1I13A

Analysis of an invariant aspartic acid in hprts-alanine mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
187
structure length
187
Chain Sequence
YEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVATALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role for an invariant aspartic acid in hypoxanthine phosphoribosyltransferases is examined using saturation mutagenesis, functional analysis, and X-ray crystallography.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
total genus 57
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i13A00
1NULA 4FYMA 1L1RA 1U9YA 2H07A 4JLSA 2JBHA 3GEPA 2PS1A 1P18A 1I14A 4WN3A 1QK3A 1XZNA 1ECBA 2DY0A 3H83A 4P86A 3M3HA 2JKZA 5BSKA 5KAMA 4RHUA 1GPH1 4RHYA 4X44A 1VSTA 1I13A 1WD5A 3ACCA 1GRVA 1DQPA 4LYYA 4Z1OA 4RADA 1BD3A 1HGXA 5KAPA 2PRYA 3QW4B 1U9ZA 4RQAA 1LH0A 1Z7GA 1DBRA 1PZMA 4PFQA 4RHXA 3OZFA 5EUCA 4X45A 4RV4A 3OHPA 3GGJA 4TWBA 1G2PA 4LZNA 4M0PA 4P82A 2YZKA 3NAGA 4LZOA 1G9SA 4WMLA 1BZYA 1A4XA 2GEBA 5K51A 1UPFA 2VFAA 2P1ZA 4RACA 1TC2A 1MZVA 1P17A 1G9TA 1ZN9A 2JKYA 1R3UA 3DMPA 2C4KA 3O7MA 4PAWA 5E38A 1NONA 1UPUA 1O57A 4M0UA 4RAOA 5BQOA 1ECFA 1I0IA 1QCCA 2JI4A 2HCRA 1D6NA 1ECCA 2AEEA 2IGBA 1XTTA 1ZN8A 1QCDA 4RHTA 3S5JA 5JV5A 4S2UA 3DAHA 1DKRA 4KN6A 5HIAA 3N2LA 1AO0A 1ZN7A 3OZGA 2FXVA 5IPFA 5ESXA 4ZFNA 1JLSA 1STOA 3ACDA 3LPNA 5IAOA 4RABA 4JITA 2H06A 4RQBA 5JSQA 1I0LA 2XBUA 4P80A 1VDMA 1YFZA 1A97A 3GGCA 5BQPA 1OROA 1L1QA 5ESWA 1XTUA 4F8EA 1V9SA 2E55A 4P3KA 1QB7A 3EFHA 4QYIA 4MB6A 2PRZA 4LYGA 2EHJA 4OHCA 1A3CA 4P83A 5BRNA 3MBIA 1FSGA 2WNSA 4P81A 3HVUA 1DKUA 1JLRA 1P19A 3MJDA 4QYIB 4RAQA 1IBSA 1A98A 1DQNA 1OREA 4P84A 1QK4A 3DEZA 1HMPA 1W30A 1BD4A 1CJBA 1Y0BA 2H08A 1UFRA 3ACBA 1ECGA 1A96A 1TC1A 1G2QA 1QK5A 1O5OA 1XZ8A 1A95A 1ECJA 1VCHA 1XTVA 3G6WA 1I5EA 3KB8A 4IJQA 5HKLA 4M0KA 1OPRA 1J7JA 1P4AA 3LRTA 4QRIA 4LZAA 4RANA 1QB8A
chains in the Genus database with same CATH superfamily
1U0HC 2EJBA 2R7AA 3DE4X 1YA8A 2F1RA 3EWNA 1VXOA 3OU6A 2ASVA 4RL4A 3CRW1 5ICMA 4YREA 3AEQA 4PAMA 2PZFA 5AUQA 4PLFA 4TKZA 2VXBA 1KA9H 3W2GA 3ADBA 3WB9A 3VHQA 4AZSA 3L7NA 1JIJA 2BEWB 2FXIA 1TJ5A 3D3WB 2XT6A 3JU3A 4FYVA 1HKHA 2CFCA 4QYMA 1YHYA 4AU1A 3L7DA 1J5PA 4IDGA 4RE6A 2E87A 3QPUA 1E0AA 4L08A 3CH7A 4B74A 1FTQA 5HS4A 4R9RA 1Z0DA 4U02A 5BMOA 1B0UA 3UV3A 1DC5A 3IVMA 3KS9A 4Q6WA 4EM6A 4COOA 1NPTO 1PX2A 3OJXA 1VL1A 5FYQA 5C51B 1QYXA 3EDRA 3KWLA 4GM4A 1R6TA 1X1BA 2E5WA 2FGKA 2YJZA 3V42A 3I5XA 2XB9A 5AKIA 5ERYA 4PYNA 5LM3A 4ZU3A 1RYNA 3KKQA 3PQ3A 2ZYAA 1BW9A 3KSAC 3LUPA 4LGYA 2JFNA 5G02A 4H0NA 5G4KA 5CH8A 3DOJA 1FU4A 3N7AA 2PR7A 1T24A 3IEUA 3DZCA 3K4QA 3N2YA 3V00A 3D2BA 1U81A 2WMNB 4HP8A 2R6CA 3TDNA 1Z5OA 1E6LA 5D5PA 2J0EA 2J67A 3GV0A 4D42A 1QVAA 4NFSA 1HWYA 4ZO9A 2O8EA 3BFJA 3DGFC 3QXSA 2AJ8A 4G0VA 2QROA 4HBZA 4MMXB 3AY7A 1HV8A 4NZPA 6AT1A 3L05A 4TV8B 2PWZA 4ITVA 2GXSA 1NONA 1G5QA 4UM5A 4Y6LA 1BG6A 5ALJA 4E70A 3KKKA 4PWYA 3V4PB 3ZTYA 1KXZA 3LK7A 5EJGA 1PFGA 1GGNA 1T8YA 4F9EA 2CJFA 2B6HA 5FAKA 3B53X 4MUIA 4QASA 1BHO1 1PWXA 4NK5A 5DEIA 1WE2A 2BGJA 4II2A 1Q3HA 2EAUA 1SJ9A 1IBRA 1AQLA 1LPAB 1UJMA 4YV7A 3L02A 3OJFA 1UJ6A 2QMHA 3R3UA 4KQIA 2P6NA 4ZMSA 3FW1A 1V8OA 3EBLA 3FHJA 1B7GO 3O8OB 1PBTA 1RYYA 2IP1A 4HFRA 4YK7A 2UYCA 5H0IA 4DCPA 2OO3A 4UKDA 4B17A 4MP8A 1CCWA 1N8TA 1PLLA 3B8HA 3PQ5A 4DY6A 3RROA 2WHEA 2OHJA 4I6GA 1XZGA 2DFNA 3O8BA 4BAGA 2GPTA 4MICA 1T8PA 1IG3A 1WMBA 1DGQA 2WNSA 2VH1A 4BO9A 4KO8A 3B1WA 2N9UA 1O97C 1IN6A 2XADA 4IOLA 1XF1A 2EKZA 4POOA 5IJ0A 3ES9A 3A6HA 5CCBA 5FOQA 3ICWA 2A2ZA 4OQFA 4F93B 1HTWA 3WK7A 2JL1A 4O29A 4D44A 3BUSA 3JWEA 3AFHA 1A5AB 1JQ3A 4M0LA 3NTRA 3KALA 4DWWA 2REBA 3W8EA 4EUSA 1JIQA 1H42A 3HDVA 5T4HA 2NZUG 1T5BA 3DPSA 2PWAA 3OTGA 4KXXA 1I5EA 3OEEA 2Q2VA 2W6QA 4MWCA 3ECAA 2W6OA 5AW6A 4ZTZB 3MHTA 5CYOA 4J2OA 5CG2A 4EP1A 2XY4A 4MUKA 2BR3A 1HL3A 1ZU4A 5G53C 4CQNA 4I4TB 2IBTA 2HBQA 1C9JA 2I7XA 3ZHOA 2NYAA 1NSTA 3QBVA 2RH8A 1ZH2A 2MR5A 2FPPA 4EVIA 1ZW1A 4XX0B 4A4DA 3IAM6 3OCYA 1EG7A 1XRRA 4DSUA 1Y1SA 3PQEA 3OTOB 3LRPA 4JUIA 2BGMA 4ZHQA 2AEFA 4MV7A 2B35A 5FQNA 2GVNA 5G40A 3V1YA 2JGAA 1DJQA 2QV7A 3VX4A 2OV2A 4PQGA 3FMIA 3DV9A 3C5CA 2V0GA 1G5FA 4YB8A 5FL3A 4LQDA 1Y63A 2Q9CA 3AX6A 3EW9A 5KAPA 3L7BA 3R0IA 4R4JA 4J29A 1GGKA 4HEA6 3Q3VA 4O4HB 1ZGCA 2R6GA 1RHUA 4LMRA 4KPEC 1R6BX 3ZGOA 2DHRA 5ERGB 5SZJA 4DIEA 1XCLA 1TQ8A 4MVJM 4ROSA 2OK8A 3RSLA 3I34X 3GYBA 1N5MA 1XEWX 3SGLA 3J7AC 4BWGA 4Q5IA 4CG0A 1XPRA 3ZD9A 1AHHA 4HAUA 4HMOA 1BFDA 1PV2A 4JR2A 3CW9A 1JALA 1ULUA 1J24A 1PT6A 1TF5A 1Z3IX 5EIAA 1U0EA 4FLFA 5IJZA 2Z04A 2ZUVA 1SVMA 4RLHA 4WEQA 4IIGA 1RSZA 5DKFA 1H8HA 1VFPA 1H2YA 4DCCA 3B1YA 2QJOA 4OAOA 2HQSA 3GVXA 3T7SA 1SHUX 2R48A 2NZWA 2CDCA 3WRYC 3PPYA 4GPD1 4YV0A 4C07A 3THYB 2Z2JA 5EKXA 5EZYF 3VZDA 1AQNA 3KHKA 2C1EA 2QW1A 2ZBFA 4W5TA 2WU0A 3P19A 2H7VA 1JEEA 3MJHA 1MZPA 2GF2A 3A4VA 3OQJA 3PJDA 4BL5A 1O58A 2WA1A 1T8WA 5EIFA 4OX9Y 1IWPB 3BVPA 3C6YA 4BUZA 3ZS9A 4YMLA 3DFUA 4PAOA 3KRTA 3ZH2A 3RRYA 4C0BA 4ZZ0A 1IY0A 4QTYA 3PNSA 4MUHA 2HOQA 1L6RA 3C7KA 1EUDA 2YDYA 4DHWA 1XLTA 4Q16A 2PMCA 5JCZA 3RFUA 1JIUA 5A4IS 