3AHFA

Phosphoketolase from bifidobacterium breve complexed with inorganic phosphate
Total Genus 322
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
322
sequence length
802
structure length
802
Chain Sequence
VIGTPWQKLDRPVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFIMGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVAGFDNEDHMSIHRRFAELFETIFDEICDIKAAAQTDDMTRPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVIREDLKLPELDQYEVTGVKEYGHGWGQVEAPRALGAYCRDIIKNNPDSFRIFGPDETASNRLNATYEVTDKQWDNGYLSGLVDEHMAVTGQVTEQLSEHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSLLINKTFNNDHVTNIYFATDANMLLAISEKCFKSTNKINAIFAGKQPAPTWVTLDEARAELEAGAAEWKWASNAENNDEVQVVLASAGDVPTQELMAASDALNKMGIKFKVVNVVDLLKLQSRENNDEALTDEEFTELFTADKPVLFAYHSYAQDVRGLIYDRPNHDNFHVVGYKEQGSTTTPFDMVRVNDMDRYALQAAALKLIDADKYADKIDELNAFRKKAFQFAVDNGYDIPEFTDWVYPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylulose 5-phosphate/fructose 6-phosphate phosphoketolase
publication title Crystal Structures of phosphoketolase: thiamine diphosphate-dependent dehydration mechanism
pubmed doi rcsb
source organism Bifidobacterium breve
molecule tags Lyase
total genus 322
structure length 802
sequence length 802
ec nomenclature ec 4.1.2.22: Fructose-6-phosphate phosphoketolase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
A PF09363 XFP_C XFP C-terminal domain
A PF09364 XFP_N XFP N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahfA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahfA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahfA01
1NI4B 1X7WB 2VBGA 2PGOA 1PYDA 4JU8A 5HGXA 4KXUA 2EZTA 1ITZA 2BP7A 1W85A 1V1MA 4KXYA 3EXFB 2VK8A 2PGNA 3ZHVA 1UMBB 1W88B 1X80A 5ERXA 4K9PA 1OZGA 2Q28A 2JIBA 1OLUA 4FEGA 5EJAA 1MCZA 1AY0A 5EJ7A 2G25A 1WCIA 3OOYA 2VK1A 4JUBA 1TKAA 5K3SA 3M49A 1PO7A 5EXEA 4Q9DA 1YD7A 3ZHUA 3FSJX 2BP7B 2JLCA 3F6BX 1W85B 1PVDA 1V1MB 5IMSA 1QPBA 2G67A 4K9NA 2UZ1A 1ZPDA 3AHCA 2IHUA 3HWWA 2C3PA 5EJ4A 3AHGA 5K6TA 2BEVA 5EJ8A 4GM1A 1X80B 5ESDA 1OLUB 2G28A 3UK1A 3EXG2 2JI8A 4XEUA 3LQ1A 5AHKA 1WCIB 1V5GA 4QELA 1TRKA 1Y9DA 5HHTA 1T9DA 2QTCA 5DGTA 2PDAA 1V5EA 1QS0A 3FLMA 2C3UA 2BFCA 1YHYA 1YI0A 2BFEA 5EJMA 2C42A 4KXWA 2EZ8A 2O1XA 1R9JA 1X7XA 1T9CA 2IHVA 1UPCA 2IHTA 2OZLA 1KEKA 2BFBA 2VBIA 4RJKA 2NXWA 1UPBA 2JI7A 1N0HA 1U5BA 3OE1A 2Q27A 2JI9A 1BFDA 4JU9A 2VJYA 2BFDA 1YI1A 5I4IA 1V1RA 1OZHA 3EXHA 4GM4A 4JUCA 3M7IA 1X7ZA 2BFFA 1OVMA 4COKA 1JSCA 1QS0B 2BFCB 2W93A 1X7YA 2Q5JA 3FZNA 2BFEB 2V3WA 1X7XB 5I51A 5DGDA 2OZLB 2YICA 3EXHC 5K2OA 2BFBB 2JGDA 5I5GA 1V5FA 3EXEA 4QPZA 1U5BB 5HYVA 3HYLA 2Q5OA 4WBXC 1OZFA 4JUDX 3F6EX 2R8OA 4MPJA 4C7VA 1DTWA 2BFDB 2BEUA 3D7KA 2R5NA 4MZXA 2X7JA 2BEWA 1T9AA 1PI3A 1V1RB 3EXHB 2WVAA 3EY9A 1X7ZB 2BFFB 2EZ9A 2R8PA 2VK4A 2C3MA 1X7WA 1X7YB 4ZP1A 4D5EA 3AHJA 4KXVA 3LQ2A 3DV0A 1OLXA 4K9MA 1B0PA 3LPLA 3AHDA 1T9BA 2EZUA 3MOSA 1V11A 5K6RA 1POXA 3DVAA 3EXEB 5C4IA 4FEEA 2XTAA 2UZ1B 2C31A 2XT6A 1DTWB 2BEUB 4C7XA 1OLSA 1YNOA 3ZHSA 5EJ5A 2BEWB 3AHEA 1UM9A 2BEVB 4GG1A 2JI6A 2AG0A 1NGSA 1QGDA 1TKCA 2FN3A 2J9FA 5HJEA 5EJ9A 4RJJA 3LQ4A 2WVHA 3UPTA 3M34A 4RJIA 3DV0B 1OLXB 2O1SA 3L84A 2FWNA 1GPUA 2Q5LA 1V11B 3JU3A 3DVAB 3IAFA 3E9YA 2Y0PA 4KGDA 3EXIA 3AHIA 1UMDA 2DJIA 1OLSB 3EYAA 5FEMA 3EA4A 3M6LA 2XT9A 2UZAA 1UM9B 4K9LA 1RP7A 4JUAA 2J9FB 1UMCA 1IK6A 4GM0A 2E6KA 4JD5A 5EJ6A 4MPRA 3ZHTA 4QQ8A 3RIMA 2QTAA 2C3OA 1V16A 1POWA 4GP9A 3DUFA 3AHHA 3ZHRA 3EXIB 3AHFA 1UPAA 1UMDB 2Q5QA 4KXXA 1NI4A 2AG1A 1Q6ZA 4K9QA 3HWX1 4D5GA 5I5EA 1TKBA 5DEIA 3KOMA 2JLAA 1YHZA 5EXDA 5ERYA 2JGDB 1UMCB 1Z8NA 1L8AA 4JUFA 4K9KA 2Q29A 2YIDA 2WVGA 3EXFA 3ZHQA 4K9OA 1UMBA 1YBHA 1V16B 2EZ4A 1W88A 4MPPA 2VBFA 4GPEA 2C3YA 3DUFB 4MQ5A 2IEAA 3IAEA 3EXG1 3AI7A 2PANA
chains in the Genus database with same CATH superfamily
1X0VA 1Z4NA 5HBGA 4PYOA 2HA6A 1YUMA 2VTKA 4J7AA 1DAMA 2HBZA 4X85A 2NUBA 2VSOA 1K7SN 2GZAA 2WB4A 2H07A 1C30A 1UH5A 3DWGA 5F35A 1ORTA 2O5VA 1F2VA 2ZYVX 1UBLS 2P2NA 4KVFA 1S02A 4BLPA 1EFPB 1WPQA 5FWDA 1AM4D 3T1TA 1XRRA 3LT0A 3QX9A 2VI5A 4N3GA 3E84A 2XCLA 1J39A 2EWVA 2YMQA 3KZKA 4JEMA 1VKNA 1L6RA 4KEAA 3HDGA 2WTEA 1OGJA 2VXBA 2OQ2A 4YAUA 4RQBA 4RDHA 1COWD 2AJDA 4RV5A 3H3FA 1WW2A 4GKJB 1RI3A 1FP2A 4KX3A 3Q72A 4WOKA 2AR0A 1NE7A 5DGHA 3X1WA 5EPOA 4IFEA 1NZDA 3AEYA 4HS9A 1XD9A 5CYOA 1E6KA 1JV2B 4HC4A 2R6CA 4JT8A 4KXYA 1DEOA 5D00A 3UUEA 3DZGA 5JFOA 3G1WA 1XRQA 4CKEA 5KQPA 1XJCA 3F6YA 3FOEC 1J2UA 1VRVA 1RQLA 1ZK0A 3CNQS 3QU7A 3ESYA 1L4GA 1ISMA 3SNHA 5BSMA 4BFTA 4ZYWA 4R2JA 2X76A 3N86A 4QOIA 4DCNA 2QJFA 2BEJA 2YW2A 2FRDC 1J70A 1HI9A 1XEAA 4GBGA 1A2BA 4OUDA 5ED0A 3KDAA 5LA6B 3LX5A 4CF5A 1N7HA 4CR7A 5LLDA 1OW3B 4LI0A 3EFEA 1ISJA 1I2BA 1FC0A 3Q3GE 3VR2D 3IXLA 3DL0A 3ODGA 1M76A 1EBUA 4KO4S 3IIKA 4OREX 4XQGA 3HUFA 3ZZ1A 1K88A 2RHDA 1LI5A 2RSLA 2V7GA 4FEGA 2P4HX 1JT2A 4PRLA 4QOHA 4ZDWA 2FJPA 1N9ZA 2XCTB 1GG2A 3ON5A 4WL0A 3JQBA 3GUCA 3VDXA 5DASA 1XC7A 1FDOA 2B8JA 2VQFB 1TMKA 3FNEA 1B6TA 3JRNA 2Q3LA 4V0OA 4B80A 1O96B 3FCCA 2EFJA 4QHSA 3BYZA 2DFKB 1D7OA 2RIRA 1EFAA 2N1BA 4BDSA 5K3SA 2AI3A 1QVWA 3MFYA 4J2HA 1ST2A 4RPCA 3WLTA 5C5IA 3B13B 5LJIA 4PO3X 1LBHA 3F71A 2WQZA 4KYVA 4BFCA 2DQSA 4DSAA 3T94A 4XIIA 3D3NA 2D7DA 5K0ZA 