1JJ7A

Crystal structure of the c-terminal atpase domain of human tap1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
251
structure length
251
Chain Sequence
GLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ABC ATPase domain of human TAP1, the transporter associated with antigen processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords PEPTIDE TRANSPORTER TAP1
total genus 75
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jj7A01
1GUAA 1ZCBA 3B6EA 4BFUA 2PT5A 3EWSA 4GOXA 4I99A 4XSGA 3THYB 4MRSA 4CEJB 1NI3A 1QHSA 1GRRA 1L4YA 1PLLA 3UPUA 4M22A 2Z4SA 3ZQ6A 2WAXA 1G64A 3VKGA 3RSOA 4BEJA 3GLIA 4JBYA 1KY3A 2QP9X 2H5EA 3W90A 3RLFA 5FL7D 1BH2A 2YNMA 3BERA 3ICEA 3PITA 5TXGA 4E5UA 2WWIA 3IEUA 5TB5A 2BMEA 5KOYA 1G5RA 4V0KA 4Z54A 1T3LA 3VNUA 1YQTA 4IDOA 4ON9A 4P4UA 1NN0A 3TR0A 2O8CA 3QKUA 1Z6GA 2H92A 2GK7A 1QHNA 4DWJA 1OKKA 3RABA 4F4JA 1KSHA 4A0GA 4ZPXA 4A4DA 2GILA 2KB0A 1BO6A 5JEDA 2W58A 1Z83A 1RRFA 1RE0A 1HQCA 5FL3A 2ZRIA 1E9BA 4AKGA 3OZXA 4PSVA 1Z2CA 1KDOA 3K1JA 3B9PA 3FVQA 4FWIB 2V9PA 3IHLA 1JR6A 5EE3A 1NJGA 2D7CA 3HWSA 1ZD9A 1ZP6A 2EFDB 2CJWB 2Z5FA 3ETLA 1A1VA 2B7BA 5LB4A 1LF0A 1O87A 1U98A 4DXAA 3TQCA 4YC7A 1X1RA 4NYMR 3G82C 4HLCA 3W3ZB 1SVKA 4QGGA 3F8TA 1NG1A 2VH5R 1NVWQ 4FCWA 4QBHA 3RRYA 4AKIA 1H8HD 4QBIA 2GCOB 2NO6A 2IXFA 2C99A 4XD7A 1Q12A 2O8BB 5H70A 1W36D 2WKPA 4W5WA 5SZIA 5EXSA 5KNBA 2I4IA 3I3SR 1VPLA 4M9ZA 5CM8B 2F43B 3U44B 4EDHA 3GLFB 2UZ3A 5JRZA 3FTQA 3FDIA 1W36C 1N6RA 4GP7A 2J45A 1M2OB 1A2KC 4P4TA 4LYJA 4BFVA 4NYIQ 4DUGD 1NLFA 4MH0R 3E2IA 3M0EA 3THXA 4Q9HA 1E9FA 1P6XA 4M9SA 1R0XA 4TMVA 1JJVA 1Z29A 2EYUA 2NTYC 2WWGA 1G4UR 2CK3D 4C2UA 2NOAA 2Y8EA 3Q9LA 4EPRA 4TTPA 1EWQA 3HPRA 5K8UA 3SQWA 2WMNB 4LYFA 2RGNA 4LZZA 4GBMA 3CM0A 4PTLA 3X1ZA 3FKSA 3PEYA 4UXHA 4FXPA 4BGDA 3AP1A 3LAWA 1Z6AA 1KO7A 2LKCA 2QQEA 2V1XA 4GOJA 3I5XA 4N3NA 4B2IA 3K0EA 3GLGE 3SE0A 4QM7A 2XITA 1W0JA 2A5GA 5GJVC 5JLJA 5KYKA 4G1UC 2P6RA 1G6HA 1KI2A 2A5YB 2D74A 4LHWA 1NRJB 3T1VA 5JECA 3IPXA 3C5CA 4D82A 3EPKA 1CTQA 2FGJA 3KKMA 4BEBA 4ZDIA 1TTTA 3TUJC 4PAQA 2C96A 4A6XA 1GNPA 4BLQA 1OW3B 1DAKA 3LW8A 4JYCA 1N6KA 1N6NA 2WHXA 4FCVA 4URWR 4B6EA 1OE0A 5FOXA 4GT1A 3KKOA 4HAWA 1R2QA 1U9IA 2VF7A 2YWGA 3ONWA 1GZSA 1SHKA 4KVAA 1Q1ZA 3C15C 3Q7PA 1P62B 4CEHA 4RCYA 3RSLA 2MSDB 2GCNA 3NBFA 4ZI3A 3H86A 3AKCA 3DM5A 4JT2A 3GJ6A 4TTQA 4BFSA 1E1RD 4IDPA 4FMDF 5JWHA 4MYHA 4ITRC 4EFMA 1TQ6A 1ZM2A 1Q1QA 3IQXA 1VDZA 1R8QA 3TIFA 3RS7A 2BM1A 2W0MA 5J40A 1D6JA 2W83A 5L3VA 3QF4B 3DMDA 1NY5A 4DLXA 1K5GA 2AWOA 1GNQA 2CL0X 2YJTD 3BORA 5CYOA 3UATA 2G1KA 3KJHA 4C0AC 1QG2A 3D8BA 3LQQA 2O8DB 2PLFA 2QNRA 4WIAA 3A4NA 3I92A 4AURA 1M7BA 1AQYA 1HY3A 2VO1A 3B1VA 4L4UA 1ZW6A 3GJ4A 4D4JA 1US8B 2GHIA 4Q1FA 4ABYA 4URVR 2WOOA 2JLXA 2R62A 3RWOA 1HYQA 3VMFA 4RD1A 3ZS9A 2MMGA 4JL6A 3CWQA 3R8FA 3PEWA 2QE7D 2V8OA 4C3ZA 1CJTC 3SHWA 4OHYA 2UVQA 3PR1A 1IY1A 5IT5A 4F7WA 3EX7C 2JLZA 4DEXA 4HZUA 2IXEA 4A0RA 2CNWD 3ZD6A 4Q00A 1G7SA 5EE0A 3GFTA 5DHFA 2RHDA 2A5DA 2JDID 1W48A 2QSYA 5DN6A 4BWYA 2QTHA 4ZDKA 3B85A 4PSKA 4LV5B 2B8TA 3LVQE 4ZIRB 2JJ2D 3AVOA 2C03A 1IN5A 4C7OA 1FUKA 1YZNA 1H8ED 1FQKA 5FFMA 4DBLC 1S3SA 1N2CE 2HLDA 4TL9A 3CR7A 3I5YA 2JLYA 4KO8A 3GJ0A 4WVFA 4AYWA 2Q21A 3IO5A 4NE2A 2KJQA 5L3RA 1NVVR 4B73A 2BCJQ 2Q9CA 4JBXA 4Q9LA 3LQRA 2F43A 1PV4A 4G5RA 1MV5A 2HT6A 2BWJA 2YZ2A 4HAVA 2WIBA 4AKHA 1GWNA 1Z0JA 3LRPA 2VHUA 1DO2A 2J9RA 4JKYA 2DPXA 1AM4D 3K0CC 4WZBE 1G7TA 3GFPA 4OHZA 1LNZA 1XD8A 2ZANA 3V4FA 3GJ8A 3C8UA 2ZSDA 3RS0A 4DLSA 4AYXA 1TEVA 3N2IA 1IN8A 1QBKC 4KXFB 2A78A 1HA3A 2P2LA 2X2FA 4DDVA 2LKDA 2MSCB 1M7GA 3GQBA 4A2WA 3MFYA 1Z22A 1FNNA 3W34A 1Q21A 1WCV1 1ZNYA 3GLHB 621PA 4H1UA 1TEXA 3P4YA 1NN3A 5CIWA 2ZRAA 5EUMA 3VX4A 3O8RA 3A1UA 3CLVA 3QPUA 5FR2A 2DFNA 2OSBA 4M1YA 3LXRA 3HDTA 1U0HC 5FI1B 3RS4A 2ZS9A 3CONA 2RHMA 5DHAA 4D0NA 2FFAA 3X1YA 3QVUA 1NVVQ 1GNRA 3F5FA 1O3YA 4TQAA 1V43A 4DLUA 1U0JA 4MITA 2CXXA 2WJGA 4IJMA 4R98A 3K0SA 1GM5A 4B44A 1I2MA 4BUJA 2ZREA 2PEYA 4QOSA 4A0HA 5EXXA 2ZYUX 1U8ZA 2AD5A 4HUQA 4Q47A 1N5IA 1P73A 4HI0E 4PC6A 1KAGA 3GFOA 3QG1A 1CEEA 1ESNA 2IF0A 2NZ8A 3CNLA 3AB3A 4WOPA 4WXPA 1Z0DA 3EXAA 4B3BA 1X8JA 3A1SA 3A1TA 4I1UA 3CWZA 2VP9A 4JLBA 5EZ6B 1W0JD 1WRBA 1TMKA 2F1JA 1ZYUA 2ZSAA 4P0TA 1XNJA 2QM8A 3VHLB 4MRPA 3DHWC 4GMXA 5KDDA 3SNHA 4DDUA 1AIPA 2GWHA 3CRQA 3IIMA 4V02A 1XTIA 1W4BA 4US2R 4B74A 1YR8A 1UF9A 2JIZD 1OHHD 4ZCLA 3PJRA 3N5CA 5FOWA 1WE2A 2GXQA 1EFCA 4LBWA 5FL7A 2C95A 3P32A 4NU0A 1UJ2A 3Q5EA 2OV2A 1GKUB 1E79A 4TMWA 2CDNA 4IDNA 4M1KA 4NHOA 3WBKA 5AR1A 1P2TA 1RKBA 3VQTA 4A8JA 1YVDA 5AJYA 3ZJYA 3DM9B 3G5UA 1IOZA 4IEEA 2DR3A 1CF4A 1XP8A 4IVQA 1JJ7A 2QT0A 3SJBA 1AA9A 2ZJBA 3T61A 4BRWA 2WTUA 1M74A 1U8AA 1IXSB 1Y3AA 4S2EA 2GJ8A 3GJ7A 4R9UC 4E03A 4US0R 4PAMA 1YJ5A 4EKDA 4QXAA 2X77A 4POAA 3KXLA 2G83A 2GKSA 1N5JA 4YDHB 1DO0A 2WJJA 3THYA 4TT3D 2IYQA 2G6BA 2MSEB 1U81A 4OHVA 2ZI4A 3B7GA 4DCNA 5J4HA 3QXJA 1F6BA 2FSFA 4BLTA 1VTKA 5HPYB 2NG1A 4QHSA 1L2TA 2WJVA 4X8LA 5C1BA 3GJXC 3WRYC 3AVTA 4OKSA 1KSJA 1DTSA 2ZJYA 3I62A 2PEZA 2SHKA 5K8LA 1OH6A 5M04A 3U7FB 4B47A 1MRSA 2ZE7A 2J59A 1NKTA 2ZU0C 