2EKBA

Structural study of project id tthb049 from thermus thermophilus hb8 (l19m)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRMLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Structural study of Project ID TTHB049 from Thermus thermophilus HB8 (L19M)
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 60
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2ekbA00
1E58A 5AJYA 1SKAA 2HHJA 4D4LA 3LNTA 4FDUA 2ENWA 3GW8A 4IJ5A 3E9CA 3QPUA 4FDTA 2P75A 3EZNA 2YN2A 1BQ3A 1DKQA 2P9FA 1DKNA 1H2FA 3D8HA 5CX4A 2AXNA 1NT4A 1E59A 4D4JA 4EO9A 1H2EA 1V37A 3IT1A 1C80A 1DKPA 1DKOA 3HJGA 2BIFA 2I1VB 4IJ6A 4MA4A 2P30A 3KKKA 4EMBA 2P79A 1T8PA 3MXOA 2P9YA 1C81A 2QNIA 3IT2A 3GP3A 3K4QA 2P6OA 2P77A 1UJCA 2P6MA 1SK9A 1ND6A 4JOCA 4D4KA 1QHFA 3O0TA 4D4MA 1SK8A 2DWPA 2F90A 2P9ZA 4GPZA 2OWEA 4ARVA 1YJXA 1TIPA 2A6PA 4PZAA 1BIFA 1K6MA 3R7AA 4E3WA 3QPWA 1C7ZA 3E9DA 3D6AA 1RPAA 2H4ZA 5AJZA 2WNHA 3DCYA 4PGMA 1SKBA 3FDZB 1EBBA 5HR5A 2WNIA 3EOZA 3OI7A 2DWOA 2H0QA 1FZTA 2GFIA 3D4IA 3F3KA 4TSRA 5AJWA 2HPAA 3IT3A 3NTLA 3PGMA 1RIIA 1DKLA 1UJBA 2H52A 2H4XA 1RPTA 3GP5A 3NFYA 3F2IA 2YN0A 1DKMA 2PA0A 4GPIB 3QPVA 2EKZA 3DB1A 3LL4A 4HBZA 4JOBA 2P2YA 4PZ9A 2IKQA 2HIAA 1XQ9A 3FJYA 3LG2A 2EKBA 5CDHA 2A9JA 2ENUA 2RFLA 3MBKA 3BIFA 5AK0A 1YFKA 4ODIA 3IT0A 4JODA 1BQ4A 1ND5A 5HTKA 3ZHCA 5CU7A 3E9EA 1FBTA 4ARSA 4QIHA 5PGMA 2EOAA 4AROA 1QWOA 5AJVB 2P78A 2OWDA 3K4PA 1IHPA 3C7TA 5AJXA 1CVIA 1V7QA 4ARUA 2P2ZA 3FDZA 2WU0A 1QFXA
chains in the Genus database with same CATH superfamily
4PS0A 1TZJA 1P6QA 3H0KA 4Q1VA 3FCEA 2ZRLA 3VO1A 1J9EA 1CUHA 2GBLA 2K2WA 3LU1A 4ZCTA 5KNDD 3DDOA 1SEPA 3C7DB 2FPRA 1QPZA 2XWSA 5CH3A 5FUBA 1NJ8A 2I34A 2Y2VA 2ZIFA 4HDAA 5ALWA 2GDZA 3HVUA 1Z7YA 3CJRA 1E4EA 2I8LA 4BRSA 1DAOA 3L0ZA 1H5UA 1QQTA 3BFKA 4CFSA 4RK6A 5BT8A 1PNTA 4MR9A 4MWBA 3NT2A 4KJXA 3JQ8B 1Z7GA 2PWAA 4OYYA 2ZRFA 1GQFA 2GAIA 3TXXA 3HVJA 5JASA 2ZXUA 2ZT6A 2R8OA 3G9ZA 1U0GA 3P0FA 3IGFA 4CT0A 1JMYA 4BLWA 3T5GA 4BL5A 3T7EA 4HGZA 1EK6A 5DBHX 1S8AA 3OETA 2QQEA 2FUKA 4IVRA 4A0HA 4ALNA 2GEBA 3ELBA 4YAJA 2KM1A 4FFRA 5JQGF 2CYBA 4N8EA 4YP5A 1NSYA 1KOGA 1BHJA 2H17A 2QQFA 1C7FA 3IELA 4G56A 4HZUB 3J80A 2BGLA 3N8IA 2DUJA 3A1UA 4P7GA 1QP0A 3FUUA 2GD1O 2AG1A 2RB5A 5FO0A 3NBYC 1NNUA 4GI7A 4HLUA 4J76A 4FMCB 3MHTA 1IJKA 5BNZA 3GIDA 2QVBA 2FWRA 2XWPA 4P1ZA 4HYYA 4K40A 5AOBA 2HU8A 2ZE7A 1GNTA 1GARA 1ZRNA 2BHSA 2CXHA 1V3QE 2Z2YA 1C8KA 2BMAA 2GBLC 2MDTA 4Q03A 2LCQA 4R1SA 1DT5A 3SIPA 1RAHA 1JKFA 2EERA 3MUOA 2GBGA 5BQOA 4D3SA 4NAHA 5KI6A 3RO7A 4LXTA 1NVUQ 2Y67A 5AHRA 3PQDA 4BLTA 4AKSA 1J6UA 3A2NA 1Q14A 2VP5A 3N8GA 2O3RA 4KQXA 4RENA 3CJQA 1RYYA 2EGUA 4UE3S 3RFTA 3F3KA 4DM3A 4EP1A 2HO5A 4QXQA 1MJ5A 4JI8B 1ZOPA 1CG6A 2XNSA 3V8BA 3TN7A 4BV9A 4UKDA 1UT6A 1X8JA 2QA5A 2ZBQA 3PG5A 5DM1A 3AETA 5BQ3A 3U4HA 2QMUA 3EF3A 4KMMA 5T7BA 1QX3A 2DYKA 4B3SB 4JBYA 3DB2A 2D0OB 5JPDA 3SQLA 2HZ7A 1QF7A 2HJGA 5MFPA 1POWA 2WIAA 1I3NA 4ESVA 1C50A 1NRJB 5BN1A 4HRYA 1A82A 2BMWA 5J2TF 1KDZA 4AAYA 3R9WA 2BP7A 5ESXA 4IZ6A 2BGRA 3RT7A 5KYVA 1O08A 1KJQA 3PUZA 5DBEX 3A25A 3EGEA 1MIHA 1G98A 1TECE 1BN6A 4HLUC 1YFKA 1M9NA 2EEPA 2JGLA 3JAKA 1YRHA 1LJLA 2I4RA 2Y92A 4M0CA 4ND4A 4ODIA 3UWSA 4GC5A 4H3HB 2ZJOA 4MW5A 4HVLA 4OATA 2WJZB 3ETGA 2PSDA 3IKLA 4Y6LA 3UV6A 5GTDA 5FBWB 3LQQA 3M6MD 2QQ0A 1DCTA 1NG9A 3L6BA 3KTDA 1ISRA 3HKCB 3HJNA 3EAGA 3VPXA 1QJCA 1ODFA 3JY6A 2QTBA 5DX0A 2C03A 3LT0A 1U7UA 4OJKA 4NOMA 2BZGA 2REXB 2YKGA 1QIHA 3CPJB 1FLVA 1VMKA 2DBZA 2OXIA 4O4IF 5ITVA 1UZAA 4TKVB 2ZJ8A 2GH1A 2M6RA 5LM3A 2YIMA 4JSRA 1DAIA 1Q0SA 1I5RA 2XY4A 4JJKA 4AP5A 2IHTA 4FM9A 3EC2A 5HOEA 3AXSA 4F4FA 4E5DA 2QE7D 1J1IA 3UAZA 1UMCB 3JU3A 2UUPA 3NP7A 3BSFA 4A8TA 3I2JA 3SIWA 3AWIA 4JVMA 2HLNA 3A28A 2ZJFA 1X14A 4QT4A 1AQYA 4GWKA 1SCUB 2DQKA 2LPMA 3D6TB 3FFTA 4YR7A 4RY8A 5BV7A 2V03A 4L1KA 4XYEA 2BBSA 3QXHA 4EUSA 2OBXA 2OV1A 2FZEA 4XGRA 4LZAA 2GPWA 4EG8A 4QFDA 4TLBA 4YQEA 3PQ6A 5F33A 4BKRA 3SMVA 1U3UA 3NTQA 1NLUA 4D8YA 4LA4A 3P9CA 3AT1A 3CVOA 1OXTA 4KXFB 1AKQA 3I92A 3TL2A 1OLXB 1QR6A 3PX7A 3HL0A 3KKZA 1R4NB 1K8ZB 3KL4A 4GXNA 1RACA 1FB5A 2WHPA 5IBQA 2F8TA 2I7XA 1RI5A 1M0WA 3NETA 4DRYA 1ZJZA 4YRKA 2Y93A 2EL9A 2OBNA 1C1DA 4LCEA 4ZARA 4BDSA 3H5LA 3KZMA 4LZOA 1P17A 5L3SA 4D9FA 2AFIE 2RGAA 3VH1A 1AMOA 1TQ2A 3ONEA 2GN0A 1KBOA 1ORTA 3VKFA 4GGOA 2WTAA 3G2HA 3LQRA 3KLBA 1Q1AA 1M8JA 3RVPA 3VYRB 2WQ7A 2QI9F 3EZFA 3RTDA 1ZC3A 5BV1A 1NKSA 3FPSA 5A5GA 2PH3A 4YPFA 1FS5A 3GEIA 4LJYA 3FYUC 4L8WB 2HLDA 1R66A 4F46A 1U0TA 2WM8A 3DE0X 2KSQA 1NVVR 2FEMA 3G9QA 2O2JA 5THXA 1DOZA 4FKZA 3MVEA 3ZY2A 5GV8A 4ML3A 5CNJA 1FLAA 3W90A 1CS0B 1N9GB 2WPNA 2VBFA 2YV1A 1WAMA 3QW2A 2CXXA 3BF7A 2ZRQA 3OSUA 4QDTA 5CDUA 2J9FB 1E2BA 3NOQA 3ZDCA 1OU0A 4MQEB 4MRRA 1II8A 3FMFA 2DG2A 5AVRA 1D2GA 3LZDA 1SUFA 5H59A 2AEJA 4QUDA 1ZSYA 1NW7A 5TQ2A 2VOEA 3DM5A 1XPJA 5MGNA 3KYDA 5CJPA 1DBRA 3RUIA 2J9RA 2QP3A 2F67A 3WTBA 1US8B 1GXSA 1X1EA 4XPIA 3IQEA 3HH8A 1U3TA 4FI3F 3RC9A 1XWWA 3H6GA 3PYXA 1KARA 2W00A 2OORA 4UC0A 3T35A 2PKXA 2H1SA 3ZCSA 1E3QA 3I32A 3WB2A 2VDUE 2X4IA 3VBEA 4B4WA 1A5AB 2B4KA 3W7AA 1GRNA 2F62A 