1IUOA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with acetates
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
272
structure length
272
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords meta-Cleavage product hydrolase
total genus 103
structure length 272
sequence length 272
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iuoA00
4E14A 5C8ZA 3K6KA 1ZD3A 3FWHA 5AKZA 4P92A 1AC5A 3GZJA 2BCEA 5K3FB 3D0KA 1MNQA 4BVLA 4Y9SA 5CURA 3V1KA 2H7YA 2QOEA 4AZ0A 2XUIA 4BDTA 1CUXA 2XE4A 3AILA 1GT6A 1YB6A 2WIKA 1LPAB 2EEPA 4K5QA 1LBSA 2WSLA 3IB3A 2YASA 1WCYA 2FX5A 1FFBA 3GFFA 2DFPA 2FUKA 3H1AA 5EHZA 3SX4A 3WQHA 2AJDA 4X6YA 1VE6A 5HFNA 3L1IA 1ZGCA 5HKAA 2ZSHA 3D5EA 2G4LA 3QBJA 4RPCA 1I6WA 4A23A 1K6EA 3WKEA 4C4ZA 1VOTA 3MGAA 4EY4A 2V9ZA 2WJ3A 4K6KA 3R40A 2VJCA 1G4HA 2ZJFA 5C8XA 2O7VA 2BUBA 2GZSA 4RNCA 3C87A 4TGLA 1ZI8A 1MX5A 1XROA 2XMCA 3STWA 3KXPA 4WJLA 4B9AA 4MYDA 4QDOA 1EB9A 1DWPA 4CG1A 2JGIA 4Q34A 2VQ6A 2XUHA 4FFWA 3X3HA 1KU6A 2ZYSA 2OGZA 1VXRA 3I2FA 5AKIA 1XZBA 4X91A 4E46A 3BE8A 4GBGA 4G4IA 3ZWQA 5FPPA 1DQYA 4MQMA 1IMJA 1BN7A 4DSAA 2BFNA 3VJKA 2B9VA 3PE6A 3A6ZA 5FDFA 5JARA 1X2EA 2ES4A 2WQZA 5HCUA 1CUYA 3F9CA 4RE5A 2PSFA 2O2HA 3O4GA 3WYNA 4UFPA 2Z8XA 1A88A 3C43A 4HRYA 3V9AA 2RGUA 3IA2A 5ALKA 5T4HA 4EY6A 1DTEA 1TK3A 4DIUA 4U2CA 4EY5A 3HACA 4CCWA 1NX9A 2B4KA 4TVKA 2VAVA 4MYSA 3NOXA 2PKYX 3T52A 3VJLA 4AQDA 3DYIA 1XZHA 4X92A 4EB0A 2BGRA 3G8YA 1JJIA 1H2WA 1N8SA 4P93A 3BJRA 1A8SA 5AKJA 3WMRA 1XQYA 5D3ZA 5FOQA 5HQ3A 3LCRA 4OUKX 5AOBA 3QM1A 2XMSA 2DHDA 3DL7A 4IH4A 4XX1A 3BF7A 1JT2A 2WFLB 4DMKA 4WFJA 4BTLA 3WK7A 4Q82A 4OCZA 1G5FA 3SC2A 3L1JA 2G5TA 1UOPA 2WG2A 5ALJA 5LZ4A 3FSGA 2EDCA 1TCAA 1U2EA 3O95A 4ARBA 2OQVA 4QDUA 1AZWA 1CUJA 1LZKA 1WB6A 3BIXA 4KRYA 5C8VA 1E8MA 4BCCA 4UBOA 1MPXA 3CN7A 1CQZA 3HC7A 1EVQA 5HF6A 3PDCA 2OAEA 4XVCA 3QMWA 4G8BA 4PW0A 2QKYA 3LS2A 3DOIA 1QZ3A 1E89A 2OXEA 4D9JA 3M82A 2C0PA 4PV7A 3ZLVA 3TRDA 3EQ7A 3ESCA 5JAUA 4CG2A 2CMFA 1W6RA 3WJ1A 3T4UA 1QFSA 1UZAA 4GW3A 3M81A 4EY8A 3RK4A 1BS9A 3G9ZA 4CI9A 2XMRA 2WFMA 5ALRA 4FFVA 1EHYA 3STXA 1F0PA 1CQWA 4OB7A 1CVLA 3AIKA 1LNSA 4PO3X 1P0QA 4JNCA 2NW6A 3PICA 3FOBA 3HABA 5ESRA 5JZBA 4OB8A 1JU4A 2ZVDA 4QDZA 3WIBA 4UBLA 4Y2SA 3UUEA 4UHHA 3WKBA 4NMWA 1W75A 3I1YA 1XRQA 5JAHA 4MEBA 1YS2X 3FLAA 5FV4A 2D5LA 2JGEA 5FPQA 2HU7A 1XZAA 3U1TA 1YS1X 4C6HA 1AQLA 1WB4A 2VF2A 1BCRA 3AINA 1EK2A 4X90A 3OOSA 1MN6A 5ALLA 1MO2A 3WWDA 7YASA 4LIPD 4N5IX 5AOAA 5JATA 1QO7A 1DX6A 3WA6A 3FYTA 1QTRA 5I8PA 1CUIA 3G0DA 1CEXA 2FJPA 3BWXA 2WFLA 1K8QA 3VDXA 5IKXA 3ESDA 2JBWA 1R88A 5LP1A 3VKFA 3U0VA 5I7UA 3B3QA 3GBSA 4L9AA 3IUJA 2EDAA 3HYSA 1IVYA 4X71A 4DMCA 1YCDA 5DYWA 2JGFA 3HSSA 1CRLA 2HRQA 1CUUA 1FFCA 4W1SA 1XZJA 3D2AA 4C01A 1L7RA 1QIDA 2HADA 3LIPA 4AN1A 2C5FA 3TJMA 4C89A 4ZV7A 4C4XA 2VAXA 4AXBA 1FFAA 4O08A 2Y2UA 2G5PA 4B80A 2UZ0A 1JI3A 1VXOA 3OTQA 2HA4A 5DYTA 4ITVA 2RIPA 3O0DA 1XZCA 2VJDA 4HVTA 5IVIA 1WHTA 3LP5A 2I3ZA 5HKBA 2XB6A 4W1PA 4FBLA 3I2HA 1GGVA 5CT6A 5JAOA 4FDMA 3WKDA 3PF8A 1THTA 5CH8A 3WI7A 2QJRA 5DNUA 4W1QA 3GROA 3DJYA 4H7FA 1TQHA 5LZ2A 3BDIA 2GBIA 2V98A 3HXKA 3NWOA 4IO0A 4BATA 4EUSA 4KYVA 2JEZA 1GKLA 2HHAA 5E4JA 2OGTA 1VE7A 1MT3A 3O4JA 3MVEA 2QUBA 2YXPX 3FBWA 2QR5A 4WFKA 5AI0A 3FVTA 1MU0A 3DYVA 4GDMA 3G02A 1E3QA 5AM5A 2VA9A 4A16A 4JH0A 1AURA 4H77A 3WL7A 3ZI7A 3C6BA 4QA9A 1KEZA 1LGYA 4INZA 3DOHA 3I2JA 3WK6A 3A2MA 1XRPA 5BWCA 4QLAA 1H2ZA 1T4MA 1SCKA 4DSZA 2XDWA 4BC0A 5EFZA 3YASA 3H18A 1YAJA 4B9EA 1U8EA 1H2YA 3RARA 5EHXA 5BWBA 5IVDA 5AI9A 4G9EA 2X8BA 4B85A 2CKMA 5ALIA 1XZMA 5AIBA 3S2ZA 3WYDA 5ALWA 3G0CA 4BP9A 2BJHA 1QIGA 5C7YA 1K4YA 4WDQA 5LZ9A 4FNGA 5A71A 1J06A 5CXUA 3KSRA 4J7AA 4Q05A 4H7JA 1MX9A 4P9NA 1RWQA 1R9NA 5AKXA 4X00A 3H04A 1LPOA 5HK8A 2CZQA 1TAHA 1GXSA 3C70A 5CMLA 1U4NA 5ALVA 1ORWA 4JEIA 5ALDA 4BTVA 4F21A 1HQDA 2LIPA 5LZ7A 4YX9A 2QXUA 3WKAA 1ZOIA 1VJ5A 4J0CA 5J3JA 4UHEA 5KWJA 1YAHA 4BP8A 5A7GA 5LZ8A 1L7AA 4UHDA 1DT3A 3IDAA 4FKBA 5AKEA 1XRRA 2PBLA 4Q1VA 4B81A 1ZIXA 2VT6A 3VISA 1MX1A 5A2GA 3C8HA 3IURA 1HKHA 5K3AA 3JWEA 4RE6A 2QT9A 2HA2A 1D07A 1NU6A 5AM3A 2WTNA 1UOOA 2GZRA 4BB0A 4CCYB 2XQIA 1AUOA 2OQIA 4GECA 1XRLA 4ZRDA 3O4HA 5E2IA 1Q0RA 1ISPA 2IX9A 1QIJA 1IZ8A 2ZJ6A 2PX6A 2DCMA 1BEZA 4FOLA 2VJAA 1GZ7A 4LXHA 4UBNA 3RLIA 4BVJA 4Q3OA 4V2IA 4B7ZA 1H22A 1CV2A 2XLBA 2IIVA 1QE3A 3I6MA 2Z8ZA 3BL8A 3WWCA 3A70A 1T2NA 4KE6A 4U2EA 4G5XA 2GBCA 4X95A 4DYHA 1QFMA 2VEOA 5AKYA 5CXXA 4DNOA 1BN6A 1DU4A 3ESBA 2WU4A 2XUFA 1CUZA 1LBTA 2Q0XA 3IVMA 5ALZA 4CFSA 5LYYA 2HM7A 1O6GA 4XJVA 2O2IA 5K3BA 3UUFA 1UKBA 3A2LA 4N5HX 5K3DA 3PUIA 2O2GA 5JD5A 1A8UA 3WJ2A 1XZEA 5ALOA 1SFRA 3AIOA 2WHPB 5FP0A 1XQXA 3AUKA 4BZWA 5FLKA 3K2IA 3KWJA 3F98A 1FFDA 4I19A 5AM0A 3C5VA 3L1HA 4N8EA 2HDWA 3STUA 3AJAA 1FJ2A 1AMNA 3F97A 1OILA 2CUTA 5E4TA 4KE7A 5AKGA 3A2NA 3GA7A 3WK4A 3H1BA 3WK8A 3WIOA 4U2GA 4HS9A 4OSEA 3BF8A 2C0QA 1UK6A 2QTBA 3M3DA 1QO9A 5I9IA 4AO6A 1WB5A 4UFOA 4F5ZA 2OPHA 1Q83A 4Y2YA 5ALHA 1ZJ4A 5KBYA 4MWTA 2ACEA 1EX9A 2XMZA 1RP1A 1W52X 2AJ8A 4J0DA 4KRXA 2PSJA 3HI4A 1YSCA 1EDEA 2HA6A 3DLTA 3M83A 