1IUOA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with acetates
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
272
structure length
272
Chain Sequence
b'NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords meta-Cleavage product hydrolase
molecule tags Hydrolase
source organism Pseudomonas fluorescens
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
total genus 103
structure length 272
sequence length 272
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iuoA00
4JNCA 5CT9A 2WJ4A 2JF0A 4BDTA 3H17A 1AC5A 2ZYRA 1XKTA 3GZJA 1UKAA 4PNZA 3H2KA 2HM7A 4KE9A 3AJAA 1XRMA 5LKAA 3BXPA 3F97A 1AMNA 5EIAA 1BS9A 3BDIA 1VLQA 3I2GA 3HSSA 5E2IA 4AO6A 1QTRA 1T4MA 3ZPXA 3L1JA 1H2XA 4UFOA 5I9IA 4QA9A 3KD2A 3WKCA 4BZZA 1QONA 1G4HA 1JKMA 4ZV9A 4PSCA 3PDCA 4LYDA 4M0MA 4BCDA 4QWWA 4RE5A 2Z3ZA 4ZWNA 4BP8A 4DGQA 1OILA 3H0CA 1E8MA 3G0IA 4WJLA 3SK0A 4QDUA 5C7YA 1R50A 5T4EA 4E46A 2JGKA 3SWWA 2JGIA 3IUNA 3VISA 1CQZA 4H7JA 5DYTA 2XUIA 2WTNA 1SCQA 1ZD5A 3AFIA 2Y1KA 4N8EA 2XDWA 1UWCA 1F0PA 4WY5A 2FUKA 4D9JA 3GA7A 2FJ0A 5DLPA 1HBJA 4OB7A 4CIAA 5ALTA 3WQHA 3C45A 4B80A 2WU4A 5ALZA 4QZVA 2PKYX 4FLFA 4UUQA 2BUAA 1RWQA 3KWJA 1UK9A 5IVKA 3BWXA 3FCYA 3B5EA 1KU0A 3S8YA 4DSAA 5CT5A 3EQ9A 2JGLA 4X94A 2QJRA 5ALNA 4W1PA 1VOTA 3RM3A 3CN7A 4YK7A 1O6FA 1XZLA 5FPPA 4EY6A 1ZI6A 1LPOA 5AOAA 2OG1A 5ALOA 1RP1A 1CUFA 4X6UA 2XUKA 4WFJA 4B9AA 4EY7A 2OCGA 1CLEA 1XZHA 4JEIA 4DTCA 4UFPA 5JAOA 3QH4A 3RKSA 4K6HA 5HF9A 4AZ0A 4J0DA 4W1SA 4XX1A 2WHPB 4TPKA 1A88A 5AHXA 3WLAA 5K3AA 3R3ZA 3LLCA 1A8QA 4N8SA 4BVKA 1BCSA 4QWMA 1ETHA 3C6ZA 3H04A 1DX6A 1P0PA 3V1LA 1LPBB 3D7RA 3VJLA 4BE4A 3CN9A 1OCEA 3DKKA 2Y6VA 1FFBA 4Q1VA 1R88A 1CUAA 4DM7A 2DQYA 2XMQA 1QFSA 4HXGA 4BRSA 4FTWA 1Q83A 1GPNA 1XQVA 1U4NA 5JIBA 4FBMA 1CUBA 2C0PA 4H18A 3H2HA 1DQZA 1SFRA 1TCCA 5ESRA 1C7JA 1AUOA 1BU8A 1QIGA 1XKLA 5CURA 1TCBA 4BC0A 2V98A 4EHBA 3C5VA 5C81A 4Y9SA 4OPMA 4AX4A 4XWGA 3UUEA 4J3JA 4WDRA 4GECA 3FAKA 2XQKA 1F8UA 4NMWA 5K3EA 1BEZA 3W9UA 4Y2JA 2XMSA 4WDQA 2OQVA 5ALGA 4MXDA 4X6YA 4PO3X 2I3ZA 4FLEA 5LKRA 1PV1A 4U2DA 4GXNA 3C6BA 4LHEA 3JYHA 1EHYA 2GYUA 1DX4A 5LZ4A 3IB3A 3U0VA 5AK3A 4B82A 1T2NA 4L9AA 4EBBA 1XLVA 2BUCA 3HACA 2WSLA 2CBGA 4N5HX 4IQ4A 5LZ8A 2PU7A 1HKHA 2I78A 3AZOA 1JT2A 5AK5A 5K5EA 4Q3OA 3FLBA 3WWPA 1EVQA 1BCRA 2WIJA 1Y7HA 3WIOA 1ZD4A 3M81A 4KR0A 3O0DA 4Z49A 1EA5A 4QDOA 5AM1A 4CCWA 1UK7A 2XQJA 1MX9A 1MX1A 4DNQA 4RPCA 4X85A 2XUPA 1H2YA 5JYCA 4UBNA 4UHDA 4FNGA 4BZWA 5BV7A 5AI4A 2RIPA 2HA3A 2PSEA 4AN0A 4H7EA 5ALWA 3SC2A 3IIIA 3HRHA 4HRXA 5KREA 1CUYA 5IVHA 3ESAA 2V96A 1X2EA 1QIHA 4UBOA 4DMCA 5EHXA 2PVSA 2HA5A 1YB7A 1E3QA 3TRDA 1QE3A 5AOCA 5CT4A 1LPNA 2R8BA 3DQZA 2QUBA 1LPPA 4B0OA 4ZI5A 1CVLA 3LIPA 2VT6A 3KXPA 4LIPD 4I3FA 3HI4A 5FUMA 1LBTA 1X70A 5CH8A 1BEEA 2WUFA 4GHWA 1W76A 2HFJA 5CXUA 2HA4A 3D2AA 5BWBA 2Y6UA 5AH0A 3AZQA 3A2MA 1MNAA 4NZZA 3I28A 1K63A 2V9ZA 4B7ZA 4C88A 3IDAA 2PSDA 1Q0ZA 4EB0A 2GBFA 4GEGA 4BB0A 2OAGA 5DYWA 3O95A 1HLGA 5T4BA 1P0MA 1VXRA 2G4LA 4J7AA 3ICVA 2JEZA 2WIFA 5CMLA 3FYUC 5HF8A 1JJIA 4I19A 2XMCA 1H2WA 1W52X 2HA6A 3NWOA 2C4HA 3X3HA 1LPMA 4QE3A 3ILSA 2J3QA 4XVCA 5AOBA 1XRNA 1W6RA 4HS9A 3NGMA 2QS9A 3C5WP 4KE6A 3VKFA 5C8ZA 3C6YA 1R3DA 1CUVA 4LKOA 1QFMA 2HRRA 2Q0XA 3WL5A 1DT5A 1ODCA 3F67A 5E4JA 3FCXA 4B85A 4C6HA 3OC0A 4B9EA 2C5GA 2EDAA 3WWCA 1A7UA 4KAAA 1JFRA 3R3YA 5JASA 1IUPA 1MPXA 1CUWA 4Y2SA 2XQIA 1JJFA 1N5RA 2JGFA 3GELA 5F4ZA 5AI8A 2WHPA 4BP9A 1FFAA 4JUIA 2BKLA 2CB9A 4HZGA 1GQSA 4EA6A 1UOQA 2OXEA 1GGVA 4G9GA 3H2IA 3BF8A 2QM0A 2OGZA 4X93A 4BRZA 5HF5A 5LYYA 5HFNA 2WHRA 1WPXA 1HL7A 3A6ZA 3W04A 5JALA 3ZV7A 1XQYA 2WIGA 4H7DA 5LLSA 4W9RA 1K5PA 1K6EA 2QMQA 5LIPA 1TAHA 1EVEA 2CEKA 5ALEA 3KDAA 2XUOA 1C4XA 1ZD2P 3ZI7A 5HF6A 5T4FA 2OCKA 4L0CA 1N1MA 4IH9A 5EHNA 4J0JA 2QXTA 2UZ0A 1JMKC 5ALDA 5FRDA 3RARA 2HA0A 1MN6A 1NU6A 3HXKA 1QLWA 3G7NA 4CG1A 4N8DA 4B83A 4QDTA 1MU0A 4H35A 5DWDA 3HC7A 2VJAA 4GBGA 4UBJA 3G02A 4DLNA 3FYUA 5D3ZA 2AJ8A 5K3BA 4PW0A 1K4YA 4CG3A 1CPYA 2OAEA 4PV7A 3WK8A 1HPLA 3WK6A 1YCDA 3G0BA 3T52A 1R9MA 3ANTA 4KEAA 3G9TA 3WZMA 4AQDA 1GZ7A 1EK2A 2WG0A 1PJAA 5DTIA 5DYYA 3R3VA 1FFCA 4IO0A 1EB8A 2WTMA 1LBSA 1NX9A 3DJYA 3LP5A 3FVRA 4BYMA 3STUA 2H7YA 4GDMA 3V1KA 4U2BA 4YPVA 2PX6A 2VTVA 3ZLUA 1FSSA 2QT9A 5A7FA 2RI6A 3PE6A 4FFVA 4NVRA 3ESBA 5A6VA 4L72A 3GUUA 3PFBA 4BCCA 4MQMA 4UFNA 5CW2A 5JATA 2PSFA 3WWOA 4BAUA 3PI6A 4Y2UA 4G5XA 2FX5A 3DNMA 3G0DA 4JYMA 3H2JA 2H7CA 2OCIA 1BN6A 2HDWA 3DCNA 3R0VA 3G9XA 2NW6A 5LP1A 5JAHA 2DSNA 3MVEA 3LIIA 1X2BA 5D3KA 1QIMA 4CI9A 5ALHA 4X00A 3D5EA 3DD5A 3Q0TA 2DHEA 1RYYA 5A71A 3QPAA 3YASA 1LZLA 4Y2TA 4B84A 1XFDA 4UPDA 3W06A 3N2ZB 5IKXA 2JGJA 3C8HA 4OB6A 4MEBA 1IVYA 1UOPA 1I6WA 5JADA 2D0DA 2VAXA 3R41A 2Z3WA 5AI9A 1ORVA 1L7RA 2JBWA 1LZKA 1ACJA 1VZ3A 2VT7A 2CKMA 1DWOA 5CT8A 4FLMA 5AI0A 1JU4A 3MUOA 5JD5A 5JZBA 1G5FA 5C8VA 2WFZA 1C7IA 2QZPA 1WHTA 5AKHA 1QGED 4X6XA 1KEZA 4DNOA 5AI5A 1MJ5A 6YASA 4MQLA 3FWHA 2C7BA 1SC9A 4QLAA 4W63A 4J0CA 3ESDA 1YSCA 4DNFA 5H3HA 3I1YA 1XLUA 4QEKA 5LZ5A 3UUFA 1CUIA 4GW3A 5FLKA 1XZBA 1VZ2A 4BTVA 3BE8A 2BJHA 5ALKA 4HXEB 1CUUA 