3DBRA 1PFQA 5BMVA 3P9YA 4MYTA 2GBFA 4TWIA 1OI2A 3DOOA 3I6QA 3ZTTA 5IXSA 4I1VA 5FTMA 2PQ0A 3E0XA 2LTAA 2XZDA 2JJ8A 1XNJA 2KMLA 2FSGA 2VDOB 2IIVA 4FFPA 1DCMA 1ZH6A 3O8LA 4QPDA 2FFJA 4L07A 4ZI2A 3HADA 1N2SA 5HSGA 3S81A 3N87A 1UDXA 1V8ZA 2QR5A 1GPYA 1QFXA 2JLSA 2Z4SA 3G23A 4RHUA 4XJTA 1XZHA 3NHYA 3QXXA 1HM5A 1IM5A 3Q7IA 2Z0MA 4FZ3A 3MT7A 3A6PC 1XAHA 1HR0B 5TGDA 1X1QA 3FYUB 3COZA 4OG2A 2QSYA 3GVHA 1JZSA 2DQSA 1QQ5A 3W4IA 4DLNA 1HDRA 4YDHB 3H1AA 3KTAB 3HGTA 4CMKA 3PDJA 1LDMA 1T6XA 2YRXA 1NDHA 2XLCA 2D13A 3M0EA 4EGQA 1U2TA 2FKNA 1WCWA 1BWSA 4R01A 2Y0CA 3DTVB 4R7TA 4WY2A 3TX6A 2AFHB 4IS2A 1JLKA 4GMKA 2ZR0A 3KP1A 2RGRA 4LC9A 3N2YA 3AFGA 1I7SB 1U6KA 1L1EA 1ZVJA 2XNKA 3HB0A 3NWBA 4KYIB 4L73A 3AX6A 3A1FA 3GZNA 1LS6A 1OBHA 1AGYA 4JQCA 3CVYA 3AUYA 5AXCA 2ZSIA 1D2EA 1BS2A 2GAOA 16PKA 2XQFA 4KO8A 3DP9A 3LBHA 1ULUA 3U13A 1XSEA 2JIZA 1ONSA 3CZRA 4QTXA 1T6BY 4HNAA 2VPWA 4EW2A 2FSHA 3GQBA 3SXUB 1YCDA 3STWA 2P9ZA 1GPLA 1P1RA 1IMOA 3ZUPA 3HKBA 3TSCA 4AO8A 1KJIA 3IUMA 3TUZC 2C0QA 3F3MA 2GI4A 1ZCZA 1QRDA 3MMXA 3FCUB 5KYXB 1XNHA 3LY7A 5DHPA 3DOCA 3MK31 4YA6A 1YL5A 4HLCA 5GJWC 4C7XA 2H1IA 2ZYUX 1KFKB 1E6WA 3ZHYA 3O2NA 5JS7A 1THMA 1LI4A 1QUFA 1TQHA 2ERYA 3PX3A 4A6XA 2AKAB 1Y8QB 1GPNA 4CM8B 3DHEA 1A8HA 1IUKA 3DXZA 1KEWA 2W2LD 4L02A 5K0GA 1YK0A 1SH7A 5JANA 1RABA 1N78A 3LYLA 3U3JA 3L4BA 3TINA 2EG5A 3OEEA 4C03A 3CUUA 2XB4A 2ZAMA 3L7MA 5M7EA 2FQYA 1EP3B 2J3EA 5CLFA 4D3YA 5EY5B 1NBWB 4QTUB 4ND8B 4KR9A 3JTEA 4HL6A 4S1VA 1XMPA 3QLUC 4TSKA 1QH1B 3FOFC 2OTCA 4DWOA 4Q9KA 1CZRA 4DA9A 4CVNA 1Z5NA 3U40A 2JZOA 3NWEA 1X7WB 3LH5A 3PC2A 4XUEA 3EXG1 4YCCA 3TQRA 2WWHA 4R5MA 4AX8A 2HBZA 2Q8QA 3KSAC 4UVDA 1L3IA 1CFJA 3HY3A 4Y18A 4XIJA 2X2FA 3TECE 2FJUA 4XWTA 1BKDR 4NBRA 1KK1A 4KMRA 5KMGA 2QRKA 2IH4A 1GZ3A 3FUTA 2QGZA 1B73A 1N2OA 3H97A 1B42A 3WGTA 4AS2A 1DCKA 5KJFA 2IT1A 1P7PA 4BFWA 1NJ5A 1VL2A 2ZIZA 1E66A 3WRWA 5C32A 2N0SA 2GCNA 2OCKA 3MJSA 1HQDA 4JA0A 1W36B 4PAOA 2W98A 1AVTA 2VPYA 4JLVA 1U0FA 4L5JA 2XE4A 1E3SA 4JMLA 1KFEB 4Y1GA 1ZVMA 3EQZA 3K32A 4MZXA 2H1RA 5J2UA 2Y6VA 5ECDA 3DYIA 1MDBA 4P7JA 2XODA 3L5OA 1P77A 4AKEA 3HN6A 4BUCA 1SBHA 4G36A 4D6PA 4DMUB 3ENNA 3L4BC 1LLQA 1OV4A 3M6XA 1EVJA 4L9WA 1YRBA 4MUAA 1SKAA 3FYSA 4OF4A 3TSWA 1M1YA 2X1MA 3ABIA 2XVMA 2ZJZA 4FC7A 4J1TC 2GD6A 1AX9A 1GL9B 5TF4A 3DV9A 2Y4NA 4KACA 4OP1A 3WSTA 4TXNA 3RABA 3ZLUA 4JK3A 5BWMA 1Z2CA 3PR1A 1YOBA 4HV4A 1NXWA 3E1SA 4RZUA 1R12A 2D2XA 1RRMA 1WDMA 1FQOA 3AF5A 1EFVB 3ED5A 1RZRD 1T36A 1FTNA 2IVFA 5KOIA 2Q3BA 3IBGA 4DMKA 1QQ6A 4HQOA 1Y33E 3AZQA 1C80A 3DT6A 3RGGA 4EYSA 3ZJUA 2DHCA 5KYYB 3ZHUA 4CLOA 4W5OA 4W9RA 3N58A 2BM9A 4NFSA 2VZEA 5HZHA 2DWUA 3GEEA 5EZSA 3WHIA 8GPBA 4L75A 3DV2A 3GLGA 3AESB 4H3KB 3O83A 2I78A 1IOZA 1S1CA 2IZOA 3OQIB 4B43A 1FJXA 2NO6A 2REQB 1AC5A 3R5TA 3IE2A 5IHPA 4M0MA 3VBCA 4F93B 5JZMA 1KPIA 3CS3A 5EQDA 3UY4A 5C7YA 4UM8B 3V9PA 4H27A 3G5MA 3M6IA 3UC5A 3GLRA 1P5FA 4R81A 2H2FA 1VE3A 1DV2A 1RXYA 2IHVA 5FXMA 3WIEA 5JI2E 1EP2B 1X2BA 4B3XA 2A5JA 2VXOA 3M6VA 4XVUA 1JBQA 3GNLA 4RMJA 1S5PA 4PLYA 3BQNB 4CLDA 5IKEA 1K7FB 1MJHA 5EE1A 4RNCA 2XPCA 4NZOA 1SU6A 4Q3DA 2JLAA 4D8UA 1RT9A 2Z56A 1NBMD 3KCQA 3DKVA 2VDVE 1X86B 4DLVA 3WK8A 4TZ6A 2CHVA 1Z2OX 1GKLA 4JJIA 3TQIA 1OFHA 3NYRA 1GRQA 1JE0A 3FR8A 2CE7A 3RFCA 1Y37A 3ZU5A 5IBCA 4MAMA 4CQLA 4YAGA 3ZWXA 3A1TA 4C14A 1W49A 3N0TA 1T8WA 3ZCUA 2P9JA 1DI0A 3TL6A 1DJOA 1WUJS 1CFZA 3JZDA 4MCJA 2WV7A 4M4SA 2PY6A 2YJTD 5CW2A 3NORA 2FW9A 5ALKA 3ZU4A 5HWSA 3N7TA 4L27A 2M2IA 2ON6A 1K2WA 5DJ5A 2HPHA 1QIEA 3GPIA 3ONDA 4ZD6A 4WESB 4HRVA 2HHHB 2VTBA 1JR3D 1M10A 5JDIC 4XXHA 3RUPA 1R5JA 3WGOA 1EX6A 1BE0A 2W6ZA 3AIKA 2YY5A 2AQHA 3MGGA 2Q99A 3PNQA 4KRXA 3P19A 5EERA 4ZOLA 3CX8A 4I9NA 3D8RA 5B12A 4MUFA 2R00A 2QUKA 2WJJA 4LWOA 5KCMA 3FWZA 3RS2A 1FVXA 1E7YA 4BVHA 4NBWA 4YMSA 1AKRA 5DTIA 5AW6A 2EIHA 3BDVA 3DS8A 3HA5A 1BXZA 2P8SA 3O4RA 2VJQA 4QD3A 2X14A 2QUIA 4WOPA 5FCDA 3BM5A 3UICA 4ARZB 5COQA 4B3CA 3IVAA 1CNEA 4BCBA 4DMCA 5ICGA 3V7NA 1Z3CA 2E5FA 5LBTA 4UCXA 4KHZA 1JAXA 2IY8A 3GFPA 2FZWA 1MV8A 4JUFA 3FI0A 4DLRA 3OO1A 4ARBA 3J7TA 4NESA 5K8CA 5B6IA 3NVKI 3LXRA 1UZLA 2DBYA 5IABA 4RGVA 4XTRA 4PAWA 5ANRB 3WK6A 4BP1A 1WBBA 5C8VA 2RMKA 5J4HA 2EYUA 1CJUC 1H8HD 1E0KA 1WHSB 2AHOA 2ZI6A 4OQXA 4PHGA 1WZNA 3UM9A 1J22A 2WNSA 1RWKA 4HN9A 5CXXA 3G0HA 2CXTA 5JXGA 4L2IB 4EEXA 4D9IA 1B8PA 2DVMA 1QHGA 4GR9A 3RUDA 1GQSA 4G0ZA 1L4KA 4PCLA 4NZNA 3U3XA 4JVNA 3JASB 1GNVA 5G40A 4O2BA 3VPFA 1L7MA 2RHDA 1XL0A 1U0OC 1WDWB 2FQXA 2J07A 1UINA 2GPSA 3CNQS 4WT7A 1RVDA 4MKZA 2CJXA 4B6EA 4R05A 5JSZB 2R00C 3CLSC 1CEEA 1RAFA 121PA 1XT6A 2JAWA 2DFPA 1YC2A 3I6ZA 3FPGA 3K2QA 3KKLA 3GC6A 4MR8A 3ZNOA 1KP2A 1R6BX 1VL5A 1EGVB 3I9KA 3TIFA 4TOIA 4YV7A 1PFWA 2RJNA 1I33A 2C04A 2QN9A 1LJUA 1M34A 2PNFA 4LXIA 4MV0A 4ZU1X 3K9BA 5ELLA 4DCJA 5C8YA 3ET5A 3GG9A 2GEUA 2ASEA 3GJRA 4ZCSA 2QXYA 1I2CA 1P2DA 3T3HA 2WMNB 3CUVA 2B30A 3Q8WA 3SM3A 1Z4IA 3K96A 1IJBA 4RDIA 4F4IA 1C8LA 3MC1A 4GKAA 2YW9A 3D59A 4C2BA 3ANXA 2A1IA 3MLEA 4K88A 9ATCA 1PT5A 3HLTA 6Q21A 4YO7A 3OTGA 3LBIA 3U44A 2X19A 2W58A 5FNZA 4BVEA 4X6UA 1RYMA 5CEFA 1NPTO 1YS1X 