1IUOA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with acetates
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
272
structure length
272
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords meta-Cleavage product hydrolase
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 103
structure length 272
sequence length 272
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iuoA00
3UUFA 1SOMA 2QJRA 3VISA 4BYMA 2R11A 3K9BA 3H1AA 4QEKA 5HKAA 3TGLA 3ESAA 4S0XA 4EA6A 5FV4A 4EY4A 4BCBA 1NU8A 2GBCA 3IVMA 4QE3A 1EB8A 2O2IA 3VVLA 4BVJA 1F8UA 1C7IA 5LKRA 1VLQA 2DHEA 3GZJA 5DNWA 2VATA 2WFLB 1QIFA 1QIJA 5HFAA 2BJHA 3MVEA 4CI9A 4X6YA 4W1QA 4FLEA 4K5QA 1CUWA 4BVLA 1U2EA 1X2BA 1BEEA 2G4LA 4MQLA 3DCNA 4B81A 3KSRA 5FPQA 3WK5A 3ICWA 2O7RA 5JZ9A 1EINA 4J3JA 3RM3A 4PW0A 3O4GA 4H77A 2WM2A 3VJMA 3WJ1A 3W06A 1U8EA 2Y6UA 1XKTA 4CIBA 4WY8A 1CUSA 5ALGA 1P0IA 1YA4A 4Q34A 2WLSA 1QTIA 4RGYA 1IUOA 5ALVA 3GUUA 1JI3A 5JATA 3EQ8A 5AKXA 3C43A 5ALNA 4DTCA 4H7EA 4KE7A 3I1IA 1SFRA 1ISPA 1H2WA 5AM2A 4BRZA 1SCKA 4BE4A 5AKEA 4BTVA 2RI6A 4JNCA 1R50A 3FOBA 2VAXA 2XQIA 2YXPX 4QWWA 1WHSA 3Q0TA 3O4HA 3ZLUA 5SYNA 3A2MA 2XB6A 4C4YA 1DX6A 3R3UA 4BC1A 1XRMA 1CUHA 4AO6A 3WWPA 2H7CA 5JZSA 2JGKA 4HZGA 2FJ0A 5HFNA 5HF8A 2OXEA 1CEXA 1MT3A 4MYDA 5DNVA 1VZ3A 1FJ2A 4GECA 2YH2A 3O95A 5ESRA 1XZDA 3VDXA 2PSHA 4DLNA 1M33A 3WKAA 3PDCA 5CH8A 3I28A 4BZZA 2BGNA 3QPDA 1UKAA 3O4JA 5AI0A 4X95A 3K6KA 1XZLA 3BJMA 4RPCA 1YB6A 5EHXA 2ZJFA 3DOIA 1AQLA 4KACA 1OXMA 4DNQA 4UBIA 2IIVA 1MNAA 5ALQA 4QDTA 4X00A 4G5XA 2XMSA 3NUZA 5AK3A 3WYDA 1EVEA 5AIBA 3HYSA 4G8DA 4H7KA 4X3CA 1F0PA 3R3WA 5AKIA 1TQHA 1XZGA 1YAJA 2XQGA 5E4YA 5LZ8A 2RAUA 1TAHA 3PFCA 4X91A 1R1DA 3VJKA 2HA2A 4XIIA 1FSSA 2QVBA 4B9AA 5JANA 1XQWA 4OYLA 4DNFA 5K5EA 3DOHA 5DYWA 1Q84A 1XLVA 5KREA 2BFNA 4X92A 4BDSA 2ZSIA 5IVHA 2GYVA 2WG0A 3RKSA 5DTIA 3KXPA 3SWWA 2H7XA 2O2HA 3WMRA 1ZD3A 4J0HA 2XUGA 5BOVA 2PSDA 1DT3A 1JU3A 3G9UA 4ITVA 3DJYA 1EXWA 2QUAA 1VA4A 1Q0RA 3PE6A 4PSDA 2B4KA 5E2IA 1ZICA 4KE9A 3NGMA 4W9RA 3C87A 3AFIA 3B12A 2Z3ZA 4G8BA 5D6OA 4U2CA 1R9MA 7YASA 5CURA 4J7AA 5A6VA 4C88A 2QR5A 1DQZA 3QMMA 4G4IA 3PICA 1CUJA 4BDTA 2JEZA 4LYDA 2ZVDA 1DWOA 2XMCA 4IHAA 5HKBA 1DQYA 5C7YA 4M0EA 4CG1A 1GQRA 2R8BA 4U2FA 4EUSA 4N8DA 5AKKA 4YK7A 2BAGA 4QA9A 1CFJA 3W04A 3O9MA 4UHBA 1UK8A 3FLAA 3H2KA 4Y2QA 4N8SA 4IH9A 5T4BA 3F9CA 4WFIA 4QWMA 1ZI6A 2Z8ZA 4KRYA 3DLTA 4U2EA 4F0JA 4QDXA 2ONCA 5CT5A 4I19A 3I6ZA 2Z5GA 3CCBA 3I2JA 2PKYX 2K2QB 5CT6A 3DL7A 2JGIA 3MGAA 5EIHA 1ZOIA 3FYUC 2XUJA 5AI6A 3HC7A 1EDEA 1XRRA 1K4YA 3K2IA 2OG1A 3N0TA 2WKWA 2BKLA 3R3ZA 4B6GA 1GPNA 2J3QA 5EGNA 4X93A 3WIBA 3V1NA 1X70A 2DQYA 4FFVA 5ALTA 4Q82A 1AURA 1QZ3A 1W52X 5YASA 1IMJA 3GROA 1QO7A 4N8EA 1D07A 2WTNA 1H22A 3FCXA 2OGTA 4FHZA 3DEAA 1A88A 3R3XA 1XZKA 2PSJA 2HA7A 1QO9A 3D2AA 5C8VA 1H23A 3F98A 1JFRA 5AKYA 4GEGA 4J0CA 2PU5A 1UK7A 4GI1A 3D5EA 1HL7A 4K2AA 1MNQA 3WK6A 5JARA 5CT8A 4FBLA 2B20A 4UUQA 5ISMA 1E8MA 2WUEA 3DNMA 1ZJ5A 3D2BA 2V9ZA 1N1MA 3TRDA 1BRTA 3O9VA 5AKLA 5A2GA 5DJ5A 3OTQA 1LNSA 3LIIA 1GT6A 4BVKA 5CW2A 1XZBA 2OGZA 3I2FA 5HF9A 2WU3A 3R3YA 3GELA 5T4HA 3V48A 3HXKA 1XRLA 4OSEA 4HS9A 1K8QA 1XZAA 3WL7A 1L7AA 5AICA 4G9EA 3WZMA 2HM7A 3V1MA 1NX9A 2QUBA 4DSAA 3G0IA 3D59A 1UOQA 5DYTA 3WL6A 4NVRA 4QLAA 1QIHA 5FDFA 4G4JA 2XI4A 3QM1A 1TCAA 5E4TA 4B83A 4J0DA 4BBZA 1DINA 4GXNA 5LZ7A 5AM3A 3WJ2A 2ZYSA 4Q3OA 5LLSA 5HF6A 4OUKX 1N5MA 2DCMA 5AK6A 3WZLA 2VQ6A 5JASA 2XMZA 3WL5A 2XUFA 4BB0A 5ALSA 2C0PA 3IA2A 2OCIA 1N8SA 1B6GA 5DYYA 2B61A 5K3DA 3FWHA 2HFKA 1WHTA 4Y2UA 3ICVA 2OCKA 2V98A 1XQYA 4KAAA 5ALMA 3W2TA 4UPDA 1UFOA 1E8DA 3WWEA 4AO8A 2OQIA 4AN1A 3N2ZB 2XMBA 5HZGA 1BCRA 1XRQA 3KWJA 4XJVA 3BE8A 1JMKC 3DL4A 1XRNA 4ZV9A 1Y7IA 5CH5A 4EY7A 4UBNA 3IUMA 3FBWA 3S2ZA 1HDEA 3H18A 3WK8A 2RHWA 2WFMA 4MXDA 4P93A 3ANSA 3I1YA 3R0VA 2VT7A 3G9XA 1YR2A 3BDVA 2CJPA 4BRSA 2WUFA 4BAUA 2PX6A 3H2JA 1BCSA 2HIHA 1ZI9A 2H1IA 5FP0A 4ROTA 1C7JA 4B0OA 5C8XA 4N5IX 3IB3A 3LP5A 3E1GA 1AGYA 4OCZA 3QMWA 5AM0A 4YX9A 3OURA 3C5WP 2WG2A 2OCGA 2WIDA 3WQHA 1RP1A 4BE9A 4H7DA 3LS2A 4A16A 2C5FA 3RLIA 1TCBA 2PU7A 2WU4A 1LPMA 2ZSHA 4O08A 4NZZA 2GZRA 4B84A 2VT6A 4W1RA 2DFPA 2AJ8A 3KD2A 4AXBA 4C4XA 3C6XA 4W63A 4KRXA 4X6UA 5K3BA 4U2BA 5AHXA 3AINA 3WA6A 2JIDA 4JUIA 2JGJA 3AILA 1K63A 4G4GA 5A7GA 1GPLA 5ALYA 2QTBA 4DMCA 5JZBA 2H7YA 1MU0A 4CCWA 5KBYA 2CUTA 1ZGBA 1YS2X 5HQ3A 2ORYA 4AZ3A 1EA5A 2AJDA 2FX5A 5CXXA 5LP1A 1XZMA 1CUCA 3WK4A 1ZIYA 2EDCA 4OB6A 5EIAA 1ZD5A 4H7JA 2QXTA 4MWSA 3IUQA 4B82A 1O6GA 3RARA 4CCYA 4DGQA 1SCQA 4HXEB 4OPMA 2XMDA 4A23A 4FOLA 1E8NA 2PSFA 3OC0A 4PNZA 1HPLA 5EHNA 1TK3A 5AOCA 5E4JA 1XROA 4YASA 4UHFA 2HRQA 2WUGA 1CUBA 4ETWA 1QJ4A 4LXGA 2OGSA 2PM8A 4AMZA 1W4LA 5JIBA 2OPHA 5ALKA 3FVTA 3G8YA 2AJBA 1MN6A 5J3JA 2P8SA 2HA3A 2JF0A 5AO9A 1K6EA 3H19A 1XZIA 1MX5A 3G9TA 1WPXA 5HF5A 2XMRA 1TIBA 4YPVA 1LBTA 4KJXA 3WKEA 2C0QA 1EDDA 5AM4A 3I2KA 5IVDA 3ZI7A 5AIAA 4A5SA 4FMPA 3ILSA 4KE8A 4W1SA 1MTZA 2V97A 2G5TA 3QYJA 3DQZA 1DU4A 4H0CA 5FOQA 3QH4A 1CUZA 5ALPA 4UHCA 5LZ5A 3STUA 1CR6A 1LGYA 1EDBA 3AIOA 3C6YA 5ALDA 5I7UA 