3MQ2A

Crystal structure of 16s rrna methyltranferase kamb
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
MRRVVGKRVQEFSDAEFEQLRSQYDDVVLDVGTGDGKHPYKVARQNPSRLVVALDADKSRMEKISAKAAAKPAKGGLPNLLYLWATAERLPPLSGVGELHVLMPWGSLLRGVLGSSPEMLRGMAAVCRPGASFLVALNLHAWRPSVPEVGEHPEPTPDSADEWLAPRYAEAGWKLADCRYLEPEEVAGLETSWTRRLHSSRDRFDVLALTGTISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA methyltransferase
publication title Structural insights into the function of aminoglycoside-resistance A1408 16S rRNA methyltransferases from antibiotic-producing and human pathogenic bacteria.
pubmed doi rcsb
source organism Streptomyces sp. dsm 40477
molecule tags Transferase
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mq2A00
1D2CA 1JG2A 2P35A 3X0DA 1ZGAA 3FTCA 3G7UA 3LDFA 3PB3A 4PIPA 4BLUA 1AV6A 2AN5A 4X41A 3OFJA 2QYOA 1NW7A 3CBGA 2VZ9A 3CCFA 4ER0A 10MHA 2NP7A 2ZFUA 5CVVA 2XYQA 2ZWVA 3LX6A 4RTLA 3HVKA 1NV8A 2CWWA 2PT9A 3MCZA 3PX3A 3S68A 2ZZKA 2E5WA 3AY0A 3VYWA 1SKMA 3QOWA 1RI3A 1JQDA 1X1BA 4HG2A 5EHGA 2FCAA 3VSEA 3FUXA 2FHPA 2ZVJA 4PNEA 4EK9A 1FP2A 4HC4A 1Y8CA 4HRAA 4YV2A 2JG3A 4RSRA 1R8YA 2Y1XA 4HTFB 1BOOA 4E2WA 1L1EA 3FPGA 1YUBA 5F2OA 5LQJA 1O54A 3TR6A 2AS0A 4PIMA 1NKVA 3TM5A 3MCTA 2G8NA 1NBHA 1QANA 2ZIGA 5GM1A 3RODA 1JG4A 3GRYA 5KQSA 3GIWA 2H00A 1PJZA 3EVFA 4PINA 3AJDA 5ICEA 1VPTA 3V8VA 5E9WA 2AVDA 3CKKA 3P2IA 3G5LA 3ORHA 3ME5A 2Z6UA 1TW2A 2P7IA 3B5IA 5E2AA 2PWPA 5K0EA 3GRUA 1H1DA 4DCGA 4E70A 3UBTA 3LCCA 3C0KA 3HTXA 2HTEA 2YUIA 1QZZA 1Q0TA 3FPFA 4GC5A 4U7PB 2JHPA 5K0BA 9MHTA 3MGGA 5DTQA 3HM2A 1XJ5A 2PKWA 4YUVA 1KYZA 4X63A 4E2ZA 1RI4A 4Y30A 3DULA 1G8AA 4AZSA 4P7GA 3L8DA 3BGDA 3DP7A 3UJDA 3KQVA 2ZZNA 4DM3A 2ZZMA 2AOVA 4GF5A 4DMGA 2ONYA 3FUWA 4KW7A 3FPEA 2EX4A 2K4MA 5E9JA 2VDUE 4DA4A 1EQAA 3UJBA 2OBFA 5DRYA 2IBSA 4CXMA 2AOUA 2B25A 1NV9A 2GPYA 3LKZA 1IXKA 3A26A 3EVZA 4OBWA 5DRTA 2NYUA 1R74A 3CJRA 2PX5A 3EVAA 1WXWA 4IKPA 4DKJA 3HCBA 3IEIA 4JXJA 4QVKA 5HOQA 5GM2A 4KIFA 1NBIA 2PX4A 3KHKA 5FQNA 1Q0SA 2IPXA 3B3FA 2FRXA 2VDWA 5KS2A 1JG1A 3LPMA 1JTEA 3BKXA 4KRGA 4XCXA 5B1SA 1NW5A 2JHAA 3T7RA 1YF3A 4RTRA 1O9HA 2AOXA 3KR2A 4P58A 5DWQA 2C7OA 4PYLA 3PVCA 4YMHA 2YR0A 2VDVE 2Z6QA 2ZBPA 1IY9A 4GC9A 1VP3A 3DXXA 3UJAA 1SVUA 2HV9A 4U7TB 3LKDA 3BUSA 4RTQA 5GP1A 2G71A 3H2BA 1I1NA 3TFWA 4BY9E 5HIMA 5LQUA 4MQ4A 5EMLA 3R24A 4X60A 1N2XA 3EEYA 2JH9A 5EMKA 4RTSA 3MTEA 3AXSA 4QPPA 1EG2A 2C7RA 2ESRA 5EHIA 4C04A 3CGGA 3KKZA 3LCVB 2IBTA 1Z3CA 2XVMA 3FZGA 4IV0A 1O9GA 4GOMD 2P3LA 4QDJA 3TKAA 1KR5A 3T7TA 1R00A 3A25A 4C05A 2I9KA 1QAQA 2PXAA 5GWXA 4CKEA 3LBFA 5CUQA 4ZTBA 2ZCJA 3EVGA 3REOA 4AUKA 5K0LA 3O31A 3R0QA 2AR0A 2O57A 2PXCA 1UFKA 4M37A 3UJCA 4DQ0A 3G2PA 2IH5A 3PFHA 5C9ZA 2G70A 4PCLA 2UYCA 1JTFA 5FWAA 5FA5A 3NW9A 2AOWA 3LHDA 5U4XA 5ERGB 5DXAA 4WXHA 2QRVA 2PX8A 3MHTA 4YUXA 2IP2A 2QM3A 1PRYA 3MAGA 3RW9A 5LQNA 5D1NA 3KPYA 5HIJA 4MTLA 3KR1A 3SX0A 2UYOA 2O06A 1TPYA 3G8BA 5M5BA 3UJ7A 5IH3A 3MTIA 1R6AA 3P9IA 4F86A 1SG9A 3EGVA 4FSXA 1YZHA 2OB2A 5EMMA 1RJFA 1B42A 5K0JA 1QAMA 4AX8A 2BR3A 4RV9A 4RYLA 5EEHA 4L7VA 5E8JA 1AQIA 3K0BA 4ISCA 3NDJA 1IM8A 2GLUA 3B7PA 4E30A 3MERA 2R3SA 3FYDA 2EFJA 5JUWA 2B78A 3I58A 4CTJA 1JG3A 1FPQA 1SQGA 1OR8A 2H1RA 3EMDA 4QQKA 3SMQA 3OZSA 2WK1A 4OA8A 1X1CA 2NXEA 1KXZA 5EVJA 4E2YA 4ER6A 2PWYA 3E8SA 5DT2A 3LBYA 4AZWA 4MWZA 4F84A 1XVAA 4RTNA 2C7PA 3KU1A 7MHTA 3OE4A 1HMYA 4K6MA 1WS6A 5G02A 3FPJA 5MHTA 3PX2A 3KR9A 3HNRA 3R6TA 5CVDA 5EZQA 5IKMA 4KDCA 1M0EA 1JSXA 3G8AA 2P3OA 2N47A 2PJDA 4AZVA 2C7QA 3G5TA 4RTOA 5CCBA 1EIZA 1P1CA 2PVCA 2ZBRA 3ID6C 4MIKA 4P7KA 4AZTA 3I64A 5BW4A 1RI5A 4X1OA 5CVUA 1RJGA 3LGAA 1YFLA 5C1IA 2BZGA 3C3PA 2JHCA 1KPIA 1DUSA 3B89A 3U81A 3P9NA 4CKCA 5K0NA 1R8XA 1TW3A 5BP7A 4M7RA 3NJRA 4FZVA 2ERCA 3ELDA 5FADA 3B3GA 3GJYA 4M36A 4RWZA 2VP3A 5T67A 2EJUA 5K0FA 3GWZA 3BT7A 3E7PA 1BKYA 3HP7A 5DSXA 5EZSA 5GINE 2ZULA 3GU3A 4HTFA 2PSSA 2P40A 1XDSA 3A27A 2OYRA 4BLWA 3JWJA 3GO4A 3P9KA 4P7JA 4YV0A 2IDKA 4QPNA 1INLA 5BXYA 4PYIA 4PYKA 1WZNA 3TQSA 3RIEA 4OX9Y 5DX0A 3I53A 3GCZA 4NECA 3DMFA 4PONA 3E23A 5LQRA 5GIOE 1DL5A 4POOA 3NDIA 3BXOA 4RTKA 2B9EA 3KQTA 4HGZA 3NTVA 1KHHA 3HCEA 4MHTA 2GH1A 1NT2A 3TLJA 2OZVA 3G89A 1ZGJA 3FUUA 3FUVA 2EG5A 4DCMA 4LG1A 3TMAA 4PGGA 1D2HA 4R8RA 3UJ9A 4OBXA 1YFJA 5EC8A 3HA3A 4EKIA 2KW5A 2BH2A 2AOTB 4V0QA 1NE2A 2IH2A 1F38A 1VBFA 3AWIA 3R3HA 5LSAA 5E1MA 4A6EA 2XYVA 3BGIA 1YZ3A 5K0CA 2YX1A 3THSA 3IHTA 5EMJA 1KIAA 3HVJA 3KQYA 3SR4A 5LQCA 5K05A 4RTPA 4DF3A 2AVNA 4EQZA 2GA9A 3GRVA 3E05A 2IIPA 3A7EA 3CC8A 5D1HA 5FHQA 5KYGA 2I62A 2ZIEA 3DMHA 2UYHA 3FTEA 5F2NA 1KYWA 2ZWAA 5EIFA 4E2XA 5DX1A 2ZW9A 3V97A 2A14A 2ADMA 3M70A 5K09A 1QAOA 2FK8A 5T64A 3UJ8A 3OFKA 2B3TA 4BP3A 3MQ2A 4G56A 2FK7A 4CKBA 3FUTA 2LD4A 1V39A 1BHJA 4RTJA 2V7EA 3G2OA 3HCAA 4KIGA 5C0OE 2IDJA 5HILA 5DM2A 2PX2A 4QTTB 4YUYA 3OZRA 3DTNA 3OE5A 1L3IA 3BKWA 3DXYA 4RTMA 2BR5A 4Z2YA 1SQFA 5K01A 3KPUA 2PXXA 2WA1A 3LL7A 3LSTA 1RJDA 1L3BA 3JWHA 2OB1A 3PS9A 4FT4A 1XCJA 3HEMA 2XVAA 5CD1A 2ZIFA 4GUAA 3KQOA 1XTPA 5DLYA 5HIIA 1EJ0A 2ZLBA 3HVIA 2ZSUA 3CJTA 4FT2A 3EVCA 2HR1A 3G2QA 1NW3A 5HZMA 3C6KA 3Q87B 4F85A 4HGYA 1UIRA 