3IA2A 4CCYA 3H2GA 1UK6A 2VF2A 1QIDA 1XZKA 2XUGA 3F8SA 4W1QA 1M33A 3ZLTA 3PFCA 1THTA 1Q0RA 4CIBA 2GYVA 4DSZA 3V1MA 1WB4A 5ALVA 4AXBA 3CXUA 2DR0A 4J0KA 3O4IA 3HJUA 1XLWA 2JGMA 2WG1A 5ALXA 4GLBA 1TIBA 3WZLA 2K2QB 2OQIA 3T4UA 3A2NA 1N5MA 4W1RA 1EDDA 3D3NA 2HU7A 3R3XA 2WM2A 3WK5A 4ZRDA 3FNBA 3AIMA 3QYJA 5YASA 5EFZA 3U1TA 1XQWA 3DKRA 2XUHA 5EGNA 1MAAA 4F21A 4OUKX 1WPRA 2BCEA 1GPKA 1E66A 3BIXA 1YS1X 3BJMA 1G42A 2OCLA 1DU4A 2YXPX 3WKDA 3H1AA 3VVLA 4G9EA 1VXOA 2DCMA 4MYDA 1JU3A 1Q84A 2Y2UA 4P08A 2LIPA 1DWQA 1A8SA 5FXMA 1H2ZA 1CUHA 4IHAA 3L1IA 3WYNA 4DMHA 4BVJA 1K8QA 3WYDA 1UZAA 1MX5A 5HK8A 5EHQA 5AKYA 3H18A 5FP0A 1XZAA 2HL6A 2WFLB 3DOHA 1GXSA 1GPLA 3C43A 4HRYA 1QOZA 4OYYA 3S2ZA 5FKJA 3DLTA 1CIJA 1U2EA 1LLFA 4X71A 1U65A 2PBLA 4QDXA 1WM1A 4AN1A 4YX9A 4QDZA 1HDEA 2DFPA 4INZA 4P92A 3F96A 2B4KA 4HVTA 4BVLA 3HABA 1LNSA 4Q3LA 5AKEA 5AKXA 1QTIA 1FJ2A 3OG9A 4G8CA 4MEAA 2QTBA 1CV2A 3KWFA 1XRQA 2HFKA 3O4HA 5ALPA 2XE4A 3STTA 2BGRA 3STWA 5K3CA 3BL8A 4ITVA 3STYA 2D5LA 1XRRA 3NOXA 4G1FA 3BDVA 5AJHA 2W6CX 3LS2A 3QVMA 1W4LA 2DHDA 5ALJA 4E14A 2QR5A 4Y2PA 4ARAA 2ES4A 5AICA 2Z8XA 3GFFA 1EDBA 2ZSHA 3DYVA 1R4ZA 1U8EA 4C87A 4OD0A 1BROA 5E4TA 4V2IA 4U2GA 5JANA 1QIFA 5AIBA 1QIJA 3L1HA 1WOMA 2X8BA 3V9AA 3WKAA 4QLOA 2WFLA 4BAGA 4C89A 2QVBA 5JAUA 5AM2A 1DT3A 2XQFA 1HQDA 3BIWA 3O9VA 2EEPA 2P8SA 2HA7A 4U2FA 1W1IA 2XB6A 4UHEA 1XRPA 4PSDA 5LZ7A 4BATA 3WA6A 5ALRA 1ZIXA 3WWDA 2HIHA 5EIEA 5HK9A 3NUZA 3MUNA 3W9BA 3K9BA 3E1GA 1AX9A 3JWEA 1A8UA 1CUEA 4FHZA 1USWA 2XUAA 2C5FA 2AJBA 1UOOA 1MO2A 1F0NA 1VKHA 5CRIA 2PUHA 2VQ6A 3EF3A 5ISMA 5DJ5A 5ALIA 3ICWA 4KRYA 2VJBA 4FDMA 3AINA 1H23A 3FBWA 2WJ3A 1XZEA 3WKBA 3WK4A 1PFQA 2YH2A 5AM4A 1LGYA 1ZI8A 2X76A 1E8DA 3C8DA 2PSHA 5K3DA 3HZOA 1NU8A 4F5ZA 4MJ3A 2XMGA 3HYSA 4JYPA 3UMJA 4WY8A 4E15A 4A5SA 5FPQA 2WKWA 1DINA 4M0EA 3FYUB 4A16A 5CXXA 3B12A 1Y37A 1VJ5A 5JD6A 3IVMA 3CCBA 4J03A 1SCKA 4OCZA 4EUSA 1GKLA 5AK4A 2WG2A 2YYSA 1CFJA 2RHTA 2ZJ6A 3O4GA 2G5TA 4NS4A 2AXEA 2GBCA 1TK3A 3FVTA 3GBSA 1YA4A 1JI3A 2WFMA 2Z8ZA 3I2IA 3PICA 4MWTA 5K3FA 4C4YA 1ISPA 2JIDA 4X90A 3IURA 4A23A 3VVMA 3K6KA 1Y7IA 1P0QA 4LXIA 3RLIA 3PF9A 2AJLI 2ZJ7A 4EZIA 5AI6A 2O2GA 2WUDA 3WI7A 1CUSA 1F6WA 3VDXA 5HQ3A 1XZDA 4BE9A 3IUQA 3EIOA 4PF1A 1CUJA 4X3CA 4G4IA 5JD4A 3HLKA 2XMDA 2WLSA 4PQEA 4OU4A 1TRHA 3KSRA 1QIKA 3W05A 1CUGA 2O7VA 3O4JA 1ZJ4A 4HXFB 2HU8A 3ANSA 3WWEA 3K2IA 3IULA 1FFDA 2ZYIA 4BTLA 1VE6A 3TJMA 2OGTA 4OYLA 1EINA 5E4YA 3I6ZA 4RNCA 3G0CA 5EIHA 4Y2VA 3QBJA 3WK9A 4AZ3A 5AM3A 2XLBA 2RONA 3STVA 3OOSA 3MGAA 4M0FA 3I6YA 3Q8WA 4UHHA 1ZIYA 2ZJFA 4TGLA 2AJDA 3R40A 1ZJ5A 4J0IA 2VJCA 4RE6A 4OSEA 1DQYA 1YB6A 4CCYB 3TEJA 2ZSIA 2O2IA 4B81A 4H77A 1W75A 3V48A 5KBYA 3WL6A 4Q3KA 1IZ8A 2JEYA 2QKYA 2OGSA 1ZI9A 2WUEA 3QMMA 2PL5A 3G8YA 1L7AA 5AP9A 3HEAA 3EQ8A 4B6GA 2HHAA 5HFAA 3DYIA 4FNMA 2HADA 2H9YA 1XRLA 3OTQA 4AB1A 1XZFA 4WFKA 2V97A 5AO9A 1R9NA 2IITA 3W2TA 3FLEA 2RGUA 5ALLA 3FSGD 1UT6A 2J4CA 5BOVA 3JW8A 2B9VA 3DEAA 3BF7A 3AIOA 4UBMA 5SYMA 3H19A 2Y2VA 2GZRA 5ALFA 1GT6A 5ALSA 1UKCA 2W22A 2VEOA 1AZWA 3DOIA 4B0PA 4I4CA 2ONCA 5D7BA 3E0XA 3QM1A 2GBIA 5AM5A 1IUNA 3M83A 2JGEA 2RAUA 1E89A 4UBIA 4X97A 1JJBA 3D59A 4BBZA 2RHWA 1EK1A 2CUTA 1EI9A 4KRXA 2XT0A 5IVIA 1FFEA 3A70A 4DMFA 4AO8A 5JARA 2GZSA 4KE7A 4FOLA 4FKBA 3VXKA 4CG2A 4H0CA 1EB9A 5A7HA 3D2BA 3SX4A 3WL8A 3WA7A 2O7RA 5I7UA 1CR6A 2WIDA 1E8NA 2H1IA 4IH4A 4P93A 3I2HA 5AKJA 5IVDA 3I2FA 4AO7A 1YS2X 3O9MA 3G9UA 3AUKA 5ALYA 2ACKA 3M82A 3QMVA 1XZCA 4J0GA 4F0JA 2IIVA 3WKEA 3OPMA 4WCVA 1UXOA 3VJMA 3AIKA 2QRUA 2PUJA 4S0XA 3C87A 3STXA 2XQGA 1CUXA 5ALMA 1QJ4A 4Y2XA 5CTAA 1ZICA 1CUDA 2ACEA 2XUJA 3N0TA 3GROA 3R3UA 5JAPA 4Y2YA 3EBLA 1VA4A 1Z68A 1UFOA 2J3DA 5HKAA 1WCYA 4DNPA 4KAFA 5FOQA 4Y2RA 4XJVA 3I2KA 3ZWQA 3VJKA 1XZGA 4PSUA 3D4LA 3KOOA 7YASA 1J07A 2G63A 1UKBA 4DIUA 2BUBA 2DHCA 2XI4A 1CEXA 1SOMA 4LYEA 4GWLA 4ZXFA 3I2JA 5J3JA 1QIEA 2CZQA 4J0HA 4FWBA 4FMPA 2X5XA 2HRQA 4QNNA 1BRTA 2CMFA 2IX9A 4ZV7A 5C8XA 3D2CA 1AGYA 1ODTC 4C4ZA 3CCCA 4WFIA 1WB5A 5K3FB 2C0QA 4MYSA 5T4HA 2B61A 2Z5GA 2OPHA 2VSQA 4TVKA 2VATA 4K6KA 4UHBA 1EX9A 3QPDA 2WJ6A 4Y2QA 3WMRA 4H7FA 4KYVA 5JZSA 1YR2A 4BC1A 2WIKA 3QPCA 2VA9A 2XUDA 5DNWA 1ZD3A 1EH5A 2XLCA 3LCRA 1ZGCA 1DTEA 5AM0A 3QITA 1O6GA 1YAJA 4EY4A 4K6GA 4K5QA 2ECFA 1EXWA 3PUHA 4ARBA 1MTZA 4X91A 1LPSA 4BDSA 5A7GA 1CQWA 1QIIA 5AKLA 5KWIA 3WJ1A 3PF8A 3RK4A 2BFNA 5LZ2A 2WUGA 3EQ7A 2AJCA 5JZ9A 1XZJA 3QMWA 3D0KA 1AKNA 1TCAA 2ZVDA 1KU6A 4IH1A 3F98A 2PSJA 1LPAB 4ROTA 2WU3A 2XMZA 4UHCA 1DWPA 3DDUA 4K2AA 4OU5A 5AIAA 1OXMA 1QZ3A 5I8PA 4ZREA 3G0GA 2XUFA 1TQHA 4EY5A 1IMJA 1B41A 2XMRA 1ACLA 2OLEA 4G8BA 2ORYA 2G5PA 3I1IA 4Q82A 5AKKA 1ODSA 4KAJA 1XZIA 4C01A 1MAHA 4N5IX 3A2LA 5IH7A 4KACA 1GQRA 1S8OA 4E11A 4UBKA 5DNVA 3M3DA 3AILA 2PM8A 1EDEA 5LZ9A 3ED1A 3TGLA 4FBLA 5CH3A 2E3JA 4LXHA 2VJDA 1ORWA 5AKIA 5CT6A 2B20A 2WILA 1YAHA 1J1IA 2BAGA 4X92A 3V1NA 4O08A 4LXGA 4Q34A 5AKZA 1N8SA 1GKKA 3DL4A 4G8DA 1J06A 2I03A 1VE7A 4MWSA 4U2EA 2H7XA 2ROQA 4DMKA 1WB6A 4UBLA 2WQZA 3OM8A 3E3AA 3IBTA 3C6XA 3DS8A 2GYWA 3WIBA 3FYTA 2GBGA 4ETWA 1P0IA 4F60A 4Y7DA 1MT3A 1WHSA 