3RCBA 2OYSA 1ZICA 1Q7BA 4DKXA 1QJ4A 2GLTA 2REXB 3ADOA 3KJFA 4PFJA 4ZDIA 3FI0A 3ZN2A 3QHAA 5J4VA 3WWZA 3LHKA 3C5WP 5HOEA 5FBQB 3WWPA 3CZ9A 2QSUA 4TXJA 3BC1A 1VRWA 2I1WA 1YUBA 2UYOA 2ZSUA 3D5EA 4W5OA 4XQCA 3GD5A 4UFPA 4AICA 3SD7A 5JVDF 1XDWA 5JWOA 4DY4A 1XALA 4WCFA 3OURA 4HQNA 3HA7A 3I61A 1JR3D 5HE9A 4P4LA 1RFLA 1KDZA 4YNBA 2ZE6A 1C9YA 4JP8A 4K6MA 4LVCA 5EFZA 4FOPA 1NR7A 2I2BA 4C04A 1U94A 2LGJA 3FOFC 2RG1A 2AJLI 1A9XB 3DDHA 5TJHA 5JMPA 4D0NA 3JARA 2J0SA 1DO8A 2AN4A 1AH2A 4C2UA 3ZWBA 1KNQA 4CF3A 1KJIA 4MR8B 4IIJB 1JP7A 2NTVA 3KAKA 1MABA 1JSZA 1WPGA 3LRTA 4CFZA 5I4IA 3GT0A 4GNKA 4ZOEA 5LFAA 3G5MA 4J16C 1F6BA 2J0UB 5GVRA 1P74A 4FM9A 1ZSYA 3U62A 4YJ2F 1SIUA 3DE1X 3OSZA 3HJHA 1O3YA 1Z08A 2A67A 3NDBB 2RGAA 3MTJA 4G1BA 1M8FA 2H8KA 2O7SA 2VDKB 4WY5A 1YZ3A 3NNSA 4RK1A 5B1IA 3I32A 1EUYA 1JB1A 4A8TA 2QTRA 3GHYA 3Q7QA 4JAVC 3RWBA 3OPYB 2Q0XA 3DLAA 3IDSA 1YRWA 4TWIA 2P41A 4HVCA 1MEOA 4L6AA 1YR7A 3SF8A 4NVRA 1CP3A 1IHXA 5I8PA 1EVZA 4D8WA 1VG9B 3F9RA 4FPXA 4HMQA 4QOSA 1H2FA 4C0JA 4ML3A 1CXZA 1DBWA 1QYIA 4ZVRA 1ORIA 3PYXA 1ZH6A 1AXEA 2AHOA 2QX8A 1NVUQ 2D1FA 2FWJA 4QBKA 3DT6A 3ZDRA 3A05A 5EKTA 5L3ZA 3DUFA 2DAPA 1D3AA 3L41A 3FPCA 4MPTA 3ZTWA 1VIDA 3E3OA 4XYMA 5AJWA 2VXCA 4WIAA 3MCTA 1OJ7A 1NOIA 4V0NA 2Q27A 4X3PA 2XUHA 3MIIA 3AL3A 3K8YA 4P2BA 2D6FA 1M5TA 5LMUB 4YPOA 4EABA 3RUIA 1ZLYA 1D09A 1R5NA 1RXCA 1K0FA 2Q2WA 2VZEA 1BWQA 1U4OA 3S8MA 4BNZA 3P94A 3IL2A 4LXXA 1L4BA 2CXHA 1JX6A 2QMUA 1K6XA 2Z08A 3AR9A 5DW0A 3T54A 5BR4A 3DTNA 3VNVA 2XB6A 3LA8A 2EU8A 3C4VA 4JX8A 1I5RA 1Z12A 2OUKA 5BN5B 4AXBA 1SWVA 1F51E 4NC9A 3QWBA 3IAS6 2L82A 4X3OA 3I53A 4EATA 3VR3D 3J7TA 1JU4A 1YMQA 2X8AA 2XKAA 2ZWVA 3B8EA 2PXAA 4GGOA 4RL6A 1OSNA 2YMPA 1VKJA 3B9PA 3T1OA 4B6OA 4P0PB 1HYHA 3UENA 2LKDA 4S1WA 5KYVA 2W4QA 4LGMA 3UWMA 4LJ8A 3GLIE 2GN8A 1C5KA 4K8RB 4LIPD 5A5EA 4IYJA 1KEEA 1R50A 4W5WA 4Z49A 1DKRA 3BXOA 2I6QA 3AESA 1EFVB 1JQEA 2Q1XA 4RE5A 3KHTA 1SUSA 4S1NA 2CFTA 3EPJA 3I2IA 2QPTA 2ENUA 5F1PA 3AR2A 3FMFA 1WZCA 4M60A 4XUGB 5BN3A 2J85A 1Q0TA 4PYRA 1WV1A 3ILSA 3D81A 3HKEB 3KUCA 5SICE 1L7PA 2HLNA 3K2IA 3MOIA 4OJNA 1DQZA 3HFSA 4JLAA 4Q37A 3TNYA 5G41A 5JQWA 2BTQA 3ZZMA 4TKVA 2C58A 2FUEA 4E08A 5KOJA 1QB7A 5IWAB 4GWLA 4OK3A 2QKYA 3EFHA 3A6LA 2R0QC 1MPXA 4GQIA 4AN1A 2NSDA 3AR5A 3HVUA 2Z2ZA 4WINA 1DAHA 1Z4OA 5ALRA 4Z4CA 3WXMA 3EQ6A 1JAXA 4V3CA 1SQ0A 5C46F 2VYFA 3AM5A 2AFRA 5A04A 3C6QA 6GPBA 5KVSA 3DDSA 2IC5A 2Z5FA 3OZWA 4KZKA 4Q1FA 3VYTB 3W78A 5K8CA 4DR1B 1QQ7A 1E79D 3DLIA 1RPZA 1MH9A 3O4JA 4NATA 2ZITA 3WZ2A 1H1TA 2VQ6A 4K9LA 1W0JA 1A1VA 1ECGA 2O2HA 5FJJA 2Q5CA 3K9NA 4GXRA 1KQOA 2NAFA 1D2AA 1IUPA 2EWVA 2ZJ5A 3FXAA 5L3QA 3MWGA 4JC5A 2OCYC 3AC0A 3OLYA 4C5AA 1U3GA 4D9JA 1L2TA 5TX7A 3QELA 3E81A 4M1KA 2QF7A 1Z6GA 2CXUA 4YS6A 1UH5A 1GXSA 3K8OE 4V1CA 4Y8VA 1E2MA 4YO8A 2HDWA 1O95C 3HA2A 1WMAA 4JLJA 4RY9A 2C97A 2ZR9A 3AF4A 3B1JA 4RY8A 5DM60 4QM6A 2BDTA 2Q3MA 5DNDA 1U7PA 2DLCX 4I9NA 4D57A 1Y8RB 2VYNA 2PMKA 1Y81A 4P33A 4DSNA 4NYIQ 1JDBB 1PKXA 2VUTA 3G7NA 1QV6A 1B00A 3NDJA 2LUOA 2OD2A 4BUJA 1G38A 1MX5A 2GVDC 1AU9A 4JJZA 4JY7A 5DCUA 4EW6A 7GPBA 1QH9A 4D5GA 1KDTA 2VNKA 3EEQA 1NJGA 4B2YA 3EFBA 3WIDA 4LY9A 4P5PA 4LS3A 4KEAA 4TMKA 3OQBA 4DLAA 4LBYA 2HSGA 3NTOA 4KVFA 2GHTA 4ZJPA 1KFKB 1YQGA 3CGGA 3CNOA 3LT5A 4WNIA 3F6CA 2ZATA 1PLKA 1MVOA 4AX4A 3GZTB 4P4SB 4UEJA 3WVNA 3CA8A 5LB4A 1MP0A 2A0WA 1ZZGA 2VP3A 1CVRA 1L7BA 3K05A 2KW5A 1USWA 3EGIA 1N0IA 3PEVA 2II6A 4BNGA 3IDQA 5JNTA 1K5GA 2I5PO 1B16A 3AM4A 3M49A 2YHUA 5AXCA 2I22A 3DMRA 4O4LF 4TS4A 5EMKA 1E1QD 1H6BA 5EXDA 5CDHA 2PHZA 1LLFA 2IS6A 1SKBA 1ZGBA 1TKCA 3NEPX 3RJ9A 2HHLA 1V8ZA 4HVAA 2W6PA 1UXHA 4C78A 4EG0A 5HRCA 1XDGA 2FUKA 4JJEA 4NZZA 1IH8A 1IJFA 1SXIA 1HETA 1WF6A 4Q21A 3IQIX 3V2UA 1QX4A 1HE4A 2B21A 2QPOA 4AVYA 2PZBA 2H4HA 1Q1NA 1IQRA 2ETVA 4GX0A 1RFGE 3F6PA 4FZVA 3INYA 4PZUA 1K66A 1PGNA 3BM5A 1NOKA 5JZSA 3BWDD 4BNKA 1W0JD 1J8DA 2R66A 5F77A 3BL6A 3HBAA 3JWIA 5SV2A 2CD7A 3JYOA 1REQA 5IHPA 4L3WA 1P91A 2FFQA 3UKJA 3PTLA 4GG1A 4KFSA 1FFDA 1G5TA 1TVCA 3PUJA 3PE3A 2ZUDA 3DD1A 5ELLA 2YZNA 3E84A 4KAXA 3WB2A 3L2OB 1O94C 3VV2A 4GU5A 4NBVA 5HIMA 2YXBA 3OU7A 3ZK9A 3QXJA 2P35A 4YAWA 2OSBA 4J43A 1RHKA 1OI7A 3LHDA 4HNTA 1KYIA 1WB4A 3X2SA 4LX8A 1SHJA 1O6GA 4WV3A 4ZOCA 1EQUA 1G8GA 1YB4A 2Z58A 4FX2A 3M9WA 5DTQA 5YASA 3LC0A 3TI7A 1OZGA 2VCHA 2DQSA 1D2NA 3L0PA 2VYQA 5JVDA 4KV7A 5EXPA 4DLUA 3SCZA 3JAMA 4IIJA 4EHJA 4H7FA 1T1RA 2QMOA 3O8NA 3F8WA 1XZBA 2FSFA 2WYVA 5HF8A 4X1YB 4OQMA 1MQ8B 1SHZA 4HI0E 1Y1LA 4ID3A 1QK4A 2UVPB 4RC9A 2YV1A 3DEZA 1J42A 3I04M 4PYMA 3VKFA 4Q4AA 3IMKA 3U7RA 2UUBB 4EYOA 1IDOA 3I4LA 1AXGA 1QYRA 1ZKMA 3NRCA 4M1OA 3DOUA 1EIZA 1GCAA 1X94A 3OF2A 4UXJA 2OFWA 1BCSB 2WC1A 5E1OA 4BVLA 1NJ2A 1NF8A 3L77A 5HKLA 3SMQA 1QO0D 3VNSA 2VPTA 4ZK2A 1MV5A 1U0OC 2BCJQ 3ZCSA 5A1TA 1YOVB 2AQ8A 2ZJAA 2PZJA 3ETGA 1H93A 1TCBA 3AHGA 3O2SB 2P4UA 3QLTA 2P4EA 4G63A 3PCXA 1CUSA 4ARVA 3OE1A 1NLFA 2P68A 1U7ZA 1OW3B 1J8MF 1JF8A 3DS8A 3DZBA 3AUSA 3OE7D 4E21A 3A4MA 4RSHA 3ZZNA 2GBGA 2Z30A 4UHFA 1UBHS 1M73E 4HR7A 1QOPB 3RTCA 5COBA 4TV9A 2I2XB 3KOZA 5IUKC 3T1YB 2A0UA 1R0RE 1Z29A 2QN1A 4MQ6A 