4RVDA 3DR5A 4C03A 3D2LA 2PBFA 3M6XA 3KQPA 4IV8A 2QY6A 3M6UA 3T7SA 3TKYA 2PY6A 4YUWA 3BZBA 5E9QA 3AXTA 3OU6A 3DLIA 3OU7A 4FGZA 3I5UA 3QOXA 3DXZA 2ZBQA 2G1PA 1XDUA 3KR0A 3NWEA 4OQEA 3DMGA 3CVOA 1AQJA 4BP1A 3EPPA 3C3YA 2CKDA 3EVBA 3GDHA 1X1DA 4FP9A 4GOND 2WA2A 3G88A 1N7IA 5DX8A 4EMSA 4UOEA 3HA5A 3R9XB 3PLAE 3F4KA 4PCAA 4EVIA 1XXLA 3OPNA 1I4WA 4IWNA 5E1OA 5CIYA 3DLCA 4FSDA 4KWCA 2PGXA 4R8SA 1T43A 2PT6A 5EGSA 2GS9A 2YQZA 3P9CA 4YUZA 1I9GA 3A7DA 3HVHA 5DTMA 1P39A 2FYTA 3A4TA 5GOZA 3P97A 5P8WA 1RI1A 1ZG3A 4KVZA 1M6YA 3BWYA 4OA5A 2V74B 5CVJA 1JSZA 3G2MA 4Y2HA 5BW5A 2AZTA 3LECA 2CMHA 3BWCA 3EGIA 3FYCA 4EKGA 5DTRA 5DPMA 2YXEA 4GOOD 5EG5A 2P3QA 3K6RA 5CM2Z 1VIDA 5FHRA 1EAMA 4RVFA 2XBMA 3M33A 4HH4A 5HIKA 4PGHA 1FP1D 3SGLA 1FBNA 5T6BA 1VE3A 4XUEA 4B17A 5DM4A 4ATNA 2EJTA 2AN4A 3OZTA 1SUIA 1G6Q1 4DZRA 5JR3A 3HCCA 3TOSA 3P71T 1EJ6A 2Q41A 3KQSA 5LR6A 2QE6A 2HWKA 3FRHA 1AF7A 3FPHA 4PYNA 1U2ZA 2ZTHA 2Y1WA 2YXDA 1UWVA 1G55A 3GRZA 2B2CA 4E31A 5GIPE 2UYQA 4C4AA 4A6DA 1WXXA 3PT9A 3THRA 4CWAA 5FQOA 3ANXA 3TPZA 3HCFA 3EVEA 4H0NA 5FA8A 2IFTA 2PLWA 3JWGA 3KQMA 2AOUB 3KPJA 3M4XA 3SSOA 1KPHA 1JQ3A 2F8LA 5DM0A 4FS8A 3UJ6A 3SXJA 3PFGA 4YMGA 1ZKDA 1WG8A 1RJEA 3FRIA 4WVLA 3EMBA 5ICCA 3DH0A 3C6MA 4PWYA 2OO3A 4R6XA 5EIWA 3VC2A 2CL5A 5K03A 4ER3A 2BM9A 5HEKA 5ICGA 4E32A 3SSNA 1QYRA 2DPMA 1G8SA 5EKXA 4R6WA 5EPEA 1VLMA 4XUDA 2NXNA 1NW6A 1SUSA 4PYOA 2Z6AA 1ZHFA 3M6VA 3TM4A 4PYJA 1ORIA 1XDZA 2JH8A 2O05A 5CVEA 3ELYA 3KQQA 3PTAA 3NVMB 4BLVA 2NNWB 2CMGA 1RI2A 3EGEA 2VS1A 2AOTA 2P7HA 2NP6A 3P2EA 3I9FA 1BC5A 3ERCA 3BWBA 4C07A 2JJQA 2ORED 2HMYB 4YV1A 3OU2A 1G60A 2FPOA 2I6GA 2NXJA 5E2BA 2OPBA 5EOVA 2GAFA 2O07A 1D2GA 3WSTA 2ONZA 3GNLA 3HA7A 5E1DA 1KPGA 1YB2A 5KVAA 2O0LA 3BGVA 2IH4A 3UA3A 4GEKA 5F2KA 3GXOA 3DUWA 5FWDA 4CTKA 2R6ZA 3IV6A 5CCXA 5FCDA 3VC1A 4LECA 3P8ZA 1JR4A 2PV0A 4QVGA 1MHTA 2P41A 3GRRA 3QV2A 4RVGA 5LQKA 2YTZA 4ER5A 3ELUA 3O7WA 4V0RA 3BWMA 5K0GA 1R18A 5H02A 4KDRA 4PYQA 3UZUA 3NVKI 1HNNA 4C06A 1JQEA 1ZQ9A 5LQAA 1VL5A 3P2KA 3NWBA 1DCTA 2I7CA 4RX1A 4QTUB 3LCUA 4LWOA 3GGDA 1G38A 3FTDA 4FR0A 1VQ1A 3M6WA 1ORHA 3KPVA 3EVDA 5EQJB 1M6EX 4OQDA 3SM3A 2YXLA 2QRVB 3FTFA 1F3LA 3UA4A 1MJFA 3JWIA 2UZ4A 1XCLA 2GB4A 4QDKA 2H11A 3SSMA 2BR4A 5EEGA 4ER7A 3HCDA 4PYMA 3ELWA 2XYRA 5KQRA 3B3JA 1VP9A 2P8JA 3LDGA 5DSTA 5K8VA 5DXJA 3LDUA 4E33A 4LWPA 3ER8A 4M38A 1P1BA 2G72A 3IYLW 2IGTA 1L3CA 5FTWA 2OXTA 1NW8A 4GBED 3UFBA 3UWPA 3EEOA 2HNKA 5ICFA 4P7FA 4O29A 1N7JA 4QQNA 4HSGA 1KP9A 1X19A 5FUBA 3T0IA 5E8RA 4GQBA 5DM1A 2DULA 1FJXA 4XUCA 3O4FA 3TRKA 5FULA 3ER9A 4X61A 1L9KA 2OKCA 3NMUF 4RVHA 1P91A 5EKUA 3DOUA 2BM8A 2NXCA 3KPWA 4R05A 8MHTA 4GOLD 2AN3A 3MB5A 3OCJA 4C08A 3Q7EA 5HFJA 1WY7A 1X1AA 2OY0A 2YVLA 3SVZA 3CJQA 5E1BA 2P1DA 3KQWA
chains in the Genus database with same CATH superfamily
1E0JA 1YQQA 4QPJC 1JG2A 4G23A 4OYYA 1QGUB 1S2OA 2AN5A 5E0OA 1EBBA 2AWOA 4X41A 3NH9A 1G9SA 4ID9A 5H3HA 1B2RA 1R0ZA 4LQCA 3G85A 1CYDA 3QKRB 1P29A 5A3SA 4G5QA 1P73A 3DHEA 3F4BA 1P2GA 3NHFA 3RRFA 3ZDYB 1L8QA 3EWNA 3AWDA 1YU6A 2HU5A 3GH3A 4X7PA 5CVVA 5IXJA 5JD3A 2A5GA 2QG6A 2DWUA 5DLQC 4NJOA 1E2PA 1YAJA 3LT4A 5CR9A 4BMPB 1BG6A 1UMCB 4D02A 4NLLA 1U3CA 5T7BA 2QP4A 2H1OA 4RW0A 2I7TA 4D2IA 2EKZA 3CLKA 5EHGA 4I1RA 3FF4A 1UBRS 2VCYA 3DFIA 1JZQA 1P72A 3PQEA 2QMEA 3BD7A 4PNEA 2WSLA 3RRBA 2OMEA 3U62A 2C3OA 4E2WA 4W5TA 2BGGA 3VC7A 4BJ1A 1XWWA 4XM2A 1CY0A 2PJUA 5EWLB 2JLUA 1QMGA 3KBBA 4XJVA 2OFXA 3BCSA 5EYPA 3W7BA 1T4CB 3HV0A 3SHQA 1LBQA 2YJZA 5BV7A 2R62A 2JW5A 5E2AA 3KJZA 1QIJA 1G98A 4RHFA 3LX5A 3IBGA 4LGVA 4JKOA 4AI6A 1IN6A 4LYAA 1GPMA 2C4UA 3GFTA 2XBLA 1XLWA 4UMFA 4D3SA 5CFMA 1QM5A 9MHTA 1LK0A 4URZR 3COYA 4YN3A 2JLWA 2PANA 3MPUA 2GRJA 4J76A 4WNCA 4LXUA 5FNVB 1ZMXA 1TKRA 2B2XA 1T5SA 4ND4A 5LB4A 1B43A 4EHLA 4EJSA 4GWKA 2ST1A 3RS3A 3MOSA 5DRYA 3VZPA 3HWRA 1MV5A 1TFUA 2VWHA 3D0OA 2D54A 4DA7A 3DOOA 4X1IA 4RPJA 2IRWA 3RVMA 1UEXC 1FJHA 3CUWA 3LLSA 5L53A 5ICMA 4G07A 5B7NA 3W2EA 5C7YA 5IMBA 3CNEA 4EQ6A 3HUDA 4JUAA 3U4MA 3G49A 2ENUA 1E2NA 1ZD3A 4XCXA 1FDOA 5B1SA 4MV7A 3FAKA 3WMGA 2CXSA 4F1JA 2DETA 1GR1A 3G0BA 3KR2A 3NFYA 4X0EA 1JKXA 2P5TB 1NG9A 2ZBPA 3QF4A 3MT7A 4X64B 3PF8A 2JJ2A 4PAGA 5IDQA 3EZYA 4OGFA 1JHYA 2X8AA 4ZKEA 4ZC1A 4JZYA 3JQQA 3LKDA 2H1CA 1J49A 2C42A 4IBOA 1NP6A 4PG6A 4B3TB 3T9CA 4BV2A 1ZH6A 4J7CA 1S02A 3WG9A 1MP0A 3OLCX 3MJ4A 3F3KA 5CNIA 1JR6A 1Z6AA 2I3DA 3RC3A 2R1ZA 4DNXA 3QGMA 1J22A 2RKOA 4Z9BA 1P6XA 4PQEA 1H94A 2CNBA 4EHKA 4UBJA 4HDMA 1PD0A 5JMPA 3WWYA 4F3NA 2GGSA 1Q2UA 3EEBA 4W5HA 2I6UA 3MT9A 3QA9A 4R4JA 3KFXA 1RYHA 2BONA 5C2JB 3A05A 1DIAA 1P8AA 2GCGA 3RC9A 4M1MA 2W6IA 4KAAA 4R0MA 4V2UA 1QIEA 3OOJA 2IE0A 4CV2A 2PXCA 4H59A 3E70C 4MVJM 2KLBA 2KS6A 3RAJA 2XMRA 4FOPA 4GGPA 3WBKA 7MDHA 1E6CA 1K7EB 4GMFA 2QZPA 1FSGA 2WM2A 2XE6A 3WNQA 4PLFA 2VXOA 4LNUA 3ZEIA 1ULUA 4CIBA 1AD2A 1Y1RA 3QFFA 8LDHA 2LR0A 5CFLA 1U90A 2ZP1A 1GPH1 1NONA 3NYRA 1HFEL 1RFGE 2OM2A 1PEDA 3IQIX 1N9KA 3CM0A 3VBCA 2I2BA 5HS4A 5JS8A 1X92A 3CLUC 1MIOA 6AT1A 4L74A 4ACBA 8OHMA 2H4FA 5TMEA 4HQNA 1RJFA 4NU8X 2FWMX 4AMVA 4UQLA 2A0XA 2ZKIA 3WGLA 4AX8A 5JXGA 4K0KB 2AA3A 2JLVA 3VYVA 4EITA 1AQIA 