1JJ7A

Crystal structure of the c-terminal atpase domain of human tap1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
251
structure length
251
Chain Sequence
GLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEPTIDE TRANSPORTER TAP1
publication title Structure of the ABC ATPase domain of human TAP1, the transporter associated with antigen processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 75
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jj7A01
4DLZA 2BKUA 3GCGA 1Y63A 1M74A 1Z08A 1Q21A 2B21A 4NL4H 3WYFA 4DT1B 1GDDA 4NYJR 1QBKC 2PH1A 2JDID 3AKDA 1G8YA 3KKQA 4FW9A 2D74A 2JAQA 4AC9A 2O8DB 3A8TA 2PCLA 2HCJB 5AUOB 3KZ1E 3VX4A 3W6PA 1XPOA 2O8BA 2W6IA 3EA5A 4KSBA 1NI3A 2W83A 3WNCA 4NYMR 5JS7A 1SKQA 5JHHB 1Q1EA 4B2PA 3HPRA 1FFHA 2EFCB 1SXJC 2KB0A 5JBQA 4HYYA 3K70D 3RWOA 4MYUA 2QUZA 1CJKC 4X8OA 4EPWA 1XD2A 1NKTA 1LTQA 4R9UC 1NN5A 1E4YA 2QNRA 2BMFA 2VP4A 4JLNA 2ZJ8A 4XVQA 2ZR0A 1WF3A 3AH8A 4KBFA 1GRRA 4MGIR 1QVRA 2P5SA 1MABB 2YINC 4AY2A 5EE5B 4OL0A 1AIPA 3FVQA 4MUAA 4TMVA 5C2JB 5KPDA 1P5ZB 2ZRFA 4NZYA 4M2LA 4PAMA 3TR5A 4IFEA 2ZRBA 1NBMA 4RY2A 3TLXA 4DVGA 1VHTA 3VU9B 2JJ2A 3QENA 3LVQE 4URWR 2XTZA 5CJPA 2VYFA 1E9RA 1W47A 2BKEA 4FWTA 3DO6A 2ZSBA 1US8B 3BC1A 3I92A 4LJ8A 3VHXA 4F93B 1UEJA 2WWYA 1J90A 3U60B 3B9PA 3GJ3A 3GEHA 3OEHD 3VR6A 1XTKA 4Q19A 3W6OA 1E9FA 2FOLA 5FI0B 2HJVA 3RANA 5FPKA 2NZJA 2Z6VA 3THXA 1JR3D 2CL7X 4Q9IA 3MWJA 3EIQA 4KSCA 1EX7A 2W2TA 5FTKA 4BLQA 2QRNA 3K0FA 1N5LA 2VP2A 2F1IA 4M1SA 3UG6A 5IDVA 1MV5A 4OHVA 2EVWX 3MWLA 3LVRE 3U3MA 4C0JA 3KJIA 1Z28A 1DAEA 2V6IA 3EPKA 2ZJOA 4MDFA 4CEHB 1HY3A 2RAPA 1KJYA 1KNXA 1R10A 1M8PA 5J5CA 1ZNXA 4A4DA 4PHFA 1EK0A 1D8TA 1WDTA 1G41A 1E0JA 4TTPA 3RS5A 4EAQA 2A5FA 2MSEB 2QEQA 3EIHA 1NF3A 3BH7A 5DLQC 3EZ7A 4Z1MA 3V4RA 4OI1A 2HT1A 4OQXA 3L0IB 2E87A 1S2MA 5L3QA 2NO1A 1GG2A 2BCGY 2EFEB 3JVUA 3THWA 3K9NA 1Y3AA 4ZI2A 1EFTA 3DDCA 4NCJA 2W0SA 3KXLA 3LWNA 1MOZA 3GLGA 3BFXA 4KFSA 2FSHA 1XMVA 3BGWA 4I81A 4Q7JB 3ADDA 4MGYR 2PJRA 2ATXA 3ZS8A 2ZR7A 1R5NA 1KYIA 2BJVA 2N42A 3SQWA 3AKEA 3O8DA 3I3SR 4FIDA 3BBPA 4MDEA 4L15A 1E2FA 2ZRLA 2GXQA 5TV2A 1RZ3A 2DFKB 3SHFA 2ZIAA 1WB9A 4DB4A 4WZAE 1DG3A 2VP0A 3O8RA 1DOAA 2JDIA 5B2ZA 4KLZA 1E2GA 1VIYA 4BFWA 2AL7A 1KO4A 3D3QA 3DKVA 4N1AA 1U8AA 3TW4A 1PLLA 1HE1C 4I1UA 1G9XA 4A8JC 4IOLA 1W0KD 4KCGA 4R98A 3FMOB 4LV8B 3RRZA 1YZGA 3KQUA 2ZE5A 3QKSA 4RCZA 2O8EA 4ASUD 2BOVA 4GI7A 4TLDA 4B76A 4EFLA 2G77B 5DHFA 2QI9C 3GJ5A 2Z4SA 2V4ZA 1SVOA 3C5HA 5GADl 2PEYA 5HPYB 1E1RA 3ADKA 1F2TA 1I4DD 1MR3F 1TX4B 4OHYA 3VQTA 3ETLA 2VIIA 2OO7A 2XTMA 1R0WA 3RYTC 5GJVC 4D81A 4F91B 4M53A 3X1XA 1RFLA 2RKOA 5AUPB 5HZKA 1BMFD 3K09A 1N2CE 4EJSA 1Z6TA 1ELOA 1OHHD 3A36A 3RAPR 5DHAA 3N70A 5JS8A 2XZOA 2H16A 1E2DA 2QSYA 2IT1A 4TMKA 2XB2A 5UKDA 2OXCA 4DLRA 2F1JA 1NG9A 2OAP1 1SXJB 5KDOA 2QP9X 2UVQA 4GOJA 4PHHA 3AVWA 3QBVA 4IDHA 1Z0JA 1KI6B 3B1ZA 3EZ9A 4M9ZA 4GDFA 2QY9A 1FX0B 3JZAA 3SDZA 4E5UA 1RIFA 4JMPA 3EASA 3WMEA 2HYDA 5AJYA 1M7BA 2IXFA 3NG1A 4RFSB 3UMSA 3IBGA 1D2MA 1Z6YA 1N0WA 2XNDA 2ATVA 2CCKA 1CXZA 2ZVPX 4OHXA 2BM0A 4L5BA 1J70A 5FFMA 4PZLA 1CJMA 4NYIQ 2VEDA 5E4FA 4EFNA 5LDDC 4M22A 3TQFA 1FL9A 1KO1A 1ZJ6A 4B6EA 5J47A 1Q20A 1CP2A 1Z0AA 3QIAA 5HE9A 3VFDA 4EKDA 1KK3A 2IYSA 4IKEA 2CE2X 1IBRA 3PUZA 4BZQA 1TAGA 2PL3A 2ODBA 1LF5A 1RRFA 1DAMA 1T6NA 1QDEA 4JSTA 4CT4B 2V8OA 4NU0A 4BRWA 4AI6A 3B85A 2PEZA 1UBFA 1S96A 4L9WA 4YLGA 4Q7LA 2NO7A 2P0EA 3HDTA 3AUXA 5JI3E 1AQUA 3GFTA 4PQFA 2YYZA 4ZCIA 3FPAA 3PVSA 5JLJA 3HWSA 2TMKA 4O2RA 2CMKA 2WJVA 3TAUA 1Z06A 1MKYA 1CTQA 3LX8A 3TSWA 4AD8A 5G3YA 4QNMA 2J41A 2IYTA 2JASA 5DI3A 5E7MA 4DSOA 3OAAA 1L4YA 1COWA 3LAWA 3T1QA 2ZQ5A 4A0FA 1VHLA 4TSFA 1L2TA 4CW7A 3SBDA 4Q1EA 4A9AA 2O8DA 4PQRA 1P9NA 1KZ7B 4BASA 5H70A 2CK3D 4JKIA 3T5GA 1OYWA 1H65A 2QG6A 3A58B 4UKDA 5BW8A 1D6JA 4PPFA 521PA 1QRAA 4JS0A 3GLHB 1OSNA 1E32A 1W0KA 2PLFA 5JEDA 1PUJA 4II7A 3FOZA 1BYUA 4EPTA 1G3RA 2J1LA 5JHGB 1MABA 1P75A 1KZGB 3CONA 3HYRA 4ASUA 4DDTA 3TK1A 3E2IA 3NHBA 3TSOA 3MAAC 4GP7A 3WRYC 1HQYE 2ZRKA 1LFDB 1E2QA 1M7HA 2J7KA 2OCYC 3CRRA 4UXIA 3TQCA 3VU9A 1UKZA 3M4YA 4G5SA 5HTKA 2WPDD 3CR7A 4G5GA 3QXXA 5H68A 1AGRA 2RGXA 3Q85A 2ZSFA 5IK2A 2PLRA 2GJKA 1FUKA 3LD9A 3RHFA 5C1BA 1SXJD 4B74A 3AF3A 1OHHA 2OCPA 3ZD7A 4PHGA 3CNNA 1US8A 4OK5A 2AK2A 2C99A 3QNUA 3UWKA 4B71A 1KY2A 2O0HA 5JECA 4P32A 1N0VC 4Q4HB 4FCWA 4LJ5A 5DO9A 1OXUA 2PCJA 2XZPA 1PLKA 4B3BA 4DC9A 4KU4A 2RGAA 3CNOA 1YZLA 1Z6GA 2I3BA 4TQUS 1CS4C 4TL9A 3B8HA 1FQJA 3KJGA 1W5TA 2OBLA 3SFVA 4YMSA 2OBNA 5JJLA 3KFVA 1AZTA 3JVVA 1VG8A 1DS6A 2CLDX 1E1QD 4OI2A 4LOAA 4BLTA 2YOHA 2ZU6A 2NO9A 2BV3A 4OHWA 4D82A 4EPRA 4BLOA 1ZD9A 1GL9B 3F0TA 3N5CA 3QVVA 2DFNA 1N6PA 2VHTA 4MRSA 3EC1A 1A4RA 3K70C 3U7HB 3P20A 4CEHA 4K8OA 2RH5A 3RVBA 4XVRA 3DMNA 4TN1A 3SS8A 2QMEA 2BM1A 1KO8A 1X86B 3KB1A 4FXPA 2BWJA 3A1WA 3Q72A 4QJ4A 2J7PA 1G3QA 2GILA 4I4LA 3CF0A 4OHZA 3WYGA 5E3HA 5LPNA 3H0KA 4B2IA 1YZQA 1G64A 1E9DA 4RD4A 3I1FA 2AK3A 1E2LA 3K09C 5SZKB 4JLAA 4LPSA 1G4AE 4GOXA 2VHJA 3X1ZA 4DLWA 2YV5A 2CBZA 4D4MA 2B7CA 3PUYA 3VX3A 1YZKA 2YOFA 4LJ6A 4A0GA 4PSAA 2AX4A 1TQDA 2ZJ5A 