3QKSA 2KI5A 4MGYR 4ZDJA 1U2RA 3IQWA 1C4OA 5IF9A 2XJ9A 1P4SA 4R7ZA 1L4UA 3W5JA 2I1VB 1AS3A 3T1TA 2D62A 3BGWA 4LGMA 3NBZC 3SFVA 4QGHA 5JJIA 3NDPA 1EX7A 2WSMA 4RKFA 3W6NA 4DCUA 1RYFA 2XNDA 1DS6A 1G5TA 4QBGB 1ZU4A 1K6MA 2B6HA 4NP6A 1H8HA 1E2EA 1K8RA 1GOTA 2IYLD 3BFKA 4JZKA 4KFTA 1P3JA 1XTQA 3W3AA 2ERYA 3T34A 5FI0B 2J3EA 1OIXA 3B2EA 4HDCA 1JNYA 4P3YA 2FE4A 4TQUS 2WWWA 3FFBA 2VTKA 3DZDA 2Q9BA 4WBSA 3ZS8A 1DBSA 4QJ4A 2F1IA 1G3MA 4E22A 1XDBA 1Z8FA 3PQCA 4KAXA 4BLRA 3CF6R 4F93B 4DLTA 1KZGB 3T35A 4QHYA 3IBYA 1XTSA 3KB1A 1NLYA 4JSYA 3U3MA 3PUXA 2I3BA 4D4KA 2BBOA 3LLUA 4M2LA 4L15A 2J7PD 1G19A 4AK9A 4B3DA 2GCOA 1XMVA 3TUZC 1YZQA 1JR3D 4JVSB 2ZITA 2RGDA 3L0OA 3MRSA 2OZEA 3WNCA 3H84A 4TWZA 1NN5A 1RC8A 4LHXA 1KKLA 2D06A 1IY2A 1Z3IX 1NBMA 3Q85A 5JWRA 1OPXA 2RGNC 4MA4A 4PQRA 5JI2E 1VYVA 4DLRA 1XPRA 2OM2A 1VIAA 4EPXA 4NCHA 4DCVA 3O8BA 3U4QB 3OEHD 1Z28A 2FDCA 2ZRNA 5EP3A 1W4AA 4IXNA 3RC3A 2Q9AA 3TLXA 1XD2A 5LPNA 1GG2A 2FX3A 1BMFD 3MWKA 4NYMQ 4HEJA 5G40A 1JR3E 3B1XA 2O0KA 2VA8A 3D7MA 5E4FA 1DELA 1NBMD 2QZ4A 1XTJA 2GJKA 5KSYA 4QFMA 2A5FA 1QVAA 1MRNA 4NCKA 3NH6A 1Z47A 1EFRA 2QM7A 4C9BA 4D4MA 1XJ0A 2DFKB 1FX0A 1SKYE 3AKYA 5E95A 1E2QA 2FFHA 2N1BA 4D6PA 5FOVA 4TQ9A 2LWIA 1EGAA 1W0KD 3C7KA 4TLBA 3KJEA 2PZGA 4D81A 3KJIA 2OXRA 2YC4C 2ZUBA 2G77B 2G88A 1KDTA 1D2MA 1HE8B 3K9LA 4JLMA 1WB9A 5B64A 3NTUA 4EFLA 1NVXQ 2F7SA 3MCAA 8OHMA 1U0LA 4V0LA 1WBDA 2MMCA 4N1AA 2H16A 3SU8A 2OEPA 3KKPA 3ZH9B 4ZCMA 2J7PA 1XF9A 4D2IA 2XZOA 2GJ9A 4UKDA 1OXUA 2OUKA 4DSNA 2RGAA 5EXTA 2NGRA 1KOFA 3KXIA 4XVQA 3AVPA 3EARA 5E7MA 5J47A 1DE0A 1TF5A 1MH1A 1YZTA 5JBQA 2ZXUA 3T1OA 1YR7A 5SZKB 2BV3A 4M1WA 3UWOA 5KPJA 1HT1E 2OBNA 4GMDA 5DI3A 2O8BA 2QROA 3UIEA 1Z0FA 3PVSA 5KHOC 4QJ5A 3EG5A 2W0SA 2WPDD 3NKVA 4E07A 2AL7A 1E3MA 3ZQJA 3N70A 2WMOB 3L82B 2GRJA 3CIOA 1YZUA 3BH7A 3KB2A 3A36A 4LPSA 2FSIA 4AG6A 3UXMA 4C0JA 4KU4A 2KSQA 4E09A 2RB4A 2ZYTX 4ZI2A 2VYFA 2CVHA 3GLFE 4P31A 3DL0A 4CT5A 5AUPB 1AJEA 4FCTA 4M9XA 5GJCA 4EPTA 1ZRHA 2GBLC 2GA8A 3ZVRA 4IHQA 1SXJC 3ND9A 1F2TA 1ODFA 4DIDA 3B5JA 3SHFA 2Q3HA 2IT1A 4PZYA 2BMFA 4LHZA 4AWXA 5HKKD 1U99A 1QHIA 1SXJD 3VU9B 1DG1G 1IN4A 4TTRA 5JRJA 2OCPA 1V5WA 1G8YA 221PA 2DY1A 1MO3A 3EIEA 3KZ1E 4KODA 4M1MA 3TW4A 4YXWA 1LFDB 2QORA 1RZ3A 5H1YA 4B2LA 2DWOA 1Z06A 3IPYA 1OKKD 3JZMA 3PFIA 3B1ZA 4OK5A 3A1WA 4D25A 4YMUA 2VIIA 1G5PA 1XU4A 4BZXA 2AD1A 4J0QA 3C16C 3FB4A 3J81k 1COWD 5D3QA 2AR7A 4JLNA 2ZS8A 2CCGA 4W5JA 2XEXA 1LS1A 3LXXA 1JALA 5CLQA 2OCBA 3WYGA 4YQFA 4LI0A 3QXSA 1S4QA 3FMPB 3QQ5A 3ZZ0A 1EG7A 3T06B 4B3XA 1N3BA 5FPYA 1ZINA 3G0HA 3H1TA 3CX7A 3AVQA 1N0WA 2BHRA 4CZ2A 1M7HA 1G9XA 2H7VA 2X2EA 1KO1A 1WBBA 2VP0A 5FOUA 2C9OA 4XJXA 2ZVQX 1GRQA 1ZNWA 3ASZA 1T8UA 4ZO4A 1P5ZB 2AFIE 2UZIR 2NO1A 3U4QA 4TN1A 1AZTA 2Z4RA 1YE8A 3JVUA 4L9WA 1QHXA 1KSFX 1X3SA 2YWFA 4I1VA 5HZKA 1XRJA 4MKHA 3EZ9A 3K70C 2CE2X 3NG1A 3OE7A 4EQ6A 2ZI5A 2ZRKA 4H1VA 4JT4A 4WZAE 3OEED 1CIPA 3VR5A 3QENA 4JL5A 4LBZA 3RS5A 1VECA 4QRHA 2GDJA 3UMSA 3LY5A 3CO5A 3I4LA 1P60A 4LHYA 1Z6YA 2YWHA 1IM2A 1G8GA 5FR1A 3GEEA 2FFBA 4F91B 1JPNA 3QE0A 2CLDX 3MG9A 4HLQB 4KFRA 1GRNA 2O8EB 3OIVA 2IYYA 4HLDA 2WWHA 4KHZA 1QHGA 1XCGB 4Q7MB 3TAHA 2QAGC 2YOHA 2RH5A 3QBVA 3KQLA 2EQBA 3OF5A 4GNKA 4KVGA 4M21A 4QG7A 4DB2A 2BC9A 2FNAA 5KSOA 5KU1A 5FUWA 1UKEA 2IL1A 3O8DA 2VHQA 1DAFA 1EFHA 1Q1EA 2GJAA 4A15A 4XH9B 2P67A 5FPSA 2WJYA 2ZQ5A 4PHTA 4BLOA 3R9WA 2QAJA 4JBWA 4MRVA 3HPQA 1U8YA 3VNVA 4ESHA 1JQLB 3L0PA 3GLIB 2QMUA 3CR8A 3UK6A 5KNCA 4TL6A 3I32A 1CJVC 3P26A 1E9DA 1KI6A 4PC7A 4C0HA 1CR0A 1CXZA 4Q4JA 3WNDA 2ONKA 1D2NA 1KI8A 2ORIA 4URZR 1CKEA 3CNNA 1CR2A 3MUFA 1XEWX 4EUNA 1II8B 2R9VA 4LX0A 3CBQA 4FD2A 5JZVA 2XTZA 2QRNA 2ORVA 4DUGA 3OAAD 1KTVA 3DDCA 2VP4A 4I1OA 5KSZA 1KDRA 3O47A 3WXMA 4KJZA 4XWAA 4XTCS 2QPOA 1TNDA 1KMHB 2HXYA 3VU9A 5KNDA 1G8PA 3VAAA 3SI7A 1G17A 3EPHA 5DE3A 5EQTA 2O0JA 2ODBA 2ONJA 2NO7A 3LNCA 1YZLA 1YU9A 3FFAA 5JEEA 1AS0A 4LPKA 3FMIA 4TSFD 3RS3A 4Q18A 2CVFA 3BXZA 1XXHB 4BQSA 1VYTA 4NBSA 2JJ1D 4TYPA 4NZYA 2GESA 4V0OA 4W9MC 4GZMA 2UKDA 1I4TD 4Z8YA 2XGJA 3NVAA 3WNBA 1TAGA 2J87A 3FHOA 1JI0A 1EXMA 4BRUA 2D2FA 2B21A 4ZDWA 3UMRA 2HF9A 3RHFA 4C0KA 4EPYA 2QE7A 1VYUA 1SVMA 4DEYA 3WY9A 1NMZA 2WM9B 2VQSA 1IN7A 1QZXA 2J5XA 2W2TA 5A4JA 2WWXA 2O8EA 2CEAA 3FGNA 5F9FA 4AKEA 4QBFA 1XMJA 5G3YA 2OO7A 3SJAA 5KO2A 4L9SA 4U00A 3RNLA 1GKYA 4FWTA 2EFCB 1FPMA 2ZTSA 4KSBA 1SVSA 3ASYA 1CBUA 4GDFA 4CW7A 2OLKA 4KI0A 1DOAA 2OCYC 1W44A 3GD7A 2AFHE 2V54A 5J5CA 3KUCA 2C2HA 5FBLB 3NHAA 4TLDA 2BDTA 4JLKA 5C2JB 2VSFA 1RRCA 3EIHA 4Q4HB 1VG8A 1ZJ6A 4YMVA 4UQOA 1E2PA 1E2MA 4YONB 1HTWA 3QIAA 3U6KA 2O8CB 1RYHA 3LLMA 2XX3A 2N42A 2Q6TA 2WBLC 3A4MA 1M8PA 4NCJA 5BWMA 1GTVA 4HSEA 4M1OA 3KTAB 4LRWA 5SZHB 2HEIA 1EX6A 4KBGA 2AK3A 4OI4A 3DKVA 1Z07A 3QF7A 3D3QA 1KHTA 3RYTC 1FQJA 2JJ2A 4II7A 2EU8A 1AKYA 4LCBA 1GKIA 1GSIA 2DFTA 3L43A 2JA1A 4Z1MA 5AUNB 2WJHA 3EIQA 3HP1A 4QKQA 1KNXA 1SXJA 3S1AA 2CHQA 2XZLA 3QJYA 4C4PA 1OXXK 4IOLA 3QXXA 3VFDA 2QPAA 3TSWA 3ZDQA 4U5XA 3ZVNA 2IYTA 2JEOA 3EZ2A 1DVRA 3M6AA 2JASA 4XTRA 1DARA 3GPLA 1TF2A 3PIRA 5HTKA 4IOJA 4FMCB 4B32A 1G21E 3L0IB 4PPGA 4X8HA 