2ZYHA 4C4XA 5CH5A 4KE8A 5FV4A 3E4DA 2XMBA 3AZPA 1XROA 4L3WA 1JMYA 1XZMA 4AMZA 2DQZA 1D07A 1J2EA 1YA8A 4X95A 2BGNA 4GI1A 4HAIA 5AK6A 2O2HA 1CRLA 2HU5A 5HQ3B 3BJRA 4JH0A 1CUZA 1ZOIA 1YASA 1QO9A 1THGA 1R1DA 1QO7A 3WL7A 3ESCA 2VAVA 4G4GA 1CUCA 1IZ7A 5HZGA 1BE0A 4BCBA 2R11A 1ZGBA 3C70A 2QJWA 4UHFA 3IUMA 1MNQA 2J4FA 3ZLVA 1XQXA 4AMYA 3P2MA 5DTJA 4CFSA 4XIIA 3WK7A 3FLAA 2PPLA 5HCUA 4EY8A 2FJPA 5SYNA 4RGYA 1AURA 1AQLA 3R3WA 3QZUA 1E5TA 2QOEA 5KWJA 4BAZA 5ALQA 2QUAA 4H7KA 4YASA 1L7QA 2ZYSA 1G66A 3WJ2A 1SCIA 2XUQA 5D6OA 4H7IA 4ZGBA 4Q05A 3B3QA 2CJPA 5A2GA 5FDFA 5CBKA 3PUIA 4P9NA 1IUOA 2YASA 2EDCA 3F9CA 4G4JA 1B6GA 3H1BA 5EI5A 4FFWA 2WHQA 5HKBA 2C58A 4H7HA 4OB8A 1VA5A 3DL7A 3OURA 5ALUA 1UK8A 5EHZA 1H22A 4DYHA 5A62A 5AKGA 3I6MA 3FSGA 5DNUA 2PU5A 1BN7A 2QXUA 2HA2A 4KJXA 1TKRA 3G9ZA 2I3DA 3FOBA 5BWCA 4X7BA 3IUJA 4U2CA 4HTAA
chains in the Genus database with same CATH superfamily
5F33A 3T7SA 4G5HA 4NTZA 2JF0A 2NX2A 3AESB 1U8TA 4E21A 1ZHOA 4R2JA 1ZCFA 2VTBA 4GOND 1UC8A 4ZA2A 1G5RA 3Q9SA 4IFBA 2D62A 1U3WA 5JQGF 4S2UA 5CVCA 1SQSA 2D2VA 3BMXA 5AHRA 5IDVA 2ZJOA 5AJVB 2Y4OA 4KE9A 1T43A 4RZIA 1HDIA 4TXNA 2F90A 3MCWA 3T5DA 5BP7A 5LKAA 3A4YA 1H05A 2AEMA 2VN8A 3U56A 1MDFA 3A6DA 1FW8A 3TW6A 4I5FA 3QU9A 1ZDMA 4GYKA 3D3QA 4YRRA 3U3MA 4D41A 2QVCA 1X3SA 2RGDA 1YS6A 3EDRA 1AHHA 1N1GA 3JAWB 3IKTA 3TD2A 2FQXA 2FX2A 3ZOKA 5JSZB 3EVDA 3K1AA 2EQBA 3V1UA 4BGUA 4PAWA 3TNFA 4JBHA 2FW9A 4O4LB 4AO6A 4DWJA 2QXYA 5J4VA 1WHTB 2C9ZA 3UHOA 2ZIGA 3ZPXA 4AXXA 4F8EA 4EJ2A 5EESA 1PJ2A 4OHFA 2G67A 4UFOA 2DPGA 3E9NA 3KD2A 3KEMA 4LE2A 4PS1A 3WKCA 4P3NA 2XWJI 2X5NA 1RRVA 1GTMA 2HPAA 4ZEWA 5TMDA 1U5AA 4BZZA 4EJFA 2PA0A 2HSZA 1RQLA 3DP7A 3PDCA 3VNBA 3Q98A 3D43A 1PZXA 2YJ3A 4RKEA 1PN3A 4M0MA 2ZOSA 2EARA 2D00A 4L22A 3VU9A 1I13A 3OC6A 4OBEA 2HHHB 3R6TA 4FFNA 4X44A 5JAIA 3OZIA 4PFSA 3UJHA 1CZUA 4HAUA 3KAQA 3SZLA 2G1AA 4AJ4A 1E6KA 4O2AB 4JWKA 1MC8A 4US2R 4KBGA 1BOFA 4RA9A 1XC7A 1K68A 2Z3ZA 3LE8A 4ZWNA 3A06A 4YO7A 4DG8A 2NQTA 5KNCD 1FFWA 4UNPA 3K4HA 4DGQA 3CLTD 4K2HA 4UE2A 4KUEA 4WBSA 2C9YA 4ON9A 4B34A 1HE1C 2H2WA 1QZXA 2QU7A 2YWCA 1Q7GA 3DAPA 4QDUA 4RMGA 3QU7A 3PC6A 4HDRA 3ZUPA 3FGPA 3QFSA 3OX2A 2JGKA 4HUJA 1PV4A 1A2QA 1M1YB 1OZHA 3CW9A 1A71A 1N5OX 1ZLYA 3HO6A 3FJ1A 3IVRA 1UT8A 2I6SA 4QQKA 3WIEA 3U4QA 3K1YA 2QDXA 4POAA 2H11A 1HDOA 2WTNA 1Z83A 2ZRCA 3E6AA 3JS5A 2CLLB 1AIPA 3LOQA 5AW5A 3TW4A 4BFWA 5BVHB 1PVDA 3EISA 5IUNC 5F5XA 1A9PA 2AWOA 1X7ZB 1RE0A 2HDNB 4HNQA 2X9GA 2HF8A 4EY3A 4F6CA 4N5MA 1U4OA 1ATZA 1X9HA 1SVOA 1UWCA 4HL6A 5KVAA 1NYTA 3UOAB 3F5QA 4BMDA 4ZQBA 2R66A 1QB7A 5K0LA 2HR1A 2ZI9A 1P74A 3H65A 2A1UA 3WLFA 5LD2B 1WE2A 2P8JA 4N0EA 2BI7A 1F5SA 4DLPA 3SJCA 4E12A 1PFGA 3TIXB 1GUBA 4AYTA 3PKZA 2HYIC 1XF1A 4NNOA 5CM2Z 2WU4A 2W93A 4HGQA 2WMDA 5ALZA 3I12A 1G63A 5FLEX 3BZUA 4W5HA 4W7HA 1PFVA 3ETNA 1MEJA 3LGSA 5ITZA 5TQVA 4CN8A 1J0DA 4J1NA 3GMTA 2R6HA 4AICA 2BUAA 1RWQA 4CW7A 1DADA 1KOJA 4OVKA 3KWJA 1UKEA 2G06A 2NU8A 1DAPA 5DBEX 2GCPA 4RENA 5IVKA 3RIGA 4PO1A 3CIOA 5BSWA 1M2OB 2I99A 3WOHA 2SECE 4WOPA 2HAEA 2WWVD 3B5EA 4DG9A 2BMEA 2WF8A 1YVEI 4YRLA 3EQ9A 3A28A 3JQ7A 1KBZA 4HFJA 5ALNA 5B37A 3AI2A 3LI2A 4MW4A 2XIQA 3IBSA 1YB1A 3ZR4B 2NZUG 3G9QA 4Y9TA 2Q41A 4OLBA 2AG1A 3IIKA 2FMKA 3RNOA 3SIPA 5HRAA 1THZA 1DKOA 2FEKA 4LG1A 3M1LA 2I2XB 3C4QA 3DLIA 1NQOA 4EY6A 10MHA 1ZI6A 2BEJA 4GWKA 2BR5A 1LPOA 1Y7LA 1R10A 2OG1A 5ALOA 1P6QA 3ZQ4A 1SKQA 1NC1A 4LWOA 1GT91 3INGA 3CWZA 2XUKA 3H4TA 3OE5A 5BQXA 4D3YA 3W8RA 3T7TA 5B64A 3SR0A 3ZGXA 4WIAA 3A36A 3LA8A 3OFNA 1TLTA 4OKIA 4P84A 4IDQA 1HL3A 4GZMA 3UANA 4ZZ1A 5BQ3A 4KAXA 4OJNA 5DNYB 4DTCA 3A6PC 3GNSA 2P1DA 1N5LA 1VRVA 3O8QB 4Q4DA 3RQIA 2JFGA 5TIIA 1KAHA 1NUPA 4V0OA 4TV9B 1T13A 2IE0A 3QH4A 2VOJA 2FMIA 1RHRA 4J16A 4R0MA 4E5YA 4WK4B 4L73A 1EQ2A 4RZUA 1N0HA 4W1SA 4Z3DA 5BSFA 3TTWA 3KKZA 4A2QA 5KO2A 4EFLA 2OM6A 2A7XA 4DLLA 3A1FA 1ESNA 2EJWA 3K0CA 4UAGA 4TPKA 5EYPB 4WLNA 4B3BA 3BGVA 5DOZA 4C08A 4TTPA 3N2KA 1JHAA 3LUDA 2CEAA 3AUTA 3PR1A 3R3ZA 1QF7A 4BRWA 1F8XA 4YRMA 4U3JB 3PJRA 3QLVC 1M83A 1H2EA 3KYJB 4QBHA 2OV6A 2Q2WA 4LECA 1PDOA 1IBMB 1X39A 2OEPA 1ETHA 4RVUA 4ALLA 5I47A 3PD1A 3C6ZA 1RQNA 1DX6A 3OLXA 2QPOA 1BNCA 2QVGA 1JMVA 4W7IA 3D7RA 4BE4A 3TZKA 4EUEA 3E61A 3DH0A 4TYPA 3C8ZA 3IT2A 5EXDA 1PVVA 4F9FA 3RV3A 5JNWA 2V1UA 1WQ3A 1XB2A 1NI4A 3RAJA 2PD3A 2VNHA 4YP0A 3VTZA 3MWJA 3CS3A 1SWWA 1OU0A 2DQYA 2XMQA 2Y9PB 4Q93A 3W6ZA 4XSVA 4O4IF 4II2A 1ZYUA 4HXGA 3OWHA 2RCYA 3DKIA 1O94D 4G0PA 3ISVA 4NABA 1M8FA 5L3SA 4OUDA 4URWR 5E7IA 1JHMA 5JIBA 3OETA 3ZCPA 1HDRA 5JH7F 1RBMA 2XVMA 5F76A 2NXJA 3TOCA 2NYRA 1Z8DA 4TKZA 5DMHA 5CFOA 2RH8A 2X7XA 5BORA 2C0PA 3LDFA 3X1KA 1G21E 4GOJA 3SS9X 2ZDGA 2QNRA 4G1BA 4YCNA 1PQUA 1SFRA 1XN1A 2QROA 3FWZA 4MEJA 4XQ0A 1C7JA 1T6BY 5J1SB 5CURA 3MJSA 1C14A 2PRYA 3C5VA 3K9LA 3P97A 3B1JA 5THKA 3ZKWB 5CB6A 1LNQA 2JLZA 1UBGA 1MEEA 3INTA 1NKTA 4AX4A 4M4SA 4HMOA 2GLXA 3ZE9A 4ZVOA 3JQ9A 4YQEA 4BJHB 5SY6A 3T12A 2IEYA 1EE9A 3PD7A 2DUMA 1F8UA 2MSDB 4JC0A 3D0QA 4LVUA 5HOQA 1MW9X 3W5HA 1K7YA 3W9UA 3PX3A 1T4GA 3O73A 3F8WA 3UJ3X 1XWFA 4M38A 1OXXK 4ESOA 1X13A 4W5NA 