4RACA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
204
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
total genus 71
structure length 204
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4racA00
5BQOA 3O7MA 4P83A 1OREA 1I14A 4P80A 3GGJA 1QB7A 4ZFNA 1GRVA 1CJBA 1BZYA 1UPFA 1U9ZA 1J7JA 3ACDA 4RQAA 4MB6A 1QB8A 1R3UA 4F8EA 2AEEA 3MBIA 5KAMA 2PS1A 1BD4A 1A97A 1GPH1 1I0LA 1QCDA 2IGBA 1ECJA 3LRTA 4KN6A 4RACA 1O57A 1I0IA 1NONA 4RABA 5EUCA 4P82A 4RHXA 1DKRA 2FXVA 4RHTA 1YFZA 1IBSA 1P4AA 3DMPA 5BRNA 4OHCA 1A98A 1MZVA 1FSGA 4P86A 3ACBA 3ACCA 3H83A 1ZN7A 2WNSA 4TWBA 4RHYA 1BD3A 4X45A 1A3CA 2DY0A 4M0KA 3EFHA 1STOA 4RV4A 5JV5A 1G2PA 1TC1A 1XTUA 2XBUA 1DQPA 3GEPA 1TC2A 3NAGA 1NULA 1P18A 1D6NA 5ESXA 5IPFA 3GGCA 1G9TA 4WN3A 1P19A 4RAQA 4JLSA 3HVUA 3M3HA 2JKZA 4WMLA 3QW4B 4RANA 4PFQA 1ECBA 1DKUA 2E55A 2JBHA 1W30A 4RHUA 4JITA 1G9SA 3OZGA 1P17A 3KB8A 4RQBA 4QYIB 1OROA 2HCRA 1U9YA 5E38A 1ECFA 1V9SA 1O5OA 4PAWA 1HMPA 1VDMA 5BSKA 4IJQA 4FYMA 5HIAA 4P81A 4QRIA 2P1ZA 2H08A 2H07A 1I13A 1G2QA 1ECGA 1L1RA 1JLSA 1XTTA 1A95A 1XZNA 2PRYA 1Y0BA 4LYGA 1A96A 5ESWA 5BQPA 1QCCA 1QK4A 4X44A 2C4KA 1VCHA 1UPUA 1LH0A 5KAPA 1QK3A 1WD5A 1QK5A 2YZKA 4RADA 5K51A 1JLRA 3S5JA 1I5EA 2PRZA 4QYIA 3MJDA 5IAOA 1XZ8A 3DAHA 4LZNA 2VFAA 3OHPA 2EHJA 3LPNA 4LYYA 1AO0A 1A4XA 2JI4A 1VSTA 1L1QA 1OPRA 4Z1OA 4S2UA 5HKLA 1HGXA 1ECCA 4P84A 1DBRA 2H06A 4LZAA 3DEZA 1ZN9A 4P3KA 1PZMA 1Z7GA 4RAOA 1UFRA 4LZOA 3G6WA 2GEBA 2JKYA 5JSQA 4M0UA 4M0PA 3OZFA 3N2LA 1XTVA 1ZN8A 1DQNA
chains in the Genus database with same CATH superfamily
2IYEA 3RUCA 4G1BA 3UZUA 4JROA 1E66A 2NVBA 1Y1RA 5CM2Z 4UPVA 2IHTA 3N3BC 1GAWA 1HQYE 2XV1A 1OILA 5DTIA 3GNQA 5AVUA 3TLJA 2Q21A 3GP5A 1YZNA 1L4GA 3V8QA 4ZZ1A 1F6DA 1W2GA 1T6NA 2KLBA 1PUXA 2IIVA 2ZSKA 3DW3X 2HF7A 3QNUA 5HJ7A 1WOMA 4G4IA 2JEOA 2NUAB 4J0KA 5JHGB 4I0WB 2ERYA 2BGWA 2C9DA 1NOIA 1ZBDA 2WTEA 5I7HA 2BELA 2O0MA 2WDZA 4IHAA 3KEQA 4NHEA 2CHFA 5DX8A 3KOXA 5F7JA 2VHYA 3FB4A 3HU1A 5DDIP 3IP6A 5REQA 2P6OA 2ANCA 2PZJA 4MQUA 2IS1A 3U3MA 3ZVKA 1EHCA 1E3MA 3DOIA 3D54D 3E9ZA 4WXPA 4MW9A 1UBEA 1T8YA 4IDOA 4XB2A 3HSYA 5DYYA 3MXTA 2XYGA 3VBEA 5JCXA 2F6RA 2Y67A 2X4IA 1BDJA 1RZVA 3H0KA 5KSWB 5HKOA 2BFEB 3GO4A 4G8DA 1DAMA 4D4IA 1BOOA 5JU6A 1UOPA 2OHJA 4GZ6A 1PSDA 3GDOA 3IP3A 1XJCA 1GPAA 1TI7A 5EJ5A 2X4LA 2OM6A 4B6EA 2C84A 1DDOA 3N2YA 2Z6UA 2O0JA 3U13A 4BU0A 3CUTA 2I99A 2INGX 5FH9A 1WNFA 5EXDA 3VSDA 4CM3A 1JUDA 2QMEA 2H4JA 1WSWA 1OGYA 2XRFA 3OPMA 1WEHA 2VYQA 2ARKA 1SH7A 4HWOA 1TU4A 1AURA 4YXWA 4Z6KA 3A04A 3KSAC 4TTVA 2PMFA 3F3KA 4MW6A 1Z13A 4HZGA 1VCNA 2O50A 4MVJP 5M34A 4K0RA 2WMOB 2D2VA 2DX7A 2C99A 3ROEA 2JANA 2NUPA 3DZKA 1XRMA 5KDLA 1SRQA 2J3KA 1RKBA 1TM5E 1KU0A 1TM3E 4DNFA 2XH8A 3HBFA 3OHSX 5BMVA 2CKMA 2QA5A 3VU1A 2WTNA 2PU5A 4V0NA 1XN1A 3FY4A 2HV8A 1GYQA 4IEEA 4EFMA 4QZVA 2HSEA 4XVRA 4PHCA 3VR5D 5TQVA 2H2WA 3E7WA 4IBOA 4DBLC 1I3OA 4G5XA 4HCJA 5TT1A 3VPXA 4I4TF 1AUOA 1PSZA 1A2OA 3D1JA 3FDJA 4GRDA 4Z0TA 1XYGA 4CMKA 3PVZA 3IBYA 3L1UA 5SZJA 3TRIA 4DRYA 3M6UA 2EFYA 3IQZA 1FMCA 3BSSA 3LO5A 4DV7B 1DTSA 2ET6A 3JQEA 1WB5A 2HT1A 3EYAA 3GLVA 1M8JA 5E3HA 3JTMA 2GH1A 4G4JA 1ZNXA 3TQIA 1SEVA 3WYCA 1PQUA 3CUUA 3U44A 2WZBA 3RABA 3TFOA 5D00A 3LWDA 5DT2A 2FN3A 1OLSA 1JG2A 1UKBA 3ZWOA 4ENRA 5KQRA 2XB2A 3RYCB 2J6CA 3BWYA 3A6GA 4OHBA 3M2TA 1GITA 2PGJA 1I3LA 1J56A 2OCDA 2PAAA 2ZK7A 4PC2A 3VPCA 4YRGA 2J4CA 3VH3A 1SM4A 2Z5VA 3ZHZA 3RTBA 1OLUA 2RAVA 4P92A 5FFNA 4AJKA 4GMHA 1KI8A 2GXQA 2NLOA 4PCLA 5JXWA 1PFUA 2C2XA 3OJ0A 5BSTA 3FNRA 4Z51A 1EJ2A 2ID8A 1K88A 2QU7A 2VDOB 3ORRA 3PPYA 1UIRA 3PE4A 4O2AF 2GTHA 3ABZA 3M9LA 3BQNB 3H1BA 1P8AA 3IQFA 2C5GA 4N6NA 3V1KA 3KJXA 1BD4A 1A97A 1PT7A 3ECCA 3THXA 1PV4A 2GAOA 4H1UA 1N6OA 2QLNA 3QF7A 1P7PA 2DVMA 4ND7A 1W4RA 5IAKA 2NUPB 5A0VA 1CR0A 3Q9UA 4EP1A 2DFVA 2IKQA 4R1NA 4RTKA 4GBMA 2UUAB 2GD1O 4LK3A 4KVFA 4C76A 1VKZA 2WZCA 2V7VA 4Y2YA 4COOA 2I2XB 1XDDA 2ZR8A 3H2KA 3W8NA 4F21A 1RP7A 1YS4A 2AQ8A 4EW3A 2WHRA 3QPCA 5L4LA 3G59A 1MZVA 4MPRA 5GTDA 5KHOC 4ND4A 1FDIA 1IBLB 1G3QA 2NTYC 4GGMX 4LXYA 4D0RA 4Q37A 4ZGWA 2R8OA 3MD9A 5A4KA 3MCWA 2EERA 3IRVA 4MTLA 2Q3BA 3OQOA 5FWXB 1HL3A 5LXTF 1TF7A 2J0VA 2IEIA 4HQFA 2RIRA 3KTAA 4Q16A 3I62A 4BWGA 4DANA 1GZUA 4L7VA 1B26A 3T7RA 2KMLA 3TOXA 4E7PA 1QTIA 1X1BA 4ZXPA 3QEMA 4N18A 2XQVA 1S1MA 2XCQA 3C3EA 3K70B 2X0IA 3HWSA 1GG9A 4HADA 3DQPA 4AS2A 2WIGA 3BXHA 4HZUB 5AKKA 4YRZA 1NNI1 3NKLA 2H7YA 1NNEA 3SZMA 1QORA 3RYHA 4LZPA 1M2WA 3KZNA 5FLKA 4EMUA 1SVWA 2IHKA 1IK4A 3TTSA 3ZKWB 1EFVA 5C0OE 2V97A 3OFVA 5J4YA 4NE7A 5K3SA 5CLGA 3N0WA 3S68A 1V96A 4LUCA 4MCHA 5BV8A 1N8SA 3MMNA 2LIVA 3O91A 4I6JA 3WRXC 5IBRA 3GLFB 4X1YA 2QT1A 4F1WA 1L5SA 2NTJA 1AK9A 1GNVA 3NVKI 5CA0A 1P81A 4B74A 4NZNA 3GD7A 3GUHA 3ZXXA 2AMLA 2Q1SA 2GFQA 3T7DA 5BSMA 2FW7A 3A4MA 2J30A 4MVXA 1DIBA 2ADFA 1WSBA 5JWRA 4QBTA 4KPUA 4HQOA 1RQXA 5IPFA 4N3NA 2G5CA 2MT9A 3LYUA 3KVNA 3BHIA 1H1LA 1IFXA 3CLKA 2J5XA 1AQYA 3Q9SA 4KHPB 2ENWA 3HKCA 2XSZD 4NBNA 1SUDA 4EITA 3D3EA 2PKRA 1XP5A 3KSZO 4JOBA 4N76A 3OE5A 1MJNA 2OXCA 3NBMA 3T1TA 4S2UA 1V5EA 