4RACA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
204
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 204
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4racA00
1QB7A 1UPFA 4F8EA 3MJDA 1DKUA 4JLSA 2PRZA 1OROA 4WN3A 1G2PA 1BZYA 1J7JA 1QB8A 1XZ8A 3HVUA 1I0IA 4M0UA 4QYIB 3S5JA 5JSQA 1AO0A 2PRYA 3GGJA 2EHJA 4LZAA 4PFQA 5BQPA 3ACCA 3OZGA 4X45A 4X44A 4P83A 1Z7GA 1O57A 4RHYA 4IJQA 1L1QA 1TC1A 5ESXA 5ESWA 3KB8A 2H08A 4P81A 1HGXA 1GRVA 2C4KA 3MBIA 4P86A 1P4AA 4P82A 4PAWA 5HKLA 1W30A 3G6WA 3N2LA 4OHCA 1V9SA 4LZNA 1A4XA 1NULA 4RAQA 1YFZA 3OZFA 1G2QA 4S2UA 1QK3A 1ZN7A 1P19A 1WD5A 2P1ZA 3DAHA 1I0LA 4Z1OA 5KAMA 2H07A 3EFHA 3DEZA 1ECFA 1IBSA 4RQAA 1XZNA 5IAOA 1FSGA 4M0KA 1HMPA 1L1RA 1QCDA 1ECCA 2AEEA 3GGCA 1OREA 2DY0A 4RABA 1P18A 1G9TA 2XBUA 4KN6A 4LYYA 1VDMA 2HCRA 4FYMA 1VSTA 1LH0A 4RQBA 1XTVA 1NONA 4RHTA 1P17A 2WNSA 2JBHA 4RHUA 1XTTA 1XTUA 1ZN8A 1A95A 3LRTA 4ZFNA 3QW4B 1ECBA 4RACA 1R3UA 2IGBA 1O5OA 4LZOA 1ZN9A 1BD4A 1GPH1 1ECJA 3GEPA 4P3KA 1UFRA 4RV4A 1DBRA 4WMLA 1D6NA 4P84A 1CJBA 2JI4A 5JV5A 1DKRA 5EUCA 5K51A 1BD3A 3H83A 5HIAA 1A97A 2GEBA 1I14A 1TC2A 5KAPA 1I13A 2VFAA 3ACBA 3LPNA 2JKYA 3M3HA 4TWBA 5BQOA 4RHXA 1DQNA 4RADA 5BSKA 1VCHA 3O7MA 1UPUA 1PZMA 4RAOA 2FXVA 1G9SA 3ACDA 2YZKA 1QK5A 5IPFA 4RANA 1DQPA 1Y0BA 2E55A 3DMPA 1QCCA 3OHPA 4MB6A 1ECGA 1OPRA 2JKZA 4QYIA 5E38A 4LYGA 3NAGA 4P80A 1JLSA 1U9ZA 2PS1A 1STOA 4QRIA 1JLRA 5BRNA 4JITA 1A96A 1MZVA 2H06A 1U9YA 4M0PA 1A98A 1I5EA 1QK4A 1A3CA
chains in the Genus database with same CATH superfamily
2V4ZA 5HE8A 1P33A 5C1BA 1HDRA 1N77A 5AJUA 4C7VA 1WV1A 4JJ4A 4JUIA 5JAMA 5AKXA 3FTNA 4WTOA 5LYJF 3LLSA 3NH9A 5E3IA 5TEVA 3RFUA 1XX6A 4U6NA 1CR6A 3NJ8A 4UJ3A 3MC1A 3IVRA 4FC7A 2UVQA 1WCV1 1CUVA 1R50A 2ZFUA 3GFRA 3NP9A 4L16A 4OHZA 4FFMA 4RELA 3VTAA 1QGAA 2HIAA 3CR8A 2B61A 2VDLB 5AVWA 1CY4A 2CWWA 1IDOA 1G8FA 3EH1A 1AF4A 1L4UA 2XD4A 3BE4A 4OYHA 3Q4GA 5LXTB 2WF5A 3A4IA 2GZMA 5JSKA 2JF0A 1DJPA 2PSEA 3RU9A 3EGEA 4OI4A 4HPJB 5H59A 3ZW9A 1NE2A 3VAZA 1GKYA 2KJQA 5D1HA 5FLEX 4I55B 4BBAA 1FL9A 1G8YA 2XE6A 2ZXUA 4RVUA 4UXJA 3TQFA 3U7EB 1XP8A 4YPFA 4HVCA 4BNHA 3GOQA 4CUJA 3AQIA 5AVSA 3A1DA 2GN6A 1DINA 1PJ3A 2P9YA 1JWAB 1QORA 4X8MA 3ASZA 3I6BA 3TD6A 3AKYA 4KV7A 1T0BA 4J7CA 3K9FC 3MHTA 1GGHA 4BNMA 4Z7OB 3QMPA 4ZK2A 2RI0A 2Y77A 2YYZA 1E6LA 1FXUA 1AUQA 2R5FA 1NLFA 5BN5B 4UMFA 4E2YA 2RBGA 3PXCX 4TMZA 4YCCA 3JCZA 3MB8A 4D8VA 1H8EA 2JGDA 1JP7A 2Q0SA 3B3GA 4HPWA 2XKAA 5FPKA 1VE9A 3V1KA 4LHXA 4WKNA 2WNHA 3OCZA 1PLKA 1E64A 2QZJA 2R44A 2C1EA 3MAJA 4CT0A 2WUEA 3HB5X 4OHUA 4YT8A 3GXBA 4B7ZA 3CZ5A 2W71A 2PZGA 4L2IB 2WU3A 3EB9A 4O4LA 4B4OA 2NYAA 2XOKD 2O2YA 4PCLA 2FSIA 3U49A 3PNBA 2PE5A 4AJOA 3PRKE 1Y6QA 3H04A 3D2AA 5DTIA 4IHQA 3LCMA 1ACMA 3JQAB 2IXTA 5LMUB 2IEYA 3VJRA 1VKZA 3RYHA 4DFDA 1PZFA 2JEZA 2XH8A 1T8SA 3QI2A 1J06A 1T1RA 4I1YA 1CE8B 4OHWA 3FSEA 4BO7A 4IDDA 1VG9B 4CVNA 4ZZ3A 3R9WA 1Z47A 3HU1A 4R3WA 2NO1A 3K71B 1M6VB 4Z9FA 2NQ8A 5A2GA 5KC8A 1DT5A 3DHVA 4ALIA 4DM4A 3KKOA 4HH0A 3RFTA 5IBQA 5FWDA 3JQ8B 1QNLA 2I80A 4F6RA 3P9IA 3QG1A 3W79A 2XUQA 1KMHB 1E2QA 2BHSA 1NRIA 1G8PA 2WEKA 2YV5A 3DEIA 4IIBA 1Y1TA 3FJYA 4V0MA 2Q4EA 2I76A 1RTTA 3KTOA 1JIVA 3ZHSA 4TS1A 4ROSA 3S2FA 1C3VA 4EG4A 1NFFA 2WYOA 3EXFA 1MPTA 1NP3A 1X8XA 3TOVA 3UAGA 3W5DA 1WCYA 3WB2A 1VJDA 2I78A 1EEHA 2XE4A 3U4HA 1FTWA 4IINA 1NXOA 4QGFA 4X91A 5F12A 2JHCA 2X0RA 1O96A 1V5WA 2OO7A 3QFCA 2NUAB 3WLJA 4MGZR 4D57A 1NXPA 2NOAA 3PR2B 5JIBA 3TTXA 4HYEA 4OMDA 1N34B 3Q10A 5CCBA 2HMSA 3ESZA 2CNWA 2PXAA 3P9QA 4KO2S 3SBOA 3UANA 2DH6A 4YUAA 2HIMA 3BDIA 4G0QA 4WBNA 3Q8MA 3L6UA 1PEDA 3I6ZA 4O4JB 1H42A 3OHMA 4UBKA 1OXVA 2J85A 2JCVA 2BVNA 2Y76A 4M9RA 5E6RB 2YBEA 4URWR 2VTBB 1UBEA 4YRDA 5HKAA 2QX9A 2Q5QA 4G8BA 3C5HA 4PV7A 1YBHA 5CA1B 1LPAB 1DTWA 2F6RA 3GDFA 2VJBA 3L05A 4JODA 1C7FA 3BGIA 5TQJA 4FHGA 2OP0A 4PPGA 4JP5A 4GX5A 4WBXC 1LZKA 1RM5A 3EFBA 4UTVA 5DTRA 4M1EA 1X1TA 3OUZA 1HDGO 1ZIDA 1Y8RA 3BFPA 3FYTA 1N8KA 5FNVB 4AN4A 3FR8A 3B7PA 4DDMA 3E5NA 3EH2A 1ORTA 5LQKA 3M4ZA 4BYGA 3HQ4O 4QDOA 2Z57A 4IMIB 3N75A 2IXAA 3HB9A 1E9CA 4MUXA 1X7WA 2GA9A 1SOUA 5BXYA 4JVLA 4GGPA 1T1GA 3JYLA 3N9IA 2A5LA 2DAPA 1G9TA 1P1HA 2YHAA 4D0SA 2IK8A 2FZEA 4JU8A 1L3IA 3I2HA 2XVZA 4AJ2A 3QXXA 5FUXA 1Z8DA 1AN9A 2NYVA 1HNXB 1U2ZA 3V00A 2NU9A 5F98A 4RHUA 4U6QA 3NBAA 4CM9A 3MOGA 2BR4A 3EGIA 3FGOA 3M2PA 5KC9A 2GPAA 5KIAA 4GPEA 5KDOA 2FJUA 4NBUA 3OZSA 3D0RA 4BN5A 2C5LA 2WJ3A 3BK1A 3BD6A 2H7YA 4TT3D 1C8KA 1SELA 2VHXA 2YVUA 1GDHA 4OH1A 5EXXA 5J2UB 3TQOA 4PYIA 1GU1A 1FTGA 4G0WA 3P27A 4CMAA 1AX9A 1E1QD 3AEXA 2XWPA 3HXPA 4DIMA 3IUPA 1Q1AA 1LK5A 1CUIA 2Q2WA 2B5VA 3RHSA 3TCXB 4GZ5A 3T5GA 3UT5A 1OH6A 4JJIA 2QP3A 4NFLA 4TKZA 1YQXA 1XRNA 2ZULA 4WA7A 1A4IA 1GA6A 2OZLA 3PJFA 5EQTA 1N4DA 3LY8A 1PL0A 1W59A 3FGPA 1JFVA 1YL7A 1FSSA 7GPBA 3E81A 2V03A 3IC5A 2ZSBA 4IVPA 3DL4A 1TJYA 1JYFA 4FW8A 3ZLJA 1T9AA 4QAQA 1KYQA 2CLCX 2FP4A 1E6EA 4LF4B 2BI7A 3AEUB 1R8SA 5CXXA 5AK3A 1Z29A 5ECWA 4WECA 1SCJA 1Q91A 2ZB8A 1PBNA 4H7DA 4JLDA 1JAXA 2PM8A 5EQFA 5BRNA 5T3YA 3EIUA 2PD4A 3TRFA 4U7GA 