3DBHA 3O21A 3I6BA 1KKMA 3JQBA 5EKTA 1EAMA 2G8LA 1I4OA 2Z5FA 5JJIA 1YE3A 5BNIA 1PUIA 4GOMD 4RFLA 5JCOC 3N2YA 3L7BA 3A0UA 3VR4D 4TS4A 3QUQA 1F0YA 2I4IA 1PR9A 3CX3A 1O95C 1NQXA 2IEAA 3NO4A 1MC5A 4L4ZA 1YH3A 2J46A 4PLZA 3LXMA 4GXNA 5FYQA 5CA1B 1TQ2A 2QRKA 4LHEA 1QKIA 3JYHA 4KX5A 4HYTA 1DX4A 4DV5B 3RAGA 4TSFD 1VMAA 2HSDA 5LZ4A 4OM8A 3V8EA 3KVOA 2XXAB 2Q7OE 1ZWKA 4QFBA 4Z7QB 3TW8B 5I9LA 3OEYA 4MVJM 3KVVA 1HEIA 1BYUA 4A0RA 5GTDA 4NG5A 2B8NA 5CUQA 2FWNA 4EBBA 2A84A 2MINA 4R69A 3PEEA 1X7ZA 1XLVA 3BJZA 1A96A 5FBZA 3CSDA 1E1CA 4RL4A 2HWKA 3VR2A 2OB1A 4IQ4A 1ES9A 3PLAE 3CNEA 2FU5C 5KWEA 3WVNA 3OKCA 1PK9A 2I78A 3C3CA 2AK3A 3QUSA 4ND2A 1FDVA 1JT2A 4QU8A 3FB4A 2IH5A 1JQLB 3SE0A 4MMXB 4YCAA 3TF5A 5K5EA 3AERA 4Q3OA 5HP4A 1H2RS 2QGFA 3EPKA 3AJ9A 4CTNA 5D7NA 3NYWA 4RULA 4KMMA 5G53C 2CLEB 2NSDA 1ISJA 3JYOA 2BGJA 2WIJA 4MWZA 1Y7HA 1WKVA 1ZA1A 1ZS9A 3M81A 1OWOA 3AHJA 4Z49A 3V4LA 1EA5A 4HXYA 4RK7A 3BBPA 2JJ2D 4CCAA 2Z2JA 4D3ZA 3LK6A 1KJWA 5B3JA 5EIXA 3CM0A 3E35A 3KYIB 1YZNA 3CNOA 4NX2A 2OMKA 2OBFA 2P9BA 2I22A 3ROPA 4AF6A 1QKKA 3KQUA 3RC8A 2IHZA 2LNDA 4RPCA 2A9FA 5C3MA 3IVCA 4UBNA 3MELA 4B6JA 2RGNC 3U3DA 4B6RA 2AZTA 3K32A 3D4NA 2HJWA 2JEOA 5BV7A 2P69A 4L2IB 2D5IA 2HA3A 3DBVO 1JKJB 2YR0A 1L8XA 3E2PA 3EVTA 2Q21A 3H8JA 1CZHA 3ZYZA 5ALWA 1H9BA 4RH0A 4B48A 1E0AA 3S8MA 3CZPA 2NVBA 2JK0A 2C2MA 3MFYA 5DVZA 4CL8A 1E6LA 3PVCA 3MT0A 2OSBA 3PX2A 1LQTA 3QKIA 3GLRA 4KMOA 8LDHA 5JVDF 3EOZA 5LP6A 3GLIE 2D0OB 5MHTA 4L8GA 4ALNA 4I4TA 1OFIA 2EX1A 1IXYA 3FZYA 4ZQHA 3TI7A 2GCNA 2X6RA 3S28A 4IQFA 3AB3A 2DVMA 5L7TA 4XX0A 4ZT5A 2HA5A 3WRXC 2Q9CA 1UBUS 3LSTA 3TRDA 4NCAA 1JYFA 5AW6A 1BMTA 1LPNA 2R8BA 3FPEA 3GOHA 5BSGA 3OTOB 1ZVVA 2OFWA 3EAQA 4DIDA 3P9SA 5FADA 3URMA 1ZUHA 5G4LA 2I65A 2V6GA 4U9UA 4D42A 1X1SA 2IEZA 4EJMA 521PA 1CVLA 1O77A 2V7UA 4JL8A 5FO0A 4Q4CA 3CZ4A 4YONB 4V1CI 3WL4A 1JSZA 3LHFA 3AESA 4FDLA 4LIPD 4AZ0B 1U2SA 1CNMA 4A03A 5BV8A 2CLFB 2NV6A 4UPVA 2FPGA 4DMMA 1X86B 2LIVA 1X70A 4LGCA 3I83A 1UZNA 2ZBFA 4NE7A 1SUSA 4KQ2A 4NYJQ 4G97A 5C0OE 1KVSA 4FYPA 2PRZA 1TEVA 4E94A 2WUFA 3EVNA 4GHWA 3WGVA 2HFJA 4EO4A 4JWTA 4QO8A 1H42A 5CXUA 3LKVA 3EVZA 5KYNA 1I1HA 1ZNQO 2BZSA 4KRGA 5DHTA 2YJ6A 3RHTA 4B47A 3NH9A 5K7SA 2LW7A 4M88A 1QRTA 4FN5A 1L5LA 5M5BA 2QRVA 4EJSC 2P6OA 2MTBA 2QZ9A 3CE6A 1MNAA 1B0ZA 1SGWA 2FSUA 1K63A 2ZB4A 1PQWA 1ZSYA 3ZTYA 2QPAA 1T1GA 1GPAA 4XGIA 3IDAA 4BQEA 1WZNA 2YTZA 4OK5A 5DCLA 1FUEA 4JP3A 2ZRQA 3NP7A 1CB7A 1TTQB 2G08A 1RW4A 4EABA 2ZGVA 2FUNB 5LDGA 3AR2A 4EUFA 5LB2A 3LAWA 1TT5A 4UQOA 5DYWA 4CF5A 2CJXA 1IHDA 1U7PA 2IUUA 1J7JA 2A4KA 3AM5A 3GPIA 4OLHA 1VYHA 2IHYA 4Y9RA 2AOUB 1UDWA 1CLUA 3OAAD 3RGGA 1P0MA 5FV7A 3F49S 1VXRA 2G4LA 3T15A 3NBQA 1R8YA 2JEZA 1ZIDA 2FVXA 4PX2A 2A0KA 3ZGNA 3MK31 1RDFA 2FW8A 4K46A 3E3NA 4R3UC 2NUBA 3FTDA 3GDOA 4HDMB 2BHSA 5J2TB 5DHFA 3TTXA 1ICEA 5GJVC 1KBQA 2K6GA 2JKVA 2XMCA 1O6BA 2QRMA 4YMSA 4YB8A 5WRFA 3NWOA 1FQWA 2J6BA 4KXVA 3U9SA 3IQDB 1VYVA 1C0LA 4D2IA 2V6FA 1QHIA 1UBTS 4L4SA 4LSWA 5IJWA 3NJRA 4V1CA 2M32A 4XQGA 2BI8A 1LA2A 4KFSA 1Z6ZA 2Q4RA 1LDBA 3H5NA 1A04A 1GR1A 4D97A 4QGSA 4X8MA 4JVNA 1U0TA 3VHLB 2OHGA 2ZT7A 1K92A 3M0EA 4ZYWA 5JXJA 5KPDA 2X4GA 5FOWA 1XRNA 2I8LA 2W42A 2IFTA 3NGMA 3WGZA 4IS2A 1NVDA 2RAFA 2BKVA 5EE9A 4QBKA 4NXNB 1SZPA 1F8GA 3HKDA 1KP9A 3RC1A 5JMPA 1JIKA 3OPYA 3VKFA 2GXSA 3H5VA 3AVXA 5C8ZA 3C6YA 4IEEA 2ONZA 3KP1A 1R3DA 4YECA 1QFMA 5FI5A 2RGWA 1QQ7A 3UA4A 1XVUA 2E49A 3W5UA 1G8KA 3PWSA 5L7WA 2HPZA 3UJPA 3F6RA 3AONB 4CF7A 4IHKA 1IY9A 4MDFA 2QDKA 4WKCA 4C6HA 4PLWA 3RRJA 1PJQA 1MCZA 3SYLA 4MGYR 4HSGA 1E0DA 1HDXA 5EJ9A 4AZ3B 2ZKIA 4RVOA 1PZHA 2FLVA 1Y3AA 1RMYA 2PHZA 5F1OA 3E5RA 3JQAA 4KAAA 1XHFA 1JFRA 3RIMA 5K01A 5JASA 1ZAKA 2B8WA 1CUWA 1HDYA 1NDQA 1P1FA 2CHVA 2YVLA 2XQIA 2ZSUA 3CFYA 5KU1A 1QP4A 1RJGA 3T3DA 4BMXA 2PYZA 1SZCA 1AN9A 1A7KA 3GELA 1XRJA 3BWDD 3ZD9A 4R9VA 3GLUA 3URKA 5BUCA 4RX1A 4TKMA 5KTPA 1VJ0A 4JUIA 2RG7A 5TY0A 4E88A 1B16A 1EP9A 1X15A 1GZDA 1GGMA 2JIPA 2CLIB 2ODQA 5KSOA 2ECQA 4N0QA 3LNCA 1Q2UA 3GPLA 1WZEA 4ZT2A 1GGVA 1YBHA 4H16A 8OHMA 3H2IA 1DHRA 3SS8A 3W7BA 4BQQA 4IMRA 1HMYA 5FR2A 1A4XA 3ENNA 4KITB 1XNRB 2OGZA 4BRZA 3N87A 2Q5CA 1W4RA 3GHYA 4MV3A 5LYYA 1N77A 5DSXA 3KSBC 2VAMA 3FHOA 3BN3A 5HFNA 5AQEA 421PA 2J3HA 5DX0A 1USKA 1UJ6A 1WPXA 5KAPA 3GRKA 5LMCA 5TQ2A 1ZK3A 3H86A 3HJGA 3W79A 1MO5A 4ZVNA 1QVVA 3ABQB 3K2QA 1UDCA 4IIBA 4KQKA 5JALA 4QOSA 4NKRA 2WHYA 2VKQA 4Y0VA 4UATA 2YQZA 3RJZA 3RSFA 3WP1B 2X7JA 1UBJS 1CEQA 2DECA 3MAJA 3SVTA 2CHGA 2MYUA 4NCXA 1QGUA 1XWIA 3FHCB 4FJ2A 1K5PA 3E48A 5K1ZA 3FSRA 2QMQA 3QX3A 4FE7A 1EQAA 3ZHTA 3B48A 4JCOA 3KDAA 2OZVA 4ND4A 1CWUA 4GPBA 4RADA 4TTVA 1JWBB 1QZTA 2XUOA 3CUSA 5GONF 4QREA 1C4XA 3VDMA 3JXEA 4OMCA 1ZVQA 4EB3A 3ZI7A 2AG0A 2XCRB 5P8WA 1JR3D 3AY0A 1O96B 4UVHA 3DULA 5T4FA 4Q4LA 8ABPA 5K0EA 2OCKA 1YFJA 3GJ7A 1IXZA 3MGKA 2O9JA 4IFIA 1YMQA 4D82A 1MMFB 4ZYTA 1JXQA 4IH9A 1V5GA 1QH1A 1RAAA 4BFLA 2R96A 1NXTA 2O54A 3TCXB 4BZXA 1VBKA 3ZE6A 3IR6A 2Y27A 2AN4A 4NENA 5FTKA 2W9XA 2R6FA 4BNYA 4DGSA 5ALDA 2WSMA 3I9JA 3ZV6A 2EQ5A 4QG3A 3HU1A 3KQMA 4MRMB 4QODA 3NOOA 3T1OA 1J33A 1V1MB 4LSMA 