3AHFA

Phosphoketolase from bifidobacterium breve complexed with inorganic phosphate
Total Genus 322
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
322
sequence length
802
structure length
802
Chain Sequence
b'VIGTPWQKLDRPVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFIMGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVAGFDNEDHMSIHRRFAELFETIFDEICDIKAAAQTDDMTRPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVIREDLKLPELDQYEVTGVKEYGHGWGQVEAPRALGAYCRDIIKNNPDSFRIFGPDETASNRLNATYEVTDKQWDNGYLSGLVDEHMAVTGQVTEQLSEHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSLLINKTFNNDHVTNIYFATDANMLLAISEKCFKSTNKINAIFAGKQPAPTWVTLDEARAELEAGAAEWKWASNAENNDEVQVVLASAGDVPTQELMAASDALNKMGIKFKVVNVVDLLKLQSRENNDEALTDEEFTELFTADKPVLFAYHSYAQDVRGLIYDRPNHDNFHVVGYKEQGSTTTPFDMVRVNDMDRYALQAAALKLIDADKYADKIDELNAFRKKAFQFAVDNGYDIPEFTDWVYPDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylulose 5-phosphate/fructose 6-phosphate phosphoketolase
publication title Crystal Structures of phosphoketolase: thiamine diphosphate-dependent dehydration mechanism
pubmed doi rcsb
source organism Bifidobacterium breve
molecule tags Lyase
total genus 322
structure length 802
sequence length 802
ec nomenclature ec 4.1.2.22: Fructose-6-phosphate phosphoketolase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
A PF09363 XFP_C XFP C-terminal domain
A PF09364 XFP_N XFP N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahfA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahfA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahfA01
4D5GA 2YICA 1V5EA 1N0HA 3M7IA 3LQ1A 1UMBA 2Q5LA 2Y0PA 1UPAA 2VK8A 2J9FB 4RJIA 2VK1A 5EJ8A 2BFEB 3OOYA 2UZAA 2O1SA 1TRKA 3F6BX 2UZ1A 1UMDA 1KEKA 3DV0B 1X80A 2C31A 1T9BA 2BFCA 4RJKA 2BEVA 2PGNA 1X7XA 2XT6A 1ITZA 4GPEA 5K3SA 3M6LA 3EA4A 2XTAA 4K9MA 5HYVA 1V16B 5AHKA 5DGDA 5ERXA 4MPRA 4FEEA 4GM1A 2W93A 1OLXA 3EXG1 4MQ5A 2OZLB 3EXEA 5HJEA 3IAEA 5ERYA 1MCZA 1UMBB 2IHTA 3UPTA 5K6RA 1OZFA 2QTAA 3ZHTA 5DGTA 2UZ1B 1GPUA 3E9YA 1UMDB 2BFDA 4JUCA 1X80B 2AG0A 2BFCB 5EJ5A 2BEVB 2FN3A 1X7XB 5EJ6A 2Q27A 1YI0A 2Q28A 2XT9A 4QPZA 4JUFA 1OLXB 1JSCA 1V11A 4D5EA 3ZHSA 4K9QA 2VBFA 2G67A 3EXEB 1NGSA 4JUDX 1B0PA 1UPBA 3ZHUA 3LPLA 1ZPDA 4RJJA 3JU3A 4GP9A 2Q5QA 4K9LA 2BFDB 5EJ4A 5FEMA 3ZHRA 1DTWA 2C3MA 2DJIA 2JI9A 2IHUA 4JD5A 3DUFA 1T9AA 4KXUA 2O1XA 2FWNA 3F6EX 1X7WA 1X7YA 2IHVA 3IAFA 2C3OA 3FSJX 3AHHA 5K2OA 4QELA 2C3PA 4GM0A 5EJAA 1T9CA 4C7XA 1OVMA 1V11B 5EXDA 4C7VA 2VBIA 4QQ8A 1OZHA 1Z8NA 2BFBA 4MPJA 3HWWA 1RP7A 1NI4A 1QGDA 2BP7A 3LQ2A 1Q6ZA 4KXYA 3EXHC 5I5EA 1YNOA 1QS0A 5DEIA 2BEUA 2BEWA 3EXHA 1V5FA 1TKCA 2R8PA 1UPCA 3AI7A 1DTWB 2R5NA 3DVAA 4GG1A 1V5GA 3DUFB 2JLCA 3EXG2 1OZGA 1X7WB 4KXVA 5I4IA 1TKAA 1X7YB 3UK1A 2NXWA 3OE1A 4KXXA 3FLMA 1V1MA 4COKA 1AY0A 2C3YA 2G25A 4XEUA 3KOMA 1UM9A 1V1RA 3EY9A 5EXEA 2BFBB 1YD7A 2JI8A 1POWA 4JU9A 2EZ9A 2R8OA 5EJ7A 1PO7A 2EZ8A 1PVDA 1UMCA 2VK4A 1NI4B 2BP7B 2C3UA 3HYLA 3MOSA 2PDAA 1QS0B 1OLSA 2Q5JA 2BEUB 2BEWB 3EXHB 1PYDA 2PGOA 1L8AA 2EZTA 2X7JA 2BFFA 3DVAB 1WCIA 3AHDA 2IEAA 3AHCA 1X7ZA 1YHZA 4K9OA 1QPBA 4WBXC 1BFDA 2JGDA 1V1MB 1U5BA 2VJYA 4K9KA 2Q29A 2OZLA 3D7KA 2Q5OA 3EXIA 1UM9B 1V1RB 1OLUA 4KGDA 1T9DA 4KXWA 5EJMA 3AHGA 1UMCB 5HGXA 4MZXA 1OLSB 1IK6A 4JU8A 1W85A 1W88A 2AG1A 3EXFA 3ZHQA 2BFFB 1WCIB 3L84A 2JLAA 2WVHA 3FZNA 1X7ZB 1TKBA 1PI3A 5I51A 1POXA 2JGDB 1YHYA 1U5BB 5K6TA 4K9PA 3AHJA 1Y9DA 4MPPA 2VBGA 3EXIB 1OLUB 1R9JA 3ZHVA 2C42A 2E6KA 2V3WA 3AHFA 5EJ9A 4K9NA 5ESDA 2J9FA 4Q9DA 2QTCA 3AHIA 3HWX1 4JUAA 2JI6A 4FEGA 5C4IA 1W85B 2YIDA 1W88B 2WVAA 3EXFB 2BFEA 4ZP1A 2JIBA 2JI7A 3RIMA 2G28A 4JUBA 3DV0A 2EZ4A 1YBHA 3LQ4A 3M34A 4GM4A 5HHTA 3AHEA 5I5GA 1V16A 1YI1A 2PANA 2EZUA 2WVGA 5IMSA 3M49A 3EYAA
chains in the Genus database with same CATH superfamily
1R1DA 4S1TA 4URYR 1LZLA 4D5GA 1QP8A 3OD5A 3DBRB 4BNHA 1G6KA 4BRZA 3F5MA 1E2DA 1IIBA 3IBGA 1VCOA 1ZCZA 2OKCA 1RPAA 2FW1A 1QAOA 3FWNA 4L4UA 3TRDA 3FGNA 4EGAA 1C4OA 1E5VA 3JQFC 3K71B 4DJ5X 2VK8A 2J9FB 2H0AA 3AESA 1DEHA 3FYDA 1Y5NA 3KCNA 4IQ0A 4WFIA 2XE8A 1W96A 3B70A 3L0ZA 2PIAA 3SSMA 3JAKB 3MIZA 1KS9A 5CK5A 3E2MA 4AU1A 1TFUA 1JKJA 4LX0A 2P5SA 8GPBA 1Z12A 4EL5A 2NIPA 3IMEA 4KQFA 4PC7A 4WN9B 5KVAA 3JQBC 4M8SA 3JRXA 4V0OA 1ONBA 3ZIDA 1RXUA 2WMYA 5EIBC 1NUAA 3C41J 4FGZA 5TS2A 4AL4A 1GAXA 1EFRD 4REQA 4C0HA 1BCSB 4UHCA 1KO8A 1VHWA 5K6AA 1X0VA 3ROQA 1OWLA 3KO8A 3OECA 5BWMA 3DEIA 4I0WB 5ADHA 3MD0A 3EHEA 3FWZA 5KZMB 2OEPA 1IM5A 4OYRA 3D3KA 1A95A 4TM8A 1W6UA 6PFKA 621PA 5HR5A 4INJA 5TEVA 4JP2A 1QAQA 5KQSA 3COSA 3DBLB 5JSFA 4BLRA 2AR7A 4C0SA 4F3RA 2JIRA 2ZBQA 1A5TA 1NQ5A 1QORA 1V8BA 3QM1A 4B7ZA 5IEJA 4BNDA 3UC9A 1J56A 5FX2A 4YYZA 1P7WA 2XQVA 4GM1A 1Y4ZA 1YQQA 3AUYA 3FPGA 1WUHS 2SKCA 5EUMA 1CRZA 2BGTA 2ET6A 5GVRA 3ZWPA 3C6BA 3KXDA 3NHWA 5BW5A 5GY7A 4EGFA 2OLEA 4HYEA 2Q4RA 3SR4A 1YDWA 3CKYA 1C7FA 4LVOA 5LXTB 1ZGHA 5KS2A 4QSMA 2HYIC 1Q7TA 4PNHA 4R8SA 3I3SR 1SHZA 3E8XA 4OXIA 1C14A 3I9FA 4R1SA 3PC7A 5F52A 3LHDA 2WYIA 3PGKA 4GMXA 4TXMA 2VKTA 3CZ5A 4WGFA 3RKRA 2HNAA 3I04A 4IO1A 5DULA 5ERYA 4AYWA 5JH7F 1U9CA 2ZYTX 5DP2A 3WISA 3E7WA 4C0WA 5IJZA 5JNSA 2AC4A 4PLFA 1Z6XA 3UPTA 2I8AA 3H6HA 5ALRA 2HT6A 2MSWA 2J3QA 1DXQA 