3HRHA 1DTSA 1W1WA 1Z33A 2WZBA 1MMFB 4CM1A 2Q2OA 3HCBA 3QF4B 1QNFA 1N8SA 2OLKA 3KK0A 4MMYB 5DIFA 1YOVB 3IIJA 5T67A 4E22A 5J4YA 4QTUB 1ZXLA 4WFKA 4C78A 4IKEA 3FYHA 2HA2A 4FJ1A 5EMKA 2IZ7A 4Z0TA 4GVLA 2ZK7A 1IHDA 3CO5A 5K20A 1UOEA 2IHKA 4IDFA 3VR5A 3FMIA 2WWVD 1RMQA 3PT5A 4B6FA 2QTHA 1XQ6A 3CX3A 4GWLA 1MT0A 4FCCA 4G0PA 5JY6A 2EIXA 3AUUA 3SR0A 2OGTA 4IH4A 4QLOA 4COKA 3ZPXA 2JZOA 1NW6A 3CRVA 4DDWA 1YQQA 2W2XA 3PDJA 5LFAA 4TLAA 3OZGA 1EDOA 1RXIA 3ETLA 2N42A 4P83A 2AK3A 2QRZA 1J0CA 1CY0A 4IVNA 4QBFA 3RTGA 4AP9A 3KPWA 3GVPA 2R7MA 3LQYA 4J90A 3GLIE 2IVFA 2JLRA 4I8DA 1Q77A 3L7DA 3QLUA 1PFGA 3G5MA 2A30A 4XIGS 4BUCA 2QMOA 3PF9A 4BVGA 4RKWA 4ER5A 1HUQA 1XPOA 3CPSA 4MR9A 1ORVA 2OXRA 2G3YA 5B57C 1NWHA 3CZPA 3MCTA 1SUSA 1BVYF 1TTPB 1TKBA 3OSUA 2FN4A 5FAXA 3VMFA 1A69A 1RWXA 4AMUA 3OC6A 4UDNA 3RVSA 5K03A 4MXDA 3WBFA 3AVUA 1Y7TA 3FDZA 2PUEA 3CPEA 4HAOA 2AC7A 4OI2A 1N6RA 4OGGA 4MV3A 5ALUA 3IEMA 4GYJA 4ZXPA 3UC9A 3VMMA 2GRAA 3BMOA 4QEZA 1DUSA 2VYCA 4X5OA 1ZRSA 5CITA 4HC4A 3WLNA 3G17A 3EGCA 3OURA 2OMKA 2YDXA 3UO8B 3LFHA 1R4NA 4BS9A 1JU3A 1D0IA 2B98A 2JJMA 2NZVG 1CR2A 3OWHA 5L7TA 4ZTUB 2QN9A 1H1TA 1J5PA 4TYMA 2XEXA 1JIIA 2DPHA 4QQRA 2WFLA 1VG8A 4IOKA 1UWVA 4CDNA 4AY4A 5JNLA 1RBZA 4JL8A 2YH2A 1BROA 5JO9A 4DA6A 1QZTA 4ZCLA 4FDVA 2Z30A 2NWQA 1BA2A 2R6HA 2X4DA 3ML1A 5SY6A 4MQEB 1SWWA 1Y1SA 3L04A 1RW4A 5ALLA 3T5CA 5JC1A 4Y6QA 3OX2A 1Z56C 1VKNA 4BFZA 3KQWA 3RAGA 5LKRA 4LXHA 4YO7A 3QWHA 3UMCA 1YSCA 2EJUA 3JALB 4JP1A 3NANA 3KL2A 5AHRA 2CXPA 2EBUA 4ZPXA 1DCKA 1VGRA 4O08A 1CTQA 2NVUA 3DTVB 5FPPA 4AYWA 4NULA 1KO7A 4Q1CA 5F3WB 1Z2AA 3AFHA 1W8IA 3EPPA 3MMNA 4FLFA 5CHEA 3I28A 3KHSA 1LCIA 3TW8B 4POOA 3E2PA 4NXMB 3EIFA 1RAEA 3KFLA 1YCHA 3UAZA 1FCJA 2MINA 2E1PA 4XWYA 3ZQ4A 2J6IA 4D74A 1FP1D 1DE0A 1UKEA 2D7CA 1IJKA 2YZ7A 3GEEA 5KKAA 5H83A 5BMVA 4KXYA 1MO5A 2GESA 4FYPA 1BDBA 4A0FA 4BVAA 3IMCA 5TC4A 2A9KA 3CF4A 1NP7A 2OQ2A 1EXWA 1H05A 3EVDA 2ZUTA 3UFBA 2RMKA 3U9TA 3PT9A 3TLKA 3U4AA 4LSGA 3M9WA 5EJAA 2YIVX 4E33A 4QOGA 2HX1A 1NVWQ 1TB4A 4RTSA 4WZ6A 4TKMA 3U3MA 5I9LA 1QONA 2Q0HA 5IT0A 1YS6A 3LBYA 4LYJA 1NR7A 1V3UA 4DB2A 3K9BA 1CEQA 221PA 3B53X 4IL5A 4OQDA 1I7QB 3P97A 3T12A 1ZSYA 2PRZA 3HSYA 1V39A 3MS2A 3L8GA 4FOOA 4Y98A 2VDPB 2J8ZA 3OLYA 4DMGA 3Q40A 4KQ1A 5IVHA 1JKMA 2CBZA 5B1HA 3TIGA 1HV8A 4D56A 5CFMA 5AVJA 3PCXA 1A8SA 4LRWA 3STWA 2P91A 3EVFA 1IUNA 1VBMA 1AS0A 3IERA 1UJMA 4MV6A 3ZIAA 1WQ3A 3PR3A 4QOFA 4JHXA 4CM5A 3CJTA 4X9XA 9LDBA 4ZYVA 2WHQA 3E82A 1I2MA 2TMYA 3F4LA 3FSGD 4FGKA 4QWMA 5DGCA 4H7KA 4DMLA 5C7OO 2B92A 3QU7A 4JKYA 1U65A 1W2HA 2AE2A 3CZ4A 4RFLA 4EGFA 2WQ7A 1UBHS 4C4PA 4I50A 2V54A 4BNNA 3U2QA 4BVEA 2PKWA 4CBVA 2IH2A 4OFBA 4EVIA 5HUJA 1OI2A 4D9GA 1VMEA 4JELA 3T4UA 1CZOA 3UCXA 3BULA 3UJPA 1KP3A 2I6SA 3DMYA 5KQGA 4V3CA 4N5HX 5SZJA 3AP3A 1C4KA 2O48X 2H1WA 1PR1A 3IQEA 3KE9A 3CEHA 4CDMA 1ZVVA 1AD2A 4TX1A 2FMHA 3PI7A 3N86A 3D6FA 4DJ5X 4IHJA 4CEJA 5K2MA 3R74A 5B58T 2COKA 1E7QA 2CL0X 2VRNA 1GJRA 4Q15A 3R23A 1HDOA 1U98A 5HF9A 4JWKA 1KE2A 3U31A 2JLBA 4FMPA 2VYVA 3P96A 1U0JA 1E2BA 1C2YA 3B48A 1UDAA 2XDYA 1DIGA 3CS3A 1C9YA 2NAFA 1D0SA 3AVQA 3D1VA 1EJBA 4Q7JB 1N57A 5IKPA 3WLFA 1FYEA 3S7ZA 2AXQA 1LUAA 3FIJA 3JSXA 2WT8A 4ZT5A 2WHRA 2D1YA 4H7FA 4RU1A 1MVLA 3AKEA 4DV6B 1S1MA 4RWEA 1JQDA 4CKYA 2DFLA 1SUEA 3KLMX 3OKFA 1JJBA 2XOEA 4I46A 5CXQA 3RS8A 1J8QA 2PPVA 4JWTA 1P1FA 4TWRA 2B8WA 2X19A 3LQRA 3H11B 4CKWB 1H65A 1KP2A 3GVIA 1L4EA 3KJHA 2A88A 1EPUA 4LZWA 4A0SA 1NVFA 1TDJA 1DEKA 4P4SA 1NC1A 4D0RA 1RAFA 1TVMA 4IO1A 3E9MA 2GN4A 4Z6KA 4YXWA 3QEMB 4HRAA 4E6EA 2XQVA 4RQTA 4M21A 4YAGA 1G5QA 3JPYA 3OU6A 1THGA 1SBIA 1SOVA 2WMDA 1DU4A 4LJ4A 2BFDB 4HL6A 1Z5UA 4MVJF 4QYIA 4MUKA 3EG9B 4G0XA 4PY2A 3VH3A 4YRIA 2BFAA 2AZ4A 3GA0A 3COSA 3ONFA 4V02A 4UCQA 2O2CA 1NF3A 2ISSD 2UUOA 5ERGB 4ZVLA 3SC2B 2B5WA 1WCIB 3GK3A 4I5EA 2DGDA 4HUTA 3L0YA 1VL2A 2OV8A 1HE5A 3K0FA 4CMCA 3FKSA 1YQGA 2I0FA 5K0FA 3ROGA 2YJ4A 2IUEA 2Z2XA 2PDAA 3AUTA 3NOVA 3QVJA 3WOVA 1ADFA 4NG4A 1GRQA 4I4NA 2J33A 1CVRA 1T43A 1W2GA 4I5GA 3NBFA 4EA9A 4HO1X 4ESEA 5LMZA 5A0VA 1ORRA 3CZMA 3P20A 1NPTO 3N39C 3KETA 5A6SB 3WGNA 1GD1O 1PKXA 4RPJA 1LS6A 1NURA 2WILA 3L6EA 3BTSA 3DL7A 3OY2A 1TK9A 1C9NA 5FA5A 3FMGA 4Q9IA 1N1MA 5CFZA 1R7RA 3MGKA 5J3JA 5A04A 1SVWA 1G7TA 3QTBA 2CK3D 1NNEA 1JF8A 2WOJA 3RK0A 2OPHA 4DB4A 1QU3A 1DMRA 1X39A 4OMUA 3B51X 3B36A 1TC1A 2XDAA 5FIUA 2C2GA 4RL4A 1M2OB 4J75A 2C4KA 4YMUA 1H9BA 5IVPA 4R40A 4WADA 3STVA 2NVWA 3HBJA 4EH1A 2C00A 5LXTA 2BBTA 3C8DA 4LVUA 4IDGA 2F1OA 3NOQA 4KODA 5LZ4A 2QUAA 3EARA 4XLLA 3HCAA 2VIIA 1DLIA 4DSUA 4RAQA 4XIJA 2GO7A 3BWYA 4L28A 3GCWA 5F4ZA 4XVCA 1R8XA 2B35A 3UMVA 5EESA 3VTZA 2CVOA 3OU7A 3K0SA 2IOFK 3UJNA 2P5YA 2AZXA 4RD0A 2CFRA 3NHAA 1X94A 1VECA 3WFIA 2G6TA 2ATVA 1H6CA 5LWQA 4IG9A 5EJGA 4HFNA 4J0HA 3B89A 3PDWA 3E9CA 3SFTA 4O2RA 3RLFA 4CTJA 1C3XA 3C3BA 4XB6B 4MP8A 3L7MA 1NXQA 1FYFA 1K08A 2RGNA 2WSLA 4QXOA 2IHZA 2DCMA 1QHNA 3MSXA 3G0IA 2I66A 3R7DA 1DSSG 4Q1VA 3UXYA 2I8LA 1NVDA 1NXWA 1W73A 2VCHA 4GRIA 5AM0A 4RV4A 1Q3HA 4AZ0A 4OAQA 1XEXB 4KKXB 4D9FA 5A62A 1Z37A 