4Q03A 2BBOA 2D7CA 3AEZA 2C95A 3ZH9B 3WHKA 2ZU0C 3T61A 5EJEA 1VMAA 1GWNA 3WRXC 3F3YA 1NJGA 4PSVA 1OKKA 2GCOB 5KHOC 2FX3A 5EP1A 1FNMA 5FPYA 5HZHA 5LD2C 2JLSA 3TGPA 1J7KA 1JALA 5L8VA 1NMYA 4B3FX 4DUGD 2WWHA 1KK0A 1IJFA 2JJ1D 2PT5A 3MSXA 4TYWA 3E1SA 1JAIA 2VF8A 1R0ZA 3A1TA 3FFBA 3D6TB 2D2FA 3GLFE 1Z6AA 1NVXQ 4RKEA 2PZFA 4Q21A 5FOVA 2NPIA 2BVNA 5EE3A 3AVQA 1GZSA 1VYTA 2CK3A 2NZ8A 4ZCMA 3TVTA 4B35A 4WBSA 2VPPA 4DSNA 4M8NE 1SKYE 2BMJA 1KGDA 1DADA 1RYHA 1ZAKA 1ZW6A 3W9YA 4IDNA 1XCGB 2HCBA 3V00A 4ZDJA 2YKGA 2GTPA 2IHYA 2H18A 2J5XA 1GRNA 1N6KA 2BBTA 4CEJB 2Z83A 2VRWA 3QEOA 621PA 5JSZA 2ORWA 1R6BX 4L4UA 4NONA 4DCSA 3AP1A 1W0JD 3PEVA 1X3SA 1XDBA 2IWHA 2G1JA 2KJQA 1QHIA 3FKSD 3SN6A 5FBWB 1GKYA 4M1KA 4W5HA 4GMDA 3IPXA 1Z6XA 2ERYA 4QC2A 3KTAA 2WPDA 1GAJA 1Z0FA 3A1SA 4JYBA 2IL1A 1T9HA 4C4PA 1NMZA 3R8FA 2GHIA 1SXJA 2OLJA 1OJLA 5DE3A 1JPJA 3DL0A 1GRQA 2AKAB 2J3EA 3TNFA 3BOSA 1KI6A 1H8EA 2ZROA 2N46A 2ZVQX 3B1YA 5FTLA 3TUZC 3KQNA 1FX0A 3BB3A 1FNNA 2OAQ1 2A7QA 2Q3MA 2J59A 2OILA 1YQTA 5D3MA 4AYXA 4H1VA 4DBLC 4JLOA 5CB8A 5JFGA 2BJWA 1XBTA 4LBZA 5LB4A 2W0MA 3MWYW 4BZPA 2BHRA 4WXRA 3GFPA 3BK7A 3QXHA 3O8CA 4DSTA 4WXPA 2XB4A 4TLCA 3NH6A 5FR1A 4D25A 4WIAA 3TMKA 2QORA 4BRUA 2EWWA 4LYHA 4CF7A 2R65A 5JRZA 4R71A 3EPJA 5FL7D 4O2LA 4D2IA 3K0SA 1SVSA 4HB2A 3T5DA 1EG7A 3LW7A 2IHBA 5CYPA 2ZRJA 3ADCA 5GVRA 2ZI5A 4F4CA 3CZQA 3KXKA 4UNRA 5GVSA 4OBEA 5B64A 1DG1G 4M1MA 4EIWA 1XTQA 4LHXA 3B5JA 4AIIA 2GWHA 3CKLA 1EFRD 3LQRA 4URYR 4YMTA 1W2HA 3VNVA 1XTIA 5G40A 4LZZA 2J0SA 4PXAA 4NBSA 2FPLA 4GL2A 5CDFA 2Z5FA 3EIEA 5KYKA 2IYVA 4L9SA 4UXHA 2FA9A 2ZYWX 1G291 5EZ5A 4NCHA 4ZV4A 1FMLA 2R6DA 1Q22A 1ANKA 4JLBA 2H17A 3LLUA 1GILA 4NYJQ 2QTVB 4PC1A 1XEWY 3QJYA 1KI3A 1D9XA 4G5QA 4E09A 1NMXA 2GCPA 2QQ0A 3P26A 2H7VA 4ZIRB 4Q48A 4XD7D 4C0QC 3ZDQA 1EFCA 2CHQA 2ZRCA 1YRAA 4GT1A 4A6PA 1XF9A 3FKQA 1OB5A 1ZNZA 2ZREA 1N6OA 2DBYA 1GL7A 1ESMA 4MKHA 2XSZA 3CX7A 3GLHA 1CRPA 4JLDA 5EXXA 1E79A 1A5TA 2HLDD 4XSGA 5FH9A 4OI0A 3SQXA 3R7WA 2DR3A 2RGEA 3RDPA 4BWYA 3BIFA 4B47A 1EESA 1U94A 2BBWA 1CR0A 1XZPA 4MKFA 1AS2A 5JWOA 1DPFA 2F43A 4PZYA 1VCMA 2G9NA 3EA0A 4TL8A 3M6AA 4MH0R 1ZD1A 1NN3A 2V9PA 3GLIE 5LD2B 3PUWA 1G17A 2REBA 3QUSA 4B3XA 4JKYA 2XXAB 1RC8A 2DFTA 1W0JA 1G5PA 1Z29A 1YR7A 2JIZD 4A6XA 1D2EA 1S3SA 2GESA 4FN5A 4Q9JA 1KK2A 2Z0MA 1M1YE 2YOGA 4A92A 1YR6A 2NTYC 4LJ4A 3U44B 4A8JA 4PTLA 2FGKA 3PJRA 3DVLA 3HU3A 2FV8A 1Q0UA 2OESA 2YJTD 4B75A 4W7SA 4IXMA 3AP3A 2FNAA 3SJZA 4AG6A 3ASYA 3T1OA 3TRFA 3SZRA 2HXYA 4RJLA 3K9LA 3QY0A 3BFKA 3J81k 4D0LB 2Q6TA 2NGRA 2J0VA 2RGBA 1QHYA 1XJQA 4MUBA 5DI9A 3MUFA 1ZIOA 2ZE8A 1CRQA 2EYUA 3OEED 4LHWA 4G3XA 3KDSE 1LNZA 4R2IA 1KO7A 3U61B 4V0MA 2OFXA 3HPQA 4ZPXA 1TPZA 2GETA 3CWZA 1Q3HA 5DYIA 5DNYB 3QF7A 2VSFA 4BEBA 2GZDA 4V02A 1XPRA 3D31A 1LF0A 2DPXA 2ZI7A 2OCBA 4A2PA 4DCUA 3ZD6A 1Z83A 4OJQA 1UDWA 5KOYA 2YC2C 1XX6A 3U7FB 4RSGA 2CL0X 3IKJA 3NBYC 3U5ZB 4YONB 2QAGB 3VR5A 2KI5A 3HJNA 3LDAA 4YMWA 4P33A 1EFRA 1HH4A 3PIRA 3EXAA 3MWKA 4C9BA 1F2UA 5EP4A 3B60A 1M7GA 4P4TA 3L43A 4U7DA 2FFQA 3M0EA 4JLPA 1H8HA 3LXRA 1XJ0A 1QHGA 1Z2CA 4TZ0A 4ACAA 4IOKA 4GMXA 1G18A 4QHYA 1XTRA 4EPXA 4FINA 2AR7A 1W44A 2NO0A 3IPYA 4RKFA 2FEMA 3SJAA 4DLTA 3BH6A 4GNKA 3FHCB 1CEEA 1MO4A 1DEKA 3K1JA 1X1SA 4QBHA 3BB1A 2DY1A 4C0KA 2ZRGA 4HATA 2IK8A 4GPTA 4NCNA 4GZMA 1FTSA 4JVSB 4A0HA 4LRWA 4B2LA 1UFQA 4LGMA 4Q1AA 4I1VA 3QKRA 5F9HA 2YZ2A 4C7OB 1L4UA 3FDIA 1WRBA 4V0KA 4HLUA 3FMFA 2VP5A 3B78A 3K9GA 3W8NA 4DCTA 1W7AA 4XTCS 3O47A 1T3SA 1YRBA 4CEJA 2ZM5A 4PC7A 3BD9A 5JI2E 3I62A 5J4YA 5EQTA 4M1YA 3I5YA 4PPGA 1HEIA 2Y8EA 3OIUA 5DISB 1TF5A 3SHWA 4LX0A 3PEWA 4KXFB 1T3LA 4TZ6A 2ZYUX 2XOKD 2MSCB 4DKXA 1BH2A 4G0NA 3A4LA 2JIZA 1U99A 2CEAA 4Q1BA 2V3CC 3R8CA 2A30A 1CR4A 1NN0A 1RE0A 3BFVA 3LW8A 1XXHE 1UDXA 4F4IA 2VP9A 5H1YA 1OE0A 1W4AA 4R2HA 5FI1B 3WMGA 4Q01A 4HZIA 3IHWA 1NSTA 1VYUA 1KSJA 1FP7A 2F7SA 4AKIA 1UM8A 1XJCA 4FCVA 5CK5A 5EE1A 2AFHE 4QGHA 3QPVA 3CR8A 1GNPA 1KSGA 2PMDA 3UK6A 3AVVA 2IYQA 4CGZA 4AKHA 1U2RA 3EWAA 1OH6A 1KKLA 5BQ5A 1N6HA 5FTNA 1ZC3A 4MRNA 5FR2A 4TL7A 2ZAOA 2IF0A 1DO2A 1J99A 4PC6A 4EQ6B 4F4JA 5KSYA 1KIMA 1JAHA 2OEPA 3LBHA 1IN8A 4WZ6A 1GIAA 3RC8A 5TB5A 3OEEA 2FH5B 3PXGA 1WBDA 1EGAA 4C0BA 1ZCAA 2J0UB 3KKNA 3QE0A 2XJ4A 4ESHA 3REFA 3OIWA 4TL6A 2OFWA 4FCTA 3RSLA 4IW3B 3CH4B 4QHSA 2D7DA 1NBME 1X1RA 1ZUHA 1ONBA 1S9HA 1P6XA 1AS3A 3U7EB 3QI2A 5BN5A 4PZZA 2D06A 4V0NA 1N6NA 1Q57A 3DOFA 1ZINA 4IJMA 3TBKA 4C0LA 1W46A 3U6BA 2O5VA 4WOPA 3V9PA 1HE8B 1R2QA 1OPXA 3OFND 5CYOA 2ASEA 4Q66C 3MJHA 2J0QA 2R2AA 3RS3A 3UMRA 2WV9A 1WP9A 1U8ZA 3GJ7A 4B3CA 4F92B 3THOA 4XWOA 2QBYB 2WZQA 1CULC 2QMUA 1UBCA 4B34A 2I4IA 4LSGA 2IS2A 4J0QA 2VBCA 2QGZA 4JBWA 1XD8A 1WQ1R 4JLKA 3HU2A 4ABYA 1E2HA 4ZIRA 1RJ9A 1AN0A 3C15C 3L8ZA 4KFRA 2CVFA 2OSBA 3AVPA 4U5XA 4QBFA 5DIFA 1TEXA 2JGNA 4ZDKA 1IM2A 1NIJA 3IIJA 2W6JD 1CIPA 4NH0A 4OYHA 2ODWA 1ZP6A 3CRQA 4URUR 1U98A 1MRSA 1P9WA 1OH5A 2F3RA 1XEFA 4HDQB 1GKIA 5EXPA 1YHNA 4XWAA 3WBJA 4XH9B 2GEDA 1RRCA 1W1WA 8OHMA 1G5TA 1Q12A 3ZVNA 2EU8A 2V55B 3REGA 1X8JA 2F3TA 1R0XA 2VHQA 3B1VA 3LX5A 2A5JA 3OEHA 4NCKA 3WXMA 2ZI3A 2WJJA 4TYNA 