3MQ2A

Crystal structure of 16s rrna methyltranferase kamb
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
MRRVVGKRVQEFSDAEFEQLRSQYDDVVLDVGTGDGKHPYKVARQNPSRLVVALDADKSRMEKISAKAAAKPAKGGLPNLLYLWATAERLPPLSGVGELHVLMPWGSLLRGVLGSSPEMLRGMAAVCRPGASFLVALNLHAWRPSVPEVGEHPEPTPDSADEWLAPRYAEAGWKLADCRYLEPEEVAGLETSWTRRLHSSRDRFDVLALTGTISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA methyltransferase
publication title Structural insights into the function of aminoglycoside-resistance A1408 16S rRNA methyltransferases from antibiotic-producing and human pathogenic bacteria.
pubmed doi rcsb
source organism Streptomyces sp. dsm 40477
molecule tags Transferase
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mq2A00
5KS2A 1RJGA 3EVCA 3KQTA 3IYLW 4GC5A 2OB2A 5DXAA 5EEHA 3LDFA 5ICFA 5DRYA 5EVJA 1N2XA 1XCLA 3MCTA 2GS9A 3G88A 1NBIA 1G8SA 3X0DA 4JXJA 2PGXA 2WK1A 5FHQA 3A7EA 4IV0A 5EZQA 4QQNA 4OBWA 2PX2A 2G71A 4X63A 5E9WA 3VC1A 2IBSA 3THRA 1X19A 3CJQA 1RI3A 2V74B 3LCVB 1NW5A 2B78A 2OBFA 1F3LA 3M33A 2I7CA 3TKYA 4FP9A 1QAOA 3EGIA 4M7RA 1L9KA 3FPJA 3EMBA 2Y1WA 4V0RA 2AOTB 3ELDA 3P2EA 3P8ZA 3MAGA 5EQJB 2G72A 1G6Q1 2CL5A 1VL5A 4AUKA 5GIPE 5E2AA 4OA5A 1N7JA 1R6AA 2ZW9A 3MERA 4AZSA 5LQAA 2P1DA 3TFWA 3A7DA 2EJUA 4B17A 4C05A 1R74A 1YZ3A 4AZTA 4P7FA 2FK8A 3B7PA 4IKPA 3HCEA 2IPXA 3MTIA 5F2OA 3KR1A 3EVDA 4XUCA 2BR3A 3G5LA 4CKBA 3ELUA 4V0QA 2O0LA 1BKYA 2P3OA 3HVHA 3OZRA 5EG5A 3FUUA 2FHPA 3G89A 1BC5A 2AS0A 2OYRA 4C07A 4PGGA 5E9JA 5E8JA 5DTQA 1D2GA 2OY0A 3AJDA 1EJ0A 2BM9A 1L3IA 5DTRA 4DCMA 3HEMA 2PXXA 4WVLA 4L7VA 5DX0A 3R6TA 3GGDA 3C6KA 2C7QA 4YUYA 3P71T 5LQRA 4IV8A 5FCDA 1XCJA 4Y30A 3TKAA 4E32A 1ZGJA 3HA5A 2HR1A 3JWGA 2ESRA 2PVCA 4PIMA 2HTEA 3AWIA 3BXOA 2BZGA 5HIJA 5K8VA 1MHTA 3KQOA 4RTNA 4X41A 2P35A 1YUBA 3ERCA 3KKZA 3OPNA 3PB3A 5EEGA 4PINA 3OFKA 1V39A 2AOXA 3NW9A 4PYNA 4YV1A 3FTEA 2N47A 3FUTA 2B3TA 5BW5A 2KW5A 2WA2A 5ICEA 4OQEA 4YV0A 4FT4A 3NTVA 4GOOD 3WSTA 3NWEA 4BP3A 2VDVE 3ME5A 1N7IA 4P7JA 3ORHA 3LPMA 5C9ZA 4RTJA 3SX0A 2FYTA 3GRZA 1NW6A 1P1CA 1SUIA 1B42A 3QOXA 3SVZA 4ISCA 2CMGA 4MIKA 5DWQA 4F86A 4F84A 3L8DA 3Q87B 1Q0TA 2QYOA 3FUVA 5M5BA 2B9EA 2VS1A 5LQJA 1R8XA 3CJTA 3FRHA 3HCAA 5DM4A 2VDWA 1XDSA 1R8YA 2OXTA 4C03A 3LSTA 3EMDA 3LCCA 5LQUA 4KDCA 2ADMA 4X61A 2IBTA 4LWPA 4YV2A 3UA3A 1O54A 1XJ5A 5GM2A 2BR4A 4R6WA 1PJZA 4QPPA 3TQSA 4MWZA 1L3CA 5DM2A 2PX4A 3HVKA 4PGHA 5KVAA 2UYHA 3S68A 3OCJA 4CKEA 5GP1A 5FA8A 5CVJA 4FT2A 2ORED 2ZZKA 1RI2A 3M6XA 3OU6A 2ZWVA 4LECA 5GM1A 4ER0A 2OZVA 2PT6A 2ZULA 3OZTA 2BM8A 2YXLA 4POOA 2XVMA 2QM3A 2NXJA 1JR4A 3EEYA 3EVBA 1P1BA 5B1SA 3G5TA 4E70A 5F2KA 5T64A 1NBHA 2NXCA 2P3QA 2ZBPA 3REOA 2IDKA 1SQFA 2NXNA 2P8JA 2YVLA 4PYIA 4QDKA 4PNEA 2CWWA 2C7OA 1KPIA 2GB4A 2AZTA 4X1OA 1Z3CA 1F38A 4XCXA 5JUWA 3F4KA 3T0IA 3FTDA 1INLA 5GOZA 5K0GA 3UJ6A 5BXYA 2YXEA 3B89A 2FCAA 4EKGA 5KYGA 1YZHA 3BZBA 5FUBA 1L3BA 1DL5A 2ZIFA 3TPZA 1NW7A 5CVUA 1NW8A 5K0FA 1RJFA 3NVMB 2ZIGA 4KIGA 3CKKA 2VZ9A 2K4MA 3KQQA 3KQWA 4M38A 4QTTB 2HNKA 4E30A 2IP2A 4YUZA 4C04A 4RTQA 3P2IA 1RI1A 4FS8A 4PCLA 1ORIA 4RTLA 3MCZA 3P2KA 3PFGA 2NXEA 4BLWA 5BP7A 1FBNA 5DM0A 2BR5A 2O07A 3HM2A 3JWIA 3P9NA 5CVVA 3FZGA 3TM5A 1WG8A 4YUWA 3UJDA 3G8AA 4XUDA 1KPHA 4RX1A 3SSNA 5CCXA 1IM8A 4F85A 3CGGA 3RIEA 3A26A 2PX8A 4M37A 4PIPA 4PYKA 4RVGA 5CM2Z 1VLMA 2O57A 5EIWA 5H02A 3CCFA 3FYCA 1ZQ9A 4CWAA 3ER8A 2G1PA 2IFTA 2LD4A 2NNWB 3GRVA 5LR6A 3GIWA 4A6EA 3AY0A 4P7KA 3P9IA 5JR3A 3NDJA 3HA7A 2PT9A 3M4XA 4RVDA 1NT2A 1Y8CA 3LDUA 1QANA 3VYWA 3LBYA 5E1OA 4YUXA 4RVHA 1EJ6A 2PKWA 3KR0A 2C7RA 4U7TB 3SMQA 5EMLA 4RTMA 1L1EA 5FULA 3CBGA 3EVZA 3R24A 2ZBRA 3C3YA 2ZWAA 3EVAA 1VP9A 3FYDA 1QZZA 1I1NA 1XDZA 3MGGA 4Z2YA 4CXMA 3BT7A 3O4FA 1JG2A 3DXYA 1SUSA 4RSRA 1AF7A 2FRXA 3KR9A 3JWHA 4KWCA 5CIYA 2IH2A 2OPBA 2IH4A 3FTFA 3G2PA 1KR5A 1WXWA 5E1BA 2JH8A 3M6UA 2GPYA 2OB1A 4FZVA 5HEKA 4E2XA 1BHJA 1Q0SA 3FPFA 3HCBA 4P7GA 5ICGA 2O05A 2ONYA 2WA1A 5CCBA 3BKWA 5K05A 3HCFA 1P91A 2ZZNA 3T7SA 3UWPA 5F2NA 1VBFA 3FTCA 2Z6UA 4PWYA 2NYUA 1YB2A 1ZG3A 3M70A 4HGZA 3DMHA 2XVAA 2ZSUA 5DSTA 5EPEA 3KQSA 3HA3A 5HILA 3QV2A 5K03A 4FGZA 5EZSA 4MHTA 2PJDA 3DULA 5E9QA 5DM1A 4PYJA 2PXCA 3TOSA 5KQSA 2QY6A 5K0NA 2GA9A 4RTSA 1NV8A 3KPJA 4GOND 4EMSA 5DRTA 4G56A 3U81A 3I5UA 3DH0A 4FSXA 3HVJA 3BGIA 3A4TA 5HZMA 2EG5A 1U2ZA 1WXXA 4OA8A 5T6BA 1R00A 3EVEA 3BGDA 1JSXA 5C0OE 2PV0A 1HNNA 3FUWA 4KVZA 3OU7A 3UBTA 4NECA 2HWKA 3Q7EA 1KYWA 5FHRA 1JG4A 2AN4A 1PRYA 3IEIA 4GOMD 4QDJA 3NJRA 3ID6C 4FR0A 5EOVA 5U4XA 2UYQA 1OR8A 1WS6A 1EQAA 3DOUA 3FPHA 3PLAE 4HTFB 1M6YA 1JTFA 1KXZA 4C08A 3O31A 4ER7A 1AQIA 2UYCA 4M36A 2JH9A 1YFLA 3NMUF 2DPMA 4GBED 1X1AA 4BLUA 3E23A 1FJXA 4R8RA 3T7RA 4RTPA 3IV6A 1RJDA 3NVKI 4YUVA 5FQNA 4E33A 4HRAA 2QRVB 1SG9A 3UJAA 4DMGA 5K0CA 3OE5A 3EGVA 2VP3A 2QE6A 3G2MA 1VQ1A 4HSGA 4R6XA 2AOVA 4HTFA 4RWZA 2YXDA 3GJYA 3KPWA 5DX8A 5E2BA 4LWOA 5IH3A 4RTRA 3DUWA 2Z6QA 3LX6A 1YFJA 2B25A 3I9FA 3VC2A 4UOEA 4K6MA 4RTOA 4E2WA 3LHDA 4PONA 1JQDA 1ZHFA 4LG1A 2IDJA 5EKXA 5FQOA 2XBMA 2QRVA 3HNRA 3FUXA 3JWJA 1DCTA 2Q41A 3KQMA 5C1IA 4R8SA 2AOWA 4GOLD 1FPQA 2H11A 1EIZA 4KRGA 4YMHA 4OX9Y 1VE3A 3G7UA 