4RZQA 1Q1QA 3RARA 1VC2A 4PQRA 3HJAA 2II6A 2QZJA 4QDJA 4ZRMA 2BMWA 1PNRA 4IVPA 3EJWA 5EMKA 4YJDA 2HA0A 3R77A 2E4WA 2GCIA 1KXJA 2ZRPA 4EZBA 5BMVF 5C7OO 5DXFA 2ID9A 4JSRA 5SY9A 4QJ3A 3ROKA 2UYHA 1TI7A 4XXHA 4JI1B 4Q1FA 5HXAA 4X7PA 2VHVA 2AX4A 4MRPA 5DTMA 3SU8A 1CE8B 4R1QA 4UZEA 1XO1A 4LGMA 2CWWA 4PG6A 2CVQA 1VI5A 5LNK1 4MKIA 4E32A 1IJBA 3VU3A 3HC7A 4DV3B 3LXUX 3NBYC 5JYDA 1DFGA 1POXA 2AR7A 1HE2A 1JR3E 3MEQA 1LVUA 3DLAA 1SKBA 1CZKA 3OX3A 4N0PA 1IIRA 5JQGA 1F6BA 2OA0A 4OAQA 3U7QB 1QU3A 1OT5A 3UB2A 3ZKAA 3WTCA 2GSWA 1GDDA 4KQ1A 4RMHA 3RUFA 4YRFA 3SIRA 1HNZB 1MF7A 3WYCA 1K4YA 1SPBS 3B13B 3EA4A 1YOBA 3EGXA 2H1CA 3GDHA 2WYOA 2XTAA 3F7OA 3QG1A 2O6HA 3TH5A 4DCSA 4FGWA 1KF0A 3OSUA 4N18A 3FFAA 1S2GA 3MG9A 3IAXA 3B8EA 1P39A 2GEKA 5JG7A 2QVLA 3WK6A 1YCDA 2ANBA 3H83A 1EK0A 3QWBA 3O4RA 4UJ3A 1YZHA 3QW4B 3V8RA 5KX5B 2Z2ZA 4HT3B 4IOKA 3BG5A 1KK3A 4AQDA 4KZPA 1JYEA 3FRJA 2WG0A 3AB7A 4HN4B 4IQ8A 5CJJA 1YWGO 4GQBA 2XTJA 4D25A 4PBSA 1E6EA 3LKZA 1Z35A 4OQNA 4RXUA 5C8YA 2GZMA 1XVTA 1K1EA 4X66B 3VDRA 4RTMA 3HCDA 4DXHA 2NUAA 1A9ZA 1W88B 4MS4A 3KQKA 5KDOA 4OLFA 4Y7CA 2QBYB 3W2IA 3V3KA 2ZRKA 1JTFA 2AYZA 2VSNA 3TOXA 4J0QA 3EEYA 2EIHA 3PXDA 1U1EA 5GM2A 1LUAA 3FVRA 4BYMA 1GDHA 1WIWA 2APJA 5L7YA 1T25A 3Q3GE 5KNCH 1DDIA 4EHKA 1Q17A 3HR7A 2PX6A 4Z86A 3HYRA 1XZNA 3RRXA 3TIIA 4NRDA 3TBHA 1FSSA 5I3CA 2VF4X 5JWHA 1KXZA 2O3UA 4BBJA 2AEEA 4KDCA 2RI6A 1MPTA 2LKCA 2VUTA 3QYPA 1M66A 4FFVA 3ESBA 4NVRA 5H16A 5A6VA 2CFRA 3LBNA 1N2ZA 1JI0A 3IJEB 5JC1A 1XZ8A 3EPRA 5IK2D 1COZA 1BGXT 4NZPA 4MCIA 4OV6B 1KDVA 3RU7A 1L3IA 1L8OA 2QE7D 3PFBA 4ZQCB 2GHIA 3NKLA 2BMJA 4UFNA 1JG3A 4PIMA 1WEKA 1XCJA 2YHAA 1VI6A 1NVVQ 4ZCSA 3WQRA 4WHMA 4BY9E 3ZBPA 2CVFA 2PSFA 3KIPA 3PI6A 4ALKA 5J4HA 2RJ3A 1EFRD 1FF9A 1XE3A 3EY9A 3HB1A 1JBKA 3O8DA 5ENZA 3S1AB 4F46A 3GEIA 4HBZA 2EP7A 4K7JA 1PNVA 2H5JA 3EIUA 4FXOA 2F8LA 4P7FA 2EFYA 4GKJB 3G0DA 4EI7A 3F0TA 3KFVA 4PZCA 3C3AA 5DE3A 1N3YA 3C5EA 3OPYI 1KZHA 1W19A 1E9VA 4I4TF 1Z47A 3TPZA 2HTFA 2BSXA 3N0XA 4PANA 3LY7A 1J8DA 2YWFA 4HGZA 4NOMA 5CB4A 2ZS7A 4YEDA 5CX4A 1X87A 2EYQA 5KYVA 3K0BA 1PGOA 2FZ5A 4ZRNA 2ZDHA 1Q3KA 3RRZA 1XQ1A 2ZI3A 1KK1A 1RFGE 1TA9A 4LOIA 5THXA 3JATA 1ZJ6A 1YKSA 3B89A 5D3KA 5IT0A 1QIMA 3I3OA 4C0SA 4NEQA 3RJTA 4BGIA 4KFRA 1EEHA 4X00A 3WRXA 4WT7A 2ZCJA 4IHJA 5BQ5A 2QP4A 3Q0EA 1G0OA 3K1AB 3T3NA 4D81A 1RYYA 5EXXA 1J8QA 2BGTA 2O14A 2QJTA 1BJRE 4TTJA 1PWHA 4ARVA 3QPAA 3CRQA 2BE9A 1FMLA 4FB4A 2LKDA 2H4JA 4Y2TA 4LPSA 1XFDA 1QH8B 3FMOB 3CW2A 2C1ZA 3A27A 3H5RA 2O07A 3TN7A 2Z1MA 3EWAA 3W06A 3N2ZB 1JR6A 2H63A 3NORA 2X4DA 3CG0A 3GRFA 3W2GA 5E3HA 4I4IA 1NVWQ 1L7NA 1EYZA 3AKZA 1SMKA 3HBLA 3SXJA 3ZVMA 5CEFA 4XM2A 3ELWA 4FEYA 2IHJA 2PZFA 1II8B 2GK3A 3LX4A 3FGOA 4PSKA 5DHUA 4UTVA 1I6WA 1OFHA 3KL4A 2VVTA 2BZGA 1IC6A 5ADVA 2D0DA 4JS0A 3R41A 2B1IA 1E9CA 2H52A 3GEMA 4KQ6A 4QOJA 1E3JA 5B2EA 5HPYB 2AMVA 2IZ1A 2UVPB 5FL3A 5BVGB 4FZJA 1IHPA 4M1QA 3QPVA 4UMDA 4Y18A 1OYOA 2R87A 2VLIA 1FX0B 1N2CE 3IAM6 1ACJA 2VT7A 2AZ4A 2WJGA 2CKMA 3M4NA 3SFTA 3WDKA 1PSZA 2NO4A 3JSXA 1NJ5A 2F43A 3S2YA 5CT8A 5GJBA 4PBRA 5LYJA 3WGQA 2FPUA 2W4MA 4NYMR 3EEOA 2FMTA 4BMZA 3COVA 4P4LA 1OFTA 4INOA 4PLPA 5CITA 4LFAB 2IS4A 3W6PA 4DUZB 4L6AA 3QY9A 5FBLB 1M6VA 5KHAA 1ZGAA 2XVYA 4MW5A 5T3YA 3UY4A 3FIUA 3ZDXB 4AT1A 5JZBA 1NRWA 4WFQA 4R8RA 5CHYA 1VE9A 1VPEA 4L4XA 5IJ0A 2QENA 2QZPA 4HNAA 1WHTA 5IC6A 4W5OA 1QGED 1GG2A 1KEZA 3KKEA 2Z2XA 3B70A 1QOPB 1OC4A 1G8GA 4WNIA 2C3YA 5AI5A 3I37X 1L4YA 1T8UA 2JAUA 3UG6A 3ITKA 2QN1A 2IXBA 2CE7A 5D00A 1Q0LA 3I42A 3CF0A 2IP4A 2XKBA 4CN9A 1DRKA 2EU8A 2OR3A 2NGRA 4KTTE 1XNQB 4G63A 4MQLA 2GN8A 4YJGB 3HY4A 1E2NA 3ZWOA 1IUKA 1CQPA 4EG8A 2QP3A 3ZYCA 4W63A 3KHKA 4J0CA 1PS8A 4WXRA 1HK7A 1X14A 5DM60 2W2MA 4ZKDA 4H1TA 4WX2B 4NBNA 3M6MD 4JR1A 4NBTA 5JD3A 1ZESA 2BP7B 2UUOA 4EQ6B 4GMGA 1XLUA 4TWAA 2QW1A 5H80A 4FVTA 2GZ3A 4LQDA 4RMIA 1KORA 1Y34E 4KG7A 2L82A 4MJ7A 5EE3A 4PRYA 5LZ5A 1QP7A 2PH5A 4CMIA 3T5MA 1ZMTA 4S1TA 1D2HA 13PKA 2B30A 1FU7A 3CZAA 4C04A 6REQA 1IL0A 5CB8A 4M36A 3H4VA 2J9FA 3OD5A 4IICA 2JH3A 4PY2A 3WGKA 1AMUA 5JH7A 3FPFA 3CC8A 4CCSA 1KRXA 3T6KA 1QH0A 5JCOA 4BKRA 4KVAA 5K3OA 2VRNA 1QIDA 1WW8A 2XD9A 1QCDA 2AXQA 1HETA 4KGVA 4W1QA 1S9DA 1JZSA 2OGWA 2Y1WA 3A6EA 1DX9A 1U0JA 1DUSA 2YUTA 3BWVA 3SLRA 1HT2E 2Y66A 4DA7A 1THTA 2ZUEA 4LDAA 1AO0A 2WV9A 5GY7A 1DE0A 1JSLA 4G26A 4A8JC 4CLDA 1X42A 1NKSA 4DSZA 4YMVA 3NPMA 3PUYA 3ZJ4A 4HGPA 1DIAA 4CMAA 5B3JC 1TF2A 2GESA 2IYWA 4FJ1A 2VF5X 3W34A 3UK6A 1RYHA 5ALVA 1D03A 1TJPB 2RAVA 3CXUA 5C2JB 3UJDA 4EUNA 3L46A 4Q3CA 1EVZA 1U7XA 2PEZA 3EFOA 2D13A 2B78A 2XCOA 3GUVA 3O6VA 4UKDA 2WM9B 2BBWA 3ZEIA 1INLA 4E5DA 1E6MA 5AK0A 2QYHA 2ZR8A 3DVRX 2AI2A 4YJKA 5BYKA 1BDMA 3HO1A 1E2KA 4RTKA 4B6OA 3ULKA 1BQ4A 3OF3A 1W8IA 1TIBA 2C0CA 4FEGA 1O6ZA 3P7MA 1CRQA 4IXWA 2Q5EA 1ZCBA 3F3KA 4OQDA 2VNAA 3HP7A 4JNKA 2FPXA 4K6MA 2DY0A 4OXQA 4W1RA 3U4DA 5DGDA 3USCS 3IVGA 4NH4A 1J5EB 2JRLA 1FJHA 1R0KA 2CXSA 4FEAA 2Y8EA 2WM2A 3D0RA 1YZVA 3LGAA 4GO1A 4JFRA 1WAMA 1I10A 1GRQA 4KV7A 3AIMA 1DBQA 2YWEA 3CW8X 4G4SP 5JXGA 5EFZA 4N4AA 3P45A 1ARZA 1L0BA 4LYGA 1NIJA 1CRZA 3U1TA 2D2XA 