1QDEA

Crystal structure of the atpase domain of translation initiation factor 4a from saccharomyces cerevisiae-the prototype of the dead box protein family
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
211
structure length
201
Chain Sequence
b'IQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION INITIATION FACTOR 4A
molecule tags Gene regulation
source organism Saccharomyces cerevisiae
publication title Crystal structure of the ATPase domain of translation initiation factor 4A from Saccharomyces cerevisiae--the prototype of the DEAD box protein family.
pubmed doi rcsb
total genus 72
structure length 201
sequence length 211
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 1999-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qdeA00
3LBHA 4OI1A 3L43A 4Q18A 2MSEB 3RDPA 4RSGA 2AN9A 4CGZA 3RVBA 1M7HA 1N5IA 1FX0B 2EFDB 2MSCB 2N46A 1S4QA 4XWAA 1NLYA 5JCPA 1Q3TA 3E70C 4A6XA 1TF2A 1U0LA 1HA3A 2ZSBA 1GAJA 2QAGB 4WBSA 4BFVA 1LF5A 1UBFA 2NGRA 3MD0A 1CRQA 2I3BA 4QKQA 4HUTA 2CXXA 3LXXA 2WJYA 4QNMA 3PXGA 4I1OA 2C9YA 4NCKA 2JLRA 2ZTSA 1AA9A 2ZS9A 3AB3A 3OAAD 5FI0B 2IK8A 4ZCIA 1XTIA 1SXJC 2HUPA 3KFXA 3SDZA 1NVWQ 1OE0A 2VEDA 2ERXA 3P26A 1G16A 5EE3A 4RVCA 1R4AA 1E2MA 4BPBA 621PA 2BMFA 2FFAA 2YKGA 1P9NA 2Y8EA 2DFNA 4XD7A 2XJ4A 2PZFA 3SE0A 4PC7A 2IEZA 1Q1EA 2W83A 4DSOA 4FMDF 5EP4A 5CDFE 2ORWA 4F93B 2CLDX 2PT5A 2BKUA 4MGZR 1SVIA 5BYJA 1EX6A 5SZKB 1J8YF 3FGNA 2OZEA 2O8FA 1P7CA 2H1LA 1XJQA 2C9CA 1GNRA 2UVQA 4RFVA 1YR9A 5FOXA 4W9MC 1CF4A 4DCUA 4ZDWA 1R7RA 4PZLA 3BS4A 2HCJB 2VSOA 1Z3IX 4OHVA 2MSDB 1QG2A 4HDOB 4Q1FA 4C0KA 3AGQA 4MDEA 2I1QA 2QORA 3PUXA 2Q9BA 4AD8A 2GRJA 4RZ3A 3ADCA 1W36C 2Q21A 5FBVB 1MR3F 3BH0A 3CZQA 4BFTA 4HLQB 2IL1A 3Q85A 2GZHA 2X8AA 1OH7A 2KBFA 3DM5A 2JLXA 2ZREA 3NBXX 4L15A 5TB5A 2CJWA 4ESVA 3A1SA 3T12A 3OF5A 3U7GA 4Z8YA 3UG7A 2PLRA 2RGXA 4L4UA 3I8XA 4Z1MD 3NG1A 2GXAA 4PFSA 1KNXA 2WIBA 5CDFA 2NZ8A 1YRAA 2LKCA 1COWA 1FOEB 4TWZA 4JZKA 2LCFA 1NMYA 4M9QA 1HT1E 2ZRKA 4B6EA 2FWRA 3IKJA 1IJFA 2GAAA 5E7MA 3AV0B 1A1VA 5AJXA 1PUJA 1IY0A 1XXHA 2WWGA 4KV9A 2XX3A 3B2EA 4QBHA 4A82A 1JPNA 5EE5B 3I92A 3QUSA 2H57A 2O52A 2V9PA 1T91A 2JLQA 3BFKA 4KBFA 5FOUA 2ZE8A 2IWHA 3B7GA 1II9A 4C3ZA 3KB1A 4HYYA 1YZNA 4WAUA 3DHWC 1OYWA 2ZM5A 4PAOA 1E2HA 1S96A 3KJGA 3MWJA 4S35A 1NN0A 3FVQA 3ND8A 2A5DA 1AIPA 3CR8A 2X2FA 4C0JA 1YZTA 2FEOA 2OAP1 1F2UB 2J0QA 4HUQA 3DOEA 3EPKA 2IWRA 4B6FA 3QXCA 4P33A 4TYPA 4WVFA 1NG9A 3EASA 3TLXA 2QEQA 1WXQA 1TEXA 2VL7A 3H86A 1RJ9B 5EZ5A 4OQFA 2P6UA 4G01B 3NC1C 4DCTA 1HE8B 1ZAKA 2ASEA 4LYAA 1KJYA 1E4VA 4M9XA 1XEXA 5KNBA 1TU4A 1OT3A 4EPTA 1AZSC 1R5NA 1N6PA 1G3QA 5L3QB 2ZEJA 2JJ2D 2R6FA 5AUPB 4GL2A 4BGDA 1I4TD 3UMFA 2AXNA 2IYWA 2ZRIA 1TNDA 2IA5A 2GTPA 1C1YA 1UKYA 5JS8A 2J7KA 3K9HA 4LSGA 1BO6A 1JEEA 1IXRC 4C7OB 4NDZA 5DI9A 2CEAA 1KO5A 3QXHA 2H7VA 2GJ9A 1Z6AA 2IUSA 3TNFA 3ZVMA 1DVRA 2PH1A 4PX9A 1VG0B 3CB4A 3V00A 4MYHA 4MA4A 2CNWA 2B6HA 4FMCF 5FUYA 4B74A 4DCNA 3GLHB 4PAQA 3SC3A 1JPJA 2CNWD 1DAGA 3PEYA 2V3CC 1KHTA 3KXLA 2ZROA 3QPWA 3NDBB 2G6BA 2GJ8A 1X8LA 3B9QA 3EPLA 4FCTA 1IN6A 3U4QB 4B3CA 3KJEA 1G3UA 1JXOA 5KPJA 5KNCA 2ZRCA 3Q5EA 1R5BA 1VMAA 1M74A 2RGGA 1FUUA 4NYIR 5LDDC 4I4LA 2IS1A 4ZDKA 1G5RA 3WNBA 2DB3A 4Q7MB 1QBKC 3IO5A 1JNYA 1RC8A 1CLUA 3CNLA 5FR2A 3EIEA 2D7DA 4Q7KA 5DYGA 4JYCA 4TYWA 2WKPA 4B35A 3D6TB 4LOAA 2RGAA 4LJ5A 4LYHA 2OFWA 1QG4A 2G0NA 4E03A 5AUNB 1ESNA 2J1LA 1BMFD 3VMFA 5DN6D 2VQSA 3VR4A 1RYHA 3CF0A 1TQ4A 1XD2A 2AFIE 4M1TA 2JLYA 4IRUB 1MABA 2GZAA 4Q4JA 4DSTA 3M1IA 1QHNA 1IQPA 2P5SA 1E1QA 2Q3FA 5EUMA 4A0GA 4BFSA 2P6RA 3IIJA 1ZNXA 1BYIA 4LBVA 1W1WA 1N6NA 4GT1A 4PPGA 2HCBA 3WNDA 4ARZB 1OFIA 4TSFD 4G5SA 3KKNA 4MRVA 1AQUA 3GLGB 2BM0A 1XPOA 1W0JA 5JMTA 1KDRA 1QDEA 4Q19A 3NC0C 4I1VA 4PZZA 2A5FA 2YJTD 4IVRA 4M0LA 4KFTA 3THWA 4TZ0A 4QG7A 4MGYR 2JLSA 3KXIA 4EFNA 1ZNWA 2NIPA 1WDTA 3EC1A 1YR7A 3T15A 2XEXA 3TIFA 1COWD 1CIPA 2CBZA 2OFXA 2YWHA 4RD0A 4LJYA 3UMSA 3C5HA 1G7RA 1N6IA 3TBKA 1GG2A 4PHFA 4TL6A 4CZ2A 1OPXA 1G8PA 1E4YA 3EW9A 2Z43A 3K0AA 2CVFA 2XZPA 3U3OA 3R20A 3FOZA 4LK2A 3CPHA 3MWYW 4EKDA 3MMPA 1IJEA 2NQ2C 3W90A 3DKPA 3NVAA 4DLWA 3ECCA 4A4DA 1ZD9A 5JSZA 2DPXA 5L8VA 5B2ZA 1KY3A 1ELOA 4EPYA 1G3RA 3NKVA 3I5XA 4LDJA 3KFVA 4YMSA 3UXMA 4CIDA 4D4LA 3QENA 4QXAA 4DDTA 1ZU5A 2V1XA 2A3RA 1UKEA 1YRBA 2FPKA 4AKGA 4FI3C 1KY2A 2C5LA 2ZS8A 4PZYA 5DLQC 4ARZA 1XXHE 3NBZC 1NF3A 4RZ2A 2F1IA 1JR3D 1XBTA 3AUYA 1NSTA 4PQRA 5FBWB 3MGCA 2HJGA 2ZRDA 2HYIC 2WAXA 2EYUA 1X1RA 1FPMA 1MT0A 2GEUA 4KJZA 4DKXA 2F43B 3X2SA 4A9AA 1E9BA 3U61B 2QRNA 4O2LA 2P6NA 1ZU4A 2WKRA 1XTKA 2C95A 3GJXC 2IT1A 2P67A 4BQSA 3A37A 1P72A 4N0DA 3T1VA 2IYTA 2QAGC 1X6VA 4D80A 1E9DA 2NG1A 4EFMA 1NMZA 1RFLA 1W2HA 1E0KA 1LW7A 1OH8A 3DOFA 2ZRHA 2YINC 1NJFA 2KBEA 4HI0E 3AVUA 1TF5A 4ILEA 4OQXA 1KDOA 1T9HA 2OUKA 4MKHA 3TSWA 3OEHA 4BLRA 1T0HB 3T34A 1OXXK 3DEFA 1VG1A 3KXKA 4LPSA 5KDOA 2WZQA 3E5HA 4LJ9A 2J87A 2WBLC 3FHCB 4PC1A 3CONA 2IX3A 1NVXQ 4X8MA 1U99A 5C18A 5FBRB 4HB2A 2J0UB 2WTUA 1YHNA 4PSVA 3KZ1E 4A2PA 1BKDR 3QEJA 2BOVA 2ZUCA 2ZYVX 1W4BA 2C99A 1XU4A 2VTKA 3IQXA 4XSHA 4ZIRA 5HCNA 4BFWA 1KK2A 4B2IA 1SVOA 