4BVBA 1FP6A 3AF6A 4UATA 1FPQA 1QH8A 3U7IA 2PS9A 2XWJI 4CMJA 3CX7A 3G0IA 2VZLA 2WYWA 2YWXA 2REOA 2AYYA 3JRWA 3QHQA 4FGZA 4JGIA 4TV9A 1Q16A 3SY8A 2N75A 4RCYA 3VTFA 1P29A 2WF5A 3WISA 4F11A 3D31A 4Y0NA 1QAOA 1K0UA 3H1FA 5CTAA 2AOWA 4GYJA 2GPJA 4CR7A 1QVZA 1MAUA 2H2DA 3AWDA 1G16A 1ZZEA 2R8YA 1ORIA 3WWEA 2OCBA 1NUAA 1ZU5A 4U5XA 4XWAA 5DX1A 5BOVA 4EY6A 1IBKB 1GDDA 3VHLB 1KORA 2G88A 4IUYA 3GBPA 4TL7A 4PNEA 4FGSA 2XADA 1G3RA 2HJ9A 3QOXA 4YRNA 3VQTA 1DKLA 1F8XA 1ZONA 3I30X 3JATB 4N1AA 3GH3A 4BFXA 4CHTA 2E4UA 2QQ5A 1SBTA 4ICIA 4PLZA 3UGJA 3A2LA 3AKEA 3BJRA 4QU0A 4EJSC 4WKNA 4D8WA 4P58A 3HFGA 1TUBA 3DB1A 1T5SA 2R60A 1FA9A 4IEIA 5B7NA 2RKBA 2VDMB 1NN1A 3G7UA 2ZTSA 4N39A 3ZS9A 3BD6A 4ENQA 2YZGA 4OGKA 3RKUA 4Q1CA 2ZKLA 1QONA 1UBJS 3QX7A 2HY7A 4IV5A 4AW9A 5ALZA 3LY9A 1I24A 2LKDA 4N5HX 3CRVA 4P22A 2NTVA 1NN0A 2FW6A 2KQUA 2G5CA 2QF7A 5JCJA 1ZUNB 2NYRA 2QAJA 3OJXA 5JMOA 4PX2A 3P26A 5DT2A 3WFIA 1Z6ZA 5CJJA 4CM7A 5JXIA 4FOSA 1IWOA 2XCOA 3L41A 2OBYA 3QIAA 5AKIA 2YNMD 3LNCA 4HEJA 5G0TA 2D62A 3W0LB 1OB2A 3DZHA 2XYVA 1H0KA 1N7JA 6YASA 1KTIA 3ADOA 2AD5A 4BNTA 4EF6A 3WGVA 1WRBA 3BEOA 3L0OA 1BYUA 4P82A 2ENWA 5C8XA 3DWFA 5CG1A 1LQ2A 2J0VA 1SQFA 2OO3A 3LLUA 3T3IA 1JDPA 1N0IA 1ISHA 1ZN2A 2DPYA 1RXCA 3EDYA 3NNSA 4OUDA 4FFDA 4CFZA 3L0SA 1ISJA 2JAQA 3LC7O 3RR2A 4TSFD 1GL3A 4G89A 2PRJA 4N5MA 3KOZA 3ERCA 5HKAA 5HDQA 1DXQA 3N6RA 4CM6A 4HAYA 3I76A 4PWZA 1R6VA 4DTIA 2JD0A 1P3DA 2P3QA 4G4IA 4ENTA 1WXDA 3PJGA 4OLAA 4R54A 2J7PA 4FILA 4IMIB 1DX4A 5BW6B 3PL5A 2OHVA 1KOFA 2XDAA 1QHEA 3ELUA 2GFHA 4YYEA 4OSEA 1KJNA 3NHBA 1CX9B 1ESDA 2FFQA 3KXLA 1SVOA 5LA6A 2G8LA 4V24A 1Q20A 1S3GA 2IP4A 3AVWA 2WUEA 2IY7A 4AIRA 4Y6GB 5B3JA 4BQEA 4RK1A 3H19A 4YBRA 2WHEA 4INZA 5K0JA 4YLEA 1S2NA 2ODQA 3ZVLA 4TMVA 3P0EA 1PW5A 4QQNA 4C0AC 4C0SA 1YZNA 4B4OA 3OZUA 4LTMA 1C9NA 2FK7A 1Y8RB 3C4QA 1K0FA 4IEEA 1F2UA 3P97A 4JY7A 5L4LA 4UUOA 1LD3A 4ER6A 3NS7A 4BATA 5E9WA 1VL0A 3MWEB 2O19A 1E2UA 3RB8A 3GLFB 1PF7E 1QE0A 3OU6A 3Q3VA 3LOUA 3F5QA 4N3CA 4BNYA 4DNOA 2IHJA 1IQ0A 4IIJB 4C07A 2OVBA 2AQKA 3G17A 3I1YA 1SXJC 4BXOA 2W4QA 4EB6A 4OQZA 1GU0A 3W4JA 4Z2YA 4BAUA 1H6AA 1HDEA 2G4VA 4KQMA 3O4JA 4CF6A 2VF5X 5KHOC 1ADCA 1JLLB 4BGDA 4L6CA 1AGRA 4WNAB 2D0IA 3DLPX 4M1EA 4B6SA 4UM9D 5HRAA 1ZMRA 4WZBB 2H2WA 3TGLA 1X7YA 2O8CA 4J1QA 4MB0A 3CKMA 4GNRA 3QFHA 3W3AA 4KU4A 4QA9A 3VYSB 1ZINA 3S4YA 5BQ5A 1FFDA 4IIHA 4D80A 5A6VA 3DZBA 5B3JC 1UM9A 2R62A 2XT6A 5MN4A 4ZQGA 3HWSA 5IT0A 3H65A 1OA1A 4HMOA 3PC4A 3L5KA 1EP9A 2X3YA 3MINA 3EH1A 3JWPA 3WE7A 4QFCA 1PL8A 1KGSA 1F9AA 2R9VA 2NO4A 2YZ7A 5JJKA 3OQPA 2G70A 2ZAGA 3NEPX 1PKEA 4B3TB 2F1JA 1CP2A 2XVAA 1CR2A 1I3LA 1IK4A 1OZGA 3NR2A 5DEOA 5BOSA 4K0RA 3UAGA 1B0PA 2HLHA 3PUJA 2AHRA 3I6BA 5BV0A 2FR8A 5C8ZA 2WJWA 2O2IA 4AYXA 1N3YA 3DW1X 2XBUA 4JL5A 2F43B 3VDMA 3DT9A 1ZISA 3OMWA 3P0JA 2ZBRA 1IQRA 1Z2PX 2Z2KA 3KOUA 3LX6A 3NDIA 3AFNA 1EYZA 1MOZA 4LW8A 1USVA 2LZ0A 3H75A 1W2GA 3FPBA 4JJZA 2CFOA 1GUBA 1TMOA 3Q12A 1XUOA 1KNQA 2VNJA 4FP9A 1FPMA 4IJ5A 4EPRA 2ZWPA 5CTJA 2BH2A 3O7MA 1GTRA 3T4EA 1MABA 1Y1QA 3FZYA 3IAS1 4KN9S 4D02A 4KFSA 2QL9A 3QG1A 1RW4A 2VJMB 2A1TS 4C6HA 3VR4H 4D4JA 4DSZA 3RSFA 2POQX 3A3KA 2I2XB 3PEEA 5KAMA 3U60B 3AEYA 1YOVB 1IXKA 3CURA 3DP7A 2G9QA 1AO3A 2VQDA 3QLVA 2JGEA 2PKQO 1E2PA 2AVDA 3G79A 1FEZA 3N8HA 2EW2A 3Q0IA 4OB7A 1E3JA 4NENA 4U2BA 3RSQA 3GNTA 1SHJA 2J9ZB 5A4AA 4OYHA 5GVSA 5LZ2A 2Q3CA 1NXQA 4I4CA 4ZAXA 3OC0A 4O4JA 3CXRA 2IH5A 3ZWWA 4UD2A 4MV8A 1BZYA 4Z9YA 1KZ7B 4FOTA 3CISA 3S40A 4B81A 1E1KA 2QUAA 2EYQA 4KLCA 2QTFA 5A5VA 3REOA 2C95A 3VVBA 4BNUA 4KLRA 1HPLA 3PZRA 1Y1PA 4G1VA 1KDRA 1N5LA 3VGJA 4L57A 3UH1A 3GRCA 4WGGA 1WXIA 4ZAGA 3IE1A 4QU8A 1QVAA 2GXSA 3Q2KA 5K2MA 3WLNA 4BQPA 2FPPB 3W1VA 3OQNA 2GM4A 2PUJA 2XYQA 2JK0A 3AH8A 3M7IA 1JYEA 3NBUA 4E32A 3L77A 1T3TA 1A76A 2NT4A 4QYMA 5DNWA 3LHFA 2XF8A 3KQQA 3O84A 4WKGA 3AU9A 3SDZA 1XXHE 2A4KA 1RRVA 4CU5A 4EH1A 4P2GA 4YMUA 5SY6A 1JLHA 1ZA2A 2H9AA 5E6RA 4ZT7A 1NLFA 4G4SO 3JQRA 3IAHA 2X2OA 1QGOA 1CJVC 1PX0A 3D0QA 2P6NA 2CJYA 1XC7A 3IB3A 5ICEA 3QLVC 3P8ZA 4F3TA 5B3LA 1KO8A 3ADKA 3THYB 1B1CA 5KYUA 3WYAA 1IBRA 1Z07A 4M2LA 4M1QA 5K3DA 3UCXA 5EMNA 4D99A 4OX9Y 3RDPA 3DPIA 4ETIA 1FNMA 5BN5B 2M9MA 4CTNA 2HA0A 2Q6VA 3WIOA 2GN8A 2QVLA 3IMFA 5B1DA 5LDDC 1K4KA 1E7WA 4QSHA 3CINA 3WJ1A 3QKSB 2IU0A 4N41A 1CEYA 1YS9A 1T1IA 1MCZA 2A92A 3VSAA 5A3QA 2ZBUA 3GGCA 3OFSA 5JYEA 3K0FB 1ZK1A 3PUXA 4D8XA 3C6QA 1ABBA 3E8SA 3FZNA 1DQZA 4UNNA 1I5EA 2E49A 2NO5A 4ZYZA 2H1VA 3U4QB 2F55A 1SJ9A 1O97D 2ONCA 4HDMB 4PX5A 1NWCA 3FF4A 3PVZA 1Y9AA 3PF9A 4I9HA 4YRIA 1T9GS 1UJ5A 4HDOB 4AICA 4CIYA 3NT4A 2MSEB 4HJXA 1S02A 2IEZA 1R4MA 2O4UX 4CF5A 1XD2B 1JB1A 4Q15A 5JQWA 1MH1A 3I4LA 4QARA 3R9XB 4R8SA 5FLYA 2OYCA 1CZKA 1SVLA 1XEWX 4FFVA 4GDMA 1QZUA 5A7GA 3EFEA 3NC4A 4C21A 4RJIA 3HDJA 5TVGA 1GYRA 3KL2A 4D1YA 1IXRC 3L3BA 4G8CA 4B6JA 2VHYA 3RODA 1TZBA 1M8KA 3R3UA 5DP1A 2DQYA 3L6DA 4FQ7A 3SR3A 5FBKA 3M6AA 3UA3A 1BG6A 1O77A 2JCVA 3FCCA 1X8LA 3NIBA 4HPWA 4I8IA 5D7NA 2FWBA 2F1KA 3CHYA 3PC8C 3TPZA 2VG8A 4OMDA 1MTOA 4B3JA 3WL6A 4AZ3B 2C59A 4ZO9A 4NZZA 5AI9A 1A8UA 3ZV4A 5LDHA 