2WTNA 3AETA 5AP9A 4ZV4A 1HDYA 3IVMA 3L7AA 1DCFA 4ND7A 5JSFA 2BH2A 3SBOA 2F3UA 4Z86A 1A8UA 1F4VA 3EVBA 3FVVA 1IN6A 2W43A 3FBWA 4GX5A 4IX1A 5TQ0A 2M1ZA 2RH5A 3HWWA 3KQUA 2R751 3RG8A 2QTNA 4JBXA 2PS9A 3RB8A 3WRYC 1OFUX 1PSZA 4Q9IA 3SYRA 4BNHA 2ZSJA 1QRUA 4C08A 5IJ0B 1LJUA 2MSLA 1Z2EA 3E5NA 1A4IA 1J4AA 1V4VA 3SP1A 1TRHA 1Q14A 3R9WA 4AKIA 4Q02A 1AXEA 5ITWA 5JSUA 2B9EA 4PINA 4EY7A 3LUCA 4QBHA 2Z8YM 4HB3A 1IH8A 4AVYA 2XA9A 2YYZA 1I3OA 1JYEA 1MEJA 3FBGA 4ZOAA 2AE1A 2HRCA 2H2IA 4FLFA 2CNLA 1NUPA 4MKXA 1JF8A 1XD8A 1LPNA 3HEBA 3ERCA 3KR0A 4C5AA 2B9VA 3UM9A 2UYCA 1H5NA 1DAHA 4K7JA 2P9QA 2VYCA 1XJ5A 4FINA 3QW4B 5IBCA 3CKLA 3FFXA 2GEUA 3WO1A 3ND6A 1RPAA 4F5EA 3O4VA 2PL9A 1C9NA 1VCNA 1KFKB 1Y9DA 3MTDA 3U9SA 2EKLA 4RPGA 4XYGA 4TT3D 5I9MA 5TSDA 1Y48E 2BFMA 5TPZD 4EARA 4HRAA 4DMRA 4HYEA 4G9EA 3IEMA 4BNFA 2IYUA 1GZ6A 1TYCA 2H54A 3UUFA 4EDHA 1LA2A 3EF1A 3WGOA 1MKYA 4I1OA 2WHEA 1ZP6A 3C97A 4XJTA 5KOHB 3U40A 2YWGA 3WAKA 4DPMA 2XZOA 3SY8A 1E61A 2QR3A 3H5WA 4YJGB 4PQEA 3WLFA 4AJ9A 3UJAA 2CBZA 5TF0A 4WNAB 4KXWA 1EM6A 1YAJA 2X8LA 3N87A 1ZA2A 1R0BA 1M34E 4QYIA 1UKVY 2QTMA 2ZIGA 2VF4X 4R1QA 5A4FS 2BFBA 2TMKA 4RJKA 2BCGY 1OZAA 3EDRA 4XARA 5I8ZA 3AFMA 1TDJA 3MPUA 4MI9A 3I2IA 1KHHA 2MR6A 4PM4A 4G07A 1UBEA 4BVKA 5GV8A 2HQSA 3M4JA 4FHDA 3MBKA 5I7AA 4TUYF 5KSOA 1PK7A 2Q27A 1TYDE 2R6ZA 3PIRA 5JD6A 4LMPA 1G7CA 2WKSA 2Q5IA 1ZD9A 3CEMA 5IW8A 1LPOA 2BGJA 2PYDA 1U31A 2H7VA 2P9CA 5DTJA 4YBRA 4ZAWA 3LGSA 1E5DA 1I33A 4A73A 4F9TA 1DEKA 4EECA 5J4VA 1TNDA 2Q3FA 1X2EA 3L4SO 4N7MA 1M2HA 2MR5A 5CP8A 4F3CA 1CPYA 2JLYA 2P0AA 1ISFA 3O8QA 2I99A 3FCAA 1MDFA 1HT2E 3GMDA 2B20A 3OCXA 4L5BA 4M36A 4NYJQ 5IJXA 3T54A 3UCFA 1EFRD 4PQYA 2VT6A 2BMFA 1U81A 2R4QA 2CFCA 2RHLA 2XGMA 2Z09A 1LVHA 1VGRA 3MW8A 4GMHA 1HC7A 4HDMA 1Z5OA 2RHBA 3HCEA 3KJXA 1QG0A 3WV5A 2FDXA 1TM2A 2IYXA 5BWLA 1X7ZA 4LSZA 4M8SA 4L74A 1KRWA 2RCNA 2WMNB 2JFQA 1NYQA 3MMZA 4MWZA 1W4BA 5JH7A 4COKA 1T3HA 5DYNA 1XZBA 2EL9A 1X38A 3BWYA 5IC5A 4REQA 4NV3A 1PL6A 2W93A 3LHIA 4QNRA 5TS3A 5TIIA 2DF8A 2YXNA 4MQFA 2QLFA 1M7GA 1VG1A 1RYFA 3HCCA 4PAMA 1ZESA 3IUSA 3U5TA 2BSXA 4FUTA 1KP9A 4YRSA 1ZC3A 5BUCA 4LOIA 4QTYA 3MBIA 3LKDA 3OOWA 1NT2A 1RTTA 1TT5B 2I9PA 5FR2A 3VHLB 4WHMA 1U2DC 1NSTA 3N0XA 1DJMA 1JFTA 2PHZA 1Y9ZA 4N3AA 1CXZA 4WOPA 2W6ZA 3TW6A 1N6HA 3GGJA 2PA0A 3A9RA 2ZSIA 3LLSA 4QPZA 5IKEA 3RYCB 5HNKA 4P7GA 3N2IA 3LX8A 4YCBA 2VDUE 1W2GA 4GPAA 4UZFA 4R1TA 2Q46A 4CQJA 1S8NA 3V7YA 4G5QA 3GUVA 1PJQA 2ZE7A 5LL6P 2HC9A 4IDAA 1ZGHA 3K20A 4ISBA 4MKZA 3S28A 3V8RA 3MGBA 3PQ3A 1OASA 3LU1A 3KKPA 4G5OA 4YH1A 1HKUA 3I42A 4GX1A 4OLAA 4RL4A 4XYMA 1T9AA 2JZOA 1PI3A 3I12A 1GQQA 3K4QA 5JRDS 2PUBA 3Q7SA 4I81A 3CKKA 1VHQA 4G23A 4JP5A 4RGVA 3UB3A 4GC5A 3E9CA 3UMFA 3UAOA 5JXGA 5DXJA 1SC1A 1HDGO 3VO9A 3T9FA 2V6JA 4LAFA 2BH9A 3H5OA 2DY0A 1NAIA 2H1LA 4KE7A 4PSUA 2O0KA 1QZXA 3KQOA 2VP6A 4FCVA 5G41A 4L50A 3GG2A 3KSMA 1Z6GA 4L08A 5CT9A 1LVUA 3A6GA 2C88A 4IHQA 3VTFA 2P9BA 1SGWA 3EGEA 2IIPA 4J29A 1SVMA 3C3KA 1VB3A 4MKFA 3P52A 1LEHA 2I7TA 5BV0A 4G4GA 2EJWA 2A6PA 4Z1MD 4YR9A 3TTYA 5ESRA 3H5IA 5CGQB 3W1WA 5K6RA 1AMOA 1QBGA 1EEHA 2QRGA 5BSWA 4HG2A 4Y8VA 4BECA 1ZR2A 4NCBA 5DMHA 1Z18A 6CHYA 1GPJA 2PUWA 2FZLA 4IDPA 4CMGA 1NJGA 1J7JA 4A6EA 4C89A 3HZOA 4JJKA 4E21A 3F1KA 1O9BA 4C0WA 1DQRA 4GYYA 5AVQA 3SDSA 2HY7A 3UK0A 1D0VA 4UKDA 3L1VA 1E0AA 2R7KA 3NWBA 1SUPA 4A2QA 5KQSA 3IEUA 3AY0A 2UDPA 3EY4A 3BEOA 1VLJA 3E22B 2WSMA 4C03A 2OBFA 3OMWA 5A6VA 5IKPA 1BXRB 3QVSA 2R84A 1QFYA 2BEVB 3VZBA 3AKCA 2OAGA 4DLUA 3VOTA 4DFDA 1TM4E 1KH1A 2O6LA 3V7NA 3FUVA 3UJ9A 1FFHA 4BL5A 4CL2A 2WUEA 4QODA 3MGGA 2VLBA 1DV2A 1ZUWA 2NTVA 2ODEA 4CIWA 1BDHA 5ECGC 5LP6A 4WZBB 4J0IA 2AMYA 2EV9A 1G5FA 2CVHA 3PVSA 3NVMB 4ARZB 2FFQA 3B9PA 1H2XA 2BFOA 2UYHA 1ZS9A 2HBYA 4LC9A 4O02B 3U26A 3EBLA 5HF5A 3WAJA 3DTVB 1IIBA 4PGFA 4O2AA 2BHRA 4AUMA 3L9XA 1DRKA 3V32A 4N7RA 4W5JA 4AJ1A 4EKEA 5HUHA 3SVTA 1I7DA 3EAFA 1XRLA 3DCJA 1QYWA 3O3OB 4IDHA 1YA4A 1QE3A 2IEDA 4XGIA 3VVCA 5G0WA 1KDTA 3T34A 1C3JA 1FP7A 3DE6X 4G63A 4X6LA 1PR6A 3PJFA 5E6RB 5FQNA 2G9ZA 1PEYA 4X00A 3ZJUA 3WRXC 2O7NA 5LOVF 1RXSA 2NNWB 2J59A 4EDFA 2RE8A 5CFLA 4RVDA 1NYRA 5E0OA 2XRMA 1KYVA 1TMYA 3PUXA 4MR9B 5MN5A 2XGOA 3B1ZA 2VCYA 1L1QA 1DOHA 4RDXA 1NRJB 4F4DA 1NAHA 2Z2JA 3GLHE 1A9TA 3L1HA 4NMWA 3SQDA 1ZUHA 5ALQA 1W1WA 4IAOA 4RVHA 2JH8A 3P9YA 3U17A 4DNXA 3MJFA 1ODJA 4GKAA 1FS5A 2W4MA 4BZZA 1D2CA 3FKJA 4GR9A 3EQZA 4MP3A 4O29A 5ALDA 3W4KA 4DJAA 3NBUA 3HJAA 3ZV5A 1JLRA 4E5UA 2GZSA 2WHRA 5ESWA 4GT1A 2CLLB 4KTVE 2V6GA 2QUAA 1PNRA 4AZ0A 1GGNA 2L82A 4OB8A 4NYIR 1SXQA 4B3SB 1LWNA 2RKWA 2ZJYA 3DAOA 2QE7A 1OH6A 1NSYA 2PGXA 1U9IA 3DMTC 2IYPA 4RTLA 5ISMA 4YT4A 5FWAA 2PH3A 4R0NA 3PXXA 4CMIB 4LPKA 4CQMB 3GY0A 1NHWA 5EKXA 5L7WA 2J9YB 2B61A 3GC6A 5AIAA 2XNKA 2ENUA 4GWKA 1C9JA 2F48A 3DOOA 5B64A 2ZIWB 4XWWA 1M6NA 3DW3X 3E9ZA 2OQVA 3WMRA 5D1HA 4Z2AA 3PZBA 4MRMA 3BQ9A 2B2NA 3M9WA 1SOWA 1XVIA 4YRAA 5A62A 1E5VA 4HWKA 2CDBA 3DKRA 2X58A 2I1QA 3K1AB 4E70A 1I4TD 2IGBA 1UXJA 3KELA 3N6XA 2GPWA 1A8SA 4HRXA 4XJSA 3NTQA 2CV0A 4AIIA 3KS9A 4G1MB 4QBTA 5EHNA 2Z2YA 4CFYA 1V71A 4TMTA 3SR3A 3GEMA 1DDGA 1T6BY 2Q5QA 3CEHA 3JQBC 4A0RA 3BDAA 3EOZA 5H4GA 1O6BA 2OO7A 3D1VA 4D26A 5DGCA 4D92A 2WJGA 4OHRA 4PHGA 4N3BA 5FEUA 2PVCA 