3U6KA 3VKWA 2IYQA 3K8YA 3OE7A 5EXTA 3PUVA 2CHGA 1OKKA 1GITA 1TAGA 5J40A 3NEYA 4L5BA 4M1SA 1IY1A 3DO6A 3MG9A 4B73A 5A0FA 3GLIB 1ZUHA 2CMKA 2GA8A 3PITA 1G19A 3VR1A 3VR5A 4DLRA 1JXMA 3ZQ6A 1KI9A 1PLKA 1W44A 2WAYA 1FTSA 1EX7A 2RCNA 2X77A 1Z0KA 2CL7X 4KSCA 2YYZA 1UM8A 3SFVA 5KSYA 3RS0A 1NLZA 2OV2A 2ZRAA 4X8OA 3QKSB 1N5KA 4WZBE 2SHKA 4D81A 4KHZA 2GESA 1T0JB 1DG1G 4PAMA 5P21A 1ZIOA 3B8HA 2QA5A 5AUQA 2EYQA 3CWZA 4NE2A 1E1RD 4TT3A 3F8TA 1JR3A 1FP6A 1PUIA 3BGWA 3B1VA 3DPUA 3QXXA 5KYKA 1FUKA 4DEYA 4BLPA 2BWJA 1S2MA 1S0UA 1W5SA 5AK0A 3WMGA 3T1QA 3OIWA 1OSNA 4RKFA 2GKSA 4TL7A 5JBQA 2O8DB 2R65A 4NPHA 1Z6GA 2H5EA 2VO1A 3KDSE 2EFEB 4OHZA 1S3SA 2REXB 1KAGA 4LPKA 3W6NA 5C1BA 1GVNB 4LV6A 1E0SA 1U0HC 2YWGA 1XMVA 1LB1B 1Z8FA 3AVOA 4HAVA 4EPWA 4XVUA 1MH1A 4JLDA 1ETUA 2GEVA 5BXQC 4WIAA 2BBOA 2WSSD 4HUQB 4XH9B 4F4IA 3K0EA 1AS0A 3O8DA 2ZR7A 1VECA 4TLEA 3WP0A 4RKEA 1NIPA 3GJ5A 4PQYA 4YQFA 2ZR0A 2C96A 2ZRFA 1CRPA 1XMJA 2V8OA 4DDUA 4TLCA 1T3LA 2IXEA 3WRYC 3T06B 4ZCMA 1DTSA 3K0CC 2XXAA 1H8ED 2ZRLA 3QXJA 4QJ4A 4Z51A 1SQ5A 3FKSD 2C9OA 2RKOA 3IGFA 2JDID 2XOKA 4LJ6A 1TL7C 4MH0R 4WA7A 3ZJYA 3U3RA 2V1UA 4M22A 1U0JA 1OXUA 3LW8A 1OFTA 3SS8A 1GL9B 2I1VB 3GEEA 4DVGA 2GF9A 3CKLA 5HR5A 3KQLA 1F6BA 1KK0A 4BRWA 1XD9A 4P4SB 1ONBA 4G5GA 4A6PA 4B75A 1E99A 3TW4A 1O87A 2FSFA 1W4AA 4MYCA 5F9HA 3G0HA 2FGJA 2REBA 4Z8XA 3TW8B 2QTHA 3AF1A 3W34A 4RD1A 4PC6A 1II8A 1QZXA 4G5RA 1ZM9A 3U3MA 4PSAA 2QQ0A 4D4JA 3UG6A 3S1AA 3C4JA 1E2KA 1Z63A 1CJKC 2X2EA 3KKMA 3OIUA 4HAYA 4QBFA 2YOHA 4TQUS 5DH9A 3JVUA 5DNYB 2QG6A 2QROA 3GFPA 3PENA 3QEOA 4IOJA 1XPRA 3Q5DA 3FE2A 1DPFA 3F0TA 1P9WA 4FW9A 1K5DA 3AKEA 4PPQA 5CLQA 4JLPA 3U7FB 4XTCS 4TMXA 2REOA 4OK3A 2G1KA 2WMNB 2YC2C 4KCGA 2B8TA 3JZMA 1LV7A 2UZ3A 2A7QA 1QHSA 2WWHA 4QJ5A 3SYKA 4BZQA 3FMOB 2ZAMA 2B7BA 5JHGB 3T1OA 3KQNA 4Q9HA 4C0SA 2ZJOA 4A1FA 4CEJA 2ZI4A 3VX4A 4DZZA 3BD9A 5HPYB 2ZJBA 1HE1C 1W4CA 4Q4AA 3C8UA 1E2LA 1HURA 1OV4A 4GDFA 1E3MA 1KI2A 2WMOB 3Q7QA 4GPTA 3U3JA 1R6BX 4IEIA 1O3YA 1DAFA 3TVDA 1XEWY 5GJCA 1RPZA 1EFRD 3C14C 3V9PA 1Z06A 2NO7A 3NWJA 5CYPA 4B3XA 4CEIA 4LHYA 1E1QD 3RS2A 3AF4A 3QE0A 1E98A 2FZLA 2NPIA 1VHLA 4KBGA 3A1UA 4OI2A 3U7EB 1CP2A 2MMGA 2QAGA 4D26A 3WYGA 1U81A 2F6RA 4L16A 1JI0A 1N6OA 2WJJA 2V7QA 5FUXA 1DELA 2VP4A 3IDQA 4IW3B 2Z4RA 4LUCA 2WWWA 3O8CA 4C30A 1HT2E 2R6GA 2NMVA 3EA0A 3LFUA 2KB0A 3L8YA 1Z29A 1JJ7A 4KVAA 3K70C 1JR3E 1Z6YA 3Q72A 5HE9A 1Q44A 4TZ6A 2F1RA 5CK4A 1KO4A 5CM8B 5FUWA 2FU5C 3AP1A 3ZGXA 4GNKA 1Z08A 5C2JB 3A36A 1VHTA 4Q4HB 1HQCA 1PLLA 1GKIA 2YV5A 2ZSFA 2NO1A 1DAEA 2VP5A 1FX0A 4JYBA 4MRSA 3VHXA 4BFXA 2K5UA 2PX3A 3Q9LA 4DCSA 4HEJA 3EIQA 1N25A 1W4RA 4TYQA 4O25A 5DE3A 1G64A 3LXRA 1OLOA 3K0SA 4B43A 1IN8A 1M8PA 3L0OA 3DVLA 3PQCA 5AJZA 6Q21A 4NYMR 3D31A 2VHUA 2XNDA 1PJRA 4RCZA 3K70D 3U5ZB 2DHRA 4OQLA 4YDHB 3IO3A 4ON9A 5TVKA 4B33A 4FXPA 1SGWA 1S3GA 2W6IA 4WXRA 4DBLC 3SJZA 3EZ9A 4F38A 4NYJQ 1OW3B 4RD3A 2ECKA 3NEJA 4D0GA 4KITB 1PVOA 3CX7A 1Z6XA 4PXAA 2WM9B 4A15A 1FL9A 3QKTA 1NN3A 4GOKA 1ZCAA 3NDPA 1SVSA 4OQMA 3W6PA 3SBEA 3GLHE 3OIVA 4TMZA 3A1VA 4EUNA 5JEDA 3TUIC 4PHHA 4BEBA 3TVTA 2RGDA 4Z1MA 1MO4A 3LLUA 4JLJA 2WJVA 4MYUA 1U9IC 4BASA 4E22A 1J90A 4D0NA 1IN5A 2GXUA 1M2OB 4HATA 4TYYA 2OCBA 3DM9B 2G9NA 1T6NA 3P4XA 4XIGS 1AKYA 1NVVR 3NHBA 4MKFA 3MLEA 4QM6A 3KKPA 1DBSA 5TY0A 1G1MA 3RYTC 1E96A 3RHFA 1X1SA 1G5TA 5KHOC 1US8A 1I2DA 1XRJA 2ZJYA 2IW3A 3ASYA 5J4HA 2C03A 4MITA 2IUUA 1U90A 3PFIA 4JVSB 4A92A 2ZSAA 1BS1A 3P4YA 2FH5B 3LV8A 4OKSA 4AY2A 1YZLA 1E0JA 2RGNC 4GZLA 3WY9A 4EJSA 3WRXC 1SXJE 2R6CA 4RZUA 4KFRA 5B58C 5FTJA 1ZCBA 3RANA 4C0QC 2GBLA 2YC4C 2ZRGA 2WWXA 2ZRBA 3IEVA 1GOTA 1F3OA 3TUZC 1HY3A 2IYVA 4LI0A 3ZZTA 5EP3A 2YOGA 3UWKA 2RGCA 4PQFA 1J70A 4MKGA 4L9WA 1VDZA 4DT1B 1KMHB 3I72A 2D06A 2ODEA 4MQBA 2ZR9A 1NLFA 2CE7A 5TARA 3IBGA 3PCRB 4NP6A 3DKVA 3TR5A 1DEKA 4U7DA 4HB3A 4LHVA 3CRRA 4B2LA 4CW7A 3WMFA 2JIZD 3SJBA 4QFMA 2Q3MA 2PEZA 4GRAA 2IF2A 5JJLA 4C9BA 3A8TA 2FG5A 3K9NA 1AM4D 5L3QA 3GD7A 2DCUA 2GXSA 5L3RA 3E2IA 1GTVA 1KI7A 2OO7A 2F1HA 1CJUC 1VIYA 1XEXB 2NTYC 2VPPA 1TUIA 4RD6A 1E2NA 4US2R 3BH7A 1R0ZA 3AVYA 4V03A 1MO6A 2XNSA 1NMXA 1W2GA 2IYLD 5G41A 2Z6VA 1KMHA 1N0UA 2AD1A 4XJXA 2CVHA 5CITA 1P2UA 1KOFA 1I4DD 1LS1A 3VNUA 4FWIB 2WSSA 3MJRA 1UPTA 4N0EA 4LGMA 2GVZC 4V0LA 4BEJA 2D4HA 2N42A 1X3SA 2BJVA 4ABYA 2V7QD 4KXFB 4R98A 1EK0A 1QF9A 1GL6A 5FPYA 3X1YA 5EXSA 5LB2A 3W3AA 2HLDA 4QBIA 3TKLA 3R8CA 4Q1BA 4CRWB 3NIBA 3AF0A 1M7BA 3AEZA 1OIWA 1Z22A 4DLXA 1DO0A 1Y3AA 4B3GA 5FOWA 1FFHA 1ZRHA 2G0TA 5EJEA 1CS4C 4YMWA 1JEDA 1TUEA 3WP1B 2GCPA 3B6EA 2IEYA 5D3MB 1ESMA 1T5LA 4HDQB 2LKDA 4PR0A 3QY0A 5JSZB 4NZYA 4ASUA 1LTQA 4Q66C 1FQJA 2HF8A 5KSPA 5JRJA 4DIDA 1KYIA 2GZDA 4OI4A 8OHMA 1AJEA 2KE5A 1NBMA 1NN1A 1UF9A 4HAXA 4ITRC 3GLFB 1EWRA 2E87A 4NYJR 4QGFA 4YMUA 3GJ8A 2HLDD 3HJNA 4JLVA 5FR1A 1OIVA 1XD8A 4Q03A 2ZRMA 3K09A 2XJ9A 1KO1A 4FINA 2G83A 2FFQA 2VA8A 4Q4AB 5IK2A 5M04A 3FFAA 5BQ5A 4OBEA 3G5UA 2CK3A 2IUTA 4BZPA 4QGAA 2P5TB 3ZIAA 1RVDA 2IS4A 4CDGA 1VCOA 2ANCA 2V54A 4LRWA 1KDTA 2BVNA 4JBXA 1UEIA 4JIMA 3GJ0A 1W47A 2DY1A 3U2QA 3L0SA 4AG5A 1KIMA 1TEVA 4DC9A 2P2LA 4NCJA 3VAAA 2ATXA 3RSOA 1G291 