4BPRA 3Q8WA 1FBTA 1NLMA 1ENZA 2V0NA 2YWFA 3RV4A 3K15A 2IRWA 3FVVA 2V6JA 3GELA 3DE2X 3JZIA 2QVCA 5DNAA 7ABPA 2IX3A 3JVVA 1CIJA 2P6RA 3EDCA 1A9RA 4COKA 3VV2A 4KSCA 3SP1A 3X2FA 1JIUA 5GQSA 4MRSA 4DCMA 1B1AA 5DM4A 1V11A 2R6DA 2EZTA 2OCPA 3C24A 4TWRA 1U8UA 1DZ3A 1ZMBA 2G0AA 3CEPB 4OLFA 2Z2XA 5FLEX 2YZ2A 2O52A 4CQLB 2C9BA 1VP3A 4UASA 1M2NA 5I01A 1Y9JA 2JRCA 2B5VA 2B21A 4ZQEA 4TSFA 1PJ4A 2WKWA 4UHBA 3TTVA 3WKDA 4BATA 1UL1X 4RKYA 2PA0A 4AKIA 4BFCA 1DO2A 4WL0A 2OLEA 1UJ4A 1HYQA 3GB9A 3G68A 4CN8A 2PGNA 4NHOA 2X76A 1J24A 3TVYA 1XD2A 4UATA 5BYAA 2WF7A 1WE2A 1L5LA 3W5UA 2Z58A 3F9CA 3WSWA 3B2EA 1JR2A 5TVKA 4R0MA 3GDGA 1XK6A 1V7ZA 3NR2A 3VSEA 2YWBA 5HZKA 4G67A 1NSTA 2VRCD 4G9EA 2CYBA 2ODWA 3DE4X 1XTJA 2WG2A 5JSKA 3VDNB 1WVGA 4G1UC 4I4TB 3KXIA 5F1PA 5HPYB 3FPHA 1R0BA 1UXOA 3S6JA 3LF1A 4KUEA 1O6BA 3C5EA 1G64A 2B82A 2WNSA 3CNQS 3IKTA 4G84A 1PCXA 1AKYA 4L3OA 1BA3A 4X45A 4BEJA 4EYGA 4F46A 4ZVMA 4DWVA 3NOVA 3CEHA 1RWKA 1TU0A 3F5QA 3GPDG 1TC1A 2YC2C 3C4QA 4KQIA 3PUJA 3JCZA 5HF8A 3MK31 1D09A 2ZYGA 3ORQA 3S2GA 1AZTA 3WGUA 3UV7A 3HXKA 3A4LA 3NYQA 2YNMD 2QAJA 1MNQA 3UAWA 3E8SA 4J6FA 1KRWA 5JW6A 4GOJA 3ITDA 4QVKA 4QREA 2NXJA 1YHYA 2C9YA 2BF4A 3AMVA 3PGXA 1U7OA 3BMQA 4R54A 4RJJA 1HX7A 3LLVA 4LXTA 1U65A 3IPRA 1GTJ1 4RLSA 4K05A 1T4CB 1U0NA 2GASA 3RUFA 4IDHA 4N6OA 2FZVA 1H2ZA 2P9BA 5LL6P 1VIAA 2J7PA 1P9LA 2DPYA 3E2IA 4ITUA 4L6CA 3TPCA 2VQEB 1NJ2A 4E30A 3P20A 3ND9A 3IVAA 5L7YA 1CS4C 3EZGA 1E99A 4YQFA 2YWJA 2Q2WA 4QUBA 3GUVA 1T2CA 1LV7A 4RK0A 3G0HA 3MOGA 4PLCA 3VSAA 3VR5A 4FE4A 2XDWA 3H9JA 4RHFA 4R1MA 1L5QA 2WWFA 5AJZA 3U3XA 2IPMA 1V1MB 1L5OA 3D6TB 3DEIA 1BMFD 2J9GA 3WC4A 4X00A 2Q4DA 4M1YA 1WXFA 2WYOA 2O3SA 4LI0A 5BSEA 1YACA 4C1NA 1L4LA 5CIWA 3PG5A 1IJEA 3DUFB 2GXUA 5IJAA 5E1DA 5JZOA 3KPVA 2OAEA 2ZBFA 2VT2A 1XAIA 1AY0A 3LOPA 4F2GA 4YUYA 3COWA 5KPJA 1QG4A 3NEAA 1SVKA 1T2EA 3U4IA 4PGMA 5TS2A 1PJCA 3TX6A 1ZKMA 2FQXA 3IKJA 1YZLA 4BTVA 1BAPA 1HE4A 1TA9A 2IPLA 1CUIA 1VXRA 3AONB 3O95A 3PNOA 4KGZA 4J2TA 5AJTA 5J5VA 2H2GA 3VR4D 4RPIA 1G7RA 3L43A 3OZCA 3BWEA 3DGFC 2RC6A 3FWKA 1J09A 1T6YA 4JIGA 1ZS9A 4NFHA 4OYYA 1FNNA 1VRWA 3TRFA 5HUJA 1RE1A 5F9FA 1VHTA 1RYNA 3WKEA 3ECSA 1B74A 3G2OA 3AY6A 4MHSA 4C4SA 2XRYA 4F5DA 2DBVO 5KTPA 5HP4A 3G13A 1FFGA 3I3SR 4L8VA 3ZCUA 2O8BB 3RJ9A 2EYUA 3GGJA 3N05A 2BGJA 2BMJA 5CTAA 4ENUA 1R4NA 1CSEE 1IUNA 2GCNA 4U9IS 5HE9A 1GEGA 1TKAA 2VJMB 3ZHTA 4AT1A 4N47A 1CNFA 2ZZKA 4GI1A 3ZV6A 4XWTA 4Z1MD 1F38A 1VHQA 2QQEA 1MOZA 3EB9A 4RWZA 1DUIA 1O97D 2QNBA 1Z6XA 3PFHA 1WUTA 3Q9NA 2H9YA 2G0TA 2XUIA 2XMBA 4JUCA 4S1OA 4DR1B 5DGXA 3FPCA 4O2BA 4LV5B 2GJAA 1RJDA 2VJDA 2GKSA 3K09C 3OE7D 3HYNA 5B55A 3U1BA 1P6QA 4IH9A 3D7RA 3AF3A 1IHOA 2QZSA 2R5WA 5FULA 4Z7QB 1O96A 1JEQA 4G4SP 4OHKA 5ESDA 1MIHA 4OQFA 4WD3A 1HXHA 4LDNA 4E4TA 3T34A 4DM3A 3KU1A 1T1IA 2GK4A 2WG0A 3GRAA 1PEAA 3GT7A 4GX0A 3OEWA 1AV6A 2FP3A 5CH3A 4UEQA 1ZZEA 5HE8A 1SPXA 2PSJA 4OAPA 3ZUGA 2W9XA 2EGHA 1TMOA 1NG1A 4FMBB 2GTPA 1BDBA 5HIMA 2J7KA 1UKEA 2NO4A 4RZHA 3HO1A 3I9OA 4D4MA 1QX4A 1YZUA 3E7PA 5KSOA 1JHVA 1JL3A 2FZEA 3AWIA 2FW1A 3HVUA 1KFCB 3I45A 4L2IA 4BCDA 2PV7A 2HN9A 2ZCJA 1TOAA 5FPHA 1UH5A 2Q6KA 1BCSB 1ULBA 2A2ZA 2IP2A 2JBHA 3DOOA 1HY3A 2GKOA 3T9FA 4ZGGA 1S1CA 1A8QA 1UEJA 1CR2A 1EVIA 5ALGA 2KSQA 2P2ZA 3DE1X 3QVGB 4OEHA 4WV3A 3WRYA 3H4TA 3VNUA 4JI6B 2CNWD 4IL5A 2E18A 4B7CA 3EG9A 4OM8A 5HTOA 4KO4S 3ZLJA 4YFVA 1UM9A 3S5UA 2WD7A 2ZUVA 2QM3A 3TD6A 2IH5A 1VA4A 3AEQA 1KRXA 4YCLA 2PQ0A 3RJTA 2ENUA 4F3TA 2V65A 4R2LA 2C29D 2ZB7A 1AS3A 2ON6A 4I1VA 4LQDA 2Q5IA 5JBQA 2FQQA 2KLHA 2I1QA 4MUJA 1QK4A 3A3OA 1V8OA 1UCFA 4WH0A 2GEKA 4Y9DA 3V3KA 4YJ3B 1WCIB 3ZWDA 1R0RE 3GDFA 3KOOA 4E5NA 3PA6A 2OV2A 1ZGCA 2I4TA 1EK2A 2WVAA 4NCXA 3VRHA 3BX1A 3D4NA 3IS3A 4LIPD 1NBAA 4MWGA 2DKOA 3SYRA 4ZT7A 2VJPA 3NJRA 1XZ8A 4IIBA 5LKAA 3T95A 4QFDA 1OA0A 3IAXA 2PGLA 3B9PA 5EJ8A 1OFGA 1A4XA 4KJZA 1FDSA 3KQTA 4DUPA 1Z56C 1PS0A 2DRIA 2I2FA 3WIBA 1ISHA 2I62A 1TK3A 5A4MS 1M7HA 4HRVA 3UENA 5LD2B 2PUFA 3DMRA 4PR0A 4P22A 5ANRB 1JFRA 3T9CA 3T3PB 2CJPA 2NUAA 1WZ2A 2LP4Y 4PTYA 3TW8A 2VUIB 2RFLA 1KO4A 5L6MB 2Q5HA 1R0LA 1E0KA 3QMVA 4XFKA 3RYHB 5KSZA 3PXEA 2QTLA 3VR2D 1EFRA 4EYSA 5K9ZA 3P9ZA 4YJ2B 4MRVA 3C16C 1SUAA 1Y6JA 4JB8A 1JN0A 5KTMA 4D0SA 1Y3CE 2ZIUB 5HFNA 2PUJA 2DBQA 2P9ZA 3GLKA 2V7XA 1YRQA 3VYSB 2GK7A 3GD5A 5CHEA 5CEJA 4MUAA 2XQKA 5NLLA 1IMOA 4PG7A 4UCXA 4DREA 3GJXC 3SWWA 1YB1A 2UXDB 2IS6A 1CQXA 4MQLA 4EG4A 3CBGA 3NHLA 4JU9A 3STXA 1AIPA 2WHEA 2QTVB 1A8SA 4HSEA 4V24A 4Z8XA 4RHTA 3TAHA 2H1OA 1PGQA 2EYQA 4H1WA 4TUYA 3OT1B 3P45A 2E2WA 5B1SA 2VZLA 4IJ6A 5JMPA 1SUEA 1PJ2A 2XECA 1PO7A 3O5AA 3QVSA 1YRHA 4GYKA 1L7QA 3KQKA 3LECA 1Y6QA 1S3SA 2MIIA 3FZNA 3OJXA 1V3QE 3ILYA 3Q7IA 1W1IA 4CMEC 1ZHHA 2PMKA 2OQRA 2ZVJA 1R3DA 1G0OA 5J4LA 3HFRA 1XTUA 1GL3A 1LC0A 2O7RA 2QTMA 4PU0A 1QHSA 2ZS8A 1RHUA 1FA9A 2DFTA 3B3QA 4G2NA 5GP1A 3WDLA 1KAOA 1X7DA 3G7SA 3HI6A 1DARA 2XTJA 3K53A 3QGMA 4KQ9A 3MN1A 1TKCA 4BE7B 3F47A 5I8PA 4Y2VA 2WDPA 4RETA 3THYB 5D5QA 2QD2A 1EX9A 4LZZA 2G1KA 4GQIA 4ZVQA 1DBWA 4LX0A 4TZKA 3MRSA 2QAIA 1QIFA 1G291 