1PJ4A

Crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate malate, atp, mn++, and allosteric activator fumarate.
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
552
structure length
552
Chain Sequence
KEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD-dependent malic enzyme, mitochondrial
publication title Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 188
structure length 552
sequence length 552
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pj4A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1pj4A01
3D7LA 3I1JA 2DFDA 2Y1EA 4WEQA 4M89A 1LDMA 1TT5B 2FMUA 3VTFA 5EERA 4D45A 4YYZA 4E2WA 5B4TA 2HKIA 2PWZA 4RV9A 4BNXA 5HS6A 3AOGA 2X0RA 2Q45A 4LISA 3K6JA 4DPMA 4WOKA 1FDTA 1PQWA 4EW6A 5FF9A 3NAQA 3SX2A 2I6TA 1V3UA 2DQ4A 3JQFA 3MZ0A 2P5UA 1XG5A 2Y68A 5IF3A 2OBNA 4BMNA 5CEFA 1ONPA 4CM9D 3O8QA 4L4RA 5J23A 3DOOA 3IKVA 4TVOA 1R4NB 4BNIA 5JY1A 2EP7A 1CRWG 4MVJM 5TGDA 4E5NA 4TWRA 1V8BA 1YDWA 3KSDO 4YQZA 3RAJA 4YT8A 3U62A 3MWEB 4MVJP 3RFXA 2W98A 5BNIA 1ZJYA 3JQFC 2OBYA 1U8FO 1MGOA 4OKIA 4OSOA 4L75A 3W8DA 5HRUA 4NIMA 2AMFA 2I65A 4NI5A 2FPIA 4FCCA 3RBVA 4YBZA 2NU7A 3JQAD 3GOHA 2OL4A 1M2WA 1MC5A 5KKCA 3HSKA 1E6WA 3PEFA 1LJ8A 2XPCA 1HDXA 1VL6A 1SAYA 1JTVA 4RLHA 4OQZA 3DBHA 3DHYA 2CVOA 5F3RA 1DO8A 3VH1A 1E3SA 1DEHA 1LDBA 4I9UA 1O95A 4C7KA 3KB6A 1ID1A 4TQGA 1PTJA 1QYVA 1ZK1A 4XGNA 5FYDA 3KM0A 1LLQA 4MVJA 1UAGA 3BTOA 5IZ4A 3OHSX 3GN2A 5CDSA 3I83A 3R3JA 1T2FA 1I0ZA 2WD7B 4PFJA 1L7EA 4WKGA 5L9AA 3U3XA 4IZHA 4XQGA 1J49A 3FBTA 5U1PA 3JQAB 5KCZA 3HDQA 4FFOA 1OZAA 4JBIA 4ALJA 3GR6A 3RC9A 4LRTB 3UXYA 1E3IA 1I2ZA 1RPNA 4JLWA 4E6PA 2DPGA 4BO3A 5L4SA 3KYCB 1G1AA 1ISIA 5L3ZA 1MXHA 1TB4A 1NASA 3B1KA 3GZ4A 2NVWA 1E1LA 1EQ2A 4CODB 3ONEA 4XYGA 3UGKA 1RM0A 1NR7A 1E7MA 4YQYA 4JJIA 1JAXA 1YKFA 3GDFA 1RM3A 3GN1A 3OQ1A 3PJEA 3BMOB 4PRKA 2F1KA 4JN6B 1O94A 5IDXA 3WYEA 3P2YA 1S6YA 2G0TA 1PJTA 3DBLA 3AI2A 1B7GO 4QSMA 3AI1A 3QWIA 3MJ4A 4Q3NA 3EVNA 4R9SA 3QVXA 3QVTA 3FTNA 1MX3A 1SCUA 4OXNA 1LBEA 4YXFA 1VM6A 3BMCA 4GSKA 1NWHA 4E12A 4MVJI 3W4KA 2OMEA 1BMDA 4P38A 5BQFA 1YL7A 3RUCA 4LW8A 4PLPA 2BFAA 5AQ1A 1SBYA 4OOEA 4WLNA 1QYXA 2HMUA 3RUIA 4BKRA 1V3TA 3PQEA 4BNKA 4D46A 1HYEA 3GHYA 3GNSA 5T64A 2EXXA 2CD9A 2NV6A 3TWOA 4IY1A 3WJAA 4HUJA 3DZBA 3DOCA 2IXBA 4LMPA 4QX6A 4D41A 1EFLA 2JFFA 1ZSNA 1ULSA 3K96A 4NPCA 4TKLA 1N7GA 4P4NA 5G4KB 5CAEA 4RVFA 1AE1A 2EJVA 4ESOA 1WPQA 2OZPA 3I9NA 3NGLA 4CV2A 2O3QA 2Q49A 4YAGA 1FDUA 3KEQA 4J1QA 4E5PA 5A3JA 1CDOA 1XKQA 2O48X 3FWZA 4NHEA 4RLSA 1P1JA 2H63A 1R37A 3DAFA 1C0IA 1U3VA 3D3WA 1UZNA 1ZW1A 4LCEA 3HADA 3CXRA 4J4HA 4CLEA 3TFOA 5EN4A 3H6KA 1J5PA 4NFHA 2V7PA 4JXKA 2NTVA 1Q7BA 2VUSA 4ND1A 1ORRA 1YJQA 3R0IA 5IFLA 2P4QA 4IMRA 1QR6A 3A06A 3DQPA 4U6SA 3C1OA 5CHEA 5EJ2A 4D79A 5EESA 1LC0A 4J3FA 2G1UA 2PGLA 4OXYA 2PKQO 4WGGA 1FDSA 2G17A 3GGPA 3QY9A 3JD1A 4GX2A 1N9GB 5JO9A 4AJPA 1AXGA 1DC3A 4CQLB 3FNGA 3M2PA 3JCZA 3K8ZA 4YRAA 2I76A 2YDYA 4RVGA 1GD1O 4QECA 4NU5A 2EGGA 2Y0CA 3UHAA 1E7YA 2GD1O 2D1YA 3MTGA 4W9NA 5DP2A 4CQMD 1ENZA 2GR9A 4IXWA 4LN1A 5TRTA 2X7HA 1P1RA 3I23A 5CG2A 5F5LA 2PH5A 2IZ0A 3MJSA 1JWBB 1C14A 5L51A 4OXKA 4I9NA 1HZJA 3ZWAA 5TQVA 4R9RA 5CPBA 1E7QA 1G6KA 1YB5A 5TC4A 4CM6A 1EBFA 1ZO8A 2FOIA 2YHIB 3INTA 3ZU2A 3OFSA 1ZIDA 4E13A 3ITKA 1YB4A 3ZWBA 1TT7A 2D4AA 2HJRA 4MOWA 1ISHA 3CIFA 4B79A 3OQ6A 4BO0A 4MKZA 