1JJ7A

Crystal structure of the c-terminal atpase domain of human tap1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
251
structure length
251
Chain Sequence
b'GLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEPTIDE TRANSPORTER TAP1
publication title Structure of the ABC ATPase domain of human TAP1, the transporter associated with antigen processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 75
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jj7A01
3JZMA 5EE9A 5F98A 4M1KA 4Q4HB 3ICEA 2ZR7A 1OXXK 1Y3AA 2GCOB 1VCOA 3ASZA 1P5ZB 1M7GA 2KBEA 2W0SA 2IF0A 5E7MA 1XTKA 4OJKA 2NPFA 1WBBA 5FTMA 4MUBA 1U90A 5AJXA 2GHIA 3DDCA 2ZXUA 5CM9C 3ZYCA 3LY5A 3CX7A 2IUUA 3RS4A 1DAHA 1FUUA 4D4JA 3WMEA 2AKAB 2ZRMA 2CMKA 4LV5B 4AIIA 2QA5A 3K70B 2QTHA 2BOVA 3WBJA 3H4MA 1UDXA 1QDEA 2QG6A 3SYLA 4RD3A 2O8BA 4DCTA 3GJ7A 1RVDA 3IQWA 3THOA 4KXFB 3GLGB 2AD1A 2HF9A 3LFUA 4CRWB 1Z6GA 1O87A 4C2TA 1G3RA 4KHZA 1L4UA 2P5TB 2IUSA 4DLYA 1Q22A 1XF9A 3GLHE 1X8JA 3OEEA 3CX6A 4PC3A 2VHCA 4GZLA 4YXWA 1Q57A 1KI6A 4P4SB 3B85A 4NCKA 2CLCX 2FV8A 5IDVA 4BUJA 5K8TA 2FPMA 2F9MA 1HQCA 2BEKA 2RH5A 5CDFE 3PJRA 3CKLA 3EWAA 5FOSA 3OIYA 2RGBA 2XOKA 3I4LA 2ZJOA 3EZ6A 2N42A 4BLPA 1CR0A 1HQYE 1NSFA 3HPQA 4TMKA 1YRAA 2DY1A 1W7AA 1HURA 2XB4A 2VSXA 2HV8A 3QQ5A 3ZD6A 1G4AE 5EP4A 4BZQA 4G3XA 1QHIA 4GP6A 4B74A 3GFOA 1RRCA 2EW1A 1UKYA 2XTNA 4JT2A 121PA 3QUSA 4MA4A 3AUYA 4JLPA 5JSZB 4XWAA 3QKTA 4P3YA 2V7QA 4XIGS 1X8KA 5JCZA 1UBCA 2X8AA 1QF9A 1ZU5A 4JZKA 3M6AA 1TEXA 1GZSA 3A1WA 3NDBB 5AUPB 2PT5A 4CEHA 3QF4A 4Q48A 1E2JA 1XMIA 3LRPA 4ON9A 4RY2A 5EUMA 4CGZA 2HT1A 2IHYA 3ZIAD 2QTVB 4Q9KA 3EA0A 1ONBA 1YR6A 2WZQA 4LRWA 1G41A 1T3LA 3WRYC 1PLKA 2ODEA 4Q7MB 3PEYA 2O52A 5JZVA 2BKUA 4AKHA 4TYYA 3HR8A 5IT5A 3PUYA 2CVHA 4KODA 4UNPA 3QXSA 3CB4A 2AFIE 2ZAOA 1KDRA 4A0RA 1B23P 1JNYA 4V0MA 4B3BA 3QKSA 1AQUA 5JJKA 3RDPA 3B2EA 3U5ZB 2FMXA 1WP9A 1HT2E 1D9ZA 2ORWA 2BDTA 4P0TA 3BBPA 1XJCA 3D7MA 2JEOA 3L2OB 4AI6A 4Q4HA 3AEZA 1GUAA 1IBRA 1A2KC 1ZD1A 4FW9A 5L3RA 4BEJA 2R65A 4TTPA 3AF1A 1RC8A 4D0LB 3P4XA 5CJPA 2BC9A 2QPAA 2VP4A 3EPLA 2P65A 4BFVA 4KYUA 5EE5B 4M21A 1Z0KA 3D8BA 4AG6A 1ZP6A 1KO5A 4NHOA 4NONA 3THYB 5G53C 1OW3B 2Z5FA 3KDSE 3U60B 3QPVA 4RZUA 1W36D 1KJZA 4ASUA 1G16A 2QM7A 3TH5A 3VKGA 1OFHA 3SS8A 4L15A 4QFMA 3VX3A 4PC1A 4GMDA 4JBWA 2QT1A 1DAIA 3ZGXA 2FZ4A 3L0OA 2ONJA 2AK3A 1D6JA 4F92B 1ANKA 1YZNA 2J5XA 3EASA 1VYTA 5HE8A 3TJZA 3C15C 3GLFE 4FMDB 1FMJA 3EWSA 2F1HA 3I1FA 2YJTD 1KSJA 2GVDC 4UNSA 2ZIAA 5FOWA 2ERYA 4HLDA 3PV0A 4IJMA 2GJ9A 5LD2C 1CF4A 4P4SA 4JLMA 1XD8A 2FX3A 1JQLB 1VDZA 1UKEA 2ZR9A 2RGEA 2V4ZA 4HAYA 2X77A 5FOXA 3QXXA 2IC5A 4DT1B 2QP9X 1Z0AA 4FIDA 4PC6A 2JA1A 3PENA 2OESA 3B9PA 4RSGA 5EXTA 5FR2A 4H9GA 3T61A 1JR6A 3M4YA 2B6HA 2D3WA 4POAA 4Q7LA 1NG9A 4U02A 2ZYWX 1UAAA 4ZV4A 5FL7D 1KY2A 2ZUDA 2XSZA 5SZKB 2NOAA 3MG9A 4B2PA 3LV8A 5JHGB 1JALA 1U2RA 5EZ5A 5M04A 4NMMA 4TL8A 4A6XA 1KI8A 4WOPA 2FFAA 4HDCA 2FFHA 1AZSC 4KO8A 2GK6A 4JLOA 1T6NA 4FCTA 3EIHA 2EWVA 5JSZA 4KLZA 2V1UA 1XTJA 4GNKA 1R8SA 1W46A 3TIFA 3PQCA 2JATA 3RHFA 4EKDA 4LHZA 4Q47A 3CLVA 5FH9A 4CEIB 1Q3TA 1TTTA 2R6GA 1X86B 2ERXA 3CZQA 1IM2A 4CT5A 2QGZA 5ELXA 4M8NE 1UKZA 1AQYA 1Z47A 2J59A 3OEHA 3K1JA 1OIVA 4URXR 3CPJB 1E1QD 1OYWA 1VKJA 3RS0A 3X1DA 4IKEA 2GCNA 4TMWA 5EQTA 5IRCD 5JBQA 2FNAA 4QHYA 4R2HA 4M22A 3CRW1 1COWD 4K46A 4OBEA 1JR3A 2ANCA 1E2HA 2F1IA 4KAXA 2OFXA 4EPXA 2R44A 3UATA 1Q1EA 1ZD9A 3KQUA 521PA 2ORIA 4BLRA 4HAXA 3QSYA 3CF0A 3ZDQA 1T91A 4PZLA 1GFIA 4A82A 2MSDB 3EW9A 3C16C 3AGQA 4I81A 2DYKA 3AQ4A 3T5GA 3DMDA 5FUXA 4TZ0A 2ZS7A 2A3RA 2JGNA 1IY2A 4TWZA 4E5UA 2K5UA 5JEEA 1E2FA 4C0AC 3A1TA 4DB2A 2V6JA 4FXPA 1GL9B 2AL7A 1D2MA 1MT0A 4CIDA 3SU8A 2JLYA 1P2SA 1GNPA 2ZI3A 3PCRB 3IDQA 3TAHA 1N6RA 4I1VA 5B64A 3FOZA 2F7SA 3ZS9A 1Z6YA 2ZYUX 2F3RA 4H1VA 1V43A 1ODFA 2O0JA 4TT3D 3THYA 1UBEA 2ZJAA 4AKGA 1JQJC 4DEXA 3ASYA 4B3FX 1OKKA 4NCIA 4Q1EA 2C95A 4ERNA 3TW4A 2QRNA 3MRSA 4IXNA 3X1WA 4S35A 3B13B 4IEIA 2BMEA 2W2VA 2WKQA 1JEEA 3KQNA 4I1SA 4DUGA 2XOKD 2D74A 1FNNA 1RRFA 2J9RA 2X19A 2YC2C 3PUWA 4LZZA 5JMTA 5TDHA 5CLLA 1S96A 2XNDD 4LYHA 4WA7A 4WAUA 1CS4C 5JJLA 4IDOA 4YLGA 2J7PA 3AF3A 4EQ6B 1JBKA 3Q8XB 4G01B 1LFDB 2JLRA 2L0XA 5JJIA 1W47A 1JAHA 1RYHA 4TLCA 3OESA 2A30A 4C0LA 1BKDR 3TSOA 4DT1A 1CJTC 1E1RA 2OV2A 3EARA 5G40A 3ZVLA 2ZSBA 2V7QD 3O8DA 5AJWA 1WCV1 4BRUA 2JAQA 1S4QA 2W6ID 3K0AB 3AVTA 3IIJA 2C9OA 2FFQA 5G3YA 4LHYA 5KDDA 1N6HA 1UPTA 2OEPA 4PO1A 4ZDWA 3TK1A 1FPMA 3QEJA 4IOLA 5FUVA 1GP2A 2ECKA 2QI9C 1KKLA 1KJYA 2QMEA 3BWDD 3EAQA 4ILEA 4B48A 5DH9A 2DWOA 1ELOA 3C41J 4ZDJA 3Q7PA 2REBA 3I5XA 3I72A 3KKNA 1DAGA 2ZM5A 5IHPA 1KO7A 1EGAA 4GOKA 1I2DA 3NWJA 5KNDA 3EIEA 1ZD8A 4P31A 5FOVA 3Q3JB 4F4JA 2FU5C 4JL8A 4ITRC 5A4JA 1W4RA 1I4DD 1YZTA 5BN4A 2LKDA 3QVUA 1VG0B 3KFVA 1WMSA 1R7RA 3CPHA 3LA6A 1IXSB 2VHTA 2I1QA 1Z06A 4HSEA 1Q12A 4HLCA 4TSFA 1NVXQ 1P4SA 3KB1A 4IDPA 3W5JA 5BW8A 1DO0A 2OXCA 2PEZA 2B8TA 1ZJ6A 1GKYA 3MFYA 2Q3MA 3THWB 2W2TA 2CE7A 3TUZC 1S8FA 2CVFA 2R2AA 4F93B 4OI2A 4PAQA 1ZCAA 2GESA 3C14C 4MGKR 4OK5A 2Z43A 3VTKA 1FOEB 2GJ8A 2PJZA 2WWHA 4JKYA 3W6PA 2IT1A 