4LCBA 4BZXA 3CRW1 1T8TA 1JR3A 2QAJA 4FMCF 2XXAA 1CLUA 4UJ5A 4B6FA 1F48A 3W5IA 1XTJA 3AVUA 3CM0A 2R8RA 3K0AB 1TF7A 4QHTA 5TXGA 4AYTA 4LC0A 3IDQA 2VL7A 1C1YA 2A5DA 1K5GA 2H5EA 3B6EA 1YZNA 4FI3C 2XOKA 4DCNA 3GLGE 1NVUQ 3HP1A 3HYTA 3IBYA 5KUTA 3BAFA 3KUCA 4Q1FA 4C30A 1OB2A 1V43A 3RRYA 2YWFA 4MRPA 3GFOA 4KODA 4Q1CA 4BUJA 2QM8A 3G5UA 1E2KA 4TTQA 2NQ2C 1T91A 2HYIC 4YXWD 3T1TA 3U3OA 2ODEA 3DEFA 3ZVLA 3AGPA 1J8MF 4AURA 3ZVRA 5H8WA 2G0TA 2CLCX 1G8HA 3RS4A 2ONKA 1U0JA 5KSOA 5M04A 1CR1A 2ZRIA 3MFYA 4LI0A 2C9CA 2GZHA 4O25A 1A2KC 4JJKA 4KV9A 3EZ2A 4Q5IA 3QF4A 1A2BA 4HLUC 4X8LA 2ZJYA 2ZITA 2GRJA 2D62A 3T35A 3ZLJA 3Q9LA 5FOUA 3ZZTA 5K8LA 3A4MA 1RRPA 3I73A 1O87A 1R8SA 3FHOA 1G16A 3CWQA 2ZYTX 4GOKA 4Q00A 4KI0A 3EPLA 4NPHA 5F98A 2DCUA 4LJYA 1S1CA 4DT1A 1MO6A 3CRVA 2QA5A 1BOFA 1VIAA 3BORA 5EZ6B 3FFAA 5B58C 1LW7A 3NKVA 1QHNA 5HCIA 3LY5A 3KQHA 1IN7A 3MLEA 4MA4A 2F9LA 3THYB 2W2VA 1DAGA 1I4LD 1OFUX 2JLRA 2QMOA 2WKPA 3L0OA 2WJYA 3Q8XB 2ECKA 4HAYA 1CU1A 1XCMA 4KVGA 3W5JA 1G8PA 3RNLA 1JB1A 2FMXA 2WWWA 2VSXA 3TW8B 5KSPA 1KKMA 1E98A 3EWSA 3WHLA 3OFNA 1IAQA 4W5JA 4DB2A 3W3ZB 1ZBDA 2QPOA 2BCJQ 1NKSA 4C0HA 2EWVA 2QTHA 1AKEA 1P72A 3A6PC 4JLJA 3KJEA 2Q9AA 2ZJAA 2XEXA 4KLNA 5FPTA 1KDPA 2E9SA 1GKUB 2FFAA 2H57A 1QHSA 2KSQA 2ZS7A 4LYJA 1XWIA 4PR0A 1BMFA 2YWHA 1D5CA 4M9QA 1CR2A 1P2UA 2ZETA 3QPWA 2CLSA 1LV7A 1JBKA 1DE0A 3EG5A 3SU8A 4TT3D 2QL6A 2ZEJA 5FBQB 1KMHB 4BECA 5G41A 3H4MA 4W5WA 5IHPA 4HB4A 2IC5A 3VR4A 1DAFA 1SVIA 4TLEA 1TTTA 2VLIA 2IYZA 3TUIC 221PA 5JJKA 5BN4A 2CHGA 3W90A 1G3MA 3BB4A 2QPAA 4HI0E 3EAQA 4S2EA 5HKKD 4PPQA 3SYKA 2D2EA 5KNCA 3CBQA 3X1WA 2REOA 4HAXA 2GXSA 5J40A 4EFMA 2CVHA 2BEJA 5K8TA 4LY6A 2BMEA 2RCNA 1P7CA 2SHKA 3VTKA 4HZUB 2FG5A 3C16C 2QM7A 4UJ3A 1OW3B 2OXRA 2GAAA 2Q21A 4P31A 3I5XA 2CJWB 1XMIA 4P4SB 5SZIA 1E99A 821PA 3CPHA 1IXZA 3GD7A 2FSIA 4MYTA 2R62A 3EPHA 5KDDA 1J8YF 4CVNA 2VHCA 1QG2A 4PHTA 1Z2AA 4PSKA 3KB2A 4IVQA 3RRMA 1T4GA 1C9KA 4K81B 3X1YA 4KJZA 3ZQJA 3D8BA 2YNMA 2YC4C 4TMZA 3SYLA 1D9ZA 4US0R 2OLKA 3AF2A 1OYYA 2JLXA 1Q1BA 4IDPA 2R9VA 4EQ6A 1QVAA 3GP8A 1N6LA 1KK1A 2FZLA 1IY2A 1NLFA 1VPLA 1XP8A 2QU8A 2ORVA 2RGNC 4E22A 1U9IC 5DN6D 1I2DA 2GXAA 2IBMA 2ORIA 5CIWA 1ZM7A 1OXTA 2P65A 3ASZA 3RC3A 2D3WA 5G53C 4AKEA 2GZAA 4LJ7A 5A4JA 1KO5A 2J0UA 3GEEA 3QXJA 1BIFA 2OZEA 3PITA 4QBIA 4DDWA 2ZS8A 4M4SA 3BE4A 3KX2A 1RRGA 1GP2A 4PO9A 3LBIA 1DELA 3SJCA 1KDRA 1F5NA 3UKDA 4B32A 3SNHA 1XD2B 1RPZA 4YMVA 1W48A 2WKQA 4A1FA 2WICA 4HLQB 3OE7D 3CLVA 1E2PA 1E9BA 3P4YA 4MRRA 1XRJA 1M2OB 5P21A 1LB1B 1L7VC 5JJIA 1AM4D 1KJZA 4TQ9A 4AWXA 1Z22A 4LV6A 3UG7A 1F6BA 1IN5A 4QJ5A 1E0AA 3NH9A 1G7RA 1ZM4A 2YVUA 4QG7A 3U2QA 2QBYA 4FMCB 3CX8A 4R7ZA 1KAOA 4KAXA 3K8YA 2R6CA 1EFHA 3RABA 3P32A 3ZIAD 3WNBA 1HYQA 1W5SA 2X2EA 4LDJA 4BFYA 3AF4A 4M9SA 4B3GA 3K0EA 3L0SA 3D7MA 4QGGA 2CCJA 2QT1A 5J4HA 2PT7A 4DHEA 1JXOA 2VTKA 1QHHB 2HV8A 1AA9A 2J9RA 3C14C 2IS4A 3AP2A 1KDTA 2EFGA 3R9XA 1B23P 2HF8A 3C8UA 2FFBA 5J4KA 4I1OA 4HLCA 3ICQB 4OKSA 1WXQA 2RHMA 4TT3A 2IYUA 3N2IA 5TVKA 4WVFA 4DCVA 2DHRA 1WA5A 4C0AC 2WSSD 5FPHA 1HT2E 4BQSA 4RFSA 1GOTA 1IN6A 4UNQA 1PLJA 4TTRA 5DH9A 4WA7A 2WM9B 2X19A 2H92A 2AHOA 1VTKA 1OFTA 1E2IA 1ZC4A 3K0AA 5TY0A 2QAGC 4MGZR 3WYAA 4N3NA 2UZ3A 1E1QA 3KJHA 1HURA 3LH5A 1NP6A 4JJZA 5KTYA 2ZRAA 4TWZA 4KFTA 4TYYA 5JWRA 3I32A 3OIYA 2XZLA 3UWOA 4CEIB 2QN6A 1LVGA 1YZTA 2GCNA 1LY1A 4Y0AA 1VKJA 2O8FB 6Q21A 4C2TA 3GJ6A 1DAHA 3W34A 5CLLA 1JNYA 4HUQB 3GMTA 3MD0A 5JCPA 4RCYA 4HSEA 2G0NA 3LO5A 1HUQA 5J4LA 2XITA 1PV4A 1U0HC 2QRZA 4HAVA 3OESA 2ONJA 2V7QD 2G6BA 1JJVA 5BN3A 4BE7B 4EPYA 2B8TA 3PFIA 5HCNA 1K8RA 2ZJZA 4QRHA 2FSGA 2HXSA 3VR2A 2WMOB 2Q3HA 4C0SA 2GF9A 2ZPTX 2WOJA 1NNEA 1FUUA 1XCPA 4JZKA 1YZUA 3LBNA 2H1LA 4LC1A 1IQPA 1IOZA 1K6MA 5JWHA 2R44A 4GSYA 3IHLA 2ZXUA 2O0JA 3QOFA 1SQ5A 5DN6A 2W6ID 4ZO4A 4V0OA 1XB2A 2GAOA 1ZM3A 5EUQB 1MO5A 5FUYA 3L0PA 5EP2A 1PVOA 5CLQA 2B7BA 1FP6A 4LJ9A 4XVUA 2OUKA 3GJ8A 1GNRA 2C03A 1N0UA 4JLMA 1ZYUA 3S1AB 3DKPA 4ITRC 1YR8A 2F1HA 4DUGA 2REXB 2FPKA 2JJ1A 3CB4A 3CIOA 4G5OA 3DMDA 4BLPA 2EFDB 3UPUA 1ZU5A 2ANBA 3THYA 2GJSA 3HU1A 4D0NA 3QKSB 5JEEA 4YDSA 1IXRC 4BLRA 2O8EB 4YQFA 1Z0DA 1E69A 5TARA 1I2MA 2CE7A 4CRWB 4DWJA 1ZNYA 1SHZA 4OK6A 3PENA 4NDZA 1KI8A 2DWOA 2I1VB 1T5IA 2AFIE 5FOSA 1G7TA 1SXJE 1P2VA 4L8GA 3B9QA 2ZE6A 4IFBA 1FQKA 4TYPA 2YHSA 3FMIA 1NY5A 2JJ2D 3ZJYA 4AK9A 5L3SB 1RW4A 2JLZA 4BFTA 4IDOA 2HDNB 3E70C 1M34E 2JLQA 4EJSB 2AKYA 1G4UR 2WKRA 2IWRA 1NY6A 3BS4A 1UADA 3EW9A 2B92A 2PJZA 3ZIAA 4DEXA 4D26A 1XPUA 2DB3A 1FW6A 4WZBE 3FKSA 1SULA 1E9CA 3LFUA 3WY9A 4AKGA 3ADBA 1JEEA 3SFZA 2LKDA 3OZXA 1S8FA 1G7CA 3CF6R 2NMVA 3BERA 2ZRPA 4KVAA 1KMHA 4Q4HA 5EE9A 5FTMA 4DZZA 2XAUA 5AUQA 3NIBA 4JVNA 4KHZA 3RS0A 4RZ2A 1ETUA 2W58A 3GJXC 4E07A 5CK4A 3RSOA 1II9A 5CM8B 3U4QB 3AV0B 1R5BA 2BIFA 2ZI6A 2JJ8A 2P6RA 2C04A 4G1UC 4MYCA 4C3ZA 3FB4A 3C7KA 2WSSA 5FBLB 2ZSEA 3AVOA 3CUEF 3TH5A 3K53A 2ZI9A 3X2SA 3K0CC 5KSZA 2VQSA 4BGDA 4BFUA 4MRVA 4JVLA 3AF0A 1S4QA 4LHYA 1BKDR 1JECA 3QXCA 4HZUA 2W00A 2CCGA 2OFOA 3P1JA 4NE2A 3SE0A 1VECA 1CJUC 721PA 1XD9A 4IOJA 1BO6A 3GQBA 2R6GA 2QENA 2G83A 5CDFE 2ZRMA 