5C4GB 1G7CA 3UG6A 5GJWC 4DDWA 1LVGA 4MUBA 1TUIA 2BVNA 2FV8A 2H17A 1JBKA 2R6DA 3QNUA 2CCJA 4ASUD 1KI6B 4OI0A 3MMPA 1W2HA 1J2JA 1KO5A 1ZM3A 3MGCA 5ELXA 2CK3A 5CLLA 5IDVA 2AWNA 2R44A 2W6IA 1NSFA 1RFLA 4BFWA 5BN3A 2Q0HA 2BEJA 3X1XA 1PZNA 3E70C 4Q19A 1XJQA 4Q1CA 4HYYA 2Z83A 4NYIR 1EFUA 5TY0A 3WMGA 2IS4A 3QKRA 1ONBA 1Y63A 5FTNA 4X8OA 5EP4A 4GP6A 5L3SB 3LX5A 4KFSA 4ZKEA 4RZUA 1Q22A 2FPLA 3PEUA 2DHRA 2ZVPX 3SDZA 1DPFA 5GVSA 2QBYB 2CL7X 3HU2A 3KL4A 4KBFA 3SEAA 1RIFA 4OYHA 5LB2A 3RVBA 1B23P 2BKEA 4LV6A 2ZE8A 1BYIA 5D3MB 5TMPA 2GF0A 1R5NA 4RSGA 3K9GA 4ZIRA 3AGQA 4WAUA 5L8VA 1ZM4A 4JJKA 4R71A 1YR9A 4LJ6A 4B48A 3QBTA 3IIJA 1E94E 3HR8A 4DIEA 1SHZA 3X2SA 3TR5A 4XIGS 2IYXA 4LBVA 2QI9C 1QDEA 3THWB 2V6JA 1E2NA 1KGDA 2PMKA 1I4DD 2BMDA 4FIDA 4JKIA 5J4VA 3KQHA 3K8YA 2OT3B 1N0UA 3LDAA 4NONA 1D5CA 1R8SA 4H9GA 3CRMA 4M4SA 3LVRE 4KV9A 4B2PA 1QHHA 1UKVY 2F1RA 2RAPA 1XEFA 3UMFA 5H68A 3MJHA 2ZE5A 4EJSB 4RFSB 2EFEB 4Q21A 3B1WA 1OIWA 1IQPA 4JLJA 2C5LA 4M53A 3W8NA 5UKDA 4BLPA 2QMOA 3BAFA 1KI7A 4Q9KA 3FHCB 4URUR 4B3GA 4JLVA 1ZIOA 4G5SA 3BH6A 1FMLA 3VTKA 2FN4A 4K8OA 3WRXC 5K8IA 1COWA 3QVVA 2X19A 1NLZA 3KFVA 3UWKA 4XVUA 1OJLA 4K81B 3OESA 1S8FA 3BD9A 5TVKA 3QEOA 4HATA 5GADl 1FZQA 3KKNA 1E6CA 2QAGA 3DMNA 4IXMA 1RPZA 4MGIR 1ZM9A 2ZPTX 3PUYA 1P7CA 3C4JA 3BRWD 121PA 3RC8A 2GZDA 1EK0A 1XBTA 2BJWA 2ERXA 3BIFA 3LD9A 4PPQA 4RFVA 2G9NA 4DLWA 2GVDC 2OFOA 4EPVA 1X8LA 4C7OB 4YMTA 1W46A 2XSZD 4Q9JA 1SXJB 1XTRA 2CHVA 2ZRPA 2QT1A 4IDHA 4Q7LA 1R10A 1OF1A 2AX4A 1ZUIA 2DWPA 1E4VA 5IHPA 4JMPA 3RRZA 1AGPA 1NMXA 2F3TA 4OHWA 4HAZA 3TJZA 4TLEA 1ZC4A 4HZUB 1D8TA 3NC0C 4W5HA 1UBFA 5EUQB 3IIKA 1ZM7A 4OBEA 5BYKA 4V0MA 2ZR9A 2EYQA 2IXGA 4L8GA 3S1AB 4OQXA 3Q5DA 3E5HA 4FI3C 4MKGA 3TVTA 1VIYA 4JVLA 3B1YA 4RD2A 3A4LA 4BZPA 3FOZA 3T5GA 3OFNA 1E2DA 2IF2A 1EFTA 3NIBA 1Z6TA 3U3RA 4IDQA 1VHTA 4P33A 3ZVMA 4EPWA 2XNSA 4KFUA 2G3YA 4RD0A 4PC3A 2GZAA 1T8TA 4A82A 1A4RA 4AY2A 1BS1A 2GBLA 3E1SA 4HLUA 4EIWA 1GL6A 2IYZA 1KK1A 3R8CA 1Z6XA 4ARZA 2ASEA 3H2YA 4BFYA 4WZ6A 1W5TA 3C14C 4DCSA 5F3WB 2Z6VA 1Z63A 3L8ZA 2WWFA 5EZ5A 2ZUDA 4XVRA 3I8SA 4BASA 1IAQA 1S1CA 2ZM5A 1DADA 1E0SA 1NP6A 2REBA 2HUPA 1A7JA 5FTLA 4GRAA 4PZZA 2V55B 4Q1AA 2DWQA 2IBMA 1UKYA 3AUYA 3FMOB 4PHHA 5A0FA 2QA5A 2YWEA 2KBFA 3W6OA 1WMSA 5BN4A 4L16A 3IGFA 4XOIA 1RJ9A 1LTQA 1N6IA 1OYWA 2WPDA 3PCRB 2F9MA 3B9QA 1W0KA 1UBCA 2HCBA 3TK1A 1IBRA 3EA5A 4C2TA 1GITA 3EC2A 2CLCX 1E2FA 1UBEA 2J0UB 3GP8A 3CZQA 2JLQA 4G3XA 3T12A 1FP6A 1QHYA 3FPAA 4A8JB 5LD2C 2CJWA 1OH7A 1KO4A 2ZS7A 4FINA 1JEDA 3GJ5A 1AGRA 521PA 2OBLA 4TMZA 3PXGA 2D2EA 4MKIA 2Q3MA 5LDDC 1XEXB 2AN9A 2GETA 2YKGA 1PUJA 3QSYA 3MJRA 4Q03A 2K5UA 2B7CA 4PANA 2OFXA 2O52A 3LBNA 1HV8A 3EA0A 1SVIA 4HB0A 1T5LA 1OXSC 2R6CA 4NTZA 1OSNA 1NMYA 2OBMA 3I61A 2BJVA 4R2IA 5CYPA 2ZJ2A 5CK5A 4RZ2A 2ORWA 2CHGA 3K70D 2IW3A 4PQFA 4DSUA 1VG9B 1WQ1R 1UBGA 4N0EA 1QHHB 4QJ3A 4NCIA 1DAMA 4OHXA 4ACAA 3TH5A 3BS4A 3REGA 1UKZA 1WF3A 4NPHA 1TPZA 1AK2A 1KMHA 5KPDA 2YHSA 1NG9A 2ZYVX 4PPFA 2FEOA 5B2ZA 1VG1A 1YHNA 3AP2A 5AJZA 1XX6A 4BFXA 1ZCAA 4YMSA 4EFNA 2F6RA 2B8WA 5HKKA 3Q72A 3V00A 4V03A 3LV8A 3P27A 1PLJA 1UM8A 3EC1A 1EWRA 4NCNA 4O3MA 3A58B 4TYNA 2N46A 2IYWA 2ECKA 3ADKA 4B33A 2JAQA 1KI1A 3GJ3A 4K46A 4LJ5A 1YKSA 1OFIA 3REFA 4AC9A 2PLRA 3CNOA 4MKFA 4OK6A 1VCIA 2GZHA 5E7JA 3U44A 2DFLA 2REXB 3I73A 4XSHA 5E7IA 1G8HA 2R65A 3HYRA 3TQFA 4CGZA 1Z0AA 2XAUA 5TARA 4A6PA 1TX4B 2ZSFA 1L8QA 3K09C 5JWOA 1JAIA 4PC2A 1ZNXA 4MYUA 4MYCA 4A9AA 2FEMA 4LYHA 3MSXA 4EAQA 1OYYA 2IS6A 2QP4A 5AK0A 1PUIA 5IRCD 4GI7A 1WXQA 4DLZA 1G1MA 2BBTA 4LOAA 5HE8A 3H0KA 1TU3A 3LBIA 2JGNA 2NQ2C 4Q1BA 5JHHB 1RJ9B 2QQ0A 4YLGA 2WICA 4P4SB 2J41A 3BWDD 1S3GA 3WP1B 3ND8A 2VHCA 4OI2A 1FP7A 2F55A 3VR6A 1DEKA 2I1QA 3EZ6A 1NF3A 1SVLA 4Q4JB 4DHEA 4AI6A 1S1MA 2XZPA 5DLQC 2IK8A 2VRWA 2OCAA 3AF0A 3IKJA 1CRQA 3ZZTA 3QKSB 4LYAA 4Q4AB 1QRAA 1QVRA 4Y0AA 3DVLA 3DZ8A 4N0DA 4QNMA 5CJPA 1E2GA 5J4YA 4CT4B 2D4HA 2GCPA 1SXJE 4ESVA 3KKQA 3OHMA 4GZLA 2Q3FA 4DCTA 1G16A 4RKEA 1E9SA 4RD3A 3GEHA 1ESMA 3KTAA 1MKYA 4RJLA 3HU3A 2IYVA 2EFHB 2JCSA 4JJZA 1JAHA 3NEJA 3I72A 2IA5A 3NHBA 3THOA 4JL8A 3AM1A 3TKLA 1E9CA 1KI9A 5FBQB 1KI3A 3OFND 4M8NE 5AJXA 3T15A 1KK0A 1E2KA 3B8HA 2REOA 5FBVB 1XD2B 4LJ4A 4LC1A 1XXHA 1XJCA 1JR3A 3F3YA 3KJGA 3L2OB 3QF4A 4Q1DA 4A1FA 5B30A 2PJRA 2PCLA 4AD8A 2QTVB 1KMQA 4Q66C 4ARZB 1II0A 2XTNA 3SQXA 1UEJA 3V4RA 2W2VA 1UDWA 2ZJZA 1E69A 3BC1A 1G6OA 5JSZB 2C9CA 2QUZA 2VBCA 2FGKA 4IVPA 3ZLJA 4B34A 1J70A 1H65A 1N25A 2WWYA 1E32A 1XMIA 1KYIA 5FPHA 4ZKDA 4L5BA 1NIJA 1MOZA 2GNOA 3IUYA 721PA 3AH8A 4FW9A 1G3RA 1P9WA 2BOVA 3CKLA 3RAPR 4G5OA 4Q5IA 2PJZA 3T1QA 1E0KA 1OV4A 4TMTA 4MDFA 3BB3A 4TYYA 1R5BA 4HAUA 1N5KA 1NVUQ 1E1RA 1NY6A 4V0ME 5DO9A 3N2EA 5F9HA 4LHVA 2W2XA 4PHGA 5JCZA 2BBSA 3P4XA 1ZUHA 3K0FB 4QGFA 4DLVA 1F2UA 1ZC3A 3K0CA 3EZFA 4EJSC 3RWMB 2FZLA 4TYQA 4Q4HA 3KXKA 1E2LA 1ZUNB 2HJVA 2FSHA 3BFVA 3MAAC 4HLUC 4O2LA 4KLNA 1ETUA 2FPMA 4YDSA 2FA9A 3RRMA 5FPTA 1IY0A 4DSTA 3I1FA 2HXSA 3BJIC 1GFIA 3TW8B 4OJQA 5DSZA 2G0TA 4A0FA 4O2RA 4U7DA 1RRGA 4TSFA 4DT1B 1JXMA 2C9YA 4KSCA 2HF8A 5TDHA 3NBXX 4QC2A 2F9LA 3IDQA 