2VTVA 2XLBA 3I2HA 4HAIA 3BDIA 5F4ZA 1FFCA 1ODSA 2PVSA 3F97A 2XUDA 1CQZA 3E0XA 2QKYA 5K3FA 1J07A 1MO2A 3M81A 4LXHA 1XLWA 3DKRA 2CKMA 2Z8XA 4H7FA 2HFJA 3M3DA 1DWQA 2ECFA 2QOEA 4AN0A 1UK9A 3R40A 5AI4A 4JYMA 4BCCA 1LLFA 4M0FA 2ACEA 2OAEA 4K6KA 4UFOA 4MEBA 4WY5A 4Y2XA 4P9NA 1CV2A 1USWA 3IIIA 3HI4A 3ANTA 4UFNA 4WDRA 4W1PA 3CCCA 2XDWA 2BCEA 1QE3A 5DWDA 5HK9A 4OB8A 4AQDA 4FFWA 5A71A 2GBIA 5SYMA 2WJ4A 1L7RA 3MUNA 1ODCA 4Q3LA 4QZVA 2VF2A 4HRXA 2XUKA 4GHWA 2DHCA 1QLWA 1E3QA 2BUAA 1UKCA 2DR0A 3IUNA 3AZPA 2PUJA 4Y2JA 2NW6A 2XLCA 4PSUA 2GYUA 3HLKA 3W05A 5AP9A 4BP9A 1DTEA 3GA7A 2QRUA 1H2XA 1PJAA 4J0KA 2VAVA 1YA8A 2WJ3A 3STYA 1CVLA 2JGEA 3ESDA 4X71A 1XZCA 3HABA 3U0VA 1AUOA 4J03A 4X90A 2JBWA 1CLEA 1N5RA 5AJHA 1PV1A 1YAHA 4B80A 3O0DA 1EH5A 2X8BA 1YASA 2WG1A 5ALHA 4FTWA 3JYHA 4PSCA 1Y37A 5JYCA 2WILA 4CFSA 3DKKA 4BZWA 3ESBA 4LXIA 4EB0A 4EBBA 4BP8A 3P2MA 2VSQA 1SCIA 1XQXA 2I78A 1OILA 2BUBA 1BN6A 4BAZA 1VXOA 4RE5A 1QGED 3WK7A 1UKBA 4K6HA 3G02A 4EHBA 1MX1A 1AKNA 1EB9A 3D2CA 4NMWA 5BWBA 3I6MA 4B7ZA 4H18A 4PQEA 4I4CA 2XUPA 3KOOA 4LKOA 1CRLA 1UWCA 5CTAA 1VE6A 2ROQA 4PO3X 5ALFA 3QITA 5JD4A 3F8SA 3L1JA 3JWEA 1CUDA 1G5FA 2YYSA 3WWCA 2PSEA 3C8DA 5CT9A 4BATA 2HRRA 2J3DA 1BU8A 1L7QA 5A7FA 2XQJA 2XUQA 1FFDA 4HVTA 5JAOA 3U1TA 2DQZA 2EEPA 1ORVA 3QZUA 4FNMA 1AZWA 2X76A 1MPXA 4XVCA 3DDUA 5FPPA 1R4ZA 3L1IA 4AMYA 2QJWA 2WIGA 3OOSA 1XZJA 5AKHA 4UFPA 4NS4A 4Y9SA 4L72A 3IUJA 3JW8A 4J0JA 3BJRA 5FLKA 4V2IA 4X6XA 4E46A 2RHTA 4TGLA 1MAHA 1B41A 4X7BA 2C4HA 1WPRA 1HBJA 2CZQA 4AB1A 4DSZA 3IURA 1PFQA 1YB7A 3AIKA 4DMHA 4INZA 3STVA 1SC9A 1ZI8A 2RGUA 1BEZA 3M83A 4F21A 4UBKA 1RWQA 5KWJA 4AZ0A 3OG9A 4C6HA 4EY5A 3BWXA 4KAJA 4Y2PA 1UXOA 2RIPA 2ZJ7A 4X94A 3NWOA 2AXEA 4WJLA 2Y2VA 4FWBA 4Z49A 5AK5A 2OAGA 4BC0A 5H3HA 2VJBA 3H2GA 2O7VA 1QFSA 2OCLA 1W1IA 5IVKA 1WB6A 5K3CA 1QIDA 2WHQA 3WIOA 3X3HA 5KWIA 2WIKA 3W9UA 1F6WA 4RNCA 4KYVA 1S8OA 2Z3WA 3VKFA 4F5ZA 1EVQA 1QONA 3RK4A 4BTLA 3LLCA 1JT2A 1GKKA 3EQ9A 5EHQA 2VJCA 3EF3A 3C5VA 4P92A 3AUKA 4QNNA 5ALRA 5EIEA 2GZSA 1W76A 1H2YA 1YSCA 1ZGCA 2ZJ6A 3WKDA 1CIJA 1P0MA 2FJPA 1IVYA 4DMFA 2G63A 1LPOA 4GW3A 4KEAA 1BN7A 2HU8A 3W9BA 5AK4A 2EDAA 1YCDA 5ALEA 3SC2A 1CUEA 1KEZA 5CH3A 1XRPA 1J2EA 1BROA 3G0BA 4QDUA 1ZIXA 3AZQA 1JJFA 2QT9A 4MQMA 4CG3A 1TRHA 4Q05A 4M0MA 3WYNA 3QBJA 3FYUA 1AX9A 5T4EA 4E15A 5JAHA 4PV7A 4FLMA 5AOAA 5EHZA 5FRDA 2JGMA 3O4IA 4KAFA 1VJ5A 1P0QA 3V1KA 1XKLA 1KU0A 2I3ZA 3G0DA 3ZLVA 3SK0A 3WWOA 4UHDA 2GYWA 4BAGA 4LIPD 4UBJA 1GZ7A 3AJAA 2YASA 3QPCA 1G4HA 5HQ3B 4EZIA 1QOZA 3FCYA 2W6CX 4Y2SA 4Y2VA 2LIPA 1MX9A 3HRHA 5BWCA 4G8CA 1Q83A 3OM8A 4OYYA 1CUAA 4I3FA 2XUIA 4CCYB 4C89A 3A2LA 1T2NA 1QIIA 3H04A 3AIMA 1HKHA 4Q1VA 3G7NA 3FSGD 3DYVA 1CQWA 1JU4A 1U4NA 4UHEA 1ZJ4A 2W22A 4HXFB 5ALOA 3ED1A 5ALUA 3WI7A 3BL8A 3CN7A 2IITA 3IDAA 3DD5A 2CBGA 2AJLI 1W6RA 2G5PA 4DIUA 3S8YA 3VJLA 2Y1KA 4G1FA 1Q0ZA 1P0PA 2WFLA 3V1LA 3G0CA 4EY6A 1I6WA 4IH1A 2JEYA 2WIJA 3HZOA 4FKBA 3CN9A 3D0KA 5HK8A 5LYYA 2O2GA 4DM7A 1WB5A 2XQKA 1EK2A 3PFBA 3FAKA 4GBGA 1XQVA 3FNBA 3D7RA 1VKHA 1BS9A 5BV7A 1VE7A 1AMNA 1CUXA 4X85A 5LIPA 1IUPA 2HA6A 4Q3KA 5C81A 1R88A 1ZD2P 2XMGA 3T52A 2QS9A 1IUNA 5CBKA 2XT0A 3QMVA 4BCDA 5CRIA 1GGVA 5K3FB 2WSLA 4XX1A 4J0GA 4JEIA 1UK6A 2IX9A 2OLEA 3WLAA 3SX4A 3ZWQA 4UHHA 5ALXA 2WJ6A 2ZYIA 1WM1A 3C8HA 4ZXFA 4E14A 3I2IA 2JGLA 1GQSA 3ZPXA 3C6ZA 5I9IA 1NU6A 4IQ4A 5AKZA 5ALIA 3FYTA 2HA0A 2OQVA 4QDZA 3BXPA 1MJ5A 4JYPA 3DS8A 3KDAA 1THTA 4QLOA 2D0DA 4H7HA 5DLPA 2HA4A 1WCYA 4HXGA 1K5PA 4CG2A 4MYSA 3H17A 2HU5A 3HACA 4DNPA 4CIAA 4AX4A 2V96A 1J1IA 2ES4A 1FFBA 1X2EA 4ARAA 4TVKA 1DWPA 1GPKA 1LZKA 1EHYA 5LZ9A 4C87A 4FDMA 1R9NA 1AC5A 4TPKA 3OPMA 2GBFA 5IKXA 1LZLA 2CMFA 4XWGA 1GXSA 3C70A 2CB9A 2X5XA 2PUHA 1XZFA 1TCCA 3H2IA 4N5HX 5K3AA 2J4CA 4F60A 2H9YA 4Y7DA 2QZPA 4PF1A 2WIFA 1LPPA 1A8UA 1JJBA 5IVIA 3ZLTA 3E4DA 4ARBA 4X97A 2WTMA 6YASA 4MJ3A 1Z68A 1ACLA 5A7HA 2JGFA 2BGRA 1FFAA 3IBTA 4GWLA 4UBMA 1EX9A 2VEOA 3GFFA 2WQZA 3C45A 5I8PA 1T4MA 2PPLA 1FFEA 3STXA 4K6GA 1QIMA 4J0IA 2ZYHA 1IZ8A 2QM0A 3A2NA 4KE6A 1VOTA 1IZ7A 1E5TA 5IH7A 1A8QA 2B9VA 1QTRA 2HA5A 5ALZA 4L9AA 1MAAA 3M82A 2HHAA 1G42A 2QMQA 5JAPA 1LPSA 3WK9A 3HJUA 2C58A 4Y2TA 3CXUA 4FBMA 3WA7A 3IULA 4MWTA 4IH4A 4L0CA 3DYIA 3WKCA 3B3QA 1UZAA 1F0NA 2ZYRA 5AI9A 4DNOA 3F96A 4G9GA 4Y2YA 4WDQA 3HSSA 1U65A 5JD5A 4B9EA 4P08A 4H7IA 3MUOA 4OU4A 2BUCA 3L1HA 1JKMA 1W75A 2E3JA 1OCEA 2ACKA 3AZOA 5FXMA 3EBLA 1A7UA 4D9JA 5D7BA 4HTAA 5CMLA 2VA9A 1R3DA 3I6YA 1GKLA 4LHEA 1QIKA 4GDMA 4KR0A 4QDOA 1J06A 4C4ZA 2PL5A 1QIGA 3BF7A 4Y2RA 1E66A 4DMKA 3E3AA 3C6BA 1ACJA 2I03A 1CUYA 3ZV7A 4H35A 4OB7A 4L3WA 1THGA 5T4FA 5CT4A 4LYEA 1XLUA 1CUIA 3PUHA 5JAUA 2Y6VA 3UMJA 5FUMA 2Y2UA 2WHRA 1ODTC 2XMQA 3VVMA 3GBSA 3VXKA 3FVRA 1XZHA 1A8SA 1UOOA 5EFZA 4ZWNA 1DX4A 4FNGA 1BE0A 2UZ0A 3PI6A 5AM5A 5ALWA 3WWDA 2PBLA 2DSNA 1G66A 2VJDA 4IO0A 3KWFA 3WKBA 1HLGA 5HCUA 5A62A 3LCRA 4GLBA 4MEAA 3I2GA 4E11A 1LPAB 1WB4A 3D3NA 2VJAA 4EY8A 2C7BA 2HADA 2XQFA 5AI8A 1UOPA 2QXUA 2HDWA 3PUIA 3TEJA 1EI9A 3STTA 1CUUA 3HEAA 3D4LA 2RONA 2J4FA 1CUFA 3G0GA 5DNUA 2GBGA 5DTJA 3PF8A 5ALJA 