4Q9LA 4N0DA 3W6NA 1NSFA 4RD3A 4XJXA 2ZAMA 2WOOA 5FL7A 2WJGA 2ZJ2A 5CB6A 3OHMA 2JA1A 1TQ6A 3QVUA 4FMBB 3KQKA 2P5TB 2RMKA 4H9GA 2JLYA 3ECCA 1G6OA 4IOMA 4JL6A 1Q3TA 4CIDA 3N2EA 3T06B 1T3HA 3QEJA 2E1RA 3EZ6A 1S3GA 3QQ5A 3QKUA 4B73A 2KWIA 3H2YA 3Q7QA 5DI3B 3GLHE 3L8YA 3PCRB 1AQYA 3QXSA 1IJEA 2VP6A 1ZNWA 4HAWA 1KI9A 2GCOA 2HEIA 2RGGA 1OIVA 2UKDA 1MT0A 1DAKA 4OQNA 1NIPA 4PPNA 4E03A 3G82C 1EXMA 2GK7A 1SVLA 2VSOA 421PA 2YWGA 1OXSC 1E6CA 1VCIA 1ZIPA 4RD6A 2GK6A 1GL6A 1OF1A 3BWDD 4Z51A 3LLMA 1KOFA 4CDGA 4MKGA 2VH5R 1JXMA 3P4XA 2AWOA 1OH8A 3KL4A 4XD7A 2WVJA 2C98A 4ERNA 3BH0A 1E1RD 3A1UA 4TLAA 5E7IA 1S9DA 4C2UA 1TQ4A 4LJAA 5K8IA 3MGCA 1J2JA 1YE8A 1ZUIA 2PX3A 1G20E 4OJKA 3OIVA 1K5DA 1IONA 1E2NA 5JZVA 2HLDA 3GLFB 2JLVA 1HQCA 1Z3IX 5C18A 4I99A 2FF7A 4DLSA 3GEIA 4TMXA 4X8HA 4D0GA 2G3YA 4D4KA 3CRMA 3V4FA 2O0KA 1SKYB 1C4OA 1I4TD 2R6AA 3DZDA 4JVMA 4RFVA 3R9WA 1W4BA 3TR0A 3T1VA 1QHHA 1KI7A 1WBBA 4DIDA 1UKYA 3VKWA 4DDVA 5L3VA 2GA8A 4IHQA 4V0ME 2QZ4A 3U7GA 1SGWA 2P2LA 2WSMA 2XNDD 3H84A 3PEUA 4OQFA 2BDTA 3AQ4A 4PO1A 5E7JA 1YVDA 5FTJA 2W2XA 4WW0A 1T0HB 3KXIA 5CITA 1N5IA 2IYXA 1G3IA 3WP0A 2IF2A 2LKCA 4HAUA 4PANA 2OCAA 1UBGA 3T12A 1VCOA 1BS1A 2R6FA 5KNDA 4B48A 1OV4A 1R8QA 4MITA 1JPNA 3QBTA 4S35A 5CM9C 3VR3A 1TMKA 4QJ3A 1HA3A 5FL3A 4CT5A 3G0HA 3P27A 1D2NA 1JJ7A 1CF4A 4DXAA 3ND8A 3M1IA 2V6JA 4HB0A 5LB2A 3WBKA 4NHOA 3FHTA 5EP3A 3ZS9A 4AYWA 4QGAA 5FOXA 2WWGA 1XEWX 4YC7A 3TUJC 1Z63A 4CEIA 1E2MA 2QSZA 5IF9A 1TEVA 2RB4A 4DIEA 2O8FA 1CBUA 4HB3A 3DZ8A 4TMWA 1A1VA 1Z47A 3VMFA 4HUQA 1XEXB 5KDLA 4HAZA 1YKSA 1OFIA 3UATA 2B8WA 5F3WB 1UJ2A 2ZRHA 5ANRB 1WMSA 5HE8A 2GBLC 3QSYA 1R4AA 2IXGA 4M1OA 2VA8A 4LPKA 4LBYA 3MMPA 1NVVQ 2IEZA 4RVCA 1OLOA 4LWZA 4POAA 2GXUA 1KMQA 2EW1A 2JLUA 1W36B 2WWIA 2WMNB 3FWYA 2WIBA 3OAAD 5SZJA 1COWD 1YR9A 4M0LA 4TSFD 1TF2A 3NTUA 2VF7A 3OF5A 5EE0A 4A0RA 4NP6A 1EFUA 4NCIA 5AJXA 4ARZB 4Q1DA 1OIWA 4W9MC 4PAQA 1A82A 2OBMA 2CL6X 4QXAA 2MSDB 3KQLA 1XMJA 1IY0A 4D6PA 1F3OA 1UKEA 3KKOA 4Q9HA 4IXNA 4AG5A 1XNJA 4ZKEA 2QP3A 3S1AA 3SR0A 4CZ2A 4DLVA 1VDZA 4US2R 2RHDA 5FBVB 2PZGA 2GJ9A 4EDHA 5TDHA 3L82B 1JQJC 5G3ZA 4XSHA 2ZUDA 3SC3A 3NEYA 3R9IA 4F7WA 3WMFA 1UEIA 2EYQA 4TQAA 1R5OA 1E9SA 2A5YB 5JSZB 4BPBA 4ZDIA 2RGNA 1ZM2A 2UZIR 1U9IA 5L3SA 4DLYA 1U90A 1GNQA 4KBGA 2YWEA 2KBFA 3A37A 5IK2D 4XWKA 2FE4A 1MH1A 3EZFA 2GJAA 1TU3A 3PUVA 2G88A 3CPJB 4JYCA 2KE5A 2BEKA 3EX7C 1Z0KA 3KTAB 4D4JA 5F9FA 3NBXX 1AK2A 3VKHA 1VCNA 1WE2A 3VHLB 2G1KA 4DRZA 1S1MA 4N0EA 3NXSA 2IS1A 2HF9A 1PUIA 2C77A 2P6UA 2ERXA 4F38A 3KFXA 2AXPA 4BFVA 3B1WA 2V1XA 4JT2A 1XZQA 2IYRA 3NDBB 1FZQA 3U44A 1A7JA 2HT6A 3FMPB 3C4JA 5D3MB 2WAXA 3RRNA 3GLIB 2ZJBA 3LQQA 4Q7MB 4Z8YA 1LS6A 4FMDF 1RKBA 2PBRA 1E96A 3U4QA 2CNWD 4MYHA 2DYKA 5E95A 2J87A 4X8MA 2ZYVX 2XGJA 1II8B 3SJBA 3B2EA 2WIAA 3TVDA 1NVVR 2C8VA 1L8QA 2ANCA 3WP1B 4BLSA 2C9OA 3BXZA 4JL8A 4DSUA 2J7PD 2Q3FA 5KPJA 1G5RA 3CPEA 3B7GA 1ZVQA 4JT4A 4QBGB 4EUNA 3AKCA 2A5GA 1HV8A 2O8CB 2EQBA 3VNUA 2D4HA 1B0UA 1RYFA 2JEOA 2VO1A 1SVWA 3ZVMA 4PO8A 1KSFX 1UF9A 4XTRA 5SZHB 5DYGA 1E0KA 4ESVA 4QM6A 1CKEA 1HT1E 1P4SA 2Q0HA 3NC1C 4Q4JB 1GSIA 4QL3A 5AR1A 5EUMA 5C4GB 1DBSA 2QGNA 5B57C 1UBEA 2OHFA 2F55A 2OM2A 4LYFA 1X6VA 1V5WA 2IUSA 4A15A 2PMKA 3QG5A 4KO8A 2IUUA 1Z5ZA 5AUNB 1W36D 3SYNA 1UPTA 3C5CA 3RS7A 1OKKD 2C2HA 1IHUA 1GITA 4Q02A 2QAGA 1FOEB 3MG9A 2VHUA 1N3BA 3H1TA 3LV8A 4QKQA 4YDHB 4Q4AB 2GEVA 4RZXA 4UNSA 4B44A 3DM5A 4PC3A 2GF0A 4GRAA 1G8GA 1JQLB 1YJ5A 4WAUA 1P62B 2Q9BA 2Z4RA 3F5FA 5L3RA 4KFUA 3CF2A 4UXJA 2P3SA 2GVDC 3B82A 2OV2A 2IEYA 2QP4A 4P3YA 1JR3E 2X1VA 2XNSA 2V1UA 2ZUBA 3VKGA 3GPLA 3PV0A 2GNOA 4OK3A 2QE7D 2WWXA 3Q7PA 1OXXK 3U3RA 3R7WB 4G01B 4QOSA 3FE2A 3GJ4A 1UKVY 5FUWA 4C7OA 5DSZA 4JSYA 2W6JA 5D3QA 1SVKA 2JCSA 2F43B 1EX6A 1NG1A 3PEYA 1E2JA 3KUDA 4LYAA 3AVTA 2PZEA 3GLFA 1NLYA 4NMMA 3AUYA 1GTVA 1XU4A 1P2TA 3AVYA 3Q3JB 3O8BA 4NYIR 4JBXA 1Q1QA 2NG1A 1DTSA 2IYYA 4XOIA 1P9RA 4B33A 4JLVA 1H8ED 4BFXA 4A8JB 2H8KA 4IVRA 2ZE7A 5A0FA 1OIXA 2ZSAA 3DPUA 1GM5A 1O3YA 1JEDA 2QMHA 2IS6A 5AJVB 5KO2A 3ZZ0A 4U02A 3QKTA 2X77A 1JR6A 1QG4A 2BC9A 4U00A 4Q47A 3SBEA 3B1XA 1X8KA 4OI4A 3HR7A 3JZMA 2EFHB 3QPUA 1DARA 3ZYCA 3BRWD 1PZNA 4KYIB 2A78A 3CNLA 1SVMA 3VAAA 2GJ8A 4BFSA 5DGXA 3UXMA 2CNWA 4YXWA 1W2GA 4DLXA 3DHWC 2DWQA 4GP6A 2WTUA 1ZU4A 4DJTA 1E3MA 1XXHB 4Z54A 1ZMXA 1NJFA 2NO6A 1IXSB 1AKYA 2K5UA 2QT0A 4LBWA 4QM7A 2XTNA 2DWPA 4CYMA 4Q9KA 5TMPA 4PFSA 3I8SA 4EJSC 1E9EA 2L0XA 2GEUA 5EXSA 1KSHA 1XEXA 4TYQA 3ZZUA 1ODFA 4I1SA 2O8BB 3PG5A 1T8UA 2IX3A 3I61A 3WNDA 2LWIA 5K8UA 3QG1A 4O0MA 2F9MA 3CW2A 1KY3A 3UMFA 2DFLA 4IEIA 2B6HA 1GUAA 1VG1A 2WBLC 2A9KA 3IUYA 3U3JA 3T15A 3K0CA 1F2UB 3NBZC 3NC0C 4K46A 4RD0A 5FUXA 3H86A 2WWFA 4MGKR 3LA6A 3IIKA 5FUVA 4PC2A 3W8RA 2FDCA 3AM1A 2C96A 1ZCBA 5KU1A 2J46A 2XX3A 4P0TA 4ARZA 1PJRA 2CDNA 2NOAA 5JMTA 1N5KA 1TL7C 5JCZA 3MCAA 3IEVA 1KJWA 1SHKA 2F6RA 3A4NA 3IO5A 2X8AA 2X2FA 4ZCLA 3DOEA 2FJUA 1G1MA 1QHXA 2XJ9A 4ZI3A 2Z43A 4IVPA 2XSZD 4ACBA 2C5LA 5BYJA 4HUTA 3QKRB 1E79D 2ZTSA 5A5GA 3NHAA 4BEJA 2FPMA 1P60A 4IRUB 1VG9B 2C9YA 4Q7KA 4FWIB 4TMTA 3AGQA 4LHVA 1Z0IA 5FPSA 2F1RA 2QE7A 2HJGA 