1AN0A 2EWWA 2PT7A 3LH5A 1H8EA 3SN6A 5AWFC 3WHLA 3HYTA 1IXZA 4Z8XA 2NZJA 3ZVLA 1VMAA 3ADBA 2C8VA 4Q7JB 2HDNB 4B6FA 4CRWB 3FE2A 2H18A 4O0MA 1R6BX 1F48A 5HE9A 2QBYA 4HB4A 4ZCIA 5G3ZA 1A5TA 5K8TA 1J90A 1E1QA 5FTJA 2PBRA 2WIAA 2CNWA 3PV0A 1BOFA 1R0ZA 4HAXA 3MD0A 2KBEA 2ZR7A 3M1IA 1WDTA 4LJAA 4UNQA 3K70B 1LV7A 1MO5A 4NKRA 2XJ4A 5C4MA 5JCPA 4OQMA 4DZZA 4A92A 3RANA 2ZJ5A 1J8MF 1CRPA 1Q3HA 3EAQA 3HU1A 3CPJB 2WV9A 3GLHE 4NL4H 3ZGXA 1N6PA 1KKMA 1XZPA 4Q02A 2CCKA 1J7KA 4LJ9A 2OG2A 2RKOA 2IUUA 3ECCA 4LJYA 1Z0KA 1XZQA 3AF3A 4JVMA 4RY2A 1FOEB 2GAOA 3WYFA 4B35A 4IFBA 1G7RA 5BXQC 4C30A 5HZHA 1Z08A 2VP5A 1K5DA 2X1VA 1OLOA 4QM6A 4D4LA 821PA 2JLVA 3T5DA 4HB3A 3TSOA 2E1RA 2HYDA 4TL7A 1SVWA 4AG5A 2X8AA 1FMJA 3QOFA 5LBIA 3KQKA 4NH0A 4BE7B 2AXPA 1T6NA 3NWJA 1XMSA 2PL3A 5B57C 2J0SA 1HUQA 2BM0A 3U7EB 4C0LA 2Z43A 2QENA 1MABA 1HURA 2EWVA 4JLPA 1J8YF 2QL6A 3DOEA 4G01B 3AUXA 2IHBA 2OFWA 3PUZA 2C78A 1NL3A 1HT2E 1G18A 2YC2C 2QGZA 1ZVQA 2ZYWX 3L0SA 4Z1MD 4Q4LA 1R5OA 3BB4A 1CR4A 3HJNA 4AYTA 5DIFA 4M1TA 2FZ4A 2ZRFA 1TADA 2VP6A 5BN5A 2ZIAA 4MQBA 2H57A 1R0WA 2J7KA 3SFZA 3TUIC 4CVNA 1XWIA 4A36A 3DPUA 5JMTA 2RGXA 3SYKA 1XCMA 5SZJA 1NJFA 3VX3A 2GJSA 1PJRA 4FN5A 3W9YA 3ZD7A 2VP2A 5F2EA 3DEFA 4A2QA 2QP3A 3AVUA 5DYGA 1XTKA 3F0TA 3VHXA 3O8CA 1W4RA 5AJVB 2IHYA 2VL7A 2VSOA 1D2EA 3K53A 5BQ5A 4RD6A 2VHTA 4HUTA 5L3QB 5HR5A 1XPUA 2BBWA 3TNFA 3GMTA 2GEUA 3K09A 4LUCA 2DB3A 2Z0MA 2AHOA 2V6IA 4IW3B 3SC3A 1PVOA 3IBGA 4UJ3A 2GXAA 1T0JB 2OAP1 3I8XA 1JEEA 2FFQA 2YV5A 4IOMA 4QNRA 1SULA 2A3RA 1DAGA 1A82A 1MT0A 1RVDA 5E3HA 1Q44A 2ZAMA 4RD4A 5CDFE 3RS2A 1FX0B 3TAUA 2FG5A 1CS4C 4RVCA 3FKQA 2XOKD 1LB1B 1P2VA 2ANCA 2E87A 2GF9A 1GP2A 1OXVA 1W49A 2KWIA 2RCNA 2WVJA 3EPLA 3JVVA 1KJYA 2ANBA 2A9KA 2TMKA 4IEIA 1GL7A 2OILA 3U6BA 1TF7A 2DYKA 1Z0IA 1C1YA 2QG6A 4LY6A 2ZRGA 4PFSA 1HH4A 3B13B 5FUVA 3WP0A 2QSZA 4D26A 1LS6A 5C46F 3OIUA 4OK3A 4DVGA 3LW7A 1SKQA 1OH8A 1ZBDA 2J0UA 4UNPA 4X8MA 4QGAA 2FWRA 3BB1A 2VLIA 1Z5ZA 4XD7D 2OE2A 2YOGA 2PX3A 1EESA 1GDDA 1BYUA 2HLDD 2W6ID 1KI4A 4UXIA 2C04A 4R2HA 5A5GA 3GLGB 4Z51A 1Q3TA 1US8A 4XWKA 3CRVA 4GPTA 3SOPA 1FNMA 2C77A 5DI9A 1JXOA 1ZIPA 2XSZA 3A1VA 1GIAA 2JLRA 3AQ4A 1P2UA 3IEVA 1R4AA 2V3CC 5HCIA 5EE9A 2OLJA 1UEIA 1ZNZA 5JFGA 1KY2A 1VCMA 3U3JA 1OXTA 1WP9A 3BK7A 5DH9A 4IKEA 2YINC 5FOSA 3JZAA 2ZEJA 3LFUA 4PQYA 4WA7A 2JLWA 3BE4A 1CR1A 3D31A 1ELOA 2DBYA 1U90A 1NN1A 3W8RA 1KK2A 5FTMA 1UDXA 3OIYA 3AVYA 1I2DA 4G0NA 3W6PA 4BLSA 1KJZA 1UFQA 2GAAA 2XOKA 2NO0A 1KNQA 4JVNA 1OIVA 4F4CA 1WA5A 5GVRA 4DC9A 2AK2A 3BFXA 5FPKA 4HUQB 1S0UA 3EZ7A 2OXCA 3BH0A 1FW6A 1G4AE 4HDQB 1OT3A 2ZI7A 1IXRC 2P0EA 3RRNA 4Q48A 1N6OA 2A2ZA 2IWRA 5FOTA 3AVVA 1YZGA 3WYAA 3SYLA 2HT1A 4Y0VA 5FUXA 4OI1A 4HAYA 1Q20A 2ODEA 4BECA 3EW9A 2W00A 3QY0A 3OEEA 3TSZA 4DDTA 5CJ2A 5JHGB 3CX6A 4QL3A 3AV0B 4B76A 1AZSC 4IFEA 5BYJA 1F3OA 2IX3A 3TVDA 3OIWA 2ZSEA 2LCFA 1W5SA 3U2QA 4MDEA 3PUVA 4KYIB 3PEVA 2GK6A 1Q0UA 2OAQ1 6Q21A 4F38A 3QG5A 3LBHA 4GSYA 1NKSA 3QKRB 1KJWA 1P61B 4C0SA 1XFAA 5CB8A 2HYIC 4TZ0A 5L3SA 4QHTA 1GL9B 1E0JA 2ZI9A 2QRZA 2ZRHA 2OHFA 1MABB 1S9HA 3A8TA 4PO9A 2JLSA 2W6JA 4PHFA 4ASUA 1GVNB 3U5ZB 2D7DA 3QXCA 4GL2A 2ZI3A 3CH5A 3B60A 2E9SA 2ZE6A 1DAEA 2IC5A 3OAAA 1P75A 1S2MA 1P9NA 1OFTA 4CYMA 2ZROA 1N0VC 2XTMA 2FH5B 3AF2A 3GLHA 4GOKA 3QKTA 3MWYW 3KUDA 1G8FA 1ANKA 1CULC 2QPTA 4NYJQ 3UG7A 3THWA 2AKYA 2QN6A 1F60A 4YMWA 3A37A 1KIMA 5IK2A 2V1UA 4WXRA 3RDPA 1E98A 1KZ7B 2QTFA 2YVUA 4JYBA 1IHUA 4OQNA 3TMKA 3SBEA 4URYR 4LJ7A 3NH9A 1FUUA 3THXB 1TQDA 3LX8A 2HCJB 2FF7A 4URXR 1LF5A 1W2GA 2GVZC 1ZD1A 1E9RA 4G5QA 5FH9A 3IHWA 3U3KA 3NBYC 4EQ6B 5BW8A 5H8WA 3DKPA 1CJMA 1JQJC 2ATXA 4A8JC 1VKJA 2B92A 5LD2B 2ZJ8A 3MWLA 2P6NA 5AUQA 2R6GA 3KQNA 5EP1A 1G3IA 1RRPA 1OFUX 4OJKA 5AJWA 2ZR0A 4IRUB 3CH4B 5KTYA 4KCGA 1CLUA 5CIQA 2G0NA 3C5HA 5EE1A 1CJUC 1TQ2A 4HDOB 4RFSA 4FMCF 2YOFA 1XEWY 2QY9A 1VCOA 2DCUA 4RZXA 1X86B 3ZZUA 4AIIA 2QAGB 2QEQA 5JS7A 3AEZA 3AF1A 2OESA 4Q1EA 3AKDA 3CPEA 3Q8XB 1JECA 4B71A 3M4YA 2ZAOA 3K9HA 2IEYA 4FMDB 3X1WA 2A7QA 2FMXA 2VF8A 4JLAA 3V9PA 2IYRA 2A30A 4OQLA 5P21A 4CEHB 2XXAB 5HCNA 3WMEA 4PSAA 3U7HB 2GXUA 1C9KA 1U9IC 4HB2A 4TLCA 2A5JA 1W4CA 2F1HA 1LY1A 1IJEA 1X6VA 2ZRJA 1G20E 4ILEA 4B75A 3CUEF 4YXWD 2IS1A 4M9QA 2H8KA 5AUOB 5CK4A 4A2PA 2AKAB 2FSGA 2ZRCA 3IILA 2JJ1A 4TYWA 1P2SA 4JIMA 3AF4A 1NSTA 3OEHA 1X1SA 1OB2A 1KDPA 2WSSA 421PA 4UNSA 1SKYB 5JSZA 1VG0B 4DSOA 4PX9A 2WAYA 1SVOA 1W7AA 5F98A 1N5LA 2IWHA 1E0AA 1JPJA 2WZQA 2VHJA 1X8KA 3BOSA 3ZIAD 4F4IA 1U94A 1UPTA 1ZMXA 3OE7D 4V0NA 4NDZA 4P32A 4UNNA 3C41J 1QF9A 2ZRMA 3CB4A 3NEYA 4ACBA 3KQUA 4KYUA 3W5IA 3CPHA 3QPWA 1NNEA 2VEDA 3QI2A 2V7QD 2D3WA 3QXHA 1IN6A 4D0GA 4U02A 3ADDA 3H4MA 2BKUA 3WHKA 1FTNA 2P3SA 2PZFA 4LV8B 1E9EA 3AVWA 1S96A 2NPIA 5EE5B 2PCJA 3K0AA 3ICQB 3CRRA 2O8FA 4CIDA 3CF0A 4NYJR 4TZ6A 4PAOA 3R9IA 1CJKC 3P1JA 1D9XA 4MGZR 1UADA 3FWYA 3PUWA 5FBRB 3GLIE 1T9HA 4B43A 3VKHA 2PMDA 2ZUCA 2NO9A 5DNYB 2IS2A 3EPJA 3KX2A 3U3OA 1IONA 1A2BA 5KSPA 4KLZA 1TQ4A 4PO1A 1SGWA 2J46A 4LK2A 1MO6A 2ODWA 1E96A 1OFHA 3DO6A 2P5TB 2NIPA 4B3CA 4G5GA 2WOJA 1AKEA 5KUTA 3FKSD 5TV2A 4LDJA 3U60B 3ADCA 