4WZAE 5DW3A 1W85B 4N5HX 3UAYA 3LHFA 3TLMA 1Q3HA 1CF9A 4MPTA 2X1HA 3ETHA 4JSTA 4Y2SA 3W78A 2I9KA 2O8CB 4UULA 1NXTA 3WGMA 2CBZA 1KETA 3CZMA 3P94A 1IEWA 2Q49A 3R3XA 4HEHA 3HY4A 4N6GA 4Y9RA 1YIAA 3LJKA 4KYUA 4NH4A 2P1ZA 4FNAA 4YCBA 2CNOA 3NBZC 1K66A 5DZSA 5EZ5A 3ZOZA 5JXGA 3FMPB 3WLAA 1XKTA 1ISGA 3C7TA 4IUCS 1XVIA 1OI3A 1QCCA 2YMLA 3RAJA 3DVLA 5KQPA 1NNLA 1U8ZA 3MERA 4PW0A 5KKCA 3B1FA 3GH1A 2CL7X 3UATA 2GEJA 4H0FA 1XRLA 1QZ3A 2CL5A 2HRQA 3P5SA 2YZKA 3TE7A 5I7VA 2CFCA 2X8JA 1RXWA 3DW1X 1J20A 1Q0PA 4HFNA 2IV7A 2CXPA 1IQUA 5FOTA 1D1SA 4GYWA 5AKHA 1ZM7A 3SZOA 2GBGA 3SE0A 3H19A 3Q7QA 5I7RA 4B3GA 2HJSA 2NXEA 3EA4A 1QOPB 3GL9A 2QVGA 3ZWKA 1SY7A 3A1TA 4PG4A 4G1FA 4U9HS 3WNBA 2ZZNA 3V8BA 1ODKA 2VRCA 2JW5A 3QFSA 3BRCA 3HKBB 2O1EA 4TKMA 2O07A 3EK2A 4MR8A 5SZIA 4FT2A 3U3KA 1CUCA 3LNTA 2PUCA 4ZYWA 5IDVA 3QLUC 2HMUA 1OIVA 3CG0A 2ZIEA 4O4LB 5D3MA 2VR1A 4IGEA 2OXTA 4DLYA 3LCRA 3L46A 3WWYA 2HZ7A 3OIDA 4HNRA 4MYHA 4PZLA 4CG0A 1IBKB 4F84A 4D6PA 1XMOB 4K9RA 4ZCMA 4LC1A 3HXQA 1HNWB 5EIHA 4A2WA 1L5KA 4C04A 4YXWD 2FZ4A 4O02B 1J7JA 1WU8A 2BC9A 3TVDA 5I4IA 1F2TA 1E3WB 1U02A 5D7NA 3GNLA 1CZKA 2P67A 3EBOA 2JFQA 1I3MA 4DA6A 2DKFA 1E1QA 1GGNA 1YVUA 2ZAGA 1XCOA 3DBRB 1KJNA 4A6PA 3IKVA 3AKZA 1I0IA 1XQXA 1Q17A 3L7LA 1PJTA 2HDNB 1JTEA 3CNHA 1C9NA 3BB3A 4KX5A 1QFJA 3ZJ4A 3CNNA 1O1YA 2RBKA 3QVVA 1AGNA 1NKVA 3GUYA 4QUGA 1PDWA 4K1XA 5JZMA 5JUWA 4LCBA 1M1UA 3NDRA 1L5HB 3T1QA 1AA9A 1MVNA 1RKUA 3LGSA 4K9SA 5KQMA 1IBRA 5KU7A 3EXG1 4OL9A 3F78A 2W6MA 2G40A 4DMGA 3B85A 4EQ6A 4MP6A 3S2ZA 4ZC8A 1NN3A 1G2PA 1RWWA 1TA0A 3CWQA 1I7PA 2VKTA 3RVNA 3UGQA 3V9PA 2R1TA 4BKUA 1DEHA 1LS6A 1H9AA 3GG2A 2HWKA 3HG7A 3O2JA 4O4HA 4Q4AB 4S1NA 4UNNA 2GN8A 4N01A 1GNSA 3C5WP 2RK6A 2DHQA 4RNCA 3K09A 1HLGA 3HJUA 4FEEA 2NZYA 3U0VA 2AFHB 4YB8A 4F8JA 5H02A 1T0IA 3H9BA 1MT3A 3CKKA 1ISJA 4NZ9A 1O95A 2Y66A 3BTOA 3UYLA 4RANA 5IRCD 1N9GA 5E7IA 1XKLA 4OSOA 3I58A 1GQ2A 2WSLA 4YAUA 1VJTA 5CHYA 1HTWA 1K7SN 2CXQA 1WF3A 4JAVC 5JATA 2YN2A 1T2AA 1X0XA 2J45A 4PNEA 1I2AA 2JLBA 4F1JA 4PS1A 4Y6GB 5L53A 5HW0A 2ZYHA 3T3GA 2ACEA 2P9HA 4L5JA 4JLUA 2ZG6A 1OHHA 3IP7A 4X8OA 4X7RA 4MEAA 3HO8A 5CX1B 1L5FA 4AZVA 3M0EA 4CQMD 2A9PA 4DCNA 1KMIY 4YJ3F 1R6BX 1Q0ZA 3N6XA 3HKEB 5IM4A 1DEKA 1PLLA 3FYUB 1T91A 3L8CA 4MV1A 3RM3A 3FYUA 5ALKA 3DTVB 1TMGE 2AOXA 2XQIA 3A2NA 1RZ3A 4JGGA 4WZAA 3EMKA 2GRAA 2QZ9A 5AW4A 3FNIA 4IIJA 4JK3A 5LWHA 4QHSA 2R96A 2Z2ZA 4TTPA 2EQAA 4HQRA 3WA7A 2YX1A 3BL5A 1PHPA 2WEKA 2NVUA 4C0WA 1CULC 1VBKA 3G2MA 4RJ2A 4V3CA 2OO5A 3T5PA 3NORA 4P84A 5FOVA 4RTOA 3I1IA 2R8YA 3HI4A 3TRJA 1GNRA 4B82A 5M2QA 2XWBF 1BJRE 1YA4A 1GCGA 3M1IA 5KBYA 5AVJA 2CUKA 4CBVA 5BXQC 3W6ZA 3GCXA 3G2LA 4HLUC 1BEZA 1JHMA 1FK8A 2E5WA 1A7AA 5IYZF 4BNNA 2C94A 3HB9A 5AW9A 1G55A 3RUDA 4NMXB 4BVLA 3QPBA 1XTKA 3EWAA 4L9RA 2V7EA 4LDZA 3WGTA 4OQDA 3G3EA 5E6RB 1YFLA 3MHPA 4UCWA 1EP9A 2ILTA 4GI2A 3RVPA 4IWYA 3RRBA 5ALEA 4BVHA 4XYGA 1WD7A 3FE2A 5LB2A 2ISQA 4D0NA 4C03A 2WY2D 4JODA 4RTQA 2HOQA 2NZUG 1XMJA 1GLGA 3K1JA 4WTOA 2ZE7A 4OL0A 4RMJA 2ZJ4A 4TVKA 1R6UA 1C4XA 1SUBA 2C5FA 1GG5A 3WRVA 2VOJA 2O3JA 2XXBA 3BXFA 4QUKA 3WNDA 4DB4A 1Q0TA 4UUAA 3V4RA 1VIVA 2BDTA 1QIEA 1C7JA 3SZRA 4WEQA 4QQKA 3TKYA 3W5DA 3U37A 4HGZA 3IE2A 4IXDA 4WZBE 4ETNA 1WCV1 4EA6A 2PN1A 5DOVA 5M3BA 3RASA 2IXBA 5E2AA 3E1GA 2XDQB 4C22A 2D62A 3I6ZA 1CLUA 1TT5B 1XSEA 3W04A 4DIMA 3QUAA 1UWCA 1EXMA 1KDZA 1S96A 1NZJA 5E4JA 3BXEA 3BUSA 3WHIA 5LIRA 3BJZA 1JP7A 1CQJA 2GN6A 2PT9A 2BRUA 1E1DA 1PYOA 3TTYA 1K8XB 1QS0B 2AC7A 2K4MA 3ESRA 4LRTB 5ESXA 1Y48E 2H51A 4BVJA 1QKKA 3LLUA 4PR3A 1GJRA 4KE9A 1LK0A 2OCIA 5DHQA 5DULA 1A72A 1HOTA 2W6ZA 4NZMA 1XLTA 1UMDB 3OUUA 4KXQA 4OXIA 4OQ4A 3TMAA 2P2DA 4FB4A 4MPPA 5T4BA 4H3SA 4P53A 2ZUUA 3UJHA 3SXJA 1RI4A 4MROA 3A06A 4HPJB 3BXGA 1B93A 4MPDA 3CRW1 4EIWA 3GRFA 1W5SA 1WCYA 3PNMA 2RHGB 2V8OA 2IITA 2XGMA 1HDYA 3MUEA 1PAUA 4D02A 3FYHA 1RACA 1XXHE 1FDUA 1PTJC 2BKXA 2YFYA 1Y82A 1EAYA 3KQNA 2QU8A 2VH2A 3AI7A 2GXSA 3W5SA 1U2TA 1XVUA 2AT1A 1WX1A 2YQ4A 3IPAA 4O1IA 1Q7RA 4BV8A 1MO5A 3ECAA 3G49A 3ZTWA 5LR6A 1D8TA 3BIOA 3IUMA 3Q7PA 4IDDA 2YKGA 1GCAA 4G4SO 4RS4A 2I7CA 5EE5B 4EENA 1JLLB 1FYFA 1UPUA 3IMGA 2WQZA 1NUPA 2QNRA 4AF6A 4WN9B 2PH1A 2J3EA 1PR2A 2E4XA 1EDOA 1T3TA 3IESA 3P52A 3S5JA 1ESEA 3TN7A 3W6UA 3WLMA 3AVTA 1L7OA 2QVBA 3RFUA 5DNCA 5JJCA 2R25B 4DQDA 4KIJA 1SG6A 4G5HA 4Y2QA 1MO4A 3LPNA 4UNSA 4EAAA 5FBQB 1E3JA 3D8RA 5C7YA 2GSDA 2EW1A 3LDHA 2OZEA 4A8JB 3ZZMA 5SY4A 5T4FA 1O94D 2WD8A 4HQKA 5B6IA 1A8UA 3OC0A 1PT8A 4LFAB 4XEHA 4MRAA 2A59A 3K9QO 2ZM5A 4LXXA 1BU8A 1MEJA 3AETB 3RREA 3A1EA 1ZK1A 4A16A 2GZ3A 3C3BA 3I3OA 2PZGA 5KWEA 1W8DA 3TW8B 1U0LA 2G83A 4Y67A 3Q6MA 4AK9A 3U5TA 4BL5A 5EJIA 3WB1A 5CEEA 4L1KA 3S0JA 3OOEA 2ZPAA 4LCJA 1JAIA 1E9CA 1O96B 1OYVA 1JYEA 2K2WA 3QA3E 2IDKA 4KMSA 4RPGA 5AUOB 4JXZA 2TMDA 1Z73A 3G1TA 1PZFA 1U3TA 1Z88A 3W4IA 1B23P 4U7DA 1EDBA 4YRJA 5CJPA 2XYVA 2XY4A 1JTFA 2JIDA 1NJGA 1DAHA 1FSFA 2I03A 3G1WA 5H4GA 2AHOA 3ADKA 2AOVA 1W8IA 1DG3A 3NAMA 5L3VA 2GD6A 1SVUA 3OD5A 1P1BA 2W6NA 1KR2A 4XIYA 1FJGB 2QLTA 1CYDA 5FUVA 1Z0AA 4PLTA 1QGDA 