2EKBA

Structural study of project id tthb049 from thermus thermophilus hb8 (l19m)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRMLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Structural study of Project ID TTHB049 from Thermus thermophilus HB8 (L19M)
rcsb
source organism Thermus thermophilus
total genus 60
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2ekbA00
1RIIA 2P9YA 2DWOA 1RPTA 2HPAA 1BIFA 3FDZA 5AJYA 1YFKA 2EOAA 3ZHCA 4ODIA 1T8PA 3KKKA 3FJYA 1XQ9A 5CDHA 1BQ3A 1BQ4A 2BIFA 3NTLA 1SKAA 2AXNA 3IT0A 1DKPA 2P9ZA 1UJCA 2P77A 5HTKA 2EKZA 4ARVA 5PGMA 2P30A 2A9JA 4D4LA 3EZNA 1DKNA 2WNIA 2GFIA 1NT4A 4JODA 3LL4A 4IJ6A 3R7AA 1TIPA 1EBBA 2P2YA 4IJ5A 2ENWA 2A6PA 3EOZA 3GP5A 2P6MA 3MBKA 1FZTA 2IKQA 1DKQA 3K4QA 3GP3A 5HR5A 2H0QA 2DWPA 1CVIA 1H2EA 3D6AA 3DCYA 3D4IA 3QPUA 2F90A 1K6MA 1V37A 3O0TA 2P6OA 1SK8A 4E3WA 4EMBA 3BIFA 1UJBA 4MA4A 5AJVB 1DKMA 2H52A 4D4JA 4JOBA 2H4ZA 3FDZB 4FDUA 2HHJA 3HJGA 4D4MA 2P79A 5AJXA 3F2IA 2HIAA 3MXOA 2P75A 3LG2A 2ENUA 1FBTA 2P78A 2PA0A 4FDTA 5AJWA 2P9FA 1QHFA 2I1VB 4QIHA 4EO9A 3K4PA 2YN0A 2EKBA 3GW8A 2QNIA 1DKOA 1DKLA 3PGMA 1QWOA 1RPAA 5CX4A 1E58A 3F3KA 1IHPA 3E9CA 3QPWA 1C7ZA 4HBZA 2YN2A 5CU7A 5AK0A 4GPZA 1SK9A 1V7QA 4D4KA 3E9DA 4PZAA 4PGMA 3IT2A 2WU0A 3C7TA 1YJXA 1SKBA 1C80A 2P2ZA 4ARUA 4AROA 1ND5A 3IT1A 3E9EA 1E59A 4GPIB 3OI7A 2OWEA 1H2FA 4TSRA 2OWDA 2WNHA 3IT3A 1ND6A 1QFXA 5AJZA 4ARSA 4PZ9A 3LNTA 3D8HA 3QPVA 4JOCA 1C81A 2H4XA 3NFYA 3DB1A 2RFLA
chains in the Genus database with same CATH superfamily
2BTQA 1R8JA 2W71A 3QKRA 2J5QA 2N46A 2P5SA 2V03A 5KQMA 2FW8A 1XRRA 3KPWA 1I3CA 1OWPA 2QUBA 1LXCA 1AXRA 1JFRA 2N9UA 2EJWA 2F1RA 4WFKA 1YGYA 1QR2A 1Z45A 2CGEA 3G5LA 4GEGA 3UFXB 4DR5B 1JU3A 1Y3AA 2RCYA 1JILA 2Q1XA 4ACAA 4RH3A 4LBVA 1E2UA 3KPVA 3PT5A 2FUCA 2N0SA 5JEEA 4EKIA 3TCXB 1J1IA 4RFVA 1HQYE 4PZCA 5GONF 1WG8A 3OZRA 3BMXA 4KC0A 5BSGA 1HE3A 3K1AB 4NIMA 4G65A 3IE1A 2V3VA 2V4MA 1ZZEA 3E22A 2G70A 4GMFA 1G59A 4MIOA 3VPDA 2R66A 2GI4A 3JR3A 4Q1DA 1EX9A 1PJRA 3QFHA 5CVEA 2O2HA 1E2PA 1YUBA 3TPZA 1H4QA 1RFLA 4P8RA 4OYLA 4D46A 1JSCA 1N2HA 1G18A 3KZXA 4GSYA 4JMPA 4N39A 1A9QA 4N0EA 1I1NA 1UPAA 2O8BA 2V6BA 4ZO7A 4YP9A 3GP5A 5C34B 1U7ZA 3I0NA 3V8EA 2WAXA 2XWQA 4PTZA 4G0VA 1OY1A 1HOXA 3DT9A 1T5TA 2FPGA 2LGJA 2QSUA 1I2CA 1HMPA 2V0CA 5A5VA 3T6KA 1CR4A 2V97A 1EINA 1LJ8A 1EIZA 1K6MA 4KVFA 3MUOA 4DT1A 3DHYA 1G291 1SC9A 3O0DA 3U1VA 3CH4B 1IOLA 4YT4A 3QGMA 3TPFA 4HDSA 3TIIA 3F3MA 1MX5A 2Q50A 2NZJA 2TMYA 3EC1A 1HTBA 4FCVA 5JSYA 5K3SA 1EU1A 4GZ5A 4DAOA 4OGWA 3KV3O 5HQ3B 1JKIA 2ZSIA 4UHHA 4YLGA 3VPSA 2R4TA 4YCAA 3WSTA 1SPBS 2GN9A 2WOOA 3GGJA 1WCIB 2NUAA 3V1KA 4RULA 2QLFA 5AI4A 3PPIA 2GBPA 4KFSA 3DP7A 2FEKA 3DE0X 1U0TA 2RGDA 1AGRA 5BN4B 5P21A 5B1EA 1MQSA 1PK8A 2HJRA 2I8AA 3I9V6 1JLLA 2PSDA 1U8CB 1Y9DA 1BU8A 3MUFA 4OG2A 4PX9A 4ZWNA 3T1QA 4JIGA 1CY1A 1QUEA 2BFAA 2ZUUA 4QDKA 3HKBB 3JALB 1B6SA 4Q9LA 3L6BA 5F21A 4MQFB 1HNZB 3THOA 2WMOB 3OTGA 1UT6A 3P97A 4XVRA 1H42A 5H4HA 3FY4A 3C14C 4UM5A 1QJ4A 4QXRA 4DEYA 1LGYA 4K81B 3THXB 5B36A 4DY4A 1JR2A 1LLCA 1YZHA 4OV6B 1TCCA 1F06A 5EJ7A 1WAMA 2NU7A 4DLSA 4CZ2A 3FMOB 1V7QA 4HUJA 1ZCJA 4OAQA 4RESA 5F51A 1E79D 1Z22A 2AFRA 3S5JA 3C7TA 4U5QA 2NV2B 3W77A 3WL6A 4BS9A 3GZ4A 5AYVA 3QKUA 3RO7A 2I6TA 5HUJA 3QU5A 2ISSD 1K2WA 1C30B 4RSGA 4YAWA 3T7RA 1YDMA 2IYSA 1Z5GA 4RIGA 2WAAA 4Y2GA 3ONFA 4D3ZA 4W1PA 4BECA 5H59A 4NC9A 4Y6LA 2ZWPA 4Q9KA 3SYNA 5CB4F 5KTYA 3P0FA 3ZQ6A 4UCQA 4HDMA 1M10A 4MMXB 1B7GO 3DJFA 4EHIA 4URFA 4A4DA 5IX8A 5IWCA 1USIA 1WHSA 1SC3A 3UBTA 1ULTA 1T35A 2IEZA 1TRHA 5CPFA 5AKEA 2Q6TA 4AC9A 4E12A 3HJFA 4A8TA 3RTAA 2O8NA 3VNAA 3OY2A 3QG5A 4O1IA 1G0OA 4MYRA 4QFMA 5DDIP 4JGIA 1MABA 5LXTA 3HCWA 3DOFA 4KPYA 1RJWA 1UMDB 4BJHB 2W6CX 1T8PA 3CW9A 4M0UA 4ZKEA 4OLJA 3O7WA 1M7HA 5BOSB 3T0IA 2WSIA 1MD9A 1BMTA 1T3TA 2V55B 3MM4A 3FOEC 5FFMA 1I8TA 3DH0A 1JEEA 2X1MA 3KX2A 2AXNA 3V7YA 1XTKA 5JSUA 4OP3A 3H9GA 4URYR 1A9SA 1WS6A 3GQVA 3QLEA 4WZAB 3KTAA 4Z54A 3UATA 2M32A 2LZ0A 2ATVA 4BZQA 3EXHB 3EZNA 4BNDB 1WU7A 4YC7A 1IN8A 1WUKS 4ZYYA 5DB4A 2CL7X 1YZ3A 1ZUIA 1VLHA 3PEWA 3LOQA 3FWYA 4Z86A 3NS7A 4DRXB 4GI7A 2XYQA 1GZ7A 3JQ7B 3EGEA 3ZWPA 3ZZNA 4FLMA 3BX1A 1J7JA 4IJ5A 1FFGA 3UICA 4JXZA 4BQNA 4MRSA 3IEPA 1KIAA 1CP3A 2GFHA 2VJBA 1UFRA 1SHTX 4G67A 4PWZA 5F2OA 1YI1A 2IEYA 3EVEA 5FA8A 1LPBB 2DX7A 2P9TA 2DVMA 1TAGA 1QIHA 3O0TA 4H9GA 3ZDRA 3MRVA 3VDNB 5IEBA 5KNCA 5AM0A 4UVDA 2GPAA 4WACA 1E32A 3Q72A 5J2UB 2W6NA 5CITA 1EWVA 3RC7A 2RBGA 3GVPA 4J0FA 3SEAA 4CM9D 4AYWA 4EGCB 4BKRA 3NH9A 4RX1A 3H5IA 1ORHA 1JJFA 3M1AA 1U81A 3T5MA 3DVLA 4DQLA 3LRXA 3VHQA 5JC8A 3ZDAA 3C6BA 2YWRA 4C0BA 1ZIYA 2B8TA 2JKVA 1CUSA 5LZ9A 3R5TA 2PANA 2EX0A 1LZLA 2VXYA 2W8ZA 3VZPA 5LP6A 4BBZA 1EXVA 4LS3A 4QIHA 3WRXC 4F4DA 1E9FA 4HLUA 3AIIA 4QE3A 3JR7A 4PSAA 4O2AF 2QX8A 2HSWA 2QTFA 3ZCRA 3PGVA 3G17A 4AJHA 5JS8A 4GLLA 1ZW6A 1VL1A 2C4UA 2WPDA 2PXHA 3BAFA 5BSWA 3PYMA 4DB4A 1YRYE 3HJHA 4JBYA 3B3GA 1GN8A 4HBZA 3Q12A 1MFZA 3LHIA 4HAZA 2R1TA 2KSQA 2JNWA 4GRIA 3T5AA 2R47A 3NRJA 5FBZA 1KH1A 1OWMA 5HS6A 1J0CA 1LLDA 4II3A 1NMYA 1ZJWA 4EABA 1VBNA 