3AHFA

Phosphoketolase from bifidobacterium breve complexed with inorganic phosphate
Total Genus 322
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
322
sequence length
802
structure length
802
Chain Sequence
b'VIGTPWQKLDRPVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFIMGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVAGFDNEDHMSIHRRFAELFETIFDEICDIKAAAQTDDMTRPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVIREDLKLPELDQYEVTGVKEYGHGWGQVEAPRALGAYCRDIIKNNPDSFRIFGPDETASNRLNATYEVTDKQWDNGYLSGLVDEHMAVTGQVTEQLSEHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSLLINKTFNNDHVTNIYFATDANMLLAISEKCFKSTNKINAIFAGKQPAPTWVTLDEARAELEAGAAEWKWASNAENNDEVQVVLASAGDVPTQELMAASDALNKMGIKFKVVNVVDLLKLQSRENNDEALTDEEFTELFTADKPVLFAYHSYAQDVRGLIYDRPNHDNFHVVGYKEQGSTTTPFDMVRVNDMDRYALQAAALKLIDADKYADKIDELNAFRKKAFQFAVDNGYDIPEFTDWVYPDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of phosphoketolase: thiamine diphosphate-dependent dehydration mechanism
pubmed doi rcsb
molecule keywords Xylulose 5-phosphate/fructose 6-phosphate phosphoketolase
source organism Bifidobacterium breve
molecule tags Lyase
total genus 322
structure length 802
sequence length 802
ec nomenclature ec 4.1.2.22: Fructose-6-phosphate phosphoketolase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
A PF09363 XFP_C XFP C-terminal domain
A PF09364 XFP_N XFP N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahfA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahfA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahfA01
3ZHTA 2C42A 1OZHA 1T9CA 5HYVA 4JUBA 2PDAA 3LQ1A 3M6LA 1V16B 1V11A 1V11B 5ERYA 2UZAA 1UM9B 4K9MA 4KXXA 2EZTA 2QTAA 2FN3A 5FEMA 5IMSA 2O1XA 4GG1A 2EZ8A 3RIMA 1OLUA 2VBFA 5DEIA 3E9YA 3DUFA 2JLCA 3M34A 1UMCA 1T9AA 1UMCB 2XT6A 4QELA 5I51A 1DTWB 1L8AA 4JUAA 2O1SA 1PYDA 3UPTA 3ZHSA 1QS0A 3EXEB 3DV0A 1TKBA 3AI7A 1U5BB 2VK8A 3F6BX 4JD5A 1V5EA 2E6KA 5I4IA 2OZLA 2OZLB 5EXDA 2EZ9A 2PGNA 2WVGA 2J9FA 1N0HA 1WCIA 5ESDA 2XTAA 4GM1A 5EJ6A 2BFCB 4JUFA 2Q27A 1OVMA 2BEVB 4MPRA 2BFEA 1OZGA 1KEKA 2Q29A 4JU9A 3DVAB 4GM0A 1YNOA 1Q6ZA 4ZP1A 4D5GA 3EXG2 4K9OA 1TKAA 3UK1A 1Z8NA 2DJIA 4MPPA 4RJJA 2JI6A 4QPZA 3EXHC 1OLXA 1B0PA 1OLXB 2Q5QA 1TKCA 4JUDX 3AHEA 1V1RA 4RJIA 1V1RB 2QTCA 2YIDA 1V1MA 1V1MB 5DGDA 5EJAA 2BP7B 4RJKA 1V16A 3AHCA 1UM9A 1UMBA 1UMBB 5HHTA 2VBIA 2C3UA 2JI9A 3F6EX 3ZHVA 2EZUA 4GP9A 3EYAA 1R9JA 5K6RA 5EJ7A 2PGOA 3HWWA 4K9LA 2BEUB 1X7WA 4MQ5A 1X7WB 1PI3A 1RP7A 1DTWA 1TRKA 4K9PA 5ERXA 3HYLA 2BFFA 2BFFB 3EY9A 5C4IA 1UPBA 5HGXA 2UZ1A 2UZ1B 3EXEA 2C3OA 3AHIA 5EJMA 2Y0PA 1W88B 1U5BA 2W93A 3EXFA 3EXFB 1ITZA 3FSJX 4COKA 5HJEA 2BEWB 1W85B 1POWA 2JIBA 2EZ4A 3AHJA 2C3YA 1X7ZA 1X7ZB 1AY0A 4KXVA 2BFCA 2C3MA 4GM4A 2BEVA 2BFBB 5EJ4A 4MPJA 2JGDB 5K6TA 3DVAA 2C31A 2Q5JA 2FWNA 3EXIA 1YHYA 3EXIB 1UMDB 3FLMA 3EXHA 5K2OA 3EXHB 2G67A 3EA4A 2X7JA 3MOSA 1QPBA 2G28A 3AHHA 2R8OA 4KGDA 4C7XA 4JU8A 3M7IA 1UPCA 4C7VA 1T9DA 5EJ9A 5EJ8A 1UPAA 1X7YB 2BP7A 2G25A 4K9NA 1OZFA 1OLSB 2Q5LA 3IAFA 2IHVA 2IHUA 4WBXC 3AHGA 1MCZA 1X7XA 3AHFA 1X7XB 1YD7A 4XEUA 5DGTA 2WVHA 4KXYA 2IHTA 2WVAA 1ZPDA 2AG1A 5EJ5A 2BEUA 5AHKA 5I5EA 1NI4A 1NI4B 4MZXA 1PVDA 3FZNA 2JI7A 5EXEA 2Q5OA 2VBGA 3JU3A 4D5EA 2V3WA 2VJYA 1QGDA 2JI8A 1IK6A 3LPLA 3EXG1 1NGSA 1BFDA 1YHZA 1X80A 4QQ8A 1X80B 4KXWA 1OLUB 3M49A 3DUFB 1W88A 4K9QA 2XT9A 2VK1A 2BEWA 4JUCA 1W85A 3D7KA 1QS0B 3LQ2A 4KXUA 2R8PA 1GPUA 3ZHQA 2IEAA 1V5FA 3DV0B 3AHDA 2AG0A 1PO7A 2R5NA 2BFBA 3KOMA 2NXWA 1Y9DA 3LQ4A 2JGDA 2J9FB 3HWX1 2VK4A 1WCIB 1T9BA 5I5GA 3OE1A 1JSCA 1YI1A 1YI0A 2JLAA 5K3SA 2PANA 2BFDA 4K9KA 2BFDB 4Q9DA 1UMDA 3L84A 2BFEB 2YICA 4FEEA 4GPEA 1V5GA 1YBHA 3IAEA 3ZHUA 2C3PA 3OOYA 1X7YA 1OLSA 3ZHRA 1POXA 4FEGA 2Q28A
chains in the Genus database with same CATH superfamily
2XUFA 3M4JA 1A71A 3PE3A 4Y3UA 1H0RA 1J4AA 3F5MA 4ND6A 5EUQB 3AR6A 4K0RA 4ZAXA 3TLCA 4DXDA 4KFCA 2RHGB 3AEKA 3PDWA 2ZT5A 5GONF 1M7HA 2V0CA 2VXBA 3VH3A 5HCNA 1JXMA 4CKWA 2C4VA 3IQIX 4EOGA 3L7LA 1DXQA 5AXAA 2B35A 4F3RA 2G4VA 3AY7A 4NL4H 1V11A 2P5TB 1KFCB 2XECA 5BMVB 3CBQA 2YX1A 1ULTA 4BZQA 2D8AA 1JWLA 1RJEA 4ZCTA 4D02A 3VKGA 1M8GA 1YZTA 5DCLA 2OBYA 1N9ZA 4L95C 3CLRD 2PWBA 1XLWA 4X1KA 1CVRA 2QTAA 1P5ZB 3ZXXA 4AKIA 4X62B 3FUXA 2DT8A 4RCVA 4G09A 3RABA 1HORA 1X2BA 4QQKA 1II8B 2JANA 1PZHA 2BR5A 3GY0A 4TVBA 1PTJC 4X3PA 5CLLA 3T7DA 3TLGA 3MTIA 1CZLA 3QOXA 4UTVA 1QAOA 1GITA 1XDSA 3FPFA 2JLZA 3L9XA 5TEWA 3GRFA 1TQ8A 1A2QA 5T67A 4N5NA 1W2HA 1ZI8A 3L43A 3ZJ5A 1BFUA 1JMVA 1TW3A 3D8UA 1PYOA 4F45A 3H99A 1T9AA 1UMCB 2DPXA 4XIFA 3IILA 4LN1A 4JHXA 3U4AA 3MRXA 3E18A 3OG9A 3VNAA 3ZY2A 1JILA 1RXVA 3O8QB 4B3JA 1N25A 1PJQA 2W2LD 4JZYA 2JVKA 3D7NA 4BVFA 1E0KA 3ILYA 1RIIA 2JFGA 2WINI 1RTKA 1E6KA 2MCFA 3JR7A 4UMFA 2A59A 1Z38A 3ABZA 4MKHA 1WZIA 3DMYA 5EE9A 5C46F 1P3DA 5IAGA 4YJGB 5J2UB 2Y05A 3C1TA 4FGSA 3GJYA 2NSLA 2WJJA 1XNQB 3RR2A 2GRAA 1U11A 2FR0A 3FNGA 4DIFA 4OQMA 1SA0A 2XOXA 3X2FA 5ALUA 2I8AA 4OHYA 3SBOA 3GJZA 4JQOA 2AJBA 2FP4A 3RREA 4RTSA 1G2OA 1LY1A 1TM5E 2Y1EA 3KVYA 3RS2A 2OZLB 3I12A 4QOJA 1H3FA 1KH1A 1TM1E 3DWIA 3EZNA 3IX7A 1RBZA 1Z45A 3DOJA 4GSLA 3G5AA 4PHFA 5CRIA 1OI2A 1PGNA 3SQOA 1MBZA 1GG8A 3A28A 3VHXB 4OJMX 2F8SA 1W4ZA 3HABA 