2WJIA 1HEIA 3W9YA 4O2RA 1SVKA 2W2XA 4KI0A 3I73A 4CF7A 3WMEA 1EFHA 5JJIA 4IHQA 4P3YA 4B3DA 4B3FX 4QBGB 1Z0JA 1N5LA 4BE7B 2O8CB 2VP6A 3TR0A 1X8JA 2VH5R 3FHOA 3FMPB 3KKOA 3MFYA 4URXR 3K0FB 2IHYA 1KSJA 1D2MA 3WYFA 1II8B 2HT6A 3CPEA 3CWQA 2WPDD 2ZI9A 4GBMA 2XITA 1CXZA 4UKDA 1RRFA 5F2EA 3B1WA 3RC3A 5C4GB 3UATA 1NY5A 2WOOA 4QHYA 3GJ6A 3MCAA 1Z07A 1JECA 3THYB 3VFDA 1G8FA 1OFUX 4Q1AA 2AK2A 3KJHA 3TQFA 2ORVA 1EFUA 4MYTA 4D4MA 5FUVA 3AVPA 1OH5A 1TQ2A 2VIIA 2QZ4A 3SQXA 2OLKA 4A0FA 4ZI2A 5BN3A 4KFSA 1H65A 3P27A 1R2QA 3F3YA 1W36D 2HJVA 4MDFA 2Z4SA 3RRZA 3HDTA 2VRWA 1T3HA 4AKIA 4IVPA 4C0BA 1FQKA 1K6MA 3GLIE 4NHOA 4LBWA 2VP0A 3TUJC 2W00A 3PUWA 1ZUNB 3ETLA 3QNUA 4AI6A 2ZYUX 1KI3A 3FMIA 121PA 1R8QA 2BV3A 1E2JA 1OB2A 3T35A 1ZNZA 4BZXA 1B23P 1Z83A 3B60A 2EFHB 1ZINA 2LWIA 2D62A 1KSHA 2PMDA 1G21E 3GLFE 4X8HA 2EWWA 3JZAA 2QGZA 4RJLA 3GLGA 1R5OA 2DFTA 1N0VC 4I1UA 1UADA 4Q1EA 5K8IA 1AKEA 3EWAA 4Q9KA 2GCOA 3EZ7A 4M4SA 4US0R 4F7WA 3FFBA 1J8MF 4Q5IA 1GRRA 3HR7A 1T8UA 4PHTA 1KK3A 4AYXA 4DSUA 1TX4B 1VIAA 4RD2A 3AVXA 2O8EA 1TF7A 4Q4JB 1F5NA 1ZMXA 1M34E 2JLZA 4KYIB 4HDCA 5HZKA 4CEHB 3UPUA 1G7TA 3D8BA 4LX0A 1VKJA 2DWOA 2FFHA 4GOXA 4XD7D 5TV2A 4TYNA 5E95A 1QHXA 2X19A 1ANKA 5JI2E 3RABA 2O0JA 3K9GA 1Z28A 1FNNA 1ZM4A 2AWOA 3DZDA 5DSZA 1H8HA 1OIXA 4Q7JB 2AXPA 1A7JA 3H0KA 4NCHA 2GBLC 2QU8A 1WF3A 2XNDD 2BMDA 3FB4A 4IDOA 4Q9JA 4BLOA 3BH6A 5IT5A 2FE4A 3B85A 3WHKA 4EDHA 3VU9A 2A30A 4MGKR 2JGNA 4JL8A 2PCLA 4R2IA 3ZD6A 3R7WB 3MAAC 5FL7D 1DS6A 2W6JD 3CO5A 4P4TA 1VYVA 1S9DA 4AKEA 1Q1ZA 4K46A 1RRPA 2J7PA 3NBFA 1W36B 3NXSA 3GLGE 3SQWA 2GJKA 2DBYA 3QG1A 2ZJ2A 5K8TA 5EE1A 1GSIA 3QKSA 1OH6A 3N2EA 3TAUA 3KQHA 4B32A 1ZD1A 1YU9A 4MRPA 2EW1A 1Z0AA 1PZNA 1WMSA 2CK3D 1JAHA 4P4SA 3RNLA 5EE9A 1G4UR 4DLSA 2J5XA 3GJ7A 1XB2A 1ZC4A 1G3MA 2ZYTX 2RMKA 3LWNA 3CBQA 4FN5A 1E9CA 5GVRA 3Q7PA 1E69A 3RS4A 3GEIA 4ZV4A 1NN5A 2A5JA 1IN7A 1HUQA 3CF6R 3ZD7A 2HDNB 2JJ8A 2QT1A 2F3TA 2IXGA 4C0HA 4DLVA 1T8TA 5EQTA 4EAQA 4AYWA 1E2PA 2VF7A 2NPFA 2H17A 5JHHB 3FYHA 3HP1A 2BBTA 3OFNA 1EESA 1SVLA 5KDLA 2XTNA 4I99A 3V4FA 1SKYE 4F92B 1W0KA 4XVRA 5BWMA 1WQ1R 4DB4A 2QPOA 2FPMA 1JJVA 2ZI6A 3PJRA 4QOSA 2QM8A 3LY5A 4PTLA 2FOLA 4UJ3A 1EGAA 1EFCA 1G5PA 1CEEA 4OI0A 1KTVA 3WHLA 1Q1BA 2E9SA 2GCOB 3QVUA 2Q9CA 3GJ4A 3B1ZA 3QVVA 1KJZA 4KAXA 1RW4A 1VTKA 1GILA 1XZPA 2R9VA 2O8EB 2XB2A 3WBJA 3CLVA 4H1VA 4AIIA 3GPLA 2WHXA 1NIJA 4YXWD 1Z0DA 2VHJA 4I81A 3KQKA 4KU4A 1CBUA 2OM2A 3C5CA 4LV8B 1Q1QA 1UDWA 1ZVQA 4PO1A 1CULC 1P2VA 5DYIA 5JEEA 3DDCA 4K8OA 821PA 5ANRB 1YE8A 4US1R 2WWIA 1P2TA 1E9AA 4G5QA 1N0WA 1TPZA 4TL8A 2RHMA 1X86B 3A58B 1VYUA 3HU3A 4TN1A 1E2QA 1W48A 1LNZA 4JKIA 3GLIA 2JLUA 2J41A 4P32A 1XX6A 2GJSA 3FHTA 3EAQA 1DOAA 1GKUB 1GP2A 4E09A 4KLZA 4TQAA 1LVGA 3UIEA 1JBKA 4M1KA 2AKAB 3DL0A 4HLDA 4URZR 4TQ9A 4GMXA 3TRFA 4C0LA 2XOKD 5A5GA 4LY6A 4FMDB 1XEWX 2IYUA 2C04A 2W2VA 4MKIA 4DXAA 3H84A 2ZIAA 2EFCB 5HKKA 3H1TA 1H8EA 1KSGA 4L8GA 3ADDA 3TGPA 1KGDA 2PBRA 5JWOA 2PMKA 3RS5A 5FTLA 4YONB 3R7WA 3BOSA 3LBIA 4M1MA 4A8JC 3CR7A 2VF8A 3OEED 4IFBA 3KL4A 3B1YA 4EQ6B 1NVVQ 3GP8A 3E1SA 2E1RA 5FPTA 4XWOA 1VCMA 1S8FA 3WNCA 4A8JB 1ZIPA 3AP2A 5TXGA 5IHPA 3GFTA 3Q3JB 1AQYA 4JLNA 5FI1B 721PA 1ODFA 2J3EA 4ZIRB 3H4MA 1OXVA 3C15C 4OHWA 3K0FA 1X8KA 2C8VA 3ND9A 4DWJA 5JRZA 4D0LB 4NYIQ 3ONWA 1Y63A 4TMTA 2FMXA 3HU1A 5BYKA 4AC9A 1D2NA 1XTJA 4PPNA 2J7PD 3PEVA 5J5CA 1N6LA 4TMKA 1JAIA 3LH5A 4X8LA 2OEPA 4GP7A 1U8YA 2W6JA 4B44A 5JWRA 1NBMD 2BC9A 1OF1A 2ZE6A 1YKSA 4HZUA 3U44A 3K9LA 2IYSA 1RIFA 2FPLA 4CT4B 2IS6A 2I4IA 2VSFA 3BJIC 5CM9C 3ZZ0A 1L8QA 1U8ZA 2OSBA 1GZSA 2JA1A 4W5HA 4DUGA 2D2EA 2FNAA 4ZPXA 4O3MA 2YOFA 3DZ8A 1Q22A 4TMVA 3CX8A 4V02A 1YJ5A 3QF7A 1FW6A 2QGNA 1FZQA 1J2JA 3N5CA 4KVGA 2ODWA 3IPXA 3L0IB 4HSEA 4JS0A 4LV5B 1GUAA 2OESA 4IXNA 1HV8A 2EFGA 2QP9X 1V43A 4DLYA 4HLUC 4Q01A 3BB3A 1G20E 2CLSA 3L8ZA 2CHQA 3V4RA 4DUGD 2EQBA 5DIFA 1OHHA 2QP3A 4JLAA 4A0RA 4M9SA 4W5JA 3B78A 4QL3A 4JT4A 1KI6B 4B76A 3J81k 3EPJA 4AURA 2D2FA 3NBYC 4D82A 3T5DA 1RKBA 2GNOA 2OT3B 1ZW6A 1BH2A 1N5JA 4HAZA 3ZVLA 4H1UA 1T5IA 1EFTA 2B92A 2VHCA 1YZQA 2UKDA 2QBYA 3VKGA 2BEKA 3VNVA 1KNQA 2O0KA 1U8AA 1W7AA 5SZIA 5K8LA 1HYQA 2DR3A 3K0AB 4IOKA 3A1WA 2VP2A 4P31A 4PC2A 4U02A 4DLZA 1E0AA 2RAPA 1R8SA 4CVNA 2ONJA 4D25A 3EZ6A 2ZXUA 5H8WA 3A1TA 4HAUA 1NVUQ 2FX3A 1XFAA 3HYRA 3BB1A 5C4MA 2P3SA 5EZ6B 1EWQA 1EXMA 2XTMA 2VLIA 2CL0X 2ZU0C 4LBYA 1AGPA 2YHSA 4GP6A 2PZEA 1IAQA 3REGA 1GM5A 3OEHD 3TMKA 2B8WA 5DGXA 1TU3A 4C4PA 5JWHA 1NRJB 5TMPA 1OHHD 2PL3A 1KDPA 1XMIA 1WBBA 1E6CA 2F3RA 4EPVA 4JJKA 4ACAA 3QKRB 2GWHA 4CYMA 5D3QA 1Z5ZA 1G7SA 1U94A 4Q02A 3NH9A 1P5ZB 4TTRA 4GZMA 1XTSA 2Z83A 3AM1A 2V6IA 1MKYA 5E7IA 1C4OA 3RS3A 3BK7A 2ZJAA 2R8RA 5CJPA 5E4FA 5L3SB 3FPAA 5LD2B 5CJ2A 2A2ZA 5G40A 5DHFA 1TMKA 1J99A 3DMNA 1Z6TA 5HZHA 4DT1A 3B5JA 1RRCA 3U4QA 2QTFA 5FBLB 4JSTA 5G53C 2BJWA 2D74A 2HYDA 1XNJA 1E32A 3QSYA 2G88A 2H16A 4I1SA 5JLJA 1I2MA 1Z2CA 2ZJ5A 3BE4A 1A5TA 2L0XA 2OCYC 3GLHA 3AH8A 4E07A 5J47A 1UJ2A 2PEYA 2G3YA 3QQ5A 1WRBA 4TLAA 2F7SA 4M53A 1TQ6A 2R62A 2VSXA 4AKHA 2V4ZA 3THOA 4MUAA 4FWTA 1W5TA 1Z2AA 5H68A 3CM0A 1UEJA 1AS3A 4JLOA 5JCZA 4GFDA 1CKEA 