3P4XA 2JLSA 1XPOA 3KL4A 2BTQA 4JC5A 1DGQA 4TUYB 1WNTA 1Y6RA 3D2CA 1NVKA 4G0XA 5B64A 4EI8A 1MO2A 4HDNA 4WKGA 3SFVA 3EF3A 3HH8A 3VZDA 5CCXA 5C5IA 3BKXA 3GUCA 2WP0A 3DDHA 4CGZA 5KDOA 5I7FA 1AKVA 4AWAA 3IDSA 5BWOA 1M8GA 3BG5A 5ESRA 3T5TA 4C08A 4EUSA 5BWCA 3AUTA 3FG9A 1YNOA 2OXEA 2IK8A 1JW9B 3EOAI 3A70A 4IX9A 2ODBA 4OCZA 1KEKA 4I4CA 3EGDA 3S2EA 1KPHA 2ZATA 3DB1A 4IJMA 1CP3A 5LQDA 1N2CA 1CZRA 1QSGA 2O9JA 3SZGA 4RULA 3JQ9A 3V2HA 3M4ZA 3SX2A 2WYWA 2FFHA 2L0XA 4I1IA 2QSZA 3V7UA 1YR2A 3W2GA 3VZPA 4KNVA 3ZQUA 4ZREA 4UM7A 1FVOA 1IRXA 1QBGA 2I33A 1NURA 3MYYA 3NEPX 3NHMA 3NRJA 4R2KA 5SZKB 2QP9X 2HNKA 3KHKA 1Y98A 2RJNA 4HAYA 2D4HA 4Q7KA 3FAKA 4WKCA 5DP2A 2PKXA 1KQPA 3IAEA 4KQCA 4MB0A 4IHKA 4KH1A 3NALA 4M9XA 4DPMA 3B6MA 3NTVA 3D0KA 5AUQA 2ZAYA 5FUXA 4BO0A 4CM4A 4JHLA 3JXEA 3PQ7A 5A4FS 4JL8A 4EO9A 1U1FA 3DF7A 1OLSB 3DDOA 5JC8A 4LAFA 4YHBA 3EZNA 1Z2NX 3KXDA 5PNTA 2GB4A 3TIFA 4JX9A 2D1FA 1Z0JA 2QD3A 3L6CA 4EMBA 2A5JA 3HLYA 3T5AA 2X1LA 1E9FA 1KP2A 1O95C 1NQWA 3GJ6A 3LMKA 3OX1A 3P9CA 4I55B 4LZNA 3TBFA 2J3JA 2YJ4A 3NTRA 5CXSA 4U6NA 4KWHA 4CKEB 3ZXYA 4WJLA 3N2IA 2QIOA 1JQ5A 5GINE 1YJAA 2P35A 1ZG3A 5AKJA 5HKLA 2FF7A 3GJ3A 4BNLA 3PTAA 1EX1A 1G8JA 1QCZA 1J06A 2H5EA 1NI5A 4X6UA 1FW8A 4LA4A 2QWXA 1CF2O 3ITNA 1BQ3A 1JXMA 3Q5GA 2Y9PB 4PIMA 1K5GA 2B69A 2CB0A 5CR9A 5C80A 2EFEB 5GJBA 1ZRNA 4PVCA 2MMCA 2PUTA 1PR9A 2VATA 3HLKA 2HGZA 4G41A 6CHYA 5KJFA 2R86A 2J0EA 5FA5A 2AOUB 1T10A 3JWJA 1VYUA 1E9EA 2BONA 1RLTA 2OB1A 3HKCB 1USVA 4JY7A 2NP6A 3M4NA 3A4TA 3GK3A 2PGDA 1JVBA 3NWBA 2DUJA 2CXNA 5GOTA 4HH1A 4POOA 5HM8A 1QB8A 2OSBA 1V2HE 2VI5A 4IVPA 2JIOA 1YQTA 4QGFA 3VA7A 4X0EA 1LI5A 3KUKA 1W96A 1YDEA 1B0ZA 2OT3B 4DSTA 1XNJA 3RNOA 4B9EA 4Z8YA 2XUKA 3BCSA 1WUJS 2F48A 3O4RA 5A7HA 2BJVA 2EZ8A 3ODPA 2JFHA 3B5EA 2DPXA 3G0GA 4QPJC 4JZKA 1TFUA 3QE4A 2EJCA 1BFUA 5AI9A 4CMAA 7REQA 3N2EA 5EUQB 4D3ZA 5LYJF 2ETXA 1KKUA 1P1JA 4YAWA 1QDUA 3MOSA 2QZ4A 3KSUA 3FGNA 3O0DA 3N28A 4X97A 3TVTA 4Q21A 1NF8A 3H2IA 4FDLA 1DWOA 3FB1A 1LVGA 4B76A 3HJBA 2IZZA 4QJBA 5LVAA 1WXQA 4JUDX 3P9RA 5IUJC 4MVYA 3BSWA 1B15A 4WY8A 4DAOA 2ECQA 4E6EA 4EF6A 2P27A 4CCWA 1IY9A 2OEPA 4O2AB 3TR5A 3U4GA 5BV0A 4BX2A 2ZR0A 4FCWA 3RNLA 2HWWA 3JR7A 5HX7A 5EIOA 2PL1A 3SF0A 4WVLA 5D5HA 4K03A 1I1NA 2ZRPA 3AKDA 5MF6A 4AP9A 4F12A 5EL0A 2EZUA 3H97A 1OXUA 4EJSA 2VPTA 5EE9A 3MMXA 1VPWA 4L15A 3IURA 3TS1A 1GZDA 2FPXA 3RH0A 3SJCA 4B0OA 2AV6A 3CF4G 3O8NA 4XQ0A 1TPYA 2AYXA 3TZBA 4IIFA 1KQFA 1HMPA 1P4SA 2HIGA 4NULA 4RSMA 1L7EA 1U6JA 2ZB4A 4LJ9A 4Y2GA 4JEUA 3F4BA 4BNHA 4HWRA 1EEHA 5DSXA 2IUTA 3U6KA 1SU7A 2A84A 4F6RA 2Z9DA 3VJRA 3I04A 1Q57A 1GCOA 3SC2A 5BR4A 5K5EA 2D8MA 1KS9A 1XAGA 3RVKA 1OFIA 2VBGA 5LYJB 4N8SA 3CZ9A 4KIFA 3GJZA 3COPA 5IANA 2P5UA 1T9KA 1WS6A 1JPJA 3DEHA 3LLSA 3HXLA 3PFCA 1U99A 5K7SA 3L8FA 2AKAB 3E0XA 3ZZ1A 4BO8A 2H4ZA 5JS6A 3DXYA 4UKDA 3L04A 4ZJYA 1GUBA 2IEDA 3G7UA 2MINB 2H31A 2C4TA 4IKEA 1GTSA 2OLKA 3H1EA 2BBWA 1RMTA 3S1LA 4J0FA 4OSEA 4QNRA 2WT8A 1EM6A 2C5LA 3LT2A 3QUSA 5EA2A 4IFTA 5GM2A 1CRZA 2AD5A 1YNSA 3OZTA 1DBRA 1RWVA 2JFNA 3FPAA 4AS3A 5HIKA 3S3TA 1JA1A 2OBBA 2PGAA 3DF9A 2X6QA 5BXYA 5DN6A 4GKKB 4DRXB 1W93A 3UHOA 1L5MA 5JSQA 2QRNA 2PGXA 3G89A 4MEJA 3RUIA 1ZVVA 3GQVA 2XUFA 1FX0A 3EXFA 5AHWA 2O54A 3OCUA 1CJKC 4X8HA 4X60A 3OP4A 1JE1A 3IPYA 3SM9A 3WNZA 4EEXA 4PO1A 4GO1A 5JCJA 5ALWA 1Z75A 4YPFA 2XF8A 2HWXA 2PM8A 4TLBA 2WNHA 4TV8F 4HWTA 5DIFA 1DCMA 3CNBA 5F2NA 5JH7F 1M1YB 3WICA 4TTSA 1RQGA 1JQLB 3BE8A 1RRKA 2OKGA 5HTKA 821PA 2JJ1A 3OETA 2VHQA 3FUWA 4F71A 2F8TA 5FOWA 1RZUA 3CLHA 3GT4A 3TG8A 4JS0A 1EPUA 3QZUA 1NM5A 1TT7A 2R8EA 1UIMA 2YIJA 3KKZA 5KEIA 1EZZA 4ZVLA 2AUNA 3MBOA 2KHZA 4X24A 1KVTA 4G0NA 1RYDA 1AKUA 3KOZA 2VK8A 4FW9A 4ZU6X 3WTCA 3TD9A 3ZY3A 3PD1A 2XBMA 1BWSA 3ROQA 1NVTA 2CCGA 3N0RA 3OCZA 1D2RA 2OQ2A 3AO0B 4M21A 2C7RA 2VWHA 2I8CA 2YN0A 2DG2A 4GR5A 2XA1A 3MC1A 1ZW6A 3RVRA 1OU0A 1M66A 3EZFA 3PRJA 2FSGA 2FNAA 4QOHA 1HKUA 3FLAA 3FTQA 3PC3A 4XGRA 1F0KA 5EGNA 1K8RA 4W8OA 1IPHA 1YQUA 1W46A 4BV2A 5FHRA 1N57A 4FFDA 2PX4A 1ZHOA 3CRRA 4ZMSA 1N32B 3MFQA 2PR7A 1RFLA 3D6VA 1ZI8A 2MYTA 3L0PA 1XMXA 3LI2A 1I51A 2XYHA 3CN7A 3FDZB 4KUGA 3R5KA 4YPVA 3ZIDA 1M5RA 3KSMA 4BQOA 2WF5A 1GKUB 3EVTA 4DNOA 1V1MA 2HCRA 4FHGA 4XJSA 3UJBA 4WNAA 3O4JA 4TZ0A 3L0ZA 1SOWA 1G17A 3FAZA 4IRXA 4OHOA 2FTKE 1H42A 2AJTA 3BFXA 3BF8A 1FLNA 1US8B 1LPAB 4DLRA 1Q7TA 1AK1A 3UA4A 3ZD7A 4CF7A 4HGRA 2Y1CA 3H5TA 1W5FA 1IZZA 4RF5A 5F4BA 1WG8A 2F2TA 3LVQE 3Q3GE 4MZXA 2V3VA 4QXOA 3ESZA 4BN0A 5ITWA 4ZAXA 2OBFA 3SYNA 4EDFA 1M5TA 5AHKA 3AEYA 1R1DA 2W8BA 3QLEA 1J8FA 2P3OA 3O8DA 4N8EA 3RVJA 3WWOA 3X1MA 4J2OA 4OBXA 3VU9A 3AL2A 1JLHA 2D06A 2O4CA 4R6XA 5DGIA 4ER5A 3NV9A 1WOYA 3S7TA 2LNDA 4LBVA 2F1KA 5J1TB 1ZICA 2UZ0A 4DYHA 3KYBA 1O5TA 2PZMA 2ZIWB 3FUVA 3RS3A 1U0HC 4A6DA 1ZZGA 3SVLA 1KEEB 2JGEA 4XUCA 4RIHA 5BNIA 1EXVA 5ICEA 4OREX 2AC4A 4GWKA 5IXSA 3B9BA 2GEVA 2QUJA 1ANKA 2Y1KA 4X92A 2GS9A 4RF4A 4X3OA 1X70A 5LJLA 3NXSA 1CY0A 1HOXA 4O2BB 1NYLA 4BLRA 1DBPA 3ESXA 5EJ7A 3K8QA 2ZCUA 4R8LA 3W8RA 2Q3MA 2HHJA 1IATA 4EY4A 1EBBA 3IQHX 1FSPA 1J49A 