2FWRA 2QPTA 3Q5DA 3THXB 2ODNA 4FMDB 4QNRA 1G19A 1R7RA 4OQLA 2I1QA 2IXEA 2FGJA 2IW3A 3A1VA 5F2EA 3Q5EA 1ZD8A 3TIFA 4Z8XA 3TSZA 1HTWA 3IILA 1KI4A 1Q1ZA 1T5LA 1Z07A 3K0FB 3ONWA 5AJZA 3FTQA 1N6RA 4PAOA 4URXR 4URZR 4M9XA 5GJWC 4XIGS 4LHZA 1QZXA 5AWFC 4HLDA 3U3KA 1DO0A 4NKRA 4KYUA 3FGNA 5HKKA 1FMJA 1S0UA 1KI1A 2AXNA 1TU4A 3LXXA 3RWMB 1TUIA 4ZKDA 4YMUA 3HR8A 3NWJA 3C41J 5B30A 5ELXA 4UNPA 5AJWA 2P6NA 3ZGXA 1P73A 5AK0A 2ZSDA 4HDCA 5GJCA 3GLIA 4LK2A 5L3QB 4MQBA 4UNNA 3GJ0A 4MKIA 1U8YA 4LUCA 1JI0A 3LNCA 2AN9A 2QROA 2QTFA 3THWB 1VYVA 3DM9B 1II8A 2RGCA 4KITB 2OG2A 1N6IA 3CO5A 4Q4LA 5BXQC 3GLGB 5GJBA 3ICEA 4GBMA 4LV5B 1E2EA 1KHTA 2OE2A 1KNQA 5CJ2A 2O8CA 5LBIA 1P61B 1ZUNB 2N1BA 3B13B 4V03A 1VG0B 2JATA 4LBVA 2BBSA 2IYWA 1UAAA 3TKLA 4O3MA 2WJHA 3IGFA 3IO3A 2AWNA 3PR1A 3BJIC 2J45A 1W49A 5BWMA 2AD1A 3PUXA 2MMCA 1AJEA 4Q18A 2HUPA 5BYKA 1OFHA 1MRNA 4Q4JA 3SEAA 2IA5A 4GFDA 4JL5A 3UANA 5JRJA 3IQXA 2FU5C 3AKYA 1G6HA 1QF9A 1OXVA 3I72A 4JBYA 1E9AA 3AF1A 2ZI4A 4ZDWA 4M1WA 4URVR 1FPMA 4US1R 2WHXA 1GFIA 5CIQA 1IY1A 1TQ2A 3K70B 1ZM9A 1H8HD 2O52A 1DVRA 2FEOA 2FZ4A 3RS2A 5J4VA 4A36A 4ON9A 3TAHA 3CH5A 3OE7A 4Q4AA 1TADA 1X8LA 4A82A 1E94E 4P4UA 1EWRA 1NBMD 2KBEA 1F2TB 2CHVA 2C78A 3NDPA 1WCV1 3R20A 4DEYA 5IRCD 1RVDA 121PA 4B43A 3ND9A 1XMSA 4IEEA 3IQWA 3KKPA 1U0LA 1P2SA 3F8TA 1RJ9B 1M6NA 1NRJB 4PX9A 1Z8FA 5IT5A 2QQEA 4NYMQ 3IIMA 1U81A 2LCFA 1T0JB 2FFHA 1EWQA 1CJTC 1P3JA 1LS1A 3K9HA 1KAGA 2GDJA 3UIEA 2GBLA 1MO3A 4L16A 3E5HA 4EPVA 3AVXA 1ESNA 2JLWA 1XTSA 3X1DA 3FYHA 2IYLD 1AGPA 1DAIA 1G7SA 1AS0A 3EC2A 4BFZA 1ZRHA 2NIPA 5FOWA 1G21E 1G8FA 4JIMA 3MRSA 3TJZA 1II0A 4QGFA 3EARA 1F60A 4NTZA 4RD1A 2A2ZA 2GKSA 3NEJA 2WAYA 5FOTA 3IEUA 1R0YA 3LRPA 4OQMA 5C46F 3MJRA 5KNBA 3T34A 4GZLA 2FSFA 3SI7A 4D80A 4G5RA 2V54A 4B3DA 4A2QA 1IN4A 2WJIA 2A3RA 1XFAA 4IDQA 4TLBA 1YU9A 1OT3A 2GVZC 5EXTA 4D4LA 1GVNB 1W36C 1TUEA 3NVAA 2ZANA 1E0SA 1W4RA 4PQYA 3L2OB 1N5JA 3W3AA 3I4LA 2Q9CA 1NL3A 4RZUA 2RGDA 2P67A 2MMGA 3TE6A 5C4MA 1NVWQ 4M21A 4Z1MD 2CXXA 5HR5A 3AB3A 3VR1A 4DLUA 1N25A 4QFMA 2CJWA 4FD2A 1CJVC 4P4SA 3I8XA 3CZPA 4UQOA 1E4VA 2ZUCA 1NN1A 1TNDA 2ZS9A 4HEJA 2BMDA 1OH7A 2FN4A 3NBFA 1BYIA 1AZSC 4RD2A 1G3UA 4V0LA 3CX6A 4Y0VA 2IUTA 2AD5A 4H1UA 3ZQ6A 3PQCA 1KDOA 2NPFA 2PX0A 1W4CA 3QF4B 3SOPA 4HDOB 4A2WA 1KI2A 2ZRNA 1KTVA 1Q44A 2OT3B 1SZPA 5FBRB 2ZR9A 3U6KA 2V7QA 1FTNA 1XXHA 1NLZA 2ZRDA 4RZ3A 3KKMA 3RLFA 4ILEA 4M1TA 4DDUA
chains in the Genus database with same CATH superfamily
1XVIA 1TAQA 2I80A 4UEOA 1QOQB 4DQXA 3UJ3X 4F4UA 4NL4H 4BQPA 1L4HA 2WP8J 4NYJR 3DR3A 1QBKC 5LYJF 2WSYB 3NIWA 4UUMA 3FYTA 1YZ3A 3PXUA 1U2SA 5DEOA 1V8FA 1IL0A 3VX4A 1K2VN 1JFSA 3DZFA 1TB4A 4N0PA 4KSBA 4OUKX 4II2A 2GR9A 3OZGA 1VPDA 1HETA 4YLEA 3CH6A 3GNQA 1EVQA 1N9ZA 3PQ8A 4YPOA 1FFHA 2RKBA 4B3JA 1H2BA 3O8NA 1BDBA 3K70D 3LCMA 4X8OA 1N3LA 1CJKC 2VLBA 2WHRA 4OLAA 1XD2A 5IYZB 3S2GA 5JAUA 2Q9UA 1E4YA 1FY2A 3RUEA 4OAQA 4JLNA 2BMFA 2VP4A 5TMBA 3UC9A 1QHFA 2AYXA 1UBJS 3AH8A 1DLJA 1GRRA 4KBFA 4I6EA 1AUOA 1FA9A 3FUUA 4G0OA 1GV1A 1L9KA 4H1WA 1E20A 2D4AA 5EE5B 2B9EA 4O4IB 1EG2A 3IUBA 4OL0A 1AIPA 2C1ZA 2BEVA 4MUAA 1JIQA 1KY5A 3F2VA 5BUQA 3WK9A 4YJ3A 4BC0A 4NZNA 2ZRBA 3NDRA 1NBMA 2FWNA 2O07A 4HXYA 3WLJA 2IZOA 1VHTA 3VU9B 3ESXA 5KYUA 5JUWA 1JQEA 1GCUA 1AF7A 4F4FA 4RDHA 1W96A 1GCAA 3MLBA 3QELA 1W47A 3RVKA 4WECA 2JLAA 4GYWA 3A9RA 3WX0A 4FWTA 3LQFA 3BC1A 4Q9AA 5TGDA 4D97A 2WWYA 1UEJA 2HPVA 1J90A 2A9RA 1Z6PA 3RIMA 3I64A 3S5JA 3U60B 4LFAB 2IX9A 3F3MA 4GG1A 1PGQA 4OM7A 4YBRA 2WTBA 3QOWA 2X14A 5AXAA 3VR6A 4UM8B 1XTKA 4OQZA 4DXHA 5E9JA 2PLWA 1E9FA 1Y4AE 2Z6VA 2H4YA 5E3IA 3R5KA 2D6FA 1JZQA 5KVCA 1JN0A 3MWJA 3E81A 2PD6A 4MDYA 4KSCA 3UBTA 3M6WA 4W4TA 3C48A 3IR5A 3VBCA 4D5GA 1EUCA 5AJTA 2H1WA 3K0FA 3PTZA 2VP2A 4IQ4A 3KT0A 3HXMA 1JBEA 1K66A 3PVZA 1GR1A 4N9WA 4GOLD 2CFTA 4OHVA 1JHPA 2EVWX 2M32A 4YRNA 2VNIA 3LVRE 4BRSA 3N0XA 4HVLA 4JGGA 1NONA 4C0JA 3G0GA 1Z28A 2V6IA 3VNSA 5IXJA 2KPOA 1EDZA 1I24A 1QF7A 2O6HA 2ZJOA 3HY4A 4MDFA 2YVQA 3SDSA 1PZHA 1U4NA 3ETCA 1DIOB 2JVKA 3HVUA 1D8TA 2ECFA 3EDRA 1YJQA 3ZGOA 2PKEA 1FFDA 4LXXA 1XNQB 1FLVA 2OQVA 3J7AC 3H83A 3DVQX 4BN0A 5FB3A 4LQLA 1HE4A 3KG2A 5ITZA 3BH7A 4MV6A 3EXIA 2YFYA 2FW9A 3O8OA 2O54A 4NU6A 4P4UA 4AJIA 4RETA 2EFEB 4QPCA 5ER6A 2GEBA 3O4VA 2L69A 4AZ3A 4UDOA 2VJOA 1CR6A 3USZA 1FJXA 1AQLA 2SCUA 4I66A 5KJFA 2W0SA 3IB6A 4J0GA 4NJMA 3LWNA 1MOZA 5ENDA 2IBTA 1XTPA 1QBGA 1P80A 1A72A 1Q7EA 1XMVA 2Q4RA 4YQYA 2XUAA 2XCSB 1GTG1 2ZR7A 4ZVOA 2N42A 1OAOA 3SQWA 1G9SA 1FFSA 2B4QA 4FIDA 3I3SR 4YJGA 2YJNA 4DIMA 1ZUNA 2R5NA 3MLAA 3SJ7A 1YWGO 1I30A 1RLMA 3WV5A 2NTJA 4MDEA 2NP7A 3BMNA 4J6EA 1OT5A 1QKKA 2PGJA 4WWHA 1DKOA 3WISA 5LR6A 1XRPA 1J9ZA 2G70A 3F96A 3HV0A 5TV2A 5F77A 3D4LA 1LUAA 4L51A 3JYOA 2ZIAA 1SR8A 1P0CA 4DB4A 4POOA 4Z9AA 2VP0A 1FS4A 1ZL2A 1DOAA 2Y1EA 4XUEA 4KLZA 5BSGA 1E2GA 1PE0A 4HX2A 5L51A 3Q9UA 1MW9X 3JQBA 4EJMA 2AL7A 1KO4A 2P75A 3DKVA 4B8ZA 4N1AA 1U8AA 3G3EA 4M37A 1HE1C 4I1UA 4I8IA 1G9XA 4ENRA 1GNLA 4IOLA 4D56A 3EDQA 1RABA 1RMYA 3FLMA 4ZQGA 3RRZA 3RIEA 4W7HA 2D7JA 2ZE5A 2O8EA 1H69A 5GM2A 3T7RA 2G77B 4WBNB 2QI9C 5K8LA 3GJ5A 