4U2GA 2XUOA 2HL6A 4ZV7A 3R41A 4RE6A 3V9AA 3WL8A 1EK1A 1ETHA 1H2ZA 1Y7HA 1YS1X 2WHPB 4AO7A 4U2DA 4FLFA 1QFMA 1JJIA 2XE4A 5AKJA 1UT6A 4B0PA 4ZGBA 5AKGA 5AOBA 1QIEA 4WFJA 5JD6A 4ZREA 1CPYA 1JMYA 1ORWA 2WUDA 3NOXA 5D3KA 3Q8WA 3B5EA 4WFKA 3ESCA 2Q0XA 5D3ZA 1RYYA 1XFDA 3TJMA 1LPNA 1HQDA 3A6ZA 5AI5A 3EQ7A 2AJCA 4HRYA 3A70A 4OU5A 5AM1A 5K3EA 5LZ2A 3R3VA 2CEKA 3PF9A 1KU6A 2HU7A 3H2HA 5C8ZA 2WFZA 3FYUB 4UBLA 3FLBA 2WHPA 3UUEA 5LKAA 5EI5A 3BIXA 1WOMA 5JALA 3STWA 4C01A 5CXUA 3FLEA 3EIOA 3FSGA 4ZI5A 1O6FA 1CUGA 4B85A 2XUAA 1ZD4A 1XZEA 4UBOA 3G9ZA 5LZ4A 2C5GA 1TKRA 4WCVA 4JH0A 3BIWA 4DYHA 1LPBB 3YASA 3T4UA 4ZRDA 3H0CA 1DT5A 3QVMA 3H1BA 5AH0A 5JADA 1LBSA 1CUVA 2D5LA 5FKJA 2XUHA 3QPAA 2DHDA 1VZ2A 3LIPA 3BF8A 1C4XA 3F67A 1VXRA 1E89A 4OD0A 5ALLA 1VA5A 2FUKA 2I3DA
chains in the Genus database with same CATH superfamily
1U0TA 2RHHA 1H2HA 1SOMA 2GLUA 1I5OA 3G1TA 1DV1A 1JV2B 1SCNE 3VISA 2DFDA 4CJXA 4EATA 3DFFA 2F3UA 3CF4G 1BMFD 2B99A 2X0RA 4J1QA 4PFJA 5EZYB 3WRVA 4B2PA 4B71A 4CLXA 1PLLA 1TTQB 2J6IA 2GHRA 4R8MA 1FL9A 1RXUA 4RVHA 4ZOLA 3ZUPA 3ESAA 5DX8A 3OTIA 1NMEA 4JT8A 4LGMA 4S0XA 3UOAB 4YV2A 3CMMA 1NNEA 2BEVA 2Y9PB 2G6BA 4REQB 3IVMA 2UV8A 1BJTA 1TQ6A 3EGXB 4CN8A 2RJOA 3DOFA 1KFEB 1T1JA 5AQEA 2XGMA 4NMHA 5HJ2A 1OXBB 3ZE0B 4S05A 3GD7A 3HDGA 1KYVA 1F8UA 2CBXA 2ZATA 1C7IA 5F3RA 5LKRA 4FFBB 1VLMA 1VLQA 1X8JA 2G8LA 2ZJ4A 3GZJA 4LJ5A 1XEAA 3GJQA 2WFLB 5I9TA 4P3KA 4OXNA 2C99A 3OZ7A 1USVA 1U0FA 1GN8A 5GZ6A 1QIFA 1KQ3A 1X92A 2P3LA 1K2WA 1NUSA 1RJWA 3OUUA 4EG3A 5KOHB 3R9WA 2HCJB 3ER8A 4H3VA 4ND2A 4DSNA 3DBHA 5BSFA 1OYOA 2G04A 1GYPA 4ZKEA 2GERA 2G4LA 3BZWA 4MQLA 2DFLA 1RVDA 5BN4A 1WZIA 1DBVO 2A0FA 2CC2A 1QRSA 1KMHB 1XZNA 2WF7A 3ICWA 1Z6PA 4MVWA 1G8MA 4MUJA 4PHHA 3UJ3X 3TNFA 3L79A 4ZAZA 2P6RA 1NP3A 3MHPA 4J3JA 4Q47A 2BHSA 3JPWA 5KDDA 4B3SB 2C2GA 2OO3A 2QYHA 1Q2XA 3LV8A 4AJOA 1ZRSA 3OOHA 1USKA 1RKQA 1UJ4A 4REQA 1G0NA 3B70A 3O4GA 3SZOA 3BK2A 3G5TA 2W8BB 3LVBA 2BVNA 3OU7A 4ZCLA 2FHSA 5H3CA 5BYBA 3VJMA 1RPZA 2I0FA 1BVHA 3ZJUA 5MGBA 4YIKA 3MYRA 4DR1B 1TRKA 4LKRA 2PGOA 5FR2A 5IAKA 2FSUA 1CUSA 2PEYA 3PYLA 1BHSA 4GX2A 5ALGA 2AEFA 4CIBA 1KKUA 1BWSA 3NFRA 4FGUA 4RGYA 1M10A 2E6KA 3IPYA 2PXXA 2G9NA 3RKUA 4CKCB 3AIIA 3WHLA 4MR7B 3ED5A 5JATA 3DULA 3HP4A 4RF2A 3VVBA 1XK6A 2OORC 1RWNA 1MRNA 1O1YA 1PL6A 3W1WA 2W7TA 1PR1A 3EYWA 4KE7A 3HV2A 4Y8VA 1G98A 1G4AE 1P5JA 1O4VA 2DFVA 1JDSA 1H2WA 3G5UA 3PPVA 2COUA 2YWRA 4BRZA 4YAKA 5GOTA 4QNRA 1RRCA 5MFPA 3UWKA 4B40A 4ZOAA 2PGIA 5KHAA 1KR5A 1DEOA 2JFHA 4DJEC 4BTEA 2VAXA 5ULLA 2X2EA 2PLWA 1SKQA 3V7WA 1P77A 4DV4B 1R4MB 4MA5A 1JA1A 1QANA 2M1XA 2RGAA 2FUNB 2VYNA 5F64A 4B74A 3OEED 4QWWA 3AF5A 1QC5B 1IPFA 1J8DA 2Y99A 1WHSA 2Q46A 3TR6A 4HUTA 1RAIA 3TJRA 2C2OA 3KETA 4NXMB 1P60A 3FTPA 3H5RA 3UPDA 5KQPA 1PEYA 2OK8A 1JFTA 1GUAA 1J7JA 2XB6A 1DX6A 2FSIA 1K89A 5TSDA 1A2BA 5BW8A 2ZU0C 1OFVA 1X7ZB 2ZUCA 1ZISA 3B1JA 2AFIE 3DDHA 3ZHRA 4ZVRA 4W5WA 2H7CA 5JZSA 1WUJS 2JGKA 4P86A 3OT5A 3HFGA 1OW3B 1YIAA 5K6AC 1UBKS 2IKQA 2OHOA 3A05A 4NPAA 2OTCA 5BUCA 2G8NA 2OT3B 1MJGM 4MR7A 1MG5A 3ZC3A 5FR1A 1B93A 2YYYA 4XB6B 2YINC 1A50B 3T0FA 1Q19A 3U7QA 1Y98A 4L0MA 3RE1A 4GP7A 5LDGA 3FETA 5DIZA 2LBPA 3BSWA 3DTVD 1KQOA 1EFRA 1GGKA 1VYTA 4WESB 1QBKC 1K5GA 3HXTA 1IN6A 1I7LA 3I0ZA 4DNXA 4GOOD 1VIAA 4BMCA 3LRXA 1LV7A 1RWMA 3W6UA 4C5BA 3ONVA 4Q4DA 1CQJB 1P4GA 4TTJA 1NLMA 3T7AA 4XVUA 4HAZA 2DKFA 3I28A 1GCGA 3KQWA 1KEKA 3L06A 4MUGA 4UOZA 4I9FA 4HLUA 5MN5A 1U11A 4I3GA 1WB9A 5AI0A 1IIRA 3H5NA 3R1IA 2VJQA 2V7PA 2WMOB 1QC5A 3BC1A 3NASA 1A5TA 4MW0A 4G81A 4PHGA 4R1OA 4RQTA 4R9VA 3PCXA 3H9BA 5EKSA 5ILGA 5TT1A 5DBGA 4EYSA 1U0LA 4DSOA 2Q4RA 4O0LA 4G26A 8ADHA 1MEEA 1Y4AE 1GRCA 3MMZA 5CNKA 5HZKA 2ECQA 5KMGA 1EHIA 4JFAA 2PGDA 2GEVA 2ZJFA 2HI0A 2FPLA 4XLTA 4U3JB 1BWQA 1TXGA 2R84A 1E4VA 3UN1A 1J2RA 1IHUA 4EFNA 3IKMB 4RPLA 4L2IA 2KS6A 4OFXA 1VBFA 4R8RA 3P71T 3SYLA 3DMYA 4DNQA 1CRQA 1WLSA 2QD2A 4D5GA 4UBIA 3JRWA 1BWRA 1QCYA 1MNAA 2IIVA 1YVRA 4R1QA 3OQOA 3GMIA 4FD3A 4UAGA 2OHIA 1ZCAA 3DEYX 2ZKIA 1R5JA 3QXHA 3RSFA 4G5XA 3RQSA 2NV2B 5C1BA 4DYVA 3TECE 2K7FA 2CV0A 1N9ZA 3E2IA 2DWCA 1JDNA 4LF4B 5HUQA 2ZJ0A 3ZGLA 4YJFB 1E2FA 5AK3A 2PD6A 3BFPA 3DZBA 3L0CA 3IDFA 1VE3A 3CH7A 2PL3A 1T3HA 4JOSA 5EJMA 4BFLA 1SVIA 3QLVA 1U0JA 1ZGHA 3SE0A 1F0PA 3ISVA 1Y8AA 2BM8A 3B1WA 4IJQA 1CU1A 3V7YA 3U60B 2EKDA 2XZOA 1ZVMA 5JY6A 5A4FS 3KXIA 1CTQA 4D0LB 1ZZEA 1KS2A 4JDPA 5I7RA 4LSMA 3HYTA 1HDIA 1YRWA 2ANBA 2JJ1A 1WL8A 4O4JA 1N2BA 2Q8PA 3B6IA 4REOA 3RTEA 2WPDA 3SHQA 1KI4A 2Q4DA 4EKNB 5I9LA 2A9VA 1XKXA 1O4WA 2RHLA 3AV0B 4U4AA 4XIIA 3ICQB 1CB7A 3FCSB 1J2UA 1Z8HA 2C3MA 3HDJA 4Q48A 2QMZA 1CK4A 1YFJA 1XMPA 1WUYA 3VGPA 2HCTA 3VR2D 3KKPA 1H69A 4WNYA 4EMUA 1J8YF 4KQGA 4ZMBA 1AKEA 1W36D 5DYWA 1EG7A 3MWLA 3V1YA 3N59A 5IEBA 4DC0A 4G0UA 1XLVA 3BQNB 5HMLA 4ARVA 4R3UC 3T9AA 3H75A 3PA6A 3QLTA 3M3PA 1FRZA 2W0MA 4HH4A 4X8LA 3DHVA 4RVOA 3GT0A 3KCQA 1RM5A 5IVHA 2HSDA 3L49A 4X24A 2EFCB 2FR8A 4XQGA 3FPHA 1DXOA 3ZTTA 5A0TA 3NWEA 5CB6A 3LDHA 1GL7A 5ITWA 1IHXA 3W78A 2WYUA 2J33A 2YWFA 4J16C 4YJFA 3Q3GE 5JLAA 5TARA 5CFLA 1ZIOA 4QPDA 4J0HA 