4C7OA 2JFXA 2YV3A 2FG5A 3L0IB 2BM8A 3GLIE 2BM0A 3U3ZA 5ALMA 1U8EA 5CVEA 5B12A 4L5IA 2BWJA 4UEKA 1BCRA 3RHFA 4GICA 4DR3B 1QRUA 1DUSA 1L7XA 3KDPA 5E6UB 3D1VA 3ACDA 1AUPA 5GZ1A 1EFTA 2J0QA 3GMSA 4GWLA 4PV7A 4ZO4A 3WKCA 2Z57A 1N7GA 1M83A 3Q72A 4X1KA 1EUCB 2Q3DA 5AKYA 3T35A 1ZR2A 4YRFA 1BVYF 3L7CA 3STYA 5I7UA 3GPLA 1BQEA 2DHRA 3NHRA 3PNKA 4FCVA 1JU4A 3EA5A 4FSDA 1SC9A 1Z45A 1UK8A 5K0LA 2GBIA 1DB3A 2JVJA 4RS3A 4CCAA 1R50A 2V0GA 1J0XO 1ZD4A 2HF2A 2E48A 1NASA 1NVWQ 1PJZA 4Q1EA 2F55A 2UXBB 4CKYA 5K45A 4HFJA 5BRNA 2ZRMA 4KITB 5K01A 2AG8A 4BWYA 5DM70 3RU3A 3H5RA 3T5MA 4CFYA 3CLSC 1X7ZA 3I05A 3JPWA 1M2OA 2QTZA 4CLHA 1Y6GA 4BNZA 3WZ2A 2RCYA 3FFXA 1C29B 1SNYA 3O2SB 4QOFA 5BV2P 1VZ2A 2QJOA 5HVNA 1W52X 2F3SA 4LHZA 4A7PA 5BW5A 4O29A 4N40A 2J08A 4DLTA 2HPAA 4EATA 4KL8S 3R9XB 5TSDA 2I76A 4V0ME 4RPCA 5HBGA 2PIDA 1KK0A 3QFCA 4N41A 4RKWA 2VPYA 1HFJA 3PJEA 3HM9A 1DHRA 1BXZA 5KO2A 1D2HA 3ZU4A 3LQQA 4OQNA 4CV1A 1QHXA 5DNUA 3G0IA 4Q6BA 3RRZA 1G66A 2ATEA 2R6ZA 2W6OA 4JC0A 4L50A 4Q6WA 1XQYA 4CM8B 2BFDB 2NO1A 2BBTA 1TM4E 5BW6B 3FF1A 2QMUA 5IFKA 3EQ8A 1F9EA 2WF8A 4DMRA 1A50B 3UPTA 4REQB 2CVQA 2W6JD 4EPYA 1F0PA 1UBRS 4A92A 3IDFA 3H13A 3EQ7A 3Q0EA 1ZVJA 4KDRA 4MIKA 2BGLA 1KZHA 1AQ6A 1TYEB 3GX1A 2WJJA 1NRWA 1MC8A 5AVSA 1YUNA 1MJFA 3QX8A 4E46A 1RRFA 1ZIOA 2C98A 4BX0A 2JLZA 1IC6A 3H4MA 1H23A 4UUNA 2OYRA 1G8PA 2W11A 3ZHVA 2AD1A 5A5GA 5CAEA 1GUAA 3ZYCA 2VP9A 1E6WA 1ORTA 1V6CA 3UQYS 4EELA 1T1JA 2J09A 3V4FA 1R12A 1T4GA 2A9KA 3F4KA 4I55A 1SCQA 2J4FA 1C4WA 2CEAA 1Z2AA 1TEZA 2B2XA 2WYUA 2CVFA 2O2SA 4X54A 2FSIA 4TKVB 4L76A 4C5AA 1PD1A 1KK1A 1ZGBA 1MX5A 1VCIA 4MVJI 1GA6A 3GEMA 2Y1XA 2V98A 4Q3EA 4DN6A 5J1SB 2XADA 2IOQA 4R9UC 1M1YE 2C1XA 3WB9A 2ONCA 4UUBA 3L7JA 4U2DA 2IP1A 3CO0S 3DWEX 2WZQA 2FCRA 3NBAA 3I9MA 3I4FA 3K0CA 1RMQA 4KAFA 2ABWA 3C41J 3INTA 2XLBA 2PGOA 3OX3A 5IT4A 4PX3A 1E4VA 4RXMA 5L3ZA 5A3QA 3HACA 4CCSA 4FDAA 4HL6A 1P0FA 1UQTA 4L07A 1S0UA 1RPTA 1RBQA 2FYTA 1F14A 1R3UA 1XP8A 4K5QA 1G5FA 2WSBA 2WSYB 3KOYA 4KRYA 5DKFA 3SC2B 3DLCA 3UAOA 1YVDA 3WK8A 2DP4E 3BJMA 5T8KC 3O82A 1Z2DA 2QLFA 5KINB 1DVRA 1W0JA 3SVZA 2QY6A 1F5SA 1PTKA 4X3PA 5H9VA 2YXPX 1C81A 2Q6VA 4OXNA 1OBVA 1DKRA 2AOWA 1JDTA 3JD2A 4H4DA 3WLPA 2JJ2A 4EM6A 1WMFA 1V35A 3W6PA 1E5DA 2AA3A 1O0SA 2KI5A 2PZBA 4I8DA 1VLQA 2Y8EA 4L73A 5EWLA 3TIVA 2IGTA 4MQEB 1LS1A 3EMDA 1TM2A 1E7RA 1URPA 3JWEA 1Y9AA 1C3VA 4XYBA 1ZSYA 4W9RA 2ECKA 4R2MA 4YDRA 5ER6A 3NOXA 3OZDA 3G2KA 3OQMA 5TPZA 2I3GA 5FFFA 2YWRA 1XZEA 4EGFA 3O47A 1N6IA 2WHYA 1YJ8A 2WIBA 1IQPA 1VG1A 1M1XB 1Y7PA 1ZD5A 3N8HA 2BFFA 4JH0A 4QGSA 3BFJA 5ED0A 4YO8A 1DAFA 1MF7A 2AKYA 3JYPA 3GYBA 3PEEA 4KB5A 4J49A 1ISRA 4GXNA 9ATCA 2O2YA 5CDFA 1W19A 4ECEA 4OH1A 4KQ1A 5CA0B 2HR1A 1AU9A 1E61A 1JKJB 1BSVA 3TUJC 1TVKB 1XK7A 4PFQA 4R40A 2P9QA 4JVSB 2H7VA 3AWDA 2HJGA 1YCGA 4I4TA 1VL8A 3GA5A 3CX3A 2ZIGA 4WT7A 3RTDA 3NCTA 4EB6B 4EQ6B 5FTWA 1I3NA 3SR4A 1RI5A 3MJVA 5DYIA 1VE7A 1Z2CA 4WKPA 2WJWA 5ISMA 1FMLA 3HBJA 2H2HA 4FN5A 1ZGZA 4O4HB 3KB6A 4XJVA 3MAAC 3CF0A 1BIFA 2ECFA 1FB5A 2PLRA 3LRPA 4QGBA 3UMBA 5J2TB 1FUUA 5AVRA 4UD2A 4JGIA 2W7TA 4PXAA 3OIUA 2VZ8A 4TLAA 3IUSA 1NT2A 1W76A 4FUTA 3W0LB 1YBAA 5KVAA 4OAQA 5DFAA 4AYWA 4HDSA 4CQMB 2PKWA 2W58A 3T1NA 2V4MA 2WMDA 4HS9A 2HO4A 4OY3A 3WYDA 2PSEA 4N82A 3IVGA 1JFFA 4INJA 4TVOA 4LSZA 4CKWB 1RQRA 2ID7A 3LC0A 1S8NA 2YNMC 3PEVA 4NCNA 4TS4A 4Y3UA 4KFCA 2RHMA 2BW0A 1NYQA 1P0PA 2GJ8A 3AR8A 2OVFA 3LGXA 3MJDA 1DC4A 4W63A 2VP4A 4NP6A 4A5OA 2G76A 1S3IA 5JPCA 2FP4A 1JPNA 4B3CA 4AYTA 1CJSA 4D8VA 2Q50A 5JXIA 3CR3C 5IJ0A 1AOXA 4LRYA 1VIYA 2EG9A 1WZUA 1OWMA 3KYJB 4PYQA 1Z82A 1HZJA 1LK7A 1F3OA 4GOXA 4UREA 1KJ8A 1Q2XA 3VR6D 1E3WA 1OXVA 1GTVA 3V48A 2WVHA 4HB4A 4GPTA 4LBWA 1ZN9A 5FADA 3WJ7A 1ZH8A 3PJDA 4YAKA 4BKRA 4LXHA 3WYAA 1F6WA 4LZOA 5LUAA 3DTVA 3W9UA 1QTNA 2HMWA 1PS9A 5CYFA 1PN3A 4AYXA 2C8JA 2ECPA 2VXOA 4YRTA 3TLKA 1PJLA 1FTYA 2GZRA 2F3RA 2OGSA 3MQFA 4R98A 5FNVB 3MPOA 3RC1A 3SSMA 2J3DA 1KWGA 2IQIA 2ZZMA 2DULA 2H4XA 5FLYA 1CUBA 4RGQA 5HF6A 1OWNA 3DBIA 4QGGA 4YLEA 1ETUA 1QMPA 2QPTA 2Z83A 2XR1A 3EEFA 2RHTA 2RHWA 2N46A 4B34A 1QU2A 1MX1A 3TAUA 2C7GA 2HL6A 3VAZA 3LUDA 1GRCA 3R77A 1W48A 4B3BA 3T61A 4R51A 4IX1A 1Y80A 3UJ9A 3WR5A 5B6JA 2P2LA 2V7WA 1P91A 2XRMA 5IJ9A 1P6XA 4D6XA 1KYXA 1RQ7A 1VLJA 3K4PA 1WXIA 3N7UA 1LX6A 1SCNE 4NBRA 3KS9A 4ACBA 3C8UA 3LD9A 4JLBA 3JSXA 2CXOA 2DFLA 2ODTX 3MJEA 4HX2A 4UNQA 3RIEA 4AQDA 2QPAA 1SUIA 2XE4A 5ALUA 1C8KA 2SKEA 4CV2A 2PCLA 4ZT4A 1QAMA 4MV8A 5FR2A 4DNQA 5EAIA 5BWLA 4TRJA 4TRRA 1ONBA 4ZEMA 3UJ6A 2OV4A 4MULA 1FNBA 1LSSA 1ZH2A 2VPPA 1T24A 5A02A 4OHYA 4OJNA 2WJZB 5DHTA 4J16C 4ZI7A 4KPYA 4HG2A 2MR5A 3DFFA 2VT3A 3WLKX 4JIMA 5ECGC 1RRVA 1SKQA 1XEWX 2J9XB 2FB9A 1LTHR 3EVZA 3DLHA 3PRHA 3UPDA 4IV0A 3K0AA 2JKZA 2ZU0C 4RESA 3AI1A 4R8VA 1LPMA 4HDOB 3VPDA 1OIWA 3CUKA 5EZSA 5G0SA 4N9QA 3UT5B 3RSLA 3FCSB 2FOXA 4JV5B 1NXPA 2VSOA 3N2KA 1VPDA 4L8WB 3GGOA 4DC1A 1DKQA 2PPLA 4OK6A 1G20B 3G5MA 1D0VA 4ZVRA 1KJWA 1LFAA 1Y6ZA 3OJOA 3O8CA 3C7AA 4J0QA 4FQ8A 1EEXB 4OF4A 3EZ7A 5D3QA 1GFZA 4ODIA 5G4KA 5JI2E 4BBJA 4LQCA 4LQ4A 