2H1LA 2G1JA 2IUSA 2RGEA 1SZPA 3HR7A 2RGCA 3Q3JB 2XNDD 1OH5A 2RGBA 1HQYE 5KDLA 1YZKA 1XEXA 2PZEA 3LO5A 4PXAA 1AS2A 4BFTA 5ANRB 1T91A 1ZU5A 2J0QA 4CDGA 3K9NA 4HZIA 1QG4A 3TE6A 3FHTA 4Q01A 3SBDA 4TLAA 3P20A 1ZAKA 3B78A 1G3QA 1E1QD 3D6TB 2FPKA 1DAHA 2NPFA 2VSXA 4BFZA 1E4YA 5JI3E 3Q7QA 5CDFA 3TRFA 3VR1A 3VKWA 1Z2AA 5CITA 5J4KA 1TUEA 2NMVA 3FYHA 1KSGA 4LWZA 4PC1A 4LSGA 4IVRA 2QMHA 4PO8A 1E99A 4LBYA 1KAOA 3VR4A 4JSTA 5JS8A 1J99A 3R7WA 5IK2D 4DRZA 1NBME 1P9RA 1HE1C 3FMFA 3UANA 2QU8A 3WMFA 4DKXA 1L7VC 2FOLA 1R7RA 1T0HB 1VHLA 1EFRD 1SQ5A 2P5SA 3QUSA 3MLEA 2XB2A 3CF2A 1G3UA 4MRNA 1CP2A 4TT3A 3ZIAA 2J0VA 1T4GA 3SZRA 3X1DA 2O0HA 2IYUA 1M34E 1N6LA 1GILA 2WJIA 4B3FX 4D0LB 1KO8A 4JS0A 2GEDA 1GAJA 1R0YA 1XCPA 5DI3B 1P72A 2R2AA 2WSSD 1E2JA 2ZU6A 4DLYA 4TL8A 3KDSE 2HV8A 3R20A 4Q9IA 1OHHA 3NXSA 3QPVA 4CEJA 2F3RA 5J4LA 2O5VA 1T3HA 3U61B 2CLSA 3ZYCA 3SJCA 1XD9A 3KFXA 2GTPA 4C0QC 2XXAA 1TL7C 1CU1A 2EVWX 1W36B 2O8DA 2RMKA 4NMMA 2P6UA 1E79D 3EASA 2J1LA 1B0UA 3TBKA 1FFHA 3TGPA 4CEIA 4PR0A 2R6AA 3EWAA 1OB5A 5GJBA 2GXSA 5JJKA 5D3MA 2HJGA 1F2TB 1NIPA 3AP3A 4Q4AA 2PX0A 3GLGA 4P4SA 2GEVA 3PENA 3SR0A 4GFDA 1E2HA 2FJUA 4KITB 1HEIA 3DOFA 3U7GA 5DGXA 1G291 3L8YA 1FL9A 5EJEA 3SS8A 2P65A 1Q1BA 1BKDR 1W47A 1TU4A 1G41A 1DAIA 2O8FB 2ZI6A 2JIZA 2ZSBA 5KDOA 5FTKA 3IO3A 1BIFA 3CW2A 4MRRA 1W1WA 4O25A 3SYNA 3MWJA 5L3QA 1JB1A 4DJTA 4FMBB 5C18A 5G53C 2IYSA 2R6FA 4UNRA 2C98A 5CM9C 1RW4A 4TMKA 1YRBA 3K0AB 1AQUA 2V4ZA 1MR3F 3VR2A 4US1R 2XB4A 1I4LD 2AXNA 4I81A 3AVXA 3SJZA 2VPPA 1M1YE 4DB4A 5G41A 3WBJA 2YYZA 4ERNA 4RCZA 3GLFA 2BMJA 4D80A 3A6PC 2QMEA 2ZJOA 1II9A 1FTSA 2IUTA 4OQFA 2BIFA 2ZRLA 4C0BA 4JLOA 4ZV4A 2JLUA 2RGGA 1DG3A 1F5NA 2WKRA 3CZPA 3GEIA 3CRW1 1D9ZA 2ATVA 2EFGA 1YRAA 4MYTA 4UJ5A 4BZQA 2CMKA 1PLKA 4MUAA 5CB6A 4PPNA 3R7WB 2KE5A 4I4LA 2CE7A 3NC1C 2JDIA 5DN6D 4W7SA 2V7QA 2CL6X 1N6HA 1Q57A 2WKQA 2ZRBA 3K0FA 4LJ8A 4M0LA 4OL0A 4S35A 2ZRDA 5DISB 2ZETA 2W6JD 4WW0A 2L0XA 4JLDA 2BCGY 1MO4A 1XXHE 4RZ3A 4Q7KA 5EP2A 5JJLA 5FBWB 4CEIB 2IEZA 4M1SA 4MGKR 2FU5C 4CF7A 5EXPA 2ODNA 2R8RA 2ZJAA 1E9AA 3PG5A 1M6NA 1ZD8A 3CX8A 4F92B 1KK3A 1IJFA 1XB2A 3QEJA 3AKEA 3GCGA 5DYIA 3LWNA 1T5IA 2CBZA 4IOKA 3BBPA 1XPOA 3VR3A 1LW7A 2JATA 3B82A 4TMXA 1YR6A 2QGNA 3LA6A 1VCNA 4PZLA 4EJSA 3UKDA 1F2UB 2EW1A 1S9DA 4I1SA 2PH1A 3NDBB 1E2IA 2JJ8A 1UAAA 3R9XA 1II8A 3AGPA 5B58C 4BPBA 4LC0A 4UXJA 4XWOA 1BMFA 4DT1A 5FUYA 2BEKA 1T3SA
chains in the Genus database with same CATH superfamily
1GUAA 2OCIA 3DBHB 3MLAA 4EHBA 2WJAA 1U0FA 3NTVA 3HXKA 4GOXA 2PL9A 4OHOA 4AL4A 3THYB 1QHSA 4OXRA 4ECAA 2QD3A 2QTMA 4EDFA 5C5DA 2Z4SA 3R5TA 4J6EA 4BP8A 4IYRA 1TCCA 4RZSA 1OBVA 3QLTA 4RXTA 3VJLA 1B2LA 5B3KA 1KC3A 1NQOA 3PB3A 1V5EA 2V4MA 4ZT3A 3WIBA 3Q7EA 3LZCA 3GW8A 4YUXA 1XYYA 2FW1A 3PGXA 4KE9A 2J33A 4KIUA 4NZ9A 5HBGA 4F04A 3NHSA 1C1HA 4I14A 1R5JA 3NUQA 3G02A 3GBVA 4IILA 3IKMB 4ON9A 4KPGA 4P4UA 3DPSA 3TR0A 4WFQA 4MV8A 4O2BF 4MQEA 3TS1A 2HPZA 1TCVA 4HWSA 1OKKA 4F4JA 2I76A 2KW5A 3R3UA 3TPCA 5EWLA 1WVGA 3BA1A 3ISVA 1OU0A 1UWCA 2QT9A 3CSSA 4E08A 4EHDA 2BM8A 3H5AA 3OCZA 2GILA 1B8NA 2KB0A 5BN4B 5JEDA 2W58A 4NFYA 1HQCA 2YY5A 3EMVA 1SQ0A 4P98A 1PDOA 2GFHA 4PSVA 5EJ9A 1Z2CA 2WF8A 2YQZA 3F78A 1F14A 1VA5A 1ZICA 2PV0A 3Q3IA 3B9PA 4IGIA 1CYEA 1N75A 2QZJA 1P39A 1N33B 2D7CA 3H13A 2CWWA 3HWSA 3OM8A 3ZKWB 4C01A 1KEWA 1PFUA 1S4MA 3BGOS 1ULBA 4A6EA 1JEJA 2O14A 3C1TA 3Q9UA 3LVFO 4MGHA 4F4FA 3JAMA 1A1VA 3RSQA 1RI4A 3VOAA 1VRWA 4I6EA 2PZBA 2V97A 4YC7A 3TQCA 2J9FA 1KY5A 3O73A 3WYDA 3I09A 3W5AA 1NBIA 3P94A 2XUJA 3RFCA 1OLUB 1PN3A 4G1FA 4PLTA 4H60A 4WMLA 3GVCA 1NVWQ 2PTHA 3HABA 4FCWA 4KWHA 4OMCA 4OQEA 4ZPJA 1PTJA 4QBIA 1UOOA 4LXIA 4YRNA 5KMGB 4IKPA 2Y77A 3UYLA 2C99A 4XD7A 3ZCQA 3VZCA 5LKRA 2ZKIA 5SZIA 3UJHA 1M2HA 4ZO7A 5KNBA 1VPLA 4M9ZA 1BTOA 1JTEA 4OLBA 2A86A 4FD3A 4KACA 1W36C 2EC5A 2R6R1 1PW5A 3IT1A 4AKHA 3FDZA 3BGVA 1PZGA 4ZOLF 5HYVA 4BFVA 5HZKA 4ZOAA 1NLFA 5DHSA 1VE3A 3WLFA 4Q9HA 5THKA 1RPJA 1Y4UA 3WDKA 2HNBA 1YS7A 5TGDA 5TR9A 2OZLB 4M9SA 3G2HA 4TMVA 4UBMA 5FNVB 5C1DA 3QE9Y 1RKVA 1JJVA 4OX9B 2NTYC 1DKQA 1N1DA 2CK3D 5CLFA 3IJEB 3ESZA 3LUHA 3Q9LA 2Q1TA 3IQHX 2QYTA 4O08A 1DXYA 3UAVA 4CIXA 4XDGA 3HPRA 3MS7A 3UOAB 3SQWA 3A9CA 1JDZA 1E4OA 2RHGB 2XPCA 3LWDA 4GBMA 2XW6A 3X1ZA 5KINB 4ARVA 6ADHA 4WBXC 3FVRA 2RJ3A 2PR7A 2XUPA 4HQLA 3ZBTA 1QYWA 1Z6AA 2ZXFA 3N0XA 1VBFA 2XYHA 3MSCA 4NARA 4CN8A 1FTYA 2O4CA 2QQEA 3R1IA 4KE6A 2V1XA 2E21A 1XJ5A 3SEFA 3GLGE 1Q11A 2A5GA 3DT8A 3I3OA 4YUVA 5F7XA 4XIFA 1GD1O 5KYKA 5HSGA 3T1VA 5JISA 4JQSA 4O0LA 4BEBA 4NULA 2HMUA 4ZDIA 1TTTA 2JA2A 1CB7A 1V16A 2HSJA 2VBIA 2ZBQA 1I1NA 1OW3B 1P4RA 4X1YB 3A9UA 5H5JA 4BNGA 4CM8A 4JYCA 5C8VA 4B4OA 4JNKA 2D2IA 4AS2A 1Q95A 1K8XB 3DBHA 3RVJA 3GQVA 5FOXA 4GT1A 1YS4A 5A3RA 1U9IA 4PYQA 1FLNA 3JQ7A 3C15C 4KVAA 3E23A 3FNBA 3TM4A 4C6TA 3SNKA 2QLTA 3AL3A 1K7YA 1PL0A 4ZQGA 1BGXT 4FZ3A 3RSLA 4FHGA 5JC8A 2GUGA 1U4SA 3NBFA 1UOEA 1JEQB 2FVYA 3SF0A 2AOTB 1H2RS 3OIFA 1HKHA 5GONA 2CJPA 5A62A 3WMWA 1QH1B 4UBIA 5LQMA 4EFMA 4B1FA 2GT1A 4ITRC 3H1BA 4LE2A 3EVGA 5LSAA 1GPMA 1MXHA 5EFZA 1JQDA 3DZFA 1ZM2A 5BNZA 1Q1QA 4R69A 5IN5A 