5TQVA 1LX7A 2J09A 5BOVA 2PSDA 2VSXA 4H08A 1SXQA 5E7MA 5H68A 3EISA 1XXLA 1JU3A 4MUNA 3AFGA 3QE3A 4RNCA 3T12A 2VP5A 5AXCA 4DN6A 1M0SA 4M0DA 3TX6A 5DN6A 3RVQA 2QUAA 3R4CA 1Z4OA 4FYHA 2GDJA 4G4SO 3D8TA 3U1BA 2HRBA 3QV2A 3AEKA 1Q0RA 3UJPA 3AU9A 3S7ZA 1KY3A 5JY1A 2B4KA 2JFNA 2ZRGA 1V6AA 2AZMA 4OYRA 4YCDA 2H9IA 2GK3A 4MWCA 2PTHA 2P0EA 4TKZA 1GLVA 3AFIA 5JC8A 5KIAA 3JASB 2RGDA 4E5KA 5D6OA 2H5EA 1EBFA 4U2CA 1HR0B 1PWXA 1F38A 1R9MA 3K31A 4NH4A 2ISSD 4CKXA 4W5OA 1IEQA 1WMDA 2FPGA 2XX3A 4S2UA 3TLAA 3E70C 1NRJB 1U1GA 1QUEA 3MJCA 4L8VA 4KIWA 3D3JA 3S1LA 4YRMA 3QU5A 1CETA 2QR5A 4QXPA 4LHVA 4DA4A 3LO8A 2HHJA 3FNEA 4ONEA 2ZGVA 1PTJA 4JITA 2WAXA 1YMVA 2P62A 4G4IA 1RZUA 3KHSA 4MLDA 3D1LA 5E4FA 5BNFA 4KOEC 1I2ZA 5EZ5A 2JEZA 2P1DA 2YY7A 1DWOA 1FQJA 3EW9A 4IYRA 5M34A 421PA 4EENA 3PDIA 4M0CA 1QBGA 2ZBFA 5E6UB 3AHHA 4D99A 2OHXA 3EFOB 3C6KA 5DTMA 1ZYUA 2XCSB 1HNXB 4CM5A 3E7XA 1AB6A 2NT3A 3HYLA 3JYPA 1IY9A 4ZZ3A 1G3IA 4D25A 4EUSA 2I99A 2Z4RA 2PKRA 1CR4A 4U7DA 5ECDA 2QMOA 3AUAA 3H83A 5BWMA 4ISBA 1QO0D 1T1EA 3UH0A 5KCZA 3ZXIA 4RJIA 1I3MA 1LW7A 1VPTA 2XV1A 3L8GA 4DCJA 4YJ3B 4QA9A 2R0QC 3VU0A 2OVBA 2WP0A 3QK7A 2VHQA 2C9DA 1AOXA 1OPRA 1VSUA 3O9MA 3ZXUB 4MKIA 2IYTA 3VR6H 2W8ZA 4KWTA 5ES4B 4N8SA 3VAZA 2BDEA 1GZ4A 4GPD1 3QSGA 4AY3A 4IH9A 3GEBA 3NBFA 4FGWA 4YYEA 4EP1A 3L7BA 3A14A 1DDGA 4RH1A 2DBVO 3BRWD 3CVYA 3RS8A 1YOVA 4TM7A 4E5VA 4KO4S 5DHTA 1GYQA 1ZI6A 3CNBA 2ZRKA 2ZIAA 1WV1A 3A8TA 3EDCA 1E4YA 4OQQA 1XTUA 1QS0B 2J9XB 4QHYA 4B76A 3PB3A 2AE2A 3AEXA 5C52B 5BSVA 1YWGO 5CHEA 2WKPA 4LC9A 1JDJA 4ZKDA 1T5BA 5L4NA 2RKWA 4HEA6 1WKVA 5CT5A 3IT3A 5GONF 5TPZA 2GRUA 1P0CA 2P5TB 5IC6A 2VP2A 3BULA 4U7HA 1GSIA 1RYFA 2XYHA 2Z5GA 1Z16A 1YNOA 3GRRA 4KRGA 1NF2A 3HA3A 4AKEA 3DV0B 3LKVA 3IP8A 4FD2A 3SEZA 2PKYX 3IIKA 5CT6A 2ZBQA 3A9TA 4JODA 4JUDX 4FHGA 4C0HA 3B1XA 3OEHD 2IDZA 4Q0MA 3W9YA 1Z0KA 2MSLA 3M33A 4HLQB 1ATZA 2ZRFA 5FTJA 1GNLA 2ZI7A 1ZOIA 2HJHA 2OXCA 3AEQA 1YFZA 1A71A 5IM4A 5BQFA 1PK7A 2G6TA 3MQ2A 3WB9A 1EESA 1HTWA 4JBGA 4ES6A 3PGMA 1XRRA 1KA9H 3LXMA 4DJAA 1A9RA 1K4YA 8ATCA 2R00C 1ZH4A 4HR7A 5JBQA 1LBHA 1FDUA 3NS7A 4R1TA 2WKWA 2BGKA 1SZDA 5KKAA 2IRWA 3LP6A 4FPXA 1XG5A 3ROTA 3HJBA 3S2FA 5CB8A 3RRBA 1OGJA 2TMYA 1V8FA 2DQYA 2QX7A 1R0BA 2ZRIA 4KI0A 4PN3A 1QGZA 3UAXA 1QS0A 1RYBA 5C37A 3ORRA 4X1KA 2Y1LA 4OHXA 5TIIA 2BBOA 2EP5A 2R47A 2IP1A 4YJGA 4FFVA 1RJEA 1AURA 2O8BA 4AZSA 4S1NA 3RSGA 1QZ3A 3FI0A 1Z5GA 4RKEA 3IR6A 4HBZA 2WKQA 4LTDA 4WK0B 3I92A 5FWXA 2WJIA 1G59A 5YASA 3GROA 3RFFA 4OYHA 4C0BA 5A4IS 3FCXA 2DH5A 4YTEA 2I3BA 4LYAA 4GRAA 5F5NA 1K6JA 1RKBA 1WXXA 3EDOA 4QUJA 5TQ2B 4CYMA 1C7QA 3R3XA 3IRVA 2EYUA 3ETGA 3CX7A 4CHGA 3UY4A 2PSJA 4EA9A 2IP2A 1DJOA 1RQLA 4WPGA 4TSKA 3B78A 2XCUA 4FXPA 4H1HA 1ESCA 3FYDA 4HSEA 3AR5A 4M98A 1A7JA 1UJCA 2JH3A 4XR9A 3WNDA 1M7BA 3GNTA 1GTG1 2V55B 3F98A 4ZPJA 5AJWA 3H4MA 5DVZA 4F3NA 5AJZA 3RJ9A 1NN0A 4OLBA 5IT0A 4AS1A 1C9MA 4EMBA 4FJ0A 3TLEA 2FR0A 1XL1A 1Z74A 2W2LA 2Y68A 4GI1A 4WUVA 3ROMA 3UK0A 3RGWS 3D5EA 1HL7A 3K09C 3N8HA 5FUBA 1L5RA 1MNQA 2PFKA 5JARA 3NYIA 1NW5A 4AECA 1U8TA 2HGZA 2O5VA 5CT8A 4HWRA 4KIFA 2B20A 4TTRA 2LE0A 2WIAA 1GLGA 2VHZA 5ESDA 4F6LA 2EFYA 4UUQA 5ISMA 2WSBA 1X14A 3E9YA 1TW3A 3D2BA 1OH6A 1ESDA 4LQLA 1BRTA 4LBVA 2GEDA 2QI9F 3O9VA 5IK2A 5SZKB 3IQWA 3BGWA 1M1YA 2AT1A 1L7EA 1WVMA 2IUSA 2WAAA 4JA2A 1X7DA 4UZSA 2Y0BA 5DJ5A 3IHLA 1ISJA 1LRKA 1SXHA 4RVNA 2YW2A 3D0RA 4XIYA 2I7XA 1JYSA 1LNSA 2FPOA 2YHAA 2YOFA 2HRZA 3LIIA 3RUHA 1N33B 1T2VA 3GOHA 4ARIA 4Y67A 4WAUA 1GT6A 3P9PA 3ZHOA 5TQ2A 1XZBA 1AA9A 4CMEC 3FGNA 3V8MA 1VIYA 2Z2XA 3IBCA 4D9NA 4F6RB 4NOMA 1Z25A 4Z99A 5MN4A 3R3YA 4FFLA 1PT8A 3DDOA 4HVAA 3HXKA 4D44A 4KMOA 4N5DA 2QTZA 2ZJ2A 3T9EA 3R4VA 5EHIA 3P8ZA 4AI6A 3I9KA 2JDIA 1R7RA 2XKJE 3M4YA 2A5JA 5AICA 2HMUA 1AMUA 1XTVA 1GV0A 4C4AA 4BLRA 3O83A 1IFXA 2HM7A 3WZMA 3OCCA 3AEUA 4JI6B 1T5HX 2I2FA 1NZJA 2QUBA 3EXHB 3NKVA 3OLQA 4UC0A 2WVGA 1TEXA 1NXVA 3P52A 5JG7A 1KSGA 2QP9X 1UOQA 1BHQ1 1X7WB 4BX2A 5JNLA 4D8TA 3OQNA 2XB2A 2FF7A 2O8DB 3WB0A 2EKLA 3LFTA 1E6CA 3FNFA 1WU7A 2PL9A 5JXHA 4TLAA 3BEOA 3QVOA 5B3AA 1HX7A 2II6A 5E1DA 5CX4A 4FGZA 1KDPA 2PCLA 3K9HA 1WP4A 1BMFA 4ALJA 2GPAA 2XYPA 3IT1A 2CHQA 3SJBA 1PD1A 4C4OA 1TCAA 1KH2A 1W0JD 5BMVA 4J0DA 1KDRA 1GL6A 1WNFA 2AI3A 3NHWA 2CVOA 4TWAA 3D7LA 4GXNA 4F6RA 3Q3EA 2WKRA 2AC2A 3PD0A 4KB5A 1UZNA 4KU4A 1RWVA 1WHTB 4QT4A 5H16A 5AM3A 1NWHA 1PDWA 3WMGA 4HX9A 3KT6A 4G25A 1CR1A 5LLSA 5LOVB 2WF9A 2PPVA 1NOKA 5JROA 4AG6A 4CUZA 4OKNA 1MB4A 5HF6A 3EXEA 4EF4A 4ROSA 1YS9A 1OZFA 1MJGA 4XYEA 2HQBA 1M8FA 2CLHB 4BKQA 2DCMA 2GF0A 3EQZA 1JHXA 1HT1E 1UMDB 2FPPB 1GKIA 1HFJA 3WLFA 6REQB 1X7WA 3EGVA 5JMOA 2CWWA 1W4BA 3CUWA 3VOBA 1AD2A 3WL5A 3C3CA 4BB0A 4S1WA 1G7SA 4JVNA 5HBGA 2PNFA 2W2KB 1GA6A 1HM5A 4GPZA 4RELA 4AKTA 2OCIA 4BVFA 4DLXA 1BD4A 3SBXA 2B61A 2Q8QA 5EPUA 2Q2QA 1F0KA 5K03A 4Q9AA 1U8YA 4TZ6A 2Z57A 1BXZA 2A9PA 3UT5A 4NBWA 4M1TA 1CJUC 2Q62A 2XVZA 1WA5A 1U90A 3H5LA 1O87A 2HGSA 3FWHA 2FDCA 5TT0A 1UQRA 1GZ6A 1V6SA 2QY6A 2CFIA 4ZT4A 1LRLA 2FPKA 1XMSA 2HWYA 3PNPA 5HOQA 3ND9A 4ZHSA 1D2CA 5IUNC 1LSJA 5LQJA 2V1UA 1E2KA 