4FCWA 3U44B 1E2KA 1QHXA 1PV4A 2ZR0A 3W5IA 4X8MA 3K70D 4G5OA 4E03A 4NKRA 3N5CA 2JLUA 1EG7A 3RC3A 2DFLA 1W36C 1DS6A 2AFHE 1WE2A 1GWNA 4OL0A 3TR5A 1P61B 1TL7C 4HAWA 4A8JC 4A8JB 2NZJA 5JS8A 1R2QA 5GJBA 1FX0B 1E69A 3UK6A 2PX0A 1QHNA 2JJ1A 3KQHA 4DCSA 2C8VA 3ZQJA 3CRQA 5HTKA 4D4MA 3SR0A 3THXB 1KDTA 1VG8A 2DHRA 3ZZTA 1A4RA 4BLTA 4D2IA 3FKSD 3IUYA 2QT0A 4QJ5A 1KI2A 2W58A 3SYNA 4GPTA 3F0TA 1MO4A 5DN6D 1XBTA 3T1OA 1KIMA 2HXSA 3DEFA 1Z22A 1SKYB 1XEFA 2WJIA 3GFTA 2CK3A 1YZLA 2YOGA 3VAAA 1ZNZA 3LW7A 2ZUCA 1S9DA 2OUKA 2XSZD 3P1JA 5TV2A 1HY3A 2BM1A 2J3EA 2WSSD 3U2QA 1NBME 2VPPA 2XJ9A 2GAOA 2YNMA 4EJSC 4EJSB 4MH0R 1JI0A 3WMFA 3VU9B 2CJWB 1G17A 2ZSFA 3SZRA 2XJ4A 4K81B 1E9RA 4YMTA 1R0YA 5JLJA 3L0IB 4RZXA 2V55B 2VHUA 1R6BX 2WWWA 5FBWB 2CHVA 4A92A 3PEUA 2ZU0C 4Q02A 4QG7A 5FTLA 3DZ8A 3LQQA 2BBSA 1KZGB 1AA9A 4A0FA 3T06B 3K0AA 1HH4A 5FR1A 3G0HA 5FFMA 3LBIA 1XPOA 4JLBA 1YU9A 1UM8A 5CB8A 4DDTA 2WWGA 1VPLA 3AGPA 3JZAA 4Q1DA 2GF0A 4LC0A 4V0KA 4P33A 2QNRA 3KKMA 1M8PA 3WNCA 2EVWX 1G3MA 3ZIAA 3CWQA 4IDHA 3NH6A 1VYVA 2G77B 5TXGA 4DCVA 1I2MA 3LWNA 1FQJA 5E3HA 4LI0A 4DLXA 1R0XA 2QQEA 2WJJA 2I1VB 2VRWA 2QMOA 2W00A 3K9NA 1NVWQ 5JS7A 1U0LA 4U00A 4M9SA 1Z63A 821PA 4PQYA 5DHAA 4QKQA 1KMHB 3K09C 5E4FA 621PA 4B73A 4EPYA 2ONKA 2GTPA 2O8FB 2WM9B 3B6EA 4W5HA 3KQLA 1T3HA 1RIFA 1UKVY 3QKRB 5C2JB 1XD2B 5C18A 5BXQC 3M0EA 5DYIA 4X8LA 5P21A 2RMKA 2VP5A 2G3YA 3GQBA 4QM6A 1GL6A 1II8B 2VTKA 3THWA 2FE4A 5JWRA 1GRNA 4PZYA 5KNBA 2H92A 5EXSA 3RANA 2GXUA 3HJNA 1YZKA 5HCIA 2DFTA 3U44A 3GD7A 4XD7D 4UNNA 3LO5A 4AYWA 2XXAB 4WVFA 5F9HA 5CITA 2VO1A 4HUQB 3FPAA 3Q5DA 1KOFA 1KKMA 4HEJA 1JPNA 2ZRKA 2RGCA 4OHXA 1EXMA 3WMGA 4DUGD 1KTVA 1LTQA 1RRGA 3ADBA 4A8JA 2YC4C 4KV9A 4N0EA 1G9XA 3HWSA 1FX0A 1SVMA 2ZTSA 1N5LA 2QENA 3EZ9A 4KI0A 2NO9A 2ODNA 1P9NA 3NC0C 2HUPA 4L9SA 5EP2A 3GLFB 4Q4LA 3THXA 1FTSA 3RRNA 3FMPB 2PBRA 3FYHA 2MMCA 1E1RD 4Z54A 1RPZA 1UF9A 2XGJA 5LDDC 4PO9A 4Q4JB 2FN4A 3CRVA 3TAUA 1NKSA 3MCAA 1G3QA 4EPRA 5FBQB 4TYNA 3GEIA 1MO3A 4GRAA 1Q1ZA 1IOZA 1NIJA 4QBGB 1A82A 2VF7A 4TQAA 3IIMA 3NXSA 1S3GA 2ZITA 4EAQA 4EJSA 3CNNA 4M9XA 1SVIA 4LBVA 2C77A 4LSGA 5FL7A 4F4IA 2I4IA 2HYIC 2LKCA 2ZSEA 2G9NA 4C4PA 3VU9A 2CJWA 2ZRNA 4D6PA 5SZHB 5HCNA 2NG1A 2V6IA 5GVSA 2PZGA 3PUXA 2ZPTX 1G6OA 3B1ZA 4HDOB 4Q5IA 1U0JA 4OKSA 2RAPA 4IHQA 2JCSA 4AYTA 1IXRC 1TPZA 4B3CA 2QSZA 4JBXA 1C4OA 4HZIA 3CRMA 3T15A 3GCGA 4JL5A 1BO6A 2IUTA 4PHTA 3K0CA 3TVDA 2PEYA 3AVQA 2Q6TA 3NG1A 2EWWA 3I62A 2EFCB 3FWYA 3I73A 3C5CA 3X1YA 2EU8A 3UMSA 1G7SA 5J4VA 3TSZA 4G5RA 1Y63A 4LCBA 2JLQA 5FOTA 2QMUA 4WW0A 4ZKEA 4MDEA 3I8SA 3VR3A 1BYUA 3HP1A 4RZ2A 2H18A 1QHHB 1EX7A 1G8GA 3LDAA 1D9XA 2FEOA 4B3XA 2PZFA 3CONA 3FVQA 4YC7A 1ZUNB 4C3ZA 4BECA 3IEUA 4PPFA 1N5IA 2R9VA 3LXXA 4QHTA 2NMVA 2DB3A 1COWA 2CL0X 4M1YA 3I92A 1G1MA 2ZE6A 5KPDA 1R5BA 1YHNA 3BGWA 1KMHA 1TUEA 3K09A 3SJCA 1XCPA 3SYKA 4X8OA 2A78A 2O8FA 4A0GA 3QKRA 3RSOA 5CM8B 3SFZA 4KFTA 2C03A 1P2UA 1CP2A 2RGXA 3K70C 1QG2A 2F3TA 1FP7A 4G5QA 4B6EA 1II8A 3A36A 3GP8A 2WKPA 3I3SR 3GJ5A 3BJIC 1VG1A 2JJ1D 5UKDA 1E2DA 1IN6A 4Y0AA 3R9WA 3T34A 1CRQA 1U8YA 4MITA 4QBIA 4BLSA 4R98A 1SGWA 1LS1A 3KFXA 4LJ8A 2FEMA 4O2LA 5AWFC 5TMPA 4XVRA 4D82A 4R2IA 2OBMA 1T3SA 1ZUIA 3U61B 2XXAA 4AYXA 2BMJA 4HUQA 4NP6A 4TT3A 2H5EA 5A5GA 3MJRA 4TL6A 1NN3A 2F9LA 1P2TA 4QOSA 2CK3D 3F8TA 2WAYA 1XCGB 2FZLA 3A1SA 2ATVA 2G83A 1A5TA 1PUIA 3LX8A 4NYJQ 4II7A 1XTSA 4LPSA 5CJ2A 4QXAA 2GEVA 1E9FA 1R0ZA 3BFKA 1F6BA 3SOPA 2WJVA 1S1CA 2HJGA 1IN5A 1TF2A 2XNDA 2KSQA 2GXSA 4PANA 3NIBA 2E1RA 2KBFA 2P3SA 2EFDB 4TTRA 5H70A 3W9YA 2A2ZA 3FKQA 4Q4JA 3CF6R 4CYMA 1IHUA 3W6OA 4MYHA 5DI9A 3BK7A 2O8DB 1E0KA 3GJ4A 3DM9B 4IVPA 1Z08A 3GLIB 1KO8A 3BH7A 1XTIA 2PT7A 3D3QA 2W6IA 3IPXA 1KGDA 2CL6X 4A2PA 3QVVA 3HYRA 4U7DA 1CR4A 2E9SA 5DI3B 4HAVA 4BFTA 4RCZA 4G5SA 2CCGA 2VP6A 2J87A 1L8QA 4B3GA 4LV8B 1YVDA 3A37A 5DISB 4Z8XA 3UANA 4XSHA 4YMWA 4M53A 2WJYA 2HXYA 3NKVA 2WWIA 1SVKA 1WF3A 4DLUA 2IA5A 3PIRA 4M1SA 4L5BA 4KITB 4W9MC 3HDTA 4DEYA 4U5XA 4XWOA 1ETUA 1YR9A 3RS2A 3E2IA 2DPXA 4MYCA 4HDQB 3RYTC 2YKGA 4PSAA 4C0KA 4BFSA 5C4GB 3R7WB 3ZD7A 1QHHA 2NO0A 2REOA 3U4QB 1ZIOA 4LBWA 1W44A 3KKQA 1J8YF 1OIWA 1TU4A 4JVNA 4FI3C 2J0QA 4LGMA 1FUKA 2W2XA 3LBNA 3TUIC 4DCUA 4C0HA 1N6PA 2PMKA 3WP0A 2GCOA 4LHVA 1KHTA 4NCNA 1DAEA 2OT3B 2V8OA 4JLVA 2W6JA 2IYLD 5D3MB 1AZTA 2NO7A 1Z2CA 2J46A 5B58C 1X1SA 4KFSA 5AJVB 1ZNXA 1XPUA 1NMZA 3BFVA 2QP4A 3AVYA 1HV8A 1V5WA 3P20A 1OB5A 1KK2A 3EA5A 4LHXA 4ZI2A 4QJ4A 1VIYA 2IEYA 4KCGA 1NJGA 1II9A 4URUR 1BMFD 4R71A 1M2OB 1Q1BA 4GOJA 2RHMA 3GLGA 3DPUA 4QC2A 2YWFA 1TMKA 1IN7A 2IS6A 5B2ZA 2I3BA 3WYGA 1EFRD 2X2FA 4BEBA 5EE1A 1J2JA 4DVGA 3OFND 2B21A 5F9FA 3LH5A 2ZUBA 3TQCA 2E87A 5GJCA 4HAUA 5J47A 1XX6A 4HZUB 3GEHA 2IS2A 2OXRA 4JSYA 5AK0A 1DAKA 3FKSA 3HPRA 1KAOA 4UJ5A 4A15A 1GNQA 5DN6A 5JWOA 3SDZA 1EESA 1B0UA 4CVNA 4RD1A 1GAJA 4IOMA 2OFOA 3QG5A 3NHBA 4AWXA 1GIAA 5J4LA 1NLYA 2R8RA 1VCNA 3Q9LA 4PSVA 3SJBA 2ODWA 4O2RA 4ABYA 4TYWA 1PVOA 3QXHA 3H1TA 3NEYA 4QGHA 4GDFA 2WSSA 5FBVB 3KTAB 2WOJA 1AKYA 4O25A 3WYAA 3A4MA 1KI7A 1SHZA 1CJUC 1KO4A 1XXHB 3KKOA 3NDPA 1J7KA 1NLZA 4JVSB 2YINC 