3R20A 3M5PA 4DYHA 2H8GA 5CA1A 2YUIA 5L6MB 2PY6A 3EFHA 3S2FA 2GK7A 1IIRA 1U2QA 4HPWA 1H2FA 3R23A 2N75A 4MS4B 2JZOA 4L72A 5E2BA 4JI7B 3VA7A 3GMTA 3ETGA 4YI3A 2ZIZA 4JI2B 4U7TB 1GXSB 2HTFA 2UV8A 4JLOA 3KLPX 3BUSA 4PPQA 2DR2A 1M2JA 1QGUB 1JG4A 2FGKA 2VXOA 3PNYA 3AY7A 4J0JA 4LAFA 5J47A 4K1LA 2BFBA 2VUIB 3SHTA 3X43A 4LDJA 1LBQA 1FJHA 1GEGA 4JP5A 4U4AA 1SBYA 2WF5A 3FVWA 4YASA 4ENRA 2PSFA 3BPSA 4UDXX 2K6GA 1FYDA 4HS4A 5BOVA 3FBWA 2OHHA 4I4TF 2VYCA 1OLXB 3NT4A 1EFPB 1BS9A 2GNAA 2GWRA 4HAOA 1GAQA 1XQ9A 3LVRE 4XWYA 1IULA 2AK2A 3B20A 5UKDA 3VTZA 4E5YA 3DONA 1II8B 1A76A 1SC1A 2PV0A 5T8KA 1HEUA 3P9KA 4XA8A 3IP9A 1EXDA 2O2ZA 4EKEA 1JIJA 5E4FA 3IQZA 1JLHA 4N3AA 2J9YB 3SN6A 1JF8A 3A4NA 3VHLB 1W76A 3EPLA 1QAOA 3QU4A 5CX1B 3WIEA 5E95A 4MDHA 4M21A 2FN4A 3C87A 1KP2A 2BR3A 4PANA 3S99A 4AF6A 2P2SA 3AOEC 4M36A 2YTZA 1M6YA 1GQ2A 5CXXA 1E3TA 3OPXA 1N3LA 3VR4A 2QVCA 2R8EA 1QCZA 4DM3A 2D2XA 3T3DA 4IV5A 5C1IA 2IODA 4Y2XA 5U4QA 3D6AA 1RAFA 3DEFA 3NBQA 1VM6A 3JVIA 1YS9A 3LTEA 3B36A 3CFYA 3LLVA 3KJIA 2WJ4A 1Y9JA 1ODKA 2ZT8A 5IMSA 2OYSA 1GRRA 5DOVA 5KDOA 1YCGA 3IOMA 4FB4A 3BE4A 2BSXA 4I2NA 3JW8A 1W35A 3DMNA 4IQ4A 1LY1A 5AW1A 2DFDA 3HFGA 2BP7B 2E5FA 3T7EA 1LQ2A 3GT0A 1TDJA 1D4FA 1XA3A 1XMPA 2HLNA 3DGFC 3I6IA 4L78A 3ORYA 4X63A 3WBFA 4KV7A 4DSUA 3ET5A 2GCPA 5AW0A 1LLFA 2QMYA 1NKVA 3OFNA 5IFKA 2NSJA 1GZDA 4ER0A 2GVZC 1UMKA 3U7GA 3U49A 4S35A 1U28A 4MUAA 1G3UA 1QK4A 3JZAA 5ER9A 3RIMA 1SFRA 1Q1NA 3U4MA 2WKWA 4FYPA 3VPHA 3O91A 1FEZA 1MJGM 2JFXA 4RGBA 3N0XA 4X7PA 1ZI6A 1PGOA 8ADHA 4A6XA 2EJCA 2BRUA 3JQRA 4ARZA 3AEKB 3VR2D 3MQ2A 1EGHA 2F4NA 2TECE 1PR6A 3EG9A 4FIDA 4V0KA 4UDYX 1T4CA 4B43A 3G8DA 1JYFA 2GZSA 3DL0A 2PXAA 3O4JA 1W30A 2FLVA 2MR5A 3DFZA 5I9MA 2G1JA 2GBIA 3I2JA 3KVRA 5CNIA 2QMZA 3UYLA 4FYIA 4QBGB 2O4UX 4Q7MB 3AKYA 2D0IA 4Y2HA 3PFCA 4PS1A 2X8JA 4I4LA 3RE1A 1TUIA 3O8DA 1WMFA 5ICGA 1FTGA 3FH0A 4JQOA 1UBTS 4O08A 1NUHA 1QCCA 3P94A 1QU3A 1IVSA 1JHAA 1W85A 1QLWA 5DM70 3ZD7A 2GT1A 5JD5A 5I51A 1DTEA 3GDHA 3NBUA 2HDOA 2RFLA 2LKDA 2VP4A 3LE8A 4GC9A 1E0JA 4YNBA 2CDRA 1CWUA 2R7AA 4MGHA 4A6DA 1SOWA 1DUSA 2YS7A 1NAHA 3CS3A 1F8XA 1ISSA 3GLIB 3Q87B 1YR8A 5CT9A 2ACVA 1DIBA 2FWIA 1I7NA 3OZTA 2D06A 2R65A 1AV7A 2R48A 1U5BB 2W4QA 3IAFA 4LVUA 2DTEA 3BTOA 4OA8A 1J2TA 3GLHB 2YC2C 3A3NA 5CW2A 3U62A 3REOA 2A0XA 2JHPA 2YL2A 5D7NA 5FPSA 1PKXA 4YWJA 3AR5A 4CEIB 1MAUA 4BQFA 5MDHA 4U0JA 1P7ZA 2VEOA 4YFVA 3SQWA 1MQ8B 1NULA 1TMGE 3W0LB 5CG2A 4PS0A 1JQEA 3MJHA 5JQGF 1G7CA 2OTCA 4YDQA 2AG0A 3KEGA 5FORA 1VLMA 2O2CA 3RIYA 2XHZA 2OG2A 2ZIXB 3ECAA 4LZLA 3B5EA 1JHYA 4MWTA 5JS7A 1KOGA 4DV4B 3ZHTA 1XP5A 2QTMA 1TQ2A 3CQ9A 1UH5A 1XJWA 4LGVA 3TLJA 1VC2A 5ITVA 1Y7PA 3LC2O 1H6BA 4WJKB 5EIBC 4ETIA 3RVDA 1V37A 5CB0A 3WLAA 1DAPA 1JXQA 4CUZA 4ETMA 3T7KA 4ZAWA 3AYXB 3E8MA 1VBKA 2J45A 1Y3DE 3FF4A 1R5NA 1GAWA 3RCBA 4I0WB 2QBYA 3CNBA 4BUCA 2YXBA 1NP3A 2P79A 1SN7A 4WECA 2OQ2A 1N2GA 5TXGA 1YUMA 1FQKA 1VOTA 2IYFA 4WV3A 2CCJA 5KTRA 3KJZA 1SKYE 2W2PA 1OFHA 3JQCA 3N53A 4I5FA 4IG9A 4K03A 3VKGA 4BNWA 4MUEA 1K7EB 1D0SA 4RZQA 3FIJA 4MGKR 2IH2A 1VJTA 2C0CA 2GLUA 3D5QA 1ZNWA 3L4BC 3OUTA 2DC1A 6ABPA 5CK4A 2R4QA 3VUEA 2Z6UA 4WZBB 1I7DA 2W70A 1V7CA 1L7BA 2HLDA 2NVUB 2ZWMA 2EFDB 1CNMA 1VHWA 3O21A 2WPNA 3W2GA 4Q9DA 1E8DA 3DFKA 4RD3A 4E1AA 4N76A 1FZQA 4KH0A 3EBPA 3QYAA 4QOEA 2ZUTA 2C5AA 3M3DA 4F1WA 1P2BA 4LDAA 3B3JA 4N0PA 2QORA 4D3FA 4FM9A 5H4GA 1MXHA 5J1TB 2XCLA 4J0GA 2NNLD 4IGFA 1Z5UA 1CB7A 3A8TA 1FDWA 2FY8A 3MMNA 3VZQA 1WPRA 4BYMA 2Q5IA 3NC4A 4B33A 5KTKA 1NQWA 4FD3A 2EDAA 2FMIA 4IJQA 5A6SA 4AJNA 1A8HA 2OAQ1 4J43A 3F6SA 1LDNA 1SC4A 1S2GA 4FS3A 1M33A 4UDOA 4DARA 3ZLJA 1U2EA 4FGUA 4D02A 2JDID 4EZIA 1SUPA 4UEKA 2HZBA 1YFJA 2HT6A 5F9FA 3LXXA 4JC8A 1RAIA 1CJKC 3LUAA 2C0QA 5CG1A 1OZAA 1XELA 3CZPA 3HVIA 1KS2A 2YXDA 1JQ3A 1WBBA 4QQ8A 4UU1A 2D8MA 1ODTC 1IAQA 4UVHA 5H80A 1TO1E 4YCLA 3UWPA 2V8OA 1R2QA 4IMPA 4CM7A 3VVMA 1B15A 5ECYA 2ZYHA 2ZUBA 3PE4A 5AM4A 3MGGA 4FMCF 4W4TA 2AV6A 2EJVA 1KDPA 1B6RA 3F7MA 3U19A 1L7OA 4XGIA 3C3WA 4IP0A 4B6EA 3E61A 3U1BA 4QHSA 4XFKA 4BLSA 1A3CA 1OHHA 3SPXA 2PL5A 4C08A 3ITKA 2P9BA 2IYQA 2QF7A 4MV6A 2IPOA 2C7QA 2Z6AA 4CRWB 1BFUA 1NT4A 1EK0A 3NHYA 4UHDA 1YVPA 3R0XA 4XJXA 2F8MA 1ISMA 3WB1A 3HQ4O 3P0HA 4RKQA 1XA0A 4CI9A 5I5EA 2FWBA 3S3TA 3HB7A 4CETA 5HQJA 4BFYA 3BXHA 4OLFA 4JROA 2YJTD 3WK5A 3L0BA 1N6KA 3ISTA 4BKQA 5JZMA 3TLAA 3MD0A 1UKYA 2D3TA 3TW6A 1JKXA 4XGKA 1WZCA 2FVYA 2O8EA 2R1ZA 1KU0A 2EFJA 3GEGA 1YULA 2EKLA 1ZMRA 2QAJA 1QZ3A 3KJNA 2PIAA 3OWOA 4TMVA 5AVXA 2C2XA 4FB5A 2JGIA 5D51S 4FU0A 3U7RA 4Q9HA 3W2HA 2QRHA 4CUJA 4DNXA 4UAGA 2WHEA 1QZUA 2ORED 2Y66A 3ZNOA 3S27A 4AS2A 2CF5A 4INJA 4IS3A 3HPQA 2QIPA 1G21A 3F8WA 3NVMB 3O2SB 4WY2A 3ZK8A 3HXMA 2I5PO 3IALA 1BQEA 1P91A 2R9VA 4Y2SA 5B3JA 5SYNA 3WYEA 3PNSA 4YAOA 1TQ8A 2H3HA 1L4FA 2QIOA 1MA3A 2ZULA 3D2LA 4P4NA 4KOEC 3DZCA 2V1XA 2QRNA 3OM0A 2CVQA 3LLMA 4M7RA 2BMJA 3IKVA 4RTJA 1RI4A 2O3TA 3PUHA 1QNLA 1T4GA 2H7YA 3BVPA 2ZCVA 3L8EA 2VYNA 4QYWA 1L5HA 4W5NA 4MV9A 5HWSA 4Y9SA 2GLXA 1QTNA 3U7HB 4WBNF 4ZK2A 1HDCA 1DBVO 1PJLA 3U26A 4XASA 5TMPA 4N6OA 1RCTE 2VNAA 2MU1A 