1IUOA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with acetates
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
272
structure length
272
Chain Sequence
b'NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
molecule keywords meta-Cleavage product hydrolase
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 103
structure length 272
sequence length 272
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iuoA00
4Q05A 2WUGA 3BF8A 4XJVA 5DNUA 1XLWA 4N8EA 1CR6A 1MAHA 2HA0A 3DL7A 3I2KA 3JWEA 2HA2A 5FV4A 2WG1A 3WYNA 3DOIA 1JT2A 3R3WA 2VT6A 5ALVA 3C8DA 3DYVA 3BIXA 3WL5A 3DEAA 5JALA 1WPXA 4B83A 2VT7A 3CCCA 3I2JA 4MQLA 4KJXA 4FLEA 4G8CA 1H2XA 1VE7A 1Z68A 5AI0A 4G8BA 5DTIA 2OLEA 5F4ZA 1LLFA 2ONCA 1LPOA 3IUJA 2HL6A 4WDRA 1K8QA 2HU7A 3G9UA 5ALUA 3UMJA 2CKMA 5DNVA 2X76A 4CCWA 3MGAA 3W06A 1J1IA 2QTBA 3FAKA 5EIEA 5AI5A 1UWCA 4U2DA 1VKHA 3MVEA 4CIBA 4DNOA 1BS9A 4M0FA 2V98A 1GPKA 5FPQA 2XE4A 1SOMA 2HFKA 4Z49A 4B0PA 4DSZA 4BVLA 2FJPA 3LCRA 4BCCA 5LLSA 3PF9A 3R3XA 1EDEA 3E4DA 3C6ZA 3QPAA 1QZ3A 2PPLA 5AK4A 2GYWA 3PF8A 4M0EA 1JKMA 4B80A 1TRHA 3S2ZA 2WIKA 2C58A 1TAHA 4ZREA 1WM1A 3CN7A 2GBGA 1QLWA 3AILA 2DQYA 5LYYA 1G4HA 1YAHA 5IVKA 4RE6A 5HF5A 4AQDA 3LLCA 2XMZA 1LBTA 4K5QA 2Y6UA 1MTZA 3WK9A 3H17A 4I19A 1J2EA 1ODSA 5AI4A 3C6YA 4U2GA 4NMWA 5FXMA 1QE3A 4Q1VA 1N1MA 2I3ZA 4L9AA 4UHHA 2NW6A 4J7AA 1C7JA 1UK8A 2BCEA 2ACKA 2OCGA 1XZEA 2WFLA 4BAZA 2OGTA 5BWCA 1U8EA 5A7GA 2C5FA 2WJ6A 3NOXA 3GROA 1QIMA 4LXIA 3FSGD 3IUQA 2BAGA 4U2FA 4EBBA 2RGUA 4M0MA 2DHCA 3VXKA 2H9YA 3CN9A 1FFAA 5KBYA 1UK6A 2QRUA 4P9NA 2WUFA 4BCDA 4G9EA 4U2CA 4UBLA 5DYTA 5AKKA 2PM8A 4FNGA 2JGLA 3R3ZA 4OD0A 2OGSA 4E14A 3WI7A 2HA6A 1GQRA 4UBIA 5FRDA 2DR0A 2H7YA 2XQGA 1BN7A 3AIOA 4N5IX 5C8VA 2WTNA 1F0NA 3F98A 5C7YA 2WLSA 4H7KA 4HZGA 3LP5A 1N5RA 4QDZA 3ZLTA 4F0JA 4B7ZA 4B9EA 5ALEA 2ZJ7A 1LZLA 2C5GA 4HXEB 4UBOA 4ZRDA 4AMYA 1T4MA 1SCQA 5JD5A 4X94A 5ALKA 4AO6A 3WA7A 1FSSA 1FJ2A 5AM0A 5DYWA 2AJDA 2OCKA 1WCYA 3H2KA 1XFDA 1HPLA 4UFOA 3EIOA 5EGNA 4DYHA 4OSEA 4NS4A 3QYJA 1THGA 4ZI5A 3L1HA 4ROTA 4DIUA 2IITA 3L1IA 3BF7A 3E3AA 4CI9A 1QIGA 3K2IA 1SCKA 3AJAA 1JU4A 4H18A 1BCRA 1XRLA 4G4JA 3PUIA 4ZV7A 1QJ4A 4MQMA 2E3JA 5KWJA 3I2HA 3I1YA 3G0IA 3SK0A 1GGVA 3MUNA 1XKLA 4AN0A 4D9JA 4G1FA 1U65A 1MT3A 5JAUA 4XIIA 5K3BA 1YAJA 4TPKA 4IH9A 1Q0ZA 2LIPA 1MPXA 2AJCA 3A70A 2WG0A 1J07A 3VJLA 4UBMA 2G4LA 2XMCA 5ISMA 5JZ9A 5CURA 3ED1A 4FBMA 3WKDA 1W76A 5BWBA 4Y2XA 3D4LA 4UBJA 3BIWA 3HABA 1ZD5A 4EZIA 5AIBA 5AOBA 2QS9A 3QPCA 5EHQA 4QEKA 5JD4A 4BP8A 4RE5A 5AM4A 3FVTA 1BROA 3I2FA 4DNQA 3K6KA 5ALPA 2HU8A 4DNPA 3BDIA 4MYDA 1ZGBA 1CUXA 3H2HA 2XT0A 2ZJ6A 1QIEA 2ACEA 3O4GA 4UHEA 4DGQA 3F9CA 1A8QA 4KE7A 2PSHA 1AURA 2WU4A 4MWTA 3YASA 1VOTA 1EK1A 3D5EA 5CMLA 4WFIA 3RKSA 1CUWA 1EHYA 3N2ZB 1BEZA 4H7HA 1UOQA 4RNCA 5IKXA 2ZSIA 3ANSA 5JIBA 4KE6A 1K4YA 3FWHA 4G4IA 4TGLA 5E4JA 4BP9A 3ESCA 5ALOA 1XROA 4IHAA 4F21A 2WFZA 1IUPA 1GT6A 4UBNA 5EI5A 2JF0A 1C7IA 2BJHA 3HI4A 2XB6A 3OURA 3WK7A 4X91A 4WJLA 2BGNA 3EF3A 3GBSA 4LIPD 1CUZA 4X90A 1OXMA 4W9RA 2W6CX 2GYVA 5IVHA 4YASA 5AKLA 3WJ2A 1USWA 1P0IA 1ZD4A 4X6YA 1X2EA 1CQWA 3G0CA 2CJPA 3H1BA 5EHZA 3S8YA 4Q3KA 3DD5A 4KE9A 2OXEA 1G5FA 1VZ2A 4DNFA 4MEAA 1XQXA 5JASA 1CIJA 4B9AA 1YA8A 2OQIA 3G9TA 1THTA 3IURA 5I7UA 2WHPB 5IVIA 1XZHA 4WFJA 1JU3A 1ZICA 3AFIA 2PBLA 4H35A 5CBKA 1CUHA 1CFJA 1O6FA 2WIJA 1DQZA 4A16A 5I8PA 4E11A 3FYUB 3WYDA 5DLPA 5E4YA 3AIKA 3KXPA 4CCYA 1A8UA 4BAUA 4QZVA 4Y2TA 1AKNA 4ETWA 5JATA 3O9MA 2PSFA 1ZIXA 2HDWA 2YASA 5HCUA 5ALGA 3VISA 4X6XA 5E2IA 3D2AA 5ALNA 1XZGA 4L3WA 2XLBA 4W1PA 5BV7A 2K2QB 5AM1A 4BDSA 1CUJA 4FTWA 3G0BA 2ZJFA 3C6XA 1BEEA 3DKRA 1EVEA 1F0PA 1IMJA 3WIBA 1A7UA 4HVTA 2QJRA 1YS2X 5CT8A 4HAIA 4U2EA 2CBGA 1XLUA 1UOPA 5SYNA 2O2GA 3ZLVA 5LKRA 4KYVA 3R3UA 3FLAA 1HBJA 4C6HA 2ZYHA 2XUKA 2G63A 4X7BA 5EHNA 1N5MA 2PL5A 3AZPA 1XZDA 2PVSA 2DHEA 4PF1A 3M81A 1ZOIA 2PU5A 1CUDA 1XRRA 5AM2A 5HZGA 4OB8A 4B81A 3WL6A 2G5PA 3RLIA 2BKLA 3RK4A 2XUFA 2VJCA 4EY6A 2VJAA 3RM3A 1BCSA 7YASA 2B9VA 3AUKA 1ORWA 3DQZA 3KWFA 1T2NA 1XZFA 5HQ3B 4FFWA 4BC1A 1PJAA 2WIFA 1BE0A 3C70A 3EQ7A 1IZ8A 3HEAA 4FHZA 5AH0A 4BRSA 3D59A 4GECA 4UHCA 1GPLA 4INZA 4X00A 4C4XA 5AKJA 5LIPA 4FKBA 1ZD3A 3QMWA 3W9BA 4EB0A 1XQYA 5AP9A 4ZXFA 6YASA 3O0DA 1UK7A 3CCBA 2CUTA 1MU0A 1DT5A 2XMDA 2VAVA 3HACA 1ZI6A 4KEAA 4JYMA 2Z8ZA 3VVLA 1CUCA 4X6UA 1W1IA 4FLFA 3G9ZA 1FFDA 4AXBA 3FCXA 2DHDA 3E0XA 4DM7A 2BGRA 1ODTC 1HQDA 3F96A 5EHXA 4AZ3A 4F5ZA 1MN6A 4QWWA 3Q8WA 4X93A 1JJBA 3DNMA 3O4IA 5ALLA 2BUBA 5C81A 1EK2A 3AINA 5ALTA 2XMBA 4W1SA 3AIMA 3IBTA 5K3CA 2Y2VA 3I2IA 4J3JA 3PI6A 1TKRA 1EH5A 1VA5A 4B6GA 2XUPA 4BDTA 4EY5A 4QLAA 4ZV9A 1LZKA 4N8SA 1IVYA 4H77A 3TRDA 2XQIA 1XLVA 3H2JA 4GDMA 1MJ5A 1XZAA 3LS2A 2HADA 4J0JA 5FKJA 3WWDA 2OGZA 5JAPA 1UFOA 3DDUA 4HTAA 3I28A 5C8ZA 3V9AA 3OC0A 3QZUA 1J06A 1IUNA 4H0CA 3SX4A 5ALZA 1DWQA 3M3DA 3HSSA 1CUGA 3UUEA 1VXOA 4C01A 1CUFA 2FUKA 2P8SA 3WA6A 1ZIYA 4G5XA 4BZZA 5K3EA 2WHRA 2ORYA 5EIAA 2XUJA 2ZYSA 1LPPA 1EDDA 1DU4A 5CH3A 3FBWA 3T52A 1O6GA 4HS9A 5D6OA 3WK4A 5ESRA 3VVMA 1EI9A 1R9NA 3WLAA 4BRZA 3QMVA 