1RLMA 3H99A 1ZNXA 2B2CA 4OSPA 3UJAA 4D25A 3FROA 3KDPA 2DJ5A 4IILA 3PJFA 1W25A 4WA7A 4I50F 4HEHA 2WP8J 2R6FA 4MW2A 4W9MC 2HUNA 1XZKA 1IWBB 4MV5A 2PGXA 1N8TA 3PXEA 4O33A 4E32A 4IDBA 1QJCA 1QOPB 3GLKA 4FFOA 1CS0A 1LPSA 1WL8A 2I7CA 1Q0QA 4KBFA 4XWTA 4ZAGA 5I7UA 2XMCA 4QUKA 3OQJA 1G9TA 1L7BA 4JVSB 3IDZA 2CFSA 3VHXA 1E8NA 1GNRA 1CNEA 1OFHA 1VE6A 2YZMA 5JQGB 2AWOA 5LZ9A 2QVZX 3K94A 1FOEB 1P1BA 1P31A 3EGVA 5JADA 3KS9A 3KB2A 1WO8A 2IY7A 4JIMA 2XRYA 1C1XB 3LOQA 1DWOA 3P27A 3PUKA 1PKXA 1R8JA 2A5JA 2GCOA 3O3NB 4QDZA 3VC2A 4ZDJA 4G8CA 5FL3A 2WYVA 2ZSDA 3AERB 3WMWA 3CKLA 3QENA 2PU7A 3WYEA 4EKDA 1BWSA 2AFHA 4FFMA 5CJPA 5EGSA 1BGWA 1JIXA 2X13A 5AM0A 3SEFA 2EYQA 2IP2A 1W2WB 3P52A 2GLTA 4J9VA 2GN2A 1JG2A 1EAYA 5F35A 1U98A 1CEEA 1Y8QB 1O57A 4BNWA 1J2RA 1EE9A 2DGDA 1ZM4A 2ZJAA 5C3UA 1GEEA 1O6FA 1RSZA 2QPLA 3SZLA 3PF9A 2J41A 2W6JD 2NSJA 1ADGA 4I8XA 1E5LA 5EGNA 1O9GA 3TGLA 4NCBA 1GR1A 1UPBA 3G1UA 1DCFA 1HDEA 4X1YB 4WCVA 1F3LA 2OHGA 2Z9BA 4JX8A 2CE7A 2WF9A 4CKBA 3OF5A 3TZHA 1IG3A 2B1IA 3GEIA 3LGAA 4L6IA 1B1AA 2JCBA 4BE7B 1MPTA 2C0PA 3AIOA 4HP8A 4D79A 2CJYA 3HBNA 1MJFA 3ELWA 4QG7A 5GJBA 1Y6FA 3DMHA 5CCEA 1T0BA 5FTLA 1U7ZA 1MKYA 4MYSA 1TUIA 4EHJA 1NVBA 5LQNA 1KEEA 1B3BA 1DX6A 1KJNA 2C4VA 1ULHA 3EA5A 3Q1KA 3UN1A 4L85A 4PIVA 2HO4A 5BV0A 4MW6A 4DZZA 3OM9A 2WBLC 4HRAA 4QVKA 4TVOA 3AKZA 1L5MA 5G0UA 1P2GA 3GA7A 5G0VA 4ZV7A 1UDXA 4RA9B 3KT3A 7ABPA 2AZ4A 3NZEA 4MV9A 2GK3A 5F12A 3B82A 2NVUA 5JJ5A 1YC2A 3LWDA 4P8RA 4BNVA 3KB1A 4YBZA 5GJCA 5TJ9A 1T13A 4JD5A 1KC1A 5FWDA 1JQDA 3PQFA 1BYUA 1L7XA 1L7OA 2P9QA 3CF0A 2JFFA 4KKVA 3WJ2A 4UVHA 1XNRB 1TLFA 4PZ9A 1YA4A 2NM0A 4TT8A 1QYXA 5DRTA 4FZRA 4IF6A 1E3WB 4MIEA 3D0OA 4FGSA 1G3UA 1IJBA 1N6HA 1DO0A 1U5CA 3IIIA 2OO3A 2MSKA 3K1TA 3O74A 1QG0A 5IAKA 2VVTA 1ANKA 1F1JA 1AZLA 2V74B 3QXJA 2F59A 1U5AA 1BDHA 4BBJA 4RLQA 1AKWA 2B37A 1PFWA 3SS8A 2HGZA 2GBPA 3CX8A 4WV3A 1W5FA 1WXDA 2OORA 1SUFA 2WP0A 2LCIA 3BDIA 3RU9A 3H9JA 3B6EA 3HRHA 3W8RA 1QYIA 2CLHB 5EXDA 3RYHA 4D9BA 4DG8A 1LWNA 1VIDA 2CJWA 2IU6A 2VZ8A 4WEQA 2BFBA 4UCXA 5KTPA 2HH9A 4PXAA 1E7RA 1MAAA 4CU2A 2DLDA 5DVZA 4PXYA 5JO0A 1M1ZA 2QM7A 1XF9A 3HYRA 4HXYA 16PKA 5AK4A 2H9IA 4OXXA 4R2MA 2XBLA 3LQQA 4HKTA 3Q3IA 5TMPA 1ZN9A 2E21A 5U1PA 1NC3A 1U1GA 1N2EA 4F11A 4HT3B 2BBSA 4MW1A 2CY0A 1EIWA 1USUA 1ZUHA 2FSFA 5L3RA 4ENVA 2R6HA 1LY1A 4Q9HA 3GT4A 1ULSA 2C03A 3QUAA 4AJ4A 2GLXA 4EO4A 3HUFA 5B4UA 1V5FA 2W37A 3N8GA 2A9PA 5D01A 3BF7A 2ZXEA 1BTOA 1LDYA 3JW8A 1A5AB 2O2YA 4JLUA 2BJVA 1ZI8A 2A0UA 3PDUA 1NF9A 2FP3A 2WDZA 2RCNA 1KA9H 5IDVA 4TTPA 3HP1A 5F1OA 1M7BA 3JQAD 1AUVA 3RUAA 3W9UA 4D4KA 5KQRA 1EXWA 4YPFA 3UGKA 1NTOA 4F2GA 1JG1A 2BLLA 1OT3A 1ZNQO 4FGKA 4WCFB 5ALZA 3T99A 3MHPA 4CEJB 1U0BB 2XWJI 5I9IA 4N12A 1COWD 2B0CA 1X86B 1EG2A 1G21E 2PQ6A 4O25A 3OE1A 1EXDA 2A0YA 1I0IA 3WS7A 1V5IA 1EG7A 3RSLA 1MT3A 3GLTA 4CLHA 3K4QA 4QJ5A 5I6DA 1KP2A 1NVKA 1L5WA 4JHXA 4RVUA 3TINA 1UDCA 4DV7B 3PPYA 5JXHA 3U44A 2CDCA 3KTDA 4D9CA 4EK9A 4EPWA 1E6KA 4PG8A 2XKBA 4X6UA 1X94A 1QHSA 3L6OO 5EXEA 5H02A 1YD7A 2R6R1 4HAWA 1M7GA 4IZ6A 2CXSA 3DD5A 5FBRB 2R8OA 4TKMA 3UKDA 5JECA 5A4JA 4FSXA 1P39A 1UDAA 1UMCA 2VKQA 1I1QB 1TLLA 2YC4C 5DWDA 4CKWA 3DTVD 1NJGA 1AKMA 4NOLA 1B8PA 1W4BA 2VQ6A 1IYZA 1H2RS 1RLUA 2DY0A 1QH8B 2AN9A 1A9QA 3A26A 3PUZA 1QHYA 2VDPB 1U94A 2GVDC 2PLRA 3R3SA 2EX1A 3PI7A 1GAEO 3EEQA 2JZNA 4AVYA 4ARAA 5L3SB 5K8UA 1LNSA 1R4AA 4Y9RA 5D3QA 1SG9A 3OCZA 1KKLA 4YUAA 1GGKA 1P9RA 3FHJA 1RI4A 2IKQA 2WT8A 4UM7A 4J75A 2K2QB 1V43A 5JYDA 2SKDA 3AHCA 4OFXA 3WKDA 3A1TA 3WLQA 5I9LA 1HUQA 3KR2A 3LW7A 3KXKA 3UJ6A 4JDPA 5IZCA 1SC1A 4PV7A 1J6UA 4ZEXA 3FUCA 1CQZA 2GMWA 1WETA 4BVLA 4DJTA 5EE1A 3FVRA 3OLWA 4BLUA 4ENTA 3D8HA 4HADA 1Z5GA 2REOA 4JZKA 4ZOLA 4B9AA 3HCPA 1WB6A 4O4HA 4BN0A 2J9XB 3QKRB 5CFZA 1VMKA 1O9HA 2GA8A 3V8EA 4E33A 5H80A 4GP6A 1YCDA 4XQGA 3P97A 3OJWA 4OQPA 1IG0A 1EB8A 3PC2A 3FKQA 4DFDA 5J1SB 2NU9B 5CB8A 5JXWA 2YL2A 4GMHA 5IAJA 1CF9A 1AN9A 2WWTA 1TEZA 4M1WA 4D96A 3WMXA 1YDGA 1F17A 4YCAA 3TZQA 4PO8A 3RRXA 4ZPXA 4JY7A 5NLLA 4DVGA 1YDFA 1O95D 5EJMA 1KQ3A 3FWKA 3BMOB 1CUYA 2F3PA 4DB4A 2MYTA 1WQ3A 4J4HA 1CQJB 4PY2A 4ILEA 1CV2A 3LXMA 2OFWA 2SNIE 1JFLA 2NO5A 1OA0A 5A2GA 3TZKA 5HGXA 3JXEA 3ZWKA 3CRVA 3KVRA 1YQWA 4JP3A 3WG9A 6ABPA 5TGTA 4BKMA 3U6BA 1Z16A 2Q2QA 2CVQA 5BUQA 3CNNA 4I5EA 4B4KA 4G5QA 3U6KA 1YJQA 3KOWA 3BG5A 3LA8A 5HUQA 1CY1A 1KEWA 4MTCA 2J45A 4X1IB 4RV4A 4Q5IA 3HEBA 1NV8A 1UBTS 3E6AA 4YJ3B 5IC5A 2M6LA 1UBEA 1PQ4A 1XL0A 4UATA 1N5JA 3OZFA 4YACA 1I5OA 3PWSA 3NEPX 4RXTA 4QL3A 2EKQA 2ZI6A 2G04A 2VC2B 3L7MA 4EELA 3IBFA 3M5CA 3EIFA 2F3RA 3WO1A 2DKNA 5HDBB 4E7OA 4WCDA 1CUAA 1FS6A 4ND8A 2JG3A 1UR5A 4CMEC 1ZRHA 5KINB 1NUUA 2DBQA 4E4YA 1VSBA 3DBIA 5JOQA 1SZCA 4EFDA 1VLVA 2QTVB 3TZBA 1UBJS 2J6HA 5G4LA 2SBTA 4AW9A 4TKVA 2W9XA 4AY5A 4DDVA 4M0CA 4YECA 4MPPA 1UBSB 2J7PA 5I7RA 1I2DA 1JPNA 4A8JC 2W5UA 5EHNA 3U7RA 1C1DA 2PVPA 4FFBA 4DR3B 2BZSA 4DL9A 1XCLA 2ZYRA 4YRFA 1PFQA 5ECYA 4OXYA 4FGUA 2ZU6A 2V3WA 2Y8EA 4EAAA 2GBFA 3AUSA 1LI4A 3ISJA 3P5BA 4QEZA 2A9QA 3ZU2A 2AOVA 2ZT5A 1DAFA 4K0KB 5KNDH 4J0CA 3PGXA 2FDCA 3UFBA 5BN3A 3U7FB 2QG4A 2X9LA 1IC6A 3BH6A 3MYYA 1EBFA 1M34A 2AG8A 2FB9A 2PMDA 1HOTA 3BWBA 4W9NA 3SAJA 5ES4B 3ZLJA 3CISA 5JHHB 2J4DA 4YAEA 3FN4A 5AJHA 3NHZA 