA 1EVJA 2CLKB 2BH9A 3KC2A 4W7HA 1TXGA 3VYUB 4CIWA 4NF2A 1GZ4A 3K5IA 1ULZA 1Z0ZA 3KSRA 4R2XA 1M73E 3D6UA 4IDOA 4XD7D 2LZ0A 3M1IA 2JC3A 3DBOB 3MJRA 5TY0A 3FPCA 2WM8A 2JFBA 2ZIXA 1M2FA 4F93B 2C7RA 2IU6A 2QX7A 5THQA 1ADJA 2AF3C 2O5RA 3QU2A 5JRZA 1TFRA 4YMSA 1RYMA 4H1TA 1WPRA 3D43A 2JHAA 3W5VA 1VOTA 1PEKE 3H2HA 3PFKA 4NZYA 4IR7A 1AK1A 4MVCA 5LPNA 1QWOA 2HMVA 3LCJA 3L06A 3GRCA 4I4TB 1RWBA 4C01A 3ILVA 3PFFA 4ZRDA 2XB8A 1U5BA 3ABRB 5J5AA 3PFNA 3H3FA 3DHWC 3WE7A 3WL8A 4CM1A 4C0LA 1CSEE 4PF1A 2QN8A 4ENVA 2D3WA 3S40A 3VPHA 2BCJQ 3V2GA 1FYVA 4NPAA 3K1AB 1WP9A 4B3SB 2EBUA 4JBXA 2NNLD 1DVRA 2C8VA 3PPIA 4GS5A 5DP1A 3MJEA 1LDEA 1ABEA 1W0KD 1ZH2A 2QD2A 3IB3A 1E7YA 5IT4A 1SB9A 3KXLA 1P6XA 2WJYA 4QASA 5T67A 4PYRA 1L3BA 5JH7B 4A9AA 3KAPA 3PSAA 1VGQA 2F4NA 1GPAA 4RZ2A 3LA6A 4CUJA 4S1NA 3BERA 3PE3A 1TVCA 3UV6A 3AR9A 2ACEA 3FAKA 3TUIC 3CONA 3KEQA 3MC1A 4B2LA 3SZOA 4B7XA 1I0LA 3A6PC 2BI4A 5CGZA 1E3LA 1EK1A 2E4ZA 1K7FB 3JWIA 1IG3A 2I1LA 1QHGA 3GQBB 2L2QA 1KKUA 3QEKA 4JJIA 2FSSA 4PONA 5DI9A 5CYOA 2EZ8A 1BX3A 3ICWA 1N3BA 3RHSA 4DQVA 4WZAE 4B2YA 4RY8A 1OZHA 2XMZA 3HCEA 3CNOA 2ZIEA 3OKFA 2NADA 1W581 3LK6A 4FQ7A 4PEVA 5ENVA 5K0FA 3DAGA 3DYBA 5KTNA 4C7VA 1HSZA 1DP4A 3F71A 5ARDA 3WWDA 2OXCA 3G2LA 4EY5A 4HUJA 3DEYX 1EUCA 1E2HA 2ZRIA 3L02A 1XN1A 4EG7A 3CUSA 6YASA 1HDOA 1EA5A 1HE3A 2BJWA 3NHRA 4B84A 1YMQA 4DBLE 2FQ1A 4BFLA 3GELA 5KKNB 4AQ7A 2IUFA 1RWOA 1UXHA 1WQ1R 4O2BF 4ZEVA 1AQJA 2J6CA 3BVPA 3FDZA 2ZPUA 2VHEA 2P68A 3QLUA 4WOCA 4ZVTA 4CLEA 5I3ZA 2QOEA 1GSHA 1RQNA 2OV3A 1HMPA 3NB0A 2B1GA 1PNQA 4DJ5X 2CJFA 5IBQA 1K66A 1RYDA 2PT9A 2YXNA 3QTLA 4EHBA 3UGTA 1M6VB 3I5MA 3N28A 3NGLA 1ZWKA 2WYOA 1GNPA 4B7ZA 3PKJA 3IMCA 1U5AA 4XLZA 1IHDA 3L43A 4CQJA 1JUDA 3WP0A 1YGPA 5ALQA 1E69A 1Y7TA 3B89A 1IMJA 3SIRA 2VPYA 1H8ED 2O8DA 3GROA 5DNCA 4PYIA 3ZVLA 2C99A 4OLFA 3WNZA 3LM8A 2C5HA 2PCLA 1A7KA 2LE0A 2A0WA 4II3A 4RL6A 4YRDA 1KI6B 2FRVA 3MGAA 1JTVA 4HUQB 1II0A 3CVVA 3AJ8A 2ANBA 2P6UA 1O9BA 3PHIA 3L7BA 