1AHNA 2F9MA 2GCEA 1A88A 4K9KA 1KYTA 1YHZA 3AY3A 5NULA 9ATCA 5JCPA 3NHSA 4YUXA 4CQMB 2YTZA 2XRFA 1BDMA 4M9CA 1SFRA 3N2ZB 1JMVA 2MJLA 1M1YA 3HDHA 3FUCA 3W6NA 2DR3A 5JLJA 2BJHA 4YAUA 4XOUA 4Z0HO 1CJCA 1ILWA 1U2QA 4MHOA 4BLWA 3K31A 3I3SR 4Y9UA 2C8JA 3K9WA 4CLHA 3F47A 2BYTA 1YB5A 4DMFA 3ZEIA 2JHFA 3N0VA 4Z5XA 1CUHA 3BRSA 1KEUA 1Z6QA 3QSGA 3CLHA 3ERCA 3H99A 3WKAA 3ICEA 1F8GA 5E9QA 2MR6A 1CT9A 4Y6SA 3GZJA 4P4TA 4XCXA 5TT0A 4BP8A 1T5TA 3QFHA 1RAGA 1GEEA 3EPKA 2C92A 2GJKA 5GOZA 4UUBA 2XQIA 2J07A 2JAOA 3BZUA 2J7KA 1KYVA 5DW3A 3SHFA 5KSWB 2CMFA 1SG9A 3MWFA 1RTKA 5JZ9A 3T0GA 1EFAA 1LV8A 1C80A 3ZWBA 2DT8A 2WUDA 3P2EA 1GZUA 3OOEA 5DLYA 4M6WB 5EIHA 4EPVA 1KYIA 2FN9A 3ZWCA 4KXFB 3L6DA 3OJEA 3I53A 3O5AA 4NH4A 3I5MA 1OIVA 1KAQA 1G2PA 1N5RA 2NUAA 4YAFA 3ZQJA 2FUCA 3D5QA 1FUUA 3DZGA 3EW7A 3KKPA 2P6NA 3QVLA 5DZSA 1Y3BE 3B52X 5GOTA 5DISB 4EUEA 3SLGA 1W581 3ROTA 4KIJA 1PW7A 3CWQA 4IJMA 3W7BA 3GJSA 4RHFA 4ZK6A 5EJ4A 3DUFA 3ACCA 5AW9A 4N41A 2VUSA 5BP7A 3RS4A 5ALNA 4DIBA 1BNCA 4P7KA 2B4YA 4IXWA 5I9TA 2AUNA 4OSOA 4CG1A 4RZXA 4FBLA 3SOPA 1RKQA 5EHXA 5TMDA 1T3TA 2QROA 2WYHA 3EQ7A 1EBFA 2BRUC 3PLRA 3R7AA 2CJWB 2QX8A 4YA6A 3CN7A 2AN9A 1ZH2A 2AR9A 2FWAA 2O2XA 3OAAA 2FOLA 4Y2YA 2X2FA 4FX5A 3IV9A 3N8IA 5DKFA 1YFKA 2H4JA 1Q84A 2WAOA 3M6VA 3QNMA 1K6XA 4L4RA 4Q3EA 4BB5A 1J25A 3Q72A 1Z06A 4TTJA 1B93A 1ZSVA 5IHPA 2Q3CA 4WCFC 4FJ2A 2JAHA 4WNIA 2GO1A 4EF6A 4QGBA 4CLRB 1DO0A 1UC5B 4U2GA 5ICMA 4B3RB 4I36A 1IVSA 4OGWA 3SAJA 1QJ4A 4GM0A 3O7WA 4P7JA 4ARUA 4F4DA 1XCOA 3JWIA 4KO4S 1U7OA 1KS2A 1JJVA 4B3XA 5HUQA 1CUDA 1NVMB 3N2NA 1N75A 1U7WA 4K86A 1U1CA 2WF9A 2H4XA 1VQ1A 3UTCA 2ONYA 3AFNA 4AJKA 4PAQA 1CQJA 1Y9EA 1H2EA 1XTTA 2WIBA 2H00A 2QUJA 3O2SB 1L7NA 2PG3A 3L7IA 7YASA 4F85A 4CE6A 2IIBA 3UWSA 4NY1A 3KV3O 4XASA 1BKDR 2VK2A 1PWYE 3C3AA 3IX7A 4B71A 3TM5A 4A36A 1CJBA 1L7VC 4CM8B 2ZRMA 1RJGA 3E3MA 4BWYA 2QUKA 4BV2A 3HU5A 4XR9A 5J2UA 2LRHA 1GPWB 3PHJA 1IY0A 3VJLA 2XYRA 3QLJA 2QR2A 3MD0A 5EUBA 4EVSA 1ILEA 1TC2A 3G2HA 2YFYA 1C0IA 3IIEA 3M49A 4RZQA 3NOOA 3W6ZA 3ZHCA 1XPJA 4CT5A 1C7JA 4D9MA 1FPQA 1PO7A 3M34A 1KI4A 4LZLA 1P45A 3FZGA 5CVTA 2QE6A 2EU8A 2ZRJA 3DR3A 3IQFA 1ISSA 5L3ZA 5L4SA 2ZRNA 1BXGB 1XN4A 2OBBA 4H4EA 5AW2A 4Q00A 3O73A 4TUYB 3HCEA 2P9EA 1FW8A 1RXSA 4EI7A 2PKYX 3C39A 3F5FA 1VPVA 2BMWA 3A6GA 1B1AA 1BE8A 1XTZA 3NWOA 4LC1A 4WEQA 4XEUA 4ZRNA 3HBFA 3ZZ0A 5AUNB 3GWGA 1VJRA 1QMPA 3TE6A 3JAWB 3T3DA 2FFBA 4RSHA 3ZWMA 4Z4FA 3AEUA 3I04A 2H06A 1XAHA 3GLTA 4JQCA 4S0ZA 4U3JB 3VX4A 2XHEA 4A8JA 3U0VA 2C95A 1TZKA 2OXCA 4II2A 4B6SA 3WJ2A 1QMGA 1U3VA 3F8TA 4ILKA 5ICGA 2PGAA 3OECA 3NEYA 3B6KA 3OLQA 3WWDA 2VLIA 3ND7A 4HDNB 1P4RA 4D4MA 3CLVA 4N39A 2ONJA 2H18A 2RH9B 4M0UA 2ETXA 3PKIA 1VE6A 1NW9B 1XVAA 1KRHA 2G8LA 1T5SA 4RCZA 3DKIA 4G1FA 1KDZA 1HKHA 4BGIA 3OQOA 2OZPA 3AM4A 3DLHA 2WVAA 4TQUS 3T34A 1P3Y1 3GLFA 1PL7A 1IZ9A 3AEYA 3AGQA 3THOA 3TRJA 4D0NA 5ELMA 3QX9A 5C3MA 3COJA 4ZJZA 2XT0A 3R6GA 2W6CX 1UMBB 5IHXA 4LV5B 1VLZA 2YIMA 4HAUA 3B13B 1K1EA 2AL7A 4MWEA 4PYOA 1DIAA 2XRZA 3CSSA 1TFRA 4LX8A 4AX4A 4BKUA 3GUCA 4LOJA 4HRXA 5M5BA 1FZTA 1LDGA 1T6NA 4QUIA 4F5WA 1V2GA 5AHWA 1SRQA 2X15A 2ZRBA 1VJGA 3NHPA 4OXIA 4XX1A 4YWHA 3VFDA 1F4PA 2MOKA 4MWTA 1H8HD 1NJFA 2CNOA 2PGIA 1NJ5A 2CBGA 4TN5A 2C9BA 1CWUA 2DOKA 4XM2A 2AYXA 4H77A 1B6TA 1Y42X 5F35A 4MITA 3SF0A 1SGWA 4B81A 2BCEA 5HA5A 2UZAA 4K8RB 2OBXA 3A6FA 5CPFA 3QYJA 4AMVA 1GGEA 4RULA 3OEED 1U90A 3I32A 1K0UA 1N9KA 1UT8A 3E2IA 2VPQA 4TLDA 3MJCA 1CRWG 5J4HA 5LDHA 4Q6BA 1MOSA 4R71A 2IHYA 3IDFA 4U9UA 1Y81A 2VHWA 4NEQA 1OGIA 1R4ZA 3FUVA 3ZBQA 5AVVA 4LYDA 4NK4A 3PX3A 3RRYA 5BVHB 4EJSC 2ZQYA 2H5LA 4JBLA 4TXHA 3CVYA 3Q3VA 3F5QA 4GUAA 1PTJC 3PTLA 4UNQA 1OH8A 4FFBA 4ZPJA 5IM5A 1GPH1 4F6LA 5ER9A 1SVSA 4ITRC 4HF7A 1SH7A 4R8KA 5B7GA 1XTQA 2KYRA 3F5DA 2IYUA 3SLKA 4AUNA 5JV5A 4RLSA 2DFTA 3HM2A 2QZSA 2FOIA 2WSSA 2CDRA 3RJ5A 5HKKA 2QRKA 1AQIA 1RWKA 1ZM7A 3ELBA 2IOYA 1LFAA 1E8MA 2AKAB 4IIEA 5H68A 1G3RA 3AFGA 4YRBA 4B3BA 2IEGA 1MO6A 3H97A 4XQCA 4YRZA 1HOTA 5LLDA 3GLGB 2PA0A 2Q1XA 2XT9A 4OSEA 4RPHA 1MN6A 3IHKA 3TPFA 1OH7A 5IN4A 3DBLA 2CLKB 3O8NA 4LC0A 2UZ0A 1N25A 1AKWA 4L78A 1SCUB 3WMFA 5LOVA 2IYPA 1B6SA 1VGVA 2FYTA 5JQGA 2B4TO 3A3OA 1MDFA 4OMCA 4XKJA 5DIZA 1XZHA 4DWJA 4P53A 3FYCA 2V1UA 2V0GA 1OPRA 1K66A 2ZETA 2QV7A 3H1FA 3GG9A 4DCNA 1QF6A 1XCGB 2XUFA 3G2MA 2O3SA 3IQGX 1X1RA 1JFFA 3AR4A 4PNPA 3T3NA 1SBTA 4URHA 5ENZA 1XK7A 1EX7A 1XCLA 3NUGA 5CPBA 3S2SA 3UQZA 3BSSA 3LCUA 4EKGA 1TM5E 4QBKA 3TQCA 4G0MA 1LSJA 2F90A 3I01A 4EPTA 4QZVA 4M8LA 3TDKA 1DLJA 1PR9A 1A3CA 1VGQA 3HRIA 1KR2A 1G18A 2DPGA 1SQGA 4H2DA 4I9UA 2QTVA 4QA9A 1U0FA 4LV6A 3TAXA 4N7RA 1U2TA 2FSSA 1TUEA 1NRXA 2Q9CA 3DCYA 3EXEB 3HHEA 2XKJE 3TJMA 2DH5A 1D07A 2QNRA 1TFUA 3MQ2A 3OO0A 1N5MA 1RXYA 3NRCA 4HUQB 1I7NA 1C3LA 2SKCA 3B1XA 1L5OA 1YI8A 3F6PA 4D9JA 2IIQA 5BORA 3LQQA 3L0CA 1VPEA 1AV6A 1W76A 2CCJA 2O5RA 4I19A 1N2HA 3AF1A 3OE7A 4GEGA 5JCZA 5ESWA 4XB2A 1WDWB 1GRVA 1JT2A 4ND1A 3LW8A 3N8HA 4CYMA 1PE0A 1YCFA 4PR3A 1B43A 4WJZA 3UK2A 3VU1A 4DA0A 3NT4A 3DMFA 2GUGA 3W3AH 3TNDA 1D04A 4AD8A 