1X1SA 4A0RA 1EXNA 1A8QA 3QHQA 1AGNA 2UUOA 3IURA 3D31A 4FP9A 2J4CA 2HQRA 1TAUA 1RACA 2QORA 2G7MC 3DPUA 1TUGA 1K7SN 5CH5A 1NHWA 1F6DA 4J4HA 4JU8A 3RSSA 4EHIA 2ZB7A 3IUNA 2C57A 4BFVA 4ZQHA 1A8UA 1X77A 2H5EA 1PKEA 1U9ZA 2P2DA 2ZI5A 5IM4F 4W1QA 3MTEA 2GO7A 4B4UA 3O47A 2JFZA 2XOEA 3GUVA 3JQ7B 3KQSA 3MTAA 1BDMA 2CD9A 3F47A 4JWKA 1GPJA 4QBHA 5LP6B 3OU2A 2FZLA 3JVVA 4NENA 3ESAA 3ZWOA 4FKMA 1DLIA 2WU4A 2OPBA 3IX7A 2G9QA 4TT8A 1BSVA 4HGYA 4REMA 1RXEA 3EXIA 4XOIA 1SPBS 3N2KB 4IRUB 3STUA 1EJ6A 1DC7A 4OG2A 1LWNA 3TZQA 5LDHA 3AESB 3I1IA 3DNPA 4XQ0A 1PJ2A 4GPIB 4EKIA 1N2EA 3FF1A 4L27A 4MWSA 4YLEA 3LTNC 2FB9A 2VQSA 2XBLA 5P21A 2OTCA 1XZPA 1LBTA 1E3QA 2BFDA 2J3QA 4F6CA 5IEJA 2I2AA 3KBOA 3I2FA 4RPLA 4OI0A 3GMSA 4EB8A 2I54A 1MH1A 3BBPA 1Z13A 4UBJA 3CMMA 4L0CA 5LP1A 4B31A 2YV4A 4A8JB 1ICIA 4S2UA 1ZI9A 4JL8A 1AC5A 4F97A 4KUEA 4Y6QA 3W8RA 4DGSA 1ECLA 4IICA 2ZTMA 4BBAA 4UU0A 1RQ7A 3H16A 3HRHA 1WKBA 1SVNA 1ZM3A 4LDZA 5EIOA 2MSWA 5DBFA 1XB2A 3IVAA 4L85A 1O8CA 2FW6A 1K3FA 3MUOA 3GGDA 1IK4A 4P0QB 4OYLA 3DONA 3G2KA 4O2AA 2G0AA 1FRQA 2CL5A 3EB9A 1DXHA 4UUBA 2PVCA 3IKTA 1VDMA 5L7YA 3T1HB 2RGXA 3GGCA 1BU5A 4BRZA 3SHFA 4DA4A 2E0IA 1HSOA 5IT4A 1DBIA 3TLXA 1I8TA 4NTZA 4PHTA 1GSIA 2JS7A 4N76A 2WWFA 3FIJA 4KXMA 3FNGA 5FO0A 3U3KA 5KWJA 1E1KA 3A4YA 4HDKA 5F2EA 4OU4A 2IV7A 1YJAA 5GONF 3R0VA 2H18A 3KB1A 3ONDA 1SKAA 1UKYA 4ZYXA 4DV7B 2HM7A 4BVHA 4IWNA 1EINA 3PS9A 4N47A 3VO2A 1BXRA 1HRDA 2A9QA 3HLYA 4NCNA 4ZO7A 4FC7A 1VYTA 3MT8A 4LBVA 3LOUA 4DYDA 4URUR 5BSHA 1YIOA 1JEAA 2XMQA 2HRBA 3F7MA 3N2GB 3RU9A 2I6GA 4G8DA 2OQ2A 4LJLA 4OATA 4C4RA 1KI7A 2OORA 2IA5A 1APBA 2FP4A 2XRZA 3HYTA 2FK7A 3KFLA 1ZNYA 1T36B 4KOAA 3G13A 1MKYA 4D92A 1NNUA 5IJ9A 1XXHB 1Z0KA 2BKUA 3H87A 1FF9A 2V58A 3AHIA 1GILA 3FCYA 2XUDA 3W06A 2FJPA 3FG9A 4OYRA 1WULS 1CUJA 1JR4A 2XH8A 4ZYWA 3Q2KA 3LKVA 4B3FX 2GJ4A 2XDQA 3QKTA 1L5SA 4NXNB 3DV0B 1H8HD 1QDLB 1OLSA 4WK4B 1OVMA 1T1IA 3BTSA 2LCIA 3THXA 3ZKWA 4ZVOA 5LYJF 4X62B 3K6SB 2FN8A 2J4DA 2YH2A 4FOSA 3PWKA 4Z6KA 5C3UA 3E1GA 4QOIA 6PFKA 4M37A 1OT3A 4CMCA 4CM9A 2QU7A 2OXEA 3G23A 2WABA 3MMNA 5CMLA 1B73A 3LI2A 3M89A 3ABIA 1FL9A 1N6KA 2PBLA 3A2NA 2CHEA 2EX1A 4S35A 4XJSA 4YDQA 1ULTA 3ONVA 4K9MA 1XN1A 3JYNA 4AZ3B 4TV9B 4ETWA 2B1QA 3VNBA 4WOKA 3BEOA 4YCDA 3QYPA 4UMDA 1SCNE 3LY8A 1VSBA 2UKDA 3U4GA 2M6KA 5C1PA 4NCIA 1V5EA 5A06A 2I3ZA 1IAQA 2E21A 4A0HA 1W0KA 3L06A 4GKBA 2XQFA 2A4MA 4MRSA 1HNXB 4M49A 3QKUA 4EENA 4D56A 3RYHA 4Q9KA 3PXCX 5JJ5A 1C9EA 3NXSA 4IJ6A 1ONSA 2JZCA 4WL0A 2R3SA 3CNNA 5CGZA 1P7YA 4RGBA 4ND5A 2HBYA 4BVFA 4F4JA 2BFOA 1HE1C 1PZXA 4ZARA 3COJA 2WIDA 3AP1A 3RC8A 2F4VB 2A33A 2IOQA 4NS1A 1D2EA 1SD1A 3OOJA 3SSNA 3N8HA 1MJFA 2FSHA 2A5JA 1COWA 1SG0A 3EC2A 4MYRA 4PYJA 4PX9A 2XT0A 4EA8A 4EQZA 3P9IA 1P4SA 1LBSA 1U3DA 4BO0A 1TCCA 1ULAA 4PXSA 4DABA 3HKCA 2QGZA 3QE3A 3O82A 4JKYA 3KDAA 2ZYGA 4U6QA 1Z7WA 1ZHOA 1E9FA 1SVLA 3U7QB 4MEBA 1NXVA 1L9KA 1S2OA 4XAQA 1UKEA 5THQA 2W2QA 4LZJA 1KK2A 1WPRA 3KOXA 4CIVA 1QZZA 3QU7A 1KK0A 3N8KA 2Z4SA 4AFNA 1KZGB 2B99A 3AF5A 4YUYA 3DLHA 1K7EB 3HZHA 2O3RA 3KL2A 3U44B 1CNFA 1K86A 1QO9A 1GTZA 1R9MA 1VIMA 4BFSA 4ERXA 1TRHA 3LCCA 4BWFB 4CKWA 3F49S 4F46A 1Z37A 3DKKA 3NRBA 3AM3A 2WU8A 5BORA 3C16C 2FZWA 3QFRA 5JAHA 3E48A 3L04A 2OKCA 1QCYA 3ZI4A 3CEJA 1GZ6A 1Z35A 3DMTA 3PI7A 2Q4BA 4OTZA 1KORA 3EXHC 3CV3A 4GPEA 5K4AA 3U4CA 1TADA 2ET6A 5F52A 4WAUA 4I5FA 3ENQA 2NP7A 5TMBA 4QU0A 1ELOA 4H1HA 4AQ7A 1CUZA 5EZYB 1J20A 1NPDA 1QK5A 5B6JA 2RDMA 4L5CA 1A8IA 2DY1A 5ALEA 1FNBA 1S7CA 4E6EA 3FZGA 3ANXA 3BIFA 1SBYA 1ZJWA 4I2NA 3G0GA 3PD1A 5B1SA 2I6FA 4RTPA 5BUQA 5DHAA 2FZVA 4ABYA 3REOA 5EMJA 2FLWA 4G07A 2BYTA 5DU2A 1CF2O 8ABPA 3HGMA 5DRYA 4YLYA 1NXWA 3R3SA 4FHZA 3KDPA 3A9UA 2WQ6A 5T7BA 1HKUA 1L5OA 3TUZC 4KN5A 5JYCA 1ZCFA 4H17A 5HKKA 5K03A 1PFWA 3NJ8A 3N2GA 4LJ4A 5D7NA 1BXGB 4DLKA 3GFQA 1O2DA 3CT6A 4JXKA 4MVYA 2B9VA 4RELA 5FOXA 1ZBDA 4B6FA 1MDFA 5CB4A 4HTFA 3O4RA 1SD5A 4X44A 1J2JA 1WUTA 1E3MA 1SQSA 1SQGA 3NANA 1M6WA 2B4TO 4GMHA 5BR7A 4JHXA 5LL6P 1Y5MA 4AMVA 3FROA 3OPYA 3NOOA 3G1TA 1R8YA 1WLSA 2OWDA 2R1VB 3FBGA 1D4OA 1K6MA 1XL1A 2P11A 4B0OA 4DLTA 4DZTA 3RKSA 5MF6A 3KM0A 3OZDA 5A9TA 4CMGA 3JAWA 3O9ZA 5JH7F 2A0KA 2A86A 2H9IA 3Q5GA 4JROA 5DB4A 4BV3A 1KEUA 4GBMA 3W90A 5ITZB 5KJCA 2FX3A 3DJYA 4U2CA 1TK2A 3NBMA 4KWEA 2OFOA 2ALJA 4LRSB 3RT7A 2GS9A 3MCZA 5E3IA 4LJ9A 4P4UA 3WISA 2Q3CA 4IX9A 3RF6A 3WBKA 3SJAA 4KKVA 3JV7A 2PCJA 3PYLA 2ZBDA 3WQRA 3JD1A 2P3LA 1TQDA 5E7JA 2WWXA 4DV0B 1IBKB 5C8YA 5KEIA 3DR5A 3PPVA 3KL4A 3SQLA 1EXVA 1B74A 3G1UA 5EFOA 5FI3A 2FRVA 4MJXA 3A1SA 3HJGA 2DBQA 1ZN8A 5FORA 2EYUA 4BAUA 1EA7A 2W93A 1NXSA 4KR3A 1QMGA 1XRLA 3AFNA 4HWRA 3ZU2A 4CMAA 4DNFA 2IYYA 2X2PA 4R40A 5CITA 1IQUA 4F3KA 1V5FA 4U9HS 3Q5EA 1IXZA 2PRIA 5ESXA 5IUJC 4J7CA 4XJVA 1RR6A 2TRSB 4V0ME 3UWDA 5CK5A 4YCMA 4UM7A 3X1ZA 2B3DA 1R0LA 3EY4A 3CMCO 2OXFA 1OY1A 4RIGA 1YFZA 3F4BA 2SECE 3WL5A 2RC5A 2PKQO 2XZLA 3R75A 4P3KA 3JQ7A 1W94A 4WHMA 2GN6A 5ICCA 3QV1A 1YI0A 2Q6KA 4FW9A 5F7XA 5C4IA 1VMDA 1HLFA 1WCV1 1C3OB 4LNHA 1LUAA 4HDNB 4UBIA 3X1MA 1RRCA 1UOPA 1O6CA 1T8RA 5C5CA 4DJJA 1K4YA 3KKZA 5HF6A 2OLKA 4L22A 2DHCA 