4HC4A 5D1NA 4X60A 1X1CA 4CTJA 1JG1A 1JQEA 5DX1A 5GINE 2YQZA 3ER9A 1VIDA 1H1DA 3H2BA 2JHAA 3DXXA 4Y2HA 5DSXA 3PTAA 1SQGA 4A6DA 4YMGA 5CUQA 5DLYA 5HIMA 3MB5A 5LSAA 3HTXA 1AV6A 3P97A 2ONZA 3C3PA 5EKUA 4HGYA 3DP7A 2C7PA 2ZBQA 3PFHA 4PYOA 4MTLA 3ELYA 2JHPA 3ELWA 3C0KA 3K6RA 3O7WA 3SSMA 3SSOA 4DA4A 1NW3A 3DMFA 5KQRA 5EC8A 2ZIEA 2AVDA 3R0QA 3SXJA 1HMYA 1IY9A 1D2HA 3GU3A 3LBFA 3SM3A 3CJRA 2ZZMA 5GWXA 3B5IA 3P9CA 5CVDA 1QAQA 2EFJA 2GH1A 2PLWA 3GWZA 5FTWA 3TM4A 1ZGAA 3TRKA 3I53A 3G2QA 3OU2A 1X1DA 1QYRA 2CMHA 2XYVA 3AXSA 2Y1XA 1TW3A 1VP3A 2UYOA 1G38A 1TW2A 1KIAA 3KU1A 5E1DA 2R6ZA 3I64A 2V7EA 4RVFA 5CD1A 1XTPA 4CKCA 5HIKA 3GO4A 4ATNA 3LDGA 4E2YA 1JSZA 3QOWA 3A25A 4PYLA 4ER6A 2GAFA 1M0EA 1MJFA 1JG3A 1P39A 2PSSA 3BKXA 4KDRA 1JTEA 3BGVA 4MQ4A 4P58A 4OBXA 3TMAA 4RV9A 2I6GA 4BLVA 4ZTBA 7MHTA 3GNLA 4PCAA 3B3JA 4FSDA 3IHTA 5DTMA 3PX2A 4DM3A 1UWVA 4QTUB 4OQDA 4QPNA 3GRYA 4QVKA 3E05A 1EAMA 1AQJA 5K01A 9MHTA 2PX5A 2ZTHA 5EIFA 2I62A 3DR5A 2F8LA 3CC8A 3KQVA 8MHTA 5LQNA 4PYQA 2JJQA 3UFBA 1G55A 3FRIA 3I58A 4GQBA 2EX4A 2H1RA 3OZSA 4E31A 1XVAA 3TLJA 3B3GA 1X1BA 1NV9A 3HCDA 4EVIA 5LQKA 2EJTA 1M6EX 5BW4A 4KW7A 2P3LA 3LKZA 3RW9A 1I9GA 1KP9A 5EHIA 4EQZA 1ORHA 3BWYA 2AOTA 2PWYA 3G8BA 2GLUA 2PWPA 5K0EA 3GDHA 3KR2A 1EG2A 4DKJA 2HV9A 4QQKA 3HVIA 2B2CA 2YTZA 1O9GA 5T67A 4AZWA 3UA4A 2AVNA 3FPGA 2ERCA 3BWCA 3TR6A 4PYMA 1RJEA 2AN3A 2NP6A 3B3FA 4O29A 2VDUE 5FWAA 3DMGA 1NE2A 4HG2A 5EGSA 3R9XB 1FP2A 2JG3A 5D1HA 5ICCA 4ER5A 3ANXA 3SR4A 3EVFA 4QVGA 3C6MA 3V97A 4EK9A 2PXAA 1RI4A 4U7PB 4H0NA 1VPTA 5DPMA 3MTEA 5ERGB 1KPGA 2A14A 3UJCA 5CVEA 4BY9E 3UJBA 5MHTA 3PX3A 2ZCJA 10MHA 3KPUA 4AX8A 2YUIA 3M6WA 3EGEA 2AOUB 2YR0A 3V8VA 2PY6A 5E1MA 2IH5A 3KPYA 3AXTA 2H00A 3HCCA 3RODA 4R05A 3MQ2A 3D2LA 3P9KA 5G02A 3PVCA 5HOQA 4DF3A 1ZKDA 2G8NA 2P41A 5DT2A 1KHHA 3UZUA 4BP1A 3EPPA 4C4AA 3E8SA 1NKVA 3HP7A 2FK7A 4GF5A 3PT9A 1UFKA 3MHTA 3FPEA 3DXZA 3OFJA 2DULA 4ER3A 2AOUA 2OO3A 3OE4A 5EMKA 1T43A 2P40A 1QAMA 1R18A 4GEKA 3THSA 5GIOE 5HFJA 1YF3A 3UJ7A 2O06A 3K0BA 5EMMA 5EMJA 5K0LA 2PBFA 1BOOA 1I4WA 1D2CA 2ZFUA 2AN5A 1G60A 5LQCA 3KPVA 2CKDA 1UIRA 2IIPA 3LCUA 3DLCA 3GRUA 3VSEA 2E5WA 2ZVJA 3BUSA 5K0BA 2R3SA 4KIFA 1XDUA 4HH4A 1WZNA 4DZRA 5K09A 4RTKA 2Z6AA 3EVGA 4E2ZA 3GCZA 3R3HA 1FP1D 3A27A 4XUEA 3EEOA 2UZ4A 1KYZA 3M6VA 3BWBA 1RI5A 2JHCA 4WXHA 2P7IA 3PS9A 1WY7A 3GRRA 1SKMA 4AZVA 2NP7A 3LECA 5HIIA 5FADA 3DTNA 3LL7A 3KQPA 3NDIA 2OKCA 5EHGA 3T7TA 4DQ0A 2BH2A 4DCGA 3NWBA 3KQYA 2IGTA 2G70A 3SGLA 4EKIA 5DXJA 3BWMA 3UJ9A 4GC9A 1XXLA 1G8AA 5FWDA 3CVOA 3DLIA 1O9HA 2I9KA 2HMYB 2XYQA 2YX1A 4IWNA 3KHKA 4RYLA 1SVUA 5P8WA 2ZLBA 3UJ8A 4CTKA 2FPOA 1JQ3A 1TPYA 3LGAA 2P7HA 4C06A 3G2OA 5E8RA 5IKMA 1IXKA 5K0JA 3E7PA 5FA5A 2AR0A 3LKDA 2XYRA 4GUAA 1DUSA 3GXOA
chains in the Genus database with same CATH superfamily
4AULA 1CUBA 1RJGA 2XUGA 4GXQA 1MO3A 1E18A 4GC5A 3HU5A 2WTMA 3WXBA 1UBMS 4ESEA 5ICFA 4J3NA 6LDHA 2DSTA 3FXAA 3U62A 1IUPA 5COAA 1PZHA 5F98A 1ZH8A 3PUVA 4G9EA 1NBMD 1RQLA 1TVCA 3H5OA 1FB5A 3U0VA 3X0DA 1U2EA 1Z2CA 2XH8A 2J7PA 4TGLA 1E6LA 3RC2A 4DTIA 1R16A 1KJWA 2JIQA 2QKYA 1QIKA 1P0MA 3ILXA 1N9GA 2AYZA 2ATIA 1RI3A 1LD3A 1EJ2A 1CDOA 2QAGB 1QK5A 1OY1A 2OBBA 1CLUA 1D07A 1NJ6A 3A4MA 3FNIA 1C29B 2BMDA 4RQBA 3WGLA 4CKBB 3E5MA 4A27A 4G4GA 2XUZA 1KI8A 3IULA 3EZLA 5KNBA 5IM4A 2YMMA 3GLHA 2R11A 1W9MA 1NFQA 4G1MB 2WABA 1CW2B 1K5PA 3UOWA 4L3OA 1CYEA 2YZMA 2ZB4A 1V71A 5HMLA 3B7PA 1KWKA 2H59A 1XUOA 4F2DA 5FI3A 4X71A 1I3NA 3ZW9A 5AJTA 4DDTA 4B80A 1LPOA 1KI9A 2DWOA 2R8YA 2HO4A 1Q3HA 2AS0A 2CNWA 2FG7C 3BE6A 3EFOB 4IDAA 4AS3A 4WHMA 4AN1A 4MARA 2NXWA 2PZMA 4YRTA 4UCQA 3O90A 3NAMA 2CVFA 1ZD8A 3G9QA 4QRIA 2CFSA 4J91A 3EHEA 4D26A 1E89A 2QIPA 1R12A 1XT6A 4PPYA 4X94A 5K3AA 3KD2A 1QR2A 2MSKA 4XVUA 2RONA 3E70C 4P2BA 1F2UB 4GMFA 4W8GA 4P0QB 3IUBA 4LSMA 1EFRA 3FMVA 1YCHA 2R8OA 3EGCA 3WHPA 2P35A 5CLJA 4M60A 3I72A 1FFWA 2OGSA 4M1YA 4W9NA 2FP3A 1DUIA 2AOXA 2H1SA 2PLNA 2FR8A 2ZP1A 1LRJA 2O8BB 3FUTA 4REQB 1RCFA 1JEYB 1T13A 2YJNA 1QYCA 3HNPA 3K5WA 5JADA 5M34A 3LOUA 4RHUA 2BFEB 4G8CA 1R10A 4R5HA 1CT9A 4P81A 5DN9A 4PSCA 4RL4A 4EB0A 3ME5A 4JBWA 1PT8A 1J0EA 3F6RA 2JPDA 3N8NA 1NNUA 1RFGE 2XUQA 3ETHA 3EXIA 1LDGA 3IAUA 4N03A 4PLPA 1LBEA 2FYTA 1KE2A 4CU2A 2GYWA 3I9JA 1DAKA 4DAOA 2GK4A 4BVLA 2PRKA 3JQGB 5CAEA 1B42A 4ZRDA 3ASYA 5SYMA 4F86A 1Q0TA 3L8DA 3D7KA 2LGJA 3OOJA 2EW1A 3RS5A 2G6TA 4RQAA 1LI5A 1WDTA 2WM2A 2PK3A 1IVNA 3DCIA 5K1ZA 4R3UC 4BQIA 1R0YA 3UA3A 3DVAB 1XJ5A 5KSPA 2A5YB 2G4LA 4AJOA 5HOEA 5DK6A 1KA9H 1EZZA 1W0KA 1GGHA 5BQOA 4B8WA 3UJPA 3TB6A 2JBAA 3H65A 1SZDA 4KCGA 2PX4A 1GUAA 1SXJA 2Q4OA 1SPXA 2RGNC 3LBAA 1FSZA 2AZ4A 1QGOA 4FE7A 4PVDA 3H6GA 2GNPA 1A69A 1EDDA 3M6XA 3OU6A 3QH4A 7MHTA 3GYBA 4X1YB 2VDPB 5A5VA 5B58C 4BGVA 2JGEA 3HKCB 3W8DA 3H5WA 4UXIA 2XMRA 1MGPA 2QROA 4RUKA 3KKQA 5BRNA 1K0UA 1KFEB 1KK2A 2J7KA 1DKNA 4WXYB 5ILGA 4D0NA 4BIIA 4E3ZA 4A16A 4MWTA 2D06A 1I4EB 1QRUA 4U2DA 1AVTA 2VXBA 1E3QA 3EB9A 2PQ2A 4Y6RA 5A7HA 1XQYA 1ZCAA 1X77A 1GFIA 3DSRA 3OWHA 4HNVA 1S8NA 3T0IA 5HUJA 4RSHA 3FTDA 4QGSA 4HRYA 4YAWA 2J0SA 4WDRA 4GICA 4ZYZA 2IHUA 2HHCA 4UNQA 2FRDA 4P84A 3MJRA 4IQ8A 3I92A 