3PQ7A 3QPWA 1YFLA 2WQ6A 3GK3A 2PU5A 5KAMA 2DR0A 2FUNB 1QFJA 4FOPA 3LCUA 2GOYA 3L8HA 2I4RA 2DTXA 5JFOA 4CLOA 5KOJA 3SKVA 1IZ0A 1V6SA 4WNAA 4UFNA 5E9JA 4F4IA 3DBLA 3IMEA 5DGHA 1UAYA 3A6KA 3GBSA 3KNZA 5LYJF 1U04A 3WLPA 5J4VA 4KAJA 5K0NA 5AVTA 3TQTA 2CFRA 2FR1A 2NXJA 4D57A 2YY5A 3WIDA 1G2QA 3W79A 4XJSA 5KCZA 2JFFA 3JYQA 4QTYA 2PS9A 4GKAA 2UVPA 1U3FA 2Y76A 2KB0A 3RVPA 5JXWA 3RH0A 2X2FA 4R84A 1AKYA 3ZQKA 2MMGA 3K0CC 3LIIA 5DZSA 5BYKA 5I4IA 3E48A 3U7FB 1AKQA 1LDYA 1CD5A 1P75A 2DHQA 2P9YA 2PSHA 3Q3GE 4QWMA 2AKAB 3ZJUA 3LPAA 3GEHA 1VSBA 3HVJA 4GXQA 2E6UX 1ZUD1 2YX1A 4C0SA 3RAPR 5JWRA 4GPD1 4ZGGA 2X40A 4ZV7A 1PJSA 1T10A 2GZ3A 2QJFA 4EYOA 1HE8B 5FTKA 2VPIA 4J0HA 3W1EA 3PRJA 4LXHA 5B1DA 1KWGA 2E49A 4OKNA 5TRTA 4AD8A 5LMUB 3U44B 4WIAA 3HP1A 3ZNPA 3COJA 5IJXA 1NQAO 3TJMA 1OYYA 2JLAA 1GL7A 2VDKB 4EA9A 3S40A 5IDVA 3DE4X 4TTJA 3JD0A 7ABPA 1YDGA 1MMFB 3SQDA 3P9CA 4X44A 1Q7TA 3LCJA 5JFGA 3O4RA 3O8CA 4XWAA 4D9BA 3LQ4A 1YA6A 4DR4B 1V5GA 3NTXA 4D4HA 1NRXA 2BGGA 3H5VA 3JVEA 4G5HA 4WAUA 3IAM1 1VMAA 4NE9A 4FNMA 4QQFA 3HGQA 3Q3IA 3FPBA 2A0FA 4RE6A 1PP4A 1TAHA 3WQSB 1QG6A 5KHOC 2ENWA 1NR7A 4BB9A 3WLRA 4PV7A 3BK1A 5E9WA 4F5WA 2DJ5A 2ERXA 4ZYUA 1WZUA 4I1YA 3I9FA 4F1JA 4H4DA 2AC4A 1G9XA 3ZDEA 1UADA 4FEAA 4KO3S 5J3JA 2W42A 4XGNA 4BNKA 2ZYTX 3OIWA 1X13A 1K9VF 3S2EA 5EZYF 4R83A 1QMGA 1XTSA 1C41A 3NVDA 3OE1A 5B2ZA 1SBHA 3OT4A 3ZKWB 3C5CA 1FJXA 2FW7A 4L73A 4ZPXA 1M2VB 4MB0A 3BS4A 4RA6B 3WQQA 2QR3A 5SZJA 1Z0JA 4R2WA 2YNMD 1T43A 4UTVA 5IZCA 3NWEA 4LC0A 4M88A 3CRW1 4IM7A 3F9CA 3KKZA 2TSYB 2I6XA 4B2PA 1MB9A 3LW8A 2WVAA 3H8JA 1G6OA 1Y42X 4B48A 1I6LA 4HBGA 2FDCA 1QE5A 1ZIPA 4JBXA 4OK3A 4TWRA 5L45A 2HNAA 3QY0A 1NVGA 2W22A 3PFKA 2RKWA 3GJRA 4R05A 4D2IA 4XQEA 3K4PA 2JVIA 2RARA 5LQDA 1D5CA 4J6FA 4XB6B 1D2GA 1T8UA 3JASA 1TM3E 5DCUA 3GOQA 5A9SA 1KR5A 1ZY2A 2QNIA 2X7XA 2ONCA 3GVCA 3P9QA 4JGBA 2BE7A 3G13A 4NMMA 3UAWA 2XT0A 3NDPA 4KYUA 1WPXA 4BX9A 1ULAA 1Z6GA 4N5NA 3WMFA 1BE1A 2AQ8A 5E2AA 2P41A 3T9CA 3GLFB 1L4MA 4FI3C 3ZCPA 3E23A 1ESNA 4AZWA 1VPLA 2AMLA 3LUPA 1QZZA 4PZAA 3WXMA 1DJMA 3T9AA 1IEQA 2PUVA 2XJ4A 1KJIA 1GKLA 1K7CA 3HSKA 3THSA 1E2BA 2R1VB 4G23A 5FPKA 3P4XA 1FJ2A 4GWLA 3NP9A 2X0DA 3JAKB 3TM4A 2ZB8A 1COZA 3F0TA 3PEFA 3RVSA 4CI0B 1YSCA 3PIIA 2P7HA 3LKBA 1VPEA 3K5WA 4HV4A 5EJ5A 5BYBA 4OP2A 4LRSB 1D7AA 2EZTA 2FWPA 3KOUA 4M53A 2ZU6A 1I1QB 3NALA 2ZJ8A 4HDAA 3RUPA 5IH7A 1DTWA 1QQ5A 2B2XA 1WMEA 3AZPA 3U3JA 2YXLA 2E37A 3DB2A 4UUQA 3WNVA 3KTDA 3KUKA 4EO4A 4YEDA 2HHLA 1QK5A 2XZPA 1N2CA 4DB2A 1B0ZA 4FX2A 4NI5A 2HA7A 5ES3A 3H9BA 5BR7A 4KX3A 1XTTA 2HL6A 3G85A 3GVXA 3C7KA 4F92B 1E6WA 3WO0A 1UPFA 4LCJA 4HTFA 5HGXA 2QZZA 4WXHA 4KRGA 2OYCA 2C1EA 3WKDA 5GOTA 1L4UA 4N01A 1O9GA 3OIYA 4TGLA 4Q4DA 2FTKE 1W88B 2J6BA 2L69A 1EFHA 4PQYA 1GDTA 5AUOB 2QVZX 4GLOA 4BKPA 5L4NA 2XGSA 4U7HA 2QLBA 5TARA 2W4MA 2YWFA 4REQB 4HZGA 2OGTA 4CKWB 2GD6A 4X1YA 3PS9A 4LMRA 4MULA 1P9WA 1IWOA 2Q2VA 3EGDA 3H4IA 5KDLA 1Z6QA 4B4OA 2PUCA 3OETA 2X14A 3QJ5A 5JWHA 4BNZA 4ETWA 5TV2A 3BB4A 4GX5A 3ZDCA 2YZ2A 2Y1GA 4HY3A 2E2WA 4AN4A 4RD2A 4PO8A 5CLQA 2HW8A 2I2XB 3ZWCA 1QG2A 1VJDA 4XUEA 4XSGA 3KB1A 1CKEA 1WV0A 3VR6H 4CKEA 1EA5A 3ZH2A 1IM5A 4PSUA 3I2KA 3Q85A 2AR7A 3QQPA 1KI3A 4I1VA 2FK8A 3C6KA 5C5CA 1YT5A 2X4IA 3D54D 4L4XA 2WSSA 4NECA 4F9TA 2O0MA 5ICCA 3DMRA 5EYPB 2WU4A 3OCCA 3MJ4A 1JBEA 3F2VA 2F3TA 3F90A 3IOBA 1P61B 2DWUA 4MJ7A 5IBCA 1CV2A 1DV2A 4L2IA 3LGSA 3IUBA 3M34A 4NPCA 1RI3A 4WY5A 1L8XA 4AJ1A 1RMQA 4PRZA 3AFOA 3O8QB 2JCBA 3MHPA 5ESDA 4TTSA 1SIWA 2DPXA 1EWRA 5FI0B 1ZK2A 4KO8A 2OKGA 2H1SA 1GUAA 4RBNA 1JNXX 1SCAA 4PQRA 4ARCA 5CFRA 5I8ZA 3WGOA 3KVVA 1THMA 1ESEA 5ALYA 3MJEA 2PKCA 3L1UA 1YQ9A 1SHKA 2ZJ2A 3GRUA 3QOXA 5AUQA 3GLQA 2NVWA 4H27A 4IJWA 3A1TA 4IKEA 2SCUA 3QBTA 2I99A 1U7PA 1UQUA 1IDN1 5DBOA 3WGZA 3ZWYA 1VA5A 4IHAA 2OXIA 3DAGA 1C9KA 1LKZA 3CVVA 4DA4A 3TW0A 2JGJA 2CKDA 5FTMA 1H8HD 3LFHA 5C8YB 3K0FA 3ADCA 4DQXA 2QI9F 2PIDA 3OF5A 3EPPA 4HGNA 5GM2A 1LBEA 2HSDA 5AK0A 2QOEA 3O82A 4ZRDA 1ZJ5A 3P2JA 3T15A 4RWEA 2EBFX 2GRUA 1C1XB 2FXVA 1BN7A 3V7NA 1GILA 3AUAA 2V6GA 3RUHA 2GPBA 2VATA 3T3GA 1MF7A 3A1VA 1UBHS 3JY6A 3WK8A 1F2DA 4MW6A 1GYQA 1IWPB 3ROPA 2DHRA 1XRNA 2GEBA 2PUHA 4KPFC 3PXXA 4RK0A 3RJTA 2C04A 4NMLA 2IU0A 1NAIA 4S12A 4Q4HB 3D7LA 3RYIA 1ZD4A 3SF8A 3N70A 2PX6A 1YVUA 3M82A 1RRKA 3WGGA 2NAFA 4HEA6 4INZA 3LUFA 2FUG1 2WHYA 3AUXA 4WADA 5FWYB 4XPIA 2FN7A 4MGIR 2QY6A 5AVYA 2XB8A 3DPUA 5TS2A 4MUXA 4MROA 2G07A 4ON9A 3PVSA 3LUHA 3OZUA 1T2DA 2WT4A 4K05A 3OFKA 4EW2A 2P40A 5F9MA 1XMJA 1DZ3A 3UK0A 3A10A 3OICA 3NO4A 1F8UA 2Z30A 3BCRA 5LD2C 5HUQA 3BSYA 3BWCA 5JCZA 2F4VB 2F59A 1EM8B 3E18A 4E09A 3MCZA 3PYXA 1KMMA 3K09A 1EHCA 1FDIA 1UMBA 1F0YA 1VE5A 2AH5A 3L02A 3LBNA 4RLQA 4BMDA 3ZDBA 4GGMX 1XALA 1NFQA 3QUTA 4QQNA 5I9LA 2C78A 3Q3HA 5HTKA 1M1YB 2VSOA 3AHIA 3CNEA 1KOFA 5G4KA 5HBGA 1EK1A 3RSSA 2CXUA 5BP7A 2VSYA 2WHQA 3FTCA 4WASA 1ZEMA 1R9GA 4MA5A 3RU9A 3RSZA 1HGXA 3TCNA 4BFTA 1JWLA 1Q12A 1UJ4A 3IQDB 4TS4A 3T5DA 2HSJA 1G7RA 4FD2A 3S4YA 5JNSA 1T0IA 3A1EA 1C8BA 4HX5A 4KZKA 1YU6A 4HRVA 4CTMA 3NBAA 1CYDA 1XL1A 3TK1A 3ETDA 1PS8A 4DCNA 