2YV3A 1T2NA 1WXHA 2NTYC 3AL2A 3BJEA 1GKUB 4IXNA 2GBCA 3PHBE 3AEXA 1JU4A 3V4OA 1J0CA 2KW5A 3DR3A 3I92A 2I2AA 1JQ5A 3ZOZA 4PINA 5C8YB 1IBLB 2BFEA 3QMWA 3F5SA 3G2IA 4IUDS 4NIMA 1NN1A 4QYIB 3WLRA 2XBMA 2ZE8A 3HB1A 1PNTA 1NSFA 4S1WA 3KBBA 1CLUA 3NR2A 4BGVA 1EFTA 5G4KB 1S7GA 2FEXA 3NCHA 3RSFA 1P0CA 4EVQA 2PXCA 3H2YA 3K8YA 3FSEA 3DV0A 3VSEA 4Z7QB 3ZHZA 1Y9JA 4EABA 4PYOA 3MNFA 3UT0A 4N7BA 4H7HA 2VUUA 4TSRA 1SCUB 4ZJYA 4RO0A 3H11B 4Z4HA 1RQXA 3EGWA 3NAGA 1PFYA 3STVA 2EBUA 1EFHA 3V1UA 2AF3C 3ESYA 4BZPA 2IUSA 3V00A 5JYBA 2QUJA 4KWIA 1E4YA 4EO7A 2QUKA 1MQSA 1XVAA 2BGRA 1B42A 4JJEA 4ZQHA 2PGDA 5ECDA 3VR5D 3HDJA 5IFLA 3UC5A 1OIVA 4DQVA 2O07A 4CMKA 4Y1EA 3MPUA 3NBFA 3EYAA 4MIYA 1XD2B 4S24A 2BCJQ 5ELMA 2W70A 3MMZA 5ALNA 3KZVA 3OJLA 1YC5A 2X8LA 1ZHHA 1GSOA 3KYCA 2L19A 1SHLA 4PNEA 2O5CA 4MKRA 1TQ2A 1N0HA 3R5FA 1GGHA 4ETNA 4X63A 3RRYA 2X8BA 1CZHA 3PYXA 3I72A 4KK3A 1BD3A 3RAGA 4MGYR 3VFDA 2IE8A 2GFHA 4CGYA 5FWYA 1BE6A 1K4YA 2XB2A 4YDHB 5CYGA 4MVJA 1UPAA 1QWOA 1EWTA 3EX7C 4L8LA 2ZANA 4HB4A 3ZU3A 3FWPA 4AG3A 4NU6A 5EZQA 4DIFA 2ES4A 2R6JA 3IT2A 5KWEA 4C01A 1QV7A 3SMVA 3U3ZA 2JAXA 4A2CA 4BE4A 4URFA 1UJBA 3MJEA 3HKDB 3ITEA 4FFDA 3D2BA 2IVFA 1XMXA 2AK3A 1AHHA 2YOHA 4DSTA 2O1SA 3BOSA 3I6MA 3KD2A 5F21A 1ESCA 1M1UA 2OTCA 3F6BX 5E6RB 4B4DA 3U3RA 3NASA 1DOHA 3UAXA 3RRNA 3VR0A 4CTNA 2WJJA 2RFLA 3CRRA 1YFJA 3STTA 3W8NA 2P2ZA 1KEKA 5JVDA 3DEFA 2CUKA 1J9GA 1E9DA 3PNOA 2DHDA 2BFCA 1XRPA 3EGOA 2Z5LA 3PI6A 3D6AA 3VDRA 2FDXA 2FZKA 1ITZA 3I05A 3L5KA 1B0UA 4NH4A 3SCZA 3VYRB 2YOGA 3TUZC 2CC2A 1M54A 4AJIA 3PUVA 1OTXA 2WQZA 1WUTA 1XAHA 4EMSA 5JD3A 5DNCA 3CZAA 1P5FA 2O5VA 3E1SA 4ID9A 4UD6A 9GPBA 3G0CA 2P5YA 1Y42X 2QM8A 2H4YA 1Q6YA 3OT1A 5AIAA 2GB4A 2OLKA 4N5HX 4PTZA 3ZCUA 3NETA 3OKPA 5BSHA 2P9TA 2I1WA 2RHBA 1CVIA 4GI5A 5JQWA 2CMDA 2K5UA 2YINC 1ENPA 2JLSA 2YMLA 3L7NA 2ABWA 4E46A 1FLVA 4Q9JA 3KELA 4L50A 1T6XA 4ZZ3A 5JISA 2ZIGA 3GDHA 1PL6A 4UHEA 2AX4A 3OE4A 3F2IA 2X6QA 2C2XA 4L27A 1A4RA 4OXKA 1G60A 2IPOA 3FWHA 4RIFA 1FRVA 3SSNA 5IFKA 1FTWA 2ASVA 4YPOA 3Q6IA 5DBGA 2H11A 1G3MA 1Z2OX 4YRPA 3FUUA 2FV8A 4RZQA 4C76A 3FUWA 1O95C 4KZKA 3PUHA 1R6BX 1DRWA 4MR8A 4NF2A 4D4LA 2HQSA 2P2GA 4NZYA 3NVMB 3PCXA 1LDNA 4I5DA 2O7NA 4P53A 2DBRA 4F12A 3T3PB 5JPIA 1WF6A 2VIIA 4OHOA 1ORVA 4Q21A 3WYGA 1X2EA 2HO5A 5IKOA 2I6SA 2H3EA 3NHAA 2CNNA 2R47A 1WF3A 3ZEIA 2P68A 5CLJA 2X5JO 3E9YA 2J1LA 2KQUA 4BLWA 1SQ6A 3RHZA 4J2HA 1A2BA 3D2AA 3R5TA 2QQGA 4PYNA 3I5UA 3TD2A 4B87A 3K1AA 4DHEA 3ZWXA 1NNI1 1Q20A 5CDUA 1GP2A 2VJPA 3C1UA 4X20A 4BY9E 4R8RA 2GWRA 2M32A 3RGGA 3TJMA 5ALMA 4YI3A 2XYVA 2DKFA 3KQMA 1RWQA 5B36A 1YZUA 4DMRA 4ESOA 3GPIA 3GJ4A 4ZYXA 3A32A 4HNQA 3ANSA 1CVLA 3HI4A 3RU7A 4A16A 3VI3B 4AZ3B 2P40A 1ID8A 4IDHA 4PEVA 4HDSB 1Y9EA 5EQJB 1W4AA 3IQIX 1S8OA 5FLKA 5AK0A 1SD5A 2QOEA 5IUJC 3DYVA 3OEHA 3BSSA 1NJ1A 4FHFA 1GYQA 2P4EA 5U9CA 2DM6A 3VC3A 4TRMA 3ANTA 1X8JA 2W2LD 3AUAA 3T5GA 4IOLA 3DM5A 2GYVA 4V38A 2O23A 1WG8A 4HAIA 1E79A 3QX3A 3U16A 4C6HA 1WZCA 4RHCA 2FXIA 2ID9A 3WAJA 4B76A 3QX8A 4IFTA 3CG4A 3PKIA 1ZI9A 4IIJA 4KUHA 3ZD9A 1F60A 2CXPA 4L3VA 4L0DA 1OAKA 1YOVA 4BQSA 1FX1A 5HOEA 3RSSA 2PWPA 3ETNA 3EDYA 3T1NA 1C7RA 1LPBB 4OHKA 2PZAA 3K0CC 3W5BA 3EZLA 1ACMA 3KJFA 1PX0A 4ZI7F 4G1CA 3I5AA 3EVGA 2WPDD 4D9IA 1HNWB 3TRFA 2O19A 4AKGA 1QO0D 3HJNA 2X6TA 3UKJA 2Q5QA 3JS5A 4OAPA 4MWEA 4URUR 5A9RA 1LBEA 4JOSA 3NO4A 3QLEA 2UVDA 3QW4B 1LD3A 3CH5A 3HFJA 2FRXA 1V0JA 4E94A 2QF7A 4HNTA 3R8XA 4RA6B 5B57C 1U7XA 1NE7A 2IYNA 1IHPA 1ZM7A 4WOPA 4QTXA 3MFYA 3TAHA 4ZKDA 2YC2C 1BGVA 1TJNA 2C3MA 3ABIA 1WTCA 1PHPA 3C8HA 5H82A 4ZT5A 2Y6VA 3OH8A 3HS3A 4IO0A 3BQ9A 1PVVA 2LPMA 2NV0A 2P9EA 4OXNA 4Z7OB 4TXHA 2YRFA 4I50B 5E6SA 1V37A 3X2FA 4DNPA 3PWZA 3TLGB 3VKVA 2C3OA 1UL1X 8ABPA 1N8KA 4LHVA 3X1YA 1JILA 3BK2A 1CR1A 4MDHA 4QELA 4GM0A 1K92A 5I7WA 4XCVA 4J0IA 4Z99A 4G5FA 4FOPA 2IVZA 4QOFA 3ED5A 4U6NA 2VQFB 4G5YA 4P83A 3WLEA 2IU4A 4XYMA 5CH8A 2BM0A 5FP0A 4Q03A 1VJ1A 3II6X 5BWCA 3FKJA 3PGA1 3W3AA 2V3CC 3ONFA 4CM9A 1EGQA 3M4YA 2MHCA 4IJ6A 2X4IA 4KQ1A 5BW6B 1CEQA 3QPVA 4FOTA 4NXNB 3HWRA 1SVOA 1TM7E 1Z73A 1V3UA 4NC9A 2YV2A 4D97A 1YRLA 5I3CA 3KFXA 2G9UA 4AQYB 2YWDA 1TJ5A 4H4DA 4QUBA 5EP3A 1S2DA 4U2DA 2RC6A 1DQRA 4TL8A 4II7A 3SN6A 3TL6A 5CDYA 4R31A 4MGIR 5JMOA 1YB6A 3V7NA 3P9SA 4EG1A 2WWGA 1H93A 1BO6A 1WMDA 5J2UA 3O8OB 4HOYA 3TNYA 3OF3A 3EH2A 4TTTS 2RAFA 5KX5F 4CLXA 2ZM5A 1QG6A 1SJ9A 2WJ3A 3DXXA 5ENVA 3V4LA 1P2DA 1UKVY 2WG2A 3F4LA 1T1SA 4OREX 2XQIA 5HWSA 1K75A 5KNCA 3EXHA 3GD5A 4YMLA 2PBFA 3NDIA 1FF9A 1MOZA 4MQFA 2I3ZA 4ARZB 2AGVA 1YULA 3IUPA 4L4YA 1ZOPA 2GFQA 3FPFA 3GGPA 3JSXA 1IPEA 1C8LA 1U90A 1G19A 1YJCA 4HGRA 1QVAA 4L6CA 3VNRA 3ZE8A 1M1XB 1GAJA 3EC1A 1EFVA 2UVPB 4BX8A 4ESHA 1A50B 1SEPA 1Y8AA 1GGJA 2HLHA 1M5RA 1ISHA 2J3EA 2V0NA 2WWHA 2PE5A 5IK2D 1ZNYA 4Q01A 2XCIA 2CFTA 3KQKA 4F9GA 2GF0A 1KJWA 5B58C 1P7ZA 1TIPA 3KOZA 5EHZA 3N76A 3ICCA 5AOBA 2WWVD 4D8WA 3L7LA 1ZQ9A 1T34A 3STHA 2PD3A 3I2KA 3AB7A 1SBQA 5HW0A 1OHHA 1FB5A 1UFRA 1HL3A 3BZBA 1TAGA 3PQ5A 6NULA 4WAUA 3Q85A 4MA5A 3A0UA 4GO1A 4GXRA 1RWOA 5BQXA 5KKAA 4DVJA 2HPVA 3SLRA 2QNIA 2QRPA 1Z5UA 1H85A 1Z07A 4H1VA 5IT4A 1K4MA 1XPUA 4IEEA 1IN1A 4Z4EA 4XUCA 3AV3A 1YL7A 1R5BA 3H9CA 1YZGA 2J7KA 4X44A 2YUIA 5IVHA 1GARA 1RJGA 1AO3A 4BIIA 