2BZSA 2DR3A 3QI7A 3H2IA 1W29A 2Q3MA 3HO6A 3ZU3A 2HU7A 2NVWA 2O57A 3MJVA 5EJ6A 3PLAE 1RJWA 4B80A 2WYHA 1P8AA 4ZO7A 5FULA 2HI0A 3DBIA 1Y9AA 4PSDA 2XITA 2NZVG 3REGA 2RGEA 2BI8A 4YRKA 4OJQA 2R751 4DLBA 1R4AA 1VLVA 2YNMD 4M0DA 2XF8A 4YPVA 2J31A 4G0QA 3R6GA 2XOEA 1C0PA 1PG0A 4OGWA 2VLBA 1MDFA 1ZAYA 3V7FA 4OHFA 1PLJA 2XTMA 2YWHA 2VP6A 4IR7A 2H5IA 1PFQA 2Y0EA 1OXMA 3KLNA 1B8NA 2VCEA 1QDUA 3COVA 4UHKA 3QX9A 5AVKA 4BQPA 1YJXA 1YR3A 1KF0A 1T4GA 1L3CA 2PMWB 3DC7A 3HHPA 4BX8A 3IQZA 5KNCA 3C14C 1NN1A 3PQ8A 2Z3VA 3AF0A 2BGIA 4LKOA 5H8WA 4WOKA 2DJIA 2XCOA 1Z07A 3L8EA 3OMLA 1OLXA 3DDZX 4TV8F 4WLUA 1K5HA 4AUNA 1QANA 4BNMA 1U81A 4I6GA 3B6JA 2EF1A 4HMOA 3HKEA 4W9NA 4MKFA 2F67A 2I55A 1SBZA 2Z8YM 5E7JA 4BEJA 4COOA 5CD9A 1UADA 3NHRA 3PXUA 1YDWA 4QDJA 1ILEA 3ZD6A 1MG0A 1RYHA 3B9PA 1LJUA 3DTNA 2AZ4A 3QBJA 4DTCA 3RW9A 4X90A 1XEXB 4JCCA 4YWJA 3HG7A 2E85A 4NEQA 2V9PA 1UZMA 4UU7A 2O2XA 3LGSA 2B3DA 4JJ7A 3F7MA 1SCBA 1PZNA 5BUCA 1M6YA 3HUEA 3HCBA 2VA9A 3G1WA 1W36D 1I0IA 1SD2A 2VDJA 4DR6B 3N0TA 3ZJVA 3U3MA 4CLDA 1FFAA 1R0RE 1PJBA 2HQ1A 1UMBA 2PX6A 3TRHA 5BRNA 2EBWA 2ECOA 3GA7A 3QG5A 4QQNA 5HHTA 5L3QA 2BFWA 1G6Q1 1E2PA 1R0CA 3K9CA 4HRXA 4Q9JA 3E2MA 1X6VA 1U8YA 4LQLA 4R5MA 3WLFA 1JTVA 2CYCA 2CVPA 2WT9A 3I04M 3E3LA 5CT8A 3BKWA 1E3IA 1PTJA 4KQIA 4ZJPA 4Q1AA 3EMBA 3FDJA 4HNRA 4PCVA 2HJ9A 4FZ3A 4LRWA 4PLZA 5SYMA 5BQFA 5JEDA 2C7VA 5IWAB 4N0QA 5TV2A 4MLDA 1YF3A 1Z8FA 4O5AA 4FYPA 4CT4B 3UAWA 2OP0A 2QV0A 4QYTA 3QWHA 4Y2SA 1X9IA 3RWOA 4MWTA 5CB8A 1QRTA 3DL0A 4IX9A 2C20A 3P9KA 1J33A 4RF5A 3GF4A 2IUEA 1KAGA 3K0BA 1DQYA 1RQGA 5A0FA 1FX0B 3WL3A 2G9NA 4PPGA 3O2NA 4I55F 1GPKA 1I7PA 2YL2A 2X15A 1XKQA 5BMVA 5F2KA 3TBKA 4C4ZA 5HGXA 1ICEA 1R1DA 3GJQA 4M53A 5LU8A 1Y5IA 3NU1A 2VIIA 5HF5A 1P9WA 3PR3A 3K0CC 1GPDG 1KH2A 3PT5A 4LJ6A 4TLDA 2O07A 2Z98A 4RY2A 4EDHA 3ZUPA 1I7DA 1QFZA 1U7OA 4P9NA 1NATA 2NN3C 4U7PB 3H86A 1P9OA 5LR6A 1O7JA 3UANA 2HF8A 3P0HA 3M8KA 2Q0XA 3DTVD 4OB8A 2QZ4A 1M76A 1VIYA 2X22A 2V1UA 1S96A 3HR8A 3HBJA 2M6SA 2JHGA 4G85A 1Z0UA 3RWMB 3AFMA 5FPKA 2XZPA 5K9ZA 4XWGA 1XF1A 4OF4A 3TXAA 2YBEA 5BSKA 1G8AA 1IQ0A 1CE8A 1GZ7A 1YRLA 2F8LA 3PE4A 3WLKX 4CI9A 3KJGA 1W85B 1JKMA 3DBOB 3I3SR 1L5LA 5JV5A 1FFSA 2MSNA 1Z7BA 2IS4A 1KMHA 1XIVA 3HACA 4YMWA 3FYSA 4O2BF 3S7TA 3IBCA 5FOUA 5IG2A 5BXYA 2XCSB 1J99A 2X14A 1X7ZB 3FNEA 3MMXA 3PDJA 4I1IA 1V5IA 4J0IA 4MQMA 4REQA 1JVSA 2JCSA 1V8BA 2ZUEA 3Q8WA 4JYMA 4M89A 1ABEA 3AJAA 5I3CA 4BB6A 3F4BA 4ZAVA 2QL6A 4ZEXA 1GKIA 4JCOA 2W90A 4B3SB 1RHKA 4Q47A 4B35A 4BX9A 4DVGA 4FYVA 1JR3D 3QVKA 2AYXA 4F9TA 4RKRA 3QNUA 1U7DA 1KVQA 2D0PB 1CJMA 3B3QA 2XF2A 3LQFA 4OREX 5IHPA 4C1NA 5L53A 3TS1A 4G5FA 1R6DA 5JWOA 5KX5B 1Z0AA 4LC0A 4BV2A 3JASA 4R54A 4G6ZA 4U9IS 4MO9A 4YAFA 2HGSA 3JYOA 1ZD9A 1R3DA 1YB7A 4M8IA 3T1VA 3Q2KA 4BJ1A 5TLSA 3OM9A 3ZTWA 2RE8A 3PQ5A 1UFVA 4B7ZA 2PGAA 3E5RA 5A62A 1G4HA 3HZRA 5F23A 5LQAA 1JLLB 1Q84A 3ITNA 2VYND 5ESRA 1Y3FE 3AOGA 2J6CA 3WX0A 1CR4A 3OCXA 2AL7A 3ZV6A 1B00A 1COWD 3B20A 4LDZA 3I23A 1NMXA 3MYYA 5LQKA 2OBBA 1XZLA 2ZDQA 2H4YA 5FA5A 4NCAA 4WIAA 2EDCA 5CDFE 4CMIB 5KJ6A 3FUVA 1HA3A 3VSAA 2OCPA 2CD7A 4YQZA 3QBDA 3FZQA 4JGBA 2JL1A 5A05A 3WB0A 2H4WA 4L4ZA 5K8UA 1TM7E 3FJOA 4YECA 4R7GA 3R75A 2NO4A 4RLSA 4DE5A 2HF9A 2B94A 2QVXX 4PGMA 4TRJA 4DREA 4EUHA 1FRQA 4N0DA 3NRCA 4B2IA 1NW5A 1L4KA 4OK5A 4TXMA 3FKSA 2QL7A 5DGXA 3IMFA 3IMKA 4JY7A 4POAA 2NV2B 3SSMA 3HZOA 3OPXA 4C5BA 5JSZB 5HFJA 3H5OA 3TNLA 2I33A 4ZVKA 4TZ6A 5BSUA 1LH0A 2W6QA 3C1UA 3EZ6A 2F62A 1Q21A 3PFHA 4KGVA 4ZC1A 1FZTA 4HDRA 1PDOA 1SURA 4TWRA 4YXWD 2FY8A 4CL8A 2P6OA 1FJXA 3F6YA 4EFMA 4EPYA 2OV8A 4L78A 1AGNA 4PC7A 3Q8MA 1VA5A 1Z4IA 1T6ZA 1YD7A 2FSIA 4O02B 5F3DA 2CV1A 4BNTA 1SHUX 2GBPA 3L3BA 2DBZA 5BWMA 1G19A 2OMKA 2YQZA 2DUMA 4JLAA 4QOFA 3RFCA 3KR0A 4JQYA 4LYFA 4KU4A 9LDBA 3N5KA 5IRCD 4RZUA 1ODSA 3VZRA 1TYBE 1NXPA 1OJLA 2Z4RA 3KEQA 3UHFA 3PDUA 1HV8A 1Z0DA 2IXAA 4YI3A 3RTDA 5C5EA 5CLJA 2IYAA 2NU6A 2ZI4A 1ZL2A 1RC1A 2VDWA 4K88A 4WGGA 3SCZA 4QWWA 3JWHA 4RKFA 2P2ZA 3VZBA 2Q4BA 3MTEA 3ANTA 4RZQA 4MK4A 4YP0A 5HZGA 4E51A 5CBPA 5JFOA 3JU3A 3QKIA 1Y7IA 2BHLA 2OCGA 5EA2A 4A92A 4EF5A 4XSHA 1O58A 3WB2A 5E1BA 2R8ZA 1VE6A 4PIPA 4RK4A 5DN9A 1H0SA 1EUQA 1X70A 1L7MA 4W5RA 5EIXA 3T3HA 3AI2A 2W11A 4QEKA 2PSDA 1NQ5A 3GPCA 4NMXB 3RC7A 1QGAA 3HGTA 4U7GA 3VGJA 2FWRA 2HH9A 3G1UA 3T99A 2AD5A 1NL3A 2AOXA 2GBFA 2JCXA 1RI5A 3DDWA 2ZE8A 4WNAB 2SCUA 4GAEA 4ZREA 5EE0A 3U81A 2DZDA 2C88A 3CCBA 3DMFA 3G8DA 2QSZA 3PUJA 5ALXA 4YQEA 4BNDB 4XVCA 2I91A 5D3MB 2X13A 3L7AA 3HBNA 5MN5A 1ZMXA 4ZJZA 3QYPA 4ZT2A 4DCUA 3GFQA 3CRQA 5CDGA 4L0CA 4GMKA 1VBNA 2DAPA 2NUAA 1GPUA 3IT3A 4W6QA 2PTHA 2NNLD 4QXQA 2NT3A 1RJ9A 2BISA 3CUEF 3D1VA 3EIHA 2IK8A 1H2ZA 4FLMA 5F5LA 4AG3A 1ABFA 1FDUA 1SXJC 4HN2A 4GI7A 5CFLA 4WH0A 1WG8A 1IEVA 1JEQA 3U3DA 3W3ZB 1NUUA 3IR6A 2A94A 3ORYA 1ZUD1 3II6X 4ER5A 2UZ3A 621PA 3ELWA 3R9KA 2K87A 4CQLB 3S0JA 2O3UA 3OO0A 2R48A 3LQ4A 4EZBA 3ZZ0A 3GLFE 3L8GA 3DEHA 1I51A 3A8TA 2BMAA 3G2JA 4GOXA 1ZR2A 4DYHA 3IB6A 3DAHA 3WWPA 2PSFA 2C94A 1JH8A 1K66A 1T8YA 3H5IA 3IEKA 3OKAA 3KEFA 1HETA 5D5QA 3HCOA 3K1AA 3GLQA 3IKVA 5C5IA 2IOYA 3KQWA 1IFXA 2VNKA 5KSPA 3L7OA 2YDXA 4AS3A 4E7OA 1E3TA 3R41A 4A16A 1R66A 3ND8A 2X3YA 3KEGA 4MB6A 1H2BA 4IIJF 4TMZA 2BFDB 1JIJA 