4TLDA 3LDAA 4ERNA 5AJWA 4ZKEA 2C2HA 1ZBDA 3QXSA 4Q9IA 1T3SA 5J4LA 3BB4A 1XMSA 3GJ3A 1IXSB 2OXRA 3ZDQA 2JAQA 4F91B 5KU1A 2QENA 1NG1A 2F1JA 3UKDA 2RGEA 2BDTA 1SXJD 3GMTA 3T1TA 3SR0A 4Q21A 5LB4A 5L3SA 2QM7A 1MRSA 4BECA 3B82A 3CPJB 4M8NE 3F5FA 3ZYCA 5L3VA 2WPDA 2QN6A 2XSZA 2XTZA 1OXSC 2H18A 1E79A 3PUYA 4QGHA 1I4LD 4FCWA 1W0JD 1IBRA 2IYYA 2B21A 2GETA 2IYRA 2ZSDA 3KB2A 221PA 3SZRA 5AWFC 1YZKA 1ZNYA 1E9RA 4R7ZA 5JZVA 2IHBA 3FKSA 1Q12A 1Q57A 4G3XA 3JVVA 5A4JA 5FH9A 1V5WA 1M6NA 1R0WA 1MO5A 3PG5A 2EWVA 2XZLA 1UDXA 4G5OA 4DRZA 3QKRA 1QHIA 4LCBA 4QJ3A 1GIAA 5CYOA 1KO7A 1LS6A 4BLSA 1SHKA 2ZANA 2QTVB 4QC2A 3NTUA 2AD5A 5CB8A 3CUEF 3I8SA 2D3WA 2KWIA 2W2TA 2WVJA 1OYYA 1SKYB 2WV9A 3IIMA 3K70B 1G8GA 4QRHA 4LYJA 5DN6A 1KZGB 3TAHA 4EQ6A 4Q48A 4A0HA 4LHWA 1YR8A 3SOPA 4ZI3A 2RHDA 2WWFA 2YWEA 3AF2A 4LC0A 1D9XA 5GVSA 3IQWA 5H1YA 3LBNA 2P65A 2WJGA 4QGGA 5E7JA 2IXFA 3K09C 3SHFA 4URUR 2X1VA 2J45A 3ZQJA 1YVDA 3ZH9B 4LHXA 3FTQA 3CNOA 3KX2A 1YQTA 1CR0A 1S9HA 5EP1A 1NKTA 2GEDA 2ODNA 1G41A 1QRAA 4NH0A 5SZHB 3AUXA 3U3KA 5FTMA 3Q8XB 3PV0A 5FOSA 2WKQA 2GXQA 5JI3E 5GJBA 5B30A 2OAQ1 4B34A 2QRZA 1E79D 1B0UA 2YNMA 2OG2A 3L0PA 2JJ1D 3TE6A 3LQQA 2H92A 4OJQA 2ZVQX 3AVTA 2ZJZA 2OFOA 2C77A 1NKSA 4A2WA 2GCNA 4B48A 1DAIA 2AR7A 2DWQA 2N1BA 1Q21A 2H8KA 2AHOA 1QHHB 4XVQA 1E9SA 4M9ZA 3OFND 4G1UC 3O8BA 5ELXA 3ZS8A 1BOFA 3RAPR 1JQLB 5EE0A 3AVWA 4MRRA 5EXPA 3VQTA 1L7VC 1G6HA 1IXZA 1MO3A 4IVQA 1WE2A 4F4CA 2CHVA 5HE8A 3SHWA 1FNMA 3NH6A 2PCJA 3IHWA 1NL3A 1NBME 4II7A 4JBYA 1N2CE 1MV5A 5K8UA 3OE7D 2ZRNA 3WBKA 5LBIA 2O5VA 2CE2X 2FFBA 1E9FA 4UQOA 5CIWA 4KODA 2C78A 3TSOA 3D7MA 4F4JA 2BIFA 4DJTA 5BW8A 2FDCA 2EU8A 2ZUBA 3AKCA 1JB1A 4JBWA 5KSOA 4IJMA 4JLMA 4EFLA 2JLVA 3U6BA 3I5YA 2ATVA 2J46A 3BXZA 3CRVA 4ZO4A 2DYKA 2JASA 1XCPA 1T4GA 3BIFA 2QP4A 4Q4HA 2ZQ5A 4UJ5A 3TSZA 2UZIR 1Q0UA 2R44A 2ZS7A 4A8JA 1P6XA 4HLCA 3REFA 4HLUA 3AQ4A 1WCV1 1IOZA 2QMOA 3B9PA 3EPHA 1SVWA 1YR6A 2VBCA 2FSHA 2XZOA 1A82A 3VR2A 1P9RA 3N2IA 1KK1A 4OJKA 2XXAB 1AS2A 1KKLA 3KUCA 2AWNA 1DO2A 3W8NA 1SHZA 1UBCA 1SXJA 4BRUA 4UNPA 2HEIA 1P75A 4A36A 5FPHA 1ZP6A 3WYAA 4FD2A 1CJVC 3MUFA 5SZJA 4AYTA 4D4KA 4JKYA 4W5WA 1DG3A 3AF3A 4W7SA 5JFGA 5HTKA 4MGIR 2IYXA 3FDIA 5J4VA 2W0MA 3TK1A 2QNRA 5F3WB 2ZRJA 4UNNA 2XGJA 4GOJA 4Z54A 2OBMA 4JVMA 4NMMA 3QJYA 5CIQA 5FTNA 1HTWA 2W0SA 2FF7A 4CEJB 1JQJC 1L4UA 4IDNA 1G18A 4C0AC 3LA6A 3AKDA 3I4LA 5KO2A 2BMJA 3I1FA 3ZIAD 4P0TA 1XP8A 4HB0A 2DFKB 2O8BB 2RB4A 1RZ3A 3EZFA 2YVUA 2QT0A 1VG9B 4R71A 3LD9A 2BKEA 4MRNA 1LF0A 1IM2A 3CH5A 4RY2A 3K0CA 4EIWA 4TT3D 3TJZA 4JLBA 3C41J 5DI3A 1CU1A 3CNNA 1VPLA 4M2LA 4D6PA 1F2UA 3AVQA 3K1JA 2KI5A 4EPRA 2PT7A 5FBQB 1EFRA 2PJZA 3EX7C 3S1AB 3KTAB 1CJMA 2JLWA 2FSGA 3SJAA 4KYUA 3MWLA 2ZVPX 1GKYA 3TH5A 5AUOB 1IONA 2ZSEA 4M1OA 2A5YB 3BBPA 3UANA 2FZ4A 1JR6A 1A2KC 4JVLA 2JJ1A 1UBGA 3ASZA 3LLMA 3QF4A 3ICQB 4TL9A 2R2AA 2J0SA 2O0HA 2OBNA 2OLJA 3QPVA 2R6AA 3QOFA 2XAUA 3T61A 4TSFA 2Q3HA 1A4RA 4QM7A 4DSNA 4L9SA 3CRQA 2ONKA 4BLQA 1N6KA 2OCPA 1Q20A 2GDJA 3A4NA 1F60A 4RCYA 1DAMA 5KSZA 4RZXA 4LJ8A 5DO9A 4XWKA 3ZVRA 5BN5A 3OHMA 1G8YA 2WICA 3MJHA 4D2IA 2FGKA 3SNHA 4H9GA 2JJ2A 3VU9B 1G9XA 5AJVB 3SJCA 1S1MA 1SZPA 1ZUIA 3IIKA 3QBVA 4LYFA 4S2EA 5AJYA 4ZCLA 4DCVA 3I32A 4OQNA 3K53A 1U9IA 3SEAA 5FOTA 3UK6A 5LD2C 1G6OA 4PHGA 4NTZA 3T5GA 1F2TA 1CR2A 2VHTA 4PPFA 1R0YA 4WW0A 3SU8A 4U5XA 3KTAA 1KI1A 3AGPA 3TQCA 4BUJA 5IRCD 421PA 4Q1DA 3O47A 4OHXA 1G7CA 3OZXA 5AR1A 5IDVA 3FMFA 1SULA 2J0UA 3UMRA 1KKMA 4XSGA 1QHGA 4RFSA 1ZJ6A 5FPSA 4TMWA 2BCJQ 2P0EA 2FN4A 2QY9A 5BN4A 1RE0A 3QBTA 1OB5A 2GJAA 3P20A 3HU2A 3EIHA 3I3SR 2JEOA 4PC3A 1FP7A 4MUBA 5G3YA 1P62B 4EJSC 3L82B 5KNDA 1VCIA 4LJAA 4LZZA 5KUTA 3GQBA 1QHHA 2GF0A 4IOLA 4DB2A 5EUQB 3BAFA 2D7CA 4OL0A 2QBYB 3D3QA 2XSZD 3LO5A 3W5IA 2O8DA 3U60B 2NZJA 2IS2A 1Z0IA 2ZE7A 1OXTA 4JVNA 3R9IA 3RRYA 4YMTA 4C2TA 1DAKA 2XB4A 3X1XA 4ZKDA 2QUZA 1N6RA 3LAWA 1UKVY 4LWZA 2F43A 2F55A 1BIFA 4NKRA 4WXPA 4WZ6A 4BWYA 3THXB 1N3BA 1SVMA 5IF9A 4HZIA 2IYZA 5GJWC 1XCMA 1P4SA 2ZI5A 3LRPA 4URWR 2QQEA 4XTRA 1CTQA 2BMEA 2PJRA 4AWXA 1UAAA 3GLFA 4U00A 1GL7A 3SBDA 2CCGA 3RWMB 1TADA 3UWOA 4JSYA 4B2PA 4DDVA 2ZU6A 3B13B 4Y0AA 4ZDIA 2RGBA 3R9XA 1R0XA 2B7CA 3NHAA 2OE2A 1SXJB 4JJZA 2ODBA 5J4KA 2DWPA 4ZDJA 2GAOA 2NO0A 3IHLA 2ORIA 3LX5A 3P32A 2QAJA 3EC2A 1GRNA 1FMLA 4WOPA 2QI9C 1KI4A 4QNRA 1XTRA 5F98A 2Z5FA 4IEEA 5FFMA 3OEEA 3CRW1 1M1YE 1VYTA 1ZM2A 2QE7A 2O8CA 2YZ2A 3SI7A 3CW2A 5KDDA 1ZYUA 3VR6A 2AX4A 3EA5A 521PA 1ZC3A 4DDWA 2QPAA 2GK6A 3X1WA 2ZPTX 1M7GA 1D8TA 3X1DA 5HKKD 4ACBA 3C7KA 2HV8A 1E2IA 3BC1A 1XJCA 2RH5A 3LVQE 5DHAA 3THYA 3SYLA 4JL6A 2VP9A 5EXXA 4Q9LA 3DMDA 1IY2A 2W58A 3THWB 1U98A 4R2HA 4YC7A 4LBZA 3AP3A 3EWSA 2OXCA 3HWSA 5FL3A 4BFZA 4DHEA 2KSQA 4GSYA 4ESHA 3THXA 2W6ID 5JJKA 5EP2A 2ZE5A 1KO8A 4IDQA 1L4YA 2A9KA 2Z0MA 3X1ZA 2ZETA 1SKQA 1IN4A 4JLKA 1TTTA 3QIAA 1XEFA 2TMKA 4Q7LA 2GK7A 3RC8A 3OAAA 1D5CA 4IFEA 1GFIA 1K8RA 4FCVA 4V0MA 2ZRPA 4BFUA 5JECA 3L2OB 4IKEA 4OK6A 1DE0A 1QVRA 2G1JA 3FWYA 1MABB 2HF9A 4BLTA 2YWFA 2WOJA 3ZS9A 2ZITA 3RRNA 4R9UC 1P61B 4DLUA 3I61A 2QL6A 1KSFX 3AKYA 5CK5A 1ZM7A 5CLLA 2QMUA 4JT2A 3U7HB 4B3BA 1GRQA 4N1AA 