2Y92A 3C98A 3PI6A 4CLRB 1P18A 1XTTA 4JLVA 4UFPA 4K8RB 2AJLI 2XE7A 5I7UA 4J1SA 1QCDA 1JB1A 1H6AA 4YUZA 1S3GA 1FX1A 2A9RA 2FU5C 3M6MD 1HURA 2RAUA 3I12A 3NNDA 4A10A 1QH8A 5DM0A 4Y18A 4GG1A 1GUZA 2BFCB 2PIAA 3AW9A 3O5AA 3OUUA 4XUGB 3U9LA 4Y2YA 2VPIA 3O8CA 1FTGA 2B82A 3R23A 3PX7A 3U3KA 2F90A 1OI2A 1XC7A 3ETJA 2GO1A 2V7XA 2VJQA 1J24A 3PFCA 4C4XA 3AF3A 4E5KA 1SOAA 3GLRA 2N46A 4U9IS 4I4IA 2ZJYA 1SCBA 4G0ZA 3KL2A 2C0CA 1BHO1 1JEEA 1P17A 1V0JA 4UTRA 3BDVA 4ZWNA 1YJ5A 4XWYA 4MKHA 1JIVA 4PSKA 2GRUA 3AR7A 3ITDA 4OK6A 1YZKA 4X24A 5ALFA 1YQDA 3DMDA 5EVCA 3VU9A 3BZUA 2ISSD 3C7KA 1D6JA 3ZIAA 2OD7A 4FKBA 3OHSX 1PQYA 1E6MA 1VG9B 4U39A 5HUQA 2RIRA 4UXHA 3CNOA 1H2FA 1NT2A 1XMVA 2GD1O 3KEFA 2A0UA 3LDUA 1F20A 3PHJA 4UDOA 2ZRJA 1M2WA 5FTJA 3FDZA 3BE5A 4KITB 2ZWAA 5BN4B 5F3WB 3TL6A 3K71B 1RM4A 3WLNA 4TL9A 4P1ZA 3THWB 4OYHA 1U8EA 3KZ1E 1USKA 5D86A 3WNZA 4O4IB 1QE0A 4BUJA 3WWDA 2ZQZA 1WMFA 4CTMA 1T2NA 2WM9B 4II2A 3ZOZA 3K4HA 2O1XA 3TQQA 3G0HA 2IIBA 2GLTA 3PXBA 2G3YA 3H1GA 3JZMA 1VYUA 1JMYA 2OB1A 4BO2A 2OCYC 1UXOA 1Y6JA 3FPFA 2ZUVA 3O73A 1JNXX 4YVFA 1W6UA 5AR1A 4GZMA 1RDFA 1H8EA 3HFRA 4IL5A 5DYWA 5I47A 2YZ2A 4QM6A 1B23P 4HGZA 5DBGA 4L6IA 1Y5IA 2IQIA 2WI8A 4RACA 2ZSUA 5K5EA 4NXMB 1ZOOA 5A5FA 2YXBA 3QV2A 2NTYC 4JUDX 4L28A 3VPDA 1GUFA 2AJ8A 5I45A 1P0CA 3CT4A 1TT5A 2R7KA 4FQ7A 2Q2QA 3SDZA 2B1GA 3MINB 3WQHA 1TJNA 4Q01A 1VSBA 3KPJA 5JLAA 4OQPA 1GLNA 5EE3A 5FYQA 3IT2A 1JFFA 3C7TA 4MUBA 3ZDDA 5DP2A 3G9TA 3Q1KA 3FPAA 3CKYA 4TTTS 1V7CA 1W88A 3EVEA 5C7LO 4YIHA 3CX4A 1E7QA 2X42A 3FUWA 3R9WA 4NECA 1Q1AA 4RY2A 4KH0A 1FDOA 2E18A 3LVQE 4URVR 3W5VA 2QM7A 1PRYA 2OMKA 3L4KA 3H2YA 2CD9A 3FPHA 4GSKA 2VPWA 1D2RA 3VRHA 3DHNA 4GAEA 1JTFA 4DIKA 1CERA 2LCFA 2UYCA 1AQIA 4UC0A 1PGJA 1S01A 4IG4A 1UT5A 5LL6P 3IV6A 1Z4LA 1EHIA 5DN6D 2GXSA 5L7YA 1RTKA 4M0CA 2GPTA 4NBRA 2D7CA 3ACBA 3E2MA 1EFKA 1U0BB 3HADA 2GQ0A 1U0GA 2Z4RA 1KAGA 3E3MA 3H2SA 4PLVA 5LZ7A 1OHHD 1RKVA 5E2BA 3CM0A 2JDID 2EP5A 3JD0A 4MJLA 4AMVA 5HKKA 2W8BB 3QWBA 1P77A 4GLFA 3TL3A 2ISQA 3PUIA 5HK9A 1FP4A 1BIFA 1Q20A 2XDWA 4WK0B 1WHSB 1G59A 4RK4A 1IRIA 1YRAA 1G1AA 3EX7C 1AIPA 1CF2O 1U8ZA 1WDWB 4L5YA 5HKOA 3I42A 4JP5A 4DGSA 4RIEA 2ORIA 2ZYVX 2ZBGA 5AKZA 1V25A 4OXXA 4OSEA 2WJWA 5TARA 1MTOA 2H11A 2XQIA 3HJNA 3TH5A 1C3XA 1COZA 2J0UA 3KAJA 3Q5EA 4UPDA 4DDKA 5HQ3A 4ON9A 4CM3A 3FX2A 3RFUA 2YBEA 5BNTA 3PCXA 2W6IA 3PNPA 3CUYA 1VECA 2R6R1 2YBDA 3H2BA 4PZPA 5BN5B 3ZXYA 4KDFA 2YJ4A 5BWCA 2XB6A 2HA5A 5MF6A 1VMDA 2WMNB 3JZFA 4LRQA 4B83A 2C7PA 4L8GA 1RZVA 3O03A 4Q18A 1T0UA 3X2SA 1X13A 5JIBA 1ISIA 1YRHA 2FEMA 5KWJA 4W5NA 4J0EA 5E9AA 2Z57A 3ZCPA 3TVYA 4EY4A 4C7OB 3EZXA 1T29A 1V1MB 3OF2A 2ZTMA 4QOIA 2B8WA 3CX8A 3DDOA 3MTQA 3QFHA 4ME6A 4MRMA 3U49A 4Q7KA 4DDMA 1AO0A 1JFVA 2FLWA 1DC3A 1DIRA 1NGSA 2A0FA 2VDJA 3FVVA 4LZWA 4PLGA 4OLHA 3SZUA 1YE5A 3DGFC 2O7QA 2FMHA 2H65A 5JDCC 5LBUA 4N5HX 4OAOA 4RHXA 4A4DA 4UXJA 1X7YB 3ZJ4A 4NHOA 3AETB 3KHTA 3JATB 4B71A 3VYTB 4TKVA 2CHQA 3V4SA 1O97D 4MS1A 4TS3A 4II7A 4ZAVA 3VDXA 4ZZ2A 4H16A 2XY4A 2XB9A 3K8ZA 2XXBA 5ALDA 1RLIA 3L07A 2QI9C 5C8DA 4PYLA 1EBUA 5A03A 2Q4EA 3D1VA 2J33A 1D1PA 4JEIA 3TW4A 3B1KA 2MR5A 3FYUA 3OZDA 3OIFA 4M54A 5EKDA 1P7WA 3WLOA 2YHBA 1CVLA 2OCAA 1WKCA 1SB8A 1B3BA 5FFMA 1U80A 4EAQA 4AJ4A 2QEQA 2ZYUX 4ID9A 4XYEA 1I3KA 4BFWA 1O87A 4ARAA 5B4UA 1LH0A 1NLUA 1TFUA 2VNIA 1GL3A 1Z22A 4KBFA 3HBMA 5EIFA 4PG4A 4H17A 1BW9A 4QU9A 1A2BA 5HF8A 1W35A 1RWOA 1GSAA 2CBGA 2V5AA 2VZ0A 3DR3A 3LA8A 2PBRA 5D7NA 2V65A 4B4OA 2WSLA 2E5FA 4JITA 1JKXA 5LBTA 4LF4B 5JBIA 1C1XB 3BWDD 3TLJA 4DLAA 4J1TC 4Q02A 4V24A 1NQAO 1GXSA 1XKXA 4YO8A 5BSTA 5KWEA 1EP1B 1SD1A 1QLHA 4LYHA 4HB3A 1I9GA 4E2FA 1N6NA 3E22B 5K45A 5F5XA 3GRKA 2P65A 3ENZA 3KR2A 1I3CA 1Y5RA 3CLUD 4Y0AA 3X1MA 2PUVA 2X8JA 3AFGA 1O9GA 1MO6A 2KB0A 4REMA 3RYIB 5AP9A 2A1UB 1RJEA 2ZRQA 1JR3D 4O29A 1BS1A 2G1KA 1XP5A 4K9RA 3R9XB 3KK0A 5I7VA 1ZR2A 3DUFA 3GUZA 3KT6A 1PWYE 4IDHA 2CBXA 5LLTA 4QNRA 1H5UA 3SQXA 3DHWC 5JCJA 2X7XA 4LIPD 4Q12A 2H63A 3MJSA 3EVFA 4ZVSA 1IHXA 1MEJA 1PWXA 5BSRA 4RS4A 3WV4A 2B9VA 4EK9A 2HJHA 3BFPA 5DPMA 3ZHQA 1HFEL 2W00A 1ZEJA 4U63A 4AB1A 2I3GA 2VA8A 4LRSB 2GEUA 3M6WA 2ZUFA 4NG4A 1JDTA 2J4FA 3BXZA 3JQ9C 4F5DA 3NYIA 2WTBA 1VCNA 2JI4A 2C5BA 4F71A 3VKHA 5BR1A 2P41A 2VJMA 4HDNB 3T35A 2XA1A 3S1AA 4RK7A 3FKJA 4NJEB 3D6HA 1I94B 3LTEA 1B93A 2DFNA 5CLLA 4HXFB 1NX9A 4NQRA 2Z1NA 3QBDA 2W6OA 1P60A 1WD7A 1VZ3A 2BMVA 2YWHA 3R3JA 4OFXA 5DNWA 3R75A 3SQWA 2W6QA 4GEKA 5IP5A 4Q3NA 3Q12A 5FUWA 5CMLA 2I03A 3V1NA 2XB2A 4XX1A 2NM0A 1YBFA 5IZCA 1BQ3A 3DLHA 2ODTX 3F7TA 3O82A 3ZEIA 1YFZA 1L7NA 3K30A 4CRWB 3LO5A 2E5WA 1E5QA 1UFQA 1XTUA 2OAGA 4P4SA 2GN9A 1UM9B 3HY3A 3ZHSA 3O3OB 4PO9A 1M8JA 2PMBA 4RVSA 1NUPA 3D2BA 2J6IA 2XCRB 3M6VA 2VYND 2RHOA 2Y71A 3B9BA 5B4VA 3K0CC 4R7TA 1X7ZA 4NNOA 3LFUA 1JLKA 4M0MA 4YROA 1S8AA 1JXAA 1MLDA 1ZXLA 3HMKA 1NXSA 1AZLA 2VO1A 2J3DA 2H7XA 1ISSA 2BDUA 4PSVA 6ADHA 3TIIA 4QUBA 5C51B 3BTVA 5NULA 4QYIA 2Y0DA 4Z9BA 3SKVA 3CF0A 4JUFA 3VVLA 4KXXA 2I22A 5J1TB 5AXAA 4DQKA 1SVUA 2PQMA 2QJTA 2NT4A 4YFVA 4DV2B 4RH3A 1ZGHA 2MSNA 5JWHA 4HB0A 3T9FA 3ZNNA 5L3QB 1LVGA 5K0JA 2PS3A 3UPUA 1YAJA 3FCSB 3H1TA 