2PSHA 5YASA 5A6VA 4L0CA 3R3WA 3WL6A 3ICVA 3KWFA 3WZLA 2J3DA 2JGKA 1P0PA 3STTA 4IHAA 4WY8A 3ZV7A 1N1MA 1P0IA 4Q3LA 4MXDA 3ANSA 2ONCA 3FVRA 3WA7A 2WUFA 2QZPA 3GELA 1UT6A 3VVMA 2XUKA 1EINA 2H9YA 5AM4A 1R50A 4E15A 3DL4A 1BROA 1K63A 1AX9A 1XQWA 4OPMA 5AI6A 5K5EA 1XKTA 4FWBA 4S0XA 3I28A 3CCBA 2R8BA 3I2IA 1A8QA 4E11A 3FYUA 4C4YA 3H2KA 3GUUA 1Q0ZA 4UBKA 2RHWA 1CPYA 1TRHA 2XUDA 2Y6VA 5JANA 3HJUA 5AM2A 5KWIA 1BEEA 5HK9A 2JGLA 4B0PA 3H19A 5AKLA 1CUDA 3N2ZB 2GYWA 4M0EA 4H7EA 2IITA 1EXWA 4Q3KA 5ALUA 4G4GA 1BRTA 4Z49A 2J4CA 3HRHA 1PFQA 4FTWA 1K5PA 2VJBA 4AMZA 5AKHA 3PUHA 3EQ9A 4X93A 3KOOA 2I78A 1E8NA 3WK5A 5AOCA 2DR0A 2ECFA 4DTCA 5HFAA 2K2QB 5FUMA 3H2GA 5ALGA 3DD5A 3D59A 3KD2A 1JJFA 4BAGA 4YASA 1XZFA 4Y2UA 4HAIA 1TKRA 1JMKC 5AK4A 4B6GA 5DNVA 4GHWA 3E0XA 5JZSA 4KACA 4A5SA 2JGMA 1JJBA 4ZI5A 1XQVA 2D0DA 2PUHA 1JKMA 1ZIYA 2XQGA 5JASA 3I2KA 4EZIA 5DLPA 2WM2A 2PUJA 5JADA 2PU7A 4UBMA 3B12A 3HEAA 1XRMA 3W9BA 1ODTC 3DNMA 1KU0A 5FKJA 5AK6A 1JFRA 2W6CX 2HL6A 1ZI9A 1G42A 3R3ZA 3H2HA 2HA7A 1MTZA 5DNWA 3V1MA 2WLSA 5A7HA 4UPDA 3NUZA 2WFZA 4Y2XA 1C7IA 5FRDA 3OURA 4H7KA 5BOVA 2DQYA 4H7DA 1QGED 5DTIA 4F60A 2WUEA 1CUBA 2Z3WA 2DSNA 3C5WP 1S8OA 4DMHA 2BKLA 2HU5A 3QPAA 3PF9A 2QJWA 1IUOA 2I03A 1WM1A 1ETHA 5CT9A 4BC1A 2HFKA 5JALA 3ICWA 1ACLA 2GBGA 2H7XA 2WIJA 2C4HA 4OU4A 1YA8A 1VZ3A 5DYYA 1YASA 1SCIA 2XMGA 5EIEA 3VJMA 4ZGBA 5JZ9A 2Z5GA 3IUNA 3R3VA 4X6XA 2FJ0A 2B61A 3LIIA 1FSSA 4H0CA 2VATA 3Q0TA 5F4ZA 1Y37A 2GYUA 3BXPA 5JAPA 1J1IA 4YPVA 2XUOA 4BZZA 1M33A 3IBTA 1E5TA 3H2IA 1OXMA 4FHZA 5ALYA 4UHBA 4RGYA 1C4XA 4J0JA 3ZPXA 4IQ4A 4J03A 1X2BA 2HU8A 3MUNA 1F6WA 1EA5A 5ALNA 1R4ZA 4BCDA 4J0IA 1H2XA 1BCSA 5AP9A 1EK1A 4KAJA 3QZUA 4H7IA 3D2CA 1XKLA 4QLOA 4GEGA 2XLCA 3EQ8A 1LLFA 2HA0A 4OB6A 2BUCA 5JYCA 1ZD4A 2OCIA 3C6XA 2XUJA 3VXKA 2WHPA 1QIHA 1XZGA 4C87A 1HBJA 4W9RA 4M0MA 4F0JA 5AIAA 4U2FA 1UXOA 4W63A 3ZLUA 3TGLA 4PQEA 4Y7DA 2B20A 4MEAA 4AMYA 3B5EA 5SYNA 4DNPA 1UKAA 2WILA 5CT5A 1CUFA 2QMQA 3D3NA 3AZOA 3R0VA 2XUGA 4CG3A 3QH4A 4BBZA 4XIIA 4BYMA 1QJ4A 3QPCA 1LPBB 3IIIA 1GPNA 4J0KA 1IZ7A 4KE8A 5LLSA 2WJ6A 4ZWNA 4MQLA 5H3HA 3LLCA 4QNNA 2PPLA 2E3JA 4FLEA 4PF1A 1A7UA 3S8YA 3C45A 1CR6A 2Y1KA 2XMQA 1TIBA 4BDSA 1ZGBA 1ODCA 4ETWA 3FAKA 3WWPA 2AJLI 1C7JA 2ROQA 4QDTA 5CTAA 4BAUA 4IH1A 2QVBA 1BU8A 1QIMA 2V96A 1Q84A 2HA5A 1SC9A 1UKCA 2VSQA 4ZREA 4Y2QA 4J0GA 5AHXA 2J3QA 5ALMA 1B41A 1QIKA 3O9VA 1XLWA 3I6ZA 2XMDA 1MJ5A 3ILSA 4ZXFA 4IH9A 3JW8A 2CJPA 4U2BA 3STVA 2XUQA 3R3UA 4AO8A 2VT7A 1PV1A 3FYUC 3R41A 2DHEA 1CUEA 5DWDA 3ESAA 3CXUA 1THGA 2OLEA 2ZYHA 4EHBA 3OPMA 2WG0A 4UFNA 1R1DA 5DTJA 4L72A 4AZ3A 5ALSA 1W76A 2XQJA 1CLEA 3WLAA 1CUSA 1NU8A 3BIWA 4I4CA 5T4EA 5A7FA 5AJHA 2OCGA 3RM3A 1AGYA 4PSUA 1EDDA 3ANTA 4HRXA 1SOMA 1VA4A 4TPKA 2JIDA 5EHNA 5SYMA 1DQZA 1CUHA 3QVMA 3ZLTA 1GQSA 4UBIA 1CFJA 2BGNA 1WPXA 4FNMA 4J0HA 1HLGA 3I1IA 2RAUA 1L7QA 2ZYRA 1EVEA 2WU3A 4NVRA 4W1RA 3O9MA 1XZLA 3TEJA 4HXFB 4BE9A 1TCCA 2CBGA 4KR0A 4NS4A 1TCBA 4J3JA 2AJBA 2JGJA 5JIBA 3D2BA 3DS8A 1YB7A 4JUIA 1WPRA 1WOMA 4ARAA 4EBBA 4HXGA 3C8DA 4GI1A 1RYYA 2X76A 4KAAA 4EY7A 4DM7A 1B6GA 5HZGA 2OCKA 1HDEA 2H7CA 2WG1A 4BRSA 3W9UA 3UMJA 5E4YA 3I6YA 3R3YA 5A62A 4H18A 1XZIA 4QDXA 3AZPA 5CW2A 3G9TA 4M0FA 4H35A 3E4DA 3QYJA 4OD0A 1UOQA 3WK9A 1Z68A 3OC0A 3JYHA 2PL5A 5ALPA 4QWMA 3AZQA 1ZJ5A 5ALEA 1O6FA 5JD4A 2OGSA 4Y2TA 3HLKA 4HXEB 5CH5A 3FLBA 3EF3A 4AX4A 3PFBA 4X97A 1GQRA 2HA3A 3DDUA 1VZ2A 1BE0A 2R11A 1QLWA 3R3XA 1P0MA 1EH5A 4UBJA 2ZSIA 1E66A 3K9BA 3NGMA 3IUQA 3CN9A 5EHQA 3AFIA 4P08A 4DNFA 4GXNA 2HIHA 4AO7A 1LPPA 3O4IA 4FBMA 1DT5A 4OYYA 5HF5A 1W4LA 2ACKA 1JMYA 1MAHA 1CUWA 3MUOA 2ZJ7A 1LZLA 3WZMA 4CIAA 3EIOA 4AB1A 1ZI6A 2XUAA 3G7NA 1N5MA 4B84A 4LXGA 2WUGA 4OYLA 2WIDA 4BRZA 4LHEA 2W22A 2WJ4A 4BVKA 3I2GA 1MAAA 2WKWA 5AI4A 5LKAA 1JU3A 1G66A 2OG1A 1X70A 4U2DA 4JYMA 3KDAA 1J07A 4KE9A 2WUDA 2AJCA 3Q8WA 5CH3A 5HQ3B 5LIPA 1XLVA 3AIMA 4BE4A 2QXTA 3QMVA 3FNBA 2WHRA 5HF9A 2C7BA 4DMFA 2XI4A 2WHQA 3H0CA 4Y2JA 3FLEA 1XFDA 1ODSA 4X6UA 2PVSA 5DJ5A 5KREA 1ZD2P 2VTVA 4BCBA 3WL5A 4WCVA 1ZICA 4C88A 2AXEA 4QEKA 2YH2A 1QIIA 3QMMA 2BUAA 4X7BA 1U65A 3C6ZA 2PSEA 3DKKA 3OG9A 2JF0A 5CBKA 4DLNA 3RKSA 2DHCA 2RHTA 3H2JA 4ZV9A 2WIFA 1MNAA 4K6GA 1CUAA 5EIHA 4KEAA 2PSDA 2Y6UA 4I3FA 4X3CA 1H23A 3G9XA 1CIJA 2CEKA 3P2MA 4G4JA 2Y2VA 3SK0A 5FXMA 4G1FA 3FSGD 4MWSA 3G0IA 2RONA 3C6YA 1XLUA 3IUMA 4WFIA 1UWCA 5LZ5A 4CCYA 4X94A 3DQZA 1IUPA 1Y7HA 1DWOA 1USWA 1HL7A 5T4FA 5IVHA 4FMPA 3WWOA 5C81A 1AKNA 1IUNA 2GBFA 3QITA 2HRRA 1J2EA 1FFEA 5AICA 1CUVA 2QS9A 2I3DA 5EGNA 1F0NA 1QIEA 5AI5A 5IVKA 1OCEA 4JYPA 3EBLA 4EA6A 1XZDA 5AKKA 1DWQA 1WHSA 4GLBA 3FCXA 4WDRA 1QIFA 3OM8A 3PFCA 4MJ3A 4B83A 6YASA 4QWWA 1CUCA 1ZD5A 4HTAA 2O7RA 1GPKA 5CRIA 5D3KA 3W2TA 1LPNA 5ALXA 3G0BA 4PNZA 4WY5A 4Y2PA 4B0OA 3E3AA 2JEYA 4K6HA 5D6OA 3V1NA 1VKHA 5HF8A 1LPSA 4LYDA 3STYA 1R3DA 2XUPA 4H7HA 2XQKA 4B82A 5CT8A 3W06A 4Y2RA 5ALQA 4LKOA 2PU5A 1ORVA 1QTIA 5K3EA 4N8DA 3F96A 4G8CA 4ROTA 1EDBA 3DCNA 1QONA 5AK3A 3W04A 1E8DA 3QPDA 1EI9A 4PSDA 4YK7A 4N8SA 5BV7A 1DINA 5K3CA 1R9MA 5ISMA 1GPLA 3V48A 4K2AA 2ZYIA 4G9GA 4X85A 