3MQ2A

Crystal structure of 16s rrna methyltranferase kamb
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
MRRVVGKRVQEFSDAEFEQLRSQYDDVVLDVGTGDGKHPYKVARQNPSRLVVALDADKSRMEKISAKAAAKPAKGGLPNLLYLWATAERLPPLSGVGELHVLMPWGSLLRGVLGSSPEMLRGMAAVCRPGASFLVALNLHAWRPSVPEVGEHPEPTPDSADEWLAPRYAEAGWKLADCRYLEPEEVAGLETSWTRRLHSSRDRFDVLALTGTISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 16S rRNA methyltransferase
publication title Structural insights into the function of aminoglycoside-resistance A1408 16S rRNA methyltransferases from antibiotic-producing and human pathogenic bacteria.
pubmed doi rcsb
source organism Streptomyces sp. dsm 40477
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mq2A00
5BXYA 3EMBA 3KQPA 2ZULA 3HTXA 4EKIA 3B3GA 1BHJA 1FP1D 1VPTA 2AS0A 2YUIA 4PIPA 3G2OA 4QPPA 4FSDA 5B1SA 4JXJA 2XVMA 5ERGB 3SSMA 1BC5A 2OZVA 5EZQA 2HR1A 4CKEA 1X1CA 2YVLA 3S68A 1NBHA 3M4XA 4DM3A 2IP2A 2HNKA 4PWYA 3A7EA 4KDCA 3NJRA 2GLUA 3G5LA 5EGSA 5JUWA 2OB2A 3SM3A 3GNLA 4MWZA 5F2OA 3GWZA 1EQAA 2IPXA 5K8VA 4P58A 2G71A 3BZBA 1Q0TA 5DM2A 3TFWA 1YFJA 2ZIEA 2ZTHA 4KRGA 3GIWA 3TM4A 2O06A 2NYUA 4RTOA 2IDKA 4R05A 4HTFA 5FQOA 3FUVA 4RTRA 4YMGA 4F86A 5FHQA 4OX9Y 3FUXA 2AZTA 5EMJA 3BGVA 3MGGA 3GU3A 1JQ3A 3P2KA 3DR5A 3P9NA 1L3IA 3R24A 5DSTA 5T67A 3RODA 2VZ9A 3VSEA 5K0BA 5K09A 3BUSA 2ZBQA 3GCZA 5E8JA 3G89A 2O07A 5DM4A 4KDRA 1RJFA 4RX1A 2BZGA 4GC9A 2OXTA 3HEMA 2FYTA 1WZNA 1RJEA 2ZSUA 1ZQ9A 2HWKA 1XVAA 5LQNA 2AOUB 1O54A 2ZWVA 5DX1A 4FR0A 4RVHA 3KQOA 2ADMA 3M6VA 3BKWA 2H11A 2CMHA 3KKZA 3L8DA 2B78A 5EMLA 5DWQA 3NWBA 5DSXA 4DQ0A 3A25A 3EEOA 3NMUF 3B7PA 4R8SA 1SG9A 2AN3A 2CMGA 2ONZA 4HH4A 4PGHA 4E2WA 3P2IA 1I1NA 2ZZKA 5KQRA 4GEKA 3JWJA 1IM8A 1TW3A 4PCLA 4ATNA 1DL5A 4DCMA 3LDUA 4MQ4A 1YB2A 1X1DA 2QRVA 1RI5A 1KPGA 1KPIA 2JHCA 3AXSA 1JSZA 3LGAA 3EGIA 3NDJA 4GBED 4PYOA 1JQDA 2JHAA 1QAOA 1EG2A 5FTWA 1YZ3A 5D1HA 3LX6A 2QE6A 4FGZA 4XUCA 2AN4A 3DOUA 3PFHA 4Y2HA 4HG2A 2WA2A 1AF7A 1FPQA 4GC5A 4QDJA 5DT2A 3V97A 5KS2A 4C04A 3FYDA 3JWIA 3MAGA 5FA5A 3SSNA 1M0EA 1JTEA 1UWVA 3TR6A 5HFJA 1FP2A 3HCDA 3KR9A 3NWEA 3EEYA 2B2CA 3Q87B 4HGZA 4KVZA 2ORED 2UYOA 4CKCA 4RYLA 4AZSA 3FPHA 1EAMA 2XYVA 4RTLA 4R6XA 5F2NA 4M37A 4DCGA 3KHKA 1RI3A 2BR5A 1ORIA 1ZG3A 5FULA 5EZSA 3I53A 4E2XA 2VDUE 2AOTB 1M6EX 1ORHA 4QDKA 3P97A 5HIMA 3CJTA 5KQSA 2AVDA 2IFTA 4PGGA 3FZGA 4A6EA 4PYQA 4YV1A 5HOQA 2I7CA 2PT6A 3I64A 2YXDA 2IGTA 4OQEA 3ID6C 2NP7A 3MTEA 4BP3A 4EQZA 1UFKA 2GH1A 2P1DA 3C3PA 3LSTA 4XUDA 3EVAA 1L3CA 3EVGA 1EIZA 1KPHA 3CC8A 4WVLA 1JG3A 5EQJB 3SR4A 4GUAA 4YUWA 3UBTA 1FBNA 4A6DA 2GS9A 3QOXA 2ZIFA 1ZGJA 2DULA 3CKKA 3FTDA 2Y1WA 3OE4A 4ISCA 5DTRA 3SX0A 4BY9E 2NXJA 4U7PB 3C3YA 2O0LA 4GOND 4E2ZA 3NDIA 1G55A 4IWNA 3UFBA 3T7RA 3DXYA 1MJFA 1NW7A 2AOUA 4C08A 1WG8A 5DXAA 3BGIA 1RI1A 2PKWA 2GPYA 5HZMA 2O05A 5DX0A 2AOVA 3IYLW 3R6TA 3P9KA 1ZHFA 1JG4A 4AZTA 3KR1A 5EPEA 4ER5A 3CCFA 3KPWA 3KQYA 4BP1A 1YUBA 4GQBA 2IH5A 5H02A 3DXXA 3M6UA 5CVJA 4P7GA 5CUQA 3F4KA 2NXEA 4PYKA 3I5UA 2I62A 4GOLD 4V0RA 3KPJA 5G02A 4YUYA 3UJ7A 1D2GA 3KR2A 3UJCA 2BR4A 1INLA 3KQQA 1XJ5A 3EVZA 3T0IA 1R8YA 3FRIA 4CTKA 1N2XA 4G56A 5GP1A 2PX2A 4C06A 4HRAA 3CGGA 2YXLA 3FTFA 1L3BA 3UJ8A 1RI2A 2JG3A 4OBXA 2K4MA 2PXAA 3M6XA 4C4AA 5DLYA 2B9EA 4YMHA 4YV2A 1TW2A 5EG5A 2Z6UA 5DX8A 5MHTA 4KW7A 4Y30A 4AUKA 3LCCA 1L9KA 3QOWA 4PYLA 4RSRA 3UZUA 4RTJA 3BT7A 4POOA 3EMDA 1QANA 5DPMA 2PBFA 4DF3A 3FPFA 3HCEA 3R9XB 2PX4A 3BWBA 1XCLA 3G5TA 3I9FA 3V8VA 2ZVJA 3GDHA 3GRUA 4FT4A 4UOEA 2PVCA 1WXXA 3I58A 1VLMA 2AOTA 5C1IA 1R74A 3SXJA 2IH4A 3T7TA 4B17A 1NKVA 2HTEA 1XDUA 4CKBA 3KQTA 4M38A 3UWPA 3R0QA 3DP7A 2CKDA 1DUSA 1B42A 5CCBA 3FUWA 1D2CA 4IV8A 3C6MA 1JSXA 1NW3A 2PT9A 3LBYA 3SSOA 4QVGA 1X1BA 4KIGA 4PYIA 1SQFA 3DULA 1RJDA 3EVDA 1HNNA 1V39A 1XXLA 3HCAA 1G60A 5GWXA 3TLJA 1NW5A 5LQAA 2Z6AA 3UA4A 3LCVB 4DZRA 4OA8A 4YUZA 2P7HA 3DH0A 2Z6QA 1U2ZA 5E8RA 1VBFA 3JWGA 4LWPA 4RTMA 2PX5A 3DTNA 2YX1A 1KXZA 3P71T 3BGDA 4H0NA 2C7RA 1NV8A 2XYRA 3NW9A 2G70A 1X19A 3RW9A 2AVNA 2G1PA 5E1DA 2O57A 5HIJA 3IEIA 4ER0A 2GAFA 5CM2Z 1ZKDA 5FHRA 3GJYA 4EK9A 2G72A 1SUSA 3GRVA 3EVFA 3OCJA 3LPMA 2ZLBA 4DMGA 1Y8CA 2Q41A 3VYWA 5GM1A 2AN5A 4V0QA 5E1OA 1L1EA 3NVMB 3OFJA 2PXCA 3A4TA 3EGEA 3NTVA 5DTQA 5GIOE 1PJZA 3HVKA 3HNRA 4QVKA 1YFLA 1F38A 4RTSA 2R6ZA 2FRXA 4HSGA 2OPBA 5HIIA 1VP9A 4E31A 1KR5A 5K0EA 4PONA 2ZCJA 3ELUA 4YUVA 3ORHA 5DM1A 3LDFA 3OZSA 3GXOA 3IHTA 4LWOA 4FZVA 4E30A 1AV6A 2V7EA 2B25A 2FK8A 1NW8A 3KQMA 1I9GA 4QTUB 3PX2A 3A27A 2P41A 3REOA 3PS9A 4KWCA 2P3LA 5IKMA 1JG2A 3FPGA 3PB3A 1ZGAA 3OZRA 1VP3A 5EKXA 2F8LA 3DLIA 1XDSA 1R6AA 5EMKA 1NBIA 1IY9A 3G88A 5T64A 4KIFA 3UJ9A 5K0CA 4L7VA 3ME5A 3LHDA 2ZBPA 2FK7A 1SKMA 1JR4A 4ZTBA 2IBSA 3O4FA 4HGYA 4R6WA 2ZFUA 3LCUA 8MHTA 1F3LA 4RVGA 1Q0SA 3BXOA 2VS1A 3MQ2A 3IV6A 5FQNA 2I9KA 3FRHA 3HCCA 1QAQA 2ERCA 3THRA 3FTEA 1KHHA 4MHTA 3P2EA 1RJGA 1NE2A 1EJ0A 4EMSA 1MHTA 5F2KA 1R18A 1WXWA 3MTIA 3PFGA 2EJUA 2IBTA 5K0LA 3EGVA 3TKAA 3MCTA 3MHTA 5CVVA 2JHPA 1P1BA 3E8SA 4XCXA 3LKDA 3A26A 4RVDA 4NECA 5K03A 3ER8A 5FA8A 1SVUA 5CVUA 2YXEA 4RTPA 1BKYA 3KQVA 4FT2A 4LECA 2YR0A 5K0FA 1N7IA 3LL7A 3FPJA 4X41A 