3UJHA 3L6BA 5CVUA 3RYFB 1E1CB 2FPOA 3UK2A 4CIDA 4JBYA 5BXQC 5CFLA 1ETHA 4JJGA 3SIXA 1FP7A 1GG2A 2Y6VA 3D4BA 2QR3A 3MAGA 1ZU5A 4WECA 2KLBA 2VK8A 3GC6A 1U3VA 1AB6A 5IJXA 4A92A 4BKPA 5CB0A 2FMHA 1NG1A 4DREA 4Z2AA 1RRMA 2YZ7A 3AHFA 3G8BA 1XRJA 1XTJA 4PSCA 3E9QA 3C3PA 2NADA 5JPIA 4QLAA 4I5GA 4KYUA 3LBNA 3T52A 3TQSA 4R1SA 4LMAA 3KE8A 4FWTA 1F2TB 4TT3D 4N8DA 4QG7A 3JQBA 4N7RA 4FFBB 2HGZA 2W6CX 3C6MA 4RDCA 5IULC 4AIIA 1FFEA 2HSDA 3UJ8A 1N5DA 1FP6A 1WVGA 1P2TA 4RD6A 4K6OA 4W5JA 2HLPA 3R41A 1SXJD 4YAJA 4F5DA 2KLHA 3D7RA 1PFYA 2CXSA 3KEQA 4EPYA 1N2XA 2NTJA 5AK3A 2R11A 4FDTA 5KQMA 1CP2A 3DMGA 1BX1A 1RMTA 1VI6A 2VWPA 3O7WA 1DTSA 2J3IA 3HP1A 5FUVA 5F9FA 3UO8B 1R4NB 2CY0A 2YY5A 2CFOA 3NEJA 3L6DA 4KNVA 1BKSB 2CHFA 4WN9A 4D3YA 1PFKA 2YVKA 4EQ6B 4MWDA 4TROA 2SKCA 3DEJA 1XJCA 3SFZA 1WXDA 4PR0A 4B8YA 4Q9JA 2XOKD 1AKNA 2WJ3A 4UQLA 4M0FA 5HQ3A 1OIVA 1MABB 5ALWA 3K6KA 3TW8B 1LLCA 3MWYW 2VSYA 2J9ZB 3G68A 1E3WA 1W8DA 3AFGA 1RPAA 1XEFA 4GECA 5CJPA 1QHHA 3UH0A 1M1UA 2VQDA 4AMZA 2PUFA 4B3GA 2P0YA 2JI7A 1ZEJA 4HEA1 5IM4A 5I9TA 1U2PA 4HQRA 4IVNA 1IBMB 1IXRC 2HADA 2G25A 1P17A 4IIDA 2RJ3A 4YMUA 2IF2A 4ESHA 1JVBA 3ZW9A 1FFXB 1Z0SA 2XBMA 4Q4DA 1QLHA 5KPJA 2D5IA 1OOEA 1UAAA 2UZIR 1YZLA 2H48A 5ALDA 4GPAA 3DXZA 4YONB 3HSKA 1FP1D 4KQKA 1X19A 2UXBB 1KIMA 4RXMA 4JJ4A 4LXUA 1E2EA 2V8OA 2XPCA 5CIYA 3ZQKA 2B7BA 4JGGA 3UK6A 3H5TA 3BILA 1JNXX 1DBVO 3N2LA 4JOBA 4BQIA 1JUDA 2QEQA 1KO5A 1HEIA 1KP2A 3IH5A 3N8NA 4HZUB 4AT1A 4MP6A 2Q3LA 4HNSA 1N77A 3NUZA 3LDAA 4E0BA 3HXOA 3MHPA 2DEUA 1UEIA 3AG5A 1L4YA 2JAWA 1G16A 4IHJB 2FN9A 1F5NA 1RAGA 3P20A 3U39A 3DFMA 3C14C 5B64A 3DDNA 4AMGA 3R9WA 1GAWA 1XTUA 4KXYA 4L51A 4XWYA 4Y6RA 4D4MA 1YNOA 3H9EO 3WIOA 4CGZA 4DTIA 2OYRA 4LYGA 5WRFA 1WAMA 1F4LA 3RWOA 2AXEA 2WILA 1PG5A 1TTQB 2JAHA 3NDPA 3RARA 1ZD4A 3TLYA 3V9PA 4DA8A 1AUVA 5C18A 2ZTUA 3IP5A 3ZDQA 4U7DA 2HW8A 1P81A 3BE4A 4IW3B 1Q14A 4FJ1A 1MAVA 4WLFA 3KQQA 4OQDA 5B2FA 1YONA 5CA1A 4QELA 4XSHA 3IAUA 1O54A 3PGVA 3QUCA 5AYVA 1WDMA 1O0SA 3C97A 3PKZA 4RIFA 4YYEA 4B6SA 3WBJA 1DB3A 4Q4AB 1N4AA 1MOPA 1W49A 4B2LA 3OC6A 1P33A 3F90A 5I4KA 4ZC8A 3U5ZB 4QYTA 3HHEA 1EFLA 3LS2A 3ZGYA 3EIUA 3O9MA 1ZOOA 5KWIA 1R0KA 5IXSA 1DTEA 1W88A 3CRVA 2QN2A 4YRRA 2F8MA 2A3RA 5AKHA 4DS3A 1T36A 2ZVQX 1KYXA 2CUNA 2HQBA 4OIFA 3DP9A 3HGQA 2C4NA 3LYLA 1KBZA 3VRHA 1EK0A 2X0NA 1Y9DA 1YK1A 5B58C 5IKPA 3G5LA 3LQ4A 1KH2A 2PXXA 3IDAA 5BN3B 1NNLA 1GU0A 5CPBA 4PU0A 2QPAA 3TQFA 4CIAA 4IQ0A 3RTGA 1M2FA 1BMFD 1W35A 2FPMA 5JU6A 2GFIA 1ZK3A 1E8NA 2CLIB 1E6CA 1HI9A 1H0RA 1QG6A 2DSNA 4PPYA 1O96A 2PXHA 2WDPA 1PJ3A 2C2HA 3EGXB 4OBEA 1DU4A 1GV0A 3ZC3A 2ZYVX 1W1UA 3H8VA 3OM1A 3QUSA 4L1KA 4F5WA 3H11B 4MRMB 1W5AA 1UBKS 3O1LA 2ERCA 3JX9A 4NDNE 3U09A 1RBMA 3VTKA 5G4LA 2XX3A 1V7PC 4NMHA 5KOJB 5ALVA 2AFHA 3VR2A 3ROQA 3PEFA 1JKFA 1NJ1A 3TTWA 1IZYA 4JBXA 1JXQA 3RO7A 1OILA 2WF9A 4OHZA 4B35A 1YTLA 4JC4A 2JD0A 2DUWA 2NTNA 2NTYC 1U9JA 2UZ3A 1GUBA 5JJLA 3I9LA 1PJLA 5FBKA 1CBUA 3A6KA 1JTEA 1TM2A 2X9VA 1G55A 2EJTA 2Q1SA 3CSSA 4P7FA 1N2GA 2DOKA 5BO5A 3KZXA 2A94A 2BBTA 2N46A 4G1CA 1KMQA 3PEWA 1PJ4A 4UNPA 1CUDA 3Q3GE 3U4QB 5FNVB 1I7LA 1T2AA 1TL7C 3A36A 3WGHA 5KPDA 1F2VA 2C7OA 3OIYA 4A1OA 1UC9A 2BP7A 3GDWA 3KG2A 5KYUB 1UMBA 2X76A 2YRFA 4P08A 5HCIA 1DV1A 3DC7A 3EARA 2ATIA 3H8SA 4S04A 4NESA 1V96A 4HY3A 2ZIEA 3OOSA 4Y9SA 3PWTA 2YHBA 4KO4S 3ZYCA 4G9GA 4DQDA 1TZ2A 1Y8AA 2GA8A 5A6SB 5UKDA 3NWOA 4JA2A 3FVRA 1NTOA 3QFCA 3CZQA 3OOYA 4GMDA 1PR3A 2EF1A 5FHQA 2PYIA 3S68A 1ZW6A 2AKAB 1KAQA 2P6MA 3VZQA 5BSGA 2PMFA 1EJ2A 1FUEA 3QVVA 2O8FB 2GWRA 1J2YA 2PX4A 4N3AA 3P0JA 3SIPA 5JZ9A 1XMXA 1V3UA 1Y6RA 4YDHB 2DCUA 3CUKA 3KR9A 2XTJA 5NULA 3SJ7A 3MRSA 5JPCA 1CZOA 3EHEA 4MR7B 2XQGA 5L3SB 3RYCA 2ONKA 2B5WA 2EGUA 1M1NA 1QBKC 4NICA 1MX3A 5AWFC 5D6NA 4AL4A 4BJ3A 3GLIA 3DMTC 2MMCA 3WLNA 2FE4A 2OHVA 3LQKA 5IKOA 1U5BA 4QYIB 4XDZA 3P9QA 5KYUA 2QJRA 4G5RA 3KD2A 4BLSA 5M7EA 4Z4EA 2Q0SA 2AUTA 3IHTA 1DBQA 4GRDA 1I4LD 4G65A 4DLSA 5MFPA 1E3EA 4G6ZA 4Q3OA 1Q1AA 2AOUB 2Z2IA 4QREA 2WI8A 2BRUC 3AIIA 4P4TA 5CYPA 1U8XX 3PUIA 1PZGA 2C9DA 1UCFA 2NUAB 2C3UA 2ZRIA 3PL1A 3WICA 4DC9A 5JY1A 2JFQA 2C9ZA 1N0UA 4V3BA 5FNVF 4UULA 4KYIB 4ESEA 1XLTC 2HCFA 2X40A 1GG9A 3EULA 2H17A 4TVKA 3TQRA 1O08A 2QTFA 4L28A 3AEKB 4Q6BA 3RIXA 3EEYA 2F48A 2BEJA 2AWNA 5COAA 2JGDB 1YDHA 2PSDA 3VSEA 2X77A 2VZ8A 4OP1A 1J2TA 1YD7A 1FP2A 1L4FA 1WUYA 2YS7A 1L4EA 4G5OA 4N9WA 3IEPA 2HJVA 3O92A 4KB5A 2CB9A 4L9SA 4WKCA 3QF4A 5LWQA 3L79A 3UGTA 1UDWA 3CUEF 2CLFB 3I92A 1XTIA 1E7MA 4IXMA 2FQQA 1V2GA 2E5FA 2OB1A 3EGCA 3BX1A 2CL0X 3OTHA 4NR0A 4Q7MB 1KZHA 1NSYA 5C1DA 3JQGA 4BUCA 1WCIA 5FUXA 2IEBA 4ZHSA 5CFPA 1BVYF 2D4AA 4BB5A 3OFKA 1QPBA 1C3EA 5GONB 4DB2A 2HRCA 1VZ3A 5BSWA 3F7NA 1YQXA 3OD5A 1VYUA 3GELA 1XNRB 1PVDA 1KFBB 3FCAA 4MJ3A 5ER9A 3FB4A 1CUAA 4US1R 5BNFA 2BM9A 4L57A 1XCJA 3CUSA 3TRDA 3A7EA 4U7JA 4TWBA 4RZHA 4BVGA 4J03A 3WBBA 1JAZA 2AQHA 2OAGA 4ITRC 3TR5A 1A5ZA 5KYYB 2JFWA 3I4CA 3G1WA 4JYPA 3U7GA 5ANRB 2PN1A 1ZLXA 3GCWA 3N07A 3QJ5A 3SDZA 5TF4A 3UH1A 4CWAA 4KREA 1U7UA 4YALA 4U39A 5AM4A 1IC6A 4YRDA 1ONNA 3HCAA 3S99A 4DV2B 8AT1A 2QUIA 2J45A 1C7JA 1PK9A 