5JD6A 3BDVA 3DKRA 4QE3A 2XMBA 1VA5A 2XT0A 1ACJA 3V1LA 2QUAA 5AI8A 4PSCA 4GWLA 5AO9A 5ALFA 3WWEA 1Y7IA 3BJMA 1UFOA 3FYUB 1PJAA 1YA4A 2OAGA 3CCCA 4LXIA 3SWWA 4G8DA 3WL8A 4KJXA 1W1IA 3ED1A 1QOZA 3FCYA 1DX4A 2H1IA 1EB8A 2WIGA 3VVLA 4HZGA 4QZVA 2QRUA 1YR2A 3H17A 3D7RA 5IH7A 4DGQA 5AM1A 5ALTA 4LYEA 1HPLA 1XZKA 4FLMA 1VLQA 3WKCA 5EI5A 1UK8A 1UK9A 1CUGA 4CIBA 1LPMA 5AH0A 2CB9A 3IULA 2X5XA 4L3WA 5CT4A 1SCQA 2RI6A 1GKKA 5AK5A 2ORYA 5K3FA 3D4LA 2Z3ZA 4UHCA 4Y2VA 2C5GA 4UHFA 2V97A 3DEAA 4UUQA 5LKRA 3E1GA 4XWGA 3N0TA 4KAFA 4OU5A 3G0GA 3G9UA 2G63A 2WTMA 1N5RA 1F8UA 2QM0A 3PI6A 5EIAA 2P8SA 5T4BA 2DQZA 1XRNA 2J4FA 2HFJA 5D7BA 4AN0A 2GYVA 1UK7A 3F67A 2C58A 2OCLA 2BAGA 2XQFA 3F8SA 2PM8A 4BAZA 4FLFA 4DNQA 3HZOA 4NZZA 2YYSA 3W05A
chains in the Genus database with same CATH superfamily
1ZD3A 1CFZA 1X0XA 2GPTA 2JJ1A 3FWHA 4X60A 5G53C 4UCXA 5JBIA 4EHKA 3PTZA 3LBHA 4IMRA 3M4XA 4P92A 5EE5B 4F91B 4LSZA 1C0PA 3D1VA 1YK0A 2QAGA 5T64A 3URKA 3ZVLA 4YT5A 1CZLA 1NW5A 1WSDA 2ZSFA 1KP2A 3B3GA 4PYJA 1ODKA 1ZHHA 1UMDB 5ANRB 4ZDWA 1WZUA 3V1KA 2DG2A 2PR7A 4JODA 1LFAA 2YWDA 3EWNA 2V58A 1NWCA 4BDTA 1EKXA 4G1EB 1YZ3A 2FX3A 3N5KA 4HSEA 1VP3A 1KBZA 1Z29A 4DDWA 1U9YA 3PKIA 4MW2A 4O3MA 3K2BA 1NAIA 3Q10A 5FWXB 2A7XA 4R1SA 1ULTA 1QCCA 1RI1A 1XJ5A 3JQBC 5HGXA 1TQ2A 2P2DA 2WIKA 1LPAB 2EEPA 4FGKA 1QP0A 4MW7A 1LBSA 3GG2A 3IB3A 1T3GA 1NQXA 1PHRA 2OVBA 2FX5A 1H1DA 2SNIE 2ZJ8A 3AQIA 3JQ8A 3LUJA 4N49A 1N3YA 3GFFA 1R8JA 4C7BA 1HDIA 4G8JA 4WOCA 3JZMA 4IF4A 3KPUA 3JQDA 4RA6A 1Y8QA 4ECAA 4YMSA 4O2BA 4BZPA 1Q2UA 2FUKA 3NKVA 1NJ5A 1N6HA 3KKQA 3OIDA 4IIJA 4IKPA 4MGIR 4OY3A 3H1AA 4D4GA 4FWTA 2CXTA 4MCHA 3SX4A 3FAZA 1T1SA 3S2SA 2N1BA 1QGDA 1OGYA 1B6SA 1PZMA 4X8OA 5GOTA 1W44A 5HFNA 3G23A 3L1IA 3F7NA 1U0NA 2NU6B 3GQBA 4QFDA 4ZAVA 4DPMA 3NHKA 1J7KA 4G89A 5HKAA 1YQDA 4B2IA 2D1SA 4NYMQ 5EE1A 3V7YA 1E9FA 1KNXA 2GFQA 1TQ6A 2AHOA 5E1DA 3T1NA 1PZGA 1RE0A 1BZYA 2H48A 1K6EA 3BTUA 4IXMA 5D51S 4BUJA 3SYLA 4DLLA 2B1QA 3NH9A 3OZVA 4LHYA 4MYHA 4ARVA 1DMSA 1EDOA 3L9WA 1TF5A 4B1FA 1R2QA 3H5TA 4JJKA 3WGGA 1A5AB 4KV9A 5AK0A 1B73A 1NFFA 3CIOA 4MGYR 2RHHA 3RRBA 1ZW1A 5DX8A 3V4PB 5BSWA 3AOEC 2F9MA 1CWUA 2Q99A 2ZJFA 3DV2A 3QA3E 5TQ0A 1JEQB 1FS6A 4ARIA 2XNDD 2CV0A 5CU7A 4RNCA 3DOOA 3NHRA 1VGQA 2DLCX 1XAHA 4RADA 1ZI8A 4JBHA 1P5RA 3UAOA 4PPGA 3X1KA 2AMYA 2O2JA 3EGCA 3QP9A 3STWA 2V5VA 4WL0A 5G0UA 3HGQA 2YFQA 1YGPA 2J3KA 2WTBA 4ANFA 4ACBA 1UOEA 3RG8A 1KZ6A 4GKAA 4CIDA 4F9TA 4QIHA 4G0QA 4TM8A 1ZY2A 4QAJA 4GP9A 3IR5A 2VQ6A 3EGXB 1CZNA 1NMEA 2DT8A 2X0KA 3IVXA 2CVQA 3KVYA 4BRUA 1TVEA 3TQSA 1UKVY 3I32A 4LDQA 3G82C 1LJLA 1LK0A 3OEWA 2D62A 2NSJA 3BMQA 3RYHA 1U0OC 4QBGB 3WMGA 2FPGB 2VUTA 2J85A 3PE4A 5F64A 3FXAA 4CM8B 1KU6A 1SQ5A 2PS3A 2ZYSA 3B85A 4MQ4A 2F48A 2OGZA 4O4IB 4B7UA 3M7IA 4QSHA 3NDBB 1VXRA 1U80A 3N0VA 3UBTA 3OOEA 2ZSJA 3LUPA 3PQ6A 4X91A 3AESA 2J5RA 3BE8A 4E5KA 5FBQB 3O83A 4NC9A 4GOJA 4RA9A 5D85A 2IWHA 4MK4A 3ZWQA 5FPPA 4RZ2A 1EIWA 1Z4MA 3E6AA 4NRDA 4G25A 3R9IA 2ZAIA 3RGWS 2C9MA 5PNTA 4ENSA 3BGDA 4RC9A 2JFBA 4G85A 4MHSA 3TL6A 2B9VA 5JE8A 3U4CA 4BWYA 3EPJA 5AW7A 4LHZA 1I3NA 1VYTA 1UT8A 1RT9A 3D3KA 3IXLA 3ROMA 4EAQA 1G2OA 3A7DA 1X2EA 2PUBA 2ES4A 4DARA 5HCUA 2IS4A 1T8SA 4FDUA 2PRKA 3UUWA 3V97A 1U3CA 2NO7A 1G8HA 3EBOA 1NKVA 1TB4A 1Y6QA 2P67A 3D3QA 3JYPA 4XIYA 3WRXC 1NVWQ 5I9TA 4K1XA 1CJKC 3EVGA 2PFGA 3ZH9B 2FEKA 3EEQA 3N2KA 3GFOA 3LXRA 4N5MA 1P6UA 4P81A 3TMYA 2AQHA 4UHJA 3EOBI 5K0LA 1TLLA 4X8LA 2OMEA 3V2HA 1XNQB 3DTNA 1YB1A 5EOVA 5AVUA 1U5CA 4R40A 3CZ9A 4PFQA 1E5QA 1RWWA 2FZWA 1GGJA 4HRYA 3WNZA 1DV2A 3N2GB 4KXXA 4QGBA 3V9AA 4C4AA 1E3JA 1EFDN 2RGUA 16PKA 2X1LA 4QOJA 5DHAA 1W5TA 1E3WB 2Q1TA 3WSVA 3D4BA 2DBZA 4ZALA 3AL2A 1DTEA 1EDZA 4DIUA 4U2CA 1AZTA 3HACA 4GE3A 4CCWA 4R7TA 1XCJA 4Q1CA 4TVKA 2RH9B 2DB3A 4MYSA 1DTWA 1SEVA 4C14A 1AXEA 1L9XA 3IVAA 5EUMA 3T52A 4B8WA 1GTRA 1TAUA 3QEJA 3DYIA 3PCXA 4CKWA 3TOZA 5IP5A 1XZHA 1NC3A 2YZ2A 4CHTA 3G79A 4S12A 2ZSAA 2BGRA 3MB8A 4ZOLA 4ZQEA 4NJEA 4MJXA 5D3MA 2GN2A 2H0RA 5KSPA 1JJIA 3EF0A 1NURA 1RPAA 2ALJA 1W88A 2OCAA 3VV2A 4OVKA 4XSVA 4Q3DA 5T41A 5IAOA 3ONWA 4HLUC 5EY5B 4U7PB 3BREA 2EG9A 5EEGA 1O0SA 1STOA 4NWIA 4EG3A 1X8KA 1A8SA 1E2HA 3LE8A 1P60A 1EK6A 5AKJA 3UG6A 3ZDXB 4BO4A 3SDSA 1IULA 4KGDA 4NL4H 4C0KA 1FE8A 3IEUA 4Y1GA 3RLFA 1MA3A 3A9WA 4TS1A 1J0XO 1BXRA 2WA2A 2QGFA 3BHJA 3VR4H 4RCZA 1G17A 4DLZA 4FXPA 1FTGA 2RG1A 3GIWA 3F3MA 4KHZA 2HIMA 1VE9A 2Q0HA 3ETEA 3OM9A 3JVIA 5F2OA 3PA6A 2XDYA 4EYEA 4ZYLA 2W6MA 2DHDA 2Y27A 3IP6A 1H4TA 4EI7A 3R9XB 1O4VA 4E1VA 1TJ3A 4RVNA 3ESXA 4IH4A 4XX1A 2INGX 1ZN8A 3L7NA 1G0OA 1SXHA 2GPBA 3CUSA 1FS5A 4HFJA 3TBHA 1M3SA 2CK3D 1KKLA 4ZO8A 5E95A 5GM2A 4WFJA 1UC9A 1FSGA 5EAIA 3WK7A 1KQOA 1QSGA 1NVVQ 1Z8DA 4Q82A 2QR3A 2QTHA 2BV3A 2IDKA 1F3OA 1EFCA 3HADA 3PWTA 2OV4A 3CNLA 4YJGA 4ZVSA 2AFRA 2UZ4A 1G5FA 1A69A 1E3LA 5HZMA 3SC2A 1XPJA 2OHXA 1UOPA 1FJHA 2GFHA 2WG2A 3RBZA 3E81A 4V0KA 3TOSA 5E3HA 1BDMA 4CQJA 4BFCA 5LZ4A 3HP1A 1UBGA 2W2QA 3KZNA 1XEWX 4PX3A 4WY2A 4HDMA 1U2EA 2FOXA 2QRHA 1YTUA 2CLLB 4XTCS 13PKA 1TEXA 3A6EA 3N75A 5BSEA 5CB6A 3GLFA 1O94D 