1WHTA 4TZKA 1PQUA 5AUOB 3KLMX 2IYFA 5GJCA 2WWHA 1SVMA 2NVBA 4AN1A 4FMCB 2QTTA 5KINB 4Z8YA 4MGYR 1CE8B 1BXKA 2H3HA 4NZPA 1NYLA 1XRQA 3GT4A 4WT7A 3AVYA 4XJVA 2HHLA 1E3IA 1II8A 5AMXA 2W9XA 3RG8A 3WGTA 4ER0A 2FPPA 1UMDA 3Q3VA 4TV9F 5EIFA 2D74A 3RUCA 3LO5A 4IX1A 4JL8A 4F2GA 3ZGVA 1YQ9A 3ZVRA 1GZ5A 4A1FA 2VRNA 5D86A 1IHYA 1I4LD 5TQ0A 4O3FA 1H9BA 4IIYA 3FZGA 4H4EA 16PKA 2AN1A 1Y7IA 4XM0A 1A8IA 4AUMA 1MQ9A 3R0ZA 3PXGA 2F8TA 2RGEA 3E9MA 4MDFA 1V2HE 3L4BC 3TEMA 1JE0A 1SCAA 2XADA 2QSUA 3BKXA 3FBWA 4LGVA 5JBNA 3DFZA 1KDTA 3QEMA 1SBCA 1WE2A 2F62A 2GJSA 3OZFA 4A2WA 1IB0A 2NZXA 4EHIA 4RAOA 4RFSB 3WK8A 3MSCA 2XGOA 2J9ZB 3OEEA 3GLIB 5EXPA 4XUEA 3H42B 1O54A 4LRWA 4R9NA 4Z86A 4OXRA 3Q3IA 5G4KB 1VFPA 1L5VA 5DF1A 3VZRA 3MEQA 2OV8A 4NE7A 4OHKA 5IKEA 2FPUA 1XP8A 3ET5A 3RKRA 1TYZA 1SJ9A 4Z0PA 3U7EB 4B33A 3G9XA 3VO1A 5IX8A 1WSDA 1WMSA 4G5YA 4YCNA 2QX9A 4GF5A 4HDKA 3O3OB 1ZI9A 3HCBA 2JAHA 1YJQA 3J7TA 3UWPA 4AKHA 1C7JA 4MPDA 1K66A 1YRAA 3TLCA 5HYVA 5DKFA 1RYEA 2IZ6A 3ZOKA 3A26A 1PSZA 2HEGA 1RHMA 3NI2A 4ZU3A 5AYVA 5GWXA 2ESRA 5CDHA 1VL6A 2VHEA 5FO0A 2W2XA 2F4VB 3DTVA 2C31A 4L8LA 2FW9A 3KU4A 4XI9A 3WQQA 3QMWA 2JHPA 3VKUA 3AUJB 4CDRA 1R6XA 3FVWA 1EE1A 1PX0A 2BCJQ 4ENWA 3ETEA 3AOEC 3IPXA 1PR2A 1WCIB 2NO1A 2WG2A 4Q3AA 3IEXA 2OCGA 1YDFA 3GFTA 4MUXA 3RVSA 2GNPA 2B5OA 2PDAA 4B47A 3JAWB 3VU1A 4RTKA 4OMCA 4Q4CA 2DBZA 5H59A 4PPFA 1PNVA 3LS2A 1LKZA 3P5SA 3SXJA 4EGQA 1E62A 1K7SN 5EXTA 1VKJA 4ZRNA 2R6R1 4A16A 4BGEA 5K8UA 5DULA 3W3AH 1UFRA 1L4FA 1E32A 2TRSB 3RLIA 3SHOA 4JLMA 4B7CA 3D6UA 4TWJA 1TCBA 2BHLA 1XTPA 4YN3A 2NTNA 4V02A 3TLGA 1JL3A 1LPMA 4QVKA 3GJ8A 3NHRA 5CP8A 4O08A 3B85A 3GHYA 2O0MA 2GZRA 1GU1A 2VT6A 2EX0A 2XD9A 2AJ8A 2RBKA 2OFWA 1NVWQ 2P3QA 1P1RA 4FCTA 2K6GA 3DEHA 4QUAA 2OKGA 4W63A 3TW6A 1U8UA 4F91B 5K3BA 2QQ0A 3WLLA 5EZYF 4BV2A 4EABA 2QV7A 4HDNA 4CKBA 3PIRA 5CBPA 1U63A 1C7EA 3ITKA 3CR3C 3PXBA 1TEZA 2W2PA 2C7RA 4R68A 1RD4A 3LLSA 4DLSA 5AK0A 1LUAA 3AILA 3HBFA 4UMFA 2RGYA 3LUGA 3NXSA 4PC7A 4A8PA 1GPLA 3KQYA 5ALYA 3RJMA 1I33A 3PQ2A 1H6AA 2QTBA 3K15A 1WCIA 4OA8A 4R3WA 4TTSA 4F5EA 1L5FA 2ZULA 4HTFB 2XJ9A 4JJ4A 3SYNA 3URMA 5A6SA 3KOMA 3ZDFA 2EGUA 4LJ8A 2CUTA 4N48A 1C0LA 1G3QA 1TU3A 3WDSA 3ZE6A 3WGIA 5HQ3A 1M2VB 2ORYA 4J0FA 5KYYA 6NULA 3L5KA 2D7DA 4JR0A 5MF6A 3Q7EA 5CXXA 2FI1A 1IQPA 1RZVA 2KX7A 4M1SA 4WNCA 3WYGA 4DCSA 5LP1A 3AJRA 2ERXA 3D7MA 4QKQA 8ABPA 5BT8A 3QENA 3LD9A 3HKCA 3VR2A 2RJ3A 5JDCA 1TZKA 5K4GA 2JASA 3K6RA 3DBLB 4OB6A 4MI6A 3TDMA 1CYEA 1B6TA 4N49A 1W2WB 2V4ZA 4QFDA 5EP2A 3D4IA 1EM6A 4IJ6A 1U9YA 2R9VA 3DVLA 4RXUA 4MWSA 3PJEA 3EXIA 3IUQA 5FOWA 1M6YA 3JRNA 1DWUA 2RAVA 3RARA 2VT2A 4CCYA 2I7CA 5HIKA 1QAOA 1M8GA 3IBSA 4AUEA 5MHTA 5PGMA 2X6QA 3DBIA 3FPFA 4HXEB 3WNQA 5I7VA 3OTHA 3SCZA 4NLLA 3V2HA 3M89A 2Y1EA 2P9TA 1UDAA 3TOVA 1E8NA 4GMGA 4I81A 4BJ6A 1KNXA 2C0CA 5ESWA 2F1JA 4I9GA 4YRPA 4G09A 4OQYA 4FOSA 4QHSA 5EHNA 1X74A 3T5CA 1Q57A 2G1JA 4RO0A 5IH3A 5B3LA 5DEOA 1SHLA 4RD2A 3B13B 1XSEA 3BGVA 4YASA 3V4VB 5DHRA 3DUFA 4NENA 2HRQA 2YYAA 4BVEA 4UCWA 1M2VA 4F7WA 2WUGA 3HS3A 1CUBA 3QI7A 4P3NA 2J0VA 4ETWA 5LQMA 1YQTA 2OGSA 3DVSX 1LJUA 2A6PA 1O9BA 3PWKA 3L8CA 4MQUA 2WZQA 1SUWA 3DZIA 1W4LA 3EODA 4WOCA 1DKOA 5FT9A 3UXHA 3V4PB 4EW3A 1HDGO 1Y80A 1SKYB 1SR8A 3GP5A 5HRUA 3IEKA 5ALKA 2X0JA 1JSXA 3FVTA 3O1IC 4BB6A 5KSYA 3DBLA 1F2TB 3EDQA 4MQEB 1ONOA 2AJBA 3ECSA 4F86A 3GP8A 1JHDA 3ZDQA 1AKUA 1ADBA 2IYYA 4RK1A 3PT5A 1YA6A 2GN0A 1K6EA 1P3JA 3EGDA 4AJ4A 5L3QA 1UR5A 1XZIA 4DIFA 1MX5A 3RC8A 2JLBA 1U9JA 3QVVA 5CVCA 3WSTA 2VF4X 1KGDA 2IDKA 2FWPA 2F1OA 4KJXA 3WKEA 2DPLA 3WL4A 4HBGA 1EDDA 5ADHA 3HY4A 4QBHA 4JC8A 4X20A 3I6BA 3B3FA 4I5DA 4E5DA 1L4YA 1T9HA 3JWJA 4RDXA 3OOWA 1MO3A 3I4FA 1Z7WA 2VO1A 4FMPA 4FHDA 4MR8B 4KE8A 4V24A 3IAS6 2QVZX 2R1TA 1U1FA 4I46A 2YJ5A 3U4IA 3NDIA 3N7AA 3GLGB 2CFTA 1DU4A 1QO0A 3UA4A 4PZEA 1NQXA 4UNQA 4YT2A 2ZCUA 1ZWKA 4UU1A 1QXSA 4ARCA 5FCDA 2OLJA 4C6TA 4FB4A 5DHFA 1N7GA 2A9JA 2FN4A 4OJQA 3AIOA 3N58A 5H0IA 5EG5A 4CR6A 1DQRA 5K01A 2AZ4A 5I7UA 5K2OA 4EEXA 2VTVA 2FCAA 5KO2A 2RDMA 1PZMA 3BRWA 4MQEA 2HYDA 3UMFA 1A69A 4NJEB 1EWVA 1X3SA 3FOAA 1BDJA 1SUIA 2YX1A 1FSGA 3K8YA 2I6TA 2DUWA 3VPCA 3H5WA 4YAGA 3E0XA 4BJ1A 4IAOA 1FCJA 2JIQA 3T3DA 4D80A 2X3FA 4MUFA 2I87A 1EFVA 1H2BA 5B3KA 3M81A 4RY8A 4HNSA 1JWAB 1XLWA 4IDDA 1AQYA 1M5RA 1CP2A 1NKVA 2CKMA 1TM5E 4ANFA 3N2GB 5FJIA 2HFJA 4PBSA 5L95A 4QASA 1ADCA 3OPQA 2R3SA 1UWLA 3HSYA 1EFLA 2HBZA 2JGRA 1RCUA 1T13A 3K2BA 3R40A 4FDAA 3RG2A 1I0IA 4JDUA 4DLWA 5ICMA 3SJAA 1T9GS 3V1TC 4BCCA 4JJ7A 1IAVA 1MO5A 2A7QA 2FRDA 4YRLA 2OAEA 5CX1B 1PGQA 1B42A 4AKGA 3H9QA 5LP6B 5H81A 4G86A 4A73A 3GLGA 4AIIA 1YS4A 4XWAA 2LWIA 3E3NA 2A67A 2G77B 3HU2A 4OKSA 1XJ5A 4UFOA 1TC2A 5KOYA 3IAUA 2PZAA 4COOA 1CV2A 4N7BA 3E05A 3IIIA 3BGOS 3IKVA 3SZUA 3ANTA 2QRJA 4UFNA 3L43A 3SSMA 3TSAA 1T5SA 2IA5A 4FWTA 4XD7D 4I4IA 3NVDA 4W9MC 4G85A 2FVYA 3KG2A 4ZQBA 2VYCA 1KO7A 2REXB 2BTEA 1QE3A 2VNAA 5I5EA 4EFLA 3CWCA 3GUYA 1Y33E 2X2PA 4NJEA 1F8GA 4AQDA 3INTA 3PDWA 3E22A 1PYDA 2GBIA 5DP2A 4B6OA 4EWLA 4UAUA 1A76A 1JA9A 1N2CB 1Y6JA 1ONBA 1QPGA 3CO0S 1Z26A 3MUNA 4OLHA 