2E9SA 1G6HA 3FWZA 4JQSA 2BJWA 1ZJJA 3CPHA 1L5YA 2O2IA 4FC6A 4L72A 4OMDA 3SX0A 3VC7A 5C32A 1K27A 4CLOA 3QITA 4LF9B 1QOQB 2CV2A 1EZ1A 1YHNA 1NQWA 2P90A 4FZ3A 1P0FA 3LPLA 4HGZA 1T3HA 1N2CB 3RDPA 4EOGA 2TSYB 3QFTA 2WFMA 3GOQA 2RONA 1CQIB 1OLXA 3CVVA 2XT9A 2FNAA 1HOXA 4IXWA 5HS6A 2F8SA 2FZCA 2ICAA 1NZJA 4F38A 4FB4A 3KQUA 1JDZA 4OQXA 2Y1KA 5C52B 1HZJA 4UE6A 1CUFA 3IFSA 4XIFA 5D2CA 4KR2A 4QGFA 4Z7OB 2QVGA 1KMHA 3W3AA 2P79A 4ZVQA 4B3IA 4K6GA 3KFXA 7MHTA 4OB8A 1KMIY 1KR2A 2F1OA 3FPGA 3JZIA 3LYHA 3HVRA 4DM3A 1VPWA 4TSKA 2IS2A 3FGNA 3F74A 4P2GA 1GY8A 1Y9ZA 4DUPA 3AXSA 3TSZA 4MO9A 2E49A 2BBSA 4TMZA 3RF7A 3WYBA 1MENA 2I78A 1TEXA 4E5DA 1EA5A 1KBOA 2WLTA 2C0QA 1NUQA 1P0MA 3GA0A 2CLEB 3JS5A 1Y34E 4CKXA 1GNLA 4DCOA 4YAUA 1DCMA 2ZIFA 3R6TA 1P3JA 2GEVA 5DGCA 4URVR 3TSCA 1PT7A 2JG3A 3F4LA 3DVRX 1KEZA 1DC4A 2AYXA 5HA5A 1AKMA 5EMMA 1A9XA 4EHLA 1VIVA 2OCDA 1QM5A 2FMIA 4RZIA 1LX6A 3OQ6A 4ZYYA 2B5OA 3QM1A 3R5FA 3WGZA 1A96A 3UA4A 2HPHA 4A03A 4AKEA 3MQ2A 1XZ8A 2H7CA 2Y1GA 4Z4FA 1AQUA 3DFZA 4FB5A 3WLSA 4J0IA 3UWKA 4BCCA 4M1SA 4QODA 2VJMA 4M38A 1MQAA 3I37X 3IQFA 2GYVA 2O0KA 4YAEA 3RSCA 4XYEA 2BKXA 2AC4A 5F5LA 3DQQA 3FFWA 3VOBA 3BS4A 3OX4A 5JR3A 3JD2A 1Q74A 2CMDA 4Z3KA 3VDQA 4C08A 2A7QA 2RSLA 3GGPA 1D1TA 5I3ZA 4JB3A 1Z4QA 2PBZA 1N25A 4BX2A 5LJIA 2WZQA 3SC4A 2OM6A 2RGEA 1XEXB 3DAGA 1VP9A 1CPYA 3DB1A 3KOMA 3T5MA 5KC8A 1ISFA 4HGNA 1WB9A 2JVJA 4JKOA 4PLCA 1XPJA 3F8TA 4M87A 1JQJC 2E18A 2BEVA 3BD7A 3RU2A 4HRAA 3H4VA 3K9FC 1AS2A 1EP3B 1JKXA 4PGMA 2AH5A 1E5QA 4N39A 2FPWA 3ZW8A 2Y0BA 4LF4B 2RAUA 1L8QA 2OAQ1 5TMEA 4EMUA 1BRTA 4V0MA 4CTMA 5J63A 1KI6A 1KQGA 3IQGX 3RFXA 4FXOA 2I8LA 1MD9A 1YJ5A 4X95A 5JAQA 1W6UA 3HUFA 4HJRA 4I8XA 3BHJA 4Y1EA 3VSAA 1UFKA 3DG9A 5H5JA 2TYSB 3RBVA 5KYYA 3BA6A 3RASA 3P1JA 1QFMA 3UHAA 3W9SA 3QK7A 1VHTA 3ZEAA 5GTDA 4FDLA 1YZFA 2BI4A 2HK7A 3IMGA 2YZKA 4KLCA 1ZOLA 2Z9DA 4KQ1A 2DQZA 3A3YA 1SB8A 4MI9A 2Q5EA 3HM2A 4OHUA 2Q6LA 2WKPA 5HRAA 2JPDA 1WRBA 4P3YA 3V34A 1B0ZA 4ER7A 1WU7A 4HO1X 1TYCA 4XARA 3U9LA 1HNNA 1NLUA 1DAEA 3LFHA 4BFZA 1S2DA 4H18A 4LECA 4DRYA 1YMVA 4NP6A 4ZT6A 2FPUA 1LQTA 1R16A 1T4GA 3WLLA 3B5IA 5I7HA 2ECPA 3ZHRA 2HT6A 2POQX 2D0IA 1DRJA 2JK1A 1F48A 2ECFA 3ZIDA 4YXWA 5JWHA 5JD6A 4GBJA 1RJ9A 1F6WA 1D4ZA 1S3GA 1UPCA 1NXQA 3BE5A 4UBNA 2H29A 1M67A 3KD3A 3U0VA 4YP6A 4JCCA 2QE6A 3D7NA 3IV6A 2YXDA 4FQ7A 1VG0B 4WLOA 4Q1VA 3LHIA 1Q77A 1AVTA 4ZZIA 3CM0A 2WR8A 2VJQA 1PS0A 4YECA 2AMVA 3PRJA 1JDJA 1DMSA 4BVAA 1KJQA 5ED0A 5FB3A 1L7OA 2P5YA 2W6IA 4UUPA 5CUQA 2XGOA 4P7KA 2BGRA 5HQTA 3NIGB 2FN4A 1FFCA 1BW9B 3FUXA 3PGXA 4BO1A 2WHXA 3WWYA 2VDWB 1BDJA 4QKQA 5IFLA 2FEPA 1R9NA 1DAOA 1XP5A 2C5AA 4PX3A 1RWMA 4MUYA 2POCA 3WNQA 4HTAA 2Y92A 4CM8B 2HHAA 1CC1S 3GIWA 5IJWA 3OLQA 1EGQA 2PGLA 4UEQA 4BO8A 3VJLA 5A03A 5KYXA 4ARCA 1PJQA 1HO3A 3FLEA 2Q3BA 4FKBA 1WXXA 4CVNA 1JJIA 4ZEVA 2HWYA 3OTQA 3PYMA 4MA5A 4FK8A 5AXDA 5L7TA 2ZWAA 4C4SA 1AQIA 3L8CA 4OXXA 4YMIA 6LDHA 2IZ6A 2BI7A 1FTNA 5B12A 1M1ZA 4DRXB 2O1EA 3NWJA 2O3JA 3OEHD 5FL7A 1P4RA 3THWA 2PV7A 2Q3HA 2VYVA 2H59A 2JIPA 3E18A 3D5QA 5SZKB 1H9BA 2HHCA 1Q11A 3MT0A 4FR5A 4K87A 4ZAYA 1L1RA 3QWAA 2YWHA 1RKUA 3T8YA 4OIMA 3C6BA 4ENTA 2NPIA 4J0QA 3OQMA 3D59A 2G9ZA 4IH9A 4DT1B 3CBGA 3NHJA 1YASA 2X4IA 2YN0A 4F3NA 1XU7A 1D1SA 2WP8J 1IEXA 1OFVA 2QHXA 1DKQA 4LY3A 5DMXA 3SEZA 2WVGA 3X43A 4ALIA 5GZ6A 3EAFA 5AFSA 1JLMA 3QBEA 4ESVA 3F7OA 3DE0X 2EJUA 5JALA 4YDRA 3HDTA 4I36A 5FV7A 3KQHA 3NAMA 1RLIA 1VJCA 4H3SA 2R7LA 4C2BA 2C2XA 2WG1A 3CJQA 2P9HA 3KAQA 3ORSA 3PUZA 4X54A 1E20A 4WT7A 4XD2A 3KQLA 4JVSB 1OTHA 1XLWA 1R0WA 2AKYA 3O74A 4RGVA 3EJWA 5GGYA 3BWEA 2W70A 1EGHA 1D2HA 5EUCA 1BN6A 1OV6A 5A5VA 5IXJA 1CS0B 3NYQA 2HEIA 5D1NA 3E3NA 2C31A 1GTMA 3GARA 3LNCA 5HJ7A 1TK9A 3V7FA 5ALKA 4G84A 1G60A 4KL8S 4G26A 1EVEA 4AF6A 4O25A 4O4IA 2ZIVB 4ICIA 3FPSA 1G64A 4MYUA 1W75A 3CLTC 2IHBA 4L9RA 5F78A 3FR8A 4ZCTA 3AVWA 1FUUA 2BH2A 1J49A 4YAKA 1QSGA 3BGVA 4Z0TA 3CF4A 2ZPAA 5J2TA 5A3QA 5GP1A 3CWCA 1NATA 2NVOA 2ZIZA 4ZAFA 3FVQA 3PFCA 1IWBB 5CLHA 5K3FB 1X3LA 3M6UA 3O3OB 4PAGA 3WL6A 1U2TA 2O0JA 2CKDA 2CDNA 2ZJ6A 3R5KA 4BMVA 1KVRA 1BWPA 2QA5A 3BMXA 1ZWKA 1WCXA 3Q7PA 3S5JA 2XWPA 5FL7D 3HNRA 1TT7A 2ZEJA 2ZIAA 1QFYA 1PS8A 2HTFA 3DFIA 3EGDA 3G9QA 1H1LB 1JXOA 1GPWB 3EMVA 2DPGA 3H13A 1SKQA 3MELA 4MA0A 4NE2A 1WQ4A 3FNQA 4ZOBA 2D54A 3WP0A 3ZHTA 3HUEA 3KSZO 4UUOA 2P27A 3RG2A 3VO8A 1FBTA 1ZCAA 1M34B 2ISQA 1ZRSA 3GJ6A 4HXGA 1PZEA 3VU9A 1XNQB 3GLGB 3PFIA 1M54A 3TDMA 4ZYUA 1OI3A 2FH5B 5JCXA 4H1TA 4Z2YA 2XTNA 1PQYA 13PKA 2B5VA 2OR3A 1FK8A 2YHIB 3E9EA 3GQVA 3KQOA 4FEYA 2H4ZA 4A7PA 4CE6A 5BNZA 3EJ6A 3OT1A 4E94A 4QM7A 3O5AA 2JLSA 3K2BA 4GYWA 5T41A 4FYIA 3OH8A 4CETA 1SXJE 3U3JA 1JBKA 3P26A 3A1VA 3GRPA 4TUYF 4ZU1X 1KP9A 1XN4A 3ZWYA 2PKRA 3QVMA 7ADHA 1EFHA 5M2QA 1X39A 1W4BA 2MOKA 4FSDA 1YRQA 3T0GA 2G0NA 2J7KA 3GDGA 3K0CA 4LSWA 2B37A 3HLTA 4UTRA 2WWYA 1WP9A 5HUQA 4JR1A 3M1AA 3VPGA 3PTAA 3B3GA 1K7FB 2NV2B 4MK4A 2IH5A 2H0AA 2HSZA 1QJCA 3LH5A 4DLPA 1NIJA 1T5IA 2JJ1A 3E7PA 5BNTA 2B25A 3K1AB 5LZ2A 2FW0A 2D5AA 2HSJA 3KYDB 1IEWA 4TMYA 4WFKA 1SIWA 4Q4CA 1CB0A 4X1OA 3R4VA 1B3RA 1NULA 3WSWA 4UU7A 