2OG1A 4DCPA 1NLUA 5B2EA 3NWPA 4BOYA 2F00A 1WPRA 3JWHA 3RLIA 4Z3KA 2DBRA 4O1MA 3ZNPA 1JV2B 1CG6A 4X7BA 4AJ4A 4UTRA 4JR0A 3PWKA 3CUUA 1H2FA 3ZDYB 4BE7B 1SKQA 2HJWA 3ADKA 2WYUA 1Q17A 2BFEA 1QFSA 2QENA 4C20A 4D4GA 3ISJA 5LZ5A 4EM6A 3E1GA 1F5NA 3H8WA 1FPMA 2ZBQA 1KI1A 1NBAA 4BQNA 1AQYA 3G02A 2OHIA 3VPAA 3OEYA 3MTAA 2HW8A 1IN6A 4FB4A 5IZCA 1WMBA 1AUXA 4O2AF 5JNRA 2IYLD 4B8ZA 2B1QA 3L4EA 4B0OA 1GU0A 4CM4A 5AK5A 4TZKA 4BQQA 3N05A 3DZIA 2CV0A 2P3OA 1JTEA 1QKJA 4PQFA 3W9SA 3EXIA 4NU6A 1VSQA 2I4TA 4J94A 3EXG2 3SK0A 7REQB 4IXMA 4R2MA 2A0YA 2HQSA 4HN9A 4HLUA 3BJRA 5ECDA 1WXHA 2GPNA 2B2CA 2GEFA 2G9RA 4JJGA 2WAMA 5HYVA 3ONEA 2QTLA 4BNZA 4JXZA 2O1WA 1Y7HA 3A06A 3Q0EA 5CRIA 4WKGA 1T8YA 3CVWA 4DNXA 2PZMA 2XI4A 4KXXA 1W88B 3WKCA 1TT5B 5BSHA 4O2BF 1U1DA 3GNSA 3CEPB 5JAUA 3AY6A 2BKUA 5JBIA 2A5FA 3L92A 1V26A 3OIDA 2VAVA 1SXJE 2D8AA 1JTVA 4FYYA 4UUMA 1KR5A 2O4CA 1CB0A 4UZEA 4I4CA 1W47A 4EA7A 4WJLA 5JCJD 1KMNA 4ENPA 2B2XA 3M3PA 3YASA 1JEQA 3GN2A 4G1MB 1T8RA 1P0QA 3GGOA 4RV5A 3TL2A 5BN4A 1H4TA 2NZXA 2PLWA 1U9ZA 1K7CA 4L8FA 5ED0A 4BLTA 3DD1A 3EAFA 5AYVA 5AVYA 1TI7A 4JITA 3AINA 1SQFA 3S1AB 2IDJA 1JIUA 3NAZA 4ZTBA 4CQLA 3GJ3A 3AG6A 4LHZA 2CXXA 3W5VA 5F1PA 1K8QA 2GBGA 1L5WA 2XUDA 2IZ5A 4Y2UA 3OTQA 4PYLA 3TRIA 5DV9A 3PDHA 5H3LA 1LEHA 3V48A 2G76A 2G9QA 3L9XA 2BE9A 3R3JA 1XPUA 4QYWA 2W6OA 3QQPA 1U6JA 3QIAA 1IEWA 4C4OA 1DFGA 4JIGA 1USIA 3HKBA 4Z1MA 4S1WA 2JG3A 1EZZA 1GUFA 4C07A 2V4MA 2XE8A 1AS2A 3KJFA 4PIVA 5FI1B 4Z2YA 3ECCA 3KG2A 5A6SA 2GMWA 1TYAE 3B5IA 2PZAA 1MX9A 4IOLA 1ELOA 4B85A 5EJ8A 4IEEA 1KVUA 3H0CA 1YL6A 2VP3A 3KJQA 3L8DA 1UQRA 1XKTA 3ZW8A 4IF4A 2VG8A 2ZRFA 2EATA 4NBTA 4XE5A 4MAMA 3MWGA 5GONA 4DTIA 3FOWA 2WKRA 4JJ8A 2X14A 3Q12A 4HBGA 3VBEA 4KFCA 4NBKA 4IIJB 3FFTA 5IG2A 1XLTC 5TPWB 4WZBA 1GR1A 1E3SA 2R6DA 4D8TA 4Q47A 1W48A 2EERA 4JIMA 1NVBA 2UUBB 4R7GA 5IDXA 1WUJS 2Y0PA 4PTLA 4NONA 3KYIB 3U7JA 4YCLA 4X71A 2YVAA 5AK4A 3T41A 2NUPB 3FCUB 2EJVA 3EZXA 1DKPA 2QK4A 3LCJA 3OC0A 2DHQA 4JVMA 4RIGA 1ZJ4A 2KHZA 2BONA 4PAMA 4C1BA 4D9EA 1KHHA 3D6VA 3QG5A 3ZE7A 4RK5A 1ZHOA 2VDUE 3ZG6A 2IF2A 3AFMA 3ZEAA 3PVZA 3QBTA 2B30A 4FFPA 5IVDA 1FFSA 4LZZA 1SN7A 2BGIA 2EZ8A 2GPTA 5AI8A 3VVCA 3LKVA 4A2QA 2Q3FA 3I45A 3HNOA 3OZAA 5ENVA 2DHCA 1OLXB 5J47A 2J31A 3WRWA 1G42A 4MVJG 3LUAA 4MUIA 3ZKWA 5AOVA 3H9EO 4FXPA 4GYYA 3W5JA 4CR7A 4HGPA 5IBPA 2ZSHA 1EFVA 4H3SA 4N3AA 3DVAA 3FYUC 3L43A 4Y9TA 2ZZNA 1K2WA 2QUHA 2YBDA 3HP7A 4KW7A 4KO8A 4UTOA 1Q0HA 2IE8A 3VM6A 3OPYI 2NU8A 3RK4A 5ALDA 4MRAA 2CGEA 3KC2A 5EN4A 3UKOA 3K70D 4ZT7A 1R9JA 1U0LA 4QWWA 2B21A 5J43A 1MEOA 5FLXA 1EVKA 1UJNA 2XMRA 5LQNA 1DXQA 2OQRA 2F64A 1N5JA 1DGQA 3AONB 3CH7A 2R2GA 3GP5A 5KAPA 4DCVA 3WAGA 3IKVA 2JASA 4ZZ2A 5ILQA 5LUBA 4TRMA 3T7AA 2I3DA 2YCBA 3BUSA 4Q3NA 4R1QA 4CQMA 4GL4A 5LSAA 3BIXA 3N3BC 2MSEB 4HWSA 4HDSB 3ASYA 2QGFA 1VB5A 1XL1A 2H52A 3AM3A 4Q1EA 4V1CB 4IIHA 1RYNA 3BORA 4UVHA 4NECA 5LD2C 1V5GA 3O91A 1PRYA 4ZAWA 1N9GA 4J8PA 4MO2A 5H4HA 4YQEA 4BQRA 4LDRA 5FWXB 3AHGA 5TSDA 3AWDA 3KR1A 3OQPA 2WJIA 2UYOA 4MP6A 1U3UA 2FZGA 4AKHA 2ZBGA 4AY3A 1Q2UA 4XGQA 2ZWAA 1AA9A 1AQ6A 4FXOA 3TLEA 4URVR 1FMFA 1YKGA 3JWGA 3QSYA 3I62A 2RKBA 2V7GA 3OWOA 1KMCA 3ZH9B 2H0QA 3I73A 1U2DA 2YJ6A 1B8OA 2FR1A 2NXJA 2ZI4A 1B8NA 4WN3A 5AICA 3OQMA 3NKLA 1RC8A 4IKOA 1U4SA 1F2TB 4KLAA 3FBWA 5JSQA 1K98A 3TW4A 4DZZA 1Z6TA 5A71A 1ONOA 2HHCA 3E03A 1J20A 1M1NB 1XVLA 5JPIA 1THMA 4HVTA 3KP1A 1COWD 1TA0A 3HUEA 1KJJA 4ZHQA 3KYBA 1NV9A 1OQAA 4A26A 3JAKB 1JX6A 1Z3IX 3A58B 5ESXA 1L4GA 2HM7A 1NW8A 2H08A 2R1TA 3GJXC 3SCZA 5JU6A 1PR3A 3ZD9A 4B79A 3UXMA 1C9JA 2V7PA 1ZUD1 4DJTA 1WY5A 2W6JA 4ME6A 4V0NA 2V7XA 3T9AA 3IIMA 2V3VA 3KT3A 2Q7XA 2XZPA 3VVLA 3K92A 3HKDA 1TU0A 3PUXA 4LGYA 1WRBA 4Y2PA 5HBGA 1ZKDA 1E9DA 1AK1A 3JQFA 3HXLA 2ZUDA 3IE2A 2RCYA 2VPPA 4P33A 1C30B 3C7TA 1LLCA 2DWPA 2DX7A 2OCLA 2OR3A 2W37A 3JQEA 1G17A 4MW4A 4XB1A 5TGDA 3KS9A 5FOQA 3PDIA 4YALA 3TSAA 3DZCA 5F2KA 4K3UA 4GQAA 1DZ3A 1BTOA 4RNDB 1YKSA 1J5XA 3L6CA 3T7EA 1ZZEA 2B36A 2DKFA 5AI5A 1O5IA 1PDVA 2WHEA 3E9RA 3FIUA 2VL7A 1Q7BA 2HSGA 1D1TA 1GQFA 5TB5A 1Z62A 4F2PA 4J16C 4BATA 3BB3A 4JBIA 4E70A 3UJ7A 5BUZA 1GPMA 4JFRA 2XWBF 1P0MA 5FL7D 4KR3A 2PXXA 2AYZA 5DLEA 1XL0A 1GWNA 1XHLA 2YYSA 3W2EA 1E2KA 1YZHA 3U7IA 2FPWA 2NN3C 3VPSA 2WU1A 1W0KD 2XWJI 2AD5A 1JA9A 1FNCA 4MLCA 1ZD3A 4R98A 3DZHA 2HWYA 3HC7A 3UV7A 1YRYE 3BXPA 2IYOA 1YI1A 3PR1A 3IV7A 1Q7TA 5LUAA 1L5KA 4TM7A 1QQ7A 2GHRA 2HMYB 1XALA 1QH1A 3RH0A 1A50B 2QRHA 4AK9A 2FA9A 4N3NA 5EINA 4EKYA 1D6MA 3AF3A 2BAGA 3KQNA 4FBMA 4RKYA 4G1VA 4C1NA 1SUBA 3B8EA 1VCHA 2CD9A 4CHTA 1JSZA 1IPEA 2JH9A 2OAGA 2WSYB 3OKPA 4Q9AA 1ZUIA 4R9NA 3AEKA 3RKSA 5KX5B 2PMFA 3CYFA 5GJBA 4BE9A 3FAZA 5FA6A 2RAUA 3DMPA 3K0HA 4LNUB 1QQAA 2D1QA 2H51A 3HZHA 1RKUA 3G2KA 1N0UA 3PV0A 3PYXA 3F3YA 5E38A 5B1IA 5IJAA 2O5EA 3I92A 3GAMA 4Y7DA 3DHEA 3MERA 3H2HA 2JCSA 4NAUA 3RSOA 1FRVA 5BYAA 3S2EA 1YD7A 5AJVB 2REQA 3X44A 4QDJA 3KDSE 5A1JA 1XEWX 3KTDA 2Q2VA 3N0RA 1I3CA 1RLJA 2IYFA 1H85A 5A5DA 3ROKA 2HRBA 1XU4A 2BMDA 2I7TA 2R87A 4BP1A 3OPMA 3G7SA 4UDOA 1UPFA 1CY2A 3D4PA 