4CLOB 1U8XX 4XQCA 5JAMA 4W4TA 5KNLA 3H2ZA 3W4IA 4MINA 3H7AA 4DBVO 3ZWYA 3JV7A 4CQMB 4MP8A 4CMIB 2GN9A 2VQ3A 4WJZA 3AUAA 3OF2A 4RZHA 1TLTA 2YV3A 2JAPA 3I4FA 1DIBA 2FRDA 1Q7GA 3F6YA 4XGIA 4CMGA 2DFVA 2O7SA 4BO9A 3VZSA 2Y1OA 2NWQA 5IG2A 1BHSA 4TROA 1NVGA 2AG8A 3ITDA 3DZKA 5DZSA 4FFLA 3H9GA 1ZBQA 1HDOA 1U1IA 5KJEA 3GA0A 4RDIA 2GYYA 3VZPA 5THKA 2DTEA 4ZU3A 3WSVA 5G0SA 3HB5X 4RF3A 1SB9A 4L8VA 4IQ0A 4R01A 3A4VA 4J7CA 1OBFO 4AJ4A 4E2XA 2HRBA 3SJ7A 1KYQA 4L73A 5I9LA 1EDOA 4KMSA 5A02A 2IE0A 2OFPA 3BA1A 1QSGA 2WE8A 4ND2A 4UVDA 3RUDA 2EHDA 4IDGA 2J3JA 3HHPA 4FJ0A 1XLTA 4P4GA 1DIAA 1GCOA 3ON5A 1VSVA 2AQIA 4R51A 2UDPA 2X23A 1EK5A 3PVZA 4WLUA 3AUSA 3JYNA 4OM8A 1VL8A 4WPGA 3WBFA 4EUEA 4GKBA 3ROPA 2UUPA 4IDCA 1YBVA 4AJLA 3PPIA 4WCFB 2QRJA 1RWBA 4UULA 2HK8A 1Z7BA 4R41A 4CUZA 1GQQA 2EKLA 4CMHA 1LRJA 1R4MA 3QVWA 3G1TA 1LX6A 4ZN6A 2GN8A 2I5PO 2I9PA 5EL0A 1CIVA 3N7UA 4XYBA 3HDYA 4NZ9A 4DPLA 4CL3A 4IQGA 4YAJA 3WQQA 4Q3EA 3Q1LA 3O26A 1EUCA 4BO2A 1ML3A 5BSEA 4FFMA 2FWMX 4NJMB 1Y8RA 2Q50A 4PLCA 2P9EA 4PLYA 1DC6A 3JYQA 4XR4A 3WGQA 3PHJA 3PWKA 3GEGA 1E3LA 4BNWA 4RPHA 3ZHXA 1IUKA 3B1JA 3EMKA 2C2YA 3QP9A 4XEHA 4XWYA 1NPDA 3ZHYA 1JU9A 4TRNA 3OJOA 1Q1NA 1UXKA 3PYMA 3ZDFA 3ADOA 4AICA 4UEKA 5DULA 4RQUA 5L7WA 1BXZA 4RVSA 5F1PA 4FB5A 3ZGYA 5CPFA 5U4QA 3K73O 1FK8A 3DONA 1C1DB 2A9FA 4N18A 5CDUA 1SOWA 4HXYA 4CMEA 8ADHA 1C0LA 1H5QA 3PIDA 3KEOA 3ZWXA 1HEUA 3O4RA 2X4GA 2Y1FA 3ZN2A 1DOHA 2C2XA 3WLFA 3S8MA 3FCOA 1PWZA 1K6XA 3FNHA 3ZU4A 3RUAA 4W82A 1BDBA 2O4UX 3PWSA 2IEBA 1QV6A 1Y9EA 2GNAA 1OFGA 3PIIA 4OIMA 3KLPX 5TT0A 1CWUA 1TVEA 3PHLA 1XHLA 4CV0A 3SVTA 4CM8B 3OQBA 2D5AA 4Q3DA 5COAA 1WMAA 4MKXA 1YQGA 4LRSB 4CMEC 5TJHA 1I36A 3EZLA 1A72A 4A5OA 3GFGA 4ZRMA 4CUKA 4E5KA 1ZK4A 4GLOA 1MA0A 1OMOA 1ARZA 4RPJA 4KQXA 1LDYA 4DA9A 5GZ1A 1NQTA 5IN4A 1B3RA 4XR9A 4OOFA 3BIOA 5HM8A 5KJCA 4OH1A 3GQVA 3RBZA 4YAEA 2BFPA 2I67A 4XZ3A 1E3WB 3SBOA 5A03A 2VT2A 3AW9A 1E0DA 4EEZA 4BKQA 2AEJA 3GGGA 4R16A 2RHRA 4GWKA 3VKUA 4FFPA 3X2FA 4QFCA 3WR5A 2WMDA 2VZ0A 2Q1WA 2PKQP 3W8FA 1I3KA 2ZTVA 3GNQA 1UP4A 3FI9A 3BHMA 1JN0A 1PL6A 1ULUA 1QKIA 4M1QA 3LT0A 5L40A 3KZVA 2JKVA 2ZTLA 3PQDA 4AL4A 3CEAA 1PL8A 2QX7A 3FPCA 4D0SA 2VUTA 3LZ6A 1GUZA 2DTXA 2QHXA 1E7WA 2PLAA 4JP2A 1X1TA 1XCBA 1M67A 3F47A 2V65A 3ROQA 1GYRA 1KC1A 2RCYA 5L4LA 4XCVA 1PJLA 4XYLA 4PZDA 3TNLA 2EGHA 1QYWA 3QWBA 2W2KB 3ULKA 4AJ1A 1IY8A 1W4ZA 1H94A 4FW8A 3RC2A 3WICA 5C7OO 4RZIA 3TFQA 4FDAA 3WWYA 3RUFA 3VTZA 2IYOA 1E6UA 3FNEA 1I30A 3JD3A 1EE2A 3Q3CA 2VHZA 2X9NA 4QFDA 1HLDA 5GMOA 2ZK7A 3DZJA 1DFIA 4PLZA 2ZB8A 1YWGO 3HB4X 3VC7A 1NYTA 3GGOA 4EDFA 1EUDA 1Y8QB 3BTSA 4I5GA 4R5MA 5JYEA 5HBRA 5JAZA 1KBZA 3Q2IA 2NVBA 3VZQA 3JQ8A 1UXGA 3VVBA 4D42A 2XAAA 1E1NA 4LK3A 4R3WA 2B4QA 2GZ2A 2EJWA 1WZIA 4FJ2A 1T25A 1HYHA 2Q2WA 2O3SA 3EDMA 4Y6RA 4BGVA 1DJNA 4IQ8A 4YJFA 5IN5A 2JHFA 3GFBA 2CY0A 4DQUA 1Y1PA 3C7CB 4XIJA 3ONFA 2HDHA 1A9ZA 4QQRA 3FBGA 3LF2A 1HE5A 1NQAO 2Q1UA 5G0VA 3IC5A 4IJWA 4I8XA 2Q4EA 1L7DA 4A0SA 4D7AA 2HRZA 4EBFA 4NFYA 2DKNA 1FDVA 4WK6A 3D5QA 3I4CA 2WTBA 1PGOA 4PLHA 2FN7A 1N7HA 3BTVA 1PJQA 2ZJ0A 3BMNB 3JYPA 1TT5A 1JA9A 2RBEA 4JNKA 1P0CA 4BQRA 5ENVA 2PK3A 1LU9A 3IP3A 3S2IA 3WSWA 1F8FA 4NBUA 3WOHA 4MJLA 5T67A 1C1XB 1U5CA 4XB1A 5GZ3A 4EYEA 1B26A 2PH3A 4K1LA 1MV8A 3L07A 4YRBA 2YFHA 1TEHA 3U5TA 2OGUA 3W8EA 1A4UA 4ZA2A 1O5IA 4G2NA 3FHLA 3L6OO 4PN3A 