3LKDA 4Q6BA 4QFCA 2ECOA 4DQLA 4NEGA 3LW8A 1JU4A 5A9SA 3EVCA 3MRTA 3K6JA 3OT5A 1QF6A 1PDOA 4U2FA 4MV6A 4U7HA 1KFKB 1C7ZA 4Q4AA 1ZK3A 5DRYA 3VUFA 4LE2A 4WOBA 4LZNA 3FZQA 4FOTA 4Q82A 4GX0A 2OG1A 1ZCFA 1L5VA 3LGSA 1O6ZA 1NM5C 4NJOA 4YP5A 3I37X 4JJAA 3ADKA 1SC4A 4QRDA 1ZIDA 1P8AA 1SHUX 4ZEXA 2CV2A 3LCVB 3VPXA 1PJ8A 2OBFA 2YV5A 1VJDA 2A3NA 1RMTA 1XZMA 3OO0A 3G85A 3KALA 4JIGA 1SIOA 4JX9A 5BPFA 1WXQA 4ZVQA 5JSZB 1NX6A 1REQB 2Q1YA 2Q46A 4DVGA 4AUNA 1CU1A 1OUMA 2O1EA 3OA0A 4NVRA 1N7JA 3FUCA 1DKPA 3SICE 2Q1TA 2NUAA 3GCDA 1VCHA 2DKNA 2N3ZA 5AW6A 4FHCA 5ITZA 2MSEB 1A0OA 2P6NA 1I1OA 5CHYA 2E21A 4F38A 3LHIA 3HCEA 4PWZA 4W8HA 1BWRA 4PBRA 2J85A 7AT1A 2CE2X 2KBEA 2QU7A 5CX1B 1JZTA 3DV0B 4CDNA 7ABPA 3W5CA 3DTVD 2WZQA 1CIPA 2X76A 3OZRA 4FDVA 3GLFE 1L5OA 3IP5A 2H08A 4XTCS 3WAJA 2Y1OA 1ULBA 3CS3A 2P77A 4Z3DA 5E8JA 4AS1A 4FFLA 3BILA 4K5QA 2C4WA 3BJZA 2HT6A 2PU5A 3GFGA 4RKEA 3U3RA 1E0JA 4L7VA 3GGDA 3VDQA 3ZLTA 1ZBQA 1AU9A 3LXMA 3O1HB 1IBSA 5LYJF 5AH0A 1UQRA 2FV8A 2DG2A 3AWIA 2EW2A 3MS4A 2JRLA 3PQCA 3ZBUA 1XKTA 3CX7A 3V2IA 3NJ8A 3HWRA 3R5FA 2AZDA 1YQ9A 2EYUA 3AR4A 3IBSA 4NOJA 3OKCA 4U6SA 3L6OO 2I6FA 2ZETA 4ARBA 4L3VA 4UNRA 2IYWA 1XTKA 3H3JA 3NTQA 5EPOA 5TPZA 4P36A 4UM9B 1ADGA 4BVFA 1JALA 4PANA 2CJFA 1ZA1A 3MOSA 5AM5A 4I55F 1PFVA 1RCUA 2EYQA 3M3PA 4ZYVA 5BSGA 2QTRA 2OMEA 1IWOA 4J7XA 4URHA 4QT4A 1N34B 2QIOA 3UMMA 4P34A 3SVZA 4ISCA 4DIMA 3UB3A 4QU0A 4XKJA 1P7VA 1PGOA 1YZYA 2H4ZA 4O4JB 4BWFB 5CFLA 3BQMB 2VDWA 4MYCA 1SG6A 9GPBA 3UK2A 1N2CB 2QS9A 4C2UA 3QBTA 4FK8A 3A6PC 1FEZA 1Q44A 3EG9B 2C9ZA 3T34A 4YV2A 3JCZA 3MUFA 1L8XA 1OREA 4XM2A 4I4TB 3C8MA 2TS1A 3TLZA 4CEHA 5DM2A 1XZLA 5IVDA 1UZAA 1C30B 1IN6A 2FRVA 4PGHA 3DEKA 4AG3A 1T10A 4YDHB 2ONJA 2WIAA 3OCJA 4FM9A 4QPZA 1DMSA 3FLEA 3FAKA 1JEQB 3R6LA 4C6HA 4G4JA 3OZTA 4F12A 2OQVA 1XI2A 2RKWA 2QLJA 2XVMA 2GDJA 1UOOA 2Q1SA 3GBVA 4MYHA 4TZTA 3V46A 5L4SA 1JR4A 1UAGA 3PYXA 1PR5A 5KVQA 5ECYA 3CXRA 1P1BA 4B6GA 4BJ6A 2BFMA 3RSZA 1U2QA 1L7DA 3TI9A 4V03A 1RIFA 3D3KA 2XNHA 2A1IA 4MB6A 4L8WB 3RK1A 2JB9A 4PHFA 1NN3A 2O7NA 1DWPA 1RHJA 5JUWA 2G40A 4AZ0A 3AEYA 1VSVA 3WB9A 1H65A 3H9UA 4IOJA 5FOVA 4ZYWA 2NU8B 2RGRA 3V3KA 2JEYA 3WLPA 3TZKA 1R4NB 3BBLA 3D1JA 4OIFA 1X9GA 1VHQA 3RTDA 1C81A 2G76A 4LDQA 1UBTS 1IBLB 2V6IA 3KEMA 1XAIA 4WNYA 1HLFA 2YYAA 3SHOA 4WBNF 3GJ8A 3KQWA 2BP7B 1B00A 4G9BA 1T1RA 1TM2A 4MCAA 4QTTB 4TYQA 2QX8A 5EUQB 1L8OA 3KE9A 1H3NA 2BGMA 4V0ME 1Z5NA 3MVEA 2BSAA 4QBHA 3U3JA 5AIBA 1XCPA 4MQEB 1GV1A 2PGIA 2PD3A 4IIFA 4TYWA 3STHA 3VDNB 3ZXUB 3W7BA 3ZH9B 3BMNB 4D42A 4BEBA 5C81A 4K9OA 2O5RA 2EKLA 4FNAA 2BM0A 4Z1MD 1KPHA 3AOEC 3TLGB 1FNBA 1VE1A 4UZSA 2X8LA 1PEDA 2ZUTA 3SDSA 1IZ7A 4UMDA 4GYWA 3PGKA 1ZN8A 4JOBA 1ISGA 3H4IA 2PX8A 1WUHS 2A1TS 1LC0A 4PC1A 2PZAA 4XM1A 2C8LA 2QTMA 4UNNA 2GD6A 4JT8A 5EQFA 4ZIRB 3PC8C 1AB6A 2D4AA 3AHFA 3QVWA 1BVHA 2ZIVB 1B73A 1EK5A 1ELOA 2QN8A 2ZRIA 2FWIA 4POAA 4A8TA 3R4VA 4C5BA 4DBLC 1U2PA 1Y8CA 2YOGA 4NYJR 4DNQA 2YC2C 4ND7A 1X87A 2HCJB 1C3OA 4MQUA 3V4FA 1L1EA 4DB4A 4M7WA 4CLDA 4CMIA 2ZBRA 2YINC 3N8GA 4G41A 4P3KA 4AY5A 5FRDA 4KQ9A 1TD1A 3SYRA 2WF8A 3FWYA 2FW7A 5HFNA 4ZFNA 2QM8A 4EB6B 2Z9BA 4X8OA 2ENUA 4G0QA 3RFTA 1SQ5A 1EB8A 1SCDA 1UFOA 3KXPA 4HAOA 1BVYF 3WLEA 3C3DA 4N7BA 3MJHA 3AEUA 4L4YA 4OY3A 2P9HA 4FOOA 3WLKX 3NLLA 4MR9B 1XMQB 1JAZA 3A2LA 1BHJA 4P7GA 4CIBA 5JSQA 1ID1A 2W2PA 2GYUA 1TB4A 4AYXA 2YJGA 2C97A 8ATCA 1MDBA 3PNOA 2V6BA 3WDKA 5KYXA 1D1TA 3U80A 5LLDA 2ZZNA 1ONBA 2RH4A 5H68A 4EWLA 2NYUA 4C4YA 4BIMA 4LFBB 3LUAA 2F3QA 4HHEA 3EJ6A 1WW8A 5EPEA 4L78A 3IVXA 4TWRA 4NOKA 5K9ZA 2PXCA 4YJ2B 4XSVA 1SCNE 3GNSA 4S04A 1Q0ZA 2OQRA 3OJWA 4MUYA 4F91B 2RSLA 2EL7A 2FAXA 1NVDA 4PSUA 4BQPA 5CB4A 2XYHA 5FORA 3HV2A 2LKDA 2KQUA 1EK1A 3AL2A 1F8FA 4B48A 1Q11A 2B8NA 4QTXA 2HADA 1V8PA 3WNQA 3CRRA 1KDRA 3F67A 3FPBA 3OEYA 4K3UA 4HWOA 4ZT4A 1TLTA 1XCBA 4WNAA 4C6SA 3F90A 1D9XA 4FR0A 4LJ4A 3M5CA 1THZA 1DUVG 4MVJE 2P75A 2X8BA 3O31A 1YFLA 2NPOA 2VH2A 3EIEA 1AKWA 2H9AA 2DPMA 1RWQA 1UKVY 2YWCA 3WGHA 3L8GA 1F6BA 2YL2A 1XRMA 2NO6A 3CMCO 4TLLB 2WLTA 1TZMA 3T3EA 4HRAA 1M34E 1SG9A 2AXQA 3UY4A 3LQRA 1IBCA 3OQPA 3DPUA 1ULSA 2HDNB 1SD2A 2CY0A 1PJSA 2XB8A 3G0CA 4LSGA 3MCWA 5KYUB 1M9NA 1H22A 1QGAA 2G28A 2G08A 5FOWA 2EZ4A 3T52A 4D9GA 4DR4B 2PR2A 4N6NA 1CNEA 2HQRA 3KVOA 1WSDA 1CFZA 1U4OA 1LNQA 3VM6A 4M9QA 2ZBUA 3RRZA 3QU7A 5EKXA 2OCPA 3DPIA 1P7PA 1O9BA 2MYTA 4E88A 1JHZA 2C77A 4LHYA 2YHAA 4BNZA 2JW5A 2N1BA 3NWJA 2PDAA 2BGLA 5LA6A 1SOUA 1U1IA 4OHBA 4C01A 2P6RA 4IDGA 3ZHUA 3OJFA 1U2DA 2QDXA 3RFCA 2EHDA 2SICE 1NTRA 4YNBA 2BWJA 1PR9A 2CB9A 4K8OA 3MD9A 4F3NA 1IBKB 1MAUA 2ABWA 2Q0HA 4WZBE 5DYNA 1GKUB 2BFOA 2YQZA 2NZ8A 4JI7B 3BIFA 3ZTYA 4DQUA 2JHGA 4MRPA 4QFMA 5T4BA 1NR1A 3MMPA 1AV6A 3C3PA 3HYCA 1IN7A 1OW3B 1Z18A 3IHLA 9ATCA 5A0VA 2HEGA 3DEIA 5FH9A 3C3XA 2QLTA 1TMKA 4V2IA 3A0UA 4ZD6A 3EFHA 4CCSA 5ALHA 4OQZA 5EC8A 2ZIEA 1R3UA 4MV8A 3EHDA 4DBVO 2R751 3IFSA 3CJRA 4KGZA 3RHZA 2GM4A 4KTVE 3R8CA 4DJEC 2V7VA 1T1JA 1E1LA 3LUDA 5LB2A 3C7AA 3ORRA 4BTLA 2NO7A 1NJ1A 1YTLA 3CCBA 5F9FA 2I2CA 2AL7A 5EZYA 3OEED 3U48A 4NPAA 1TRHA 4IMPA 2OO5C 3L8FA 3NC0C 2IUTA 2Q0SA 3DE2X 4GQAA 2FW8A 3IMFA 4HDKB 