4FDLA 2NQ8A 3R3XA 1E2GA 4HLNA 3FBTA 4LVNA 1YASA 4HAOA 2IJGX 3BL6A 2JLBA 6AT1A 5D1HA 1Q17A 2VP0A 3CF2A 5IC6A 2Z3WA 1TZCA 2CF5A 3D59A 2IYYA 1Y37A 3D31A 1LFAA 2CXOA 2PIAA 2ECFA 4KRXA 2A4KA 2AFHA 1Z37A 1QYCA 2HK8A 2MDTA 3ABQB 3DZ8A 3P9RA 1DO8A 4DG8A 3EVNA 4EHIA 4F8YA 4Z4FA 3PUIA 1HR0B 1SVIA 5L45A 3T3OA 1TZKA 4XCQA 4BLVA 2W00A 3OCUA 4MUBA 1EYZA 1YI8A 1CR1A 3BSSA 5FPSA 4MHTA 3FCEA 3T9AA 2JLWA 2WPNA 2HWWA 5DSTA 6NULA 3QMWA 4HFMA 1P77A 2G06A 1Z75A 2HCTA 1Z5PA 3QU9A 5E1OA 1VFNA 2WIKA 1KOJA 1M2EA 1Z06A 1T13A 2WOJA 4IL5A 1XQXA 1O94D 2Y0BA 4Y2XA 3SHTA 2A9QA 3ZCQA 3FR7A 3PICA 3G85A 1PR4A 1YV9A 2HRCA 3LUKA 2XB9A 1W48A 4ZC8A 3VO2A 3GRYA 4Z1MA 1LC0A 2FX3A 5JDIC 2FW8A 3R9WA 1E6EA 5B58T 3L93A 2HRQA 4D45A 5ADWA 3A3YA 5BUSA 1NBIA 1IZYA 2FEWB 4FOLA 5TGDA 3URMA 2BGWA 3W4JA 4JEMA 1GNTA 2OVBA 4JYBA 2JGIA 4TMYA 1N5IA 3C48A 4HYYA 3IHWA 1TE2A 2W2KB 3A06A 4X1YB 3DEKA 4RPIA 5CEFA 1Z4KA 2IX3A 1M5UA 4C30A 1JW9B 2CEKA 4MMXB 3UWMA 2J8ZA 4YAGA 3MQ2A 2HSGA 2QL9A 3G49A 1ZG3A 2NUTB 1CUEA 3BB4A 3T15A 4M7RA 1AA6A 4MUYA 2R85A 3LC2O 1CEXA 2OTCA 1ZUWA 1V6AA 2JIMA 3R77A 8LDHA 4WOCA 5E3JA 4OFBA 5FTKA 1ZOOA 4CEHB 1HYQA 1FSGA 3IOYA 4L16A 4M7PA 4WI1A 1A9RA 2PBFA 5LP1A 3F1LA 2AFVA 2J3MA 4NX2A 2BBWA 2QQ5A 4OI2A 3U7IA 2IDJA 4ARIA 4B4VA 5A3RA 3PC3A 4IQFA 4PEVA 1F8FA 1QB7A 3VR3D 3B3FA 3A1NA 1E1LA 3EJWA 4LE1A 4C0AC 4PVDA 5CVDA 2Z30A 2CDBA 1TEXA 5DCUA 3VR4A 4MR7B 4BBJA 2PLFA 1MRNA 1OJ7A 2GVDC 3ND7A 4C0BA 5J2TA 3ANYB 2PY6A 2X8AA 1LDNA 2HHJA 2P68A 3L7IA 3RUHA 2PUBA 1ORWA 1N0UA 4U63A 4KO3S 5KNDA 1RQNA 1PW7A 3WP1B 3S1AB 2C7GA 1D2GA 2WWXA 5AOVA 4BPRA 1AV7A 4C7MA 4JI3B 2UYQA 3UA4A 3EY4A 3BRWD 1SUPA 1T5LA 3ZLUA 5CFOA 3TTXA 1VSUA 2HB6A 3SI7A 1URPA 5EC8A 5TEVA 4DLNA 5G40A 1AJEA 2I1QA 1NLZA 1U4NA 4NYMR 1DG3A 1JEJA 2AGVA 3DQPA 1KJYA 1SXJA 1Y7HA 3DZGA 3L82B 3QXXA 4HDSB 2HV8A 4BWGA 4YJ2F 2FVXA 1L4FA 1SQ0A 2J87A 1ZJJA 1R5BA 3C6XA 3V55A 1M0TA 4BCDA 3THXB 4BMOB 1PT8A 1V5EA 1T5DX 3OESA 1H6DA 1J39A 1ESCA 4PZZA 4S12A 4JYCA 3C8HA 5THKA 3HCFA 2IVZA 2WPDA 3NDRA 1QLJA 4KFRA 4DBVO 1PD1A 1IN1A 5JJLA 4BNUA 2BFPA 2RH4A 4C4XA 1WCWA 4JHLA 5T41A 1M5TA 2G5TA 2RB4A 3DLCA 1Y5NA 1WCIA 3Q8XB 4UAVA 1H9BA 4JJ6A 4E14A 4JXXA 3OX1A 1THTA 1TPYA 1M2WA 3NEJA 3KHTA 4QHSA 1BA3A 2VZ8A 1AD2A 3L1KA 4WK6A 3NTOA 3ZDZB 4UPEA 2A88A 2AEMA 3SJ7A 3WLEA 2BFCB 1XG5A 2R97A 3G3EA 4FYHA 5IUJC 2B4RO 4K8RB 3BXZA 1QE5A 2QTNA 4YJFA 4C88A 5LQUA 1PEAA 4B8WA 1T9ZA 2REQB 3K53A 2W4QA 1Z4PX 4LRUA 5AWFC 3PIRA 1GG2A 5LA6B 1I0LA 4S1OA 3L4EA 3QVLA 4D8TA 3GAZA 5CNIA 1KL7A 2JH8A 2Q29A 5JD3A 4DJEC 1TDJA 3W6PA 4DJDC 3C6MA 2WK1A 5IC4A 4BVGA 4RULA 1KWKA 1G1AA 5H4GA 4RM3A 3G2MA 3R7FA 4DIOA 4DLYA 4RZ2A 1ODTC 3NW9A 1FP4A 4RS4A 1R9GA 2GZ1A 3BHIA 3GG2A 1CJKC 1CS4C 3RLIA 1ANKA 2GKSA 1EVQA 1CY0A 3HBAA 4JJFA 1M2VA 3THWB 5LUAA 1DDGA 1KK0A 1T9GS 4BVLA 2LIPA 5KDDA 4KVGA 4Y6GB 3BG5A 1Z8NA 2AUMA 2IYOA 4BATA 1VPWA 3AR2A 4R9NA 4EAAA 4EEKA 2P9BA 1ORRA 1PR2A 4U7JA 2OYRA 1B0PA 2NSYA 1A97A 3DZJA 1FBNA 1P9LA 5TPWA 3U3JA 4YJHA 5JDIA 1C29B 1M2FA 4JOSA 3MJCA 5A3SA 3N87A 1PT6A 2J32A 5ARBA 1I7QB 5ALKA 5ICGA 3CLKA 4EX7A 2IPNA 1SUIA 3DV2A 5L3SA 3GLIA 3KFVA 1ZN7A 3PFWO 4RORA 2QE7A 3CCFA 3DULA 4HZUA 3FNQA 2FWPA 2Z08A 4R6XA 2IV3A 3L6EA 1YTLA 4Y0AA 5BY2A 1PSWA 1CRLA 2Q1YA 2ETXA 4F21A 4WKOA 3EPKA 1NF9A 1S2OA 1HDIA 1QYXA 1HE2A 1Q91A 2V55B 2D1YA 3K0FA 4HS9A 1SKBA 4LOIA 1JTFA 1DLIA 3IPAA 4Y9DA 4FFNA 1X1EA 3C3JA 3H2ZA 5K20A 1SEVA 4ZI7A 1D1SA 3GUYA 3LK6A 4WX2B 2ZYHA 2VHQA 3ZXYA 5K4GA 4CGZA 1XA4A 2ZATA 5GP1A 1N2IA 2OHOA 1F38A 3FFAA 1C41A 3GN2A 1V45E 2W5UA 2Y1OA 2Z8ZA 2H3HA 1S5PA 4G37A 5K0LA 3TTVA 3KWJA 3IAM6 2I6SA 3RIXA 1L4EA 2AQIA 3RS0A 5B36A 1N2GA 2AYZA 4M9XA 3GLSA 2BR3A 5KAMA 3VJKA 1V96A 2ZT8A 1U6KA 4DQLA 1K63A 3F97A 4G84A 4NMHA 3GLGA 1QCZA 2J3QA 4MUFA 4FSDA 5CT4A 5JNWA 5KCZA 4D98A 1LLUA 4BZWA 1YB6A 4QASA 3FOEC 3R7BA 2UVDA 2WD9A 1DRVA 1KU0A 2CZCA 1K0FA 3CUVA 3A9TA 1KIAA 2QRPA 1NJ6A 4S1VA 2IH2A 1UC5B 4QICA 3A7EA 1B26A 5TIIA 4IGAA 5MN6A 4L28A 2DBQA 1RP7A 4J7XA 4CM4B 2O20A 4UBOA 1H2HA 2E4UA 3MJSA 2HMWA 4M7WA 3MS2A 3PPIA 5MGBA 3P9NA 2FG6C 1D8AA 3EFOA 1ZK4A 3CSSA 4KE8A 3HWRA 3Q1KA 5FWXA 3N6RA 3WYDA 3ZGOA 1N9KA 1UF9A 2DPYA 2EP7A 1BXGA 3H5WA 1X0VA 4JBWA 4XUDA 4QLOA 3ZZNA 1BDHA 3ROGA 3KU4A 1BZYA 3CRW1 3LRXA 4IV5A 3EXEA 2BI7A 3A1UA 3VTAA 4CKBB 4QLBA 3LDAA 2GJAA 5EIHA 4YCSA 1XI2A 4PR3A 1M34A 3L0CA 1SQFA 2P6NA 1I1OA 5LFAA 4EKNB 4MDHA 4Q4CA 2BF4A 4WD3A 1TJ4A 1JIQA 1RYNA 2H2FA 4DB2A 3DG9A 4GE0A 4YRSA 3GEGA 4NQRA 3ZV5A 1UDWA 1MNAA 2ACEA 4J0JA 3X1KA 1LSUA 2YHBA 1PQWA 3EXFB 3IO5A 4RL6A 2JBWA 4LXHA 3EASA 3F0TA 3H04A 1U1CA 1W8IA 2ZYDA 2RHOA 4U6NA 3CMCO 3GVXA 4FFDA 3TQSA 4BQOA 3SQLA 1O3YA 1BE0A 1DC5A 4XD7A 4RAQA 1JDJA 2WAYA 4FXPA 4LRXA 2O2DA 1HRDA 2ZIEA 3S2YA 3KQLA 3DMHA 3W77A 1HI9A 4PAOA 3KL2A 2QENA 3BCUA 3GRRA 4RKYA 4I8DA 3A9VA 5JXIA 2WT8A 1NONA 2ONCA 3AHJA 3LUGA 4EY3A 1BWRA 3CEPB 3BGWA 1GKKA 1CR6A 4A8JC 4B3DA 1QWSA 1NMEA 1PJAA 3AY0A 4ZYWA 1EEHA 1NMZA 4ZXFA 4J7CA 1JDNA 1NW8A 3BE6A 4WN3A 1EBUA 1K8QA 1H93A 4ZAZA 2RK4A 3TKAA 4N7BA 2OO3A 3VC7A 1XZFA 2X0JA 4LCBA 2PRZA 3AKDA 3EARA 3OEYA 3L7KA 3B7WA 4PFQA 3HS3A 4MYSA 4JBGA 4CV2A 1QV7A 5ALDA 3VHRA 3H8JA 1F2UA 4U7FA 2O6LA 1P4HA 4CEJB 1R4NB 4UMVA 4JLUA 1GPWB 2QMHA 3VKWA 2JHCA 3AESB 2ZT7A 