4W5RA 5AW5A 2AS0A 4INOA 2NSDA 3WYFA 4NNOA 3LX8A 3PFNA 3BB4A 5A9SB 2J0UA 3AUTA 3RRZA 4CIWA 1TFRA 1DRVA 1WCV1 5H4HA 4IJ6A 3TI7A 2P1ZA 1T1GA 4QUIA 5T4HA 3TJRA 3WDMA 5JNRA 4TZ0A 4ILKA 3OCJA 5I48A 1ZD4A 4MQFA 3SWWA 1IBSA 2JCYA 3I73A 4RTRA 2O8BB 1HQKA 5LDGA 3GP3A 1O94A 2C97A 2OLJA 3PA6A 2C82A 1E9DA 2IZ5A 3N7UA 4TUYF 3GJQA 2G9ZA 3ESXA 3IMCA 3TZBA 2BDEA 1NXVA 3QVWA 4K9RA 1I4WA 3OFKA 3D0KA 2QVXX 4MP3A 3RU2A 2JANA 3RUFA 3WJ7A 3AKZA 1YB7A 5T4FA 2JL1A 3SFZA 2DERA 4Q47A 1J8VA 3FKSA 3I2KA 2WHYA 3O4HA 2YWBA 1L1FA 3RYTC 4I4TB 1E9AA 1CUXA 3A4VA 2I1LA 2A5DA 1OC4A 2QTHA 2VIIA 4WBSA 3QXCA 2G07A 2XMPA 4NPCA 2Y66A 4EHNA 3HM9A 4GMHA 3CN9A 3LT5A 3TIIA 3TZQA 5KOHB 2VF4X 1J4AA 1GT6A 4RIFA 1LPNA 3NUQA 1YULA 3DNFA 1OYYA 2ZUUA 3DXYA 3E9YA 4LZLA 3S2GA 4BBJA 3H16A 1NHGA 3P2YA 4FHGA 5DBOA 3WLLA 1SUSA 1DWQA 3Q2OA 4PLCA 2R8BA 3KQMA 1SOWA 3C15C 3KLOA 1WOMA 4GX1A 4CMEA 5JRJA 3R5HA 2DULA 1JQ3A 3N0VA 3YASA 2FG6C 4MVJA 3AHGA 3D6HA 2OSVA 3LOPA 3NTOA 2CV0A 2A9RA 2E9SA 4YCDA 1RIIA 4BO3A 3W1EA 3SHWA 1Z6QA 4OLBA 4ZVVA 1GFSA 3SXJA 1E18A 3HV2A 3GRKA 2PXHA 1LVUA 3MWLA 4JBNA 4DA8A 1IXYA 3EVEA 1JHMA 5JHGB 4B3DA 1OLUA 3CEMA 1L5HA 3RV4A 4RJTA 5LP6B 2OB2A 4C08A 3HDHA 2DHRA 3EZ9A 2ZG6A 4LYYA 3LCJA 4YAFA 3EGOA 4ZI7A 1DFGA 621PA 3D2CA 1DE0A 1PT8A 2JDIA 1KEZA 2JBWA 1WSWA 2JNWA 4J43A 3IQDB 1WF6A 2CFSA 4MJLA 4OX9B 1GPWB 2GCOB 3EZ2A 1NW6A 5BSEA 5BV8A 3CVVA 4CEJB 4CLEA 3AJ8A 3D6FA 3WIVA 4MGKR 4RXMA 3WMEA 5CA1A 1C0KA 3L7AA 4M83A 1U8AA 1WMFA 3I4CA 2R4UA 5FL7A 5FPHA 4DIFA 5IJWA 4ZZIA 4Y0VA 1GYQA 2WJYA 1HTWA 2OV3A 1CIPA 5EQTA 1WQ4A 4B47A 2PH1A 4O6VA 1GG2A 3CNBA 3CTMA 2GBIA 1J49A 1QXSA 3NBXX 1A9ZA 5F9FA 2B4RO 3KUXA 5EHGA 4TT3D 3WWZA 4AO6A 2YHBA 4C4RA 5M34A 3MAJA 1DIAA 4DUGD 4MRMA 1VSQA 3SZ3A 1FQWA 5LP1A 1GJRA 4BNXA 3ET4A 1T24A 1UK6A 1ECGA 2VWPA 1H8EA 1P1JA 2PLFA 3OP4A 1QC5B 1E1CB 2IS1A 1XCMA 2OFWA 2YJ4A 3IILA 1MAVA 2VQ3A 2FPIA 3PRJA 1FNDA 3FPHA 3QEMB 4RQBA 4IUBS 3HZHA 4FFBA 1JH9A 2AN1A 4XQ9A 2GXQA 5FWAA 3M34A 4TRMA 1FRQA 1C29B 1TE2A 3OWHA 3K0KA 3BXHA 3A36A 4LIPD 1T2EA 1ZN8A 2UVDA 3FRJA 2WMDA 3S8MA 4ES6A 2X8JB 5IW8A 1QLJA 2HCRA 2P3SA 1NQVA 2EFCB 5KQSA 2R79A 3KJGA 4U7JA 5J1SB 2IUSA 3KYJB 3PSHA 5ADWA 3MRSA 4S2UA 2YWHA 2A0FA 4F3YA 2EX0A 3QU7A 3PXEA 2IQIA 4P4LA 4WVFA 4CLXA 3NPMA 3EVGA 1F1JA 1L7QA 1QM5A 3O9ZA 1E7RA 2AR7A 3RW9A 1M0SA 1GGKA 3K0HA 2R44A 3B3AA 4YASA 4DDUA 3QFTA 5ESWA 5ADVA 2JARA 1OXUA 2FY8A 4QATA 3B2NA 2NYVA 2Z6AA 4MWTA 2SKCA 2CL7X 3E81A 4OHCA 4RKEA 2X23A 1FLDA 5AQ1A 2V6JA 2VSQA 2W2VA 5EI5A 1IDN1 5CB6A 1QV6A 2R4TA 1Q2UA 4MYUA 2V59A 2FQ1A 1CNMA 1CQJB 1PO7A 4JV5B 5DHTA 3OIGA 4ID9A 3QE2A 4QOJA 1WVIA 4U7TB 4Z7OB 1KP9A 2Q7DA 2IQ5A 3ZD6A 3KV1A 3KQOA 3Q87B 3G2NA 4H3SA 2X0IA 3CW9A 2HSDA 3G9XA 5AVQA 2OKCA 4ZHQF 2DPXA 5IN5A 3IUQA 1Z6GA 4DV0B 5L9AA 5FH9A 1X2EA 3VAYA 4R0VA 2AFRA 2PMDA 4M8NE 5D51S 4YUVA 1MFPA 3RSGA 2QTVA 3BWCA 3FNEA 1GSAA 1Z0AA 2F00A 2MWMA 3OPYB 2HXYA 5JBQA 5FBQB 2QAGC 1NIPA 3BRWA 1R0YA 2POCA 4GUAA 3WTCA 5EUCA 3DVSX 4GHWA 2XCIA 5EZQA 5KSWB 1D4FA 1XDDA 1P2VA 1Q17A 3WGYA 4N6NA 1J33A 4IO0A 2OCPA 5CEJA 2BCGY 1ZM4A 4PZ9A 3E1GA 1JFFA 5HJEA 3I9OA 1A3CA 3OKPA 4JP2A 1VKNA 1N6PA 4LNUB 4DGQA 3EFHA 4DIBA 2Y27A 5HEKA 1U99A 3Q9LA 4P54A 1A5ZA 2DQ4A 2FUG6 1D4OA 2J85A 3EXHA 1JFLA 1ZCBA 2MINB 4EPTA 4XQGA 5D86A 3HO1A 3WB1A 1MIOB 4LBYA 2NTEA 4KIFA 3WOHA 2JG3A 1ECJA 2XKKA 3TJMA 1FXSA 5FOUA 1QRAA 4N0EA 5FX2A 1J25A 2RI6A 4JX9A 4ZOQI 3V1MA 1N6HA 3HU2A 3QK7A 1JXQA 4ZCQA 1M67A 1XTTA 5F5LA 3G6WA 1JQDA 3A9RA 3HYRA 4KQHA 4RYLA 1WCYA 1M6NA 1Q1EA 3FD8A 3RUEA 2ECQA 4HO1X 3V4SA 1NVAA 1R8XA 2FMUA 4HXGA 1HZJA 4M9RA 4REQB 2ZBDA 3BERA 1FVFA 4OOFA 4UUAA 1TW3A 1I10A 4XPZA 3ADCA 2AZMA 3PUHA 5HG0A 3F3YA 1ZI9A 2C2MA 5AUNB 2WW8A 1M6HA 2E21A 3D6JA 4ASUA 1XCLA 2O6LA 5AVJA 2WFLB 1JQAA 3P1JA 1PDVA 2XI4A 3ZH2A 1NRWA 3GMTA 4EABA 4EO9A 4RY9A 5FBLB 4BFVA 3PL1A 3P2EA 4G0YA 4IDBA 1HE2A 4RPCA 1L4LA 1J56A 5H3LA 1WW3A 2C88A 2ZROA 2OBBA 4WX2B 4RTOA 1RLUA 3VU0A 3CVJA 3R9IA 3EWSA 3VX3A 2MR5A 3O47A 4JLPA 2P79A 1YUMA 2R1VB 3EXHC 4QICA 5IX8A 3QMMA 1Y5LA 2R66A 5AJHA 3K4QA 4UE2A 4NCXA 3C5HA 2JCBA 4XYLA 5IKMA 1JPUA 1QWSA 2LIVA 4B5KA 1IHUA 3ANLA 4ZAYA 1TJ4A 2IY9A 3FA2A 1KDTA 4EYEA 5JDCA 3TD6A 3P7MA 3A3PA 3USCS 4DG5A 1NW5A 4RZQA 4EHJA 4OA5A 2PXCA 5F7JA 1W5TA 5TT1A 4O4HA 4KPFC 2VFAA 3TEJA 4NEGA 3KZOA 1F20A 2NVUA 3AOEC 1KYTA 2WC1A 4AUKA 4DMHA 1MVLA 4X85A 4EKIA 3TZKA 4JLJA 3L7BA 2ZXFA 2VNKA 4N7JA 3DCIA 4JBWA 4L6AA 1GLVA 1GKIA 1W4CA 2DBVO 1M6VB 2QT1A 4UDYX 3VKVA 3OX4A 4IBOA 4KZKA 4AJLA 1GNQA 4WN9B 5K3FA 1TMKA 1X8XA 1EAYA 5U1PA 3OIVA 5AHOA 2FW8A 2HWXA 1E96A 5BN3A 4PC6A 1DBPA 1E9RA 5ITZB 3QV2A 4CCYA 3HBFA 4C89A 1A8PA 1HSOA 4GR4A 3EIHA 2RD2A 2D7CA 1XA4A 4XSVA 5FUXA 2E4YA 1HGXA 2VH1A 3GGOA 1CR0A 1AIPA 3F71A 4PCAA 3C24A 2ZJBA 4PW0A 2R5NA 4Q1BA 5FPYA 8OHMA 2NXJA 2XDQB 4OHBA 4RH3A 4YXWA 3I8SA 4N5DA 3HYSA 1I1NA 4JMPA 1ABFA 1FNCA 3W9YA 2PA0A 1XMOB 5E4YA 2B7LA 3K1JA 3UJ8A 1KIMA 2D3WA 5JDCC 4DQKA 4RNDB 1GGNA 3TOSA 5BQXA 1SUWA 2YMQA 3BIJA 4WXRA 2HT6A 1NU6A 1JQ5A 1SIUA 1II9A 2LE0A 4ED9A 3WGIA 3V8VA 4C6TB 4LF8B 4ZCLA 3LT1A 3MWFA 1ZK2A 2YWRA 4HC4A 