4IEEA 2O8DA 4S2EA 4JLNA 1G8HA 3BH6A 2HF8A 5C46F 1FL9A 4KU4A 3WXMA 4TZ6A 4D0GA 3GLIA 2Y8EA 1AS3A 2R62A 3AVPA 3C7KA 5HE9A 1IJFA 5KOYA 1QVAA 2QORA 3DZDA 4TL9A 2GWHA 1JEDA 4Q9IA 3NC1C 5DI3A 2R6DA 3ZJYA 3TBKA 2D2EA 1NNEA 3KZ1E 4GI7A 2JIZA 4OYHA 4A6PA 5DHFA 1TEVA 1U99A 1CIPA 3L82B 1G64A 1ZW6A 1G21E 2QZ4A 3P4YA 2NIPA 1D8TA 4XVUA 2ZRCA 3RVBA 4NTZA 3K9GA 1N6LA 2OAQ1 4TYQA 1CR1A 3G82C 1WQ1R 5AJZA 4NYIR 2RGGA 2NTYC 4URVR 2YOFA 4RVCA 2H57A 4TN1A 1VYUA 1GRRA 1TF5A 3LLMA 1NL3A 5CYOA 3ZZUA 2F1JA 3LLUA 4JVLA 4ZCMA 1ZNYA 4PPNA 1U94A 4Y0VA 4KBGA 4BE7B 1RE0A 2LCFA 4V0ME 2OCPA 2EYQA 2BCGY 2GXQA 3R7WA 3UXMA 4FMBB 3L43A 1NLFA 5E7IA 5LPNA 4A2QA 5KU1A 3U4QA 4DDVA 2IWHA 4LBZA 2GDJA 1BYIA 4JYBA 1F5NA 2QEQA 2ZJ2A 1X6VA 1R4AA 3L8ZA 2QSYA 1KI4A 4Q9JA 4JLKA 2FFBA 4ZI3A 1ZM9A 3FE2A 1FQKA 1E9EA 1KZ7B 2Q9AA 2X2EA 1KK3A 4DXAA 2JLVA 3AV0B 4OHVA 2DWPA 3ND8A 3TNFA 4ZCIA 1D2NA 1DO2A 1S1MA 1R5NA 2OSBA 1KMQA 2GRJA 5DO9A 1P72A 5D3MA 2ZETA 4L4UA 1ZU4A 4HLUC 4KJZA 4DLWA 4Q03A 3SNHA 3UIEA 3ADKA 3BFXA 3KX2A 3OAAD 4NE2A 4TTQA 5SZIA 3B82A 4GSYA 3SFVA 4BWYA 4DB4A 4NU0A 4XD7A 5L3QB 2H7VA 4Q21A 4PSKA 2GNOA 5BYJA 4LJ6A 1PZNA 4HAZA 3T1TA 4RD0A 1K5DA 1KK1A 2J45A 1EFHA 2QL6A 2A5YB 5AJYA 1CJVC 3QXJA 1RYFA 3R9IA 3CX8A 4BGDA 4DHEA 1JXOA 3TMKA 1QZXA 4I1OA 4M1WA 2JASA 1K5GA 5DE3A 3AVVA 1CU1A 2C96A 4LJYA 1ZUHA 3SHWA 4CW7A 4HZUA 2N46A 5HZHA 4UKDA 1W5TA 1Z5ZA 1PLLA 3IBGA 4P32A 1OT3A 1ZM4A 4GZMA 3RRYA 1XEWY 3SN6A 1JXMA 1AS2A 1UFQA 3HR7A 4LX0A 1NG1A 1N0VC 2DWQA 2FJUA 3FHCB 4WZAE 3QE0A 4B47A 1RW4A 3CIOA 1S3SA 3NEJA 2VSFA 5AUNB 2PX3A 4DLVA 4ZCLA 1ZNWA 2AD5A 1W2HA 2EYUA 3VX4A 3NBYC 1GITA 3CPEA 4HYYA 2J0UB 5L3SB 4TMZA 2YZ2A 3KTAA 4BFXA 1S2MA 3TUJC 2BCJQ 2ZI5A 1XXHA 2FGKA 3O8BA 5EUQB 4YMVA 3I32A 1OH8A 3IIKA 4WXPA 2BWJA 4KYIB 2N1BA 2BMDA 1WB9A 4L9WA 4B2IA 5FPSA 4LOAA 3GJXC 2Z6VA 1E6CA 3AUXA 2WPDA 2IWRA 4Q00A 3LX5A 1MV5A 4CEIA 4HB0A 3W6NA 3BXZA 4EIWA 4TLEA 5HZKA 3ZQ6A 4E22A 5DSZA 1VMAA 2VEDA 1SXJB 2BBTA 1Q0UA 4V0NA 1ZM7A 1N2CE 2AX4A 1XJQA 3OHMA 4YONB 2G1KA 1XD9A 4EPTA 2R6FA 4EDHA 3O47A 3SHFA 3RABA 2B8WA 1SVSA 3AP1A 3PUZA 2F6RA 2G0TA 3PR1A 4J0QA 3CNOA 1JR3E 1W48A 2ZVPX 1KK0A 4IDNA 3AH8A 1T9HA 2W6JD 4IXMA 2GF9A 4OI4A 1IN8A 1U0HC 1VTKA 3NBZC 1SKQA 4WZBE 3RS5A 4Q01A 1LW7A 2RGNA 5K8IA 3EX7C 2C2HA 4D0NA 5KSZA 2NO6A 2J1LA 1XMJA 2VP0A 2NZ8A 2VSOA 4GMXA 4LJ9A 1T8UA 2W83A 1WRBA 1F60A 2BIFA 1XZQA 4XJXA 1IJEA 1IQPA 1AM4D 4UXHA 3QPUA 1P9WA 1G4UR 1Z6XA 3R20A 3T12A 3H2YA 1JAIA 1HT1E 4PO8A 2VF8A 5HKKA 2OLKA 2UZIR 2ZRDA 5G3ZA 2VQSA 3FTQA 4MYUA 1F3OA 4OK6A 4M0LA 4MDFA 4TMTA 1E79D 4H1UA 3BB1A 4XVQA 1N6OA 3B1VA 4LYJA 4OHZA 1LV7A 3U7HB 2ZSAA 4Z1MD 1PJRA 4HLUA 5EE0A 4C0JA 3AM1A 4YDSA 5FTNA 1AK2A 3HYTA 1GOTA 2YOHA 1G7TA 3OE7D 3GLHB 1M7BA 3P32A 4NDZA 4QNMA 4GT1A 5D3QA 1ZC4A 5L3QA 3U3RA 3T1VA 1NN1A 1UDWA 2EFEB 2G88A 2OM2A 3R8FA 1KYIA 3AB3A 2C5LA 2UKDA 3ZH9B 2F43B 5IF9A 1YKSA 2V9PA 5KDLA 1QRAA 1VCIA 3UWOA 1DTSA 1DARA 4A9AA 3ADCA 1CJMA 2CHGA 4NL4H 3UG7A 2IYWA 2BV3A 4WZ6A 5AUQA 3RWMB 3EXAA 1MOZA 1U9IC 2ANBA 1GL7A 2QM8A 3U3JA 2BEJA 1XB2A 4EQ6A 5CB6A 1KDPA 3WRXC 1O3YA 1Q21A 4NCJA 2NGRA 4RZ3A 1Z83A 4WBSA 1OH5A 5KSYA 1NY6A 2SHKA 4NCHA 1OIXA 2Z4SA 5C4MA 1RJ9B 4UXIA 2ZE8A 3L0PA 2PCJA 3I5YA 1LNZA 4DC9A 1XPRA 5FOUA 4PTLA 3K0CC 3BIFA 2ZI6A 4Q19A 4US0R 4D4LA 4EPVA 4DSOA 1RKBA 3BD9A 1CTQA 1MO6A 2J0UA 5L3SA 2JIZD 2V3CC 4ZDIA 2HDNB 1OV4A 4FMCB 2D2FA 2ZSDA 3VR4A 3PEVA 1A7JA 3U7FB 4LJAA 4EUNA 3LNCA 2RKOA 1GNRA 3AKDA 3HU2A 4MYTA 4UNRA 1OB2A 3W8RA 2H8KA 3ZVNA 4V02A 3WHLA 3B1YA 3IEVA 1GTVA 1GILA 1GSIA 5A0FA 4QM7A 2GZDA 3ZS8A 2ZI4A 2AKYA 4HLQB 5CIWA 4V03A 2BBWA 3GPLA 1WDTA 1QBKC 1Z0FA 3VNUA 1E0SA 1AN0A 2OBNA 2VYFA 3A4LA 3UWKA 1NN0A 3SE0A 1SXJA 2O8EB 2PH1A 1GKUB 1IN4A 1DAMA 1Q3HA 1OH6A 1DOAA 1LB1B 1TUIA 3BB4A 3GJ8A 4US1R 4ZIRB 1VHLA 3W3AA 2R6CA 1R0WA 3TSWA 1OHHD 1C1YA 3A8TA 1FMLA 1P9RA 2OBLA 3EG5A 1FNMA 5FPYA 2JLSA 1SVOA 1ESNA 4P4UA 2VP2A 2CDNA 1P3JA 4C2UA 4CZ2A 3CBQA 3QOFA 421PA 3U7GA 1Z0IA 4C0SA 721PA 4MKIA 5JI2E 3MGCA 1ZINA 1QVRA 4MKGA 1R10A 4I1UA 1BH2A 5GVRA 5EXXA 4MGYR 5KHOC 1D2EA 4M1OA 3CW2A 1T5IA 2IYYA 2V1XA 2C9CA 3IO5A 5BWMA 2PJRA 2VLIA 4ZO4A 4B2LA 4D26A 5JI3E 3EPHA 2W0MA 1NVVR 3VNVA 5BYKA 3JVVA 3VKWA 3AKEA 3I8XA 3QJYA 1BMFA 2MSCB 4PC2A 1AGPA 3MAAC 1TNDA 1XEXB 1DVRA 3N2IA 1VCMA 3QNUA 4TLDA 4NYIQ 3GLHA 2VA8A 1EFRA 1A1VA 5AUOB 3U6KA 3EPKA 1CULC 3OFNA 3B60A 3VFDA 3KJGA 3KXLA 3SEAA 1RRPA 3AP3A 2F43A 4D25A 1CRPA 3QENA 1G8FA 2FSGA 3ICQB 1OXTA 2JLWA 5CDFA 4Q9HA 4DKXA 3C4JA 4JMPA 4OQNA 1NBMD 4Q1FA 5JECA 2QBYB 5F3WB 4QBFA 4M4SA 4A2WA 2BBOA 1NIPA 1U9IA 4UNQA 1E9AA 4PPGA 2AR7A 4AD8A 1VHTA 2P6NA 4RFSB 3WYFA 2RHDA 5K8UA 4RFVA 2O8BB 1KNQA 2CCJA 2QAGB 2PLRA 4PC7A 4LBYA 2WPDD 3BOSA 1YRBA 4LYFA 4QGFA 2IS4A 1RJ9A 4PR0A 1FZQA 2CHQA 2EQBA 2QE7A 4PHHA 3T5DA 5E95A 2ZJZA 3AVOA 3MSXA 2UZ3A 1Q20A 3W8NA 3H86A 2CBZA 4KFUA 3B1XA 2OLJA 1NP6A 1FFHA 3IQXA 2XZLA 3IPYA 2BJVA 2ZRLA 2VH5R 2JJ2A 2PZEA 5CLQA 3I61A 3SQXA 4Q1CA 3SBEA 4M9ZA 3CF2A 4AC9A 4MRVA 1M1YE 2Z0MA 4MKFA 5FBRB 1G291 3R8CA 1X8LA 1AIPA 1G3IA 1ESMA 2C78A 1P75A 4MUAA 3TE6A 1E2QA 4OHWA 1N3BA 4PHFA 1DELA 4TLBA 