3NC0C 4REMA 1YRAA 1FS6A 3HA7A 3PXBA 4W1RA 3KZVA 4LSGA 1JMKC 1PFGA 3JQ8A 4MDYA 1U7WA 1G291 1XHLA 4DCMA 1VSBA 4TKZA 4Q3NA 1JHRA 3EG9B 1YC2A 1LV8A 4KUEA 2BKUA 4LVCA 3KOWA 1TJ5A 2ZUTA 2HX1A 3K1JA 4JJIA 5IYZF 3CLUC 2YJGA 3ZI4A 4EGQA 2DH6A 3SQWA 1V25A 1OH7A 4RGYA 1LTKA 1JAZA 1MF7A 5ALWA 2HLDD 4RENA 4R8VA 3IQFA 4L4XA 2P6RA 1U2ZA 2YCLA 3B7PA 2XMZA 2I76A 3WA7A 2XEDA 1AKQA 4H7FA 4RVOA 1IDN1 2A1UA 1MDBA 3U39A 4TL8A 1RADA 2X42A 3E4CA 4X71A 2I9PA 4MB0A 4N12A 3FHTA 1O6BA 3GCGA 4Q3DA 2WHYA 5ECDA 3FNBA 2ZAGA 2FGJA 1G42A 4URZR 4JBIA 4G5RA 4A0FA 5DASA 1X7YB 4ROSA 5TY0A 3LW8A 1E0AA 3N8DA 2QAGB 3H3FA 3K9GA 4JI8B 1CYEA 3FGPA 5FH9A 2J0UA 3AVPA 3F9RA 4OKNA 4IS3A 1JDTA 3OJCA 5CDHA 1EDOA 1VPVA 2ON6A 4UHCA 3AH8A 4WOBA 1VCOA 3WJ7A 2QOEA 2FEMA 4BGVA 3I76A 3OQMA 5FWNA 3HVRA 1W93A 1D4AA 4J49A 2CFCA 3BMQB 3QFRA 5IAJA 3KTFA 4Q3OA 4L9AA 1T4DA 5FPYA 3GROA 3LYUA 3NTUA 2ACKA 4NMMA 5M34A 1WP4A 4Q66C 1PFWA 6REQB 4D9IA 1OIVA 1EESA 4FGKA 4TLCA 2AKAB 3ZW7A 4DXAA 1D07A 2JEOA 3DCJA 2ZWOA 3LW7A 2ZJ2A 4LCEA 3UMMA 4P93A 5EAIA 2CNOA 3OUUA 5AMXA 3TMKA 3HJFA 2BTEA 3PC4A 4J1SA 1Q2XA 4PE5B 4CM3A 1SHJA 4DCCA 1ENOA 3R6TA 1ZK3A 2ZROA 3K6KA 5A4FS 4K81B 3TTTA 2WIDA 1XZCA 3SEFA 1DVRA 2FW9A 4JT2A 3JATB 2B8NA 4RFSA 3K1ZA 5GV7A 4F2PA 3G5UA 1JTEA 3DKRA 3DLBA 3CEJA 4JQZA 3QOFA 1BA2A 3R8CA 3EX7C 1QG6A 1PJZA 2ESRA 1N0IA 4CKXA 4YO7A 1B2RA 5IARA 1L4UA 1IONA 5H83A 3O2JA 1IH8A 3H42B 2PL1A 4IVPA 4MR9A 3T52A 1LLFA 4ZU1X 1NVUQ 1CDOA 3A3KA 4IIBA 1U0RA 1UT5A 2PL9A 5I48A 1KTIA 4ME6A 2NVBA 5CLHA 2J4CA 4KBYA 1RE1A 4Q7MB 4AZVA 3PPXA 2OV1A 2WFMA 4Y2JA 5F9FA 2YVUA 5HTKA 4HXGA 1WD5A 4DMRA 2G17A 2X0NA 2W0SA 5CA1B 4UBMA 2JDIA 3AJ9A 3DJFA 1EB8A 2O4CA 3R44A 4JVNA 4Q1BA 4CW7A 3OLXA 1E2KA 3IUEA 5ICCA 3IOBA 4JUCA 3LY8A 3TNJA 4PBTA 1K7SN 3KDSE 4GX1A 5M29A 4U6QA 3QU5A 2WJ6A 3GPLA 3NAZA 2GASA 5DNAA 3IAHA 1XCBA 5BN5B 3TTYA 3PQ2A 2K7ZA 5JHGB 2AJLI 2EGHA 1CDZA 1C8LA 1FXSA 4N6GA 4KBFA 3WYAA 1P0QA 5DMHA 4AJ2A 3N05A 16PKA 5IS2A 4LWZA 2FMTA 1DXHA 2B8WA 2IY9A 1DRUA 1OFHA 1WSDA 4A8JA 4F71A 3ZGZA 3FX2A 1X8JA 5EL0A 1T0JB 4C7JA 3NYQA 3S55A 2ID4A 1IULA 4TV8A 5I9MA 2MJLA 1LDBA 1PGOA 1E3WB 4LQCA 4XKJA 2ATVA 1LF5A 2NW6A 4RXMA 5EWJA 2VP2A 1A7AA 2J9FB 3R4VA 1U0OC 1YJ8A 1G3RA 4KDFA 2IPOA 1YK1A 1Z4JA 3L6DA 3LBHA 5CLIA 4G4GA 5HZHA 3G2NA 1U3DA 3NRBA 4P82A 3X3HA 3USCS 1C7FA 1VG0B 1XSEA 3B13B 4UVDA 1K98A 3KQUA 3QIVA 1RM4A 4LC1A 3GLHA 5C5DA 1JHOA 4UPVA 5KEIA 1KY2A 1RYZA 2HCBA 4P8RA 5ADVA 5KTKA 1BJRE 1CP3A 1RYYA 2BLNA 2AW3A 3Q4GA 4QRHA 4W1PA 4CQJA 3EGDA 1K75A 4IQ0A 1UMDA 2P5UA 4YGXB 4H16A 1CUCA 3L4JA 2QRGA 3UHPA 4M54A 5AHXA 5HBGA 3KTOA 4D8VA 2DHEA 4IUCS 4EBFA 5BMOA 1J8MF 4MQUA 4DUPA 2CMFA 2RG7A 3LBAA 2YY6A 1MX5A 4FKZA 2AFIE 5TQVA 6LDHA 4RBNA 2IUFA 3P32A 2C07A 3AOEC 3IBSA 5J23A 2H06A 3O9ZA 4P7GA 4G8DA 1CQZA 1ONNA 4EF4A 3R9XA 4MGHA 5H9VA 2DG2A 4M87A 4WOPA 3Q3HA 2ATXA 3JXEA 4J0HA 4HUQB 5K0TA 4U1RA 1A72A 2QW1A 4DIUA 3R5HA 3L0DA 3MTQA 2GMWA 3QE4A 1P45A 2RAVA 3QKWA 2DUWA 4MICA 5KTPA 5CVVA 4X44A 1OI7A 2HZ7A 3NHBA 3OEWA 5TC4A 4RY8A 4EL0A 4KZPA 2D5AA 4FCCA 3ZU6A 5AK6A 4FFBB 3NI2A 1ZEJA 3O26A 4U7HA 4DC1A 4EFLA 1P9RA 1SCJA 2EG9A 4CUKA 4DBZA 3NDPA 2IRWA 3IP8A 1DLJA 3FPLA 3OJOA 4I55A 2XAAA 5DHAA 1NVTA 3Q5DA 5ALSA 1WZCA 1OWNA 1B8UA 1KI9A 2H2DA 4Y1RA 1IBKB 5DTRA 3EGXB 5EIAA 4KX3A 5A4JA 1T9CA 4P0TA 1UQTA 3HJBA 1GGMA 3Q0EA 1KZ7B 1ZR4A 1OE0A 4CIYA 2H1SA 2I9KA 1CZNA 3VZDA 5JCJA 2P2YA 1B76A 2GN4A 1X9GA 2FFHA 2VDMB 1LI7A 3H13A 4E09A 4NECA 1A95A 2IH5A 5K45A 3ZBTA 1V16B 2ADFA 1G8MA 1EM8B 1WF3A 4XCVA 1J24A 2BHNA 1YR8A 4DMGA 4TTPA 2ZIAA 2WTAA 4U02A 1A7UA 5LMUB 2QUAA 4HD8A 4CM7A 3EGOA 2HDHA 4RMHA 2RJOA 4ABYA 5GADl 1VL1A 2ECKA 1H4QA 2BHRA 3HXQA 3D02A 2CJFA 2HC9A 1D2MA 2VKQA 3ELDA 4H6XA 5EKTA 3A11A 4HN9A 2FWMX 5AHRA 5IMSA 5EHGA 5EMKA 3CH4B 5CFQA 4YCNA 3FHCB 4TS3A 5E0KB 1H0HA 2F59A 4B9AA 3JD3A 1G20E 3M5WA 4IXWA 2PUTA 3GJ6A 1DTEA 3KE8A 3OF3A 4RIGA 1E1KA 4CR8A 2FX2A 1GPMA 1VRVA 1YIOA 2N75A 2SKDA 3P9CA 3M34A 1QE0A 2W70A 1QIDA 1V7QA 3X1ZA 5E4TA 3U61B 5I51A 4CU5A 3I5YA 3ZX5A 3ZCXA 3HNOA 4OHKA 4FYXA 3D0KA 5JMTA 1G5RA 4NWIA 5K2MA 1TQHA 1Z2OX 3AMVA 4HB4A 3SWWA 2G1KA 3CWZA 4MKXA 1TGYA 4TV9B 2YJ6A 4S2UA 4ZOQI 3TO5A 3I0ZA 5GJWC 4EG5A 1QU2A 3BDIA 2RKOA 5CXQA 1OYOA 2RHDA 4H3KB 2JD0A 4MW1A 2G72A 1HDGO 2W6ZA 1QTQA 1ISHA 1NOKA 3VOSA 1B8VA 2QR2A 1VKHA 2C2ZA 1V0JA 4BUCA 4WNYA 1JR4A 4DLZA 4E2WA 5LD2B 1KAQA 3D2AA 1W47A 3D7RA 1F8GA 1WUHS 1VM6A 4OUKX 3RUFA 4ZVTA 2A1TS 2GZ2A 3BK2A 3D3KA 3V8QA 1U5BB 4B3GA 2FJ0A 3CUYA 1PUJA 1FU8A 2HMYB 2PZLA 4IOJA 3RUIA 3F6BX 3B6IA 3VU1A 3U7RA 1MQAA 4B3IA 4F2GA 5BV0A 5T3YA 3PB3A 1A4RA 1GZ4A 2R1VB 3DVLA 1KY4A 2YWCA 1F4VA 4G89A 4PIMA 2HA7A 1NT2A 3D4IA 3HJAA 3MSXA 2B2CA 1QPZA 2QBYA 1SBYA 1U8XX 3H2JA 1USKA 4IZOA 4ECEA 3PJGA 2JW5A 3D4LA 3SC6A 3C3YA 2UZ4A 3IVGA 3A6FA 1DBPA 1ULHA 1WS6A 4IDBA 2QUIA 3GQVA 3OQIB 2G04A 3CKMA 5IX8A 2FWIA 1OIWA 1Q19A 1WDLA 3UYLA 1QHSA 1JWAB 5D8DA 4B6GA 2CKDA 1AU9A 4MUHA 3OSUA 3FRJA 3M1IA 5HZKA 5IFKA 4IF6A 4TQ9A 4PAQA 1KPHA 2ILTA 4DM4A 1DEAA 3RT9A 1E2LA 1Q44A 5FPQA 1C1XB 3D64A 4KIWA 2A58A 1P3Y1 2C84A 1JKIA 4PAMA 3ROPA 3AOEA 1G5HA 2IIPA 2JFUA 2B0JA 4JR2A 3A4NA 4HBGA 3NHMA 3CVYA 3CJTA 3MM4A 2HLHA 5L51A 3FBGA 4Q24A 3NHLA 3R0QA 3VMFA 4B46A 1JSRA 3G59A 4HEA6 4BWFB 2VK2A 