3HVIA 4Z2YA 3E7PA 3H2BA 4F84A 3CVOA 3ELYA 4M36A 1Z3CA 1T43A 2EX4A 2BM8A 2EFJA 5E9WA 1JG1A 3OU6A 4PIMA 3TRKA 9MHTA 3DMFA 2IIPA 1SUIA 3OU7A 5FWAA 5GIPE 5LQUA 4QQKA 4WXHA 4ER7A 3BWMA 5C9ZA 3TMAA 3C0KA 2Y1XA 5BP7A 1G38A 3TQSA 3HA7A 3TOSA 5CD1A 3B3FA 2GA9A 2UZ4A 5LQCA 2OKCA 3GRZA 3A7DA 4HC4A 5KVAA 2C7QA 2UYCA 2OB1A 2BR3A 3UJBA 3RIEA 2P3OA 5C0OE 3UA3A 1YZHA 4P7FA 5DRYA 3M33A 4ER6A 4GF5A 3AJDA 3DUWA 5ICEA 4RV9A 3B5IA 5EC8A 2FCAA 3CJQA 3LECA 5K05A 1M6YA 5FWDA 5FCDA 3VC2A 2IH2A 3GGDA 2OY0A 3KR0A 4PYNA 5E9JA 5EHIA 1I4WA 1P91A 2UYQA 3ELDA 4E32A 4YUXA 3PTAA 5DRTA 2ZZMA 3PLAE 2XBMA 2PY6A 2EG5A 5CVDA 5FADA 3HCBA 3EVEA 4PYJA 1XCJA 4DA4A 1R00A 3OE5A 4EVIA 3HVJA 2FPOA 3HM2A 3QV2A 1H1DA 2P8JA 3G2QA 3SVZA 3FUUA 3WSTA 5CCXA 1VE3A 2V74B 5E2AA 1JQEA 4BLUA 4RTNA 2PWYA 4P7JA 5CVEA 4BLVA 7MHTA 2NNWB 1UIRA 1PRYA 3UJDA 2VP3A 2NP6A 3P9IA 3G8AA 2OYRA 2OBFA 1AQJA 3TM5A 5GM2A 3U81A 1WS6A 4AZWA 2A14A 3AY0A 5EOVA 3CJRA 3OZTA 3HP7A 3AXTA 2P35A 3P8ZA 3UJAA 3VC1A 2FHPA 1VL5A 5BW4A 2PLWA 1G6Q1 3AWIA 1KP9A 1QZZA 3EVCA 3D2LA 3G2MA 3O7WA 4QPNA 4E33A 2PV0A 4RTKA 5K0NA 1NV9A 4FSXA 2BH2A 2XYQA 5EEHA 4PINA 4X63A 4OQDA 4E70A 3OPNA 5GINE 2NXNA 1DCTA 3FYCA 3G2PA 2NXCA 3CBGA 2OO3A 5K0JA 2ZWAA 2LD4A 4FP9A 3K6RA 3MERA 4GOOD 3ELWA 5EVJA 1X1AA 5E1MA 3P9CA 1HMYA 5LQRA 5P8WA 2H00A 3PVCA 4MTLA 4OBWA 4X60A 5LR6A 3O31A 2PGXA 1G8SA 3E23A 4C05A 1N7JA 2AR0A 5HILA 3ANXA 1O9HA 2PX8A 1R8XA 2ZIGA 3DMHA 4R8RA 3GRYA 1FJXA 2ESRA 4FS8A 1JTFA 3EVBA 5ICFA 2EJTA 5BW5A 2PJDA 4U7TB 1VQ1A 3EPPA 4PYMA 4YV0A 5LQJA 4C07A 2ZBRA 4OA5A 4ER3A 4X61A 5HIKA 5CIYA 5EKUA 4GOMD 1YF3A 2VDWA 5M5BA 2HV9A 3KPUA 2QYOA 2CL5A 1XTPA 2E5WA 5K0GA 3THSA 5LSAA 3NVKI 4RTQA 4E2YA 3HCFA 3BWCA 3HA5A 5KYGA 1KYWA 3BWYA 2G8NA 1P39A 3M6WA 2QY6A 2PWPA 4CXMA 3T7SA 1P1CA 4LG1A 5EIWA 3LKZA 3FUTA 3DXZA 4CTJA 2AOWA 2JH9A 3FTCA 3Q7EA 5EHGA 3X0DA 5DM0A 1KIAA 4C03A 4DKJA 2GB4A 4MIKA 3GRRA 3MB5A 2BM9A 3SMQA 2DPMA 4P7KA 4O29A 5U4XA 2WA1A 5ICGA 5LQKA 2C7PA 5JR3A 5DTMA 3KPYA 3B89A 3HVHA 4IV0A 1WY7A 1IXKA 2B3TA 2R3SA 5IH3A 4IKPA 5E2BA 5DXJA 5EMMA 4AX8A 4HTFB 2P7IA 4F85A 2ZZNA 2ONYA 3G7UA 2UYHA 2YQZA 4AZVA 1G8AA 2H1RA 3LBFA 5HEKA 4K6MA 2CWWA 10MHA 1QAMA 5T6BA 1XDZA 3FPEA 3K0BA 3KPVA 3OFKA 4XUEA 2JH8A 1BOOA 1NW6A 1RI4A 2I6GA 1TPYA 2YTZA 2ZW9A 2XVAA 3E05A 3TKYA 2N47A 5EIFA 3ERCA 4PNEA 3KQSA 2PSSA 4CWAA 2P40A 3PX3A 2VDVE 3M70A 2C7OA 3ER9A 3DLCA 3HA3A 3GO4A 2QM3A 1QYRA 4PCAA 3TPZA 2WK1A 5EEGA 3B3JA 2JJQA 5FUBA 5GOZA 3SGLA 1NT2A 3JWHA 3C6KA 2AOXA 3PT9A 4RWZA 3UJ6A 5D1NA 2P3QA 2PXXA 1D2HA 1KYZA 1EJ6A 2KW5A 4QQNA 1OR8A 5K01A 3LDGA 4M7RA 2IDJA 3DMGA 5E9QA 4QTTB 3KQWA 4X1OA 1VIDA 3BKXA 1SQGA 3MCZA 5E1BA 4BLWA 2QRVB 3KU1A 2HMYB 3OU2A 4RVFA 1O9GA 3G8BA 5ICCA 4EKGA 1AQIA 3R3HA
chains in the Genus database with same CATH superfamily
1ZNYA 1Y6JA 1SVNA 1TQ4A 2ZR8A 1ISGA 1ZJZA 3AF1A 1IJEA 2LGJA 2BWJA 2JVKA 4MWSA 3G5MA 5ALHA 3ZNQA 4JA2A 1MPXA 3C97A 3ZI7A 4PIPA 1VYVA 2WAXA 3ODPA 1FDIA 4XW2A 3OQBA 3REFA 4XD7D 5CA0F 3HS3A 4N40A 1T35A 4AUEA 2VUUA 1J0BA 1VLZA 1MC5A 2ATXA 2XTNA 4TLAA 1RE0A 3TLEA 3E3MA 4KDCA 4TS3A 4JLDA 4TTPA 4G65A 5KQPA 4LX8A 2QRNA 3O3CA 4ON9A 3MELA 5CT6A 1NX6A 4EGJA 2HK7A 3BK2A 4IP0A 2Q0HA 4F04A 5D6OA 4U7WA 4BQFA 1YONA 2UUCB 3ZBTA 2Z09A 3GT3A 3TFWA 4OEHA 5BSGA 5D3KA 4RTOA 2P9HA 3PQ2A 2C78A 1M0TA 5CFQA 2VP2A 3G8YA 3EFEA 4F86A 5FHQA 5A5FA 2OHHA 4OJKA 2WAYA 2WT4A 3KVYA 5JI3E 3I9MA 1JX6A 1XEXB 3SR0A 4JT9A 1Z22A 3ULKA 1IQPA 5AUNB 1R0SA 3WDMA 1E89A 4R1MA 2GHQA 2MMCA 2X22A 3U7QB 4ZVPA 4DPMA 1UJ4A 2AD1A 5LQNA 1ODKA 3WLNA 3GH1A 4DKXA 4FR0A 1M1UA 1KEUA 1LTQA 1U02A 2QGFA 2QNIA 4FOPA 3WYGA 4B2PA 3OQOA 5EMLA 5C34B 1RLMA 5AK0A 2XXJA 4OK6A 3GVXA 3QLEA 1UFVA 3CUKA 2NSHA 2UVPA 4CM6A 4PS1A 4FM9A 1P2SA 4DV1B 2EJCA 2AJDA 3QA9A 1MQAA 3O84A 4OAOA 5TMDA 1W36B 4AQDA 2HWYA 3FDFA 2Q4OA 4IUCS 4BZZA 1BWSA 3CNNA 1XIVA 1Y9ZA 4MGKR 2Z1NA 2FF5A 1BJRE 5HTKA 3O8OA 4CMBA 1LD3A 3EGIA 2YFKA 1EP3B 2C5LA 2XMSA 1EG2A 1Z5WA 5AWFC 2XQFA 2ZYIA 2H7XA 2V8BA 4LVCA 3L1VA 4ZP1A 2I3ZA 4GC5A 1X7YA 4TS1A 1NYLA 3ZW9A 5CDYA 1CF4A 5BYKA 1JUDA 4Z7JA 1OXVA 3QRWA 5L3VA 3OOHA 3FETA 2HKIA 3I6YA 2D59A 4QE3A 3RB8A 4EHFA 4CPDA 4NU0A 4XE5A 1H9BA 4BNKA 4EPRA 5KKNB 3FPHA 4CKWB 3UGJA 1E5LA 1QYDA 4MCHA 4NHEA 3OF2A 2ICAA 1QVRA 1PJRA 1IWOA 3TLKA 2Q4EA 4TX1A 1M34A 4J3NA 2JKZA 4DBLC 1DUVG 3VTAA 1D8AA 4G5HA 3BMNA 4H2DA 4OMFG 2VDUE 5FF9A 1ORHA 3NRBA 4QDKA 3LA6A 2BUBA 2VHWA 2PJZA 2X77A 3I8XA 2G25A 3TUIC 3LD9A 3SICE 5A06A 1FVOA 1KJ8A 4DEYA 5HOQA 1YQDA 4LN1A 4FB5A 2LP4Y 4NCKA 1TYDE 1E79D 2VQ6A 3DT8A 1L7VC 3FSGD 4FE7A 3I28A 4NBVA 3O2SB 3EG9B 1JG3A 3NC4A 2YMMA 2ZBGA 2Q2NA 1KE1A 3CH6A 4YUWA 2F9FA 5JRJA 1LX7A 1O1YA 3JQQA 4LHYA 3QPUA 1WZ2A 1CNFA 5F35A 4ARUA 2IHTA 1Z4QA 1P7ZA 4Z9AA 3QPAA 1NQUA 4GLOA 4R7ZA 3OIVA 1M67A 1C7JA 4CF7A 4BO0A 1DKLA 4C0LA 3NIDB 3VVMA 1X7HA 4G8BA 5ELLA 4HWPA 3TQFA 1R27A 2YN4A 1NNLA 4G9GA 3SKYA 3HJGA 1X7ZA 3ESZA 2QW8A 5FOTA 5C51B 2ID8A 1MDBA 1Z8NA 5BQ3A 1POWA 3UHOA 3ZBPA 4KYUA 4WMLA 2QTNA 2EBUA 3R6TA 5KYKA 3DDWA 4YROA 1RLJA 3ONFA 3EXG2 3IXLA 2ILVA 3CH4B 3GGCA 2FNAA 4DJ5X 1V1JA 1KY3A 3R5FA 2J6HA 3BD8A 1YJXA 2WWRA 2NQTA 4ZOEA 2FFBA 