2FFRA 3JWHA 1NR1A 3NC0C 2VH1A 3QWFA 1KF0A 1QIKA 2J3MA 4LWQA 5T67A 1XRQA 4I3FA 4L2IA 1RIFA 3Q9LA 2HJVA 4Q7JB 1H5UA 1DQNA 1XTIA 5AKEA 3U1VA 2YFHA 5LU9A 1RFGE 3VA7A 1SQ0A 4AJOA 4D9EA 4K6CA 1A8HA 3DOJA 4Q4DA 1PT9A 2QJWA 4FYPA 5A9TA 1IN7A 2ENWA 4X3OA 1PYDA 1NG9A 1DJMA 4PGMA 3IE2A 2XOKA 4II2A 3QOWA 1R4NB 1RJ9B 1YL5A 2MR5A 3UMFA 5C1BA 2IYPA 1SB9A 3RU3A 3QLUC 4AYTA 3EMDA 3KPJA 4R0MA 5HQ3B 5K05A 1HX7A 2BMJA 4WNAB 5F2OA 3H05A 3UJNA 1E0SA 2V9PA 1ZOSA 3LX5A 3U4DA 1NOIA 3JZFA 4NYJQ 4MUYA 3G2JA 3VPDA 5MGNA 1COZA 1DKUA 1NVDA 2Q6TA 3LX8A 2PH5A 3SXUB 3B6JA 4P84A 4B40A 1JZSA 4GZLA 1NR5A 4CM4A 4Y18A 3AUXA 3QP9A 3A4NA 3LP6A 3ZQUA 4QPPA 3GCXA 4Z8YA 4O2BF 3PU6A 3WWPA 4YC7A 2J48A 3LBNA 5CXQA 1QHIA 2VZ0A 3UMRA 3W9YA 1PZHA 5AVZA 3EUWA 3T0GA 3UB3A 1CZUA 4GWKA 4WZBA 3K70B 3GFVA 4AM8A 1NX9A 2NPOA 2XZDA 4GYYA 5BMVF 1FX0B 1PSWA 3BE6A 2VTBA 3I2FA 1ZL2A 5AXAA 1ZVQA 4DV3B 2AFIB 1S8FA 2BSXA 3DDHA 3HBMA 5KCMA 3V8RA 1C3EA 3ITDA 4DV6B 4JJ4A 1GQQA 1ETUA 1Q14A 1SHUX 1T8SA 5TE9A 5BWNA 3CZMA 2QL9A 3HDTA 2Q0QA 4E1VA 4ZAZA 2DTXA 3WNDA 4B4VA 1KQFA 1FVOA 1A69A 1XQVA 2KI5A 2PMBA 4XB6B 2OYSA 1YMVA 4OYLA 1JHZA 1ECCA 5TXGA 1JIIA 1YQGA 4C2UA 1WCWA 1GSIA 1GZ7A 4Y2GA 4A0HA 4B7AA 4N3GA 2ZDQA 5K03A 3MTQA 1KFEB 1NI3A 2ATXA 3S1AA 2A58A 2JFBA 5CXXA 4HNUA 4I46A 1R6XA 2E49A 3RS0A 1Z2PX 1RRPA 4KFTA 2C5LA 2CD7A 4O4LA 4EYOA 2XKKA 2CUTA 1QWSA 4TLDA 1CHNA 1UANA 2EWMA 1QK4A 1JSRA 4ZRNA 2V6GA 4F3CA 5BVHB 4D43A 1PJAA 5CD1A 1C7ZA 4U3JB 2Q1WA 4OFWA 4OIFA 5E3JA 5KQPA 1F2TB 3LUFA 5DX8A 1FUKA 2LR0A 3UWPA 1X7ZB 2RGYA 2WILA 2X1VA 3FPAA 5FQOA 3KEFA 1CZKA 2RIPA 3PDJA 3PX2A 3QXHA 3VHLB 4DLRA 3O7MA 4G89A 2C20A 1ISIA 3AFGA 3ZWMA 4WVLA 3WOVA 1CJUC 3DZ8A 1B00A 2WE7A 2WG0A 3LHFA 3Q15C 1RNLA 1WDWB 3C43A 3I2IA 3JATA 4AXBA 1E6UA 1DMSA 2WIGA 1TM3E 4N8EA 5K6TA 4HGPA 4TV9A 2E2WA 4L07A 1S2LA 1SBNE 2NXCA 4LA4A 3H17A 4J7CA 4YRDA 2QZ4A 4K9PA 1SA0A 2VI5A 1E63A 4LHSA 4RM2A 5J40A 1L8QA 2P77A 3JQEA 2Z9DA 1B6TA 2R8EA 4GUDA 3ZXSA 2B6NA 1GVHA 4B79A 4HWGA 4BWGA 5LOVA 3HDQA 2VHQA 1X38A 5KOIA 5IKPA 2I4OA 3INYA 1E9BA 3ZU4A 2L17A 1G5TA 2ONCA 5DK4A 1B14A 4GL4A 1FFYA 1KO1A 1CCWA 2PL3A 1TM1E 2YVUA 4JLWA 4L5CA 1C3OB 4RDHA 3U31A 5ARBA 1CRQA 1G1MA 1A7JA 2JB9A 3IS3A 4NMWA 4Z9AA 5TMBA 2QMZA 3RANA 4RVNA 4RPKA 5KNBD 2UU9B 4KV9A 4TYPA 1GA4A 1MXHA 3M1LA 5DTJA 4AKIA 2G1KA 1QLWA 1W8IA 1D4ZA 1XLUA 2VAMA 3J7TA 1XTBA 1SR8A 3COZA 4X0EA 3VNBA 3DZBA 1E9CA 3ZZ0A 2HDHA 3OP1A 4EY3A 1V9LA 2BPOA 1PDOA 2EHDA 1W85B 4NYMR 3OFKA 3I2YX 1E4EB 3E4CA 1II9A 3A3YA 3EASA 3M4JA 5LUBA 3B12A 2FMTA 2FPGB 2PFSA 4WY8A 4URWR 3FDZB 1G18A 4ZQEA 5EVCA 1S3IA 2BWJA 1CUFA 2DFTA 1U0NA 2VCYA 3AB3A 1WSBA 1Z68A 3OMWA 4WUVA 3OQOA 4LVUA 3R7WB 3G3EA 3ZW7A 5JCJD 4G0YA 4LHWA 4RFSB 4JUBA 2O8EA 1R27A 2R60A 2YJNA 4UQPA 1DC8A 5JJIA 4LISA 3KSBC 1TXGA 2CB0A 2GBGA 2PUHA 3O26A 3PXGA 4PLGA 2XXAA 1X39A 1Y4DE 5BSMA 1NOKA 5HGJA 2GEVA 3F5QA 3K9FC 1JVNA 1ZL0A 3D4PA 3P9CA 4G2TA 3WGVA 2FW7A 2YR0A 3E8SA 1U63A 2CLMB 1FTGA 5FO1A 4E5DA 3WQHA 5H8WA 1E5QA 3G6KA 3N2YA 5CP8A 2YV4A 5CT8A 4AJEA 2ILVA 1Q0SA 2YYAA 1GFZA 2WV9A 3GPBA 4RY8A 3QU2A 4Y6OA 5C18A 4CL2A 2HW8A 3B6MA 3HGQA 2GQ0A 2QUZA 3Q6NA 5HKKA 4AQ7A 4C4ZA 4LJKA 2CZQA 1KDYA 1D2HA 4G5XA 1AHPA 4UBKA 1OWNA 2XAUA 2FN8A 4Z8XA 2EJWA 1TYBE 3M49A 3OAAD 4AC9A 4J7AA 2EOAA 5J2TB 3K0AA 1VB5A 2HU5A 2CGEA 4LJ7A 1V25A 3FBWA 1SFRA 1T8PA 2JIOA 1N2ZA 4QUJA 1ZYUA 4Z6KA 2O57A 3JD1A 1GQRA 4INOA 3RSOA 4UBLA 5M7EA 2FSIA 3CX3A 1YUNA 4G4GA 4US2R 4Z1MA 1NKSA 3K30A 3HWSA 4MJLA 4D6YA 3VVBA 4PHCA 3T8YA 3UUFA 4DCMA 2QRGA 4R54A 1YT5A 1SEVA 3HTXA 1UKZA 1YZ3A 3O47A 1XV5A 5ICCA 2X0FA 1ZXXA 2V7XA 2FKAA 3O1HB 2C59A 3GMSA 4UPDA 1UBKS 2Y0PA 2CNBA 3GI1A 3NHMA 1Y3BE 3A6EA 4RJIA 5DLPA 4ANFA 3RADC 1ZRSA 3D6JA 3PFWO 4R84A 1KOJA 3JALA 4GOMD 3U4QB 3GFGA 4TXNA 1X1EA 3UATA 4D9HA 4DV4B 2NYUA 3JQFA 4L51A 3EZ7A 2EKDA 3NYWA 5HJ2A 2JDID 2XNCA 3ADPA 2H31A 3AF1A 4HFRA 2BKAA 5DW3A 4ARCA 3DAPA 2FEWB 5HTKA 2C7RA 1NX6A 2QTNA 2XXJA 3EDQA 3FZGA 4GOXA 4MRMB 4TRRA 3P9RA 4N54A 3ZGXA 4YUVA 4PANA 4Q1CA 1J23A 1J99A 1OU4A 1M6VA 4XWGA 3ZWAA 4FD3A 4FTWA 4DJDC 1B15A 1OXSC 4JYAB 1RT9A 2OGZA 1D8AA 2OAQ1 3W05A 5ITZA 3SICE 1RWWA 1VYTA 4A0RA 1FP1D 1MNAA 4HQLA 5A04A 1UOQA 2VF8A 4M3NA 4DMMA 4DLBA 2PGNA 4JITA 5JBIA 4YRZA 2NP7A 2XMPA 1GCUA 2PU5A 2V5AA 4FUQA 4K3UA 3RVBA 4C03A 1EU1A 2ZU0C 4O3MA 1E20A 2EIXA 3R6DA 4NPHA 2GI4A 4AX4A 1FS5A 2HKIA 1THGA 4Z9FA 1CF2O 1KIFA 2A0FA 2DBZA 4ND3A 3CXRA 4K9MA 1UFQA 4RPJA 4TZTA 5IWAB 4L8YA 1LQUA 2EBHX 1ISRA 2EYUA 5AHKA 5HMMA 2PMEA 3V2UA 1WE2A 1D03A 2ZTMA 1OQAA 2R6CA 3UJPA 1UXGA 1DUIA 4P32A 3VKWA 4YP5A 1QIDA 3M6IA 3Q3EA 2G70A 5HK8A 3F8SA 1I10A 2YDXA 3JASB 3C97A 1IHXA 1ZIPA 2CHFA 1BW9A 1MAUA 4A36A 4PZAA 4XWKA 4CR8A 4DLTA 1X42A 1XJCA 2Y4OA 3D5EA 3I9JA 4U7FA 2I66A 5HJEA 1TT5B 3ZHCA 1NMZA 4BYMA 1GKIA 4P3OA 5EMKA 5CIWA 1VHLA 3DLAA 5DNVA 1E1DA 4EG8A 3TZEA 3H87A 2HM7A 1H2YA 3GAFA 1OB5A 5DMXA 2HBQA 2CEAA 4TKUB 5KWJA 1E2FA 1FFHA 2Z4RA 5DTQA 4DV1B 4OUDA 3UMBA 2QRZA 3GCWA 4FNAA 3UK7A 2HSZA 1XEXA 4IV5A 5FPYA 5LYJB 4UUPA 5KYUA 2BGKA 3FJYA 1LH0A 4YI5A 4RTJA 1KDOA 3CVWA 2I7DA 4Z7NB 4FMPA 4K1XA 1G2QA 2DWQA 1BOOA 1DP4A 5AFSA 5L4LA 2CT8A 1TYAE 5H4GA 2JCSA 4U0JA 4XX0B 5B1IA 2Q1YA 2QN9A 5BN4B 2R00A 3V8BA 4ND7A 4PXSA 4MUXA 2G09A 1VCNA 3LM8A 4YRQA 