1U8FO 2VS1A 2G5GX 2FX3A 4IDCA 4IJMA 2ZPUA 1IRXA 2P79A 3OLCX 4D81A 1AXGA 3A37A 2HIAA 2CMKA 2RHRA 3R5KA 3KKEA 5AQ1A 5BR1A 1QK3A 1N6PA 4H1VA 2C3OA 1ENOA 1AZSC 1OR8A 1U4SA 4P7GA 1PZNA 2TMGA 4J2OA 3UAWA 3N2GA 4XKJA 1UKCA 2DR0A 2GH1A 3BE6A 3JAMA 2E4WA 4BFZA 3WYEA 4ZQCB 3SQDA 2JCVA 1YL5A 2BKAA 2VJYA 4Q19A 2DTDA 2XBLA 5DHAA 3W05A 2V7EA 3P20A 4FEEA 1XBTA 4OAQA 3DXZA 5AP9A 4R54A 2EX1A 3HCFA 3OHSX 1EBUA 3N1UA 1EX7A 4Q37A 4BP9A 2IS6A 1H2XA 2CVPA 2ZYGA 4BX9A 1TJ3A 3L6RA 3DGEC 4J0KA 3VC3A 5LR6A 1UJ2A 3U6BA 4YACA 2BFBA 1ABFA 4PM4A 4REMA 3O8LA 4BLSA 3LFHA 4RF5A 3TIGA 4FT2A 1S1MA 4DMGA 1AA6A 3ZVNA 1CVLA 3M6WA 3WDLA 1SOAA 1TT5B 2RARA 4TLEA 3BCSA 5CCEA 3DOOA 4A36A 2L2QA 1NVDA 1JPUA 1Q20A 1XZCA 3LYUA 1K7EB 3KEQA 3U0VA 3B3AA 2GVNA 3P7MA 4B4KA 4CMGA 1SEVA 3GQBB 3IALA 1VI5A 3EZLA 3KB2A 3PFKA 2DKOA 4NONA 3TDNA 3C8MA 2OESA 1CLEA 3GCGA 3PG5A 4N01A 2Z1MA 4N65A 5EPOA 5HEKA 4YMLA 1PV1A 2Q5IA 2DECA 2IYWA 4FFDA 4L8YA 1BKYA 4RH3A 5C51B 4I1PA 1SC1A 3CXRA 3HYRA 3QLEA 2B30A 1ZXXA 4MJLA 1S3GA 3BD6A 4G84A 4WK2B 1QOQB 4LZJA 2QLLA 2PBFA 2JIZD 1F17A 2OORA 1EM8A 1YASA 4RK4A 3U17A 2JAPA 3OD5A 3NTXA 3PKZA 1I14A 4TQUS 4UXIA 1OWMA 2XBMA 4NJOA 3IOYA 4XB2A 1XNJA 2AZDA 4RNDB 3QUSA 2C7VA 2ZR8A 3EWSA 2JI7A 4QICA 4KN8A 5CM8B 3CX8A 2X15A 2GYYA 4D0GA 1GSAA 3G1UA 3PYMA 4P3YA 1YQXA 3WSVA 3BMOB 4URXR 4O4LF 2IL1A 1M6EX 1Z7GA 3L3BA 4ENRA 2H8GA 2ZWOA 4HNGA 2PZ8A 1KFBB 3VR3D 2DB3A 1T6BY 3AYZB 1C3OB 4FYKA 1SPXA 4TWIA 1JHAA 3GEEA 1OFTA 3H9UA 3OIDA 1X13A 4LMPA 1Z2EA 4RADA 4E1VA 2ATEA 4G5RA 3MERA 3B6MA 3LOUA 4URZR 4K0RA 1ML4A 3H2SA 3U2QA 1JIQA 4RE5A 3ZGXA 2YHSA 1AUXA 2KBFA 1L7MA 3D3WA 4GBMA 4C3UA 3P2IA 2FTKE 1JLKA 3DOJA 1LI7A 4BFYA 1T5DX 4EHBA 2HQRA 2YOHA 4QDKA 3U7HB 1QDUA 2Q1TA 2IYSA 1NVKA 1TVKA 4H0NA 1DL5A 3LCJA 4OHUA 1IDN1 1RRMA 4NP6A 5CM2Z 3OIGA 3OKFA 5I7WA 1F3OA 2JI9A 2XCOA 3VC1A 3UICA 4X60A 4YR7A 2ZYDA 3MTAA 9ATCA 1T3GA 2H4YA 4I4CA 1TI7A 3HPQA 5K6AA 1NY6A 1XVAA 3IP9A 2WJWA 2FETA 4U2KA 5DGHA 1W0JA 1XUOA 2Q1WA 5IT5A 1SBZA 4ENQA 1FS4A 3D6MA 3IRUA 2GAOA 5FAXA 5L7YA 4YYZA 4ZCMA 5AUNB 1U0BB 2RMKA 3GN1A 1VE6A 1FU8A 1VJDA 2ROQA 4P4SB 2WV9A 4PO3X 5E0KB 4BXOB 3QITA 2BGTA 3H86A 3W34A 5K3SA 3QG5A 3L1JA 5B4UA 1FJHA 1H5QA 2D5BA 1P9LA 2VZ8A 5HDBB 3TM5A 2J46A 3QX7A 1Z4MA 3C8DA 1ZUWA 1IBMB 1WUHS 4AZWA 4L4ZA 4E1BA 1CZKA 1Q11A 3K1TA 1WG8A 2SKDA 4OJKA 1C3OA 1CS0B 2EFEB 4LE1A 1W4AA 1PHPA 4RHEA 5LQSA 2YMQA 3OE7A 3LWBA 4W82A 1JLRA 2G9UA 2I4LA 1P39A 3Q72A 1M54A 3A1TA 4U7WA 4ZMRA 5A7FA 1S2GA 2NNLD 4PZZA 2HX1A 2RGNC 4L15A 1G7CA 1XCPA 4HVTA 3CPSA 2FWJA 3T5AA 2ZXFA 2I29A 621PA 1AZWA 4XX0B 3ZHXA 4EJ0A 1CIPA 1HMPA 1MC4A 4NYMQ 2CNDA 2X76A 1MPXA 2IXFA 2AVDA 2ZDHA 1DIBA 3A1FA 3DDUA 2ASVA 3T5TA 4FZJA 1K3UB 3GYGA 1IDOA 2J3HA 3PSHA 4E2XA 4DEYA 4PNPA 1EAYA 1I01A 1Y5IA 4QELA 1Q92A 3L82B 2DLCX 4P5PA 4ENTA 2WIGA 3KDPA 1SA0B 1RQPA 3ZD7A 3GLKA 3F5FA 3RI3A 5CCBA 2C94A 1GTZA 3X1DA 5BV2P 4KTVE 4F2PA 4Z4CA 2J6HA 2XB4A 3TI9A 2H9AA 2BBSA 3NCHA 1RT9A 1JJ7A 2Z6VA 1T0PA 5KUTA 2HMTA 2VQDA 3JW8A 3QFHA 4J0JA 5JNWA 2GCNA 3W3AD 3ZZUA 3VPBA 3CG0A 5EJ2A 4AU1A 5BWLA 1MX3A 4LOAA 2RHTA 1NVGA 3GDHA 2GPJA 4TGLA 3U39A 2HMYB 3NHFA 1NSYA 2GCEA 4KV7A 1J09A 1LLDA 2JHCA 1DQPA 1DX9A 2Q9AA 4JP8A 3VSBA 4PS1A 3QU7A 1JUDA 3K0HA 2P5YA 1WPRA 2EBWA 1IZYA 2LXNA 3D6NB 5LJLA 1KQFA 4DV3B 2FPMA 2FV8A 1REQA 1EQAA 3GRVA 4AB1A 3FDFA 2PT5A 2QR3A 3ABSB 3INRA 4LTNA 3L8YA 3MSXA 3IX7A 2FWNA 4JLWA 5J4LA 5EERA 1LC0A 3AM5A 2AZXA 1IJKA 1Z13A 3MWDB 5BYKA 4GO1A 4D3SA 5CXQA 4WD3A 2CN1A 3L1UA 2RAFA 2W4QA 1CHDA 3Q41A 4QL3A 1NTOA 2NZVG 4UBKA 5EE5B 1M67A 3WGVA 4J16A 4CCAA 3OG9A 3A6LA 1SA0A 4F04A 4F4JA 1XTBA 3ITNA 4AKIA 5IKMA 4WZAB 4B3MB 4K3VA 2WD7B 3CO5A 3L2OB 4Y6GB 2Q5HA 5EZ6B 2GAJA 4L1KA 1JA0A 5L9AA 5LWQA 2NUAB 1MTOA 4Y1RA 4RVGA 3C3KA 4Q16A 3NWOA 1SK8A 4BBPA 5B6JA 4IEFB 4LE0A 3TNJA 2JIMA 2REOA 1M66A 3K0BA 5D51S 2IS2A 2OAGA 3BWYA 3CX4A 3K4QA 3DYBA 3HM2A 3OLWA 3A6JA 1SPBS 4XUDA 4BC0A 3DD1A 4LXXA 2I7DA 4ARSA 3H2GA 5K0BA 3OZCA 3U13A 1YKGA 1KI3A 1ZRMA 1QVZA 3L40A 4W7HA 3WBBA 1XI2A 3ESQA 3TRFA 2JA1A 5C5IA 4D42A 3Q6IA 4RGBA 3IJ5A 2OCLA 4PBTA 2D8AA 4ABYA 3S2IA 1W1IA 4JVOA 4EMTA 5A03A 4RTMA 1T5TA 4BE7B 3BSYA 1E1NA 3L8DA 1BG6A 1ADJA 3PTLA 2PKEA 4KFTA 2PKCA 2AQHA 2C9MA 5T64A 3HB5X 3X3HA 5KWIA 3W9UA 4TXJA 4XM2A 5DEIA 1F6WA 1ZN8A 4F4HA 3OECA 2JFPA 3VZBA 3AESA 4IIGA 5IFKA 2IGBA 2IHUA 3AI1A 1C5KA 2AD1A 2ZJAA 1EIWA 1S8OA 1ZCJA 3WGNA 3RJTA 2A3RA 1P7VA 4IVQA 2HRCA 3GFOA 3Q7PA 4QBKA 4NL4H 3EZGA 5ELMA 1CS4C 4UMVA 1S2MA 3ZD9A 1EVQA 4F5ZA 4HLNA 5CYOA 3DMFA 5K3OA 1YGPA 3DBRB 4GYJA 2QMYA 3V55A 5L7WA 3ZDXB 2ZRLA 1LJ8A 3RK4A 1JT2A 3RASA 4POOA 5A0VA 3NLLA 2BLNA 1PJLA 3I8XA 1FRVA 2QE7A 1BOOA 3EQ9A 4H4CA 5G1OA 1VDMA 3G2NA 2D1QA 1A5ZA 2VJCA 3QP9A 3WLHA 2GZDA 4MWBA 3HKEB 1SVKA 3EF3A 1KKMA 3F7TA 4PZDA 3I8SA 1I2AA 3AUKA 3ENZA 4G24A 3USZA 5BSGA 1EWTA 7ADHA 2I4RA 1G1AA 2QGZA 3OM0A 4KN9S 4V0SA 2C2BA 5ALRA 3IMCA 1KYQA 3MS2A 1H2YA 4UTOA 1GZ3A 5KCMA 3ZUGA 3USCS 3ZU6A 3JY6A 4MMYB 5ABPA 2LDXA 3NDRA 4KFUA 1P0MA 2FJPA 4DMFA 5ICCA 4RM2A 3OESA 1V5FA 3S2YA 2FPXA 2V3WA 1UF9A 4XRRA 4A6PA 4YUZA 3DPIA 1EZ1A 2GEJA 