2Y0PA 3KJZA 4R7GA 4WKNA 3GARA 1KFJB 3QIVA 1FUUA 1M8GA 2C4HA 3RREA 3JQ9A 2B4AA 4N01A 2ZYSA 1JMKC 1B6SA 2GASA 2IYNA 2VPQA 1AB6A 3VJKA 4B81A 4RDHA 3VHXB 1XCMA 4GWKA 3W6PA 5IC4A 4W5NA 4DY4A 3KOOA 4LYYA 2WWIA 4K9DA 1N25A 2PYIA 3V55A 3H9CA 1N9KA 3ILSA 4IS3A 1X7WB 4PR0A 4BX0A 4M1EA 4CN8A 4D9GA 1VBNA 2ODEA 3X2EA 2YHBA 1QQBA 1TVCA 1PWHA 1QH9A 1V1MB 2J5BA 1I7LA 1ZIPA 3SFTA 1PT8A 1CUGA 4TWBA 4EG5A 5JSFA 1HFJA 1T1SA 1VFNA 3L7BA 4I9GA 2JBAB 3FFBA 1GDDA 4MQFA 2J3IA 2Q3EA 2ODPA 1XCLA 3BWBA 2P4QA 4NENB 2NO0A 3UM9A 1C7RA 4EG8A 3KFVA 4ZAZA 3IAEA 1HK7A 1MC1A 3AU8A 1ZRHA 4DBVO 1K66A 2YJ4A 1Z2DA 4DADA 2H0RA 3K1AB 4P81A 3QXXA 4ZODA 3LK7A 2CSXA 3UGKA 2O7VA 1CIPA 1ZIDA 3HJRA 1EYZA 1ZVJA 1H4SA 4DWJA 2QLNA 3Q7RA 1WO8A 3K0CC 2NV0A 4O3FA 4WGGA 4YP6A 4H15A 1IAVA 1ZICA 2OK7A 3AB7A 4RXTA 1PIWA 5KYUA 3WLHA 4HPWA 3HCAA 1J5XA 3F3YA 3LCVB 1EA5A 3Q8KA 1UBRS 2JBHA 3G0IA 4FHEA 3UN1A 2QEQA 4FYVA 1VBFA 4GYYA 1YE5A 1FVFA 3MAJA 3COWA 3F0TA 4OSEA 2P30A 4KIJA 4UVIA 1UC5B 1EUYA 2AMYA 4PR3A 4RK6A 4OYRA 2WF5A 5HE8A 4R8KA 1W1IA 4URUR 2YFYA 2GAFA 1SOWA 5FHRA 2PKCA 1H6BA 2A33A 3GJYA 2G72A 3IQEA 3MMZA 1CEQA 4L8WB 4MV9A 4EK9A 3KQNA 2HL6A 4AF7A 5HZGA 1MFZA 3AK4A 3G2HA 1YS9A 2OAQ1 3FSRA 3INNA 5L4LA 2FI1A 3GR6A 4H7HA 4AICA 1ODSA 2X5XA 5LMNB 1QF6A 2R1VB 3BA6A 1SB8A 2QUBA 4YWHA 3CKMA 2HLDA 5KJ6A 2FW8A 2XAUA 1BE1A 2YVQA 1ADJA 1H1TA 2PQ0A 3PYMA 1E7QA 2OC9A 2KB0A 4I1YA 3CEPB 4B8WA 4JCOA 1JDTA 4XCQA 2RGRA 3CX7A 2X5KO 4N9QA 3DHNA 1UL1X 4ZXFA 1G20A 3QSGA 1G3IA 4IS2A 4JLPA 4RIEA 4EYOA 2PZEA 1A88A 1XQYA 3LQ4A 5C8YB 3LWNA 2XD4A 4YAFA 4C4TA 3ZQ6A 4OHRA 1QQ7A 4A8PA 3RUIA 2XE7A 5I9MA 3T9BA 2IOQA 3Q1KA 3TINA 3U3MA 4N5HX 1KEZA 1FPMA 1NBIA 2YJ5A 4M0LA 3RU2A 4MVCA 3ABZA 4UDXX 3ZU2A 3KL2A 1NRWA 3BFXA 1WRBA 5CDUA 3MXTA 4OXKA 3TXYA 3HEAA 2ZBPA 1SUPA 4CM9D 2JAOA 3CLUC 4KPGA 2IBSA 3H97A 2ZJAA 3OHSX 2JATA 3Q5EA 4IFBA 4QTZA 3VU8A 1D4AA 1JBKA 3R76A 2ARKA 2J32A 1F0NA 1ONNA 1NHWA 2J5XA 4K9MA 3FRHA 3NT2A 5EVCA 1JYFA 1P9LA 1UM9A 4BEBA 3M1AA 1E3JA 3H19A 4PV7A 4XH9B 2OGSA 3M4JA 1KKUA 4B2IA 3VX4A 4IFEA 3K0CA 4NBKA 2V4UA 4L0DA 5EA2A 2XUHA 4H1VA 1WDLA 3FHTA 2OHFA 3CRW1 1QWOA 3H86A 4NECA 5LDGA 2MR5A 4YYZA 4N41A 2DH6A 2QAGC 2CYAA 1QUEA 1Q91A 3JZDA 3KT0A 1TTTA 1DKNA 2WIDA 4IZOA 4X41A 2B36A 3STVA 5KINB 3FW1A 4LZLA 3ELYA 1TL7C 1Z6GA 5T4BA 3MHPA 4BNNA 1USVA 2O5RA 3COPA 4EMTA 2B6HA 4P5EA 2NO7A 2AR9A 2BTOA 2HQRA 3JZAA 4H3KB 1SHUX 4F91B 1YULA 4I1OA 1KAQA 4JLNA 4ALNA 2W22A 2Y66A 3G2LA 4HFMA 4TTQA 3LVBA 5C9ZA 1E5TA 2F4NA 5KU7A 2X14A 4BNLA 5BUSA 2GFQA 4PLWA 5BMOA 3KELA 3MBIA 4GL2A 1OA1A 2HSDA 2JDIA 2QQGA 3PYXA 3KFLA 4LJLA 1VPWA 4X5OA 4WNAA 1Y3FE 2OR3A 6CHYA 2C7QA 1P17A 3UT5B 3RSOA 3WXMA 1Q0QA 3EC1A 1ZUD1 3UJBA 1LBHA 1ECLA 1FQWA 1NW9B 3VZRA 1GL3A 1FS6A 4GU5A 3E0QA 1GXSB 4WVFA 3OAAA 3HDJA 3VNBA 1JP7A 1TTHA 2JGEA 2ZIZA 3NHPA 4IJMA 4CMCA 5K05A 4L2IB 4HQ0A 3AP1A 5BUCA 1WHSA 1OFIA 2C54A 3QBVA 1ULZA 3KUCA 4BMNA 1ZUWA 2TRSB 2V7TA 3C70A 2JAQA 5J5AA 2PQMA 3JQ7B 1BCSB 1X8KA 4B43A 1KWKA 2L19A 4UHBA 1T9GS 3G2QA 4MRPA 4PO9A 4RHCA 1C3OB 1HDEA 1N7GA 1QC5A 1QGUA 3SVZA 5K45A 2YIJA 3RDPA 1WQ1R 1XLTC 4MJ3A 3LUBA 5K5EA 1FXWA 3RQSA 3TW0A 2QR3A 1U5CA 2NU8A 1HYHA 1F7VA 4W7IA 1FYWA 4O4HA 1YR8A 1P4JA 3COVA 3STHA 1NN3A 1P5HA 2AKYA 1G8JA 2OO5C 1WS6A 1Z2PX 4K6HA 1DX6A 3HJHA 4M1WA 4R98A 3ESQA 4MXDA 1E3SA 2G5TA 2EYUA 3M6AA 5EOVA 3R7NA 3CEAA 4HWGA 1JAHA 3F6YA 2GZHA 3KJHA 1K6IA 3GVCA 3UMMA 2FPPB 3LBIA 3PT5A 2FJ0A 4AY4A 4LGMA 2ZYRA 6PFKA 5BSEA 1WCYA 2Y6UA 4BBAA 1PBNA 1HLDA 3DKPA 2Q3CA 3U62A 4H7EA 4J43A 2R25B 4BNIA 2Z56A 2GLXA 1KMQA 1PJ2A 2QJWA 2HK9A 3DFUA 3SF0A 3UT0A 3BB1A 3RH0A 4E70A 1Y7LA 2Q8QA 3FYCA 5AJYA 3FPKA 2IT1A 4FVTA 4FB4A 2Y92A 5CT9A 4ZI2A 4MARA 2IIBA 1VA5A 4MQEB 2O3QA 3JVVA 1PFGA 2Z08A 1XQVA 2DWCA 3OQVA 4KVGA 3OJWA 4GE0A 5D7NA 4ZD6A 1P73A 4O0LA 4ZFNA 1IXZA 2FEMA 1Y3HA 2VJPA 4JBHA 4J1SA 1LK7A 1PD1A 4LXQA 5ALRA 2FUNB 1NAIA 3ZI0A 4GYJA 3BK7A 2PX8A 3LHFA 3T8YA 2ZEJA 3L7AA 2HYDA 1DCKA 1XDDA 1FJ2A 4YP0A 1JZQA 2C8VA 2ECQA 2JL1A 2O1XA 2OILA 4ZOLA 5ICFA 2C9ZA 3N2YA 4G0XA 5B5SA 2X2EA 2PIDA 3EISA 4ENVA 4HEA6 4E1VA 4J0KA 3TLGB 1SD5A 1YQQA 2P77A 3WWCA 1GZ6A 3H7AA 2VYVD 1HKHA 3MWFA 5GOTA 1XTPA 4CIYA 2EQBA 2YKGA 4RTQA 2R7MA 5JH7B 1CUSA 1M2NA 1OLSA 1KYWA 1SCAA 1TKRA 1Z4PX 2BHNA 4P93A 3KT8A 4CKEB 3AB8A 1D2AA 4RV5A 1H6AA 1T10A 4MWTA 4CXMA 4MKFA 3AUXA 1GUZA 2DBQA 4DIEA 1KKLA 2XA9A 4QVIA 4C03A 1E59A 2VAPA 3MSXA 1TQDA 2WSSA 4Q4AB 2DPMA 2JI9A 1EK5A 2XMPA 1WL8A 3IDAA 5U4XA 5JNTA 1XLTA 5EUCA 2G9UA 2J6IA 1J2YA 5LL6P 1S9DA 4E51A 2WIJA 2HQBA 1SHLA 5LB4A 1I5EA 2OO5A 3EGCA 5ARBA 3U7FB 2P1ZA 1GPUA 1D1SA 1XMSA 3BDVA 4FQ8A 1A50B 3GBPA 1T0PA 1RHKA 3OUZA 5DF1A 3VZCA 1SB9A 3QG5A 4EELA 3P4UA 3PNMA 1MXHA 1DRKA 5HEKA 3TLAA 1QAMA 2CEAA 3EODA 3RBVA 3I5XA 1EM8B 4NBSA 2MSKA 3H1TA 5TR9A 3W8FA 5HDQA 3JYOA 2EFGA 1N5OX 2JFBA 3FTNA 3ZH2A 1AMNA 1L7BA 4MYUA 3KL4A 3R0VA 2Z1DA 1C30A 1ULSA 4PQEA 4WZ6A 3MGBA 3WGLA 2XHZA 2P67A 3TPZA 2EP5A 2BI8A 1AQUA 1Y7IA 3RS0A 2ID9A 4D8XA 2D8AA 3ZX4A 1I3KA 2HMAA 1PUJA 3JWHA 2C9BA 4Q5IA 4DA9A 1FXWF 2C7VA 3WWEA 2VDOB 2QF7A 4CEIB 1D2HA 3F78A 1A8QA 2QN7A 4OK5A 3EUFA 1J06A 1Y8RB 3HJNA 5TSDA 3HV2A 