2OQVA 4A27A 4QDUA 2V0GA 1U3GA 1C3VA 3BICA 3I23A 4EF6A 2DULA 2XYHA 1C3OA 2GD0A 3BFVA 3BRCA 1E8MA 5ESXA 3RIGA 4IILA 2NVUB 5IC6A 4ZYYA 2NU8B 5EJAA 4ZTZB 5EN4A 3U4IA 5DXFA 5F35A 3CN7A 4A82A 4FR5A 4FHFA 4W5QA 2XCTB 5C3UA 2FW6A 3HC7A 4KKXB 4MMZB 3P9CA 4G8BA 3WRYA 5D00A 2ARKA 1MABB 2F67A 1SB8A 3QA9A 4FEEA 3W7VA 2H54A 4EFLA 2QKYA 4OV6B 1MX3A 4EOGA 1QZ3A 3CZPA 3WMWA 1U8AA 2P5UA 2MMCA 2XDQB 3LAWA 3NBQA 4YYEA 5KNBH 5LJIA 2MTBA 4GLJA 2XZPA 4QOFA 1GU7A 1JF8A 1H4VB 4GVPA 3PQ7A 4J43A 2Z2IA 2C7OA 2XVYA 2WVGA 3HU2A 2CUZA 4RMHA 4RPJA 3VU9B 3ESCA 1V8OA 4HX2A 5EIWA 3ENNA 3N6RA 3T4UA 3A3YA 1TMYA 3B52X 2VJMB 4DKJA 3GPDG 5EC8A 1ZAYA 1H8HD 3E3OA 4QRDA 5F1KA 3EGDB 3M4NA 4OAOA 3HG7A 1IZYA 4ZDIA 5DYGA 2C78A 3F49S 3G9ZA 1Z75A 1TUGA 4OQQA 4ZGWA 1V5IA 4CI9A 4JWTA 3U31A 2BISA 3D4OA 3EDMA 4S0ZA 3SQMA 1FNMA 4RD0A 3TW8A 1IIRA 4CM9D 3EXIB 1I36A 3B1WA 4FFVA 5DSTA 2QX7A 3HR4A 4JOQA 1HDCA 1L5OA 2XJ9A 3RS3A 5ALUA 2ID8A 4OB7A 4X8HA 4N6OA 2ZR7A 4G0OA 2PUEA 1M8JA 3MT8A 3ONFA 2FDXA 1PDVA 1V16A 2NW6A 2QM3A 3PICA 5E2AA 2CKDA 1WV1A 1Z6YA 2NXJA 3GMSA 4V0RA 5IASA 2VCHA 2E2WA 3DM5A 3K1AA 1T5LA 2I6UA 3JWHA 1KYWA 2FKAA 2WBLC 3GEDA 1QFXA 3WYGA 4UPVA 4UBLA 3JD0A 2AEJA 1FS4A 1HDZA 1UFQA 1HXHA 4YACA 3UUEA 3VYRB 3WKBA 3TSCA 1GPMA 2JHCA 5FF9A 1W75A 3P9PA 3RHTA 1NAHA 5JAHA 2OZEA 3EXHC 2DBYA 2OHFA 3OQ6A 5HYVA 2JLCA 5E6SA 5BN4B 3ZIAA 3FI9A 2W4IA 1A8IA 5FV4A 4KNWA 1IXKA 2JFPA 2AMJA 4X84A 3S2GA 5MDHA 5A3RA 5KSOA 2C9CA 2JGEA 1I01A 4P34A 2BHRA 5L95A 3QEKA 2REQA 4QOSA 3GF4A 2HU7A 3WXBA 1TA0A 1M9NA 1PNVA 3GP3A 3MIZA 1XZAA 3O6VA 4ND3A 3FWKA 1KI1A 1YS1X 3ML1A 4B6PA 4K3UA 4Z1MD 1G18A 2P9JA 4MVJH 3KL2A 2YXNA 1WVGA 1JDTA 1G8PA 3LW7A 4XVQA 3FNGA 5TQJA 3B6ZA 4HB4A 4GGMX 1D2AA 1NW7A 3AINA 4TMZA 3EN0A 3ND7A 1B3RA 1V48A 4MUMA 4EY3A 3OOSA 4ABTA 1GSHA 1MO2A 1NJSA 2PCLA 2PGXA 3ZHZA 3HWSA 4MAMA 4NMMA 1GNQA 5L3QA 7YASA 3SR3A 1W30A 2NNLD 4IUYA 5HQTA 5JATA 1YE5A 2F90A 4OEHA 4QSMA 3U13A 4DRXA 5JHGB 1NXSA 2G04A 3WA6A 1EVYA 1E1NA 2ZXEA 1V25A 3FHLA 4I81A 3KFXA 2VDQB 2UZIR 3B8EA 3WWZA 1LV7A 2ZWVA 1ISGA 2QN1A 4TTRA 5I8PA 3CPEA 4HNSA 3PLAE 1CUIA 4R3UC 4HDKB 2OC4A 1ADYA 1DRUA 3DBOB 5CTJA 4DF3A 5DI3B 4TQ9A 3H75A 3PFGA 3HKEA 3ESDA 1U2TA 3K30A 4AMGA 5LMCA 1SOUA 1FCJA 2J45A 3A9TA 3CH5A 3NOVA 4X1YA 5JS2A 5LP1A 2CNOA 3L8MA 3U3DA 3DJFA 3U0VA 4DY6A 4HNUA 1EX7A 3ZCVA 3HWX1 1YDGA 2DR3A 3KLOA 4CKWB 1BAPA 2ZPTX 3E84A 5DM60 5I9NA 5TMEA 3E15A 1SPXA 4LK3A 2FEXA 2GBLC 2G09A 2QX8A 4JOSA 1X8XA 4BVHA 3IUJA 1OWPA 3N7AA 1LW6E 1V5FA 1JWBB 3CZQA 4TMFA 4L4UA 4D9BA 1LRLA 5CVTA 4R41A 1YUMA 2NVOA 2QQ0A 2V7PA 1E3WA 2NG1A 1A5BB 3QXGA 9ATCA 4AXXA 4R6WA 4AK9A 1OXTA 2JVJA 2ZB3A 2JGFA 3KVRA 3O2SB 1PNTA 3THOA 4QOGA 1B0AA 2X8LA 3L7YA 3THXB 4BHTA 1C3JA 1W25A 3WLHA 1R0RE 1T9ZA 4W1SA 2JHPA 2WPDA 1R0SA 2BM1A 1X92A 2VSYA 4UUBA 3UT5B 4PZ0A 1ZD8A 1DAEA 2F00A 2VSNA 1KZ1A 1M7BA 1X8JA 2QUHA 3AF5A 2DPLA 4IDFA 4C01A 1NWHA 4L1KA 4AN1A 2FZEA 1UP4A 3CUKA 1ZK3A 3H97A 4PR3A 2G0TA 2QTVA 1JS1X 4KZKA 3ZDCA 4C4XA 4DSTA 2VAXA 1FFAA 1RBMA 1UEIA 2G8LA 4PQGA 5E6SB 1P0CA 4C04A 1G6Q1 5CA0F 2G5PA 4P3NA 4LQDA 4YRGA 3NVAA 2IUSA 1O4WA 1VXOA 1II9A 2O3QA 1FXWA 2HA4A 5DMXA 5HJ7A 4GX2A 5KYUB 1DB3A 2I4TA 1QH9A 4NENB 1YC5A 2CLCX 1ZESA 3IBCA 3SN6A 1YRYE 5HDBB 3O0DA 4CV1A 2VJDA 4HVTA 5IVIA 1O96B 2Y1FA 4R68A 3S29A 4X64B 1NATA 4M8LA 1SVKA 2JG3A 5HKBA 2VDVE 2O2YA 5DHTA 3VKWA 3QTBA 2H4FA 1NQOA 3O75A 3OKCA 2C3MA 2BC9A 3GMDA 4LTMA 3ILVA 3AKYA 5TGZA 3W1WA 2I2DA 3QX7A 2ZVJA 3BA6A 4IDCA 1KAQA 4CVNA 2FHSA 4DZTA 5L9AA 3PGJA 1KSFX 2XPCA 3FYSA 1KAHA 2JIQA 5LQKA 1JZQA 3PF8A 2IPLA 1FU7A 1OFUX 3WKDA 1HMPA 5SV2A 4DDTA 1BE8A 2PKQO 3DB1A 3HL4A 4RORA 3OFVA 2VDNB 3G49A 1RMQA 5BV8A 3RIXA 4NU6A 1P61B 2O19A 2AN9A 2JJ1D 4W1QA 1ETUA 2BI4A 3T1QA 3GAFA 4ZHQF 2YS6A 5DNUA 1C81A 5BV1A 2W6NA 3TLYA 3IKMB 1XA0A 4PZEA 3TNFA 3DJYA 4BN5A 2I7CA 3H42B 3RU7A 1TQHA 1QUEA 3BDIA 2G08A 3NB0A 1SC1A 4RWZA 2GBIA 3HXKA 3I73A 2HQBA 4UM9D 4FGLA 1HE1C 2YC2C 2F8LA 3FFBA 2GVDC 4N65A 1M0SA 2YVAA 5AHWA 1DRWA 3COJA 4GBJA 4PG5A 4EQ6B 1PW7A 4L75A 3IDQA 2HSWA 2OGTA 1VE7A 2VHEA 4LHVA 5JDCA 1IXSB 1L8OA 3K32A 3CLSD 1Z6QA 3TDMA 5IF9A 3COPA 2V7QA 1G291 4LE2A 1KARA 2IIPA 2V03A 3GGGA 3BK2A 5AI0A 1NX6A 1UEXC 4G37A 4DHWA 4CXMA 1K6XA 3N8GA 2QD5A 3DYVA 3DT6A 1AB6A 4GDMA 5JG7A 3WWYA 3ZU4A 3EEOA 4H15A 4DQKA 1MD9A 1UZLA 2GYYA 2ZPAA 3TAXA 1RRMA 1YI0A 3ON5A 4J1TC 3ISTA 3ZV5A 2C2BA 4XGQA 1AURA 1P2FA 1MR3F 1UDWA 1UMCB 4ZOBA 3WL7A 4RHCA 3P9ZA 3PHIA 4PN3A 1H9BA 1ZM3A 5ECWA 2JJMA 1NDUA 1PLLA 2F43B 5EIBD 4F2HA 5B1IA 4INZA 4G2NA 3ASYA 3FYDA 4LNUA 4ZVUA 1U1GA 2BLNA 5P8WA 3WLNA 4WN9A 3ITDA 1B42A 1RSZA 3DOHA 3PC4A 4ZCLA 2YOFA 3HVUA 3JU3A 4OK6A 4HUQB 2FZLA 4YS6A 4MGKR 3G9QA 1OYVA 4F46A 1PQPA 2FSSA 3I58A 1TADA 1KAOA 3QQPA 1ISHA 4RDXA 5B2ZA 3ROFA 1UF9A 3WGTA 4MQFA 4U02A 3WQRA 3AF6A 1G9XA 1OKKA 3UG7A 4BC0A 4CCAA 3GJ5A 4JL6A 4IQGA 4RMNA 1T2CA 2X3YA 2WM8A 4JC4A 4KUEA 1X14A 3ZDRA 4EPVA 4CM8A 3W78A 4Y18A 5E9AA 1DG3A 2XWJI 3CO0S 3DOCA 4C0HA 1G2QA 3W5AA 1MF7A 3O91A 4OI4A 1NQTA 3DXFA 3H9UA 3EIHA 4J7XA 4XPIB 4F96A 3G85A 4BNVA 3VMFA 1QU3A 3LQ2A 1KRWA 5AJUA 1H65A 