4X41A 1MXFA 1L4FA 2H29A 2OHFA 3HNPA 1R0WA 4ETNA 4OBBA 5BUCA 2DUWA 2B37A 1WZEA 3DKPA 1VGRA 3A70A 2PL9A 5NULA 1Z75A 2BY4A 3N74A 3Q7QA 1XROA 3NNDA 1SM4A 4HQRA 4DW8A 4ETWA 5FJJA 5ADUS 5B7QA 4F6CA 3KSUA 2L2QA 2PZJA 3P5SA 1KDVA 1PK9A 5JC8A 1N1DA 2DT5A 5EWMA 1VB3A 1VIVA 2DR0A 4MLCA 2C92A 2WU1A 4YECA 4R1MA 3AQIA 5KQGA 5EWLA 3E70C 1SEVA 4W8GA 1NMSA 1N6RA 1C4XA 2HQSA 3IUPA 3VH3A 3PT9A 3STHA 2MR6A 3DEIA 2WTBA 5EKXA 4E2ZA 1RYNA 1E2HA 3FLAA 1F2DA 2GSDA 4FMCF 1TMGE 4NHOA 1OI4A 1WPGA 3HDQA 2KBEA 2H31A 4LZNA 3W2IA 3B38A 2WLSA 3PVCA 2AFIA 2GKOA 1TAGA 3GJ0A 2J3KA 4G41A 3EPKA 5IJXA 2VQSA 3QELA 3EA4A 5IAKA 1NMZA 5JATA 2E3JA 3V00A 5FI3A 3CR3C 3ROFA 5IN4A 4OBWA 2WG2A 2PBZA 5FAXA 3O6VA 4ZMRA 2O0HA 4Q3CA 1QO0D 3S68A 1NN5A 1VHDA 1NE2A 4MA4A 3CU5A 2VDQB 1YJAA 3H8VA 2QZPA 2GNPA 3F6PA 3VUFA 1P4RA 2XNDD 4IGFA 4RF2A 3GUVA 1MUUA 3G2PA 5K3CA 1Z8FA 3K30A 2A1UA 4QBKA 1TEXA 2HN9A 4Y6PA 9MHTA 3MAGA 2V8OA 4GBJA 2ANCA 1N2CA 2OM2A 3PA8A 2VPTA 1KYWA 4HATA 4EZIA 2FNAA 4HQKA 2QDKA 2ZJ0A 1K7EB 3JAWA 5FNVB 2CUKA 4AWAA 4KITB 2DTEA 1WCIB 3CBGA 3GUZA 4IJMA 3E03A 3HUTA 4NU0A 4WOJA 2H06A 1IVSA 3ROPA 5DEIA 5IJZA 3RJ9A 3UHAA 2IU4A 5F2KA 3TG2A 4KX5A 3F97A 4EFLA 3IJPA 1MO4A 2I5PO 2R6FA 3N1UA 4W7IA 2O2ZA 1CIVA 1T0PA 2R6CA 1KY5A 3CWQA 2C9BA 3MTAA 1F2TB 4L4XA 2QW0X 3VV2A 1UBOS 1CZOA 1NOKA 2ZRHA 3A1DA 4QZVA 1IN7A 1HYBA 2AC2A 1QHNA 1ZVQA 3MFQA 1NZDA 3A04A 3DMGA 1D2HA 3I83A 3MRVA 2QRUA 1P2TA 1X94A 4H59A 1ISIA 1W2HA 3V6MA 2YJ6A 3WI7A 3WJ2A 5K8LA 3DEKA 4WERA 4NX2A 2YHIB 2B99A 4MS1A 4Z3OA 5J5CA 3OCUA 2OD9A 4R2IA 2ATCA 4AB1A 4LZJA 3SLKA 5LOVA 2WSBA 5AVTA 2AXEA 4EY5A 6ADHA 2QJFA 4MPRA 2ZT5A 1GDHA 3ZHVA 3TRDA 1N0VC 2YVKA 1E5DA 1GVHA 1PZMA 4QWWA 2P90A 2PBLA 4EUEA 4DCMA 2B98A 3MHPA 3O5AA 3FF1A 4GKKB 3B7PA 4NBTA 4PX3A 2TMDA 1O9HA 2GKGA 2QTGA 1JHXA 3COPA 1OFUA 2GRJA 5AK3A 3QJGA 2YXNA 3O3NB 4M6WB 2FUCA 3GLSA 4I5GA 4I1UA 2RCYA 4H4CA 5MHTA 5EYPA 4CIBA 4EHHA 1WF3A 4QO8A 1QVWA 5IBRA 2RHBA 1JIVA 1CETA 2RGWA 2P9TA 3MJ4A 4W7HA 3MM4A 4J7CA 4EHDA 5I4KA 1JF8A 4NWIA 1GRCA 2AKEA 3LNTA 3F5MA 4UD6A 2XMQA 2M6LA 3HA7A 3CNEA 2CFRA 1Z0IA 5CDTA 4U6NA 1SELA 1ISGA 1HRDA 1C3JA 2FPSA 1U9YA 4X6YA 3RC1A 4N3BA 6REQA 1PK8A 1R3UA 2QRVB 1L5SA 4XFJA 1RCFA 5AKLA 5B58C 1XMSA 4K1LA 4I19A 5A0TA 5KC9A 3VU9B 3W3ZB 3MWYW 1FX1A 3EUFA 2NZ2A 3AY0A 3ER9A 1QP4A 1R6XA 1KIFA 3LBYA 3C70A 4FZJA 1XDBA 1YB5A 4XKJA 1VBFA 1DTWA 1WM1A 2ZPUA 5ALDA 1KVRA 3F4BA 4JYBA 4BFLA 3H2BA 3JZFA 4RDHA 1W0JA 1E9SA 2YC4C 2O7VA 3IDQA 4Q4JA 1J90A 4S1WA 4BFTA 1P73A 3DE6X 5IAJA 3JV7A 1G5TA 3ZKAA 3GCGA 4I55B 5IPFA 1VQ1A 2DFNA 2XEXA 3IB6A 2PMEA 1SCQA 3WVNA 2AJLI 3OLYA 2BC9A 3ROGA 3VPCA 3VR2A 2VEDA 3N3BC 3I3SR 3GVXA 3JD1A 3T5PA 3PHHA 3WBBA 4CTOA 2OYRA 1Q1QA 1Q15A 2F59A 1V4BA 1Q77A 2F90A 4MWCA 3Q1KA 3AF0A 4CEIB 2FZ4A 4BPBA 3UKDA 3ZLBA 4GKVA 1BIFA 1QFMA 5AM3A 2WAAA 3WMWA 3VR4D 1XDGA 2GHIA 2LKCA 3LHSA 2NP6A 1C7RA 5CB4B 3K1AA 2VPPA 4JUIA 1VIAA 1YE5A 3WIDA 1NW3A 3HJBA 1OPXA 5EJGA 4BB5A 2GK7A 3WGUA 4KHPB 1QBKC 1ISSA 1I30A 5HQJA 3EX7C 4WJKB 1HX7A 1IBCA 2VYVD 3V7WA 4EPWA 3C7KA 1WB9A 5BWLA 3GOQA 2QGFA 2VCHA 3A1NA 4R1TA 4WDRA 5A03A 1AGXA 1M74A 4IHKA 1BE1A 1R5OA 2L42A 3EWAA 1EM6A 1H1TA 1PTKA 2BEVA 2Q1TA 2NU9B 2R1ZA 4CGYA 3VH4A 5CFPA 2BJHA 5GZ6A 4X61A 1AUOA 1HETA 1NI4A 2E6KA 2HMVA 1GD1O 3RS3A 1W35A 4WK2B 1K8QA 3M3PA 4DARA 4BIIA 1L5MA 2YWJA 4CTMA 3GN2A 4UNSA 4C6SA 5DLEA 1FSGA 4OXNA 1YDGA 4D45A 4XUGB 1WO8A 3HBLA 1RP7A 3QF4A 3H3FA 4F3KA 3OZEA 3PQEA 2P2DA 1LK0A 1KIAA 2CN1A 2WWIA 4MR9B 2H3HA 3MTQA 2D8MA 3W78A 3MWGA 4FZVA 5C8DA 5IKPA 1IAQA 3EQ9A 1CQIB 5T8KC 1T1JA 3SMQA 1JB9A 5DXJA 4IDDA 4WKPA 2Z5LA 2ATXA 3VO2A 2JFZA 5EJ2A 4D3FA 2XUIA 1CY8A 1X80A 2DRIA 2JIOA 1WTCA 2P1RA 4XYGA 1UBLS 4OK6A 3VC3A 3ZZTA 2BWJA 2V1UA 4NCHA 4Z4IA 3OHSX 1XG5A 5C5IA 4FT4A 3HGQA 4YJ3F 2Q0SA 5I7VA 1RRPA 2CCGA 1DMRA 4DA0A 4IXTA 1YMUA 1J2YA 2H9YA 1RWMA 3R2JA 4OJMX 2V4UA 3VZQA 2C7QA 3KYCA 1SD5A 3VR5H 4EG6A 4M9SA 3BE5A 4RL6A 4HQ0A 1OHHD 1Z7BA 4QFMA 3KTOA 1H1DA 3TSOA 4D4LA 5JISA 4WCFB 3QE0A 4L8YA 3A06A 2OFFA 3W5HA 1GNSA 2VF7A 5EHQA 3HEMA 4YJ2A 3JRXA 4TKUB 3UB2A 1C2YA 4P4NA 4ZEWA 4F3NA 1CE8A 1BFDA 1T9ZA 4RULA 1FSZA 1H9AA 3EAFA 4NDAA 1J21A 1V1RA 4D41A 1NKTA 4FW9A 1MG0A 1YZTA 1J8YF 4Q02A 2JFYA 1SPXA 2I7DA 2OQ2A 2PS0A 3CCFA 4KAFA 2IYXA 1PWHA 2GUWA 2IZ0A 4MJ7A 1WA5A 1JX6A 2VAXA 3P2MA 1CUWA 4PZZA 3SHTA 3QXJA 1T8TA 2WWVD 1QE3A 2JJ2D 2FYTA 1G5QA 1TUEA 2OFOA 1UC8A 3OT4A 2G8NA 2C2OA 2KJQA 3X2EA 4G9GA 3UWPA 3CZAA 4F60A 1MD9A 1MX1A 5DNAA 3CSSA 5HMLA 3JQGB 3BJZA 3U7JA 1BA3A 1BD3A 3AW9A 3IL2A 1C1XB 3CRQA 3ZNPA 2QRLA 5DYTA 2OQIA 1VI2A 3OZIA 5EGNA 4AI6A 3O2JA 4N48A 3KJXA 1FJGB 2R8PA 2C20A 1GAJA 3FWYA 3SQMA 1E2LA 1KBQA 3JYNA 3JAKB 3TZLA 3S99A 1RYBA 1EG2A 3HI4A 4EK9A 4N4AA 1P2UA 1VBMA 3TIVA 4BJHB 5KTPA 1N57A 3A2KA 3GFSA 3ZVMA 3UHJA 3SEFA 5TPZD 1W4RA 4MW2A 4BS9A 4QDKA 3MN1A 2W4IA 5BWOA 4JLKA 5DPMA 3RG2A 3GXOA 3LV8A 2AD1A 1KQPA 3W4KA 4NXNB 2BTQA 1NTRA 2VK4A 1FP4A 4KQFA 2VI5A 3PFCA 5JUWA 4FTWA 1XRQA 3F8SA 2QAIA 4JU8A 4O2RA 2WABA 2D1FA 1T91A 4DUZB 3OOSA 1MTZA 4KNVA 4LYGA 4I81A 4QO7A 4Y2YA 3VDXA 3G2IA 4IFBA 3ESAA 3ENQA 4DS3A 