1OILA 5KWIA 2DQZA 4HXGA 3WWEA 5J3JA 3ANTA 2BUCA 4OU5A 4I3FA 1JI3A 4Y2PA 4L0CA 4CFSA 1EX9A 5D3ZA 1XRPA 3R0VA 3TEJA 5T4HA 4X71A 5K3FB 4PSDA 3WJ1A 1EINA 1YASA 4CG2A 4N5HX 1AGYA 2UZ0A 4YK7A 4N8DA 1Y37A 4UFNA 1VLQA 3D7RA 1CPYA 4EUSA 5LZ9A 2OAGA 4MEBA 4FDMA 1UKBA 4HRYA 4E46A 2VAXA 4QDOA 3FYUC 5AO9A 3KD2A 2Q0XA 2AJ8A 3AZQA 1LGYA 5DJ5A 4Y2SA 3WK6A 1LPBB 5CXUA 3U1TA 3I6YA 4OCZA 4QWMA 5AK6A 3C5VA 5T4EA 4AO7A 5HFNA 1H23A 4B82A 3FOBA 3B12A 1XRMA 4P92A 1HLGA 2WHQA 4Y2JA 5LZ2A 3DOHA 3R41A 4BYMA 1TCCA 4UUQA 5ALIA 3WIOA 1QIKA 4DLNA 3ESBA 5CRIA 3DJYA 2JEYA 3V1LA 4H7EA 3QVMA 2HIHA 2BFNA 4LYEA 2O7VA 1G42A 4Q3OA 3C43A 4UBKA 4A23A 1EB9A 2IIVA 1JJIA 4C87A 4W1RA 4IQ4A 3NUZA 4LHEA 1ZJ5A 1JJFA 3STYA 1JMKC 4J0IA 1KU0A 3PDCA 4KAJA 3ZV7A 2QMQA 1ZI8A 4EY4A 3I6ZA 1KU6A 2XQKA 3WKAA 1XZKA 1QIFA 1W75A 1EXWA 1LPSA 4KACA 2WSLA 3FCYA 4DSAA 5ALHA 5FPPA 2J4FA 4XX1A 1CUBA 2O7RA 2D5LA 1U2EA 2QR5A 4X3CA 1LPAB 3LIPA 1GXSA 4OB6A 4H7IA 4CIAA 5A7HA 4WY5A 2XMRA 4Y7DA 1MO2A 4CG1A 3BWXA 2I03A 1X2BA 3NWOA 4XVCA 2PUHA 3DS8A 3BXPA 4BCBA 5H3HA 4K2AA 3DLTA 3BJMA 1E3QA 5AK3A 2Y2UA 2RHWA 3AZOA 1A88A 3FVRA 3G7NA 4QA9A 2HA4A 2WFMA 5D3KA 5JADA 1QGED 3V1MA 4UFPA 1CUIA 2AJBA 2V9ZA 1L7QA 5I9IA 4U2BA 4B85A 3R3YA 5AM3A 4MXDA 4FLMA 4LXHA 4BB0A 3V1NA 3QITA 2QUAA 4J0GA 4AN1A 1CUEA 2GZRA 1Y7HA 3STWA 3OG9A 4IH1A 4E15A 4S0XA 4MWSA 2IX9A 5JZSA 3V1KA 2WIGA 3O4HA 2XMGA 2VTVA 3D3NA 4DMHA 2OQVA 1S8OA 3E1GA 1QIJA 1YS1X 4K6GA 1K63A 4UHFA 1VZ3A 4C89A 1UZAA 4BC0A 3FLBA 2WU3A 1X70A 4GBGA 2XMSA 1BU8A 3G0GA 2HA3A 5DNWA 2D0DA 3VJKA 4Y9SA 1XZMA 3WZMA 1QIIA 3KDAA 1AZWA 5LKAA 2ECFA 1TK3A 2WIDA 2YH2A 4I4CA 3F67A 2QXUA 2WM2A 5CT9A 1E66A 1RP1A 1ZD2P 2RONA 4QDTA 3BE8A 1DWOA 5JD6A 1CUAA 4OU4A 5AKGA 1R50A 4A5SA 2H1IA 3Q0TA 5AKEA 3EBLA 3JYHA 3WMRA 4Y2QA 1CUVA 1VA4A 1XRNA 1B41A 5LZ5A 1F8UA 3PUHA 3M83A 5ALSA 5ALRA 1LBSA 2O2IA 3CXUA 3HXKA 5ALYA 2YXPX 1K5PA 1E8DA 1XZCA 3C5WP 3HYSA 4RPCA 5JARA 2H7XA 4PW0A 4WDQA 3ZLUA 1YB7A 5C8XA 5FDFA 1U4NA 1LPMA 1GPNA 4EHBA 4JUIA 1ZI9A 4GEGA 5ALJA 4B0OA 4RGYA 2CEKA 4TVKA 2V97A 4B84A 3O9VA 2O2HA 1NX9A 2VJBA 3IA2A 3O4JA 3WKCA 3A6ZA 1Q0RA 5CH5A 4JYPA 4QLOA 5AI8A 5YASA 3P2MA 4BTVA 5HK8A 2RAUA 2W22A 1DINA 2Y1KA 2HRQA 1XZJA 4ARAA 1CLEA 4GWLA 4BBZA 5AJHA 1CUYA 3W05A 1QO9A 4AX4A 4FWBA 2JGMA 5CTAA 3QMMA 5AKIA 1UKCA 2WHPA 5AI9A 3IULA 3WK8A 4JEIA 3WZLA 4HRXA 3VJMA 4YPVA 5A2GA 5AK5A 2DCMA 3K9BA 5IH7A 2C0QA 3FYUA 3G0DA 3VDXA 4CG3A 3B5EA 3I2GA 1MNQA 1N8SA 5E4TA 4PSCA 2XQJA 2H7CA 1ACJA 4DTCA 4QNNA 3KOOA 1DT3A 2VF2A 2JBWA 4J0HA 4JH0A 1D07A 2X8BA 5HKAA 4NVRA 5ALDA 1RWQA 3H2GA 1HDEA 2PSEA 3ICWA 2I78A 2XDWA 2Y6VA 1E89A 2JGKA 4J03A 3WK5A 4GHWA 2WFLB 4ZGBA 1GKLA 2QUBA 1TCAA 2QM0A 2FX5A 4KRYA 5JAOA 5FUMA 5LP1A 3LIIA 2XUOA 1M33A 2AJLI 1R9MA 2CMFA 2QJWA 2XLCA 3A2MA 3WL7A 1GQSA 4XWGA 4X95A 1YCDA 3STVA 3STUA 1QIHA 3FLEA 2XUDA 2J4CA 1DTEA 1K6EA 1G66A 1QFMA 2GYUA 3R40A 4AB1A 5A71A 4GXNA 1BN6A 4X92A 1R3DA 4QDXA 4PNZA 4WFKA 3FSGA 3OTQA 1NU8A 5K3AA 3NGMA 3U0VA 2CB9A 4Q3LA 3W2TA 3PICA 2VA9A 3RARA 1GZ7A 1Q83A 3IVMA 1QTIA 4K6KA 1HKHA 1FFCA 5HQ3A 3PFBA 5CW2A 2HRRA 2J3QA 1ZGCA 3OM8A 1R88A 4W63A 4G4GA 1Q84A 5ALQA 2X5XA 1YSCA 3O95A 2R8BA 3WKEA 1YB6A 2VJDA 5DTJA 1CUSA 2RI6A 2BUAA 1W6RA 1WHTA 2R11A 2DSNA 1YR2A 2XUHA 1DX6A 5ALXA 4WY8A 3G8YA 2VEOA 1I6WA 5ALMA 1L7AA 4PV7A 2I3DA 2VQ6A 3M82A 2WILA 4P08A 3WQHA 5A6VA 5FP0A 5LZ8A 3ZI7A 2JIDA 1TIBA 4O08A 4Q34A 1E5TA 2HFJA 1QO7A 4FOLA 4OUKX 3H1AA 5ALWA 4DMFA 1ODCA 4OB7A 1ORVA 2GBFA 3KSRA 3H0CA 4MJ3A 4PO3X 3FNBA 4QE3A 3T4UA 3ZPXA 5AIAA 2FJ0A 2HM7A 1H2ZA 1XQWA 2WJ3A 4K6HA 3SC2A 3HJUA 2EDCA 1FFEA 5HF9A 3GA7A 1XZIA 5HK9A 1CUUA 3QH4A 3C8HA 3G9XA 3ESDA 3EQ8A 1W4LA 5LZ7A 5A7FA 1VJ5A 3HRHA 4OYYA 2GZSA 1XRQA 1QFSA 1HL7A 2HA7A 4AMZA 3F97A 2G5TA 4GI1A 2JGJA 3MUOA 5JYCA 1L7RA 2XMQA 1E8NA 5CXXA 5AKZA 3VKFA 4Q82A 1TCBA 1WB5A 5KREA 3D2CA 4QDUA 2QXTA 3SWWA 1WB6A 4H7JA 5CT6A 5A62A 1F6WA 4KAAA 2OCLA 2B61A 5K3DA 5K5EA 1PFQA 3OPMA 3HZOA 1R1DA 3X3HA 1ISPA 5HF6A 1Y7IA 4BATA 2HHAA 1SFRA 3UUFA 4P93A 2PUJA 2HA5A 3IB3A 3PFCA 4IH4A 2XUQA 2QZPA 1MAAA 1MNAA 1R4ZA 1QTRA 4G9GA 1PV1A 2PKYX 5AICA 1QONA 4X97A 4EY8A 1A8SA 4C88A 1WPRA 4BE4A 2XI4A 4ITVA 5BOVA 1CRLA 1P0MA 1P0PA 4LYDA 4UHDA 4H7DA 5K3FA 2B20A 2Z8XA 3WWCA 5HKBA 1VXRA 1LNSA 3D0KA 2JGEA 2C7BA 3B3QA 3IDAA 3TGLA 3OOSA 1UXOA 2ZSHA 2B4KA 1CVLA 5AM5A 3WKBA 5JAHA 4AZ0A 2PSJA 2WG2A 4OPMA 4F60A 1DQYA 4J0KA 5SYMA 4AO8A 3IIIA 1UT6A 4PQEA 4FMPA 3H2IA 4GLBA 5FLKA 2GBCA 1CV2A 2WJ4A 3N0TA 2GBIA 3DCNA 4X85A 1UKAA 1OCEA 2JEZA 4ARBA 5AHXA 2ROQA 3I1IA 4UPDA 5LZ4A 1MX5A 2JGIA 1UK9A 5DWDA 1EDBA 1ZJ4A 4W1QA 2PSDA 1AUOA 2VSQA 4J0DA 2V96A 2WKWA 1B6GA 1JFRA 1AX9A 5CT4A 2EDAA 5ALFA 2PU7A 4CCYB 4MYSA 4GW3A 5AKYA 1QOZA 1DWPA 2OAEA 2J3DA 3QPDA 2VATA 3GZJA 3GFFA 1FFBA 4WCVA 1P0QA 4BVKA 4LXGA 3QM1A 3BDVA 5JZBA 5AI6A 2XUAA 3I6MA 3TJMA 3WL8A 4KRXA 5T4BA 1XQVA 4KE8A 1CEXA 1MX9A 4OYLA 3F8SA 5HF8A 1BRTA 4DMKA 3BJRA 1XZBA 1UOOA 1KEZA 3BL8A 4FFVA 3STXA 1QIDA 5AKXA 4BAGA 1H2YA 2OCIA 2YYSA 5EFZA 3QBJA 2C0PA 3H18A 3HLKA 4UHBA 1EVQA 5JANA 1RYYA 3DYIA 4DMCA 3IUNA 4ZWNA 4BTLA 1IZ7A 4BVJA 