2G9ZA 1P1RA 4FCTA 4JITA 3DBRB 4ND5A 4F3RA 2GWHA 4ZT7A 3ESCA 1VRWA 2CNOA 1R66A 1TGVA 1U1EA 4I3GA 4HV4A 1GG5A 2GYVA 4KU4A 1ACMA 1JHXA 3T5DA 2MWMA 3VR4H 3VR1A 2B78A 2ZJAA 3KAPA 1DAKA 3ZWDA 1T1EA 3PHJA 3UK0A 3HEBA 2Q8NA 3WHLA 2EZ8A 1LQTA 2CCGA 2QUJA 4I3HA 3KLNA 2CZQA 3NJ4A 4MX8A 1T35A 4QASA 3T0GA 1NAIA 1V9SA 3V4PB 4UOZA 2IYAA 5B58C 3Q2KA 2PUEA 1S8NA 5KDLA 1IWPB 1YZVA 3OE4A 3ZHUA 4ZVUA 1IVNA 2V9CA 1O9BA 4ZQEA 1V26A 1PT9A 4NZMA 2UZIR 5THKA 3K31A 4WUTA 2V7QD 1N7GA 2JAQA 3CPEA 1MX1A 2XNSA 3FHOA 4Z4HA 2WIBA 3E3LA 4C0BA 2W8BA 1WEKA 3GEEA 2H1LA 1CB0A 3U37A 2E3JA 3QLVC 3ZTWA 2Q2OA 3OZDA 4HX9A 2D2VA 4RD6A 3KL2A 1G66A 2NU9A 1L4LA 1NFFA 3W5CA 1QP7A 2A3NA 4KQ2A 4M83A 4PSVA 3PC2A 4OHWA 3U81A 4PPGA 1TW3A 2P67A 4MW6A 4C2UA 2PZFA 4IZHA 2OLEA 2G9VA 3IQHX 4FZ5A 3MRXA 1T34A 2FNAA 3MXTA 3NT5A 4TTTS 2VP5A 2K87A 3LHIA 1RIIA 3W9UA 4AICA 2H9IA 1XDSA 2QENA 5JO0A 4Q6WA 3VR6D 2QGNA 3FI9A 1XDGA 2ZBGA 4MVJA 5ILQA 4NFYA 4QPNA 3QWHA 4OXIA 4H2DA 2OBYA 5BXYA 4LMAA 2CJPA 5EGNA 1LD3A 3BXPA 1GFWA 2GZHA 2QM8A 3VR5D 3M5CA 1QLHA 2RK6A 3HYCA 4HXFB 4JT8A 3N39C 4GMDA 2ZYSA 5CNKA 1QPGA 4RJKA 5J2UB 2CHUA 5A05A 4DXHA 1G7CA 1SG0A 1VHQA 1GU1A 1Y7PA 2I4OA 1M8GA 4N7RA 5CLLA 4NC9A 4DDKA 2J87A 2Z5FA 3MWFA 2IZ5A 1LKZA 3Q1LA 2HK9A 2YIJA 2XOKD 2Q3MA 4KIWA 4XASA 4WECA 3D5TA 3QE9Y 1PVVA 2AJBA 2OO5A 4BL5A 1KU0A 3H13A 1X86B 4KSCA 4NBRA 1F4LA 3QLUC 3VYRB 3H3XA 4R1MA 2D1RA 2GK3A 2OLJA 2WUVA 3JAKB 3I4CA 1XNJA 2HO4A 2ZJ3A 2W70A 3RS8A 5ALMA 1VB5A 5AHWA 4EARA 4JI0B 1YZ3A 3IQDB 1MORA 1RWNA 2H59A 1W1UA 2GEJA 3KQYA 3LHSA 4URYR 2QQGA 3UEOA 2AVNA 3DV2A 3BZWA 3H1EA 3SM9A 2JFNA 2XTJA 4HB0A 1ZK2A 3A06A 1LK7A 1I5OA 3BIOA 1BXZA 3E61A 5IWCA 1ZMRA 1VG9B 2GSWA 4QUDA 2PS3A 4JVSB 5EIFA 5AW4A 2CBGA 2I1QA 4MQ6A 2AC4A 2H3HA 2ZAYA 2Z2JA 3RWOA 2BV3A 5F33A 1NJ5A 4RK6A 1DTSA 1OLSB 4R41A 4QFMA 3OTOB 1BHJA 2FSFA 4R9VA 1H8ED 1MGPA 2LCIA 2XYGA 4GX0A 1ARZA 2GBLC 5BSFA 2ZWOA 1TK3A 1HTBA 3K0SA 1KL7A 1ZRHA 2BR5A 4UNSA 1PR9A 4J0CA 3LWNA 3H5AA 3W5JA 2Z4SA 3O21A 3KPUA 3OJLA 4MWSA 1N5DA 1P0PA 1N4AA 5F5XA 1N3IA 2V5AA 3CW9A 1SC3A 5GONA 1CZOA 2ZPUA 1NVAA 1WOMA 1K2WA 1XD9A 3T3DA 2V58A 3DOHA 2C00A 3SQWA 1UFVA 1G9XA 2QSUA 2XCQA 2OVBA 3RYHB 4GUAA 2MYNA 4ZU6X 3WHKA 5KYYA 2G7ZA 5J59A 1OPXA 2Q6KA 2XMCA 4L2IB 3T3EA 3R7SA 3FWPA 4EO9A 4Z3OA 5KTYA 2GESA 4HBZA 5JI2E 1TZ2A 5E9AA 4IWYA 2NVUA 3KQPA 1QYWA 4G5SA 3VZQA 2HJHA 1R9GA 1CRWG 3H2SA 3T1NA 2WSIA 3OPVA 5E6UB 3U7QA 4US0R 3WGJA 1NLMA 2GJAA 2FFQA 3F1KA 1OAAA 4X3CA 1SY7A 3AEYA 1YQDA 3L7BA 1F2TA 1P0FA 5FV7A 3WNBA 4GP9A 4PHFA 1VJCA 1V6AA 2Y0PA 4H7FA 1CLUA 5CPFA 5HXAA 1UBOS 3RGWS 4UOEA 4EDHA 4E6PA 2AG1A 4LJAA 3HA5A 5CFPA 1IULA 1LRLA 1SUDA 4OHVA 5GGXA 1X7XA 3OKCA 1PDVA 2YNMC 3FLEA 4FSDA 3NOOA 3HBFA 3DUFA 2DR2A 1BDJA 5BWNA 5EGSA 3GDOA 1DKRA 1NMYA 1V8PA 4FFVA 1DQPA 3ZGOA 4G37A 1UXIA 2AJDA 3NM6B 1PWXA 2I7DA 5GOZA 3UT6A 1Q1QA 4G1UC 1EUZA 2FR8C 3C4VA 3ZY4A 4EA9A 4GUDA 3GUYA 1B15A 1B7GO 4LQDA 2PMEA 4ZGWA 4FYJA 5CT5A 2OEPA 5ITWA 3RU7A 1Y37A 3VO8A 2AD5A 2ZREA 1QIFA 2B1GA 2HRRA 1XDWA 2YOHA 1UEIA 1IHUA 3VZRA 1OKKA 3UXMA 1VYUA 5THQA 1EH5A 2A0YA 2MSNA 3RQIA 4EDFA 2BGMA 4CV0A 2CCJA 2XTNA 3EEFA 3LA8A 1UK9A 1GPYA 4YK7A 5EYPB 1AIPA 1VXRA 4UXIA 3W4JA 5IM4F 2BMDA 2IHKA 5HIKA 2W00A 5T6BA 4RGVA 4BO1A 4G9EA 2DCMA 1TM5E 4TYMA 2Y1KA 4FFPA 4UBLA 4B79A 2FWIA 2DPGA 3L18A 1EZ4A 2GHTA 4R2LA 2DBYA 4W5WA 1GQYA 1EJ6A 1NPDA 1OXKB 1R88A 3BICA 3FMGA 4KE7A 4QJ4A 1AF7A 3OJFA 4FI3F 5I9BA 2XB8A 4MS4A 1KFKB 2ODBA 4E31A 1UQUA 4RC9A 2VQEB 2Q1WA 4A6DA 2FLWA 3W5BA 4LF8B 2WWFA 2BKUA 5FTLA 2C5LA 5FQOA 4EJSB 4H0CA 1CYEA 5FTKA 1Z5UA 3SVTA 3FNQA 4IJMA 4YAJA 4KB5A 2XNKA 3RDPA 1B0ZA 4UNPA 4XDYA 3BG5A 2ECFA 1T4BA 1HR0B 1FE8A 2W48A 1PWZA 4O5AA 5DNAA 4RDXA 4X1IB 1YRLA 2QLNA 4JDPA 2BJWA 2O6LA 4C3ZA 3FOFC 1XQ6A 3JTEA 4INOA 1YR7A 3HO1A 1TMGE 4QLAA 4AUEA 2QK4A 1NM5A 2YRFA 2LCFA 1U9ZA 2F9LA 3K6JA 3OZBA 1CZRA 4P2GA 1S89A 2KYRA 4W99A 1FUYB 3QVJA 5EHZA 3VH1A 2Q3LA 1CULC 1CDDA 1G8SA 1YL7A 1Y3DE 3W5IA 2Q1YA 2B92A 4MWEA 5TF0A 4TVSA 1SUSA 4H60A 2DQYA 1SRRA 3QF4B 4KTVE 2VHEA 3PQFA 4B31A 4DJTA 4E2FA 5LA6A 3TL3A 3ORFA 2ONCA 4FOSA 3SDSA 4ITUA 4TWBA 3EMVA 1RI2A 2AB0A 5TF4A 2VS1A 1IJKA 2FN9A 4S04A 4CL0A 4BUJA 1EFLA 3N70A 3PGXA 4ZCMA 2ORED 3TH5A 1DJOA 3AM5A 3C3WA 3UO8B 3WSTA 5KVAA 4QJIA 1O58A 3CQ9A 4EUFA 4ZT3A 5E4FA 4ONEA 4HP8A 4HDMB 1PQYA 3CT6A 4DSTA 1M6NA 1RKUA 3IMFA 3EAFA 3VC1A 2GBIA 1JR4A 1GFSA 2V59A 1ZL0A 3QV2A 4JU9A 1JHVA 2XVYA 1DXHA 2ID4A 3AKCA 1YZYA 1J9GA 1NSFA 1X7DA 1Z4MA 1XMXA 2VHXA 3KUUA 4L4ZA 5K0GA 3A1EA 1XRRA 1VECA 2XWJI 4B75A 3DOEA 4U2EA 4FS3A 4FR0A 2YYSA 1CCWA 3DEKA 1DEXA 1QFZA 3ABQB 1NOJA 4J90A 2AHRA 2RI1A 3DBHA 4DKXA 2RHWA 2V45A 4HMOA 4LNUB 3G82C 4RVCA 1X42A 1F3LA 2ZUVA 3CEMA 4E5VA 2PZAA 4AXBA 3RVOA 3VYUB 3D9QX 1M2JA 3CEJA 2A5FA 2WPDD 4P81A 2PT5A 3B8HA 2C2ZA 5BSRA 3QBEA 4GAEA 4BP9A 5IWAB 2J3KA 4Y2YA 2HF7A 2Z1NA 3E3AA 5EIEA 3LDUA 1MIOB 5DIFA 3ADPA 4DIOA 3VJLA 4WA7A 2HHJA 2WC1A 3UFBA 2Z8YM 2IOHA 3IXQA 5A71A 1PR3A 1AHIA 1Z5GA 3OLYA 4M1YA 2F1JA 1P7PA 3CN9A 4DMUB 2BHLA 1JIVA 1M6VA 3T0IA 1YHZA 4WY2A 3VZDA 3WFZA 3OWXA 4D9CA 2O3TA 4OIFA 1N34B 1F6BA 4YA6A 3A2NA 4YRIA 2NN3C 4KE8A 4LDQA 