3WOVA 2H52A 3LO5A 5T64A 4WUVA 2SCUB 4Z4HA 1U0LA 2ZK7A 3AVPA 4JU9A 2EZ4A 1NJ6A 3U31A 2E5WA 2RIRA 3KQKA 1DG9A 2YOGA 4K9DA 3GLIE 3O21A 4QRIA 1PZXA 1DAEA 5ICSA 3L4SO 3EFOA 4M0FA 2C99A 1KZYC 3KXPA 4YY3B 1P8AA 4M7RA 1WKCA 3OZTA 3REGA 5INTA 4UTZA 5L7YA 1Y98A 1K86A 4RGBA 2A0YA 2E55A 1PFVA 3BL6A 4RY0A 3SR4A 1WU7A 2FEWB 2WHPB 3Q9UA 1GCGA 1R8QA 3HSKA 3DTVD 4NSNA 1KAMA 3GFOA 1OBOA 3U7RA 2J3LA 3AKYA 4JC8A 5IC6A 2O8FB 2XMZA 4XW2A 2AXQA 3O8BA 1I36A 1MMFB 4C3ZA 2ECKA 4HMQA 4RACA 4BJ5A 3EN0A 4GPTA 4Y30A 3QVUA 2WWGA 4URFA 1GGHA 1FFHA 4K9MA 1Z28A 1E2KA 5EIHA 2WF6A 3M2TA 2Y68A 3THRA 3ID6C 9ABPA 2NLOA 3RJTA 1KXJA 1G20E 2XQVA 5EIBD 1TW2A 3WGMA 1RCUA 2ZVJA 4DCGA 2QYOA 2OOSA 2XDWA 3LP6A 3LX4A 5GIOE 3HCPA 3ILSA 3WC4A 2Q3HA 2Q50A 3HCFA 4QC2A 4WKOA 4ESOA 2CZCA 3UMSA 5HP4A 3PC3A 3HLYA 2YIJA 5L3QA 2ZZNA 4OHYA 2G9NA 2W8BA 2ZJ5A 1II0A 1BE8A 4NV1A 1PL7A 2I33A 2YRFA 1HDZA 2HDHA 5GV7A 4C7KA 1OWOA 3C6YA 3HKDB 3S2SA 3AYXB 1II8B 1KMMA 3BMOB 2W2OA 3O8RA 1LQUA 3F3SA 4HWSA 1X19A 4ZOAA 3QWIA 1NX9A 3BX1A 4Y6SA 4URXR 1USIA 1PAUA 4QRDA 3IVXA 1OT5A 1J2TA 2P9YA 2XGOA 4U8HA 5TQ2B 3T9CA 3W6NA 3KYDB 5KHAA 1T4GA 2VZ8A 2VPZA 3NJ4A 3B52X 2NNWB 4BAGA 1Y7TA 3K16A 4YCSA 3SE0A 2VNIA 2AN9A 4YUZA 4FEAA 4OJTA 5BR1A 1UZUA 5F5NA 1MA0A 3RUAA 3P9RA 4YAWA 1YQGA 4H7HA 4HLQB 4EW3A 2AOTB 1DZ3A 3S8EA 3I9V1 1H3FA 3PV0A 4LDQA 3DJYA 4QYIA 1UBEA 1YJXA 4IX9A 4Z3DA 3DBRB 5BMVB 4LQLA 5KX5B 1DG1G 3OF5A 4I2VA 3RV3A 4LY6A 3SHQA 3LTEA 1U65A 1VL6A 1ZCFA 3L6UA 1K7CA 4TL9A 4C76A 2OL4A 5KNBA 5GINE 3S1AA 1P18A 1ORVA 1JEOA 1EK1A 4EAAA 3MNFA 5AW1A 2ZSKA 3A4NA 2PJRA 4N65A 1W36D 3TR0A 1IRIA 2G1JA 3EZXA 3W34A 4AF7A 3ZCVA 4ZYUA 5K4HA 4PG5A 1G2IA 3PLNA 4ND1A 3EEQA 2MIIA 1GG9A 3MSXA 5LBUA 4NOJA 2PLRA 3UFXA 4LSMA 1XRMA 1EUCB 5CHEA 2FEXA 4BIMA 3VSCA 1E1QD 1N2IA 1S8NA 2RDMA 4DDKA 3II6X 5KYWA 1XMJA 1T5HX 4XH9B 1A71A 1EDDA 1T0HB 4MCIA 4RPKA 4X9XA 4ILEA 5H82A 3QPVA 5I9IA 1U8UA 4ZEOA 4RFLA 2E4XA 1QIFA 1L3CA 1X8KA 1VCIA 4REOA 4AJ2A 4UBOA 1NXSA 2CHEA 1GDTA 1I2DA 3Q3GE 4FQ8A 4KE7A 4R84A 3BXXA 4WGFA 4ECAA 1OD6A 3GBSA 1RQ7A 2VJLA 4FSHA 4RMHA 3AEKB 5F98A 1PLKA 3BVPA 4B1FA 2VBCA 2OO5C 5CT5A 3GVPA 5E4FA 4F6RB 4RABA 5A3SA 3G0CA 4JB0A 4U6SA 3NTRA 4GBMA 4LGCA 4D6YA 3W9BA 1KFBB 1L9XA 2AB0A 2CMFA 4YT8A 5BORA 3I23A 1H6CA 3K8YA 1E5VA 2M6SA 4LWQA 1YF3A 1YS7A 2X4DA 3MQFA 5DYYA 4BV3A 1E77A 3DHNA 1P1FA 4CZ2A 2P11A 1FC0A 3GG2A 2Q9UA 3INRA 3IQGX 4FLEA 1OH5A 3S44A 1PD1A 1B00A 1PNQA 3PHIA 2FETA 2PLNA 2A9VA 1U0EA 3AIIA 1T5OA 2WSMA 3MJDA 4KR0A 3KQUA 4WDQA 3UKJA 3IEVA 3T52A 4AZ0A 1PQPA 3D81A 2F8MA 2KBFA 3PXUA 4ZT5A 2JIRA 1N8KA 3L1IA 1D0SA 2E85A 2PHZA 3KPJA 5F1PA 4PSVA 3DVLA 4UFPA 4PV7A 1P60A 4Q3EA 1YCHA 2JKVA 2C84A 1BDMA 2QZJA 4JJEA 4YV2A 3HSSA 2Q3JA 2J87A 4B35A 3JQEA 1EA7A 4C4AA 3PWKA 4J94A 4MV1A 4Y1EA 3U9SA 3WY9A 3R75A 2JFWA 3NFRA 4AN1A 4BV2A 1IULA 3C3PA 2BUBA 2WT8A 1K89A 4TROA 5IASA 4PQFA 4UPVA 1P4JA 1MOQA 1N2EA 2XKBA 2PH7A 1EVEA 5LKAA 4MUMA 1QOPB 1QYWA 3WL4A 3WQSB 1WKVA 3TFQA 5CVCA 2ZITA 2B9VA 3CF4A 5K3EA 1XTSA 1E7QA 4DDHA 3EIWA 4GOJA 3C3MA 5KMGB 3U3ZA 1AS3A 4RANA 3SPXA 2X7HA 3O93A 1HZZA 1M2HA 3M1LA 3GDGA 3NATA 4TN5A 4XX1A 1OH7A 1Q19A 2QLLA 3TSZA 3KWFA 2Y1KA 1UK8A 2W6MA 2OPHA 3WXMA 4DJTA 3DDUA 1RC0A 3K73O 4M1SA 3ZXUB 4AU1A 3K0BA 4YUXA 4GX5A 1KS2A 3EJWA 1AE1A 4DM7A 5C80A 2PO5A 4MI9A 5EJ8A 3AILA 2PANA 1HYEA 2O8NA 3PGXA 1XPRA 2E87A 1ZK0A 2YICA 4GZ6A 4U2EA 1OIWA 2VHZA 2IPMA 3NU1A 3Q98A 1Y6QA 4IM7A 1WP9A 2C83A 1I4DD 3TTSA 5KNLA 3F9RA 4LDAA 1EJ2A 2PGDA 1H0RA 2IXBA 2DXIA 2AW3A 4EY8A 1M1YB 3B9RA 3U16A 2WM9B 3KVRA 4I3GA 1TYBE 5HPYB 5HM8A 5CT4A 5LQNA 5JT1A 4Z53A 1WMAA 3BK7A 2V7UA 2YN4A 3QI7A 4PRKA 3ZJVA 3ZCTA 3ANTA 1SBYA 5AUPB 3A9VA 3NDJA 3MF4A 1A77A 3EVBA 3JWEA 4R16A 1B8OA 3WNDA 2IYPA 4RW0A 3D5TA 4BMNA 1O6FA 3IHWA 7AT1A 2EKZA 1Z5GA 1W88A 1E2GA 1GLGA 2WV9A 3FHJA 4GO1A 1AQJA 2V58A 1IBMB 4D3XA 1TUIA 2ZUWA 2I7VA 3O31A 1M1ZA 4NPHA 3V7FA 2EKBA 2N3ZA 3CZQA 4M60A 4EJ6A 1HZZC 1CQPA 1EFPB 1UCFA 1YQDA 1UDRA 1XYYA 2ZTVA 3CUSA 3MIIA 3P96A 4HY3A 5EJ5A 4UM5A 2INGX 2I22A 2QMQA 1LDEA 4RDCA 3ND7A 4Y2SA 3OP1A 1I14A 1Q5PA 1X1TA 3PPYA 4LY3A 5JYBA 3HXQA 1UBSB 1XN1A 5FFNA 4MGZR 5LXTF 2ZWVA 2ISCA 1HO3A 3AVOA 1RVV1 1SKYE 4MARA 5BVGA 1RWXA 3PNPA 4F38A 1VJ5A 1LPSA 1MU0A 1TU4A 2O0KA 3EIXA 4K3UA 1KEPA 3FZEA 4W5HA 5LD2C 2QE6A 1VXRA 4PX9A 4CRWB 1K3FA 2FOLA 1DTSA 1NSTA 2OBMA 3GZ4A 5HS6A 3KPWA 4E33A 1BS1A 3O38A 5DVZA 4BRZA 4ARUA 4X0EA 3J81k 4NMLA 1DELA 4UHFA 1N5DA 1C7ZA 5EWJB 3E4DA 1Y9EA 2AWOA 3L93A 1QDEA 1WIWA 2WTNA 3C3XA 3MIZA 3HM2A 3HVKA 3PPIA 2Y0PA 5F2NA 1V3TA 3ETCA 3KJEA 1YB1A 2BFAA 3QPUA 1C0EA 4HXYA 4JC4A 4OXQA 3EEOA 1SA0A 1OCEA 1N4DA 5KOJA 4K2HA 4BNNA 3GMIA 3BWBA 4Q3KA 3RHZA 3PUIA 3FLBA 3HS3A 3IT1A 3BFPA 4RPLA 5J4KA 5KNDA 3CVUA 3IURA 3DZKA 5IM5A 4P36A 3IDSA 5EPUA 3E82A 1VXOA 3MT9A 3AM1A 2HCBA 2C2XA 2KYRA 4RSHA 3RC2A 1NVTA 5IMSA 1W46A 1AK9A 3ODGA 4P3PA 3AINA 1NT2A 1XXHA 2OYSA 3CWCA 3PXGA 4ETMA 1K5DA 5A6SA 1RIFA 1UUFA 2Z5GA 2VTBB 5ARBA 1TO6A 2FFBA 2ODPA 3K0AA 3VZPA 4EHAA 3QVLA 3PFGA 3FPKA 3UWDA 1T1RA 1YQUA 4ZOLB 2NUAB 4ZDWA 1ML4A 3KJIA 5THQA 2QTCA 2OOKA 3AZOA 4OCZA 