1H2WA 3DKKA 1C4XA 1ETHA 1WHSA 5AOAA 3EQ9A 2WQZA 5CT5A 1ACLA 1XKTA 1DX4A 2PX6A 3GUUA 2QOEA 2QKYA 2JGFA 3DL4A 3FYTA 4KR0A 1GKKA 1VE6A 4J0CA 2OPHA 4JNCA 1JMYA 2XUIA 3C87A 2EEPA 3C6BA 3ESAA 5T4FA 5FOQA 1MX1A 3JW8A 2XUGA 5D7BA 1AC5A 3IUMA 4Y2UA 4H7FA 2WUEA 2RHTA 3ILSA 5EIHA 1SC9A 3ICVA 2HU5A 2RIPA 4FNMA 1NU6A 3WWOA 4V2IA 1EA5A 2WTMA 2ZYRA 3STTA 4HXFB 4L72A 1W52X 4IO0A 4Y2YA 3H04A 3W9UA 2XQFA 2QVBA 2ZYIA 4BZWA 4KAFA 4FBLA 2C4HA 2ES4A 2OG1A 3G02A 5AKHA 4EA6A 3L1JA 4NZZA 4C4YA 3PE6A 1WB4A 2QT9A 1SCIA 1AMNA 4Y2RA 2DFPA 3V48A 4EY7A 4LKOA 5HFAA 3H19A 5CH8A 3HC7A 1CQZA 5AOCA 1WOMA 3KWJA 2ZVDA 3WWPA 1EB8A 3GELA 1IUOA 4PSUA 1LPNA 4YX9A 1E8MA 3A2LA 3C45A 3D2BA 2Z3ZA 2CZQA 1YA4A 4G8DA 1TQHA 2Z5GA 1XZLA 3W04A 1H22A 3A2NA 2Z3WA 4C4ZA 2WUDA 2AXEA 5DYYA 4BE9A 3R3VA 4Y2VA 1AQLA 5IVDA 3ZWQA
chains in the Genus database with same CATH superfamily
2R7MA 2GCIA 2AN5A 3PYXA 4RQAA 4FEYA 4LMPA 4HNTA 1XCOA 3BFVA 1GO2A 2JKVA 4IY1A 3F3MA 3DWEX 3FPKA 3EDQA 1ZS9A 4J1SA 3ADDA 1G18A 4KG7A 3HR8A 1DDIA 3O8QB 2VP3A 2BZSA 1XBTA 1G60A 3R23A 3MGBA 3WLKX 1UBGA 4PHGA 2VH2A 1UBUS 2FW7A 5JSZB 1G9SA 4TLEA 3DPUA 4II3A 1O89A 4DRXA 3PT5A 5CDTA 3C3KA 1SCUA 4CI0B 1GTRA 1CW2B 1QU2A 3AEUA 1L5MA 3F1KA 4FOPA 5JJLA 3A7EA 4XVRA 5FV4A 3CNHA 4IQFA 1NWCA 2WG1A 4ZHQA 4A36A 5JDCA 3IP5A 3P0IA 1RLTA 3ET5A 3LGSA 4B6EA 3U3MA 3DOIA 3FPBA 4LJAA 4RH1A 1P60A 3THYA 1E1MA 3VPDA 3L4SO 1AO3A 3E7WA 3FDIA 3M6AA 4FI3F 2J1LA 4R8VA 2GRUA 1H1DA 1CNEA 3NASA 4I46A 4X54A 4KPFC 1H0RA 3C8DA 4KRGA 2AHOA 3DYVA 4WKOA 3RU2A 4FGJA 2LBPA 5CFNA 5LU9A 1QLJA 2LWIA 4F7DA 5CITA 5J43A 3OTHA 4XWTA 4CHTA 2O8EA 4XCQA 1N7HA 1XKQA 2JFPA 1A9XA 3O84A 4I36A 5CVEA 4LWQA 1CRQA 4G5YA 2O2JA 3ESYA 3E3MA 1HRDA 4G65A 4KREA 3PDJA 2W4QA 1R4AA 2O2EA 2V9PA 4KAXA 5HG0A 1MIHA 3L3BA 2C9ZA 3F5QA 3UUGA 1LNZA 2EWWA 2ZZMA 3CU5A 3ORYA 1W36B 4LW8A 4EI2A 1I32A 3B1YA 3GGPA 4HZIA 2R85A 2VQFB 4F9GA 1PTKA 2PUFA 3A0UA 3N3AC 1IBSA 4D9FA 1LPOA 4G86A 5ADHA 1U0EA 3EH2A 5EZ5A 3EZLA 2A9RA 3GGDA 2HL6A 2J08A 2NSJA 3IUJA 1KY3A 2OD7A 1CS4C 3EEBA 4NOLA 2GUWA 1K8QA 1Z6GA 2X4DA 5F2OA 3U40A 3UJ9A 1Z4NA 4BN4A 1KL7A 2EF1A 2H1WA 3G9UA 4RPHA 4PRKA 3TAHA 2GO1A 1SCNE 1JXOA 4NICA 4XSVA 2OC9A 3HMKA 4BN5A 3W06A 1ISHA 3N5CA 4G41A 4LJ4A 4QQNA 5FHRA 4ABTA 3GFPA 1J1IA 2QTBA 3A6DA 3EVGA 1QVRA 5FUBA 3BG5A 1ZAYA 1M6VA 1BX3A 1VKHA 2RH5A 3MVEA 4IKEA 3MWKA 5J1TB 4CIBA 2QLBA 3MINB 3U7QB 4R8MA 3GUCA 1NRIA 1RWMA 5GJWC 1KRHA 1A9YA 1D9ZA 4BX9A 2HFKA 1EJ0A 3PPVA 5J2UF 3TB6A 5JLJA 2X9QA 3HJAA 5T8KA 3AB8A 4DSZA 4BVLA 1V43A 2EL9A 3UV6A 3OAAD 3LCRA 3UMSA 1ENPA 4CUKA 3R75A 1N6KA 2P27A 3R3XA 4UC0A 4XM1A 1P2DA 4QUHA 1GL7A 2VUUA 2XCUA 2ZR7A 5AK4A 2BCJQ 3FTPA 4F4JA 5JH7A 3EWSA 2OC4A 3FCOA 2VHCA 2HWXA 1W0CA 3GUZA 1Q7RA 3MJHA 3PF8A 4RETA 5EPEA 3ZHBA 4B74A 1PDWA 4B80A 5GVSA 4J2TA 3HKBB 3BBLA 1RLMA 2Q5QA 3RRYA 1RM0A 1RRVA 3MTJA 4AF8A 3FLMA 1SD1A 1OXVA 1JEAA 3H6KA 4KV9A 4DG9A 1IRIA 1WLYA 3CN7A 3EIFA 2UXCB 3R5JA 4R81A 4C6TB 3G6KA 1QLWA 1I7QB 1E98A 5IBRA 5LQKA 2XVXA 5F5XA 2PRZA 3TVYA 1D2MA 4NZPA 1NMEA 3I09A 4A8JB 5IVKA 4BMYA 1CEYA 4BZXA 2QYHA 5HKKD 4Q4JA 4I50B 1KSFX 3ZIAD 4NTZA 4YRIA 2DBVO 4JVLA 4HWOA 4K5QA 3UO8B 1W96A 3D31A 2VF4X 3ZBPA 4C0JA 2NTVA 4KH1A 3BKXA 2JLCA 2OV1A 1DHTA 3FCEA 3H17A 3ENZA 1XCBA 4B71A 4K87A 1J2EA 3ZDFA 1ODSA 2BFAA 3NOVA 4X6LA 3HJCA 3PXBA 4IUCS 3GVCA 1MOSA 5JE8A 3CTPA 5T41A 1N0WA 1XEXA 3FB4A 4CMKA 5JS8A 1SD5A 3AEXA 5CBPA 5EJMA 2G0AA 4LMRA 2X42A 4TVSA 1GZVA 1YB2A 1QE3A 4KQKA 1SEPA 4F4DA 1N1MA 1KPIA 1Y82A 4RANA 3V4SA 1I3MA 3MRTA 3PK0A 2NW6A 3T9BA 4J7AA 1Y0BA 2FH5B 3EA0A 4ZQGA 5B58C 1DB3A 2ACKA 1NBAA 2RB4A 3UA4A 4EFLA 1CKEA 4CL2A 3FBTA 1F17A 2NSHA 1U8EA 3RAJA 4CR6A 1E7WA 1ZUNB 1HX7A 3KVYA 3RBXA 4IHJF 5KU1A 2MIIA 1NXTA 4BX2A 1Q1BA 3VZDA 3WQQA 4HWGA 1NPDA 4OHWA 1NVXQ 3GLUA 1NUAA 3HN6A 3RSLA 1QIMA 3SJZA 2GKGA 3OFSA 3P4UA 1EJ6A 5C34B 3N76A 4CM4B 1E3LA 2X0JA 4PYOA 5IANA 2G7ZA 1M75A 4CT4B 4PCAA 1JMVA 5B5SA 2NVOA 2YJNA 8ATCA 4EBBA 4C7JA 1WO8A 4IEEA 4ZCTA 3L4EA 5KSOA 1ATIA 5JVDF 2DHCA 3L6EA 1U8YA 3R0QA 1V3VA 2NU6A 2Z1NA 3PC2A 3AFGA 3H5AA 3ESRA 1R9JA 2H9YA 4GKVA 4QFDA 3TRIA 5IDVA 2NADA 3NHSA 2NUAB 4PYJA 5KBYA 2YJ6A 3NZEA 3GFVA 5J63A 5DULA 1PFUA 2FRDC 5JAZA 4HN4B 2NGRA 2ZSKA 4HX9A 2J3EA 5KJ1A 1JSZA 2NVWA 3IB6A 4P9NA 3GNQA 3GFRA 4DABA 4BCDA 2GK4A 3K73O 4UBLA 2BMDA 1A9SA 2IV3A 2VSXA 5AKKA 4EFDA 4L4YA 3EIWA 1QQTA 3P9PA 4RW0A 2VDOB 2R751 4CIYA 2OFXA 3JAKB 1RQ2A 2O1SA 3ND6A 4TV9A 4C1NA 1HE2A 1PGNA 2JW5A 1GQRA 3EXFB 5FRDA 1X0VA 2DR0A 4N5IX 2H1FA 2XQGA 5EA2A 2VSYA 1WNTA 2V8BA 3AV0B 1LS6A 1KMQA 4NSNA 3PC3A 4BQFA 2CVQA 4HLUA 3QKSA 1ZOLA 1OJLA 2I3BA 2F3PA 2WTNA 3PCRB 4OJTA 3H2BA 1YZLA 3DHNA 3NATA 2BJVA 1F0NA 4CYMA 2G9QA 3BWMA 1JHZA 4PX9A 3ZU5A 4LA4A 2YZNA 5CDHA 2QGNA 2ETXA 4HZGA 2N75A 3SSNA 4EUNA 5JYDA 3LP5A 1RKQA 1XTVA 1IYZA 1IEVA 1OYYA 3AHFA 4QDZA 3EHDA 3WADA 3H86A 2OHVA 4ILKA 1GUAA 5DM70 2JBAB 4DC1A 2F62A 4YAFA 1DPFA 1H85A 3JSAA 5CPFA 1L1FA 2R7AA 4KP7A 5ALEA 2ZJ7A 1LZLA 4DARA 2O8BB 4HCJA 4HXEB 3MN1A 5LPNA 3BMNB 4YAJA 1GOTA 3D0QA 2PMCA 3GA0A 1K2VN 4MR7B 1T4MA 2O0LA 2QJOA 2COKA 3VR5D 2G1JA 1IHOA 3I8XA 