4G0XA 5H4GA 3DD5A 3GDFA 5EIHA 1BEEA 5M5BA 1I94B 1P9RA 3T5GA 3P2YA 5EQTA 1ZA1A 3SI7A 2ZP1A 2JW5A 2NXWA 3MWLA 4UEKA 2OO7A 1X7ZB 4QARA 5J59A 1G3UA 3CRMA 4LTNA 4LN1A 4M8KA 4ZCIA 4N6NA 3VZPA 4AC9A 2W11A 4UVDA 2C9MA 3TQCA 1PTJC 4BKQA 1OAAA 4DPLA 1DJNA 1TAQA 4YJ3B 1J8FA 5CFRA 2YWRA 3VR5D 2AA3A 3KT0A 3CNQS 3PUVA 5C80A 2W4MA 3NDIA 3LRXA 4NS4A 1ES9A 2GXUA 4OFBA 1YFJA 4AF8A 3PXXA 2O0HA 3B52X 5C5EA 3KQNA 3CX3A 4NULA 1W9MA 2PA0A 4OKNA 1RBYA 4YUZA 3WLAA 2B30A 3DDWA 1IXKA 4S05A 3UOWA 4K6KA 4J0CA 1FUIA 4LZNA 4AROA 3NOVA 4N0QA 2XCOA 1E9RA 3QW2A 3OLCX 3BMOB 2OXRA 4QFMA 4L07A 4B81A 2VJAA 2YJGA 4LUCA 3IPRA 2F8LA 3HGTA 4MROA 4RHFA 3SE0A 1OWMA 2RJNA 1EBBA 1IZ9A 3HCWA 2QIPA 1XWFA 1J56A 2BKLA 4WZ6A 5F7JA 5KYTA 5LOVB 1XU4A 4OJKA 3P0HA 4KWCA 1UKZA 4ENWA 2PT7A 3M5DA 4I66A 4X6UA 3TTUA 5LMZA 4HJXA 2UXCB 3QWHA 4BV9A 1I0IA 3ELBA 3KE9A 4LV5B 1ZI6A 2PRJA 4KH0A 4CM6A 5KOHB 3L0SA 1ISSA 3SSAA 2F9MA 2O5VA 4FHGA 4PSKA 3D8UA 2FQWA 2QSZA 3E7WA 2QXYA 3II6X 2IBMA 3FWNA 3K5HA 1UMDB 3NH9A 4FMCB 4MS4B 1Z8HA 2XUKA 2QTTA 3AUTA 4J76A 4JGIA 4YMVA 5KNDD 1MB3A 1NZFA 2AC7A 1R4MA 3T7TA 2HXYA 3FJ1A 1F8UA 2QE7D 1YQTA 1L5NA 4N6OA 5A02A 1CS0A 4BMNA 1B8UA 1X15A 3OJCA 2CLOB 2I62A 1SZDA 1VP3A 2JCVA 3VNRA 3OG9A 4FN5A 3ZD7A 2CK3D 3KYCB 3R9XA 1XWWA 1M0EA 4UM8B 3NS7A 3S27A 2H85A 1ADBA 2EQ5A 3AUJB 1C0IA 1MX9A 1Y8QB 1NT4A 2XCUA 3CCCA 5JD5A 1VKRA 3RUCA 2WM2A 2VDVE 4B9AA 1OX4A 4RZSA 4GDFA 3TZEA 3TZHA 3B3JA 2AJTA 2NTEA 5EUMA 4C6RA 4E1AA 2BFCB 4LOKA 4KO2S 1QXSA 5JDCA 2DWOA 1C2TA 3BFVA 4O2AF 5BSFA 5BVGA 2XXAA 3I8SA 3LCUA 4HLUA 4BKUA 2WHPA 3CLRC 3UAGA 4O4IB 1T3TA 5LQNA 4L6CA 3RFTA 1ZJ6A 3DOIA 3GO4A 3O03A 5B53A 1TZMA 3I9V1 3BRCA 3SC2A 3SSMA 2WYUA 3P4XA 4LZPA 4PE5B 3SR3A 5KYWA 4GF5A 4E4YA 1L7VC 5TRTA 2NSHA 4KMMA 3V7WA 5TGDA 3DBIA 4KIJA 1EVYA 1U9CA 3UF0A 5HYVA 3GOHA 3GT7A 3KR2A 2GWHA 3MWKA 4LYJA 3BMCB 2ZTHA 1KBQA 3A1EA 4R1NA 4LZAA 1NBIA 2B4RO 1PV4A 2C1XA 3ABOB 1A4RA 2WWTA 1TZCA 2RHJA 4OSPA 2WDZA 3BXGA 2IBSA 2HXSA 3NQ41 3C45A 4N7BA 3WMGA 4HWTA 3IQDB 2B8NA 2XXJA 1G8MA 2OG1A 1IMJA 1TAGA 3FETA 5FRDA 3LDFA 5I7FA 1EQAA 1G21B 4HEJA 1OH5A 3CYFA 2XR1A 3G0HA 3S81A 5BMVF 2Z9CA 5JS1A 4QAQA 4PVDA 1AKVA 4MQLA 1NQUA 4R68A 3BRSA 5T4EA 4KW7A 4W1RA 3K72B 3UZUA 3ZKAA 5JWRA 4QUDA 3AXTA 4Z1OA 4QUAA 3RTEA 2MSKA 3A9WA 4LPSA 1IM8A 2GAJA 4H7PA 4Z86A 2WE8A 1T8SA 1R8XA 2D0DA 2C3PA 2IDMA 1WL8A 3FUVA 3EZ6A 3CWQA 1MA0A 1D07A 3P2MA 5TMDA 2FQYA 4PR3A 1YHZA 2PE5A 2HN9A 3TW6A 1ULSA 1QV7A 2ZS7A 4JVLA 4QATA 3CVJA 3DXXA 3E5RA 5B57C 3P5SA 5J43A 4H08A 2ZRGA 3HCOA 4F71A 2Z98A 3FMOB 3Q10A 3V6LA 2WJPA 4GSKA 4OJQA 4RVOA 5FWDA 4AY4A 5K05A 2C7GA 4F6LA 2BFBB 3N7TA 1NU6A 4R1MA 4BQSA 1J0DA 4FOTA 2Z3ZA 5E2BA 4Q82A 4RMGA 1JAIA 2NNWB 4M1WA 3UUEA 1UFVA 2G17A 3NGXA 1S8FA 3DP7A 4WZBE 3P52A 1PUIA 3F2VA 1Z0FA 2G5GX 3I01M 4MH0R 1G6KA 2JD1A 2Q3JA 2R2GA 2VDMB 3C43A 2B20A 1MIOB 5ECWA 3ZDXB 1Z83A 4CLEA 2QRLA 5AW0A 4ED9A 4KKXB 1QCDA 4WA8A 2G1UA 3JQAB 4WOBA 4W8OA 3GJZA 3M3PA 3KQWA 3NHYA 1OXXK 1P1RA 1ITZA 1QG0A 4KO1S 3HB1A 4LDRA 3SR0A 5JDIA 1R0CA 4Q02A 1DRUA 3WHKA 4K9PA 4Z4IA 1EP9A 4JC8A 5DW3A 3RC1A 4PG7A 3UHOA 2I87A 2BKVA 4MR8A 1DFIA 4CG1A 4FDUA 3OFND 4P80A 2BE7A 2ECOA 2XJ9A 4P53A 3GZNB 1PF7E 1KYYA 2DRIA 1DS6A 3EH1A 4RIEA 1EXDA 1LS6A 2P9YA 3W8NA 3RG8A 2AHRA 1BX3A 2PEZA 5LUAA 1SHTX 5TB5A 5LA6B 2GAIA 2XF8A 3M6XA 1WCWA 4NONA 3T9CA 4E5VA 1UBEA 1Y7IA 2UZAA 1U4NA 1TRKA 3FYUA 1TEZA 2R5WA 3MBIA 4P81A 4HX9A 5JADA 2WICA 4TRMA 721PA 3HJFA 1C30B 1DRKA 1R5BA 1P3Y1 4C1BA 2N3ZA 4J1TA 4B4DA 4OK6A 3C3EA 3USZA 3ANNA 3RNLA 3WDLA 2A78A 1YS1X 3MWFA 3B3AA 1TUBA 2F1IA 2J3EA 3DE5X 3S2ZA 4DNQA 3FGPA 4XGKA 4ZCQA 1CDOA 1S2NA 4JR0A 1U6JA 4I4LA 1LLQA 2IX9A 1LFDB 2ZI6A 3H6KA 2JD2A 1U2GA 1V8FA 5AXBA 1N5OX 5AVUA 3S55A 3C85A 3V2HA 1RI2A 5KNBD 2O19A 2N1BA 4D26A 4BJ6A 1OBOA 3WYNA 4LAFA 4WCVA 3L40A 2RC6A 3GLUA 4B09A 1NAIA 5SZHB 4LFCB 4E03A 5I4BA 4QT0A 2H65A 3NTVA 5GQSA 1TQ6A 2HEGA 3LY5A 3RVQA 2CNKA 4TTIA 4E32A 1DCFA 4Y6OA 1DWUA 2XUJA 1F0PA 1SELA 1H23A 1N8SA 2EFHB 3E6AA 1XK7A 2D59A 3KC2A 5DJ5A 4RTKA 4RETA 1LSJA 3BQ9A 2QRZA 1VSQA 3FKQA 5ELXA 2RGRA 2JCXA 2VAXA 2OGWA 3HCFA 2JGMA 4Y2HA 2CXQA 5K7SA 2FVXA 4GGPA 5B3LA 4LJKA 4QVGA 3AEKA 2PZMA 5BV8A 3CEHA 2CHUA 2D2IA 1G8FA 4P6VF 3IS3A 4G85A 2FRDC 2EARA 3K35A 2IX3A 2B82A 2E7ZA 1ZQ1A 3FYDA 4HYTA 4Y67A 4HYQA 4RK4A 5SYNA 2ON6A 3T6KA 3UT6A 1UT6A 2QRNA 1T0HB 4TRRA 3WRVA 3THXB 1PP4A 2ATVA 2ZETA 3HCCA 4NOJA 2IYOA 2ODQA 3R6GA 3SHTA 3U7JA 1KWGA 2F7SA 3TB6A 2VT7A 2OXIA 4FONA 4O4HF 5A7FA 5K8JB 2OCAA 3TPZA 4E07A 3DW3X 3VO1A 4B6JA 3WFIA 4ES6A 2YYSA 3N3BC 3NVKI 1KE2A 3B7GA 3E0XA 2B69A 1ZNXA 1JB9A 3BWBA 2PPVA 3HCRA 3DKIA 4PLPA 1EBFA 5AO9A 2H1FA 3FPEA 3TLBA 4DA0A 5JO0A 2BLNA 2XNDD 1TTTA 4LVNA 4KQHA 5BURA 1QE0A 1JFFA 2GKGA 2RHRA 4PRYA 3I9OA 3RANA 2GJAA 1O57A 3SNHA 3C1TA 3EFEA 1Z4PX 1E4OA 4J4TA 3GQBB 3SDBA 3VVMA 7REQA 4AWBA 4X20A 2PVSA 4C7JA 1I3CA 2GNPA 3C3CA 3QWIA 1HYQA 2YXPX 2HH9A 2DFTA 2PSJA 3L9WA 3SIWA 4EHHA 4RJ2A 4EYSA 2E2WA 4K9QA 3IELA 4EFNA 3ZKWB 1GCOA 3JYHA 4NU0A 5JEEA 1EUQA 5DN9A 4KNYA 1VE6A 3K8QA 4UZFA 4I4TA 2GAFA 1CW2B 1RS0A 1XF9A 2ZWPA 4JOCA 4B3HA 1BHQ1 4WADA 5EOVA 