4CLRA 3OIFA 3V8BA 4H3VA 3ICPA 2HMVA 1H2HA 3RQSA 4GX5A 4R1UA 4XYEA 5TJ9A 2GCGA 4DBZA 2PR2A 4YVFA 2P9CA 1XGKA 1QP8A 4CPDA 4XJSA 1CEQA 3A9WA 5ITVA 1EVZA 1PZGA 4DC1A 2B35A 1QLJA 5EIOA 3RASA 2B5VA 3DEYX 3ZU5A 4IUYA 1A9YA 1GQ2A 2AQHA 4TZTA 4IIVA 2E6UX 4NBVA 4KUEA 2CVZA 1PX0A 3TRIA 1KY4A 3ZHBA 5FI3A 4GI2A 4IJKA 1FF9A 2OOSA 5JFOA 5AOVA 1GZ3A 3JQ9A 2QW8A 4GPD1 4Q9NA 1ZUD1 4EGFA 1ISJA 3DDNA 3WTCA 4CM9A 2BFMA 3IL2A 1I01A 2D2IA 2DUUA 1K89A 3GF4A 4B3IA 4FS3A 1H6CA 2Z95A 1UAYA 5ES3A 4BGEA 4W7HA 3K30A 2DLDA 3QWAA 3GY0A 3UCXA 3INGA 4KTVE 2YZ7A 3DAGA 2ZCUA 4TVBA 3LLVA 4UVEA 4HFJA 4CM5A 3ZWOA 2W2LD 3JQ9C 1Z82A 4IDDA 1ZK0A 3WGGA 1SB8A 3D5TA 1BW9A 5LDHA 3DBRB 4J91A 3U4CA 4FD3A 5TT1A 3RUHA 4DTIA 5DF1A 3ZWCA 4RJTA 1KVQA 4XDZA 1P74A 1LDGA 2YV2A 2VYVD 4LGVA 1E7RA 4NDNE 3TQHA 1IULA 4DQVA 3QE3A 4OMUA 4J9VA 3ETDA 1P77A 1VPDA 1UXIA 1HWYA 1VSUA 3RD5A 1T24A 4NK5A 4YB8A 1DFGA 4FR5A 3TSCA 1BTOA 1GQYA 1QRRA 2NADA 1BXKA 2ET6A 1E1KA 1HETA 2D0IA 1EEHA 4CR7A 3GEDA 3DFUA 1JW9B 4J4BA 2OORA 4BO4A 3W6UA 1E7SA 4B8ZA 1MG5A 1PIWA 4NJOA 3CKYA 2EF1A 4OL9A 2BELA 4WEOA 2PZJA 2NVUA 2GPTA 2VZ8A 4YJGA 4KTTE 4NFSA 4U8GA 3LVFO 1UUFA 4CM4B 5DOZA 3K9QO 3GAZA 3L4BA 3PJFA 4O0LA 2VYND 4EEXA 5I9NA 2GF2A 2IRWA 3V2UA 3EUWA 1LRLA 4HP8A 4PG7A 3OIDA 2Z1NA 4U0JA 1BXGB 1U3TA 4TKMA 4FN4A 4O5OA 4Y6SA 3L4BC 1IZ9A 3HN2A 4NR0A 4GH5A 2FSSA 3GAFA 3ZWPA 3WNQA 2EEZA 2YJZA 4I5FA 5A3VA 5KJFA 1V3VA 3DXFA 3EY4A 1YJ8A 5EMHA 5JO0A 4NBRA 4I9HA 1GYQA 2DAPA 2UV8A 5ENDA 2JCVA 4U7WA 5HWSA 1P1HA 3LLSA 5A5FA 3G49A 1Y81A 1W8DA 2NTNA 2IEDA 4IJVA 2DBVO 5JMWA 1SEPA 4FBGA 2ZQYA 3ORFA 1IHYA 1WNTA 3PDJA 4JQCA 1NAHA 3D3EA 2DU8A 4BGUA 4AJHA 4YJHB 2WYWA 4B3HA 5BNTA 3ZW9A 2FR8A 4R1NA 2D5CA 3P2OA 5G4KA 3FPLA 3NTQA 1GUFA 1U2GA 1VL0A 3GDGA 3QLJA 4XDYA 5IXYA 5DP1A 1ENOA 4E2YA 4PZEA 4Z3DA 5I7EA 2VNSA 3C7AA 4UUMA 2FR1A 4GQAA 4R54A 1ZSYA 1KOLA 2ZATA 3WXBA 3SC4A 4RDHA 3PFFA 3ZI0A 1DRVA 2BF7A 2X5KO 3PJGA 1DPGA 3GDOA 2B37A 3V1UA 4XIYA 1DDOA 1B15A 3GHHA 4GMFA 4CM3A 1LDEA 3HQ4O 2Y0EA 2BI7A 4LVCA 4MP6A 2CMDA 3GNTA 4IXTA 1Z75A 4HFRA 4MP3A 4IDBA 2OHXA 3T4XA 4PLFA 3SEFA 2QZZA 5DBGA 4E5MA 4KWIA 3S55A 4CQLA 4E33A 1W0CA 4J0FA 4A7PA 3C1AA 5A9TA 4TSKA 1OC4A 4YTEA 1F0YA 4G81A 5IJZA 3ETEA 1Q2XA 3H9UA 4MVJD 1DXYA 4XKJA 3MCVA 3E5RA 4Q3BA 2D8AA 4PVDA 1MFPA 1UR5A 4L76A 4JCOA 1LTHR 4IMPA 1NFRA 1R0KA 2P5YA 5KVSA 2C0CA 2HSDA 1JKIA 4A03A 3AU9A 1A7KA 3TZQA 5JS6A 4BNHA 2ZTUA 2JD1A 1N92A 1U2DA 2YHUA 3KTDA 4II2A 5FEUA 3DBHB 4BNVA 2FHSA 2AE2A 1GDHA 1BSVA 1H6DA 3COSA 3I5MA 4N5MA 5BSGA 2O3RA 2NLOA 2EP5A 3VDRA 4BNLA 3BMQA 4K26A 1XQ6A 4QXMA 2P68A 3WYBA 1F17A 3T4EA 1PR9A 4R1SA 3E5MA 4JROA 4WASA 3F9IA 3GPDG 4CMIA 4DXHA 3GVXA 3PHHA 1CJCA 4PIVA 3V1YA 3PXXA 4ZQEA 4J43A 2VOEA 1D7OA 5ILGA 2EW8A 4ROSA 3ABIA 3SXPA 5ADHA 2H1SA 3LC7O 5F1KA 4J1SA 3H9EO 4WLFA 4HWKA 4D3FA 1PJ2A 9LDTA 1WDLA 2B4TO 2B5WA 3UFXA 4ZRNA 2H6EA 3HG7A 4HX5A 1VRWA 1PJ3A 2V6FA 3EVTA 1VI2A 3UF0A 3WNVA 4HV4A 2B0JA 2GSDA 5HTOA 1YBAA 4EITA 3F3SA 3ZH2A 4YAIA 1PZEA 1UJMA 2YQ5A 3MTJA 3QVOA 4BB6A 4TRMA 5B12A 4CR6A 4FC6A 3KV3O 3G0OA 4QTZA 2FP4A 3WGZA 1HL3A 1ZSVA 5DBFA 5DDIP 3LYLA 5KKAA 5IXSA 1I5RA 3VOSA 3A28A 3WTBA 5I8ZA 4TRJA 5IAAA 4BGIA 1KEPA 2E49A 3BMCB 1UDAA 3GZNA 4B4UA 2J5RA 1DHRA 1O9BA 1EVJA 1UH5A 1NM5A 1P33A 3WMXA 1I33A 4GGPA 3O9ZA 1ZZEA 3KLMX 3PP8A 4W9NC 1YXMA 1EVYA 4KP7A 1NX6A 4IGEA 5H82A 2GERA 