2FSPA 4XWTA 3WWDA 3NGLA 4EHBA 4O8CA 5DLPA 3LIPA 4WLNA 1FMFA 4E5YA 1BJKA 3EQ8A 5DW0A 1XL1A 4GOLD 4RK1A 2N42A 3VX3A 4GECA 1LXCA 2WFMA 4C08A 3Q7EA 2RC5A 2PR7A 1Y4UA 3B51X 2ZR8A 4E03A 4EG8A 2GN0A 1J00A 3SPXA 5KNDH 1UK7A 3UH0A 2Z2XA 4E5NA 1ZONA 2Q29A 2EZUA 4CTMA 3IL2A 1ZOIA 3UWDA 2XEXA 4JCOA 2DPXA 3H1PA 4BVAA 1J42A 5LL6P 2DY0A 4LWQA 1RKBA 1FW8A 4XIGS 3DQZA 1O6ZA 2W8BB 1EUCA 3PR1A 5HCNA 1VL2A 4KACA 3CONA 2GRUA 3PPWA 3HVKA 4KDFA 2I3BA 3HU1A 1U8YA 1XC7A 2E5WA 2OQRA 3FIJA 4ALIA 4BNJA 2JGDA 3E58A 1QHGA 2JAHA 1L7RA 1UBGA 1X1BA 3G6WA 1BEZA 3K73O 5CJJA 1JH9A 2WWHA 4PAOA 1G5IA 2NO0A 4XX1A 4R8MA 1DIGA 4DREA 3UAXA 1I7SB 1LV8A 3HR7A 2JG3A 1N2EA 1GCAA 4MVJE 1YUBA 4NE9A 1H2XA 4HH0A 5CM8B 4HB3A 1E1CA 2Q6IA 1MPTA 4HLDA 2GPAA 2J3QA 1GA1A 4JGIA 1G0OA 4NCHA 1FA9A 4QVIA 3A4YA 4UQOA 3SBEA 2ZQYA 1C9YA 3ZGZA 1JKIA 1FS4A 5FOVA 4J3FA 2AL7A 2KE5A 3N5CA 2XSZD 2AMVA 3I9KA 3LP8A 4Q1DA 4B43A 2GARA 1PGNA 2G67A 5AT1A 3UOGA 1A4RA 1DVRA 1WUHS 3P9QA 4HN4B 5ANRB 3ZK8A 1PCXA 1ZS9A 2WJWA 4WXYB 5LCXA 3HN7A 5DTQA 3WP0A 5DP2A 4YUVA 1Z2EA 2VNKA 3P5SA 3HFRA 3RLFA 2WBLC 1RI4A 3UGKA 2VRNA 3BN3A 4A91A 3DHYA 4DR7B 1E64A 3HJGA 2G09A 3LWDA 4IQ8A 3ZTTA 1ISGA 3KQVA 3OCCA 2Z8YA 3IILA 3V1UA 3U80A 3VHLB 5IJWA 5ERYA 5MGNA 1VLZA 3STYA 3NX4A 2NSYA 4G1MB 1FXWA 4FHFA 4U8HA 4ZOCA 4ZU3A 3GNQA 1U7PA 3VSAA 3KC2A 4HL6A 3H9UA 3CB2A 5EJGA 4LEIA 4UAGA 5CTAA 3EWSA 1PT8A 1CFJA 2JATA 1GDDA 3L8MA 3JQPA 3HCBA 3WGMA 2F3TA 2Z09A 2QAIA 3AKYA 5DASA 5KX5A 1N7HA 1THMA 4HXYA 4UEWA 5FQNA 1C41A 1GR0A 5HJ7A 4PS0A 1ZJ5A 3DWIA 2RGGA 4R9SA 4EVSA 1GRCA 1IFXA 2K5UA 5LOVA 4IIBA 3H3FA 2XADA 3COVA 1RMYA 1ZA1A 3UW1A 1YF3A 1GRNA 1GGFA 2AOXA 3VYSB 5DWQA 5JMTA 4DUZB 2O7RA 1D5CA 4YRSA 1EFAA 3AF4A 3LNCA 4Y6RA 2IHTA 1TCBA 3HXPA 3EQ7A 3G1TA 3RVKA 4UEQA 2BZSA 1VP3A 5EE9A 1SVUA 1MBZA 2ZRAA 4B85A 4XFDA 4YEDA 2QVGA 1FS6A 4HTAA 1YKFA 2WDZA 1E4EA 3RT7A 3UK6A 1BTOA 3JR7A 4MQ4A 5GONB 3TJZA 4UFPA 5BWMA 2K2QB 3HDJA 1RBZA 3S1AA 4MGHA 4RTSA 1IN1A 1FDRA 2EBUA 4NH0A 3A6ZA 5AJHA 5ALOA 4EKEA 3JVDA 2PMKA 1OI4A 4AURA 5ITVA 1HDIA 1N8KA 2O48X 5KYYB 4FNGA 4WOCA 1V16A 3TKAA 3V4VB 3HC7A 3ZDDA 1P3DA 2VK1A 4A8JA 3WYDA 2BH9A 3A1TA 4IJVA 1L1FA 4RPCA 2NVUB 3IOMA 4JT9A 2ZE5A 2ROQA 3R3WA 3M5WA 4M37A 4Z7JA 4KLNA 3CF2A 3U7QB 3Q10A 1TJ4A 3BK2A 3R23A 2B98A 4M0EA 1Q3HA 3BYZA 2IUUA 3ROQA 5ED0A 4KN9S 1F2TB 3LHDA 1I7DA 2FSHA 1K68A 2ZVDA 5IVPA 3BFVA 2FSIA 4M7OA 1VXOA 4N7JA 5SY9A 4BO5A 5K3CA 2FUG6 3EEQA 3VGPA 5FLXA 1HQCA 1PBNA 4HVLA 3SX0A 1J0XO 4FJ2A 3V8PA 1B76A 1Q44A 2BISA 4P86A 4KZPA 3G8BA 4CV3A 1PT6A 1AQUA 1X7XB 2PZBA 3BJZA 3KJQA 4Z1MA 1SG9A 1KK0A 4KK3A 5JCJA 1KO4A 4BECA 3DUFB 3PDJA 2FOIA 4QBHA 4DDWA 3T38A 1YACA 5FPHA 1XU9A 1B42A 3NRJA 3LUFA 4CIVA 4BGUA 3QXSA 2Q4EA 1MX3A 4ZODA 2MSWA 4WGFA 3K0BA 2CKMA 4D4MA 1Y9JA 4Q93A 2NUPA 2OV2A 3EF3A 3DTYA 4GZ6A 3IT0A 1J9ZA 2BC9A 1YRYE 1A72A 1RRKA 2LV8A 4QD3A 5FYDA 1NP7A 4QGSA 1T3SA 4MIYA 2C8LA 2ZRMA 1FPQA 5D5QA 1WWKA 1C29B 1NXQA 3BJEA 2XDQA 1NXSA 2BGNA 4ZRDA 4BKQA 3OZSA 4B83A 1Q1ZA 5CRIA 5C8XA 1YQ9A 2CXUA 3TSWA 1GO2A 4OTZA 1YKGA 3Q0TA 4H1TA 2BFMA 2RGWA 2YVQA 4MRSA 4P36A 3N58A 5D86A 2FFRA 3KTAA 5I9NA 5IEJA 1WAMA 3DLPX 2ZSIA 2O3RA 4K6MA 4ZA2A 5G0VA 1I2MA 4FFBA 1UOQA 3JQRA 3TBKA 4LDRA 1F60A 2B6NA 2HN9A 4NFSA 4XDGA 3DKVA 3TR0A 5KQPA 1RBMA 1REQA 2MTBA 2HGSA 1YZLA 3QYJA 5DCLA 5CG1A 4EA8A 4BIIA 1NI3A 5CCBA 1UBCA 2O1EA 2PKQP 3ID6C 4MS4B 4P7KA 4X90A 4CGZA 1I7QB 1PGPA 4OJYA 3C7DB 3GFBA 3G1WA 1KPIA 2CUZA 1I5EA 2AK3A 2GD2A 3V3KA 3HBNA 1WXIA 1W8IA 1K75A 3E9DA 2F1KA 3ELDA 3NFRA 3NJRA 3QU7A 4FZVA 2VP3A 1QOQB 3Q2IA 4UCXA 3DHVA 3HJHA 3E7PA 4EUEA 3E9EA 1BVHA 2CNWA 1R0BA 4ZAYA 5TMDA 4F8JA 1T5LA 3WLSA 1N3LA 3PYXA 1QHEA 4PZPA 4EY8A 2OP1A 2GBCA 4YRFA 1LFDB 1PJRA 4W5RA 5IG2A 4ZXPA 3HZOA 4ANFA 4FGJA 2RHLA 2J48A 2A4KA 4FKMA 4NESA 4RZSA 5DX0A 1T2EA 1M54A 2QYHA 3JQCA 3NWOA 4WLFA 3E23A 4IFBA 5LQRA 3D64A 3VOBA 2V1XA 5DV9A 2O3QA 3HCEA 4MI3A 4KV9A 1ULBA 4UU0A 2EGUA 3G17A 1QV7A 2FPRA 2VYFA 1P7WA 3SMVA 3I6BA 5LA6B 4ZYZA 2F3RA 4QDZA 5LBIA 1ZNWA 5BV1A 1A5ZA 3FW1A 2W4MA 4JLSA 4UBIA 3T5BA 3BEDA 3Q7SA 2J5QA 1Z4OA 2ZSFA 2YV2A 3ENKA 2QR3A 2JA1A 5GVSA 1GD1O 1D4ZA 3DW1X 4TYYA 1H9CA 3PXUA 3ZVMA 3QE3A 3UB4A 3SNHA 3PRJA 1VKJA 4Y6SA 1S3SA 2W90A 1CJSA 1KKLA 3DMHA 4A92A 4V1CI 1H3EA 4IVNA 2BTOA 4EB0A 4L4YA 3M70A 3FG9A 1VCOA 3NT2A 3BXFA 2ZDHA 4KSYA 5KBYA 3O8RA 4D8WA 2CLEB 2GEBA 2Q5CA 4L51A 4RTJA 3OHSX 3EZ7A 4EENA 3G2OA 3X43A 3JWPA 5DYGA 5C0OE 2QMOA 1LI7A 3DBHB 3KV3O 5IVHA 3Q98A 4LE1A 2VF8A 1MRNA 2XXAB 1BDHA 4S1OA 1DAMA 3IO3A 4NL4H 2PUCA 2QD4A 3FX2A 2WM3A 2FMHA 4G0UA 3EQZA 2X9VA 3O4VA 4CF5A 1FFDA 3RIHA 3C85A 1H93A 2HLDD 2RHTA 1WUKS 2X0RA 3BDAA 1DO2A 1M5UA 2A5DA 3JWHA 1Z5PA 1FY2A 4JYBA 1QPBA 3HEMA 5TGDA 1E9EA 1K4YA 1KXJA 2ZLBA 2YFHA 1CR1A 1J8VA 3A3PA 4GEGA 3VVLA 1PYGA 5CXQA 1M6VB 5JNUA 2D7CA 3HVRA 1SVLA 4OY3A 4LCJA 3B38A 1FDUA 1R0YA 1J7KA 1I1OA 4IYRA 3OESA 3W3AH 2PY6A 4MWGA 2G28A 1YGPA 2CXXA 3KVRA 4URWR 2AW3A 3LC7O 3DLIA 2ZUEA 2H4HA 1ZCZA 1FFSA 3BBPA 3CVOA 4GD3Q 4QEDA 4FILA 2H7XA 3NGMA 1OGJA 1KDZA 3DAFA 2VT7A 3EPPA 1POWA 4K81B 3I5MA 5AIAA 3AFHA 1JKFA 5KU1A 2VZEA 5JZOA 4LFAB 1UWLA 2MSCB 2P4SA 1SBZA 1AS3A 3VM6A 