4HVAA 2B3TA 3VTAA 4BUCA 4WASA 1ZESA 2IYRA 3VR1A 2QS9A 3CJQA 2DVMA 5CA1A 3WQBA 5BN5A 1ADJA 3FKSD 3TTUA 1OA1A 3AW8A 4E03A 1TC2A 4NFLA 3O8LA 3KQTA 1JHAA 1PWHA 2GD2A 5JV5A 4P58A 1UT6A 3C87A 4DNOA 2MMGA 5B2FA 2B99A 1FTSA 1RI2A 5K45A 1LFAA 4RU1A 2VWPA 2VPYA 3O9VA 3FSGD 3KKPA 3M5PA 1J2UA 4NATA 3UYLA 3GLIA 1YQXA 4IZOA 1FFGA 3U17A 1PJZA 1PNQA 1RBMA 1XZJA 2HEGA 4X61A 3KQWA 3EXEB 2JJQA 5HS4A 4MTLA 4RY9A 1LC0A 1ZIDA 2XKJE 1LV7A 2B5OA 2GN0A 4JUDX 4RVGA 1MBZA 4E51A 2O1WA 3O8RA 2QY9A 4C21A 1RWKA 4KE7A 3HDGA 2Q49A 1P0PA 3RSGA 4O4IA 5DXJA 1IJFA 2ZYWX 3RF6A 4CQMD 5D5PA 2PKEA 1KDRA 2PSEA 1TRHA 4N47A 4CM8A 1DJNA 1XCGB 5EZYB 1RADA 2WAMA 4O4HF 2L18A 3HBLA 5A4IS 2FYTA 2QMHA 3V80A 5F3RA 1ACLA 3VM6A 2NGRA 2R1VB 3FOAA 3FTCA 4HPJB 3CGWA 5HF6A 4M76B 1CY7A 3NRBA 1HNZB 4XB2A 4DQUA 2O9JA 4K9LA 4W1SA 4ESVA 3H04A 2XRZA 1SPXA 3KWJA 5CLIA 3PHGA 4WY2A 4BNUA 3RROA 1VLJA 4OEHA 4PFKA 3RS2A 2ZQZA 5AQEA 1DTWA 2WHRA 4N18A 3U3JA 2H1RA 2VHYA 4URZR 2DJIA 5H68A 3UAWA 2HZBA 3OOHA 1MO6A 3OJFA 1Y3DE 2MYPA 3EF0A 4CG0A 4CYMA 3SE7A 3AVPA 3W7BA 3ZGOA 1PS8A 4XIIA 2C83A 1R6UA 2JH9A 3R8CA 3UGQA 3GWZA 3KPWA 4JJGA 3HL4A 5AUPB 2HA7A 1SVWA 2YXBA 1H69A 4WDRA 1QVVA 3GO4A 1RWXA 5DHTA 2Y27A 3I32A 1KE2A 4MHTA 1DBPA 4E09A 1A2KC 1PGNA 1W4CA 3OT5A 1NN5A 2NUAB 4R9SA 2ZRIA 1CEXA 3HA2A 1IZ9A 1QKIA 1QUEA 2POQX 4OBBA 1ZWKA 4NVRA 1MVNA 1P74A 4S12A 1PR2A 1DFIA 1HE3A 3WIDA 4PLYA 4RHUA 3BK7A 4D8XA 1OFUA 2I76A 3WYAA 1VRWA 5H5JA 3P9IA 3UCXA 1U65A 4E5YA 3DF9A 1K88A 1JX6A 2A1UA 2LKDA 3D4OA 5TPZD 1R8QA 3IJEB 3O3OB 4KMSA 3GUVA 3SQMA 1F4LA 2QN6A 2XBUA 3LRXA 3R40A 3GZJA 4U9IS 4ZWNA 4LCJA 4BFZA 1OWOA 1QG4A 4XIJA 3GJRA 2CHEA 2XWPA 5JJLA 1SB8A 2VDUE 3E27A 5G2OA 4D26A 1KEUA 1N5DA 4GYWA 4LGVA 2BT4A 3HM2A 4OHMA 1EX1A 2ERCA 4Q39A 4G1FA 5FOWA 4PQRA 3SZ3A 2PSSA 4P93A 1TMGE 4TVSA 3MTJA 5JMTA 4B80A 4UOEA 3IJRA 3K9GA 3MWEB 1DRKA 4JB2A 5IASA 3OIGA 4QYXA 7ADHA 3NDRA 3LPDA 5HF9A 3QVUA 3NIBA 2LIVA 5J23A 5DHSA 2EXXA 1F06A 1VMDA 2PSHA 5AKHA 1YFLA 3RS3A 5KAPA 5AW3A 1S3FA 4OQLA 2FTKE 3BWDD 2W2VA 4X6LA 5KQLA 2XGGA 3HM9A 2OCGA 1CEYA 4RCVA 5E1BA 2H3HA 2ODAA 1NSTA 1FFSA 1KL7A 3D8BA 1GY8A 3LUBA 2JGNA 3P9NA 4RD3A 4B9EA 1Q17A 1OZGA 1UPTA 4E5NA 1QTRA 3DL2A 1I3MA 4KYIB 3U49A 1TKAA 2YWFA 2QNBA 2GASA 1EFRA 3K6RA 5JALA 2DH5A 2HWUA 4NZNA 1BEUB 5KSOA 2FMKA 4OKSA 1YWGO 2EQ5A 3KTAB 4IRUB 1ECPA 4WDQA 1ZVVA 2JEZA 1TTQB 3ZWVA 3BL5A 3ZDFA 5EHGA 4GLJA 5IEBA 5KTTA 3PD1A 3E03A 3PA6A 2FWMX 1R00A 2IYOA 2QX7A 1UFKA 3HXPA 1A8SA 1OX4B 4NE7A 5JEEA 1R0ZA 4QT4A 4KWEA 2JRLA 3O95A 4DKJA 1WUJS 4D56A 4OQQA 5E2IA 3BB3A 3DO5A 3TIIA 3H3FA 2QJFA 5EJGA 2BP7B 3QHPA 3IERA 5IUKC 3ZE7A 3GLGE 2IXFA 1I9GA 3HBFA 1U8UA 4V0SA 3SF8A 3T1HB 5GZ1A 1NVVQ 3CFYA 3A6KA 4LY6A 4UPVA 3UZUA 2ZTLA 3ITNA 4BX2A 2PQ0A 3M6XA 3N28A 3LGSA 2A59A 3KFVA 2Y68A 1L5VA 2X23A 4YCBA 1ODTC 2F43A 3H5NA 4Z0TA 3WKAA 1JEQA 3THRA 3JVUA 5CH5A 5ALQA 5DMHA 4P9NA 1OGYA 2Z9CA 4L75A 3LE8A 2YQZA 5FIUA 1DC6A 2ZIVB 1J0DA 4EI7A 1LW7A 3C74A 3ETEA 1FW6A 2NPIA 4BPBA 1YHZA 3WBBA 5B2EA 1FFWA 2H1LA 3MCZA 4MVJF 3HA7A 2LBPA 5GP1A 3I6BA 3K9WA 5CX1B 2PS3A 2HQOA 3LIPA 1YKGA 4BDSA 3NS7A 2EGHA 5T3YA 4CFYA 3HXQA 1J5PA 2BEJA 3A4LA 4HJRA 4DSUA 4LXQA 1VP3A 2OBMA 5AKLA 3ZTWA 4N5DA 3P2JA 1BHSA 5FBVB 3P8ZA 4BNTA 2OESA 4OX9Y 5FJJA 4L5BA 2ROQA 3EXIA 3AONB 3KR9A 4RHEA 4QTYA 4MYTA 4BEJA 5M2QA 1FNNA 3CNQS 3MJRA 5K8CA 2ZYSA 5F64A 4AS1A 1PFUA 3JYPA 4YJGB 5GM1A 3RT7A 1QAMA 4X94A 3U4CA 5THKA 3TRKA 1VE1A 2W2PA 2BDTA 4V3BA 3UWMA 2VDKB 1NFQA 4WK6A 2AFIE 1YZHA 2O0JA 2QAGB 5EERA 1XZDA 3SNHA 1Y5RA 2J07A 3L82B 3R9XB 3S29A 4F85A 1XU7A 4F3TA 4RD2A 3ZBQA 3DP9A 5AW4A 3VZDA 5L7WA 4QUIA 4MKGA 5JD6A 2E6UX 2P2NA 2XB8A 5GGYA 4H1WA 4TYWA 3IPXA 4KWTA 1QR2A 3D8SA 4BFVA 1FVFA 4LK3A 1Q0LA 1QCYA 1RYNA 4D41A 5KUTA 1IXRC 2BI7A 1CUWA 4NJEA 2O8BB 4M1MA 1Z0KA 1QZTA 4KE8A 1KSGA 5F9HA 1AKEA 2OZVA 3EH1A 2XMZA 1AB6A 1F8XA 2N1MA 4L72A 3GGDA 3V8QA 4OLBA 2AE1A 2KBEA 1Y8RA 1KJ9A 4IDFA 1XXHA 3TW8B 1Y48E 2A5LA 1T5DX 2VTKA 2A92A 3PPIA 3QUBA 2P9GA 4TLAA 1L7RA 2GAIA 2YRWA 1TKBA 1YO6A 4BQFA 3M6MD 4DWOA 5K09A 1EUCA 4IOJA 3SJ7A 1JLHA 1P1HA 5EKUA 3JAWA 2V8OA 3GT7A 2EFDB 1US8A 4FOOA 4UDXX 3SQLA 2CF5A 1VHDA 1ZW6A 4OB6A 1PT7A 5HFJA 4BNNA 4CMCA 2OV1A 4H3KB 3DDUA 4QXOA 5KDDA 1EXNA 1QP4A 2BVNA 4BVAA 5REQB 1CFJA 1FRFS 2DWPA 3KVYA 1NQUA 4JI5B 1JALA 3H1FA 4CMEA 4TQAA 1SNYA 1C4WA 1T8WA 4YV2A 4C7OA 1BJTA 5JS7A 1MDFA 1UZNA 3NPAA 4HI0E 1ZU4A 3I1FA 1WQ1R 2QQFA 4DJJA 3ABQB 1OPRA 1KOGA 5BSEA 2G71A 5DDIP 3OQPA 1C30B 4CDNA 4I9HA 4M1TA 3OOEA 4O63O 4AG6A 4O2BB 1BU8A 3DLTA 4BAUA 4B0PA 4ZOCA 1DJPA 2FPWA 1NM5C 4OBEA 3LT5A 5AVOA 4DWVA 4UNSA 4M0MA 3GFTA 3AUUA 3GC6A 4RUKA 4IJVA 3PJDA 4QNMA 2IFTA 3U7QA 2V6JA 3ZWNA 2ZTVA 3BFVA 4YAGA 2ZSHA 2OXEA 5BMVB 1GDTA 2JFGA 2PCJA 3PIIA 4M9SA 2OZKA 4JGIA 4S0ZA 4E5KA 3A58B 1XHFA 3E18A 1VFPA 1JNXX 2QTCA 3S8EA 1QYDA 3L4JA 2Y1KA 5HE8A 3REQA 1U81A 2C5HA 3QMPA 4K86A 3PBKA 1P4JA 4PIPA 4TYQA 1AV7A 1UWKA 4EJ2A 3ZIAD 3ZKWA 5A7GA 3HB9A 2OD2A 2ZB8A 2WIFA 4IZHA 1RBZA 1QRRA 2I2DA 4UJ5A 2XNSA 3VUEA 1K6MA 3OUTA 1XA0A 3LPMA 1NQVA 3JQ7B 4W5HA 2R3SA 2XB9A 4M83A 1E6CA 3Q5EA 3WNVA 4Y2JA 1LTHR 2YJ3A 1Z8HA 5JW6A 4CMJA 3ICWA 2J5BA 4N0MA 3H2ZA 1GU1A 3ZYZA 1RBQA 4IIJF 4YJ2A 1G6Q1 2ZRKA 3MBKA 3DC7A 4BO5A 2LCQA 1GNQA 4HZUB 2HRBA 