3BERA 3K3PA 3W5SA 4RJTA 3DWIA 2H1FA 2WJJA 1PIWA 2Z4TA 3EZXA 2HU8A 3SS7X 4DEXA 4Z4IA 2QBYA 4HP8A 4Z4EA 5CAEA 2H18A 5HIJA 1WQ3A 3FE2A 2EDAA 5AK4A 5LOVF 1YCDA 5ALEA 1Z75A 4GR9A 4A0RA 3M5CA 1A9TA 4JEMA 1G20B 2TMKA 5HOEA 2WJHA 3QVWA 3G2LA 1B43A 1XRPA 3WS7A 4Z4HA 4PLWA 5B4TA 3G0BA 4QTZA 2C7PA 4HB4A 1ZIXA 4QDUA 5CB4F 3C3EA 2H8KA 2AEMA 2OQRA 4TS9A 1B3BA 1GRVA 1JJFA 3LX4A 4HEQA 4P84A 5I9MA 3V7UA 4DV2B 4CEJA 1K8ZB 3A31A 4LDZA 3LBNA 4OV6B 3B1ZA 4KMSA 1YBHA 2IEDA 1TRHA 3SQNA 4IEEA 1GITA 1YI1A 4Q7LA 2ZB8A 4Z6KA 1Z0FA 4M83A 2NUTA 2UUBB 2GCPA 2AVNA 3QBJA 5CA0A 1QMGA 2ZUBA 1AX9A 1TUEA 2G0AA 5LIRA 3R9XA 4B8ZA 1KAGA 4ENPA 4QNMA 2PZEA 3O93A 1PW5A 2KI5A 3SDZA 5J63A 4WZBA 2XWSA 3PQFA 3TUIC 1T43A 1PKXA 1RRVA 4Q6WA 2AFHB 4E03A 3EH1A 3CBQA 4S0ZA 1D6MA 1MVOA 2OGWA 121PA 3FUCA 1ZVKA 1RRKA 1XE3A 1G8HA 1YB2A 1FP4B 1Z0UA 2FSFA 2R60A 1OT3A 3DCYA 1IWPB 2C4TA 4FLMA 5CUQA 3N6XA 5ER9A 1GAQA 1JQLB 5EHZA 5EXXA 5FUVA 2XSZD 3OOYA 1XMIA 1BYIA 1OUMA 1II0A 4V3CA 1P3DA 3ZY3A 4JV5B 3O4IA 4LY9A 1Z22A 4FMCF 3ELDA 1RU3A 1DAOA 1VJ5A 4EB6B 2Z95A 3V1KA 3AONB 1XKLA 4JI8B 1KU0A 4RL4A 4KBGA 2AOTA 5THXA 2WJYA 5HP4A 2I3ZA 2YXEA 3ZNPA 4MS1B 5CJPA 1UFKA 1J56A 4ZANA 4BAGA 5IABA 1W4CA 1LB1B 3E1SA 3IEUA 3AJAA 2NAPA 4AMVA 3GYBA 2YASA 4UJ3A 3W7AA 1G4HA 2PRZA 2W4MA 1DZ3A 4NBSA 4U7GA 5E9WA 4JUBA 3UK7A 3LCVB 5DI9A 4AZ3B 3U4QB 4JC0A 2EXXA 3RYCB 3CE6A 4ND5A 3NBZC 4V0QA 3CW2A 4DCCA 2ZW9A 2ZIWB 1UPUA 4EA7A 4I50A 5IN5A 3ZY5A 3KHUA 4D8UA 1VSVA 1MX9A 4KWEA 2VAMA 4UASA 2IYUA 4AYTA 4RPIA 3V7NA 1WPQA 4MQFA 4MSUA 1RI2A 1Q7RA 2IHYA 4ZD6A 4L85A 4KYIB 4G8CA 4CIYA 2QAJA 3GZTB 4K9KA 2CL0X 4QT0A 2PUTA 1QVRA 5G2OA 1YZLA 3ITDA 4BKOA 3R6DA 2WU8A 1UQUA 4CUJA 2NXWA 1ZKDA 1CUAA 3K09A 4I3FA 2I34A 2XUIA 4MVJH 2UZ1A 6ABPA 3ZZ0A 1V11B 1T2NA 1QIIA 3AF2A 2XB9A 4D57A 4B3DA 4Q1VA 5IVPA 1V5EA 1FRQA 3FTNA 2P9HA 4Q24A 3F1LA 3WO0A 4L7QA 4LZAA 1WDKA 3NKLA 1JU4A 1U4NA 2FGJA 5UKDA 5F35A 2WWIA 2C4WA 1RE0A 3TR0A 3WLKX 5BMOA 2F8SA 1ZJ4A 3RC1A 4HSGA 1NJ5A 2Q3BA 5ALOA 4NCAA 2JLZA 2B1QA 1LVUA 1ZM7A 3BL8A 2CJYA 2IITA 3CN7A 3IDAA 2OYRA 1T36B 3TD2A 3GCDA 2BM0A 1W6RA 4M9QA 4CMEA 5HR5A 3V6LA 1LSSA 1W5SA 1WCWA 2GCOA 2QTMA 4KPUB 3ZYZA 3RYCA 2IQ5A 2G9QA 3SR4A 2J0SA 2ZVQX 2QIPA 4CWAA 4G1FA 4JQOA 3SOPA 1HFKA 3LPLA 3VFDA 1C1XB 5EUBA 5CVEA 2SCUB 1P0PA 3BG5A 3N53A 1GFIA 3G0CA 3UTCA 2ZSDA 1N6HA 2Y71A 4DG8A 4KGVA 2JEYA 2NO0A 4IH1A 1Y5RA 3HZOA 4FKBA 4X61A 4YO7A 4YJKA 2XCRB 2O2EA 2QRQA 2PJUA 1NN1A 1ZUD1 2O4UX 3OAAD 2VC2B 3ZQJA 3LHFA 4DV5B 2I4NA 4R2HA 3UV3A 4X65B 5JR3A 1SU7A 3ASVA 3IR5A 5L3VA 5KQGA 1V11A 4LRSB 1Y5NA 3O8BA 4NESA 2JL1A 3CR7A 3JZFA 5B2FA 1J9EA 1JLMA 1WB5A 3S7TA 2FPIB 4R7GA 4CMKA 3TRIA 4O8CA 1LF5A 5CLJA 2ECKA 3BPSA 2GARA 4BNHA 4HUQB 1KOJA 3D3KA 3QFTA 3L4JA 1NYTA 2B2CA 3FTQA 2DHRA 3C7TA 2XNSA 4GBGA 3ZNNA 2QW0X 4L9WA 4GI3A 4EVSA 1S2IA 4MEJA 4XD7A 2R62A 4WADA 3G2MA 4II2A 4C07A 4CM9D 3PLNA 5CK5A 1G6Q1 3A1UA 4M99A 1DIAA 1EGAA 4E5YA 2P3OA 4AW9A 1HNNA 1WZUA 1T9CA 1WKBA 2YC4C 4KXFB 5TGDA 4NZNA 4YEDA 5LIPA 2FN8A 4NJMA 2Z43A 4TTAA 2VDRB 1KEWA 1BXRB 1NXSA 4OJTA 1G291 1R88A 3RWBA 4BJHB 3FI9A 5CEFA 1M6VA 4JQCA 3T52A 1IUNA 3OZTA 5DYGA 3MOIA 3AJEA 1G64A 2PWPA 2QW1A 4UQOA 3FYSA 3ZW8A 4BMPB 1PT9A 5K3FB 2FOIA 2WF5A 2I71A 1AT1A 3U3DA 1Q7TA 3UT0A 4JEIA 1W5BA 3N2KA 1UK6A 4GE3A 5FADA 3WLAA 1NW9B 1DIOB 1R2QA 1CQIB 3TXAA 3ZHZA 5LNK6 2H2WA 4UHHA 3VH2A 1AKVA 2B9EA 3BTUA 2P9BA 4BMZA 4RV5A 1E1LA 2JCYA 1SKYE 2KHZA 1Y8QA 2ZIGA 3BMCB 1QAQA 2OP1A 3M1LA 4QC2A 4S1VA 1JILA 4DQUA 3OQMA 1WM1A 1U98A 4XH9B 4LRQA 4BNLA 2JGLA 1GQSA 3KQTA 4LHYA 2BI8A 3VNSA 4YMGA 3C6ZA 5JCZA 4LZOA 1XMOB 1NJGA 5I9IA 4ZODA 3I9JA 3VH1A 1NOJA 3ZCTA 3ZY2A 4B7UA 1C9NA 1KO8A 4XIGS 2YWBA 3CZPA 4N4AA 3G5LA 2WUVA 3HB1A 5DXJA 1AGRA 2P0AA 3TRJA 1TO6A 4XDYA 3LU1A 1VRCA 4JL5A 1C8BA 1M1XB 2OQVA 1BXRA 4QDZA 1PR5A 2RH9B 2IHTA 4E22A 1BMQA 3LQRA 5JDIC 1EX6A 3DS8A 3CWQA 4UM9D 1GGEA 1QHIA 2E4VA 2WVAA 4TOIA 2IODA 2IEGA 2RH5A 3ACCA 3LUHA 3AKZA 3OF2A 2IP4A 4X8HA 5DLPA 1Y7TA 5DNCA 2QXYA 4R8KA 4ZTZB 4IHQA 1VCHA 4NCJA 3ROKA 1DUIA 2E9SA 5EJEA 5IARA 2NYVA 1TLTA 2CHUA 4TUYF 2XECA 3CW8X 1FW8A 2HU5A 5AR1A 3GLGE 4X8MA 3U9LA 3VU3A 4KDFA 2CXTA 3NTUA 4AK9A 4OHVA 4RS3A 1AN9A 1BAPA 2IZOA 2O07A 3ROZA 3HVHA 3I61A 1OLXA 1J1IA 4PNHA 2FFHA 5IASA 4Z4FA 3GDOA 2BHTA 2OD2A 3DSRA 3TL2A 4ARAA 2B69A 1N8TA 3L4BA 3LGXA 1EVIA 1LZKA 3JR3A 3TLXA 1Q0UA 3JQBC 2V4MA 2ZE6A 3NQ41 3O4FA 4R1NA 4S1OA 4EW1A 3TQIA 2RKBA 2UVDA 4B3GA 3GA0A 5FLYA 1XFAA 2YHIA 4LHSA 3VR3A 5HVNA 4P0TA 4R5MA 1RC1A 1S8NA 4FDMA 1RBQA 4GPBA 4XLLA 1AC5A 2DBYA 1E92A 2C59A 2D8MA 4N6OA 2A1UB 2F64A 3KZ1E 4P3OA 2YUIA 5E7QA 5G40A 1R27A 1YZQA 4ZQHA 3SXUA 5ED4A 2GN8A 1TJPB 3FB4A 3UANA 1A4IA 3ZJ5A 4CXMA 1BRMA 2BFPA 1NY5A 4M7PA 1PJTA 1A4RA 2AR7A 3C70A 4YPOA 4JLKA 4YLEA 5F51A 5IT4A 1BDIA 1OA0A 3FOZA 3LQQA 3TPZA 4FYPA 1PVVA 3D7NA 5K3AA 2PMFA 1GCUA 3QTTA 4K03A 4F60A 4Y7DA 3K0KA 1TZCA 2B4TO 3HJFA 3NT5A 2WIFA 2GZAA 1OD6A 5JCXA 1E1CA 4UVHA 2EATA 3C7CB 4I1OA 1W4RA 2OB1A 3VKHA 3GUCA 1KL7A 5IVIA 3ZLTA 3E4DA 4ARBA 5G0VA 1POWA 4D9KA 4DS3A 1DG1G 2OZLA 4YH1A 1I2MA 4HDSA 3TB6A 3ZJTA 3AOEA 4H3HB 