3IEXA 3IILA 3OP4A 4O4HF 2PUFA 4XJVA 2XW6A 3TTYA 1AZSC 3BKXA 2RI0A 3HPQA 4Q9NA 3VPSA 3ZBUA 1DLIA 3ZS8A 4IJKA 3KU1A 3V4ZA 1WXGA 3OU2A 1O9GA 4FBLA 4PRKA 5JOQA 3K5WA 1NTRA 3ABQB 3DV0B 4OQLA 4YQFA 3I1JA 3RVBA 1NY5A 3I05A 3O8QA 2A1IA 1CSEE 1PQPA 2RH4A 4KR2A 2PH7A 3SN6A 4NG5A 2Z4RA 1ORTA 5KBYA 2R8PA 3GLGE 5ERGB 3S0JA 3VH1A 1G8MA 1PFWA 1ZITA 3W4JA 2C5EA 2C9OA 4KGDA 2HMSA 4CL0A 1T26A 1YO6A 1JWBB 3BFVA 4ZTZB 4OX9B 3SE7A 3M4XA 2RJNA 5HMMA 4UEQA 4WCFC 5E3HA 4MLZA 2O0KA 3K0FB 3K9LA 5F4BA 3ROKA 2YOHA 3OIUA 1NM5C 3VU3A 2XA2A 2AFVA 3GJ6A 3DOFA 3GN2A 1YDHA 1IPHA 2B4QA 5F77A 1NI4B 4PC7A 3VI4B 1NTOA 1CDZA 5K8LA 4TTAA 2ZDQA 3DZDA 4LOAA 4F97A 1E7SA 1UKVY 2FSUA 3ND9A 3JQFC 1Q19A 5FYDA 1NF3A 3SQOA 3LG2A 4ZOLF 2ZRGA 1N1DA 4OX9Y 1FDRA 3AF2A 1WHTB 3G59A 3P2KA 3KE8A 1T9CA 3JYPA 5DSTA 4MSUA 5FYQA 1ZX1A 1WNTA 3DWEX 1VMAA 4YP5A 5JWRA 4IM7A 1DBIA 2JI7A 4MKGA 4BAGA 4CT4B 4NY1A 1JZTA 5KOIA 2WJWA 5KC9A 5L3QA 2OHOA 5KOHA 4ALIA 3HEBA 3OC0A 1DTWA 2FEPA 3OA2A 1E9AA 1DBVO 4LCBA 2HRBA 3OT1A 1RDFA 4WDRA 1EX7A 3KV1A 4MP3A 2MMGA 4B46A 5KHLB 2VDMB 3WGNA 4ZGWA 5C8XA 2AJ8A 1MV5A 2F43A 3A3NA 4M98A 4EA7A 5CIQA 1M74A 3IGFA 3HMQA 3WIVA 2O3SA 4EVRA 4AIRA 2DSNA 1L5VA 2HAEA 4AKIA 2FPGB 1GNLA 1FFCA 1B26A 2GI4A 4DRZA 4DCVA 2IW1A 2QUHA 3SYRA 1X87A 1SULA 1YB4A 4DCMA 3CRRA 2QRVA 5LQDA 1AKWA 1I6WA 2LNDA 2XBLA 3VPDA 3ECSA 4A8JB 4B45A 5CG1A 3LUKA 1XZAA 3KOXA 1R0ZA 4Z9YA 4G4SO 4PYOA 4DA7A 4LMBA 4XD7A 4CU5A 3R8FA 5AQ1A 4O0MA 4TYYA 2YCLA 2W6ID 5IKOA 1AF7A 2ILTA 1N5DA 1IRIA 2GN0A 4I5GA 4QUEA 3S7ZA 2ZIVB 3M2TA 3ETJA 4S2EA 1QGAA 1C1XA 3RUAA 1XL1A 2P75A 5J4LA 1JAZA 2EWMA 1IY8A 3TEJA 2ORED 2VF4X 4DLRA 2FAXA 2JVIA 3GMDA 4N1AA 4EX6A 1XALA 4JEIA 4D8TA 1E6KA 1PJLA 3RRFA 1T4MA 4O3MA 4WX2B 3CUVA 3V7UA 3E18A 4WCFA 4CV2A 4EDFA 1GRCA 2ZJ4A 1JV2B 2E37A 3I53A 1K6MA 1NM5A 3ETNA 3PQ6A 3AERA 4WK4B 5EPOA 3NRJA 3FJOA 5KQSA 1T5BA 4IEIA 4XQGA 3E4CA 5C5CA 4D96A 4EY4A 5KOYA 3T1TA 1R8QA 5ESXA 3ID6C 1EVZA 4F6RA 3PUZA 4LNHA 3GCXA 3ZGLA 3ZCVA 5JJCA 3V8EA 3GP8A 1F1BA 1T36A 3EVGA 1FFAA 1EIZA 3AUSA 3LHSA 3JQFA 3SHVA 3K96A 4FYYA 5DNEA 3L2OB 1JEAA 2RJOA 3SEFA 2GJKA 2VHVA 1E9BA 1Z4OA 3I23A 3RSFA 1RWVA 3E3OA 4G63A 4N3BA 4QBTA 3W6UA 5A9RA 3VNSA 2VJLA 2QUZA 5F9HA 2PFGA 3Q6NA 1NMYA 2XKBA 5KYYB 1JLHA 1LSJA 3B3QA 2GBGA 4HLQB 3DXYA 4I55A 1XXHE 2VJCA 1XRQA 1P7WA 2JGDB 2FOXA 2PKWA 4INOA 3LBAA 4IINA 1PR4A 1FUEA 4P3NA 4W1PA 3S3TA 5BPHA 1FNMA 2C31A 2MSNA 3D8BA 4NLLA 4OF4A 2GWHA 4I1VA 4ROTA 5DHQA 4DBZA 5BY2A 2HSJA 2FZCA 3KR1A 4X71A 3ZV3A 3OZGA 3QXJA 1J8MF 1W35A 2EL9A 1XD2A 1L7MA 2IK8A 4DT1A 1BXGA 4K6GA 1PL0A 5B6IA 1NDHA 2Z9BA 2VZEA 1QCZA 4P3YA 3UJCA 3TTUA 1EESA 2J0SA 2A4MA 5FKJA 2E9SA 5LN1A 3FBTA 4UZFA 3NX4A 5HA5A 1FU4A 3EAQA 1CHNA 2MINB 5FUMA 3V2IA 2MCFA 3CZ5A 3H17A 2HGSA 4CLHA 2XQKA 2QTRA 2ZM6B 3NWJA 5H4HA 1S3FA 2QV7A 1W1WA 3E22B 4TL9A 4KWEA 1QYXA 4YV2A 1I10A 1WB6A 3EE6A 3H05A 4OJYA 4PG8A 1DTSA 3HSYA 4JNKA 1KQNA 3HB9A 2O8VA 3A06A 3HZZA 2A7QA 4LTDA 1GTRA 3WWYA 1MAVA 3DBHB 1BH2A 2XMCA 1MO3A 1DELA 1YBAA 1JKIA 3QTLA 4RJ2A 2C98A 3B53X 8AT1A 5EJ6A 4PIVA 4BATA 3VJRA 3FX2A 1RMTA 1ZWKA 2O7QA 521PA 5DYGA 3BRSA 4H0FA 3RBXA 1WXXA 5C1IA 2PUGA 4ZOCA 3T7TA 1NKVA 2UUOA 4UOZA 4V3CA 4XTCS 3KQHA 1HSOA 1VDZA 721PA 2YINC 4MMXB 1UODA 1TM4E 2BOVA 1GPAA 4O2BA 2W2OA 4PLZA 1QPGA 4JI7B 4IOMA 2KM1A 4MEBA 4OGKA 5L51A 1XJ0A 5CPFA 5HZHA 2GFIA 2V0NA 5JWOA 1CV2A 2I87A 1YZFA 2NO4A 2NT4A 1IIRA 3EVDA 4KIWA 1JE1A 1XXLA 4OTZA 4PZDA 1BE8A 2N9UA 2HF8A 5ITVA 2H2WA 4GI7A 1U2ZA 4M0KA 4B85A 4BNFA 4ZK6A 4JVMA 3GAAA 2LUOA 4RVOA 1SBTA 5JARA 2X4IA 4E21A 1WSBA 3UK1A 1NZJA 1IPEA 1TAHA 1RVDA 3QVLA 4W9NA 3WGKA 2ISQA 4YJDA 4DTCA 4FWTA 4X94A 4XQ0A 2NIPA 1KGDA 2HEIA 1E7RA 4YP9A 4OBEA 3TQQA 4AQ7A 3OCJA 3IJRA 4WADA 1ULTA 4MVXA 3M8KA 2AFIE 4BLOA 3FOEC 3R7WB 1VJRA 3TAXA 3N0VA 1B0AA 4F4UA 1HUQA 5A1TA 1XLUA 2O0HA 1DBQA 2C4VA 3BM5A 1I0LA 3VYVA 3P20A 2UZ3A 5H80A 1J39A 5G3ZA 1NW4A 4FGJA 4KCGA 3ROPA 4OYYA 2ZCJA 1KDVA 1D1TA 3FDJA 3N8HA 2O0JA 2CC2A 3W5JA 2HADA 2X6TA 4QGGA 1D8TA 1S9HA 3FHJA 4B33A 4DDVA 5HJ7A 4LVUA 2HRCA 3PE3A 2VVTA 1NJ5A 3BIXA 5AXDA 1F4VA 2WUFA 1NDQA 2LKCA 1TC1A 4BHTA 3ZIDA 2CE2X 5DZSA 3WSVA 5FBRB 1R1DA 2IRWA 1KH3A 4I55F 2J3JA 2GRAA 3JVUA 3DLIA 1Z47A 3E82A 1P80A 1WB9A 4FEAA 3SKVA 4EW2A 3R9XA 1UMDB 2C3YA 1T91A 1G8KA 1ZHHA 3A4YA 1L1QA 2VG8A 3OE7D 1O6ZA 4L7VA 4Y2JA 1N2BA 4MQBA 1O6CA 2C5BA 1NLMA 2EKPA 2PL3A 4BO1A 1DBRA 1OLUA 4QA9A 2SNIE 2GCIA 1Z7WA 4JEMA 4V0KA 4DREA 1YJQA 1ZBQA 2H2FA 5B37A 1DS6A 4RNDB 3LQ1A 3MW8A 3HZOA 3HCPA 4XYMA 4IQ8A 4AKHA 1VIYA 4LRWA 2R6AA 3SE0A 2BH9A 3WLEA 3CZ4A 3TL2A 4HD8A 1CVIA 2OFXA 2PBLA 4GLLA 5K0LA 1FNCA 4DV4B 4Z8YA 2NYVA 4DNQA 1C9MA 5JZBA 4NCNA 4XCXA 4A0QA 5AVOA 4QFCA 3D7RA 4U2FA 2ZS8A 2B6NA 4QIHA 3TAUA 5JW6A 1DQYA 4YQZA 2PJUA 1FYXA 2GAJA 4NESA 2K5UA 3RFXA 4L4YA 2EV9A 4DC9A 3NHFA 4M49A 4BV8A 1QFXA 2X8LA 1WMDA 1CULC 2CXPA 3O91A 4MV6A 3G79A 4U2GA 4DJTA 5E9WA 1JG1A 2V9CA 4OQXA 5LMUB 2P9GA 3DLAA 2MWMA 2QDXA 4W99A 4PIMA 4P32A 1OBCA 3T99A 3TRKA 4C88A 3RE1A 4WJZA 1BDBA 2D8MA 4Q48A 1EFLA 3B2NA 2H2DA 2QUJA 3EIHA 3F74A 1IEVA 2CJWA 2ZJ5A 4O2BF 1KF0A 1TJNA 4QYIB 1FMLA 2FPIA 3FM9A 2JFUA 2OHGA 5INTA 