1EX9A 3ONVA 1JA9A 2D5LA 2XE7A 1RYEA 2I4RA 3B51X 3HEMA 3K5IA 4LI3X 3L0BA 1XJWA 4BJ3A 3U81A 1XMPA 1W5EA 1KEPA 3LQ4A 4HMQA 4TWAA 1MX1A 3B3JA 4YIKA 1KI8A 1SURA 4NMLA 2IHNA 1JTEA 4TOIA 1QCZA 3FYUB 1SVUA 3JQAA 3AHEA 3KJXA 4MITA 1YVDA 5AXDA 4OHYA 4XVQA 4AWBA 2H18A 4ZT4A 4JJKA 1Q0HA 2MINB 3C6QA 2XUZA 1P8JA 1UC9A 1COWA 1T1IA 3GDGA 4ID3A 4LV6A 3WE7A 3IXLA 2VAVA 4MVJH 3L77A 4H35A 4GPAA 2CKDA 3HPRA 4MLPA 1PR6A 1MU0A 3DOIA 4TWIA 2WWYA 1S5PA 3QF4B 3UHPA 3T15A 3TTWA 4D42A 1JRLA 2ISCA 5BPFA 2ZWIA 1N5IA 2A4KA 4K46A 4F84A 1LRLA 4IQ8A 1SG0A 1KDZA 4PONA 5IG2A 1LSJA 1Y5MA 3Q7RA 4OI1A 5EFZA 3P0RA 5F7JA 5GV8A 4AO8A 4I9FA 5ALTA 1DAKA 4FE4A 3VBEA 4C0KA 1D1TA 4FDMA 1FE8A 2P75A 2QXYA 3E9EA 3OICA 3GEDA 3JYOA 3Q7PA 4Y6GB 3F6CA 5JSYA 1KH3A 2QSUA 3DOOA 3A3OA 1IWOA 2AC7A 3BKXA 3EF1A 4WQMA 5H3LA 4KO3S 4JXXA 4DM7A 3FWYA 3STXA 4OL0A 3GF4A 1T9GS 1SUWA 1EUYA 2F3SA 2XEXA 1QO9A 2XYQA 1RE1A 3M5WA 4A5SA 2QA5A 4MWGA 1ILWA 4L0QA 3B2QA 2XUDA 5DX1A 2ZJ1A 1DX4A 3EIWA 3JQDA 1E62A 4HGYA 2CK3D 3OZ7A 3HXOA 2I8CA 3VDQA 1QCDA 4TN5A 3K70D 4R8KA 4L5IA 1UQUA 2O3TA 2ZS7A 1SHTX 3BBLA 2R8YA 5JBQA 2RJ3A 1SVSA 2WSLA 3O3CA 3M4ZA 4GLLA 3OLZA 5IVIA 2WSSD 4I3HA 3KR0A 1PTJA 1ZD1A 4F2PA 3W2FA 2EW8A 3BYZA 3SLKA 4HDKB 2CNWD 4JBXA 4UEWA 3L4BC 3WXMA 5KNDD 3RYCA 3FZYA 4YTEA 4ZYTA 3LFUA 1UEXC 2FHPA 1GPJA 1R16A 4LNHA 1YQTA 2PV0A 3K8QA 2KX7A 3ZWYA 2VOEA 2P9YA 1QC5A 4IRXA 1A4XA 1ADCA 1RYBA 3PRKE 5JXIA 5BV1A 5TR9A 4EVIA 1NZDA 1VHJA 1O08A 1J0XO 4YMUA 4MKXA 1RAGA 4IWXA 1VL1A 3CY6A 4HS4A 4PCVA 2IDJA 2ZUBA 4HWKA 3TQOA 1MVOA 1GL7A 5K3DA 4M1EA 1UMBB 2FLKA 3WHKA 3WLJA 1GD1O 4HK4A 4EL0A 3ND9A 5AW7A 1MG0A 5CD9A 4RK4A 1QTNA 2O7SA 3VDNB 4BVFA 1TQ6A 1PT8A 2QRVA 4HX2A 4CRWB 3I62A 1Z74A 5I7HA 2AI2A 4EO9A 1Y1LA 5LBTA 3KIPA 1O95A 1PJBA 1ZGCA 4OMUA 4RHTA 4R1LA 4RQAA 4CL8A 2V0GA 4Q7QA 4Y0VA 5EXXA 4JI7B 5G1PA 4BZWA 1U80A 5D3ZA 4JI1B 2NU8A 2BMWA 4GIBA 2X0JA 2IYEA 2JFHA 3FFWA 2XVMA 2VRCD 4AWAA 3VR3D 5CAEA 4G5SA 5CEJA 2BFNA 3TQTA 4NENA 5ALFA 1NBEA 3NBAA 4KO2S 1YCGA 2RE8A 4ATNA 4G6ZA 4I1OA 2OYCA 2NPFA 3K35A 5A4FS 4IVNA 2CBZA 3NTQA 2F4VB 1AU9A 4MAFA 1RPTA 3VNQA 3GAMA 4OXRA 5CLHA 2JIQA 4BMNA 4F1KA 2X77A 3RRZA 5KCZA 1XQ9A 4ROSA 4A6PA 2NSLA 2YRXA 4AZ0B 5HIKA 1EP2B 4Z9XA 3NRCA 5BW8A 1NBWB 5JBNA 3CCBA 3C3BA 4HLDA 4DEVA 2C84A 4I6JA 1VKRA 3M6VA 4MW7A 2I2XB 1W59A 2EERA 5KOJB 2G0NA 2YHAA 3R7BA 4C4TA 3K6JA 4ITUA 3ZDRA 4BB9A 1FDUA 3NUGA 1D1QA 4P4SB 1TA9A 4PBTA 4ZJPA 4D46A 3LKBA 2Q3EA 1XMSA 2JFQA 1U2ZA 1UIRA 4ZOQI 4TV8A 2DHEA 3CUTA 1W1UA 4PG6A 4CQNA 2X2PA 4NHEA 3GUYA 1BOFA 2WB4A 2XVXA 3MJSA 1PP4A 3FOFC 4LQLA 5JY6A 1KBOA 2WUVA 3MMSA 2FE4A 3JWGA 1E1CA 1JXOA 1ZOOA 2DHQA 4R0VA 4Y1FA 2XCUA 1P2VA 4RSRA 4QXRA 5AJVB 3RJMA 4M4SA 2GM5A 3IKVA 1QQ7A 1NXVA 3OLYA 4F2DA 2VJCA 3HJAA 3GG2A 1R5JA 4WKBA 1X1RA 4GP9A 3VSCA 2B35A 3OQIB 2DU8A 3K0CA 4PX3A 3M2PA 1CRLA 3NVDA 5J63A 1GCGA 2BHNA 1BDJA 1W87A 3TSAA 1TMKA 3PRYA 4Q3KA 4RCZA 3HN7A 5HFNA 1G8SA 3CMMA 1ZLYA 1AXRA 1GG2A 4YASA 1P77A 4A03A 1HLPA 1X9GA 4RKWA 2C4HA 3NKLA 4KQ9A 3RVMA 4RQTA 3WFJA 1UOOA 1G21A 1Q11A 1JYSA 3CJTA 4FNOA 2BISA 2PCLA 1DS6A 3VI4B 5AVYA 3TGWA 3G0BA 4DW8A 3MLEA 3WTBA 1Z37A 4XR4A 2C82A 4NBUA 2FR1A 3M81A 1Q3TA 3HXTA 4X66B 2BFMA 2PX3A 3DDSA 1YR6A 1G2OA 3ZN2A 4E2ZA 1JFFA 4EG7A 3QUQA 4NL4H 1AJEA 1G7CA 1KPGA 2ZQ5A 3DW1X 1XDWA 4R68A 3W06A 1QDLB 1E2NA 4O4LF 1TYEB 4INPA 1P33A 2BMAA 2VH5R 4XXHA 5CR9A 3GHHA 5H16A 1Q7EA 1PR1A 1SUDA 1ZI6A 3FM9A 3ZGNA 3QW2A 5FKJA 2YZ2A 4C7VA 2IIBA 1XZCA 1NXTA 2VHEA 5D3KA 3TMYA 3HY6A 3Q7SA 3VU8A 1T2AA 1E2EA 1FDRA 2BHLA 3BRSA 2C1XA 3W6UA 4EGQA 4FYYA 5FL7D 3GEGA 1W0KA 3KPYA 4AY2A 4TV9F 1SUAA 1I6KA 1A27A 4HNAB 4HSGA 4LXUA 4BNIA 4Z3KA 2JD2A 3H6GA 4DXDA 4R2WA 5F7OA 3FNHA 4UUMA 2YXNA 2H4WA 5LOVF 1Z6YA 1QS0A 2VQSA 2AOXA 2E4XA 1VM6A 3IOCA 3NDBB 3PQCA 2NTEA 4NU8X 1Q95A 1NMSA 2VP3A 4LGMA 4Z0HO 1FBNA 1N0IA 3WWCA 4UPEA 4MQ6A 4K28A 2OQ2A 1DI0A 4QWMA 2BM9A 3A3PA 1N4DA 4W7SA 2OFXA 3K8ZA 3F4BA 1O9BA 5IF9A 1RTTA 2PBZA 3L8GA 2BI4A 5ES3A 5CDHA 2OILA 1TJ4A 1BS9A 1SOAA 3H65A 1THTA 3DM9B 4KFCA 1EM8B 1WZ2A 3F8TA 3WL3A 1WJGA 2QTHA 3IAS1 4C6TB 3HJHA 3DZIA 1IBKB 1N9GA 1NMYA 1QH0A 2O2SA 4LOHA 1U3CA 3HUTA 1VKOA 3F1LA 3RC3A 1KK3A 4NDNE 3S4YA 3K70C 1RS0A 1G8KA 3T1YB 4UTNA 4B5LA 4RANA 1M83A 1NBAA 2VSNA 1N7IA 2A1TR 3WLSA 4Q15A 3F98A 3VYSB 2QTFA 1GAWA 2ZE5A 4MMXB 3KLBA 1GRRA 5F7ZA 1P3Y1 3OF2A 5D6NA 4E11A 2VTVA 1KU6A 4JLBA 4URHA 5H0IA 4GRAA 2UYYA 2NT4A 1H6CA 4E2YA 4D3YA 2GM9A 1JDSA 4HAVA 1UM9A 5ESXA 2DECA 2Z1MA 3KUCA 4XVHA 1B76A 3BRCA 1E1NA 3D1LA 5BURA 4BL5A 3AOEA 5TY0A 4GS5A 4KG7A 3SSAA 2EZ9A 3RRBA 3FIJA 3NV9A 3A2LA 5CB4B 2PGLA 2ODWA 3U4IA 5KB3A 3E1KA 3M0EA 2DHRA 2DTDA 4I9GA 4UM9D 1BHJA 2GPNA 2W0SA 1UOPA 4EZBA 4BO4A 2VSOA 2OGTA 4KMRA 1ZUWA 4CMHA 1D04A 2A8YA 1L5OA 3AO0B 3KZMA 1JHYA 3H4IA 4RKYA 1AUXA 3PDIB 2RK4A 4EKYA 1G8YA 4GQIA 3ZX5A 1SQSA 3KP1A 5GTDA 3FOZA 4HYQA 2PDAA 5F2EA 4J91A 1LFDB 3CX6A 3PHLA 4OJNA 4BWVA 3JARB 3ZWDA 4CU5A 2X0EA 1KZHA 1CG6A 1WP9A 3AVVA 1ZGAA 2B9VA 1FSFA 2GXUA 3PFFA 3O4IA 1SIBE 3OLQA 4AB1A 3C98A 4B6OA 1L8AA 1EK5A 1EVZA 2VWGA 2D0OB 3F78A 3FRJA 1M2OB 3O73A 1DRJA 3NT5A 2F4NA 4NBLA 4QUDA 2YBDA 5BUCA 4OV6B 4X62B 4EI2A 1N2HA 1ZUNA 3BFPA 3KE9A 4ND6A 1IY0A 3HB5X 3MGGA 4FJ0A 4QPJC 1GZ3A 4UARA 1E2MA 3TD9A 3WGJA 4J9UE 