2HA4A 2FNAA 3ORQA 2VQEB 2VDWA 1OJ7A 3TL3A 2IY8A 2ZEJA 3B9QA 4ZGGA 3WV4A 1XZ8A 3DMRA 3MT0A 2FVXA 5U1PA 1RWNA 3KJGA 4CV3A 3UATA 4X20B 2YXLA 1A9ZA 5CNJA 2X8AA 1HYEA 1QDLB 1J39A 4JKOA 3GIDA 3HBNA 3S6JA 5KOHA 1SCNE 1JDTA 4OHXA 1FYVA 2B2NA 4PNZA 3HGMA 4YAWA 2C42A 4LRQA 1RQRA 4G5RA 2NTNA 2N75A 2O7SA 2OORC 2P0YA 2XOXA 2H5JA 2CMKA 1QHHA 1JJFA 1VZ2A 4Q9HA 4CLOA 3JQPA 1QO0A 4MLZA 5TGTA 3QVUA 4TMTA 3TYXA 4WXMA 1QRDA 3VH2A 3FETA 3GRYA 5EXDA 1LTKA 4K0RA 1YJ5A 1OFVA 3PHHA 2Q0QA 1HEIA 2GLUA 3C6QA 4Q21A 3V6MA 2HA7A 3PIRA 4FOLA 2MIIA 4M8SA 2PX6A 4MA0A 2Z9DA 4UM9B 1JVSA 2FWMX 1TZBA 3QOYA 3GH1A 1RAHA 2NADA 3GFQA 3HA5A 1GEGA 1LBEA 1U2EA 3AUAA 1EBBA 3P9KA 4BNUA 1WSWA 5IYZA 1M7GA 3T3HA 3M6IA 4KWEA 4B82A 4MPDA 2HQOA 1G5IA 2KW5A 2GXAA 2ZUCA 2CXOA 3LI2A 3K2EA 2CDAA 5CT9A 3WXMA 1EMDA 3KKKA 3Q1LA 3ROPA 1DWUA 1N5KA 1ZLXA 4XWKA 4BNYA 4OQEA 1R9MA 5IDQA 1ZW6A 1VOTA 4LOIA 2BEKA 1E98A 2IYEA 3U13A 2W58A 3QEAZ 2UXCB 1H9AA 5JXHA 3HJBA 1W5BA 2JLXA 3WQBA 1BO6A 2C8VA 4RMGA 1TQDA 2FWJA 3MRXA 3QE2A 4EBBA 4ZOQI 2BTOA 1JALA 2WF7A 4I5DA 1SHKA 4ZVTA 1CFZA 1N2ZA 1NI4B 2IS1A 1JIQA 3V8RA 3TRHA 5T6MA 1K0FA 3EZ6A 3II6X 3GLHA 1VHLA 2HC9A 3DXZA 2G09A 1D1PA 2RG7A 3RFCA 3MA0A 1ZUWA 2PMEA 3BERA 5JYBA 3L46A 1DJNA 3EVTA 4LMAA 4NBNA 3ZJYA 3PUJA 1GVHA 3AR8A 4LECA 1T4BA 1VYHA 3ED1A 4JUAA 1Y5RA 4RJKA 2YFQA 5FF9A 4OQZA 3K8OE 1FB5A 4PLVA 1EFUA 5ALJA 1D2AA 3LBIA 5ALOA 1QK5A 3UMJA 4BLOA 2HJ9A 3HP4A 2X1LA 4OK6A 3OQ6A 1BXRA 1QH8B 1KI8A 3DMDA 4FYIA 3VRHA 3C6XA 1ZZGA 4D6YA 2JKVA 2FMUA 4DQUA 2AFHB 2G5CA 3FPHA 3OT4A 4R9SA 1QIIA 3MGBA 3N8NA 1DP4A 2CLHB 1Z28A 2GRJA 2JAWA 3G5LA 4YECA 2WA1A 1HT0A 1ZD1A 5FBQB 2Z3VA 1BU5A 3T1OA 4NPAA 4PBSA 2V97A 3FBGA 3GJ8A 1DAOA 3H6HA 1LF5A 4YRLA 2CL5A 1PZGA 4NE7A 5HF8A 2Q3DA 2DWCA 2E5WA 4L27A 4CV0A 5JANA 3IRVA 5JXWA 2R8XA 1E1DA 4Q0MA 1J0DA 2R6AA 2VJYA 1TA4A 2YDYA 4F1KA 1D6JA 3GZNB 4ZKEA 1CZUA 3E3LA 3PQFA 4C6SA 5FOWA 4M7OA 2A1IA 4G24A 4BGUA 5EOVA 1RPJA 2OXEA 3GUZA 3OF3A 3OFKA 4EKEA 5CAEA 1QP7A 3A1CA 5FKJA 5L3SA 2SCUA 3I1JA 3R0IA 4J0CA 2GNOA 1KI6B 4IEFB 4RORA 1JG1A 3JRXA 1CYDA 4GI3A 4HDAA 4GRDA 4KXUA 3NM5A 3TNJA 5L40A 2DHDA 1QX4A 4M0MA 1TF7A 3MW8A 4RZIA 5AW3A 1RABA 1PS8A 3EIOA 3PA6A 4Q48A 4FT4A 1KEEA 3S8YA 1K89A 1Y3AA 1NMZA 4N6GA 4JBWA 4I4TB 2DLNA 4B34A 4F45A 1CYEA 3JQBC 3ADCA 3A9RA 2JVKA 2VAPA 4KXVA 3CR7A 2YHIB 5DWVA 1F7VA 5E8RA 2NZWA 4JOBA 1YZFA 3VHXA 3ZWKA 5ADVA 3KQSA 5JISA 4IDBA 1JLLB 5DK4A 1YJXA 4N0DA 2BY4A 2QT1A 2AT1A 3OEHA 4OI0A 4WHMA 1GZ5A 2Z08A 3ESBA 1TUGA 4OQMA 1VYVA 4AMBA 5JYDA 2XEDA 5KOIA 1YR3A 3GGCA 3WLLA 3ITDA 3SEQA 3DO6A 5F77A 3IQIX 1SD2A 4WY5A 2OSVA 1TGVA 4HGOA 5KCMA 3MAAC 5BY2A 1GUBA 3Q9SA 2OEPA 1ZX1A 1CB7A 4FD2A 5BOSA 1C1XA 3T61A 3V33A 2XA2A 4RACA 3W5IA 3KSBC 2A3NA 2Y71A 2J09A 4H6PA 5FUYA 2PKQO 1WAMA 1XRSB 3TMAA 1YA6A 5FPQA 3BEDA 4ZC1A 4L4YA 1FLAA 2WM2A 4H1VA 3A4VA 4BV9A 5JXGA 1T36B 2J7PD 2RH5A 2ZVDA 4XYEA 3WZ2A 4Q3BA 4MYRA 3ANNA 1JH8A 4NICA 1JEYA 1EUQA 4RQUA 5IFLA 4R41A 7REQA 2VTEA 4HI0E 4X3OA 4MV1A 3KKEA 3ZCXA 3IAS1 4CV1A 3DAOA 4FOPA 2ERXA 5BSEA 3CVXA 3KLBA 1I6MA 2ZS9A 4C4RA 1X7XA 1YQTA 4NE2A 1DRUA 1YUNA 2A6PA 1SU6A 2PWBA 3L41A 1IH8A 4B1FA 1QVAA 1GDDA 5FUMA 5KMGA 3QNWA 3W2GA 1BVHA 4B6RA 1CNMA 2EFGA 2XVMA 4M1ZA 3C5EA 4YRRA 2ACWA 3KCNA 3F74A 3JARB 1HZJA 4GKAA 5AKYA 2IY7A 1WXFA 3X1WA 4AX8A 2ORYA 4ABYA 4B74A 4LYGA 3F5MA 1AXGA 2EFDB 4A0HA 2RHOA 3QE9Y 2E7ZA 1RKBA 4HUJA 5CA0A 1RXWA 4GOJA 1EK6A 1T6BY 3NVAA 5D5QA 4B2PA 2VP5A 3URMA 1X6VA 3LZDA 4IIUA 4GYKA 4AS3A 4KIGA 4P4GA 4M37A 4YDHB 4EYGA 3EDMA 1L6IA 1Z6YA 2RAVA 2ZUWA 2X8LA 4ES6A 2C7PA 4PLGA 5DB4A 1VCOA 3H4MA 5IF3A 5K5EA 1C0KA 4XYMA 3VKWA 2RHWA 1GT6A 1YZNA 2OC9A 4PYKA 3FZNA 1JQ5A 3AVOA 4PLWA 4O5OA 1H0HA 1OBVA 2EKQA 4Q3LA 3UIEA 5BYKA 5AKKA 4HGRA 4ZCTA 1OGJA 4WOKA 1QRAA 2FPPA 3SZ3A 3OEWA 4D4JA 5BWBA 3CCBA 1KQNA 3K53A 2NQ2C 3SGLA 4BVHA 1MIOA 5H70A 1GUYA 1V1MA 2XZLA 1E18A 1WCXA 3IIIA 3KAKA 3KAJA 3TLAA 1Z7GA 2B4QA 4DCTA 5CB4B 1PNQA 4YRFA 3W8FA 6REQB 2RKOA 1TM1E 4EAQA 3TH5A 3WA7A 1TQHA 5KKCA 3KJEA 4TLEA 1GTJ1 1VYTA 1BN6A 3KLPX 2CYAA 2PUCA 4HXFB 4D4HA 1W0JD 3H5WA 1Q0PA 3M6LA 3ENQA 1MP0A 2HLDD 1B42A 4HADA 1XQWA 1G8GA 2FPIA 2GFQA 4FHZA 4PVDA 1KEZA 1BCRA 1NMQA 2GUWA 3H9BA 3P2YA 1H1DA 3UYKA 1EDDA 2DETA 1ZOLA 3A27A 3RUPA 4Y1EA 1MORA 1KFBB 2C83A 3EUWA 4WIAA 2PVCA 3CN9A 4LNHA 3V8PA 1IWOA 1SVUA 4N0QA 2P3LA 1MQSA 4BEBA 2R85A 2BTQB 2F43A 1G5RA 1SU7A 2Z09A 3BICA 3PGVA 2QW1A 4EFDA 1MEEA 1RRGA 4HLNA 4I9HA 1FFEA 3IQWA 3BMQB 4I81A 4B46A 2MYTA 3IULA 4ZEVA 2C4UA 2DG2A 4D3YA 1OXSC 1P60A 1N0HA 5K0SA 1CX9B 4JC8A 1P1CA 3GY0A 1J70A 3M6FA 4JUDX 3DP9A 1Q12A 4B8WA 3VO2A 5C8YF 1F2UB 4AN0A 1ZFNA 3SJ7A 5EZQA 4PRKA 5C46F 2IXFA 3GC6A 1URPA 2DCUA 1LLUA 5ES4B 2IU6A 3IFSA 3I9KA 3GO4A 4PU0A 1S2OA 2VC2B 3N76A 2JL1A 4MQMA 1ZD9A 3BMNA 2Z4RA 4EO7A 2FB9A 4EI2A 2P78A 4OX9Y 4YX9A 2GTIA 3S44A 5JJCA 5T3UA 2AJCA 2FWBA 1OAKA 2JJ1D 2AOWA 2PJDA 4MW0A 4AWAA 1I6LA 4DLWA 4LI3X 1RQNA 3WWPA 1IVYA 3DQQA 5HIAA 4IDAA 4XVRA 4EPYA 2DZDA 1MA0A 2QS9A 3CUEF 2R86A 3JASB 1XQXA 5JAIA 1CRLA 1ZVJA 1ZS9A 2PT7A 3EGWA 2O2ZA 4RPKA 4BNJA 