3B6IA 4G2TA 1HE2A 1ZNYA 5E9AA 2B8EA 4OLFA 2NZYA 1ZUIA 2EWMA 3GVIA 3IUBA 3QUAA 4L6IA 3JY6A 5B1YA 1G8HA 4L22A 1L4MA 1DDOA 3OSUA 3RLIA 3HYCA 2Z9DA 3P9QA 1LPBB 1IBLB 1Q11A 4QJIA 4BXOB 1CUZA 1W25A 1GPYA 1OFGA 2V1UA 4NKRA 3DJYA 3SDZA 1UR5A 2DMRA 1FP4A 1VMEA 2NXCA 1OXXK 3KG2A 2E1RA 1BJKA 4UEJA 5E7QA 1BWSA 2M6KA 3V48A 4L4UA 2QYOA 1PSDA 4JVSB 1KC3A 5DXAA 2OK7A 2WYWA 2ZT6A 2VJDA 3EEYA 3Q12A 2XKJE 3JSAA 2UZ0A 3QOYA 3QG5A 4TVKA 4RABA 2NTNA 5CD9A 1HKHA 4JFRA 2AQKA 4FD2A 2WILA 3HXQA 4AO8A 4IVNA 1A7KA 1V95A 4OQNA 1UZLA 5JBIA 2P65A 3EIWA 4JXKA 1XTQA 3BE8A 4MI6A 4QEDA 3JD3A 4CG0A 3U4HA 3KTAB 4P54A 4C4AA 2B4QA 4C2AA 1DKMA 3BUSA 4RH1A 2HIMA 3CH4B 3TR6A 1KFBB 1RJDA 1VA5A 2ZR7A 4P4LA 3U80A 4MV4A 2H1SA 4QDZA 3INYA 2GO7A 4WXEA 3T35A 2V74B 2GK6A 4NONA 3VI4B 4E2YA 5LNK1 3FJ1A 2VP2A 4IY1A 3UK7A 2FR0A 4GI3A 2IIQA 2J45A 4FFPA 4YS6A 1G5HA 3JVEA 1BE1A 5H3LA 4RCZA 3EOAI 1FZQA 1Q1ZA 3IE0A 1S5PA 2VO1A 2Z2KA 5C8VA 3L18A 5AVWA 4JYBA 3VR6A 4EO7A 5JNLA 3RV4A 2R97A 3RVRA 5H7XA 4PC2A 4CV2A 5LQJA 4L0CA 3BGSA 4DLSA 1ZVMA 2V7VA 5D5HA 1EA7A 5JTTA 1B8PA 4Y6RA 2EZTA 3SGLA 1CR6A 1ITZA 4AJ2A 1RLUA 4DWJA 4KHPB 1GADO 4FNOA 1C0PA 4M99A 4NENA 1PP4A 5ALJA 2R79A 5T64A 4D79A 3N2GA 3HVRA 1J25A 2IE8A 1P91A 3UQYS 2IYEA 5G3ZA 5K4AA 3OX4A 3DMYA 1RI1A 2WWRA 4H3SA 3G2LA 4S05A 3UJDA 3MJSA 5G4LA 2ODWA 4ZAVA 4P34A 4BB0A 2Y0DA 1JQBA 2D3WA 1IMOA 3WNVA 1QO0D 1WDMA 5CDYA 2MMGA 4ZTBA 2R1ZA 4RAQA 3ZHVA 2AE2A 2WIKA 4BN0A 4F21A 3CEPB 2IYYA 4OSEA 2FGKA 4QGFA 4XQ9A 2PX4A 3CHYA 4L28A 4M1TA 3W1EA 4I9HA 3WLEA 4PS0A 1E2UA 2IHNA 2V4ZA 3II6X 3IQWA 2JGIA 4FJ2A 3T7JA 5C5EA 2NG1A 5CA0A 4J1NA 1X8JA 1K4YA 5FLYA 5SY4A 4N9WA 4C7KA 1MO2A 2HEGA 1E3IA 2OBBA 4OFWA 4TWAA 4PSDA 2QRPA 4ZN6A 3MYYA 1NKTA 2FUNB 4PLVA 5ALGA 3SKVA 1Z28A 4L07A 1NJ8A 5IBPA 4UJ5A 2QE6A 4Q1CA 3ZVNA 4I9NA 4P5PA 2FZKA 3CE6A 2BSQA 4CEJB 2BMDA 3E05A 4DCJA 1F8YA 1BE6A 5EE5B 1M5TA 3B1VA 3FMPB 4QOSA 1NVGA 3H9QA 3JYPA 1KI9A 1SQSA 1PK8A 3L1IA 4GNKA 5IBQA 3B9BA 5HBRA 4E12A 1AKTA 4DMUB 3EJ6A 3QYPA 2IH5A 2QVZX 4CQLB 1KZ6A 2C9DA 1K0FA 2J0VA 1XEFA 3A31A 1GGVA 4H59A 2BTQA 5KCZA 1C7RA 4Y0AA 3N53A 2CLMB 4IG9A 3RAEC 3GL9A 5JATA 3KZMA 4UPVA 3H4TA 4FCWA 2AX4A 2DUNA 2PBLA 2ZI5A 3AKDA 2HK9A 3M9XA 4QPPA 4B4KA 3T7SA 3C6YA 1DG9A 1ZY2A 3EUFA 3MT7A 3ZBTA 2WY2D 1UAGA 3IPXA 4L8FA 1DQNA 2PD4A 2R00A 3OX1A 3RS5A 1N3IA 3R9XB 1K66A 3VKGA 1NF2A 3RTGA 2CVZA 2OAEA 3BB4A 3OQVA 4MCHA 1SXJE 1W96A 2AZTA 3PQ2A 3UIEA 1TTQB 1WBJB 5JO0A 4LSWA 4JJ4A 4R2WA 3SXUA 2RHCA 2ASEA 1BCSA 2W6OA 3O7WA 3PXAA 4BB5A 3R4CA 1BCRB 4J2TA 3GJTA 4N7BA 1V7PC 5KKNB 1MJFA 3UOAB 1J2JA 2BZGA 3VNBA 3C4VA 2Y8EA 3I2HA 3S5UA 5KNDA 3TX2A 3EAGA 3ZD9A 1P8AA 4NR0A 3CY6A 2D5BA 2Q6VA 3PUVA 3AKYA 6NULA 3BFXA 4HLUA 4RV9A 1SCUA 3DV2A 4CFSA 1O7JA 4YALA 1H2RS 2FPWA 2BW0A 2NU6A 3BA6A 3A6FA 3G5AA 3R0JA 4FMCF 1WCXA 1YDMA 2WK1A 3B1WA 3HI4A 4UBNA 1CZRA 1PW5A 3L8GA 4WKCA 3QZUA 5EKSA 4F12A 5HX7A 4Z4QA 3CONA 4PCUA 3B89A 1XAGA 1KAMA 1WIWA 3TTUA 3N5KA 2AWOA 4ZO6A 5IM4A 2CUZA 3OY2A 3QLJA 2FWBA 1I6LA 4C4OA 3GO4A 1W48A 5HGJA 1C1DA 4L1KA 5M04A 3Q2OA 3ASYA 4M1SA 5F1PA 1YQXA 5H0IA 2JAPA 2JHPA 1EE9A 1W73A 3CIOA 2CL7X 5A7GA 4BZQA 3KQMA 1ZXBA 4RZQA 2EIHA 2QUZA 4TS1A 3UAXA 2ENWA 1PW7A 2BGRA 4CV0A 1VPDA 2X9VA 4TVSA 2I1VB 1K6EA 2E6UX 3CISA 4X63A 1I4OA 4UCXA 1OFUA 1ZOPA 3M4ZA 1OKKA 4AQ7A 3DLTA 1YMQA 5BUQA 2CLFB 1O6GA 3HACA 3KYBA 4WCFC 4DV4B 4EGCB 2Q1YA 1XF9A 1BEEA 1RQXA 1G55A 2P79A 2QG9A 3PQ8A 4Q3AA 1Q1NA 3Q15C 4ZCPA 3AVUA 2MT9A 3P2YA 2P1RA 1M0SA 3DHWC 4AW9A 2VTDA 5IYZF 4BWFB 1O97C 1RAAA 4ENPA 2WMYA 1GPAA 3P94A 2Q1WA 1O8CA 2VDOB 1ZGGA 2H92A 4GC9A 2BOVA 4HDCA 4ON9A 4DEYA 1R0ZA 1UPCA 4QUGA 4LJ6A 2HA5A 2UVPA 3NBXX 4QSHA 4DQXA 5BVHA 1N2ZA 1P2SA 2F8LA 1UFKA 4M7PA 1QIHA 3KKLA 4UBOA 1X0XA 2PQ0A 5LSAA 3AQIA 1L7DA 5LQAA 4JROA 3KKQA 4L4ZA 4DA9A 1UPBA 2QV7A 1P1RA 2FZVA 5CH8A 1FB5A 1I4EB 1TO2E 5DIZA 4IOJA 4BNZA 1YZUA 5DCUA 2WKWA 1QPZA 2IJGX 3N8DA 5GZ1A 1Y33E 1UFQA 4P81A 4UVHA 3AWIA 2CUKA 2JIOA 3QKRB 1JALA 2WF7A 1HYHA 5LQKA 5KBYA 1GTL1 1YI1A 1L7PA 3ZEIA 2Y67A 3Q41A 4KV9A 5DF1A 1ATZA 1BA2A 2R68A 4DV3B 2OV3A 1ZSYA 5HVNA 5IDVA 1Q1AA 1EVIA 1Y5MA 3R20A 2OD2A 4GP7A 2AMLA 1AGRA 3RWBA 5I9BA 1MVOA 4PO9A 4E33A 4R1SA 2QRVA 3U2QA 1ZX1A 2J09A 3CH6A 1NC3A 5A4MS 2B1RA 5CLGA 1XMPA 2ZTHA 1FXSA 5I7EA 4ENVA 4KZPA 2CD7A 4D4GA 1TUBB 1K97A 1IDOA 4Q3BA 2ZVPX 4U8GA 3B6ZA 5BPHA 3HDJA 4P92A 3LVFO 1W2WB 3LO8A 4P4UA 1MPXA 4PLYA 3PJDA 3OMXA 3GA7A 2BFEB 2PNFA 1OAOC 2JH3A 3BL8A 1U3GA 3D3WA 4H4CA 2MTBA 1VJ0A 2QMQA 4XGNA 1UUFA 3MC1A 2WIFA 3AF5A 4GUDA 3UYKA 1FLDA 5L3SB 3KWMA 1XZKA 2Y1DA 4G81A 1L4FA 1ORWA 1DRUA 1ELOA 2XNDD 1YKSA 2Z30A 3PRJA 4CM9D 3ZHXA 2WYVA 3CN7A 4HH3C 3LZDA 1QDEA 3J7AC 1Z06A 3EXEA 5AOCA 1PDOA 4KIUA 1MB3A 2OA0A 4XAQA 3PNLA 3V9PA 2YN2A 1M7HA 4LXIA 4H17A 3LFHA 3K9LA 4HYYA 4N8DA 5DHRA 3ZZUA 1EUYA 2A9RA 1NM5A 1RRKA 4P7JA 4MS3A 1V3QE 3BC1A 4ZVSA 2YZKA 2JB9A 1M75A 3ANLA 3BTVA 3F4LA 1PLKA 3H5VA 3ZNOA 3AONB 1GU7A 1SG0A 3L8FA 3LLMA 2D2XA 2J0EA 2WI8A 4M87A 3E48A 3KSBC 1E79D 1BWPA 2QT9A 2JFVA 2ZDQA 1Y3HA 2GVDC 4CJXA 1AH2A 4G41A 3PX3A 1VJDA 4TWIA 1B74A 3R75A 1UWKA 3ZU5A 3ADPA 1IY2A 2OCBA 2NV2B 4OQPA 3X1YA 4WUTA 1U9IC 5FBLB 3PI7A 4BBZA 2W8BA 3W0LB 4O3FA 3ZI4A 3NAQA 1N36B 3REFA 1JQ5A 4OHBA 2PWPA 4EH1A 4WKGA 1Y1SA 4F3NA 