3RYCB 1E9RA 1DQRA 3HFGA 3G2OA 2IQIA 5GM1A 3Q2OA 2PA3A 4O2AF 5BQOA 3N0RA 4F8EA 1SURA 3EC2A 3IOMA 3GH3A 2IFTA 1TU3A 4ASUD 2FW6A 1Q77A 1WS6A 1X1TA 6AT1A 1RQRA 2X1MA 2MSNA 1G98A 1FSSA 1U1GA 2GZ3A 2F3TA 3PGVA 4WW0A 5AM0A 2Q9BA 4NU6A 4OHXA 2C54A 2QMZA 3PNBA 4DKXA 3R44A 2WAXA 1U2PA 1WCYA 2OFWA 2FSSA 4DT1A 1S7CA 4Y1RA 1E2EA 1Z4MA 3PIIA 4KWHA 4ONEA 4C07A 3X0DA 2O23A 4AG5A 5IF3A 3NQ41 4YJGB 1GPJA 4N48A 1B43A 4ZI5A 4DIUA 1UL1X 3WQRA 3NDPA 1KEEA 3Q5DA 4M22A 4DA0A 3FTNA 4ENRA 4QFMA 3E3AA 3G2JA 2MSWA 1SCKA 1PT5A 4U9IS 4D5GA 1VCIA 1HI9A 2O05A 1M76A 4C29A 1BCRA 1FUUA 3LAWA 3OJXA 5DB4A 1OI4A 2B2XA 3OUUA 3WMXA 4G09A 5IT9A 1SWWA 4MQEB 4EAAA 3KPJA 3S7ZA 1ORDA 2CV1A 5I4IA 1E3DA 1MAWA 1E2DA 1N8NA 2NM0A 3DV0B 1IPFA 3HZZA 3I1YA 3SK0A 4D79A 1R5NA 3BK7A 1RJ9B 1EUDA 3D3KA 1GQYA 1A97A 4GM1A 2QY6A 3SZLA 1VLHA 1Q11A 2WHEA 3L7KA 4JR0A 4NOMA 5A9RA 1X1EA 3A9TA 5DBIA 4YJ3B 4YI3A 2D7CA 3TZKA 1U2GC 3OESA 4DILA 2CE2X 4J0EA 4QU9A 1PKEA 1Q19A 3H8VA 4EW1A 4V1CI 4IV0A 1LW6E 1YAJA 3U9SA 4HJRA 5T6BA 3FUWA 4TPKA 4KJZA 2E4UA 2XNDD 1I2ZA 1PWYE 2N1MA 1ZQ9A 1ZGJA 3SHTA 4IH9A 3IPLA 2A1TS 2BSXA 3SSMA 5BQXA 2ZIVB 5JZMA 3VNVA 1ZSYA 2H1OA 1MPXA 1EBUA 2KQUA 2NAPA 2VT2A 3A70A 1LK5A 2YRWA 3BD8A 3IE1A 6PFKA 2P7IA 2XMCA 4O8ZA 4PCUA 4DV4B 5IBPA 1HT1E 5JZ9A 2D5IA 3U7IA 2ENUA 5B7QA 2WWGA 2XNJA 3OE7D 4OGLA 3WKDA 3T54A 2WM3A 5FTJA 1QYRA 1QPBA 4OP2A 5IYZB 3RUAA 1FSPA 3BIWA 2CHQA 1ZD5A 3DVSX 4NRDA 3QG1A 2VWQA 5E3JA 3BMOA 5ETJA 5AOBA 4BQQA 4DBLE 1TO2E 2QS9A 4FB4A 1UZLA 2GH1A 2POQX 3IQWA 4ML3A 3NV7A 5C5CA 1ZMBA 1DXYA 2H9AA 1J0XO 3CEMA 4IDCA 5GM2A 1A98A 3UH0A 3HBNA 3U6BA 3UICA 3KQVA 1VLLA 3EVBA 3FMVA 1ZP6A 4BX0A 1G8MA 2BT4A 1BROA 1E4OA 2Q5EA 3I2FA 4KGDA 4DNQA 2I4IA 1YNOA 3HJRA 4BO8A 1XTBA 3VNBA 1RPZA 4MPRA 3ZDBA 3KKLA 1Z5VA 1NRXA 1XQ6A 4C4AA 4FGLA 5LMUB 4CM9D 4PO9A 2TMKA 2BBOA 2NZWA 4IVNA 4X5OA 4BWFB 1R0RE 2MYPA 2Q2QA 1ADCA 2F9FA 2XT0A 3DKPA 2Q49A 3NEYA 4D41A 2ACEA 4GLFA 4DGQA 2IEAA 5FBHA 2HIMA 1H2FA 3F9CA 3G82C 3LH5A 3QJ5A 2JA1A 3A37A 1A8QA 4DBZA 1AURA 1PZNA 3TPFA 3W2GA 1J8VA 1QAQA 4BLTA 2NYRA 4XIJA 2D06A 2LE0A 1LLCA 2I34A 1IBRA 1V71A 2WMNB 3RK1A 3RKSA 1M10A 2B94A 6LDHA 5GV7A 1O96B 4E3ZA 1YUBA 4G89A 1WY5A 3K0HA 3C1AA 2ZT7A 3SXPA 3M70A 5DGIA 4H7HA 3DUWA 4YJ2B 3HHPA 2WSSA 4NCHA 4RNCA 4D0NA 5B12A 3LDHA 4FBGA 3GJ3A 4GM4A 4PZPA 4CTKA 3WBBA 1DAGA 2BEWA 1M5RA 3QWFA 1I2DA 2PH5A 5DLQC 4DSTA 1L3BA 1PR2A 2FG7C 1XTRA 1FJXA 5JIBA 3MWEA 3ND9A 5KTMA 5D3QA 2KM1A 5KAPA 2BONA 2WA1A 1FXWA 1MO6A 1GRRA 1V8ZA 1FXUA 4EY3A 3ESCA 4Q3EA 3REQB 3V9PA 3PE4A 3ECSA 4S3MA 3W6ZA 4C3UA 1Q92A 1VG8A 5ESXA 1VE3A 3RVPA 2LW7A 2PS3A 3HCNA 3ZYZA 3EQ6A 3S40A 3GGCA 1KAEA 3IERA 3MOGA 2WFZA 4NJMB 3TNDA 3B5IA 2FAXA 3HVHA 3O3MB 1O54A 1GT6A 3QVXA 2NTEA 1RAIA 2RGNC 4KKXB 3JALB 3BE5A 3MXOA 4JGIA 4NAHA 5KVAA 2CYAA 2Z43A 3RC2A 3BTSA 2EW8A 4P4LA 4OI0A 1DIBA 4DRYA 3U3XA 4TKLA 4JDPA 2EZUA 2AYZA 2BFCB 2BJHA 2VG8A 2C8VA 4Q18A 1Q1ZA 3DQQA 4JLSA 2CVZA 2G04A 3OURA 4HDCA 1GDHA 2KWIA 2OOKA 1ZO8A 4JJGA 2PZGA 3OT5A 2J5XA 4PLTA 2IYYA 4MNTA 1KYQA 4J75A 4W99A 1J24A 4BO4A 1CUZA 3QBDA 4EUKA 1C9KA 1TT5B 4EHDA 3R9WA 1NRJB 3AK4A 4EJ6A 1U2DA 2HREA 4FNOA 2A5JA 4MITA 1P9RA 1UQUA 4RPJA 1P4RA 2GB4A 4YWHA 3HA3A 1V7CA 5A4FS 3L7YA 2ZIXA 1USWA 1P0IA 4G0QA 5BWMA 1N8KA 2JIMA 1NMQA 1HFKA 3EBOA 3LYUA 4JA2A 1IHDA 5H80A 4J0QA 4X6YA 1X2EA 1CQWA 3KTAA 5D3MA 3WNDA 4B48A 2BBWA 1GCUA 1PJZA 2CJPA 1TA4A 3VHLB 3VR4H 2BZ0A 4TLDA 1N2CE 5HRUA 3AF2A 3S8YA 1IHYA 2EARA 3D2LA 4GR9A 3BGDA 4LZZA 4PG5A 5T67A 3IV6A 1YRLA 3EDMA 4FR2A 4MEAA 4RWEA 2FZGA 2H06A 2IHVA 4B9AA 4ZOBA 1JKJA 1W19A 1NBMD 1Z88A 2J5RA 2BRUC 2Y1LA 1FIUA 5LBTA 2X0RA 2YWBA 4YT2A 4R7TA 3WE7A 5CFMA 5FAKA 2Q6OA 4RCVA 4WFJA 2C7OA 1O5OA 2GM4A 4C6RA 2KLBA 2YDXA 4YMTA 2FQQA 2VJMB 5T5QA 2ZANA 1UC8A 1YXMA 5DT2A 3I64A 3O7WA 1CFJA 3UHOA 3GEEA 5I8PA 1CXZA 2BFOA 2FPSA 4NH4A 4E4YA 1SVNA 3NAGA 4YUAA 4ND1A 3DSRA 4ER6A 4WBNB 3AIKA 4CE6A 2ODNA 1QQ6A 1XDZA 1YZKA 2VQSA 2ZTSA 3FMIA 5CVDA 5AR1A 2Z4TA 1PS9A 1I7LA 4JJAA 4PQGA 5CX1B 4B4UA 4CIXA 1B4DA 4Y2TA 4CKYA 3M2PA 1KYXA 1MHPA 2NNWB 3A9RA 3O9MA 4CV3A 5JATA 1EFAA 1ZISA 3NRCA 3ZWWA 1ZIXA 1NULA 4RF5A 5ALGA 1ITZA 4QUKA 2PBRA 4AUKA 2FHPA 2Z1DA 3C3JA 2O19A 1QBKC 2OK8A 1NGSA 1XZGA 4KWCA 4KMOA 3P8ZA 2JKYA 2JAHA 4MYHA 4CL3A 2HWKA 4HB3A 6GPBA 1GUYA 2G06A 5FTWA 3RSOA 3USCS 1H0SA 1MCZA 1M2OA 1USKA 4W1PA 4ZOQI 2ECPA 1R8QA 2OB1A 1CRZA 2CWDA 4XDZA 5I5GA 4B6OA 1VL0A 3CT6A 4HWTA 1IIRA 4FSHA 4I5GA 1QHGA 2VAWA 5K1ZA 4FTWA 4Q48A 3UGQA 1CP3A 3C6XA 4FK8A 4EH1A 3EUWA 2PT9A 2RGYA 4DQUA 2C96A 2YS6A 3BD9A 1JG4A 3CUYA 1W88B 3F3YA 3HQ4O 1NKSA 4ZU3A 3WWZA 4ZMSA 3ILYA 5CIYA 1PL6A 5EYPA 3PCXA 1XWFA 4MTLA 4C43A 4CF5A 3T1TA 5ES4B 1CLUA 1CU1A 3BS4A 2PUDA 4TVOA 4ARCA 4B35A 3K2EA 4DIKA 1UOPA 4O3FA 3VKWA 4W9NA 1GL3A 3PPXA 4R54A 2XYVA 3T7EA 1RXSA 4HMPA 2EV9A 1TRKA 2AQHA 4JI2B 4EL5A 3TLXA 2CHUA 2GXQA 1C0IA 4KYTA 1A9PA 1EGAA 5DM4A 1NRWA 2UVQA 1ILEA 2FWMX 1DTWB 1FVFA 2I8LA 2BH2A 1OF1A 3QV2A 2W5UA 3HFJA 3PUZA 3GCDA 4X7BA 1T1EA 2QTTA 3GCZA 3EOAI 1KSGA 2PL5A 3IMGA 1HDCA 3IVRA 4E5PA 2PVSA 2WZQA 4KFRA 1PEKE 4L95C 5H9VA 5T6MA 1OR8A 