3FR7A 4GVXA 4AJOA 5BNFA 4RPGA 3RC7A 1GU7A 2HUNA 4RL6A 3V2GA 2GN4A 3PGJA 1X0XA 2HU2A 2X0IA 5KTKA 3OICA 1X13A 2NTJA 1UXJA 2BRUA 2RHCA 3V2HA 3NJ4A 3RSHA 1HDGO 5JPIA 2C59A 1WP4A 1GADO 2A4KA 3GRKA 3H9QA 4IIUA 1AHIA 2E82A 5EINA 3WGYA 3DAPA 1ENYA 2CSUA 4IDAA 5JSFA 3S1LA 2VHXA 2ZYAA 1HSOA 2ZQZA 2OP0A 4XB2A 3WG9A 3PZRA 3JQGA 4J1TA 3G1UA 2C07A 3QWFA 2QIOA 3BHIA 4E31A 4YT2A 1PWXA 2NQTA 3UAGA 2JJYA 3N74A 3WLEA 4EJ6A 1SZJG 2CNBA 3KXDA 3UUWA 4EJMA 3D3WB 5CDYA 1A5ZA 1PS0A 4YEDA 1I10A 4PVCA 4WNIA 1JKFA 3PHIA 3KVOA 4MIYA 3WIDA 5T57A 1JLLA 1Z6ZA 3I6IA 3WQRA 4DLBA 4F46A 2AXQA 2YY7A 2Q2VA 1C1DA 4A10A 1V35A 1I2BA 1DAOA 3BHJA 4DREA 4J2HA 1GAEO 3L0DA 4L9RA 4J0EA 2WDZA 4HADA 1WW8A 1DB3A 1XWFA 3ZNQA 2X0NA 3TJRA 4ALMA 4BHTA 1CQIA 5K9ZA 1KVRA 4MIEA 3TL2A 4ZHSA 1DFHA 5JMPA 3U9LA 4CM8A 1TXGA 1Z7EA 3BZUA 1H6AA 4BNMA 1K6IA 3OIGA 2ZTMA 1VJ1A 2UAGA 3WDSA 2VRCD 3VZRA 3RU7A 4LVUA 3UOGA 1E1MA 4P8RA 1PU2A 2QYSA 1ADBA 1M76A 3ST7A 1H9BA 3TOXA 1QXSA 1HDCA 5JC1A 2LDXA 3P7MA 5L7TA 2EG9A 3JQ7A 1NWCA 4KOAA 2DBZA 3WBBA 4XQ9A 1KIFA 3UW3A 3GMDA 3QIVA 1SNYA 4MVJG 2ZB4A 3FTPA 2CDCA 3P19A 4H15A 3FD8A 1E5QA 2FZEA 2YQ4A 3ETGA 4Y6PA 5C37A 2HMSA 4C7JA 3WX0A 4B4WA 2NM0A 4QT0A 1KVSA 5CDGA 2TMGA 1NPYA 4ILKA 4R1TA 4Z9XA 4BB5A 5LC1A 4NMHA 3DWFA 4GKVA 2VWPA 1GYPA 2WEKA 3HJAA 4CLXA 1NVMB 1I3MA 1LSSA 3W4JA 3ZWWA 3NT4A 1DJQA 3UVEA 3NGXA 4G65A 5FFFA 3W1VA 1B14A 1DRWA 3GUCA 3HDJA 2X86A 3OSUA 3GRPA 4DIOA 5I8WA 4CV1A 2JFGA 1PSDA 4Q3CA 5JY6A 2C29D 3ZW8A 1K5HA 2DVMA 4MVJH 1LSUA 4UUNA 3H3JA 2G5CA 3WGHA 3UICA 2PZMA 5JNLA 3FRJA 4ZVVA 4CR8A 3PRJA 1LQUA 3ICCA 1K2WA 3EZYA 3KRTA 1PGJA 2VT3A 4GVLA 1OAAA 4LMRA 3UCEA 2DUWA 3OEYA 1GCUA 1GV1A 1YO6A 4YDRA 1N5DA 3RWBA 4BQPA 1LLCA 3PZBA 3IS3A 1EBUA 4P4LA 2POQX 3OA0A 1UXHA 4U5QA 5KVQA 1DIHA 3GK3A 2DM6A 2AQ8A 5L7YA 1SO8A 2R6JA 3CINA 1I3LA 5G2OA 1P9LA 3WB9A 1D3AA 1ZVMA 4BKUA 3DMYA 2EERA 2GZ3A 1I3NA 3CSDA 1V6AA 3WQSB 1D4FA 1H6BA 4ZQHA 1HE4A 3EK2A 1N8KA 3INRA 4PCVA 5DNAA 2J6IA 4A2CA 2Q99A 1HYGA 3H9JA 1XDWA 7MDHA 4UAGA 1YGYA 1NP3A 1R4MB 4WLEA 1D1SA 5KOIA 4OJNA 2IODA 2Y99A 2HCTA 2BD0A 3Q11A 1MB4A 3X2EA 4I08A 4WOJA 1UP7A 2BKAA 1O6ZA 1ISMA 1UZMA 3F4BA 3U4HA 3AJRA 3ZV4A 5A9SA 1PGPA 2HK9A 1BGVA 2GDZA 1HE2A 1ISFA 3KUXA 2RAFA 2YDXA 4O6VA 7ADHA 1CQJA 5AVOA 3WFJA 5IDWA 1R15A 3GMSA 2AQKA 4H7PA 4KUHA 2O50A 4A27A 1AHHA 1WLYA 3LK7A 3PJDA 4DL9A 1C0KA 4CMCA 5B4UA 3L9XA 1VC2A 3HDHA 1NQOA 3AK4A 4FQ8A 1KVTA 2GLXA 1K0UA 4Z0TA 1AXEA 1B16A 1P1IA 5DCWA 3QWHA 2E37A 1KERA 5DBIA 2WJPA 4URFA 3MJCA 4LCJA 1E77A 2P2SA 2VHVA 3C85A 4F6LA 3L9WA 4BOYA 3DZFA 1I2CA 5T8KA 3RROA 4EZBA 3K2BA 1R12A 3E18A 2JD2A 1GFSA 2O2SA 1GUYA 4PLTA 3WYCA 4DYVA 5A5EA 1PGNA 4YT5A 1QG6A 1LXCA 5TS3A 1AGNA 1Q0HA 5BSFA 1AUPA 3NEPX 2VCYA 5ER6A 3KOUA 3CMCO 3DHEA 4WLVA 3ZWMA 3EC7A 4O63O 1HE3A 5JAQA 1T2AA 5I7VA 4J6FA 5AXCA 4J90A 3C8MA 3F4LA 1J4AA 1RYDA 5T8KC 4ND5A 3K31A 3W6ZA 2EW2A 4B4VA 2CFCA 3E48A 3ZNOA 3PI7A 1ADFA 2UYYA 4BL5A 3PFWO 3OM9A 4F6CA 2JL1A 2AHRA 1B8UA 3RKRA 2EV9A 1E3EA 4EI2A 3GC6A 4RVHA 3K2EA 4CMBA 2ZB7A 1GPJA 2W8ZA 1B3BA 3MEQA 4FPXA 2HQ1A 1KEWA 5TNXA 1ZXBA 2PFGA 6ADHA 1MG0A 2P91A 3M6IA 3L6EA 4XX0A 1EK6A 2I3GA 1QORA 4M87A 4GBJA 5K0ZA 3STHA 4Q39A 3ANNA 5C7LO 3DB2A 4WNCA 2H9IA 1UZLA 1G0OA 5G0WA 2PKRA 4CM7A 3RJ9A 3NUGA 3LC1O 2X0JA 4X54A 2X1HA 3QHAA 1LUAA 3EHEA 3DBRA 4BS9A 3SLGA 3MJVA 4BNTA 4ZJUA 1QYDA 4M8SA 