2EVWX 4UNRA 5IK2D 4QHSA 1RYFA 3M4YA 5FL7A 1G8HA 5CB6A 1XD2B 4UXJA 3IBYA 4E5UA 4DIEA 3PUZA 4IOMA 1TQDA 1XJ0A 2NO9A 4JMPA 2BCGY 1HQYE 4XOIA 1F2TB 2GVDC 1GNQA 3BORA 4QHTA 3RSLA 1E1RA 1K5GA 1RRGA 2FV8A 3GFOA 4YLGA 3R8FA 4V0NA 5C46F 3R9WA 3LVRE 3RS7A 1NJGA 5D3MA 4EJSB 2JCSA 1AN0A 2ZAOA 3EZ2A 1D6JA 1EG7A 4NL4H 3LQRA 1W0KD 3A4LA 1J7KA 2NOAA 4CT5A 1E94E 1NP6A 2BHRA 2IC5A 2RGNA 3ICEA 4V0ME 3BFVA 4EPXA 2A78A 3W5JA 4M1YA 4A2QA 2FA9A 4YMVA 2QMEA 3CZPA 1YZGA 2PX0A 4PO9A 4JL5A 4PO8A 4NCNA 4B71A 4UNQA 1XTQA 1QHYA 5FOVA 2NO6A 2BBWA 1YZUA 2VYFA 3BRWD 4FIDA 3QKUA 1AGRA 1HH4A 4N3NA 3M6AA 1PV4A 4TLBA 3VKHA 1KMQA 1Q3HA 2KJQA 1DARA 3CIOA 2WWYA 4KO8A 1OKKD 3HYTA 4B47A 2AL7A 2GILA 2FEMA 5F9FA 3CX6A 3VHLB 3SN6A 3CRMA 2ERYA 5TDHA 1RJ9A 3G82C 3EARA 1UKZA 2J59A 3PR1A 3QI2A 1G3IA 5E3HA 3HR8A 3RRMA 1P2SA 4WZAE 5FPKA 1ZM3A 3BFXA 3LW7A 3C16C 3IEUA 1G4AE 4GI7A 1E2DA 2J0VA 3GEHA 4IDPA 4Q4LA 3W8RA 4RFSB 4KLNA 4LC1A 4TTPA 1XF9A 1DAHA 2Q9AA 2WIAA 4YDSA 1KZ7B 1AZTA 1C9KA 2V6JA 1E2GA 4NONA 5G3ZA 2WJHA 4M1WA 1FTNA 3QPUA 1KJWA 1GWNA 2PZGA 1WP9A 1UFQA 2QSYA 3RLFA 1DADA 2QPTA 1F48A 1P73A 2AK3A 3B1XA 4RD4A 5B64A 5GJVC 3IILA 4OYHA 1E2FA 2OCAA 2F9LA 3PVSA 3LNCA 1H8HD 4Q00A 1JALA 3AVVA 1UBEA 1W46A 2OILA 3VTKA 4Q47A 1U2RA 3PEUA 4KSBA 5DISB 4URVR 1VG8A 1KI6A 4HAWA 2G77B 3PEWA 5HCIA 2HXYA 3M0EA 2V55B 3VR3A 2OHFA 1E2EA 1XXHB 4FMCB 2GHIA 3MSXA 3I62A 2HT1A 5KPDA 1NNEA 3OIYA 2JIZA 4OHYA 4HB4A 1AK2A 4NYMQ 1FMJA 2FSIA 4J0QA 5JS7A 4C2UA 2JDIA 3KQUA 4LJ7A 1Z0FA 1ZD8A 3OESA 2ZI7A 4LHZA 1CR1A 4KFUA 1II0A 5KOYA 1LY1A 1XZQA 2R6DA 4AG6A 1MRNA 1XCGB 3W6OA 3O8RA 2Q6TA 3ZLJA 5FTKA 4PSKA 1XPUA 2BEJA 1NY6A 2QE7D 2CLCX 4P4UA 3CF2A 1G17A 2MMCA 5GADl 3VX3A 2Q0HA 2CJWB 2ZJ8A 4PANA 3MRSA 3N70A 1PLJA 4NCIA 2FJUA 1KI8A 3QF4B 4NU0A 3U44B 2ZUDA 3GCGA 4DEXA 3A4MA 3BERA 2CCKA 1US8B 4CEIB 4C7OA 1CJTC 4UXHA 5H70A 1OJLA 3EXAA 3FKQA 3SYNA 4AK9A 2CDNA 1N6HA 4K81B 2OBLA 1CR4A 1XWIA 5J4YA 1NI3A 2BBSA 3IPYA 1P3JA 3CH4B 1KAOA 4OK5A 1WBDA 2IF0A 3HPQA 5DI3B 4Q1CA 4URYR 2DFLA 1OFHA 2HXSA 2WSMA 3EG5A 2O8FB 5KTYA 2ZYWX 2QMHA 4YXWA 4BFYA 3SFZA 2ZI3A 4DLTA 4G0NA 3KJIA 3HPRA 2F9MA 3ZVNA 1XDBA 4M21A 2QSZA 5LPNA 1IHUA 1GDDA 1P60A 4O0MA 1BYUA 1W49A 3MWKA 3BWDD 3ADKA 4LJ4A 2ANBA 4GMDA 3WXMA 4HZUB 4ASUD 4Y0VA 2O8BA 3PIRA 3LX8A 2AKYA 1WA5A 1R10A 1S1CA 2BM1A 1WB9A 3QG5A 4FMBB 4CEHA 4POAA 2AFHE 4V0KA 2VHQA 3KUDA 1GNPA 4UXIA 3ZZUA 1VCNA 5B57C 4IDHA 3ADBA 2J9RA 3H2YA 3A6PC 1QVAA 4NBSA 2PLFA 4TTQA 3RWOA 4UNSA 1D2EA 1A2BA 2IBMA 1MOZA 1LFDB 4IXMA 1NSFA 1Z47A 5UKDA 2C98A 4V0OA 2CL6X 1E9EA 3W3ZB 2A5GA 2JATA 1D9ZA 3IUYA 1L2TA 3KKQA 3P1JA 1BMFA 2CCJA
chains in the Genus database with same CATH superfamily
3LA8A 4OI1A 4KRYA 4Q18A 4EUFA 3CF4A 3RDPA 1CLEA 4TN5A 1SQGA 8LDHA 3QWBA 2AN9A 1H05A 1AKTA 1ISRA 3IQEA 1FX0B 2D4AA 3H0CA 5A4DA 1O96B 3E3MA 4PYJA 2MSCB 3SF8B 2JZNA 2EC5A 1F38A 2O5RA 4MV5A 5C8DA 3PDWA 4UU7A 5TQ0B 3WK7A 7REQA 4JEHA 3ONEA 1LQ2A 1DXOA 2X0NA 1Q3TA 4A6XA 1XKQA 1B73A 4I9GA 3KOZA 2NVOA 2P30A 3LCJA 1QLWA 4FHEA 4WFKA 2PMBA 1Y1KE 3MGBA 4OX9Y 1VKHA 5ICSA 2LCIA 3B1KA 4KXQA 1UBFA 2HIHA 1QH1A 5I3CA 3PPYA 2YIMA 4CV2A 2A0YA 3AYXB 1QV9A 2CXXA 1FXWA 3H2BA 1MV8A 2V7BA 4I1OA 3O90A 1AKVA 3STVA 2KYRA 3GQVA 4MWSA 3TD2A 3AB3A 1AMNA 1SURA 2IK8A 2Z98A 1YS1X 4RJ2A 3RHZA 1U7PA 5AKLA 4BO8A 1CEXA 2BGMA 1NUUA 2ESRA 3E5NA 1NW8A 1R4AA 4B7CA 3EXIA 1O96A 4JUDX 1DV2A 2BMFA 1E2UA 3F4BA 4MPPA 5IBCA 4DQVA 3ASVA 2YKGA 3BSSA 4HMOA 1ORWA 2DFNA 4I5FA 5ITWA 1T0BA 4KC0A 2BFOA 3BMOB 3T5TA 4E1VA 5EHZA 3K8OE 1Q1EA 5CU7A 4FMDF 3JRXA 1T8SA 1JX6A 1O6FA 1LC3A 1PS9A 1VLJA 2ZIVB 4XFDA 1AHNA 3RVOA 4F93B 5EZYF 4UTNA 2PT5A 2IIBA 4PG6A 3WLSA 3FG9A 1VBMA 5L95A 4TVSA 4DUPA 1SBCA 1H1TA 3DV0A 4KO3S 4JP2A 3LQKA 1GRVA 2OZEA 4PLHA 3LC1O 5DNAA 4RELA 3T38A 4TXNA 2BPOA 4RFVA 2UVQA 5FA5A 5FOXA 4W9MC 4S1OA 1U7OA 2A9VA 3PJGA 4MW4A 4ZT7A 1TM7E 2XUQA 4ZDWA 4HHEA 1IU9A 4M37A 1WEHA 1LVUA 1Z4KA 1JIJA 3A0UA 3BMOA 3L8FA 3CXRA 1FE8A 2VSOA 2XT6A 3L1UA 1D0VA 4H6WA 3SMQA 5CVVA 3L0CA 3COPA 1Z38A 1S89A 2E5WA 4Q1FA 5DSXA 4C0KA 2YWRA 2Q50A 4JR2A 5DU2A 2CWDA 2QORA 3GAMA 2WIKA 4K6HA 4AG3A 2Q9BA 2NXWA 1X1AA 3HCAA 4ENSA 1D2RA 4WNIA 1W36C 2B3DA 4JJEA 1MR3F 2CXNA 3CZQA 3O82A 1TTQB 4L27A 4H2DA 1XQ6A 5TF4A 3VHRA 4F7DA 1EFDN 5DGHA 2ZCJA 4KDRA 3C5WP 2AUTA 1KR2A 2CF5A 4PYIA 1EE1A 2CNKA 2ZREA 2JLXA 3NPMA 5AK5A 1IUKA 2Q5HA 1E64A 2WG1A 4ZQEA 5TB5A 5JJBA 4FS8A 3KUUA 3U7GA 2AMJA 4Z8YA 2V7EA 4N5MA 4AFNA 2XDYA 2RGXA 1WZCA 4N3GA 3V7UA 5I9IA 1EG2A 4Z1MD 2GXAA 3JD4A 4PFSA 5T41A 2XIJA 4FX2A 4Z4GA 2NZ8A 1L4KA 1YRAA 3RFXA 3RBAA 3AU8A 1VXRA 1COWA 3AEKA 5GMOA 1XWWA 3TPZA 1QIKA 2VPXA 4XGRA 3HI6A 4BX2A 3DV9A 4YRRA 4B6EA 1HT1E 2ZRKA 3OKFA 3UYKA 4CU5A 4ENWA 1SK9A 1XVUA 5KX5A 1MXHA 1XXHA 2JLAA 3D6MA 2YXEA 3P97A 4QBHA 4G36A 4A82A 1JPNA 2VAWA 5EE5B 1KZ4A 1JHMA 1T4MA 3REQB 2O52A 4KBFA 1T91A 3BFKA 3WIOA 3WRXA 2ZXEA 3C3BA 1QKIA 4YRFA 4HYYA 3F4KA 2HMWA 3IVMA 5CGQB 3DHWC 3K1AA 3PGJA 3O8OA 4PZAA 3OX1A 4XDHA 3USCS 1E2HA 2JGKA 1GVHA 1EWTA 2VYVA 5JAQA 4JWKA 2M32A 2P4HX 3R6LA 4S35A 3ND8A 4RWEA 4WN9B 2A5DA 1XQYA 1AIPA 4YJDA 4G0VA 3CR8A 2X2FA 5CFLA 1V2GA 2ZTHA 4HUQA 3DOEA 3IEKA 