1OD6A 2JI8A 3MWDB 4EIWA 2JLUA 2BM1A 2Q4TA 3G13A 4PF1A 1VCHA 2HQSA 1R5OA 3W5UA 1CUDA 1XRRA 2B92A 4AYTA 3KJFA 5AM2A 1KERA 1GAQA 2QNBA 5HZGA 5KDOA 3TLEA 4BPRA 3CLRD 2G5PA 3HUUA 1L5RA 3QI2A 4RGVA 1J49A 1P0CA 3RK4A 3UXMA 4D4MA 5FULA 4E2ZA 1NI4B 5CA1F 4EHFA 4QPNA 2V55B 2VH5R 3B3AA 1CJVC 13PKA 2FTKE 2GPSA 3IIMA 2CXRA 3DT6A 4HK4A 4YFYA 4F06A 1VMAA 2Q5LA 2NZXA 1C7QA 1XG5A 2HF9A 4ARSA 3PEEA 4WKCA 3N2IA 1IBMB 2PXHA 4ZO6A 1DJNA 3IAS1 3MTEA 2A35A 1RU3A 4H08A 1RQXA 5DGDA 1I5OA 2Q1WA 1N7JA 1T2NA 1WJGA 2I7DA 3OTIA 5CFOA 2JCSA 1GRVA 1XZFA 2NQTA 2X9LA 4BC1A 3RYHA 4A4DA 2WWYA 4FJ1A 1T8UA 2YIDA 3PR2B 2NZVG 3I0NA 4L8VA 2WIFA 3CLTD 5C3UA 3RIXA 2YWRA 5DCUA 4CLOA 7AT1A 3L6BA 5TMBA 2VHUA 3MMSA 1KI6A 4PFKA 4W7IA 2B99A 4FYKA 4QUDA 4BRSA 1YUMA 3D59A 5HIMA 4JDUA 4LQLA 2NWQA 3ZWPA 2DWPA 2OFPA 1XD9A 3MJDA 5I01A 1MVLA 4YV7A 3PLAE 1KXZA 3QYPA 5ESDA 4W5OA 1P29A 2YBDA 2QU8A 2NACA 1MPTA 4FMDF 1QR6A 4N3BA 1XQYA 4Y1GA 5F33A 4M9CA 3BULA 2ISSD 3ZWKA 5HR5A 2P0EA 3C97A 4QL3A 1V5GA 1T0IA 2JPDA 4LGCA 4QYIA 4KNWA 2W2XA 2GRJA 3JQCA 1MJHA 4WLFA 4KEAA 1WDWB 1Z0FA 2J9ZB 4F93B 5JXGA 4IIGA 1ZCZA 4S2UA 4BLSA 1N3BA 1GPBA 2WZBA 2X5JO 5AFSA 3OQIA 1WCWA 1KBQA 4KBGA 1VCNA 3RJTA 3MPUA 1FDUA 3GEGA 2J0QA 3N0VA 4BRWA 1JQ3A 3NC0C 2ZYDA 1UP7A 4B2LA 4M6WB 2Q5IA 2QP4A 3SQNA 3H0KA 4EHAA 2PGNA 5HKKA 1OA0A 1FFDA 1FW6A 4IINA 1SRRA 2R66A 1VJ1A 3PITA 3ZIAA 2BGRA 3IA7A 1ODTC 4FDAA 4MRSA 4DM7A 4JC8A 2IK8A 1N0UA 3NBFA 4IICA 3O3OB 1MN6A 4F5ZA 2COUA 2UV8A 1CWUA 5IP5A 3DNMA 1L7MA 1TK9A 3A31A 2ZBPA 3NOOA 4U0KA 2XOXA 3GDHA 2B5OA 1Q1AA 3AINA 5ALTA 2IPNA 3OJ0A 3ADBA 1NT4A 1MFPA 4Q9IA 1U3GA 2P5UA 4BNDA 4H4DA 1OH6A 3LKZA 3HEMA 1P1FA 3Q6IA 3ZU3A 4DSNA 2LCFA 4KSCA 3OIDA 3SYRA 1VDMA 3KJIA 3O7MA 4ATNA 2AFHA 1X1QA 4AKGA 1HXHA 2F7SA 2SBTA 1ZIOA 2Z58A 1X0XA 3RR2A 4QODA 4QLAA 1KIAA 5CBPB 3TL3A 1QSGA 3QTLA 5F73A 4NJEB 2OBFA 3IUYA 2HHLA 3WJ7A 3SYLA 3P19A 3I32A 3S1SA 1IVYA 3V4FA 4N1AA 1I80A 3VPGA 3ESXA 4OI2A 3HVUA 2XQIA 1CBUA 1XLVA 4JBNA 4BNJA 2PIAA 4QJ3A 4BFTA 4JXXA 2HYDA 4QTTB 1LWNA 1EVYA 4MGKR 4CEJB 2H00A 2JASA 5LP6F 2PX8A 2ODEA 4ECEA 1RBYA 4ND2A 1Y5MA 3C3BA 3W4KA 2BISA 3LX6A 3ENNA 4BNXA 4U8HA 3HP7A 3TCXB 5I9NA 2IOYA 4W7SA 4BFLA 4A15A 1C3OA 2ZBVA 3H97A 3TW4A 5JTUA 2XYGA 3QZUA 3CVJA 1J97A 4CKWA 1EMDA 2RAFA 3MC1A 3HB7A 1UP4A 1T2FA 4QOSA 4R1LA 5EJIA 4GOMD 5ALZA 1DWQA 2D8AA 4EFNA 3CVUA 3FWNA 3HSSA 3ROEA 4EZEA 1CUGA 2GCOB 1COWD 3T1OA 1ZK1A 4AURA 2P9FA 4CGZA 1YT5A 4RA6B 1J5PA 4UNIA 1SVKA 1PUXA 2FUKA 4L8FA 2P8SA 1AJEA 3OA2A 3K4PA 4CFZA 4CTNA 1AHPA 1I3CA 2G4CA 3EZ6A 5A03A 5KNDD 1M1ZA 4O3MA 3BD6A 3GPLA 4FKZA 4D5EA 4DIEA 4B4DA 5EWJA 1ZIYA 4G5XA 2YY6A 3EY4A 4INOA 4BZZA 4V3BA 1AKQA 3BMQA 3NJRA 5K3EA 3QOXA 2ORYA 5EIAA 2A9VA 2HU2A 3IC5A 5DISB 4EEZA 2HWYA 4Q19A 3A4NA 4MAMA 4L4UA 2P6RA 4EGQA 1OC2A 4WESA 5M2QA 1DU4A 1YGPA 1RKBA 3VVCA 1A71A 4S1OA 5EIOA 3WHKA 4FFOA 3WSWA 2XRZA 2I99A 4M1SA 3O82A 3OKAA 4X66B 5DGTA 1NVBA 3RSGA 3EVTA 3WK4A 2YMPA 3R5FA 3UXHA 3CKLA 3REOA 3P2JA 2D4AA 1J99A 3DV9A 1VCOA 2DSTA 2OLKA 4MUNA 4DC0A 2HQOA 2CK3A 2NUPA 2A33A 3PRYA 9LDBA 3ZDEA 3UFBA 4BRZA 3L1UA 4O4JB 3CGWA 5JCPA 4HXGA 4BMZA 1Q6YA 1UC4B 1Y33E 3ANTA 3FPCA 4K0RA 4CCSA 2FP3A 3M49A 4OY3A 4BP1A 3VR5A 3KAQA 1MA0A 1KO1A 1R0LA 3HWRA 3THXB 5DI9A 1PX2A 3ETLA 3BZBA 2GVDC 4OGGA 3VR6A 5IM4F 3AIIA 5HNKA 2R44A 3A6PC 2Z1MA 3OPYA 4JROA 1SB8A 4O4LA 4J1NA 3R24A 1N5JA 1TO6A 3FNEA 2PQ0A 1N5DA 4TV8A 4UOQA 4BNUA 4BUJA 1GIAA 4F6CA 4M3NA 2EBWA 3QW4B 3GJ6A 4BKQA 4RK0A 2XOKA 2YVAA 3NETA 2C9CA 3WMGA 1RYHA 2YBEA 1MEOA 1NE7A 5F3DA 3BFJA 4KVZA 2ZUVA 2RHOA 1Z56C 1K86A 3WJ1A 1L7EA 3R5KA 4EMUA 1IMOA 3ISJA 5IN4A 2C5SA 1ZOOA 3UATA 4JI4B 1E5DA 1CQIB 1YASA 4US2R 3DEIA 2OV4A 5BSVA 1R6DA 4CG2A 2XAAA 4AF7A 1ZPDA 3EXEA 3QLUC 1NDUA 3H8SA 4GOLD 5C8YA 4UTNA 3U37A 1P1CA 5EXTA 4N8DA 2WOOA 3PEYA 2ZLBA 1Z2AA 2IPLA 4L5JA 4J9VA 3U17A 4LZJA 2HLDA 2RMKA 1D7OA 1DL5A 5J58A 1U0GA 1UUFA 2EW1A 4XIFA 2IYTA 2ZBRA 4BASA 4YCJA 4IDFA 4YCSA 1JEQA 2DT8A 5K8LA 4P4NA 2CV2A 3LY9A 3E9MA 3SC4A 4EUSA 5LZ9A 1BD3A 3RFTA 3DZCA 4AJ1A 4JBYA 3RFVA 1T6XA 2DJIA 4B3GA 4FDMA 4K6OA 4PX5A 1OWNA 1UKBA 2QTVA 4HRYA 4E46A 1VHLA 3AKEA 2YWFA 4QDOA 3SBOA 4XD2A 1JDSA 4F85A 2C4NA 1GD1O 4WN9A 4YRTA 1V96A 2Q0XA 1W5FA 1OZ0A 4OHFA 4XFKA 2PUWA 3G2PA 3GI1A 4Q4LA 4P36A 3CW2A 4YYZA 3ZDQA 1F1BA 3KE8A 3KOYA 4RL4A 3NVAA 1SK9A 4EMSA 2ERCA 3EZYA 3T1QA 2BHNA 3U1TA 3WLOA 4E51A 4GQAA 5AK6A 4O5AA 4EKDA 2VCEA 3OFKA 3SHWA 4A0HA 5J40A 1AVTA 5BSGA 4DDMA 2ODPA 1KO5A 3FI0A 1NNLA 1V2HE 4PBTA 5I45A 1EIZA 3ZE2B 3AI1A 3B12A 3JD4A 4P92A 1HLGA 3VYRB 1Q7BA 4P0PB 1RJGA 3LG2A 3SNKA 3NR2A 1R00A 4JHXA 2J6HA 4B4KA 4LC9A 4CKCB 2A7QA 4RMJA 1BWRA 1UKYA 2A5YB 3DDSA 3JD1A 2YZ2A 3R41A 1N9ZA 2X2EA 3OE7A 1WD5A 3Q3IA 5COBA 1ZY2A 3VZPA 4HMQA 3EQZA 3NP7A 3UF0A 4TMTA 1WQ1R 4OO3A 3TKAA 3EXIA 3Q9SA 3WLEA 4B79A 3DC2A 1Q12A 4EPRA 2WYIA 3JQ6A 1D4FA 3NWEA 4WV3A 4UNSA 5CRIA 1HLFA 3DJYA 3LT0A 3PU6A 5BXYA 4HC4A 2L17A 4IIXA 5C5EA 4BXOB 4EG5A 4JLAA 1PAUA 2DH5A 1F2TB 2QG4A 2CLEB 2SECE 4K1LA 3MTDA 1ZIDA 1B2RA 2B37A 2NVUB 1ST3A 3W7VA 1EP3B 3OQPA 1W1UA 4KMRA 3TRJA 4M8IA 1EVIA 1LVUA 4LYAA 5EY5B 