1BMDA 3LBHA 4R5HA 3W6OA 5B5SA 4EGJA 4EUEA 2EKPA 1GR1A 2XTZA 1FUKA 3CF6R 3L4EA 4HI0E 5BR7A 4CV0A 2IEYA 4YGXB 4BQRA 3MGGA 1E2HA 3AHCA 4WLNA 1Q0TA 4HZUB 1I7DA 3C45A 1N2CE 4ENUA 4IIUA 1KFJB 4LY6A 1P2UA 4JHLA 1KH3A 2A1UA 4OTZA 3PWZA 1NMYA 1SU8A 1WDMA 2C8LA 3STXA 2P4EA 4HGNA 1QIMA 2A57A 4H3SA 4DADA 3Q8MA 1TO2E 2QG6A 1KMCA 2ZYHA 5G0TA 1IZ8A 1JBKA 1JLSA 1PR9A 3A2NA 3EAGA 2O7SA 5B37A 2H5LA 3CB4A 1VOTA 3CSSA 3SR0A 1SULA 3HUUA 1E79D 5M04A 1E2PA 4PG4A 3HP7A 4KIJA 1G16A 4HH0A 1QYVA 2H2FA 1AHHA 2PS9A 2XVAA 4KQMA 4QO7A 2HAEA 1C2YA 3U4HA 3P9IA 5ALZA 4L9AA 5BOSA 3CFYA 1FUIA 1S8FA 3RODA 3F90A 5AJYA 4BEBA 4AJ9A 5JXJA 3IP3A 4AURA 2V59A 4A2CA 1B8VA 3ELUA 3GNLA 1E5DA 1NBMD 3BJIC 4H1WA 2YQ4A 4FK8A 1SM4A 1MRZA 1HDOA 4Y2TA 1Z33A 2FNAA 5K0JA 1HG0A 1ZEMA 1K08A 1DJLA 4LQCA 3H65A 3WA7A 2C1XA 2WWXA 4OHCA 5J5VA 3GARA 2CE7A 3DYIA 3W3AA 3WKCA 5FOUA 2YWJA 4B1FA 2PZLA 2JI8A 5A9SA 2YWGA 4PX3A 4WECA 2YUTA 3BORA 4LGYA 1NVVQ 3F96A 2AQIA 5PNTA 3L7LA 4FX2A 2J7KA 3K35A 1YC5A 3RFUA 3OPVA 1VG1A 3CINA 3O74A 2H4FA 1EJBA 1P17A 1U2TA 3N9IA 1JDVA 2XWPA 3CLVA 3DMTC 4MYTA 4P08A 2P75A 4WINA 5ES3A 1I6KA 4OQEA 2CLOB 4M8NE 3PL1A 3AKYA 2FCRA 3E4CA 2DT8A 4MV4A 1R5NA 1MEJA 2RHJA 2QRKA 4GIBA 3WAKA 4ER3A 2HLNA 3A4VA 3EBLA 1FF9A 1UEJA 4GX1A 2Q3FA 3M6VA 4GC5A 1T3LA 5A4MS 3F5QA 3ROPA 1G1MA 5GV8A 1JAXA 4BB5A 2HBYA 1RACA 2HMVA 1YHNA 4BO0A 4GWGA 5CMLA 5EAIA 3SYKA 4D4LA 1U8XX 5DBEX 1O89A 3H05A 1TL7C 2NX2A 3OUTA 1QG2A 1CJBA 1SG6A 2EEZA 2J48A 5AHWA 1R3DA 5E8JA 1FIUA 4KNYA 4DCPA 4OX9Y 1DKLA 2Z5FA 3KB6A 1TFRA 1OAOC 4NBKA 4PC2A 3QWBA 5LQAA 4MQ4A 3PFIA 1XHFA 4IDNA 3ORYA 2AYXA 3SFVA 1AHNA 2NVWA 2A0XA 3G8AA 4F9EA 5C3UA 2YIVX 1QKJA 4KR0A 2DHQA 3SDSA 2X2OA 2GD1O 5LC1A 1XD8A 5IHXA 1E1QD 2AUMA 2V7QD 3GNSA 3IP1A 4FYIA 3VX4A 3JYQA 3Q2IA 1D6JA 2GXQA 3E3AA 3P2EA 3QPWA 4PYIA 1VYVA 2WJAA 1Z6XA 1NI3A 1TZMA 3OKAA 4B7XA 1YACA 1CUYA 4H35A 2VBIA 1Y6GA 2IPXA 4XXHA 5I7EA 3UMSA 2HT1A 4L3WA 3VR4H 1THGA 2OBMA 3L7MA 4YV7A 4IRXA 1R0KA 4URWR 3SN6A 2NVOA 4PBRA 2B3TA 1CYDA 3LA6A 2BGJA 1K0UA 1K7XB 5TMEA 5KOJA 2GD0A 3SR3A 4CM4B 1KRXA 4C7OA 1KI8A 2G25A 2CCKA 1T35A 3JX9A 3PUHA 5CEEA 2QT0A 3V33A 1NI4B 2Y6VA 3UMJA 2ICAA 1H1LB 2DCUA 2HQOA 1WXEA 2YV5A 3L7JA 4GSKA 4KIUA 4MK4A 5EPEA 3OQIB 2L82A 2COKA 1MT0A 4NICA 3VDNB 3VVMA 1C0PA 1WXDA 3VSCA 3BBPA 5LYJB 3DHWC 3WGUA 1XZHA 1A8SA 3F1KA 1UOOA 4ML3A 3AG6A 4PR3A 3V4FA 4ZWNA 1DX4A 1LWOA 3TFQA 1MB3A 1MF7A 3AB3A 3D43A 1Y8RB 2Q4BA 3CUEF 2AMLA 4FNGA 4AZ0B 3E3LA 1J0AA 3H0EA 2J9YB 1ULAA 3KQMA 1USIA 2PH3A 3PI6A 5CIQA 2UAGA 3UJBA 5ALWA 2CL6X 1QZXA 2QWXA 4OEHA 2OHVA 1Z5PA 3ABQB 2R96A 3JYOA 3OHMA 2PWAA 4W5JA 4BX3A 5I48A 1J7KA 3DWGA 5AUQA 3NDBB 3WKBA 1HLGA 1JYEA 4NC9A 1ORIA 4PVCA 5A62A 4QUBA 3LCRA 2QEQA 2O0JA 3DE0X 3A32A 3H2BA 1V8BA 3TKLA 4UQLA 2AN9A 3Q12A 3I2GA 1NM5C 1U7HA 1TCUA 2I66A 3ANLA 4QYSA 2CHVA 4H6PA 3RIGA 2IZ5A 2NYRA 1VPEA 2V45A 2VJAA 1DC6A 4F11A 1EDZA 4CM4A 2R1UA 2QENA 2UYYA 4N3GA 4NF2A 4EHNA 2XQFA 3KYCA 4NEHB 2E5LB 5A3SA 1Q91A 4X3OA 1ZUNA 3Q88A 4H3KB 4KQWA 4OQPA 1YU9A 3JWGA 5JC1A 3TCNA 4KL8S 1PJBA 3T3OA 1HYGA 5WRFA 4ZDKA 3FGOA 3FY4A 3PRYA 3A9SA 2D7JA 4MQ6A 5BR4A 4MS3A 3SJ7A 2J4FA 3F4BA 3ONWA 4TV8F 4FN5A 2VIIA 2FMUA 1D09A 3F4LA 3LUJA 5DNUA 3OZWA 4NZMA 1QYRA 1Y8RA 4LZLA 4R40A 1DAHA 3VU8A 1M8JA 1EFPA 2ETVA 1O2DA 1TLFA 5CVJA 4FE4A 1A96A 1NUPA 1Z0AA 2O8EB 1Y3HA 2H7VA 2XUOA 1MQSA 3K9CA 4ZV7A 4YWJA 1T8RA 4GPEA 2AZTA 1W8DA 3FH0A 2G7ZA 2GTPA 3KK0A 3AL3A 3WL8A 2A3NA 5KEIA 1OIVA 1AKTA 4KXLA 5CK4A 1QNLA 1ETHA 3SMQA 1H2ZA 2AN3A 3LVFO 4EI8A 4B4UA 1UIRA 1Z8FA 1IRIA 5IJ0B 1BXGB 1U02A 1YS1X 4QUIA 4C2AA 5ELXA 4AO7A 4ZOCA 4P81A 4XUGB 1GPBA 1U5BA 1T4CB 2XE4A 4HXYA 2XSZA 5FYDA 3O82A 1HTTA 2ZLBA 1NI5A 1ZCZA 3EVZA 1NQUA 2QTRA 2O2DA 5IJ9B 4FN4A 5E9AA 2ZSAA 2AW5A 2MT9A 1P2SA 2YFYA 3QX3A 1EFKA 4JLNA 4WZAE 5LQKA 1Z4KA 1DEKA 2OVFA 2QQEA 2EGGA 5HXAA 5JSQA 4ZHQA 1U5CA 1X1DA 4DCTA 3CRMA 4AY6A 2NG1A 3ZN2A 4C7MA 4KKXB 1G3RA 1Z2AA 3FX2A 4NZ9A 3KQNA 5D3KA 2PRKA 3Q8WA 1CZRA 3BEDA 1OVGA 4JP1A 5D3ZA 3DTNA 1GYRA 2H1VA 3T61A 3U56A 3WLTA 2ZDGA 3ZZMA 1XFDA 3I4LA 2NVUB 5AW5A 1SO8A 1NL3A 1T2AA 2MSDB 5KTTA 3HXOA 4P0QB 1HQDA 3A6ZA 4GICA 2AJCA 4NV3A 1ILWA 3FWPA 1R6AA 3HU5A 5BSUA 1SQ0A 3IXQA 2BDTA 1EJ6A 5LZ2A 5KTRA 2XIJA 3AU8A 1XNQB 2CEKA 1ISIA 3Q5EA 1BA2A 1KU6A 2HU7A 2RGRA 3E5RA 4PLGA 4O4HB 1RLMA 3T4PA 1UBOS 3NP7A 3V1UA 3O9ZA 1IZZA 3FLBA 3O91A 2CK3A 2P8JA 3KOUA 1T4CA 1M72A 5AVVA 4O2AF 1WOMA 1W47A 5LQNA 3LY9A 3STWA 3LT2A 4YJ2A 3CT6A 2Q6OA 3JWPA 1O03A 3D4NA 1WZ2A 1L1RA 3FLEA 1V4BA 4H17A 4L4RA 3ZH9B 4BFWA 4DLKA 5CXUA 5M2QA 1I5RA 5F7OA 1IH8A 5IS2A 3JVUA 4B85A 1A9ZA 3HDTA 2JANA 3P27A 1DBSA 1M1NA 4IG9A 1JEQB 1E5LA 2G1KA 2WRZA 2E4UA 1RC0A 1XZEA 3K5IA 1CG6A 1GG2A 4J29A 4MWEA 3G9ZA 4XJXA 4ZYUA 3HVIA 4Q5IA 5KNDD 3I1FA 2P27A 4QQRA 2RKOA 1U3FA 5K0GA 1QU3A 1SK9A 1Z0ZA 1Z7BA 3FPGA 1M2HA 3T9CA 1GNPA 1FA9A 4WCVA 1YD7A 3QVLA 4G5FA 1TD1A 3KTFA 2ZIXA 1EQ2A 4YFYA 5F1KA 4DYHA 5KC9A 3MJFA 3KKKA 5J2TB 2PO7A 4WZBE 1O0SA 3CRRA 4C4SA 1IMOA 4ZRDA 2VTBB 1OI3A 5B1SA 1OYVA 2JG3A 4YQZA 2O05A 3KT8A 4FZ3A 3X1JA 4K9LA 1A5AB 1LBSA 1CUVA 3OAAA 4RORA 2D5LA