1J8MF 1XQWA 3DFMA 1U8ZA 1WUJS 1Y33E 3AUJB 5B1DA 2IS2A 2F9LA 2RHMA 1MAAA 1OI4A 4AS1A 4C2BA 2N47A 3VU8A 5DPMA 2EWWA 1YBAA 4KQCA 3LC0A 5ADUS 1EFKA 3KKKA 1JJ7A 2MSLA 3R7LA 1MVLA 3SXPA 1FBNA 2BN4A 3HFGA 3CH7A 2QD1A 1PJLA 3MJFA 3OKPA 4GMFA 3IDSA 1Z4QA 3BIXA 3N28A 5EY5B 5LBUA 3AG5A 3BJEA 4DLRA 4Z4HA 3GAAA 2ODNA 1XGKA 1NVAA 1RQ2A 3BJMA 4UE3S 4BO8A 4O4JB 2O06A 2VTBB 4H3KB 1ECPA 3CSSA 4NF2A 3PXBA 1TJ4A 4QGAA 3WKDA 3VYTB 4K03A 3DOFA 2XAUA 4HB2A 4HRAA 4ZYLA 4G9EA 5EKXA 3E7FA 1VXOA 3M6FA 2HNKA 1WLSA 4BWFB 1MH1A 1V8ZA 3B36A 1QGUB 4HQNA 5DSTA 2AOUA 2C8LA 5A9TA 1RM4A 3WRYC 2E1PA 1XMIA 1S1CA 1SU6A 2A0UA 2B25A 4QFMA 4C4YA 4CODB 4C4OA 1DJMA 4J4HA 3O2QB 4I08A 5KCMA 1IAQA 2XITA 3KLOA 3HU2A 5DYNA 5FEMA 5JNUA 1VSUA 1ILWA 1L6RA 1ZK4A 2DBVO 2E4ZA 2X0IA 2A5JA 2ZT6A 4JSTA 5MFPA 3NTOA 4LHXA 3D3WB 4UC0A 1KVUA 2VHCA 3WLEA 4AKSA 1BDIA 2D4AA 5F7XA 3EXHC 3GW8A 1LC3A 2UZ3A 3PGKA 4GKBA 2FSIA 3H6GA 1RJ9B 4KFCA 3HUDA 1FRQA 4XUCA 5JY6A 5IAGA 3AEQB 4C9BA 1P17A 4Q3BA 4R01A 4YMTA 4AZWA 5B7QA 3IP6A 4REOA 1C7QA 5J23A 5EHQA 3Q2IA 5AVKA 5KQGA 5ITSA 4DZTA 3OLYA 2XZLA 1XZAA 3AR8A 2YWXA 3D3WA 1XV5A 2ZFUA 1QG2A 5B7GA 4D9EA 3C3DA 4WXPA 1FUYB 2D3TA 4HRYA 2MSEB 1Z13A 3UTDA 4QPDA 4LRTB 4RD0A 3B2NA 1CIJA 4B8WA 3CH6A 3M2TA 2JBHA 1WBDA 3AM4A 4J7UA 4Q9KA 2A57A 2AFHA 3KQOA 3C6KA 4WJKB 4AKIA 1QGYA 4J0FA 2O50A 4IJVA 5IZCA 4IIGA 4LX8A 1RVV1 4IJ6A 1U9IA 1WM1A 3FD8A 4M55A 2ZEJA 2X0FA 3RUHA 4BNLA 4Q9HA 5G02A 4YX9A 4U2KA 4A8PA 3QVOA 1GHTA 1JHXA 1K06A 2YMLA 4INZA 3DE5X 3HWX1 4CF3A 1KO4A 1R0CA 4I50F 3THOA 4ERXA 2PA3A 3UFXA 1RIFA 4C0WA 2O8DA 4OGGA 2IOYA 2REQB 5AKEA 2C4TA 4IMJB 4QGHA 3TX6A 4CL2A 5AKXA 1WO8A 3G1TA 1QTIA 2HRZA 4LDNA 1FJ2A 4YCJA 4Y1GA 5AOCA 3ZU2A 4NONA 2GPSA 2QTBA 1A9XA 3KR9A 3IB6A 4RKQA 4MW6A 2NNWB 2OQRA 4YO8A 3AJDA 2LP4Y 1XRQA 1OZGA 4ZHQB 3WMGA 4DDKA 3OJWA 3ZWBA 2ARKA 4DARA 1KVTA 4QHTA 4DYVA 4C05A 1QHFA 5ALPA 3PDUA 1U3TA 3STTA 4GMHA 4GE0A 3OO1A 1F38A 4PG8A 2G9VA 2OO3A 4OI2A 4JJFA 1E2LA 1O9HA 3CF4G 2IE8A 3VC1A 5FWDA 1IEWA 3PRJA 1G9SA 2Q99A 4ZJZA 6REQB 2B7LA 3BDVA 3OMWA 2XRZA 1KEVA 5CM8B 2W6CX 4HNUA 1MUUA 2DHDA 1WQ4A 1G3MA 1YQWA 3KZNA 2Y4NA 4M0KA 4S0ZA 3S2SA 3ICQB 4JJGA 4E14A 5H1YA 5FOUA 4PCUA 4IDGA 1LSUA 3ADOA 3IEPA 4JHLA 1NJFA 1WUIS 2Q7XA 4XZ3A 1Z56C 4RIFA 4L75A 4B4UA 3W6UA 3NONA 5CGZA 4CEHA 2QQ5A 1NMSA 2HB6A 1JDBC 2X13A 3WS7A 4AY4A 4EARA 2EF0A 4COKA 3A1DA 2UUCB 9GPBA 2H1LA 5ESWA 3DM9B 4P34A 4C87A 2C5LA 4Y30A 1ZBQA 1BROA 1BXGA 3ASZA 4OHUA 4KVFA 3N8GA 4LHSA 2GJ8A 4KXNA 5C7IO 4XUEA 4V2IA 4RTOA 1K9SA 2IYZA 2Z6VA 3DMTC 1QIFA 1P8JA 1QTNA 4KQGA 1H8HA 4AC9A 2X8BA 2UXCB 2G6TA 5GOTA 2WWFA 3DO8A 3AI7A 2Q62A 5DM0A 2WFLA 2YFHA 2B4AA 4KWHA 1F6DA 4PGGA 4IZIA 3WRVA 3MRTA 4LWZA 2GBLC 3G85A 3GEEA 3JQFA 4RU1A 2CLDX 2K4MA 3CPHA 1VJTA 1QYWA 2C98A 4RZ2A 2IVFA 4FYJA 3TTYA 4ANFA 2HA7A 3PQ6A 1AH2A 1OJ7A 1MB4A 2FY8A 3HKDB 3IBYA 4U2FA 1YUBA 1W1IA 3GYBA 1ADGA 3I92A 3ZTWA 5FTLA 2AW5A 4GF5A 1T3LA 1O0SA 3CRMA 1LLQA 4XLLA 1OX4B 5BOSB 4AY2A 3NIWA 3ON5A 3K0KA 5FUQA 2I6XA 3HY3A 3JZIA 3U44A 2J5QA 3TAUA 2R1TB 2SCUA 1CB0A 2HIHA 5F98A 4JP1A 4RTQA 2HRCA 1OWLA 1T2CA 4KL8S 3H0KA 721PA 1PNTA 1NNI1 2X77A 3PHGA 1R4MA 5B3AA 3MUNA 2BGUA 4ZKEA 3QMPA 3E1GA 3TOVA 3W9BA 4RTRA 4LKRA 4LTNA 2DTEA 3JWEA 4TWRA 5KQRA 3PC8C 2OYSA 1NKVA 1VJGA 2BI4A 1JB1A 3B60A 2HWXA 5H9VA 1MEOA 1EM8B 3B38A 1XDUA 3DT6A 3Q7SA 2F9MA 3KQVA 5BNZA 2EZ9A 5ICGA 4LWPA 5LBTA 2RI0A 4LX0A 2DPXA 3M5CA 4CDMA 4D8VA 1MO2A 1PL6A 4AJEA 2CGEA 1F0NA 5CRIA 2XZOA 3H16A 2ORIA 4E2FA 2Q0SA 2VQ6A 5DEIA 2B3DA 2RMKA 1IZZA 3M4XA 4YAWA 4EPYA 4HC4A 1P5ZB 2BFOA 2GNPA 2WT9A 3D1LA 3TL6A 3ZE2B 2Q49A 2FCRA 3BHJA 1K5HA 1GL6A 3MSCA 3OZDA 3MINB 1XTPA 4YRTA 5ALIA 4NC9A 1SELA 1A3CA 3NKFA 2OB2A 5E2AA 3QPWA 4V02A 3O8QA 3TUIC 3H1TA 1KGDA 1SHKA 4IUYA 2ZTMA 3FBWA 4FILA 2ZJAA 5FL7D 4Z7OB 1LI4A 2W37A 1XZEA 1WS6A 5JXIA 1JVSA 4US1R 1N9GA 1KMNA 1N2SA 2HNAA 4MKRA 1S2LA 3UWOA 5HUJA 2H48A 5CCBA 1FYEA 2VJYA 1RWXA 4MPDA 3IHWA 5LYJB 1XNJA 2X76A 3ORHA 3HA3A 2E6UX 1VIMA 3T7IA 5DM70 4IIXA 3J81A 2PUBA 3IQWA 2GZAA 3CB2A 4J1TA 1P91A 5DIFA 3TNYA 4D45A 5KTNA 4O59O 2PJRA 1NU8A 3DWIA 4FFSA 3ET5A 5GONA 4FBGA 1KIAA 2BJWA 3QF4B 2EJBA 1FNDA 3INNA 2GNAA 4I55F 4QBTA 5CX1B 3UMJA 4DL9A 2AQIA 4FC6A 1W0JD 5IH3A 4D9HA 4E15A 4DCVA 3CTMA 3IPYA 1U0BB 3SG0A 2FW7A 4HQRA 4CLXA 3HDHA 1EFDN 5IAKA 7REQB 1GRNA 2WT8A 3QELA 4TKVB 4AJNA 1AUXA 1DINA 1O57A 3ICPA 3LUKA 1GV0A 3ZHRA 5TPWA 4ONEA 3FYUB 3ZZTA 3CR8A 1ABFA 5AJYA 3SZUA 5EJ2A 1RM3A 3TDMA 1BQ3A 3I1FA 4Y9DA 1FNSA 1E6WA 4B2PA 1HO3A 4ZQFA 1W2WB 2R6DA 2JLVA 2J67A 2HIGA 4TLEA 2BLNA 2WBLC 4OQFA 2BM8A 2FG6C 5CU7A 5C7YA 3CCBA 1LDMA 4D9BA 3PEWA 1L5WA 5KI6A 4DEXA 1YJ8A 4R1TA 4W5RA 1M2JA 4MWOA 2VNKA 4DCUA 4HWTA 4OUDB 5AQ1A 2B3TA 1M34E 3KDPA 1BFUA 3ROMA 2V7EA 2VP2A 1Z4OA 1H9AA 1JBQA 1JIVA 2E82A 1OTHA 4AP9A 3ZBTA 5LUBA 1EZZA 2MDTA 3O4GA 2G5TA 4YV2A 1MFZA 1WU8A 3GJTA 4AWAA 3AM1A 2AXEA 3ND8A 2GBCA 4FCTA 3MGBA 2X0EA 3SDSA 3UMFA 2FKNA 3FVTA 3A37A 2PAAA 4KDFA 4FS3A 4RHTA 1K75A 4TVOA 2Z09A 3N74A 2FK8A 1D3AA 2V03A 5BXYA 4MRNA 2FWJA 1YA4A 1JI3A 4YP6A 2Z8ZA 3O1LA 1RSZA 2BISA 3BORA 2LVBA 4INPA 5LQSA 1GCIA 