5GADl 2V4ZA 3AUKA 1QK4A 1F7UA 1FDUA 4O2BB 2ST1A 1I4DD 1DCKA 1MR3F 4O5AA 1QJ4A 1R9JA 2F3UA 2CSUA 2UYQA 2B36A 3IT2A 2C5SA 2XTMA 2NNLD 2PKXA 2P4EA 4XCVA 3INYA 1BMFD 4PLFA 4EJSA 2O9JA 2WUVA 3OE4A 1ELOA 4XRRA 4X64B 2WSLA 5ELLA 1LBHA 2HAEA 3D7NA 5JS8A 2CMHA 1R3DA 3GAFA 3R5SA 3O38A 2XB2A 1X9GA 5DHUA 4HFRA 3RVDA 4E88A 3R9XB 1LBTA 3D1VA 3UNXA 4OAOA 3KLBA 4P38A 4BP3A 4LYEA 3AVWA 1JAZA 2IU0A 3R6WA 5T64A 3QBVA 3JV7A 1KI6B 3GDWA 1U0GA 3L6RA 2QVYX 1RP7A 5JY6A 1C3LA 1RIFA 1TK3A 4JMPA 4KBYA 4LJRA 2AGVA 2YXNA 4YJ2A 2HYDA 3NG1A 4RFSB 5EKTA 1EDEA 1T5BA 4YV1A 1E62A 3OZSA 4KGVA 2IRWA 3IBGA 2JK1A 3AR8A 3E53A 4EMUA 1AMUA 2YDXA 2GM3A 4EABA 3IPAA 1YF3A 2ZVPX 4Y2GA 5H16A 4ARSA 4EMBA 4RTNA 4L5BA 4UOQA 5FFMA 2OHIA 4WZBB 3DMRA 4YXFA 1TZ2A 4PZLA 3QEKA 4NYIQ 5ALFA 2A5LA 5LDDC 4WK6A 3WB0A 1K7SN 2OQRA 2R47A 4HEHA 1KO1A 1LJUA 1Z73A 3PYMA 5J47A 2XYPA 3OBIA 1WXDA 5AKIA 5EZSA 1CP2A 3JQAD 4XX0B 3FZNA 3HVKA 3PDIA 1IPFA 2GS9A 4IKEA 4DR1B 1GLGA 1ZN9A 3N7AA 1TZBA 4W6QA 3DDOA 3OZDA 1B26A 1Q7RA 2PL3A 3K0HA 5EG5A 1LF5A 1NF2A 4N5DA 4KL8S 4CT4B 5I48A 3BL8A 1QJCA 2VBGA 4JP1A 4K7JA 3LYAA 1M6VA 4NU0A 2XUPA 1ZGHA 3ZDZB 1O57A 3FZGA 1L6RA 4DC1A 4PLCA 2G28A 3R3JA 4YLGA 3JASA 3DAYA 2NO7A 1TO2E 4L4XA 2P0EA 3HDTA 1FFAA 2AKEA 4PYOA 4MULA 1AQUA 1V16A 3GFTA 2Y99A 3C1TA 3U0BA 4BX9A 4ZCIA 4UMDA 3FPAA 1A9SA 2OBFA 5JLJA 3SVZA 4RHCA 1K98A 4LG1A 3WNVA 1MKYA 1JMKC 3K9FC 2O0MA 4AD8A 1EFVA 2CV2A 2SBTA 4BNDB 3DVAB 2J41A 1Z18A 2I9PA 4KLAA 5DI3A 5E7MA 1JG4A 3ZWCA 4AXXA 1ZD5A 3LAWA 5A3JA 3DMTC 1VHLA 3P9RA 4IIJB 4ZQCB 1QIMA 5DM2A 1L2TA 2P8JA 2PUBA 2QV0A 2E4VA 3OCYA 2LDBA 1VL1A 5CX4A 2NSHA 2Q5EA 5H70A 2YXEA 4JNCA 4I7EA 3MQ4A 2E3JA 1ZDMA 3HL4A 4KE9A 5LBTA 3T5GA 1T8RA 4JXZA 1OYWA 2IODA 1H65A 2CLOB 2PKQO 3L0ZA 1CRZA 4MR8A 4XLTA 2JIMA 4GQBA 1D6JA 5AVQA 4NXMB 1R50A 521PA 2XHZA 4IJ5A 1ZONA 3NTLA 2ECPA 1FYXA 2BFDB 5A5FA 3LBAA 3FOZA 3ESQA 3SKVA 2AC2A 1BQEA 2VN8A 1G3RA 1P75A 3M2PA 4K86A 1N5RA 4GPZA 1IWOA 1G63A 2PWZA 3QPBA 4PWZA 3TK1A 4K6KA 3DQPA 4OATA 3TSOA 1KE1A 3JWHA 4R51A 4Y2HA 1LFDB 1E2QA 3ROFA 4BIMA 1XR3A 4MLPA 3I6BA 3MB5A 3CRRA 1UDRA 3TQCA 4CDRA 4I55F 2G36A 1BE8A 4KXYA 2BTEA 1R3UA 3K9BA 3SIWA 3LD9A 2J3IA 3TLGA 2YN0A 3DO8A 1SXJD 1E66A 1XZJA 4ZAWA 3W06A 3QP9A 3UUWA 3NRJA 1OWNA 3OWXA 2ZSUA 2C99A 3QNUA 4DLAA 2TECE 1MQ9A 3KUUA 4N5IX 1K0FA 2HGZA 3LGXA 4AZ0A 4B71A 4P32A 3HBJA 4F46A 5EQJB 2PCJA 5A4AA 1PLKA 4K6OA 4ABTA 2GZ2A 5SYNA 4AROA 1BGWA 5FHRA 1P0QA 1C8VB 1JHQA 2JAPA 2QN1A 3HJRA 3WWPA 5ICCA 2M2IA 4UEJA 5WRFA 4WH0A 2VOJA 2A59A 3B8HA 5K8JB 3KJGA 3HP4A 1W5TA 1R1DA 3SFVA 2GGSA 3PF9A 3KFVA 1AUXA 1AZTA 1UOOA 1OYOA 1VG8A 3E9RA 4NQZA 4TSKA 1GQ2A 3VR0A 2Z8YA 3BE8A 1EB8A 4LOAA 4B84A 4IIFA 2HU8A 4N7JA 3HHPA 4OHWA 3CF4G 4D82A 4WN3A 4G97A 1SK9A 1UPAA 3BD8A 4BLOA 4MRSA 1CSEE 5G4KB 3K70C 3IOEA 4BX0A 1BQ4A 3CF4A 3ZDDA 2QN7A 4K8OA 1T0UA 2IHTA 3QLVA 2AZTA 3AR6A 3F67A 4OLFA 4GR4A 4TN1A 3SS8A 4BJ5A 4CQMD 3T5BA 3KWMA 2PYDA 3Q72A 3JARA 5ALWA 4ZT6A 2V7BA 4I4LA 1SQSA 3CF0A 3JWIA 4NC9A 1F8XA 3CNBA 3H2IA 4XUCA 1UMBB 4DQKA 4MPDA 4O63O 1YZQA 2FPXA 2BGJA 3OZTA 3VH2A 3G59A 3I1FA 2AK3A 2O2EA 4RD4A 3JQAA 4R8LA 4QLOA 1JFTA 3DZHA 3SR3A 4XKJA 2D0DA 3DJFA 1ZQ9A 4MRMB 5TQ0B 4EMTA 3AR5A 3NAQA 3VR2D 2G4LA 4YDRA 2O19A 4RJKA 1XNRB 2GF2A 2YOFA 2QE6A 2QTLA 3EXG2 1VPWA 1DHRA 2AX4A 2HMVA 1TQDA 3I39X 2ZJ5A 3G8AA 4G0PA 3HRKA 1OGJA 4IKPA 1WUHS 1YUMA 3JRXA 4MW0A 1KQGA 1PS0A 3QU2A 3QV1A 4BLUA 4F2WA 2PSSA 2H2GA 2QT9A 3AEZA 1X7HA 2O8NA 3DOCA 4QASA 1PJ8A 2ZU0C 1Y1SA 1VMAA 2PWYA 3HE3A 3L93A 4PX2A 5CJJA 1GUYA 1L1RA 1XU7A 3FUTA 4IP0A 3TLZA 4JODA 1OLSB 4PSVA 3ZWXA 5HHTA 2FPGA 2GCOB 1IOWA 1O6BA 3M4XA 4EB8A 4JQOA 3T8YA 3RVLA 3TGPA 1LX6A 1DEOA 2AJDA 2D1TA 1MTOA 1NMYA 4B3FX 1MB2A 2WWHA 3IKLA 1KK0A 1IJFA 3R3WA 4M86A 4DUGD 5BSHA 2QRHA 3E1SA 2EZ9A 2QIPA 2VF8A 1R0ZA 3A1TA 3FFBA 5IDWA 1AKRA 3ETDA 3GLFE 5U9CA 1LJ8A 4BTVA 1HFKA 1NVXQ 3GRPA 1ECFA 1QAMA 4G0WA 1J33A 2PZFA 4Q21A 1J9EA 5A7HA 5LP6C 5DGHA 1O0SA 3KT8A 2K2QB 2ODQA 5BSRA 2VJDA 3AERB 4E33A 1GZSA 2NZ8A 3VHQA 4ZCMA 4KGXA 4EY5A 3WWOA 1QFJA 3BE5A 2BZGA 3I09A 3H9BA 4AO6A 3WIOA 1VA4A 2C2MA 5K1ZA 1N7IA 3SOZA 3DXFA 3GRRA 1O9BA 4Y2UA 3WJ1A 1DADA 3MWDB 5IYZF 3M6IA 1ZAKA 1ZN7A 1PU2A 2PZKA 4ZDJA 4RX1A 4CEJB 2IHYA 2H9AA 3DUFA 5BMVF 5JSZA 2ORWA 4DV6B 3AP1A 1BDJA 2D1FA 3WYNA 5LU8A 3UJ6A 3LY9A 5BY2A 4BQNA 4CLRB 4D8WA 4RZIA 2KJQA 2H11A 3GEGA 3VDRA 2RHWA 3NORA 5CB4F 1NATA 4RA6A 4W5HA 4XPZA 4B7AA 4GMDA 4JELA 4KFCA 1OREA 2C2KA 3D6MA 2CNNA 2PYZA 2C2YA 3P94A 4NI5A 3HO8A 4XR4A 3KELA 3KTAA 5MF6A 1GAJA 1NXPA 1ECGA 1Y4DE 4U2BA 1T9HA 2IL1A 3SJUA 1SC4A 1NMZA 3ORHA 4HP8A 1SXJA 4OGGA 1ZMTA 3BKWA 3RT1A 3MAJA 5DTIA 4L07A 1QVVA 1KE2A 3RFFA 3TFQA 2BGNA 1YQEA 4B4WA 1QMPA 3BOSA 3OM1A 4YMGA 2VZ8A 3CE9A 1HI9A 3E0XA 2N46A 2Q5FA 4B8WA 1NBHA 4LXUA 4E5SA 2MSKA 5LL6P 1FX0A 2B3TA 3BB3A 4BJHB 3QWIA 4B2YA 3V2GA 2R6HA 3EJ6A 4G81A 4U63A 1DB3A 2J59A 2DTDA 4HQ0A 4N65A 2OD2A 4TKUA 4UQPA 5D3MA 4AYXA 1BA2A 2HB6A 7ADHA 4H1VA 1XLVA 5JSHA 4JLOA 3WIDA 4GEKA 4TKZA 1Q0SA 5LOVF 3MWYW 1ZVMA 3HB1A 3HDJA 3C7DB 4PYRA 1H6CA 3ZV3A 4S2UA 3BRWA 4YJHA 3DZJA 1UWCA 5HYVA 3MD9A 3I01A 4KJXA 2I62A 