1KQGA 3WLIA 1A1SA 1OH5A 3G2LA 3T35A 2OILA 1EGMB 3D3WA 3H2YA 3LUFA 5CFNA 1RWOA 3W3AA 3T1HB 3LLMA 1KO8A 2P68A 4B9AA 4AJ1A 2Q8QA 2ZCJA 2G63A 4Z2AA 4JUCA 3T7IA 1WOYA 1BMFA 5PNTA 2QNIA 5BSKA 2II6A 2XSZD 2UZ1B 3HHPA 4JVOA 2X0FA 3OKCA 4H60A 3FNBA 4QUAA 4ZU1X 1XROA 5I3CA 5JS6A 5FLKA 1JQEA 2PBLA 4RH3A 3DLAA 1ESNA 3TVYA 1W9MA 1ACJA 4J0DA 3FPGA 4PSDA 4Q93A 4FNOA 3M83A 3RYCA 3RVLA 3BE6A 1C1DB 4QOJA 5TS2A 5JRJA 4CNBA 4FLEA 4RK4A 4B87A 4BWFB 1MOQA 4I50F 3AYZB 4Q7EA 4CMHA 4XEHA 3QVVA 4H3HB 4MH0R 1G8KA 1ZJYA 3EUEA 3FFWA 3HVKA 3IBFA 3WWZA 4FDUA 1NX9A 2EJBA 1QQBA 4QL3A 3ENWA 3QBEA 4I08A 1QTNA 3S2IA 4BCCA 2HA0A 4M1MA 3U4CA 5JMOA 1QIEA 2E37A 2G88A 3ROZA 2OVBA 4K28A 2DFVA 4MQFB 4P5DA 4ZGBA 2CLFB 4X45A 5DMHA 3H8JA 3NBUA 4QQ8A 3RCBA 3TQSA 4MS1B 1FDIA 1Q3KA 1M1NA 4K03A 4NOLA 4DNPA 3B1YA 2J08A 3DE6X 4KE7A 3PX7A 4CGZA 1T2CA 1N2JA 1OX4B 3NGXA 4HZGA 1PYOA 4RF2A 1BDIA 3CTMA 1I2DA 4DGQA 4EQ6B 1P4AA 1G21B 4Q3CA 4E03A 4EHKA 3S4YA 1Z5VA 4L15A 1WHSB 2I29A 1O08A 4JJZA 3QUSA 1NLZA 2Y27A 1Y6GA 2WUWE 1OX6A 2ABWA 2W22A 1LX6A 3CUKA 4GXNA 3ES9A 3PEEA 2FW7A 2E0IA 4X1KA 3GP8A 2BGGA 3GT3A 1WJGA 2O7RA 2R5WA 2PX3A 3T3OA 1NZJA 1EJ2A 1UM8A 2YUTA 4L75A 2FF5A 3BQ9A 2A78A 3FAKA 1UOQA 3Q88A 4QQFA 4F4UA 5EAIA 1II8A 5ALKA 3L7JA 3Q7QA 3C6BA 4TSKA 4DNOA 4RS3A 4K9OA 3R40A 1C8LA 2X3YA 4ZC8A 2Z83A 2GJ4A 4DDKA 3QV1A 1EFCA 1AXRA 2W2LD 1DKOA 1NVKA 2WT9A 3A7DA 3UGTA 4DR7B 3IAAA 2HLHA 2C99A 4LY3A 2IZ0A 1AURA 4RQBA 2F3QA 1Z34A 5CBPB 1HLGA 2Z1DA 3ZTWA 2VT7A 4E5SA 3EJWA 5L8VA 4NJOA 4GOKA 2O8DA 4JBYA 1L5VA 2JGFA 2QVZX 3T3PB 3LVFO 1OFTA 1PVVA 2K2QB 2X7XA 1VLJA 3HR7A 3MRTA 1P4GA 1F4VA 3KKMA 3LTEA 4FJ0A 2YOGA 3MOIA 3PYMA 4J9UE 3RSHA 1ISIA 2JIPA 3UOGA 2VJPA 4R2HA 5LQMA 2AK2A 5FXMA 2ZUFA 5GJWC 3X0DA 5DH9A 1JQAA 4DSZA 2ICAA 3LT5A 4IICA 3HCDA 2CF5A 2O3TA 3PXDA 5IRCD 3WGTA 2C4HA 2IRWA 4RM2A 1R88A 1NQOA 2GWRA 2V98A 4MP3A 2VFAA 4NCKA 4Q3OA 4B3GA 1X0XA 4GI7A 3V6LA 5C4IA 5HK9A 4JOQA 1A2BA 3A1NA 1M9NA 3I4FA 2F1RA 1ZK0A 4IGEA 4XLTA 4BLPA 4BZPA 3GF4A 2V7EA 3GAAA 3AV0B 3N2GB 3SMQA 3NTRA 2JFYA 5EHNA 4WNAB 1E7MA 2X9NA 3KYJB 3VTKA 3ZZTA 1P75A 1G41A 2IP2A 2QN2A 3O1LA 1EX9A 4QC2A 1YRQA 4OO3A 3NEAA 3LDUA 1XCBA 2NO5A 5EP3A 3R41A 4IGKA 4CKZA 3PFHA 1TCUA 4H59A 2HDOA 3H2BA 4NCIA 4NFHA 4C4XA 2IDMA 1NAHA 2HBYA 4W9NC 3C3KA 4XJXA 5HDBB 1Y9DA 1YH3A 3JQGB 3WRYC 1D4ZA 2P6UA 3F3KA 3WV5A 3RC3A 5LXTF 4YMGA 2HCTA 2OL4A 4JR2A 4EDHA 2AEFA 2QL5A 4KXWA 1VIVA 4RXMA 4NDZA 3KOWA 3OWXA 4F8EA 2QLNA 3X1KA 3M1LA 5K3OA 5IM4A 3UFXB 1ZNZA 4PSKA 2RGWA 4V0OA 2HEGA 2PMWB 1DAFA 4NCXA 3DE7X 1DZIA 5FFFA 3LYAA 1QSGA 3HA3A 4C6TA 3T1VA 3V2GA 1VZ3A 4PG8A 2PK3A 2RCNA 3H9QA 5CDUA 3J81A 1CRPA 1SXJD 3UB3A 4QNNA 2PHZA 4OBWA 4YTEA 2XTNA 4O4IB 4YRCA 1N2EA 3VU9B 3HO1A 3H3XA 3VXKA 5KSZA 4C29A 2WWHA 1W25A 4MWBA 5AKIA 4AKEA 3WLPA 4UMEA 3U5ZB 1L5FA 3CVJA 4TS4A 5KI6A 3KU1A 5KNCD 1VHTA 5HKLA 3CMCO 4GX2A 1JECA 2ALJA 4L08A 4HQ6A 4BU0A 1U7ZA 3U0BA 1QR2A 1RPNA 1SZJG 1ECPA 5AKJA 4GXTA 3DMGA 3EODA 3GRFA 3KZVA 5GMOA 5TPZD 3TLYA 4IZHA 2H1FA 1ZN7A 4QFMA 4PNEA 3FHJA 4DXHA 4IMPA 4TS3A 3VC3A 1VKOA 1GSOA 4C5CA 2H1VA 4CKXA 3CPHA 3CA8A 4MRMB 4QJIA 2JNWA 2BR3A 4OB8A 5E3HA 4F4IA 3ZGZA 2LKDA 3OVMA 1G1AA 2PSFA 2BT4A 4FEAA 4WSOA 5DM4A 5L51A 2IL1A 3L0DA 3FE2A 2V9CA 4MINA 3PQCA 5A9SB 2Z8ZA 2O8FB 4MKRA 4KFTA 4RPGA 1K6JA 1YBAA 4OF4A 1KDOA 1KDYA 3OA2A 4JX8A 1EX1A 1Z75A 2QR5A 3IRUA 1KK0A 3JTEA 2BIFA 3UK7A 5FV4A 3CH6A 3JZAA 1YB1A 2PH1A 4BKPA 4LA4A 2HWKA 5K3FB 3M9LA 1TZCA 2WWTA 2Z9CA 4UUAA 1UKCA 5LWHA 5AK0A 1PQUA 1JNXX 2XMGA 2NGRA 4FNMA 4TMFA 4PLCA 5FI5A 1B0PA 2EX1A 2A92A 3CKMA 4WDQA 2FMFA 1POXA 4FDLA 4KQFA 1DAIA 3LT1A 1SA0A 3KO8A 3OD5A 1E1MA 1H0SA 2Z6VA 2IU4A 2WU4A 4UM5A 1P5ZB 2ANCA 3MMPA 2J6HA 4HLQB 1GL9B 1BGVA 2HMVA 2IYRA 2XUIA 5E1MA 4KPUA 2ID9A 3FVQA 2IUYA 3GQBB 4N5MA 3KOYA 4NV3A 3DMNA 3GFOA 2C31A 4MEBA 4BNDB 5DM2A 5EZSA 5IH3A 2JAXA 4F21A 1EP2B 1W4CA 1KORA 4MGIR 3RQSA 3K2QA 2OKCA 1CR0A 1Q22A 4RHXA 1SK9A 3TINA 4B7CA 1RRKA 2QUZA 2C0QA 3TTWA 1PFYA 2KE5A 3OUTA 4C2BA 3RUFA 3U48A 1Z0AA 1X70A 3OZWA 4UTXA 5FBVB 1D7OA 1E6MA 1WKVA 2BUAA 2D4HA 3S70A 4EYSA 5JPDA 5AH0A 2A0UA 4F2HA 4F12A 2WTAA 1UMDA 3R0QA 4Q7LA 1K75A 3EXG1 5EHQA 5FUWA 5LQUA 1JIKA 4ZO8A 5BN1A 4UUOA 3DEJA 3A26A 2ODQA 4IQ4A 4CEHA 4D45A 4EHFA 3MJHA 2ZE5A 1VPDA 2O7QA 3K9CA 4ZU3A 3UUWA 4QSHA 1SUWA 4QODA 4NZOA 4OGKA 4DR4B 3R44A 3CWCA 4K88A 4Q7QA 3I30X 4UEWA 3X43A 3C87A 1V96A 3RUEA 2PUFA 2IJGX 3CJRA 3K30A 5FBLB 2XTAA 2QRNA 3CSDA 1DEOA 3D6TB 5AJHA 4ZMBA 3HJFA 1Z2EA 1O6BA 2NU7A 4HMPA 1SMKA 4EQZA 2FZWA 4MW2A 2V7BA 3SC4A 3NO4A 5HCUA 4PZ0A 1HYHA 2XX3A 1K5PA 3D1LA 3KELA 4R2XA 4S1OA 4DV0B 2QB5A 4J7XA 2Q9AA 3IMKA 2F1JA 1T25A 4XUDA 1UZAA 2E5LB 2C9DA 2D5IA 2CXHA 1FXWA 1QM5A 3L8FA 1DAMA 1GARA 2C5AA 2NSHA 3INRA 3AIIA 4EHJA 5IEBA 4TL6A 3KD3A 3T6KA 3NHYA 1NQAO 1NLMA 4CU2A 1H1LB 3GHHA 1XVVA 4TLMB 4U0JA 3EXHC 4N1AA 1UEJA 3WOHA 2VBIA 3QPCA 2RB5A 1M6WA 2C0PA 4I1VA 4ERNA 2VJNA 3PNQA 1A4RA 3W2TA 3IOBA 1P74A 1NZFA 3Q5DA 3TL6A 2B1JA 3ND9A 4Q7KA 3BDVA 4AKTA 3WDLA 4FX2A 1BGXT 3LUBA 1V8PA 1TF5A 1OVMA 1FJGB 2BTEA 1EM6A 5A05A 