1HFEL 3OZGA 4BLOA 2GKSA 4N03A 4MW6A 4IMIB 3ZYZA 2P9GA 4F9TA 1YT5A 2QK4A 4XYBA 3PHBE 4LVUA 1BE1A 1QVVA 1R8SA 3ZWXA 4AM8A 3K70C 4DIKA 3WK5A 4WNCA 1PYOA 5D3ZA 4JYZA 2VPPA 1Y82A 4C7KA 1NN1A 5DNUA 5KSWB 4FFSA 1ESDA 1T9HA 3NUQA 4ZAZA 3RIEA 3WNBA 4TYMA 4EPTA 2R87A 3DPIA 2C99A 3NIBA 3OCWA 2IPNA 2W0MA 3G8YA 4YASA 2CVOA 3GA7A 1PCXA 1QGOA 3QPWA 3OJOA 4TLAA 2NUBA 2IXDA 3CISA 821PA 2Y93A 2VNHA 3K0CC 3KLNA 4HKTA 4RLQA 1MOZA 5TVKA 2R9VA 2GCNA 4BMZA 5KYXB 4AJPA 5TV2A 1UC5B 4F21A 1ZL0A 4TMWA 5FUQA 4L73A 2BMFA 4ZO6A 5JYBA 2YN2A 5FTNA 2D1QA 3FTNA 4HUQA 3H9GA 4LDAA 4LV8B 4MAAA 4D9HA 3BMQA 3UBMA 1T0BA 4EJSC 3ZCRA 2GJKA 5K8IA 1SC1A 3OMXA 4DQKA 3QKRA 1YCHA 4HYEA 4IQFA 3CU5A 4IDAA 1PDWA 4BZWA 1ZONA 4QUKA 5HG0A 4JBGA 4CDRA 3ICCA 1YE3A 3L0DA 3ZVNA 5DI9A 3LPAA 3MMXA 1QHSA 3NALA 3QU9A 5K6RA 3S5UA 1FX0B 1QIMA 4IXTA 4EHFA 2WYHA 3KLBA 5A3JA 1J5EB 4IIYA 1EFRA 3D6TB 2Y05A 2GESA 2OGSA 1OAOC 3ELYA 4B32A 4WJLA 5HR5A 4KPFC 2JLUA 2B4KA 1ORHA 3Q9SA 3QFFA 2HSEA 1ZM4A 1I4OA 2AE2A 2YXEA 1C0EA 4POAA 5AHXA 3W6PA 1E1LA 3OIGA 3ZCPA 3ECSA 3HVIA 3NOXA 5KNDH 1RZRA 1VGVA 1NDUA 1ZNZA 2E4XA 3I4FA 3DOHA 4JLUA 4M7OA 4AXXA 1TMYA 2HWWA 1GA4A 1JQDA 1RM5A 1YS4A 2ZJ4A 1NBEA 4D25A 3LQYA 2FV8A 1XXLA 2VJNA 4Q03A 5EJMA 4AJKA 3IPLA 2PRYA 1PU2A 3BXHA 5A1JA 2JZOA 3H75A 3I2JA 1HK7A 1C1DB 2ZRFA 3M1LA 3WYDA 4J7UA 4OHRA 3LPCA 1RYBA 1WTCA 5DISB 4Z7JA 5T6MA 3VJRA 2P9BA 3GN2A 2DX7A 4BVJA 2FPGB 2J59A 3KU1A 2GPWA 1C30A 2IPAB 3BSWA 4CLDA 2YX1A 4Z9AA 1J9EA 1YQ9A 1SXJA 1O94A 3NM6B 4D43A 4RACA 5CIQA 4ZQFA 2H54A 4XPIB 5DTIA 3DZIA 4W1SA 2OXTA 3SMVA 3VHXA 4BFYA 3UUWA 4RTQA 2O8DB 1R3UA 1JBEA 3BE8A 3W5CA 3UAVA 2WOJA 4PHGA 1U80A 3DBRB 1T2EA 4B8ZA 1YV9A 5C4MA 1KTVA 4N5MA 2RB4A 3LLUA 3HRKA 1FMJA 4TMFA 1VXRA 1K6JA 4ZU6X 4P7JA 2P4SA 5TLSA 3ZI0A 5MFZA 2X1HA 3AY3A 3IA2A 3FVTA 1IB0A 5FEMA 3TUIC 2C2BA 2CLMB 3A27A 3KPJA 5EN4A 3DZGA 4W7IA 3V33A 3VHRA 1A9RA 1ZN7A 4OQEA 5GAJA 2I91A 1ORWA 1RJWA 3OIUA 2F00A 1MEEA 4RPJA 1F5SA 4EW3A 4F4FA 1SUDA 1DBPA 5E0OA 1G7CA 5GIPE 3SZGA 4FCCA 3S0JA 5BWBA 1J22A 3ICPA 5AKYA 3B6MA 1VGQA 3T9AA 3AJDA 3LUAA 4Q3KA 3VA7A 4FD3A 2O2GA 1U5AA 4UVIA 4CV3A 4HDAA 5FDFA 1KPGA 4JI1B 2V7XA 2ZRBA 4MJLA 5IKMA 1KI1A 3FAZA 4TRNA 1VLVA 1RZRD 2HSWA 1O95D 3AHHA 1G8JA 1JILA 4G5SA 2VSXA 2EGGA 2FK8A 4QL3A 3LW8A 3PLNA 1GCGA 1ZHHA 4Q4HA 3GUUA 2RHBA 4LJRA 1H2AS 4XWOA 3K5IA 3D3KA 3AR3A 1HQDA 5GJCA 5U9CA 2NNLD 2BUAA 5AK5A 1M5RA 4KDEA 4M36A 5CLQA 1Y7PA 1WHSB 3WL8A 3WK4A 1HR0B 1BD4A 1EX6A 1E5DA 3K20A 2JKVA 5IVIA 1SQ6A 2J31A 3GJ8A 1RAFA 1UQUA 1WTAA 1YKGA 3PNYA 2GAAA 2OZVA 2JLBA 3HCDA 2R8BA 4FZRA 3VJMA 4HT3B 4UU8A 1E58A 1II0A 2IVFA 2YVUA 3UXEA 3HV2A 5EXEA 3BKXA 4MDEA 4C20A 4I5IA 5CW2A 1WZEA 1I7NA 5GV7A 3KLMX 2AEMA 3DQPA 4JLKA 4C7MA 1MORA 2WKWA 5H68A 3TECE 2YZGA 2OAEA 5CVTA 3SOZA 3G5AA 2QRQA 5DNAA 5INTA 2QTNA 1Z2OX 2YVQA 2VT6A 1S6YA 1LLDA 1P1CA 1UEJA 1PGPA 1Y7HA 2QJTA 2ZJ1A 3K7EA 3OZAA 1Z62A 3U3RA 5JD4A 2CXNA 3EGWA 4YP5A 3U9TA 1P8AA 1XQWA 1XRPA 4WKNA 1EHCA 1J7KA 2HJRA 1N6OA 2ZDQA 2ZBGA 3PRKE 5AJHA 4DJAA 1XMPA 5KQRA 2HF9A 4FX5A 4US0R 3EIHA 4XGIA 3CTPA 5AM0A 1GRVA 3THWB 5I8ZA 1NKSA 2AS0A 2Q5LA 4RMHA 4BJ5A 5AM3A 4PIMA 4A3SA 1SIBE 4JEUA 4DDHA 5JS8A 1RBZA 2GLXA 3S2FA 3JZMA 1T0IA 2J9FB 1RJGA 3EVEA 1N57A 1OU4A 2D3WA 3NP7A 3P2IA 2O2SA 5DWDA 4CMBA 2HRDA 1NMQA 2AOTA 2F1KA 3GGOA 2VWGA 2DPYA 5ALLA 5FOWA 4B40A 5B55A 2GHRA 1AK2A 2NT4A 3ZGZA 2NUTB 1CZLA 1Q1EA 2OCKA 4MHSA 1HORA 4I2VA 1SVIA 4LGVA 2C5GA 3UJ9A 2C03A 3FM9A 3TCNA 1ZHFA 4M98A 1Y5RA 3WGLA 3QLJA 1W5BA 3HU3A 3CBQA 1Z4JA 2Z5VA 4KTVE 3ZCVA 1FC0A 4K6FA 4HSGA 4AUEA 2RAVA 2WVAA 2IE0A 3NT5A 2GSDA 2VQFB 4KYTA 2CW5A 4CUZA 3TLJA 1X1RA 2YMLA 5HKKD 3DEIA 2BTEA 3VR6A 1PE0A 2FHPA 5LQKA 1XDBA 2XSZA 4JDUA 1JL3A 3MJRA 4J49A 2PS3A 4U7WA 4BNYA 4ECEA 4QTXA 3HACA 3D6MA 1C80A 5A5DA 2IZ0A 1HEUA 3DZKA 3OO1A 2NU6A 2GZ2A 2XQJA 3I9V6 4Z8XA 3ANTA 4DA6A 1EVLA 3B70A 3I05A 1XD8A 3O94A 1RKXA 3OZCA 3ZLVA 2BM0A 5E4JA 4DMLA 1AS0A 2W7TA 2GCIA 1RD4A 3I2YX 1V5IA 3IVXA 4FYPA 3WQBA 3IP8A 4IJUA 4LE1A 5B36A 1JLSA 5EVJA 5F1OA 2BH9A 3EF1A 2RHHA 2XRFA 2RGGA 1P2SA 1JKIA 4ODIA 2FDRA 4J1NA 5B1DA 3RTBA 3L0BA 3AF1A 1CR6A 2AE1A 3ED1A 3WLJA 3E7XA 3TIVA 4BBZA 2R1TB 4D4JA 3LZDA 3T3DA 3HSSA 5DOZA 4BOYA 4F8EA 5JXHA 1ZZEA 4CN8A 3M4ZA 4A5OA 1VQ1A 4EUEA 2XWQA 1UBOS 4UCXA 1XD2A 1JHQA 3AB8A 4IIHA 5PNTA 3KAPA 1ILWA 1U8FO 5L9AA 2BZSA 4B47A 1E2QA 2QXTA 1JLLA 3BA1A 3MNFA 1MAAA 2PLFA 4FHFA 3HUDA 4R8SA 1KI8A 5FOUA 1MNQA 1N5LA 2HMYB 1PT9A 4PPNA 3V7NA 4IGEA 2BY4A 4NJEB 1MJ5A 4Q3LA 4GX1A 5EJEA 1MRZA 2PJZA 3VAZA 4TMTA 3HC7A 4YV2A 3GRZA 3QQPA 3KPWA 1CV2A 4DIOA 2ODNA 3FYSA 3ISTA 3PBKA 3FCUB 1MJNA 1ADFA 4P92A 1P44A 4NAHA 3CIFA 1WD7A 1USUA 3GFBA 5LZ7A 3VUFA 3JW8A 1DAMA 2GJSA 3DKRA 1OXSC 1R4NA 4PZAA 4X91A 4D4GA 1QZTA 1LPNA 1G21E 4EO9A 1VFNA 3H17A 5IAGA 8OHMA 1KO8A 2SICE 1W4AA 3ENVA 3GJYA 3NX4A 4MUJA 5K3OA 3UPTA 5BR8B 1IN7A 1MF7A 3FKJA 2RAFA 2CBGA 3V1LA 2BVNA 1GD1O 4G2NA 3TEFA 2J3MA 2PWPA 2XMDA 4B84A 1V25A 5JS2A 1U98A 3ACCA 2P6PA 4J1QA 1ZMOA 4TVBA 3BXEA 3DWGA 3IP1A 4E5MA 3FOZA 4PYIA 1YCGA 2BSXA 3JVEA 1S3IA 4G4JA 3DKVA 1RJ9B 4AULA 1HLPA 1K89A 3NBUA 4XRGA 1WABA 1F20A 