1Y8AA 1TL7C 3DEFA 4O5AA 5BYJA 2TMYA 5I7WA 4FSXA 1GKYA 4JI4B 3USZA 2XNKA 2NVUB 4V39A 4ZQCB 1EI9A 2BIFA 2WJ4A 4LW8A 3SBXA 3T15A 2VJBA 4QOGA 3G0BA 1NUHA 1CZOA 5SICE 2I4MA 3QVXA 5WRFA 3MWDA 4NJMB 1ICEA 1X7XB 4Q3BA 5K4HA 5FLXA 1SQ0A 5FI0B 1JHAA 2B3TA 2GYVA 2ODQA 2ZROA 3C4VA 4I6GA 1C1XB 1VHWA 4R9SA 3ZDFA 4ASUA 2AXEA 2DMRA 3AKEA 3A8TA 3FPSA 3C6YA 2QPOA 3PHJA 3STHA 4BMOB 5TLSA 4QNMA 2YZMA 2ORWA 3JQAB 3NVDA 4D9GA 2FDXA 4KOAA 3V4SA 3OCYA 3AUAA 3BAZA 4H6VA 1SCKA 1YC2A 4D9IA 3FWNA 4D57A 1KQGA 3OA0A 5U1PA 3HB4X 1ECPA 4IMRA 3COZA 3NU1A 2BHTA 1GQRA 4RD3A 1DRVA 2BFCA 1VLZA 2SICE 3STWA 4P0PB 1J2EA 4RSHA 1I10A 4OA5A 5H70A 4ZN6A 5C81A 1NVEA 3N2LA 3K2IA 3I72A 1H6DA 4X91A 3B3GA 4AF7A 4X5OA 1T13A 3T5CA 5K1ZA 3PXUA 5EXTA 2OECA 2OVBA 1N75A 1R64A 5A3SA 4WKOA 2QGZA 5DJ5A 1C1HA 2NVWA 1LRLA 4JMLA 4DIEA 5GONB 5A4AA 2QE7A 3R3HA 4KE6A 4D5GA 4HYTA 2I67A 2XBLA 2KM1A 2HDOA 3PFKA 4Q4DA 4LF9B 4HNVA 2Q8NA 1QG6A 3HMQA 5DCYA 5CITA 2FKNA 3CRQA 2VP5A 2EJTA 4RNDB 1MEOA 4L5CA 3K5IA 3TR6A 5D3KA 2UUCB 2MJLA 2PLNA 1KC1A 1JI3A 2G80A 2HRZA 2KE5A 4CMIA 1CY2A 3GIDA 1KZYC 3A58B 1VP9A 3OQJA 4ANFA 4GLOA 3LU1A 2O7NA 4IDEA 3V4PB 3MW8A 3RUAA 3L0BA 4U2FA 3OCCA 4NZOA 4DQLA 1QPZA 2J0UB 3KAJA 1HZZA 4M37A 1YKSA 4JLAA 4ER7A 4CLOA 3OIVA 4FFNA 1V8ZA 4NARA 5E8JA 4IMJB 4W5WA 4F4HA 2VKQA 1V43A 1US8A 3TQSA 1RVDA 1NRIA 2HQOA 4BMNA 3D64A 4JGBA 1VYHA 2CD7A 3IQDB 1PDOA 4RM3A 1QGZA 2QRPA 1FL9A 2NADA 3CXUA 3I0MA 3KZOA 3NFYA 1FYWA 3KSBC 3G5LA 3P0HA 3QP9A 1ZESA 1QHHA 5A6SB 4CLDA 1P5HA 1X1EA 5CMLA 4AKHA 1NRXA 3HN6A 4EGJA 1VHDA 3W8DA 3QSGA 1U8FO 1DC7A 3WL3A 4FJ1A 3BRQA 1VOTA 4HGNA 4IHJA 1QR2A 5E6SB 2SHKA 1QOZA 3L02A 1DO8A 5J5AA 3RGWS 4N0MA 3X43A 3A4YA 1MAVA 2Y1FA 2YIVX 5AM4A 5CDSA 1HURA 1XTTA 1YR6A 2YWDA 2WUVA 3GAMA 3HRKA 4Q01A 4D5EA 1QGED 2G72A 1GPKA 5KYGA 3THRA 2RHOA 2D7CA 2VK1A 3TQFA 2IEAA 1YR7A 3GEEA 1CB0A 1KMCA 4I81A 4M53A 1WD5A 3CF4A 4EHNA 5KTNA 1O89A 3ET5A 2X0DA 1DQRA 3K16A 3ZI4A 1JIQA 1ESCA 1TUBA 4IPTA 4C7OB 3MPUA 4WXMA 3IP1A 5EJ4A 1E0DA 4M0DA 3F67A 5IBQA 2RKBA 2WJGA 4IH1A 2AN9A 1BMTA 4IIJF 3S2SA 3N76A 3HCPA 2I9PA 3HVRA 2I4OA 3FMFA 4DOMA 1D1TA 1QANA 2R8RA 4PQGA 4F3NA 2G09A 3GNSA 4BFUA 1U7PA 2CLLB 3KPUA 1Z18A 3H8SA 4KRXA 3FTCA 3C39A 3PGJA 4QX6A 2FMTA 2P7HA 2P3SA 1X38A 4UEWA 2B6HA 4KGXA 4R1SA 4RAOA 1N8KA 1J2JA 1DRWA 2Q8QA 3E9DA 5DX0A 3W4KA 2IYVA 1ECLA 3B7WA 5A06A 2R97A 3NT5A 3QTTA 3GHHA 4D42A 3ETCA 4ARAA 2PLAA 4MMXB 1SR8A 2WSIA 3OQBA 4QOIA 1GRVA 3D8UA 1D2GA 4LGMA 4L22A 2FY8A 3K70D 3QKIA 4OG2A 1WRBA 5I9IA 2GAIA 4QFBA 4RMGA 3PEYA 3UJDA 3TI9A 2R2AA 2OZKA 1T1RA 4FFVA 5KKAA 2JGDA 5BW8A 3E9MA 3IAHA 1XLWA 3C3DA 3ZCSA 2BT4A 3EGDB 4P82A 1HRKA 1Z4KA 4WZBB 1P3DA 3FI9A 3ZX4A 4TOIA 5LM3A 1W9MA 3O31A 1MQ9A 2V59A 1TO6A 3WMWA 3B8EA 1XO1A 5IWAB 3AVWA 2GA9A 1RI3A 2XWQA 3GGDA 2FSVA 3AESB 4PYIA 5KS2A 4ENQA 1P2FA 4NFSA 4O4JA 4DIDA 5KNDD 3IEKA 4TV8B 1NTOA 1JBKA 2ZE5A 3ISTA 3ZVNA 2PUHA 2NYRA 1DOZA 4MJ3A 4ZU1X 5TE9A 4M99A 2NPIA 2X5NA 2C7BA 4HKTA 1UEIA 4JFRA 4YI3A 3UICA 4C7XA 1JZQA 1G5PA 4MKIA 1XTRA 5AKEA 1NDHA 1OI4A 2FRVA 1GAEO 2VHXA 2DWCA 5J23A 3KJEA 2EX1A 1I6LA 4AX4A 3EH2A 1SU8A 1UKVY 2AEFA 1P75A 5F64A 1G21A 5I5GA 1G0NA 1T0UA 4PONA 3WL4A 2XUGA 4XJXA 4DJ5X 5CFZA 2AR0A 2EBUA 2HXGA 4HNQA 4OKIA 3W06A 1R2QA 1JEYA 2ZBDA 4PC1A 4M1MA 2RH4A 1Y3DE 4FOOA 4M0CA 1FYXA 2JLRA 2QV0A 2ZYIA 4QELA 4RVGA 1HLFA 5AICA 5B3KA 4G0WA 1PNVA 5LZ2A 4N5DA 4TTAA 3ZKWA 4MYDA 3HNPA 1UXKA 3WLSA 4I50B 2H00A 2HUNA 4BAZA 3NHUA 3RG8A 3PJFA 1I01A 1ZLXA 1G5IA 3ZVMA 1FSZA 4AWXA 2FK7A 5AM3A 1NI4A 1XALA 2QDKA 4D0LB 1OKKD 2HU8A 2XQJA 4MUYA 1NIPA 3TW6A 3OPQA 3MJHA 2VXYA 1MHTA 1P8JA 1VLLA 3PDJA 4R2XA 1DEAA 4F9FA 3ZHQA 1YUMA 4ZKDA 4CI0B 1QNLA 4BJ3A 4POAA 4D9NA 2HRDA 4GR4A 1Q95A 1VBMA 4UBKA 2J6IA 2DSNA 1ZFNA 4QYIA 2AOUA 5CA1F 2ASVA 1F8YA 1W44A 3L8ZA 4M7PA 4RD4A 5F2EA 4DHEA 4IJUA 1HSZA 2ZTMA 1V26A 4RDIA 5CJJA 4LZLA 1F17A 3PJRA 3U60B 5FWAA 3A3NA 1YT5A 1OLXA 1KO8A 2OSVA 1GCIA 3BD9A 3PLRA 3R0QA 3AESA 3MS2A 1T5TA 2AYYA 5HDBB 3U7RA 3E4DA 4AG3A 3L92A 3SJBA 5LZ5A 4LMAA 3OVMA 2HNBA 5ALFA 4W5TA 1U1GA 3NBKA 3NTXA 3ZBQA 4RPKA 3OUZA 4Y2JA 4V03A 4BP1A 1ORDA 4QU0A 3E70C 2YS6A 4MYCA 2W2PA 3A6ZA 2FPOA 2IPNA 3VYRB 2CW5A 5F12A 8AT1A 1ULUA 4GSKA 1PK9A 2JGAA 1V3UA 5FCDA 3QG5A 5G0UA 4EG8A 2JG3A 5G4KB 1NJ8A 1PYGA 2OL4A 4BZZA 1R88A 5I9LA 1E18A 2R8XA 1N7HA 2EX0A 4ZAYA 1O6CA 2C57A 3KM0A 3R3WA 4LDAA 5I3CA 5DYGA 1Y8QA 4M3NA 2VNIA 1MN6A 2A5YB 5IABA 3FNEA 2WJ3A 1E1CA 2M9MA 3ZNQA 1CUXA 1L7NA 3REFA 2Q7DA 1FZQA 2C00A 1OQAA 1E1CB 2N47A 1DP4A 1YJXA 5KSPA 1NU6A 4U3JB 3LSTA 1A1SA 3PCXA 1G8HA 1XT6A 2NZJA 4BBPA 3G8BA 2OZPA 3IMFA 3EIWA 4JSRA 2WJYA 3SDSA 1J07A 1FC0A 4E5KA 1HWYA 2AF4C 3ZH2A 3KZCA 2JDID 4K9MA 3A2KA 3ZBUA 5CB0A 4BZPA 2VQ6A 1LLDA 1S9HA 1NT4A 3LY7A 5MDHA 3ZDZB 1MTZA 1W29A 5EVJA 2H1IA 3E7FA 3QW2A 1O5IA 1AQLA 3OT5A 4FFOA 5KNCD 3KHTA 2YRWA 4LX8A 4RLQA 5AJVB 4JLPA 1WMEA 5T6MA 5L9AA 1FP1D 1MB4A 3F0TA 1C14A 3UHPA 2C61A 2P0YA 4JB2A 5F51A 3BHNA 3M83A 2CWWA 4IW3B 5HF9A 2AGVA 3T5DA 4CGYA 1SC4A 1ZXLA 3IEIA 1K8YB 2YFHA 2JCVA 3AOEA 3PNSA 2BOVA 2PYDA 5CPFA 5A9SA 5M5BA 