2AK2A 1XWIA 2P2LA 3EZ2A 3LD9A 5FUWA 2OAP1 3RSLA 3AVUA 1US8B 2IK8A 1EWQA 3REFA 3HU3A 1UEIA 2QU8A 1GKIA 1P73A 4HATA 4XTCS 5L3VA 1ZAKA 2FA9A 2O8EA 2IL1A 4EPWA 1TAGA 1CLUA 4TL7A 3O8CA 4C7OB 2CNWA 1EFCA 3SJZA 3TLXA 1XD2A 2ZS8A 2ZI7A 4ZIRA 4IOKA 3G5UA 2FOLA 1MH1A 1QHGA 3SBDA 2D62A 2IBMA 4F91B 5HKKD 3UPUA 3SJAA 4RKFA 1W2GA 4ZKDA 3IILA 1OXUA 1N5JA 2QQ0A 3RWOA 1KI3A 1JPJA 4P4TA 5H68A 1R8QA 4HB3A 5JHHB 4TMXA 4Z51A 3NVAA 1I4LD 2O0HA 2ZJYA 2XITA 4A36A 2FF7A 2HJVA 2WIAA 2G1JA 4B76A 1BIFA 2VHJA 3FMIA 2ZRIA 3GJ6A 2C04A 1E2PA 2ZJ8A 5EP1A 1IY0A 3CM0A 2XNSA 1DAFA 2GK7A 4FINA 1KSHA 2CLSA 1K6MA 3K53A 5LB4A 3B8HA 4HI0E 4G5GA 2GZHA 3OAAA 4ARZB 1TQDA 3OF5A 3CH4B 4W5WA 5KTYA 1E9BA 1OLOA 4GP7A 2ZE5A 4Q4AB 3WHKA 1XRJA 3S1AB 4KVGA 2BKEA 1H8EA 4DJTA 2WVJA 4R7ZA 1TQ6A 5TARA 5HR5A 2WJGA 4IOJA 1DBSA 3BORA 4LUCA 2AWOA 2ZRGA 4EFLA 4B32A 1XEXA 3GLFA 4DWJA 3D6TB 4LPKA 2EFGA 4EFNA 4CT4B 4KLNA 5JWHA 1YQTA 3VHLB 4I4LA 1NI3A 1T0JB 1MKYA 4I99A 4QNRA 1G5RA 1SKYE 3WBKA 3B5JA 2GJSA 5E7JA 2KJQA 4CEJB 5B30A 3LVQE 4IDQA 2H1LA 2IYZA 3GMTA 5IK2D 5JCPA 4URWR 5TY0A 3ZLJA 1KDOA 2RB4A 2UVQA 3EZ7A 1OE0A 2QBYA 2WMNB 2AHOA 5B57C 3X1ZA 1JJVA 1M74A 3A4NA 4CF7A 1G18A 4JL6A 4QHSA 3QIAA 3FB4A 3RNLA 1T8TA 2XX3A 4BASA 5HPYB 4RFSA 2WAXA 4FCVA 4JYCA 2BM0A 1OFUX 3C5HA 2F55A 1H8HD 1XU4A 1ZVQA 1ZIPA 2PCLA 1SZPA 2QAGA 2WWFA 3LVRE 3MWYW 4GOXA 2O0KA 4BRWA 5H8WA 1EX6A 1ZRHA 1NKTA 4F4CA 3H84A 3OIWA 4YMUA 2GILA 5ANRB 2EFHB 2FSIA 4C30A 1XCMA 2JJ8A 1LY1A 1HE1C 3DOFA 1KO1A 2HEIA 5J4HA 3UMFA 5EE3A 3CO5A 3TGPA 1SXJD 3NBFA 1XTQA 4XSGA 3W34A 4DDWA 2GBLA 2WIBA 4BZXA 1T5LA 5FTKA 4LDJA 5SZJA 1L7VC 3F3YA 3DOEA 1N0WA 1YR7A 2Z4RA 3FGNA 1S0UA 3DKPA 3IBYA 1DPFA 4LY6A 4V0OA 4TQ9A 3N2EA 5KUTA 2PL3A 3WY9A 2C99A 5F2EA 4OQXA 3Q72A 2Q21A 2VIIA 5GJVC 1US8A 1CEEA 1Z8FA 2B7CA 2CCKA 2VBCA 4F38A 5KO2A 1E96A 1YR8A 1E4YA 2ZU6A 1XMSA 2HLDA 3LAWA 1IAQA 1KSFX 221PA 4N3NA 4M9QA 4IFEA 1G6HA 1T4GA 1Z29A 1DE0A 4A4DA 4C7OA 4TYPA 1NF3A 4IW3B 3Q85A 4PHGA 2WBLC 3GEEA 1W4AA 2R6AA 3NHAA 2ORVA 1U81A 2WKRA 1Z07A 3SC3A 1SHKA 5G41A 5H1YA 1U98A 2IXFA 1NN5A 2ZRAA 4AG5A 4DLTA 2GVZC 2JDID 4G0NA 4NBSA 2QTFA 2HCJB 1UEJA 1E79A 3VR2A 5JEDA 1BS1A 3LQRA 4Z1MA 2IYUA 1MRSA 3B1WA 4ARZA 1CR2A 2IYTA 3E70C 3OE7A 1L4YA 1LS6A 1HYQA 3A6PC 2QMHA 4C0QC 2FPKA 3DHWC 1OXSC 4O0MA 4Q4AA 4DBLC 3S1AA 4PAMA 2AXPA 5K8LA 1G20E 5FI0B 3EIQA 2GZAA 4TLAA 4ESHA 2NO1A 1E9DA 3BRWD 1OYYA 2XZPA 1R5OA 4K8OA 4IRUB 4JJZA 4XTRA 1OFIA 3VQTA 1J8MF 1KY3A 4LV6A 4BZPA 3IKJA 4A1FA 2VL7A 4BFUA 3FMOB 2NQ2C 5GADl 1OFTA 1XFAA 2QAJA 1HUQA 3QEOA 4Q7KA 5LD2B 3ADDA 1F2TB 2IX3A 4JSTA 5CK4A 1SVLA 2Q3HA 1FP6A 3A1UA 2QE7D 2B7BA 4DLZA 4CEJA 2ZQ5A 4DZZA 5JRZA 3EPJA 5LBIA 3BERA 1MR3F 4E07A 3V00A 1F2UB 2GJKA 2ZANA 2QUZA 1W0JA 3GJ3A 4PQRA 3B9QA 4GL2A 3KQKA 3JVUA 2OCAA 4JLAA 4WIAA 1VECA 3ETLA 2H16A 2JJ2D 2DFNA 4L8GA 4US2R 2P6UA 1PUJA 1XDBA 3NH9A 3RRZA 3AF2A 1NVVQ 3FDIA 1CBUA 4M2LA 4PXAA 2Q9CA 4R9UC 2AXNA 2XZOA 3ZVRA 4ZDKA 2YWEA 1II0A 3ZVMA 2GA8A 1UBGA 3MLEA 3IGFA 2ZRJA 1E9CA 2A5FA 1TADA 3PFIA 5J5CA 1GVNB 1VIAA 3FFAA 4BLOA 4Q1AA 2ZI9A 1DEKA 1ZBDA 3K0FB 2OHFA 3PEWA 1T0HB 3E5HA 1TF7A 3ZZ0A 2JLZA 1J90A 2ZRPA 2GETA 3KJHA 3MWLA 4OHYA 2CLDX 2ATXA 2CNWD 2RGNC 4O3MA 4QGAA 1MRNA 2J0VA 2OO7A 1NSTA 1ZMXA 2ZYVX 1P2VA 4RKEA 2G0NA 4B34A 2QPTA 3KXKA 3QBTA 1M7HA 2YV5A 4URZR 4HB4A 5EP3A 3NTUA 4JKIA 4BFWA 1TX4B 4XH9B 1M34E 1RFLA 3VMFA 2WV9A 2YWHA 2JLXA 2HYDA 5J40A 1ZYUA 1OHHA 4JT4A 1XEWX 3MWJA 3FHOA 5FPTA 3FFBA 2IYSA 3RS7A 3U3MA 2A5DA 3EC1A 5JFGA 4LC1A 1E2LA 4URYR 3L0SA 3RC8A 2ZREA 3DM5A 2FSHA 3UG6A 2IF2A 3CWZA 2XB2A 1W0KA 2IHBA 2KWIA 5FL3A 1WA5A 4OI0A 1AJEA 4TMVA 1H8ED 2QPOA 1NJFA 4GFDA 3DMNA 3QXCA 4KSBA 4N1AA 2IXGA 3V4RA 1IY1A 3GLGE 1XTRA 3IHWA 4MGZR 4ACBA 2A5GA 4LYAA 4XWKA 1QG4A 5FBLB 2ZJ5A 3OEED 2RGDA 1MO5A 4YXWD 2X1VA 4NYMR 4DSTA 4IVRA 3LW8A 4LK2A 1KSGA 1CJKC 5L8VA 4KFRA 1HE8B 4JIMA 3K9LA 4DDUA 3CZPA 1KNXA 1Z3IX 3QPWA 1XZPA 2HT6A 2O8CB 2Q3FA 4B33A 4FMDF 2QN6A 1N25A 4RD4A 3V9PA 2DFKB 3EZFA 4NPHA 2YWGA 3P26A 3AF4A 5LB2A 1NBMA 1G5TA 3CR7A 5FI1B 3CNLA 4WXRA 5TB5A 2VP9A 2WOOA 1ZM3A 3KB2A 1F2TA 3PUVA 1EWRA 2OE2A 2ZEJA 4M1TA 2YVUA 4QGGA 4FN5A 4JJKA 3CR8A 4N0DA 5C1BA 3RAPR 3OZXA 4UXJA 4B35A 4F7WA 3AP2A 3A1VA 3VR6A 1UADA 1M6NA 3GLIE 1F2UA 1GDDA 1E4VA 2DCUA 4PPQA 3TVTA 2ZAMA 4DRZA 1GG2A 4C0BA 4V0LA 2C98A 2XTMA 1P62B 4KSCA 2RGAA 5JRJA 1Z2AA 2ZYTX 1SXJC 1NVUQ 3VR5A 1U8ZA 2D7CA 3ND9A 3J81k 1E0AA 1SQ5A 2ZS9A 3U3OA 1LVGA 2GEUA 3DVLA 2XAUA 4B3DA 4QBHA 2VHQA 2IYRA 3IO3A 3UMRA 2GCPA 4DIEA 1W5SA 2IYXA 4DLRA 3FHTA 2FG5A 3K0FA 5FPHA 2HLDD 4E09A 4RD6A 2RCNA 3QY0A 3TKLA 1G3UA 5KYKA 3KKPA 1QHYA 4IVQA 1WBDA 4KBFA 1H65A 5DIFA 3SQWA 1AGRA 3V4FA 3DKVA 4NYJR 1E99A 2QGNA 1XJ0A 1XNJA 4FD2A 4B75A 4MQBA 4XOIA 2FWRA 3DO6A 1XP8A 1YZUA 1CXZA 4KVAA 4IFBA 1NRJB 3OIUA 4MKHA 3X2SA 3TW8B 2CL7X 1J99A 3RS3A 2V54A 2QROA 1Z6AA 2IXEA 5CYPA 4OJQA 2P0EA 2Q9BA 3QKUA 1OSNA 1ZCBA 2OFWA 4X8HA 3AVXA 3ECCA 3C8UA 1PLJA 4L16A 5EXPA 2OZEA 4LHWA 2ZRHA 4Z8YA 3U6BA 4ASUD 4PQFA 2P6RA 1CKEA 2KE5A 2IYVA 1E9SA 1N6IA 4BFYA 3VKHA 3BB3A 1W36B 2H17A 2QY9A 1JECA 2YYZA 5BN3A 1E2IA 2GAAA 2BVNA 4LJ7A 