3IP5A 2XPCA 4FE3A 4TS3A 3VU8A 1Z6ZA 5FJIA 4BOYA 3GMIA 4OKNA 1ZJWA 4Q7EA 2CV0A 2KQUA 4IO0A 3OICA 5GIOE 3OETA 3EASA 1F7UA 3P9IA 4G67A 2QRVB 4CG0A 1SIWA 1PZMA 2FUNB 2VL7A 4QE3A 2VHWA 5C35A 3G7NA 3NDRA 4G4IA 4HRVA 4C0WA 2VQFB 2YDXA 5EZ5A 1G0OA 2FMFA 3EGWA 4DQKA 4JJGA 4FIZA 2JAHA 2ZJ0A 4FEGA 2Q2NA 3LL7A 1Y8QA 4NVRA 5K0TA 1KEEB 3HDGA 5TQVA 2AUMA 3TINA 3GJSA 1MN6A 4OJTA 2JD1A 1TU4A 4FQ5A 2ZKLA 1DUSA 1WVGA 3PVZA 1AZSC 4ANFA 5L3QB 2JJ2D 3EEYA 3PNMA 4EJ0A 5EJMA 3COJA 3RIGA 6REQA 2CD9A 3QWAA 2QPLA 1I4TD 2AXNA 4ENPA 2IYWA 3HXKA 2ZRIA 5BNIA 1AGXA 3NRJA 2ZFUA 4JFAA 2GTPA 1UJ6A 1AGYA 2JFGA 4YCSA 2DVMA 5JS8A 4LSGA 2WJZB 4LOHA 3ST7A 3KO8A 2IITA 3TNFA 4R81A 3ZVMA 2BJHA 1DVRA 5I9MA 1QH0A 2PH1A 2ZSJA 3R3WA 4X92A 3V00A 4F6RB 5HOEA 1JEYA 2YNMD 4MA4A 2B6HA 3UFXB 2XGGA 1NOJA 3U7IA 3SC3A 1RHQA 4D9MA 4MW9A 3PEYA 1ZOLA 2HA5A 2QD3A 1FK8A 3KXLA 2H5LA 1MTOA 1V35A 3NDBB 2Q1UA 3EF1A 2GA9A 5BUCA 4S1NA 1IN6A 1DOHA 3ODPA 1G3UA 3QU4A 3DMPA 2DTXA 1JXOA 1J39A 3QUQA 5LXTA 4XFJA 2HHCA 2OZKA 2R96A 3JYOA 1M74A 4GLBA 2E55A 2VRBA 1EI9A 2AYZA 1OVMA 4ZVUA 4AQDA 4ZMSA 2ISQA 3OSUA 5EA2A 2DHDA 3FSRA 4ZDKA 3DFKA 1MAVA 2DB3A 3G3EA 1ZH4A 1EDZA 1XJ5A 4PCLA 1CLUA 3AEQB 3AI3A 2WYWA 3ZDAA 2OAGA 2D7DA 3K6SA 4Q7KA 3SZ3A 1UMBB 5HHTA 4TYWA 2F59A 4B35A 1O9HA 1IZZA 2ATCA 4LOAA 4N4AA 4DA6A 3KBBA 1SCAA 3P0IA 2OFWA 1QG4A 4W82A 1RZVA 5LUBA 4E03A 1LWOA 3I2YX 1QTRA 4II2A 4UVHA 5DBEX 4BMNA 1ESNA 4CMEC 2YYAA 3PC4A 1FJHA 1QOQB 4RE6A 5G0UA 3H19A 3RVDA 2QX4A 3VR4A 3W06A 3P96A 1XHEA 5C5CA 5AM1A 4ND6A 4RKRA 5CBPA 3ORFA 3W1VA 2P5SA 1WSWA 3B9BA 3N0TA 3P0JA 4FLMA 2MYPA 1WZIA 5EUMA 1HDGO 1JWBB 1ZNXA 2O0MA 3D8UA 3FGOA 3IHKA 1W1WA 3IP8A 4UZFA 3NGMA 3BCHA 3MJSA 4GT1A 5CXSA 3ITEA 2PD4A 4FR5A 5CW2A 4ARZB 2ID9A 3M89A 1LSUA 1JZTA 2OZPA 4I1IA 1X94A 1M0TA 4G5SA 4UEWA 5G4LA 5C1PA 3KKNA 3M3HA 4CF6A 2HTFA 3NYIA 3OTIA 4QDJA 2HFJA 1EJBA 4UMVA 4BZZA 3ER8A 4FQ7A 2GSDA 5COAA 4DTCA 2YMMA 1IVSA 4I4CA 1KZYC 1J07A 3B6ZA 1CC1S 3FMVA 4XGIA 2YJTD 5KYUB 3HFGA 4KFTA 3I09A 5A3SA 3ZBQA 4CIWA 4IZIA 5CH8A 1TCCA 1GCAA 2JLSA 2WJWA 3C4QA 4X20B 3V4OA 3UAOA 4EFNA 4RGVA 4OHKA 2NIPA 2VDNB 5I51A 4B82A 2NUBA 4LQLA 4U9UA 3D64A 4HQLA 4ND2A 2QTBA 2CBZA 3V97A 1QOPB 2OFXA 3I45A 3Q5GA 3RSFA 4OQPA 4RD0A 5AHOA 1FTWA 2YIJA 3JV7A 4OFZA 3RRBA 3VO8A 1N6IA 1DBQA 1GG2A 1R3UA 1XF1A 4PHFA 4TL6A 4KYVA 2VEOA 2ZATA 4NE7A 4QXPA 2F8TA 3K0AA 3C24A 3URKA 2V74B 1YBHA 5EJIA 3AR4A 3M2TA 4KG7A 2XQFA 3WKAA 2XZPA 4XGNA 1A8HA 4LNUA 2PG3A 1K7CA 5LYJF 3DMRA 2WINI 2XF8A 2NQ2C 3MMPA 1V25A 2C31A 3C6YA 3MIZA 4P08A 3NVAA 3F5DA 1E7YA 2POQX 3GI1A 1ZD9A 2HM7A 5G4KB 4R8MA 3WFIA 5BVGA 1QJCA 5AKKA 2FFRA 4EPYA 3DQZA 4QOGA 5JDCA 3I5XA 3DEZA 1GKLA 1IATA 3GCDA 1UWCA 3UXMA 5LKAA 2V1XA 1VPWA 2FPKA 2B5OA 1K4MA 3O8QA 1JKMA 4M55A 4KREA 4BE4A 3MBKA 4ARZA 2CLEB 2F1IA 2LZ0A 1FJGB 2I2FA 3QSGA 1JW9B 5FBWB 3ZNQA 3MGCA 2ZRDA 3HUDA 4OGWA 4Z4HA 3JY6A 4XM1A 1A9SA 4KJZA 3ULKA 1SXQA 4BO4A 2HBQA 3DXZA 1Y6JA 4EB3A 1E9BA 1KETA 4KE7A 5ITVA 2RHTA 5TPWB 2WKRA 2I6UA 1ECPA 1XTKA 1LLCA 4HDNB 5IJ9B 1W1IA 3KOUA 1ZUWA 3GELA 1P72A 4BQSA 5KYWB 4N41A 1IB6A 2QAGC 6LDHA 2QVCA 1P29A 2DERA 4JXKA 3M6IA 1HXHA 3HBMA 2IU0A 1E0KA 2BRUC 1GQYA 4I08A 1LW7A 5CT9A 3DOFA 1IZ8A 1DC6A 1WMAA 3K73O 1ORTA 5DP1A 1PNVA 2YINC 1EEHA 3N5KA 1NJFA 2KBEA 4XWKA 2W70A 1N2HA 4CBVA 1K3FA 3LPMA 3NAZA 4IDEA 1KDOA 4UTVA 3A10A 1J2YA 4MKHA 2JVKA 1ZOOA 3EQ9A 3DEFA 3KXKA 4LPSA 3L1KA 4IYJA 2FCAA 4PC1A 1Z26A 1NVXQ 2BFDB 3OD5A 2C54A 2FHSA 4X8MA 2F1OA 3L7CA 1K98A 4GWGA 3IVRA 1GU0A 5FBRB 1JPVA 1FP2A 3RRFA 4BS9A 1N2XA 3GLQA 1YHNA 4CKBA 3LQFA 4XIYA 3CF4G 3IT3A 1W4BA 2BUBA 4G0OA 3DTNA 1FSGA 2E4VA 4HVTA 4OVKA 4DW8A 3CGWA 3EXHC 4G0PA 3DDUA 1ZK2A 3QU2A 4AUNA 3O84A 4EL5A 1LZKA 3OQHA 1E3WB 2FPOA 1KK2A 1J9ZA 2PBFA 3PE6A 3ZW8A 1G1AA 1HE2A 2BEUB 3RNOA 3CVXA 1OTHA 1W35A 3PUVA 1XDSA 1TYBE 4OU4A 1TAQA 1VFPA 4H3SA 1OKKA 1T5OA 1TAGA 5KOHB 1G63A 1XR3A 1JB9A 2JK1A 3NIGB 4C6SA 2FY8A 3B6KA 3JWPA 3BD8A 1YCHA 1ZUHA 3RF7A 5C37A 1J21A 1G19A 3S68A 2H00A 4QFDA 1KY4A 3JRNA 1KI9A 3ZCTA 1RHMA 1PLKA 1WSDA 1Z88A 1XMOB 3PXCX 4IO1A 3JQFC 3NUGA 3Q41A 5TQ2B 2WAYA 1FTSA 1EX7A 4WFJA 5K3EA 4C07A 2Z9DA 3I6QA 2FUG1 3EOAI 5KAPA 2IS6A 1P81A 3SFVA 4JQCA 1NLZA 3HDVA 2ZRAA 4F9GA 1OI2A 4QEZA 3IEPA 2J33A 3SC4A 1L5MA 2GQ0A 2SHKA 4WZBE 1EM6A 3EIFA 1P7YA 3IBSA 4KTVE 1PEAA 1T0JB 3SYRA 3WGKA 4PAMA 4C2BA 1O6BA 1WCYA 4UBLA 3KJNA 2Q1SA 5P21A 4QUEA 5C5IA 5IPFA 3AY0A 3CWZA 2ORED 3H1PA 3N8NA 1BJKA 1FP6A 1PUIA 2H2WA 5IJ0B 1PGJA 5KYKA 1FUKA 1EFPB 1DBWA 2V7GA 4INPA 1S0UA 2Y2VA 4WZZA 1KH3A 2VZ0A 1I3CA 3E22A 4NZZA 3GYBA 3WQSB 4DTIA 3C3AA 5ESDA 4RKFA 1P4HA 2GKSA 4TL7A 1USUA 3C7DB 2O8DB 4OG2A 2R65A 3GH1A 2MCFA 1U2GC 4IGIA 1OV6A 3R1IA 5IYZB 3L4BA 4EJ2A 3KR2A 1QF7A 1VIMA 1N5OX 5IG2A 4KRXA 1KAGA 2FDRA 1T36B 4LPKA 5C1BA 1V1MB 4M7OA 4AF6A 3RFVA 3C1AA 4EUHA 1QWOA 3Q9NA 1V48A 1J25A 1DWUA 1EBBA 1BXRA 1VLZA 1XU9A 1Z7YA 4H3VA 1C4KA 2CWWA 3LHIA 4HAVA 4DV3B 1C4XA 2WSSD 4F4IA 2PGLA 3FOBA 4WWHA 3TXYA 1YXMA 2X13A 5JISA 2DHEA 2WC1A 2IZ5A 4IEFB 4D0SA 1AS0A 3PB3A 3JALB 1QIHA 1SU6A 4GMGA 1ZXXA 3OQIB 2JPDA 2HV9A 4WSOA 1NIPA 2OCXA 1RQLA 3GJ5A 1HZZA 4MXDA 2YXNA 4JELA 5HRAA 2ZR0A 