3GG9A 1BG6A 1DC4A 5L4NA 5ER9A 1OI7A 3IUPA 3UN1A 4DYDA 1LLDA 4YJDA 1NQ5A 2VRBA 3AWDA 3ZNPA 4IJUA 3JYLA 1U7TA 2NSDA 2X9VA 3OEWA 1H0KA 4Z6KA 2J3KA 2VHYA 1P44A 2A92A 1KS9A 3DR3A 4RPLA 4ALLA 3DOJA 5BT9A 4E0BA 3CTMA 4XRRA 2IZZA 3KYDB 1ADCA 1GY8A 3UH1A 3TZCA 3PDUA 1M6HA 5KWEA 1R4NA 4M54A 4DQXA 1IZ0A 3D4OA 4E32A 3G79A 3C1TA 3I3OA 4I1IA 5TSDA 2W2LA 3V1TC 4B4OA 1KETA 2DC1A 1HSZA 3CZRA 1S7CA 4AJKA 4RVDA 5JDCA 4RPKA 3T7EA 4WLOA 2I99A 2VYVA 3QA9A 1D8AA 1BVRA 1KEUA 1YQDA 1P0FA 2IYPA 2JD0A 2Y67A 3B6ZA 4J16A 4D0RA 5JCJD 3NDRA 1BXGA 4IINA 2HMTA 3LQFA 4BO7A 2Y0DA 4G5HA 4JBGA 4Z9YA 4QO7A 5IDQA 4HNHA 3E1KA 1O89A 1O8CA 2EKQA 8LDHA 3ANLA 3LT1A 4BMSA 4BO1A 2X8LA 2R00A 4CL8A 5JDCC 1YL6A 2C20A 2UVDA 1OC2A 1MP0A 1B8PA 1P1FA 3JQ8B 5G0UA 1IL0A 2VHWA 2PZLA 2VYNA 3CZMA 3WFIA 1JDJA 1OOEA 2WD8A 1ENPA 2NNLD 3IJPA 4AG3A 2HAEA 4D44A 1X14A 3ASVA 3BYZA 2WD7A 2BMAA 4RCVA 1P31A 1PJBA 1HF3A 2R00C 4PLVA 4YT4A 1JWAB 3O38A 2A35A 4RO0A 3JQAA 4YJHA 2E48A 1BVUA 3TZ6A 1DBVO 1VJ0A 1XU7A 4KUGA 1SEVA 3E6AA 3OJEA 3HE3A 1HT0A 5F1OA 1WXDA 3AOEA 4HNGA 5BSHA 1LA2A 1K6JA 3KYCA 1YS4A 2YFQA 2Q46A 5L45A 4TMFA 5JAIA 1CETA 4IS2A 4UUPA 2DT5A 4J9UE 1Z74A 2V6MA 3JQEA 5G4LA 4CMJA 3GG2A 5FI5A 5CDTA 3O03A 1GPDG 4NBWA 1WMBA 5TIIA 1X15A 2VWGA 2VWHA 1W6UA 3AOEC 4R3NA 5TX7A 1PJ4A 3BMOA 2OP1A 4C4OA 3DHNA 4GWGA 3GVPA 3M1AA 1A7AA 1C0PA 4R5HA 1QLHA 2ZIZA 5COBA 2GRAA 1XSEA 2RH8A 3PYLA 2FZWA 4IM7A 4IDEA 1YDEA 4CLRB 1YOVB 4QUKA 1JVBA 2C7GA 2ZB3A 1ZJZA 2OO5A 2OXIA 2XF8A 3JSAA 4OO3A 4BUCA 1CYDA 5T6BA 4JBHA 1DLIA 3IUSA 2Y05A 2BGKA 4E2ZA 1RM4A 2CZCA 2JCYA 5JE8A 1MLDA 3VPHA 1DRUA 1U9JA 1YL5A 4K6CA 4MVJF 4UVIA 4W99A 1B8VA 3D1LA 1QV7A 3TF5A 3NYWA 4UREA 3RI3A 3WGTA 3T7CA 4R4JA 5ILOA 5A1TA 4KWHA 1NPTO 3P5SA 4BNJA 3B70A 1X7DA 4CMAA 1DAPA 1FJHA 3NJ8A 4AJEA 4HKTA 4Z3KA 2IDZA 2CDAA 3ZWVA 1ZCJA 3U09A 3I9MA 1Y5MA 3NX4A 3H3FA 4BV9A 4IPTA 1LSJA 2X58A 2GASA 1T1RA 3CPSA 3NDJA 4KDEA 1SMKA 3FSRA 4FJ1A 1SPXA 2AW5A 4P22A 3KSZO 3WGOA 3BAZA 3VKVA 4GAEA 2Y1DA 3AM4A 4F3YA 3VPGA 2BGMA 1V9LA 4CM1A 4ZGWA 4DLLA 1YBMA 5IZCA 3E8XA 2ZCVA 1BW9B 2Q4BA 3AFMA 5KJ1A 1SC6A 4J7XA 4N54A 1IB6A 5KIAA 4IS3A 3D0OA 3U4DA 3ZCXA 3ADPA 3F46A 2PNFA 3AM3A 1WVGA 1FDWA 2GO1A 3OMLA 2BLLA 1J6UA 2SCUA 3JTMA 1R0LA 2EIHA 3OETA 5AYVA 1KC3A 1PJSA 5IZCC 4ALKA 2ILTA 3TL3A 4J7UA 3O8QB 2O3TA 4LSWA 1M6WA 4E4YA 2G76A 3QVSA 3I9KA 2JAHA 1E92A 1UP6A 1KVUA 2GGSA 3LT2A 4L0QA 3RCBA 4JP3A 1HZZA 4JX8A 1N9GA 2WE7A 5T5QA 2O23A 4FOSA 2NVUB 3DTYA 4YJGB 1BWSA 3LT4A 4W6ZA 1U5AA 3OECA 4WECA 1A71A 3MJEA 3ZHZA 1WDKA 4BIIA 3I6QA 2BGLA 5BR7A 1T2DA 3QRWA 2VUUA 3AY3A 4HFMA 4RF5A 1LSOA 1ONNA 1DIGA 3Q9UA 2J3HA 1CERA 2AE1A 2J5QA 4NK4A 3ONDA 1Q7CA 2VN8A 3WMWA 2VOJA 2JHGA 1JQBA 3Q6IA 3PHGA 4IDFA 4Z0PA 1HLPA 1H2BA 4YWJA 5A04A 2ZKLA 3QJ5A 3RUEA 4S1VA 4K9DA 2EKPA 5ICSA 2YHIA 1VJTA 3ZU3A 4ZQBA 1WDMA 4PZCA 3GT0A 1YONA 1XU9A 4CLOA 2CF6A 4J1NA 3I52A 1U28A 3PLRA 5DOVA 4CQMA 2NACA 4KZPA 3EYWA 3D4PA 4BNNA 4GX1A 1F06A 3DBVO 1DHTA 1XYGA 2NUAA 2O3UA 4PG5A 2Z1MA 3RC1A 4FGWA 4TRRA 2PY6A 1LQTA 1MUUA 1X1EA 4PG4A 4OKNA 3M2TA 4RF4A 1T4DA 1YRLA 4J49A 5LDGA 1EVIA 2E4AA 3FWNA 4NH4A 1EDZA 1F12A 4PG6A 1ZXLA 1LI4A 2NU6A 2Q3EA 3HZZA 2BH9A 5JCXA 1T2EA 2I3AA 5FWNA 3VPXA 2ZYDA 4ITUA 5A05A 3ROKA 4E3ZA 1LC3A 1U3WA 1BRMA 2W90A 4S3MA 2AG5A 2B69A 3A1NA 2PTGA 4XQEA 5JC8A 5JLAA 4RGBA 3NV9A 4PLGA 1KY5A 5C7IO 4N7RA 3ZWNA 