3K0HA 4BO9A 4BMSA 3PQFA 2CNDA 4OIFA 5I4BA 4ZI3A 3LY8A 1VLLA 4G9EA 4YB8A 1GTJ1 5EJ8A 3B53X 3PQ2A 4NCAA 1T5HX 1H5QA 4URZR 1FZTA 2PWPA 3S2ZA 5BURA 1JAHA 1GRCA 2GXQA 1ZYUA 3QYPA 4MB0A 5E7MA 5F5NA 4BMYA 3CISA 4BP9A 2ZTUA 3DE3X 2CJYA 3SVZA 2OENG 1HG0A 1DP4A 2DHQA 5C7YA 3VAYA 1G21B 4KFSA 1ELOA 3RHFA 3K31A 5GTDA 5JR3A 5B53A 3L7JA 4RQBA 1NOKA 2ZAOA 3HYNA 3DCYA 4FOPA 2JBHA 3AI1A 3KAKA 3A1EA 3CXRA 2GZDA 5BY2A 1PBNA 1R9NA 1BMTA 2B9EA 3IS3A 4GMDA 3EWSA 4MV8A 5E6RA 2C7RA 4A0RA 3JZAA 1RQXA 1JAZA 3N7UA 4TSRA 3TD2A 1LPOA 5DBGA 4N0PA 1HEYA 3CRRA 1U5BB 1FDVA 2NYUA 3NR2A 4BLTA 3V2IA 4YJHB 3QKRA 4NECA 2NACA 4TMYA 2HSJA 1CEEA 1YWGO 1TM4E 1NNEA 1WXWA 1P29A 2XKJE 1E7WA 1KSHA 1RYNA 4RGVA 5NULA 4CL8A 1KQGA 3UKOA 2TYSB 4WW0A 5IAJA 1SXGA 3VNRA 1SXIA 4WXEA 2B2NA 5ALVA 3VO1A 5J2TB 4PLCA 3C1UA 2FAXA 3Q88A 2G7ZA 4YCMA 3IPCA 4P7GA 1AS0A 4XD7D 3C7DB 5LZ7A 4F8YA 5BSFA 1ZOIA 5IW8A 4LNUB 2B4TO 3N74A 3OEEA 4MRNA 2AK2A 2O0LA 4XX0A 3VOAA 1XUOA 5J3JA 3GU3A 4IGAA 2FG6C 2FZKA 4PLWA 4F4UA 4CM4A 1YAHA 2LW7A 4BP8A 4DZZA 2GI4A 3OM0A 2Q07A 5BYAA 4PGGA 2HR1A 1UMBA 5JAOA 3HSKA 1JDVA 1GN8A 4RHEA 4RAQA 4QG3A 1PF7E 3PSAA 4EF5A 4ZYWA 3MWEB 1UR5A 3DBLA 2HJRA 1JHAA 1P39A 1TDJA 1XELA 1VSUA 1ZQ9A 4I7EA 2C5HA 4LV6A 3WBBA 3IURA 1GZ6A 2NX2A 5BMVF 4UHKA 3H0KA 2HSDA 1WSAA 4UMDA 1PG0A 2G1KA 2QRJA 3HBMA 3HCRA 3JWEA 1IQRA 1D07A 4F3NA 3FNIA 3KHSA 2P6PA 8MHTA 5AM3A 1S9HA 1O95C 1XYGA 3D7NA 1Z63A 5FOXA 4AD8A 3Q85A 4FMDF 4XUCA 3S2EA 2O2DA 5CA1A 1EQAA 3CVOA 3M9LA 2WAAA 1P2VA 1BHSA 3KTFA 3ZGLA 4DT1B 1T4BA 2ZBRA 4TXJA 3RUAA 2VP0A 2ZIXA 4ZRDA 3DKPA 3TCKA 1A8HA 1MRNA 1QAOA 4YWHA 2YJ4A 4O4JB 2FHPA 2BR4A 5JQWA 4DJDC 1N32B 1ISPA 1X1AA 2GEDA 1I4LD 1DXHA 1PNQA 4PGAA 2WA1A 4PWZA 3AG6A 2IZ0A 3V9PA 1BEZA 2J9ZB 3HBJA 4ZO6A 4FOLA 2XWSA 4QNMA 2BFMA 3GIDA 2WSSD 5FYQA 3TUIC 2VJAA 3PC6A 4M7OA 1WXGA 2WVAA 1GZ7A 1RXIA 2R47A 1YMVA 1SD2A 3ESQA 3KJQA 3KQYA 4R8MA 2E5LB 1QP4A 4IMPA 4FJ0A 2E4AA 4US0R 2E5FA 4I6GA 4XUDA 2Y0BA 3EVNA 4KN8A 3UMGA 5I45A 1XOIA 1T9GS 1XA4A 2HHJA 3BORA 2QBYA 1XQ6A 1GUZA 2A86A 1K6JA 1XTSA 1KY5A 3U3ZA 1PL6A 4AU1A 2IIVA 1ECBA 1PT9A 2B4AA 5K20A 1WF3A 4MUAA 2DY1A 4YMIA 3I6MA 4F6RA 4AYXA 1DSSG 2ZWAA 4Z4HA 3W3AD 2TMDA 3H5RA 4EARA 3SQXA 4PHHA 3WWCA 1T2NA 1WW3A 4M3NA 1M6VA 1W35A 3RU9A 4ZJPA 3SVLA 5JAMA 3I01M 5LDHA 2FXVA 3S7ZA 2XOKD 1H6BA 1C7ZA 2QD2A 1AQIA 1FRVA 3HDGA 1LXCA 3AV3A 4G07A 1UPCA 2OWDA 4AKGA 3FRIA 3HB9A 1T4GA 5AKYA 1HRDA 3R23A 4L4XA 2GEVA 4W5RA 1DIAA 4DNOA 1E60A 3S5JA 4C2AA 5A5VA 5BVHA 2IP2A 2FCAA 3KOMA 3KOZA 2V7QD 5K4AA 2WU4A 1CY7A 1CUZA 2XUFA 2W5UA 1NI4A 2Q0XA 1KK2A 2VCEA 3I30X 621PA 2V7UA 2C2WA 3RAJA 3B78A 1C8KA 2QY9A 3C3PA 1A5TA 2YWBA 3ELYA 5J40A 4ZKEA 3RU3A 4CFSA 4DV4B 3KR1A 5DEOA 4EUKA 4JT9A 2OZKA 3BXHA 4JN6B 1V11B 2O2ZA 4DV3B 1UKBA 1Q0QA 1TM3E 4DUPA 2UVPA 1K89A 4QUBA 3VPFA 3RABA 3WJ2A 4F3CA 2Q0QA 3IBFA 2OMKA 1SK8A 5C32A 3HKDB 5ALOA 1SFRA 4UNSA 5K4HA 3PC3A 1CJSA 1C2TA 2WFAA 5TJHA 5KNCH 2XE8A 3ROTA 3JQFC 1TTHA 2BFPA 3AUKA 3DOEA 2A9RA 4HLNA 5JJKA 1U7WA 3ICCA 1FFDA 3TXAA 5DNCA 2REXB 1POWA 4ZU6X 4JI1B 1VCNA 5JRZA 7MHTA 3O3CA 2OXIA 1Z4QA 3MYYA 4MVJE 3AJAA 1NE7A 1LDYA 1NP3A 4NYIQ 1JIJA 1FXUA 3IHTA 2AW5A 1HORA 2XV1A 3F97A 2CUTA 5HXAA 2RJNA 5JLAA 1QYVA 3ROXA 2O5EA 4JNKA 2VJPA 1Z5GA 2Q6TA 5ULLA 2XNSA 4DVJA 1ORTA 5KS2A 3GLFE 2AD5A 3K6SB 1GADO 2M1XA 5HRAA 2CLSA 2Z43A 4OBEA 3H1BA 2FMIA 3HPQA 1XDWA 3EZ2A 2CJWA 1IWBB 1RYHA 1ZOOA 3AEYA 4BIMA 5UKDA 5TPZD 1T0JB 4DCMA 3V8VA 2C2OA 4PZDA 3WIOA 4JMLA 4Y3UA 3FY4A 2E87A 4G0VA 4OSEA 3BF8A 3HHPA 4LC0A 4QEZA 1UK6A 4IJ6A 1TMGE 2QTBA 4HUQA 4TWZA 3MWYW 3RJMA 3WMFA 1LVHA 1PJ8A 4F72A 1QO9A 2JFHA 2VH2A 2HCTA 2QN7A 3R3HA 4MIYA 4K88A 1RBQA 4AO6A 1OH5A 2O54A 1X7WB 5EPEA 3WGVA 5ALHA 2ZCUA 2R6JA 3G2IA 4QGSA 1MEJA 1LB1B 1ZJ4A 2OZVA 2P91A 3E5NA 4G5YA 3GRVA 3C3EA 1GA6A 4BN4A 5AVTA 1Q3KA 1HE5A 1UXKA 3MWLA 1EX9A 1VYUA 4RYDA 4CPDA 2RAVA 3OQPA 1MZPA 3IHLA 3OO1A 4XAQA 3HCEA 3WQBA 2AJ8A 1M2WA 3GJXC 3AW9A 5KAMA 1KETA 1T34A 1BS2A 2PSJA 3Q3IA 3HI4A 4URXR 3AM1A 4TV8B 3DZHA 4AS1A 3QMPA 2B83A 3V55A 2ZDQA 3WFJA 2XMPA 1DAKA 1Z12A 3KYCB 5AWFC 2QN9A 3G2NA 2WSYB 1XK7A 3SFTA 3U80A 3HXPA 3LBYA 2AUTA 4JJ6A 1XPOA 4JSRA 3INYA 4TSKA 1QFJA 1RAEA 3SC4A 1GCGA 1J70A 2Z2YA 3DOFA 1JEEA 2GJAA 2PSHA 3AL3A 4PZ9A 3IKJA 3M3HA 4L5AA 4BO2A 2EFCB 2Q9BA 2LV8A 2IA5A 3R4CA 4J6FA 1LX6A 4C07A 2AMFA 2XXJA 4HXYA 4WVLA 1GL9B 1W6UA 3O92A 4MI3A 1E4YA 1I3CA 3AUAA 3NHAA 4L5IA 4LHWA 4WY8A 1DQPA 1SKQA 5GONB 4MV3A 5IBQA 1KE2A 4H1HA 5KQMA 3ORSA 2VWGA 3AOEA 4Q3LA 3CZ4A 4TMVA 8GPBA 3S2FA 1IBCA 1JAXA 1P73A 4Q6BA 2NTEA 2DFLA 2W6ID 4I1SA 4LJKA 3VSEA 1UP6A 1RQLA 1B2RA 2RAFA 2RGYA 4OO3A 3W0LB 1MW8X 3T3OA 1UT6A 3P9KA 4EMUA 3VVMA 4B17A 4XR4A 4D82A 6ABPA 2GHTA 2HWKA 2F1KA 2HXGA 4UATA 1FJGB 4P6VF 3I4LA 4I8IA 5CJPA 7ADHA 1L4KA 1P7ZA 3ADBA 2JD2A 4DBVO 4WJZA 4LF5B 1T9BA 4V0MA 4P5PA 1AS3A 2B92A 3NKLA 1XD8A 1HFJA 1T25A 1E7MA 3IAXA 4R1TA 5EWLA 1BROA 3AERB 3SY8A 4CE6A 5J47A 1HOXA 1AX9A 2BBOA 1B0UA 1M6NA 3QJ5A 1DKQA 4MR9A 5U9CA 4U6NA 1XKTA 1ZJWA 1JFLA 1W0JA 4QOHA 2R8BA 1SHTX 1SPBS 4X63A 2GAFA 3KR9A 5JPCA 4LFBB 2A3NA 2KSQA 2C0CA 1J49A 