1KQFA 3MCUA 3A7EA 3OUZA 1YRAA 2VQEB 1KI3A 3PPYA 1EAYA 4UHCA 2E5FA 4HR7A 4NS4A 3GIDA 3LHKA 1XWWA 1WU8A 1MC1A 5DH9A 2DB3A 2JAQA 2V97A 4TPKA 3E15A 2XMGA 5CNIA 2FX3A 1B3RA 1JEAA 4TRJA 2JFXA 2WG1A 2CZGA 3DQZA 3IOCA 3UVEA 5FT9A 1J5PA 1XELA 4M53A 1PK9A 3ZDDA 1WMAA 3W78A 1CDEA 4EIWA 1U8FO 5DO9A 5L40A 1H0KA 1QRTA 2W11A 3H86A 3MCTA 4RYLA 3CWZA 2J4CA 1EZ1A 2RBEA 3TVYA 4EHAA 5JALA 2VHVA 4JQCA 2DUUA 5CGZA 5AFSA 2JK0A 2WZQA 1B73A 1KY2A 4WSOA 3BXGA 2XVAA 3ONWA 4B6RA 2EP5A 4EVSA 2PUDA 2DLCX 1EG2A 3PBKA 1QIJA 1WP9A 4V2UA 3IBGA 4QUDA 4B6PA 4DDVA 2O8NA 1NUQA 3H04A 5TQ0B 3NVKI 4R41A 4YC7A 2P27A 2PRJA 3C0KA 3H99A 3VPGA 2A5DA 4NBNA 5EJ5A 3KU4A 2FXIA 5JZSA 3JQ6A 3VR3A 2BM8A 4S2UA 1RCUA 1A97A 2P68A 3EIOA 3AUSA 3AHEA 1P0QA 3OF3A 4ALIA 5E2BA 4M1MA 3TTVA 1JFFB 4JBWA 4IGIA 5J1SB 3LBIA 5LC1A 2GTIA 2E18A 3WYGA 1DG3A 4YN3A 3ABQB 2Y4NA 1BDBA 3LTEA 1GGHA 2I2DA 3R3XA 3EC1A 5SZHB 3LHSA 3E0QA 1M6YA 1U0BB 2PZAA 4JJZA 4EF6A 5U1PA 1XD2A 2PRSA 3L0BA 4U7TB 3UPTA 3I9V6 1SBTA 3TPFA 4BKMA 4L4YA 2CLOB 4HDRB 2DUWA 4RJIA 2F3QA 3AR4A 4JLDA 4D46A 4EY8A 3Q6IA 3DV0B 3RC7A 1R0RE 2O1SA 3OX2A 1QKJA 1YJCA 3KHSA 3T95A 4IMRA 5BNWA 3N28A 4PX3A 4UBJA 3R6LA 4IS3A 4N8EA 2R47A 4BLOA 1E1KA 3IAFA 3JX9A 1T3ZA 1V1JA 5H59A 3RRFA 2BY4A 2WB2A 4O1IA 2NSYA 2D59A 3OIFA 4XDGA 5BRAA 2CMDA 4L73A 2B3TA 3BCHA 3B5EA 4HX9A 3WKCA 3WMFA 3PDIA 1QYRA 4KV7A 2A67A 2N3ZA 4KPFC 5A9RA 5ICSA 1ZIXA 4GQBA 4J94A 1LSSA 1XFDA 1E2QA 2A30A 1KTVA 2L17A 4KRFA 1JA9A 1T5OA 1D5WA 3DLCA 5TDHA 3INGA 5ICGA 2XNJA 2H2GA 4BNIA 3W9YA 3F90A 3VAAA 1KI6A 4WY5A 4G97A 1P4AA 1Z4JA 1ODLA 5AKJA 2VUSA 5MFPA 2WUDA 1P72A 2ZAMA 2WUGA 1HFKA 2JCVA 1R0YA 2JA2A 4BLQA 2HDOA 3KPVA 5BQPA 1G6HA 2NO1A 1ORIA 3N2EA 3PTZA 4G25A 1BN7A 3EVCA 4HUJA 4PPGA 1KY3A 5BMVA 3SF0A 4LJYA 2WSYB 1UP7A 3GN2A 2E6KA 1PNVA 3CLRD 4QTUB 1KSGA 3U3OA 1HLDA 1KZYC 3PXBA 4MQ4A 4EPXA 4RD6A 3U44A 1FSPA 4FM9A 4Z54A 1WETA 4WESB 2A0KA 3KWFA 3DH0A 3M5PA 3E9DA 3NUGA 2ZU6A 4DLBA 4QASA 5MHTA 4RKWA 2JD2A 1YK1A 4H7FA 4EJSB 4V0LA 1TF2A 4REMA 1BQ4A 3DSRA 3QPWA 4JNKA 4ESOA 1JSZA 2IIBA 3RC9A 2H17A 5JADA 2FUCA 3STXA 4QU5A 1K8RA 5AESA 4X62B 5FFNA 3WNZA 5DN6A 2FWAA 3Q0IA 3BMXA 5KSWB 3WL4A 5A4JA 3C14C 3ORFA 4FKBA 1QQ5A 3Q3JB 4U4AA 3IB3A 4MGKR 2GM9A 1RQGA 3B8EA 4IQFA 4HZIA 4WI1A 2HPHA 4MV9A 1JP7A 3JQAB 2E87A 1L5SA 2NSHA 2Q3HA 5DNAA 2DPYA 2FE4A 3ZHRA 1O87A 1WVIA 5KNCD 5AM3A 3AVWA 3HY3A 2EBUA 3EH1A 4IF4A 5ER6A 2FXVA 4MZDA 2I6FA 3NHKA 2C5FA 3GELA 2VKTA 4L4XA 4A8TA 4AY5A 5JH7B 3DOJA 4XM2A 3PGKA 4RY8A 2JJ8A 1J0XO 1U0SY 1SPXA 4JHXA 3W2IA 3WAGA 4LCBA 1Q83A 5I5EA 2H1FA 1YB7A 2WJ3A 1KJWA 2WKPA 2C94A 2EHDA 3QKTA 4U3JA 1S3FA 1T2CA 2G80A 2JLAA 2PGDA 4ILEA 5K6AA 3I2YX 4QBIA 3R6GA 2HU5A 4RMNA 1E2HA 3TNDA 1IJBA 4UCQA 5BWOA 5K51A 3CRW1 1HX7A 2HREA 2N47A 3SZUA 2AC4A 2NVUA 1QDUA 1NNLA 1A9RA 4Y2QA 2PNJA 1YTUA 4H6PA 5KNLA 3OKAA 5BN3A 5AW3A 3RIHA 2PUTA 2G6TA 3LP6A 1M8PA 5JS8A 1S2MA 2HU8A 4MGYR 5F5LA 3IX7A 4Q00A 1ULZA 1H6BA 3JWHA 4OF4A 5AUOB 3TFOA 1TLLA 2JCSA 3SLKA 2IBTA 4I2NA 1PJCA 1LPSA 1NU6A 1DAOA 3T3OA 4ZI3A 2AEEA 1HQYE 2HJ9A 3GW8A 1T43A 3C3BA 4QO8A 1I1QB 1IHPA 2I7DA 2YIMA 2ZJZA 1DZ3A 3SSAA 1XZHA 4MVJI 1R8XA 1ACJA 1K9VF 1X3LA 1AURA 4HLUC 2A86A 4Y6LA 1D1QA 2J7KA 4IXMA 4DV2B 3CZMA 3A3OA 4FFBA 1SBNE 1E2BA 1RMTA 4CUJA 2YOFA 4BCDA 1Q91A 2IUFA 3O83A 1I0IA 4PN7A 1KK1A 2C9ZA 3A6KA 4F06A 1NI4B 3JCZA 2VPTA 4XDHA 4IHJA 4P0QB 1QGOA 1KXJA 2RGCA 4ZAXA 4BRUA 2JAOA 3QKWA 3W7AA 2MHCA 3U61B 1FFAA 3QLUC 1VXRA 3JASB 2BKAA 4IIJA 3ST7A 2AKEA 3Q9LA 1ISHA 3QA9A 4R3NA 1P4JA 3AU9A 3I92A 4BFUA 2QTVA 2F4VB 1JFRA 3P9NA 1XMQB 1W0JD 4EVQA 4EJ2A 1L4UA 5EXSA 3GHYA 3QYAA 1M8KA 1VDMA 4UU8A 2FMHA 4OHMA 3BWDD 4YJ2F 5TE9A 2EJUA 1RE1A 4YRLA 4U9HS 3VO2A 1PDVA 4BZPA 2YQ5A 5B37A 5LDGA 3ECAA 3I01A 1KS2A 6YASA 3ADCA 4L27A 1YASA 1X7HA 3TM5A 3T5DA 4EUEA 1Z4IA 1U1GA 3KZNA 1S7CA 2GPJA 2PRIA 3LBFA 3CUEF 3BORA 5B7GA 1G42A 1G9SA 3QX7A 4OAPA 1MJNA 2VOEA 3U0VA 5BV7A 1T8SA 2HZ7A 2X0JA 7YASA 3FHOA 4L5JA 4PSCA 3CFYA 2ERYA 2WD7B 1XJQA 3ZNQA 721PA 1W88B 3DZIA 2EYQA 3W5SA 5KTRA 4B3IA 3H1TA 3PXCX 2P30A 1BKYA 1FRZA 1KBZA 1NVEA 3R5FA 4G86A 1HFWA 1S1MA 2QRHA 4C87A 5JTUA 3R74A 2HLNA 2X1VA 3BGIA 4M3NA 3NTOA 2QG4A 4NCAA 4HLNA 1PL0A 2OVFA 4OP3A 2KS6A 1YR7A 3LA6A 3LT5A 1Q16A 1VL2A 4LYEA 1LFAA 1IB0A 3KYIB 3LY5A 1P1CA 3ZWOA 1M54A 2PZBA 1RYBA 1EM8A 3MK31 2ZRMA 5CURA 5B4TA 3H05A 4OI1A 3WXBA 1RCFA 2P4QA 2GJ9A 3A3YA 3T3PB 4EYGA 3R0XA 1FYXA 1OYVA 4DQ0A 3N2LA 1PTJA 4JUBA 1VSBA 4EGQA 2YC2C 3RT7A 5ECYA 2FEKA 1UDBA 3GAAA 3QEMA 4JH0A 2DPHA 3TLCA 1XZEA 4NZZA 4BMXA 3HO1A 1C4KA 4WPGA 1KWGA 2YS6A 2CF6A 1KNXA 3BJMA 2H7XA 3LY8A 4RVGA 5HS4A 1Z5GA 1YD7A 4K26A 1H2YA 4M9QA 4UULA 5LR6A 1N6NA 1NVVQ 3IMFA 1ZM4A 1C1XB 3QI7A 3EMDA 5AVYA 2VJPA 1SVOA 4LSMA 3BZBA 3RFCA 4IEFB 4II2A 4M1ZA 1JI0A 1HA3A 2QU8A 3F98A 4MA4A 4RGBA 5D01A 1CJBA 1RI2A 3G13A 5EEHA 1P5JA 1H4VB 4NYJR 4G4SO 4M0FA 4IUDS 4U6SA 1TZMA 2CNWD 5ALXA 4GXQA 1XKQA 4W5HA 3OQIA 3VO8A 3W34A 1N3LA 4HBGA 4WACA 5IXJA 2IUYA 4YI3A 1J8MF 1EJ6A 2QAGA 2R11A 4BHTA 4Q9KA 3HLYA 4ZARA 4LMRA 5KO2A 3O2NA 1JRLA 4JJ7A 4PC1A 4WLEA 3L7DA 5FL3A 3QXGA 5A3VA 1XZCA 3ZGZA 4K0KB 4C9BA 1SB9A 4QNMA 1LQUA 3EZ9A 3BS4A 3OEED 4E0BA 3L0DA 3M6FA 5EGNA 2ZRKA 4F93B 4WBNF 1HTBA 4L78A 3TNYA 1CY8A 1IN4A 2NSDA 4B3CA 4BJ5A 