1OLXB 5LQKA 1Q1BA 4GVPA 5DSZA 3H8VA 4MK4A 4EL0A 5E9WA 5B53A 2PUGA 3I2GA 3UC5A 2V5AA 4CKBA 1W9HA 3JATA 1M0TA 1R9NA 5A04A 1Z0UA 5C8XA 3QOXA 3RS9A 3SHFA 1JWBB 1KP3A 2ZYWX 1U2DA 4NMHA 4JYCA 3UHJA 3O8BA 3DYBA 2WWWA 1G38A 1JX6A 3F6EX 1EK0A 4LOAA 1FRZA 2XAUA 1WZIA 2ZULA 4EB0A 4MDYA 4PZCA 1A2KC 2WPNA 4PHHA 5E3JA 1G20A 2R7NA 3CR7A 1BS2A 2Z6AA 1PFQA 4E2FA 1NVDA 2OCKA 4ALJA 1AGXA 3IE0A 1QR6A 4EBFA 1MA0A 3JQDA 1TNDA 4V2UA 2W2MA 3FZEA 4X64B 4FOLA 4YUVA 5B1YA 2ZB8A 1QS0A 5COQA 3DE3X 3M49A 4CMIB 1G16A 3GP8A 4JI2B 1LQUA 3AT1A 3SPXA 4LRSB 4E88A 5EIXA 1XVTA 3V1UA 5AVTA 1SA0A 1PT6A 1X0VA 3DPUA 1JHPA 3WDMA 2Q1XA 3EEBA 2V6IA 1HT1E 1JBQA 1PR3A 1U28C 2B30A 3CISA 3IOMA 5KHAA 3HHPA 3LDUA 1JFTA 5IHXA 3PI6A 5GIPE 2H0AA 3JVIA 4BJ5A 2QRVA 4AO6A 5KNBD 2HSJA 2JNWA 2ZIVB 5EUBA 3UB2A 1EESA 4XW2A 3DWFA 3O26A 4LHXA 2PYZA 3TQHA 1MO3A 3I5XA 2K6GA 4NXNB 2PD3A 3UFXB 4B9AA 4D46A 1JIXA 2ONYA 4WJKB 1K7EB 3OA2A 4F1KA 5LP6B 2LDBA 4KWIA 2BSAA 1B0AA 1Y1PA 5JQGF 3V97A 1EWYA 2I87A 2B94A 2HQBA 2YV5A 3A4VA 3KG2A 3WIDA 3NDBB 3H5WA 3JYQA 5CXXA 5HQ3B 5A9SB 2E6UX 4G26A 4JL5A 4TV9F 1N5KA 5KVQA 1OCEA 1T1SA 4JLOA 1Z7WA 3ZVRA 4L28A 1UZAA 3VTZA 3T4EA 3UW3A 4CF5A 5DBFA 2Z95A 3BCUA 1O2DA 1ONSA 1ZK3A 1ZM4A 2Z04A 3ISVA 1YRYE 1B0UA 1UBLS 2EGUA 3EEIA 4MYTA 4QVIA 3CUSA 3OQNA 3CVVA 1WW2A 2C59A 2VJMA 2WU8A 4YRCA 3LCVB 1IM5A 3H2JA 3RWBA 4CR6A 1W87A 2XUJA 4PGAA 1I2MA 4UQPA 2YCBA 2PMEA 5KTSA 4Q9KA 3THWB 4XYLA 3LWZA 2OCBA 1B6SA 1LU9A 4JA0A 2OBXA 3VYVA 2WMNB 3WGLA 3A6HA 2I1LA 2GM3A 5TARA 4ZAZA 3CNEA 4CWAA 10MHA 4D8UA 3J81k 3KQMA 4I9FA 2PZFA 5JZSA 2A30A 1ZM9A 3LGAA 7GPBA 1XDSA 2XGGA 4C0AC 3PPVA 1E96A 1ZITA 4JOQA 2R65A 1L4YA 4R5HA 4RIEA 4A2PA 4RDXA 1E6LA 1Z35A 1NQXA 2QRZA 3LX6A 5FBZA 2WTUA 1FSGA 1V16B 1UPXA 5CYOA 3QPAA 2IU3A 2RGCA 2ZU6A 1N6PA 1NW3A 2XEXA 1SIBE 4FGLA 2BFBB 4DL9A 3JAWB 3EPLA 3L4BA 5AYVA 3LXMA 1TF5A 4Q3AA 3T54A 3MM4A 3EWIA 1OH5A 1C3OB 1GRNA 16PKA 3ELDA 5H7XA 4MV0A 3C7CB 4H17A 3HQ4O 1IN8A 2CCJA 1F4PA 2CK3D 1SK9A 4UEJA 4MAMA 3ZHXA 4FX5A 4URYR 3O8LA 5ES4B 3KQQA 3I34X 4YP6A 5C1OA 3VO9A 2PBRA 3B1WA 5BRAA 1JSRA 1ICIA 3HO6A 2O7VA 2QUHA 3RF7A 1OKKA 4I7EA 3C6KA 1NW6A 4HWSA 1HK7A 3LFUA 1GTL1 5DLEA 3GBSA 3K1YA 1Y5IA 3R1IA 3ZXSA 3D9QX 1GUYA 4LOKA 1M67A 2X0RA 3KLNA 3MWEB 1WXGA 3SCZA 4CM7A 5K8UA 1PNRA 4TLDA 5AQEA 2Z4TA 3K9GA 4PLYA 5GVSA 2C8VA 4AZWA 1LTKA 1TECE 3P5BA 4P7JA 5ILGA 4P93A 2ZB2A 5A5DA 2WVGA 2YIMA 1G1AA 1GTMA 3QVJA 3DVAA 4M1OA 4WBXC 4DCSA 13PKA 4RH3A 5EGSA 3UNXA 1AQIA 5TPWB 1QZXA 4NJEB 1IRIA 5CDUA 2PRYA 2DUMA 1B73A 3FZGA 1RZRA 1YOBA 1KU6A 3TLGA 1XVAA 3K72B 3OEHA 1PJRA 1GFSA 4ZA2A 2BEUB 4K1LA 1M72A 3K6SB 2IHNA 4ROSA 2LXNA 2PZEA 1SJ9A 5FTMA 4LFCB 2CJWA 3ZNNA 1TUBB 3LT4A 5DCWA 1Z5VA 2YC4C 1IE3A 3KJQA 3N2GA 4HF7A 5IG2A 2RKWA 3GF4A 3FM9A 3O2NA 3GLSA 3GLQA 1FYVA 2FJ0A 4M9ZA 1EVLA 1KFJB 2UZ4A 2B4RO 4HX5A 3A10A 2M6RA 2C4HA 4LY3A 5AM0A 4KP7A 3HR4A 4NS4A 3ZE9A 5D6OA 1A76A 1SHLA 2VL7A 1Q50A 3JQ6A 2WYVA 5FOUA 2CMFA 4KFTA 5TRTA 3J81A 1Y7IA 1DKOA 5F73A 1WLSA 4XVUA 1NXWA 3LH5A 4CV0A 1KKLA 4AAYA 3TOSA 3MTAA 2EDCA 3KQVA 1L4FA 2Z1DA 4AECA 3LC1O 4MUHA 3DAPA 4LJYA 3NETA 2P68A 3KZVA 5K09A 4LDJA 3MWFA 4H4CA 5CT4A 5F77A 1DAGA 3LY5A 3LPLA 4JJ4A 4FYXA 1T0BA 4G9BA 4M98A 4NATA 5CIQA 1Y37A 4NK5A 2AZXA 4RXUA 3MGBA 4QFMA 1GRQA 1KJYA 1X7ZB 3CIOA 2IEZA 4Q93A 4QPZA 4Z99A 5DYWA 5BSUA 5B3AA 3RSQA 1TYBE 3VKGA 3VC7A 3PNBA 5LCXA 3UBMA 4EJMA 2VHEA 4RSRA 3VM6A 2IXDA 3LRTA 4TVBA 3A27A 4LMPA 4EHFA 1ZH4A 5AW0A 1PR6A 1PQYA 1ABFA 2JGDB 2O3QA 3DZGA 4ZARA 1EM8B 3NZEA 4TV9B 3TSYA 5IVIA 1DS6A 1I33A 3R0ZA 4V1CB 1M6WA 2FEMA 2G77B 3ZJYA 2DHEA 1T2NA 2Y2UA 3QQ5A 3URMA 3ILHA 4TMVA 5JRDS 4I9HA 4HLDA 1A9ZA 4U7TB 2UDPA 2JBWA 4INOA 3RE1A 3O4HA 1WF6A 3BN3A 4FYYA 2D0OB 1L9XA 1JT2A 3M6IA 1J2UA 1CTQA 4GOKA 5JO0A 1U9IA 3D6JA 3R6LA 4R3UC 1C7IA 4BV9A 1MDFA 1Z74A 1UBTS 2CZGA 2QVZX 3STTA 5AM2A 5JS1A 1N2OA 1XTQA 1MW8X 5A7GA 3NKFA 4XRGA 1L8OA 5G0VA 5EI5A 3ZE2B 3D81A 3NCHA 3WLRA 3ZDCA 2Q7XA 1P5RA 4NBWA 3W8EA 5EWMA 2UYYA 3QUBA 4FINA 3TSOA 2JFYA 4QODA 3GFSA 4OQZA 1NIJA 1I30A 3EMBA 4TLLB 4YASA 3O03A 4B2IA 3FTPA 2NV0A 3D31A 3K6RA 2PD4A 4AS1A 4HDMB 2V1UA 3P71T 4NEQA 2PQ2A 5EN4A 3H3JA 4P81A 1NVBA 1X9GA 4PC6A 3RU2A 2GCIA 2FUG1 4CDGA 4DY6A 3IBSA 5E2IA 2SKCA 2R4QA 2GBCA 4KO8A 4J3FA 4D3XA 2F67A 2I4RA 4HI0E 1IVNA 2LPMA 2PNJA 3S8MA 1XEWY 4MQ5A 1JKJA 1NVFA 2CN1A 2DCMA 2PKYX 4G0QA 4RF2A 1TQ2A 3E9EA 2XCRB 4KNYA 1KOJA 1LBEA 3G17A 4M76B 3BZWA 3IIMA 3G8AA 3RRMA 2OKCA 1FDTA 3CW8X 4LZJA 4IVNA 2Z9BA 4BYGA 1XWFA 4RVSA 1I4EB 1VE5A 3OIWA 2QBYA 4JSYA 3GFTA 4YV0A 2IXFA 4J29A 3RFCA 4ZJUA 4XDHA 1X3SA 2XEDA 5TB5A 3OU7A 4IOMA 1J1IA 1GA1A 3B9RA 3JQGB 5E95A 1VSTA 3DSRA 1NZFA 4L4YA 4PPFA 1WU7A 1DKPA 2IY9A 4RFLA 1Z63A 2PD6A 3FPLA 4R8KA 3VTFA 1YU9A 5B5SA 4I9UA 4BLWA 1CDDA 2I65A 1LNQA 4HS4A 2VHTA 6REQB 3C3CA 3NWPA 4JT8A 3VX3A 4JKIA 4QG3A 3FYCA 1CQZA 1RCTE 1K27A 4WJZA 1MVOA 4RTPA 2J8ZA 4P7GA 4FFRA 2FR1A 3FVWA 4MWSA 3VR1A 5IC5A 1MCZA 3MLEA 2JHPA 4MW1A 4N3GA 5TX7A 2RHRA 3ROKA 3CX7A 1BKYA 4C89A 1E9BA 1AMOA 2ZXEA 3VYWA 2WBLC 4A0FA 1YS6A 1OYWA 4DLVA 4BNYA 