1NZDA 3TW8B 1FTWA 4B3GA 5DM60 3IKJA 4U7DA 1YOVB 3FXAA 4KMRA 3D4IA 4P81A 5DP1A 2RHDA 4G2NA 4E3WA 4ZXFA 4EG7A 3ZHBA 3HU3A 5I5GA 1GL3A 5TT0A 3WX0A 3WRYA 1YDFA 1XT6A 3NNNA 4WOCA 1JHZA 1FDOA 3KSZO 3GFBA 1UR5A 1XCJA 2BAGA 2V0GA 1Z73A 1E9VA 1DPFA 1Y6ZA 3MLBA 2A88A 2WUEA 3UW1A 1IG3A 3DDOA 3H42B 4L8FA 3MWEB 4YQEA 2P4UA 2I71A 2IUFA 4P4UA 2O1SA 2RE8A 4QO7A 3QWBA 3GFGA 4I8IA 1O5IA 3LU1A 3QPCA 2BGTA 4TWZA 1CY7A 1YNOA 4Q9NA 5CT4A 1QIDA 1VCOA 2QD5A 2ZT6A 1EK6A 4G37A 1NXWA 3NOQA 4JITA 4PNZA 1I14A 3VSBA 4CTOA 2QW8A 1GZSA 3MD9A 1IQ0A 1OCEA 2HB6A 3OMLA 4UUAA 5BT9A 1Q16A 1ZD8A 2VXBA 1Z12A 2H9YA 2XADA 2ZI4A 3FPLA 4D79A 3OTQA 4ZI7B 3QUBA 3W9BA 1E3QA 2VS1A 4UEOA 3E53A 5CDFA 5CU7A 5EIEA 1U8UA 2FSGA 3JAWA 6YASA 1QKIA 4F86A 4MS3A 3PFFA 3OOSA 4OYYA 2C7GA 3WZ2A 3A6ZA 3PQCA 4BX2A 1SUFA 4E4TA 4DNQA 4CIAA 4D9FA 1W4BA 1Y7HA 5AIBA 5TIIA 2ZUFA 5TJ9A 1N5IA 1MENA 2XTMA 6REQB 3R9XA 1SG9A 5FTJA 1IHXA 3VUFA 1U6IA 4GDMA 3FB4A 4XB1A 4L4SA 3E3LA 1E1QD 4TKVA 2I7DA 1Z4QA 3LPDA 2CL0X 1BW9B 3KKNA 2GN4A 3E8XA 1BYIA 1PK9A 2I33A 5DXFA 5HIIA 1IOVA 4PLVA 2Q9AA 3QH4A 5ALHA 1ZSYA 4HJXA 2MINA 4ND8B 2ZOSA 2GO7A 1Z33A 1D2MA 3HU1A 3LXMA 4O5OA 4UAVA 3ST7A 2NOAA 1V8BA 3FDZA 2IUTA 3F5QA 4HMOA 4PLFA 1ZRNA 1PGQA 1WSWA 1E0DA 3M4XA 3OZIA 2HY7A 3DWFA 3T9BA 3D0RA 1W59A 5GV8A 1ZD1A 4DRZA 2KQUA 4OYRA 1INLA 4IMJB 1X2EA 4P83A 1UC4B 3AVPA 3NYQA 4FPXA 3SHQA 3SSOA 2QYTA 4BZZA 4KPUB 5JRZA 5JH7F 4P2GA 5FHQA 3BH6A 4FGZA 3G0HA 4UOQA 2BIFA 5IBRA 1FFSA 2DPGA 3IT0A 4JJEA 2ZLBA 1ZUHA 3A9VA 4X20A 4XGQA 3K1ZA 2V6IA 2QDKA 1XZDA 3ED1A 1UK7A 1WMAA 1XTRA 2AZ4A 2ZJ4A 3IIKA 4FDAA 1H5NA 3G79A 4HNAA 1KF0A 2A9JA 1H8ED 2C5FA 2GRAA 2OGZA 2XI4A 3Q3CA 3Q9UA 4LHZA 4CG2A 2O8CA 2P11A 4JBLA 3IAEA 3FHCB 1I3MA 1QGZA 4OFXA 3J7AC 4CCYB 1GL9B 4CMEA 2DUWA 2WHXA 4S1NA 1W4AA 5LNK1 4PW0A 2J9FA 5EP1A 2NUTA 1E3SA 1T3GA 1ZMBA 2KJQA 5CBKA 4ZOAA 2QPLA 2AW5A 2FRDA 4B79A 1FUEA 3H19A 1B8PA 4OJYA 1PGNA 2A9FA 2A35A 3CH7A 1V16B 3EIEA 6LDHA 5JSHA 4F06A 4D9KA 1AUQA 2MSWA 2NV0A 3DDUA 4BTVA 1ZITA 4B3FX 1ZVVA 2PBZA 4RDXA 4ZCQA 3PQ4A 5EP3A 2C98A 2FPUA 2UYGA 1YR2A 4UM7A 1HG0A 4TV8B 1TVEA 1U2RA 4QDXA 4X1KB 2ZROA 5G2OA 4DLRA 2VUTA 5DGDA 5EESA 1R6DA 2BMVA 5J59A 3I1IA 3ZWAA 1XYYA 1L7EA 2VN8A 1XZBA 3S68A 1CEXA 2CMFA 1S4MA 1F6WA 4BMXA 1PW7A 3IMGA 2J59A 1PZFA 5C52B 3AVXA 1USGA 1SOVA 3GJQA 3DAPA 1SWVA 3VYSB 1V5WA 3HLTA 4C0WA 1GNPA 2XLCA 4HH0A 4NBNA 4ZEMA 4X93A 4Y6SA 3Q3EA 2FP4B 2G67A 3AESA 1US8A 2VDOB 3EF1A 3PGMA 2QGFA 3EPJA 8LDHA 1SCKA 4N03A 4CDGA 5P8WA 3HUUA 3LA8A 3O4GA 3ZGYA 2IX3A 4EI7A 1N7GA 3ETNA 4YS6A 5H1YA 2OB1A 3T41A 2XXBA 2Q3FA 4JA0A 5REQB 1K8XB 1HT2E 4KO2S 1D07A 3G0OA 2VH5R 1LA2A 5IABA 4D92A 5AHXA 4WGFA 4PYNA 2ZRPA 5KYXB 4NCJA 2DUMA 4RVCA 5BW6B 1G8MA 1W36C 4FYXA 2IL1A 2VWPA 4ZT4A 1RYFA 2Z4SA 1JIUA 3G5AA 1Q0RA 4XFDA 2CHEA 3CB2A 4WBXC 2D7CA 2FEXA 4JK3A 3K9FC 5BWCA 3AR3A 3DL4A 1QVWA 4NMHA 3QF4B 1BDBA 4FHZA 3CEAA 3R7DA 4DJ5X 4UOEA 1Q7RA 2YDXA 4UTPA 4YUXA 1ZR2A 4D3YA 1NX6A 4PLZA 3M49A 1N8KA 3DMTC 3SEQA 5C8VA 1HDZA 3DHNA 1V11A 2BGIA 3C6XA 2B7LA 4MVJM 3G0BA 1GQSA 1AQIA 1UCFA 5L3ZA 5A2GA 3KOWA 1CU1A 2QSZA 2BSQA 5JANA 3A6FA 4FHCA 2WZQA 2ZIVB 2ACEA 4I81A 4NU8X 5DNWA 3RUFA 2X1HA 4DDMA 1SCQA 1OYVA 2IBSA 2QAGC 3QU2A 2HBYA 3B3QA 4QG7A 2BFDA 1A1SA 3MUNA 4ZOQI 5JI3E 1DX9A 2W6QA 5T3UA 5IJWA 5FR2A 3KAKA 1E4YA 1JWAB 4EBFA 1LB1B 3WHPA 3N2YA 3OTWA 3EWAA 2XMRA 4LJ9A 3QVSA 1KJNA 3OC0A 2ZSEA 3PF8A 4JUFA 3BGSA 3PWTA 3BMQB 2EFHB 4QFCA 4ZO6A 3ONNA 3T1HB 1SELA 2LDXA 3H6GA 3A2LA 5ERYA 1PE0A 4Q21A 3HJUA 2Q7DA 3C85A 3NPAA 1U1DA 2VYQA 3AVQA 1NLUA 1H5UA 5DTJA 3V4ZA 3ESYA 1S01A 2AK3A 5KYYB 1WB5A 1EUYA 1KYZA 3ABIA 1XXHE 5DX1A 2ZE7A 3AY3A 3LO8A 5ICSA 3HKEB 3T8YA 1AHHA 2EV9A 3C7DB 3JQ8B 1OB2A 4U9UA 5C46F 2B94A 2PR2A 3C2QA 2QL9A 3GH1A 3G2KA 3DCYA 1SXJD 4R41A 3Q6NA 3RREA 1RHRA 1ZL2A 1LBTA 1RXWA 2NTJA 3SOZA 1EBUA 1JG7A 3P9PA 3OZFA 1T5DX 3U40A 3U4CA 3DLBA 4KQ2A 4TPKA 1PG5A 1KMNA 1T3HA 2B1QA 2XZDA 2JJ2A 3BXFA 3I5MA 2RC5A 3L0SA 3O90A 5M29A 2AFIA 1EMDA 2FN3A 3F7NA 3HKDA 1ZVKA 3HHPA 3NOOA 4JWKA 1G8SA 4WTOA 5EKDA 2CF6A 4TXNA 1ONOA 1M1UA 4OJTA 2E89A 3G0CA 5F7XA 1UPCA 4FFRA 2JEZA 3I37X 3RI3A 2OSBA 1WABA 4BQQA 1G64A 4YPFA 3X2EA 5FI3A 1RDFA 4O4LF 2CZGA 1NW6A 2WIDA 3RT1A 1J39A 4KZPA 3ENNA 3ZGOA 1CNEA 3KR0A 3T0GA 3IIIA 4G0ZA 1FLNA 4I99A 1R8QA 2IYNA 2SKEA 4LYHA 3GPBA 2CXTA 5LA6F 2AOUA 1PG2A 2BD0A 2GEDA 1KNXA 4Q12A 1A0OA 2VTEA 1QOZA 3FRHA 3M6FA 4GKBA 4YRRA 4NDAA 3CWZA 3QE0A 3V1TC 4WZZA 4MQLA 2P1DA 1SKMA 2HFJA 2VA8A 2O1WA 1Z5PA 1U0FA 5GONB 3HBMA 4PYQA 1X7ZA 1MJFA 3OJ0A 2VDWB 2YMQA 1A4IA 1SHZA 2V0NA 5CEJA 1U7WA 2DRIA 1ZN9A 5KYUB 1I0LA 1UKVY 1MJHA 1CNFA 1BH6A 3I5XA 4B6SA 5AJHA 4HNUA 1YJXA 1PJ4A 2I76A 1RZ3A 4RZ3A 5SYMA 5KX5B 3NDIA 2B8WA 1CETA 2Y27A 2I66A 4HX2A 1MO5A 3ILVA 4WLVA 4YP7A 5KKNB 4Q3EA 4TYMA 4DBLE 1HYHA 4LDZA 1WCXA 4XB2A 1KE2A 1EUCA 2V98A 4CFYA 1CUIA 2PQ6A 3LNTA 4EEZA 2Y77A 1WSAA 2Q46A 2BGRA 3IGFA 4EUNA 3U09A 1WVIA 3DG9A 4PXYA 1PIWA 1R9NA 1MVOA 3CEPB 4CIDA 1OXVA 1TIKA 2Y92A 4UJ5A 4IEIA 1CRLA 2O0LA 2UZIR 3QSYA 1L6IA 2DHDA 1MB0A 1RHUA 3IRUA 4RNCA 1U2TA 4ND7A 4Z0PA 4HAWA 4P2BA 3VR5D 