1Q1GA 1KA9H 2QQFA 3E22A 3IH5A 3DR5A 1PLJA 3JYHA 4CF6A 5BSVA 1XWFA 2Q27A 1VG1A 5J2UF 2VDRB 3UCEA 1E3EA 1KI3A 4PANA 2JVIA 3HN7A 1V25A 1H94A 3AMVA 3EN0A 4Z9BA 1WTCA 2XV1A 3KWFA 1SQ6A 1PF7E 1PX0A 1VIAA 4CCYA 5EP2A 5EKUA 3K1AA 3BTVA 2UVPB 3PD1A 1ISPA 3P9PA 4TL8A 2ZWIA 3W2FA 1P1JA 2OZEA 2YQ5A 2OD2A 1R8QA 3Q6NA 1Q1EA 1EGVB 2EP5A 4OHFA 1PK7A 2EVWX 2C2YA 2XBLA 4NMHA 2AMFA 3O4FA 5EP1A 4AO6A 4OGFA 2VHZA 1C1YA 3PC8C 1LI4A 1SUPA 4GE3A 3LOQA 5L3QA 2R6CA 3A31A 1GAEO 3D43A 3GZ4A 3T5TA 3UJ3X 4KIUA 2OWDA 4AZTA 1DG9A 1JB9A 4F11A 2NSYA 3RSSA 1US8A 3BWCA 3EHEA 5ULLA 1E5TA 2A5GA 3DDOA 3F6SA 2GXSA 4J3NA 1A9QA 4RTRA 1KJNA 1TCBA 1X9GA 5AOCA 4GYWA 3KHKA 3PL1A 2HA5A 4AS2A 4CWAA 2O6HA 2JFBA 4N01A 2P9BA 1M7HA 1K88A 4MROA 4JT9A 3NHBA 1Y89A 3ABIA 3NCHA 5FOTA 1K3TA 2OYSA 2EX4A 4CIBA 4K05A 3PHGA 2PT9A 4G1CA 3V97A 3QNUA 3JX9A 4C6HA 4IYRA 1D3AA 2HDWA 3DZBA 2NP7A 4OEHA 5A7FA 2UVDA 4WKCA 4X95A 5BR7A 5IBCA 2W43A 3MK31 1PJZA 1CUCA 4QFBA 2DP4E 1V3QE 2L18A 1Q1QA 1YR2A 3LX5A 2WAYA 2WQZA 4B3FX 2GM5A 4OK3A 4YEDA 3DLBA 4Q19A 4UBNA 5HQJA 1CEYA 3DCIA 3IVGA 1LVGA 3CKYA 6Q21A 4BTEA 1D1SA 5TMBA 4KNYA 3NI2A 1RLTA 2PWPA 1SOAA 1Y33E 4Q6WA 3W6PA 3ZCQA 2GKOA 2Q4BA 1SIOA 4E5YA 2AKYA 4KBFA 4HDRB 2DXIA 1NMXA 3IS3A 1KPGA 2Q28A 5C37A 1Q7GA 2DMRA 3MEQA 2FVYA 4Y1RA 5HK8A 2UXDB 1DOHA 1GQ2A 4UPVA 4FYKA 1A4UA 1VE5A 4GD3Q 4ID3A 1RE1A 3PXXA 1K7EB 2X9VA 4PLTA 4FQ8A 5AD1A 1NXXA 3ZNNA 3SQWA 3LGAA 1FFCA 4MV4A 1JDBC 3VR1A 1P1KA 3OMXA 4RA9B 3T8YA 2IEZA 2OD7A 2PUAA 1CQZA 3DBHA 3C8UA 3HJUA 3HABA 1PNVA 2A9JA 3HLYA 2QL7A 2GZ1A 3NJRA 4GXQA 5GWXA 3UA3A 1SUFA 5C8VA 2EF1A 2CT8A 5D3MB 4GLBA 3VYWA 4TT3A 1R0SA 3S8MA 1XTBA 4MVYA 5PGMA 1HLPA 4G5SA 5LZ9A 3M6WA 3SKYA 2XMQA 1GNSA 4DJEC 1ZBDA 4C0LA 1P5RA 1GA4A 1DUIA 1LSUA 3T7TA 4CMKA 5DN6D 1D09A 2OHVA 2XB6A 3GR6A 4RK7A 1T0PA 4DR6B 2XPCA 2VJDA 4P34A 2EKBA 1E1CA 3QW2A 4NMLA 5AVRA 1SXHA 4REQB 5LP6C 2RE8A 5LJIA 2DLCX 2XDWA 4D97A 2EFYA 1WR8A 2I6TA 2DT5A 1JI0A 3PC3A 3T9BA 5A06A 1DC4A 4TV8B 2VJQA 1JKIA 3Q5EA 3WIDA 5K0JA 1G66A 4RABA 3ORYA 4QXPA 4QASA 3EBLA 2MWMA 2QXUA 3W5BA 3FUTA 4E2XA 5B64A 3IT1A 3PQ5A 1L7MA 1W4BA 1P1BA 4S0XA 1U1IA 2OZKA 1ESCA 4Y9SA 3P2KA 1KE1A 5JRZA 2IXBA 5BXQC 3C5VA 5DF1A 4LHEA 3ABOB 4IHAA 3BSYA 4DM7A 4UEOA 3IKJA 4EY8A 2AQ8A 2YQZA 4HD8A 3DVLA 3FYUB 3MNFA 1EB8A 2R8RA 1AKMA 1FDVA 2CNKA 1YI0A 4FEYA 3LBFA 3KEMA 3LXUX 4GLOA 4LEIA 1AY0A 1G0NA 1H2YA 5I48A 1E0KA 2PCJA 2YN4A 3QKSA 4KUEA 5M29A 2F17A 3F3SA 1ZH6A 1O0CA 1KYWA 2CMGA 1SXJC 4UBJA 2FPGA 3EUAA 3UZUA 3IXQA 2FSFA 3W6UA 3JQAD 4F4FA 2JRCA 4GOLD 4BEWA 4BC1A 2ECQA 1RE0A 1T2UA 2QLBA 2DTDA 2MSDB 3JASA 1IOZA 2CLSA 2FWRA 2Y1OA 1V4NA 1XU9A 1OV6A 3HMKA 4FSDA 4EJ2A 2IIPA 4MWSA 4MDFA 3AVXA 4TSRA 1Z35A 2W8BA 2VP9A 2IH5A 3ZNOA 8OHMA 5JY1A 3L6BA 1JPUA 1SHJA 4XAQA 3FWNA 3ZX5A 3EQ2A 1OFIA 2X6TA 4L0QA 4EATA 5JBNA 1T2FA 2I1QA 4KAAA 1FRZA 4RJIA 9LDTA 1NUHA 5A3VA 4CL8A 4F5ZA 5HQ3A 4L5IA 1R9NA 3FHCB 3VHQA 1KY3A 3EMBA 2CNDA 1GPUA 4Q5IA 1ARZA 1D2RA 2NT3A 3ZZMA 2X8JB 3AJ8A 5EI5A 4A6PA 4MV9A 2Q6IA 4OHMA 5K7SA 2O2SA 1FUIA 1TGYA 1NN0A 3F97A 5IUKC 5T57A 3W4JA 5K4GA 2EZ9A 1VA4A 2FEOA 4J1TC 2G5GX 4YJFA 3QGMA 1G5PA 1FTNA 1UBCA 4R1TA 1V7PC 3INGA 2AD1A 3SHQA 4Z4GA 4DXDA 1U0GA 5ALMA 3A05A 3V1NA 3WGGA 4KLNA 4IWXA 1L8OA 3QU5A 2FW6A 1Y5IA 3B70A 1G98A 4BYMA 1IZ0A 1OMOA 1TYBE 1ZGJA 2JPDA 3G82C 4UJ5A 3ZHBA 1HGXA 5GM1A 4KL8S 1FBTA 3FFAA 5I3ZA 4DUYB 1ZKMA 1CXZA 2WV9A 1NW3A 1DX9A 1KOJA 3IA7A 3O92A 1ZH4A 1PJ2A 1D4AA 2X2PA 3CXRA 3CF4G 2F3SA 4WXHA 1NQUA 3G6KA 3HCRA 5E7MA 5F2EA 5D6NA 3TFWA 4EG0A 3DJYA 2OFFA 3VUFA 4AJPA 5BN3A 2EHDA 3V4SA 2JFGA 1NVTA 4EZEA 5H7XA 1KRWA 4AURA 1X80B 2NV0A 3JV7A 4LZPA 2BRUA 1CY8A 3B6JA 3E8SA 1RYFA 4EY3A 5DHUA 2UXBB 3BJMA 3PPYA 4KB5A 5BQ3A 5HE9A 1XELA 3IEKA 4LWZA 2O7VA 1Z6GA 5SYMA 4PGGA 5IXSA 2XUOA 5KJEA 1ZDMA 1E2FA 1S02A 2G0AA 1TMYA 5BUSA 2BUBA 4MK4A 3MJEA 3CZAA 3RFFA 4LOAA 4WCFA 4BKMA 2IYNA 3LOUA 5LB2A 4MYUA 4U1RA 1VSTA 2QRPA 3A32A 4LKOA 3ZHZA 2ZPTX 1TNDA 5KYYA 1L5YA 1Y3HA 2JATA 1FOEB 4G2NA 4NENB 2WFZA 5LBTA 1DWQA 1YFJA 2O8EA 3R6WA 3ETGA 3NNNA 3OBBA 4ZJYA 3LHKA 3TQRA 2HJGA 4GXRA 4YDSA 1KWGA 4QO7A 3RV3A 3EHDA 4G4SO 5DXAA 5JNVA 4DR5B 1OY1A 1UWKA 5BWCA 3EJ6A 4EOGA 1YIAA 2AG1A 4A8HA 3BOSA 2VH2A 3OT1A 4ZICA 3VI3B 2ST1A 2PUVA 3CUVA 1YA4A 1UMCA 3PVSA 2G9NA 2Q21A 4W1RA 2GAAA 1SIBE 2JIRA 2X9GA 4MUAA 2ZE6A 4P7FA 4BLSA 2GK3A 4EYKA 2I34A 1EKXA 2VKTA 4IFTA 5FBZA 3OZXA 3PFCA 3NM6B 3WKEA 1EFKA 3GRPA 5EIBD 3STUA 4BU1A 3CVVA 3U7GA 2LP4Y 1QV6A 4RFSA 1HLFA 5BWLA 2HRQA 1AKYA 2XTMA 3DM5A 2ZIAA 4XD2A 5LYYA 3VR4D 2GJ9A 4PICA 3L84A 4K9NA 2P67A 3Q8XB 1A76A 3IAS6 3DQPA 3ESDA 2RAPA 4YAJA 4Z3DA 2DJIA 1W9HA 2HJHA 4N9QA 2I99A 4EG8A 5KNBD 3N5CA 2ZU0C 4OL9A 1D2CA 1I3NA 3FSGA 4Y2SA 4GI1A 4H1HA 3GRCA 2V6GA 1P2SA 3QJGA 3RS3A 5CG2A 4QUBA 3LU1A 4DG5A 1BWRA 1XKQA 2AJDA 2QYOA 2ZR8A 3ODGA 1PD1A 2R11A 5C8YA 1PU2A 4DLAA 4J2TA 2R62A 5FJJA 3ZVNA 2ZSIA 2W2PA 3P9ZA 4H16A 5H0IA 5LMNB 2NNWB 2WB2A 4Z53A 4U7FA 2WJ6A 4QXRA 4ZCQA 2A1UA 2PZLA 4LBVA 3I9MA 3QV2A 2BMVA 3FRIA 3BF8A 1A98A 5JNSA 5ERXA 3VO1A 1I1QB 4HWGA 5UKDA 4JDUA 1GN9A 