3RJTA 4D5GA 5PGMA 3VOTA 2ZRMA 4EHAA 1PZGA 1YBAA 3SFTA 2L2QA 2QAJA 2ZYTX 1E1QD 4C7BA 4ZZ1A 3DHWC 3ZKWA 2R84A 4P4NA 5LKRA 5F35A 3WFJA 3VPDA 5GPBA 1ORTA 1QHHB 1AZSC 3QTBA 4TRMA 4UTXA 1ZUNA 8ATCA 2F55A 1HE5A 2H2AA 2DPLA 4XIGS 5FBKA 4D6YA 4ZGWA 5CA0F 4JP8A 4YRNA 4N3GA 1K86A 5CYOA 2PKQO 1KJZA 3L06A 5T4FA 3LD9A 2D1QA 1SUAA 4IXDA 2ZRGA 3EAFA 1IAVA 1GTL1 3ULKA 2CUTA 4MGZR 5D6OA 5CB4B 2CLEB 2AJTA 4C2AA 1FBTA 3DTTA 1S1CA 2FV8A 4WNIA 3FKSD 1IM2A 3MK31 3OT1B 1GCAA 4PRLA 4U5XA 4BBPA 4ESVA 3AKYA 4OAOA 2YZ7A 5DGIA 2ZVQX 1MLDA 2DCMA 4IHJF 1X15A 1YCFA 2OGTA 1FS4A 3THRA 1V26A 4R81A 5AKGA 5JVDB 3T9EA 1GJRA 4KQFA 1SVMA 1RMYA 1SM4A 2Z1NA 3BWCA 3AHCA 4AZWA 4DQVA 3H2KA 3ZVKA 3LS2A 3NDIA 2WWRA 2ONJA 4CMBA 4QYSA 2QRVA 2GLXA 5AM5A 1IBLB 3U4MA 2Y27A 2PX2A 4GR4A 1YC5A 3EZLA 1NZJA 4KRFA 3R6DA 3U3XA 2JI9A 4I1OA 1QVZA 1SCDA 4DLVA 2DKFA 4Z86A 1LXCA 1ZN2A 2W22A 3SEZA 4MQ6A 4UBLA 1FJHA 1FTGA 2BKAA 3HYNA 3WKCA 4ZFNA 2V5AA 4I4LA 5HILA 2B1RA 2PXHA 1NURA 3ECCA 2P77A 4ZAWA 4Y2GA 2HHAA 4B71A 4C78A 4EG8A 2IODA 1UP4A 2GPNA 4OXRA 1GDTA 2FOLA 4JDUA 2QSUA 5JNRA 1PDWA 3B8EA 4LDRA 4E15A 1N8KA 1FRVA 2BUBA 2R8RA 4EO4A 2EKLA 3NKVA 5BSEA 4B7AA 2YWGA 4EMUA 2BJHA 3BPSA 1N2ZA 1IHPA 2AR9A 4OIMA 5AVXA 2H1LA 2H48A 4J90A 3ETNA 3NG1A 4MUEA 3LCCA 4B7CA 4JBNA 4LXYA 2HY7A 1NUQA 1KI7A 4PS1A 1XVAA 4E5SA 1DSSG 4HFRA 1KGDA 3RYFB 2PT6A 3ZU4A 2F3PA 1VHWA 3KPJA 3OHPA 3UNXA 4BYGA 2FDXA 1V48A 4X45A 3L18A 2OORC 3UB2A 4CGYA 5C8DA 4AKHA 3Q6MA 1T1GA 2FMHA 3DXYA 3MWDA 4GX0A 1IU9A 3MNFA 2OYSA 3H5AA 1R12A 3G0DA 4Q4LA 1RAAA 4R68A 1ARZA 3RYIA 1WL8A 5C2JB 3BWXA 1RKXA 4ZOCA 1WDKA 5GOTA 1JG2A 2ASVA 3WL4A 2ZJFA 2PVPA 5M5BA 4COKA 3ER6A 4G86A 1YO6A 3KOOA 4H27A 3KYJB 3ZDXB 1LPSA 3I2FA 4TVKA 2WWYA 1KYTA 2YDYA 1NW9B 2FEXA 2IC5A 2NTEA 4DWOA 1ZM4A 3I4CA 1BE1A 3EB9A 3RS8A 2BHSA 1CRPA 5ICMA 2X2OA 4OJTA 3CLTC 2AKEA 4PLPA 3FD8A 4UUPA 2CN1A 2WIAA 1I30A 1QH9A 2WC1A 3B2QA 4HR7A 2V65A 2H4XA 4GC5A 5K3AA 3T06B 3G2IA 2VHWA 5BV2P 3S3TA 5KBYA 4UVEA 4BY9E 1JT2A 2BEVA 1T2DA 4ND8B 1JB1A 1NSTA 2JJQA 3TB4A 3DEFA 3AEZA 4GRDA 4AZ3A 2XDAA 5AQEA 1TF7A 2JGDB 2CNNA 4C0HA 2VJCA 3UFXB 4XUCA 1PEDA 3PUVA 2Y6UA 3A6DA 4OU4A 1HUQA 2B36A 2XVMA 4MV7A 2AI1A 3S6JA 3TPCA 3EC2A 4LF8B 2O8EA 3RAEC 1TTTA 3I3OA 3BILA 2OUKA 3C6ZA 4JLOA 3F5FA 5CCXA 4O2RA 1MXFA 1RLJA 2WA2A 1RWPA 1W5TA 2CJWB 1A9XB 4JDPA 4LDNA 2VJNA 1YHYA 1D6NA 4MPDA 4X7MA 3FCYA 4Z8YA 2IHYA 3U3RA 3KOXA 2I62A 2HNBA 3UO8B 1Q3KA 3B82A 1P31A 1BDMA 3DAOA 4DQXA 5CBKA 3IQDB 2PWZA 3TTSA 2X7JA 3ETJA 3HP1A 2W8BA 3KZMA 3RYTC 3CHYA 3QPCA 4FUTA 4YBZA 4KNVA 1H1LA 3WNZA 1LU9A 2ZSEA 2HUNA 3IEIA 1ZOPA 4BO1A 1GNRA 1LD3A 3QQ5A 1JR2A 1TXGA 3S2IA 3DCYA 4PSKA 1FP1D 3KZCA 3OT5A 1H5NA 4FT2A 1DXOA 3TZBA 2G4CA 3K3PA 1V37A 4EO7A 2G70A 5BSGA 3NH6A 1Z12A 1W44A 5HTOA 3BWEA 2QRLA 4HMQA 5GTDA 3M7IA 1A76A 1OHHA 4LXTA 4CUJA 4ER3A 5TQJA 3FCXA 2EKQA 1I7SB 3E6AA 2OOKA 4Z1MD 1R2QA 3ZKAA 4LY3A 4YQYA 4WVLA 4OGGA 5KS2A 2BGRA 4KMMA 3H4IA 2HBRA 1UDXA 4ISCA 4HDCA 4UFNA 1P44A 2VZLA 3ZH2A 1KVRA 2IHUA 3LUJA 1ACJA 3VNRA 4YYEA 4AU1A 5ALVA 4X94A 5K0ZA 2OFXA 3I6IA 2OKGA 4B3BA 1LPOA 2ZYGA 3DGEC 3ESZA 4P4SA 2C8KA 3INTA 5LMNB 1PNTA 3UUFA 3OF5A 2JPDA 4D7AA 3IYLW 3UJ3X 4OP3A 4QA9A 1PS8A 4E5NA 2HR1A 4AO8A 4Y2UA 1SGWA 1L3IA 1D1QA 1WJGA 3CEHA 3KTAB 1VE7A 5EZSA 4L8GA 4KXYA 5EIWA 3WISA 4EB6A 1P1BA 1MU0A 3KJQA 1ZD8A 2AUNA 2X5JO 4ZWNA 3T35A 4YJ2A 5DX1A 5THQA 1S8NA 3STUA 5TNXA 1ETHA 2GGSA 3GGOA 5FI0B 5FOXA 4BO8A 2DFLA 3BMXA 1CRQA 2JC3A 3IP1A 1V3UA 1XA0A 4IPTA 1JFLA 5KOIA 3USZA 4MIEA 2FRDC 1XLVA 3G1TA 1KS9A 1UBSB 4YMLA 4IXTA 2GKOA 4YYZA 1MMFB 4BE7B 5TJHA 1RHMA 1QK5A 1X80A 2IYNA 2OORA 1VSVA 1E0DA 3CZRA 3IUNA 3DWGA 1XK7A 4IJVA 4NCXA 1M1YB 4NK4A 3C5VA 1J0DA 4ROTA 3JRNA 4UUQA 1K2VN 3FVTA 4RKQA 4X1IA 4MUXA 4CF7A 5F7OA 2PFSA 1U3VA 4P5DA 2FPPB 3OZSA 2BCEA 1KSGA 4BFZA 3ER8A 1NBOA 2R7NA 4F5YA 1AGYA 5T4HA 4B4UA 4DG9A 4C4PA 4HDKB 3RJZA 3BIWA 3UMYA 1TYAE 3DTVB 4XB1A 3KBBA 2VQDA 2D4AA 3PDHA 4CNBA 5CNMA 2ZBPA 3AEQB 5K8TA 3KKNA 3LH5A 1R9MA 1CQIA 2FR8C 2D00A 2VUTA 4MS4A 3SF8A 5KQGA 4TN1A 4C6HA 4KN8A 2PLWA 2NYUA 5AXDA 4PV7A 5IJ9B 5JECA 1CZUA 1GKLA 2X3UA 3A7DA 1IHUA 1SXJD 4ZO6A 3OTGA 5TRTA 5GZ1A 2IKQA 1MPTA 1G0NA 2ODQA 5BYJA 1QKJA 4OQ4A 1MV8A 1WKCA 2R68A 2PCLA 3E9EA 3OFKA 3QW2A 3R5JA 4Q37A 4UEQA 1Y34E 3TCNA 4FFOA 1X2EA 2QVYX 1RM3A 5AXCA 3L8YA 3O3CA 2EBHX 3NEPX 3TXXA 1QO9A 2WPDD 1TX4B 1A4XA 3H9EO 5D3QA 1KRXA 2JVJA 2W9XA 2UUAB 1PO7A 4M83A 4JA2A 5KJCA 1J21A 1XCOA 3U26A 2Z5FA 1F5NA 1WUJS 4HKTA 1E1DA 2IPLA 4A2QA 4DJAA 2PRKA 4J03A 4CBVA 2VHJA 3HMKA 2GAOA 2ZIXB 4ZD6A 4D80A 1JR3E 1CZKA 3NORA 4GLFA 2LV8A 3LDGA 2OLEA 4O25A 4EO9A 3P2OA 1XL1A 3QW4B 1RI3A 2VHXA 3MERA 4C20A 1NG9A 4KC0A 3BWYA 2F4NA 3V8EA 4F9EA 1FDVA 4KXMA 1ONBA 3HU2A 4K87A 2ZR0A 3GWGA 4QDOA 3T5CA 5EIBC 2I4OA 3TSOA 4K9KA 3ZBQA 4B8ZA 5KHOC 4WKPA 4IY1A 4BGDA 1I8TA 2O8DB 3I9V6 3TOVA 3L84A 4GNRA 2DB3A 1RLMA 3RV3A 1DJMA 4URYR 3Q3EA 1O03A 3TNFA 3A6ZA 3UHAA 4BDTA 3SZMA 1XU7A 4E03A 4JIMA 4MWGA 4UAUA 3QHAA 3SKXA 2HF7A 2CMHA 2H65A 5IBCA 3IC5A 3WMWA 3W5VA 4BYMA 5HF6A 5A02A 4FYKA 2HA5A 4UD2A 3OU7A 3OBBA 3JQCA 1TUBB 2DM6A 4H1TA 1DGQA 4OTZA 4WESA 2XE7A 4UBJA 5EPOA 2GESA 5IDWA 2D74A 3ASVA 1Z6ZA 4L4SA 2NAPA 4LX0A 3QMVA 2CD9A 3RTAA 5KINB 4QUBA 2ID8A 2XNHA 3LT0A 