2ZSHA 4PBRA 1RHQA 3W6ZA 4R1SA 4UXJA 1ZJZA 1S3IA 1RTTA 3LVFO 3OLVA 3RUIA 3B1XA 4AZ3B 5J5CA 4D8UA 4YTEA 1P77A 4ZODA 5CFMA 1URPA 5D00A 4REMA 1PZEA 3NGLA 2C5HA 4INPA 4M38A 3O8BA 1SUSA 4OHMA 2RGNA 1ZSNA 1SB8A 1U9IA 4FUTA 4PC7A 4BATA 4F2DA 1A72A 3JWPA 4H1TA 4WFQA 5KHAA 4CYMA 4BXOA 1E6KA 3RIGA 2J7PA 1E1CB 5BR1A 4B3JA 1E1MA 3HWX1 1BFKA 1M67A 2W2OA 3P1JA 5GIPE 3UY4A 2D5LA 4Y3UA 3FNBA 3SLGA 3HUEA 1JG1A 3DOIA 3EDOA 5KOIA 5KNCD 5ENDA 3PGLA 3QFTA 2B82A 1O95A 2WF6A 3PRYA 1VSQA 3VBCA 1QPGA 2QE6A 3WQHA 2JH3A 1L5RA 4ILKA 4ITRC 1NTRA 1R5OA 3ILHA 4OJMX 3ISJA 2CDCA 4DR1B 2RIPA 3KM0A 1CY6A 4H1VA 1ICIA 2A4MA 4MQBA 3ZV3A 1U2GC 3DWEX 5ELMA 4BEBA 3ZWNA 2Z2IA 1NUAA 1YU9A 3T7AA 1T6ZA 3ISVA 1JR6A 3EZXA 1AS2A 5JJ5A 1PL8A 4PC3A 4JAVC 5K3EA 3QLTA 1PWYE 2I2BA 3OOWA 4MO9A 1H0HA 3BF8A 1VKJA 3LOUA 1NJ8A 4S1OA 2FUEA 3EVNA 3QITA 4TT8A 3FVTA 3V2IA 5CB4B 5KYNA 3RAJA 1YA4A 4J4HA 1N5OX 2G1UA 4ZKDA 1H2XA 2OP0A 2W6OA 4RA9A 2G5CA 1M0SA 4DTIA 2GTIA 3DCIA 4YJHB 1N5RA 1QC5A 1UK6A 2JFHA 3K35A 2HU7A 4TSFA 2HR1A 4ZTUB 4AULA 4MJLA 2ZJ7A 3QZUA 4RK1A 4WKBA 2Q2OA 5DSZA 3S55A 3D6UA 1NV8A 4JEMA 4IINA 2WTUA 1H4VB 1GDDA 2P65A 3HKCB 4L75A 4RTNA 1V43A 3TLCA 4CEJA 1FVXA 2IOHA 2WDZA 5FCDA 4HI0E 4PCUA 3S2IA 1P2VA 2LDBA 3HY6A 2H1OA 3UNXA 5AK5A 5FIUA 3H84A 1V2HE 4TRJA 2W6PA 2JHCA 1UBUS 1K4KA 2H1CA 3KLBA 4FC7A 5IH3A 1SIBE 5IDXA 1A2BA 4KQFA 3OJFA 3USZA 1GJRA 2GRJA 1ECJA 3PVCA 2VQFB 2MOKA 3KL4A 2R2AA 3N5KA 5DF1A 4EJ6A 1X7YA 2DWQA 4K9KA 2B61A 5I9TA 3L41A 4Z8YA 1GTRA 2C4VA 5HX7A 5K3FB 2PMCA 4NJEA 1GKUB 3GAAA 2IK8A 4RC9A 1U0SY 3OA0A 3FPEA 4KQJA 3VJLA 2WTXA 2VWHA 1ML3A 4GR5A 4MR7B 1OXUA 13PKA 1LDMA 1DG1G 1OU4A 2JJ1A 2RK6A 4UNIA 1W8IA 2JH8A 4YJKA 5DHQA 3EBOA 4ZYTA 1RBQA 1BXGA 3ROQA 1V0JA 1G2PA 1RJ9B 1TJ4A 3EQZA 1LDBA 4PXAA 5IC4A 3IKMB 1PVOA 1V8FA 1QKJA 4AKSA 1W5SA 1QFSA 2JIBA 3CISA 1YS7A 1NE2A 2VP3A 3IRVA 4KFTA 2VNIA 5A7HA 3TSCA 1XFAA 4D9EA 9ATCA 3E7WA 3EIXA 3R4VA 3KELA 3OMXA 1WXDA 4CKYA 1UKZA 1B16A 1ZK0A 4COOA 3F96A 4BAZA 1JBQA 2C07A 2XBUA 2ZRLA 4ZV4A 1OZ0A 3ER6A 3GDFA 4X1IB 1T29A 3C5VA 3SYKA 5FTWA 3K2QA 5LQCA 3HFJA 1COWA 2HCFA 3VR4D 3GEMA 1G8AA 1JR3A 2PJZA 3QMMA 4NV1A 1P2UA 4O3FA 4Y1RA 3BWBA 4N0DA 5FTLA 2QSJA 3QJYA 2O07A 1SKYB 2QTRA 1M8KA 2FSIA 4P08A 4U8GA 4FFBB 1JFSA 1LCIA 1ODLA 3IERA 1IE3A 1U80A 4O2AB 1RZRD 4A0QA 3ESAA 4YT5A 1DT5A 2A9OA 4MCJA 3EQ7A 1RXVA 3OZVA 5L4LA 2EX1A 5G0SA 4MVJD 2V59A 1AVTA 3REGA 3U4QB 1LD3A 4FZ3A 4N9WA 4EPVA 2VYVD 2HDWA 2ZTUA 3BJEA 4EQ6B 5LDHA 5EIHA 1KJQA 5EUQB 1KRWA 1J99A 4P0QB 4RQUA 4IXNA 4G1FA 3MS7A 5EJ8A 3EXFA 4WN3A 1ZAYA 1NA5A 2QRGA 3HBNA 3WIBA 3FNHA 4CFZA 1VMIA 3BD9A 3GG2A 3COVA 1ZLXA 3G8CA 3NTRA 3WMGA 5EOVA 4YVFA 2C9MA 3IAAA 1KZ9A 2R6ZA 2AF3C 4HMQA 3BE6A 3T99A 1YE3A 2AT1A 1HO3A 2DFNA 5AW2A 4JYAB 4OI0A 4EVSA 4X7MA 3VKUA 3ITNA 2DY0A 3OEED 1ZH2A 2AKYA 2IZ7A 1SU4A 2HOQA 2WR8A 3QKWA 1J2UA 4LV8B 1F9AA 4QU0A 4EBBA 2MMCA 3CUEF 5E4TA 3I32A 1JV2B 3IDFA 3JCZA 1J8YF 1IMOA 3C97A 4XE5A 1J00A 3W7BA 5LOVA 2QL6A 2H1IA 1OAKA 3I05A 2DOKA 1CQJB 1VE9A 3ACBA 4GOXA 1PQPA 3GUYA 4I4TB 1U0EA 4I4NA 5L3SA 5G53C 4B3TB 3B1WA 2YINC 3GRFA 3SS9X 2PLFA 4ZCTA 2M6KA 1BE8A 1F2TA 1KYIA 1OWOA 2AN1A 2ETXA 1O8CA 2VA9A 4KP7A 4YACA 4PNHA 4JYMA 4BL5A 5JG7A 4F6RB 3JPYA 1TO6A 2IP1A 1E9DA 2EF0A 3GVHA 2ZWAA 2NU9A 4UZFA 3UUGA 4QQKA 5B1YA 1QX4A 1O0BA 1Z3IX 1UP4A 1TNDA 1QP7A 1FSPA 3WMWA 3FWPA 2F55A 3TM5A 3UHAA 5CLJA 3QELA 3LHFA 1YQQA 3T34A 2P9EA 3UWSA 3REFA 1O96A 4QUDA 2G09A 1YI8A 1KY4A 2OBNA 3OTIA 2J5XA 3PQFA 4FQ5A 2V54A 2ES4A 2WNHA 3IT3A 1W0JD 4N18A 3SY8A 4AMYA 1GSOA 3OQNA 1XGKA 2G9ZA 2CVOA 2RONA 3PFNA 3DEYX 4QOIA 5JCPA 2V9ZA 3DS8A 4XX0A 1V1JA 1A69A 2PLAA 3IQGX 1EAMA 1S02A 4RDCA 1EXMA 2ZG6A 4BB6A 2BGWA 4R6WA 2CXSA 4HYYA 3UMYA 1GQRA 4FQ8A 3FKQA 2F7SA 3KVOA 2PMDA 4MUMA 1H9BA 3RYTC 3T9EA 5KS2A 2H07A 2OD2A 5AJYA 5G0UA 4JU9A 1I3NA 3LYAA 1FVOA 2V7EA 4LJ5A 4W8GA 5DI3B 2BY4A 2FFBA 4X3OA 5EPUA 3D3KA 3L4SO 3W8RA 5JJBA 1UJ2A 2JBHA 4KK4A 4EVQA 2BR4A 2DQ4A 4D25A 3FROA 5LN1A 2OV8A 3AI3A 4I50A 5DTMA 2FH5B 4OP1A 2B7BA 3I9OA 4F84A 3ZR4B 4ZZ3A 2XB9A 1M2KA 1YUNA 1OR8A 2A14A 5J4HA 2ZGVA 2AEJA 5G0VA 4JASB 4M49A 3DZHA 1ZC4A 3PDWA 5E3HA 4N48A 3HJCA 2QRVA 1OGIA 1QBKC 3AFGA 5HGJA 5JQWA 1GY8A 4HNHA 3AFIA 3KUDA 1G20E 3LCMA 4FHGA 3ZIAD 4BWVA 1HY3A 3LYHA 1B41A 4JYBA 2CCKA 3ZU5A 1L7RA 2X7HA 4N9QA 3V46A 3SWWA 4LE0A 1QF6A 4QREA 1GO2A 1FS6A 4KE6A 1HURA 4JI4B 1F51E 3WLEA 2DCMA 4Z4QA 2IV3A 1FXSA 3WVNA 4A1FA 4BNYA 3L9XA 4CLEA 2EXXA 1HL3A 5LQNA 2E18A 2FEAA 4P3YA 2P6RA 1WZNA 1V4VA 2Y99A 1LF0A 3OC6A 4AAYA 5CK5A 3E0XA 4IIVA 3A4TA 2ISCA 3O4HA 3M9LA 2FX5A 3BL5A 3EVZA 1H2BA 4US0R 3RFTA 2VSQA 1K5GA 4RHTA 4XQCA 3V5NA 2CXXA 3AWDA 3ZDYB 3I6MA 3OEHD 4BVHA 3RADC 1B6GA 2FPSA 8MHTA 1YIDA 4M0KA 1AKNA 2RGRA 2YZ7A 4TYNA 3E2MA 1JU4A 1FSZA 3CE6A 1SIOA 3WWYA 1JJAA 3CF6R 2XQKA 3MSXA 4JQZA 1KK3A 3NHJA 5AKHA 3U6BA 4BAUA 5K8CA 4JI3B 1AGPA 1P6UA 2P9CA 3UFXA 4DNOA 2VHWA 3FTDA 2PGOA 2LE0A 1OGYA 2QZSA 3WC4A 3C24A 2WQZA 5JLJA 1AUVA 1T0HB 4QTXA 1K6JA 2GXAA 4M9SA 5I6DA 1E58A 1WDKA 3TINA 4G0PA 5AO9A 1PQWA 3CF2A 3IUMA 1MU0A 1R0WA 3KB8A 5A05A 5C1OA 5K0CA 3C4VA 2OD7A 