1R8QA 1QP0A 4NU8X 3PQ7A 1HFWA 2ECPA 1D6JA 1W9MA 3M9XA 3H9GA 3U7QA 3DMDA 4MQEB 2W6MA 2FEPA 3R44A 4EY4A 4YK7A 5FAKA 3NRBA 4UCXA 4BQEA 1KAEA 3MWGA 1NT4A 3BORA 3EXFA 4LSMA 4OHFA 2IV7A 3TNYA 3QOXA 3SSOA 3UATA 4S3MA 5AKEA 5GIPE 2R7MA 3M9LA 3G0GA 3OT1A 3HZOA 1RLOA 3G9XA 5TX7A 5KYXB 2A88A 2PLFA 4X65B 4KSYA 4QOIA 4FHDA 1CUEA 3NBAA 1U7UA 2RJOA 3LP6A 4R1NA 4AURA 1EP3B 1HY3A 1CVIA 2FQQA 5BN3B 4WH0A 1JFVA 4N3AA 3PPIA 3IQGX 4MUEA 5FPPA 5EJ8A 3SQMA 4PVDA 1L5SA 2GTIA 2IE8A 4TVKA 1D03A 4EITA 2FMKA 3I6QA 4Q1FA 1ZN7A 3OP4A 3IBCA 2JLXA 1QG6A 1HLPA 2R62A 2BFDA 3ACCA 4UM9D 1TLLA 3EXHB 3RWOA 5BSHA 5C1PA 2R6HA 2BFWA 3V55A 2AUNA 3VMFA 2MMGA 3PDIA 3EGXA 4RK4A 2V8OA 3RVLA 5JD5A 5KOHA 3SHWA 1WLYA 4OHYA 3RSFA 4ZAGA 1WPQA 3HSSA 2PS3A 3PHHA 2FPXA 3LSTA 2A92A 1B8UA 5IT5A 2JLZA 1W2WB 2ETVA 4HZUA 4YALA 1ZK0A 2H00A 2CNWD 3COWA 3G1UA 4GR5A 2CLOB 4XLTA 1IHDA 4A0RA 3DZIA 5CVVA 2XRFA 4NEQA 4F2WA 1O1YA 2RHDA 1JLSA 2A5DA 2BMWA 1SM4A 2HSZA 2JDID 2QSYA 4YJ2F 3G8CA 4JLUA 4YQZA 1W19A 5FA5A 3VO2A 3UBTA 1MB9A 1B42A 1XRRA 2JJ2D 3AVOA 4Q93A 4AN0A 4C7OA 4YUYA 1H8ED 4GE0A 2VJPA 3TDKA 3UT5B 4CM4A 4IMRA 4DBLC 5MN4A 1S3SA 3IPCA 2X0EA 1C8VB 1EXVA 4OBWA 4Y2TA 3I5YA 4NCAA 4WVFA 5AKXA 5FNVA 4IP0A 4LA4A 3IO5A 3WIEA 3L6CA 2JPDA 1NVVR 2ZUVA 2IIPA 3ICCA 4B73A 1Y1KE 5ALQA 4DA6A 1GZHB 1GV0A 3LQRA 1EUCA 3HA3A 5KKCA 3PC7A 3INNA 1PV4A 4ZU3A 1IG3A 1NPTO 4G5RA 1D6NA 2HT6A 3DFIA 4Q6BA 3VYUB 1GWNA 2YN0A 1TA0A 4RJTA 3LRPA 4CKCB 8AT1A 1ZDMA 4Q6WA 2J9RA 2B8EA 4JKYA 2DPXA 1AM4D 3AJ8A 4IIEA 4OGKA 2GNPA 4CM6A 2HA7A 3LIIA 3GFPA 4W1RA 1TM7E 1XD8A 1K7EB 2YJNA 4WK2B 4YJGA 3RS0A 3S29A 3T5CA 4DLSA 4MWTA 3AEUA 3HXPA 4AYXA 1IFXA 1TEVA 1JHMA 2IHKA 4BGVA 2EDAA 3PUIA 1QBKC 3L7MA 1ONOA 2P2LA 2PDAA 2X2FA 3PJDA 2MSCB 4MWSA 3U9SA 3UXEA 4ZI7B 1LK7A 2XKAA 1PEAA 2CFCA 1XTBA 1ZNYA 4X1YA 4X45A 3GLHB 4B0PA 4C88A 3P4YA 1NN3A 3O8RA 1BX3A 2DQZA 3NGMA 3VZBA 2OWDA 3QYJA 2JHGA 4HGRA 3A1UA 1GNSA 3KB8A 3CLVA 3QPUA 5FR2A 1DV1A 4OL9A 2AVNA 5LA6A 4QDOA 3HKBB 4RK1A 5IKOA 2C0PA 1Q7EA 2NXEA 1T36A 3GY0A 4H6XA 5AXBA 5H0IA 3RS4A 3Q0TA 3CONA 4FHFA 1BDJA 1N2ZA 5AJUA 1XI2A 2O1XA 1JKIA 1NVVQ 1KERA 3OO0A 4RESA 1YVEI 1THMA 4OGWA 5EUBA 3SX4A 2VQ6A 4R98A 1I2MA 3OOYA 3BWMA 4BUJA 5IJ0B 1ZAYA 1TT5B 2GR9A 3JD0A 1HO3A 3PGA1 4XX1A 4A0HA 2VKQA 1U8ZA 4PC6A 4Q3EA 1KAGA 1YUBA 3QG1A 3HFRA 1NFRA 5CA0B 3LPLA 1QYCA 1X8JA 3HBJA 4JGBA 4FYVA 5J23A 2ID7A 3VNAA 5EZ6B 2Q3BA 3ZDFA 1TMKA 2F1JA 4AULA 1Z74A 2VJKA 5BURA 3WFIA 1EX9A 5AXCA 1KHHA 4AUEA 1RT9A 5KDDA 4DNQA 3IUEA 3DEHA 5CDSA 1ECLA 1E4EB 4LOKA 4V02A 4EELA 1H9CA 1ID8A 1I7PA 4Y2GA 3DGFC 3L0ZA 4C5AA 2PO7A 4WFJA 1QIIA 4FK8A 4JX9A 3N5CA 4HNSA 4X3PA 2CLMB 1HSZA 2D0OB 2LE0A 2GXQA 1HT3A 1JDNA 4I55B 4QUAA 4Y2XA 1GQSA 2C95A 5FUQA 2PRKA 4YCMA 3Q5EA 2Y4OA 5I45A 1K63A 3DEYX 1E79A 3N0WA 1GXSA 4IDNA 3EWNA 3VQTA 1O2DA 4BNHA 4F2PA 1YQ9A 4LF9B 3QU9A 4X3CA 3C5WP 2P3OA 4R1TA 1MLDA 3IR5A 5GM2A 1BW9A 4B84A 3F4KA 2ZJBA 3W7VA 1XKXA 3A6GA 4ZC1A 3NT5A 4GSKA 1RKQA 4DNFA 5DBGA 2C82A 1M74A 1P6UA 2WC1A 3MGGA 4P93A 3HB7A 2YNMD 4KNWA 4O4JF 3C6YA 3IJPA 1NAHA 2IEAA 3QNWA 4EKDA 4POAA 3QU4A 5DHUA 4M37A 5IAEA 2F2TA 1QB7A 2YJZA 4IKOA 1CX9B 1LPSA 2XT0A 4LQ4A 1RJDA 2IYQA 2G6BA 1XYGA 2EHJA 3IHTA 3KZKA 4I46A 1F8UA 4DIOA 4QEKA 5AOAA 4YXFA 2ID9A 1XA3A 5BV7A 3DTTA 1EBFA 3MXTA 5J4HA 1F6BA 2XDWA 2OCDA 3DMPA 1M1UA 4IHAA 2CUZA 4YCLA 1Y8QA 2WJVA 5TC4A 3P9KA 3TIIA 3GJXC 3SVTA 4OA5A 3AVTA 1QDUA 2R1UA 1RLJA 3GDFA 3CG4A 4DQ0A 4RQAA 1OH6A 3GCZA 2OCGA 5I9NA 1Y82A 5M04A 4QGBA 1EAMA 1KYTA 4FTWA 2J59A 1NKTA 3QKSA 4MGYR 2ZB2A 2BKVA 1SUEA 1U2RA 3B1KA 3IDAA 2O3QA 3IQWA 3JTMA 4KN9S 2XJ9A 1P4SA 1PI3A 2YXPX 4R7ZA 4UUQA 5D3KA 4R1OA 5H9VA 4BNNA 4A7PA 5DMXA 2I1VB 1VHQA 2RH8A 2FF5A 3T0GA 2D62A 1N7HA 4RBNA 3QOWA 2FJ0A 5ICSA 5L6LB 1EFPA 3NBZC 3OSZA 1QDLB 4MV9A 1EX7A 4X1KA 1Y6ZA 4UBNA 4DCUA 4JOQA 4KWEA 4QICA 2XNDA 3UQZA 1DS6A 5BV0A 7YASA 1SUPA 1K6MA 5DM4A 5A02A 4JZKA 1TVMA 4LCEA 2IYLD 1S2DA 1RMQA 4EW3A 2X8JA 3GRKA 1CC1S 4HQFA 3B2EA 4R9SA 2J30A 3B6MA 4P3YA 1A9ZA 2GARA 1LCIA 4EG6A 1IB0A 1T2NA 3FF1A 4PBSA 3V3KA 1XDBA 2JFXA 2E4XA 3S8YA 3CF6R 3WIUA 1Y33E 1CF2O 5AI9A 4F9FA 3I1YA 3KEGA 1MQ8B 4KLRA 2H7CA 4I2VA 3WQRA 1FE8A 4J1TC 3H99A 4CM5A 1TT5A 10MHA 1F0NA 4LMBA 3LLUA 1JTFA 2QLBA 3NAGA 3TUZC 1DJQA 2PGJA 1K7FB 2JIOA 2NSLA 4O1HA 3RUCA 2RGDA 4I50B 1HDOA 3MRSA 4DYVA 4D46A 4N9QA 4TWZA 4LHXA 2D06A 3LKVA 3UY4A 4JUAA 1NBMA 2Q2WA 4NQRA 3Q85A 1EM8B 4PYNA 5ARDA 3RSHA 4UPVA 2Q3DA 5JI2E 5JAHA 4DLRA 2OM2A 3AZQA 3IQDB 1VIAA 1CQIA 4MLDA 6REQA 4JQCA 3PBKA 3SBOA 4DCVA 3FNEA 1ILWA 3GRVA 4G4IA 4LVUA 2ROQA 3CPSA 4GSLA 3TLXA 4EHFA 1JHUA 2JRCA 2P35A 4L4XA 4OGLA 3K71B 3BMOB 1BMFD 3ZZMA 1D2AA 3GQBB 1L8OA 5FWYB 3A3YA 1JXAA 2PWYA 3PQEA 4JJ4A 4B40A 2BE9A 2X9VA 1DQNA 4GXRA 4N82A 2JIPA 3U62A 2BN4A 2JFHA 1DELA 1NBMD 2PKQO 4GGMX 1U9ZA 1MRNA 1YFZA 4EGFA 3DKKA 1SK9A 4QBTA 3OUUA 4PRLA 3GGSA 1QV9A 3U4GA 4L07A 4H7IA 2VT7A 4UEWA 2VYQA 5JSQA 3IJ5A 2ST1A 4LGCA 1NR1A 2FFHA 2HQRA 4L9AA 5E95A 3ZU4A 4D6PA 4JI4B 1C4XA 2WMDA 5TJ9A 3VU8A 1MH9A 1M2JA 1EU1A 2J9YB 3JALA 3K1TA 2OXRA 4NCXA 1H1LB 3SM3A 4D81A 1GZ3A 2A8YA 2G88A 5DWQA 3RFUA 5ALSA 