2FEMA 3EYWA 3HFSA 1UZMA 3C43A 3LNCA 3HBFA 3VNRA 2P0YA 2AEMA 2GPJA 4IDAA 4EHNA 4P98A 5LWHA 3GDOA 1YE5A 3C4QA 1SZDA 2YMQA 1J33A 3V00A 4HGNA 3ZJYA 3OKCA 4W1RA 1NQVA 3T38A 1W0KD 2OXFA 2GETA 1NHWA 3ILVA 3MAJA 4J2OA 1JJFA 5GY7A 4DAEA 3BC1A 5EXEA 2RSLA 3ZCQA 2ZRLA 1M72A 4Q7MB 5K8TA 3GO4A 1JMKC 2IIQA 3DAHA 3AV3A 1KU0A 3IV9A 2I55A 1YVRA 1BIFA 2QMQA 3JATA 1P3DA 3O1LA 3ZJ5A 2IS4A 3JPYA 1ZI8A 4R8KA 1PTJC 3WTBA 2PKQO 5I3CA 1T9GS 4OHPA 2EJCA 2KBEA 4PIMA 3D7MA 5J9FA 1E63A 2HNAA 4N54A 3GRRA 1VI2A 4LRUA 4CKBA 1KDPA 1ES9A 1OBFO 6NULA 4UW9A 4H59A 5BV2P 4OJYA 2Q8PA 3CNLA 4KIJA 1W75A 1WUJS 3FFBA 3GARA 3RTGA 2NSDA 4B33A 4EJ0A 1M0TA 3IP8A 4OAPA 2WSLA 5E6RB 1HNWB 5TARA 4ZAZA 5CCEA 2LCIA 3NDBB 5DYIA 9ATCA 1A77A 3F73A 4EJSB 2ZJ3A 2IS1A 1O7JA 3IHWA 2BM8A 1NY6A 2QQGA 3CVWA 3LIPA 3S5JA 1GXSA 1UKEA 4DCJA 5KYXA 3VJRA 2OR3A 2B9EA 2ZKLA 2YXDA 2G8NA 3E9RA 4O1IA 1KDTA 2QWXA 3BWYA 3ZY6A 1XVVA 2HJ9A 4REQB 2WDZA 3U7EB 1EQUA 3GVPA 4JLMA 1FYEA 1YTLA 1M1NB 2XMRA 5E9AA 3JARB 5B7PA 4KVAA 1V95A 3VH1A 1VFPA 1F8FA 2ZE7A 4O8CA 4HH0A 5JWRA 2BMWA 5DNCA 1H4VB 4BNFA 1W87A 1ZDMA 5L6LB 1SXJD 3TSZA 5I7VA 1SUEA 1ILWA 3EVNA 4GUDA 4LUCA 4XVCA 4Y7CA 3T7AA 4FE4A 3BXPA 4BCBA 2A5LA 2I7TA 2FN9A 3LL4A 3SFTA 4FGKA 2G83A 1E3QA 4KX5A 3GCWA 1MRZA 4B2IA 3KVNA 2Y2UA 3AU8A 2R00A 2RHWA 3UYLA 3ZK9A 1BS1A 2AQ8A 1T0PA 2VP9A 4G5SA 4IOMA 2PGIA 2UAGA 3W1VA 4YMHA 2EEZA 2A5FA 4ROSA 1B42A 4EJ2A 2VR1A 2HA4A 3RVQA 2ZVQX 3LBNA 2OQ2A 2HCTA 3AQIA 2XXAA 2IYUA 4RFVA 1K08A 3KT0A 1N9GB 2EG5A 1ICIA 2V9ZA 2J59A 1M1YB 2MMGA 3OQHA 2EYUA 3II6X 4WE3A 1Q21A 5CTJA 1GTZA 4DWVA 1KMIY 1Q3KA 4B40A 3DEKA 4U2BA 1E96A 1Z34A 3AI7A 3TZCA 4ZDIA 2R84A 5COAA 1YZTA 4DMRA 4L76A 4EATA 4LOAA 4EYOA 1FX0B 3I9KA 1P2FA 4EZBA 3MPOA 1C1XB 4KQ9A 3VTFA 4DQKA 1QZZA 4FLMA 1NC3A 3HMQA 4ALNA 1DKRA 1L5QA 3Q5GA 4FT4A 4X44A 2Z2JA 3SKYA 2PUBA 4QFBA 3RUPA 2G40A 7MDHA 1DBVO 1IWPB 3E53A 5LSAA 2Q6IA 2E55A 1SQ6A 5BQ3A 3U4CA 5JFGA 2CDAA 3FPSA 3DLIA 5IAEA 3ZBQA 1RSZA 3LU1A 4MKIA 4E15A 1FMTA 2C07A 2OB2A 4U02A 1TQ2A 4WNAA 4GOKA 1VSBA 2NU7B 3O2SB 3QHAA 4B3CA 2IH5A 1TJ3A 2ETVA 4DA7A 2OHFA 1XNRB 1T8YA 4C3ZA 3ONEA 4BZPA 2FFHA 3FOFC 3CX7A 2XW6A 3CUTA 2MSKA 1BWQA 4KR2A 4GEKA 1TAUA 4HDSA 3L49A 3TZHA 1S8OA 2NO1A 4XQ9A 1R18A 3RRJA 2W6JD 3E1GA 3R4VA 3BJIC 1BGXT 1EGMB 4L78A 3T1YB 2EFJA 4ZCSA 5K0JA 1CSEE 4UHFA 3DE1X 1RTKA 2XVAA 5FAXA 1MG5A 1VZ3A 2ID4A 3FFXA 2ZIWB 3GAAA 4L3VA 4R2JA 4S35A 4C89A 3JTEA 3TECE 4DB4A 2PGXA 2B8EA 5K0TA 2CLSA 2O7QA 3F78A 2QP3A 4ZVVA 2NMVA 3IKJA 3T7KA 3DF7A 5FD8A 4KPEC 3FLBA 1WOYA 3E22B 2WU3A 1P3JA 5F1YA 4ZCPA 3TTXA 3O3CA 1OKKD 4BKPA 1E1CB 2RC6A 3EWAA 3HY3A 4Q1DA 4QG3A 2PGLA 4NNJA 4CTJA 2X8LA 1BU8A 2HA3A 2J7PA 5TVGA 3VJKA 1G8GA 2XBUA 1VYHA 2W2LD 3AEKB 5J2UB 3BB1A 1QZTA 4Y9SA 3SOZA 5KCZA 1NVAA 2YWXA 4BFCA 1GNPA 3A14A 3ONDA 5LQJA 5ED4A 1AZWA 4ANFA 1KMHA 5G2OA 2BI4A 3DOOA 3PXDA 2EP5A 3O8LA 4JLVA 3NHAA 5J5VA 3ZI0A 1B23P 4LOLA 2ECFA 1E3JA 1OLXA 1TK3A 2WIDA 2YH2A 2ZS9A 2JBHA 3DMPA 1R4MA 1TW2A 3JZAA 4NBTA 4DLYA 2B36A 2HPAA 4E5NA 1M2FA 4OTZA 2C95A 1XHFA 2CF5A 4C2AA 4EO7A 2WM2A 3LFUA 1L5OA 4PG4A 1E66A 5CT9A 1RP1A 3H8WA 1RCUA 3CF2A 2UVPB 3E35A 3C48A 3CKMA 4I0WB 4NDNE 2HMUA 5BSFA 2G82A 3SIXA 2RONA 4MQBA 4D3DA 3C98A 4KFSA 2ASVA 1AS2A 2FPPA 3RIGA 3ASYA 4OU4A 4IP0A 4GGMX 5JDIC 1J20A 5KTYA 1PV4A 4G0VA 3TW0A 4DWOA 2IF2A 4MEJA 3ZWNA 1SKYE 2IYAA 1JN0A 3CQ9A 4XOIA 5C4GB 1OU4A 3EIEA 3U62A 4Q02A 3KSMA 4XPIB 2DAPA 3ZDRA 2RIRA 5AKEA 4GM0A 3HKDA 4L5IA 4UUAA 3ROKA 4CL0A 3H84A 1WCV1 1TU0A 4CV0A 1L5ZA 4TYYA 2JLWA 1SQ5A 3LM8A 5JCOA 5INTA 1U1DA 1F8UA 1II8B 2E2WA 5LZ5A 2IOHA 3UM9A 3ZTWA 4IOLA 3O2JA 4XJXA 3KBOA 3PUHA 4ZT3A 3NTVA 2J5QA 3VSEA 4C03A 2V03A 1JDZA 4IXDA 3PQ4A 4ESOA 1HSOA 3RBVA 1K7EB 2Y1XA 5ALRA 5K8JB 1T24A 3W8FA 1LBSA 2OGWA 3INRA 4YJKA 5SZIA 3RHSA 5JROA 1IRXA 1E9CA 1NXSA 2WA2A 4FX2A 3A4VA 4P5PA 4Q16A 5I8WA 3KLOA 2XNCA 1GN8A 5LYJB 4L28A 2QW8A 2VDQB 3K8ZA 2B6NA 4UCQA 2YXPX 1RMQA 3DO8A 3Q4GA 4LRQA 1HZZA 3G7SA 1K5PA 1Y63A 2W6NA 1XZCA 4PRZA 3DVQX 3QOYA 1JLMA 2MINA 2NZJA 2YXNA 4Y0AA 1ORTA 1PWEA 2J48A 1IN7A 1NP6A 2JFUA 2XE7A 5H68A 4BMSA 5DSTA 4DXHA 5JT1A 5KYGA 3EAGA 4FWTA 2AOVA 2GHQA 5AYVA 3B7GA 4LSMA 4GICA 4QKQA 4PW0A 5ERXA 5M29A 1BH2A 2HRDA 1QBGA 1V16A 4LK3A 4DSOA 1HE8B 1RE0A 1A7KA 1XXHB 1HYQA 2Q6KA 2YUTA 3ERCA 1N1DA 1FNDA 3DTYA 1JTEA 3DUFB 4GEGA 4JS0A 3URMA 3GRKA 5FOVA 5L3VA 1PJ3A 4AK9A 3E3OA 1G20A 4UVIA 3T1HB 1E2MA 3Q7TA 1RPNA 4M36A 5FLEX 1JILA 2MCFA 3AVYA 4NY1A 4WN3A 1I10A 2NPFA 3FGZA 5B3KA 4B84A 5CPBA 3O9VA 2VDWB 2O5EA 5IWCA 1M3SA 4DCGA 3CKKA 3IE0A 3DMNA 4BWVA 4D9NA 4JLWA 1MRNA 2CY0A 3G2IA 4Q66C 5CH5A 4CFYA 2OCXA 2F1RA 4MS3A 3AVVA 3AM4A 3PGA1 4HWKA 2C7RA 1ZLYA 4EUHA 5LB2A 4JEMA 4JVNA 3T8YA 4TKMA 1VJ0A 3SPXA 2DPYA 1SIWA 1W47A 1BKSB 3P2MA 4TZKA 2C59A 4M60A 5HK8A 2FGKA 5DTEA 1JHQA 4RACA 1Z7GA 1TNDA 2OK7A 4MPPA 2QM8A 5LBUA 1DINA 3ITDA 5CB0A 4MS1A 3U6KA 1U7TA 4DN6A 5DHUA 2W6ZA 1OY1A 2QGZA 3CZRA 4GPTA 3HL4A 4B2YA 4AWBA 3G5AA 4XSHA 4ARAA 5JJBA 5C18A 5C51B 4ZT4A 3NHYA 4E31A 1CUYA 4IDOA 1AT1A 3USZA 3AETA 1QO9A 2G80A 3D7NA 4O25A 3SEZA 3QVWA 4R9VA 5IM4A 3KB6A 5LQSA 4JVSB 