1I3CA 2FZVA 2HFKA 1ZU5A 2B69A 2IEZA 3CPSA 4LXGA 4XM0A 4BFCA 3ICEA 3LVQE 4S1PA 1RYEA 2RSLA 5DXFA 5LP1A 1P61B 3C3WA 4B35A 4CTOA 1ZAKA 4EY6A 3BWXA 5BWLA 3OOJA 1E2GA 2RHTA 2HZBA 3ACBA 2AG0A 2IKQA 3L7KA 5ICEA 4HF7A 2XECA 3PYLA 4RV9A 4YS6A 3V7NA 3A4MA 3GZ4A 4MI1A 5FCDA 5FWDA 2H54A 2RGUA 3SCZA 3ZUPA 4BJ5A 4CM9A 4EABA 1Q1ZA 1U0HC 2DCMA 4XTRA 1ESNA 2QVCA 1LBSA 2I3AA 3VO1A 5FPTA 2IS2A 1A1VA 2PY6A 1GQOA 2OZLA 5LZ2A 1QK5A 4UNNA 3RUPA 2QQEA 2XOKA 3VR5H 4RPIA 1Q6YA 3SZMA 1DB3A 1O7JA 3ZK7A 2WD7B 3U61B 2PR7A 2JGMA 3RF6A 1AKVA 1WPQA 4MULA 5T3YA 4RULA 2W0SA 4K03A 2V3VA 4Z49A 1ZZGA 2OCPA 2OORC 4GZLA 1AUXA 3LY9A 2GNOA 3PQ4A 3VJLA 3ZZ1A 3PSAA 1JH8A 2E4VA 2OV2A 1H8HD 2W2MA 4NI5A 4WCVA 4E03A 4Z4IA 3WYFA 2ZSFA 2AZDA 4H3HB 4JJ6A 1F48A 4KEAA 1NUUA 4FILA 4IJ5A 5AHKA 1IEQA 4B5LA 4LW8A 4J07A 1AKRA 3U9LA 5KTNA 4Q6BA 3D5EA 1KZHA 2BSQA 4WY2A 1Y3DE 5HKLA 1EFTA 2PSHA 2QTTA 1AA6A 1A8HA 1CUAA 3KCNA 2LV8A 1J33A 2PLWA 2R65A 3JXEA 3E58A 5KCMA 3PEVA 1G6Q1 4RFSA 4BGEA 1XVTA 2FEOA 1WLYA 2A5FA 4X6YA 3JASB 1T5LA 2PV0A 4HAZA 2Q3LA 1KI6B 4M0DA 1GILA 3OQJA 4X85A 5AJVB 4OQDA 3K35A 1VJGA 3BH6A 1OROA 4L5IA 1UEXC 1AM4D 3OZBA 4ZWNA 5NLLA 1LSUA 2P6NA 1AB5A 1O97C 2VDLB 3ELWA 1AOXA 2Q3DA 3BQ9A 1X1AA 2EX0A 1Y5LA 3GFSA 1RQGA 3E7XA 4PEVA 4V1CB 1FL9A 5E7QA 5CFPA 2G3YA 3G2JA 4UW9A 4BFUA 3RSZA 2V7PA 1G8SA 2AR0A 3R40A 1NUSA 3CGWA 1DQRA 4L8GA 4MS4B 4HB3A 4QOJA 3CURA 3RTGA 1ZN7A 2SCUB 1CUWA 2ZIGA 3HDHA 1S8AA 1OVMA 4JN6B 2G40A 4DV3B 3EVBA 3T0FA 2ZJOA 2GRJA 4GMXA 1RM4A 3BWVA 4KV9A 3MRXA 4UVGA 5BV1A 2CZQA 4G4IA 5D6NA 1NVTA 3LXXA 3SX4A 3WIEA 2V5VA 4Q3KA 3ZHOA 1YDEA 3GT4A 2JI6A 2R6DA 5K0GA 4IUYA 4OHPA 1Q0ZA 2EG9A 5H5JA 3GLFA 4K5QA 3TOCA 3DF9A 3BWYA 1KERA 1V8FA 2C0PA 3NT4A 4TPKA 2FOIA 1JT2A 1XAJA 1Z4LA 2C84A 3ZXIA 4ALJA 1IBRA 2ZE5A 4LG1A 1DKQA 4YECA 2JH9A 4ZU1X 2K2WA 2BF4A 2VBGA 3Q7EA 4MK4A 4OVKA 5AD1A 2DTXA 2GPSA 3HN6A 9GPBA 3SY8A 3EBPA 4ZDIA 3K9BA 1UXOA 2W48A 4HMQA 2AE2A 2XQGA 2NUTB 2OVFA 3LPAA 2YZMA 2H1OA 2W6ZA 4Y2QA 4EUHA 4V0ME 3QBJA 1NULA 3NIGB 1RC8A 4RD1A 1FTQA 3IERA 2RE8A 3EDQA 2MHCA 2I1QA 2FXVA 3GUUA 4LRSB 1IN5A 1G2QA 4P80A 4TRJA 4F85A 2KYRA 3VA7A 4AZVA 5ITSA 4LF6B 5FXMA 3B7WA 5TS2A 2AYXA 1EBFA 2R7AA 1WVIA 5LD2B 1D1QA 5CT4A 3GFOA 1HEIA 2XVAA 2D2IA 2HHHB 2VP9A 1YA8A 4HLCA 3H2YA 1YQWA 1BEEA 1TVKB 1EDOA 2B37A 2W6PA 2PSSA 4JBYA 4NU5A 7MDHA 3U4GA 3EC7A 1FFHA 1M73E 1QGOA 2I1WA 2QM3A 4NE7A 4FC6A 3BZWA 5LYJA 1WLSA 3KQLA 2D3TA 4EA9A 1EK0A 4R2IA 3FKSD 2GZ3A 4C0KA 3NATA 1JA0A 1DWPA 3WIUA 1DKRA 2VTBA 4QQNA 4CLRA 2YVUA 3IS3A 1FSZA 4GPD1 5EJAA 4ABTA 4LBVA 1SQGA 4U6QA 5E1BA 2O7RA 3BCRA 3PDHA 4WA7A 3GZJA 4YVFA 5IAGA 2HMYB 2VYVA 3AV0B 3SC3A 4GKVA 3V5NA 4KB5A 2QU8A 2EDCA 2XKJE 3VMMA 5EP1A 1SOVA 3AP2A 3IEKA 3VNAA 4HDSA 3B3GA 1TZJA 2GAIA 1JHPA 1TTQB 3H9EO 2AJBA 1BC5A 1UPXA 2Z2YA 5EZQA 1E3IA 3OJEA 4NG4A 2HR1A 4P54A 4BFYA 2XYHA 3ZTYA 2GKSA 1ZCZA 2CLCX 1VKHA 3I73A 4Y6GB 4HNRA 4YCAA 2DCUA 4LMAA 1C9NA 4FLEA 1A4IA 5DGIA 4A9AA 2IC5A 1ZSYA 4PZ9A 3UQZA 2YV2A 1NHGA 3CRMA 3C4VA 1Z0DA 2ZIEA 5BUZA 1RHUA 4RCYA 4R05A 2JIQA 5I9LA 2I4RA 1CY7A 4GP9A 5EQFA 1C1DB 4CM4A 2E5FA 4GT1A 1A9ZA 5EMJA 3BGVA 3A3KA 4I9FA 3VTFA 4YV7A 1TA9A 3P2YA 2EGHA 3CINA 4JLUA 4UREA 2DBYA 4PGFA 1UXKA 3OO1A 4L85A 3A3PA 4JBGA 1ECJA 4WN3A 3RRBA 1VE7A 2BPOA 1BA3A 2X9NA 4CCYB 1AY0A 3DJYA 1KQFA 1TAUA 1YKGA 5G41A 2HWKA 1T8RA 4BQNA 2AOUB 2TSYB 2ZWVA 1STOA 4MHOA 4TL6A 3PRJA 3FWHA 3T7DA 1WMEA 3KKZA 1RYBA 3A1EA 3L8DA 4R9SA 1JDZA 4IXNA 4WOBA 1PE0A 2Q6OA 4HH4A 1EEXB 1T9AA 2VJNA 3GFVA 4RK4A 2VPWA 2XOEA 3OIWA 4MR8A 5FTMA 2H07A 3G1WA 3P2IA 4E2WA 4EYSA 2WSBA 1GNTA 4NZZA 1HR0B 3JWJA 2DECA 3VHLB 4O1HA 1M2GA 4G24A 1C3XA 4KKVA 4X1YB 4Z54A 1SZDA 4COKA 3EQ8A 3GJTA 2Q7DA 4Q34A 4ARIA 4OATA 5EIAA 2ABWA 4KFSA 3VYUB 4EG1A 4FCWA 4OKIA 1I2MA 2P3SA 1GAJA 1U7UA 1YASA 1FPQA 3MB8A 5EXTA 3WYCA 2PS3A 4BLQA 2PR2A 5L3SA 2VP6A 4NDZA 1JTEA 3KSDO 1C3VA 3FPLA 4F5YA 1L7XA 1PUXA 1EWKA 4BDSA 3EEYA 3IVXA 4I4TA 4M3NA 4PC2A 4IW3B 4IMRA 3UY4A 1IXSB 4ZEXA 4B6EA 3U3RA 1C4WA 1CZRA 1GYRA 4RTLA 1EP1B 4YPFA 1PL8A 3UJNA 2V7QD 4LDPA 4M1KA 5LYJF 2FDCA 2AHOA 1Z15A 4M0UA 1RI3A 2BR5A 2ETXA 2FCRA 1H85A 2QYTA 2H4XA 4Y6PA 4WXEA 4B6RA 2B8NA 2R1UA 1M6EX 3PNVA 2DTDA 5HIMA 2J0UB 3KXDA 1ES9A 3AKYA 4JVSB 5KX5A 2WIBA 5K8UA 1Z28A 4HAOA 2I7CA 2PT6A 3W78A 4ENRA 1F60A 5A3VA 1S2NA 2H4ZA 3KTAA 1I2AA 3BGOS 3DHWC 3ESYA 4RS4A 2IODA 1D4FA 3AEUB 1HY3A 4WVLA 2AK3A 2G1AA 4LE2A 3ZWXA 3I1FA 4Q1AA 2VAWA 1UJCA 2DX7A 3QVUA 4IQ4A 3PX7A 2OAGA 1U0SY 3QFSA 2KWIA 4NC9A 1JW9B 2ZIFA 2ZSHA 2ZIXA 4MUEA 4D80A 4ND6A 2DULA 3D7MA 4X44A 6REQA 4D4JA 1HXHA 1HYBA 1ZIYA 5L4NA 4W6QA 1RW4A 3DXFA 3H8VA 4ND8A 5CRIA 2IWHA 4AJ4A 5DB4A 3UFBA 1GP2A 1IUOA 3PGJA 1QX4A 4JGBA 4AK9A 4ZC8A 3VQTA 2A0UA 3GYBA 3RWBA 4ARAA 1Q3HA 4F12A 3K0AB 3ZYCA 5JE8A 3AUUA 3IYLW 2E0IA 3N58A 3NHRA 1O95D 3A1WA 3IA7A 3WZLA 3QK7A 4NQZA 2XDQA 4A0FA 1D6SA 1AG9A 1ZJJA 3KZNA 1M8PA 2IS1A 1N0VC 2DT8A 4BVFA 3AUYA 3ONEA 1YK1A 1Z2CA 1YA6A 3R74A 1EX1A 2PBRA 4HP8A 2NXEA 5EJ8A 1YGYA 4JUFA 3QKRA 3V8MA 5JPCA 1KSJA 4PLVA 4UM9D 5COQA 4L02A 5BVGB 2QOEA 2DPHA 5GP1A 1MO5A 2IOFK 4RMJA 5J2UB 5HW0A 1XRSB 4R8VA 1XJQA 3DMPA 1LV8A 2FGKA 4UU0A 