4YMSA 4EFMA 5DNYB 1UJ2A 4Q7JB 1G7CA 1LF0A 4HB2A 3AVWA 2DR3A 3TRFA 1G8YA 2FSFA 5EJEA 1TU3A 2FPLA 1N6KA 3E1SA 1E2NA 1MABB 2MSEB 2BJWA 4ESVA 2CEAA 3DL0A 2PMDA 3NBXX 2QRZA 4DIDA 3MMPA 3MUFA 3PITA 1KI1A 2AN9A 2WWYA 1XMVA 2WWXA 1JJ7A 2WHXA 5CIQA 1C9KA 1UBFA 4M1MA 2O8CA 1W0JD 3VR1A 1GRQA 1Z0DA 1IONA 4Q66C 1SVWA 4AKEA 5IK2A 4DCNA 3KUDA 1W49A 3K0EA 5J4KA 4ZPXA 1N6NA 3LXRA 4MRPA 4DLSA 1F48A 2P67A 1A2BA 1OF1A 1W1WA 3KUCA 2O5VA 4MGIR 5KSPA 3PXGA 1XXHE 3QF7A 5DGXA 3A58B 4TQUS 4PAOA 3F5FA 3B78A 3QI2A 3CH5A 4JS0A 1H8HA 2FH5B 1Q44A 3GFPA 1DADA 1N5KA 2WICA 2IW3A 1ZM2A 1EFUA 2GEDA 3BC1A 5KSOA 1E94E 2GKSA 1DG1G 1JB1A 3AKYA 4W5JA 3L8YA 1E0JA 1DG3A 2LWIA 4AURA 2WMOB 4MRRA 4RCYA 4JBYA 2IYQA 3OEHD 1G19A 4LJ5A 4UQOA 1YZGA 1NMXA 4FWTA 1HEIA 1W4CA 2Z83A 2FDCA 4PZZA 2CXXA 2ZRBA 3MD0A 3BE4A 4Q1BA 5FUYA 4QJ3A 2D06A 1JR3D 2BMFA 5TVKA 3KL4A 4RD2A 1E2MA 1K8RA 3CRRA 5KPJA 1AS0A 5KNCA 1KI9A 4D80A 2CE2X 2Q0HA 1OH7A 1FW6A 1OXVA 4LJ4A 1YZQA 4AY2A 3K8YA 2D4HA 2OILA 3FMFA 1W0KD 3RRMA 2ODBA 3D31A 2KB0A 3R9XA 4LWZA 4FWIB 3W90A 1KAGA 5FTJA 2F1RA 1E98A 2G6BA 1Z6TA 4B43A 4DSUA 1IXZA 1ZC3A 2KI5A 1X1RA 1L2TA 3PG5A 2OCYC 3BAFA 3MJHA 2XEXA 4BFZA 3U3KA 1J70A 1NMYA 4OQMA 2REXB 3EC2A 3QBVA 1WXQA 1Q1QA 1U8AA 2JDIA 3Q7QA 3M1IA 1YJ5A 1NY5A 2ZJBA 4GBMA 1OKKD 4JLJA 1GM5A 4OQLA 2ZE7A 1OJLA 3GJ0A 4QRHA 4OI1A 4MRNA 1TQ4A 1KI6B 4BQSA 3WNDA 4C9BA 3KXIA 5AR1A 3SI7A 2OCBA 4AKIA 2ZVQX 2P5SA 1G7RA 2XTZA 3ONWA 4DSNA 3UKDA 3KJEA 1P7CA 3LBHA 4CDGA 1FTNA 1SULA 2A7QA 1D5CA 3MWKA 2D7DA 2BHRA 4JVMA 2J7PD 8OHMA 4YQFA 3TQFA 2A5JA 2YHSA 1MABA 2ZRFA 1Z0JA 4MRSA 5GJWC 2GXAA 1E2EA 4YDHB 1X3SA 3PVSA 1E3MA 1Z28A 2J41A 3N70A 2AWNA 3T35A 3VHXA 3WNBA 2QAGC 1G8PA 3IHLA 4A0HA 5EZ6B 5FPKA 2QP3A 2C9YA 2WTUA 2ASEA 1AKEA 4AK9A 2NPIA 4OK3A 6Q21A 1RZ3A 1TQ2A 1YE8A 4Q9LA 3WP1B 1I4TD 3Q5EA 3QG1A 4B6FA 2B92A 2WSMA 1S9HA 4B71A 2IS1A 1N0UA 4NZYA 5DLQC 3X1XA 4B44A 2MMGA 1HA3A 4BPBA 4CEHB 3BS4A 2HCBA 1VG9B 2GBLC 2FGJA 3QF4B 1OPXA 4D4KA 4PX9A 3OIVA 2PLFA 3HU1A 4HUTA 4W7SA 3W3ZB 5BN5A 2A9KA 1E2GA 4NH0A 3REGA 5KDOA 1EK0A 3K0SA 5J4YA 4NYMQ 3TR0A 1KJWA 3RLFA 4G1UC 2GJAA 2OG2A 3H0KA 4ACAA 2IEZA 3K9HA 4PFSA 4Q18A 4UJ3A 3BH0A 3T1QA 4FMCF 5DYGA 3U7EB 1E32A 3B7GA 3AF0A 2TMKA 1BOFA 1P60A 4BLQA 1HTWA 1SXJE 4OQFA 2ZROA 2WJHA 4RJLA 3CUEF 1EFTA 3KJIA 3QKSB 5CK5A 3O8RA 3P27A 1LF5A 1QHSA 4D81A 2J7KA 3AKCA 2J0SA 4TSFD 4QL3A 1P6XA 1W4BA 1E1QA 4JLDA 5BQ5A 1G5PA 2DBYA
chains in the Genus database with same CATH superfamily
1W59A 4UOEA 5EE9A 5F98A 4P7JA 4Q4HB 3ICEA 3KKLA 4EZEA 1PJ8A 3HCRA 2QF7A 1M7GA 4XX1A 3D6UA 6GPBA 3G0IA 2IPAB 1XAIA 1NULA 3BDIA 4OJKA 3RHSA 4DR7B 3LBFA 3EZLA 2QLNA 5L3ZA 3GLUA 3QJGA 2GGSA 3KYCB 4ZCSA 3VSAA 5EHXA 4GLOA 2E48A 5CM9C 4Z9XA 1OVGA 5FBHA 5FADA 3CX7A 4HTAA 4GU5A 2IUUA 2CLLB 3A05A 1XPJA 4RJJA 1H9BA 3EEQA 2AG1A 4D4JA 1GCGA 2BCEA 4KR3A 4QFDA 1AOXA 1Z0SA 1DRJA 2ET6A 4J16C 4KW7A 3K70B 3FYCA 4N6GA 1PYDA 4AROA 5KQGA 2FX2A 2QTHA 2RI1A 3WBJA 3J80A 4JP1A 1SQ0A 2QG6A 1WLSA 5EYPA 4EJ6A 3Q5GA 4HNUA 5TPZA 1RVDA 4ZT4A 2FFRA 2AR9A 4B81A 2ZUFA 2RIRA 5LYJF 4BLVA 4AX4A 1Z6GA 2C4WA 1NP3A 1D2CA 2VP3A 1L4UA 3DLTA 4H31A 4O3FA 1T2VA 2WB4A 4DLYA 3KYDB 2VJLA 2ZTHA 3CLUD 4V0SA 2VHCA 4GZLA 4YAFA 4YXWA 4M83A 4IIYA 1OI4A 4NCKA 4KXMA 2OP1A 3M2PA 4H4DA 4QFCA 3KAJA 4XLTA 1Z8NA 3OT4A 2WSLA 1TIPA 3U1TA 4IMRA 5K8TA 3TGLA 2BR5A 2FN7A 2V58A 3USES 2BEKA 3NBQA 2AH5A 4PBRA 2Q4EA 4A8HA 3W5SA 2C7OA 2ADMA 1GPJA 2RGBA 3E81A 3I4LA 3D7SA 3BGSA 5T7BA 1M2VB 1OLSB 2PBZA 2HQOA 4K7JA 5I4BA 2WF5A 1NSFA 2WUGA 1C4XA 5A4AA 2DY1A 3TIXB 1RQPA 1SAYA 2HV8A 2VSXA 4R8KA 4CM9A 1G4AE 2HWUA 3GH1A 4G3XA 4GP6A 3ANTA 5JMWA 1RM0A 3GIDA 3FM9A 4IBOA 1IWOA 3GT0A 1JAZA 2FWNA 1RRCA 2EW1A 4O5OA 3SBXA 3ZHYA 3E35A 5I9IA 4OKIA 2R60A 4XWAA 4PLFA 3RV3A 4GKAA 5I7EA 4JV5B 2RSLA 4LVUA 1DIRA 1XALA 2DMRA 1I1HA 1PFGA 3K5IA 1QOQB 4RF5A 3AHIA 4OX9Y 3EUAA 5BV2P 1MVLA 2VWPA 4CFZA 5JCZA 4WBNB 2HFJA 2CBXA 5D8DA 2A0KA 2GN2A 3O8NA 3FHLA 2VSQA 4HADA 3G6KA 2PT5A 4PYOA 4WN9A 5DN9A 2VTVA 2Y9MB 3QF4A 1LEHA 4U9IS 4B3JA 4HGYA 3IDFA 4XX0A 3EGDA 3ISVA 4HD8A 4Z4QA 2Y67A 2Q07A 1P1KA 4PNEA 1QX4A 4D42A 4OJYA 4ENTA 2HCFA 3F6RA 1K3UB 2WZQA 4MUHA 3L46A 2PH5A 5JFOA 4OQEA 4C7BA 1Q0HA 1UQRA 2WWTA 3MFQA 1JDZA 2O52A 4YRKA 3TXYA 5JZVA 3AWDA 3OZWA 1B8NA 1OCEA 3G7SA 5B6PA 1N57A 1S8NA 3WK5A 3SHQA 1U9YA 3DHEA 4YRNA 2DM6A 4XR9A 3PUYA 2CVHA 2RKBA 1H1LA 3AOEA 2E6KA 1AB5A 2EJBA 1VI2A 1JMVA 2ZAOA 3DTVD 5JOQA 4B85A 2IBTA 3LTEA 1KDRA 3OCJA 2WC1A 4FB5A 2QG9A 1UWKA 4KAJA 1CW2B 3U1BA 2C3YA 4KXQA 4UAJA 3QKSA 5JJKA 3LLVA 4OGGA 4FHGA 5AI9A 1Y7LA 2RBKA 2FPXA 5CMLA 3U5ZB 4NNOA 1GY8A 3MQ2A 3FOBA 3ILHA 4TV9F 3I4CA 2XDAA 1D9ZA 5FLKA 3KJNA 3L2OB 2JGIA 4K6HA 1CS0B 3KSMA 3L7KA 3KUUA 5EQDA 1DC6A 3O94A 1GUAA 4YIKA 4QPZA 5KNBD 3SPXA 1A2KC 2GHQA 3C97A 1MV8A 1SCJA 2I66A 4MOWA 4D99A 3T5BA 4EX6A 4X93A 3D02A 1RC8A 1XELA 4D0LB 3JASB 2CFTA 5A7HA 3DOJA 1WPQA 3L0BA 5D1HA 1DTEA 4BFVA 4D46A 4KYUA 3GN1A 5EE5B 3WDSA 1SCKA 1FDOA 4AG6A 1K75A 1NT2A 4LHSA 2QN9A 5G53C 3KDSE 1JDUA 3JQ8A 5I3CA 3D0KA 4S1NA 1HLDA 4RZUA 3ZE2B 5K03A 1EEHA 4ASUA 1J8VA 3TH5A 5DFAA 5FWXA 1OFHA 2RONA 1E4EB 