3WWPA 1QRTA 3U3JA 1U7UA 4OK5A 2JGLA 4AKGA 1V8DA 2RC6A 2X6TA 3LX8A 4TLAA 2HCFA 1I4OA 2YQ4A 1IE3A 2HA6A 5B58T 3TIIA 3QVMA 4W7SA 4WW0A 4R1QA 1SK8A 4E3ZA 1DBSA 3K9HA 1IQUA 1Z83A 5ALPA 2XUFA 4D0NA 3SIPA 3I30X 1QVAA 5E3HA 3GA7A 2JGDB 4TMVA 4G63A 1M6YA 3NDRA 2VUIB 2AKAB 2RJOA 4OA5A 1KP2A 1E2KA 1JSZA 4RQTA 5CVJA 3JQ8A 3SZUA 3T12A 4DMMA 4OLJA 2CMHA 4UAJA 4F5WA 2GEDA 1Z7BA 1T0HB 2JGKA 1XVVA 2C3UA 5DHSA 3QENA 1E1CB 2WG2A 3HE3A 1BWQA 3GMIA 3L5KA 4QSHA 3UG6A 5C3UA 5LPNA 5A7GA 2QXTA 2PM8A 2FXVA 4D25A 5D5HA 4WDQA 3I2JA 3SGLA 1U7HA 1W5FA 4GLFA 4LDPA 2Y8EA 2W2PA 4AJ2A 1SUAA 2JGFA 3DT6A 5DM4A 3WRWA 4ATNA 3GLKA 1WMSA 1A4IA 5IH7A 4IW3B 2FX2A 3HCCA 3K2BA 4V24A 3IAAA 2PIAA 1NJFA 2J3DA 3E2MA 2E4WA 2ZRNA 2QRGA 3FRHA 3KEFA 4GXQA 2QMQA 3A4IA 4MA5A 4PYNA 5H4HA 3HGQA 4ZARA 4WEOA 2FLVA 1RT9A 1JEAA 3MD9A 3RUAA 1NSYA 2CFIA 4V03A 4YT8A 2OXFA 4TM8A 3E22A 2M6RA 4I8DA 5LLSA 1W2WB 4PZYA 2BEJA 2BOVA 4TRMA 4CF6A 1PI3A 3KQMA 2GHIA 3ZJTA 2CDAA 1NMSA 3AEXA 3CLRD 1EGQA 5DM0A 3IDZA 1QUEA 3LWBA 3EIEA 2IS2A 1N5IA 4M7WA 4XJXA 2FG7C 5LBUA 1JHUA 2B4RO 1ESZA 1E2BA 1D4OA 4X71A 3C7CB 3C6MA 4RZQA 4DQLA 5K03A 3PL1A 1XZAA 3OFSA 3DE1X 5B4UA 5KX5B 5ADVA 4UASA 4FR5A 1GTRA 3O3MB 4C0XA 5LZ8A 4B73A 2JS7A 4OJQA 1OB2A 1IXZA 1WUIS 2XUHA 5LOVB 4DBZA 2XKJE 1LX7A 2GZRA 5B2ZA 3GDFA 3DB2A 4NNPA 1TAGA 2RGNC 5C5EA 1ZJJA 1HT0A 3L7CA 1ZHFA 2FI1A 3I1IA 4UU1A 1ZIXA 5JSQA 3JSXA 1KIMA 3N53A 1N2CA 1IU9A 2CE7A 1WCIA 5KQMA 2QUKA 4GOKA 2PMCA 3BE6A 2NP6A 1VI2A 1VZ2A 1PUXA 3PRKE 1HNXB 3D3NA 1E4EB 4ZTZB 4JENA 5BNFA 2VDRB 1TC2A 1XBTA 1ZU5A 3BX1A 1NJSA 1UF9A 3D4IA 1DBRA 1JALA 3I04M 3IVXA 4XW2A 3ZG6A 1JG7A 2EFEB 1V4VA 5F2KA 1BMQA 3MEQA 1G17A 4TL6A 1EAYA 1ACJA 1Z6YA 2QZSA 2ZRLA 1VBNA 2PBLA 1QGED 3M3DA 1V16B 2I2FA 2RMKA 3C1AA 2JI4A 5F12A 1QE5A 4HAZA 2Q3EA 4TTVA 3R3JA 4FOOA 4A8JB 1JR3A 4HXEB 1NVVQ 1XEWY 1QRAA 2CLOB 3OPMA 2PSFA 4OQFA 2OR3A 3D2BA 5CK4A 5JDCC 3RVPA 3SEZA 4CUKA 3NVKI 2C9OA 3SFTA 5B55A 1QMPA 3ZX5A 1KJQA 1D9XA 2PN1A 3LFTA 4RX1A 3ILSA 2RH5A 4DWVA 1STOA 4L6CA 4RACA 1NIJA 4MA4A 2R68A 4NZYA 2O59A 2IF2A 2EIXA 2A0WA 1WW8A 2OHGA 3TIFA 1YR2A 1CVRA 1UDCA 3NCTA 5CVTA 1S2MA 5L8VA 4HPXB 1O94C 1KVSA 3DZIA 1QZXA 3F1LA 3JWIA 1KRHA 4FFNA 4JYAB 3BRQA 4L3WA 1SQSA 5A4AA 1TUBA 4JCCA 1DKNA 1UPFA 1GSHA 3C1UA 1Y1QA 4O02B 2RE8A 3IKMB 3IAHA 3DVLA 1G3UA 1ADYA 1XMSA 4P3OA 3T7EA 1AF4A 1JIXA 2AE2A 4X93A 2QG4A 3C7KA 3RWBA 2KWIA 4OKIA 4OLBA 2NUPB 5AKHA 2GPTA 1U31A 5EQTA 2B82A 1A9YA 2D74A 5L9AA 1L4GA 2VAPA 4XUCA 4UTPA 2ZYRA 4DWJA 1SR8A 4XJTA 3HK2A 2C88A 4B46A 2WTNA 1SEVA 3OETA 1NXWA 5BW8A 2AQIA 2Q6VA 2XDQB 3BF7A 4XPIA 5G2OA 3MB5A 5H80A 2ZG6A 2QX4A 3ENNA 4GNKA 4RH3A 4B4KA 4YXWD 5IPFA 2C2GA 3I3SR 1ISFA 1GYRA 3OD1A 4JSTA 4RENA 5C5DA 3ZGLA 3KTAB 3FUXA 4CRWB 2IHJA 1QG4A 1XYGA 3PVSA 3CRW1 4KBGA 5B6PA 3E8XA 3GMTA 3AVQA 3X0DA 4FFBB 2QVYX 4LJ9A 3AFOA 1CFZA 2XKAA 3NAGA 4PIPA 1VRCA 5D85A 1ENOA 4LDZA 5FD8A 1KORA 2HA2A 1PLKA 3TL2A 3ZU6A 5KQLA 1XB2A 4GKAA 3R6GA 4R1TA 1REQB 1BFDA 3CBGA 3AF5A 2MMGA 3B5JA 3F5QA 4XB2A 3LQ2A 4DIEA 5ISMA 5TSDA 1VJTA 4LDJA 3FZEA 1GTJ1 3OICA 2GNAA 1GOTA 3I04A 3S68A 2ODWA 1E8NA 1AHPA 3AOEC 1PZEA 2OG2A 3PXXA 5A3VA 1RI3A 3JVEA 3LMKA 4CU2A 1D09A 1EVKA 4DVJA 1JBQA 1JPVA 4FQ7A 3SWWA 4KG7A 4PSKA 2Q7OE 1Q1GA 3H1FA 1KAHA 4B2LA 4E11A 1V71A 3LOUA 4NATA 3AR6A 3MJCA 3TSYA 3NR2A 4BLQA 1LF5A 4YRPA 2CUNA 1L7DA 5F1YA 2H4ZA 3KYBA 3I6IA 3ZE0B 3BSYA 1NKVA 2QT0A 4QYXA 4UVHA 3TM5A 4DR6B 4EBBA 3EVFA 3OBBA 4YMTA 2AK2A 2BRUA 3TAXA 3MTQA 2F7SA 2NYAA 3PQCA 4X92A 1G8KA 3P27A 4CR7A 1T6XA 1KEKA 4OATA 3VPXA 2V6BA 3IAS6 2CXNA 1QHFA 1KBQA 1B8VA 3C0KA 2HQ1A 3B9BA 4BX9A 4QXPA 1FMJA 1TVMA 2H2AA 3L7OA 3MGGA 5FBLB 5KAMA 5AM4A 1G0NA 2PKWA 4TMZA 1L7PA 1VCMA 4RLFA 4X63A 1YI8A 5ESWA 5E38A 3HNPA 2X5JO 1P1FA 2MSEB 2Y1LA 4IX9A 4D3XA 3S99A 3HWWA 1JDUA 1SU7A 3L6RA 3QJGA 4WCDA 2QR2A 4S1VA 3K0EA 4LI0A 2ODAA 5H82A 2K4MA 1BN6A 2VDUE 3BTVA 2PVPA 3GT7A 4TYQA 2BZ1A 3UJBA 1G16A 1UJBA 2VA9A 3R0ZA 3MFYA 3NNDA 1HPLA 3EIWA 3DEZA 4LBWA 5JSHA 4UXJA 3OOSA 3BD6A 3KUKA 3JD3A 3MCVA 1XU7A 4A0GA 1R74A 3PE3A 4ISBA 3ORSA 1RWWA 3FOCA 2G3YA 2Q3JA 4D4GA 5G1OA 3L02A 4HPJB 1B93A 2YWFA 1E2MA 4QWWA 3NBAA 3OAAD 3QBTA 3KTDA 5KS2A 1EVZA 1N6LA 2OILA 1T8SA 1TMOA 3ND7A 3ZBUA 1HDYA 1OAOC 2WNIA 1PJSA 2X0JA 3EFBA 4MPRA 3F73A 1BOFA 2C7OA 2JFXA 2VDVE 2Z6QA 2QI9C 5CHEA 1PJ4A 4GC9A 5HUJA 4MVXA 4YJ3A 3S3TA 4IXTA 3L0OA 5TDHA 6PFKA 5KDOA 3S2FA 3K2IA 3UHJA 4J1QA 5EZYF 4R01A 5DBFA 1XRMA 5EMLA 1K66A 4YRMA 1J2TA 1ZN8A 3QW4B 4OQXA 5JSZA 1JF8A 3NATA 4QBKA 2XZOA 2R4TA 4L27A 4WLVA 4NP6A 2GA8A 3KKZA 4MROA 3VH3A 3W78A 1BDBA 1A7AA 2VUUA 1J33A 2BFBA 1R00A 4ND1A 2BMVA 1A2QA 1FSFA 3Q5EA 5JSYA 3FGZA 2QMZA 3VMMA 3TZHA 3NALA 1NTOA 2XDWA 3WRYA 3D5EA 3B2NA 1IZ7A 2WU3A 3RYIB 3JATA 4DQ0A 1J9EA 2W2VA 2YRWA 4Z0NA 4LVOA 5KWVA 4XVHA 1YUMA 4LGYA 2X42A 1R16A 2IHYA 4DPLA 3MHTA 821PA 1TYAE 1WQ1R 4YJ2F 1LPMA 3HCOA 1Z39A 2D5CA 2FQXA 4US1R 1CZNA 4PNHA 1JILA 4FYXA 1ZZGA 4D8VA 1UMBA 1QR6A 5DW3A 3P94A 1HRKA 3Q9LA 1T8TA 3EGVA 3KKKA 2WJ4A 5EMMA 1Q50A 5T6MA 3NC0C 4PC6A 4ZCSA 3T3IA 1Z36A 4HF7A 4M87A 5D3KA 3W2TA 4AIRA 4F4UA 1V7PC 4A1OA 1RHQA 5EJ9A 2O2XA 2XYPA 1E5DA 4LV8B 4ZMSA 