3PXDA 1UINA 4OEHA 3WZ2A 3CNNA 3MGAA 5B7QA 3AYZB 2GCOA 5BOSB 3C1TA 2C2YA 2CNOA 2VDRB 1GZVA 2GTPA 4E3WA 3BJIC 1GP2A 2CLSA 2FW8A 4NZNA 4YCDA 1XQ9A 2R7MA 3BQNB 5FUYA 1GDHA 1G18A 1HEYA 3P97A 1KVRA 4RVSA 3DOCA 1RLJA 1ZCZA 3IBFA 2AFHB 5IAKA 1O4VA 3ESRA 3RTBA 4DCOA 3N0VA 1FS6A 2RHHA 3B7PA 4IZOA 5HCNA 3ZY3A 3OWOA 5IH3A 1B4DA 1WXFA 1RHKA 1P2BA 4KQIA 5ECDA 1U0HC 5K2MA 5NULA 1L1FA 4EW1A 2OHJA 2GZMA 1DGQA 3PHIA 2MIIA 3QVLA 3G49A 3FNRA 5LKRA 4Z7QB 2W2QA 2B1IA 2XUDA 3HCDA 1EZZA 1J00A 1QHEA 3A4VA 4P7FA 2Q1UA 3D6VA 1PQPA 5ITSA 3PHCA 4JVLA 3RDPA 5CCDA 1JWLA 4YDQA 5IJ9A 5JY6A 2ATIA 1YS9A 4HVTA 1MO3A 5DK6A 3VSBA 2ZTVA 3BD7A 3G2IA 4YRDA 1QRAA 2AG5A 4YXWD 1GL6A 1ODTC 3DOIA 3AGQA 5CB6A 4GIBA 4CMEA 2NYVA 2OYCA 3PNOA 5LQMA 4IHKA 4MICA 3EZFA 1TEZA 4I36A 3JPYA 3C8ZA 1FRVA 1I3KA 3TLXA 3OETA 1IBMB 3NYWA 5FBWB 3LFTA 3KC2A 5KSPA 1C5KA 2J33A 1H4TA 1Q19A 4NAHA 3V3TA 3ONFA 1G2OA 4X1IB 3LXMA 1HLPA 3MS2A 3FPKA 3GAZA 3GJYA 1FVFA 4ER6A 2BFWA 4NOJA 5SYMA 4DSZA 5K4GA 1O3YA 2BMEA 4YRGA 3MJRA 1MVNA 1SXGA 4WK6A 3OJ0A 1Z0JA 3ELUA 1R18A 2XVZA 3K3PA 2HXSA 2YHUA 2YMLA 4XCVA 1R1DA 1QHGA 2A2ZA 1W29A 1Z08A 4NK5A 3M3DA 3GT0A 1YOBA 4DYDA 3P9ZA 1PV1A 4HAWA 5C35A 2QRUA 1YDGA 4IGKA 2WJIA 2A1IA 3DB1A 3EXHA 4FYXA 4EHFA 4U9UA 2PT9A 5CJPA 4N48A 4XD7A 1WU7A 1OB5A 5HIJA 3DOEA 4CKZA 3K0FA 5TJHA 4JL8A 3IOBA 1YRLA 4AF6A 5LZ9A 1MX5A 2VWGA 5I9IA 2JRCA 1E63A 2HUPA 4PTZA 2NOAA 1VL5A 3GCZA 4DCVA 5T5QA 1GZDA 2NYUA 2XMZA 1EVZA 1PUJA 2IZ7A 5DULA 4LYJA 3OBIA 2VZ9A 4GPIB 1BVRA 1S9DA 4B34A 4F4FA 5A9SB 3UKDA 4DSNA 1RJFA 3NNNA 3I83A 1NLMA 3THWA 5B30A 1PVVA 4GXTA 1OFHA 4DUYB 3HPRA 2UXCB 2REOA 6ADHA 2LVBA 1V5IA 4O0MA 1OBFO 3DDUA 1HT1E 1V35A 2Z5FA 3CKMA 4UASA 2GLUA 1FFEA 1ND5A 1YKGA 4KK4A 3TLAA 1TVKB 4F4IA 2VF2A 1WXIA 2YHBA 3TQOA 3AIKA 3SHOA 2I78A 4XSGA 1UK7A 1CY2A 1YXMA 1SCAA 1UMKA 1UPTA 1W19A 2FZWA 3N39C 4UAJA 4FKMA 1Q2XA 3QEBZ 2OGUA 4FGZA 2C83A 4QARA 1I1OA 1S8AA 2VZ0A 4TKLA 5AXAA 3REQB 4TV8A 4NQRA 4B5KA 5CVDA 4O4LF 1S2GA 4ZT4A 5C7IO 2YHSA 4YX9A 1YU6A 3K4PA 2F3PA 4MVJG 2GHIA 4ZOBA 4ATNA 4C4XA 4XGRA 1FFCA 2IZ5A 1TMOA 4EK9A 3NGLA 4RSGA 4HQRA 2ATCA 1I7QB 1Q1QA 2CCGA 3HKEB 3ICCA 3U7HB 2WPNA 3T1VA 4KMRA 2IOFK 3L05A 4AURA 1FXWA 5KSYA 1UBNA 4BY9E 1JTEA 5GONA 3WYDA 5AM4A 1JHXA 2EZ9A 4MKGA 3L7LA 3SJBA 1RW4A 2PT5A 4YHBA 4GZMA 4PRYA 3QVVA 4PGHA 4LVUA 4ZC1A 4ASUA 2AN9A 1FLVA 2ZJ3A 1TZ2A 3T4UA 3WDLA 3NWPA 1Y9EA 2ODNA 3SYNA 1YB1A 1Z7YA 4I14A 4F6CA 1MNAA 1E3QA 1H05A 2WE8A 3O1LA 4JI5B 4RFLA 3UF0A 4A82A 3C3WA 4B17A 2Z8YA 2O8DB 4J43A 4NAUA 2C2KA 2BFNA 2ZS8A 1TA4A 1X8KA 3R3UA 3SBDA 4EG4A 1OFVA 5IARA 4EATA 1V7QA 3I45A 5F78A 3OO1A 2IPMA 4UMFA 2AA3A 5ITZA 2XODA 3Q7EA 4W8HA 5GZ3A 3K6KA 1EQAA 3JSXA 3LYHA 2QLMA 4G4SP 4ZTUB 1JR4A 3SHWA 3NBMA 1AQLA 4OQXA 2QAIA 3JPWA 3HBMA 1RQ7A 3AF2A 3R7AA 3RM3A 1KC1A 2WZCA 4NPCA 1N2CE 5G1OA 2QJOA 2XD9A 1L7EA 1G4AE 2W7TA 3AILA 5ARDA 1II0A 2H57A 2JGRA 1IQ0A 1P3DA 3C3DA 4WA8A 4EF4A 1G20A 2D1TA 5TF4A 3VDMA 5IN4A 2J3IA 4Z4EA 2H29A 2OK8A 3OOSA 3BERA 2HSGA 4YJKA 1JSLA 2XYVA 2GARA 1IEXA 1NJSA 1VHWA 2HQRA 1ECFA 3PFFA 1LJLA 3A1UA 4F0JA 4ALMA 3PK0A 4GG1A 1DUSA 1VCMA 1GZ3A 4IJUA 4NBWA 2P91A 1Z6XA 3ESXA 4Q9JA 1N8NA 3DZBA 3I8OA 4DMFA 5IZ4A 2IOQA 4Z9YA 3X1XA 3MWEA 1OROA 5EP3A 2GVNA 3C3MA 3BIXA 4OMFG 4JYMA 2FF7A 3GLIA 1HEIA 2RD2A 2RHRA 1FUYB 3B6KA 4P86A 4YT2A 4OKIA 5LYJF 2UUBB 2Z5GA 5IPFA 1GKIA 1U5AA 3QP9A 5K3CA 1Z47A 1D4FA 1R16A 4K6KA 4L0DA 3NATA 1WCWA 5KC8A 2J3HA 4YCNA 2BHLA 3PDJA 4DDTA 1CBUA 2F62A 5FA5A 1ZWLA 1C1DB 3VJLA 3CLUC 1GPUA 4Z8XA 1RJEA 1F9AA 1ZK3A 4HWGA 4K0RA 4DT1B 3T5MA 5JNTA 5DOVA 4MW6A 2PWZA 1LTHR 5LUAA 4BGDA 3HZRA 1Y89A 1YZKA 1ZSNA 4ERNA 1C4WA 1TU3A 4WIAA 1R5JA 4KGDA 5CCEA 1QNLA 2FPGB 1SRQA 1QYIA 2GAAA 2Y0EA 3EDYA 3K6SB 3HGMA 4MV6A 1KZ9A 5HF6A 1WXXA 3TIVA 5C9ZA 4W6ZA 2JFHA 1E1NA 2P4EA 3LMKA 1AUOA 5A1JA 1H66A 3A1EA 3HB4X 3TCNA 1MP0A 1XTZA 4Q4JB 3WGTA 3RUCA 4YXFA 1GSOA 1L5MA 3WBBA 3RAFC 3UT0A 1K5GA 4QDTA 2G09A 1J8FA 2ZWPA 2F9LA 5HOEA 5E1BA 1JLMA 1YR9A 2ZBUA 4AYXA 2C2HA 5HZKA 4JVMA 5K03A 3MWLA 4AECA 2JHGA 1X70A 2FG7C 1FOEB 4IIGA 4V0ME 3PD7A 4A27A 3CUSA 3GLVA 2V0NA 4RY0A 5HRAA 1HNZB 2ZUUA 2X22A 3I2GA 2I1WA 1KMMA 2QW1A 3PF9A 2GF2A 4TRNA 3LC7O 5DZSA 4E2FA 1LWOA 3L6CA 2VHYA 1PS9A 2FN7A 1GFIA 3ESQA 1DO8A 1T6XA 3BM5A 1H94A 3U37A 5EXXA 4KREA 1RQRA 1U8ZA 3GGOA 3FR7A 1H69A 3EF3A 5I47A 3IUYA 4S12A 2IELA 5AK5A 2O9JA 5EIWA 1JEYB 4YAGA 1B2RA 4TV9B 2R7AA 4I3HA 4PLTA 3EVGA 2ATEA 2B1GA 3Q8XB 1H5UA 3VKUA 3AP3A 4KPUB 4AMUA 4ZDIA 4MW4A 3TYXA 3A1CA 3E1KA 2EU8A 4KKVA 5HR5A 1RI5A 3LRXA 4JELA 3EVAA 1T1SA 4Q24A 4FYKA 2QM7A 3GP8A 1YE8A 2NO7A 4QYSA 5TGZA 4RENA 3G7SA 1E7RA 4D8YA 2F1JA 3GOHA 3NCTA 1QAMA 2ID9A 3OE4A 4QIHA 2QUBA 2AIRA 1US8B 3IXMA 3WMXA 3O4GA 4KO3S 4KXXA 621PA 3K9BA 5KJFA 1ZM3A 2BN4A 1ZICA 4EELA 1EAMA 1T24A 2JBAB 4I5EA 2QRMA 2C20A 1AZLA 2ZKLA 4ILKA 3D3WB 3K96A 4D4MA 3RYTC 1VE9A 3GAMA 2JZNA 2VA8A 2GQ0A 1ULAA 5EXDA 3A36A 2IP2A 5EC8A 3R1IA 1V8DA 5ERYA 1QH1A 2JIMA 3U7EB 4ALLA 1VLHA 3FA2A 4PSAA 3BMQB 2GF0A 2ZR0A 3D4NA 3IQZA 1UMCB 1U2SA 2MU1A 4E08A 2B0CA 2E4VA 5TMPA 2PGAA 4HS4A 1PJLA 1GNQA 3H9EO 5ADHA 1YNSA 3FX2A 3I52A 2C4HA 4R8SA 4BP1A 5LZ2A 4DR2B 1WKVA 1U6IA 1YR8A 3UKOA 3Q8KA 1REQB 4ZDJA 3PT5A 2AMVA 3MT0A 3CR7A 3N9IA 3ELDA 4UD2A 2LV8A 3X1DA 