2FGJA 5E1OA 2ZCJA 2BD0A 3FYUA 4Q02A 3L93A 4M46A 4C4YA 3WGIA 1MABA 3ROGA 1WDWB 2X1HA 5IKMA 5F7ZA 4EW2A 1TM5E 1RHRA 1WDMA 1A9OA 4C76A 3VRHA 2D0OB 4JJZA 1WZ2A 3GUUA 1BYUA 1Q0ZA 3ZWDA 3UGKA 1TT7A 4P86A 1CPYA 3GGDA 3OZCA 3CB2A 1N0UA 3M89A 1TYZA 3HJUA 5IK2D 1YA6A 1PP4A 3M70A 1OVMA 2Z5LA 1A4XA 1CULC 5IXJA 1OZAA 1X9IA 1PGNA 3ROEA 1ZJZA 5JCZA 1WZEA 5KNCA 1R5BA 3EC7A 3PD0A 1DAPA 1RPTA 3EASA 2PZKA 4K0RA 1ECLA 2D2IA 2I6XA 2PANA 5AKLA 1MCZA 3LUBA 1TZJA 3AVWA 1NZFA 3JAWA 2FX2A 1YVUA 3GVCA 3MJTA 4OHUA 4RL4A 3J80A 1DEHA 3EFEA 5EKSA 2WVHA 4ALMA 1NYQA 2XA9A 3IPRA 1COWD 4QFMA 4KSCA 2CSUA 3FKQA 4G6ZA 4BLQA 2RFLA 4YMHA 4HDNA 3NWEA 1VHWA 2G72A 4UOEA 3RADC 2VJBA 1K5PA 4PFJA 2COEA 2I4IA 1JA9A 1LLDA 1SCDA 3AKEA 4OHRA 5AKHA 3RTAA 3GLHE 2BH9A 4DC0A 4KB5A 1JKXA 3EVZA 4ZT5A 2R60A 2ZXFA 3ZHYA 4FEAA 4OG2A 2ECQA 4TV9A 1P4GA 3ZQ6A 3W6OA 3KOOA 5FL3A 2A30A 2Q27A 1EFPB 2QZSA 5AOCA 3DMNA 1RIIA 1TFUA 2ECFA 1YRQA 4DTCA 2PWYA 3GLGB 1M2GA 3ZG6A 1P1KA 2JLQA 3E1KA 3NAGA 3TLMA 4AJKA 5C4MA 1AN9A 3QU4A 4IJVA 3LQRA 1MC5A 1P7CA 4XFKA 1GTMA 2EOAA 2N47A 1JB9A 1G5PA 3H2GA 5CLJA 2ISSD 1OH6A 2GXUA 1VB3A 1M67A 1U3FA 5C3MA 3I61A 1DEAA 2GKOA 1PZFA 3OPYB 2XWBF 4P4GA 1EYZA 3HI6A 1AK1A 1BDBA 2FMFA 2OXFA 3DD5A 4X45A 3KD2A 4HY3A 1OIVA 4I6EA 1IVSA 3R9WA 2QXYA 1LW7A 2R6CA 4D6XA 1U8XX 4CRWB 2QSYA 4QXQA 5BSVA 3SVTA 4RO0A 2DAPA 4X7MA 4YASA 3ZCSA 1EUCA 1XZFA 2P41A 3AFNA 4Y2UA 5LA6F 1Y9DA 3HEMA 4F9GA 1AK9A 4HAIA 5CYOA 1GD1O 4KI0A 1Y1SA 3TR0A 4A26A 4POAA 3MS7A 3UKJA 4B79A 4CM5A 5LP6F 1TGYA 1P7PA 4WN9B 5IKPA 5GGYA 3UH0A 3NJRA 2C7PA 1ZUWA 4S1TA 1SHZA 1N3BA 4PLPA 3DTVB 5DNVA 4ZCQA 4HGOA 1K9SA 3ZY2A 1NF3A 2IJGX 3K4HA 3B48A 4RENA 2YY6A 3HDQA 2D2VA 2WF6A 3HA5A 2JGMA 1JJBA 3HRKA 3ZQUA 5AW6A 1DAHA 4PAOA 5EINA 4IP0A 2B7CA 1O08A 3LPAA 1VG1A 3FPBA 1SELA 1Z07A 1XQVA 3W7BA 4PANA 3H8WA 4N3BA 2R751 1F2UB 2AOTB 3LA6A 1J20A 1L8LA 2ACWA 4G0YA 4GXRA 1ZIYA 5DXAA 1FPMA 3SQNA 1H2FA 1LLUA 1Y5RA 3O8QA 1W8DA 1PFGA 3BM5A 3WBJA 4G24A 4EZIA 3A6HA 4KPYA 1USUA 4QBHA 5DLPA 4G4SO 3RE1A 4ARCA 4MKXA 1QMPA 1Z06A 4JWKA 2BFCB 1KZ9A 3N3BC 3A4NA 1F1BA 5EP2A 1UINA 3N2IA 3PL1A 1YVPA 5JH7B 1GFZA 2FMXA 3HCPA 3H99A 1U7XA 4GS5A 2PBFA 3O2JA 2GCOB 1TZMA 2AOVA 2ODWA 2WJPA 3W9BA 3DNMA 1U7UA 4QYIB 3JQEA 5DGIA 5AK6A 1JRLA 1NBME 1OR8A 5IAKA 1T2EA 1Z5NA 4BKPA 5C2JB 1WDLA 2IYVA 4FSDA 4QGFA 1KQNA 3UAZA 2P69A 3DT9A 4BAZA 4DY4A 1I8TA 3KVOA 4G0ZA 4OFXA 1Q95A 1FQKA 3BK1A 1V1RA 3HKEB 1XTBA 2VK4A 1DIOB 1X7XA 2Q6IA 1MTZA 4LGMA 5JMPA 2WDPA 3KHKA 1EWRA 2FWRA 3B1VA 5JFTA 1P1HA 4RF5A 2WLSA 2QRZA 2VSXA 2WYIA 4AJ2A 1CZUA 2RBGA 4D9KA 1F1JA 5DN9A 4UPDA 3DV9A 3Q7RA 2L18A 3DMGA 3ZXSA 5IJ9B 4WKBA 2WFZA 5FRDA 1KMHB 5IMBA 3MJEA 4JJ7A 4PIPA 4B7AA 1R5NA 1KMQA 1E9BA 4MVJM 2R8OA 1QGED 5DTIA 4F60A 3RYIB 1CUBA 4YFVA 3HUDA 3C5WP 3LVFO 5DP1A 4IDHA 3PTAA 3B1KA 3QVTA 2BKLA 3QPAA 1O96A 2QJWA 1IUOA 3IHWA 1KY3A 2O8VA 2O8NA 2UV8A 2PX0A 4B3DA 3KZMA 3DLCA 2VOEA 1C1DA 1I2AA 1LBHA 1SB9A 4V38A 3QYFA 4E5PA 4CMCA 4KQIA 1D2GA 4L9WA 2F8SA 5F5XA 1YR1A 4OKIA 2G8NA 2Y66A 3B2NA 1LSSA 1SG6A 3ICWA 1LBQA 4UM9B 2C4HA 3U4QA 3HUTA 3TNLA 3M6AA 2DERA 1NXVA 4UZEA 2XMGA 2XGGA 1UJ5A 4PYMA 2D1YA 5E9JA 4RUKA 3FPKA 4YUWA 3ICEA 1NHWA 2NSYA 3EXHA 4I5GA 4KQGA 3AJ9A 3RPEA 1PSWA 2BFFA 1KYVA 2A9FA 2XR1A 2HYDA 4FW9A 4MVCA 4AF8A 4Y0NA 4WD3A 4Q66C 4M8NE 4J7CA 4MS4B 5JZVA 2F8MA 1QK4A 1D6NA 1OZFA 4YJDA 2GDZA 4F1KA 1GTL1 2VJOA 5SY9A 1FFWA 1PEAA 2IHZA 2FJ0A 2H8KA 1NFQA 2PT9A 3D6TB 4HATA 4HX9A 5I8ZA 2A33A 5JROA 1EP9A 1PWEA 3Q0TA 4H6VA 1CIPA 5F4ZA 4WASA 4GZ5A 5KCMA 3AUJB 3GFPA 3IKVA 5DCUA 4TYNA 5JYEA 3VPCA 2B8JA 3OEED 1XJ0A 4TM7A 3WHKA 3J7TA 3RIMA 3H2YA 3SZLA 1E98A 2Y77A 3RQSA 3USCS 2XUOA 2A5LA 2IZ5A 4W7SA 5I4CA 1IXZA 2E9SA 5J2UF 1JLMA 1MOQA 4AMUA 3H5VA 4DMRA 3PQDA 5FJJA 1E5TA 2NSHA 3H2IA 4B73A 4CKBB 1WXHA 1ZMTA 2C83A 1FPQA 1SU8A 2B1IA 1DKRA 3DDSA 4HYYA 4R2JA 4C30A 2HHHB 2NO5A 2X2FA 2ZIXB 3DP9A 1U7DA 3ITKA 4RZHA 2ZBPA 5L3ZA 4TL7A 3GLIA 2AN5A 4G09A 4J0JA 1SOAA 4F2PA 1BVHA 1GCOA 4A92A 3VMMA 4FQ5A 2B0CA 5KVSA 3PXGA 1H66A 2LIVA 2RGWA 3NETA 4D96A 4J03A 3OBBA 2DX7A 2I87A 3MUNA 3MYRA 3QVKA 1F6WA 3G2KA 1WY5A 2GDJA 3KWMA 4S1WA 2XB4A 4JLMA 2CHFA 1CNMA 5I7SA 5KKNB 4P7KA 1WMSA 4CMAA 2J3IA 4D3SA 1E7YA 3E9RA 3CG0A 2P8JA 3MXOA 5C53B 2Q1YA 5L7WA 2IOQA 4EJ6A 3K70D 2FETA 3ZJ5A 4LXXA 1AZSC 1S2IA 4ND1A 4EUNA 1RHKA 1LNQA 2NOAA 3HXMA 1CVRA 121PA 4YI5A 2H2HA 2VPQA 1ISIA 3LUHA 3DV0A 3HB0A 2W93A 2Y0EA 1H94A 1W2GA 5EL0A 1LLFA 5HGJA 2BUCA 5F1OA 5JYCA 3HKBB 2REBA 2JA1A 2X5JO 1PWZA 5KB3A 1OFGA 1ENOA 2FRVA 1U2SA 1QWSA 2Y4OA 2RGDA 4U7HA 2AG5A 4ZVOA 3N2LA 3KUUA 3LQYA 3V42A 3DR3A 4KV7A 3O8RA 1K92A 1JKIA 3IPAA 4WECA 3VXKA 5ILOA 1QRUA 1X1DA 1MENA 3E9EA 4L08A 3GV0A 4RSMA 4EHFA 3R20A 1TUBB 1JP7A 1USKA 1XCOA 3A1FA 4M0MA 2IHBA 2NN3C 2F64A 1Z0IA 5AJTA 4ZZ2A 2O3SA 3P0RA 1K0FA 4L85A 5AIAA 5HR5A 1ND6A 1PL7A 4LBYA 5C7LO 1OFIA 3SBXA 3WLEA 4TKLA 4PQEA 4Y7DA 1ISJA 1TO6A 4MS4A 2ZUVA 4Z3DA 2XVMA 1Z5PA 3FBGA 2FMHA 4S05A 2PZLA 4IDQA 4IKEA 5EUQB 3HJFA 1ZOSA 4DNPA 4FC7A 4RBNA 5BR1A 3OUTA 1CRWG 1RAFA 4JT2A 3THWB 2HV9A 4BVEA 3HWRA 1QVWA 3Q15C 4N3CA 1CUFA 