4UREA 5AOBA 1TF2A 2PTGA 3RRMA 2ZYAA 8ADHA 2C9MA 1A7UA 3JQ8B 1ODJA 3OJXA 4JROA 1EA5A 3C3DA 3KXKA 2WWVD 4Q4CA 3PGJA 4J0QA 3OEWA 1XA4A 4K9MA 4P92A 3AG6A 2BGLA 3ZXYA 3KLPX 5J2TF 2P2YA 4J0EA 3ZGNA 3ADOA 1WQ4A 4J8PA 3D7SA 1JXOA 1PV4A 3I72A 3PLRA 1SB8A 3FMVA 2ET6A 3TNJA 1F20A 1BMTA 2JD1A 5DT2A 2IZ7A 5CYGA 3AVWA 1SULA 2CHQA 3KU1A 2ZB4A 1A2OA 1XZGA 1AK1A 2OGZA 4B2IA 4Z2AA 3C6ZA 1PL8A 3KYDA 4EG3A 1O0BA 5CVDA 2HA7A 4XUGB 1FVFA 1FLNA 1CX9B 1NI5A 5K9ZA 2GEFA 1XXHA 4O08A 2FPLA 2PD3A 1VYHA 1OZGA 2WOOA 2IT1A 2F1RA 4L8GA 4D26A 5J23A 1RI5A 5CVUA 4J7UA 4FYIA 1SBTA 2XMSA 2O5RA 3SE7A 1KTVA 4Z4EA 1V4BA 2QL9A 3E22B 4LYDA 2FP3A 2Y4OA 2Z43A 4CR8A 1COWD 2J6HA 5T67A 4JLVA 1SCNE 1WNFA 3OT5A 4GQIA 1BH2A 5GINE 5K7SA 3CVXA 1ZD5A 3DFUA 3MTJA 2W7TA 3AX6A 2GHRA 1A5TA 4AMUA 3QEKA 3U3XA 3T9FA 2J1LA 2IDKA 2YVUA 4FGSA 4FBLA 4FLFA 1INLA 4DMKA 1JX6A 3N28A 2ECKA 4C76A 5JAOA 3U1TA 1FFWA 4JMPA 4KQ1A 1B8PA 3X2EA 3L77A 1ZINA 1IRXA 4HZGA 1DB3A 4QUEA 3G2NA 4EMUA 2ATXA 4L85A 5AKXA 3NU1A 1K98A 1KFCB 4GMKA 3ASYA 3WWZA 1ZDMA 4RXUA 4X6YA 2G0AA 1N2CE 3PHHA 4Y7CA 4DPMA 3MGAA 2DUWA 2V55B 2XE7A 3ETGA 1N2CB 3PR2B 3ZHYA 4J9VA 1IQRA 1GPLA 1WCIB 4FFMA 1SVWA 2JGJA 1T25A 2O2DA 4QRDA 1ZR2A 2XYHA 4N4AA 3QX3A 1C3EA 2XUKA 3BB4A 3P19A 4K8OA 3S8EA 1ZXXA 1RABA 3AI7A 3VR5A 2HSEA 3SJ7A 1YR3A 3BGIA 1VI5A 3NV7A 4F5EA 3BRWD 4Y1EA 2KBFA 2P9CA 3DZGA 3W8NA 3WLPA 5IU6A 4Q7QA 4X6LA 1FLDA 1XCPA 3DWGA 3UAVA 4EJMA 2XOKA 2JKYA 1XZFA 4JYPA 3RV3A 1B16A 3K92A 5F98A 3IMEA 2Z1DA 5KSYA 4GNRA 3ECAA 2CB0A 1QIMA 4EGCB 4DLNA 5D84A 3KHSA 1NXXA 2C29D 3B6ZA 3OFKA 3Q3EA 1S3FA 4LOIA 3GI1A 1A96A 2JCBA 3K8ZA 3SYRA 2ZK7A 1SZCA 1V39A 2QN6A 3TCNA 1D0SA 1UC8A 3L1VA 3C1OA 1V35A 2P69A 2PX2A 3K9FC 4Z3KA 1ISMA 1DHTA 2OL4A 1KMNA 2SCUA 3F74A 5DOVA 2BN4A 4B7XA 1S2IA 3E53A 1FTSA 9GPBA 4U7DA 2OV6A 2Z95A 1R5JA 2WVAA 1WULS 1TCCA 1W6RA 2WILA 4HNVA 5KNCD 3VSCA 3GJ3A 1FNCA 1K5GA 1SKAA 2O1WA 5FI0B 4W5QA 2VP9A 4C0QC 3IVMA 3U6BA 4MV8A 1GUZA 1L5SA 2GAJA 4H7EA 1GLNA 3EDYA 3L07A 4LK2A 4YQZA 4G5HA 4P4TA 2P30A 5K6RA 3SR3A 1XA0A 5KTNA 1XZDA 1UINA 4ZI5A 3DTVD 3CR7A 1EJ0A 3QHQA 1RVDA 4MPDA 1NVTA 4JD5A 1XO1A 3D5QA 4F85A 4HGYA 3VSBA 2PIDA 2GPBA 4ZQBA 5EXSA 3GVCA 4IQ0A 4C4RA 4G0VA 5E7IA 3M6XA 3ZBTA 1PFQA 4KNYA 1ORWA 3SJZA 3K9GA 4Q1BA 4XPIB 3OQNA 1YXMA 1ESCA 3K0CA 4Y9UA 4BVHA 2UUCB 4BO4A 4ARUA 3KJGA 4HD8A 4RH1A 1RRVA 3L7NA 5K3FA 1Q14A 2W6CX 4L76A 3L6DA 3TG8A 1J5EB 1PTJA 4HLUA 1DPGA 2WA2A 4CDNA 3EBLA 2VSYA 2OZEA 1DKLA 8GPBA 1L7NA 3BMCA 1Q84A 3V33A 2ZDGA 2HYIC 1ITZA 1XXLA 4GM1A 1OXSC 2B8JA 2OV4A 4IWNA 3TXYA 5HTOA 4RSMA 5BSVA 1TZMA 1W96A 1UPXA 2FZKA 3ONFA 3RGGA 1T43A 1C9JA 4MQ5A 5BUCA 1I9GA 4X84A 2COUA 4OAQA 4XYEA 4YQFA 3YASA 4IHAA 3L06A 3IPAA 4M6WA 4XSVA 4MA0A 4KVZA 1QH8A 5EPOA 5BSTA 3WC4A 2HXYA 1XNQB 2CLMB 3EZGA 4MWBA 3OT1A 3CURA 3NP7A 4G0OA 4MVJH 2H7CA 3Q3CA 1I8TA 3GMDA 4ZO7A 2R8EA 1UP4A 2YWJA 4YPVA 4CIYA 4LZJA 2EF0A 4JL5A 2YHBA 3ZWBA 2FFAA 4GP7A 3OCUA 5EQDA 2ZIVB 1L7OA 4GOOD 4RMGA 2Z9BA 5EG5A 4ZVQA 2GO7A 1TIPA 4PNZA 1FQJA 4UTRA 1A50B 4B7UA 4NK5A 4A2QA 1YZQA 2WD9A 5AICA 2B6HA 1VHDA 3EOAI 5HMLA 1JMKC 2OSBA 3I9OA 1XRJA 1VE3A 1L0BA 4Q9JA 3ICQB 5H68A 3FROA 1YBVA 3ANNA 3I92A 3NTQA 4PHCA 4G0QA 5EQFA 1YBMA 1UT8A 2HPAA 1NUUA 3W5AA 1MVOA 1XTSA 3OECA 1Q7GA 2ZOSA 4CM6A 2FN3A 1TTTA 1Y7HA 5ALDA 5HQJA 1DRJA 3LQKA 4UEOA 3EZ6A 1SKBA 3UENA 1O6BA 3PENA 2NYRA 4XGKA 5I7AA 4Q82A 4N8DA 1ZFNA 3O93A 3WE7A 1GGVA 1GL3A 5ERXA 4DLPA 2YOFA 4BEVA 2Q3DA 2ZBEA 4D3ZA 1YS1X 2EERA 4DYDA 4FS8A 4RDCA 4ZI7F 1E3JA 2E4XA 1ZIOA 1WG8A 1LPNA 1AOXA 1QNLA 3DO8A 3EMBA 4IQ4A 3WISA 1NFRA 1QCZA 3AHJA 4R6XA 4FU0A 1LCIA 2R6HA 2R6DA 1NUPA 1OI2A 2WABA 4HWTA 3BA1A 3OZEA 4JLAA 1CETA 1LWOA 1DIRA 1C4WA 2BKVA 1BX0A 2NPOA 3CUEF 4OUDA 2HFJA 3IGFA 5DEIA 5IHXA 2D3WA 4OXNA 1H5QA 1ADCA 3BDIA 3QYFA 4F45A 2G0TA 2O4UX 3HBLA 3W05A 3LXXA 3RSOA 1PX0A 5LD2C 3HDYA 3DAHA 3DBIA 4LQ4A 3OPXA 4UMVA 2JFUA 4ND8A 3PFBA 2CMGA 3TS1A 1YGYA 4YJ3B 4ESVA 3CHYA 1GKKA 1H6AA 3I9FA 2AJCA 1GPWB 2YIMA 1KVUA 5ALYA 2HMYB 5G0WA 1G60A 3K15A 4A10A 5JSZB 1U02A 5IULC 1H0SA 3WDKA 1EDOA 1SZPA 3K20A 2XTAA 3M5DA 5ADWA 1VE1A 2TRSB 5ALQA 3K9CA 2CBXA 5LUBA 3UXHA 1LS6A 4BMYA 4EX6A 2ZROA 3CF0A 4EY6A 1QK3A 2BFBB 1CQIA 3HABA 3UW3A 2B1RA 3GRCA 4ZAVA 2O2JA 3FB1A 4E09A 1KJWA 4KGDA 1U1FA 3CNNA 2H2DA 1QYVA 2EV9A 1YHYA 1JQEA 3PP8A 3TZ6A 4NYIR 1E77A 3JATB 4KI7A 4IVRA 4TL7A 1RQNA 1HE8B 4ZWNA 2YASA 4PSUA 4F71A 2C4HA 1SH7A 5EQJB 2VIIA 3IAFA 1OXXK 4EZEA 4FGKA 1ST3A 2AFVA 3QA3E 3UA4A 3D02A 3TLGA 3PNBA 1W5BA 4JFAA 3MBKA 2QUAA 2VJMA 2YJ6A 4QDKA 4F12A 5BN5A 2PUAA 4JU8A 1UMBB 4N49A 2ZRJA 3RPEA 3B3JA 2FFBA 4X20A 1UJCA 3PV0A 1PL6A 1E9FA 3L84A 5DSTA 3F6CA 3VO2A 4B7ZA 1DZIA 1G18A 1AH2A 1QCCA 3IIIA 4BRSA 1KQPA 1L3CA 3A0UA 4K28A 2OXTA 1V25A 5F3DA 4HWPA 3TZLA 4RV5A 2P6UA 3I01M 2ZYIA 3WMEA 3KB2A 3BAFA 1W46A 3W2HA 1VL1A 5FULA 4PRYA 3LVFO 1DEAA 4W5JA 2QTHA 5CB4F 1MOSA 3L7LA 5FBHA 3UATA 3AM1A 4HQ0A 4R05A 1K4MA 8MHTA 3UAZA 2A86A 3IAEA 1TTHA 3A4VA 5DNWA 3VPCA 1Y9EA 3L9XA 5J4KA 4MVJI 4BIMA 2Q99A 2C3PA 4M0PA 4J75A 4MKIA 1RE0A 5KTOA 3JTMA 1NVMB 1OFUX 1TJNA 1SKQA 4PXAA 4Q9HA 3VC3A 5J4YA 1A04A 1DV2A 1I3MA 1QXSA 2YNMD 1EFRD 