5GOTA 3GCDA 3VR1A 4C0XA 3WYFA 3DP7A 2AS0A 1MAUA 3ROPA 2IYRA 3KEQA 3B85A 1IEQA 1V8OA 5BXQC 2ON6A 4MUFA 4BP3A 5KKAA 5BYAA 4MRRA 1JNYA 1FTQA 1QP4A 3NYRA 2FCAA 1ZQ1A 2VBFA 4RWZA 5DYWA 2IE0A 5IDWA 3NJ4A 3W5VA 4GR5A 1OX6A 2C3YA 1WB4A 2PTHA 3RRNA 1WXDA 3WLQA 3LFUA 2NZVG 3OCVA 2GN8A 4FSHA 3P45A 1M2GA 2GBLA 3P2IA 1TEHA 3QWAA 4X7MA 1EMDA 4EG0A 2W8BB 4OAQA 3F97A 3VR4D 2ZYSA 4EJFA 1YBMA 2MYPA 2XYPA 5LQCA 2FPIA 4R01A 1Z5PA 4BMNA 2ZJ1A 3HO8A 3E7PA 2NO5A 1IBSA 4NH0A 2HBQA 3C1UA 3V8MA 2VUHB 3OTHA 4X54A 3QVUA 1VYTA 2GNPA 4X45A 4F9FA 1IXSB 1U4NA 1VJ1A 1YQDA 3DMGA 1M6WA 5JJLA 3F2IA 4M9ZA 3CH7A 5CX4A 4Y67A 1L3CA 4F9EA 2ISSD 2PUVA 3WLKX 2ADFA 5HGXA 5BO5A 3CCBA 2J4FA 3T0FA 1YH3A 2WSSA 1YCGA 1K8ZB 1TADA 2X23A 4AG3A 1KOJA 4EUNA 2YCLA 4ZJYA 5BW5A 4PFKA 1FPQA 4C0JA 3C2QA 2VPPA 4E4YA 5HZMA 2BP7A 1UKBA 2ZAYA 3PC3A 1RT9A 2D2VA 2Q0XA 4BGVA 2ECKA 1GPKA 4F3KA 4TLCA 3UXEA 2WC1A 3PRKE 2VOJA 4HMPA 1GNSA 2H7CA 2JVJA 2XCRB 1GCIA 1T10A 3OIVA 4JQYA 1M1YA 1NF9A 1RXIA 4CMEC 5KYWA 1UBHS 3W06A 2QI9C 3FDXA 3N8KA 3OEHA 4IICA 3MTEA 4R9SA 3ZIAD 2P35A 4AYWA 3HFSA 3A06A 3N0WA 1JQAA 4MWBA 5DI3A 1A8QA 4XYLA 4HYQA 1M0TA 2I2BA 3PT9A 1Q12A 1Y7LA 2DFDA 1LD3A 3QEAZ 2R0QC 5HM6A 1OZGA 1Z6AA 2KI5A 3NOVA 3IT1A 2ORVA 4DOMA 4F97A 2YRWA 2J5XA 2ZDGA 3E27A 3I37X 5EVCA 5FOSA 4WKNA 5K8CA 5LQNA 2D8AA 2VZEA 4XWGA 3PC2A 4ZQCB 1JG4A 5AWFC 5K8JB 3Q3VA 4U1RA 3AM4A 1L5FA 2X0KA 2Y6VA 4EQ6A 1PYOA 1XMIA 1JUDA 5CDUA 2Y92A 1D3AA 1XD2B 2YN0A 2YZ7A 1OH8A 1ZXXA 5AICA 3E61A 5IK2A 5CAEB 1WCIA 1MB0A 2DT5A 3OOYA 4PFJA 2XUHA 4FNGA 3FYHA 4H4DA 4EA7A 1O57A 3UT5A 1ZAKA 5EWJA 1K92A 3G1UA 3BIFA 3M49A 2ZXFA 2ANBA 2BGGA 3MRVA 3ANXA 4NULA 1XVVA 4WADA 5BRNA 3ZHUA 5FI5A 2VNSA 4JP3A 1A27A 3DF7A 4OHXA 4LDRA 1V1MB 3OQMA 1JKXA 3D8UA 2F1RA 1OT3A 3KAQA 4Y1EA 2NYAA 5IHXA 3L7IA 1S3GA 3LDAA 2DSNA 3ZXXA 2JJYA 2ACEA 1ZN7A 2LPMA 1EYZA 1AZWA 2P9TA 3WBFA 5LA6F 4FHZA 1TYZA 5EJ4A 4DY4A 5IJZA 1U2RA 1XDBA 3RK1A 1IPFA 1S3IA 3E6AA 1PZGA 2VAMA 3N2NA 5FTLA 5CH5A 4GQAA 4F86A 1ZH8A 1QIFA 5CYFA 4UAUA 3W5BA 4QKQA 5JT1A 1PJBA 3VC3A 3QNMA 1GSAA 5EP2A 4P1ZA 1DARA 3UYLA 3AZPA 2C9YA 1NDQA 3HMKA 4AKEA 2E82A 4IEIA 3GMIA 1MMFB 2VPQA 1SKUA 3F3KA 3IEIA 1EUDA 4MS4B 3EBPA 4OXXA 2NU9A 4PG6A 2GZ2A 5T4HA 1UWVA 3MJ4A 3U44B 1JHOA 4QFDA 1TT7A 5IULC 2H2AA 2ETVA 2NT3A 5CCXA 3NAZA 3S2SA 1J2TA 1N2OA 2RAPA 2RGAA 1O94D 2DHQA 2RHJA 1QCYA 3TUIC 3BFPA 5G53C 3DJFA 1SHUX 1BGXT 1VLMA 2Z95A 1O0BA 2EHJA 3WKBA 4ZMBA 5AKYA 5K0LA 3ANTA 3QSYA 1JW9B 4H1VA 4MWCA 2HQOA 2VSFA 4I66A 1H9CA 1T9GS 5HHTA 2XCQA 3V34A 3VU9A 3WK7A 2B78A 5DGTA 3DNPA 3WHPA 4H4EA 4L3WA 2NTYC 4RULA 2GESA 3GJZA 2WWIA 3K0AA 5BMVB 5AVZA 3EMVA 1FYWA 3AUXA 3T7IA 2CUNA 2X8JB 1B00A 5ULLA 1DRVA 3D6AA 3FLMA 1NLZA 2PGJA 1F48A 2QN2A 4CN9A 3THYA 4UXJA 5C2JB 1KOGA 3P2MA 3QKSB 2R8YA 4KDRA 4TMWA 2CXXA 2C03A 1XXHE 5FOWA 1BQEA 1G8FA 3CVVA 1T9CA 1S2NA 3KSUA 4IRMA 4DEVA 3BCRA 3UFXA 4BIIA 4JR1A 1FTWA 2LZ0A 1Y37A 1SOUA 2OD7A 5KYUA 2YC4C 2FUKA 5F76A 3OFSA 1NYTA 4DYVA 3VRHA 3WWDA 3I8SA 5ELXA 3KEGA 2ORIA 3D3EA 2PO7A 4G5SA 1EK6A 2EF0A 2NU8A 3BE4A 4IDNA 1QP8A 4L9SA 4X91A 1CNFA 1YJQA 3MTAA 4OGFA 4DCUA 4BUJA 1G5RA 1D6MA 1YI8A 3R7WB 1X87A 1D0IA 3EE6A 2J0QA 2OZPA 2WNSA 4D2IA 2WJWA 3T5CA 3WMGA 5F9HA 4OAOA 1PGQA 1VYUA 1FSFA 2RAUA 3R7DA 2TMDA 1JEQA 4BLRA 1FYEA 1P3Y1 3RRJA 1YB4A 2V6BA 1Y3AA 3IA7A 5AKGA 2VNIA 4G65A 3EW7A 3RC2A 4D4JA 2AFRA 3DP9A 4HN2A 2W0SA 3CR8A 3H9CA 2VEDA 3HFRA 3Q8MA 5I9SA 1J09A 4MUIA 5IT9A 2ZIAA 4B3HA 1TXGA 1U28A 4ZCRA 2NN3C 4TTTS 5EMNA 1XV5A 4LRXA 1TK3A 2VPYA 3MAAC 4FOOA 4G1UC 4OM8A 1UAYA 4FFBB 4PTYA 1P31A 2RGWA 4MA0A 1OU0A 1THTA 3PC4A 3R5TA 2C00A 1F60A 3IQDB 1Z5WA 4WLFA 3RYIB 3GFBA 1ZM2A 1MZVA 3G8DA 3HN6A 4N47A 5ALHA 1G21B 2XUAA 2BKVA 2RB5A 2D2IA 3VHXA 1YQTA 1X86B 2FG5A 1BZYA 2X2OA 1KP3A 4N01A 4DKXA 4HZGA 4B81A 3QFHA 3S2IA 4D3YA 5H83A 1SA0A 4XR9A 3NB0A 5B3LA 3OPMA 4I55A 4QUEA 4Z49A 1YIDA 2KLHA 2Q6TA 2WF9A 5D3MB 4ZQFA 2B7BA 1EFLA 2P75A 1KJYA 3DD1A 5DLPA 4DNOA 2XRZA 4DUGD 2J7PA 4EKYA 3RTCA 3OA0A 4U7JA 2FPPB 4ETNA 5ALEA 4MUMA 1ZGBA 1E8DA 2IDMA 3F3SA 2VBCA 3K1TA 2EJCA 5DNDA 3AESA 1O2DA 5FIUA 3C8MA 4YDHB 1PAUA 5L7YA 4EEKA 4D9CA 1V3UA 2EOAA 2H5EA 1PR5A 1QIMA 1U7ZA 2H2FA 3C7DB 2V4MA 4U9IS 3DULA 1JJBA 3M6AA 2BELA 2EQ5A 4Z0HO 3QNWA 1XPOA 4YAIA 4GW3A 3AERA 2M9MA 2P2ZA 4D3DA 4LXGA 2ZS9A 2CVOA 4HD8A 4N39A 3SJUA 1Y6JA 4NAVA 3ZOZA 2AYZA 4C7VA 4BX9A 3F9CA 1OTXA 5KINB 3UWDA 3ZD6A 3K9WA 2WTBA 5C81A 5LPNA 1KA9H 3TVTA 4OIFA 3DXFA 5C3UA 4YQYA 3H8WA 4C5CA 3ZE6A 1BS1A 1V1RB 5E3IA 1GAQA 2I3ZA 4L0MA 2C84A 3A4YA 1QK4A 4DJEC 2WU3A 2Z58A 3L1KA 2DETA 4HH1A 4XW2A 3ZE9A 1HL7A 1ZOIA 4EHIA 1Q7TA 2R8PA 4TL9A 3GNTA 2F6RA 1ONPA 4WN9A 3V7WA 1NMXA 4LNUB 2AG6A 1Y1KE 2WWTA 3IXQA 3Q98A 2Q07A 3ZGLA 3ND5A 3AEQA 3T5TA 3RAPR 1XHLA 4ZT2A 3T7AA 4HP8A 1W1IA 4TROA 3TI7A 2YQZA 4B85A 2PT7A 5C53B 3QG1A 2C54A 2F67A 3E82A 3P32A 4QE3A 3KXIA 3TTXA 4MLDA 1U3DA 4O2BF 4UEWA 5KMGA 1PHRA 2I4MA 4JENA 3I5YA 1A04A 2A0FA 1F3LA 2Y68A 4MIOA 3G2NA 3GLKA 3USCS 1DKUA 3PLAE 1BWRA 2ZREA 4MV8A 4HUQB 1DB3A 3SC3A 3TLZA 1V6CA 3KZOA 3BXPA 3ND7A 4QG3A 2UV8A 3RFUA 2WAOA 3V5NA 3C70A 3GFQA 2PM8A 3WIEA 3A9WA 2QOEA 2C31A 3NPMA 2OO5C 3G9XA 2OV1A 4FMDF 2ZIZA 4JX8A 4X9XA 2YKGA 3KQSA 3BFKA 4JFAA 3EGXA 5K0EA 4MWEA 5DNVA 2XECA 2ADMA 