1F17A 4BRUA 2EWWA 1Y37A 3JYHA 4RQTA 3G2OA 2X9VA 4EY6A 2EG9A 1HZZC 1MX9A 5FLXA 1J56A 1D6SA 2PS3A 4H77A 5FL7D 1WB5A 2RBKA 4NCXA 4Q9DA 1Z36A 3ESRA 4O2LA 4BVJA 4CQMA 5JZBA 3K0SA 4Y6OA 3RVSA 3U17A 1TECE 3K96A 4LMPA 1I5OA 4OJMX 3T5DA 4NZ9A 1EG7A 1D8AA 4GI3A 4F3YA 5GZ3A 2VRBA 2OC4A 2H08A 2W90A 5GVRA 1NU8A 1KTIA 3M5DA 1ICIA 4NQRA 1NYRA 4QXQA 4ZVPA 5LM3A 1Y6QA 1EFPA 2HNKA 4YAUA 5GVSA 5ITSA 3AOGA 5BN5B 1IEQA 3N3AC 2VHYA 1TM1E 5D7NA 5T3UA 2GWHA 2NV6A 4OH7A 1EVLA 2A8YA 3QTLA 1V8PA 4Y1RB 3CUTA 3WOHA 4YMTA 1YT5A 9LDTA 4ZQHA 4D3DA 3VNVA 1CVLA 1XTIA 1P9OA 5KOHB 1PR1A 4LZZA 1HSZA 2GRAA 3H2KA 5THXA 2DKNA 2Q6LA 3T7EA 3WHIA 4QUIA 3UK2A 5CDFA 2V7VA 3EIEA 4L9SA 3KSRA 4MR9B 2VKQA 4TWAA 1G291 1U5AA 2QTNA 4UD2A 4UXHA 1FMLA 1J20A 3R1IA 4ZV4A 3E9DA 2R7AA 1RQNA 1BWSA 3ADOA 3C5VA 4G0YA 1ZKDA 3NR2A 3KIPA 3V1TC 2J5RA 3FFTA 2OHHA 5EJFA 3DAOA 1D9XA 1IM8A 3S2EA 3GRVA 1M6EX 4E09A 3TIVA 4U9IS 4MX8A 3WZMA 2QQ0A 1DINA 2H7VA 4ZIRB 3ENKA 2QRVB 5CYGA 2R5WA 3A6JA 4QD3A 4C0QC 1EFCA 1O0BA 2CMGA 4KIFA 4AY5A 2GSWA 1EK2A 1CS0A 3VPFA 1I1OA 1M8JA 1REQA 1V6CA 1UANA 1XF9A 3FM9A 3JRWA 3JU3A 4GT1A 5TQ2B 1QB8A 5AW3A 1Q15A 3CURA 3OT1A 1GL7A 3RYIA 3V5NA 3UGJA 3CX7A 3FUXA 3WR5A 1K7YA 1ISIA 3OOEA 1CRPA 1JKFA 2GQ0A 4JLDA 4P22A 1A5TA 3A2NA 5FH9A 2XYVA 1YOVA 2DR3A 4BWYA 3BIFA 4QOEA 3RM3A 3V1LA 1S2OA 4EUEA 2BBWA 1XZPA 5FCDA 2P91A 2PMWB 3DAHA 5JWOA 2WJ4A 1DPFA 1G8MA 2F43A 3LK7A 4F3NA 2Z56A 4E3WA 4KUEA 3FD8A 2N0SA 1JVNA 1QTIA 3H1FA 4FDUA 3SS7X 4JYMA 3QVSA 4KDCA 4O2BF 2MIIA 1WZ2A 1ONOA 3W2FA 1NN3A 1BU5A 3DNMA 3IJEB 3PUWA 2REBA 1XZLA 1U28A 1RKXA 3CLRD 3EBOA 5AI9A 3RQSA 3O95A 1VB3A 1YR7A 3AIMA 4A6XA 4CLDA 3OZRA 4G2TA 4LF6B 3TFOA 4TMFA 1TCUA 3M82A 4ME6A 2GESA 2NU6B 5JDCA 1M1YE 1QVWA 2YOGA 3E84A 3ZCXA 3O5AA 5JO9A 5KHAA 4IG9A 2A0XA 4OU4A 1JDVA 3H2BA 5SY6A 3VOAA 4YRZA 2FV8A 5ALRA 2YJTD 2YWCA 1A2OA 4RIEA 4WCFA 3AFNA 1KVQA 1VLZA 2RHOA 4TTJA 3S2UA 4MCJA 3Q2OA 3VI4B 2IPXA 5IH7A 4AG6A 4D6YA 3T1OA 3SZRA 3HJAA 2WU0A 3IDSA 2HXYA 4B6PA 1A8SA 1QQAA 2PVSA 1EUZA 3BFKA 4RV9A 1NP7A 4OF4A 4D0LB 1CUEA 2XUZA 3L6EA 1YCDA 2WDPA 1ZS9A 1OUMA 1VB5A 3UT0A 3DBIA 1ECLA 5IC4A 1QHYA 2D1YA 5FWDA 2NU7A 3BREA 2XZDA 3TZEA 4LWQA 2ZE8A 5DLYA 4MW4A 4NZMA 5F5XA 5C37A 1IMJA 4J1TC 3KDSE 9ATCA 4CDMA 4CIAA 3HEBA 3A4TA 1FDOA 2XUFA 4J16C 3T95A 3QF7A 4NEGA 2VSFA 5ADHA 4F8YA 3H1EA 1UCFA 5LQDA 1B8NA 1QIJA 2Q5IA 1WUJS 3CWCA 2DPXA 1C9YA 2I87A 2ZI7A 1VKHA 4K9KA 4RACA 4XCQA 4GLBA 4FZVA 1BSVA 5BNZA 3ZD6A 2R11A 5ED0A 4CIXA 3V4OA 3TOSA 1TJYA 3B1FA 3FPSA 4MTLA 3JD1A 1UBHS 1SOWA 3HZHA 4O5OA 4IGAA 4RK5A 1UWLA 3U7FB 1L7NA 4QEZA 1DRJA 1RMTA 3ROZA 4EUSA 3IKJA 1CUIA 4YHHB 4YONB 3U5ZB 2DERA 4F7DA 2FETA 3VOSA 4YMWA 1WV1A 5HS6A 3IDAA 3EDOA 4IF6A 4AJ9A 4OFBA 4BV9A 1HH4A 1JXQA 2JFNA 4D8YA 1TCAA 2PZBA 3TQRA 1K8QA 3WV4A 4C9BA 3ESBA 3H1GA 4MMZB 5KTOA 2AR0A 4P4TA 3PNVA 3DVSX 4DA4A 1H8HA 4BKRA 4FDVA 1YZYA 1CCWA 2G17A 4ACAA 1YKGA 2OP1A 3RYHB 1WKCA 2H2WA 3OY7A 1VZ2A 4G26A 4UUBA 4Y9DA 3T3GA 3IVMA 4FINA 1BXRA 2QM0A 2AR7A 3GRCA 4ZMRA 1KIFA 4M3NA 3SLKA 3V3KA 2NO0A 3UM9A 3EIOA 4CKEB 1C4WA 3DBHB 3G2MA 1P1CA 2AJ8A 3DMYA 4ZRNA 1MO4A 1DEKA 2O50A 3DYIA 3K1JA 5H4GA 1Q0TA 1J1UA 4GX1A 2ZRGA 4L5YA 3ORSA 2IK8A 2JCYA 4HATA 4NCNA 2VPQA 3R8XA 4LE1A 4JVSB 4EF4A 3SSNA 4BV2A 1UFQA 5BORA 3LTNC 1B15A 2KHZA 5EN4A 1A9TA 4QQNA 4BNTA 1VCHA 4RVDA 4KPYA 4L8WB 4BVKA 4ZYZA 4GR5A 3K9GA 4BP9A 2QAIA 2FRXA 1F38A 1WPXA 3QIVA 4CU2A 3GRKA 1E1NA 1VE1A 3G2HA 4MV1A 4XTCS 1ZOIA 1GN9A 1XK7A 2EZUA 3BD9A 3ID6C 3RBZA 2ZYDA 1E5LA 1O97C 3HV2A 3I62A 2KYRA 4KQ6A 3X0DA 2EDCA 4NPAA 3D2AA 1T1GA 2A9FA 1E3WA 3L41A 3DW1X 5CH3A 1TF5A 4J6FA 5ESRA 2ZUTA 3DQQA 2BRUA 1T3LA 2X15A 2RAUA 1FLNA 3BSSA 3KJXA 2ZYUX 5CXUA 1GGMA 4FX2A 2B4KA 4DKXA 5MN4A 1U1DA 1BH2A 1XDZA 2PHZA 3A14A 3AZPA 3DW3X 3ORYA 1GSOA 1UDBA 2PS0A 2EP5A 3ZHOA 4BNMA 1R4MB 3G2LA 4MMXB 4TTSA 2JIPA 2G72A 3N0RA 3NJ8A 1OE0A 2R7LA 4F0JA 1P7YA 3DEZA 3SKXA 2HRZA 3IHWA 2DBZA 1FP7A 2YHIB 3CZAA 1UMDB 2PIDA 3EK2A 2E18A 4ND1A 7MHTA 4AKIA 1I2ZA 3VC7A 1XJCA 3JQ9C 4PFQA 4FCVA 4EGAA 3E9NA 3UHPA 2AF4C 1JHXA 3H0CA 4I08A 1Q2UA 2HQOA 3PS9A 1U2RA 4MWBA 4AJKA 5I51A 1XXLA 5FTNA 1YVPA 1Q1AA 3MB8A 3WJ2A 1OBFO 4MUNA 5LWQA 2ZAOA 4N4AA 2P2CA 3P9ZA 4RMJA 4DA9A 2I7VA 1LA2A 3OQ6A 4FDAA 1CZUA 3R6GA 5DYNA 2OEPA 3LBHA 3E58A 4RKRA 2EP8A 3AFGA 1GIAA 1RQ7A 3RC8A 4RTJA 5B1SA 5TB5A 3UICA 3TQOA 3ZE2B 1YU6A 5IARA 2AZXA 3OX3A 1IBMB 2BGGA 3G7NA 1ZCAA 1PKEA 1SBYA 2JGDA 3TI7A 4JHXA 1MC5A 2J0UB 3QE0A 3VU1A 5TLSA 3REFA 1J2EA 1NJ1A 1EVKA 1GGJA 1A8HA 2JRCA 4K6MA 2HUNA 3RSLA 3LY7A 1FVOA 2PWBA 2D7DA 1ZUHA 4EEKA 1ZESA 5BVGA 1VLMA 2X5JO 3P9YA 3IH5A 1EA7A 2IDMA 2A0WA 2CNKA 4PZZA 4OHCA 5FA5A 4DQUA 1EM8A 1N6NA 1Q57A 1ODLA 3L49A 5EZYF 4IJMA 3WL3A 3LSTA 3MXTA 4C0LA 1F12A 4LW8A 4DLBA 1B8PA 1J25A 4UTPA 4IZOA 2O5VA 4L2IB 2G7ZA 1R2QA 3NM5A 1GVHA 2YXPX 1FK8A 5LJIA 5CYOA 1P2DA 3GV0A 1LSJA 4Q66C 1TI7A 2XCUA 3RS3A 2UVPB 2W11A 4DV5B 2FQ1A 3GJ7A 2WI8A 3PU6A 4B3CA 3TEJA 2XE4A 4F92B 4W5OA 5GQSA 1T4DA 1YH3A 2IGTA 1I3MA 1CULC 1KARA 1L5YA 2AS0A 1DXOA 2G82A 5CT9A 1G1AA 1NNI1 2AN4A 2VBCA 4OGWA 3P9QA 5JNVA 1QIKA 1AA6A 4UUQA 3CXRA 4N12A 2PUFA 