4X84A 1XJ0A 4QYSA 2BTOA 1EEXB 1U5CA 1JHVA 2C92A 3R0VA 2VHVA 2GAFA 2QVLA 1JG3A 2AFHA 1NQOA 3DBHA 4G36A 5DNDA 4JLBA 2HNAA 5TRTA 3PHBE 3HUFA 5AUOB 3OM1A 3K0AA 2CVOA 3K3PA 4TVBA 2BEWB 1AUVA 2IOFK 2Q5LA 3G0GA 3NPMA 4KN8A 3E9MA 3OY7A 3T5TA 3T9EA 4CLOB 2HN9A 1SVOA 1QRRA 3IJEB 5IAJA 3VH2A 3WOVA 2AMFA 3TQHA 1V3TA 1V5FA 3ZLUA 4QPNA 4Z5XA 1W36B 2GBGA 2GGSA 2ZVDA 4DWWA 5K01A 5IX8A 5CBPA 4X8MA 1I2AA 4S05A 1HG0A 1RKQA 1E6UA 2F8LA 2PZLA 2CDNA 2UUBB 1CKEA 3DB1A 3L8CA 3IAS1 3PEFA 1V95A 3GZNA 3ZG6A 1ULAA 3ZX4A 3EMKA 3FRIA 4CV2A 2B5WA 2B7LA 1G8KA 1SC9A 3QVXA 3PA8A 5LQKA 4W7HA 2RC6A 3HCDA 4MP8A 2P1ZA 3HYLA 1SHKA 2FFAA 4FEYA 4MQLA 5BW4A 2Z08A 4GSYA 1T34A 1CIJA 3GAAA 2XTZA 1CP3A 5EHIA 3TI7A 1SY7A 1KU0A 3QLUA 4CBVA 5BNIA 3ZJUA 4RZ2A 3PKIA 2NSHA 1JEOA 2H4FA 2WWVD 4FFPA 1UPAA 3QXXA 3SQDA 3HFJA 1EAYA 4LYEA 3RVSA 4J43A 2F67A 2DVMA 1UBJS 5EUCA 2R5WA 3EE6A 1KY4A 2ERCA 1O57A 1KP2A 3FPGA 4IILA 5A5GA 4A3SA 5DI3B 5HE8A 3ESDA 4MVJF 1HDZA 5CYOA 3A4IA 1GTG1 4F5EA 1KI7A 2ZGVA 4U3JB 3SCZA 1PNRA 721PA 2V3WA 3FWZA 4QNNA 2JIDA 4L9WA 1P2GA 2O3RA 3EG5A 2YZNA 1VLHA 4N0MA 3NHKA 4HX5A 5GOTA 5EHXA 1WBDA 1E9AA 1AM4D 1WBJB 2FWNA 2JCXA 2O2SA 3IDOA 5LD2C 1E4EA 1QF7A 4BBAA 3MYRA 2W37A 2WUFA 1ADYA 2FMFA 8OHMA 4ZRNA 2JFFA 5TMPA 3T5AA 3VNUA 2MU1A 3KPUA 4YTEA 1TTPB 2O2ZA 3JYQA 4NCXA 3KKMA 5C34B 3TOZA 2FDXA 1T5IA 4WOPA 3GGJA 2RG7A 3DFFA 4UM8B 2C5FA 4OB8A 4LRWA 1Z35A 1UJ4A 4I19A 5FEMA 4JJGA 4YJHA 4CDGA 3PFIA 4DR2B 2IT1A 5F5NA 3QKWA 2OLKA 1TCUA 3PDHA 5A4AA 1NKVA 3VR0A 4MS3A 4PG6A 4II3A 3WTBA 1K98A 1YUMA 1Y4SA 2EWMA 3IRVA 4XRRA 3V00A 3IHKA 4M0EA 3OPXA 4M46A 4CL0A 2C2YA 4GVPA 4Q24A 5KKNB 3D81A 4L8FA 3NDRA 3GT4A 2A9JA 4KLNA 1U9IC 4MVJG 2JFQA 3K09C 4P5EA 4KR7A 4KYIB 3JQFA 1PNTA 1SQ0A 1WLYA 4C1NA 3PQDA 4YYZA 3QPVA 1T9DA 4FB5A 2UZ1B 3VSEA 1QHYA 3GRUA 4JYPA 5L95A 3QOFA 2R3SA 2F64A 3RYCA 4IZIA 2AEJA 3B6EA 4YAUA 1J6UA 1GFZA 1O6FA 1U7XA 2FZWA 2NU7B 1QCZA 1RM0A 4QUIA 1D4OA 4RWEA 4HZUA 2JFBA 3A27A 4XGQA 3OTWA 1WW2A 1P9RA 3LWNA 4FGLA 3ZXXA 2LUOA 3IAFA 3FAZA 3TEFA 2GHIA 3Q7SA 5B57C 1GA4A 1NUSA 4BX3A 1NLYA 5T4HA 3AP3A 3W2IA 3W9SA 3ZS8A 2FJPA 4KQIA 3WYFA 3ZW8A 3T1HB 4YACA 1AUPA 3A70A 1OJ7A 3DV2A 4B3HA 5I8WA 1FBTA 1JW9B 3ZU2A 5AKHA 2HQOA 5CW2A 3WHLA 1RZRD 4AKGA 1ZL0A 1PV4A 5LWQA 1EGHA 4Z0HO 1Y5MA 3DW3X 3OX1A 3JPYA 2ZCUA 2HRRA 4N41A 4CKWA 3UJ8A 1W47A 2ORYA 1NSTA 4MHOA 3NUGA 3TD2A 5IC5A 1T5DX 2HTFA 5EIEA 2Z4SA 3NOQA 1S9DA 1T6ZA 1YU9A 4HQ6A 4X6LA 3M6FA 2CLLB 3ODGA 4Q7EA 1FW8A 2QTTA 4FIZA 4JEHA 4PLWA 1D0SA 1L8QA 4YT5A 2Q50A 2ID8A 5DSZA 2ASVA 3ZK9A 3QPCA 4MYTA 3I3SR 2Z5GA 3CZ4A 4C0HA 1DXHA 3ICCA 1I10A 4AO7A 2JKVA 2QE7D 4WZAA 3VC1A 4DCJA 5CA1A 4LX8A 1Z6AA 4C30A 3MTBA 4TL7A 2IHKA 2CZQA 3REQA 2H5EA 4RM3A 1L9KA 3LYLA 5GQSA 5ADHA 2AOTB 2X2OA 1IBMB 3G1WA 1X9HA 3QMMA 2CXQA 1FDVA 3B36A 2JK0A 1C3EA 4PNPA 4AZSA 2P1DA 4JYBA 3I2HA 3K96A 3A7DA 2C82A 3ABIA 4RZIA 3TFWA 4GDFA 1VL8A 2AUMA 3VTAA 3RRJA 3WICA 5FUQA 2F1RA 2OCLA 4AZTA 2QAGA 3IUEA 3R0XA 4OFZA 3IO5A 2XBLA 4FBGA 3V2UA 1A76A 5K8LA 1OYOA 1UMDB 4CKBA 3OAAA 2P9QA 1T1EA 1QKKA 2O8CB 2EATA 4UUNA 2HSZA 3DNFA 4Y9TA 2GASA 3N53A 4C0QC 2XGGA 3G13A 2ZYSA 5LXTF 3RT9A 1FVXA 4JJFA 4ZYTA 5DTQA 4PGMA 1BJKA 4RIFA 4R71A 3V4ZA 3KT8A 3RS3A 3AJDA 1CG6A 2BF7A 4FMCB 4RMHA 1ZYUA 4G5GA 4UUBA 1CQPA 4Y9RA 5DLEA 2W43A 3WIEA 4FGUA 2C7QA 3R6GA 2CK3A 4YUYA 2ST1A 5BQXA 3EFOA 3ZVMA 1BVUA 1UXGA 5C5DA 2Q5QA 2PGAA 2O8DB 3S6JA 3LKVA 1HC7A 1PR6A 1YOVB 6REQB 4LY9A 4WSOA 5K99A 5EE0A 7MDHA 3L1JA 2FFBA 2PRZA 5D85A 3F3SA 4Y7CA 2NPFA 4Z7OB 3KSZO 4J0CA 1KWGA 3VBEA 3AF4A 1EM8B 2B3TA 3P96A 1TQ4A 4MTCA 4H1WA 2WA2A 1RQGA 3F2IA 1CJTC 2QPOA 1F2UA 5CM9C 1KIFA 3M7IA 3FKSD 1E96A 4MH0R 4X8HA 4DLZA 4YX9A 5BWLA 2RHTA 2Z2YA 3FPCA 5CFMA 3G0DA 4P7JA 2CB0A 3H9CA 2CEKA 5J9FA 2IIQA 5CGZA 4ZMRA 1WB6A 3KD3A 4KQHA 5DCUA 5FR2A 2O8BA 3NVDA 4REQA 3URKA 3VKVA 1JEYA 3T7EA 1P7YA 4FFMA 3KO8A 5M5BA 3R41A 2BFEA 3MFYA 2COEA 3OQVA 5C80A 4KBYA 2DRIA 2ODQA 3OOSA 2RHLA 3ESCA 3GH1A 4FFWA 5JFTA 4L76A 3RANA 3MHPA 2QL6A 4UKDA 4UTVA 4EJSC 1ZH6A 3O2JA 1EGAA 2C3MA 1ZONA 3S29A 3JQGA 3HVKA 4G1CA 4BNDA 1MG0A 2D2XA 3NGXA 3O8NA 1JQJC 3S1LA 1VKNA 1ZJJA 1BQ4A 4BKUA 1EH5A 1PK9A 4HRVA 3G2LA 1XKQA 4QE3A 1QP0A 1HDEA 3G9XA 3DVAA 1YA6A 1XU4A 2CNOA 1FNCA 2XKBA 1ISPA 2FN9A 4MUMA 4X20B 5B3AA 3RUIA 5K8CA 1Y33E 4JFAA 5A4DA 4Q4HA 2VT6A 3GFFA 1T36B 3IE1A 2PMKA 3R6DA 1JSCA 3LXUX 1SZJG 1SHZA 4RYDA 4D8WA 1X1EA 5FPHA 4FI3C 1N5KA 4DSZA 1HZZA 2C04A 3EPJA 3A4VA 3LMKA 4X1YA 1AT1A 4D5GA 1BMQA 1M73E 1GZ5A 4XCXA 4LC1A 4H60A 2JZOA 3TO5A 2J5XA 2JFGA 4OP1A 3AJ8A 2I3AA 1Y81A 3ISJA 2WUEA 3B89A 1LRKA 4JLPA 3A1FA 1S7CA 4M98A 4OD0A 4TXMA 3WLMA 5J2TB 5EIHA 4IXNA 3F97A 4IOLA 5BOSB 3EXG1 4NYMR 3E61A 3HCWA 1T1GA 2QBYB 3FCXA 4N3NA 1DC5A 1I8TA 2OP1A 4O63O 3UT5A 2BTEA 3TG2A 3FF4A 1L1RA 2RARA 2VA9A 3SEFA 2JIZD 3ZWPA 1Y8ZA 3V8PA 1V5IA 1EYZA 2PVPA 2ISCA 2NXEA 3K1JA 1G291 4NKRA 1BFUA 1N1DA 1U6JA 2DY1A 1Q74A 2VP6A 3GEGA 3PK0A 2GEDA 1WG8A 3KTOA 4YUWA 1B4DA 1T25A 4MUXA 4GU5A 4OV6B 2JAXA 4CLRA 1VIAA 5ADUS 3QVOA 1C9DB 4F85A 4P8RA 2IYLD 4U6NA 3HJHA 4XRGA 1U0EA 4FFSA 4K9KA 4RMIA 4X00A 3TEJA 5LN1A 16PKA 1A8IA 3CCFA 4DV7B 3HUUA 3V7UA 