5ITWA 1E58A 3HYCA 2YWCA 3AI2A 2TECE 4KQMA 1QP8A 5CTAA 2C84A 3U1BA 1T9ZA 4D0SA 5DGHA 5AI9A 4D4LA 4EGSA 4KC0A 4QECA 1T13A 2SICE 4PFQA 5A2GA 3PSHA 3BXEA 3WZ2A 2DCMA 3TZQA 3I4LA 2GTIA 2RK4A 5F78A 3TCKA 1VGVA 2FQ1A 4F2GA 2P5SA 3BGIA 2RBKA 3RS2A 4C0QC 4OXYA 3VDXA 5A5FA 4KWTA 4HAVA 2XY4A 4BGUA 3BEDA 1HETA 3FB1A 4JBLA 3AYZB 2FEWB 1JQBA 2Z2KA 2C9BA 3T7IA 2C4MA 1S7GA 1UADA 4Q4DA 5DDIP 4QXQA 5KX5A 1QHSA 4J2HA 1LF0A 4MHTA 2ADOA 2GN8A 4YMWA 4EFKA 3CIOA 5MN6A 3U7HB 4L0DA 5GZ1A 1SC4A 2LNDA 2OT3B 4Q3CA 4O2AB 3VOSA 1UMDA 1LWOA 1OFUA 4DCNA 4ZI2A 3KEOA 2O5CA 3LRXA 1Z8NA 4C7MA 4QNNA 5WRFA 2XRMA 5E9JA 1DT3A 4Z3DA 3U4QA 2VF2A 3V4RA 1GPH1 4WXPA 4WL0A 1BQ4A 2ATIA 4J0HA 1RCFA 4HGPA 3VHXB 5IZCC 5BURA 5B36A 4JH0A 4MGZR 3RC7A 1LRKA 1AKEA 2ZQYA 4C6SA 4UU0A 4AKHA 3JQAB 5LB4A 5EJ9A 3TJZA 1FZTA 3PB3A 4LJLA 4NNOA 4WAUA 1COWA 1H3FA 4NVRA 2V0NA 5AXCA 5ALDA 3LXUX 4ZV4A 4W8GA 3KZOA 1JYSA 1VKZA 2P1RA 5IDQA 2VI5A 4NNPA 1QH1B 2BI7A 3PNPA 2XDWA 1W6UA 5KNDA 3L4KA 4V3CA 1F2UB 2V59A 2X14A 2Y92A 4PLPA 5IW8A 4DE5A 5DGCA 4F92B 2JGKA 2L42A 1EQ2A 1RC8A 4GHWA 5I4BA 3OIWA 4RF4A 4ZGBA 1GKLA 5TXGA 1TCAA 2DFLA 5A3RA 2I7XA 2VEDA 4IGFA 3ER8A 3KR1A 4J8PA 5LR6A 1JSCA 1Z2EA 2H0QA 2I6UA 3ROZA 4EJSC 4KRYA 4WZZA 5DX0A 5LP1A 3GLFB 2RH8A 5CDSA 1RLOA 2WHXA 5HGXA 3WGKA 2AJLI 2R1TA 1R9MA 3ITEA 2IZ7A 5CVCA 5JVDA 3RWOA 1JX6A 3MMZA 4PE5B 2DUWA 3AFHA 4RLQA 3ANLA 2W2PA 4NBRA 3QF7A 1DKLA 4Z7NB 1JEYA 3IJRA 4H3VA 5L7YA 3W5CA 4G07A 5E7MA 3O8BA 3MLBA 5FBQB 2P3LA 1ADBA 1HH4A 1QIHA 2AG8A 4XM0A 3LRPA 4ZU1X 1VL8A 2GCNA 1E9EA 2YC2C 3I58A 5DN6D 1PQUA 4QEZA 1DTEA 3TYXA 5LNK1 1N4DA 4XGRA 1QFMA 3S99A 4L4ZA 3DZHA 1IXSB 4E5VA 3QLVA 3HH8A 2BWJA 4GXNA 3UK2A 4CQJA 2FWAA 4BKUA 1BN6A 2W11A 5IC5A 3U3JA 3HJNA 2NO7A 4K81B 1TUEA 4FFRA 1RMYA 3GFTA 1CS0A 1HQKA 1RRGA 1VCMA 2Y71A 3AL2A 1FYXA 1OAOA 3ECAA 2HMSA 3D7KA 1SVOA 5I7RA 3DYBA 1DAMA 1PQWA 2XT9A 5JU6A 2H4JA 4ND6A 4UUNA 4EF4A 3U0VA 2IYNA 3RH0A 3FKQA 4H3KB 2RFLA 4DA4A 1QHYA 2WZDA 1UEJA 2BGKA 3PNVA 4AL4A 4ETMA 5EP1A 3AR3A 4HADA 3L6CA 3RVRA 2JAQA 2JJ8A 4PLYA 2PL1A 2FPIB 4DV6B 1MO5A 2C92A 1TVKB 1BWPA 2VUSA 3MTGA 1Z4IA 1EWRA 1WPGA 3O8OB 2HRRA 4LY9A 5DVZA 3RKRA 3VOBA 2X41A 1LDEA 1ZGCA 2YDYA 1NT2A 5EWMA 2W93A 4E7OA 3M0EA 1W5TA 1S02A 1G8KA 4DYDA 2VNJA 3FZEA 3FCSB 4ARZB 4FI3C 3L7LA 5A9SB 3HL0A 2BGIA 3R9KA 4QJIA 3HUEA 3QXSA 4RK5A 2CLDX 3JQGB 2QRGA 1YSCA 2HEIA 2CMKA 4PO1A 1Z25A 4MWOA 1DQPA 1C80A 4RGQA 1EHCA 1YWGO 3IQXA 5G4KB 3N5KA 2AXQA 2VJDA 4YRNA 1ESZA 1WX1A 4US0R 3TTUA 3FTQA 5B3LA 3NEAA 4C2TA 3UJHA 1W6RA 4LFAB 4M99A 4NU5A 1YR2A 3CLTC 3UKOA 4X8MA 3HU5A 3I6BA 3S4YA 3SLKA 2Z6QA 2JI4A 3ZUPA 2DWCA 3OA0A 3D6TB 3IAAA 4YP1A 2I4TA 3SIPA 4A10A 4ZAVA 1I6WA 1EFTA 3UBMA 3GPDG 5BRNA 5HKOA 1REQA 3DL0A 2I3DA 2VQ6A 4R2XA 2WILA 1MW8X 4J49A 2K6GA 3GJ4A 3H5IA 2G71A 2PZBA 5F1KA 3ZI7A 2JIDA 2SKEA 2ZWAA 2EZ9A 1JLLA 1ZUIA 2P6PA 2R8PA 3D0RA 3HBLA 4O08A 4F1KA 1STOA 3JY6A 4GIBA 3UT6A 4BNKA 5IKPA 1DAHA 2XDQA 3J7TA 1T9DA 3CXRA 4KDFA 3LK7A 3VI4B 2CXSA 2HFJA 1QO7A 1U3FA 2W71A 4HLQB 4BO2A 1RQNA 5GMOA 1HQYE 2V5VA 2GHTA 4HRAA 1JFTA 5K3OA 5M5BA 1GCOA 1YRWA 3BE4A 8OHMA 1OTYA 2HDOA 2TS1A 2AX3A 4H3SA 1HDIA 2WB4A 3KELA 4YP0A 2WF7A 5K4GA 1Z07A 4PLWA 2UUCB 4OB7A 5EMLA 4DR4B 1JL3A 5BR1A 2ONYA 1N2ZA 4LYJA 1S8FA 1Y4UA 3IAEA 2AFHE 3ND5A 5BUSA 1ECGA 4V1CB 2ZJZA 1CNFA 3G2HA 3NRBA 4GKBA 4KN8A 3AX6A 4PRLA 4PO3X 4TRJA 1QG2A 4XLZA 1NURA 2LKDA 4QBFA 4IUBS 2ZQZA 3U7QA 1CR2A 4WOKA 5EJFA 3T4UA 4TL9A 1V1RB 3L1VA 3K72B 3ZPXA 5AIAA 3IS3A 1D0VA 1DG3A 1LBHA 3IIEA 2R65A 4G4SO 2HM7A 2W58A 1XTTA 4X20A 5DM1A 2AZTA 1A3CA 5BWOA 2VTBB 1T34A 2DR3A 2RK6A 1XQWA 4IRMA 4K6HA 1W46A 3C3XA 3GCXA 3G79A 1BHSA 2O7SA 3AP3A 2W6MA 4JD5A 3GY0A 2CC2A 1EE1A 1OYOA 2D1QA 2R1UA 3N8NA 5H3LA 3MCUA 4UULA 3T7TA 3KJEA 3A6HA 3GA7A 2D2XA 3K0FB 4QIHA 2PE5A 2FMTA 1WCIA 1XZIA 3ZNQA 3ETNA 5MDHA 4GR5A 5K0BA 3C24A 3T7DA 3CUSA 1NN5A 2RHMA 2PVCA 3MZ0A 3BUSA 3K0EA 1LJUA 1TADA 1KFCB 3A11A 5IDYA 4CQLB 1EM6A 5KIAA 2H52A 2MHCA 1JDTA 2XIJA 4OLBA 3I30X 1F12A 1CFZA 2Q4BA 1T4BA 5EGSA 1EKXA 3MD9A 3MJCA 4DMLA 4AJPA 2NT4A 2X4IA 3ZQ4A 4F8JA 1T36B 3OT4A 4O6VA 2PJDA 4YR9A 4ZJYA 5KS2A 4DR3B 2FK8A 4MUMA 2GZSA 4ZHSA 1YU9A 5JMOA 3L92A 3BTUA 1QH8B 4JSYA 4M1TA 3W3AD 4A8JA 1QFSA 3I9NA 5IS2A 4NBVA 3ROXA 5BW5A 4AMZA 5C32A 4ZK2A 1FA9A 4GI1A 3R7DA 1U63A 1JFSA 3MB8A 4WCDA 1DBRA 2OAQ1 4IVQA 2F1HA 3ZWVA 4C4OA 4EVIA 3UJNA 3FE2A 1L7RA 2AD1A 1RW4A 2XMQA 4KXLA 3VKFA 5CA0A 4AX8A 4AUMA 4Z3KA 3AVTA 3LA6A 1UBCA 4RVSA 1E1QA 3RRMA 4H1VA 4WXEA 3P5SA 2JFGA 1U2RA 1P75A 4L9WA 4E1VA 4LWZA 5MN5A 1OLUA 1RMTA 3OEHA 2LKCA 4U7PB 3RVNA 4CQMB 2DRIA 5KREA 2X0KA 3DMYA 4M7WA 2ZITA 4JXKA 4QDUA 5K2OA 2H5EA 2AVDA 2GN4A 5JNRA 3ASVA 4KO4S 3RWBA 3WIEA 3G8BA 1WB6A 2I1VB 2VDKB 1IDN1 3I05A 4H7JA 3SWWA 3RUFA 2OCLA 2MYNA 2NSLA 2RHGB 3GMIA 1PFQA 5K3DA 1SXJA 3OPMA 3UPUA 1UFQA 2Q3CA 1J9ZA 3F46A 1TUBA 2FR8A 2A57A 1PBNA 3BX1A 2QMYA 1AQ6A 4MIKA 2X5NA 4PZZA 5DHTA 5HF6A 4ZVTA 2HHAA 3UUFA 5BSEA 7ABPA 5I9LA 4P93A 1Z4QA 5TQ0A 3K6RA 1R0CA 4NDAA 3U39A 3ZCXA 2XSZA 1USIA 3PL5A 3RC9A 4MRPA 3G0OA 4OFXA 1WSDA 2CLHB 5K20A 3EIXA 1VSUA 3T3EA 4NAVA 