3CEMA 3EGOA 2G1PA 2NM0A 5AESA 5FUQA 4U2CA 4FFRA 4PG6A 4NJEA 3PXEA 5D3QA 1LDYA 5ERYA 3RW9A 4DBZA 2VR1A 4NJMA 2FK7A 5D1NA 3IKTA 1V1RA 5H02A 2G06A 2P9GA 1W7AA 4ARCA 3VOBA 4HSGA 5J4VA 3FNRA 5B53A 4KN8A 2FG7C 1CUJA 3OQIB 3VR3D 3IXLA 3H9GA 3IVCA 4MI9A 3X1XA 1F6BA 2BFOA 1NBHA 3RUCA 3UPTA 3AB8A 3BRWD 2GPSA 4UCXA 4GI5A 2CDBA 3LC7O 1J23A 2B4KA 1TQ2A 3L7NA 2PQ2A 2HDHA 2Z5LA 1FVXA 3MTQA 4P98A 5BNFA 3VU9A 1K4KA 4KQHA 5JMTA 3FF4A 2VWQA 5EXEA 3VDQA 2HQBA 1ZJ6A 2UYCA 1B8UA 1LRLA 2O2JA 2GCOB 3NALA 3VV3A 4KQIA 5GZ3A 3CC8A 4LPSA 4LJAA 1VJTA 3EZLA 3I2FA 1I01A 2C9CA 2FE4A 2FX2A 5E1DA 5IJ0B 2XZOA 1CULC 1HTWA 2XCIA 4MIOA 3DAHA 4BN4A 1BHSA 2W6MA 1H22A 1PUXA 2ZYAA 3NYQA 4G6ZA 1Z68A 1M6HA 4IJKA 2A94A 4TKLA 4Y6RA 3TJRA 1WIWA 2AUMA 3SX4A 3T4EA 3AVVA 3E9YA 1KSHA 3FSRA 2FY8A 3DLCA 1X42A 5AW5A 4DUPA 3FH0A 1Z6PA 3KYDA 4KVFA 1BE0A 1WPGA 2QW8A 1KY2A 3PHLA 4YJHB 1TA9A 1ZOIA 3RWBA 3V4OA 4E2ZA 3P8ZA 2W00A 3W5HA 4Y18A 3DT8A 4EA8A 5B37A 5A9SA 1OLSB 3GRUA 3CWZA 2O07A 2JDID 1Z8HA 2MYNA 1LLFA 3GEMA 4ZDKA 4ZJPA 1XZMA 2Q2QA 4N7JA 4R69A 3A2MA 4L76A 4PHHA 5SYAA 4PLFA 1X7ZB 1YBFA 2EF0A 2MSCB 1H2HA 4OM7A 2IEBA 5TXGA 5HXAA 1A2QA 1P2VA 4NPHA 3CLSD 2VXYA 1F48A 1NHGA 2OAQ1 1COZA 3N07A 4NCBA 4EB6B 3ZGNA 1T9GS 4QJ5A 5T64A 4CPDA 1LSSA 4EJSA 3W2IA 3ICPA 3D3JA 4EA6A 2ZWVA 3AY7A 2AG8A 2J5XA 4MHSA 4YP0A 3UGQA 1NG9A 1TKAA 3AESB 4S04A 4R1SA 3UCFA 1T8PA 1GP2A 4ZVUA 5ISMA 5MFPA 3MUFA 3DDWA 3WKDA 2GQ0A 2RHHA 3BN3A 4ZQFA 3GPCA 3QE0A 3TWOA 1C50A 2CK3A 3DVRX 4QUEA 5CYGA 1EVJA 2LCFA 4DMRA 1NA5A 2VP0A 4PX2A 4D02A 4EY6A 5IPFA 4NR0A 4W5HA 1GVNB 1SKYB 1SC6A 3DTVD 2Z1MA 2OECA 2ZIXB 3LIPA 1ZHHA 4NPCA 3VNQA 1MU0A 3CRQA 1OWNA 1M2EA 2AHRA 1KZ7B 5E4JA 4ZHQF 2I55A 1GCAA 2TYSB 3AIOA 1QG6A 2A9PA 2X22A 2M6SA 1JR6A 2C29D 1XXHA 1H6BA 2I67A 2X5XA 3M5CA 3OFVA 4XQ9A 5LC1A 4N6OA 3MRSA 2JJ8A 1U0EA 1N2CB 4RJ2A 4RY8A 4TYPA 4JHLA 4AMGA 4HGNA 2GAOA 2Y1DA 3ECAA 4EKIA 3B6EA 1J6UA 2PUWA 2Y4OA 3DAPA 4QYMA 4B3CA 5JD4A 4OLFA 4RBNA 3L7YA 5KVSA 3BRQA 3MUEA 4CM7A 2DUUA 4O4HB 4TPKA 1L5LA 2FN3A 3RIHA 4UFPA 2PRYA 1GUZA 1NASA 3PNYA 1J00A 1NG1A 1QS0B 2XNCA 2RGEA 2Y3IA 4LJ9A 1XN1A 2PGLA 2XYQA 1G5HA 4LISA 2IVZA 4WH0A 1TAQA 3K6JA 3LPAA 1KK3A 1RHMA 5EIAA 1H0RA 3S68A 4C4TA 3D59A 5HOQA 1Y9AA 1MAHA 2ATXA 2PYDA 1KF0A 4WFQA 3C1AA 2D2FA 2AS0A 3K70B 2GSDA 4P2GA 1DCTA 4IDOA 2JA2A 2GBCA 2E87A 2G8NA 3JYPA 4JVSB 4QFDA 3ZY3A 5K0EA 2O8EB 3X2SA 1QUEA 1HQDA 2EFHB 1Z5OA 4I1OA 1R27A 4N3BA 2CF6A 3L4JA 1KH1A 1E1RA 4URZR 4ZVSA 4M22A 5KNDA 1CDZA 1CW2B 1FVFA 1AG9A 1MBZA 1EM8A 5JQGF 4P3XA 3SIWA 3K7EA 2AFVA 5JADA 4HCJA 4QXQA 1P91A 3CLRD 1GFWA 5HGXA 3G23A 4MO9A 3IQZA 1SB9A 1XZFA 4AF7A 1YQUA 4GX0A 2GVNA 4POAA 4E2FA 5JSUA 1V45E 2WJZB 3GCXA 4RD1A 5EKTA 1R6DA 5A5EA 1L5SA 2A67A 4RH1A 5I6DA 4LYYA 3K96A 4I9GA 2WINI 3FTDA 3NHKA 5DTMA 3LFTA 5E4FA 3BCSA 3CZQA 1I7LA 3RT1A 1YRBA 3REFA 1QGUB 2W7TA 2F3TA 3C41J 3HJAA 2FZLA 2YVKA 4ZREA 4BGVA 3IEVA 4UZSA 1AZTA 1DC5A 3SHVA 3WQHA 4ZIRA 1Z2CA 2COEA 3U9SA 3WGUA 2G7ZA 4P8RA 4YJ2B 1NNI1 1TJPB 3GMTA 1A8IA 4L22A 4E94A 3AR9A 1NZDA 1P6QA 1PJQA 1H5UA 1PZHA 2GEUA 3KLOA 4RY9A 4U8HA 1Z25A 1FRQA 1EFPB 2ODBA 2FEAA 3CH5A 3NQ41 3G9XA 4TUYF 4P0TA 5LB4A 1S3FA 3GJ5A 4ARVA 2PZKA 4FPXA 1KDVA 4FYVA 1EUDA 1MJHA 2WC1A 1NTOA 2V7QD 1ZW1A 1R66A 2I2XB 3GROA 4IFBA 4K9QA 4R84A 5EQDA 4C3UA 4J0QA 4CV2A 2Q7DA 2BMJA 4BKQA 2VDVE 3ENZA 4AQ7A 2VSXA 3A4YA 4IZ6A 4ZXFA 5K0TA 1DQSA 4HXGA 5TY0A 3DZKA 3JZIA 3UF0A 4BX8A 4ZVVA 1L7BA 1LPOA 1WMAA 1BS9A 5EHZA 3CNBA 1JWBB 4YAKA 3FJ1A 1ZAKA 4INZA 5EWLA 3EGXB 5CH8A 1TIPA 2UZ4A 3Q7TA 5KQLA 4HDKA 2PS3A 4JN6B 2R8PA 4C4AA 2CW5A 1IY8A 2P0AA 3DOEA 4GPZA 3LHSA 3U1TA 3U3KA 5DM70 1MCZA 4OJNA 2ZRPA 5G0SA 1G20B 2R1VB 5DMXA 5AVXA 1WB6A 3GD5A 4YPVA 4C0SA 4FS8A 1GNLA 1B23P 2GAIA 1NN1A 1ZUNA 1JZSA 1B16A 1TM3E 5JNUA 3PE3A 2FWIA 4JGIA 3L0ZA 4N76A 4B4WA 2V8BA 3QOWA 1VI5A 3H18A 1PN3A 4IM7A 4BB9A 5CFQA 1KIMA 2HRCA 4JLSA 5BYJA 1BQ4A 1RCUA 1RRFA 1XZJA 4YACA 4F2WA 2Q6TA 3BKWA 3SP1A 4DLLA 1L2TA 3IR6A 1TW3A 4HEHA 3JVEA 4AN1A 2IWHA 4MV8A 3O47A 1PS0A 4MSUA 2P62A 3KPJA 2CHEA 3IAM1 1XOIA 2DWQA 3K9NA 4K9SA 4KVZA 4U7TB 4EYEA 4ZYLA 3QYFA 2HMAA 4KYIB 4YP5A 5ETJA 5IYZF 3RRXA 2VQSA 4BQFA 1EGHA 4C0KA 5CDTA 1M2VB 5KVAA 3B5EA 3I2GA 4KR0A 2I6FA 1N1DA 5TNXA 3SMVA 1R15A 3JYQA 4W8HA 4ETMA 4YGYA 3QVGA 4XUCA 1Q7CA 4AJEA 3THYA 3TMYA 3CF2A 3O4RA 4IPTA 2PXHA 4O3FA 4Q4AA 3UMMA 5DCUA 3NBMA 1XJ5A 5KU1A 1JPJA 3I37X 4WZAA 3SBDA 4F38A 1M34B 5EIBC 5K1ZA 1ZM2A 2VHEA 3CIFA 2ZAMA 4MARA 2WF8A 5FTJA 4BNXA 3VR2A 4ITVA 3ESYA 1EVYA 4YJGB 1GM5A 1XLTA 4AKSA 1Q95A 3TE7A 1WX1A 3CQ9A 2AYYA 3UA4A 4LY6A 2DFPA 1EINA 4GLLA 3PFWO 1AHPA 3EFOB 1U2PA 3OQHA 2FG6C 2PWYA 3K5WA 3LLUA 5FBRB 4OA8A 3PEWA 1QCDA 3OZIA 5FWYB 1UM9A 2GAJA 2OLJA 2IX9A 3IHWA 1AXEA 3BPSA 2EBHX 3DF7A 2VP2A 3MJFA 4MKXA 4PX9A 2M6RA 5JNWA 1FS6A 3H2IA 3IDZA 1P6UA 4KE6A 5AJTA 3TOCA 3RRMA 4D98A 2V3WA 4EUKA 2XKKA 3FLMA 5EC8A 5FFMA 1NVGA 4H0NA 2FG5A 2FFHA 1XLUA 1NY6A 2R4UA 3HWWA 1TLLA 4MB0A 5JMWA 4ZYUA 4DDTA 2J9FB 4F9FA 1UIRA 3K9GA 1OA1A 4WA8A 2DQYA 4LZOA 4LTDA 1E5LA 2GJSA 2J0EA 2EW2A 3NTQA 5KQPA