2P4HX 3DBLB 3SLKA 1HXHA 1F8GA 3ROMA 1K3TA 3IP1A 5I7FA 4D43A 5KJ6A 2DBQA 4UVHA 1EQUA 4OGWA 4MIOA 4K28A 4L4SA 3AU8A 1T2CA 1U3UA 3QV1A 4WCFA 4AJJA 3DZIA 3S2GA 2Y93A 3H2SA 4YCAA 4FOOA 4JJFA 3WJ7A 3EW7A 3JD2A 2Z5LA 3IQDB 1XELA 1E6EA 1E3JA 3PQFA 2YYYA 1YQXA 4B7XA 4YRDA 3H5RA 4FGSA 4DIFA 3NT2A 1ZEMA 1RKXA 1N1GA 2YW9A 4NNJA 4DRYA 2B36A 2J8ZA 4Y8VA 3WWZA 4CLHA 4R69A 3KO8A 2WSBA 4NU6A 3I9JA 3DFZA 1IOLA 2A94A 3MOGA 4WCFC 3TOZA 3E9MA 1EFKA 2X6TA 1R66A 3TDKA 4DPKA 3IMFA 2TMDA 4E21A 2Y66A 3F1KA 2IZ1A 1YVEI 2JFHA 4M49A 1G0NA 1NFQA 4NJMA 2HK7A 1W73A 3S2FA 2QRLA 4NBTA 1LLUA 4HBGA 1A27A 2VZ9A 4BMVA 2RH4A 3UKOA 1NHGA 1NBOA 1X0VA 2H5LA 2CUKA 1NNUA 3BMQB 3RKUA 1PJCA 4FSHA 1VKOA 3H4VA 5L95A 5CG1A 4O1MA 4BNGA 2VRCA 1U4OA 1VLLA 4R68A 2IXAA 1EUZA 4HY3A 4Y98A 4DUPA 3F5SA 3E9NA 1L1FA 1NAIA 2X5OA 4DMLA 5C3MA 3JD4A 3A14A 5LCXA 4IZIA 4MDHA 4ND3A 2PGDA 3F5QA 5F5NA 3DZGA 5TF4A 2VWQA 1H93A 2CVQA 9LDBA 2F00A 2CDBA 4GMGA 1PGQA 3CMMA 4KDFA 4AJ2A 5KVCA 1I24A 3H65A 5COQA 5AXAA 4F45A 1SOVA 3OJLA 5H81A 4BO6A 1ZFNA 3VPFA 3AUTA 6LDHA 3GEMA 3RVDA 3JYOA 1R16A 1ZH8A 1EZ4A 3AUUA 4XJTA 1Q0QA 4Z0HO 1D1TA 3MWDB 1X7HA 5DN9A 3ZV6A 4MO2A 5KVVA 1PEDA 2AEFA 3KHUA 5GY7A 4Q3AA 2QRKA 4J2OA 1DSSG 4LSMA 2YV1A 4QEDA 4BV8A 1T26A 3JQCA 3PK0A 2NU8A 1FMCA 2PA3A 1PR3A 4JGBA 3TZKA 1ISGA 3PLNA 5ICMA 3GZNB 2HLPA 2FY8A 1MFZA 4A73A 2GUGA 4II3A 2VTEA 1XQ1A 3AY7A 3EAGA 3KYBA 5DT9A 3TZHA 2O2YA 3GLQA 1ZEJA 1E3WA 4YA6A 4E5YA 1IHXA 4L74A 4NQZA 2AA3A 4OSPA 2GN6A 5DCUA 3HNPA 1JKJA 4J4TA 4D3SA 2V6GA 4UEOA 4AJNA 4WUVA 4B7UA 1PQUA 4PG8A 3HFSA 3NTRA 1C3VA 4GLLA 1R6DA 4BNZA 4YR9A 1P3DA 1ZK2A 2CF5A 5U9CA 3U49A 1IPEA 3ANMA 4A26A 3TPCA 1MXFA 3CH6A 4INAA 5H83A 5ITWA 3B1FA 3LC2O 2Q1TA 3BTUA 4BO5A 4BKOA 1WAMA 3VH3A 3I9OA 3FR8A 1Y5RA 3JQGB 3VH2A 3HFGA 3L6DA 5EQDA 4RF2A 1X7GA 1Z45A 1I32A 1M66A 1J0XO 3H5NA 5MGBA 2W2KA 2FPGA 5B1YA 2JCXA 4OQYA 2X5JO 1KEVA 1YE3A 1PZFA 3OA2A 4U0KA 4MVJE 2B4RO 4RORA 4AFNA 4ZICA 3AM5A 5JBIA 1JAYA 3G17A 2WM3A 3M1LA 3HN7A 1BDMA 1IPFA 4E30A 3VH4A 3GVIA 3IAHA 1O0SA 1IE3A 2B83A 3QW2A 4JIGA 4OAQA 1QYCA 2VTDA 4YACA 5JXWA 4XRGA 1WZEA 2G82A 4HFNA 1U4SA 2UUOA 3KETA 1NTOA 4Y67A 2V6BA 2HMWA 3NRCA 4B7CA 1Y8QA 1JVSA 5CEEA 1RJWA 3UCFA 4GSLA 1GTMA 3MOIA 3ENNA 5I7SA 1F14A 2Y1GA 1Z73A 4BNFA 5L53A 1HDYA 1NHWA 2XXJA 1ZMOA 1T4BA 3RBXA 4B3JA 1HDZA 3BXXA 2J5KA 4KQWA 3G3EA 3RFTA 1YB1A 3S2EA 3QQPA 3VHRA 4I5DA 5C5IA 1LRKA 2QYTA 4L4XA 1PZHA 3Q0EA 1FXSA 1U7HA 1XEAA 4XYMA 2PZKA 4DVJA 1B2LA 3DL2A 2RIRA 1NXQA 1NVTA 4ZQGA 1P45A 4MKRA 3JQ7B 4B8WA 3B20A 4CJXA 5A06A 3H8VA 1HTBA 1DC5A 3VVCA 3U4IA 4JJGA 1LNQA 3LDHA 4ND4A 3JQ6A 3R3SA 3NDIA 4NG5A 2C82A 1PS8A 1Y7TA 4UVGA 1Y8RB 4DMMA 2OUIA 4IBOA 2DBRA 1RYEA 1ZMTA 2WYUA 5I9MA 3BMNA 4MPDA 4U6QA 3GH3A 4N5LA 5B37A 2DTDA 3ENKA 3LU1A 4XA8A 3IIEA 3ZZNA 5JW6A 5G0TA 1VE9A 4AVYA 1C1XA 1VKNA 4WE3A 4GX0A 2C7VA 1EMDA 2HJSA 2J3IA 3RIHA 3DZHA 3V5NA 4DIBA 2Q1SA 1ZKMA 3AFNA 4YPOA 1EE9A 4BKPA 5A9RA 5JDIA 4YAKA 2XXBA 3JQDA 3DO5A 3AI3A 3LF1A 3KYDA 2O4CA 3OH8A 3QSGA 4ID9A 5CFZA 2Q2QA 5IDYA 4GL4A 2PGJA 4K6FA 5DCYA 1LDNA 1H9AA 1Y9AA 3D64A 1P1KA 3HWRA 4EUFA 2ZYGA 3DMTA 4GGOA 2PD4A 4UUOA 2O3JA 4ZQFA 2QZ9A 3E9QA 3RFVA 5JDIC 3NT5A 2R2GA 3U0BA 2X22A 4JK3A 1N1EA 3FF4A 4BNUA 4FIZA 2D59A 2XOXA 4H16A 3RU9A 4I5EA 3KSUA 1HKUA 1IYZA 3PYXA 1NR1A 3DMTC 1XA0A 5B4VA 3K92A 3CUKA 3SJUA 1Q0LA 3IOYA 1NFFA 1RM5A 