4ESEA 1NQWA 1WMSA 3AR3A 1SKMA 2VNIA 1PWEA 4IDDA 1ISPA 2H1WA 4O5AA 1CJVC 1SXJE 2YN2A 2IC5A 3NR2A 4QPJC 5F7ZA 3OCJA 4LZAA 4YUAA 1CQXA 4DB2A 4FP9A 4A23A 1X80A 4HEA6 1NW9B 4NY1A 1TYAE 2J87A 5E3IA 1OZAA 4X9XA 1H5QA 4JBNA 2PUWA 2VQEB 1Y7IA 2POCA 2AN9A 2GPBA 4INJA 2H1FA 2BMFA 1Z16A 5LU8A 3PF9A 3S2FA 2ZJ7A 4PSVA 4OQEA 2B0CA 3BGIA 3KUCA 2FFHA 3RS0A 1ZUNB 3CTPA 3OI7A 4BEBA 1M1XB 3HWRA 3ICCA 4G09A 5AI6A 1U98A 5CDYA 1AT1A 2NP7A 1VLHA 1TL7C 5LQCA 4TMFA 3BKWA 4H1HA 4QYWA 2WA1A 4FGUA 5DNDA 4BC0A 5DBIA 2UZ1B 4ER7A 1Y82A 3IA7A 1KMHA 2RFLA 4BE9A 3UYKA 3SJUA 3N6RA 5IC4A 4S1OA 3QLVA 1BXRB 1UADA 1XCPA 3TTSA 3H6KA 2OPBA 3VV2A 1SA0B 2YVKA 3OQ6A 2D1RA 4E09A 3H7IA 4G65A 3SEAA 1KZ1A 4OL0A 1OFVA 4FYYA 2B8EA 2EKBA 4MSUA 4IJWA 1VCOA 2P2ZA 1N5JA 1NMQA 1SCNE 3DMFA 4Y1RA 2QLTA 4BNWA 3KSRA 1J2TA 1XX6A 1Z06A 2NU7B 3NVKI 4HXFB 1ID1A 1TFUA 3R5TA 2C92A 4TLMB 2E89A 5KNCA 5KTRA 3M7IA 3JD0A 2P7HA 3IULA 3QQPA 1L5MA 4QJIA 3DR3A 4YPFA 4EENA 4X63A 2Q1UA 3OQOA 4KP7A 1U8XX 5E4YA 1YOVB 2AC7A 4FQ5A 4LAFA 2MT9A 3G0CA 4RNCA 4YROA 4O5OA 3R0IA 1FPMA 4JX8A 2ZDQA 4TL8A 4N48A 3AGQA 3G5LA 4ZANA 3C3PA 2BRUA 4M1KA 5K6RA 1N9ZA 1U7TA 2BR3A 3IC5A 4KPYA 2H59A 4CM5A 4C0BA 1XMVA 3MGAA 3HCFA 3OIDA 5KDDA 2I4TA 3I6YA 5IULC 1Y63A 4UHHA 5HMLA 2ZJFA 2MYPA 4GVXA 1QMGA 2OHFA 4KXLA 1UPBA 4H6XA 1ZJ5A 5JVDA 2RGNA 2OVBA 2P40A 3VNAA 3PUKA 1ZH2A 5FB3A 2DWUA 5JWRA 1H66A 4ND6A 1SU7A 2ZJ8A 2Z43A 1TF7A 1Y7TA 1ZXXA 4M0UA 3BMCA 5DSZA 2C2WA 3VRHA 2REBA 3D4BA 3UAOA 3PPVA 1W48A 1USGA 5LA6A 2HJ9A 2C29D 3QEMA 4MUMA 3WYFA 5IW8A 1W59A 4UTXA 3AVYA 3ZJVA 5FHRA 3RT7A 4KQIA 4M1MA 2DYKA 4YFVA 3TOZA 4BASA 3SP1A 2E6KA 3A1CA 3E0QA 4G9BA 1XDBA 2BTEA 3L0IB 2Q5FA 4MKHA 3ZGVA 3M4JA 4AJ1A 5HIAA 5KWSA 4KNYA 1D2GA 3HUEA 5SV2A 4EFMA 1AMOA 3OP1A 1ULZA 1OUMA 2IXAA 1IJKA 1VMIA 1ZMRA 2JEYA 3BXGA 2Q45A 3H7AA 3QVLA 4O4IB 1MIOA 2BFBA 3OPNA 5L45A 1L7AA 2PS0A 5ICEA 3NHKA 4R1SA 4UXIA 3CEJA 5EKDA 3R74A 4LRYA 2EKQA 1OZ0A 2HADA 2H9YA 1XRLA 3DYIA 3LBIA 1K98A 3OM1A 3OTQA 4N6OA 4UULA 2NPOA 4M9XA 4Q6WA 4R6WA 3T1NA 3UJBA 2PV0A 3TLGB 4DKXA 2I62A 4Q4AA 2V97A 2VHUA 3EGXB 1QFZA 3JQAB 1NOKA 3MRSA 4DFDA 4UM9B 4HNTA 3CSUA 1SRQA 5ES3A 3RWBA 2IITA 3W2TA 5ALLA 5AUQA 3AOEC 4GXTA 4RW0A 4S1PA 4FFRA 1Y6FA 3GLFA 4RLHA 1UT6A 1VCHA 5EXSA 5K8TA 2ZIUB 5IBPA 2C3MA 3GP8A 5BOVA 1OYVA 4F9EA 1M10A 4AMVA 4H17A 2IEBA 1E1KA 4LDRA 1P4JA 4E5MA 1BX1A 1ZJZA 4ZOCA 4D3FA 3KELA 4HMPA 2PK3A 5E0OA 4KR7A 3FTFA 3EAGA 4ZZ2A 3UB4A 1EU1A 3A9SA 5FPHA 3FRIA 4ER3A 2XUZA 1WPQA 4JI2B 2GZRA 3PNLA 2KM1A 4R7TA 5C1DA 3RH0A 2QZZA 4TOIA 3EG9B 3RS9A 5F1PA 3H3XA 2CXUA 1ULBA 1OHHD 3CA8A 3FOEC 3PCXA 3UPDA 3JZDA 3QKRB 1H6AA 1HORA 1Q0HA 1U3FA 4B0PA 1ZJWA 4ARCA 1N3IA 3VFDA 4YV0A 3T95A 5EN4A 1KR5A 4IG9A 4NZOA 4D9CA 3LO5A 5HRCA 3OQNA 3M83A 5EP2A 4ZK2A 1E9FA 1MAUA 2FE1A 3EODA 3QVGB 4IUDS 5E3JA 3VV3A 2PNFA 4O2BF 1X74A 4H4DA 1JJBA 2CFCA 3D59A 1NGSA 3LUBA 3O1HB 1EK1A 4KI7A 1C3OA 3MOSA 1EI9A 4JKOA 4RPGA 4W9NA 4ZAVA 4HI0E 1FP6A 1UWKA 3HUTA 4QU5A 5F2KA 3VZCA 2MHCA 2CJYA 2CUNA 2V7XA 4HJRA 1F12A 4DMFA 5KYXA 2Y93A 3R7BA 2X6TA 4EGSA 4F3CA 5ICMA 5JARA 2HJHA 2V9PA 4U9IS 1R6DA 3CR7A 3WB0A 2FAXA 4C20A 4YVFA 3M6XA 4LNAA 4IDHA 5DGXA 1JNXX 5BNWA 1Q22A 3LYAA 4MR7B 1VYTA 4RY0A 3VXKA 2FI1A 1E92A 4RK0A 4DKJA 4X20A 1YVPA 2QZSA 1RCTE 3FXAA 5AXDA 3IJRA 5LSAA 1FUIA 3D2BA 3PQ2A 5B3KA 3GRZA 1GCUA 1YJXA 2W6MA 2YYAA 3WL8A 3WA7A 2O7RA 1RAEA 1A9TA 3N6VA 4KLZA 3RFXA 3RS3A 1U5BB 3S5JA 5IRCD 3LPMA 1VL5A 1ZQ9A 2DTDA 4RHUA 3BB3A 2WIDA 4ZZIA 3QNWA 2CYAA 4JP8A 1FSGA 4IH4A 3AFMA 3MD0A 3CX7A 2AX3A 4NHOA 1HZZC 5IVDA 1IDN1 1QF9A 3U17A 3S68A 2IT1A 4E1VA 2MIIA 3IPRA 2YWBA 1GUYA 4AO7A 1YR9A 4ID9A 4IJUA 4OLJA 3GYGA 3TTVA 2RK6A 1YTLA 3AUKA 2WYIA 3JX9A 1FJGB 2IODA 2X8AA 3NTVA 4F0JA 2BFWA 1H2AS 2VHXA 4P8RA 4BECA 3TTTA 1VB5A 3K0CC 4DXAA 2ZSKA 3CPJB 4I55B 1AB5A 1NNSA 3L6CA 1ZZGA 4HDSA 2BEVA 1JHZA 3BFKA 4C0AC 2O7QA 1GD1O 1NSTA 2YL2A 3NUQA 2E4YA 3RUCA 2J0UA 1U99A 2G0TA 2QRUA 3GT3A 1JZQA 3EBOA 1TOAA 2GKOA 2XA1A 5JSKA 1RI2A 1Z0JA 2A86A 2G77B 2V7WA 3CKYA 5EEGA 1R5NA 2FMXA 3PQFA 4BN0A 3WNVA 1CUXA 3BXXA 2EKZA 3CLSC 4JLBA 4OHOA 1S02A 2H92A 1H1DA 2I33A 5I7HA 1KQGA 3Q2OA 4CNQA 4C7BA 2BL4A 1AB6A 4UVDA 3TR6A 1QG0A 3QHQA 2FZWA 4RHCA 2VUIB 4Y2YA 3VM6A 1XMJA 3EBLA 4N65A 3ZHSA 2CNOA 4IDNA 2CDCA 4AD8A 3GT7A 3IDZA 1WCYA 2WWXA 4N7BA 1L4UA 3KT6A 2ZVQX 1YV9A 3IEXA 1QGOA 2IF0A 4CEIA 1FYWA 1YNOA 3NH6A 3I6QA 3NVDA 3P71T 2ZI5A 1C50A 3PNPA 4Y2RA 1YGPA 1AM4D 4ZCIA 3ZWQA 2KPOA 1Z88A 3A6FA 3VJKA 3PQ8A 3HJRA 3NS7A 1NXSA 1KR2A 3EXEA 1FNBA 3KOOA 4JAVC 2W8BB 4MTCA 5CVVA 4ZK6A 3LNTA 1J07A 4F4IA 5FWNA 4BNIA 2O48X 5DXJA 1P1IA 1UQTA 3QTBA 4ZVTA 4DRXB 3SS7X 3GLFE 4FYWA 1V4BA 2CMGA 1PTKA 4M76B 4LGYA 5T57A 3V4PB 1Y5RA 1QKJA 4BHTA 3O8RA 1NRJB 1RRPA 1EP2B 2VOEA 5E9JA 3SC6A 4DA0A 3AO0B 3BTSA 1V47A 4PX9A 1QGDA 1MORA 1V2GA 3K09A 4R31A 3EPJA 3DMYA 1GN8A 3E18A 4HYEA 4AI6A 2JLYA 1IOWA 3JD3A 4A0GA 2GEVA 2GK6A 2NTEA 4NFYA 3QXCA 1BRTA 5G4KB 1IK6A 4GP9A 2PGNA 1JFSA 2PUVA 4ZV7A 1UBLS 2ZI7A 3K70D 3M4YA 1AGYA 1KERA 4M1EA 3CCCA 4WFIA 3QPBA 4W6QA 1QP0A 2F8SA 4RO0A 3KS9A 3WICA 1NNUA 4MYSA 1KJIA 5K0CA 1U5CA 1J1ZA 