4B45A 3K1AA 1GU7A 3U4GA 2YWXA 3ICEA 1EXNA 1XP8A 1P0QA 2KWIA 2M98A 1NVAA 2C9YA 1XEAA 3ETEA 1MZVA 1TMKA 4INOA 4MV7A 4MVJI 4DN6A 1BDHA 1D6NA 3H2HA 2X3UA 3TLGB 4U00A 3EOBI 1B8OA 1K6XA 2D54A 3RVNA 2PMFA 5JQGB 3AI1A 1VGRA 4XCQA 4KTTE 5HF5A 5JASA 5FEMA 3ER8A 2B9VA 1OTYA 3AHDA 3K8YA 4Z7OB 3GLGE 1IU9A 2OWEA 3GLRA 1BAPA 4JIMA 5KSZA 1BVRA 3IPXA 5H3HA 2VQ3A 2XRYA 2EGHA 1XQVA 1A5TA 2J32A 4B3BA 2LCQA 2MCFA 1DO2A 3GIDA 2F3PA 2UYQA 3UWOA 1GZUA 3L49A 2PUEA 1BEUB 3EWSA 5HCUA 4N41A 4FJ2A 3Q0IA 4GMGA 4XDZA 3FZQA 4Z5XA 2D6FA 3RYCB 2TS1A 1ZO8A 5TVGA 3RSLA 1QZTA 1WL8A 3EQ9A 1E1YA 2B5VA 3AK4A 4DSAA 1HZJA 2GYWA 2BKEA 4UNSA 3FCSB 3Q7EA 5HQ3A 2AVNA 2FE4A 1WB9A 5J63A 1P0MA 1WP4A 1RYNA 1WCIA 3F1LA 3UG7A 2PD4A 1XZGA 1YR7A 1E60A 3M2TA 4J91A 4F11A 5JMWA 1H93A 1NHWA 1QFZA 4C5AA 2A0KA 4LPSA 5IN5A 4MUKA 1N92A 3ZY6A 2X4LA 4PWYA 4XXHA 1CF4A 1EK2A 2LCIA 2VBGA 4IEEA 3HKBA 1XPRA 2NSLA 2UZ0A 4QG3A 5JHHB 1OTXA 1XG5A 4MQFA 4Q9AA 3H5NA 3ZYCA 3B78A 3WSVA 3OD1A 1IJEA 4BN5A 2BDEA 4LKOA 1QO7A 3THXA 2GYVA 3PI6A 16PKA 4MWEA 4DSTA 1QU2A 1PJ3A 2X41A 4V3CA 1EG2A 1JQDA 5L3RA 3WQBA 1ZGJA 5BQXA 5LBTA 2XCSB 3OZGA 1KI6B 4W5HA 4MP6A 5JRDS 1LEHA 2P8SA 4DEXA 1QP8A 1XC7A 2HGZA 5TF4A 4CODB 4QATA 1YL6A 1Z17A 5EE0A 3BWVA 1C30A 3I72A 2SKCA 3H16A 3ZE0B 1TZCA 1XQXA 4FMDF 4WOBA 1II0A 1AN0A 2Z0MA 5LWQA 3A1DA 3OKAA 3B85A 4CCSA 5KQPA 3CRQA 4HGYA 1PLKA 4LSZA 3GP8A 4AP6A 1X42A 1N8SA 1CQPA 1CQWA 3AC0A 2NO4A 1H2YA 2H65A 3R0JA 1DMRA 4HAVA 2CBXA 5CH3A 4ZJUA 3EPKA 4WCFB 1PR3A 5MN5A 2G4CA 1GPJA 1A5ZA 1YZQA 3Q7SA 5CH8A 4D8VA 5TQJA 1EDZA 1VIAA 2PA0A 4DR3B 2OLJA 2IS4A 1VIVA 2YFQA 1P3Y1 3VU8A 4WK4B 3WKBA 4U6QA 1PDOA 2EC5A 5HFJA 4B3DA 3RJ5A 2IDZA 2G08A 2QD3A 3GDOA 5BOSA 2Z3VA 4P22A 3RT7A 3H2IA 4UC0A 1BMFD 3ZDQA 5KYWB 4IIJF 4JWTA 4GGPA 2XMQA 1KZ6A 2G7MC 2QLJA 2YN4A 3UA3A 4AO6A 4OM7A 1QGOA 1YBAA 3EW7A 1ESMA 3UCFA 1IHDA 1ONSA 2Q2WA 1SOAA 5EQFA 1ADBA 3ABQB 3EXHA 4BNDA 5LZ7A 2B5OA 4KQEA 5A5DA 1SAYA 1FIUA 2CUZA 1QX3A 1D2AA 2AHOA 3W2TA 4DRXA 1HDGO 1RCUA 3LSTA 4QQRA 1ULHA 3JQ7A 3RARA 3L7LA 2PBLA 1U5AA 4G4JA 3LLUA 1BJRE 3M9WA 3M6WA 4LDNA 3K6KA 4PZZA 4QPPA 4QUHA 5FOXA 3RHZA 2ZB2A 4ZAGA 1YQEA 2C3MA 3D9QX 1C1DB 4PZ9A 1GLGA 4QOSA 4CFSA 1UBNA 1X9HA 2ZP1A 1AE1A 3LYLA 5FOUA 3RAGA 1EFCA 5DM1A 2XUGA 3K1YA 4CLRB 2BUAA 4DLPA 1I24A 1ULSA 4LJAA 5HVNA 2I54A 1QNFA 3FUXA 4GWGA 4Q1FA 4Z0HO 3A58B 1RAHA 5J2UA 3TNYA 3M1LA 4P92A 5B58C 3DDCA 2VSXA 3TQRA 3VKWA 4DMKA 1U9YA 1KS9A 2IHNA 5IK2A 4OSOA 3SVLA 3QKTA 1PT9A 1TZ2A 1N1GA 2C1XA 3H75A 3ZY4A 1NOKA 2OHFA 2N1BA 2I4IA 1N5JA 2IHUA 5BN5B 5TR9A 1E99A 4QOHA 4GVXA 3CNOA 3JYLA 1CRQA 4HLDA 3RRJA 2XCTB 1JXMA 3X2SA 2IS2A 1XZNA 3ZHSA 4XVCA 5ALVA 2BTQB 1UJMA 1XF1A 1I94B 1ARZA 1IDOA 2GM5A 3FFWA 5GQSA 1SUWA 5AI0A 4TZ6A 1NXVA 2XKAA 3ELBA 4RF5A 2O2JA 4D9IA 3UV6A 5IVIA 3H05A 1SA0B 1ZN7A 2FMXA 3H9QA 1ZH0A 3A3PA 3NDRA 3FMGA 4MJ3A 4WBNB 1DAEA 4NQRA 4GX0A 2C3YA 4BPRA 5JT1A 5C80A 1YJQA 2E4VA 3E27A 3GJ4A 3KWLA 3P2EA 1NXQA 1M6HA 2RI0A 3BE5A 2Q6IA 3S6JA 3IEUA 3ETLA 3HCFA 3ROKA 3V33A 4LCBA 2WINI 3GX1A 1LDGA 4MGEA 5U4XA 1H23A 2FPWA 2AB0A 2L42A 3O4IA 4NESA 1NKTA 5CP8A 2E4ZA 3IS3A 3UXYA 5HZKA 1ZNQO 4Y7CA 4OB8A 4MS4A 5LYJB 2KMLA 4TS9A 3C98A 4YXWA 2QTHA 4M4SA 4FR5A 2GJ8A 5TE9A 2ORVA 1XK7A 1ZM4A 2Y93A 3EIHA 4RF3A 3VNQA 5COQA 5ELXA 1GXSA 2W43A 2XUKA 3CA8A 3DGEC 3EVBA 3LF2A 3N7AA 3NT2A 1E8NA 4LHEA 1DEHA 3GRCA 2I9KA 3HZZA 5AVRA 2GAAA 2RH5A 3ZJ4A 4EK9A 2W4IA 2QRKA 1BX1A 3DWIA 5SY6A 4DUGA 2ODQA 4AKTA 3GJZA 2WUWE 1OBFO 2QX9A 2GM9A 4XJTA 3T5TA 5BWLA 5K5EA 2ZSDA 5KI6A 1UXJA 5FOTA 2OFOA 3G2PA 2J7KA 1HSZA 3E35A 5JVDA 4E5VA 3AILA 1OLXA 1KMHB 4QXPA 5DWQA 1EFPA 1LK5A 4AX4A 4C89A 1SBTA 5CJPA 4JLMA 3D8NA 2PJRA 4ZQEA 3GUCA 4W6ZA 2BMEA 3SSMA 4ESVA 2V3CC 4HH1A 1II8A 4PTYA 2PVCA 4K1XA 3O8OB 4DKJA 1NF3A 1VL5A 3KCQA 3HY3A 3BDVA 1VG8A 4OO3A 4DSNA 1PS9A 4ZCPA 2Q4TA 3ZCUA 2FZVA 2B1IA 4L9RA 3VXKA 2Y6UA 4IYRA 2FDRA 2KLBA 2OO5C 2PZJA 1QQBA 2WIAA 4QPZA 5CX1A 3FYUC 2PR7A 2YJNA 3LBYA 1U3CA 2AI1A 2G0NA 2CHUA 2P5TB 3WGJA 4B47A 4XPZA 2IU4A 4G81A 1DQSA 1JH8A 2ZPTX 4RD1A 2VFAA 1ADFA 2J3MA 3O84A 1T2FA 1YZKA 3EHEA 2VYFA 4YBRA 2FGJA 3UMRA 3ZHYA 3WK4A 1OA1A 3RKSA 2O7QA 2WZCA 5JS1A 5JNWA 2FQXA 1X1RA 3GRVA 1CZLA 3DEIA 3SS7X 1DFHA 3E84A 3LPCA 2R0QC 1G41A 4MGYR 5ALIA 1JKJB 1QRRA 5EZYB 1GEEA 1UOQA 3GJ5A 3MRTA 3MAJA 4ZXPA 4AP5A 5I7SA 1FNMA 1NQUA 3L05A 2OZKA 4UD2A 4YUYA 4CEHB 2EFEB 4PM4A 1KIMA 4RHFA 4WXEA 2QMEA 4Y8VA 1S2NA 3C16C 1S7CA 3HWSA 4LOLA 4FEYA 3DSRA 1N5MA 3IUEA 5EE9A 1MEOA 3QU9A 3IUNA 3OPNA 2BP7A 5ALQA 2H08A 5JAPA 4JT9A 4HN4B 3DHEA 3DXFA 3KLNA 3O7MA 2VQEB 1JG2A 5CD1A 3WGQA 5KNDD 4EI2A 1DBPA 1PQUA 1E77A 1AS3A 2BF4A 1R0YA 3PHLA 1DC7A 1XA4A 2JAWA 5PGMA 3FBGA 1GVHA 2JFNA 3QWAA 5HDQA 2FK7A 1W29A 4U39A 5ES4B 5KB3A 2FSUA 1EJ0A 1NI4B 2BCEA 4G5QA 2JLUA 5GY7A 2VNKA 1GQOA 3ESQA 4X7RA 5KVSA 3MZ0A 1TCUA 5DTIA 3T7TA 3WLHA 3OSUA 1JIKA 5K20A 3AEKA 3TOZA 2K87A 1MC1A 4LGCA 5F7ZA 1K1EA 4OY3A 1KVUA 5AI9A 4MYHA 2DBZA 3THWB 5H02A 3OM9A 4NAVA 3CT4A 3AOGA 4HFMA 4ZVRA 5H83A 2HJVA 5BV0A 2WKQA 1QB7A 4LYYA 1LI7A 4KQKA 3NNDA 3GI1A 1PX2A 5AW9A 1TO2E 4Z2AA 5FDFA 1Y81A 5KREA 