2VSFA 4MYSA 1JJVA 5LZ7A 4EL5A 1RR6A 4O1MA 5DYYA 3NDBB 3ABIA 4AP5A 5DNWA 1A82A 3DMNA 4ENUA 4MV4A 1E6WA 2QA5A 2QXYA 4F92B 2Y1GA 3QOWA 3UZUA 3WTCA 4NK4A 1H23A 1ZD2P 1ADBA 1DIRA 1I51A 1RFGE 3EMDA 4OP1A 3GQVA 4LV8B 4LZWA 4AU1A 2FLWA 4P4SB 1CY2A 1U1DA 2OP0A 4KRXA 3KO8A 2C4TA 4HH1A 4TKZA 2FQYA 1GRVA 4L9SA 2PVCA 2Q27A 4UOEA 4UUNA 3UV6A 2XMGA 2VH2A 5BN5B 1K7EB 2HTEA 2QVGA 2YMLA 2BFDB 1UBTS 4M83A 3CKYA 2Y67A 4LA4A 4D5EA 3ZWWA 4D79A 4YXWD 2XWPA 2AGVA 4JSYA 3EVNA 1J70A 1NP7A 5DKFA 3K0HA 1CZUA 2R5FA 3N8IA 4E94A 1VM6A 1O08A 3PQ5A 4D5GA 5B4VA 1YJ5A 4II2A 4CQLA 1KRHA 4OUDA 5IAEA 1PU2A 1VHWA 4GOJA 1HNNA 4D81A 5ALQA 2QKYA 3F8SA 3R3UA 3UA4A 4BVEA 3UAVA 4A6PA 4N8EA 2TMGA 4YP1A 5J9FA 4MYCA 3F6BX 1LLQA 1W5AA 2WB2A 4MV1A 3R6LA 2WC1A 5HUQA 4I4TF 2A5JA 3DUFA 3JAWA 3ZXYA 2QTFA 3TRIA 3RW9A 4N0PA 1YKFA 2Y93A 4LOJA 2EATA 1KIFA 2IDMA 5TE9A 5H81A 8OHMA 5HJ5A 3QNUA 2J9FA 4Z9XA 1Y4UA 4LDJA 4L50A 4GNRA 1W59A 1RRFA 2VNHA 3R41A 2F1OA 1CK4A 1U3DA 3L01A 4LYAA 5IJZA 3P2MA 1C9KA 3NHJA 4DEXA 5KX5F 3G2KA 1IHPA 3GQBB 4ND2A 3QMMA 1BDMA 3ISTA 1NYTA 2GTHA 2FRXA 4E31A 2OPBA 2VJDA 5K0EA 1RRGA 4Y7DA 1SXQA 1GWNA 2ZJ2A 5DNVA 3CRZA 1Y3BE 4LC0A 1GYQA 2VK2A 2NV6A 2D5AA 2FMFA 3IHTA 4GYWA 3OIDA 4TWAA 5DM1A 4DSOA 4YCNA 1LEHA 2V7EA 1QPBA 4ZQFA 3S2FA 1E9RA 3KQMA 3L5KA 5ADUS 5KNBA 2V03A 1YVPA 4NJEA 1PHRA 1XKTA 2D62A 3R20A 1FSSA 1VCIA 2FTKE 2Q5JA 1RXUA 2XZPA 1YZYA 4FUQA 2WV9A 1ZGAA 4KG7A 4MAMA 4OMUA 5AQEA 5ETJA 4E5DA 4D9IA 5FBVB 4XWTA 5IDVA 1EVQA 3AL2A 2X0DA 5EKSA 3ROGA 3AJ9A 2JLBA 4BEJA 3RNLA 3WLFA 1J22A 4Z51A 3Q12A 3PXGA 4BZQA 3K9NA 4HNGA 2RB4A 1EGVB 3DBRA 3AF0A 3OI7A 1CETA 1G8FA 2YC4C 1SG6A 1XRPA 1MJ5A 2JFHA 5ERYA 5C1BA 1R4MB 3KKNA 1JMVA 4C0AC 5JYCA 3Q1LA 3NTOA 3RYCA 3MCTA 3MFYA 3V4FA 1MO2A 3UVEA 4G3XA 3TNLA 2IU6A 4PRYA 1MIHA 4U63A 1WPRA 1J2EA 4NZPA 1KQPA 4D9HA 1P0CA 1XCPA 3AKCA 4E5UA 1WUTA 1TK3A 1R6UA 2PSFA 1JZSA 4RFVA 2V5AA 1OWLA 2PL9A 2VT6A 1H22A 3OJFA 1M34E 2PZKA 1RZUA 3E7PA 2N42A 1XB2A 2HU5A 3DYVA 1K92A 1DO0A 1AHHA 2QN3A 2BM8A 3EBOA 3MSCA 3QY0A 4UEWA 2IHKA 1D0SA 3IQFA 4FW8A 5ENDA 3TLYA 3WBBA 1FUYB 1MFPA 2A9QA 4JX9A 3DMFA 2IIPA 4PNHA 3VR2D 5EP3A 1IH8A 5JBNA 2UZIR 3BWMA 3WYNA 3QH4A 5AI6A 3HA7A 1QF7A 3S5UA 3N2GB 5KEIA 3O4HA 4L57A 3UMSA 3O4RA 3WISA 1ADCA 1KDPA 2W4MA 2P9BA 3ANTA 3MJSA 1R8JA 4ILEA 1HT0A 4J91A 4F5EA 2E82A 2WFLB 1QIIA 2V9PA 2VWGA 1KFEB 3BTOA 2XD9A 4BNVA 1TMKA 3LGSA 1PEYA 5ESWA 1LUAA 4LYFA 4CUZA 2WWTA 4ZTUB 3RRMA 3WICA 5FORA 4UNRA 2NYRA 2W2LA 1OBVA 1RNLA 3B5IA 3IOBA 4GSKA 4GAEA 1WIWA 4UNQA 3V4PB 2M6RA 3IHWA 1NE7A 3R4CA 3W5HA 2IH2A 3DL2A 2Q3JA 1EI9A 1Y89A 3PLAE 1E1QD 4CCSA 4D4IA 2R6HA 1SFRA 1UBHS 2GHIA 3HYTA 1JFRA 3JQDA 3KZ1E 3L41A 3PI6A 5KVQA 5CVDA 5EIHA 3TW6A 5C4MA 1EXMA 1GV0A 1Y4SA 3QQPA 1NASA 4M22A 5E3JA 2HBQA 3DFKA 3HVJA 4OJQA 2RHJA 2WKPA 2X1HA 4ENPA 5EMHA 1T0UA 3A1FA 5JAUA 2H3HA 4X8OA 5CB8A 2IS4A 3PDIB 1QDUA 2PGOA 4JVOA 4J29A 1YV9A 3OX3A 4II3A 5TGDA 3NNSA 3RTEA 4N82A 1KH2A 1PFUA 4DUPA 3KZOA 4CVNA 1S02A 2V7XA 2A1UB 4I9HA 4MGEA 4X1KA 4K40A 3TM5A 3H5TA 4OQPA 1X1QA 1M1YB 4IDCA 5LU8A 4W5OA 3AXTA 1HDCA 3TRDA 1RCUA 5F73A 3VOAA 1J90A 1DADA 1TT5B 5B30A 4TUYA 2M98A 3PDCA 3RI3A 4UTVA 2IHNA 5FJJA 3ENNA 4RY2A 1XK6A 1SELA 5DBOA 1EA7A 1EFVB 2CVZA 4ZA2A 3O8DA 1DAEA 4L73A 3VAAA 5IAOA 1JFSA 4BQSA 2PUHA 1ZMRA 3AR4A 2BFCA 3D6FA 1YVDA 2FH5B 2XYQA 3LCRA 1JEYB 2J3DA 3GEHA 1E3DA 2DLDA 5JZOA 4A5SA 1XPOA 1O96B 1CUIA 3UQYS 3ASYA 1SHJA 2VXBA 3EXEB 5JO9A 4EFDA 1UF9A 2ZDHA 3H8JA 4LNAA 1YZUA 2I2DA 1AK2A 2QT0A 4DWWA 3S27A 2FEAA 1XVIA 2H08A 3TBFA 2IY7A 5CX1A 1WUKS 2C2XA 3TLXA 4Y0NA 5LR6A 1G21A 5BRJA 1XZKA 1JAXA 2HH9A 3DEHA 4DLKA 1WMSA 3GLHA 4PAQA 3QVGA 3DMHA 4XPIB 1FJXA 1CUVA 5EXDA 1CJUC 1H0KA 4F4IA 2J0QA 1JU4A 2PJDA 3AHCA 3B1ZA 4EM6A 1TEVA 7ADHA 1PNOA 1AQLA 3OWOA 3QVXA 3NAQA 2FP4B 1D5CA 1V16A 4PVDA 5M5BA 3EXFB 3GT7A 2IYTA 3QX9A 3B20A 1GOTA 2JS7A 5ER9A 1H5NA 1X8LA 1Q14A 1ZD1A 2QZPA 3AF5A 1OI7A 5HFNA 1MABB 3TWOA 3HDYA 3TDNA 2FSGA 3U1TA 2VK4A 3GX1A 3H3XA 2P2DA 3PJRA 1M2FA 1E4VA 4FOSA 2K87A 4GOKA 4NMWA 2AZ4A 1O57A 3GLSA 1JR3D 3CUEF 4ZGBA 3E70C 4LSGA 2JRLA 1OH7A 1OE0A 1NWCA 2X5OA 3ZG6A 3ZKAA 1P0IA 3T4EA 4BRZA 2YV1A 3MMXA 3TAHA 1FFXB 2CV1A 2XGJA 4TRMA 1Y1RA 1JJ7A 4D8UA 5KYNA 1P5FA 2HQSA 2YFQA 4EYQA 5LZ4A 3IO5A 3IIKA 4P08A 4ZDJA 4RA9B 4LHSA 2J4DA 2J9GA 1P2VA 4IMPA 3BCUA 2DC1A 3MTAA 5FL7A 2BUCA 1ZLXA 2F1IA 4QUGA 5CFNA 5JASA 4G1BA 3PR2B 3A6FA 3MJRA 1JSCA 3T0GA 4BFLA 1G8AA 1WTCA 3S2UA 2BEJA 1PD0A 4KVFA 1ZESA 3X3HA 1P2FA 2JLXA 3E1KA 1DBPA 1M0SA 2ZYVX 3LIIA 3PENA 3CH5A 4GL4A 2O3JA 1NDUA 3BAZA 3P4YA 4PWZA 3U1VA 3KSMA 3ZHRA 4BMOB 1KA9H 2WJZB 4KN9S 3W79A 4AP9A 4YCCA 5FLYA 2NZ8A 2NU7B 4OSOA 3EEFA 2GA8A 1V45E 3KEFA 3BMQA 3THYB 3AU9A 2AOXA 3UJ6A 3SJ7A 3LO5A 1ZHOA 1U9ZA 3H13A 3HC7A 4IJVA 2IYPA 1DG3A 2KW5A 2XCQA 4IMJB 1UFRA 1FNSA 3FLMA 2F1RA 3PUXA 1LK5A 4ZT7A 4LRUA 5B53A 1CVRA 5L7YA 2WTBA 3SBDA 4B47A 5HJEA 2X8WA 3TR0A 2D7DA 4FFSA 1IZ0A 4GPIB 4RVFA 2ID7A 3ZHYA 1PV1A 1JQ3A 1PYOA 2B1QA 4TUYF 5CURA 4RF3A 1XK7A 1NXQA 3D8RA 3QXGA 4QG7A 3T9AA 3ZTTA 2QD4A 4DYDA 4J0FA 1PR1A 3FNRA 1M2OB 4C2BA 5KOJA 4P0PB 2PVPA 4Y9TA 1DXHA 1P5RA 3AHJA 4FFVA 5E6SA 2R96A 