3HJGA 1R6VA 3H11B 4C7KA 3KQPA 2YHIA 3HY4A 3KKEA 3C3MA 3L1VA 5ER6A 1D5CA 3LUHA 4ID9A 1LK7A 2CFSA 2O0MA 2YS7A 4CLRB 2UVPA 1XD2A 5LQDA 5A2QA 1RVV1 2FETA 4DXHA 3C8ZA 2XGOA 3G9ZA 4X0EA 2H4JA 2ZU0C 1L1QA 2ZJZA 1LS1A 1UXJA 1FFCA 3VDQA 5JAQA 4MKGA 3AJEA 1XZEA 2QE7D 1I6MA 1D7AA 3H1GA 2EJBA 4EMTA 4QGFA 2WIJA 3RVBA 4EJ2A 1XRNA 1KQGA 1EVIA 4RY0A 2VT3A 5FV7A 1EVZA 4ETMA 5AW1A 4L5AA 3VPXA 1A9SA 2YXLA 3E1GA 2JFVA 2B7CA 2CXHA 3ZWDA 5JTUA 5AUNB 4H17A 3EIFA 1Q0HA 1M6NA 4JEIA 1QGZA 4R71A 4L5CA 1IQPA 1NVBA 1U1GA 2FMXA 2PSSA 5TJ9A 5AVQA 2WWIA 5DYIA 1LLQA 1UXOA 1ZRSA 3L7NA 2I7XA 5LLDA 1CUUA 5GV8A 4X54A 3CNHA 2B61A 3IAS1 2HPAA 2H29A 3CF6R 1QZZA 4Z3DA 2QN1A 1HNNA 1PWHA 1MXHA 2I8CA 2OM6A 3HJNA 1FRFS 3T3NA 1UCFA 4G0MA 2FRDA 3TVDA 5C80A 4KV7A 3CB2A 4LZWA 2N9UA 4XFJA 3QA3E 2WTNA 4CUZA 8ADHA 3C2QA 4RGQA 4QPDA 4S3MA 4IFBA 2DWCA 3KYCA 1GUBA 1D0IA 1G8FA 2R6R1 3Q87B 3QLEA 4TQAA 5EHQA 1Q0ZA 5EIFA 5DBIA 1A69A 5BNIA 5KQSA 3CZQA 1X77A 3DUFA 3FDZA 2DY1A 4YRTA 1JHPA 2YTZA 2JJMA 5FWYB 2YWDA 3FTCA 4HZGA 1NBAA 2ZJYA 4KVAA 4XB6B 5J4VA 1ZNXA 2QN2A 1U9IC 4EJSB 5I9BA 4H4EA 5CEEA 3BD8A 4AZ0A 4G97A 5C31A 2B5VA 1WCV1 2R7KA 4FINA 3KT6A 4O4JF 3SIPA 1IWBB 1TQ4A 1Z73A 1Z0ZA 2FR8A 4I1UA 3VNQA 4ASUA 4BEVA 4BO0A 4LOJA 1F5SA 3F78A 3LZ6A 2DJ5A 3LX8A 2XA9A 3QPDA 3H2GA 3LGXA 2C03A 3OU2A 3BVPA 3KYDB 1E18A 1DO2A 3Q40A 1E66A 1W0JA 4FZ5A 2C4UA 3UK6A 5I7RA 2TMYA 1GUFA 2C0QA 3GBSA 4D42A 4F4UA 3G5MA 4HTAA 2O14A 3MC1A 4ED9A 1RPAA 1EZ4A 3ZX4A 3UV3A 5DNEA 1AS0A 1XMVA 1ZO8A 2X1MA 4XVHA 4EB3A 1F7UA 3O21A 4Q48A 5L3VA 2ZSJA 4WRRA 2GHTA 4XWOA 1AQJA 4C0WA 2XKAA 2PMFA 2Z9DA 3C7TA 3KX2A 4MW0A 4PQRA 4XD7D 2Z2XA 5EZYB 2WQ6A 3AF5A 3PCTA 2PZ8A 3T5DA 1REQA 3JQGA 4L4YA 2WVGA 1W1UA 4N7RA 3NEAA 3T1NA 3VR5A 3LIIA 4NZNA 4XVUA 2OXFA 1N7HA 3PI6A 4ZO8A 4R7ZA 4KNYA 2YYAA 2XQIA 2Z8YA 3OIGA 1VQ1A 1MABB 4JV5B 2JFBA 3G9UA 2BBTA 2Q9CA 4KDCA 1M0EA 3TZ6A 3RU9A 4HH3C 5IJ0B 2JIZA 4QWMA 2YZ2A 3BE5A 4NQZA 4QXOA 2QQ0A 3KPYA 1TQDA 4TZKA 5JSQA 4O3MA 5JYEA 2BKLA 3B5JA 1V8ZA 2BMWA 5CXSA 5F5NA 4L76A 3LLSA 1GCIA 2P9ZA 3PPVA 4DVJA 1Q7TA 4HWSA 4PBRA 3GFOA 3GEHA 1N0VC 1MORA 2C4NA 3IR5A 5JBNA 2O06A 3FKJA 4MQEA 1Y3IA 4NARA 1T8UA 2HK6A 1CY1A 3O2SB 2QE6A 3RYCA 1KE1A 3R3ZA 2ZYUX 4S2EA 3RLFA 4BIIA 5CCEA 2F43B 3KVRA 3VUEA 4JROA 3RC8A 5FHRA 3NR2A 5CXUA 3WMEA 3PDIB 1QH8B 1G21E 3QLUC 4HF7A 3EVBA 5A04A 3PXDA 3U3KA 1OYVA 2C5SA 3CO5A 1Q1EA 4Q39A 2MIIA 2WSBA 1SZCA 1DAEA 1QFSA 3G7UA 4QTXA 3ZIAA 4NHEA 1YXMA 4YIHA 4OBEA 8ABPA 1GOTA 2QD1A 4N5IX 4MHOA 2ZJ1A 3RC9A 1VLLA 1OVGA 2GPTA 3O4FA 3O7MA 1GA1A 3KJHA 3ROKA 3FPGA 2JJYA 3EYWA 1VG1A 4KSBA 4BE9A 5IT0A 4TSFA 2OECA 1MFZA 1NDUA 1QUFA 2QLJA 5BQOA 3K8QA 4MP6A 1YJCA 5A0VA 3GUHA 5TF4A 2G7MC 4E5MA 2VHUA 3OA2A 4KMRA 1VHDA 4OD0A 5AKKA 3IDSA 5IK2A 5A7GA 5LP6F 5AVYA 5DBGA 1UFKA 2YVLA 3QGMA 1LZKA 3E7DA 3IKMB 1CQWA 2CHGA 2D2VA 2I1VB 2PX8A 3H5VA 5LQRA 4OLAA 2XDWA 4TWJA 3HCWA 1TI7A 1EB9A 4Q6WA 3S7ZA 3VAAA 1BGXT 2DR2A 4XQ9A 4RJKA 4G1EB 4JX9A 1PKEA 1RXSA 1TLFA 2WWTA 3MMSA 4CEIB 2ROQA 4O4LF 1IEWA 1UM9A 2Z8XA 3ICVA 5JDCC 1FMLA 1OB5A 5HMLA 3DM9B 2QGNA 2CVQA 4HEJA 4F72A 4N18A 4BPBA 3OT4A 5CDSA 3VU9A 3ZE8A 2V5VA 1JE0A 4FDTA 3HCEA 5JZ9A 4UTNA 2V5UA 1AHPA 3N8IA 3TRDA 5CNKA 3G9QA 1NFFA 2QTGA 2PGLA 1D04A 5FTWA 2W58A 3ZCVA 1QV9A 3WK5A 3WK8A 2E49A 2J3JA 1BOOA 3BZBA 3ZCPA 3U7HB 1F4LA 1NTOA 4G9EA 2PMKA 1ZJ6A 4M1TA 4WA7A 5DM1A 1ZDMA 3PBKA 4EEZA 2XE4A 4LJRA 1PI3A 2CCKA 1H5UA 1U9IA 4KPUB 5EKSA 3D3QA 4FLFA 2PO5A 1EGAA 3WL6A 3KU1A 3L4SO 3MWKA 2WOOA 4DCVA 3LOPA 1EI9A 1CEQA 2PS1A 4CETA 4WLFA 1RWMA 1QP8A 4CIVA 3AEUA 3D6UA 2AHRA 1HE3A 4C08A 5DNUA 3G8AA 5FUYA 3T9BA 4BTLA 2J59A 4G1MB 4O8CA 5JARA 5E7IA 3U4IA 4OLBA 4YV7A 1W46A 3Q3VA 1FUUA 4JJ4A 1EWKA 3GVPA 3FE2A 3OPYI 2JDID 1YZFA 2QVZX 2BH2A 4DQ0A 4D4IA 4ACAA 2M32A 3BIJA 2ECQA 3FRHA 2MSLA 3OZIA 2VJOA 3QUAA 4KXLA 1QR6A 4LMPA 4ZT6A 5B3AA 3RT7A 4EJ0A 2BEWB 3ILSA 1FNSA 2JA1A 2K2QB 2QUBA 3K05A 4JSYA 4RKEA 4NK5A 4OMFG 1FK8A 2ZAIA 5IEJA 1S1MA 2O7VA 1Q7GA 2RIRA 4MS3B 3RB8A 2WB4A 1L1EA 4CQMB 2HA2A 2R7LA 1K5DA 2XIQA 4MWEA 2IW3A 4LK3A 4W5JA 3KRTA 3WA6A 4AULA 4DMHA 3RKSA 4DDWA 2ISQA 1NLUA 1UBNA 2NPIA 4E5PA 4TQGA 3NBUA 4LA4A 5CIYA 4ENRA 2G1UA 3VR6A 3HUDA 4J1NA 4E5UA 4UVHA 1XPRA 1JE1A 1N8TA 4H59A 1GARA 1TCBA 2ZBDA 3MT8A 3IKTA 1FIUA 3HO1A 5ARCA 3KJXA 2BR4A 3OZBA 3TQCA 4J75A 1ES9A 2ZU6A 5L6LB 2VT2A 1MEEA 3F74A 1ZRHA 2YV3A 4IYRA 4PLHA 5A1JA 2XB2A 2G08A 4JXZA 5JSFA 5EVCA 3LA6A 4R2MA 4JQCA 2J4FA 4R1OA 3FFTA 4GPD1 5T5QA 4XYEA 3CB4A 2E5FA 3MWJA 5EKDA 1U63A 1QNLA 4PO3X 2C9DA 3CT4A 3E9QA 3MRTA 4PQEA 4GMXA 1EJ2A 1QXSA 2BOVA 3L6BA 4R8LA 4DIDA 4RTJA 1V95A 1K7XB 1WXDA 2JIPA 3D1LA 4BOYA 3P2JA 1KZGB 2ZUCA 1U9YA 4R40A 2JFWA 1Y80A 3LPAA 3QLUA 4R1MA 5EHXA 4QFMA 3UN1A 3KZOA 1ODKA 1M10A 2NTYC 3CLUD 3FLMA 1EAYA 1QF6A 3DBRA 3I53A 1K7FB 2EL9A 4PLVA 3N8NA 1UAAA 3QX3A 3MN1A 1KJNA 1KO7A 3EXHB 4E4RA 1OTYA 2AIRA 2JGMA 2GA8A 3X1XA 5AW6A 1D2NA 3H4MA 1Q77A 1FZQA 1PNOA 1JBEA 2ZETA 5D5HA 2PMCA 5IJAA 1R74A 5AW7A 1OFIA 3TFOA 3K7EA 1KHTA 2XYHA 3IS3A 4PG4A 2QTTA 1KOLA 5I9TA 1FU7A 2HZBA 1KAOA 3QEKA 3UAOA 1T9DA 3HKBB 3ZWXA 4RLQA 4FGZA 3ADOA 4MEBA 1S7GA 4N3NA 3VM6A 4UJ5A 4AP6A 4BCBA 4WFJA 5LYJB 1P2DA 2PYIA 1A5AB 3D0OA 2Y1LA 2B25A 1Z4OA 1U98A 1OZFA 3FMGA 4J7AA 5JDCA 2I66A 