3QWIA 2DFTA 4Q1EA 4OLJA 1MFZA 1UJNA 4DV0B 3D4IA 1K27A 2VEOA 2IZ7A 4L8VA 4ML3A 3B12A 3W5IA 1X7YB 1XQWA 5EFZA 5HKLA 4KQFA 3GJ8A 1MHPA 3Q4GA 3NHAA 2FW7A 3K3PA 4CLRA 5E4FA 1AV6A 3UUGA 4I1YA 4EG8A 2O48X 3EPPA 2FFRA 5ULLA 2QAGA 1RXEA 2LP4Y 1UKAA 3BE8A 3WQBA 3V4VB 3JPYA 1JDBC 4F9TA 1FYDA 3W2TA 1YJQA 3MA0A 3MGBA 4MR8A 3TIXB 5DH9A 2YS6A 2WMOB 3FD8A 3KKMA 2L69A 1OUMA 1TJ3A 2QG6A 3EVZA 1W30A 2FEXA 2I2AA 4RK6A 3BPSA 5U9CA 2EKBA 2HMUA 5BMVB 2XBUA 3VPFA 2A5LA 2ZT6A 4GDMA 1Q0ZA 2XX3A 1JQEA 3T41A 3P9RA 5EEGA 4J0IA 3DDUA 2I7VA 4O2AB 5KKAA 4RTMA 3PNYA 5GM1A 4NAVA 4HLUC 4LWZA 3B8EA 5B3JC 5EJ6A 3GP5A 3Q15C 2IY8A 5H9WA 1L9XA 3PEEA 3MSXA 2YC4C 1F06A 2EXXA 3CY6A 2OOKA 1UCFA 3O8OB 3R7WB 3ZD7A 3DBLB 4HS4A 1OBFO 1Q6YA 5D3MA 4LVNA 4XGRA 2MWMA 5DSXA 1LSJA 3KZXA 1QP7A 2YXPX 3SQWA 2BGKA 5LWQA 1QYRA 2V7EA 4G36A 3N7UA 4PZCA 4D96A 3M1LA 2DRIA 1ZU5A 2DP4E 3PQ2A 3ZDAA 3HJFA 4TTAA 3AB3A 4M9ZA 3ZH9B 1ESMA 5DGHA 4V0KA 2PJRA 2ZWVA 4NENB 2A0FA 1JR4A 3RS7A 3O83A 4CR8A 4ZYUA 1QVRA 4WBNB 3RT9A 1GAWA 3VPDA 1QQ5A 1USUA 1QHYA 5KTTA 2UXDB 1EGVB 3EQ9A 1N2BA 1R27A 2C31A 2OCDA 3PXBA 4V02A 4YJDA 4WJKB 4C7KA 2XKAA 2F8SA 3E8MA 1WSWA 3I5YA 1V4BA 3QWBA 2FLWA 3OLCX 4K3VA 1QK4A 4BPRA 5H16A 4PYNA 3NX4A 3BWEA 3KVNA 3CKKA 4GI1A 4E12A 5GAJA 1KYIA 1VA5A 5ALMA 2GEKA 4ZODA 1QH9A 1WQ4A 2FZVA 2EFJA 3RM3A 4V0SA 3O31A 1GY8A 3H99A 2JI9A 3HR8A 1ES9A 1YCGA 2O2CA 2VXBA 1Z35A 1Q44A 2HX1A 1JDBB 2GYVA 4ZVRA 3F6BX 3OX1A 5AKEA 3HGMA 2EBFX 3LQYA 4U39A 2EL7A 1E2GA 4R1LA 1U7PA 3EVEA 2BEWA 1J20A 2QYOA 1T0HB 3CLSC 2SECE 3WKEA 1QH8B 4KO2S 2BZ0A 2GRUA 2JAWA 3A14A 1USIA 3M49A 3UIEA 4N0PA 3EPLA 3BHIA 5FAXA 5LP6C 3GFFA 4L6CA 3ZH2A 1GTRA 4IOKA 4CNBA 2IHJA 3TAXA 2WHPB 3FLBA 3EGXB 4WLFA 5JPDA 4EIWA 1PR6A 2BUAA 4FP9A 4RO0A 5CEJA 4JBLA 3JD4A 1RC8A 1G8KA 2IPAB 1P39A 4I1OA 1E2KA 4L27A 1GZDA 2FPSA 1T3GA 5T6BA 2YZMA 1I5EA 3KKEA 3WL3A 4IOJA 1HMYA 4DCVA 3LXMA 3GC6A 4TX1A 4DGSA 3VDXA 3T5AA 1HLGA 2XGMA 1ND6A 5ALSA 3RS2A 1NW4A 3DVSX 1P75A 5DHUA 