1KMCA 1IOZA 3HGQA 4OBWA 2PMFA 2W00A 2UXDB 4M98A 3NHJA 2JLVA 4GVLA 1M54A 4OK3A 4MV0A 1JQAA 4QLBA 4XJTA 2VK2A 3CEJA 5BOVA 2R8EA 2RE8A 4C7BA 821PA 2Y76A 3FPLA 3TOCA 2Q1XA 3DONA 2P9GA 3NHFA 3L5KA 1P0PA 1ZGAA 4RH0A 4DWWA 4GAEA 4GP6A 3SHFA 3AXSA 4TKUA 2XB8A 4L73A 1RBMA 2ZRHA 4LZLA 4EYKA 1ULSA 3K4HA 2BP7A 4MW9A 3EWIA 3VR5H 1HURA 3GNTA 4MUIA 5GONB 3KU1A 4WERA 2YWJA 4FGUA 3ZE1B 3CF4G 1AXRA 1Z0IA 4KW7A 3E9ZA 5A5GA 2DPLA 2X9GA 4F3YA 1J22A 1ZHHA 2VQDA 2WWHA 3OOSA 4OQLA 5C7IO 2X1VA 1YF3A 3AHEA 3VR6H 3OKFA 2B4KA 4JX9A 4IEIA 3W3ZB 5FBRB 1MB4A 2J3HA 1MG0A 2JH8A 4P3XA 4Y6OA 2QUJA 3PXXA 3B1WA 4EKIA 1WUHS 3MWLA 1KQNA 1Y98A 1M1UA 5DSXA 4PXYA 2VH1A 2QRLA 1KR5A 4IFBA 3GG9A 3IEIA 3UN1A 1UMCB 4GWGA 4U7WA 3SLRA 1DPGA 1F0KA 1GLGA 2ZE5A 3KS9A 4QVGA 2JKZA 2H1VA 2ILVA 3P94A 5SYMA 1Z0JA 4DNXA 5JCXA 5FFMA 2FMIA 3OMWA 3HCEA 2PD3A 2W6JA 1B0UA 4CMCA 3DF9A 1KK2A 4MW7A 4DA8A 3H2IA 4JK3A 3KLPX 4PZEA 5FLKA 4HF7A 3GGGA 3IMFA 3UWKA 3WMFA 2ZSUA 2GBCA 3OOHA 3D6NB 3U4IA 2QD4A 2OXTA 2PMEA 3RHFA 3BIOA 1EG7A 5DI3B 4ARBA 2OOSA 1W85A 2EJVA 4EB6A 3KALA 2R8OA 2JAOA 4PZUA 5AHXA 2ROQA 1UR5A 2W4MA 2NO6A 1ISIA 1JAXA 1MBZA 3FA2A 1LVGA 3N6VA 4Q1FA 1FBTA 1UPAA 3KOUA 2WJWA 4KUGA 2BBSA 5DOVA 5BSWA 3TXAA 1JAZA 1LDNA 2W2LA 1SC3A 4QJ4A 5BORA 4RPKA 3I4CA 2ANBA 2OO5C 2PSDA 2QRVB 3TVDA 2MYTA 1X80B 4QULA 3A9WA 4JZKA 1ZW1A 1ANKA 5JBNA 1ZN9A 4MA4A 1JFRA 1AX9A 2RBEA 1JR3D 3WNCA 5LIRA 4A27A 4JLKA 4MO9A 1NUTA 2V6GA 1PZMA 1PHRA 3DMDA 2CN1A 1MA3A 1BEUB 1U0RA 3UAZA 5AQ1A 1I0ZA 4FQ7A 1TUGA 5BUCA 3G5UA 4N0DA 4EI9A 1AZTA 3D4OA 4K3VA 1MOZA 4AQ7A 4ME6A 5JNTA 5ILGA 3TPCA 4CCYB 3RD5A 4EW2A 1TQ4A 3DGFC 4GW3A 5DHQA 4A0GA 3WB9A 1VGRA 3I0ZA 3T7JA 1S2LA 4P3PA 3HUDA 2IXDA 3IRVA 4M1YA 1G41A 1CVIA 3ZE6A 2FZCA 3OFJA 5B64A 5ILOA 3KSBC 1HM5A 3E9QA 3TFWA 3PGKA 1FVXA 3IQEA 1M8GA 3FHJA 3USES 2VZ0A 2AIRA 3SXUA 3QPDA 2PHZA 2KW5A 3U4MA 1G0OA 3DV0A 3E6AA 2ZR9A 3JVVA 2IYQA 3GZJA 3DA8A 1XL0A 3O03A 1IONA 1SBQA 1G3IA 1P0QA 2KX7A 3F5FA 1SXGA 1QCCA 2XYQA 3FDZA 4RY2A 4QARA 2Z6UA 3ORSA 3ML1A 1J4AA 1DJPA 1ZL2A 2QQ0A 3FHTA 4UU7A 1WCXA 2IEIA 5AI6A 5IJWA 1U0OC 5JCJD 2HV9A 3NTOA 3WYAA 2PZ8A 4UVEA 4F84A 4I1IA 1K5HA 2YCBA 3VUFA 1U7WA 3G8CA 3KKMA 4JLOA 5K8UA 4URYR 4D98A 3F8SA 1DFGA 4YP7A 4MW4A 1QLHA 3QEMA 1UBEA 3PDWA 4JJ4A 3UWDA 1XZBA 3ICEA 1UOOA 2PD6A 3FPGA 4B3BA 5CU7A 3BL8A 3BTVA 1T4GA 4JENA 1UWLA 4QT4A 1UPTA 4P35A 3G2MA 2ZB4A 1PP4A 1A5TA 5GGXA 3STXA 4FYMA 4U5XA 2ZSBA 3HDJA 3NDJA 3WLTA 3QPWA 1LB1B 4X7MA 1Z7YA 4QGAA 2EKBA 2C0PA 3GYGA 3QBJA 5EFZA 4CR8A 1R74A 2FWPA 4M1QA 4HX5A 4NZOA 1RNLA 2X2FA 4XB2A 5F64A 4MJXA 4P33A 3PWKA 3IUNA 1JDUA 4XB1A 3RRBA 3UJCA 1E1RD 3DP7A 1UQTA 3L7MA 3IIKA 3NCHA 3NC4A 1V45E 4CLRA 2FWIA 1IZ7A 1ZGGA 3MHTA 4BVJA 2PD4A 1L1QA 2AXNA 3NHLA 3T7CA 3THOA 1OH8A 3JRWA 3BWVA 3DKKA 4WK4B 1LFDB 4BMNA 1Y5IA 4I8DA 4Q7JB 5J4LA 3U3ZA 1NBWB 1UINA 2ZB3A 4ER3A 5CA1A 4I5EA 4JKIA 2NPOA 3Q3HA 4IIEA 1SBCA 2GM3A 4FILA 1WHSA 5AOAA 1EFPB 4QU0A 2J3JA 4Z8YA 5U4XA 3SEFA 1RPTA 3HBJA 3TQRA 5LP6B 1A69A 2CUKA 5CT5A 1ACLA 1EESA 5JMPA 1D4AA 2P68A 3AOEC 4U63A 3UB4A 1DX4A 2UYOA 4TMZA 1RWXA 3UPTA 2QOEA 2F90A 4LI0A 4M0CA 4OGWA 2JGFA 4F3CA 4TLCA 1G3RA 1BXRA 3ETHA 3KJHA 4JV5B 4OX9B 2VBGA 3DL4A 4OUDA 3H42B 1GG9A 5DE3A 1R16A 5D51S 1VFNA 1XMIA 1VE6A 2ALJA 1XD2A 2WYVA 3OLQA 1UANA 1JR6A 3FVQA 3TK1A 4E88A 2PUAA 1ZRMA 1R6TA 3UJ6A 4XIYA 2EX1A 5DMXA 4H1HA 2I2CA 4R1PA 4DUGD 3OCXA 4R51A 2L82A 3IOYA 1T35A 4TSFD 5T4FA 3ZLBA 5FOQA 1NVDA 2P4EA 4MV4A 1HDYA 4MW1A 1CEQA 4IR7A 1J1ZA 1QQBA 1ZM2A 2AUNA 2MDTA 1U5AA 1I6LA 1YOVB 3GT0A 3KKZA 3UK6A 3WOHA 1NBME 3JV7A 2XUGA 1T1IA 2OZVA 1MUUA 1SJ9A 2WNIA 4OFZA 4PGFA 5D7BA 3SGLA 3SZMA 5BRAA 1YE3A 4B6FA 8AT1A 1JE1A 1JQ5A 2YWGA 4XDGA 4H7FA 2ZWIA 1K7XB 2WD9A 4BGVA 4I9FA 1PSDA 4X1OA 2C00A 2PQ6A 2RIPA 3FCCA 4UUPA 3WMEA 4D02A 3L1KA 2VDLB 4OHRA 4FNMA 3AUTA 3MTAA 5I9BA 4DEXA 5F12A 4GF5A 1EA5A 1PFGA 5CVVA 2V0GA 1IY1A 2WTMA 3GEBA 4I9HA 2ZJYA 1GA6A 1SUFA 4ZEWA 4B32A 1SOVA 1CDEA 1GNVA 2ZYRA 2VNKA 1EDZA 2FZVA 4KVFA 4XYBA 1MR3F 5DHAA 2C3PA 1R12A 3L8HA 3U4DA 1SXPA 2VRCA 2F9LA 3EBPA 4L72A 5FNVB 2G1AA 4ACBA 1PFWA 1V5EA 1Q44A 1H2RS 3KYCB 4Y2YA 3WO1A 5E95A 3U44A 1JQJC 2X13A 2QL6A 2UZ1A 2PEZA 3LQKA 3I5XA 4BZWA 4F9TA 4KAFA 1TCVA 1V7PC 1WDMA 5IU6A 1N0HA 2X23A 2ES4A 1WEHA 3A10A 4IWXA 2JZCA 3T0GA 3AFMA 2A0WA 4HDKA 3TB4A 1Z5WA 3MWFA 5AT1A 1ECFA 4NZZA 4ZIRB 1RWOA 2FCRA 3ENVA 2GARA 3OCYA 4KI7A 5TPWB 4BMPB 3CX8A 1SCIA 2QUZA 3W9SA 4WHMA 3HYNA 3BRWA 1KFJB 4Y2RA 3VX4A 1OFUX 3MWYW 4EY7A 2BF4A 4LKOA 1RJFA 2WJAA 4R84A 3DE6X 3M1AA 1E99A 1CQZA 5AJTA 3A05A 3O93A 1DKMA 1OLSB 3GFGA 3I53A 4N6OA 3T5CA 1KS2A 4XWOA 3KWJA 1DAFA 2D2VA 4RFSA 4HB2A 5DLDA 2O3JA 2B3DA 3GRFA 1ND6A 1NOKA 1SCBA 1IUOA 4QYWA 5L8VA 1AQYA 1LPNA 1OPRA 3ZBTA 3N8HA 3S70A 4DEYA 1E8MA 3IE2A 4YX9A 3JYPA 4WUTA 4YMVA 1GAJA 1G59A 5KVSA 2EERA 1RAFA 2C9MA 4FGZA 1HE4A 3T3PB 1YRHA 4WJLA 2Z3ZA 4IF6A 2R4TA 1Q3TA 1I0LA 2DB3A 4G8DA 2R9VA 5ECYA 1VSQA 2Z09A 1U9JA 3K7EA 2P65A 1XZLA 1EHIA 1XNHA 4NCBA 1KZ4A 1PW5A 3PKJA 3VC3A 5K8IA 3P9RA 1I4OA 4TXLA 1Z83A 4X1IB 1H22A 4C4ZA 2Z3WA 1RYEA 3SZRA 5F7JA 3IT1A 4DJFC 4Q1EA 1KSHA