5JT1A 2BFCA 1L7BA 3AUAA 3NYWA 1U0TA 1DBRA 3GLGE 1KO7A 2P6MA 1RPNA 3LYHA 2QTWB 2A8YA 4CM9D 2RE8A 2HO5A 3CNLA 3COZA 1P29A 4PQYA 3WGMA 4X62B 3CPSA 3EXFA 1JX6A 5CYPA 4I46A 2RK3A 2O2DA 5D2CA 1Q95A 4ZCIA 1V45E 2HCBA 3GCWA 2ZPAA 1Y6ZA 3OJOA 4Q9AA 1DIAA 4U7TB 2OXEA 2VDRB 4QD3A 3D8NA 3KSDO 4DKXA 1ICEA 4N8DA 1I1NA 1XYYA 4LJ7A 2JA2A 3IQZA 5TS3A 1AY0A 3NRCA 5K8UA 1XRSB 1OXXK 2FPUA 2Q9CA 2SKDA 2Z5FA 5GMOA 3KDAA 2QT0A 3JVEA 5IT0A 2IUSA 5JQGA 1VLLA 2WD7B 1G1MA 2DQ4A 4GX1A 4H9GA 1CQWA 1YZNA 3HN6A 3HPRA 3JD4A 3NUZA 4KFRA 1E79D 1H2WA 3MW8A 2XDAA 5J63A 3SKYA 1U9YA 4GOKA 1Q57A 2C2WA 2IYYA 4JP3A 4FZVA 5CT5A 4B2LA 1OOEA 1ZFNA 1BNCA 1F1BA 2HMVA 4GI7A 3RSQA 3PITA 1DZIA 4ILEA 5BN4A 1L2TA 2WA1A 3H1FA 4GWGA 4EYQA 5HW0A 2EQ5A 3K2IA 3WL8A 3THWA 1J8YF 4RA6B 3RRFA 4O4IA 4Q4DA 4I36A 4E1AA 2DR2A 1I3LA 1E94E 1AHNA 4NS4A 5CXQA 3HKEB 1MAAA 4E09A 4BGEA 3VX4A 3C3MA 2NZYA 4BV9A 2NTVA 4UREA 2LDBA 4FGZA 5EZSA 3DULA 1OSNA 2HSGA 5E9QA 5DM1A 3TLEA 3UCEA 3B9PA 1JHQA 2GA9A 3L7NA 1JIJA 2EG9A 4S1TA 5IAGA 3UAOA 1A77A 1P75A 1PQUA 4EMSA 2YJ5A 1EE1A 3LUBA 3PKJA 1TT7A 2F1OA 1K6MA 2Q6TA 1HDGO 1WXDA 5FPTA 2RGYA 1WXXA 5T6BA 4GT1A 3TZCA 2Z4TA 3M49A 4Z1OA 4WX2B 4OHOA 4OH7A 1D8AA 2ZWOA 2Y2UA 3MQFA 4FFNA 3SHFA 3ZWXA 4N0DA 3GC6A 2XTJA 3MINA 4MK4A 4MPDA 3JVIA 4I14A 1XHEA 2C03A 4MWEA 4UM7A 4C3OB 3L40A 4QG3A 2B7BA 1W49A 5C3UA 1LNZA 4LXIA 1P5HA 4KE8A 4EUEA 5MGBA 4Z99A 3ZNQA 2KWIA 4ZAWA 4ER7A 2VJAA 5DYYA 3DTVA 2NVUB 4GBED 1W1IA 3KOMA 4LJ5A 3PEEA 3CZAA 3L7KA 4X93A 1ZC4A 5I4KA 3A1SA 5F3RA 3U7FB 4BPBA 4YUVA 3K6SB 3NFRA 2FF7A 4EB3A 2CHGA 4WECA 5AW0A 4YRQA 5LDHA 1O5OA 4UHBA 3SZRA 1UQUA 3EGVA 2QE6A 4YJFB 4XE5A 1G17A 4RJ2A 1XEFA 5BQ3A 2X9LA 1T2FA 2BGRA 1L5FA 1LPSA 1PNVA 3P32A 1T35A 3K94A 4PONA 3UJ3X 4BKRA 2IYPA 3HNRA 3NR2A 3ORYA 1CETA 3Q0IA 3DHYA 2L82A 3FI9A 1OVMA 2NGRA 4RD2A 2XE4A 4G2NA 2RH5A 1EIZA 3HJTA 3S44A 1PJ3A 3O2SB 4HB4A 4S1WA 3TNFA 4OX9Y 1N32B 1V3UA 1XALA 2W8BA 2QW1A 3VR6H 1OU4A 1WHSA 2IODA 2RFLA 1RWBA 4LJ8A 4DCOA 4RXUA 2XOKD 3AU8A 1ULUA 5DSXA 3PR2B 4XIJA 4XYMA 3MB5A 1CB0A 5AVWA 3OKAA 5ER6A 4CG1A 5ALEA 1ZGCA 3SSMA 2W6NA 3CUSA 1M2KA 4RELA 3DFMA 4IQFA 4AECA 5EHNA 1XGKA 3KDSE 5MN6A 3LBFA 1XV5A 4OOEA 2Z09A 3DYBA 4I50F 2ZJZA 3BTUA 4I5EA 4K1LA 2CXHA 1UMCB 3ABOB 5BN5A 3GWZA 2JGFA 2ZI3A 4ZOLF 1URPA 1JECA 2NYVA 5FTWA 1LCIA 3SG0A 4C87A 3QX3A 1U3TA 3OJLA 2XMSA 1OZ0A 4DIOA 4Q9JA 4EX6A 4C7OA 4Z0PA 3UCXA 1V1MA 3KU1A 5AKKA 4DV4B 5E1DA 1JHXA 5HS6A 1RBMA 4XR9A 3LLMA 1DC8A 3SNKA 3U31A 1XTPA 4NE7A 1T8PA 4AQYB 3BCRA 1CQZA 2G04A 4OEHA 4RHFA 4ATNA 1E66A 4KK4A 5HJ5A 1CZOA 2Q8NA 1PBTA 3RPEA 3E58A 2ZIAA 2V58A 3QEOA 4WLUA 5KMGB 2EF0A 1X7YA 5LMZA 4W6ZA 3AETA 1IIBA 1PNOA 1UANA 3DMNA 3ZE2B 4CI0B 4DYHA 5HKBA 3EIFA 1N6PA 3JATA 4EYGA 1QO0A 5TQ2A 2I9PA 1KC3A 1XKLA 2JGKA 1T26A 3H1PA 3SZOA 3WKEA 1Z15A 3PNBA 1UWVA 3D6MA 3I0MA 5DBIA 1RKUA 1TXGA 2WVGA 1U3UA 1YZFA 2NW6A 1W75A 2X3YA 1CRLA 3QYAA 4QPDA 3RLIA 4DMKA 1N1MA 2B61A 1XZQA 2DR3A 5NLLA 2ZRMA 4A15A 1CEXA 2QRPA 1P1RA 1W29A 2NU6B 1POXA 4F92B 3VZCA 3EFBA 1FXUA 4JDUA 2JGJA 2IEAA 5TEVA 3UFBA 4ZK6A 3EBLA 3DM5A 2WKQA 1RXEA 2MTBA 2X6QA 3B3GA 1QCYA 2FX3A 3YASA 3P2YA 4EMUA 1CUHA 2IXFA 4WLOA 1P44A 1NP7A 4WOJA 5FYDA 1VKHA 2P5TB 3T4PA 4DLLA 3C3AA 1RQRA 1RAEA 1H23A 1ODIA 2KM1A 2WHPB 3A11A 4OLFA 5LB4A 3L0ZA 4KFCA 5HSGA 2X0DA 1X6VA 2Q6LA 1IOZA 1VRCA 3IAHA 5GV8A 1K06A 1SCJA 1M1YE 2BHSA 2HRDA 1C1XA 3N2EA 4L07A 4N6GA 4Y2JA 1A8UA 5T67A 1C4OA 1A2KC 1DKOA 1G5QA 2ZPUA 3IV9A 4LJSA 2PT7A 4TM8A 4RLQA 1U1DA 2YUTA 3HCRA 4BJ1A 1SQ6A 2HU5A 2VSYA 2OGTA 5B7GA 3Q8XB 1YIOA 1Z8FA 2XWPA 4Z9FA 3E22A 1LK5A 1TEZA 2APJA 4ZT7A 2EKBA 5AQEA 1TFRA 2GRJA 1GRCA 1Z83A 3DEJA 4ER5A 1U1CA 2C4NA 2UUOA 4B3GA 3KAPA 1YS2X 3MZ0A 4RJKA 3F9CA 1O4WA 2CXPA 3MN1A 3OZXA 3RYIA 3G9UA 3UQYS 1PP4A 2KS6A 2OHFA 4NH4A 3ZYCA 5FLXA 4JNKA 1OYWA 1GAXA 2HPZA 2JL1A 4UBOA 4FDMA 1IZYA 1A9ZA 2ZJ0A 4B7XA 4G85A 2ZCJA 1MABB 3MPUA 1YV9A 4QX6A 3F8TA 2RBKA 3N0RA 1KSJA 1GZSA 3MIZA 3HY6A 4KG7A 5CLGA 1SMKA 1XZIA 4W1QA 1DKMA 5FPQA 2ZG6A 1Z29A 5D5QA 2V96A 3V48A 2AHRA 1TCVA 4J0GA 4X54A 1D5WA 1QHSA 5CLIA 3ZHVA 4BN0A 2QL7A 2YH2A 4L08A 2EHJA 4NDAA 2PEZA 3U7IA 1JN0A 4GE0A 2ZJ4A 1UBEA 3D6FA 1QFSA 4J4HA 3GP5A 5ESDA 4ZYYA 4YV7A 3SQNA 1I4WA 3AKEA 4BP9A 2QVGA 2P4UA 3FIUA 1M2HA 3KZXA 4HDNA 3W5JA 4H1VA 4EGSA 3LCUA 1XTRA 3M34A 1COWD 4NJEA 1QTNA 3JAKA 3OFSA 4V39A 3UC5A 4F9EA 5DEOA 1Y1RA 3P9YA 4A2PA 3P0EA 4OLBA 2DLNA 3ET4A 3I23A 5HJ2A 4KQFA 5B3LA 3HC7A 2BMJA 1WDMA 1U0OC 2E49A 4G1VA 1QZ3A 4HD8A 1KDZA 2XSZD 4PRZA 2WU0A 3AGPA 1RI5A 3CVUA 2NNLD 3L1UA 3W34A 4EY8A 3B1YA 4JHLA 5B55A 2QMYA 5JI3E 5KTPA 3GNQA 4AY4A 1KEKA 1HDRA 1Q2UA 1UM9A 4JS0A 4LVUA 1F8XA 2Q28A 2QV0A 3EZYA 1OH5A 2F8MA 4QDZA 3I8OA 1DRWA 1V5EA 4Y6OA 4DY4A 4JU8A 5FI5A 2OK8A 3UFXB 1QBKC 3C5WP 3WRYC 3OM0A 3EIUA 5C32A 1M66A 1KAMA 4KN9S 4UU1A 3RYTC 1OIXA 3ANMA 4G86A 3S40A 4N54A 4MKZA 1G66A 1U2GC 1ZKMA 3COWA 3T4UA 4W6QA 4DLPA 2DTDA 4BMYA 1PG5A 3BFXA 3IL2A 4LDAA 4C06A 4ZQBA 3G2OA 5E8RA 2YNMA 2Z3WA 3AHEA 4Y2XA 1PVVA 1GADO 1S2GA 1UL1X 2AJDA 1TMGE 4C5CA 1QIFA 4YMLA 3SFVA 1L4HA 2VR1A 2REBA 2OB2A 2FW6A 2IOYA 3LDFA 4DEVA 4LHSA 4NOMA 5TX7A 1K86A 4Q3KA 4RD4A 