3PGVA 1XXHE 1EFTA 1MRZA 4FMCF 3FWKA 3OFJA 5ALTA 3DE4X 3KE8A 1BD3A 2VZ9A 1B6GA 1XXHB 4B6OA 4IH1A 1EP3B 1B8NA 4II2A 3C74A 2CDBA 3D3EA 3NIBA 4RK0A 4XKJA 4TKVA 4ZT2A 4PLTA 5EIAA 1XYVA 1YI0A 3AY0A 3HY6A 4V3CA 2K7FA 3OQ6A 2VNSA 4IIYA 3PUJA 1JQDA 1CUGA 1OIVA 4N6NA 5IC5A 1THTA 2GAOA 4CEHB 3ZWQA 1WY5A 4IIJA 1K7SN 3DP9A 4NZZA 4KXQA 1C3OA 3C2QA 4HRAA 4IH4A 2FP4A 4PG5A 4RELA 3ZWOA 1KMHA 1BS1A 3FPGA 4YR9A 5B36A 3PF9A 1O54A 3EAGA 1YFZA 1R9JA 4FDAA 5K20A 2ZIGA 2P90A 3I9MA 5FI3A 2HLHA 3TZKA 4Z0HO 1A9ZA 1H8HA 2HBRA 5EE3A 2QAJA 1BN7A 4JLPA 4EB6B 3UV7A 5B3LA 4ALKA 3IAUA 2XNCA 2X5NA 3LLVA 5B12A 4DLLA 2GQ0A 1H1DA 5BV0A 1W25A 3BMXA 1MRSA 5HUHA 3N59A 5C8YA 1Q0TA 4BAZA 3T06B 3IT2A 2A5LA 2JHPA 4MK4A 4G8CA 1EVJA 3MIZA 4PLHA 5K8IA 3DFMA 3FCYA 1Y3CE 2Q0XA 2QTRA 1LFAA 1QP8A 1RRPA 4YFVA 3I2GA 3DR3A 3USZA 4D6YA 3BFPA 3H5VA 1H66A 4PO3X 3LQ1A 4RQUA 3CO5A 5EUCA 1HOTA 4DM3A 3B48A 3C14C 1U2QA 3VAYA 3FPEA 1GKUB 3DL4A 2J07A 1YA8A 3D8TA 1HDEA 2LCQA 5IYZF 4LXHA 5D00A 2D0OB 3R3YA 5BOVA 1KWGA 3ZHXA 5G3YA 4W6ZA 3P45A 4PZ9A 3WQBA 5D7NA 1RXUA 4C7VA 3CPSA 3KEMA 2VPPA 5FKJA 4QTYA 3DOFA 4R1PA 5FUMA 5KHLB 4C6RA 3RK4A 2C2OA 1Q5PA 3IEIA 1B0PA 1JU3A 3EC1A 4WXRA 2HK8A 2HL6A 4EYKA 2FB9A 3SXPA 1HTWA 1Q0SA 4OHZA 2Z30A 3KEOA 4BZZA 5CGQB 4KMOA 3OBIA 3U6KA 1T3GA 5F1PA 3BKXA 4KRGA 1YB5A 2FTKE 2OGWA 3HP1A 4Z4IA 3D8SA 1TEXA 4X1KB 1Q0ZA 2SCUB 1T2NA 3AP2A 2I3GA 3SICE 3RK1A 2C1ZA 4UE2A 5CB0A 2HV9A 4P32A 5C81A 2JFFA 2L17A 3C6BA 4YP1A 1YNSA 4JBHA 5GP1A 5A6SA 1U8FO 3GEHA 5ULLA 4O0LA 4JYMA 5JE8A 5GV8A 1N2XA 2E1PA 3AFIA 3TGWA 4D57A 5F9HA 1FSZA 4YHBA 5CDSA 4BN4A 3LCVB 3ZZNA 1O9GA 1SC6A 4H7HA 1KOGA 4KWTA 3IHWA 4GE0A 2C5BA 1L5RA 1T91A 1TK9A 2I3ZA 1ZZEA 2X5KO 4JJ6A 4JBYA 2JAOA 3A25A 4GPIB 4OO3A 4U2FA 2NSDA 4LMBA 3SKVA 2BYTA 1Z7YA 5CUQA 1BMFA 5AH0A 4PICA 1HX7A 3KSRA 1RAHA 3O31A 4FN5A 4NFHA 4X54A 3LT0A 1UFKA 4JI1B 3B12A 4RANA 3FDXA 1Z8NA 2J5KA 1WW2A 3V4ZA 1SXIA 1OD6A 2VBGA 5DXAA 4NEQA 4UVDA 5K3FB 1J8DA 3RVLA 2QZ4A 5I4BA 4FFRA 1GRRA 1IN8A 4UUOA 1FRFS 3AJ8A 4LUCA 5AVJA 1A8PA 3AZPA 4CMKA 1DG1G 3BMCB 1E5QA 2OBXA 5HZHA 2VR1A 3KR1A 1Y6QA 1FX0A 1T5DX 1WU7A 3VKWA 4U2KA 2GKOA 1R6AA 4N5DA 5HKLA 2QN2A 4QAQA 4Q9LA 4BC1A 1CHNA 1ZA2A 1UAGA 1YZHA 3D6MA 4H35A 5A9TA 2JLZA 5JNVA 3WMRA 2JHGA 2BR3A 2ZIAA 1ULTA 2G8LA 5IT5A 3RYCA 1E69A 1G8JA 3CEHA 3LC1O 4KDEA 5FNVF 2WT8A 2FEWB 3MJSA 5DSZA 1QU2A 4M6WB 4Y0VA 5TVGA 1QH8B 1UT5A 2QSZA 2YMMA 4HSEA 5HPYB 1ISIA 3OT1B 1EFVA 4FHZA 4IGFA 3UUGA 3G5MA 2GZDA 1O89A 1IMJA 1ZM2A 3PDHA 5B1YA 3CRMA 4KO8A 4M9SA 2PAAA 3SMQA 1LBTA 1SIBE 1I7PA 3EF1A 1GKLA 3EPKA 1W4RA 3M9WA 2C78A 2L19A 3L1HA 2OECA 4CPDA 5GZ1A 3C3BA 3LBYA 4DY4A 2O2YA 2QIOA 4QUIA 2HDOA 4OH7A 1L4NA 1NDHA 5ALZA 4BFCA 1XIVA 3FKQA 3RADC 1RPNA 3PX2A 4QA9A 3R6TA 5EZQA 4Y6QA 4MDEA 2DC1A 3COPA 3LC0A 1QRUA 3CNQS 1KMQA 3LT1A 3OEHD 3S7ZA 2N47A 4FOTA 2R5FA 1FTGA 2B94A 3G5TA 1U8UA 1HG1A 3IUQA 4U7WA 4WK6A 1GZ3A 1M1NA 4AZTA 4NBSA 3WFJA 4WNAA 4CM1A 1RJGA 1TRHA 1USGA 3DMNA 4G8DA 3NWJA 1K88A 3V48A 2R6JA 3WKBA 3OHPA 2WQ6A 5FBWB 4RWZA 3D7RA 1E94E 2PE5A 2RBKA 3QVWA 2C1XA 1C7IA 2A1UA 4HTFA 2JFZA 3UAYA 5GVRA 4FCWA 4CM8A 4L9WA 2H6EA 2NTVA 4M9RA 5ENVA 1N0IA 4YBZA 4W63A 4MSUA 4P7JA 4CT4B 3M9XA 4YUAA 1IH8A 2I4RA 3EW7A 4G3XA 1R50A 3QZUA 4YFYA 4L72A 1UXHA 2IYLD 2O8VA 3LHFA 2Q50A 1Q17A 1CUDA 1MQ9A 4BX3A 3DMFA 3UANA 2VOEA 2EOAA 1OWPA 1GLVA 3L7IA 1N6RA 1E3LA 3KQTA 3QXCA 4QDTA 3IX7A 4MHTA 4MXDA 5AOAA 1FRNA 4JXZA 4CN8A 3SQMA 5C7OO 3OEEA 3WLHA 2NSJA 1DLJA 1J90A 1BS2A 4ND8B 4DIDA 1Y3BE 2IZ1A 3MW8A 3PPIA 4YDSA 2KW5A 2GJ4A 4BNWA 5LKAA 5M2QA 4GRIA 4Z3DA 2ZR9A 5ELMA 4B81A 2CNNA 2IXEA 4H77A 1GL9B 4XJSA 1L4FA 2I6XA 1U3FA 1P17A 2KHZA 1M7BA 3SR4A 5LQCA 5K05A 1JEDA 2A78A 2Z6VA 4UVGA 2J32A 5CH8A 1Z22A 4JYZA 1FYWA 3BGOS 2XE8A 5EPUA 5JEDA 1U11A 5D1HA 5LQSA 2ANCA 3V2HA 3KSAC 2CVFA 1UBMS 2NUTA 6YASA 1CQIB 5IN4A 2G40A 3EY4A 1LDBA 2VJDA 3NT4A 2QORA 1XD8A 3EGCA 5EJMA 1NTRA 2ZS8A 4U2DA 3FUTA 3W4IA 4OI2A 3S0JA 3H5RA 1P60A 3SZRA 4FYVA 5AM1A 4GSLA 3IDSA 4KR7A 5ABPA 2V3WA 1MC4A 4ZO6A 1NOKA 4ZZIA 4RA6A 3WZMA 1SU8A 4RD2A 3MWLA 3OE5A 2BW0A 2QDXA 3TLGB 1SQFA 2EIHA 4KKVA 3UC9A 1AKQA 2VJMB 4G65A 3WGVA 3AM4A 5BN5B 4IR7A 4P53A 1LPBB 5LZ5A 2Q8QA 3CINA 2RGXA 3H6GA 4X20B 4AULA 1II0A 2IHBA 2YBDA 3QRWA 5BR4A 1UH5A 5AW7A 3DE7X 1N1GA 1ID1A 2XVAA 1WB4A 2WUDA 4MV6A 1D8AA 3CRQA 4TSKA 5AJVB 5LMZA 2OK8A 3N8HA 4L7QA 1PT7A 3HVIA 1FRZA 1J39A 1EDZA 2VL7A 3OMLA 4N6OA 4UCFA 3CSDA 1YA6A 5F4ZA 2YUTA 3C6KA 4UHKA 2YXPX 1ZIDA 2UZ1A 3DQQA 1DJQA 5B57C 1H85A 3PKIA 1WMDA 4C4YA 4QJBA 2HLDA 5DLDA 3ZWPA 3SDBA 2HJWA 3C3CA 1NMZA 4Q16A 4MARA 3OQVA 2BJVA 3UT5A 4YCLA 2J3EA 3DXZA 2X86A 3WSVA 3PJEA 2CUTA 1XDUA 3B6EA 2G9RA 1CS0A 4FOLA 4IX1A 1M0WA 1C0PA 1ODSA 2FY8A 4HAIA 2CLSA 2MSKA 4DIFA 4H7KA 2QTBA 2YVAA 3UUEA 3G88A 2C20A 1N7IA 1S0UA 2W2OA 4GRAA 4QYSA 4EYSA 3OF5A 3RT1A 3LGXA 4CDMA 1NYQA 3IE0A 4XLTA 5J2UF 4YRAA 2XXBA 5DNYB 1NUTA 1MU0A 2FPKA 2JI8A 1NYTA 4QUKA 1QB7A 5E1OA 1IBLB 2ZIUB 5T41A 4KMSA 3WOHA 2XWSA 5LNK1 4II3A 4BZQA 3D8HA 5DTMA 5FEMA 3TZBA 2V7TA 3DMTA 3ZHRA 5LQDA 3PNLA 2W8ZA 1I30A 1GPNA 3KM0A 2DAPA 1LSUA 3V8EA 4QO7A 4H4EA 4HNHA 1KO7A 2GVDC 1P9WA 3ESRA 1UBLS 