3KAPA 4D4GA 2CJWB 5JNRA 3HZHA 1E1RA 5FH9A 2HDHA 3R24A 4LXGA 1ENYA 3I8SA 4ZTZB 4IDFA 4HXYA 1JUDA 4LMBA 4KVAA 1CIJA 1U2PA 3AUTA 4H0FA 4TX1A 3V97A 1VKNA 1XQ6A 1EHIA 4M9ZA 5YASA 5CR9A 1C3VA 1Q11A 1VXRA 2FU5C 3FLMA 3IV7A 2H2AA 4K5QA 5JAZA 4URVR 1GNSA 1EE1A 3U0BA 1SG6A 2X77A 3TGWA 5JCJA 1HR0B 4MKXA 3UN1A 5JDIC 3E15A 3H2GA 3NRBA 3GLIA 3UKDA 5EWMB 4M8SA 4PXSA 3QV2A 4W9NA 4B4VA 1M2FA 1OH8A 3UXMA 2PTGA 1C0EA 3PEEA 4PYOA 3DT8A 3ZWVA 3H9JA 5IJAA 2AQIA 4M37A 1EVYA 3W3AH 4HNRA 3WI7A 1J97A 4R51A 2WWHA 4L5CA 1U5BA 5DWVA 3GLHA 1YRBA 4XM1A 1WF3A 1EZ4A 4RV9A 2RHHA 3EZ2A 3RK1A 3E9CA 3S7ZA 1J0DA 1EB9A 2XCUA 2Q7XA 4CEIA 3PD1A 1PI3A 2UUPA 3GUZA 2FVXA 5LP6B 4AIIA 2VT6A 5BT8A 3DBHB 3WB2A 2FMFA 3VNSA 5EAIA 4P5DA 4LZWA 3AJRA 3C3CA 3M6AA 4KUGA 4PYLA 3T5BA 5DGTA 3CVWA 4R4JA 4GMXA 3KXKA 5A0FA 1X7HA 2FPPB 3VSAA 1FE8A 2ZIXA 1TYZA 1XVLA 2CNWA 4UE2A 2L18A 3Q8WA 4J29A 3PA6A 2H31A 2ASEA 2PSJA 4PICA 4BVEA 5TDHA 2B6NA 2GN1A 1WXQA 3D0QA 4GRAA 3PG5A 4JL6A 4XLZA 3WMXA 1NUQA 1L9KA 4OGGA 5BRJA 1KEKA 3DCJA 4YHHB 1XUOA 4G5SA 3KQKA 3VR1A 3RYHB 2ZXEA 4PCVA 2EWMA 4NFLA 3PDJA 5IAEA 3H2KA 4KQ9A 3RHSA 4KR2A 3B6JA 1EWQA 4LSGA 1QCYA 4DEVA 3AL3A 3KO8A 4CIVA 3PSAA 2XVAA 1EP9A 2QX6A 1PNTA 1AD2A 2P3LA 5EINA 5B7QA 2OCAA 3UVEA 4J1TA 4UPVA 1XMSA 1KI1A 2CUKA 2Y1EA 1N2EA 3X1YA 5JZ9A 5T4EA 1XJ0A 1TXGA 4DA9A 1ULZA 3OJCA 4UFOA 2FPIB 3HN7A 2REBA 3A14A 3LX8A 4IOJA 3VJMA 5IJZA 4B3MB 1JHPA 2F8TA 3WOHA 2DCUA 1DUVG 1BXRB 2ZCUA 4WZBA 5FPPA 1TCAA 1YL5A 2VJKA 3M4NA 4IRXA 2QVXX 3BRQA 2NVUA 3D02A 2WKRA 5AICA 2N47A 4GLFA 5CLFA 1NUPA 1NXXA 3NB0A 3LKVA 2BLNA 5EUCA 1YCHA 4K9PA 2B3TA 3SR0A 5EVCA 1GV0A 3ZU3A 4F3CA 2FKNA 1LQTA 2FRXA 2NZVG 4KDCA 5HNKA 3VSCA 3H5RA 1SG0A 4EYGA 5K8VA 3W2EA 3JZFA 2WE8A 1ZCZA 5TNXA 1EJ2A 2NMVA 2EJBA 4OKSA 1N6LA 3EOZA 1LC3A 4XUGB 1FL9A 4BO6A 5AVJA 4MRNA 2SKDA 4X6XA 4PLGA 1OWLA 5AVVA 2DERA 1K5HA 2PZAA 1FW6A 1QWSA 1ST3A 4KO4S 4OQYA 1NBHA 3GFQA 3V8VA 4C87A 4CR7A 3AF1A 5F33A 3LPLA 2SNIE 3FCYA 2A9PA 3L5KA 3P0RA 3J81k 2JJ8A 1WMBA 4JOBA 4R1TA 2WTEA 4GBED 3S29A 1J7KA 4YJ2F 1B0AA 4B0PA 4NH0A 4M55A 1IUKA 3BZWA 1JLSA 3PPXA 4WDRA 4FW9A 4X66B 4EKGA 1QYCA 2PCJA 3CRVA 2B7CA 4Y9UA 4HDOB 1MOQA 3F9IA 5GPBA 2HREA 1GNLA 2QPOA 2Z2KA 3HVUA 2AC7A 2FLWA 3PQ5A 1P7YA 5DHUA 1L7QA 3ODPA 4I55F 2X0KA 5DNDA 1PR2A 2PD3A 2HBQA 3VV3A 4UCFA 4YRKA 5EHZA 5KPJA 4BDTA 4J6EA 1YIOA 1M5TA 4JGGA 3BBLA 4GLBA 2JJMA 3PJFA 4LXXA 1UBMS 1NTOA 1A2KC 4L7VA 3TN7A 1NG1A 2B4KA 2BBTA 2IGTA 5IF9A 5KVAA 3GB9A 1YZGA 1AV6A 3V7WA 2X8BA 2IZZA 4QZVA 4N7BA 3W4KA 3FNEA 2OZPA 2VSNA 3FNIA 4GFDA 4WSOA 1M2HA 4S1VA 4HWTA 4OHBA 3IPCA 4ZOEA 2Y0EA 4BTEA 4DLAA 4UXIA 2VQSA 2V96A 2VG8A 2W83A 1P4GA 3GMSA 1Z06A 4IDEA 1CR1A 2ZI3A 5AKIA 4XQ9A 4MV1A 2BEWB 2C2KA 1SULA 3HVKA 3RJ9A 5FNVB 4J2HA 2IDJA 1ZBQA 4PAMA 2H2DA 4PYKA 3TE6A 3UOGA 4E33A 3PNKA 1KQNA 2YRWA 2ARKA 3BWXA 4BRWA 1OYWA 1T36B 1XXHB 5EKTA 3F5SA 3WR5A 3D1LA 2QMOA 5CA1F 4V1CI 3J81A 4C5CA 2ECKA 1SQ6A 1X7DA 4JI6B 4K9QA 4CQLB 3PQ2A 5AD1A 2IHTA 1DJOA 2C7VA 1S6YA 1R8SA 3DHVA 5TQ2A 3RIHA 4DA8A 1V6CA 3C3XA 3UGTA 3MVEA 4GOOD 1UEIA 2GJ9A 1R1DA 3VMFA 1ECGA 2PCLA 3EUAA 3W2FA 1NU6A 1BHSA 4WK0B 3UT0A 3F47A 4PFSA 3T9DA 3NHWA 3DV0B 4EJSC 1CUJA 3KK0A 1S9HA 1G6KA 2HX1A 3L0ZA 3CEJA 4QODA 1P19A 2IYLD 3CH6A 1Z0SA 1J23A 3D3WB 1H0RA 1L4EA 2ILTA 4RY8A 3AM4A 3D43A 3E82A 2XEDA 4WERA 3L0YA 3Q6IA 1EDEA 2Q5EA 1E9EA 1RHKA 3O75A 1JA1A 1O03A 4GNRA 2VCHA 3QLUC 3HL0A 1S2OA 4PGHA 4B35A 1IQPA 2IXEA 4YRDA 5JCOA 2B98A 2HIHA 1KOJA 2Y0DA 3D0OA 3QKSB 3I0MA 1Q22A 1ITZA 3COWA 3II6X 3UXHA 2OMEA 3E03A 2IHZA 4K87A 1JXAA 3GD5A 4ND1A 4RPKA 2CEKA 3REQB 2XECA 4Q7LA 3L7DA 2QL7A 4MX8A 4WKCA 4G1BA 1ORIA 4Q3AA 5B12A 5F77A 5BO5A 1A8IA 4KAXA 5CVJA 4M9CA 2FP3A 2Z8YM 1QYXA 5EE1A 5JO9A 1NVVQ 2K2WA 1R00A 4JD5A 5FB3A 4N3BA 3ZUPA 4A2WA 3HDHA 4IIHA 3VDRA 2OFWA 3KQSA 1GG5A 1YHYA 2Q1WA 2XSZD 1V5IA 3AL2A 2QUHA 3BFJA 1V1RB 3HNOA 3LWBA 4LSMA 2AD1A 3UKJA 4UD6A 5C53B 1E7YA 3ZW9A 5EIBD 1B00A 1HDOA 2HRRA 3BB3A 4Y30A 1LSSA 2XXJA 3EAGA 3T7SA 4OSEA 1FBTA 1Q0TA 3W8FA 4EX7A 1J56A 4DIEA 2HA4A 2H18A 3VAAA 2J1LA 4X90A 1U8AA 2A9RA 5ALRA 3LLCA 3QEJA 7REQB 2EZUA 1E6UA 2QUAA 4MVJF 2IXDA 2XNHA 3BXGA 4IV8A 3OO0A 3W05A 4N8EA 4WJLA 1SXJE 4Z51A 1JG3A 4FHDA 3PCTA 4WFIA 1YR1A 5K45A 3U44A 2AYZA 4Q3LA 3P9RA 2BDTA 1TQ6A 3TI9A 2GSDA 1EUDB 3BJMA 5AM1A 4AJPA 5JH7B 4LF4B 3URMA 3LW7A 4N6GA 3U4DA 3EWNA 4NE7A 3D7NA 1E7WA 1DQPA 1YWGO 4JY7A 5KC9A 4XIJA 4CMHA 1MUUA 2JRCA 1S2MA 3IAS1 1RE1A 4IW3B 2YYYA 3UJ7A 4BQPA 1YTLA 3IKLA 1ZICA 3NBKA 2I7TA 1PJ8A 3IMCA 4YALA 5DTQA 3KDAA 3NIFB 4G2TA 3A7EA 3I8OA 5JLAA 5TGDA 4ARUA 3NG1A 4B74A 3KD2A 2JL1A 3MCAA 4WLUA 3J80A 3TRKA 2ZATA 1HDRA 3VDQA 4O25A 3H9CA 4LA4A 5JPIA 4JJZA 3DFMA 2CJYA 2HWYA 3JQFA 3KT6A 1HKUA 3PCXA 4MNTA 2PMEA 3T7IA 1QCDA 4EG1A 4A8JC 2W2TA 1T2CA 4DHEA 4JN6B 1WKBA 2M9MA 5IEJA 1E3MA 4HWOA 1C4KA 2W2NA 4E7PA 2D1RA 1PNRA 5J43A 1Z5NA 4W5QA 3F49S 2HAEA 1ZA1A 3ANLA 3BGIA 4MPRA 3P71T 3ZKWA 1IFXA 2C1ZA 4QASA 4Y1EA 4F4HA 2NU8B 3QIVA 3FA2A 4IHQA 3EY9A 3WGTA 1VHJA 1HM5A 2I7VA 1M2VA 3NHPA 3PITA 4QARA 2XE7A 1L7NA 5AXDA 3DOEA 1MCZA 3GEIA 4UPDA 5LB2A 4QPJC 