3L02A 3LHKA 1XF1A 3R77A 1X1CA 4JLSA 3S2GA 5KNDD 1F8FA 1H2FA 3WGIA 1RXCA 5ENZA 2QX8A 2J9RA 4ZU3A 1RLOA 1VSUA 3A7EA 4H4CA 1BCRA 3TD2A 5LDDC 2FP3A 2R7NA 2OQVA 4TYNA 3SOZA 3PA6A 4Q03A 4YAEA 3O9MA 1YE8A 1ENYA 4XDYA 4WFKA 1KDTA 4EEXA 2PV7A 2LRHA 2I67A 2WHPB 3GA7A 4MIOA 1H2HA 3TUJC 2FQXA 2G71A 1PK7A 1BX1A 2O2ZA 3T5BA 4ARBA 3ZK8A 1KVSA 1TF2A 1YDFA 2RFLA 3B1JA 5LBIA 1V8ZA 4F71A 4RF4A 1HQYE 3CF4G 4K8RB 1RYYA 3LUGA 4KRYA 3JQGA 3ZDZB 3GAFA 2GXAA 3HU1A 4DNXA 1Q7RA 3ETHA 4KQKA 1P44A 3PQEA 4FOTA 1Z8FA 2H4WA 3IT1A 1BA2A 5T67A 1FBTA 3VSEA 2BFOA 1Y3IA 1IQ0A 3G0HA 4BV2A 3TEMA 3IHLA 3ZQ4A 3D0QA 4EGFA 2W42A 1J0XO 1Z5NA 2NNLD 3CRNA 3G89A 4UXIA 4Y7CA 1L5LA 4KZPA 3VGPA 5KJFA 4WLUA 4ZYVA 1SIBE 4YR9A 1FW8A 1DO8A 3U13A 3AL3A 4MYRA 4UULA 2RIPA 1OFTA 3FKSA 2AI1A 3OURA 4RZ3A 5BQPA 1IY2A 1MPTA 3QVJA 3ZWOA 3HJUA 4K6FA 4LFBB 5KVSA 1Z29A 1TT7A 3L6EA 4NKRA 4HDRA 4EAAA 1B1CA 2IZOA 1SG9A 1T2DA 5IXYA 2AKEA 2X7HA 4P0QB 3VU0A 4QFDA 3KP1A 5KQRA 4RBNA 3TRJA 2VHTA 5BOVA 4JA0A 1YIAA 4PCLA 3LDUA 4M1OA 1YHYA 1X0XA 2PLRA 4MQ4A 5HVNA 4TVSA 4NP6A 2O2EA 1VL6A 1E9DA 1SY7A 3QG1A 4B3HA 1I1OA 2V0CA 4FIZA 5DGHA 3RBAA 1YR1A 3CH7A 1U0OC 3ANYB 4AJOA 3C3CA 4H7IA 2VSYA 5FUXA 2OWEA 4RMNA 4DQLA 4ZI5A 4UOQA 2XUJA 1CY0A 2II6A 2NSJA 3RYIA 2WTAA 1A5AB 1QHGA 1P2TA 2VC2B 4DMUB 1ZUIA 1VHJA 2B8JA 4FN4A 1Q2UA 4K88A 2IEYA 1X7WA 2UYOA 2VL7A 4ZO4A 1BMTA 3ASZA 1J24A 4NARA 2C99A 2QRHA 5KSPA 4AZSA 4ZEOA 5KTPA 3C7CB 3F9IA 4XVUA 1A7KA 3WK7A 1G8GA 4CG0A 1YVEI 4M37A 3ND5A 4DVGA 3MILA 1W4AA 2ZAGA 1IVNA 1MAWA 2C1ZA 3UPTA 2R7KA 3MC1A 4MPTA 1YQXA 4NENA 1UBLS 3AZOA 2DUWA 1OX5A 2FG5A 3DBIA 4HUJA 4CLXA 5KYXA 5M34A 4MW9A 1I7SB 1YB1A 5G53C 3T5AA 1I7PA 2ECKA 3KDPA 3BRWA 3N0XA 2IGTA 3Q9LA 4GKBA 4JU8A 3IUNA 4BP3A 1ZEMA 1KZGB 3DKVA 3EVAA 2VOJA 4QEKA 3WKCA 4DSNA 1QKJA 4ESEA 2WAAA 5J1TB 3UEOA 4C4OA 5GJBA 4D8WA 2D7JA 1LPAB 1TUIA 2HMVA 2DPGA 1H4QA 5J47A 2UYYA 4MV0A 1CJVC 1TQ6A 1EZ4A 2JW5A 2H2GA 3EUAA 4LPSA 1O95C 2VJBA 1FRZA 1GNRA 4LGVA 4RK1A 4HDQB 2NXJA 4KJZA 2PYDA 1FOEB 3RAJA 3SSAA 4EJ6A 1V3TA 3M4NA 4NPHA 3KKLA 1ZAYA 2JANA 2JBWA 2A2ZA 3QX7A 1E4YA 1SKYE 2PWAA 3CV3A 3OLVA 4E5NA 3MGKA 4JHXA 2GCOA 1A9PA 1GIAA 1QZTA 4FS3A 4J75A 1V5FA 2X8AA 2ENWA 3C3JA 3ZY5A 1BHSA 3KQYA 4RADA 3STXA 3TL3A 2NSDA 2IQIA 3M2PA 3OPMA 4BIIA 1U5BB 1UH5A 1IBSA 2JFYA 1M2VB 4K9NA 4CGZA 4K1XA 4EATA 3CUUA 4ZYTA 3I5UA 3V32A 3RT9A 1UKAA 4EFLA 1J7KA 1NNI1 1R66A 2R1VA 1INLA 3C2QA 1XFDA 3KR2A 4ENSA 5M29A 2ZZMA 5C81A 3V3TA 2IHYA 4HRAA 4I14A 2BGTA 3O4VA 4P5PA 1JB9A 2A7XA 2P0AA 1RYZA 3FN4A 3G8DA 4DCPA 2OENG 3CX3A 3N2ZB 4CG3A 5I3CA 1AGXA 5SZIA 3UPDA 1KL7A 1OH6A 4JL6A 1MD9A 4BVHA 5IHXA 2GGSA 1PGQA 3TDKA 5TPZA 5IG2A 4PYLA 1FP6A 1E9FA 4QU8A 5AR1A 5K1ZA 4S04A 3UFXB 4AMUA 4YCSA 3THWB 5HNKA 2JPDA 2OBBA 2XEDA 3M9XA 3G5TA 3PFCA 1WXEA 4FZJA 1N2JA 4IO1A 4U8HA 5GONB 2FDXA 1FLVA 1NUQA 4N3GA 3HXPA 2OZPA 3S2ZA 5KWIA 3BILA 4XCVA 1T25A 2VAMA 2XUQA 3ICWA 3KB1A 5CFRA 3WP0A 1Q0UA 5JIBA 5FX2A 3X43A 3VH2A 1ATIA 1KSGA 1CB0A 4QGFA 2BW0A 2PUWA 2AL7A 3W1WA 3LQRA 5AESA 2ZKIA 4GVPA 3SSOA 5DMXA 3LFTA 5EJFA 3BHMA 1PS9A 5GJVC 4U7FA 1RJDA 3KSAC 3I32A 2XNDD 4GMKA 4E1BA 1EE9A 2WFZA 1CZKA 5AI8A 1JHUA 4D4HA 1VZ2A 5IZCC 3DH0A 3IC5A 4MVWA 5IX8A 3JD2A 3U31A 2Z6QA 3ZTWA 1PDOA 4Z1MD 1G18A 4RGQA 4A0RA 1K68A 2R6JA 3P71T 1O95A 2BKXA 2XMBA 1DV1A 1SIOA 2ZROA 3FCYA 3PEWA 3T3PB 1JJBA 4RF5A 4UXJA 2W00A 4QLBA 4GKAA 1TJYA 3RSHA 1YCGA 4CIDA 2VIIA 4HEQA 4B6FA 1IWPB 1JR6A 1RCFA 5ECWA 3ENQA 3GLQA 2DLNA 1MX9A 4EHJA 5IJ0A 2PUEA 2WBLC 3HVKA 1NMQA 3RC8A 4QVKA 2ZXUA 1ZUNB 1FTGA 5IDWA 1HX7A 3DLPX 3NV7A 2OG1A 3OM0A 3DA8A 3CNEA 2QTBA 1FFSA 2DGDA 1QVAA 5FFFA 3LQQA 1MOPA 4MCJA 2AX3A 3BZUA 2RCYA 4BP9A 2VTEA 2H29A 2GXQA 1BDHA 3G1UA 4Z9FA 1N0WA 2JK0A 4WK0B 1ODIA 5KSWB 1JDBC 1I9GA 1SM4A 3EGOA 2VQSA 4LJ6A 3SJZA 3UT5A 1OU4A 3HXOA 3DTVD 1VL0A 2BTQA 3BL5A 3MZ0A 4QJ4A 3RRNA 2GYWA 3UYKA 3CTMA 1DGQA 4PO8A 1MIOB 1ISMA 1F14A 4NS4A 1NL3A 2QRKA 3MWJA 3IUJA 2E49A 5K8CA 4MR9A 1YRHA 3HXMA 1GZDA 4AS1A 3OCCA 3FLBA 3PEFA 4POAA 5B1HA 4ND3A 1NXOA 4BUJA 1WBDA 4Z3DA 3VPBA 4HGYA 1W29A 2GHRA 1E64A 2WMDA 2GDJA 5AKGA 1F3LA 1Y1QA 2B8TA 1JEEA 1L4HA 1YOVB 2F1JA 2X0IA 4P9NA 1C3OA 1GQRA 5KYVA 3LFUA 4CL2A 3HCCA 3FTEA 1GO2A 1W85A 2PZFA 4B71A 5JD5A 4OK3A 3V8QA 1SWWA 3A0UA 2F1HA 1EFHA 4WBXC 2VTDA 1E60A 5HE9A 5IHPA 3CIFA 3OQMA 3T5CA 5AVXA 1XN1A 2VFAA 3DOIA 5DHFA 1VJ5A 3TZBA 1Y3CE 2JZOA 2QN1A 5JCXA 1QOQB 2DUJA 4LJ7A 3NXKA 4G9EA 2K7FA 1C0LA 4YJGA 3PCXA 4RD0A 1O8BA 2CFSA 1L7QA 4PTZA 1T5SA 2DQZA 5DOZA 5IZCA 1AMUA 1U0GA 4GWLA 1E9VA 4RKFA 2P6UA 5TQJA 4DQVA 3PF9A 1V8OA 1ZD8A 1EDDA 4N0MA 4L8VA 2IOFA 3N8KA 4M36A 3KBBA 1U1EA 1WU8A 3IXMA 5CA0B 4Q9AA 1V7QA 3HLKA 2X58A 3PFKA 4M6WA 4ZQGA 5G4KB 3WNCA 4YGYA 1ITZA 3D7NA 3HHPA 4RM3A 3HN2A 1CRZA 3HSSA 4G0UA 4TMVA 4C43A 2QM0A 2FQQA 4CDGA 3RCBA 2XADA 1A2QA 3V1LA 3ZY2A 2VHUA 5B57C 4WH0A 2GD0A 1U2QA 3V7FA 3QHQA 4FD2A 3ZHSA 2FB9A 5DOVA 2C61A 3SHQA 4JJGA 3WRXC 4D4KA 1UK9A 1RSZA 2MSDB 1GR1A 1NRIA 1R10A 3DMDA 1RWPA 1M83A 3FY4A 1LLFA 2PU5A 1LXCA 2HQOA 4TOIA 5JY6A 3DTYA 4TLBA 4PSKA 4QNNA 5J43A 2A57A 4RMIA 1YVRA 3PVSA 3MUEA 2O8CB 1DFHA 4KR7A 1YR2A 2IPLA 5HG0A 2G9NA 4G1CA 