5EVJA 1SURA 2CV0A 3IIEA 2GS9A 1KYIA 5L3QA 1NBIA 5JWOA 3FWNA 2RHBA 3VJMA 3SS8A 4IZHA 1W4BA 2PX2A 2O8NA 1MV8A 3MD0A 4KL8S 4NY1A 4D46A 1VCOA 1UC4B 1R5BA 3VU3A 4X44A 5LP6B 4PQRA 5JJIA 4N18A 1QAOA 1C3LA 3AV3A 3E8XA 1MTZA 3ELDA 4MRNA 1ZU5A 2QVCA 1GD1O 2NZJA 1SO8A 3MAGA 1QYWA 4ITVA 2QW0X 1CC1S 2PGDA 5K2MA 5TQJA 4CFSA 4KGDA 2EFGA 5GIPE 5G0UA 1UMBB 4D9FA 4LN1A 4BFLA 1E0SA 1FMCA 4PO8A 4FGSA 1K4KA 4QDOA 1G2PA 3K0FB 4MPPA 2DQZA 1N5JA 1OAOA 3DWEX 4TTPA 3OQIB 4X95A 1P5JA 4QREA 3N74A 2IA5A 4FMPA 3ZNOA 4RA9B 5KINB 4G4IA 1HQYE 2WJJA 2IZ1A 2PLFA 5JSZA 1PWHA 1REQA 1EBFA 2EW8A 4ZZ0A 4O0MA 3PXEA 1N5IA 3L0PA 2HIGA 3LT5A 4HQFA 2HFJA 1SBCA 2XA2A 4KQXA 4M89A 2XMDA 4NZMA 4WBSA 3KBOA 2A88A 1BGVA 2P9TA 3GY0A 3K2BA 4IJ5A 4Y9SA 1A2OA 4P35A 2AUTA 1CDEA 4US1R 4ZC8A 3UUGA 4BTEA 3OEEA 4LRTB 2IGBA 3QVVA 3NIDB 3ZVRA 1CR1A 4Q9LA 1YC5A 3X2EA 2PUDA 1O95C 3HI6A 5DX0A 5CX1A 1EEHA 2QUHA 4BVGA 3NGLA 3Q3VA 4ZCPA 3VDMA 4ZVRA 5DCLA 2X3UA 4HEA1 3ABZA 2RGWA 3OY2A 1RJ9A 4U7WA 3QQ5A 4AY3A 3BS4A 2ZJ1A 4X41A 3T9AA 4Q7JB 3IMKA 5EEGA 1O7JA 1RIIA 2YRXA 3FHTA 1DJPA 2Q3EA 2W2LA 3T0FA 13PKA 1AMOA 1SD5A 4E03A 5EE1A 3ZY4A 3NHLA 1E1CA 2DTEA 1NG1A 3F8WA 3IEVA 4FGJA 1AC5A 1ZRHA 4HDQB 1QQBA 4I2VA 4H18A 1OAAA 3JAWB 3WSTA 4B79A 5LLSA 4OVKA 4U02A 4JXXA 2OD9A 3LPMA 4LI0A 4LGVA 4ZT2A 5FIUA 5C9ZA 2Q9UA 3GRZA 1PYGA 1ZD9A 1IOLA 3O8DA 1SUIA 2RKOA 3IR7A 3UC9A 3VR4H 2V54A 2QYOA 2GWRA 1KMHB 2AYXA 2QMOA 2RG1A 2NQTA 1R8XA 3ECAA 4MA5A 1PLJA 3KB2A 4MUAA 4RK1A 5AW9A 3RRXA 1XD8A 4NF2A 1SU8A 4ZT5A 1QJ4A 2XCSB 2AQ8A 2DSNA 1BD3A 2WINI 3GUYA 4JQCA 1ATZA 2Q6IA 3PNKA 3WQBA 4DTCA 1C80A 4QQ8A 3WB0A 1P8JA 4R83A 1CDZA 1KK0A 1CR6A 1XWWA 4HAVA 4I0WB 1WXHA 4PFKA 4P80A 3ITNA 3X1KA 4EPVA 1E7SA 4O4JA 4PVCA 1Z16A 3E9ZA 3M5PA 221PA 1GRVA 1N2CA 1EI9A 1GGFA 1I30A 2A9PA 2FKAA 2GN1A 4FD2A 1RHUA 1Y3CE 1PEAA 3E9NA 2AXPA 4I4TA 3FWKA 3NAQA 2BH9A 1Y1KE 3CF6R 3G59A 4IRXA 5C52B 3UMYA 2WYIA 4DMLA 1Q0UA 1Z7BA 1C30A 4BYMA 3JQDA 5F2KA 3INTA 3SR0A 2GHRA 4KMRA 3IOBA 2NXCA 1BX1A 1O94A 1NNSA 2PZBA 2AC4A 4P98A 1W46A 3VU1A 1JEQA 3I28A 4D92A 4DR3B 4MPTA 3ORFA 1SBZA 4YCJA 5T8KA 1P2TA 2WUVA 4AKEA 2BTQB 1SUFA 1ZZGA 2OLEA 4G0YA 4KFUA 4UTZA 3RV3A 1GQYA 1AKEA 1W8IA 3ESYA 1WP9A 2QYHA 4FYJA 4EF5A 3ADCA 1GTSA 3D59A 3LOQA 4LSZA 3LCRA 3U4CA 1UKYA 2B34A 3SMVA 4OCZA 5CLHA 1U0RA 5JS6A 3AESB 1KQPA 2BFDA 4IM7A 4AN0A 2D3WA 3AI3A 4LC0A 1Z12A 4KUEA 4NHEA 4Q16A 1UDWA 3BCSA 3H84A 1RI1A 1APBA 1HLPA 1K27A 2UDPA 3IUNA 1YC2A 3MCZA 3AI2A 3TLAA 1G7RA 1R0KA 1D3AA 3A6DA 4HLDA 3IXQA 1R1DA 2XIQA 3NKFA 2ZVPX 1R4NA 2O2EA 4FSHA 4G37A 3ORSA 2MSCB 2GMWA 5JG7A 1M7HA 2D0DA 1C1YA 1IAQA 2AK2A 4TVSA 2BP7A 4JJ6A 2JFZA 3B9QA 4JUCA 3UMSA 5I8PA 1LSJA 1NMEA 3P7MA 4M1EA 4C0JA 4HQNA 4NAVA 5EIWA 4BO0A 4AROA 3FZNA 2BKVA 3WV5A 4MQEA 4JWTA 2IFTA 4AMZA 3D6VA 4DUYB 1K97A 4A26A 2MMGA 3WX0A 2I3ZA 2ZIZA 1EFVA 1J97A 1LZKA 1Q1NA 1L7RA 3EOAI 5AKGA 3TLGA 2EGUA 1OZFA 4XDYA 4KPFC 3K72B 4A2QA 3DHEA 5JD3A 2X0JA 4MVJP 1MO5A 2FEOA 3R4CA 2ZJBA 4PS1A 4TUYB 2GT1A 3NIGB 3Q1LA 2Q9AA 3LQ4A 4G0VA 5CDGA 1RPAA 4ZIRA 1RZRA 3C24A 1EVQA 1CK4A 3TJZA 4ES6A 1CEEA 1HPLA 1U65A 2VP2A 2WF5A 3O4FA 1JG2A 1O95D 2I29A 1JDJA 3M4YA 4J9UE 4EO9A 2OM6A 3KR9A 1A97A 2JLSA 4S1OA 4NCJA 5ECGC 3BHIA 3MUOA 3JQRA 4FYWA 4UFOA 4XI9A 2WYVA 1EFPB 1UCFA 1Q7EA 3M6UA 3R77A 2XZDA 3PJEA 2V7BA 1UH5A 3BB1A 6CHYA 2JJ2A 2O05A 3TZHA 1NUUA 2CWDA 4EB6A 2P3SA 1C1DA 1K6XA 3RCBA 2WWHA 3SE0A 5LDDC 5CEFA 1I6KA 3F46A 1S3IA 5IDVA 3NI2A 2JD0A 4JR0A 4NX2A 2B4YA 4BO9A 5I48A 1T8SA 1G8JA 1TC2A 4MR9A 4YT4A 4JI2B 1XLTC 1L8LA 2XEXA 4KIJA 4PYJA 2QY6A 1AZWA 1YI0A 1Y37A 1TNDA 2P6UA 4KPYA 3MUEA 1NVAA 4WTOA 4DLSA 3LE8A 1MCZA 4IDPA 1AF4A 1FXSA 3KNZA 4FNOA 5ESXA 2CLFB 5JNUA 3UW1A 2QGZA 4MV4A 1H9CA 5FLKA 3AMVA 4HJXA 5HJ7A 2ZI7A 4LNHA 4RXTA 1IMOA 3Q7TA 1Z7EA 3A4TA 4O5AA 1ZXBA 3I9KA 4R8KA 1DFGA 2CF6A 1DWOA 1IDN1 1SB9A 1A3CA 1WQ1R 2GBIA 3A05A 3OZCA 3U26A 4R0MA 5JCOC 1N25A 4BNIA 1XVTA 5EIXA 2ZXUA 2A5LA 1KJYA 4MW9A 2C95A 5FHRA 2AB0A 3ROTA 4YJ2A 4YDRA 3I6IA 5B3JA 3ONFA 4DJ5X 1LBSA 3CCCA 3MQ4A 5JRJA 1G4HA 3W7VA 1H1TA 2H0AA 4UZEA 2D00A 3O1IC 1EJBA 1PX2A 4O33A 5H3HA 3RVDA 1X1AA 4BLUA 1T8WA 2NZ2A 4DM4A 1J0DA 2J31A 3LW7A 3SN6A 2P4SA 3NKLA 4S2UA 4TTJA 3RQIA 5FBHA 1YWGO 2IKSA 4HT3B 5CFNA 1H3FA 4K87A 1SWVA 2O3JA 1B14A 2JC3A 2ZR9A 3CBQA 4CXMA 1TZKA 3KLPX 3NETA 3DWFA 1WB4A 3QLTA 4YQFA 5B7NA 1RRVA 2BKLA 4BNFA 5B12A 1OROA 1IC6A 2RGDA 3GJ7A 3GLTA 1NXOA 5KQLA 5BMOA 1YVUA 5FL7D 5ARBA 4IICA 4F4IA 4A2CA 2EXXA 3CISA 2FVXA 5AT1A 3UAYA 3V9PA 5LU8A 1VRVA 5AHRA 1YQGA 3JWJA 2Q3CA 2LV8A 3DOJA 3Q85A 5LKRA 1NBAA 5KYUA 4ERXA 1M7GA 1R64A 2ZITA 3B6KA 4CMGA 2OBXA 4KRGA 2I67A 1XF9A 4LBVA 4EF4A 1PI3A 5FJIA 2BGUA 3GZTB 3RIHA 5GINE 1EHCA 3DEFA 3FKSA 1VIDA 5KYNA 1KGSA 4I9UA 4YJ3B 1JDVA 1MENA 1WUKS 1AHHA 5DLYA 3ROQA 1ZN7A 2QUAA 4ZXFA 2BCEA 2J07A 2ZAGA 4HDRB 4K1XA 3KYDB 1SZCA 3KYCB 5C46F 3WSVA 4G5XA 2XUHA 1RKXA 3M0EA 3O7WA 4B3SB 1ENZA 3KQHA 5KAPA 3RIMA 1NG9A 3FMFA 3E82A 1E2JA 3H5AA 2W6JA 4YAFA 4YAIA 1K8YB 3W6OA 4NSNA 4YLGA 5IDYA 1KBZA 4EHAA 5HHTA 3FOZA 3L92A 2QVBA 3BGSA 3LYUA 3WK8A 2X0KA 4CEJB 4LVNA 4WJZA 2B8TA 3OM8A 1WEHA 4DEYA 2LCQA 1P62B 5EP4A 2OQ2A 1GAEO 