3RVMA 2WIFA 1JB9A 4ACBA 5B7GA 2OA0A 5T6MA 3ZVRA 2R8ZA 1NMSA 1XZAA 1DSSG 2G71A 1ZBDA 5HIJA 3FN4A 2IZ1A 2QD1A 2XE8A 3PJEA 2A0UA 4H7DA 2IV2X 3RSOA 3VVCA 2YNMC 4DCMA 4Q7EA 1BQ4A 2OQVA 3IB3A 3WNDA 1HE1C 2AZTA 1WM1A 2VJPA 1PQ4A 1I7SB 4KLZA 1KP3A 1S1MA 3OTHA 1AT1A 4KHPB 4KR3A 3QX9A 3VSEA 1POWA 2RHBA 3PFIA 2OV3A 2BL4A 2OHJA 2WI8A 2YZGA 3C1OA 3EVCA 1N4DA 4JL5A 1DBQA 1Z8DA 3JQDA 3NEYA 2QW1A 2BFCB 4UMEA 1P60A 4P0TA 5DN6A 4DBVO 3G0IA 3GLFA 4H0NA 4X60A 2ZIGA 4F12A 3PVZA 5FLXA 1IUPA 1O77A 2QM0A 1Z6YA 3C1UA 3PQ6A 4ZD6A 3TLYA 4K6OA 4E07A 1E5VA 1EUQA 3AQ4A 3VPFA 2C4KA 3FYTA 3NHAA 5CHYA 1IZYA 3SNHA 5EJGA 2R1VA 1JWBB 3BIWA 3KSMA 2B99A 4KGDA 4DCSA 3JAKA 3HXQA 1AX9A 1A7UA 4DNPA 3GJ3A 1QFMA 1ZQ9A 3I2FA 3FKJA 1ZGGA 2GN0A 4I9NA 3QVGB 1PV2A 2PQ2A 4RHYA 3KFXA 4ZIRB 4HQFA 1Y9ZA 3CUKA 4D4MA 1AKWA 3TFWA 1M2OB 3FTNA 2NTEA 4OA5A 2HQSA 4O6VA 3KPUA 3IR5A 1JFFA 1Z7GA 2Q5CA 1M7BA 4A9AA 2DFVA 3CCCA 3RTBA 3IR7A 2A8YA 3PUXA 3VZSA 4NY1A 2ATEA 4DMHA 1KZ4A 2H63A 4U9IS 3I83A 4KR0A 2AMFA 3P4UA 4HEHA 3TECE 2CDNA 1JHUA 4GRDA 1Q1EA 5IT9A 2O2XA 2IXGA 2EW2A 3C6YA 4HPXB 2WY2D 5HK9A 1IRXA 1ZINA 4K9NA 1NGSA 1ZNYA 2YZKA 3OX3A 2FMTA 2C96A 4RANA 1W88A 1FA9A 5H9VA 1PUJA 4C4YA 5EZ6B 1O89A 4V0MA 3PRHA 4REQA 3H1PA 4CKWA 3WV4A 3PKIA 4YV2A 3GH3A 2RBEA 1L5QA 1O87A 4B3XA 4GZ6A 1JDUA 4B7ZA 4UTNA 1Z4OA 1OH7A 4EKDA 1K68A 3OX1A 3FSGD 4G4SO 2IITA 3FR8A 4LWZA 4RGYA 4EPRA 3SNKA 3KHSA 1I2DA 1G8FA 1ISRA 3BG5A 3ANYB 1R0BA 4QTUB 4BVBA 4QXQA 1WQ3A 4ARIA 1SU8A 3IAM6 1RI5A 3LY5A 1RQRA 2ZRHA 4LRQA 1GITA 2QXUA 4HEJA 4TXJA 5C3UA 2XGJA 5T64A 5AHOA 3AWIA 2J48A 3VGPA 2DF8A 1OBCA 1PUIA 4OHVA 4DCJA 3AUSA 5BSEA 4ZC8A 2GEVA 3W9YA 3M2PA 4U63A 2OYRA 1LV8A 3RS7A 2P2CA 3ZH9B 2P4SA 5EYPA 2DFPA 4RJIA 3TVTA 4YECA 5C18A 5KTSA 1KO8A 3SYTA 3VYUB 1KJ8A 5C4IA 4BLTA 2MHCA 3L9WA 4WCVA 2UUOA 3O8QA 3WYBA 2WG1A 1TI7A 3WISA 1N8NA 2WVJA 2VEDA 3HYSA 1SY7A 4JC0A 5IXYA 3PHHA 4G0OA 5LQSA 4DV7B 2O3JA 3E9MA 2CJXA 4LY9A 3AFHA 4O4LB 1RM3A 4Q7JB 4QXOA 5JDCC 5K3CA 5BSKA 1O95D 2QUKA 4DR7B 1X1CA 1EWKA 1NVWQ 1PFGA 2EHJA 1SKAA 1I13A 2UAGA 3OOHA 3X1ZA 2H2FA 3ODGA 4FN5A 3QFSA 3R0VA 4JLBA 3ZV6A 3L06A 1NJSA 1VG1A 1ZOIA 2VCEA 1GQYA 3AT1A 5LA6B 4YMHA 4E46A 3DEHA 3DWGA 4I8DA 2YBDA 4Q3DA 2B21A 1CUXA 2NO1A 4J9UE 4Q37A 5SYAA 5E6SB 3QVTA 3V8BA 1UZAA 3TBKA 2OECA 3TKYA 1TA0A 1VZ2A 1ZP6A 5C8YA 5I8WA 2VTDA 1G38A 2DH6A 3MQ4A 4KV9A 3V8PA 4DIKA 4TL8A 4D8TA 4EF4A 1KSFX 2P2YA 4O4HF 3I5YA 1GHTA 2BYTA 5AFSA 1WUJS 5JYCA 1XBTA 2DU8A 1WDLA 1E1LA 5I7UA 1C1XA 3OH8A 2HMVA 4RPIA 1G9TA 5AKJA 4KK3A 3CF0A 3MJRA 3OQIB 3WAKA 1N3YA 4BKOA 4MKZA 3L4BA 4QT0A 4P3PA 3SJAA 4K6GA 1JHMA 2IEAA 4DC9A 2R1UA 1IPFA 1Y98A 2E0IA 2FPRA 3D0KA 1DAMA 4IV0A 4ZK6A 4Q4HA 5BWBA 1V2GA 1CVRA 3IQXA 2XV1A 4OLAA 2H4ZA 3EGIA 4XUCA 4FSHA 2OENG 3EYWA 3F98A 2JHAA 1ML4A 1Z8HA 1E9SA 1JZQA 1H2ZA 3H99A 3SC2B 3R6TA 3V4PB 5FWYA 1S0UA 3ACDA 1XRPA 1GARA 3C7AA 4MVJE 4IXWA 2YXPX 3FWNA 4BPBA 3ZV4A 1G5PA 1SVSA 3F97A 3KD3A 3MT9A 2EQAA 4TQGA 5FPQA 1MN6A 4HB3A 4BZWA 4JT4A 4MIYA 3B1FA 2XGGA 1Z82A 3RSCA 1RQNA 1U0LA 3PR2B 4HR7A 1EM8A 1WP9A 1S7GA 3OM8A 2GBGA 3LX5A 1N77A 1QUFA 1ORVA 2H9IA 4GBJA 4CL0A 5CDUA 3C4JA 5KKCA 4NCAA 4XYEA 4UHKA 3KSBC 2XMPA 4R7TA 1YASA 3OU7A 1M1YA 4HQNA 3MWKA 4RK5A 4RV5A 3CXUA 4UEQA 1MC5A 3CGWA 4JNKA 1W75A 4OD0A 1U02A 2P2NA 2YC4C 1N33B 3U37A 2YCLA 1GSIA 1CEQA 1E0KA 2Q5LA 3H97A 4KGZA 4B09A 4D82A 3WGYA 1E59A 1JPJA 2BV3A 3B6IA 1M6NA 2WM9B 3UAGA 3GGPA 4QRHA 5U9CA 4FGJA 1NVDA 4JKIA 3UM9A 1KEPA 4KPGA 4LMAA 1G20B 2ZYGA 3E5NA 4C3ZA 1ZONA 3P32A 3TW8A 3I04M 2J3EA 5TLSA 2R00A 4LJYA 1YOVA 1E6MA 2PH5A 3N1UA 3VX4A 5EL0A 3G6KA 3DM9B 4FFVA 3WYCA 3KAJA 3NWPA 3RRNA 2ECFA 1TLTA 2OMKA 4YJFB 1RXYA 5DHTA 4DVGA 121PA 1Z0UA 1JR3D 4MRVA 2F1KA 4MW4A 4R16A 5DBIA 3CVOA 3JQQA 5DISB 2OXTA 1Z0AA 2XXAB 4YQZA 4BNNA 1JHQA 5IM4A 1PV1A 3E1GA 1PSZA 1RQ2A 3HXPA 4FE3A 1KDRA 3BFXA 2VDNB 2PT5A 1XCPA 3PXAA 2I3DA 1P0FA 1Y4UA 2A4KA 2H8KA 2LIVA 3PDCA 4ND3A 4PAWA 5D1NA 3STYA 4D8YA 3RG8A 1MT3A 1AA6A 2QN6A 2Y1OA 2VRWA 4L1KA 1P4JA 3VOBA 4BV9A 3DO5A 2Q45A 1EDBA 2EHDA 2VRCA 2AL7A 2OFXA 2ONKA 1WRBA 2AE1A 3LHDA 4WMLA 1NPTO 1GTL1 1TAQA 2NZXA 3AEQB 3BQNB 3DYVA 2HJWA 3GJ6A 4M8NE 4TKMA 3EY4A 3QBJA 2P6NA 4P3NA 5TVKA 3AFNA 4DSZA 2JLZA 1OIXA 1U3DA 2HXSA 3LQQA 1XX6A 2TRSB 2VJNA 3MTGA 5IANA 2XIQA 1XZFA 3INTA 4BNTA 4GSLA 1FYFA 1I33A 1RM0A 1RWBA 2OILA 4CF5A 5B4UA 1IXZA 3N6VA 5AVSA 4ZI7A 3NJ4A 4RLSA 3Q15C 4J94A 3LT2A 5LWHA 3MW8A 3PV0A 1M0EA 3HCPA 1Z6ZA 2SECE 2BGLA 2X6QA 1D3AA 4ES6A 2PE5A 1HYEA 3PPYA 3NC1C 3EGDB 2V7GA 3PEUA 1FOEB 1L5OA 2DKFA 3CW8X 3GWGA 1KI8A 2ZT7A 3L7BA 2JGAA 4GP7A 4JQSA 3ZWQA 4FVTA 4N3CA 4AMGA 5EMHA 1MW9X 3WQRA 2ZAMA 3QMWA 1K63A 3R3YA 2X6RA 1TFUA 2Y8EA 4EP1A 3NWOA 3SJZA 2NQTA 4PZ0A 1BW9A 2PS1A 4UNPA 3SF0A 4YREA 3GOHA 2I80A 4XWWA 3GLGB 1Y1SA 3W34A 5KTNA 1IBKB 3MFQA 4ZYXA 3SHOA 5DBHX 3ZE7A 3LZCA 1T2UA 2ZYIA 4QBHA 3K70D 4JI0B 5CVDA 3UW3A 4AKEA 2E87A 2ZI6A 4KN6A 4CMIB 4PHCA 2FUG6 3GFTA 3SZUA 2DUNA 1SVOA 3ZIDA 4MV5A 3IYLW 3KOXA 4JHLA 4BQRA 1E5DA 3EA4A 5ALSA 1GLVA 1SGWA 1GPBA 4MDYA 4NHOA 4PSVA 3CZMA 1CW2B 3TEJA 4OXXA 1H22A 3FGOA 2F2TA 4G9GA <