1EGHA 4W7HA 3MUNA 3AR2A 3ANSA 5BRJA 3REQB 3GLIA 4G86A 3U7QB 1J2TA 1IEQA 3CE9A 3LT1A 5I51A 1HRDA 2H17A 1GPH1 1JILA 3T0IA 1QIJA 3P9IA 3SJZA 1ORWA 1XELA 4EKYA 4PRLA 5EJGA 2ZSDA 4O4IF 1LTQA 4B48A 4A1OA 1BS9A 2B7CA 4Z49A 2KWIA 1FXWF 3PC8C 5F1OA 5FNVA 3QJYA 3SHQA 2JHAA 2NIPA 5AKXA 1YVEI 3CTMA 1K7YA 3LYHA 2BGNA 4G2TA 4BCBA 2BPOA 4EHAA 1XROA 5IXJA 3QELB 1W47A 4UARA 1B7GO 2EJWA 3AB7A 3QVTA 3G5AA 4DTIA 2BZ1A 2PK3A 3C74A 4HXGA 1KFBB 1H3FA 2QN6A 5DP1A 1PKXA 4G5YA 4ZV7A 1FNSA 1YDGA 2QJRA 1UKZA 2R1TB 3ML1A 4R83A 5IJ9B 1D7OA 1DQPA 4PHFA 5ENVA 1A71A 5DEOA 2WU3A 2ZBQA 3JQGA 5K03A 4TYMA 2GJKA 3PENA 4PX5A 5CFOA 3DVQX 3SICE 4BQIA 2VNHA 3HDYA 1GSAA 3IVXA 3JU3A 2P0EA 1KYZA 4DT1B 3IVRA 4GH5A 1OPXA 3PSHA 4WGFA 1FPQA 4FPXA 1MABA 5LQRA 1RYMA 2OCXA 4TVSA 4K6KA 4MO2A 1Z15A 3AUSA 3AR7A 4IM7A 4V02A 3GI1A 3IR6A 4LJLA 5AJHA 3IAUA 5DXAA 5FT9A 3LW7A 1F8GA 4F3YA 1IUPA 3PX2A 1QUFA 4QUIA 2Q9CA 3BEOA 1PG5A 2C5EA 4DXAA 1DC5A 1HDEA 1Q0UA 5EZ6B 4BVBA 1NF9A 1TPZA 2Q7OE 2EEZA 3T3HA 1RJGA 4LF5B 5B4TA 2FE1A 1EVJA 4C0JA 3TOVA 3EYWA 2G4CA 3HKEA 1Z2OX 2W37A 2I3BA 2OAGA 4LY6A 2BDEA 4HATA 2IXEA 3F73A 2PEZA 1SD2A 5HS6A 5CFLA 2GBLA 5KWVA 4OMFG 4W9NA 1XQ9A 4EFKA 3H86A 3OO0A 4DYVA 2QGNA 5AVXA 2AI1A 3U3RA 1DPFA 4B8WA 3BILA 2HPHA 1K9SA 1ZDMA 4JUIA 3OAAA 3ELWA 3IVMA 3K5HA 4YACA 1A4RA 4MVJG 3Q9LA 4FYKA 2C92A 4GC9A 1VIDA 1Y42X 2D2IA 2O3UA 1UZMA 4M9SA 3F3YA 1DOHA 1H0KA 3IAAA 4D0GA 4TZTA 3O8OA 2H63A 5EXPA 2XD9A 3M5WA 1V3TA 3KUXA 5C4GB 4AUMA 2FJPA 1X19A 2HHAA 1U7WA 1WXHA 2RGWA 3ZGZA 3CMMA 1LWNA 2WJIA 4WOJA 4DQUA 2X9VA 2LZ0A 3PITA 3VO1A 1VXOA 1CHDA 3NRBA 3RYFB 2RAUA 3CF2A 2O05A 1JDVA 1U5CA 1C7ZA 2P2SA 4IVRA 3BWDD 2HQSA 4BWVA 2Y1EA 4M7OA 4PYOA 5LNK6 2O8BA 1KH3A 1NNSA 1JJAA 1IHYA 2I3ZA 3EN0A 5CVCA 3V5NA 3GW8A 4FE3A 3DVAB 1IMJA 4M6WB 3RAPR 1FMJA 3RUEA 2FI1A 4BQRA 1YQDA 4R9VA 1D9XA 2UZIR 2HW8A 1KA9H 1Q1AA 3IHWA 2EWWA 4M9QA 1EG2A 4MVJE 4JI1B 2ZXUA 3FGOA 3TCKA 4B5KA 1YTUA 2V74B 3MMSA 4RELA 1RXEA 4IIEA 4OLJA 2HXSA 4PG8A 3T7AA 1FQKA 3WG9A 4CMJA 3FD8A 4NPHA 5EUCA 4FFBA 4IOLA 3DV2A 3ER9A 3D6AA 3OURA 5IW8A 4NLLA 3VDMA 2RD2A 1VL6A 1X42A 2H6EA 1LQ2A 4HBZA 3LFHA 4HPWA 2ZUEA 4FNOA 4N0EA 1EGQA 1EDZA 1KOLA 1N6RA 3ND8A 1ENYA 4Y9TA 2OCLA 4CG1A 5BSFA 3KO8A 1PWXA 721PA 1COZA 4Y7CA 4FILA 3LUKA 1WPQA 4Q4LA 5ALHA 1VB5A 2FN9A 4R7ZA 4DV1B 3RVBA 3ENZA 5JVDB 1UMKA 2H9AA 3K92A 4XSVA 3NM4A 4IWXA 5J40A 4B6GA 4N3CA 2WPDD 4X1KB 5DT9A 3WO1A 1CUDA 1I5OA 3HBLA 1X1RA 3ONNA 1ZL2A 3KT3A 1SBYA 3FRIA 5ALDA 4D2IA 4HVCA 5JY6A 1W36B 2OFOA 4C0HA 3J7AC 5KYYB 4WMLA 1Z0SA 4BO2A 1CUUA 1UBGA 1YE5A 2YQ5A 4PXSA 4FMCF 3C8DA 4NJMA 4RHUA 1JIJA 3ZNOA 5JSUA 2A7QA 3WYFA 3E3MA 4Y6PA 3TRHA 1CUWA 3A9CA 1NL3A 4XB1A 1W4CA 1ISMA 2WD7B 1ZM3A 3CLRD 1BHO1 1AC5A 1PK8A 1ZVQA 2IODA 4ML3A 4NSNA 3ELYA 4P3PA 4YJFB 3U4QB 1ODLA 4QIHA 4E11A 3ZJUA 2VP3A 4Z4IA 2R8ZA 5LD2C 2OQVA 2CDBA 1JALA 1KEEA 5EHZA 4PFKA 1AM4D 4UNRA 3KD3A 1YCHA 1ZWLA 4M8LA 1SRRA 4J1NA 2ZXFA 1N2CB 4OK5A 4LTDA 4LECA 3RVMA 3U7HB 2AIRA 3QFFA 4AUNA 5K0CA 5L3SA 1OA1A 1MA3A 2IKSA 4C88A 5JTUA 2RB4A 4W8GA 3DVRX 3CVXA 1PX2A 4JI3B 2GO7A 4XD7A 3W2FA 1LBSA 3EDMA 4D4GA 2DUUA 3KKKA 2IW1A 2KX7A 3NBYC 1LPOA 5LP6C 3NHKA 2RGNA 3B5IA 4ND2A 4ALNA 1K4KA 4C78A 2DBYA 4CIYA 2FFRA 2O6HA 4PQEA 3RS7A 4C06A 1TJ4A 2OZVA 3B12A 4QUDA 3DDCA 3JQCA 4MKRA 2NZ2A 2QX6A 1JS1X 3D5EA 2IUUA 5ALRA 1V0JA 4M88A 2M1XA 1FUIA 2ATVA 4NL4H 4I1UA 2I7XA 3FKSA 4NJOA 3I28A 2X8WA 3MAJA 4LN1A 1Q3KA 4LF6B 2BGUA 1M76A 2X0EA 2HK9A 5JPIA 1V71A 4EVIA 2VHWA 4DS3A 1V8BA 4B2LA 1KQ3A 3TGWA 1FLDA 1KHHA 5KKNB 1XQ6A 1YRLA 3OZFA 3S1AB 1UMCA 1DSSG 4DIUA 3ZDRA 3WDKA 4HUQA 3CX4A 5JD6A 4B4DA 1NVVQ 3RHSA 3GXBA 3RD5A 3CPEA 2CFTA 1R0KA 4E3ZA 2QM7A 5JC1A 3FZQA 4HGPA 1UPFA 2Y0PA 4UUQA 4YXFA 2XCSB 2J0UA 1M2OB 2E4AA 1NFQA 2RHLA 4X61A 4YT4A 2LCFA 2PH5A 4KREA 1MB3A 3USCS 3WGGA 3UB4A 3BXZA 3GJQA 4B35A 4HLCA 1PSWA 2FR8A 4I3GA 5J4HA 3R7FA 2FX3A 1GUDA 2HFJA 4KU4A 2E82A 1BX3A 2JH3A 1ADGA 5BNFA 621PA 5JAHA 5I47A 4ARCA 3JZAA 4WUTA 1NUSA 3AOGA 2EFDB 4ZEOA 2QTVA 1RCUA 4BY9E 3BKWA 2GMWA 4DM4A 2QBYB 2C7VA 1KQOA 2GDJA 2ZAOA 4LYDA 1H1LB 1P4AA 1EQ2A 3MG9A 5AXBA 2R4UA 5I48A 2BKVA 1ZCBA 1XZFA 5BR1A 3OFSA 1MZPA 1HDRA 3AV0B 1U0GA 2RONA 3SF8A 4KE7A 4BMDA 4EZEA 5CB4F 3BIWA 4FZ5A 2JI8A 5GIOE 3QE0A 1EHYA 3DBLA 2HSWA 5IJZA 5I7SA 4DR7B 2G9UA 5FYDA 3E27A 4URHA 1RW4A 2VSXA 4WXRA 5LDGA 4KVZA 3P96A 1R5NA 4MUIA 4MAFA 3NEJA 4PZ9A 1JNXX 3ZTTA 3JARA 4WXYB 3WGYA 5C8VA 3RF6A 4DEYA 3RC8A 5J3JA 2WFMA 3UA3A 2QM8A 4YAIA 4C43A 5I4BA 4LFBB 1GN9A 1HT3A 3A6JA 1ONNA 1TLLA 3E84A 1U0RA 2QTNA 4YUZA 1DIHA 2HIHA 4G23A 3TK1A 3PYMA 2XZOA 1XJ5A 4MKXA 3GDWA 4QYTA 1VLVA 4J0EA 5L8VA 4IHJF 1U2GC 1FTSA 1LJ8A 1YAHA 4KMOA 2VOEA 5I7OA 2CE2X 2IQ5A 1NJ5A 1CY1A 3I92A 5C51B 2D5AA 4EMSA 5J4KA 3KCNA 3AF4A 2CUZA 2JJMA 3PF8A 3DP9A 5JDCC 2O8CA 1X39A 1Q84A 3WS7A 2CXSA 2PFSA 4JHXA 1V5WA 3FROA 4QSHA 4C3OB 1OT5A 1TCVA 2EJBA 2J3LA 2XQFA 3GLFA 3ZG6A 3ZIUA 2DOKA 4JI5B 3EULA 4AXBA 5C5CA 2G25A 3F5DA 2PS9A 1H2FA 2XTNA 5AK6A 3RB8A 4RMIA 4OQXA 4WECA 1GXSB 4BGEA 1OYOA 4HTFB 1MIOB 5FKJA 2BF7A 1AKRA 1HM5A 1X1SA 4AMVA