3H19A 5E4FA 7REQB 4TUYF 1MKYA 2EFYA 2GPJA 1CRZA 1CQPA 2VZ9A 3T4EA 4WBNA 2JBHA 1N2CE 2G71A 3KNZA 1GL3A 2O3TA 4N8EA 5EY5B 4I3HA 3ET5A 4N0MA 4KWTA 3X1DA 3G5LA 1FFXB 1JU9A 1LWOA 1CY8A 2JZCA 4FMDF 4RSRA 1DAFA 1GFZA 1BJTA 2OD9A 3QHQA 3A6PC 4H7EA 2ZIFA 3AR7A 3P4UA 4F96A 4S1TA 2VA8A 1JDBC 3O8DA 4NYJR 2GLTA 3LBYA 4G0NA 4ENTA 1U0GA 2J45A 4DY4A 2O3QA 5GVRA 3GP3A 1PVDA 1NMSA 1PWYE 2D7CA 2PZFA 4IS2A 4S1NA 4RH1A 4C29A 1Z29A 3AVYA 1QFMA 3FZNA 2BPOA 4FKMA 2RGNC 4BMXA 5E8JA 3ROQA 4UE2A 1PK7A 3TRIA 4RD1A 1LBQA 5K7SA 4C0QC 1XCLA 1Z68A 3E1SA 3NHYA 3NT4A 4PPNA 4XLZA 4B6JA 5BN3B 3FIJA 4YT2A 5HJ5A 1RRCA 1U9ZA 1UOOA 2GF0A 3HUTA 4N49A 4NZMA 2CT8A 1SIWA 2JI8A 4FSHA 3EXG1 2VRBA 1Z5OA 1A3CA 1YHZA 4OFWA 2P4QA 3L9WA 3G8CA 3GNQA 3QQPA 1JV2B 4LRTB 3UQZA 2NSHA 1VHQA 4XOUA 4OI0A 1OTXA 3AUAA 3CCCA 4XA8A 1EK6A 3TDMA 2C4KA 3FCAA 2P9JA 2C5HA 3FF1A 3HN7A 1OWMA 5BMVF 4IJ5A 4J0KA 4BNLA 4CFYA 1I2BA 2YV4A 3TFWA 1BCSB 5AUOB 1U1EA 2BH9A 1SQ5A 4OQPA 1KOFA 3U31A 3CKYA 1N5LA 4R2JA 1L8LA 4JX8A 1JKXA 3K4HA 5EP1A 4EVRA 1NVFA 1RI2A 1FOEB 4YTEA 2BFMA 3F73A 3I5AA 1JQEA 2ODWA 1VGVA 3HDJA 5JZBA 4OLFA 5ALYA 3WKAA 1XCGB 4DNFA 3K9FC 3GDHA 1YAHA 4QPPA 2OC4A 3SEAA 3IEMA 1Y98A 3I45A 1EMDA 1RKUA 2ZTSA 1AKUA 2XUJA 3NLLA 2CVOA 3GUVA 3MB5A 3VDRA 4I14A 1EHYA 1Y8QA 4INPA 4F60A 4HBZA 1E9EA 3BD7A 1RJGA 5F3RA 3SZLA 4X66B 1VMIA 1PT5A 5CA0A 3VHQA 3SSNA 3T3EA 3RNLA 1QOQB 1LKZA 1CUDA 2I3BA 4HGOA 4Q4HB 4PX3A 4DUYB 2XHZA 3OKPA 1HRKA 1JLRA 1JSCA 1Y8CA 4MCJA 1DI0A 3BMNB 3WIOA 4GYKA 4E0BA 2H0QA 2AA3A 3HKCB 3QVVA 2COEA 1GT91 1IXKA 1ECCA 4IHJA 1GHTA 3P0JA 1TM4E 3L6UA 4Q9DA 2WUVA 3KK0A 2WP0A 3O3MB 2BFEB 4BJ3A 4X6LA 1EP1B 1KORA 1EIWA 3DE7X 3SC2B 3L0PA 3W3AH 2PKWA 2Q0HA 3LDUA 3VYTB 1I2DA 3ZD9A 1KJ9A 1Q12A 1ZRMA 1PG2A 1U5CA 5KWIA 4MUGA 1WRBA 1E5TA 3COPA 2OO5C 4GPEA 2FCRA 3I1IA 3D0QA 1UANA 4IIYA 1P8JA 2WSLA 4II3A 4B43A 4XM1A 5DB4A 3QITA 1CW2B 1GPAA 3FPJA 4DT1B 1O5IA 3S40A 4E5VA 1UC4B 1ZJZA 1P1RA 2P41A 2XLCA 2EFDB 1SJ9A 4D1YA 4Q9LA 3C85A 4UUAA 3NO4A 3WWDA 3ZGYA 1N2EA 1IVYA 5I4BA 4OMCA 1P2GA 2ZBFA 1BVHA 1E63A 3DVSX 3L8MA 3KD2A 4PZ0A 3C24A 5EMMA 3D6AA 1HH4A 3UMCA 1YS2X 2NUBA 2FXIA 3E70C 2ADMA 4TTSA 1E2UA 4B6EA 4BV9A 1UPFA 3JQAB 4A27A 1BN6A 1QGYA 1FMFA 3L1UA 1J7JA 2G9QA 1T3SA 2VDVE 4Y9UA 4CLOA 3E9MA 3B78A 1IUPA 1EQAA 2P9QA 1IY0A 5EMJA 3HDQA 1FMCA 3SIWA 5LQNA 5HYVA 3AEKB 4K6MA 3L7BA 2IZ5A 4NBUA 1V8PA 3LYLA 3D1JA 1I9GA 4DBLC 4JLPA 3N39C 1JF8A 4CKWB 1M8JA 2PR2A 2R6HA 2JASA 4BP8A 1SOVA 2ZB8A 3O03A 5I8WA 1U7TA 2XUOA 4HWKA 1A0OA 1EINA 1V11B 2UZAA 2PRSA 3OTWA 1SG6A 5HKKA 4LS3A 4OXKA 4NZZA 4YALA 3T0FA 1NV9A 2I3ZA 3LF2A 3LKDA 3P0EA 1NHWA 4FJ2A 4NIMA 3DEJA 4K9MA 2RGNA 5LXTF 2HMSA 5G4LA 1TFRA 5FFNA 4ZT4A 4KMSA 2A1IA 1RPNA 3S2EA 3CVXA 4HWOA 3OJFA 1GUDA 1XUOA 2JFXA 1PHRA 1FYFA 3KAPA 3R09A 2VJLA 5DHQA 1JAYA 5LZ8A 1KEWA 8AT1A 4N5HX 5DM2A 2BZ0A 1JB9A 3LVRE 5IN4A 4GX2A 2W6MA 5ALZA 4QX6A 2PS3A 3TIGA 4J0GA 2VAVA 1YUMA 1J8DA 2BTQB 3V32A 7YASA 1RM0A 5CD1A 4F4HA 4NBLA 1NUAA 2MYUA 3E84A 3T1OA 1DNPA 1N78A 2C9ZA 2NGRA 3NTLA 4NCBA 3TSZA 1KSFX 1RJDA 1T3GA 3P4XA 3QVGA 5FTMA 3OZTA 4Q1DA 1VKNA 2RHTA 5EG5A 4TXLA 5KVSA 4UMDA 4AYTA 1Z5NA 2CWDA 3DXXA 3M6MD 1FC0A 5AKZA 1XRPA 2F90A 1KVTA 1E3MA 4R0NA 4WECA 2Z95A 3F6SA 4FXOA 4F38A 4LWPA 3T5TA 3N2GA 4WCFB 1IIRA 2NPFA 4XQGA 1RFGE 1NVMB 3JQQA 3M4NA 5B64A 1N6PA 3KYIB 1I3LA 3O8OB 2ZVPX 5U4XA 3SR0A 2BMJA 4B3RB 2QJRA 3M9XA 3GGPA 3MD0A 4QYXA 3MGCA 3LP5A 1PD0A 4FIDA 1U6IA 1TVCA 2LPMA 4HNQA 5EMNA 4CMEC 2PJDA 3VYUB 4TYWA 4N9QA 1E9FA 2PVSA 4Y2HA 1L5GB 3DNFA 3CN9A 1WQ1R 4RACA 2EIHA 3DFMA 2DWUA 4EHLA 4F2WA 1M2OA 5AOAA 5E95A 2FX5A 3W4IA 5KSZA 3EF1A 2E6KA 2OV3A 3QOYA 1T4BA 4M38A 5DX8A 3LDFA 5C4GB 2FZGA 2VRCA 3KQMA 1XTIA 1H2RS 2V9CA 1M7GA 1QHNA 1HZJA 4IIGA 3GLVA 4TMFA 3AB8A 3TN7A 1Z6GA 4II2A 2QQFA 2JCVA 4BO6A 4BXOB 1ZCJA 2FFQA 4QOHA 2QL5A 5LLSA 4TT3A 5AW3A 2IZOA 3OECA 3PNBA 3E8MA 3K94A 5ULLA 5JCZA 4ZYZA 1JHAA 1WZEA 4MW7A 4BMCA 2AXEA 2O1WA 3IEUA 5ELMA 1PJ8A 3GV0A 4F4CA 1SD1A 2QXTA 1SCUB 2IXFA 3PT9A 3TINA 1H2XA 1GADO 1WD7A 5E2BA 2ZYSA 3WS7A 4BCCA 4NPHA 4IINA 1OZGA 1DEOA 1N6NA 1ZXBA 1KKUA 4HGPA 3WKEA 2FPMA 2G80A 1EVJA 2CCJA 2J6HA 3EWIA 4ZEWA 4JI0B 2FMKA 4NE9A 2OO5A 3NGXA 4YI5A 4KE6A 3THOA 1K9SA 3NBMA 3WWOA 4B73A 4WDRA 2P0AA 3BQ9A 1NFRA 1VLMA 1ZK2A 4HDMB 3URKA 3H5RA 4HQNA 4WCVA 3RVOA 3D5EA 3EC7A 4KWIA 2K7FA 1OILA 2MSDB 1J6UA 3E5MA 3LWBA 2XUIA 2ZDGA 2QMZA 4J0QA 4C07A 3MUFA 1G18A 4UJ3A 4Y7DA 1WHSB 4WOJA 1HEUA 1DUIA 4K28A 4RAOA 1MHTA 1PNQA 4Y1GA 3ZVMA 5FNVF 2COUA 2WQZA 4G63A 3A10A 1GAEO 1PR3A 1QHGA 1F3LA 1N5JA 1VKRA 1OLXB 1TJPB 3AL2A 3NBYC 4E6EA 2XVXA 1JZQA 2FWJA 4L57A 5TMEA 4EHHA 1GUAA 1IUOA 2A0FA 2REXB 2ZBGA 1UK7A 2IA5A 2IYTA 2Y1KA 3DKVA 2V03A 3HKEB 3O1IC 4IIFA 1L5WA 5DTMA 3WWCA 4GU5A 1R6TA 1NQXA 1DJPA 3MAAC 4KODA 1KFEB 1MC8A 3T1TA 3F90A 2V7QA 4ZCQA 1L5HA 3H9QA 1OHHD 4RJIA 4EPXA 3OJLA 1ZW6A 4FWBA 2ZIZA 3BWDD 4G23A 3I73A 1U65A 4AF8A 4R98A 1JXAA 2PD6A 3EIEA 2WJHA 1V1MA 3ECAA 4YN3A 1G16A 5HQ3B 1DXYA 2FPKA 3KETA 4V0KA 1P1FA 3BQNB 3DE6X 4EARA 3WNCA 4B6FA 3V48A 3L49A 1NXSA 3X2EA 1Z6XA 4NAVA 3UG7A 3CPSA 1IN4A 2AW5A 4KTTE 1FX1A 5AKEA 2KWIA 3RSQA 1AXRA 1IUNA 3WRVA 3GG9A 1O5TA 1UMBB 3EFBA 5DBHX 1A8PA 4D3XA 3K35A 4JASB 3WLNA 5JSUA 2VBIA 5I9IA 3GNLA 5L3QB 4AC9A 