5LBIA 2HRQA 3F7NA 3DLCA 3X3HA 5KTOA 2YS6A 4NS1A 1RMYA 2WOJA 4XI9A 1JTVA 5ALNA 4E21A 5IJ0B 3L7DA 3QUQA 4JITA 1O6BA 3ILHA 3LA6A 1ZG3A 5KKNB 3K6SB 4TTSA 1GP2A 1I01A 4S0ZA 5EJ4A 3E18A 4W6ZA 3WRXC 5KZMB 5ALYA 2CNWA 4JHXA 1A8IA 2HZBA 3KSBC 3K5WA 3RGWS 4KPGA 3VJLA 1QF6A 3Q72A 1N36B 1RJWA 1Z45A 4RD3A 3OECA 4ND2A 2FVYA 3ORHA 2Z1NA 4TMTA 1XA0A 3E22B 5P21A 4X1IA 3JPYA 2WDPA 3GA7A 4RJKA 4PANA 3V4OA 4R1PA 3REFA 2XCQA 3LCRA 1CRZA 3NZEA 5LN1A 3EDMA 2ZT7A 3KQYA 3FTPA 1V8FA 2VDNB 1VYVA 2C07A 4G4GA 3TW8A 1PD0A 1FFYA 2MTBA 2VVTA 3G0BA 1YA8A 4HDKA 3TWOA 4R1OA 3IXQA 1IPFA 2ILVA 2TMKA 4LOAA 4QPPA 3A4YA 4CMIA 1JJVA 1ZKDA 3KQPA 4M9XA 4C22A 4O2BB 1H23A 5D84A 1EUYA 2FVXA 2FP4A 3OM9A 5AKEA 1U5CA 5LNK6 2A5LA 3G6KA 1LF5A 3R3ZA 4GI5A 4IIBA 1J5PA 2Q2WA 4MYRA 2QN7A 4PLFA 1YZYA 4JELA 2ALJA 4RTJA 4GOKA 5ENZA 2HHLA 2YXPX 3SSNA 4C88A 1QGAA 2R6ZA 3ML1A 2B7BA 2X0EA 5BW4A 3MBOA 2FHPA 1OLOA 1Y4UA 3C8UA 3FDXA 1K7XB 1Y0BA 1KI2A 3HWRA 1NVBA 5C8YB 1O6GA 3DGFC 5IJAA 4RIGA 5A1JA 2O8DB 3LPMA 2GPYA 3S7ZA 2NZWA 1D4AA 5CM8B 3Q3IA 4M8KA 3MYYA 1T13A 4N03A 3JTMA 3TD2A 3TSYA 3OEWA 3BDIA 3GNQA 4QYXA 4G0VA 1MOSA 3K2EA 2WUGA 3IQIX 3RAGA 3WGJA 4C9BA 5BNWA 3U44B 3N7AA 5F4ZA 4PC1A 4HDQB 3S27A 4FDAA 1B2RA 3EGVA 3RASA 2JHPA 3ZWAA 5LMNB 1O8BA 2R2AA 4V0MA 4PBSA 4U0KA 1EIWA 2JD2A 5E6UB 3OE4A 2PVSA 4HWOA 4TV9B 2EKPA 3ZK7A 4YRJA 3QKRA 3T1NA 3IEIA 3KZCA 2J3IA 4NYJR 2G09A 2JEZA 5DLPA 5C31A 2JIQA 1PRYA 1LU9A 1RFLA 4FJ0A 4S3MA 4E09A 2CSUA 5FADA 1D6SA 3ZXIA 1PG5A 2DJIA 2CC2A 2PRIA 1IN4A 2GN9A 4GECA 3A2MA 3MJFA 1JT9A 3B7GA 4RK5A 5B2EA 2EP5A 3LLSA 1Y8ZA 2ZI7A 1Q3HA 1F7VA 4KJZA 5DI3A 4ALKA 2D2IA 1LH0A 1TTQB 3G2MA 3OLWA 1AK2A 4HGQA 3TI9A 3ILVA 1TUBB 2BF4A 3ZVKA 4KOAA 1A9RA 1LZKA 2BHLA 1SZCA 3A1EA 4G5GA 1IQUA 5G0SA 3VYUB 3IMEA 1EDEA 3E61A 3B89A 4YT2A 3GFQA 4Z7NB 1IMJA 2GAAA 2BF7A 4PRLA 2A1TR 3HU3A 3HO8A 4NARA 4LMBA 3OTQA 1KYVA 5HA5A 5L3VA 2ZDQA 4RJJA 1WUHS 4F86A 1YFLA 2HI0A 5U9CA 4PZEA 1OC2A 3EVAA 2GS9A 1TB4A 4TV8B 4DMRA 2Q5OA 3I4FA 4R2HA 5CR9A 3EZGA 2O3TA 3AKCA 3OY2A 3NHWA 3Q1LA 2Q3DA 1PIWA 3CMCO 1OGJA 1EGQA 3MCUA 4FMPA 4L5IA 4O2AB 3GJSA 3L7IA 4Q3AA 5DF1A 5AOCA 3GDFA 2B2CA 3CLRD 1YK1A 1RBYA 2PR2A 5FBHA 4PZ0A 2RARA 3EC1A 4MDFA 1JZQA 1ESCA 1EVLA 2PGOA 1G6Q1 3K0EA 3FWKA 4HEQA 5B5SA 1RHJA 4L22A 1W96A 3WK5A 4X1YA 1L6RA 3HYLA 4HTFA 3KLNA 1P0IA 1DJLA 2WWXA 1NXPA 3EF1A 2XMCA 3WAKA 4J2OA 3IAFA 4NNJA 3CG4A 2PRZA 2V0CA 3EIFA 2RHOA 4QBGB 2BSAA 3HPRA 3L0PA 4QOHA 3LUBA 4EHBA 3P4XA 3MB8A 3L1VA 2WD7A 3PXDA 3HP1A 4B48A 1FFXA 3TFWA 5DYNA 4AXBA 2X40A 4CG2A 2E89A 5TJHA 3RBVA 3OPVA 2WPDD 4JOBA 4WE3A 3WWOA 4P4GA 1Y8CA 2GJKA 4MHOA 4RK7A 4JT9A 2Z1MA 1GSIA 4N0QA 1UAYA 5EJ9A 2OP0A 5K0TA 2QDXA 1ACJA 1L7BA 1Q0TA 5A5EA 3KR1A 2P3OA 2QW8A 2XGMA 1XF9A 2YJNA 3KDPA 4FR2A 1AOXA 4PPFA 3MPOA 4R51A 1RJ9A 3LAWA 4Q05A 4CT4B 2Z6QA 5A3VA 3PHCA 3FHTA 3OT1A 1VJRA 4L0DA 2W2KB 4NYIR 3C6ZA 1IE3A 2WIFA 2FMHA 5LA6B 1Z82A 1EWTA 4L9AA 4DT1A 2NYUA 1J8FA 1LK5A 5J2TA 1CF9A 4IOKA 1BW9A 3BGVA 3HMQA 3NEYA 5C1IA 4RHXA 3SM9A 1CTQA 1AKTA 4AIIA 1F14A 1M83A 1MENA 4R3NA 4ZHSA 2IBSA 3FNIA 3U3MA 4H1WA 3VZCA 1LPOA 3D7SA 3JQAB 4P3OA 4PO3X 1JL3A 3STYA 4RLFA 1F2UB 3ORFA 1LPMA 1Z26A 3GXBA 1CY0A 4I4TF 4K6CA 5T41A 3SKYA 5CCXA 3F4KA 1DWUA 1U8CB 4WN3A 3VTZA 3R20A 4GLBA 2O2HA 4KFUA 1T8RA 3BD7A 3AB3A 1WPRA 2VSNA 3ILXA 3I62A 3WGGA 1W19A 2I6SA 1D7OA 2F4NA 4H3VA 1ZY2A 2QMEA 1Y8AA 2JLQA 2VQ6A 3LUCA 1I3MA 3OPXA 4NMMA 5A9TA 4DC1A 2YFQA 4BXOB 3DCJA 4O4IA 4EB6B 5BYJA 1YNOA 1XWFA 5KU7A 2XHZA 1OWLA 1RWPA 2O3JA 3QVOA 3PYMA 2BIFA 4GM1A 3WQRA 2ZUTA 1V5WA 1NV9A 2DE0X 2VAPA 3HTXA 1TF7A 2C1XA 4JZKA 4K28A 3RCBA 4M0LA 3COWA 4DZZA 1AGNA 1X7YB 2VT2A 4LKRA 1BO6A 3U7FB 3E5HA 5KJ6A 4M8LA 4FYPA 3VR5D 5ICMA 3PQFA 1JPJA 3PQ4A 1BJRE 4XB1A 1K3TA 3NWJA 4HRXA 4ZVNA 3W2EA 5A04A 4P5EA 3PWTA 2D1TA 2JFNA 2P69A 1UM9B 4I50B 2RGNA 3PFHA 2PPLA 5LP6F 1TKAA 3ZY6A 2AWNA 1XP8A 3M3DA 3V2UA 2VDWA 2X0JA 3MINB 2FEKA 3L01A 3OM1A 5FWYB 5KVCA 4OJYA 3ICEA 2FEOA 4X7MA 5L6MB 3ZGZA 1LK7A 1JKXA 4LV8B 5IDXA 4XWKA 2BGJA 1ZZGA 3A7EA 4MGYR 5FFMA 4E6PA 1S2MA 1OTYA 5KOYA 4ZVKA 4BO9A 2RGCA 3FPAA 2NU6A 3E9DA 3PWZA 4BQRA 3IKMB 2HMAA 4B3GA 4DR6B 1EFUA 5JS6A 1IEQA 1V9SA 3EPJA 3C41J 3NGXA 4D44A 2C4HA 4GGPA 4NU8X 2OA0A 4TWRA 5BVHB 1YS4A 2IODA 1GFZA 4D6XA 2GN2A 4MWZA 4BB9A 4C4PA 1EBBA 4RD2A 2QTRA 4K6GA 1PS0A 2QRQA 2IXDA 1AXEA 2ZYRA 2P9BA 3T38A 5LJLA 2OM6A 3D8BA 2A0XA 2W2LA 3L8GA 2X5XA 4PLPA 1EKXA 3SFTA 5C52B 3MMZA 4IFIA 4AUNA 4YRMA 2PR7A 2PZAA 2GZMA 3D8NA 2C7PA 3AEQB 1PK7A 4KQ9A 4WPGA 1FDRA 4RJ2A 4OLJA 1XRSB 5IVIA 4JLMA 4RK0A 4Q37A 4CL8A 4EAQA 5LU9A 4JL8A 1DAMA 4KI0A 4L4RA 3GPLA 1CQZA 3ICWA 5K6TA 1KC1A 5G4KA 2RGNC 4JBXA 2TRSB 1S3IA 4NENB 2PZ8A 4AUEA 3BIOA 1Z7WA 3UIEA 1MO2A 3OPYI 1LDYA 5LIPA 2O20A 3C3BA 3JWIA 1B23P 1NBAA 3G85A 3HB9A 4O4JB 4B0OA 1P9NA 5CPBA 1AB6A 4ARCA 2ZQ5A 4MKHA 4QQ8A 2GVDC 3DBHA 5COBA 5ADHA 5HQTA 4AS3A 3I8XA 1HYQA 1YZVA 3GEHA 3PI7A 4PZUA 1Q74A 4IICA 3S1LA 2Q21A 2Q3FA 4NBSA 4YMTA 4OO3A 1KZ9A 4KE6A 2QXUA 5KWVA 3D0OA 5EN4A 4O33A 2OWDA 3D3EA 1CVRA 3I05A 2P6PA 4OBEA 1EWKA 3H4VA 4C4OA 1G38A 2IF0A 3ELWA 3EDOA 1VHTA 