5IKMA 5CR9A 1AN0A 1R74A 4WBXC 5EMJA 1YR1A 4KFRA 5I9BA 3RW9A 5DIFA 3AVPA 1SBZA 3HUEA 4QBFA 3WQHA 4AT1A 3U56A 3ILYA 2JGNA 2IOFK 2OGWA 1WZIA 5TVGA 1AD2A 2ODWA 1ZP6A 3W0LB 2ZWPA 5JH7A 5TIIA 5GONF 1GKIA 5JZMA 4BDSA 1CY0A 3VR4D 1ONPA 4BBAA 5JCJA 4HVCA 3ZE6A 1WEHA 1G5TA 2QMQA 4R40A 4AS3A 4A5SA 3N74A 3NPAA 2EU8A 1OA0A 3G0OA 3NUQA 4NCKA 2F3TA 3B1VA 4J1QA 4REQA 4MR7A 2BFBB 1BFDA 3INGA 3LP6A 4H6VA 1RCFA 2AG0A 1FP4B 2ZI3A 4HGOA 3BRCA 4JJGA 4Q24A 3U7QA 3UGTA 3WK4A 3VC1A 4LCBA 3ZWKA 3QEBZ 3AM4A 2QAJA 3ACDA 3IHKA 1KYQA 1QS0A 1F48A 1I4WA 3VBEA 3CE6A 3AVUA 2BFEB 3BILA 3K0AB 3U7RA 4WESB 1DIBA 1RP1A 3K2IA 3PNYA 4LC0A 4IIBA 3IDQA 3HKEA 2VL7A 1RJWA 1F8FA 1T3ZA 4U1RA 5NLLA 3AUJB 4YJDA 1JLMA 3C7TA 2E5FA 2WC1A 4TX1A 3ZOZA 5CFZA 1DT5A 1YZNA 1XDGA 2IEBA 2YRFA 4FI3C 3ZBPA 3A9VA 4MZDA 4DCNA 3GLGE 1JLSA 1NVUQ 1JLLA 2DPLA 4C30A 2FN9A 2PD3A 3KS9A 4MRPA 2PXAA 4ZA2A 5REQA 2W71A 3GFOA 1RYBA 3OLXA 3SQMA 4BUJA 1PZFA 3C6XA 2GD1O 4IJWA 2I8CA 1RZVA 1L4NA 2GN9A 2YFQA 1F14A 1EJ0A 1T35A 3HCCA 3U3OA 2CFSA 3IKMB 3L8GA 3CZCA 4M99A 4RPIA 3ZVLA 1YJXA 2EX4A 4UEWA 4HVAA 1ULBA 3ZXXA 3ZVRA 4IIHA 1GGKA 1ZWKA 1L4MA 1FFYA 4L85A 4F5ZA 4YUYA 4H1TA 1U0JA 4TKLA 5DM60 1N75A 2ZRIA 1VHDA 1I36A 4RBNA 4PZ9A 4Q5IA 4JJKA 1W5FA 3EZ2A 4E4YA 1APBA 5EHGA 2IYOA 1ZK4A 2QQ5A 2ZUEA 2GRJA 4KEAA 3ORFA 2VATA 1L5OA 4FSDA 5ALXA 5FYDA 1WIWA 3Q9LA 2VDPB 3DMGA 4YCDA 1W88A 5EPOA 3WXBA 4FD3A 4AECA 4JUIA 2JI4A 5EJ8A 3VSDA 2CDCA 3FHOA 1P4RA 4LOLA 3U39A 3EY4A 1U80A 3NHWA 3EPLA 2AIRA 1ZXLA 4D5EA 3KYCB 4LJYA 2OYRA 4DT1A 3QPAA 2JK0A 3M5CA 4X20B 4OY3A 5J2TB 2YFKA 3UENA 4XDHA 3ZUGA 2AB0A 3CRVA 1OX4B 5B58C 3KVRA 1GSHA 2O3JA 1LW7A 3NKVA 3NRBA 4RLHA 5LZ8A 4ZOAA 3RVRA 1RPTA 1L7AA 2M1ZA 3CLRC 4G24A 4H6XA 4MP8A 2FVXA 1KPIA 5AH0A 1IN7A 5CAEB 3KQHA 3NTXA 1DUVG 1B7GO 4M6WA 3W5CA 5DTQA 2BGMA 2C3YA 1E3EA 3RRBA 2H1HA 2QMYA 3L4SO 1B41A 1NTRA 1ZJZA 5KZMB 2A58A 3SQDA 2OV1A 1PR5A 1NXVA 2CXSA 2WWWA 3SQLA 2VSXA 3P2OA 3DAFA 5HZMA 1RXSA 4DV7B 3MTAA 1SN7A 3TINA 4Z3DA 4WUVA 4ZP1A 5LKAA 2CT8A 4E51A 2WWRA 1NUQA 3AG6A 3A4VA 4TYMA 3BXEA 5KQSA 4V0SA 5C1DA 3E3AA 4LYYA 3S2SA 4HTFB 4XUGB 2IIQA 5HILA 3E22A 2EWVA 2HCTA 1KZ9A 2QTHA 4JFAA 4PR3A 4AZTA 1OBVA 1AKEA 1P72A 3V4LA 2Q8NA 1KQPA 1EI9A 2F62A 2Q8QA 2XWPA 1U3DA 2W9XA 2ZJAA 3DKRA 2VUTA 3EVBA 5FPTA 4BNUA 2FFAA 4EBFA 5A62A 4KREA 1XWIA 4WXEA 2EOAA 3ANMA 2NVOA 3VDNB 5K6AA 3CO0S 2JL1A 3TECE 2C20A 1P2UA 2NSDA 1IH8A 3GPBA 3ICPA 2Y93A 1DE0A 5EJMA 4TT3D 3D0RA 5FBQB 3IVRA 5GM1A 5IHPA 1XRNA 1JFLA 5K4AA 3ITKA 4YUWA 1E6LA 1JFRA 2COKA 3H0EA 3VR4A 1TTTA 3TL6A 3D5EA 3KKZA 4DUZB 2CDBA 1EBBA 5EHQA 5BN4A 2R4UA 1OZHA 3H6GA 1NBIA 3LUDA 2OSVA 2AN1A 3BB4A 4O33A 4TKMA 1EFLA 4BVAA 2I78A 4S2EA 3ANLA 3EAQA 1Z39A 5HKKD 2R48A 4TTIA 1JQKA 3WLLA 1M8KA 4FTWA 2D2EA 1LX7A 3CBQA 4I3GA 3PR3A 1YK1A 2XODA 1ND5A 2VXBA 3M5PA 4O2AA 3D7RA 1Y80A 5J40A 1FVHA 2HCRA 1U8CB 2Q3BA 2OHXA 3C4VA 1PFUA 2GX6A 3WLKX 2YJZA 2BEJA 4HG2A 5G1NA 1WJGA 2FZCA 4DMCA 5A0VA 3U9TA 1UINA 4A0HA 2NAPA 3NT2A 2WT9A 4UJ3A 3QJ5A 2GAAA 4MYSA 2CJWB 1K8YB 3W8DA 3JQ7B 1J5PA 3S8YA 1I7DA 1KZ4A 2EKDA 3C3BA 2IHZA 1Y5IA 1ONNA 5ERYA 1C0LA 2R62A 4QYTA 1DC7A 3L46A 3O1IC 1K1EA 4BN4A 3RFXA 4C7VA 4CVNA 1Q11A 1QG2A 4PHTA 3O94A 3DFKA 4I8XA 2JFVA 3WYCA 4PSKA 4F84A 1UPXA 2IH2A 3RRMA 3H1BA 1FYWA 4MS4A 4PS1A 1ORVA 2PMCA 3PWSA 4KJZA 3X1YA 1XLTC 3D8BA 3ZQJA 2C31A 2GYYA 4JXKA 4ZTZB 5IZ4A 2W2MA 3NUZA 5JD5A 2EZ8A 3JSXA 2LIPA 2H4WA 1VM6A 1HLFA 1Q1BA 5K2OA 4ZGGA 4EQ6A 1FS5A 3C1AA 1N6LA 1IY2A 2CWDA 3E15A 1BU8A 1SZCA 1VPLA 2ADMA 2ORVA 3QQPA 4K9DA 4R2KA 2GFQA 1I2DA 4EHFA 2GXAA 2XGOA 3BHNA 1WAMA 4JZYA 4W1QA 2IHVA 2ZUWA 2VJQA 3W1WA 4RADA 2D3WA 3R44A 1BJKA 2X41A 2QX9A 3NYIA 4YI3A 5T4EA 1SKUA 5DASA 3WO1A 4DR5B 1BIFA 4DDWA 2HM7A 2ZS8A 1CIJA 4OQDA 3U3DA 2JGIA 4DKJA 3BXOA 3UJ7A 4RA9B 3ICOA 2HIAA 1F5NA 1JHOA 1MB9A 4B32A 2QN2A 3STTA 5KWVA 2J08A 3ONFA 3A1FA 4ARIA 2BFFB 3KOYA 3L7BA 1B6RA 2OHGA 3KK0A 1Q0QA 4Y9TA 1EGVB 2WICA 4IFTA 4PZCA 3OA2A 4Z9BA 4ZV7A 3CLVA 1JWLA 3G88A 2FN7A 3J7TA 3HTXA 4J7AA 3ENVA 4FZ3A 1H5UA 4ENQA 4MRRA 4DNQA 1XRJA 1TPYA 4KC0A 1M2OB 1A9ZA 1QQ7A 3K8OE 2NLOA 5HF6A 3PSAA 4HADA 4WASA 3VSAA 1AM4D 4AKSA 4LF9B 1ZX1A 2JHGA 1IVNA 2GLXA 3FDZA 4LV6A 2UYOA 3HG7A 4UASA 1RM5A 1DBWA 1NM5A 3WIEA 4CL2A 2P90A 1G7RA 1YUBA 2YVUA 3D3NA 4K3UA 4KNVA 4XYBA 1C29B 3I34X 4KAXA 4DF3A 1EFHA 3RABA 1E77A 4E3ZA 3UMBA 4CQLA 4M8SA 1M1UA 1Z4NA 1W5SA 2HJWA 4LECA 5DYWA 3AF4A 4M9SA 3N8IA 5LQAA 4B3GA 3W2EA 3RYCA 4D8UA 1DLIA 3KHUA 3G0CA 3VVCA 2DHDA 4QGGA 2CCJA 3NWEA 4Q16A 5C8YA 1Y4SA 2WG0A 1SCJA 1SOMA 5J4HA 4J2HA 3B20A 1NE7A 1WF6A 3AEXA 4G84A 3NDJA 3OFSA 3UWSA 3OM8A 1FZTA 1QAQA 3B6ZA 1QCCA 1C1XB 3IURA 4EBBA 1H4QA 4NCAA 3LPCA 5AMXA 4GP9A 4TT3A 4EW2A 2IYUA 2EX1A 3D6HA 3N2IA 4NV3A 4DCVA 5CCBA 2DHRA 3CKMA 1B8OA 4C0AC 1D2AA 4E21A 3N8KA 2J3HA 5FPHA 4YGXB 4QECA 2PSHA 4BQSA 5H7XA 4UNQA 4HWSA 1X7ZB 5DH9A 3HDQA 1PAUA 2WM9B 2H92A 3M7IA 3RS8A 1DBPA 2PUTA 1RWNA 1ZEMA 1OFTA 1E2IA 1WZNA 2GD6A 3GVCA 4MK4A 1YQ9A 1GTZA 1ZC4A 4CKCB 1IYZA 5D86A 2FX5A 5DTJA 5IAAA 2QHXA 1E1QA 1PDOA 4MYDA 1HURA 1E8DA 2XW6A 3QK7A 4LNAA 4EI9A 2ZRAA 2AOWA 3W6ZA 5CFPA 1OZFA 4TYYA