2NU9B 4J3JA 1HE8B 2AE2A 3K9LA 2OGWA 3PPWA 1WB9A 1E3WA 5B64A 5U9CA 4XGRA 2FMFA 3IL2A 1VLVA 2Q07A 2F7SA 4I9FA 4ARUA 3BD6A 4ERXA 4ZYUA 4MIKA 4PZCA 3DMGA 5FLYA 4NJEB 1HXHA 4HPJB 5I8WA 1BFKA 2HA6A 2H16A 3L41A 3SU8A 1NRIA 4UZSA 3KKPA 3ZH9B 4RW0A 4ZCMA 2HA0A 5IG2A 4N0PA 3OQJA 3D4IA 5EJ2A 3EFEA 5HIAA 2JBAB 4G2NA 4JC4A 1Y8QB 1PS0A 4RL4A 4UE6A 1ENOA 2W9XA 1K8QA 3C8MA 1C29B 5ER9A 3KELA 1RYMA 3AVPA 5K20A 1RQRA 2W2KB 4OLFA 2JGDA 5E7MA 3ZCTA 4RPKA 4I5IA 4ZT6A 3KV3O 2ZIGA 1D2GA 1XRNA 3K6KA 5JROA 2BF4A 5AVZA 3FYCA 4G36A 5DI3A 3KWLA 1RYBA 1DJMA 2CGEA 5JO0A 1JAZA 1NXVA 1DQYA 1FFSA 4YH1A 3WJ1A 3ZQJA 3N70A 1PYGA 5FQNA 1X38A 1EQ2A 2AOVA 1PCXA 2Q50A 3ZXXA 1YZUA 1P1KA 3BH7A 1UMCA 1M2OA 3A36A 5CVCA 2IHJA 3UTCA 2YWDA 3UXMA 5LQRA 3AZPA 1MZPA 1M34A 2HWUA 2VUTA 2J3IA 2VYFA 2CVHA 3DEZA 2BLNA 4WKCA 3PSAA 1E5TA 2YDXA 3GT3A 4KQHA 5AI4A 3WGYA 1H0HA 3UO8B 4CT5A 2H5IA 4TT8A 3A1CA 3IP5A 1AJEA 4FW8A 3OKPA 4L27A 3EQ6A 1N9GA 3GAZA 4OF4A 4QPNA 3V8QA 4DR6B 2GBLC 4R8SA 3ZCSA 5JTUA 2GA8A 4Q82A 4DIDA 1Q1NA 3ND9A 4J1SA 3HUUA 4RKWA 1ISSA 1VI6A 1WMEA 4Y2VA 2MIIA 4PZYA 3RVQA 4AUKA 4LHZA 4AWXA 1M6EX 5HEKA 5HKKD 1U99A 1QHIA 5JPIA 1DG1G 2XUKA 1UBRS 1T2DA 1J2EA 2K87A 1LLDA 3KPWA 5JNSA 4ZTUB 3G89A 4R0MA 4NK4A 1L3BA 3EIEA 3HGTA 3VR5H 5GONB 3RRJA 5KTNA 1LFDB 1JU3A 2DQYA 3H11B 2PVCA 2GLTA 3S2EA 1ZUNA 2VHZA 3IPYA 3S40A 1OKKD 3W0LB 4IRMA 3B1ZA 1RXIA 3PXEA 4MQLA 5K45A 4HO1X 3DNFA 2M6SA 5EZYA 1U4OA 3C74A 2Q4BA 3EEFA 3Q2KA 1I2ZA 3QKWA 4J0QA 4RY8A 3TB6A 3TZEA 4B3RB 3R3JA 2ZS8A 4W5JA 4EA9A 1L5MA 4O4IF 1ZW1A 4KYVA 5FBWB 1XLUA 2K7FA 2OCBA 4KUHA 2CVQA 3GFBA 3LMKA 2C3PA 1QIDA 1S4QA 3CC8A 1C1DA 3DUWA 1JP7A 4E5VA 3QQ5A 4BATA 5T5QA 1RXVA 2V7VA 3K5IA 3ZZ0A 2VYND 5BN5B 1ZINA 4HK4A 3H1TA 3CX7A 3CHYA 1N0WA 1YDHA 1H6AA 2BHRA 2RBGA 4KQMA 3VH4A 2IP4A 1FBTA 3IT2A 2H7VA 4IJVA 3WDMA 5I7HA 4PN3A 1USKA 5FOUA 1QFXA 3GHHA 2D5AA 4XJXA 4BX3A 2EWMA 1HQKA 1HETA 3ASZA 3QMWA 1ZEMA 3T4PA 1IM5A 4TN1A 4AMZA 2Z4RA 4LMRA 1L5YA 1USIA 4PNHA 3PF8A 2YWFA 1G2IA 3EZ9A 4QPJC 1FS5A 1YRYE 3DFKA 3EW7A 1O8BA 3PRYA 4P38A 3X44A 4EQ6A 2ZI5A 5KOHB 1XCBA 5KJEA 1H1LA 1CIPA 3VR5A 1J2RA 3VPCA 4D8VA 2AV6A 3QENA 5EVJA 1TJ3A 3S68A 4HR7A 2EXXA 1VECA 2OGZA 4ARSA 4JOBA 2C3OA 3LY5A 3I4LA 4YAEA 1IM2A 2ECOA 4H17A 4DFDA 5FR1A 3SVZA 3S70A 1WUJS 3AEQB 2O54A 3ME5A 4F91B 1ABEA 2FETA 2SCUA 4ZO9A 2PX6A 3CF4A 1DKOA 1YR3A 4NBLA 3BILA 2LBPA 4GD3Q 3CU5A 4P3KA 1PJSA 2IZ5A 4KFRA 3RC9A 4UVHA 3OIVA 4HLDA 4YFYA 3UFBA 4KHZA 4F45A 5ADUS 3W5CA 3OJOA 2J5RA 3KPJA 4S0XA 1P44A 3DONA 2PKQP 1SN7A 3HI4A 1WAMA 3D2CA 1MTOA 4GNKA 4KVGA 4ZWNA 4COKA 2BFAA 1VE6A 1B1AA 2FNAA 4DCGA 1P7YA 2RG7A 5DFAA 5I7WA 1UKEA 3CLRD 5C35A 4N3CA 4A15A 5I7AA 3WIVA 5HCUA 1KYZA 5LP1A 5ES3A 2O5CA 4CLOA 4O4LA 3P0EA 2QAJA 4JBWA 4MV4A 3N59A 3SEQA 5JAZA 4ECEA 5IHXA 4GPEA 3GLIB 3G13A 4MP3A 3UK6A 5HK9A 1QOQB 1W29A 1RDFA 2QNIA 4R4JA 5G4LA 2NN3C 4C0HA 5HM8A 4BBPA 4Q4JA 4XRRA 5IUNC 3WNDA 2ONKA 4UHKA 2OBYA 3UNXA 1D09A 1D2NA 2XKKA 3I2HA 5HK8A 3WJ7A 1MW8X 4BVJA 4PAGA 4TTVA 3K16A 1TT7A 1RPTA 2ZIFA 3HJHA 3JAWA 3LL4A 3NYRA 3WWYA 1P9LA 4RMHA 4DUGA 3OAAD 3D4PA 1LDNA 1KDRA 3PHCA 4ZALA 1X7WB 4I4TF 1EVEA 1WSAA 3WXMA 1R6UA 1EVQA 1NNI1 3IRVA 3ROXA 2VF2A 3IMKA 4NZMA 3V3TA 3QV1A 4UMDA 4CQMA 3JY6A 1YBMA 2QW8A 4AU1A 1H0KA 2DUUA 1C81A 2C4MA 1NJ8A 5HNKA 3I58A 4QZVA 1CUDA 2YVAA 4GX1A 5DE3A 5EQTA 1O5IA 1ZD2P 4FC6A 4RIFA 4CFYA 2VFAA 2H5JA 2P9FA 4B7ZA 1GQYA 3CE6A 1YJXA 2C4HA 3FFAA 3PC8C 5C80A 1P1FA 3F9CA 4QXRA 3MTQA 4TSFD 3RLIA 2CEKA 3RS3A 4Q18A 3RT7A 3QXGA 4CMCA 4NBSA 1I4OA 2R2GA 2GESA 5AHRA 3T4EA 3RVKA 1IU9A 5SY9A 3GCDA 4GZMA 3D6VA 4UHCA 1DWQA 3TW6A 1I4TD 1SD5A 1E0DA 3ABQB 1W88B 3UHJA 5K0CA 2GLUA 3FHOA 3OZAA 2JCBA 4MNTA 5BR4A 2ZUFA 5CG2A 1UJ6A 3C3CA 4WWHA 4XPIB 1EXMA 4BRUA 1VMKA 1RLIA 2D0PB 2HF9A 3E2PA 2QUBA 1JFFA 3A3NA 1EAYA 3FGZA 3LF2A 4A5SA 1VYUA 3R23A 1R50A 4UW9A 5LA6F 2F64A 4DEYA 2GUWA 3UH0A 1BDHA 2WM9B 2VQSA 2X4IA 2XNCA 3DOCA 3AETA 2W2TA 3T9AA 3A2KA 1ZH6A 2WWXA 4HQ0A 4HX2A 2EJTA 5T8KA 2R87A 4AKEA 3VR5D 2B4TO 4DBZA 1FXUA 5JLAA 4P4NA 4WBNA 5A5EA 4WK6A 4YI3A 3I2KA 2G0AA 2QJTA 4CKBB 2REQB 2ZT7A 3PWSA 4YP0A 4L9SA 4U00A 2WIKA 3I5UA 1U8UA 2VDUE 4P58A 3KLBA 4Q3OA 3UCXA 1TIBA 2OZVA 4KSBA 1CBUA 2IDZA 2Q4TA 3H2IA 4XQ0A 4BNTA 3BUSA 1LBSA 1PKEA 5JDIA 5CFQA 4GDFA 1UCFA 5BSWA 4AG3A 4CW7A 4PZ9A 2OLKA 3FWNA 4V1CB 5EIHA 1K4MA 1W44A 2IIVA 3GD7A 3VAYA 3AFOA 3GXBA 2QDXA 4U1RA 3W2EA 1M6VB 3ZIUA 4RV9A 4KWTA 7REQB 5ED4A 1QRTA 3D1VA 1RWQA 1SU7A 2OGTA 3G49A 2PS1A 4IWYA 1M1NA 2VSFA 4RHXA 5MN6A 4OQ4A 4U2KA 1NP7A 4WXYB 1ZJ6A 5J63A 3TBHA 3OTOB 3CA8A 3OTIA 4YONB 1TJYA 1WHSA 2XX3A 2GFIA 4RLQA 2LRHA 1GZUA 2D5IA 1FUEA 2G4VA 3L4BA 3PK0A 3Q6NA 1M8PA 3H8SA 5AM3A 4U0JA 2GQ0A 1QUEA 1KJJA 1V47A 2JFOA 2P75A 3IV6A 4L75A 4M1OA 1QTQA 4MICA 4KBGA 3IUNA 2J31A 3G5AA 2X5XA 4P9NA 4Z9XA 4G0WA 4PRKA 1JA0A 3JR7A 1FQJA 4QATA 4II7A 1CY6A 3I0NA 5FBZA 4LCBA 5C34B 5DOVA 1ECCA 2Z4TA 2P6PA 4XX0B 1XQVA 1K1EA 1XZLA 3AUKA 4UMEA 4LMAA 5IM5A 1MDBA 4IHKA 4Z1MA 2M2IA 1F4PA 1KNXA 3NM4A 2CHQA 1RC1A 3S1AA 4IHJA 2BY4A 1OXXK 3TW0A 5LMUB 4IOLA 3OLQA 1Q7CA 1SU4A 3QXXA 3RG2A 3FA2A 3KSBC 4NBUA 4NOMA 2LP4Y 