3D3NA 1OYWA 4IUBS 3C6QA 5FBWB 1RR6A 4HQ0A 2C4KA 3QH4A 4WACA 3AF3A 1E1KA 1KH3A 1TAGA 2HBYA 2SKCA 4DC9A 5KSYA 4XDZA 4DNXA 2EF0A 1K98A 1OC2A 2PS0A 3G0OA 2X8AA 3AR6A 1U1DA 4HKTA 1II0A 1LWOA 1GPNA 3I9KA 4HDKA 4KKVA 3CX3A 4J0KA 4PS0A 4RPHA 1GY8A 3L7AA 1MRZA 5SY6A 2QQEA 5TEWA 5B1EA 3WO1A 1Q7EA 3THYA 2HF2A 5EMKA 3NFYA 2K7FA 2PPLA 1DXQA 4ZTUB 4AULA 4DEYA 4Z7OB 1OLUB 1PFYA 2PD6A 2R2AA 4R9NA 2UU9B 1E3EA 1A7UA 3GHHA 4UUPA 2FPUA 3C45A 3FCOA 4EIWA 5EVCA 2MDTA 4GQBA 4Q9KA 3CTMA 4DJAA 2Y1KA 1R7RA 4PRLA 4P80A 2BFEB 2XMQA 1RZUA 4J75A 1MOSA 5EJIA 1S02A 4BKQA 3GLHA 3WWPA 2R00C 3L0DA 4DN6A 4JB8A 4WKGA 3CRNA 3LX4A 1QV6A 1ICIA 4QDTA 4TLCA 4ZO4A 4LOHA 2CXUA 3QUSA 4FZVA 4IH1A 3T3IA 4B6FA 4BAUA 1OXUA 3NVMB 4C0WA 4EO4A 1X86B 5JCJD 1LDMA 4N0EA 3ETJA 1BOFA 1PJRA 2B34A 4U7FA 4AUNA 4C1NA 1GZHB 1SC9A 2HMVA 2WB2A 3THRA 4YRRA 1W47A 5FBVB 2Y92A 3D1LA 4ED9A 1NBWB 4J0GA 2A0WA 2DGDA 2J3QA 1QDLB 5ALMA 1AOXA 5EYPA 2DUMA 4MICA 4PAMA 1UC8A 3P9RA 3L04A 5IHPA 5CCXA 1KS2A 1PJ3A 3FNFA 2K87A 1KP3A 4ZHQA 4ZT6A 3R6TA 1YT5A 1RJ9B 5T7BA 2P0EA 1EWKA 1D9XA 1KAGA 1OI2A 2W58A 4KXNA 1E6EA 4HG2A 3GJRA 4L4ZA 4X1KA 5AHKA 2Q8NA 4WUVA 5K8UA 5EPUA 2WJHA 1Y42X 2XNJA 4WK2B 2IS2A 3U39A 1KZHA 1W48A 4MB2A 4GVLA 2Z83A 4Q4DA 4HDRB 4QHTA 2DHEA 1WZNA 3DF9A 3ESAA 2IPXA 4HWOA 3CXUA 2ZK7A 2YZ7A 3DZGA 4IXDA 1U0RA 3FWPA 2LGJA 4II7A 1Y48E 3OPMA 1WXIA 1ZUIA 3A1DA 1KHHA 1P9NA 1HUQA 1HYQA 3LT2A 2PYIA 3PQEA 2OLKA 4UFNA 3T1TA 1FSZA 4AZ3A 2FY8A 5ALSA 2GTHA 3OE7A 2NO9A 3WJ7A 1SQ6A 4L8LA 2XQJA 2CT8A 1CLEA 3DMTC 3WLAA 1UMKA 4ZI2A 5L6MB 3UT6A 4V0ME 3CNHA 4WINA 2SKDA 1GSAA 4G5QA 3WGUA 2ZRPA 2HNBA 4Q4AB 1M2HA 4KTVE 3T5AA 1FP4A 5HCNA 4HNVA 7REQB 2Q5LA 1QHIA 2RGXA 1XCBA 3C16C 2JGDA 4RETA 2AI3A 2R1ZA 1NT4A 1ZMOA 1O1YA 3ANTA 2FQXA 1E92A 3F74A 5DGDA 4Q3CA 1GVNB 3NGXA 4L51A 4AWBA 3AF2A 5SYMA 2F1HA 3EXG2 3VR2A 4NZOA 3F5DA 5FLEX 4R8VA 1Z7YA 1PLKA 5IUNC 3VNQA 1WPQA 4ENUA 1L4EA 4ALIA 2CXHA 3AEUB 3F4BA 3QIAA 1ZCZA 1I32A 3KJXA 3N3AC 2OM6A 4FCCA 4FNMA 2J0VA 3OA0A 3SF0A 3I72A 3USZA 2EP8A 3I1IA 3JQAA 3K96A 3B6IA 4UNIA 1M2VA 3RVDA 2VPZA 4V3BA 3DP7A 1DVRA 4UCWA 4UC0A 1X77A 4OLFA 4B3CA 4C6TA 4IDBA 1EVEA 1QB7A 2QTCA 3P97A 4FSXA 4WUTA 1VE1A 5EZ6B 3GPBA 4JV5B 1UJ2A 1GU0A 3O9MA 4I99A 4WCFB 4UTNA 1SCUB 3QPBA 4X0EA 5AXBA 4L7QA 3MFYA 3MWJA 5IYZF 5TJ9A 4BE9A 5KNBA 4UQPA 4JVMA 4F7DA 3U61B 2CBGA 4IYJA 4MRVA 2PUGA 2ZTVA 5EXDA 2BW0A 2E7ZA 1O6ZA 3PPVA 4LA4A 1CDZA 4NS4A 3U7RA 3ZLJA 4BP1A 5B7NA 4B4KA 2E4ZA 4HQOA 3QW4B 2YNMC 3ZE6A 3ZHUA 3ZJVA 3ANMA 1YE8A 4X20B 2AN1A 3F6YA 3H5IA 3OPNA 1H93A 3G2MA 3L4BA 2ZCVA 1U7HA 1RWXA 1OB5A 5NLLA 4OIMA 4HAYA 4X1KB 3RRYA 2G77B 2OBMA 3DVLA 3OJWA 3GQBB 4MUFA 1HC7A 4C21A 2Q21A 4GI1A 1UKYA 2MJLA 3LBIA 2X76A 1RW4A 3N8NA 5G0TA 3CEAA 3RSLA 1BXKA 1UBRS 3LWNA 1UJ4A 3U2QA 1TGVA 2XNHA 5FCDA 2CL6X 1JKJB 1ADGA 3GRFA 3H11B 3PEFA 3B1YA 3IP8A 2EX4A 4OSOA 1HDEA 4XGNA 4KI7A 3I34X 4XGKA 5A9SA 3K0FB 1QBKC 2WT4A 5LYJA 3UMJA 2G0NA 4YHBA 4D44A 2H63A 4NE7A 3RASA 1N57A 5E4YA 2IHNA 3ZVKA 4Q47A 3FNEA 1B3BA 2BGLA 5JCPA 1P1RA 1PTKA 1SQ0A 3OJ0A 5K01A 4LDRA 5EMLA 1XZIA 4CQMD 2FKNA 3R7LA 3OPYA 2BCJQ 4RZSA 3FA2A 3AZPA 2X13A 2OFOA 2HK6A 4LJ8A 2YWRA 1AHPA 2WRZA 3JAMA 4D4LA 4FNAA 5B55A 5HOEA 3C7AA 4D6PA 1Q0LA 2VP4A 3VHXA 5DGHA 1M54A 3OQIB 1KDZA 4NZNA 1VJCA 1Z5ZA 3QYJA 4LYGA 5HKOA 3R76A 2YKGA 2ZBGA 1A2QA 1AD2A 1OD6A 3JQ9A 4BGVA 4LGYA 3OC0A 3JYHA 1QF7A 3LDGA 3JCZA 3CVXA 3NTXA 3LX6A 2ATCA 4Q93A 1ZJ5A 3IP1A 1F4LA 2A6PA 2WYHA 3VFDA 1SZCA 4GYJA 1Y9ZA 1NC1A 3NT4A 4HXEB 2H16A 2C2KA 3HJGA 2NZVG 2PYDA 3EF3A 5ICEA 5CP8A 4L74A 5IWCA 1F7UA 4X97A 4F11A 2WUVA 2O2EA 4R81A 1U0JA 1V9CA 1EFAA 1M34A 3T35A 3QX9A 2ZJAA 2QP4A 3UATA 1QLWA 4IVQA 5KYUA 5EA2A 3KJEA 4ZDJA 1C4WA 3QVGB 4PX5A 2MINA 4LDJA 4KUHA 1Y4UA 3FTQA 1BG6A 5IBRA 1NR1A 1M76A 2SKEA 2MU1A 1ZM2A 1U2GC 3CN9A 4ZC8A 4C0LA 2YFYA 3Q2IA 3TGPA 4OI0A 1NMYA 4GXNA 1C14A 3UH1A 4XJSA 4PQYA 1LPPA 1BVYF 1N2CB 1MW9X 2GF0A 3AFGA 4OUDB 3V7NA 1NW8A 1Y6JA 1CEQA 2YV5A 3KV1A 4CQNA 4IEIA 3UHOA 4EJMA 2FR8A 1IMOA 1DT5A 2QJOA 2IT1A 3CH4B 3QE0A 4OYYA 4WKNA 1XZNA 4ITRC 2PT5A 3AUYA 1N3IA 5FI3A 4IGFA 4RHTA 4YQZA 3N2GA 2G7MC 3JQ6A 1CUWA 4Q9DA 1FLVA 1FFSA 3WLRA 2HTEA 1IPEA 2PMEA 4GIBA 4YV7A 4TSFA 3INTA 1GG2A 1OT5A 2YUIA 1CE8B 3RS5A 4CIAA 2J5QA 1E9CA 1Y6ZA 2P1DA 3X1WA 5ESDA 1U0SY 4K81B 5KUTA 1BVUA 4BV8A 3JD2A 3G7NA 4JQSA 4UVEA 1N5MA 2GAIA 5LQAA 2H59A 4LXGA 1T8RA 2WUGA 4HH0A 4R98A 3IT3A 3IXMA 3LGAA 2DJIA 1GZUA 3IUPA 2XVAA 3HYLA 4MWGA 3ZY5A 3ZIDA 2QAGC 4LHEA 4KSYA 1ULHA 1YFZA 1YTLA 2W22A 3CUEF 4M0CA 4P83A 4ALKA 4DQXA 3QBVA 2GXSA 3WNCA 1U2DC 1U6IA 2PK3A 3I2GA 3R6GA 1MAAA 1T9DA 3LLSA 1W36D 4JP3A 4BGEA 5AI4A 4ZO7A 1QGZA 1MGPA 2PUVA 2B6HA 2WUWE 2BJVA 4TMKA 5CA0B 5DKFA 5KNLA 5LKAA 3D8UA 4LVNA 1BEUB 1SXJA 5B12A 2NQ8A 4G5GA 3GDFA 1GUFA 2AN3A 1NDHA 1ZMBA 2EJBA 4I6JA 3HCWA 5G1NA 4JYMA 4LVOA 1DC5A 3KUDA 1HRKA 3RC3A 4AP5A 5DGTA 2PD4A 1W93A 1EHCA 4PG7A 1QAMA 1R16A 2PKCA 2ASVA 3I05A 5AJVB 2B8NA 4EG4A 2WUDA 2AJCA 5BT9A 2Q46A 3LUKA 4R8RA 1VGRA 3SDBA 4I50A 2HREA 4QFCA 1OLOA 4KAXA 3KKZA 4AY3A 1EESA 1XLVA 3AIMA 3FTCA 3Q5GA 1QQ5A 2YS7A 1G8JA 