5BSEA 1NN1A 1KDTA 4L51A 3PR3A 2FE4A 1WXEA 2G5PA 5JH7A 4C21A 2UYOA 3AB7A 5THKA 4CV0A 1W96A 4PZCA 4S0XA 3TDNA 1HNXB 2QPLA 2P78A 2W11A 3VNBA 3HPQA 4D3XA 2BEVB 5TC4A 5E2IA 5B1IA 3OEHD 3RSLA 2J5KA 5TJHA 3ZBTA 4FYXA 3QOWA 4JBLA 4R98A 3FCUB 4ND8B 4ER6A 3WIDA 4RCYA 1YR2A 2PSSA 2D5AA 2D5IA 1WHTB 2HJGA 4FGWA 4OBXA 1MH1A 1LC3A 2GCGA 2Z2ZA 3GEEA 3UAZA 4A6PA 1YD7A 1RKBA 2AWNA 2E48A 3GGSA 3NVAA 3SS9X 3VHXA 5L3RA 3KHUA 1EWQA 5F51A 4R8VA 1B1CA 1YRLA 1VGRA 2LBPA 3N87A 1X2EA 2E9SA 1AZSC 4HDKA 4B4VA 4DM3A 2HA2A 4OHZA 4Y2TA 2EGHA 4G5HA 3E05A 5E6SB 2DM6A 2VT2A 2DFPA 1IATA 1EMDA 4R1SA 4IW3B 2RGXA 5FBRB 3DR5A 1QF9A 4FHGA 5FP0A 4PBSA 4EA7A 4OGGA 1KJQA 2Q2NA 2HKIA 3IESA 4BB6A 1FMFA 3I58A 4GQBA 3QUQA 4DRYA 4PC2A 2WHRA 4QXRA 2GD0A 1WE2A 2XIJA 3S1SA 1NZJA 3I9V1 3GZ4A 2HU7A 2FFRA 5LC1A 4DLBA 2OFXA 3SJAA 2YDXA 4DCTA 1VCMA 5DE3A 3C5VA 1PCXA 2AG8A 4MIYA 5JMWA 3L1KA 3GDHA 2WJPA 2R00C 5BRAA 1Z5WA 3RROA 1QCCA 2D3TA 4K28A 3TLXA 4KO3S 1BDMA 3MWKA 3IX7A 3UWMA 3W6PA 3HNOA 4HBGA 1G6OA 1LLFA 3BX1A 1H2AS 2XLCA 3MMZA 5HUHA 1KVRA 1LS6A 4GM0A 1RZUA 5HCIA 1P5FA 3B3AA 3H17A 2OBNA 4WFJA 2JG3A 1RVDA 1R4ZA 2Q5HA 4BVBA 5EP2A 5CDHA 3HK2A 3DLBA 5F1OA 1MXFA 3WGOA 3GRPA 1CZNA 3QE3A 4N9WA 1H0HA 1XBTA 3M1IA 4QFBA 3WGKA 4M86A 3V7YA 3LQFA 4HYQA 3ZCRA 4ZGGA 2GI4A 5LU9A 5DI3A 1F9EA 4N48A 3KWJA 1PR4A 1VL0A 4CIDA 2DFKB 4AW9A 4U3JA 3ZC3A 3ROMA 1BWPA 1NFRA 4ZA2A 3H99A 1KY5A 4AX8A 2VTKA 3GHHA 3QZUA 3W2FA 1RM5A 4S1VA 1DDIA 1O6CA 4CQNA 1N5LA 1OC2A 1A1SA 3HCCA 2Q0QA 2G36A 5HOQA 3DJYA 3ZE7A 2D59A 2JEZA 1ZM3A 1IB0A 4ZANA 2PXHA 3MGAA 4YA6A 3NCHA 2SBTA 5JYBA 3DXZA 1ITZA 4IFIA 1Z2PX 2DULA 2JI6A 4UARA 4I6GA 3TIXB 3WZLA 2GAJA 1QAMA 3Q8LA 2DB3A 2QL5A 2D5BA 1IXZA 1LK0A 4BO1A 2QJWA 2PL3A 4L5IA 3U3XA 3FVRA 1TRKA 4ANFA 4U8GA 3AR6A 3ZIUA 3OMLA 4Y2QA 1Z5GA 2E85A 5K0BA 3RUAA 3R1IA 2R7LA 3RTBA 2DWPA 1I6LA 4KIFA 4COKA 2ZB2A 3VHQA 3WLIA 4CF7A 1ANKA 2HK9A 2K87A 2RJOA 4TQAA 3UKJA 4C4TA 1U0NA 4MR7B 4C78A 4XD2A 4R2KA 2JVJA 1HORA 3B6MA 3B9RA 4WK4B 5JAOA 4BNTA 3BWBA 4YI3A 1CVIA 1EX6A 3O38A 3HCOA 4K7JA 3C2QA 3C7CB 2FQ1A 2GNAA 2EFYA 2UZ1A 3GEPA 3LECA 1ZH4A 1JJVA 4UZFA 5HIIA 3FFWA 3NC1C 1VJTA 4PG5A 2OKCA 5EHGA 4KAJA 2W70A 1OKKA 3UF0A 1W93A 1A04A 2NU7A 1IBRA 4FZJA 1JDUA 1K3TA 1P2SA 1Q1GA 1SVMA 2G82A 2REQB 2C5AA 3OJXA 4GIBA 4LNUB 3T99A 2I8LA 4NENB 3BWMA 4J07A 1QVZA 3HRKA 5ITVA 4PYRA 2O2JA 1AG9A 5C8VA 2C2HA 1YDMA 2ZYWX 2Q1UA 3DLIA 1ECGA 4YRZA 1EUYA 2F48A 2H2GA 5HWSA 2NO4A 4GOJA 4EZEA 3VU0A 1DJMA 2ZAMA 3FSGD 5EIAA 5KYVA 3QE9Y 5FO1A 5J5CA 4NBKA 1UOQA 2ID7A 4RMNA 2ZUSA 2D0OB 5L3ZA 5A5DA 1G4AE 2AR0A 3K4PA 4CUJA 1UOPA 3AQ4A 1LVHA 2YFQA 4UEWA 3D31A 2HZ7A 2WDZA 1B6RA 4RBNA 4M9ZA 1IJBA 2D5LA 2WQ6A 5IT4A 1L1QA 3GROA 5AICA 3VC7A 5JPDA 1JH9A 1Q16A 2GBFA 1G8SA 3RJZA 1IWBB 4BVEA 4IV0A 1W2HA 5J4LA 3EGDB 1IPHA 4BMXA 1E58A 1Y4AE 2YFYA 3GEDA 1QGYA 1WZCA 3HB7A 5HF6A 1X19A 5ALWA 5HZHA 1XTJA 5D3ZA 2IBSA 3EQZA 5FF9A 2QAIA 2YW2A 4XIGS 4FJ1A 1DC4A 1RBYA 3CH6A 4V0RA 4GM1A 2W0SA 3PPYA 4FFDA 1KDOA 3SXUB 3OECA 2I6QA 1M2FA 4YP1A 4NZ9A 1W7AA 3A3PA 3U17A 1Y3FE 1WKVA 3IP8A 2EJUA 3K0HA 4G5RA 3WL3A 4CJXA 2WW8A 1MOQA 2W90A 2VBGA 1QJCA 2OZPA 3QA9A 3TRIA 5J59A 2B4QA 4BNKA 1BDIA 2HYDA 2PE5A 4BKOA 3KWFA 1BKYA 2I6TA 4RENA 4FGKA 4QDTA 4FB4A 821PA 2GYVA 5KKCA 5AVVA 1SCIA 3I5AA 3G82C 1ZOLA 1V1RB 4KQ1A 1KJIA 1PLKA 1YH3A 4ZOEA 5JYEA 4C43A 2M1ZA 1P4RA 4RLHA 5AK6A 1Q1EA 2WIFA 1QWOA 3ZV3A 3ZE0B 1TF7A 3DO6A 1UMDA 4D3SA 1E59A 1T4CB 3CT6A 1DE0A 2XLBA 3D4BA 1WZUA 3QHQA 1YBVA 4X3OA 3BFKA 5EPUA 1R15A 3RS4A 3PBKA 3DDSA 2YW9A 1CQIB 1DCFA 1CS0B 1X42A 1QGUB 2BCJQ 3LFTA 5F21A 5K8VA 2C99A 3EXHC 2XQVA 1Y3IA 5DKFA 2XTNA 5GJVC 2F1IA 4HEA6 3ZUGA 2X58A 4PINA 4YMTA 5JVDA 1JWLA 1OFUA 3N07A 4QGFA 2A3RA 3HYSA 4A0FA 3WRXA 5LD2B 3LO8A 2P9EA 4BTVA 2KYRA 5IFKA 1RYEA 2XCUA 4B6EA 3WNBA 3U40A 3QX7A 2O8DA 1LLUA 1O4VA 1CF4A 2QR2A 4UU0A 1O58A 4L8VA 1NKSA 3FPKA 1YOVA 2C61A 4RZUA 1DEAA 5BSMA 6REQA 3A6HA 3VI3B 4YCLA 2B6NA 3JQBC 1KI1A 2BC9A 1XYVA 3QOXA 4MIKA 5DWQA 1EM8A 4Z9XA 4BMVA 1XZPA 3DAHA 3RS7A 3PNYA 4CKEB 1J2JA 4XB6B 1CUUA 2FI1A 3TUIC 3LNCA 3TXAA 1Z74A 1Y8RB 1V3VA 1H6CA 1P4HA 3T7CA 3AFOA 1XWFA 1V6AA 2XMCA 3CWQA 3IEXA 5K0SA 2XCTB 2BFPA 3ASZA 2BR4A 4PXAA 1PJZA 3UQZA 5EI5A 4YRCA 1WDLA 2NADA 4UTPA 1Z4IA 3CZPA 1CR4A 4M22A 3V9AA 3W8FA 3BJMA 4JXKA 1W4AA 3TTWA 3QLVA 4B6FA 3DBRB 5A0FA 4PZEA 3IT1A 3KCNA 1DX9A 4MV3A 5CVJA 1E20A 2JI9A 3SAJA 3RRNA 1D2AA 2BF4A 1E7RA 1NJ5A 2GA8A 5BYBA 3LFHA 3G1UA 2OK7A 4BQSA 4EI7A 5TB5A 2O3QA 3QENA 1CPYA 1PKEA 1SIUA 2PGOA 4ADSG 1OLSB 1P31A 3T5GA 3MOGA 2Y4OA 3TNDA 1ABBA 2P3QA 3REOA 2AX4A 1VFNA 1BG6A 3JQ7B 4KYVA 5AOBA 2OCXA 2H29A 1KPIA 2B8JA 2H07A 1G5RA 1N6OA 3F4KA 1YXMA 4DOMA 1DQNA 3BQ9A 2V6JA 3LQ2A 1P2FA 3NP7A 1VJGA 2D5CA 4IXDA 5KJCA 3UJ6A 3GGPA 3K92A 2GJKA 4AU1A 1T36A 3MWEB 2ZB8A 4GMHA 1WMDA 4YAOA 3MBKA 4CM1A 3IH5A 4RF5A 4TTAA 3GRAA 1H0RA 3I04A 4KVGA 4EG1A 3L8EA 4NESA 1JQBA 1LX7A 1TL7C 3TAXA 4KTTE 4F96A 1WX1A 5KSZA 4R1LA 2YIJA 4EOGA 4EPXA 4RD3A 4PU0A 2FEPA 1KZHA 1UK8A 2A59A 3QEBZ 1PJLA 1UF9A 3BL8A 3NTOA 4Q1FA 1QQ6A 5I7WA 3CURA 2O07A 3JWIA 4C2AA 3P9NA 5KYWA 5J2TA 1RTTA 5BOSA 2VF8A 3MSCA 3E1GA 3VZRA 2FWRA