3CZ4A 3AV0B 1BKDR 3VKVA 5BQ3A 3U81A 2X86A 3DE0X 4LN1A 4LTNA 4PGAA 3FWYA 4HH4A 4CL0A 3NEJA 1MFPA 1XA0A 4TS9A 3A3KA 2AG0A 1QJCA 1ZH4A 2FZ5A 3A6HA 4G2NA 3DDHA 4MYCA 1NBIA 3F6SA 4ZPXA 2GK7A 3PHGA 2Y1KA 2I66A 2WTUA 3ZY6A 2NO0A 3KZCA 2OB1A 1UPFA 5EZYA 4C7OA 4CMHA 2OCGA 1R5NA 5SYAA 2CDNA 2YV3A 1OBOA 2WVHA 4A0HA 1ZEMA 3GVPA 5FFFA 5IKXA 3IJEB 3VNRA 3CNOA 4F5DA 1UXOA 4X71A 3VX4A 5IG2A 5KTSA 5JS1A 4CCYA 3SZGA 1Z8HA 1XTPA 1UBMS 4XKJA 4AIRA 2QNBA 2AZMA 3UHPA 3A9VA 4NICA 1SKMA 1SH7A 1RC1A 1WCYA 3IKMB 5SZIA 5TY0A 3STUA 4DADA 4GSYA 2GBLC 3N7UA 2QN8A 2HRDA 1YIAA 2XJ9A 3LOQA 3CLSD 1JAXA 3ILXA 4IIYA 4P4GA 4PCVA 4RY9A 3E9YA 2D4AA 4B7UA 1KL7A 5BR4A 4Q6WA 2FRXA 3LHDA 4HVCA 1KDZA 5JZMA 1YUNA 5COBA 1M8JA 4BVFA 1M1NB 2REQA 2YWRA 3B20A 3D54D 5J2TA 2DXIA 1NXXA 2ZI6A 2YY7A 2O2XA 4KE8A 5HKKA 4G85A 5TPWB 4EJSC 1Q0TA 3WS7A 2OLEA 3VR5H 3EFHA 2H4HA 4L75A 2DJIA 4ADSG 3OIGA 1F6DA 2TMYA 2JLBA 3OMLA 3LCVB 5HIKA 4WK0B 1P4RA 1MA0A 4PXSA 5EE1A 1JLLA 1VCIA 3RU9A 4F11A 4K9LA 2FFHA 4DSTA 1E6WA 1UJCA 2UYYA 5AKIA 1IY0A 3ZQ6A 3GH1A 3WYAA 2QLLA 1JHZA 1E2GA 2V6MA 4HT3B 2XTZA 1VLZA 3G2HA 4HCJA 3JYLA 3W6ZA 2CHUA 3KYCB 1E77A 4B43A 1C3OA 1WAMA 3MINA 1SWWA 4EZIA 4TQ9A 3FJOA 2JGFA 4W82A 2TYSB 4BC1A 2HBRA 1KFJB 2I8CA 3ZYZA 3OIWA 4V3BA 3NKFA 3IQGX 4ZAFA 2ZAGA 2L42A 1P0MA 4CKBA 1XDSA 2ZXEA 4C6TA 3T61A 3CT6A 3LNCA 3R44A 2LXNA 1DC4A 3LIIA 2IYAA 5BUZA 1G5IA 3KHUA 2CV1A 4PC7A 1P7WA 4X0EA 3H7AA 4WZAB 1J0BA 4TMVA 3AFGA 1X7DA 1IOLA 5FUMA 5EYPB 4CGZA 2VF7A 1XZLA 3G1TA 1XL0A 3FHLA 4LMAA 3EGVA 2CWWA 3FCUB 2QQ5A 5C32A 3O7MA 2VQSA 1KJNA 2Q0HA 2XB4A 5C18A 1QX4A 3D43A 1AKUA 3CR3C 1EVKA 4BX3A 2PWBA 4R8RA 3I6IA 1WF3A 5DNCA 1KDVA 3S68A 3X1KA 1RYHA 3D2BA 1U2TA 2O7VA 4G5RA 4L8WB 4TTAA 2AQIA 5PGMA 1XPUA 4B3DA 4YGYA 1BDMA 1RD4A 4A26A 1IFXA 2BMAA 3MB8A 4HVAA 3A6LA 2QSZA 3HCNA 1MB2A 4ZMRA 4R6WA 2LNDA 2QROA 1I51A 1CQPA 3IULA 2ZUFA 2VDWA 1L8AA 3PNPA 1G4HA 1PKXA 2BVNA 2W4IA 4JUFA 4DHEA 5JAIA 5FL7D 3TKYA 5G3YA 5CB0A 5CRIA 3S99A 4RPKA 4W5QA 3M5CA 2GLXA 4M55A 1E5XA 1K63A 3VGJA 3SI7A 4TV8B 4OXQA 4XDYA 3ZVRA 2PLFA 4TUYB 1RWOA 2EGHA 2WU8A 3SC6A 2IK8A 3ET4A 2RGDA 2F9MA 4YV7A 1P9NA 2Q0QA 3K05A 3KSZO 1VJTA 4FFWA 4ZK6A 2G7ZA 2DQKA 1NVVR 2YXEA 4DCTA 1GRVA 2JDIA 5AJUA 3VFDA 1CUHA 2NTEA 3ZX4A 4YJHA 1C8KA 1W5FA 3TEJA 3EEOA 4BKUA 2ZYHA 2D13A 1XDWA 1BE0A 3MVEA 2FWPA 2ZYGA 5IMBA 3TMKA 2AOUA 4C4TA 2ZU0C 5LP1A 1I2CA 2P9JA 3F47A 3S8MA 3VZDA 2ZSKA 3N2KB 3TOCA 4TT8A 2CNKA 4G0OA 4WT7A 5EE3A 2VYND 2HMYB 5JXHA 4A15A 1NG9A 4JP8A 2LW7A 1FUEA 1G8KA 3JQGA 2VPWA 4I6GA 2A88A 4HWPA 4QQFA 3LW8A 4R2MA 1TVMA 2VDKB 3NCHA 2G72A 4Q1FA 1KDPA 4QJBA 4AJHA 4BO4A 1R0XA 4FX5A 2A78A 1RYZA 2CLCX 3DWEX 3LH5A 4BIMA 1PYDA 1NBHA 3U3KA 2QM3A 3T6KA 2GF9A 2Q4DA 4UUPA 4Z0PA 1AUQA 1H2AS 2PK3A 4FR2A 3IHWA 4OQDA 1F6BA 1N2GA 4PR0A 5ITZB 3UEOA 3KJNA 5J59A 4BUCA 5ADWA 1BAPA 4QFCA 3OJOA 1M73E 1I3CA 4PNPA 2DTXA 4A5OA 3E9RA 3L8HA 4IBOA 4ZCQA 4JQOA 3HMQA 2J1LA 2RG7A 1CERA 3F96A 4K5QA 4GMGA 1DAPA 2D3TA 1DBWA 2WIGA 4W4TA 2HKIA 2B30A 3Q7IA 2RHWA 3SIXA 1GL7A 2GD1O 2HWXA 1NI5A 2X4DA 2BCJQ 3FCEA 3WGHA 3WL6A 3EXFB 5I3ZA 5CD1A 3TS1A 4RD1A 5JBNA 3A1DA 1I94B 3OAAD 1G20B 3MSCA 2FZEA 1HZZA 5EUMA 1NR7A 2MWMA 1UMBB 2C5GA 5JFGA 4JMPA 4TZ6A 1EQUA 4OU5A 1A8IA 2GJKA 5HFJA 1N5MA 4Y1RA 4PLFA 3BSYA 5JAMA 4BAUA 1A7JA 4WA7A 3UOGA 2V7BA 5AK3A 3UKJA 3HKCB 3C87A 4UARA 3O03A 2F64A 4KQMA 1X80A 3O8NA 3GJ3A 4OFZA 3RUHA 1GSIA 1IJKA 4G56A 3RYHA 3ZV6A 1YFLA 1K5DA 3CC8A 3WLHA 4D9MA 3D4LA 4D6XA 3PXGA 3CSSA 3QW2A 4EPVA 3WYNA 4MUJA 4MVJE 4JGIA 1E1RA 4O4JF 4BMOB 5F7OA 1SD1A 1VDZA 3O84A 1EFVA 3RBZA 3FETA 4Z9FA 3JAWB 4CCSA 4KPEC 2A0WA 1M7BA 2E89A 2XUOA 1GGFA 3IAAA 4IIVA 3SKYA 4JYZA 4Z5XA 3RBVA 3LZ6A 5ALKA 1A82A 3UXMA 3GRKA 4B84A 2ZIUB 4M9UA 2ZLBA 3OU7A 1JKMA 4GYWA 3W3AD 1BU8A 2YIJA 2O8BA 4WXHA 4HFNA 3ZX5A 3G2MA 4J16A 3RJMA 4PBSA 4RS3A 4ZVPA 3DFMA 1LX6A 3PEVA 4JHLA 1HG0A 4B6EA 3IJPA 5AI6A 4U0JA 4PPYA 3AZQA 5KQLA 1GQYA 5KREA 1ZJYA 2CB9A 3KQHA 4Q3EA 2X0DA 2I9KA 5CJ2A 2HDHA 1PG0A 2IHUA 4Z3OA 2Q6KA 3BSSA 2QL7A 3I39X 4HO1X 1K6XA 2OAP1 4KDCA 4DGSA 3IBYA 3IFSA 3ED1A 3RS3A 1GUDA 3UWKA 4DSUA 4ZHQA 5A1TA 3CZ5A 3K15A 4MXDA 4R9RA 3AVVA 3OURA 1QHNA 4M9RA 4M0UA 2Q2NA 3MTBA 1LW6E 2QRLA 4TQAA 1PJTA 1L4LA 1NUTA 1P7YA 2DT8A 3GLGA 2A5GA 1XHFA 2HI0A 3MIIA 1KO5A 1M5UA 1QYCA 2HNAA 1HM5A 5F73A 1MIHA 2AG8A 3HA3A 3WGNA 4BVLA 2GBFA 3KB1A 4LGVA 4YP9A 4JJEA 4CF3A 4MH0R 4MWTA 1XTBA 1L7XA 5KTPA 5BNFA 3L2OB 1AUVA 3FIJA 3OPNA 3QLVA 3PSAA 1EHIA 1JS1X 2P40A 4W7HA 3ZXYA 1L7QA 1NJ6A 4UOZA 1P5HA 1Z7WA 2GBIA 4B8WA 2Q9BA 1R4NA 4WASA 4FC6A 3EOBI 4BEWA 4L51A 5IRCD 3DONA 3FI0A 4K3UA 2OWDA 1YBAA 3C4JA 2G63A 4E22A 1G8AA 2Q3DA 5JCJD 2VWHA 4GR4A 1RAHA 3H0EA 4HAXA 4WOJA 1U3VA 1KZ1A 2A5LA 1C3VA 2V7UA 3U3ZA 3OPYB 4CDGA 3HB7A 1U65A 1N9KA 3K73O 3HL0A 4FD3A 4ZCLA 5CYPA 2OM6A 1OWOA 2V7QA 3WRVA 1ENYA 4JBLA 1T9DA 1QCDA 4A7PA 1JPJA 3TQQA 3K5WA 5AW6A 4LY9A 3WK9A 3FFAA 2VHXA 3OWXA 2X3YA 3N3BC 4WZBE 5EJ2A 2WIAA 5JSQA 5HRCA 2PKRA 2P6RA 3DE1X 2QWXA 3IUJA 1XTTA 2FUG1 1DHRA 2OQRA 3IB6A 1VL8A 1ZGCA 1IY9A 3GVHA 3R40A 2YV5A 4NG4A 3TE6A 5U4XA 2PUHA 1P74A 4YPFA 1ZLYA 1GTVA 5EJMA 4GX2A 1N2XA 4PG7A 2EZ8A 2W6JD 1ETHA 3B2EA 5CR9A 4UTVA 2CLHB 1YVUA 3EG5A 3FOCA 1L5VA 1AB5A 1YKFA 3KJGA 3LHFA 4CGYA 1IUNA 4O4IA 