4RCZA 4DDKA 2C5FA 2OD2A 2J33A 4I66A 4GPZA 2OFPA 4W99A 3RIHA 4DSUA 1LLCA 1QVRA 2EP8A 1Q15A 4DV4B 1AXGA 1Y3BE 2AG5A 3L0IB 4BE4A 4RTLA 4JLKA 1UBCA 4S24A 1W6RA 2CSUA 3DS8A 4XQ0A 2R1ZA 3COJA 2GN9A 2IZZA 2SNIE 5K6RA 2P4HX 2FTKE 2R6JA 2Q3JA 4IIDA 5SYAA 3V8NA 3L1IA 1TVKA 3VO8A 2PGXA 4A8PA 5JC1A 2OB1A 2Q3FA 3I8SA 4D79A 4PANA 2ZKIA 4GZ6A 3KZKA 3C98A 4J4TA 1EVLA 2FRVA 3QOWA 5F5XA 3OFSA 4IDQA 4MRVA 4W5QA 1SVOA 4AB1A 3UPUA 1NAIA 4ZHQA 1TIPA 2WAAA 3G6WA 4IEEA 4HOYA 1M1UA 2CNWA 1PLKA 1GRQA 1XDZA 1QGUA 4OPMA 2QX7A 4HNAB 4PC3A 4W7SA 4C0XA 4BJ6A 4DZZA 2JNWA 4NH0A 5JSYA 1E9VA 2JCYA 3U44B 5HKAA 1R27A 2HQOA 4XCXA 4FHEA 2ORWA 3Q7TA 4KYTA 3T7TA 4CMEA 5EJMA 3AR9A 3JQRA 3AKZA 2B3TA 5EJEA 1XKLA 4ZIRA 1M2HA 5LDGA 2NO6A 4QDKA 5I7EA 4JBYA 2GHRA 4V0SA 1W73A 5E9QA 4EGCB 1XGKA 3RUEA 1DIOB 1OX4A 1UJBA 4F3KA 4MRRA 1WBDA 1QVAA 5BWCA 1DAMA 1YULA 3FWZA 1M67A 3IH5A 3VC2A 2H5EA 3K31A 4DFDA 1H23A 3HYSA 3RIEA 2HW8A 1U7PA 1K8XB 2XE6A 3N8GA 4LOAA 4Z6KA 3HXMA 4D26A 1CE8B 2Q99A 2W48A 2I78A 2VTVA 3AF1A 4D9CA 3O38A 2Q1SA 4UM7A 4B0OA 9GPBA 1WB9A 2UDPA 3CLTD 2Q1WA 4YK7A 4BKOA 4CDGA 5A4DA 2OYCA 2M9MA 4ZKEA 3ER9A 1C0EA 4HGRA 2AYYA 5BW8A 1NDQA 2Q46A 4P2BA 4LISA 4PPFA 4KQMA 4MHSA 5SZHB 2PLNA 4D3YA 4P3NA 4JN6B 1DHRA 5LZ7A 4LRYA 4Z9FA 4RMJA 3QLVC 4EUNA 4W5TA 3CSUA 4B09A 5J5AA 1E4YA 3EZYA 2G8NA 3BBLA 2D62A 1Y1LA 4GM4A 3S8MA 2WNSA 1C2YA 5E4JA 1D6SA 1N6IA 2IYRA 1WVIA 3I34X 3THSA 1S2GA 1TCAA 4FJ1A 5CHYA 1NP6A 1N7JA 4KIJA 5DV9A 3ABRB 3LU1A 4JKOA 4TKLA 3M5DA 4LJ9A 1BH2A 2HM7A 4PSAA 5K6TA 4KXFB 3OLWA 4U9UA 4DR5B 3EA5A 3BM5A 3ESRA 4AG5A 3N59A 3O8NA 4YJ3B 2A9JA 5FOSA 3ZHBA 3SFZA 3ZY5A 3E1KA 1E1NA 4ALMA 1IOVA 1G3QA 2BTOA 2F1RA 2Q4OA 3LKVA 5HGJA 1DC8A 1VA4A 3BRSA 3GP5A 3JASB 1Z6AA 3O74A 4G1CA 1QMGA 3KFLA 2VR1A 5LP6C 4M55A 2FWNA 1F8YA 2QIOA 3FGZA 1XZIA 2AFRA 4QU8A 1UXKA 3FH0A 3V1TC 3IAAA 4YRIA 3RS7A 5IF9A 4Q93A 2X2FA 2VQSA 3H97A 1GSOA 3P1JA 1W9HA 4UTOA 5IBQA 2XMDA 1JVNA 2NUPA 2B6HA 3CNQS 3GEEA 1YJBA 4O3FA 3EDQA 3L7YA 4XJTA 5J4KA 2VH5R 5ENDA 1MVNA 1JKJA 1XT6A 1KI8A 5EFZA 2PNJA 5CYGA 2VF5X 3Q9UA 3RHZA 3W9UA 5U4QA 3WI7A 1D09A 3WP0A 5KI6A 1HYGA 3WLTA 1RI4A 3BAFA 3LKBA 3NTRA 1Z4QA 4HQKA 3D9QX 4RL4A 3ENZA 3L7CA 4YV2A 1JJIA 3W1WA 4OVKA 1BYIA 3R7SA 2HMUA 3D0RA 3V2HA 4DABA 3MB8A 3DO6A 2ODEA 2NU7A 3I2JA 3KDPA 4NZYA 4ADSG 4CFZA 5AW4A 2CL6X 2NQTA 2YYZA 3ZHYA 4KR9A 4B44A 1XAIA 1QP0A 3WLIA 3IEXA 3L07A 3DPUA 1EU1A 4DEVA 1PSDA 2OBFA 1Q1AA 2E7ZA 2QT0A 3EBOA 1SMKA 3ZR4B 5DYGA 1IQUA 3CUKA 2G25A 4N8SA 4CTKA 3BOSA 3UMFA 1INLA 3QPWA 1U0JA 2Q5LA 3KYBA 3V2IA 4BLUA 4KYUA 2ST1A 4HDRB 4UD6A 4O4JA 1QH0A 4NH4A 1TPZA 4FDMA 3C6QA 1K6EA 3H75A 4OGLA 1ESDA 1UKEA 5AK5A 3LX6A 3R5KA 3KP1A 4Q82A 2PXXA 3ZLTA 4CKCA 2PWPA 2ZTUA 3IAM1 4IVNA 1NSYA 4S1WA 1K6XA 5MHTA 3MS4A 1UT6A 4FFMA 4FYYA 5BRAA 1KO1A 3UC5A 5D5PA 5JYCA 1SQGA 2HNAA 1L5VA 1RNLA 3AYZB 2IP1A 3IPYA 3MUEA 1RKQA 3OY2A 4HYEA 2BEUA 1JLHA 4AWXA 5BN1A 1HEIA 2I4NA 4TX1A 2GJKA 4ZRDA 3WE7A 4WJKB 1H42A 3PDCA 2YIMA 1VHLA 3GAMA 2NU6B 4E3WA 3KB8A 2CLLB 3HDTA 7ADHA 5FBZA 4R51A 5A7FA 1V7ZA 1D4ZA 4NPCA 3QFTA 5HS4A 4ZTUB 5CBPB 1ORHA 3OHMA 2X6TA 4FW8A 4EMBA 3H18A 4MRNA 1QIKA 3CLRC 5BPFA 1EFVA 1UXIA 5JH7A 1C3OA 4L3VA 2Q21A 2RGGA 3K2QA 1F20A 1SQSA 4GMGA 5BQ5A 3WQRA 3QX7A 1I7NA 1U8UA 2E4WA 5F9MA 2GNPA 2LCFA 4P5PA 1YCHA 1NBHA 5E6SB 3LTEA 3T9FA 3GH1A 1AKMA 1U2TA 1ZONA 2PXCA 4KN5A 2G1AA 4LHYA 121PA 4Q3BA 5U1PA 3UH0A 4JT9A 2QUJA 1F9AA 3KVOA 5KYYA 2XJ9A 4V2IA 4HDNA 2PRYA 3D6JA 3LJKA 3N7AA 1TC1A 4HAIA 4UOZA 2KW5A 2APJA 3PX7A 2XEXA 2G82A 3M3DA 1I1NA 1XZBA 1C0LA 1E5DA 3EMVA 4ASUD 3L7MA 3E27A 2JRLA 1MAHA 3HZHA 2JZOA 4H60A 3P9QA 3LQQA 1BS2A 2Q5EA 4QE3A 1UK9A 1W0JD 3ZDEA 1VLHA 4J76A 5JCOC 4PF1A 1Q7CA 4HDAA 4NPAA 3TDNA 4XPIB 5L9AA 1BCRB 2NUAB 2O2GA 2P9FA 1R0LA 4U2FA 1RQPA 2FU5C 1CFZA 3N3BC 1Z88A 2CYBA 5FWDA 2RK3A 2GPSA 2XMBA 4P4LA 3TK1A 1R18A 2O7SA 5JXHA 5C3MA 1SU4A 3JAKA 3QLVA 5JZMA 3M9LA 1ZC3A 3ICPA 2VQ3A 4M0KA 4IIHA 2I4TA 3VI4B 4DCJA 3MIZA 1QKKA 5K8VA 2IY7A 2YJ3A 3WGOA 2J9RA 2FWBA 1FJ2A 2VAPA 4EYKA 1JXOA 3VR5D 4QAQA 2GEJA 3I01M 2BF7A 3EK2A 1QOZA 1UXGA 3PFNA 4O0LA 5DGHA 5JY1A 3QIAA 1MX1A 4HUJA 1P62B 1QG0A 3DNPA 1XK6A 5FORA 4DSOA 3OO1A 1HWYA 1GFIA 4UHJA 2VWHA 1S3FA 2FJPA 3NHJA 1Y3HA 5TPZA 3JQ6A 2VC2B 3R0ZA 4LYHA 1YR1A 1GA4A 3N75A 1UBGA 3JAWB 2JIZD 5DCWA 1EJ0A 5EIBD 3IOEA 5LP6A 2YHSA 2X5NA 3VC3A 1BEZA 2PANA 1BS1A 4OQEA 4DIMA 1XPUA 1UXHA 4UHDA 1N6LA 2IE0A 2MU1A 3ME5A 4RHCA 1R0YA 1E5QA 2V45A 3SOPA 1DL5A 2R47A 1XXHB 5CURA 5JPDA 4LFAB 2O8FA 4MA5A 2VL7A 5CPFA 4NOLA 3ZZUA 2P0EA 5CG2A 2H08A 3BXGA 1MJGM 4DPKA 2DHDA 4GDFA 1YTUA 2WNHA 1Z47A 4LYJA 2WG2A 4FYJA 1TCCA 5ECGC 3JD1A 1HFKA 3EQZA 1QB8A 1ORVA 1VB3A 2AFHE 2AH5A 2HHLA 4L2IB 4Q9AA 5JSKA 3T3PB 3VPCA 2FF5A 1WV0A 4J9VA 3C1OA 1Q0UA 2YUTA 1B7GO 5B1HA 2WAXA 2WHPB 4US0R 4FMCF 1WDMA 1GPLA 2O5RA 3AI3A 5GZ3A 4UM9B 5B12A 3TQIA 2WU3A 4KQ1A 2VJMA 3LNTA 4MW9A 3ZIAD 1Y6GA 1AIPA 2HU8A 4EKEA 3N0VA 2O23A 1OSNA 4X84A 4FFRA 5CEJA 2Z58A 3H1BA 2F17A 2K2WA 3I8XA 1KQFA 1WY5A 4QQFA 3JV7A 4UUBA 4UASA 1IXRC 4TSFD 2BBOA 4YRJA 3P9XA 4CCWA 1EEXB 1MJNA 4IIUA 5G1OA 4K6HA 1DFIA 3W9SA 2W0MA 4Q4DA 3W7BA 5IK2D 4LJ8A 3TAHA 3TPFA 5K0GA 3SIRA 1AB6A 1YQ9A 2P6UA 4QSHA 5EE1A 2I2DA 1L9KA 3ERCA 2YIVX 2I1LA 5EWMB 1QRSA 3F7NA 3