1E63A 2QUKA 1ICEA 1GJRA 2D1YA 3KKLA 3ODGA 2XWJI 3D8HA 5ALUA 5KX5F 1HYGA 1L4NA 4DE5A 2AGVA 1B4DA 1P77A 1YA8A 4DDUA 3VXKA 2C7OA 4OM8A 1AD2A 1IOWA 1DT5A 3C1OA 1WPQA 3SJUA 3WRYC 4BU1A 4F4UA 1R5JA 1N33B 1QKJA 4MP8A 4Z9YA 3QXJA 4QJ4A 3GVHA 1HE5A 4CTNA 4BWVA 5AQ1A 5C80A 5F76A 3ZJTA 2C9OA 4H4DA 2W2QA 2JCVA 1QFZA 3PZBA 3IGFA 5IVKA 4JNKA 3NJRA 1DMRA 4QQRA 3E3AA 2FSSA 4L3VA 3U56A 3BA6A 4RZQA 1KFJB 3ZJYA 1M1NA 4QEDA 4F9EA 3HSYA 2NTNA 1IY9A 1WB5A 1QE3A 1RT9A 1EE2A 3DXYA 3KQOA 3QELA 1V45E 5HR5A 3K2QA 3KQLA 1JV2B 2FG6C 4HMPA 3BMCB 4Z9AA 4DHWA 4B6OA 2XKAA 3ESXA 4P4SB 1CZHA 1ONBA 5TRTA 3TW4A 3AHJA 1XRLA 1NV9A 1JG3A 4W5TA 3G0HA 1QO9A 2QN2A 3L1VA 4Z8XA 1UPAA 2SKDA 2BTQA 3AL2A 2WVAA 5IXJA 2VQ6A 3U3MA 2EZ4A 2QQ0A 3EY9A 4QQ8A 3AJ8A 4J6FA 1E2KA 4RTQA 3NRCA 3TO5A 1SC4A 2EWMA 2PV7A 4TQUS 1KXZA 2J5BA 3MS2A 5I9LA 2QG6A 2QROA 5C8VA 4R8RA 2QTTA 2D54A 2GVNA 2HSGA 3JSAA 3AESB 2WTBA 1G60A 3U7EB 3F0TA 1PQYA 4JHLA 2H4YA 1AXGA 1JJBA 3FKJA 4FHFA 4JLPA 4MEBA 3OUZA 1CY0A 2G1UA 3EXIB 4NOKA 1Y3HA 1G5FA 1THGA 2VK1A 5I7RA 3FCEA 1LV7A 3LKBA 4XGQA 3T7DA 1A9RA 3V4SA 8AT1A 4ZT3A 3SYKA 2WIJA 4K9DA 2HPHA 2B4YA 3HBNA 3LP6A 2ZAMA 4N01A 2BF4A 3GXBA 1X15A 1EHIA 3NOOA 4NOMA 4WD3A 1V6AA 4IXDA 4A1FA 3LRTA 4RIFA 4QTXA 1A4IA 5FA8A 1Z4NA 3VX4A 2UXDB 2MIIA 3QEBZ 2MJLA 1U0FA 1Y9DA 1A9TA 2PPLA 4C7JA 1E3MA 1XUOA 2PUGA 2ZB4A 3RODA 4BLVA 1KAQA 3F4LA 4IQFA 3RAGA 1L1RA 3VZCA 3WK6A 4IEIA 3PTZA 4DDHA 1KQGA 1DAFA 4TX1A 2WSBA 3IKMB 5GJCA 1XZCA 1PJ8A 1Z06A 2NO7A 2BDEA 2YFKA 4N5LA 5DBFA 2L18A 3RG2A 3UC5A 3AF4A 2HWWA 3GUUA 1CEYA 4U7TB 2NPIA 1FMFA 2JHPA 3TW8A 1CHDA 1XDGA 3DWIA 1W59A 2IE8A 1OX4B 3A1UA 4KBGA 3F5MA 1BX1A 1R1DA 2PXCA 1FMTA 2QAGA 3KSZO 5GM2A 3V46A 1JIXA 4MYDA 4FDLA 1T5SA 4QUGA 5EYPA 4D9IA 4CFYA 2BP7A 2I6QA 2V7QA 2Q46A 1DC5A 1KEZA 1H0HA 3CYFA 4C4OA 4LUCA 2J48A 3A9CA 3KZNA 3TZQA 4AKGA 1RM4A 1W5EA 2H2AA 3UUWA 1M6VA 3L8YA 4ZAVA 4L2IB 1TYZA 5HK8A 2GBIA 1MC8A 3WWDA 1KO4A 2NZYA 1P9LA 4IUCS 4ZV9A 4EG7A 4M6WB 2QOEA 3A36A 3WGMA 1VHTA 1B0PA 5AW5A 1PLLA 2VCHA 3IPRA 1MJ5A 4NMLA 5IAJA 5C1OA 3UJDA 4R2LA 3MW8A 2OCDA 1CUFA 2A4KA 3VUEA 2Q4DA 4BFXA 1HSOA 2JLCA 2QYOA 4ZO6A 5ADUS 2I2DA 5JANA 3EIQA 3HCBA 4GGPA 3OA2A 5DE3A 3OZUA 2HA4A 5JVDB 1G64A 3E9ZA 3LXRA 5ALRA 4B43A 3W2TA 6Q21A 4RGYA 2PLWA 3JQAD 2BY4A 2PSHA 3Q0EA 1AHIA 3IB3A 4P5EA 1CUWA 4A10A 5L40A 3U5ZB 4E21A 2CKDA 4D9EA 4MV8A 1DFHA 3N86A 1I6WA 2AJ8A 4G5YA 4WXRA 3LHKA 4DBLC 1QZ3A 1ZIXA 4BFCA 3WWCA 4AMVA 2XA1A 3CW9A 3EZ9A 1V4NA 2Q3BA 2HX1A 3QWFA 4HS9A 4NYJQ 5SY4A 4RD3A 3NEJA 4HO1X 4EI2A 4BC0A 3CX7A 1T4DA 1T15A 3N2ZB 2P9EA 3PI6A 2FEKA 2XVMA 4AJKA 2DU8A 5IXSA 1MVOA 1WAMA 2HK8A 2J6HA 4DIBA 3DFMA 1LJLA 3FF1A 3SBEA 3OIVA 4TTVA 4TTIA 5AKYA 1N1EA 4AO7A 2AZTA 4B6SA 4F3TA 4CL2A 4UBIA 4P84A 4TWJA 2RGDA 3V1UA 3Q1KA 4RK5A 3UB2A 2PWAA 4TKVA 4M0KA 4E88A 2YRFA 4TYMA 4KIWA 3VSBA 5D3KA 3CCBA 5K0SA 5BOSB 4IYRA 4NY1A 2CFTA 5A9TA 3SZGA 3VI4B 4QDZA 1S01A 5BY2A 1USKA 3I64A 1J90A 4FN4A 4D0NA 1CZRA 3ESDA 4C20A 3OM0A 1A9ZA 4IDAA 2NU7B 4MS3B 5DLPA 4BKPA 5AW1A 1KHHA 4HATA 4XIFA 3UAVA 3GK3A 3U9TA 1YRHA 4XIGS 3CNHA 1AOXA 5T3UA 1NVVR 3FA2A 1RI1A 1ZH0A 5JJCA 5FJJA 1GDTA 3IAS6 2YX1A 2I66A 3ZHSA 3SX2A 1W9HA 2P2CA 2VTVA 4M7WA 1UQUA 1E96A 3MEQA 5A4FS 2JK0A 5BMOA 2BDUA 1UC5B 4OTZA 3HE3A 4UVGA 1I6LA 2ZJYA 2IW3A 2QRKA 4ZAYA 3R3ZA 2C03A 4M99A 5FORA 3ZPXA 3FGPA 5CFRA 5J4HA 2R8OA 3PFIA 5L3RA 2X3FA 4D46A 1G9SA 1Z15A 3P4YA 3V3TA 4AY2A 1J9GA 1YZLA 2RGNC 3EMKA 3WGZA 3LT1A 1FFAA 4LSZA 1HYHA 2ZBUA 4BGEA 4S0XA 3NUZA 4B46A 4Q1VA 3IVGA 1VRVA 4YT4A 4DUYB 1VRWA 3U13A 3D5QA 1RXWA 1W1UA 3K8ZA 4WINA 1B0ZA 2NUAB 5JSHA 3N2GB 4REQA 4ML3A 4HK4A 4FFOA 4B31A 2PN1A 4EW3A 2QM0A 2ZRBA 4RHXA 4GYKA 3S3TA 1HY3A 3ZZTA 4LI0A 1FA9A 1RYYA 4M0MA 5EP3A 1MJNA 3EE6A 4MKGA 4DT1B 1KMHB 5DTMA 4DMFA 3U1TA 4HL6A 5F1OA 1KPGA 4JR1A 2HSJA 2FSUA 4MQBA 5F4ZA 1QS0B 2NZ2A 4RHUA 4F45A 3IBGA 1XZLA 2RIPA 1OREA 1A4UA 2R66A 4NFSA 4B87A 3HNRA 3OC0A 1SEVA 2JIZD 2AN1A 3HHEA 3SJBA 2XMCA 1MDBA 2GBPA 3WHIA 1TUGA 2YV3A 5ALYA 5G1OA 1TFRA 5JJ5A 1MOPA 5KJ6A 2FG5A 2IOHA 4NENA 3BDVA 2PO7A 5E9JA 1CUEA 3MT0A 1L5KA 2F1HA 1ES9A 3IOYA 2WIFA 1TUIA 1H2FA 1LJ8A 5I5GA 1K6IA 2YBDA 3PRHA 4V03A 1V9LA 3CLRC 2O4CA 2XNSA 4A03A 4D3DA 1VJ1A 2IYLD 3HB0A 4HQNA 4X60A 4QYXA 4XJXA 2AD1A 3HGQA 5CFZA 1P2UA 1E1KA 1I4DD 4M0CA 1C1XA 3ROGA 1QFYA 4IFIA 4FWIB 4J6EA 4S2UA 4ZAWA 5F2KA 3U3DA 5KYYB 1L5OA 3GRVA 3WICA 4BEJA 5JU6A 1X3SA 6CHYA 3QMMA 3LRXA 5JFOA 3QM1A 4N0QA 1VQ1A 4D8TA 1VJ5A 1NF9A 1JSRA 1KEWA 4TZTA 1E9VA 5IJ9A 3PUIA 3GNLA 4PONA 2Y1DA 5DBHX 1LEHA 1WDMA 4QBIA 2XDQA 3ZY5A 5KNCD 3OIFA 3R8CA 5HQ3B 3TLJA 3QPBA 4H1WA 1CD5A 4OB8A 3VISA 1Z22A 1T34A 3NLLA 2QYTA 1DBRA 3ZI4A 1EUYA 2R4UA 4DQLA 5AKEA 5EJEA 3UMYA 1CS4C 3K16A 1UIRA 4UE6A 2OBFA 2EQ5A 4JOBA 1K7FB 4F72A 3T7RA 4D6XA 1TUEA 3QY9A 2FUCA 9LDBA 2H0RA 2WEKA 4E51A 1Z4OA 1M6YA 5D3MB 1IZYA 1E4EB 1ESMA 1GUBA 1T5LA 2OBBA 1J09A 2P8SA 3WIUA 4MROA 2I6GA 5G4KA 4M8IA 1DIOB 3SR3A 4OF4A 1V26A 3O9ZA 4ASUA 1APBA 3KD3A 4G85A 1YRQA 3ZCXA 4MQLA 3FBWA 2NSYA 2VHXA 3N59A 4OI4A 2V6MA 3G8BA 4UDNA 5DNUA 1YMUA 2XW6A 1I2ZA 2R1VA 4IF4A 1BCRA 2WD7A 3H0EA 3TMYA 4CCAA 1EWRA 2OXIA 4PYOA 3S70A 