1WHSA 2C96A 3EUWA 3GAAA 2J3JA 3CNHA 4IIJB 4Q4JA 1K9SA 3BWCA 1C3OB 4KLZA 5A4FS 5JWRA 2FP4B 4LOKA 2OD2A 2XGOA 1KMHB 5FA6A 4CKWA 1Z5OA 1O8CA 1P2DA 1XT6A 2C2KA 2FFJA 3FWZA 3GBSA 1Q7RA 3H75A 2QJOA 3O3CA 4NULA 2QUHA 5AK6A 4BLPA 3GT3A 5HDBB 3FLMA 1YTUA 5COAA 3EH1A 5F5LA 3QU2A 4OOEA 4DT1A 2BDTA 2WHRA 1G4AE 4DIMA 1MH9A 1BX1A 2CJYA 2YQ5A 3LPDA 3OX3A 3OZTA 5AKIA 2H7YA 2PR2A 1GZHB 2ZETA 3ZV3A 1HNWB 4IVPA 5C8YB 3AVUA 4G5RA 3WKAA 3ZGYA 4URFA 1ZH4A 5TEVA 3H18A 1F48A 1MO6A 2E4AA 1Z18A 2UZ0A 2YXDA 3L6BA 1OAKA 4OXYA 2E5FA 3V2IA 4XYLA 1HQDA 4Z53A 4GP6A 3R7NA 2X8BA 1RPAA 2NAFA 4HDRA 5I4CA 2BL4A 4OHPA 4XH9B 5FA8A 3KKLA 2FUG1 3IP8A 1DO0A 1XCMA 4RCVA 5C1DA 4TV8A 4WI1A 1SXJC 1C0EA 1ZMTA 1UXGA 2W42A 1JZSA 2VDLB 2WSYB 3A4LA 3ISTA 4B33A 1RJEA 5U4QA 2O7SA 3BWEA 3KAKA 2JZCA 4BUCA 3DCIA 2IX3A 3PNVA 4MGEA 4KX3A 4JJAA 2XVZA 1QIIA 3F8TA 4FXPA 4K26A 3R7BA 3LUKA 2DPMA 3HO6A 5BYKA 4D7AA 1NW6A 2QD5A 2C31A 4FR2A 2C99A 4MB0A 3ZR4B 1DAOA 4PYJA 1NDQA 1AUPA 2DH6A 2HXGA 4TMYA 3WKDA 1D6NA 3KQQA 4AY6A 3NVMB 3E3MA 4LKOA 2RG7A 2Y1FA 2YDXA 1L7QA 1TYBE 2MMCA 2AOTA 3ZDXB 3C6YA 2KI5A 3JZFA 1Y7LA 3PBKA 5A6SB 3LZCA 5EXTA 2XD4A 3PI6A 2FPOA 3LBHA 1Z6PA 4LCBA 5HF6A 1D2GA 1AN9A 1E20A 1JNYA 1PNOA 3J7TA 5TV2A 4CNBA 5HJEA 1P1IA 1WCWA 2VQ6A 4RM2A 1KDVA 3WR5A 3EF0A 4G1CA 1GPKA 4RL4A 3N07A 5GPBA 5CCXA 3GZNA 4R69A 1XPUA 3G02A 4LOHA 4QVGA 5TGTA 3TLAA 1WNTA 3C8ZA 1K5HA 2MDTA 1L5QA 2B21A 4BKUA 3PEUA 5H02A 4YP7A 1RD4A 4KDRA 4RAQA 1KE2A 3N7AA 2V9PA 5KZMB 2P1ZA 1DXYA 1EBUA 3OE7D 2QBYA 3FTDA 2BBWA 3RAFC 3M6WA 3NPMA 1R2QA 1VFNA 3LLUA 4IDPA 1SQ6A 5K51A 4DR3B 1QRRA 2C0QA 1OQAA 3CT4A 3R77A 4GI7A 3W6UA 1OLXA 4RYDA 4RK7A 3V1MA 3H9QA 1K9VF 4YJDA 1YIAA 5F1OA 3SSMA 5AJUA 3AOGA 2FRDA 4PYMA 1I01A 1FX0B 1Q15A 1TFRA 5KQRA 4LXGA 4AF8A 3AM3A 2P2DA 1Z25A 3OKPA 2EATA 1S2GA 5DXJA 4BWFB 4MP8A 1CIPA 2OZPA 3NAMA 1IBCA 4KQJA 4GBED 2FN7A 3FVTA 3WL5A 3RYCB 1U6KA 1CF9A 1W34A 2VLBA 4XRRA 3I6MA 1HKHA 2QIPA 4A16A 1K6MA 1KI1A 3QH4A 1EFVB 4O4HF 2IK8A 3ETHA 3LCMA 2ZJ1A 3F5MA 4D9NA 2HCJB 5DULA 1Z2OX 2FX3A 1H3FA 3DOUA 3M4NA 5H4GA 5LDHA 2XZLA 5KREA 1ZGCA 3OTGA 3ACCA 2CVHA 1ZP6A 5HFJA 3ZV6A 1ZI6A 3JALB 4PC2A 4U2CA 5LP6B 1C0KA 4AK9A 4N76A 5SYAA 2NXWA 3RFFA 5CFZA 1QNFA 3CR8A 4CEIB 4YT4A 5BSMA 4IDHA 2BCEA 1OBCA 3F4LA 2N9UA 3ZCSA 3SF8A 2DG2A 2WW8A 1W581 4I4CA 1YMUA 4GYKA 2CYCA 3DFZA 2QYOA 4DM7A 3CCFA 4ER0A 3K09C 4TOIA 2A88A 1YDFA 2VPWA 4GPBA 5C8DA 2XYQA 1L5HA 1M1NB 3LX6A 4YXWA 3ZLTA 1J07A 4WNAB 1OH6A 4DEXA 3DFFA 1P6QA 3UMCA 4GX5A 2WTMA 3RCBA 4AN1A 4M0CA 1SKMA 5KTPA 1GP2A 1S9HA 3GEIA 4PXYA 2NO6A 4W9NA 3QEAZ 4BNDA 3OCVA 3VJKA 4KV7A 4N5MA 3DD1A 3JS5A 2AX3A 3K94A 1UXJA 1Y1LA 1FFHA 2A1UB 2Y1XA 3FHLA 4HTFB 4U6SA 2WY2D 3AZQA 3RT9A 4AO6A 1U0GA 1CDEA 2OD9A 3ASUA 3MCTA 2APJA 5GM1A 2KLHA 5HCIA 3JQGA 3AP3A 3GRYA 3CZRA 3S2IA 4DQKA 4K9NA 1XRNA 3WY9A 2JFBA 1U7DA 2WJ6A 2C4WA 1GAWA 4D9BA 1CY7A 4UZEA 2A2ZA 4EY5A 1XTTA 2P7IA 1T9AA 4MVCA 4J0GA 4Y2GA 5K0EA 4R2XA 4KQWA 1XJCA 2PYDA 1TQ4A 4NR0A 1SHZA 1P5ZB 1L8XA 2IKQA 4DLUA 4WASA 2Q45A 2O7VA 3H2GA 1KK3A 3GZ4A 2VBFA 3RE1A 2HK6A 2DKNA 3LQQA 3COSA 3NXKA 5DYTA 4AB1A 621PA 1T2CA 3ZIUA 4YV7A 2A9VA 2PRKA 4XWGA 2X14A 4KH1A 1S9DA 4KN6A 1I6WA 2QTVA 1V5EA 4O0MA 5J1TB 3WRXA 3ND9A 3RARA 4RKRA 1ZOOA 3DP7A 4XYBA 3UJDA 3URKA 4JLJA 1Z62A 3RUHA 4X3OA 5E9JA 1L8AA 3AUSA 3MB8A 5IAAA 3OA0A 2XKKA 3RUEA 2GPNA 3G5UA 1WVGA 4LW8A 2IBSA 3V8BA 1DAEA 4OD0A 1KS2A 4A3SA 3GP5A 4CNQA 3U4QA 1Y8RB 5JAZA 1XG5A 4BWYA 1VLQA 3QWIA 1DINA 2NUTB 4OMDA 3S2UA 2IOFA 3SR0A 4AQDA 2AR9A 1IIBA 2E87A 4ZO4A 2P9GA 4LIPD 1DUIA 3DL2A 3AC0A 4RD0A 1I2BA 2BFDA 4GU5A 3AEKA 3LO5A 5TJ9A 2MT9A 2IXBA 3JRWA 4QOHA 3GPDG 2EJWA 3EYWA 2AR7A 2IEZA 4HUJA 1UR5A 3FAZA 1VA5A 2H52A 3ZCVA 4BN0A 3SC3A 1XELA 1CVIA 1HLDA 5CM9C 3OLVA 1RQ2A 2NTYC 4RA6B 1RWVA 4JEUA 2AJLI 2FMUA 1TF7A 2O2HA 2I7VA 2AC7A 4CMEA 2XDYA 3FCCA 4L28A 1LTKA 3E9YA 1I4LD 1SNYA 4JBNA 4LKRA 3F67A 3DO6A 1MD9A 3AKDA 3K5HA 1LX6A 3KT0A 5EJAA 5H3CA 4AJ4A 3R24A 3FY4A 1AO0A 4PN3A 2SBTA 3RUCA 5EMKA 2JKZA 2HMWA 2R7LA 3ORYA 4YRZA 1ZNXA 3QBVA 4GOXA 1AXRA 4JP3A 4MYHA 1JFRA 2ZJ4A 1HXHA 2WIGA 4MQFA 3E9RA 1Z3CA 2X3FA 4OFWA 5T4HA 4YX9A 4G36A 4HAXA 1T3TA 1YOBA 3QKIA 3CEAA 1Z5NA 2J0SA 1T9BA 3T7TA 5KYUA 2RAFA 4JA2A 2UZ1B 2WT4A 4FJ1A 4TSFD 2Y0EA 4AJNA 1RC0A 4ENWA 1GGHA 4DV7B 3DE3X 2PRIA 4L0DA 4F8EA 2O8CA 4IDCA 1JJAA 3H2IA 1JH8A 5K8CA 4C4XA 2IQIA 1V8FA 2FZ5A 1GN8A 4Q3CA 5JMWA 1EGVB 3ULKA 2UYCA 4A36A 3C4JA 4MVJF 1OBOA 3DONA 1O94D 3HU5A 4PPQA 2AOWA 4BQIA 5MN6A 1CS0B 4MUXA 3B20A 1YC2A 2PX8A 4H9GA 5F51A 3ZOKA 4EGJA 4YUXA 4B6EA 3L7DA 4BGEA 3F6BX 3HFGA 3KPYA 1OXBB 2YS7A 2BDUA 4MTLA 1DBVO 5C4GB 4QQRA 2UYOA 1QP0A 3GFQA 2PNJA 4WKGA 4J9UE 1P5JA 4FBGA 5CFOA 1XLTC 4L8YA 4Y2RA 3D54D 2VSOA 4V0KA 3VSDA 1JU9A 1SHTX 2B1IA 1HURA 4ES6A 3M8KA 1H3NA 3S40A 3H17A 4QUBA 5CDYA 3JVUA 3GEBA 4L7VA 5FWYA 4HYEA 5FOTA 4EF6A 3PFNA 4OUKX 5ADUS 1FP6A 1VFPA 3FOBA 1CB7A 4QNRA 4WACA 4DYHA 1ISHA 4V3BA 4TWJA 3GD5A 1NBMD 4PG7A 2QWXA 4E3WA 1WHSB 4QECA 1G5RA 4G4SO 4PEVA 4IUBS 4Q4JB 4J91A 4MAMA 3EMDA 4CKWB 4C2TA 2H29A 5GJWC 2EKLA 2X1VA 3IB6A 1W0KD 2X8LA 5I8WA 1EWYA 4EW2A 3VU9A 1AB6A 3IPYA 3ZH2A 3AI2A 1LNQA