1TU0A 4UCQA 2RCYA 4PC1A 4JBWA 2QT1A 1DAIA 3G2LA 4NEQA 2FZ4A 3ZEIA 3ZGXA 1MW8X 1TVKB 4JJ6A 2JW5A 1D6JA 4TMFA 5CA1A 4DT1B 4RH0A 4CM8A 1MJNA 1O5IA 1NAHA 5JAZA 3PPYA 1I2CA 2PX5A 2YJZA 3VR4H 2F1HA 3K1AA 1W8DA 1FFGA 2ZDHA 3LKVA 2O5EA 4NZ9A 3PV0A 1AUXA 5FI3A 5LD2C 1ZCZA 3F3KA 3F71A 3NLLA 2BFBA 4JLMA 2TSYB 2ZR9A 3IAM1 3JQRA 4A23A 2RGEA 1OAKA 4HWSA 4ND7A 2X77A 2H1VA 3EG9B 2VUHB 3BHNA 3G2PA 1RBMA 2QP9X 4FIDA 1XZAA 2JA1A 2HIAA 5DZSA 2IOQA 3R9KA 1SNYA 5G1OA 1XJ5A 1PD0A 4WZAA 2YRXA 3T61A 4H9GA 4EGCB 2W8BA 3OOHA 2B6HA 2OMKA 3QFHA 4JLWA 4POAA 2VTBB 1GRVA 4U5QA 1NG9A 1W29A 2XH8A 2ZYWX 4GWKA 1YI0A 2ZUDA 2XSZA 4G2TA 4AT1A 2FPWA 4UUOA 1MVOA 3N2GB 4B2PA 1WV0A 3D4PA 4C0WA 1J5XA 1JALA 1BAPA 1U2RA 4UATA 5EZ5A 1E18A 4BO5A 4EJFA 2X6TA 5ED4A 3KO8A 3SC4A 2Q5IA 3L7AA 2FFAA 4D3DA 3P5SA 1RJGA 2FPGA 2JEZA 4O59O 2YV2A 3KB6A 5JYBA 2QHXA 3F6BX 4D96A 2FPIA 1YRWA 2GK6A 4H1TA 4KJXA 4KVFA 2P4QA 4FCTA 2EWVA 3Q3CA 4FE7A 3GEDA 3ZH2A 3E58A 4XI9A 5JBIA 4YFVA 4RSHA 1WJGA 3NOXA 5BSWA 5B3JC 4LZAA 4EKDA 1DXYA 3C3BA 1AKVA 2IOYA 4KMRA 4LHZA 5FH9A 2XKAA 4D98A 3N0XA 1Q3TA 4EA8A 3QIVA 4HV4A 5HFNA 3GPDG 5IT0A 1OLXA 1IM2A 3INNA 5KMGA 4JP5A 2OGSA 1UKZA 2KMLA 5I7OA 4IFTA 3KQQA 3A9SA 3ELYA 1WTCA 3A27A 4ZZ3A 3FVRA 3N0TA 2QTVA 3KLPX 1ZGGA 1OIVA 2IE0A 1N2CA 1E1QD 3FJYA 4GEKA 2G09A 4UBIA 5EN4A 1UEXC 4URXR 5JSHA 2GCNA 3ZD8A 4TMWA 3M6XA 3PXXA 5EQTA 1VGRA 5K8CA 2G6TA 1U2TA 4FFMA 5TGTA 3UHPA 1BQEA 2ZSIA 3HKDB 3OMWA 5IJ0A 1RQLA 3CRW1 1COWD 1V9LA 3BAZA 4UE2A 1FDVA 4BQIA 3C74A 4Q6WA 1JR3A 4PFJA 4YVFA 4F3KA 1TM2A 3A10A 1RHQA 1P77A 1E2HA 2F1IA 2P3QA 4KAXA 4EPXA 1P7YA 3TPCA 2I80A 4U2FA 4UW9A 2IPNA 3OCXA 4K6FA 2ORIA 3IQGX 5IF3A 2FWMX 1XUOA 3HRKA 4PZLA 5JCJA 5CNMA 2MSDB 3MJEA 1CYDA 4LDNA 3WWCA 5EJ7A 4I81A 5JAIA 1M5RA 1Q7EA 2FP4B 1XVIA 4IF4A 1KPHA 4OREX 4V2IA 5AW5A 4YUYA 4G1VA 5JEEA 1M8GA 4QUJA 4KN8A 1DAPA 4I4IA 1F2VA 4TXHA 4K2AA 1J33A 3EOAI 3JYHA 3Q11A 4FXPA 3SKYA 3W2HA 3ZC3A 1K89A 5LDGA 1MT0A 2C0QA 4CIDA 2NVUB 1EA7A 1GNPA 2Z2IA 4ISCA 3IDQA 1KMIY 4ALLA 1M0TA 3CVVA 2F7SA 4DM7A 4Y6GB 1CETA 2XI4A 3TFWA 1GQQA 4LWQA 3ZJUA 1FZTA 4NOKA 1V43A 3BN3A 3VZDA 4G81A 1TLFA 4DEXA 1BEZA 4DILA 5DM70 1CQIB 3C6QA 2WTBA 2O6LA 4AY6A 2VKTA 1UL1X 1L4NA 3TW4A 2QRNA 2ZULA 1HLGA 4RLSA 3WSWA 3B13B 2G25A 4M0KA 4OQ4A 4YGYA 3Q2KA 1M8JA 4FNGA 1JEEA 3OLZA 3R3VA 5THXA 4I1SA 1EDEA 4Z0NA 3TB6A 4DUGA 3KQNA 2D74A 2C3PA 4AO6A 1I6WA 2YC2C 2CB9A 5FNVB 5GM2A 1ZA1A 1S96A 5AW3A 2GOYA 2XNDD 4LYHA 4MVJE 1X7GA 2SCUA 3HLYA 3MTAA 4OOFA 4W9NA 5I48A 2I91A 3DT8A 2EQ5A 3KSDO 4XYBA 5JJLA 2QX8A 4YLGA 2NP6A 3R44A 2J7PA 1GPNA 1M1NB 1JKJB 3AF3A 1JBKA 3AYXB 3D64A 1R12A 1Y80A 1MOSA 2VH2A 3FCOA 3JX9A 4G01B 1T34A 1GRCA 1IDN1 1NUPA 2C83A 3ET5A 3PHBE 3EVBA 4HEQA 1RYHA 3M5DA 5HIIA 4C07A 2A30A 2CLMB 1QAOA 3D54D 3IQDB 4DT1A 1L5OA 1SEPA 3EARA 1EM8B 4JU9A 5G40A 1NOKA 4B40A 4TQGA 1XL0A 3SOZA 3C7TA 3R75A 4X00A 5AJWA 1RYZA 1FLAA 1IAVA 2JAQA 2XMZA 1TCAA 4E5SA 4YRBA 1LSUA 2HSEA 3NRJA 4BJ1A 1RXYA 4LHYA 4DL9A 3UF0A 3VPDA 1JIVA 3NBAA 4MV1A 4CV2A 4C3VA 1XCJA 2VK8A 1U6IA 2PUVA 4ENUA 2JI9A 5K2OA 3H1BA 1D04A 1KJYA 1L5SA 1ZKMA 1M1YB 3BWDD 1G5FA 2YH2A 4WFJA 1WB6A 3RUCA 1ELOA 3WGQA 3SYTA 4ZDJA 3WLRA 2ZWMA 1RTKA 3RTAA 2XHZA 3HVKA 4GYYA 5F2KA 1OROA 3I72A 2CUZA 2EOAA 1DAGA 5IMSA 3I5XA 5EWMA 2G9VA 2ZM5A 5IHPA 2EWMA 4ZCTA 3D8SA 1TK9A 2I62A 5BUQA 2BFAA 3ZGNA 5FOVA 5BXYA 4Y2JA 1TAUA 1JWBB 1DIAA 4EO9A 1MIOA 1I4DD 2OMEA 4QASA 4G0VA 4L5YA 5BN4A 5KWIA 3SC6A 2J4FA 3QVUA 2B1QA 3ROEA 5LQDA 5HDBB 3KFVA 3VA7A 4FJ1A 5A0TA 2BFFB 1A8QA 1R7RA 1K8XB 2JBWA 3I3OA 3PPVA 5B4VA 5F76A 1L7NA 4CV0A 3PXBA 5IABA 4DV6B 3WK6A 5IC4A 4AQYB 4MCIA 4MX8A 2VTEA 4QULA 5DHQA 4EVRA 2CZCA 1PNQA 4OJTA 4N8SA 1NVXQ 1P4SA 1Z0UA 3AYZB 5D7BA 3U7QB 3GOQA 3D6FA 3HL4A 3MFYA 3FLEA 3THWB 3EVTA 3ZNNA 3H5VA 5CNIA 4G4SP 2IY8A 2DF8A 4LXGA 4EENA 4B8WA 1PWEA 2QD3A 2AR0A 2QLBA 4KWIA 3OPVA 2H00A 4MGKR 1FOEB 2WWHA 2PJZA 3S0JA 1X92A 4QT4A 5KINB 4CL2A 3U44B 3K1ZA 1E2KA 1W6UA 3HSYA 3OZRA 3QEKA 2ZR0A 1CJBA 1RWQA 2VVTA 4GLJA 1O0SA 3BM5A 3ENVA 1SRRA 2HMSA 4G5OA 4YBZA 4L2IA 4WCVA 1MAHA 1EG7A 3FZQA 3I05A 3IOMA 5I7SA 4AF6A 1NZDA 3DG9A 7MHTA 4J0KA 1W36C 1XTZA 1Z5UA 2CWDA 4HAWA 4R1QA 3UGQA 1F6WA 2NZJA 4A8JC 1PQPA 4MQEB 2J31A 5JQGA 3T3OA 2BSXA 5JSFA 4EKGA 1UMBA 1ZXXA 3DWGA 1FX0B 4JEMA 4JP8A 4LTNA 2PX0A 3URKA 4BJ5A 5JU6A 1C30B 4MIYA 3W6ZA 4DCSA 3P9KA 2PKQO 4L5IA 5ISMA 4BY9E 4D4MA 3THXB 3VU1A 3H65A 3TMYA 1ZHFA 3SIRA 2O4UX 4L8GA 3RJ5A 3ZZTA 3OZAA 4DJEC 4D8VA 1HM5A 4H6XA 4QJ5A 2W58A 1OA1A 4GPTA 4QICA 2QN8A 1NAIA 3EA4A 4YHHB 1JYSA 4WMLA 1BCSA 3F3MA 1QXSA 3NBUA 4KQGA 5AQ1A 4FZ5A 2UAGA 5E6SB 3B20A 1IUOA 1J0DA 4OXQA 1YZLA 2R4QA 4E1AA 5LWHA 1ZNZA 3LW7A 4FEAA 1S9DA 2O7VA 2PUHA 2BM1A 5TV2A 3U2QA 3T8YA 4J0HA 2K7ZA 1VLLA 3HBJA 3I5UA 4NABA 2ZVDA 4MH0R 4X7RA 2BTEA 3G5MA 2I3ZA 4L6AA 4XGQA 2Q3EA 2AUNA 3IP7A 8AT1A 3CEJA 3AF6A 3JQAD 4UVEA 3VU9B 3DFZA 4DQDA 2GCIA 1G17A 5F35A 4K81B 1X7XA 3E9DA 1XGKA 3P5BA 4RZXA 3RREA 2FSPA 2VHUA 2OM6A 5D5HA 1FYFA 4A92A 5YASA 4Q02A 2BBSA 4A0FA 1AA9A 1WV1A 2X8WA 2VJMA 5ENZA 5ABPA 3M6MD 4FGLA 2BH9A 3SLGA 3G0HA 2J8ZA 1ZN8A 2VNHA 3RO7A 4XW2A 4IDEA 3WDMA 