1JYSA 1QGUB 2ALJA 3AYZB 5KVVA 3QU7A 1EP2B 3OP1A 1L4LA 4DN6A 1YR2A 3L4KA 3QNMA 2R7AA 3HYNA 4BTVA 2VC2B 3K09A 2XJ9A 4FINA 3BF8A 1GCGA 4GBJA 3KKKA 2OV8A 3FFAA 5BQ5A 2QW0X 5G0SA 4OBEA 2FSVA 4KR0A 3TLKA 5GINE 4AMGA 4FOOA 2BFWA 3ZIAA 3GMSA 2ZTVA 4RVDA 3TQIA 5BOSA 1XKLA 2BVNA 3FUUA 4JBXA 3GJ0A 3TNLA 3OEYA 3U2QA 5IJ0A 5EEGA 2CNBA 3L0SA 4XXHA 1JXQA 1KIMA 1SUAA 4DC9A 3TQRA 1JLSA 3VAAA 1UCFA 4CODB 1VKOA 1WXIA 5AKIA 2DPMA 2JJMA 2WJIA 3UW1A 2P2YA 4O2RA 1KAMA 4QEKA 1XL0A 3OMWA 5DHUA 1HFKA 3I73A 1LRJA 3W5UA 5BSKA 1UFRA 3BJEA 3NBQA 4UQLA 3FPLA 4B3FX 2ZB2A 5JLAA 1YFZA 1MOSA 4B3DA 5ADVA 5KHLB 3O38A 1DCFA 2EGUA 2VH5R 4AJHA 5CPBA 3MOIA 5JE8A 4WXEA 1D2MA 3ZXIA 4AJ4A 1NDUA 3PXDA 1FXSA 4YEDA 2BTQB 4GL4A 4M3NA 5AJTA 4CCYA 4YRIA 2XITA 1SOVA 1A9PA 3LLVA 2QWXA 1CYDA 3B1WA 4O4IA 2CFOA 3UATA 1NY5A 1X1EA 5FTLA 3GJ6A 3X43A 3MCAA 1Z0ZA 3EQ6A 3RM3A 4H17A 3THYB 5LFAA 4JR0A 5LP6A 2AK2A 2OO5C 1XHLA 3GAAA 4RA6B 4LHEA 1EFUA 1UT8A 4GC9A 3VZPA 3QBJA 4D4MA 4JQYA 2Q6OA 1IXKA 2VIIA 3LUHA 2H59A 2W6ZA 3OLVA 4H6XA 1QLHA 4FFPA 4Z0HO 2PSFA 4Z7JA 4A0FA 3OZBA 3A6ZA 3P27A 3F3YA 1GAEO 2FK7A 4YT5A 5GOTA 2BFMA 3F97A 4KZKA 1E1DA 1FQKA 1K6MA 3Q1LA 5JYDA 3KKZA 5ALJA 3ADOA 3CEJA 4NK4A 3FROA 1UBKS 3PUWA 3QNUA 4EYOA 4AI6A 3H8SA 1EGQA 1POWA 3AI2A 1ZXLA 4IUDS 4PYNA 3DHVA 4LXHA 4QARA 4Y9TA 5HIJA 1R8QA 1CUAA 1Q95A 4BZXA 1VKZA 1E61A 1MJHA 2Y0DA 2A1IA 2D62A 8GPBA 1TYEB 1ZA2A 3EAGA 2PMDA 4JB8A 4K3UA 1ZONA 2AEEA 4MS4B 5HJ5A 2FF5A 4X8HA 1KXJA 2EWWA 2C0CA 1NM5A 5FI5A 2PXAA 4IMIB 3GZNB 1R5OA 1RLTA 1N0VC 2C4HA 4WFIA 3GFQA 2YICA 4UZEA 4OHBA 4Q1EA 4ZREA 3OQIA 5K8IA 2C3MA 1CUZA 3TX2A 2Z2JA 1RAAA 1LPAB 4F7WA 4D8YA 4M4SA 1X92A 4E7PA 1NBIA 2DH6A 2QF7A 1Q11A 2PJUA 1T8UA 3HP7A 5AM2A 2C3YA 2YL2A 1FUEA 1KK3A 1VIAA 1WZ2A 2TS1A 2O8EA 3DLAA 1TF7A 3HWX1 4KX3A 5CVUA 2JLZA 1X7ZA 1BGWA 3BRQA 4OOFA 4CEHB 1QC5B 3SIWA 3QLVA 1G7TA 1YDGA 3D8BA 3VVCA 3F5QA 1T36A 4N5IX 4NFHA 5HFNA 4C7MA 4YRMA 4I3GA 5F7ZA 1ZITA 5TV2A 2CHEA 4Q4CA 4D9HA 1FRZA 1V8BA 3DG9A 3M4JA 3QITA 2AHRA 5JNLA 2PGIA 3DZDA 1PQ4A 3HJAA 4PN7A 3ITKA 1MQ8B 4Q7JB 2C2OA 1PX0A 3QKIA 1JTEA 1J0EA 1QAQA 2DQSA 3B3AA 4UM8B 4Q9JA 3WYCA 1TLFA 3EFOA 4X66B 4KH0A 4KQGA 2PTGA 3WHKA 4CKEA 5TE9A 4EDHA 2A30A 4I8XA 1KS9A 1USWA 2JGNA 2VG8A 1WKCA 3EEFA 1KORA 4R2IA 3MAAC 2Y1FA 1L7AA 3DL2A 4L73A 2IDJA 2VSQA 4P4TA 1THZA 2R00A 3KELA 1CQJB 1NHWA 4AKEA 2QN3A 3TOSA 3CNEA 1O89A 1Q1ZA 3KJQA 3W8FA 4AULA 3R44A 3S81A 2FPGA 2OY0A 3NXSA 5J3JA 3DV2A 4O2BF 5CFMA 5K8CA 2DBYA 3NT5A 4PZUA 1ZHOA 1D2CA 2B4KA 3JARA 4RPLA 1NP7A 2XOEA 2DJIA 2H4FA 1VA4A 3LSYA 3N9IA 3P7MA 3CVJA 3N2KB 4DLKA 4PGHA 3KQHA 1I5EA 5DBIA 1ZD1A 4JEIA 2H6EA 2EW1A 2V3WA 4MRPA 1PZNA 4N39A 5IH7A 4C22A 2PUCA 1JAHA 5K3AA 1POXA 5EJ4A 1VGQA 2PQMA 5EE9A 4J7XA 4TS1A 1KEUA 4G2NA 3LWNA 2ZYTX 2C88A 5K0NA 2RMKA 1P0QA 3FH0A 4JC0A 3CBQA 2QW1A 4WZAB 4ZV4A 4YJ3F 1NN5A 3ZDZB 2DXIA 3H2SA 3WL5A 1ZLYA 2CBXA 2HDNB 2HA0A 2P41A 4HGYA 1P5FA 1TOAA 3G68A 1WXGA 1OBFO 1WU8A 1L7EA 3V8EA 4FNAA 4Z9BA 1E2PA 3OH8A 1VSUA 1MAWA 3L06A 3ANYB 1EESA 2G8NA 5JZBA 5CB0A 4H77A 4MW2A 4WACA 4AJ2A 2RHRA 2XTNA 4I99A 3UB3A 4P5PA 4PEVA 4PNZA 1WQ1R 3NTRA 3N2NA 5C31A 4A8PA 6GPBA 4M83A 3SLGA 1VZ3A 2V45A 5H9VA 4QBKA 5REQA 3FLEA 3LPNA 3IJRA 2JG3A 3PJRA 3MBOA 1W5BA 4PTLA 1DP4A 1EGAA 1QIEA 2PX2A 3F2IA 4XX0A 3T95A 3WIVA 4W5OA 1AY0A 2WZCA 2XCRB 3H9QA 2IBSA 4OX9B 2YHIA 1DDGA 2NYAA 2Q4EA 1ONNA 1RC0A 3UENA 3WHLA 1JHPA 3E7DA 4LC9A 1Q1BA 3ZGZA 5J1SB 3QVUA 2HKIA 3TQSA 4ZVQA 3TKAA 3TTVA 3P9KA 5HILA 4QAJA 4FR2A 4R31A 4RENA 4F6LA 1KJZA 4P1ZA 2QTMA 1XZPA 4CUZA 1YB7A 4MWDA 4JI4B 2EZ8A 3CLVA 5JVDA 3GPLA 2HMUA 3P2EA 2VJNA 5AVXA 1PFYA 3TD9A 3OT5A 3UXYA 2VHJA 4I81A 3KQKA 1GV0A 2QQGA 2PMFA 4YR9A 3C5CA 3DB2A 1F6WA 3R3JA 4QBTA 3KSAC 3NWPA 1F9EA 4LV8B 1Z82A 4MVCA 2PD3A 1P2VA 5IYZA 3NFYA 5ANRB 2WWIA 1P2TA 3V8NA 3TD6A 4BGUA 3A58B 3TEMA 3HU3A 4TN1A 4RKQA 1LLDA 2GHTA 2X5NA 5C34B 2JLUA 1Y3BE 3OZVA 4WZAA 3GFRA 2BN4A 3V42A 1YC2A 3FUCA 4LZPA 2VNKA 2OD2A 2FSVC 1UK9A 2DZDA 2MR6A 1DOAA 1GKUB 4C5CA 5EL0A 5EYPB 3TE7A 4ZGGA 1Y8ZA 1ABFA 4KLZA 2IZOA 1LVGA 4M1KA 2AKAB 3KC2A 2QRHA 4O4IB 1JE0A 3W8DA 1X1BA 4DILA 3N2KA 4GMXA 1KQ3A 1UP4A 2I65A 4C0LA 2XOKD 1H0KA 4Y6OA 1ZXBA 3SG0A 3O03A 4FMDB 4LY6A 3TQTA 5A5GA 4JI0B 2ZZNA 5JZOA 4EZIA 4PG8A 3ZXSA 3I5UA 3WSVA 1XV5A 4I5EA 3H05A 3H1TA 3GGSA 5JXJA 3E6AA 5LLTA 3F73A 4JA2A 2FX2A 4IRMA 2XUGA 1Y1SA 3ZG6A 1U1IA 1VB3A 1PFUA 2O9JA 1W9MA 1N3IA 2YY7A 4PHCA 3B36A 1U1GA 3AUTA 4CMGA 1A2OA 4D57A 1EVYA 1UDBA 3BM5A 3RSSA 5C7LO 5C8ZA 3I5AA 4PLCA 1CUCA 3NXKA 4R01A 5BOVA 4D9BA 4A8JB 1ZIPA 3FOWA 5HKBA 2HN9A 5IF3A 4NCBA 2XRZA 1OU0A 4RJKA 1NQ5A 1N75A 5IHPA 1V7QA 3PNPA 1AMUA 1IWOA 4EYSA 3Q3JB 1AQYA 4EHLA 1W4ZA 2DKNA 2BGWA 3NONA 4WESA 4IG4A 5GQSA 3AZPA 4GBGA 3HEAA 2C8JA 3DXXA 3H4MA 1BC5A 3OQ1A 1K8QA 1MH9A 4MCJA 1QANA 3HCWA 2W2LD 4OYYA 4AWBA 1BD3A 1VE7A 3I01A 1PK7A 5BYKA 3BX1A 4KXVA 3D1VA 1XTJA 1QGAA 2J7PD 4PPNA 3TQOA 1QGUA 1P7ZA 2GPNA 4X8LA 3AHFA 5DW0A 2DETA 1NBMD 1NQUA 1FFEA 2BC9A 3RREA 5JS2A 4JH0A 2AVDA 1YKSA 2ZE6A 5I45A 1OAKA 1XU7A 5I8PA 2OBYA 5I7UA 3B9RA 1DRKA 2I4IA 3VDQA 3LYHA 5BWNA 3M9WA 1F4PA 1Z39A 3WZMA 1IYZA 2Z2YA 4RZSA 2OSBA 1GZSA