3WGLA 3M6AA 4C0QC 1NRXA 3AU8A 3F9IA 3U7RA 4XCQA 1HE4A 2B7CA 2JAQA 1CQPA 1DIOB 2GLTA 2PK3A 3KRTA 5KYUA 3CCCA 1L4BA 3FR7A 2Z2JA 4P93A 3KKNA 4EZBA 4YR7A 3EVCA 1WB9A 4MV9A 4YBZA 5TPWA 5DBHX 2W11A 4PLTA 5GV8A 4IDHA 1VM6A 1APBA 1XTTA 1L5GB 4X97A 4X93A 2Q9BA 3GBVA 1GQSA 1NYLA 2PRJA 3O1JC 3MRTA 1T0IA 2WWWA 5FXMA 4AYWA 3D5EA 2GZ1A 4H18A 3B9BA 4O4IA 3RDPA 4EP1A 5C3MA 2Z6QA 2PL3A 2YIJA 3IAM1 3I9MA 4PAGA 4QTTB 4WOJA 3OECA 1CE8B 4Y2TA 4V1CA 2WFAA 4UHDA 3S2SA 2VAPA 4ZI7F 1TPZA 2DFPA 1JSCA 4MDFA 2ONJA 1FJXA 1TOAA 4GH5A 1IE3A 5IDQA 2PKXA 5JZBA 5LUAA 5HJEA 4L15A 2QY6A 5LYYA 3H1PA 3D6JA 5TGZA 3NWPA 3T3NA 2IIPA 3ICPA 3SLRA 3AF2A 3ZZ0A 5IAJA 1RWNA 3ORHA 1VBNA 1CY4A 3LC1O 2SCUB 1OXKB 3JR7A 3QVJA 1JDSA 1L7XA 4YRNA 3SQOA 2Q6IA 4FE7A 4KKVA 4LDPA 4A3SA 1RLUA 2W00A 3HY6A 3B9QA 3IP3A 4PAOA 5DKFA 2GXUA 3OZUA 1GUZA 4B6QA 5BNIA 2KM1A 3O38A 3BORA 1NG1A 3U5TA 4LJKA 5HIIA 3OC0A 4I4CA 1S01A 3QZUA 1JXOA 5LP6B 4R8MA 5F1YA 3U3KA 2OESA 2XWBF 2B5OA 4DLWA 4QLBA 4QBIA 2W6MA 3T7KA 5K0EA 4QFCA 2QMEA 1SGWA 2ZBRA 4F6LA 4CN8A 1V3QE 3T8YA 1K4YA 1E2NA 1MB0A 1VIMA 4WINA 4YFYA 1UANA 4ZCIA 2H4XA 3ZWYA 4E5PA 3O92A 2O05A 4UE2A 4ARZB 3OIYA 1YS9A 1E9VA 2BGWA 4CG0A 1Z3IX 1CWUA 2HQRA 3HKEA 5CT5A 5BVHA 4YY3B 1ZAKA 2IEDA 1R6XA 4G4JA 5DNEA 2JIPA 3CLUC 4KRXA 1L5MA 1BKDR 1NQWA 1E4YA 3A32A 1F2UB 2FHSA 2JHPA 3MTGA 2VA8A 4HWTA 1MB4A 2YMMA 3Q9SA 3TVTA 2RFLA 1VL8A 1WU8A 5AVTA 4MQEB 5DWVA 1DJMA 3GT4A 4ITRC 1KDPA 2QB5A 5G53C 1SJ9A 5TSDA 4K5QA 3GJYA 3INTA 4EYGA 3TQIA 1UWLA 2GPTA 2O7SA 2QI9F 2ZB7A 1EQUA 3K05A 3DM9B 3RKUA 1DRUA 1G9SA 2YWXA 3X1WA 3N7AA 1SHZA 4ESHA 1GDHA 3QVUA 3V42A 1LY1A 1ARZA 2P3OA 3QVLA 1BA2A 2HZ7A 3OQPA 1G1AA 2BMVA 4CKWA 1MEJA 2HN9A 3H5IA 2JDIA 4XYBA 3TI9A 5JI3E 2Z8YM 3WDLA 1PV2A 1QKJA 3R5FA 1L4LA 1XJQA 4M83A 3KKOA 1DUIA 1UWCA 2IELA 3AB8A 4JB2A 4J6EA 4JJKA 1QRSA 1W88B 4WZZA 3TPCA 1IXSB 4FYVA 1A8IA 1HT0A 3DQQA 5I48A 2FZGA 3WYGA 1PVVA 2QTVB 4JBGA 2VXYA 4FHDA 2R6ZA 3ASUA 1YR2A 4IGFA 1NOKA 3G2IA 1BWSA 2QLBA