3MJTA 3TN7A 3GVHA 5A4DA 1PQPA 3N58A 3JQBA 1R0SA 3IDSA 4TZKA 5CP8A 4CUJA 1TI7A 1M75A 3I9LA 4DLAA 2EWMA 5CEJA 3GVCA 4DC0A 3C3XA 4EUHA 1TA4A 2PD6A 2QQ5A 5F21A 4BVAA 1ZNQO 1GZ6A 2X9GA 3DTTA 4RQTA 4CV3A 2PV7A 5JCJA 4CLDA 3H5AA 2P9GA 5A9SB 2BI8A 4FC7A 5AXDA 5HA5A 3VPSA 1ONOA 1UDBA 4M86A 1MC4A 3HUDA 3JQBC 3GPIA 3SC6A 2ZJ1A 3OBBA 3IKTA 1GEEA 4PGFA 1Y6JA 2NU9A 4OHUA 4OYRA 1T1SA 4ALNA 5K6AA 3LSYA 4RVUA 3WIEA 2C5AA 1A4IA 3FN4A 3D4NA 3OJ0A 2LDBA 3Q2KA 4ONEA 4IGFA 2YUTA 4ZD6A 1V0JA 3CE6A 2BHLA 1LEHA 3R6DA 1CF2O 2DPHA 3WGIA 4O59O 2WYVA 5AXBA 3NKLA 4CM4A 2I66A 3JD0A 1YH3A 1E5LA 3R1IA 5K6AC 5TLSA 3RJ5A 3ZV3A 1XIVA 2QG4A 4WCDA 3Q9NA 1XR3A 5GZ6A 3ASUA 4XD2A 1N2SA 1GZ4A 3VDQA 4CMKA 3ZNNA 4XGKA 1YOVA 3AY6A 3KBOA 2AEMA 1QMGA 4W7IA 4EJ0A 1PL7A 1GV0A 3EGOA 3PTZA 1WWKA 1ZK3A 2W4QA 4PLWA 4QO8A 2C5EA 2HO5A 2FSVA 2FPPA 2O7QA 3PWZA 5THQA 2PD3A 3NTOA 3WS7A 4DWVA 3C24A 4Y9DA 4BO8A 5EQFA 2C54A 4ALIA 4PRLA 5JYDA 2FR0A 3K5PA 4D3DA 1HDRA 5MDHA 1DLJA 1UDCA 4BNYA 3OJFA 3PGXA 4YJFB 1HRDA 4M55A 4UEJA 1GL3A 4FFRA 5EPOA 1ADGA 4AJIA 2Y1CA 1GEGA 3FNFA 1B0AA 1GR0A 4DGSA 3L4SO 3OP4A 4N5NA 2VNAA 3F1LA 3ZV5A 1AN9A 2GZ1A 2BFOA 3DC2A 2WWRA 3E03A 3VAZA 3E82A 2NQ8A 1I8TA 3C7DB 1DIRA 5HS4A 4Z9FA 3L77A 1PS9A 4FFNA 2D3TA 3IJRA 3GUYA
chains in the Genus database with same CATH superfamily
3D7LA 3I1JA 4JUCA 2WKRA 3TXAA 2PLNA 1OLUB 4GPAA 4U2CA 1TT5B 4FD2A 5BN3B 5EERA 2NV2B 4D45A 4ZJPA 3IOEA 4YYZA 5FUMA 1TM5E 4P54A 2HKIA 2D00A 2PWZA 1FVXA 4F3CA 4TQAA 3HA5A 5BP7A 2QN9A 4I0WB 1T8RA 2YHSA 2P9HA 4WOKA 4AUMA 1NVVR 1SUBA 4EW6A 5FF9A 1E3DA 4M9UA 3ER9A 4PN7A 1BYUA 1IAQA 3D8HA 3EIEA 3FLAA 5B3JC 3MINA 5AM0A 1THTA 4CCAA 4GXNA 1RKVA 1XC7A 2UU9B 1V1JA 2W6IA 4CM9D 3RF6A 3FVTA 2XNJA 1E6CA 1XL0A 3CRNA 4L4RA 1KO4A 5F78A 1AKQA 1NVAA 1SZCA 3IKVA 4PBRA 2WHYA 4KQJA 4RHTA 4A4DA 5JZVA 1ZY2A 2XNDD 4JOBA 4QREA 1CRWG 4MVJM 2AJLI 3AHHA 4TWRA 5KB3A 3UMFA 3ORQA 1EIWA 1YDWA 2MTBA 4NTZA 1PFVA 2DPLA 1TUEA 3MWEB 3E3AA 3L3BA 2W98A 4JJZA 3H2YA 3AX6A 2V6IA 5CA1B 2J0UA 1U8FO 2J33A 5TPZD 2M9MA 2RHWA 3COWA 2YJTD 3V3KA 4LUCA 5KHOC 1V1RA 4EUKA 5CJJA 1NVXQ 2GN1A 3EBOA 3TL6A 2QW1A 2Q8NA 3UHPA 2ATXA 1Z06A 3CRW1 4EX6A 2NU7A 4JEIA 3EQ9A 3MRSA 4FS8A 4IHAA 5GPBA 1E6WA 1LJ8A 4PBSA 4WD3A 5KS2A 1A8PA 1PFYA 1ZHHA 3AXSA 2XPCA 4OF4A 1HDXA 2WF8A 3QPAA 3AVOA 3VXKA 4BZWA 4HH3C 5JWHA 1SAYA 4RLHA 4R7GA 4DDHA 3UGJA 3RSZA 5BPFA 5CVDA 2X7JA 3KVRA 5I7RA 1E3SA 1DEHA 1LDBA 4I9UA 1OZ0A 4NCXA 1QVAA 4F72A 3IRVA 1PZXA 4XGNA 1QYVA 1UC5B 1Z5VA 4YGYA 1I51A 3EF1A 1T34A 2CDNA 1LLQA 2NZ8A 5AK6A 3G0BA 2BJWA 3TW4A 5GIPE 5AVKA 1TKCA 3GJYA 3OHSX 1NQWA 3GN2A 3OJXA 2IELA 3EZXA 3RYHB 1DUVG 4X41A 2WD7B 4JSTA 3JRWA 4L5JA 3HM9A 5L9AA 4L9WA 5E3IA 2IXTA 2XYGA 4IZHA 1J49A 1OYOA 2O07A 3FBTA 4MUGA 5U1PA 3JQAB 3AQIA 2E4YA 4LOLA 4M83A 1CVIA 3G9TA 3SI7A 1O95C 4JD5A 5CYGA 2M32A 1C9JA 4ALJA 5BUCA 1PTJC 3V4RA 5F4BA 4TGLA 1E3IA 1PVDA 3NU1A 3UPDA 5HKKD 3QVMA 3RS0A 5DWVA 5MN4A 1KI9A 2SNIE 5FO0A 5AHXA 1QO9A 2B34A 1I7DA 4PZZA 3BWVA 3EGDA 4ARUA 1L5GB 2OPHA 5JFTA 3VOTA 2VXCA 3ONEA 5CLLA 1KQFA 3ROXA 3UGKA 1MX1A 1NA5A 1NL3A 3K0BA 4NJEA 2G9UA 5JISA 4MTLA 4AQDA 1RP1A 3CT4A 4JJIA 1YKFA 3O7WA 5CD1A 2M6KA 4NSNA 2I8LA 3GN1A 1NVBA 2Y4OA 1YBFA 4PRKA 3PEEA 3DBIA 4Y9TA 4ZHQA 1NBHA 3P2YA 3IQIX 4UAVA 3RJZA 3SK0A 2VHTA 1PJTA 3REQA 3DBLA 1C7QA 2J6HA 3QVUA 4QSMA 3ZHOA 3AI1A 3TFWA 1N32B 4R9SA 