2YV2A 3A0RB 1WRBA 3CYFA 3KXDA 4H60A 4EHLA 3M9XA 1HM5A 3O82A 3FNBA 3PDIB 2WHRA 5CFNA 3WY9A 1ZR2A 4ZOEA 5IDXA 3A14A 5A0TA 2ZT8A 2A0XA 1OXBB 4Y0VA 1K86A 1XFDA 2QN6A 1ODSA 2W9XA 3NT2A 4FDAA 4X6UA 4CTKA 1FZQA 5DJ5A 5KREA 5KTNA 3MMNA 1YZTA 3NCTA 3R0QA 1Z6GA 3W79A 4TX1A 3A6LA 3TBKA 3KTAB 1Y3IA 3SZMA 4DOMA 1W5EA 2GO7A 4JR2A 4U3JB 1RFGE 4BCBA 4HP8A 1VI5A 1ZEMA 3EG5A 4TXNA 2QU7A 2Q5QA 4KC0A 2YOGA 1TEVA 3DR5A 3LRPA 4LXTA 1WMDA 3BKXA 3MOIA 2DBQA 1IK6A 1JPJA 2IEGA 2NTNA 3GN1A 3NTOA 1ZGZA 1F8YA 1XNGA 2JFGA 2XXBA 3QMMA 2EQBA 1DRKA 2QRQA 5FL7A 1U65A 5DNDA 2ZE5A 3TG8A 2HJHA 3BFJA 3WYEA 1RP7A 2IY8A 3JAKB 3OG9A 4MCAA 1P7YA 5CBKA 3HH8A 2AQKA 2OM2A 2RKBA 1TD9A 5C8YB 1BFUA 4G01B 1U7TA 4OM7A 2YRXA 4Y8VA 3IQFA 4BKUA 1ZOLA 4DQVA 3VNUA 4JP8A 2EL9A 1PTJA 5K45A 1MQAA 4X24A 5FBLB 3EY9A 3NZEA 4QPDA 4REQA 4NDNE 1MNAA 1R9GA 3OZEA 5DOVA 2OYCA 2J3HA 3L5OA 1FUIA 2PSDA 2Y6UA 2A35A 1SIUA 2J46A 3LD9A 4I9HA 4IV5A 2ZT5A 4GFDA 4JC0A 4M0LA 4X3CA 2QRGA 3WFZA 4YMVA 1DFGA 4GDFA 3G9XA 3F2VA 4RA6B 3ZV6A 1CIJA 1JU9A 2F9LA 1ONNA 3BN3A 3E9DA 1QDUA 4R0NA 3DAYA 4TTQA 4URYR 3H2ZA 5KQGA 2XTZA 1EUCB 3B9RA 4HB2A 1SCJA 4G1FA 4XDYA 3RC7A 3ZQJA 2ZWMA 3FSGD 2OESA 4S1VA 3SHWA 2RONA 4BUZA 2I9KA 6REQB 3C6YA 1XLUA 5A1JA 5CM9C 4HWGA 2JVKA 4A03A 2FPIB 1BWQA 2NTVA 2QRVB 4BYGA 2B7BA 1C3EA 3HP7A 3PDUA 4HH1A 1L1QA 2VJKA 1BX3A 4JUDX 4E32A 2VKQA 4Z3OA 1S96A 2FQ1A 2HZ7A 2WHYA 3IAM6 3K2QA 1Y7HA 1PFWA 2HSZA 3GRYA 2ZIEA 4L4RA 1E3MA 1USWA 3DAOA 2CLMB 4IOJA 4R3WA 5F7XA 2HMAA 5BOSB 2B8EA 2IHKA 1JB1A 1IFXA 1KVQA 4GWKA 4LGVA 4R84A 3T12A 4BPRA 4A2QA 4N3AA 5FUQA 5EVJA 3OAAD 3O93A 4CF3A 1AKNA 4J6EA 1IUNA 2FP3A 2NXCA 3EGXA 3L7DA 2CE2X 1RZ3A 1LC0A 3G8DA 1BDIA 3ESYA 3E1SA 1XEAA 4ARZA 4ZICA 1GPUA 5BYKA 1HV8A 3MRVA 4Q3NA 1DJLA 5DV9A 4JLAA 5AICA 3WNBA 4CNQA 1NW3A 2ESRA 1JLRA 3RB8A 2X0IA 2V45A 4J07A 1OTXA 1VPVA 3PNBA 4GAEA 3L07A 3UTDA 4CCSA 5LOVA 4AROA 1H4SA 3UJPA 2HK9A 1NXQA 1W5SA 1QR6A 4D9MA 2C4UA 4FDTA 3M34A 2C4MA 5IVKA 5I7HA 4AUKA 4BNTA 2HK7A 1OB2A 4JYPA 4GZMA 3PYXA 3K9LA 3QV2A 4CLRA 4TZTA 4C0QC 1AMOA 1CY8A 2B4YA 2JGNA 3C7KA 2QLTA 5ILQA 1R8SA 4C5CA 4DWVA 5HW0A 5KKCA 1V6SA 1WHSA 1Z6TA 3IP5A 3P2YA 4GLBA 2WZQA 4LRUA 1QIFA 5CIQA 3E7FA 3EXG1 3X2SA 2FZ5A 4ACAA 1DKOA 3WB1A 2QMEA 3UGJA 2Y0CA 4RD1A 4V03A 1QZXA 2R44A 1TL7C 1Z13A 5J4HA 2AG8A 3TLGA 3IODA 2W6QA 4B83A 1G5QA 1CZHA 2Z5FA 4G97A 1L5RA 3PJDA 5BSTA 3V8RA 3AR5A 1DJQA 4ZVNA 3TLJA 4BMDA 1UT5A 4EJ2A 2HMSA 2P2LA 1PJ4A 3RJTA 5I5EA 5K6AA 1N33B 3G0BA 2QEQA 1QORA 4PNZA 4D57A 4Y2PA 5LNK6 4NK5A 1U1EA 3E3AA 2JEYA 4I9NA 4K6HA 3R4VA 4HWKA 3EG9A 4JBYA 1GOTA 3DM9B 3L43A 4GBED 3R7NA 1M0TA 3F2IA 1VSTA 3IP7A 3FSEA 4Z1OA 1EMDA 1UBLS 1GL6A 1SBZA 2DFNA 2J3EA 2QLLA 1IBLB 3PFIA 1KOJA 2GH1A 4LZNA 2XADA 3BGVA 5FPTA 2BGGA 3N2KB 5EJFA 2BTEA 4LYDA 1CZKA 1NVFA 1OFVA 3STYA 1I7SB 1KNQA 1GNSA 2YBEA 1ZSYA 3OT1B 1C9DB 3VTZA 2ZYDA 4KL8S 4NYJQ 4B82A 1KI2A 5CT8A 4NU5A 5IJZA 5D1NA 2QW1A 2OCXA 1M8FA 1KYQA 5KYTA 2PU5A 1AHNA 4HEJA 2ZT6A 3K71B 1EFPA 4X7RA 4Q39A 3D4IA 1P3DA 1P5FA 2GESA 1LS6A 4B2PA 3VSDA 4G8CA 3DDOA 3CEJA 3EGVA 5K0ZA 4KN6A 1YQ9A 5LXTB 4GP7A 3DHYA 3ME5A 2I71A 4O8ZA 4OXNA 2WMYA 2Z4SA 4TZKA 4AUEA 4MUBA 3NTRA 4DBZA 2E6KA 1Q12A 1TUEA 2W2NA 3I04A 4PSDA 4XASA 4DLYA 5KTKA 2IPOA 3LBAA 4TS3A 2DETA 2RGAA 4GX1A 5K8TA 3QX3A 2UUCB 1VB5A 2D7DA 1WDTA 2Y1LA 5IDVA 3MF4A 3HVIA 1S2MA 1PTJC 3RSQA 2FF5A 3LCJA 3LZDA 3OWOA 5C1PA 5ISMA 3VU1A 2OXTA 1ZK2A 2V6GA 1WQ4A 4D9CA 2PPVA 5CA1F 4CIVA 3EUAA 4BMCA 1Q1NA 1Z56C 1RRCA 1JHVA 3BDVA 2PJDA 3NWJA 3DEYX 1UQRA 3AVOA 4E7OA 1GYPA 1IE3A 3GVIA 3OQBA 4OXYA 2XMBA 2EJWA 1G3RA 3IE2A 6Q21A 2Y71A 1ACJA 4JJIA 4DMLA 3C8MA 3DBHB 1J8QA 1FX0A 3PUVA 4KQKA 1RKVA 3MJFA 3B36A 1E1RA 1CKEA 4LCBA 5AO9A 4TTJA 2Q3LA 1M72A 3FJ1A 4RH1A 1MIOA 1CXZA 2A1TS 4QJIA 1L6RA 1Y7IA 3IPXA 4S1PA 1XJWA 4PAWA 4RPGA 4ZARA 3UFXA 1YJBA 2HEIA 1SY7A 4GUAA 4AMVA 2GBLA 3T1YB 2AKEA 2CXPA 3T5TA 4YTEA 1FQJA 4AYTA 4I4LA 4HWSA 3D0QA 3DLIA 5L4NA 1ND5A 1YA4A 2VPPA 1J5PA 4GSLA 4DAOA 2JLZA 4LXIA 1B6RA 2HMUA 3GBPA 4JBLA 1SU4A 4G8DA 4ZGGA 5I4KA 3P2EA 4WNAA 1G60A 1SD1A 3MT7A 2ODEA 1GJRA 1U3DA 2IEAA 1IWPB 1GFSA 2WWTA 4MVWA 3NXSA 5TGTA 5MN6A 1DPFA 3DWEX 5M29A 5CNMA 1EB8A 4MYRA 2XBMA 4WTOA 4D3YA 2H4JA 4HZGA 2PMWB 2EAUA 1RZRA 5IJ0A 3FDIA 1F8GA 2MSCB 3H17A 3Q9SA 3S1AA 4ZVMA 2ODNA 1CSEE 3ITEA 5BRJA 4D9IA 4LJLA 2ZI3A 3WVNA 3DUFB 5HFJA 4AT1A 3GLGE 1TECE 3PD1A 3ZU6A 1FFXB 1G8FA 4CIBA 2YQ5A 2EBWA 1YS9A 2BL4A 2WDZA 3IULA 3NS7A 3SG0A 3PNKA 3VU9A 2I22A 3L7LA 2D1TA 2P3QA 5CT4A 1UDBA 3ODGA 4CKXA 4NDZA 1DBPA 2XA1A 4NR0A 3OZXA 3TINA 5KEIA 2EVWX 1SCQA 2O7NA 2I8LA 4CLEA 5AVZA 4IRXA 1DCKA 3MELA 1S2DA 2QX6A 6AT1A 1P4JA 1GU1A 1E4VA 4GOOD 2KLHA 4IL5A 4PZUA 3QVWA 4KDEA 4UHFA 4X1IA 2WV7A 5EZYF 1DC6A 5AVJA 3NALA 4Y6LA 1DOAA 3T7CA 3TN7A 2H1OA 2A94A 4EG5A 3E1GA 2ZGVA 3M4YA 2PGJA 3WJAA 3W5DA 4AM8A 1XMVA 5A3QA 5KQPA 1UBCA 3NIDB 1JLLA 3G9UA 1JFVA 1E6WA 3OQVA 4IKOA 1F8UA 1ZLYA 4M1QA 5FWYA 1SXQA 2OBLA 3PI6A 1PL8A 4PCAA 4Y7CA 4JDUA 1KK1A 4TWJA 1X1SA 3EWAA 1AF4A 3A9CA 4L4YA 3VYUB 3OIWA 4EELA 4YRSA 4KQ9A 4YT8A 5KMGB 1DO2A 1MRSA 3AETA 4P98A 1OZGA