3CLKA 4Y2PA 1HTBA 3KJQA 3LCMA 1ZHHA 2JEOA 1NF8A 1DBWA 1DVRA 3SXPA 4M60A 1BRTA 1QGZA 1X13A 4FEGA 2C7PA 1X14A 3P2OA 4RYLA 1GO2A 2H2WA 3PIRA 4TM8A 4IOJA 2JAWA 5A6SA 2HSGA 5AVSA 3THRA 5GOZA 3R3YA 1AHPA 1G7CA 4O2AB 5GJWC 2Y92A 4DDWA 3WWPA 1J22A 2XLCA 1A8IA 5CAEA 3R24A 4DWOA 1XRSB 2P6MA 1DB3A 3O2QB 1DJPA 2CCJA 3IRUA 4YX9A 3ET5A 1PG5A 4WUVA 1KI6B 2PU5A 4OI0A 3ZD8A 4EG8A 3F2VA 4CLRB 3AU8A 1ODTC 2B2XA 1Y5IA 2NAFA 2OFPA 3EBLA 3F5DA 3BQ9A 1O97C 4I66A 2AWNA 2EQ5A 1H2BA 2VWQA 2W6IA 3B3QA 2KHZA 3H2HA 2Q0HA 3LPCA 4BFWA 4CUKA 3V1KA 5C7OO 3HXLA 3S81A 2MSKA 1PTJC 3E70C 3HC7A 2WWVD 4LJSA 1QH1A 4WLFA 3D6JA 4Q1CA 1KH2A 3PPVA 5FYQA 2JF0A 1PV1A 2MR5A 1EFUA 2V5VA 4J90A 2A0YA 4UHBA 2J85A 5TY0A 3WMGA 5CVTA 3EVBA 3ND6A 4C87A 1O08A 1NNLA 1Y63A 3KLPX 5FTNA 3QVGB 1PT9A 5CCBA 1HE4A 2HGZA 5L3SB 3LX5A 1X1AA 4G1MB 4G4GA 4KFSA 4MQ5A 2J3QA 1F4LA 1Q22A 4B6RA 4BVBA 4LWPA 5CBPB 1IEVA 2EJUA 3ES9A 2Q2QA 4OHPA 5REQA 1XHFA 1EXNA 1W88A 1XMPA 4D9MA 5GONF 2O06A 2YYAA 5GVSA 3IERA 3GZNB 3ND5A 1CS0B 3NWEA 1B00A 2PT6A 4QEZA 5KYXA 4Y1EA 3KZCA 1DKNA 1SR8A 1X94A 1DXOA 2R85A 5CPBA 4M0PA 3RVBA 3TOZA 2BKEA 2C7VA 4QYIA 2DXIA 3S3TA 1NXQA 3STXA 1OREA 1T2CA 3HSKA 4FBMA 4WAUA 4ZAYA 1KFCB 1ZM4A 2YY6A 1XDSA 4HDKA 4AF8A 4B48A 4JQZA 3QBTA 4DIEA 4YRGA 5KC9A 2NX2A 4MCHA 2QVLA 3I6IA 1OJ7A 2QI9C 1U2ZA 2QNBA 4PXSA 4WNIA 3VZQA 3WGZA 1VHWA 3OMLA 3R74A 3THWB 1KGDA 1U1GA 2B94A 3BXXA 3KQVA 1SBYA 4I7EA 4DHEA 1SUSA 1YHZA 1UKVY 2RAPA 1LW6E 2KLHA 4H0NA 5H68A 5IM4A 4EH1A 4EJSB 3JQBC 1NLMA 4JA0A 3MM4A 5BVGB 1V5GA 1M0TA 3B1WA 3JALB 4LMPA 1P7ZA 2C5LA 4YO7A 3W8NA 1M33A 1O54A 2K6GA 5UKDA 5CM2Z 2QMOA 4DXHA 2OWEA 2D13A 1FMCA 3OU7A 3P9ZA 5KWSA 4B3GA 1ZIOA 2J3DA 3A6ZA 4G5SA 4YMHA 3ABRB 3UJ9A 1Q16A 1COWA 4QODA 4YFVA 4YCDA 1NLZA 3UWKA 1RI2A 4XVUA 2IOQA 3VDXA 1JHOA 4HATA 1UDAA 2AX3A 5TIIA 4P4LA 3EQ9A 3R0JA 4PG4A 1X7XA 3C4JA 2PSJA 2ODTX 3ANTA 4YAWA 4EYOA 3P2YA 3RC8A 1DCTA 1EK0A 1VSUA 3BIFA 4AICA 4H59A 5JTTA 4AIRA 4EPVA 2PQ6A 2G9QA 5AO9A 1P2FA 4R3NA 3BCHA 4JC8A 2UUAB 3KHUA 1JYSA 2E3JA 4HJRA 3UXYA 2MU1A 4IDHA 2OHGA 3E48A 1V45E 1PR9A 1XR3A 4KDRA 4X7BA 2VHVA 2DG2A 1ZUIA 4XUGB 4EHNA 4M99A 4UMVA 2H1FA 4MUHA 1E4VA 5IHPA 1LPNA 3OPYI 1AQJA 1NMXA 5LN1A 4FYKA 1MX5A 1Y80A 2E2WA 2HK7A 4FGJA 4ZVTA 4BU0A 1RJFA 4CG0A 3TJZA 1ZC4A 2PA3A 1D8TA 1TK9A 3CF4G 3PC2A 3PNPA 5JS2A 1JA9A 1GCAA 2YH2A 3GFQA 2O7RA 4W5HA 2Y68A 5EUQB 3IIKA 3MUOA 1KEKA 2ZR9A 2WG2A 4N8EA 3W3AH 5HDBB 3E5HA 1NQTA 4M36A 2RSLA 3NEPX 4MKGA 2WTMA 1T5HX 2C4NA 2CDBA 1Z2EA 3B1YA 4GDMA 3COJA 3ETDA 1E2DA 2IF2A 1EFTA 4FEAA 4JYPA 4MPPA 1Z6TA 1GPUA 4NE9A 4ZFNA 4IDQA 1QK3A 1ZSYA 5FIUA 3ZXSA 4MR8A 5IC5A 3ZVMA 4DJ5X 4ER5A 5JQWA 1T8TA 1TJNA 4A82A 3CLTC 4AY2A 4FYHA 3ZHRA 5FEUA 1BMQA 3HCRA 4DY6A 1M0WA 4LQLA 3UOWA 1S8AA 1Z6XA 3R8CA 4C1NA 2HJWA 3H2YA 1FU4A 1W5TA 3GGPA 1UMKA 4NV1A 2PZKA 4DCSA 3AYZB 1Y5MA 3WLLA 5F3WB 2E4UA 3H65A 1DKRA 4HNAA 1T26A 3DV0B 2OG1A 1T15A 3L4SO 3N07A 4I2NA 4N5MA 5EZ5A 3UUGA 4BASA 2Q7DA 3MA0A 2HSDA 1VYHA 5AW5A 2C2XA 1E92A 3DVSX 1E0SA 1NP6A 1FVOA 4YRJA 2G07A 3OFKA 2ZYAA 1A7JA 5FTLA 1UP4A 1R27A 3RUAA 1BE1A 2PYDA 3EAGA 2FSUA 3R6DA 2ZIUB 3M4ZA 3HVUA 4MDHA 2BFBB 4QYIB 3W6OA 4ER3A 1ZVMA 4K03A 5BN4A 2JKZA 5AP9A 1CQXA 2OKGA 4QWMA 3OPMA 4Y7CA 5FUBA 1A04A 1UBJS 4ADSG 3PCRB 2F9MA 1YK0A 2I8AA 3TK1A 3OZGA 5ALIA 1L7EA 1UWLA 1ZGJA 3EA5A 3QTTA 4J07A 2Q4OA 2YCBA 3EC2A 1YDWA 5LUBA 4DABA 2J0UB 1UBEA 3KAQA 4RH0A 5JNUA 1UINA 4DILA 1FP6A 5LD2C 1OLSB 3DMYA 5C1IA 1OH7A 2OYCA 4FINA 4R6WA 521PA 3EC7A 2YKGA 2AN9A 1XEXB 3FIUA 3GRUA 5FBHA 2JCXA 1M2GA 3QM1A 2H52A 4Z7NB 3QSYA 2VAWA 2VPTA 2AB0A 2Z2KA 1E66A 1P81A 2L2QA 2O52A 3GUUA 3D3JA 1SVIA 3ROQA 1T5LA 1EIZA 1U0GA 5JYCA 1ZX1A 1KQNA 3RC7A 4KQ9A 3DMTC 4S1WA 1OSNA 3UC9A 1XU9A 3VO1A 5CFMA 1PK7A 1XZDA 3G68A 3I61A 1X3LA 4R2IA 1MF7A 2Y67A 4WZZA 1WUKS 2FE1A 2FPIA 4AVYA 2XGGA 2PWBA 3CXUA 4BMDA 4CT0A 4RZ2A 3NGLA 1QO7A 1RXYA 1YACA 2IW3A 1FRQA 4PQFA 4ZMBA 1JWBB 4Z53A 3TQHA 1QHHB 1C9EA 1BQ3A 1J2UA 3MLBA 1DAMA 4MJLA 2DTXA 2Z9BA 2Q1WA 3REGA 4AJ9A 4F11A 4NPHA 3DHVA 3PNBA 1E7MA 4D7AA 1NE2A 1ZXBA 2YHSA 3LUJA 4Q0MA 5C3UA 3FRHA 3KSDO 5ALRA 3UV7A 3EZXA 2WUWE 5HS4A 3L7KA 3TLMA 2HY7A 1Y3DE 1QOZA 1VG1A 3AP2A 5ES4B 1DUSA 2BEVB 2FRDC 1ZCAA 4HOYA 3UGQA 2B8WA 5HKKA 3V00A 2UZ0A 5EUCA 5HJ2A 4IIXA 1SCQA 1TM3E 2R25B 1UM8A 4NCNA 3TKAA 1DRWA 3A58B 5IJAA 4TYNA 2BW0A 2VNSA 5ECWA 3WJ2A 3GT7A 2IYWA 2XWBF 4B31A 5A4AA 3GJ3A 1KI1A 2NP6A 2WR8A 1XGKA 4NJMB 4FEYA 2OXEA 1FDOA 4Z0NA 4OK6A 1VCIA 3T9FA 1X15A 2GZHA 5T4BA 4ES6A 2ZCVA 4UMFA 1C41A 1P5RA 3A6JA 4NBWA 4RQTA 4N18A 3KD3A 5M3BA 3HYRA 3TQFA 1O89A 5C8ZA 4HRYA 5JQGB 4CGZA 1YBVA 1L8QA 2I33A 1MHPA 5JWOA 4PC2A 1BD4A 1C14A 1OILA 1POWA 1DO8A 2B25A 5D1HA 4YRIA 4NV3A 5AVVA 5TVGA 4EMUA 2VAMA 2ZT5A 1OYYA 3MBOA 3AW8A 4MRMB 4B6GA 4IFIA 2EKZA 2G9UA 4QQRA 3WRXA 1KE2A 3L92A 4U7JA 4DLZA 1G59A 5HE8A 1ODCA 4FHEA 1TU3A 4CGYA 1HL7A 2N75A 2POCA 2V7WA 3P0RA 5ALHA 3BA6A 4MVJM 4NR0A 1F20A 2ZVDA 1FY2A 4CIWA 1RJ9B 5KNBH 4Z2YA 2BDEA 3NHYA 5DBHX 2RARA 1GCIA 4R8MA 5L95A 4GX0A 2ZUEA 2P40A 3BWDD 3PE6A 3F71A 4CU2A 5JD4A 4V0RA 3ND8A 2VHCA 1FP7A 1CZOA 4PGHA 1QGYA 1DEKA 4NEHB