2WU0A 4KQMA 4X7MA 3N7TA 3I83A 4RA6B 1Q17A 4JLBA 4TVSA 1SCQA 1EI9A 1YU9A 3K9QO 4XCVA 3RNLA 4CPDA 3EF1A 5CB8A 4RBNA 4ALIA 4ITVA 3ZGYA 1ZD5A 4O4LB 3SLKA 2EC5A 3UT6A 1X7DA 2NXNA 3JV7A 5CYFA 4NK5A 1Z5OA 3O74A 3CJQA 3MIIA 2HD4A 1G3MA 3RSGA 2AFRA 2YV1A 4DXHA 4IDHA 3P8ZA 4XE5A 4DCVA 2G77B 5DW0A 3INYA 3SD7A 3WHPA 3LWNA 4HFNA 4RTLA 4L4YA 5E3HA 4HDKA 3HN6A 2BLNA 2I1VB 5F5LA 1GL3A 3GEGA 3G2IA 2DFPA 2W00A 3K9NA 1YB5A 3IMFA 4FEGA 1EVQA 2I6SA 4JR2A 5EEHA 2H9AA 4U00A 5JS7A 4UZEA 821PA 1XQYA 3F6YA 3LM8A 2OZVA 3GDWA 3KXPA 4MV7A 1QP7A 2YMPA 2QDKA 3K09C 4BFLA 4DAEA 621PA 3ZLTA 3FY4A 3DTVA 4TM8A 3FTPA 3QMVA 2I6GA 1PQWA 4W5HA 5LP1A 1YVUA 3JYLA 1UKVY 4C88A 3KQLA 1JT2A 3O84A 1XD2B 2C1EA 4CKXA 2OC4A 3F5MA 1D6NA 2IIVA 4OSPA 3N8DA 5ECYA 5P21A 4JJAA 5G4LA 3GQBA 3RASA 1MBZA 4JYAB 1II8B 4QM6A 4D9CA 1JHOA 3E3OA 4I36A 3QOYA 5JWRA 1GU7A 1G8KA 1ZESA 2E37A 4EZBA 1GRNA 5KNBA 3ZWWA 2JRCA 1GZ6A 3KV1A 3MT8A 4OL9A 5EXSA 1ZQ9A 1IWBB 1EP9A 1EHIA 1J07A 1WDWB 3BMNB 3HJNA 5F1YA 3RANA 1SUCA 4N3GA 1M2GA 1HDZA 2Z58A 4G1BA 3OPYB 3AEUA 2XXAB 4WVFA 5CITA 2VO1A 2AF4C 2NU6A 3CLTD 2EFJA 3OKFA 4V0RA 3MJSA 4ZHQB 5F7XA 4YRIA 3EYWA 5IJZA 3OZDA 5EIFA 4B82A 3FLBA 3WMGA 3SXUA 4N7RA 2WQ6A 1RRGA 1FE8A 4RHEA 5ALQA 3PLNA 3T3HA 3C2QA 1R4NB 4AVYA 4YR9A 3GO4A 3DVQX 3QOWA 1A9XA 4CKZA 3PL5A 4NG5A 5HHTA 2VLBA 1D03A 4AL4A 3RBVA 3N2LA 4H6WA 4R68A 4M7WA 3O21A 2HUPA 3UMGA 4ZK2A 2EP8A 2NQTA 3OC6A 3OX4A 1O08A 4ZICA 1XTVA 1ZIDA 2PBRA 2GDZA 4QUKA 2GXAA 4FSXA 1WL8A 5KOJA 1F20A 3C6BA 4P3PA 1E1RD 2QXYA 1RPZA 1VE1A 1HDGO 7ABPA 2XGJA 5EHIA 4ETNA 5LDDC 4FFBB 4GNRA 4EYOA 3CRVA 3TAUA 2F1KA 3I04M 3STUA 1MO3A 1M75A 1LH0A 2I8LA 4R84A 4E5KA 1TUGA 4PICA 1NIJA 1QVVA 1TFRA 1EP2B 4DWOA 1A82A 4TQAA 5TMEA 1E3WA 1XQVA 4D9MA 3MJFA 1U80A 5E1DA 1PZHA 2ILVA 5LM3A 1W35A 3HO6A 4UM7A 4EJSA 4ZAXA 2TS1A 2HYIC 2O59A 2I4IA 2X41A 3O2NA 2LKCA 3A14A 4JI4B 1GPMA 1E5XA 4YB8A 5SZHB 2QD1A 4KTVE 5HCNA 2D7JA 1U0NA 2D6FA 3WL6A 3ON5A 1U0JA 4ZV9A 2J9FB 4EG0A 4KPEC 4IHQA 5EJ5A 3T0GA 4JI8B 4ZOLA 3UWPA 1DKQA 1I6KA 1FDSA 1M2KA 1TT7A 4B3CA 3T5AA 3LVFO 1A9RA 4XB6B 4YJ3A 1BO6A 5LNK1 2ZBRA 2XLBA 1JG6A 5F3RA 4PNHA 3C5CA 1YA8A 3GGCA 4BVEA 1HSOA 5DTEA 1GQFA 2ZUEA 1HMPA 2YXEA 2W98A 1ABFA 2PSJA 2QMUA 2WP0A 1GUFA 3OF2A 1RFGE 3G23A 2P2NA 1K7FB 3K2QA 2H18A 4NBVA 4OXYA 1GV0A 1Q0LA 2ZG6A 3ZE8A 1G8GA 1NM5A 1FB5A 2ORYA 3I9NA 4OUDA 6REQA 3P9IA 2JFYA 3N2NA 1ECCA 1B0ZA 3D7LA 4C3ZA 4JXXA 5JTUA 1XG5A 2A0WA 2WJWA 3CFYA 1R9JA 1ULUA 3COSA 5U9CA 2I4RA 5KS2A 2VNAA 1COWA 4M60A 1IM5A 6LDHA 5KPDA 1J24A 1R5BA 1N3IA 2AFIA 2POQX 1ISPA 1ENZA 1TUEA 1J97A 2FPSA 3F98A 3SJCA 2A9OA 1GGMA 3T9EA 3BIOA 3I2HA 2PRIA 4BNFA 3CN7A 3N28A 1Z4NA 2ZSUA 4KDFA 4X8OA 3D4BA 4A0GA 5BV7A 4XQGA 2O8FA 5H82A 1Y89A 4HH1A 3C5EA 3JZFA 3QE2A 1ODCA 1PK7A 2HF7A 2UVPB 2X7XA 3SFZA 4RTMA 4RVGA 3UFXA 5BSVA 2D5BA 2ENUA 2IE8A 1L4MA 2RGXA 3K71B 3H87A 4QDUA 1FP7A 4LYGA 2Y0PA 4B6EA 4IIDA 1O8CA 4OHFA 3DAFA 1P4HA 3MMXA 3FPSA 3TLGA 5JROA 1PR9A 2JJ1D 4UVDA 2GEFA 5ESXA 4MITA 1JIKA 2O3TA 5AXDA 2MCFA 1JQAA 3W6UA 4QBIA 1H2RS 3VC3A 2FEMA 4OTZA 4I8IA 5LYJA 4XVRA 4D82A 4TV8B 4R2IA 1T3SA 3I30X 3PKJA 4J1SA 4NAVA 2FUG1 5HJ5A 4GRIA 5AM2A 1IBLB 3VR6H 2QXUA 1BG6A 2Q5HA 1ZEJA 1CEXA 1GGKA 3AEQB 3NHZA 2O23A 2WKWA 1C1HA 4IQ4A 3H5WA 1GARA 3A1SA 2ATVA 2G83A 1A5TA 4GD3Q 4NYJQ 2OYRA 4YT2A 2H1SA 1PJQA 4I1IA 3D3WA 1XTSA 4II7A 5JFTA 3STYA 1WZUA 4MCJA 3BFKA 3PXUA 4LVCA 4E13A 3SOPA 4ZI5A 1Y7IA 2HJGA 2PGDA 4G63A 5DGTA 5IAJA 3WLNA 2XNDA 1OBOA 2Q27A 3ENWA 2XRZA 1ZXBA 3L77A 5CB4F 1BS2A 2GXSA 3LOQA 1RM3A 2CLKB 2YZGA 3HUUA 1MCZA 5AKLA 2J5RA 2GH1A 2A2ZA 3KXDA 4CYMA 4MV4A 4MYHA 3M7IA 3BK7A 5DW3A 3GL9A 4C6SA 5BR4A 3I42A 5CM2Z 3R41A 2BFDB 4GOMD 3DM9B 4RKQA 1ECFA 1XDDA 2D1FA 2ZQZA 4LEIA 5LQMA 3WWEA 4CMKA 1JHZA 4B4WA 4PBTA 2PT7A 4A2PA 2YFKA 1PGQA 3KB8A 1ORHA 3NTVA 5HQJA 2VDLB 4AWAA 3HYRA 4EF4A 5HG0A 1I0IA 3SVZA 3L79A 4P83A 4LW8A 1CUAA 4HAVA 4U2EA 4F3CA 2GYWA 2YYYA 4P7GA 5A03A 2P40A 3SWWA 3BIJA 2CCGA 2VP6A 2CDBA 2H06A 4ZT6A 1SBTA 4HF7A 2AEMA 5NLLA 1L5LA 5DISB 3GUZA 4G65A 4XSHA 2ZJ6A 2IIPA 4YA6A 4H1WA 1Z2NX 4IIGA 1GPBA 9ATCA 2HXYA 3NKVA 3R6TA 1N77A 3LLCA 3PNOA 3MWDA 3UCFA 4FGKA 1PG5A 2WUEA 3ANYB 4M1SA 4X61A 3AW9A 4XIYA 4ZTZB 4KITB 4W9MC 2BISA 2FN8A 4GR4A 3UHFA 3HDTA 4BX0A 4OXRA 5F12A 1UFKA 3U9LA 1FVFA 3E2IA 2BN4A 4QJBA 3PDIA 5ALZA 3C5WP 1QH0A 4EEKA 1KYTA 1QMPA 3OX3A 4MV9A 3I01M 4RLFA 4AX8A 1XYVA 3RTGA 3G5TA 4GM4A 4WLFA 2YS6A 5HBGA 2J0QA 4FI3C 4M8KA 3OLCX 1QV7A 2HJWA 1SCAA 1GN8A 2GPJA 1LPOA 1SG6A 4Q34A 2XE4A 1N6PA 1XZGA 3W79A 2GCOA 3TF5A 2OBBA 1CC1S 3GWGA 1KHTA 4KN5A 2ONYA 4L08A 3IPCA 2D13A 1FYEA 1OWNA 2KLBA 2VYND 4NCNA 2WIDA 5CT5A 2YJNA 1LPSA 2MR6A 4JLVA 3E2MA 2FK8A 5KZMB 2IYLD 3LP8A 3L7OA 4JELA 5HTOA 4IWXA 2Y71A 1YTUA 5ALKA 3T4UA 3P9XA 1L5FA 4HNSA 3TPFA 5EJ6A 1X1SA 1QTIA 2C9MA 5AJVB 3GLVA 1VCHA 1VSVA 4E2ZA 2QP4A 3AVYA 1HV8A 4TN5A 1YA6A 2PX2A 3NYIA 1OB5A 2JH9A 1KK2A 2LBPA 1FDUA 1VL5A 2NNLD 3CA8A 2JHFA 1RCTE 3K1TA 1VIYA 3MMNA 3JRWA 4BE4A 1NJGA 5CJJA 3PTLA 1BMFD 3M9LA 3B7WA 2RHMA 4RWEA 4CMJA 2GM5A 4M46A 1IN7A 6ABPA 3DC2A 3REQA 2ODAA 3A31A 4C7XA 1R6AA 2HLHA 3OCWA 2B83A 