2OPHA 1UBEA 3KEGA 1CP2A 2WU8A 2VATA 2B4QA 4K6KA 3WIDA 3MTBA 1BG6A 1QBGA 4LC1A 2ATIA 3K7EA 1X7XA 2VBGA 2AN1A 2W2VA 1QQ5A 3OPYB 4S2EA 1RYNA 1TE2A 4N7RA 4NQRA 3U0BA 4EJ0A 1EX9A 3OIWA 1DIOB 4UAUA 4EF6A 1IEVA 3PGXA 3LLMA 5AVJA 3BL5A 3HM9A 4KYTA 4Y2QA 1H0RA 1H6BA 1KVQA 5EWMA 3O2SB 5LUAA 4GC5A 2AR9A 2ZWVA 3H3JA 1MABB 2P9EA 5HFAA 1GSOA 3ADDA 5KQSA 3R7NA 1FRNA 5KYKA 4XVRA 1P8AA 2F3SA 3CRVA 2CY0A 2VA9A 2XCLA 3O03A 3ROXA 1QJCA 1Z0AA 3QKSA 1A1SA 5K99A 3ISJA 2ZVPX 3K71B 2W5UA 5DNWA 1HEYA 1RJFA 2ZYTX 4PO9A 4RK1A 2IEGA 4EI9A 1U2ZA 1B76A 4CR8A 4QHSA 3NYQA 2HSEA 3JR7A 1JKIA 5CXSA 2DPMA 5EWJA 2VP9A 1VPWA 4CLOB 3TKLA 4JVOA 2IOHA 5K0BA 3U31A 5CFQA 2GCGA 2HREA 4DS3A 2HCFA 3KETA 4OATA 4L0DA 3AKDA 5FI1B 3DMPA 5J2UF 1EXWA 3N75A 1A9QA 2UU9B 4ZHQF 3GLHA 3DB1A 1PR6A 4D98A 2VZ9A 1DZ3A 2MSCB 1ZRMA 2BSQA 2M6LA 3GEHA 3TPFA 1ITZA 1J0XO 1M75A 1ZG3A 2AW3A 3AFGA 1CQWA 2J0SA 1FFHA 3AUYA 2ZSJA 2HMWA 2PGXA 1UDRA 4GOLD 1VHLA 4GMKA 1UBCA 2BFNA 1Y3BE 5AXBA 2W2TA 4YP1A 5LZ2A 4BYGA 3PRKE 1EGVB 2WMOB 4IOJA 1DIGA 1DL5A 5AUOB 1E94E 1L7EA 3NCHA 4A3SA 3E22A 4ZTZB 2X3UA 2O23A 1X92A 4OGFA 2AJCA 2XDAA 3O3NB 1SKYE 5JZ9A 2WZBA 4O0MA 4P5DA 1PTJA 3OOWA 4QQFA 3UO8B 3T3MB 3DZDA 2G40A 1Z0KA 3LKDA 2NUTB 3AR5A 3X1ZA 4I4LA 3NHAA 3ZE7A 1Y4AE 3HA2A 3BILA 3TCKA 4DJ5X 1ISRA 4HQ0A 4LBWA 2C3UA 2WTXA 5KC9A 2UZIR 2DWCA 2PSJA 3RUEA 3S55A 1LPAB 3N59A 5HIIA 4ROTA 2QGNA 2VTDA 3IMFA 4PPNA 4Q9IA 2K87A 2WU3A 3AKCA 4C06A 4HGNA 3NDPA 2XMZA 4JGGA 3ZHQA 2PJUA 3QIAA 3NGLA 4UZSA 2ISQA 1FMJA 3TM5A 2AKAB 4OU5A 4UEWA 2WOOA 3U4IA 5M3BA 4F92B 3LYHA 3RK0A 1NUUA 1QZ3A 4LF4B 1UJNA 4HLQB 3NBFA 4TL7A 2XUFA 3OEWA 1IG3A 1P7PA 4HZUB 3DTNA 4LJ4A 4MUYA 4EY5A 2WVGA 2IZOA 2FRXA 1ACLA 2XMRA 1LJLA 3KPJA 3RU9A 4LDQA 5I7AA 4WGFA 1GYQA 1W0KD 2NVUB 2ORYA 1D0IA 1YB5A 2FFQA 4Q82A 1I9CA 3HN2A 1GUZA 2LCIA 1T2AA 3QOWA 3SEFA 3CONA 1C7EA 1OIXA 1IY0A 3CKKA 1G2QA 2O5CA 1CIPA 4YLGA 2X8WA 4N5IX 3A2LA 3GUZA 3AHGA 4HAOA 5HIKA 1GQRA 3RRMA 4NYMQ 3ILYA 2I4LA 5DNVA 4YH1A 5AYVA 2C7GA 3WAKA 2PM8A 4RPLA 3V8QA 1NVEA 1S0UA 4HK4A 4I7EA 2I66A 3VPHA 3ELUA 4FBLA 4KUHA 1CHDA 3CBGA 4C4SA 3VI3B 1QE5A 2V9CA 3MB5A 4LXHA 2P2YA 4JC5A 1XTVA 3PUJA 1X1TA 3HB9A 1P5RA 5G1PA 3AC0A 2XXAA 5C7LO 2VJDA 1BH2A 3DDWA 5JH7B 5KPJA 1LF5A 1G20A 1DC7A 1CYEA 3OESA 5T8KC 4YMWA 3VAZA 3EOAI 3G1UA 4Q7EA 2BAGA 1JHQA 3V1NA 4FFBA 4FYVA 4RS4A 4MGHA 5FBHA 4LXGA 2Z08A 4TKLA 1N8SA 1GKKA 4ZOLB 3ZQUA 4QT0A 4K9SA 3EPLA 2V7BA 5KDLA 4B8ZA 2YS6A 1PU2A 3IQGX 4UU0A 4Q1BA 5EZ6B 3CZRA 4E07A 1XSEA 1KYVA 3EQZA 5ENDA 1KYYA 1YK0A 3JQ7B 4FCCA 5AJZA 5DO9A 1AF7A 4ENVA 1CZOA 1ZGHA 5B5SA 5CBPB 2FOXA 2RHBA 3AG6A 3B1KA 4AG6A 1I3MA 3Q12A 1EIZA 2IUEA 4EEZA 3MF4A 5D6NA 1QQ6A 4ID3A 3LUGA 3MSXA 1TUEA 3WNCA 3U3OA 5IN5A 3H9UA 3R5SA 2GWHA 3PWKA 2Q8PA 3FYTA 4ETWA 2X2EA 2IZ7A 3SM9A 1JT9A 1N34B 2Z8YA 3R44A 4E1AA 1HQKA 4KE8A 4NE2A 3DWFA 3E4DA 1IN4A 2JCBA 3E70C 3TAHA 1C7RA 3AR7A 2O6LA 2W6JA 1OPXA 1UAAA 1UJMA 1F1BA 2HWYA 1EE2A 1YDMA 2ZXEA 3IQEA 5D51S 3MXTA 2CVPA 2AFRA 3K5IA 3AK4A 1C1XA 4MVJE 1L1FA 3RKRA 2PR7A 3L02A 4ZFNA 5JPDA 2QM8A 3L6OO 3SEQA 1XZQA 5A4DA 1NF3A 3HI6A 3HKEB 4M54A 1QK3A 4W5WA 4AMZA 2DQZA 4EZEA 2A78A 2I2AA 2J48A 1B1CA 1SCUA 1KP3A 3OZAA 4X95A 3SQWA 1KYWA 2VDRB 4CLHA 1ZH4A 4HAIA 3VYUB 1Q7TA 2QLBA 1QO0D 3L1KA 3CUYA 3IHKA 5MN5A 4ZI7B 1NMZA 4HBGA 1XQ9A 2BHNA 5B58T 1FRFS 2DFLA 4P5EA 2TECE 1HFWA 1I2MA 2ZRNA 1QO7A 3JD1A 3I32A 4GAEA 1TYZA 3WL7A 3BIOA 2PRSA 2VAVA 2WWIA 2J45A 3VDQA 2BH9A 4LPKA 1AXRA 3JQDA 3R9XA 1YU9A 4FI3C 1F4VA 1IZ7A 2O0MA 4G37A 1P44A 1AN0A 2HMVA 2VQ3A 2W0MA 2FG5A 3FDZB 3HKCB 5GM1A 3U3JA 3M5PA 4EQ6A 4HZIA 3W78A 3K5PA 2A0WA 2AZDA 5CTJA 5T6BA 1GTZA 4ZCLA 3D64A 4CKEB 1I94B 2J4FA 1FMTA 4FOSA 1DQNA 1PG5A 2AUMA 3QVUA 5TS3A 3REQA 2E4XA 2AFIE 3CWQA 1V39A 1XQXA 1B2LA 5DW0A 4B7CA 1NOJA 3L0OA 1WW2A 1V8FA 3D3JA 3JQAD 3CXRA 4RJIA 1Z38A 4X65B 4LYJA 2C2GA 2PPVA 3SZGA 3EDMA 5H81A 5HCUA 4XWOA 1ZPDA 2B35A 2X5OA 1Q1EA 3N3AC 4UM8B 4RETA 2AKEA 4PO8A 1E5XA 1TX4B 3AJ8A 4OI1A 4U8GA 2J0QA 3OCXA 1LLCA 3TINA 4RGYA 4DQVA 1TKBA 4H3VA 4MJXA 4ND5A 3IAM1 3X1YA 3O90A 4FXPA 5D87A 1DHTA 1LI7A 3OIVA 4P4SB 4TLLB 4DR6B 1V7QA 2FZGA 4YC7A 2UZ1A 2WJZB 3TVTA 2J3EA 1NE2A 2IYTA 2PL9A 3QWIA 4NPCA 5KWJA 2GLUA 3OEEA 4OJYA 4BAZA 5FA5A 4HVCA 1THMA 2J5KA 2VDWB 3FMIA 4GUAA 4ASUD 3GGPA 4MTLA 1DAGA 2CFOA 3MMPA 4BGEA 1G66A 3EB9A 2VIIA 1G1MA 2FPWA 2WF6A 2XUQA 2WVHA 4W6ZA 4KPFC 3ZWVA 4BJ5A 5FH9A 1WV0A 3T1QA 1HMPA 2D2FA 5E9WA 5GVSA 1K6IA 4TT3D 3TDNA 1SUEA 2IY9A 3LOPA 3ZQ6A 3MTGA 3V7FA 5C5EA 2HN9A 3SX2A 3IV9A 3A9UA 1Z5VA 3ITEA 4ZEOA 2ZSBA 2XEXA 4ZGBA 5ADHA 3QUBA 1OASA 4J6FA 4DLKA 3SIXA 3HLTA 3UXMA 1LTKA 1X80B 3R3SA 1JTEA 2CJPA 4HAZA 1NYRA 5NULA 4CGZA 3LX8A 3ROZA 2OMEA 5GMOA 1FDTA 3B1ZA 4YRNA 2P30A 1XEWX 4P9NA 3VZSA 2C07A 2YASA 4DSOA 3WLSA 1LBQA 3F9CA 1PYDA 2WNSA 4G4JA 1B6GA 4M2LA 1K88A 1OBHA 2ZBEA 4FFWA 5HKBA 3COPA 3DVAB 2FWMX 2X1HA 1MAWA 1UDAA 3H1EA 4EMUA 1IG0A 1ZXBA 3ODPA 2J9GA 4ZO8A 5KC8A 2DM6A 5TNXA 3L6RA 1G18A 3UH1A 3VU9B 2GGSA 1GOTA 1A9SA 1U6JA 1UK8A 3L6EA 3K2EA 4DQKA 5DNEA 3PK0A 3M2PA 1CZLA 2AUTA 3U4HA 2PKQP 2OBBA 4PTLA 1RWVA 1N6HA 1H22A 2RGXA 2QLMA