1VBFA 2MSDB 2SCUB 1Q2UA 3BKWA 1NNEA 4GIBA 3MTDA 3JQ6A 4Z7QB 1E6WA 2BMAA 1VG1A 4FLEA 3EGVA 4GX2A 5DZSA 3WXBA 1DEHA 4ID9A 3IXMA 4RPKA 4F56A 1ID1A 3AUYA 2MCFA 2PLNA 1NN3A 3GQBA 4X60A 1W5SA 1JFRA 2DQ4A 5L3VA 3BRQA 4QXPA 3NAGA 2F3SA 2Q2OA 4HGRA 4D6PA 3GFGA 1T3GA 1TIBA 2F67A 3RSFA 3TD2A 1WDKA 4AO6A 3VM6A 3BGWA 3FRHA 1RW4A 4MA4A 2FEKA 1C1HA 2VCEA 2X8JB 3BD6A 5CT5A 1YDWA 3H11A 2K5UA 3PDWA 3GPDG 4MRMA 4WLVA 3SZOA 1ZGAA 4WK0B 3KTFA 4YRQA 4YMHA 1ZN9A 5I7RA 2OFPA 2Z1DA 3T9DA 3ZDFA 4CEHB 1T4DA 4IVRA 1ZGHA 4XIGS 2P9JA 5JECA 1NN0A 1GPDG 1U31A 2UDPA 2Z2YA 5E4FA 1E3DA 1D9XA 3VU9B 3VXKA 2D1YA 5C8YB 3ORFA 1TXGA 4WCFB 1YB6A 1U7DA 3EVFA 4I1UA 1U8UA 1VA5A 4MCJA 1U8YA 1JE0A 4EGAA 1AZSC 2PTGA 5ABPA 4PCAA 3LBHA 3TQTA 5F98A 1AQ6A 2YUIA 1WMDA 3IRUA 2BDUA 1GO2A 3FWYA 4FCTA 3NCHA 3HY4A 3N0RA 4QD3A 5A9SA 1A88A 2C8LA 1E9BA 4HNQA 1Z33A 4RABA 4CPDA 3N0VA 2CN1A 2QRJA 4ZQBA 2CXPA 4YP7A 5B1YA 4F1JA 1P6QA 1X9IA 2HU5A 1RI3A 2ID7A 3KB6A 2HBZA 2NU8A 2H00A 3LZ6A 1RLOA 5DGHA 1U2DC 2ZE8A 4WERA 4EHNA 1IM2A 3I5YA 1NQ5A 4OMFG 2DE0X 3GLKA 3ZJ4A 3QX8A 2YC4C 4KNWA 4WBNB 1GNRA 1YR6A 5GWXA 5M34A 1GG8A 1W59A 1UM8A 4DCJA 4PZCA 4R1LA 4NEHB 1M2EA 1O9GA 5JXIA 3IE0A 4I3FA 1V16A 3SXUB 5HCNA 4MRAA 4HNVA 3NAZA 2BBWA 3HNOA 1ODIA 2FG7C 1QF6A 1BGVA 1Z74A 2GT1A 4HGPA 3M4XA 4GLFA 3FFTA 2Y2UA 3C24A 3NAQA 1LBHA 3Q12A 5JLAA 1V35A 2P8SA 3AGQA 3ITKA 5K20A 3P4UA 4LXHA 2A84A 2F90A 3K16A 1Y3IA 1VCHA 2QL7A 4C0XA 1OD6A 5AT1A 5K3FA 3T3MB 1ZM2A 4H7IA 4YXFA 1AX9A 1JSRA 1Q0HA 1SCUB 2COEA 4GFDA 3VYRB 5CDSA 1UZUA 3CZMA 2R8RA 2ZB3A 4XGQA 4NKRA 4KMSA 2FFAA 4ZOLA 3QVTA 4KJXA 4BNDB 5J47A 4FFWA 1H2BA 4JI5B 2PL9A 2Y8EA 3GEGA 1YGPA 2JASA 1CF9A 2R68A 1G1AA 3GRAA 4FIZA 2JLRA 1AKWA 4U9UA 5AVKA 1EM8B 5CK4A 3REQA 3KT3A 2NO7A 1NW6A 1R6VA 4KXVA 4RHYA 2ZQYA 4RVUA 1JZQA 3JASA 4KK3A 5JFGA 1VRVA 1Z2CA 4QDJA 4ZAWA 5GIOE 2QYSA 3OE5A 1TD1A 4JYBA 2WF6A 2Y9PB 1KYQA 1SUBA 4HB2A 3C2QA 1T6NA 2AFIA 2Q7XA 3M2PA 3ANLA 3BJRA 4KUGA 3BXFA 4FEGA 4YYZA 3RUDA 1CSEE 1WO8A 2WD8A 1X80B 1OWPA 1FCJA 2P2NA 3BFKA 4KRYA 3TX2A 4EO4A 1ORTA 2A14A 1X2BA 2OMKA 2DB3A 4KBYA 3DCYA 4KV9A 1W2WB 2F3QA 5JC8A 4TXLA 1KRWA 3KJIA 1K9SA 1IONA 3DLTA 1PW7A 1X7HA 3FVWA 3PR2B 4HZIA 1I9GA 4MVJD 4TWJA 1OIWA 1M10A 1PR2A 4YMGA 1OYVA 2UZ0A 4B6QA 1Q0QA 5JAMA 1Z6QA 2O3UA 4IV8A 3RD5A 2PH5A 4BNMA 1SUFA 4D80A 4UMVA 5C35A 3QEMB 1N0WA 3N6VA 4B6PA 3URKA 1T4MA 1WNFA 2VEOA 1ECFA 1O9HA 1RWKA 2C8KA 2IGBA 2R60A 1S3SA 1W47A 3DKPA 4G5GA 4E3ZA 3CCBA 4C5CA 4LV6A 1FP4A 5A62A 3SZLA 3MWDB 4O4JA 1FUKA 4DLRA 1BCRB 1U7WA 3FMGA 1DCKA 4UCQA 3EIFA 2A1TS 3LUDA 3M6WA 4I9FA 4C76A 4ZZ3A 1DARA 1GZ4A 4M53A 4QJ5A 3OPVA 3NC1C 3S1LA 1M0TA 5HNKA 1VJ1A 4RTOA 2O2CA 2YIVX 4I6EA 5CHEA 3MLEA 1OIXA 1ZUIA 4GSLA 4DLZA 4YRKA 3UAOA 2WTBA 3QMVA 1DIBA 3HXQA 1VPTA 4MW7A 4M8IA 1NDHA 3OZUA 3P71T 1KOFA 2O2ZA 3N3AC 3R44A 3VR5A 2VJCA 5J40A 4IO1A 1CHNA 1P2FA 1NI3A 3ZXUB 1TX4B 2BR5A 2GB4A 3FJOA 3L6EA 3OM0A 4MB6A 4UD6A 1POWA 3WAKA 3FB1A 2MU1A 3HKDA 4D8VA 4N8EA 4BFWA 3BAFA 4QU5A 3S2SA 1T10A 3TS1A 2Q5HA 3T95A 3PP8A 4FI3C 3RS3A 3MGKA 1VTKA 1KI2A 4X41A 2F3TA 1BTOA 3PDIB 5H7XA 5KKAA 2PIDA 5E4TA 4AY6A 4YP1A 4EG7A 3VMFA 2IYQA 4D3XA 4IQ8A 2WRZA 4J75A 5K0SA 1EHIA 1NW8A 5L95A 4L76A 3LBYA 4TS9A 3DL2A 3UIEA 3AVVA 3DAOA 1TTPB 4QC2A 3RFVA 3ZCQA 4DAOA 1UC8A 3OX1A 2L17A 4O33A 4MKRA 3BFPA 2RD2A 2PQ6A 3V1TC 2RFLA 1TJNA 4CV2A 1FW6A 1FFYA 3G6WA 1Z2EA 5KTTA 2JJ1D 3RBAA 5EWLB 3ZNNA 2W2KA 3GUCA 2H1LA 2V8BA 1U5BB 2C9OA 4E30A 1A7AA 1BS1A 2R84A 3N05A 1H4SA 1PL7A 2ONZA 3L0CA 1TO1E 4ZVKA 2C8JA 1RNLA 1ISGA 1U28C 5EQJB 4BB0A 1A71A 5GJWC 2ZROA 2PD6A 3KQYA 4KN8A 1WKVA 2JBHA 4CDGA 621PA 4M0CA 2D5BA 4OJTA 3JPYA 2ZUSA 1LC3A 4RS3A 1UC4B 1E1QA 1T2FA 3GP5A 5CD9A 4P86A 1GTG1 1YSCA 4E14A 4G2TA 2PT6A 4I50F 4P98A 4G09A 5DE3A 1V6CA 3K0HA 3RU7A 1G4HA 1TD9A 5KS2A 4M8NE 1ZVJA 2ZVDA 4P3OA 3V8EA 4IFTA 1ZI8A 4G81A 5E7MA 2GCOA 5KJEA 1VA4A 1WZNA 2HTEA 2AD1A 2PL1A 3KCQA 3M34A 4Y6SA 5JOQA 1XDUA 2QT9A 3GRCA 2BF4A 2SHKA 2YXNA 3H84A 3KSUA 3MCVA 1WX1A 2CJWA 1KJJA 1HSZA 2DJIA 1EI9A 2A8YA 2EIHA 2EJCA 1MAUA 3O3NB 4MS4A 4X97A 4R0VA 5FIUA 4LHYA 2YV3A 2IYRA 4O2BB 1CVLA 2AIRA 2RKWA 3NETA 4UFOA 5K9ZA 1KJ8A 5DGDA 4Q7LA 1Z6PA 1F2DA 1GL6A 2PJDA 2REQA 1SFRA 5BW5A 4XWTA 2VSOA 3M81A 4CTKA 1IZ0A 2N0SA 1G8SA 1QRTA 3R7SA 3DJFA 1DXOA 4TV8F 4J0FA 1YULA 5DP2A 4QLBA 1GWNA 3EBPA 1VE9A 3DT9A 5EJ2A 1ENPA 1L7MA 2Y1DA 1W4RA 4IOJA 3SZRA 4ZV7A 3MTQA 3AHCA 4HH1A 4FZJA 5SZIA 3OCVA 4BB9A 4CHTA 2ZI4A 2FOLA 1GHTA 3DYBA 3DOFA 2ATXA 4M9QA 3WO1A 4MCAA 4LHEA 1UWKA 3HEMA 4GKAA 4BLUA 2HNKA 4Q9NA 2GD1O 3O26A 3ZU6A 1SC6A 2Y1LA 1NVXQ 2PUBA 4JBNA 2FAXA 2PY6A 1PAUA 5DLQC 2ZCJA 4UOQA 4JYAB 3ODGA 4B45A 3LMKA 3EVTA 4B44A 2XUFA 3GBSA 3EEIA 4X85A 2V54A 3BT7A 4QICA 4XASA 2EFJA 3UJAA 3W9BA 2VP6A 2XMRA 4ZMBA 1U0JA 5JCOC 1M2OB 2I34A 1Z5ZA 3U6KA 2FZ4A 3BN3A 4QVKA 3HZZA 1YZHA 1J0EA 5BV2P 1YS9A 3TD6A 4HFNA 4NRDA 3KWMA 3VGJA 2GPBA 2W2LA 4WDQA 3KVVA 1RBQA 1W5TA 4ZDJA 3VKHA 2OK7A 3WG9A 4R8RA 1SB9A 3LM8A 2YDXA 2RIRA 5BVHA 2RAPA 3PVCA 4E4TA 1W36B 3C5HA 2VDUE 4KJZA 4BYGA 1X1AA 4DDMA 3O4IA 4IVPA 1TC1A 3I30X 1JG6A 1PWEA 2IGTA 4NV1A 1GKUB 1M8PA 4C4ZA