2H16A 2RONA 3D02A 5CTJA 5DB4A 4JJFA 3RBZA 1L5ZA 2GAJA 3CVXA 3FB4A 3GK3A 1BA2A 3H1TA 1HZJA 3HE3A 4QARA 5DOVA 2JGDA 3G0HA 1JR3A 4YRAA 5IF3A 4BX9A 4QFCA 4E6PA 3OIWA 4UMDA 3THSA 1UK8A 4GZ3A 2I2BA 4BJHB 1HFKA 2ATEA 4QX6A 3D7KA 3LPCA 1MC1A 2O3QA 3HCCA 3S2SA 6CHYA 4TMYA 3GVPA 4BWFB 3OETA 4BCDA 3CCCA 2G36A 1IM8A 3YASA 1MB3A 1OLUA 1YZNA 1GNVA 4B3HA 1GPAA 1L8OA 3CMCO 4DZRA 1QGED 4H18A 5GZ3A 3K9NA 3GEHA 3UBMA 1C3VA 1E1LA 3P5SA 3V7FA 2XECA 3F5DA 1RHJA 4IG9A 1I30A 3DAGA 3B5JA 2VQDA 5G1OA 4MGZR 4ALLA 2XF2A 4IM7A 3WGIA 2L42A 2O8FB 1U8TA 1SU6A 3GLFA 2QRJA 4DBVO 1Q5PA 4I8IA 4HEJA 2W2LA 4DT1A 4DREA 3NM4A 4LXHA 3ZQ4A 2XUQA 2R1TB 3I9LA 4X41A 4E08A 1GG5A 4JBGA 5K0ZA 2VR1A 1K8QA 1KRHA 4QODA 1ECJA 1O5TA 3ZZUA 4TTSA 3TQRA 4CEIB 3SOPA 3T5PA 5DH9A 4P34A 1KIAA 3GXOA 4HTFB 1E2GA 1TQ4A 3EG9B 3I8OA 3JYQA 2Q62A 4HR7A 4LYEA 3GN2A 4MQEB 4TMTA 5ALPA 2JANA 5B6PA 1K7FB 2FK8A 1Z47A 4MARA 2KHZA 2TS1A 1F9EA 1IEWA 1KO7A 3FHOA 1DQZA 4GLFA 4JMLA 4P3PA 5ER9A 5LPNA 4A1OA 2I6GA 1IJKA 4Y3UA 3CSDA 5BR8B 1XG5A 2BFFB 1W36B 1N0UA 2CDBA 4RVSA 3V1MA 2WPDA 4DUGD 1GFIA 2OCDA 2ODBA 2VF4X 3DZHA 3EVAA 1L1EA 2Q07A 3CEPB 3GEMA 5G40A 1CUZA 3W78A 1DBQA 3D3NA 2O7QA 2NV2B 3DAOA 4MV1A 3RVQA 4MCAA 4J03A 4JOQA 2H4ZA 1DSSG 1BZYA 5MGBA 4UBIA 4WBNF 5DLYA 5FF9A 2WQ6A 3AW9A 4X1KA 4EH1A 4YP0A 1YONA 4HAZA 4N82A 4R83A 4R1MA 3F3MA 3BWYA 5FUYA 3R9IA 4HMOA 4KO1S 5K0BA 1E7QA 3CUSA 5TARA 2B94A 3OLVA 1E9VA 3Q5GA 3U9TA 1GFWA 2VP2A 3VTKA 1P8AA 2P1DA 2WZBA 1NT4A 2L2QA 2XGOA 1M8JA 2ZWPA 1WOYA 3LAWA 3KSAC 4CCSA 4DCUA 3EQZA 2E6KA 3KZ1E 3JD4A 2UUAB 3FYCA 4YBRA 4TS3A 1XEFA 4QFDA 3DBRA 2QROA 3B6KA 3KEMA 4L5JA 3C6XA 4L16A 2IQIA 4K9NA 3I30X 2KSQA 1NW4A 4IUCS 4WTOA 4FWTA 4ME6A 5F9FA 2AQHA 1KZ9A 1OGIA 2WJWA 2IDMA 1MB9A 1MA3A 4KAFA 2ZIUB 3OD1A 4IYRA 4JC5A 1VIYA 5CA1F 1Z63A 3IOBA 1KGSA 2J9FA 3G89A 3PHIA 5EWJB 1DIGA 4H3SA 3RGWS 3HJFA 2ZG6A 4BP8A 2R6GA 4KLNA 3QQ5A 3ZY2A 4AMYA 1Q2XA 4BQPA 3JAKA 2MU1A 4BRWA 1E9RA 1UC5B 3BWXA 3CTMA 2AHRA 3I2JA 3PRHA 1EINA 4G36A 4NCAA 5DNEA 5F3DA 3TBHA 1E2JA 3RVRA 1SELA 1DAHA 4WN9A 2PL9A 3STWA 4DIEA 4XSHA 5BNIA 2RGBA 3F9IA 4NSNA 4F60A 3BMCB 4IAOA 3KQSA 1DEKA 1CUHA 3JCZA 2IY9A 5D7BA 5AM4A 5SYNA 3TW4A 4BFSA 3RC9A 2JLZA 1K3TA 1M2VB 3ENZA 2JA2A 4D3ZA 6YASA 1BCSA 1DBWA 3FYSA 3ND8A 4JQSA 3UB4A 4DJFC 3AL3A 1YR1A 3BJRA 1CNFA 1QUFA 2QJOA 4OX9B 4PW0A 1D4AA 3Q8WA 4JV5B 4LFBB 4JYZA 1R6VA 1HYEA 3NEJA 2GTPA 1PE0A 2VYND 3ODGA 1J00A 2ZB3A 4WOBA 9LDBA 3THOA 2QV7A 4LRQA 1ISPA 4IJUA 4J3FA 3D6UA 4WN3A 4DDUA 2G40A 1LK0A 1NW5A 3DOFA 4UTPA 3RT9A 2QQ0A 1L4LA 5IK2A 4F4UA 1WXIA 2XKAA 1CJBA 4R6XA 4YO8A 5F1KA 4LC1A 1J9ZA 1F8FA 2AJDA 3A9TA 4P7JA 2CV0A 1SU4A 2YICA 2ZBUA 4RZXA 5LXTA 1Q3KA 4J76A 4TM7A 2UZIR 5FOQA 2FHSA 4HBGA 2DAPA 3CIFA 1HG0A 3R4CA 3UWDA 2ZRJA 1XKLA 3GX1A 3UCEA 2BSQA 2D5AA 1CUEA 3WIOA 1FFDA 3TPCA 4DLUA 4V2IA 5CITA 1GITA 1EBUA 3EQ6A 1II0A 1O54A 1XVIA 2BGLA 2VNKA 4ITRC 4QFBA 2HX1A 5TQ2A 3P94A 2J87A 3CNLA 3FDJA 1J97A 1F6DA 5EKSA 4HWSA 1HE4A 4F71A 2EKPA 4EA7A 1SVLA 2A0XA 2V96A 2DULA 1ISFA 3AJDA 4HQFA 1N77A 1MIHA 3KSRA 2VRBA 1ABBA 2AXQA 1P1IA 2G6TA 4JNCA 1GCOA 3W0LB 2VSQA 1SZDA 3K31A 1Y1KE 5HIIA 4IDGA 1IY9A 3D59A 1Q74A 2HTFA 4NESA 4WIAA 4QTUB 3G0DA 1IULA 2F17A 3R5HA 2RHDA 4PGFA 4DMFA 5JQGA 3B1JA 4ZXPA 4IOKA 1V8FA 1CP2A 1Z38A 3ES9A 3EQ7A 4EA9A 5DM4A 1PG0A 2HIMA 4IL5A 1ADYA 3K0HA 3OFND 3EPLA 1DFGA 3L7YA 1C1XA 3QKSB 4PGAA 4L8VA 4KFUA 3LV8A 2JD0A 2PS9A 4MRRA 1YJAA 2WSYB 4BFUA 3NQ41 5G41A 3EY4A 1OH8A 2V7BA 1G8PA 1L4KA 1M7HA 3AERA 3Q7TA 4L57A 2FG6C 4Q9NA 1F0YA 4LYFA 3TLEA 3TLJA 3H9UA 3EIHA 3D9QX 5FNVB 1G5IA 3VO2A 1DPGA 3ZK8A 3CF2A 1T8TA 1NNUA 3W4IA 3EXG1 2BSAA 2VYFA 1MA0A 4D1YA 3LFHA 1QQAA 2I6UA 1VECA 2V7QA 1O96B 1TJPB 1Y8QA 4I99A 4UUAA 3H13A 2EG9A 2OZLB 3GXBA 5FLEX 4EYKA 1N2SA 1RQRA 3A4TA 4JJAA 4XLZA 2NTJA 1W4ZA 4KVFA 4EQ6B 1DRUA 1NU8A 4LYGA 4ZYYA 2QMUA 1ZD2P 2E18A 4X1YA 2IHTA 1CQPA 3RT1A 4BQNA 5IKMA 4UAUA 5GONB 3SS7X 3EFOA 5KTNA 3QG5A 4ZCPA 4AJ2A 4CM3A 4DMKA 5KPDA 1VDZA 4ENPA 2VUTA 4GU5A 3VO8A 4NCJA 1DJQA 3B52X 2IH5A 2AVNA 4HV4A 1KPHA 1DDIA 4Q1BA 1ICEA 3AUKA 5A6SB 2CL7X 1J42A 2FPMA 5FTMA 4A8TA 3CUWA 3HSKA 3CUKA 1P5ZB 3HSSA 1CUGA 1UJ4A 3BMNB 3R77A 5KYVA 2HWXA 2XE6A 4JLSA 4MOWA 2Z98A 5C7IO 2PZEA 1BDBA 4RA9A 2JH3A 3W90A 3OQMA 2NSYA 2JCVA 2V4ZA 3Q40A 4K9DA 5K3AA 3LC1O 3E53A 2ARKA 4LWOA 4X54A 1NFFA 2CL0X 5EPOA 2QTTA 1JR6A 3CN7A 2WUGA 2BZ1A 4P82A 4AQDA 4CDRA 5K4AA 1EA5A 2NNLD 3GZNB 4LFAB 2ZR8A 3DVLA 3BWMA 4KGZA 1ZJ5A 3PQ4A 5T4FA 4JSTA 3L1VA 2DH6A 2BH2A 3MCUA 5EQFA 3UJCA 3R4VA 3ZHYA 4ABTA 1SRRA 1Z4MA 1E3WA 3CRMA 4FLEA 4RTRA 4XOUA 2FU5C 3IE1A 4EPRA 1XR3A 4F21A 2M98A 3L93A 3DV2A 4FM9A 4L4SA 5C1DA 4JASB 3FAKA 1PL0A 3VR2D 2Y0DA 4KSYA 1PEAA 2GKGA 3UHFA 1NJ8A 4N7MA 1EWYA 3NV7A 2Q3HA 1QXSA 1J0EA 1XAJA 3G8AA 4K9SA 1QO7A 1DKRA 4UU1A 1Z8DA 2C9YA 5JR3A 2QZSA 2HPHA 2G6BA 3PXXA 1BFUA 1RZVA 3DO6A 1NWCA 5ALUA 5H81A 2OXTA 3L0YA 4BB0A 1JAYA 3CO5A 1X9IA 3PHCA 3L7IA 1EMDA 3QYJA 4JLAA 5EMLA 3PCRB 4Y0AA 4GWGA 2ZRLA 5BO5A 2POCA 1QFSA 2VPIA 4XJVA 1FTYA 3KSUA 2IX9A 1UFVA 5CCDA 4G0VA 3FAZA 5FV7A 3BIXA 3BZWA 3SX0A 4KBGA 2EFJA 1CDOA 2A88A 2ZPTX 1BS2A 2QX9A 1ZUIA 3GRZA 3LKZA 1EE2A 1QSGA 1KAHA 2DUNA 2GRJA 4ZT7A 2IYAA 1IQRA 2ZVPX 3A1FA 4C29A 5KNBA 2M6SA 3U61B 5JSKA 5SY6A 2OD9A 