1QHFA 4N9WA 4WEOA 5BQFA 2PSSA 2E87A 1P9LA 4ND5A 4L9AA 2VBIA 2IZZA 2LDBA 2QN7A 4JOCA 4N5NA 4K9MA 4CIVA 4DIUA 3CX3A 1KAOA 1GNQA 5JWOA 1LPAB 3KZOA 2DBQA 1B0UA 3GB9A 2F2TA 4LOKA 2CV0A 2OFOA 1C7RA 4MW4A 1CEYA 2J4CA 3DGFC 3JWEA 1L7MA 2GFQA 3K1YA 5HK8A 1O4WA 1T1EA 2Q1TA 3TG2A 4O2RA 3ORHA 1UJCA 3CCCA 5TNXA 1PVOA 2R25B 3S40A 2PJUA 1MOQA 5BYBA 2PZLA 1NXXA 5CGZA 3RE1A 3FF1A 1CJUC 1KO4A 3ENZA 3KKOA 1RMQA 3IT3A 2BGMA 2HPZA 2OY0A 4K9NA 4P7KA 2GM4A 1N78A 1UR5A 2YINC 3W9UA 1D6SA 1U8UA 2VXYA 1KFEB 3DEYX 2X5XA 4N0MA 5KNCH 3G7NA 3K9FC 5IYZB 4RK0A 4EQZA 2RARA 2R62A 1OU4A 5HE9A 3VRHA 5LP6B 1IJFA 2YIMA 2O3SA 3HA3A 4RIFA 4XWYA 1FSPA 1U5CA 4C1BA 5C1DA 2PT6A 5DI3A 2PKWA 2R6DA 3GNSA 3TBKA 2C4VA 1W88A 3TTUA 3A70A 1L7XA 4OYHA 2PG3A 4A6PA 1TEVA 4C06A 1YO6A 4IUDS 3DXXA 3L82B 4HEA1 3H1EA 3C85A 3DOCA 2B3TA 1ZW6A 3GLKA 4RK7A 2NIPA 4LOHA 3RVBA 2SKDA 2G06A 4AJKA 1YFKA 5J2TB 1AXEA 3BK2A 4BNKA 4TYQA 4HX2A 1ZOLA 3G82C 1WQ1R 2V5VA 4UEOA 1DLJA 2NTYC 2D5AA 2YOFA 2H57A 2WYWA 1VYUA 3LLMA 3BXOA 5CYOA 4ZCMA 4TKZA 3LLUA 2WT8A 3H9EO 3DE2X 4JVLA 4RZQA 4PPNA 1U94A 1Q7TA 1V1JA 1I36A 3HKEA 4E1BA 3BUSA 2OCPA 4V0ME 5AKHA 2FUEA 2NYRA 4ZTBA 3L7LA 1I10A 3RFCA 3LC7O 2RE8A 4ZPJA 4KGZA 1TIBA 3U4QA 2DU8A 4DDVA 1QIKA 4JQYA 3TXAA 1AU9A 5BOVA 3H9JA 4LS3A 4R2JA 3KE8A 4KWTA 4IG4A 4YRJA 1RPJA 1ZM9A 3ORFA 4OD0A 4CM4B 1FLNA 1KK3A 2JIRA 1R6VA 3R7AA 3ZDRA 1F9EA 1NR7A 4OHVA 4BP8A 2DWPA 4S1VA 4F3YA 3TSYA 3RRZA 3Q40A 2OSBA 3UUFA 1JHYA 4P22A 4OHBA 2GRJA 1J22A 5DO9A 1P72A 3ZE7A 3HO1A 1YHZA 2ZETA 1L7RA 2EF0A 2A0UA 3R40A 5HJ7A 3CTMA 4NWIA 1FTGA 4Z49A 2XQFA 4DADA 4TTQA 4WNAB 3VNRA 5EPUA 2X42A 4RHYA 4BWYA 4NU0A 3F90A 3WGIA 5L3QB 5DRYA 2VBGA 3RRFA 5BYJA 4AZTA 5F64A 1RXUA 3N39C 3PGLA 4Z9FA 4MWGA 1U3TA 5AHKA 1CZHA 1IRIA 4HVCA 1ZSNA 4GWLA 1M2OA 1TD9A 2OCLA 1TEHA 1LBTA 3R0IA 5AJYA 3QX3A 1O9BA 4AJ2A 1RYFA 1UP7A 2VK4A 1EX1A 2YQ5A 4QAJA 1KETA 1JA0A 3ZY4A 4BNZA 2ZZNA 3M81A 1GSOA 4QGBA 2JASA 4V1CI 2QLMA 1ESDA 4OLAA 4CW7A 3NKFA 1B6RA 2HQBA 4HZUA 4LRUA 3S8YA 1IZZA 4LMPA 3OTOB 2X0DA 1W8IA 1Z5ZA 3DLHA 2QTWB 3QTBA 1SHUX 3PGJA 3ST7A 4A27A 4DJDC 1U0EA 2VDWB 3SN6A 2VJYA 4LX0A 1H42A 3WL4A 1PFVA 3HZRA 1J8FA 5CFZA 4JI3B 1C3XA 3WNQA 3EMVA 1S3SA 3NEJA 2VSFA 2PX3A 3LRXA 4W82A 2B69A 1MJ5A 1AKUA 5JXJA 3S68A 1ZNWA 2D2VA 1XVAA 2G36A 4M98A 3GBSA 9MHTA 3HABA 2EYUA 4FFSA 3EQZA 5EMKA 3VX4A 4J75A 3CPEA 1SKAA 2J0UB 2Z08A 2A5LA 2DQZA 5EVJA 5L3SB 2R7MA 4BO1A 1W30A 4N5HX 1QPZA 1FU4A 1S2MA 2BCJQ 1Q92A 3NIDB 2PVSA 4HBZA 1MTOA 4OH7A 2EKLA 4RXUA 3SC2B 4UTNA 2BWJA 2O2XA 3W3ZB 2G72A 2HA3A 3G2KA 4K88A 5JS6A 2XYPA 4B2IA 4YAWA 4BB9A 3GJXC 2HUNA 3AUXA 5THKA 1E7SA 1UXHA 1OD6A 1UXKA 2HBYA 2XV1A 3QTLA 3SNKA 3UAYA 1MV5A 2WA2A 4HB0A 3WB9A 4BX8A 5HQ3A 1I94B 3BXZA 4TLEA 5HZKA 3EGXA 1Z75A 3L8GA 3RAGA 4DJFC 1SB9A 5CX1B 3ZU3A 5KHLB 1QGED 1P7VA 4MS1A 5AM5A 4AY5A 1FCJA 1VMAA 3LY8A 3IBFA 4R2WA 3OLXA 3G2MA 4AM8A 2RBGA 3AI3A 4F6LA 5EKUA 2G1KA 2AOVA 4W1RA 4I9UA 4EDHA 2XBLA 3COYA 2BGLA 2QQFA 3RABA 3L07A 3LCMA 1GTJ1 3PUZA 1OGJA 4IMPA 2OBFA 3KIPA 4RVDA 4J0QA 1ZQ1A 3VR0A 4BWVA 2ZVPX 1KK0A 4QGSA 2W6JD 5KX5F 3NQ41 2PL5A 2H29A 2GF9A 2XUZA 2FQYA 3AJRA 2H7CA 5BVGB 2PSEA 4W5OA 3W8EA 1TECE 1K66A 1K8QA 3E27A 4RHXA 1I2AA 3DWFA 2RGNA 2RHBA 2W6QA 3LIIA 4JEHA 3SS7X 3VTZA 1XU9A 2GZSA 3EGWA 4HQ6A 4D0NA 1QIDA 5KSZA 4Q3KA 2NO6A 3O4IA 1XMJA 4KHPB 2NZ8A 1MEOA 4GMXA 4GICA 1T8UA 4K9KA 3PUJA 1U7PA 2BIFA 4N3BA 1IJEA 1IQPA 1PR3A 4WKNA 1G4UR 3R20A 1K5HA 7ADHA 5JIBA 1PD1A 1GLGA 4Z3OA 1O97C 2VF8A 3N58A 2FLWA 1Y4ZA 2QTLA 3FPFA 1QRUA 2ZRDA 3KDAA 4XUDA 1Q0SA 3A4VA 3IP6A 4MYUA 1GPLA 4OHZA 1E79D 3KBBA 1R6UA 4XVQA 1RWMA 1OASA 3EXHA 3KAQA 4TUYF 2FUKA 2ICAA 5FTNA 1AK2A 1CE8A 3G68A 1HE2A 2O19A 3WA6A 5A5EA 2ZBQA 1IQUA 1VJCA 3OE7D 4JXKA 3P32A 4QNMA 3TJRA 5JH7B 3W06A 2JGMA 1O1YA 3IAS6 1ECGA 1SCBA 1ZC4A 5D3QA 5D6OA 5G0VA 1M5UA 3LDFA 2ZWIA 3V1YA 3A4YA 1ZGBA 5KVCA 4CKBB 4EUKA 5E2IA 4P58A 3ZH9B 2F43B 4JI5B 4EJ2A 5BQXA 5DCWA 3AESA 1M83A 1SCIA 1X77A 3L8FA 4KEAA 4MUGA 3UWOA 2UUCB 3BGDA 3G0BA 4B5KA 5KJFA 5DP1A 4GMGA 13PKA 2QR5A 1HRDA 2IYWA 4TRJA 1TVCA 3EZXA 5BV1A 2BE9A 4GPAA 3IMGA 4YQYA 5ECGC 3EXAA 5KTNA 2ANBA 2RB5A 2BZ1A 2ZB8A 1XB2A 3ITDA 1C3LA 3QA3E 3NGLA 4MI9A 2AJBA 1ZG3A 3IOYA 1VKOA 1Q21A 4NCJA 3HI4A 2QM3A 4HO1X 2QV7A 3CJTA 3A25A 1M5TA 5CVJA 3SM9A 3T9CA 1KS9A 1ECJA 2ON6A 2SHKA 4M88A 2Z4SA 3L7NA 4OFXA 3VKFA 1JFRA 3HJCA 3LIPA 3KRTA 1OUMA 2I76A 4FOSA 1NW5A 1U2SA 1DJPA 2HU8A 1LNZA 3P4UA 5DNDA 3OT1B 5FNZA 3MBOA 5TEWA 4DA4A 4MR8B 2WVHA 1UBRS 4P0QB 2IDZA 1YGPA 3OICA 5J59A 3ZXYA 4EPVA 2AYXA 4LFAB 1EBFA 1XEAA 2DLCX 3NXKA 2O6HA 1K7YA 2V3CC 5C5IA 1DFIA 1QUFA 4KN9S 1HFEL 1L3IA 2EIXA 1O94C 2IPOA 2PS0A 4RXTA 1NX6A 4FMCB 3U0VA 1JYFA 4GPBA 2Q7DA 2ZSDA 2XZTA 2EF1A 5BWNA 3ANNA 3U7FB 4EUNA 1OB2A 2RKOA 3AKDA 1CUSA 8LDHA 1NM5C 4EOGA 3W8RA 1D2HA 3LX4A 2H8KA 2VA9A 3ZOZA 1W94A 4JX8A 3SX0A 4RTNA 4ZCRA 4V02A 1E3DA 1DKMA 5G1PA 4LMAA 5K3CA 2AQHA 2R11A 2TRSB 2WIKA 3I04A 1E0DA 3N6RA 5A0FA 3U62A 3U48A 5HUQA 1PNOA 2GZDA 4BJHB 2ZI4A 1W1IA 4HLQB 2GEJA 2ZQYA 1HYEA 4M6WA 2AN3A 3LKZA 3TE7A 1QS0B 2A67A 3UAWA 5JJ5A 3GPLA 1QBKC 2Z9DA 3VVCA 3UWKA 1IXYA 2ZUTA