1T2AA 5A5EA 3B1XA 1XQXA 3ASVA 3DMRA 1O95A 4V1CB 3L77A 1LY1A 3HR8A 3QWIA 5JQGA 2FMIA 5FWXA 1WSAA 4IQ8A 4EENA 2OFXA 3D8HA 1KVQA 3OJFA 4H7PA 1I7SB 3RUIA 1JG3A 5T6BA 4DG9A 3UZUA 3S6JA 1C9DB 2XZDA 4DC0A 4ENUA 4R1UA 4QGBA 3QVKA 1UK9A 1Q6YA 4US2R 3WGJA 2Q2VA 3AYXB 1MN6A 3BB3A 3FE2A 3KT8A 3HJHA 3QWBA 4FGUA 1E69A 4GMDA 5C4GB 3NTVA 1QXSA 2DWUA 2WM3A 3GGDA 3I4CA 2WF6A 2WW8A 4QPNA 3RODA 4Z6KA 2OCYC 2G5PA 5BSHA 2A0UA 1T2NA 2CNNA 2XOEA 3CNEA 5DHAA 1JHRA 5JUWA 1B0UA 2O2DA 4ZOEA 1RLTA 3ZK7A 4KPGA 3VV2A 1T3LA 2QV0A 4FWTA 2A3RA 3UV7A 1TFUA 3KOYA 3T7RA 4LX8A 4W1QA 4P6VF 3ZBUA 5ALRA 1GJRA 2SHKA 2EJVA 4ZI7F 2IU4A 5KYKA 3W5DA 3D0OA 2FPIB 3GJ5A 1QS0B 2HJRA 3AL0C 1D5CA 1STOA 4IEEA 5IXSA 3B5IA 1C2TA 2WU0A 3EYWA 4ZOCA 5FWYA 3UPDA 3DO6A 5KHLB 4IDOA 1S89A 2JGNA 4W1PA 4OJTA 3MCAA 4CM8A 1SXJD 1OX5A 4I50A 4KFRA 1KQOA 1AGXA 1E4EB 2YUIA 3J81k 5EIEA 3T06B 2YICA 3ZTTA 3ZQKA 3AI3A 3WTCA 1ONNA 4EKIA 2OESA 5KC9A 1WSDA 1N78A 5AT1A 1V5FA 2GM3A 4BKOA 3A9SA 3DVLA 3IT2A 4JC8A 3T8YA 3QFFA 4AJNA 1YWGO 2EBWA 2VTBB 1ZOSA 3ZW7A 2HCFA 3R3JA 2Q9UA 1TLTA 2E48A 3D6FA 2WT4A 4CLXA 4XTCS 3UAZA 3NQ41 3I32A 3E5MA 1D2MA 4Y0VA 4Z9AA 2Z6UA 1G3RA 3OM9A 4XTRA 1W34A 2GRJA 3MNFA 3CH5A 4L4RA 2V7TA 4LVNA 5LZ5A 2P9ZA 4TVOA 3R9IA 1HLGA 3PU6A 4B75A 1P2GA 1M1YB 5BSEA 1GGJA 4L2IA 4RFSA 4BQOA 1JR6A 3ZE1B 2RGEA 3SHFA 2NGRA 4TL8A 5DI3B 5K0FA 2ST1A 4DRYA 3R6TA 1TAUA 1RR6A 3EY9A 3EFOA 5HS6A 4IM7A 1EFDN 1R4ZA 2QZSA 3SF8A 1P73A 1X14A 2X8BA 4HB4A 4E6PA 1JBQA 3KIPA 1P1IA 3S5JA 4OI2A 5BV2P 1CZHA 1NFQA 2ZYDA 5DWDA 5EWLA 3WYEA 2C4WA 5JZVA 1JWBB 2VDVE 1CK4A 5IVIA 3V2UA 3W2GA 2BBSA 4ZD6A 3TG2A 2IW1A 1PBTA 521PA 3OTIA 2YNMD 2RJ3A 4E1AA 4X41A 1J8QA 4YO7A 4Z9BA 1Y8CA 1RYMA 1L5ZA 1XZGA 4Y98A 3GQBA 1ZINA 3E9MA 1B0PA 4K9MA 1M34A 3EH2A 2IBSA 2AJBA 3WIVA 1S8FA 2R3SA 1PR0A 2Y0CA 3CO5A 4MX8A 1DJOA 4LJRA 3CW2A 1FMFA 4Z0NA 3G5TA 1TM7E 2VN8A 5JCOC 3ZDYB 4OBXA 1VE5A 1OWPA 2GS9A 2W37A 1WCV1 1XAIA 2WU4A 2ZRFA 4IDBA 4CXMA 2C1XA 5ALVA 2HMWA 1EESA 1VJGA 1EX9A 2VSXA 2YH2A 1NUHA 1E92A 4P33A 3G59A 4GI2A 1ISGA 3EA5A 3U4MA 3WK5A 1HLFA 5C1BA 4TMXA 2R44A 3DHYA 3RU7A 5IUNC 3RS4A 5JSZB 4TXNA 3KEOA 3L0CA 3SZRA 2R1TB 4AT1A 1LDYA 3G2PA 1U1DA 1UM9A 5BN5A 3H4IA 3R7SA 2BYTA 3BJZA 1RRCA 1TMGE 4LGMA 2ZT5A 1G3IA 4L16A 1OBVA 1R4MA 3G8CA 4Q7MB 4ER5A 2B2CA 3H3XA 5JNVA 3BK2A 4EYQA 4I6JA 4NE7A 3GVXA 1QRRA 4LX0A 5TJ9A 4LF5B 2I7CA 4MI1A 4WLVA 3TLYA 5I7OA 3PJRA 4PIVA 3H17A 3EGDA 2H5JA 3IEPA 4Y9TA 3TPCA 4Q9NA 1D8AA 1AKNA 1I7PA 2IY9A 3FUTA 3NIDB 1JB1A 2KWIA 1ZNWA 2J87A 2B2XA 5EVJA 3W7BA 4C6SA 2QS9A 3I6MA 4OX9B 1AU9A 5D6OA 1SBCA 3KAJA 1A9XA 2NU7A 2LCIA 3JQ9A 3ZCRA 1UT5A 3P7MA 9ATCA 1CY4A 1HYGA 2NZ8A 1N6LA 1R0KA 3K70C 3MCWA 4N0MA 5BYJA 2FN8A 4P8RA 2FWMX 3V8NA 3QVWA 2ZXUA 3K0CC 4HGRA 2R6JA 3KZVA 1JFLA 3A6EA 3V1LA 3AHIA 1QHFA 1FQWA 5FF9A 4KIFA 4HMQA 3RKSA 3WKEA 5CIWA 4NL4H 1I13A 3NASA 1ZFNA 3ETDA 1FFWA 1T9GR 4MULA 1YJ5A 1NWCA 3HGQA 3IHTA 4TLBA 4N5MA 4JOQA 3G9UA 3KU1A 3TK1A 1VCOA 1J21A 2O0JA 4YROA 5CX1A 5TQJA 2ICAA 3PDWA 1XVAA 4S35A 4W9NA 1Z82A 1KI7A 2GZDA 2WYOA 3SN6A 1GQRA 2YS7A 4FXOA 4JUAA 5FUQA 3E3OA 1ZMBA 3GLSA 3IV9A 4AICA 1YS6A 4NEHB 5M34A 2QTFA 4L85A 1XZFA 4ECAA 4DZZA 3D8TA 3CV3A 1Y6GA 1UC8A 2B3DA 5DT9A 3RRXA 3VYSB 5DW0A 4IG4A 2YBDA 4LOAA 3RQSA 3IHKA 3ECCA 1CY0A 7ADHA 2MINA 4ZAYA 1K68A 1A7AA 2EG9A 4FMCB 3EX7C 1ULUA 1YZVA 3P9PA 4O5AA 1IVYA 3MB5A 2LRHA 2PXHA 4PBTA 1AK1A 3M2PA 1G66A 3CG0A 3IV7A 2ATVA 1NN3A 4G3XA 1HG1A 1JMKC 2HCBA 5DBGA 2R96A 2C8LA 3NX4A 1P0CA 2AV6A 4R31A 3ZU4A 4A9AA 4BMDA 2KJQA 4CBVA 4XWYA 3AHHA 1XA4A 2XDQA 5AOVA 4N6NA 4OYYA 3GPIA 1XVLA 2IOYA 3PIIA 3OKCA 2VUTA 3AFOA 3ZWXA 2AKAB 1E18A 1YRQA 1ZSVA 4C21A 1OHHA 2XXAB 1BTOA 1JZQA 4B6SA 3S81A 1N7JA 1UMDB 2EWWA 4HNUA 3GEHA 1FNMA 2RI1A 3ZG6A 5KYXA 1DLIA 1NUAA 2DWOA 4N03A 5E4JA 3ZWWA 4DW8A 1T4BA 5F1YA 4F04A 3ONVA 2EVWX 3TL3A 5JI3E 2XADA 1TKBA 2PKQO 3EDMA 4MYUA 4RCYA 4AG5A 2JG3A 1OXUA 2C2GA 1OXSC 4ZEMA 2ZSAA 1Q0ZA 1JEJA 3RS9A 3I2FA 1UBUS 2I22A 4WNIA 5JMWA 3KAKA 4I55B 4Q7LA 2E4ZA 4JSTA 3LECA 4BQFA 5IYZB 1ADCA 3UMCA 4MP8A 4GOLD 3VSEA 3ZDAA 2B1JA 2JEZA 4G8CA 4HMOA 4FT4A 4MIEA 5T8KA 4FKZA 3MFQA 2EEZA 4H31A 4MW1A 3S2YA 5B3JC 1PWEA 3PHHA 2VRCA 4K9KA 1ATIA 2CGEA 3IERA 1SN7A 1U80A 4ZQIA 4YJFB 4N8SA 3PPIA 2DR3A 4AZSA 1E1MA 1EFKA 2O05A 3QUQA 3PD1A 3FYUC 3HBJA 3QA3E 1FFDA 3QUBA 4O2RA 1QF7A 1JTFA 1Y3FE 3TAXA 2ZFUA 1WHSA 2M6LA 2FV8A 3D6HA 2QORA 3BRCA 3CBQA 3DE2X 4GZ3A 2PJRA 4Y2XA 4QQRA 5ES4B 1XMVA 3IOEA 4HQ6A 5B1HA 1P5RA 2A9VA 5BSKA 4J7UA 3O8RA 5JH7F 3OESA 1ZMRA 5IWAB 2Z08A 5EMHA 3NR2A 3RJTA 4FZ5A 1H8HD 2HSWA 2PH1A 3U1BA 1WABA 2FQWA 2H4FA 2MCFA 3X1MA 5HKAA 2JGKA 1QM5A 4LE0A 4N5NA 3H2JA 4RJLA 3ZUGA 3A0RB 5E0KB 3NONA 1MFZA 2RONA 3DMFA 3IAM6 3RABA 3GLHA 4LRWA 3A37A 4EL0A 2EYUA 3KFXA 1KXZA 3WGYA 4ZVQA 1FX0A 1NNI1 1QH8B 1RWQA 4FW9A 4DR3B 2X0RA 3JD1A 2BZ0A 2ZCVA 5B1DA 4AZ3B 2XLBA 4AXBA 2DFTA 4Q1DA 1YJBA 1WULS 3B48A 4QDUA 5KMGB 3ND9A 1L4BA 2C5SA 2GILA 3MJCA 1CRQA 3ABOB 3NNSA 4ID9A 2VHEA 4IDGA 2RBKA 4WWHA 5GZ6A 3VC2A 4QYXA 3WHLA 3T9AA 4XUDA 2W2MA 4BBJA 3F5SA 3L4BA 1A7UA 1U90A 1PN3A 2EDAA 1ZL0A 5U4QA 1SEPA 4I3GA 1PT7A 2P0EA 3PNBA 2C2XA 1LLQA 2G08A 3KPYA 5C31A 2AJLI 5EOVA 4ES6A 5LQDA 5F7ZA 4MQEA 3DLHA 1R9MA 1Y42X 1JU9A 3G0OA 1J9EA 4GPBA 4YWHA 4B2YA