5JO0A 1VKNA 4DLLA 5A2QA 3AY7A 1F9EA 5FL3A 3RR2A 1IU9A 4URXR 5JFTA 3A1TA 5JMWA 3KNZA 1J00A 1M33A 3AESA 1RVV1 5KIAA 2XXAA 1B6RA 4BMPB 2XLCA 1N0UA 5JD6A 2DPLA 1HQKA 1QIEA 2YZGA 3CX8A 2FVXA 3ET4A 4LJ9A 5J59A 4LF5B 2BCEA 4BLVA 4D43A 3NKFA 1UWCA 1YIOA 2H1VA 2O6HA 3NBYC 2HCJB 4HN2A 4PBSA 4DSUA 3CUWA 2JC3A 4HAXA 5FUVA 5IWCA 5JS7A 5JMOA 3JYLA 1MJHA 3MPUA 1N4AA 3TKLA 2E2WA 3FZEA 2RI6A 3WKDA 3GFGA 2FA9A 1E5QA 4WNCA 5IT9A 2CUZA 5DIZA 1BX3A 4UVHA 3RJ5A 3ZWBA 5CDFE 1B2RA 1HPLA 3E9NA 1DUIA 4KTVE 3VZSA 5JBQA 3I6MA 1CFZA 4LHVA 1DT5A 4NBRA 1PHPA 1HZJA 5TNXA 2HIGA 1BGVA 3A2NA 1X1RA 2R44A 1P8JA 4G5QA 2Q0SA 4R69A 3SC2A 4ES6A 4YCMA 3FGNA 1TCUA 2H18A 4NYJQ 4ZT3A 1T6ZA 5F2EA 4KR6A 3PDJA 1UFQA 3VR2A 5KAPA 4H4EA 3S29A 1GTJ1 3RK0A 2ZJBA 5BNTA 1JR3E 3EK2A 5GINE 4NNPA 1NKTA 3KYIB 4QL3A 4FCVA 2XMDA 3KJFA 2OO3A 4KXMA 3L92A 1N2SA 5CYOA 3LUFA 2ZK7A 1V5IA 4C5CA 3PIIA 2JLSA 3H4VA 3ZCPA 4ZCMA 3PVCA 3D02A 3I72A 4BQPA 5HUJA 3K1ZA 2WP8J 3ZUGA 3QWHA 2QBYB 4QRDA 3E0XA 4CEIA 3EZ6A 4N0DA 5JC1A 3U44A 2IYQA 1R8SA 3IDFA 4FHDA 2V9ZA 3ETGA 4ZQCB 3WNZA 1R8XA 2W2TA 1RYFA 2F67A 4M87A 3MJHA 1XNGA 1JFFB 2FSSA 3VZPA 1Z0UA 1PKXA 3KK0A 3WRXA 1OAKA 2EZUA 1DRWA 3F7MA 4YC7A 5G3YA 5LQJA 4HDSB 2QVBA 1W47A 3COZA 2VPXA 3G7NA 1V2GA 3LCMA 4IFTA 4OIMA 5EKUA 5HCNA 2XYGA 5LC1A 4A2CA 1G5FA 4PANA 1Q21A 4Z8XA 4JLMA 4YRAA 1SC9A 3IKVA 2B7CA 1JBEA 3QYAA 4FCTA 4UHKA 3DAPA 4WKGA 5KJEA 1IYZA 3TZHA 2YIDA 4D2IA 3JRNA 1CQJA 1OYYA 2B34A 3GCWA 4WNYA 5EIWA 3U4CA 4H18A 1DI0A 2FZEA 3MWEA 4NL4H 2GB4A 3AR3A 4UHCA 1CUYA 4KXNA 4URHA 3UW3A 4EPXA 5JXHA 1MQSA 4JGGA 2M6KA 4CL3A 1DLJA 3BSYA 1UJMA 5DTMA 1WMAA 1F8UA 4GIBA 3PCRB 4ERXA 1ZW6A 3ON5A 4JASB 3WHLA 2IF0A 3S7TA 2QK4A 5EMMA 3NV9A 2J46A 1XHLA 2NV2B 4J94A 3ZLUA 1GITA 3HKCA 3UANA 2PX0A 3D8TA 3BH7A 3ENVA 1P2BA 3OJLA 3ZV6A 2H1RA 3L06A 1LC3A 5LP6C 3RANA 1E3LA 1NMSA 3IIJA 4Z4EA 1NW6A 1ADYA 3VKGA 4WEOA 2CF5A 1ICIA 5B2ZA 3A1UA 1NPYA 4QUHA 1FDOA 1ZN9A 1K4YA 2ZI4A 2CLLB 1K86A 1CBUA 3AHDA 3ZIUA 3PHGA 4BFXA 4BO2A 1C8BA 2GQ0A 3RVLA 3DL7A 1IY1A 1SBZA 3K6KA 4JC8A 1PWZA 4B3JA 5C18A 4U0JA 3Q98A 1A9RA 4D0LB 2K2QB 2UDPA 4DSTA 5IM5A 2C03A 3D54D 1LDGA 2YWEA 2IDJA 1SUEA 4RHEA 1FYDA 2UVPB 2GEJA 5ALYA 1D6MA 3OZWA 4R68A 5TMPA 3CXRA 4GS5A 3KZKA 4BTLA 5K3FA 2EFHB 2V4ZA 2OV8A 4KDEA 1NN1A 4EITA 1ZM7A 2QTZA 4CBVA 2Y05A 2IIQA 3ZD9A 1I3MA 3O8OB 5D5PA 5I45A 2ATEA 5B12A 1V48A 4O1IA 1XUOA 2IY8A 3M9LA 5F78A 2O8EA 3I2HA 3P45A 2YXBA 4YUXA 3ZY3A 4DR6B 1X7YB 3NHLA 3OZ7A 5AM0A 3A28A 1E2JA 3R7LA 2DQSA 5CXXA 4LKOA 2XUKA 3Q9SA 3I52A 5AOBA 5F76A 2IV3A 2HNKA 2PK3A 4PHCA 4FKMA 3B8EA 3FYSA 1ZC4A 4RQTA 2OMKA 5JCOC 1GGEA 3NOQA 3P0IA 3WO1A 4Q1EA 1RM5A 3UB2A 1VG8A 1BFDA 1JLLA 2R8OA 1C7ZA 3BMNB 1ZNWA 3JVIA 1WDKA 3O2JA 3PHCA 3T1OA 1PK8A 5DM2A 1YFJA 1QK3A 2XDAA 1U3GA 1XZBA 2DT5A 5B58C 2O06A 5LM3A 1QGDA 1DCFA 1T1GA 5KYYA 1ZA2A 3PXUA 3G3EA 3MGGA 5GVRA 3GU3A 4MDEA 5CJJA 3RVJA 4FGLA 3PPXA 1ID8A 1NBEA 4O25A 2V54A 1A5TA 1UBJS 2ZIAA 4HUQA 3ZIAD 2GCGA 2ZPUA 4BYGA 4PX3A 4EVQA 5LP6A 4UTNA 4YBZA 1OFUA 2GD2A 5TJ9A 4BGIA 1ZQ9A 4J16C 4EGAA 1SA0A 2WM3A 4XFDA 3DYBA 5JU6A 4NDAA 1X7ZB 3KZXA 2MSLA 4HGNA 2DYKA 3L4BA 4HNQA 4ZKDA 3T5GA 3ADOA 1G42A 5TPWA 4L51A 1S01A 1Y5MA 4PHFA 1Z0KA 1W0JD 3PGVA 1T6BY 4MVYA 3VUFA 1AXEA 5IZ4A 1G5RA 1OT5A 3WFJA 1TW3A 1AHIA 2XDYA 2BMDA 2YNMD 3WB1A 4MUMA 4NQRA 5AM5A 1H0SA 4TZ6A 3E7FA 5EJ9A 1XVVA 3AXSA 3A9TA 4DHEA 2QIPA 1K75A 3AR6A 3QXSA 5AP9A 4EO9A 4YUAA 1Z82A 4UTOA 1OVGA 3CE9A 1P2DA 3U0BA 5KNDA 3DOEA 5D1HA 3PR1A 3IODA 4BLWA 4QREA 4AROA 5EP2A 4D45A 5B6PA 1LVGA 3B6IA 1HDRA 1DTEA 1GQSA 3NIWA 3IL2A 3OFVA 2FLVA 1L7PA 3E22A 1SCQA 5ALPA 3O3OB 2B2CA 1G4HA 4GSLA 1OX6A 1ZOSA 1EQ2A 4UU1A 2E4UA 2WF9A 2J6CA 1Y5RA 4TWIA 2JI4A 3UICA 4DCGA 2QTCA 3D6AA 4MQFB 1V3QE 4IG4A 3TE6A 1U9YA 5JCOA 2R8BA 2BN4A 2HRZA 4DSZA 1N6OA 4H9GA 4G23A 2FW6A 2FN4A 2VJMA 4ZKEA 4YJ2A 1V4BA 3URKA 5LOVA 1RZ3A 4S1WA 4KPYA 4UDNA 4FYPA 4IHKA 1N2EA 3U4AA 2W90A 3I9LA 1DEHA 2IZZA 3QUBA 1IVYA 3PBKA 3OCXA 4EI2A 5I5EA 3QKSA 3SR4A 1RLTA 1Z75A 5FPYA 3DZGA 3B6KA 1N6PA 2HHLA 3HDVA 5C37A 5KYUB 5C4GB 4N7JA 3LWZA 1ZMOA 3LZ6A 4UVEA 4FJ1A 121PA 3KKEA 4JU9A 1Y9EA 3EPLA 3OFNA 3CWZA 2O8DA 1HG1A 3R3JA 3QYJA 1TKCA 3BBLA 2A1TR 3C8DA 2AD5A 4IWNA 1J1ZA 4S1VA 4XYBA 3T7RA 3TVTA 5ITZA 4DIUA 4Y18A 4OJNA 1EK2A 1UKCA 2B61A 4CMIA 4LF4B 2J33A 4J16A 4BJ3A 2PQ2A 1PDVA 5JROA 2JAPA 2O50A 4FZRA 4J8PA 4ZO7A 2GEUA 2DFDA 5GPBA 3SHTA 3UUFA 2NZVG 3KPWA 5FR2A 3F9CA 4DR1B 2X42A 1JE0A 3VTKA 4ND1A 4GQBA 5DASA 3G85A 4PSDA 3PUWA 2ZR7A 2Y1CA 1Z6AA 3F4KA 1NJ1A 3D4IA 3ND8A 3L3BA 3DC7A 4GFDA 1CEEA 1Z8DA 1F5SA 2O2DA 1L3BA 2EZTA 2QW0X 4QXAA 4X45A 5CW2A 1SPXA 1G20B 4JHLA 3ZGVA 1KARA 5LP6F 2B9EA 2JFOA 4KQCA 4IIYA 3EARA 4OUKX 2H59A 4CMGA 5MHTA 3MRVA 5BQOA 3GV0A 3VR3D 4W9MC 3EW7A 1U4OA 3KLBA 4FINA 4LZPA 4N5MA 5BMVA 4N48A 1QANA 3B1YA 2PUCA 2L2QA 2RDMA 5AVVA 4HX5A 1HE3A 1XQWA 4ZREA 1UMDA 1FFDA 2HSEA 1SH7A 3N6RA 3QWFA 5GQSA 1UT6A 3EZ2A 5FBHA 3EDRA 4AJKA 3SXJA 2JHGA 1SXJC 2AOTA 1R74A 1SHKA 4I0WB 1U8TA 4KQMA 1S3SA 4MIYA 5JG7A 4C87A 3IFSA 2O3RA 5IBCA 4PZYA 4R84A 1ZD4A 3HMKA 4WZBA 4ZRDA 3IQZA 3FF4A 1EFRD 2CFTA 3UC5A 2NTYC 4EQ6A 1D2CA 1UM9B 5B3JC