4NAUA 3U17A 1CLUA 2VATA 2ISSD 4C2TA 1C30A 2Y05A 4DXDA 4BUJA 5IG2A 3R23A 5CURA 5AJYA 4H7FA 3UVEA 2G06A 5LIRA 4GQIA 4QDOA 5A5DA 3BDAA 3CM0A 4KDRA 4UUBA 2YWFA 1SHTX 1UP4A 3F5DA 5IBPA 5BR8B 3CGGA 1YDHA 3GN1A 5E6RB 3FOEC 3Q88A 5K0ZA 4CKZA 1D04A 4Y2RA 4I0WB 2XXAA 1CZHA 5EXTA 4PYKA 4AKTA 1QZXA 4D3DA 2CXPA 4R8LA 3L8MA 5DCLA 4ZKDA 1RZRA 5DASA 3E7FA 3EGIA 1I4LD 1N6KA 4FYMA 4IRUB 4BQNA 3TG8A 3GO4A 2FPGA 3T3MB 5FEMA 1XMXA 1KSHA 1YHNA 2G7ZA 2Z6UA 2CLSA 1MV5A 4F71A 4UBJA 4IVNA 2NZUG 4ZVQA 3FPCA 1UMKA 2X6QA 1JIUA 5DU2A 3SSMA 3K9LA 1PG0A 5REQA 5HF6A 3E3NA 1RSZA 1KZ4A 2R6JA 1E1MA 2ZANA 4FI3C 4FUTA 3ZWBA 1SKUA 4UNIA 4L0QA 5IF9A 5C35A 1MFZA 2B1JA 1QVVA 4AJ1A 1N7IA 3V2GA 4O3MA 1GPH1 5T57A 1EZ4A 4YWJA 3TLXA 2Z3ZA 2H4WA 1CW2B 4UU7A 3DGEC 1BC5A 1UFRA 3MMNA 2J6CA 2VAWA 1P2GA 4I9UA 5DTQA 5FR1A 3WBKA 2ADOA 1KQFA 3C16C 1DDOA 4JP1A 1R4MB 2C4MA 1RQGA 4UFNA 4F5ZA 1KAOA 4IGEA 4MP6A 4U6QA 1RPJA 1R0KA 4GYYA 1TL7C 1MAAA 3AL0C 1K5HA 1PJ8A 1L4BA 2V4MA 4O1IA 3VO9A 2FMTA 3I09A 4LXXA 5LQKA 5LMZA 3BJMA 4GR5A 1G8YA 3JVIA 4UVHA 3HDYA 2IYVA 2FWIA 4RC9A 2JIPA 1TO1E 3NGMA 4UXHA 1EB9A 4HFRA 3TLYA 3W5UA 1UK9A 5LSAA 5AQEA 2FN9A 2VHUA 4ITRC 4DYVA 1EE1A 1H5QA 2YFYA 3BK1A 3KDAA 3TO5A 2QL5A 1C1HA 1FUYB 3JARB 4AKIA 3KQTA 5EJIA 2QMHA 4WL0A 3U80A 1IU9A 2EHDA 3V33A 2CK3D 2JI6A 1PN3A 4C4SA 3QVKA 1JR3A 5B2ZA 1F06A 3KV3O 5CHYA 4CKYA 4IMPA 3QWFA 1XZPA 1TM7E 3O3OB 4H31A 4U3JB 4ROTA 3BWMA 4BB6A 1F0YA 1YVDA 1TOAA 4MV9A 3LCMA 3FOWA 2RKOA 2D3TA 2UZ3A 3B6JA 4BLPA 1W85B 4JLSA 2Q0QA 1WJGA 2YUIA 5JAIA 3R5SA 4FR0A 5DGHA 1OAAA 3BRQA 3DAFA 3SQOA 3W6ZA 5KQMA 1OH8A 4KVGA 4NCIA 3SF8A 4LVOA 5BR7A 4MLDA 1OZ0A 3U37A 1PLLA 2QSUA 3DH0A 1JTEA 3MQ4A 4WSOA 1UP7A 2GJAA 4AP6A 1A9XA 4NFYA 3A6KA 2FHSA 4DLWA 3A9UA 4JLBA 4TTTS 4RJLA 5C4MA 2QVYX 4PZLA 4F4CA 3RI3A 1UXIA 5K8UA 5HUHA 3QUSA 3BC1A 4RD4A 3LBNA 4PPYA 4V0NA 1O54A 2K2QB 1AHNA 1DZIA 1SVKA 1VYHA 1NVDA 4FYXA 4PBTA 2APJA 4F2HA 3UCFA 1H8HA 2ZATA 3GRVA 4FDTA 7MHTA 4K0KB 1O0CA 3HV0A 4NYMR 1TIKA 4QNNA 1V35A 4GWGA 3FY4A 4TVBA 4AY3A 5CLQA 5LYYA 1HWYA 2W37A 1UPBA 3H6KA 2XX3A 1ZI6A 3R5XA 3B5EA 2QX9A 4IV8A 4JP3A 4U1RA 5JTUA 3MXOA 3M4ZA 4FINA 3UBTA 2J7KA 2P5SA 1MT0A 4MYSA 1Z2EA 4KDEA 3H9EO 1W4BA 3GVCA 4ZRNA 4BZXA 4BNKA 1Q0RA 2HCJB 3GAZA 1SCNE 4ZAVA 1OLUB 3DQZA 2P5YA 4H1VA 1V8BA 2ZB4A 2HYIC 1IHYA 3OQVA 1BHSA 2CL6X 4TTPA 4GH5A 1L4HA 2WRZA 3WGQA 4YCJA 1YS2X 4CUJA 2J46A 2FJPA 3FB1A 3COSA 4E5NA 3EPHA 1A5BB 1A9SA 1Z2DA 1SWVA 3FTDA 4QPNA 3CIFA 4EG4A 4OHXA 4ARVA 1M3SA 5AK6A 1A1SA 1GLNA 3HBAA 1MVNA 1XXLA 4XA8A 1XU4A 2A8YA 3UBMA 4EEZA 3DOIA 3DZFA 4N40A 2PV0A 4HN4B 3VNBA 3I28A 4X8MA 2XVXA 4QNMA 1WQ3A 3U3KA 4TYNA 5B1HA 4RA6B 4N0DA 2GN4A 5EE3A 5JCOA 4GVLA 4EYKA 3F96A 3DL4A 3KBOA 1CJKC 2CWDA 1NG1A 2Z9DA 1ZGZA 4Y9RA 1A7UA 3RYFB 3G2QA 3RYHB 3LLMA 2L82A 1D2NA 2V96A 1GILA 4IYJA 1C3LA 1L0BA 2Y1XA 4LMRA 2J3HA 4MRMB 4NKRA 3UENA 1VHLA 4GIBA 1HTBA 4IYRA 1FSPA 4HD8A 4XFKA 3SN6A 3HXMA 3GJTA 2RH5A 2GN1A 1E3DA 1UBUS 3ODPA 2ODAA 1B76A 5CK5A 1KAHA 1P1KA 1QH9A 3BE8A 4OMUA 4Q0MA 2H4HA 2WBLC 3LYUA 2IYUA 2ZYGA 5DX8A 2FWJA 1NM5C 2IYOA 4JR1A 4YIKA 2I67A 2AOUB 3RG8A 4FYVA 2ID7A 4OFXA 5F2OA 3UATA 2PNJA 1G8PA 1VPTA 1BN7A 3IPXA 5GJVC 3LY8A 4PHTA 4F5WA 5EKUA 4EVSA 5KWJA 1OX4B 3OG9A 4QOSA 4A6PA 2I4OA 1WABA 5LQCA 3P0IA 3OIWA 4DMMA 3T7SA 2TYSB 3LC0A 2R6AA 4J7AA 1GG5A 1L8QA 3N8DA 4FLMA 2IV3A 2BHTA 3IQFA 4N3AA 1OB5A 1BQ4A 1CV2A 3FDFA 4H77A 1YVUA 3EASA 5AKGA 3BRSA 2DUMA 3NX4A 1TVKA 2CXSA 6CHYA 2H5JA 1HBJA 1NXTA 2XTZA 3UG6A 3KQLA 5I8ZA 1IOLA 1F8GA 5BXYA 1G3QA 4U7WA 1BWPA 1HDOA 1VIMA 1NJ1A 1W9HA 1E9VA 2IOHA 2QTTA 5AJXA 3L4KA 2H8GA 1LC0A 1NPYA 2ZRBA 4TLEA 1JA1A 1IZZA 1L5OA 4CJXA 2B61A 4IUCS 4MWDA 1CF2O 4W8OA 2ODEA 2ZGVA 3PTLA 4OM8A 3KD2A 4QX6A 4Q9LA 1F2VA 1A9TA 4NMXB 2QUJA 1KKUA 2V6IA 1AZSC 2CCKA 5T5QA 5BWBA 4PYMA 3F49S 4IZOA 4LOIA 4ER3A 1UXJA 4GPAA 4FMDB 4IWYA 4TSFA 4XB6B 3RU7A 2QTVB 1UMBA 2NXEA 1RXSA 3VOBA 2I1WA 4LJLA 1JFTA 4Y6QA 4G8DA 5JWHA 3ZC3A 3R0IA 4B85A 4Q4AA 2ZS9A 3L06A 2NV2B 2WWFA 3UOWA 2IVZA 3OVMA 2ZRAA 1OBCA 1HDYA 3U1BA 2HFKA 1ZW1A 2F2TA 4BPRA 2XUZA 2F3TA 1FW8A 3LF1A 2O2EA 4IILA 4Y7CA 5LC1A 3IUBA 1WZIA 3VYTB 1Z38A 4CKWA 5FLEX 2B4QA 2HPVA 1SY7A 2SICE 4KV9A 2YQZA 4TL8A 3FOBA 1JECA 4TKZA 1MC8A 3HKEA 1P74A 2X0DA 4QOFA 4JI5B 2ONJA 2QZ4A 5CPFA 7YASA 2II6A 1ESZA 3GWZA 3H13A 4RE6A 2RONA 2YNMC 3U4AA 2D7DA 1GNPA 1K88A 4TKLA 5EIFA 1DQRA 5TMEA 1JALA 3NDRA 4Q3OA 4C01A 1UPUA 4JP5A 5AT1A 1PJAA 1XEXA 2C57A 4XGNA 1V3UA 1RQXA 2YS7A 1DQYA 3FWHA 3OD5A 4A0SA 2G04A 2V6FA 2FEPA 4P7KA 4XDYA 4FEYA 3AEXA 4EWLA 4DF3A 2COKA 3L07A 1H42A 3WHLA 4DWVA 3A58B 3OCZA 3MT8A 2VA9A 4OKSA 1B26A 4DIEA 5FUQA 1ZD9A 1TJYA 1SCIA 2ZI4A 5K1ZA 4MITA 5D1HA 1KZHA 3CPEA 4I08A 2PSJA 3DCNA 2EC5A 1JG4A 2IA5A 4XR9A 3Q10A 1JFVA 2NU8B 3ORQA 2VRCD 1ODKA 4RFVA 4RV5A 4FIZA 3WYGA 5AKZA 3EVTA 3E1KA 3K8OE 5EEGA 3E5NA 4F6LA 5B57C 2CE2X 3NJ8A 3ZHQA 1C8VB 2HIAA 3MJCA 5I45A 4BNIA 2XR1A 4E5VA 4X8HA 3WDKA 1KHHA 1NF3A 1QTRA 5IVHA 1ZU4A 2YCLA 3IH5A 3R6DA 4N8SA 4NE2A 1EQAA 3NOXA 1KSJA 4O4LB 5KWEA 3IRVA 5LU8A 3DAPA 2A35A 1J0XO 1U3WA 4K05A 2RBKA 4JQOA 1YB6A 1DIOB