3WLNA 3DE3X 2C2OA 3NM5A 1O8BA 3JQPA 1AS3A 3OM1A 4MWTA 3UWOA 1QLJA 1BKSB 1O58A 4MUGA 3WBFA 4FDVA 3SSOA 1AGXA 3KJHA 4OKNA 2OK7A 4DCJA 4YIHA 5JAPA 1FCJA 2X40A 3SZUA 3ZU5A 3RWOA 4NEGA 4Y2TA 4KVGA 1GPDG 3LKDA 4O2LA 1JG7A 5C80A 4DMLA 4WCFA 4QPDA 2JCXA 3O93A 4IGEA 5EXPA 4NICA 4CEJA 2NMVA 4QSHA 5KTYA 5LL6P 3AEKB 1EJ6A 1JQBA 1W94A 1JN0A 1MAHA 1QBGA 2OHXA 3BK1A 3QE0A 1C7IA 4FWBA 1R7RA 4YR7A 3PEFA 3IQXA 4KSBA 1NW3A 5LIRA 3ZVKA 3MW8A 4LBWA 4MPDA 4BMSA 3UK0A 2HCFA 1PL7A 1D3AA 5AP9A 2VHXA 5BSUA 5KWVA 2A5YB 2CN1A 2P78A 3R0VA 1G8MA 1QZ3A 3PFNA 4KWHA 4LDNA 2RH9B 3L7OA 8AT1A 1JH8A 4UQOA 5C9ZA 4L02A 4Z4FA 4YAKA 1S1CA 4ZOBA 1Y4SA 3DWGA 4MZDA 2Y9MB 1KYVA 4OMFG 3VGJA 4DDTA 5LSAA 1OZHA 4MW4A 2WMOB 3PTAA 4Y9TA 5C32A 3IP6A 3A4MA 3MJCA 5KJEA 1BSVA 4FCTA 4R1UA 1U7UA 2WTMA 3QRWA 3UK2A 3ZD7A 3CRQA 4FYVA 3H5IA 4FNMA 1WEHA 2GF2A 3X3HA 2IZ6A 1SXHA 2R87A 1JQJC 3ZV5A 4BLVA 2QRHA 4F72A 3EWSA 3D4LA 4U7DA 4I1SA 4UBMA 4ZO9A 4I4CA 4EMBA 1U6JA 4Z0NA 4FGLA 5A3QA 3SIPA 2ID8A 4AYXA 2JLBA 1VXRA 4KIJA 3WB0A 3KLPX 2ZSIA 3ZJ4A 1H2WA 3ONNA 2YY5A 3VOTA 4AY3A 2PUDA 3EVEA 4MGHA 1TUEA 1DV2A 3GDWA 4Q3NA 3WHPA 4BMPB 5AVXA 5L3SA 1WU7A 4XKJA 4S1OA 5ALKA 2IWHA 2RD2A 3ZWQA 3LUKA 4FFLA 1X2BA 1OUMA 1EJBA 1QFJA 4DLNA 4O8ZA 5CYPA 1QHGA 3C5HA 5KPJA 2JDIA 2WOJA 2PUJA 4XOIA 4BNYA 1A71A 2FF7A 2HQBA 3BHMA 1EX6A 5ESRA 4J0FA 3LY8A 2IF2A 3B8EA 3CE9A 2G9ZA 1Q15A 2G80A 1LBSA 2Z5FA 4M6WB 1TAUA 1Y6ZA 2AHOA 2A4MA 1BXZA 4G2NA 3PDCA 5L7TA 4FB4A 1VKZA 1AK2A 2NXWA 3MT0A 2WIAA 3PJEA 5HCNA 4J3NA 3D64A 3CPJB 3H9QA 3ROMA 1RLJA 1BQ3A 2AZDA 2YVAA 4M2LA 3TSZA 1GKYA 3QKRA 3IB6A 2PYZA 5DWQA 2R62A 5JROA 3C15C 3IULA 3JQRA 1P7VA 3BJMA 3ZJVA 2QY6A 1IN6A 1Y3CE 5BNFA 3ENQA 3KETA 2ZXFA 4XM2A 2PA3A 3EY9A 2NU9A 3FB1A 3PUJA 1GZ6A 1RRGA 1IRXA 2JFUA 2QAGC 5EIAA 3ZUGA 5IC4A 4YJ2F 1VA4A 4GPIB 1H05A 3SQNA 1ZA2A 1FFCA 2ZT7A 4EYQA 1WNFA 4A91A 2XT0A 4S1VA 2BHTA 2JC3A 4LZPA 2WKPA 3FF1A 1GPWB 2UUBB 1XTTA 1XQ6A 2HMSA 3BMOA 3ESZA 4CDMA 1CQJA 1R88A 3MHTA 4CN9A 1E4OA 3PD7A 3A27A 1DT3A 4JLDA 4RGVA 2JJ8A 2Y1FA 5JIBA 4M54A 1L7MA 2Q5JA 2CB9A 2ZETA 3CA8A 3IVXA 1ZM2A 3T52A 3B3AA 4NXMB 3FBGA 3G5AA 3A10A 3CLRC 3QPBA 4BQRA 2WF8A 1MN6A 3A9RA 3ZCPA 3MJDA 1TF5A 1QGZA 3N8KA 2GVZC 2VZ9A 4K88A 5K8JB 3L7BA 4X1IA 3ABZA 1RW4A 1OXBB 3FOWA 3H16A 4PU0A 3EW9A 4UMFA 1H2EA 4YJ3A 3HXLA 3N07A 5T57A 1FIUA 3H2JA 4UTVA 3IBTA 1A5SB 4B43A 4HVTA 4GZ5A 4LVNA 3U9SA 4PQEA 5CIYA 1P5JA 5ADWA 4NU5A 3UF0A 1IN4A 2I55A 2EWWA 4FI3F 5LZ5A 3FHCB 5JAMA 5HCUA 1BFDA 1S01A 4XDZA 1P9LA 4TTAA 5K0FA 1JA1A 1FUYB 1UBGA 2GYWA 2AEEA 3H5VA 4H4CA 5B30A 1ADBA 4R1PA 5A0VA 1T2CA 2QJTA 2QTVA 1VI5A 1R9MA 3UGJA 1Z7WA 4BHTA 3NJ8A 3WMFA 4NV1A 1GRNA 1IXYA 1LQTA 2Q5OA 1VE7A 5TMDA 1DC4A 2M9MA 3BE4A 2VNAA 5JS6A 1XO1A 3FKSA 1GZHB 1A77A 1KYXA 3B85A 3CH6A 4KGDA 4PYMA 5K5EA 2IHYA 4YXFA 1ZCBA 3DDOA 2DFLA 3A6PC 1G9SA 1MPXA 3PC8C 5K51A 5JEDA 1FZQA 2OA0A 1KZ4A 1MOSA 1U28C 1ULTA 1C3JA 2IEGA 3B1VA 3CLHA 3FSGA 4HGQA 1VKJA 3P26A 2IY8A 1AGPA 1GV1A 4KRGA 4EHAA 3LXXA 2XUIA 2HHAA 2VAPA 3RS5A 3RHTA 3AI1A 3FVVA 4X92A 5CJJA 3C3XA 2KMLA 1YJXA 4HJXA 1BHO1 4MVJG 5DJ5A 4BKOA 3ANYB 2R97A 1BXKA 2FSHA 5C8YA 3QZUA 2P7IA 4GGMX 2PA0A 1U9YA 4QYIA 4U7PB 1MMFB 3UIEA 1ZJWA 4YDSA 2Z04A 4LRXA 3H75A 2AD1A 1O0BA 2QPTA 3EK2A 3T3MB 1RABA 1WCIB 5G4KA 4LHYA 1WW8A 2BRUA 2OCBA 2VPQA 3HCBA 4RIEA 5DHPA 5KU7A 4E70A 2RGWA 1PI3A 2WLTA 2GNPA 3OJ0A 2G5TA 4AZWA 3SKYA 2LCFA 1T25A 1E1RA 3EVZA 1AHIA 1I5EA 1SCUA 3FYUC 4JI0B 2MTBA 5AJYA 1T26A 3H11A 1U5BB 1UBMS 4EHNA 2VXOA 4W6QA 3KKKA 4OH1A 5A03A 1EKXA 3MVEA 3UWSA 1X8KA 2P2LA 4NZMA 2ZSAA 3ZWOA 4CMBA 4MVYA 2H9YA 2QENA 2BF4A 2R68A 1D2RA 2X8WA 4YAWA 4JB3A 1UDRA 2VBGA 5JZBA 3BTUA 5ICMA 1ULZA 5CUQA 4IZIA 4W5NA 2O8CB 4UHDA 4X24A 4AY4A 3W79A 3X2SA 4OI4A 1PIWA 4LNUB 1RJFA 1XD2A 1Z29A 1NPTO 3EFBA 3MD9A 3T3EA 3DL0A 3KXPA 4DIKA 2N0SA 3HADA 4M8LA 4R98A 5L9AA 3IXMA 3OWHA 4P08A 2PUWA 4KIUA 1I7PA 1HWYA 1TK3A 2WTNA 1SOWA 3RPEA 4FT4A 4FT2A 3ZCTA 3HKEB 4EJSB 3AR3A 1NM5A 3I12A 1J09A 1G20E 1U0OC 2GPYA 4IQFA 5AVWA 3OZWA 2EG5A 2NU7B 2G3YA 5FWXB 1Q22A 1WWKA 2B0JA 3DTNA 4HH0A 1HRDA 2O3RA 4TWJA 1HI9A 3H9EO 1YAHA 5TMEA 2VT6A 2PGIA 3N0XA 1JI0A 1JSLA 3EZXA 1H9BA 4MV8A 1SUCA 5TPZA 2Y05A 3N7TA 1RAIA 4KN9S 3R7NA 5AUOB 4KR7A 4POAA 1ND5A 1NFRA 1OFTA 3EGDB 3HKDA 5KJCA 4QLAA 2J0QA 1YU9A 4U5QA 2PUTA 3GDFA 4EKGA 5F23A 1B4DA 1TLTA 2DP4E 1H3FA 2XE4A 4IEFB 3RTDA 3TR5A 5E6RA 1K66A 5AKGA 5CA0B 1EM6A 1NP7A 2J09A 4TV8F 1UPXA 3HN6A 2A35A 4RLHA 5AI6A 3REOA 4KX5A 1Q0PA 4XZ3A 5LZ2A 4FC7A 1M8KA 1P81A 3GRVA 5AHWA 2IYLD 4ZJZA 3U9LA 3RD5A 3T12A 3VTZA 3NLLA 4W9RA 5CHYA 4QDKA 3T9FA 7MHTA 3D3EA 4HEA6 2AUNA 4XFDA 5CB0A 1HGXA 3HR7A 1AQLA 1CWUA 1P4GA 4TWZA 2YFQA 1KXJA 3TNLA 3AF2A 4Q24A 4V0MA 1OXTA 4QAQA 3HVHA 3O91A 3DF7A 5ULLA 4KI7A 3V7UA 3D6NB 3ACDA 1ML4A 1T8UA 3OEWA 1ZIXA 2PANA 4OJMX 3V4SA 4D4HA 1KO5A 2D7DA 1YRBA 2AL7A 2RAVA 4X8OA 5IXJA 5JZ9A 1A04A 2QTBA 4ZQIA 1XVTA 1JQAA 1O5IA 1UBCA 2BKXA 4CF7A 2WWRA 2C98A 4NBVA 2GYYA 2HEIA 5B3AA 4QATA 3TNJA 1RZ3A 4WBNB 1R4MB 3D2CA 4LZLA 4MJXA 2PHZA 1MH1A 3DR5A 2PKCA 1XK7A 1YRHA 1Z45A 3ETDA 3LUHA 1NQAO 5FBLB 3M7IA 5FFFA 4FMCF 3AH8A 4QUAA 3TMAA 2FSSA 3V42A 3M2TA 3V8PA 4RTSA 2ZZNA 5IXSA 4OATA 1GGNA 2C5EA 2JJMA 4ERXA 1TZMA 1PR3A 1YR8A 3MZ0A 2WUDA 3ER8A 3T5CA