4PICA 7ABPA 3DUWA 3IFSA 3PNKA 4IO1A 1W1IA 2WOOA 3QVTA 4V0ME 3BIFA 1SCUA 3EMVA 1C41A 1LBEA 1BX1A 3P4XA 4PHTA 2RGCA 2ZSIA 4KFSA 1L4LA 4WZ6A 2HNBA 5BQFA 2OMEA 1BMDA 2F4NA 5JH7B 4DXAA 1UJCA 1U0HC 4BASA 2JJ1A 3CQ9A 3RF7A 4ZCIA 2X2OA 4Z4FA 1NI4B 4LJAA 3H16A 3QELA 1YCDA 4CU5A 1SUAA 1ML4A 2WWGA 5K0CA 4EUSA 1U0RA 1W9MA 3R4VA 4BNKA 4D46A 3GNSA 2GLTA 3W5UA 4PSAA 2H59A 1G2IA 2BMDA 3R0ZA 3TG8A 1K66A 4IY1A 3FYUC 4QX6A 3DOCA 1YOBA 4TWAA 1ZESA 2VQSA 3ZJ5A 1NNLA 2ZSEA 4JWKA 4TXHA 1UMDA 1OFUA 3VNVA 4D0GA 5KQGA 1P61B 4XPIB 5EQTA 1TCAA 3UJ3X 2JFVA 4GC9A 4UOQA 1CIJA 2D2XA 1J8MF 3ORRA 1G7TA 1N7GA 1RTKA 4FT2A 4PBTA 3O8OA 4WCVA 4XASA 4UU0A 4TV9B 1ZI9A 2G6BA 3U40A 2PQ2A 2YYAA 4CV2A 3KB8A 3P1JA 2O3QA 2YWXA 2Q49A 3G88A 5GONA 3TBHA 4RJJA 1QZTA 3K6KA 4L85A 3VV2A 2ZKIA 3K0FB 2NYRA 2QV0A 5EWLB 5AVUA 1ZN7A 2NN3C 4KO2S 4NHEA 4RLSA 4X1YA 4YV7A 2AI3A 3B1WA 1P1JA 3GFFA 1DJPA 3OTOB 2WNHA 1X19A 1NTRA 3SSNA 1FFXB 2N1BA 2Z09A 5AH0A 3ZHCA 1ZW1A 4JP8A 2OFOA 1XA3A 3CXRA 2OYCA 3U5ZB 1H0SA 5EN4A 1WSAA 1N6LA 4QDUA 1AK9A 2JG3A 1KAHA 4JXKA 2NTVA 3R8CA 2QM3A 2VUSA 1QOPB 1ORRA 1RI5A 3OOWA 5EZSA 4IMRA 4EF6A 1ZG3A 3KSMA 1SKUA 3E58A 5EESA 1X39A 4J3FA 1SCBA 2XNKA 4CKEB 1AF7A 1P9OA 4EI8A 2PKQO 3RS3A 5AUQA 5ALQA 3UB4A 1I2MA 4EJSB 3VX4A 2DPMA 4FYMA 2FCRA 5JO9A 1ECGA 1RKQA 1QVVA 3PFNA 4L4UA 4CQLB 1SKMA 1JLMA 5SZHB 4G41A 4QD3A 1XLWA 3LQKA 3MOSA 1UBEA 4N65A 5D85A 3L02A 2JLCA 4EYOA 1ZJWA 4DZTA 3VU1A 4AN4A 4QECA 5C31A 4B83A 5I5EA 4BU0A 5IS2A 2PVSA 1T4CA 2Y0CA 3EIXA 3NORA 5C8XA 1LV7A 1JEOA 3MTGA 4K05A 5DP2A 4JJ8A 1Z7GA 5HIAA 5TRTA 4IXWA 3MHTA 4LN1A 3ZYZA 1NI3A 1P1RA 2H9YA 2R7NA 2LWIA 1SUWA 3QU2A 4JLJA 5CG2A 4CEIB 2IZ0A 3AWIA 1K1EA 3MJSA 3GGDA 2II6A 5ESRA 3QTTA 2RMKA 4HJRA 4KIJA 1XU4A 5UKDA 821PA 3HSSA 3MB8A 4OXKA 5EP3A 3L7AA 4I9NA 4D6XA 1SA0B 3LK6A 3RHSA 3V97A 1N3YA 5FLYA 2PBFA 5TQVA 4P98A 2IPLA 4LNHA 1E60A 1R8SA 3MD0A 3JAKB 1SVIA 2Z2IA 1IJBA 3K0EA 4UE2A 3WLKX 5TC4A 4CM6A 3PX2A 3QX9A 5DN6D 1ZO8A 3AJ9A 4Q7QA 4X3CA 5DNCA 4KO8A 3ZWBA 4N39A 1TT7A 2XNCA 5AW9A 3T0GA 3SSOA 2CUZA 3CIFA 3O8BA 3OQ6A 1CZNA 4IDQA 2CK3D 1U8XX 4JCCA 2ZUFA 4S2UA 1X77A 1R9JA 1C9KA 2GAFA 4KPGA 5JAMA 1Q1GA 3UYKA 3W4IA 5KNLA 5CB4B 4MINA 5FOUA 3H7AA 4A36A 4MUAA 1Z26A 1K75A 4BJ1A 2ZAGA 3BULA 1NIPA 4WERA 4C4TA 4LWZA 2D0DA 4QPDA 4U9UA 3I01M 3OF2A 4MHTA 2JHPA 4Z8YA 2PT5A 1FRVA 4K6HA 1N2XA 3F6YA 1PRYA 5IUKC 2BEKA 2DFVA 1VDZA 4FOTA 3V6MA 3VZSA 4B76A 5ALVA 1JDTA 2AG8A 1GGNA 3AF6A 1ZRSA 2B94A 3EWAA 3VSEA 4FFLA 2AR0A 3PCXA 3DVSX 1U1IA 3OX1A 4RDIA 1XMIA 4ZU3A 4U39A 4LYHA 4B8YA 2BHNA 2VF7A 2QR3A 3DPSA 3M6XA 3A2LA 4H1HA 2QT1A 3M33A 4IQ0A 4PU0A 2H1CA 3C48A 2QUHA 1TVKA 2HRBA 4LZWA 3SJ7A 4LXGA 1YUBA 2V7TA 3U37A 3ZY4A 1EDOA 3P4UA 4KMSA 2IE0A 4NCIA 5IT0A 1BS2A 4UHCA 1PUXA 2D1TA 2EFJA 1GRVA 3HHEA 3N2NA 1CZLA 2NXJA 4PXYA 5TDHA 3RR2A 1SVKA 1H2WA 2GD0A 4IDGA 4UDYX 2J3JA 3S27A 1P1CA 1KXZA 1N0IA 1XLTA 4UPVA 1GCOA 4QZVA 3H2BA 4GXQA 2AQIA 1E1RD 3LO8A 1E5VA 4QE3A 1NXWA 2FV8A 1PYGA 3PVZA 4QJ5A 4WLUA 1M10A 1XQVA 2FKNA 2QOEA 2HR1A 3A04A 3B8HA 5F5XA 4WCFB 4DDUA 4ER3A 1RWBA 3HBMA 4C4XA 2HK8A 3AVVA 4CUZA 2CUTA 1GQQA 2PYIA 3NBFA 3OQHA 3TPZA 1KYVA 1Y9ZA 2BJHA 2HXYA 4P0TA 3AXTA 1UKYA 3GEPA 1LRJA 4IQFA 2VXBA 4JQYA 4YUZA 3GGCA 4ZP1A 4C0HA 3WNZA 1V9CA 2I5PO 5EIHA 5GM2A 1Z3CA 2BUCA 4AU1A 1G59A 4LHSA 4M0FA 1K5GA 1Q83A 3LUKA 1QGYA 4DUZB 2AFIE 4NZ9A 1O03A 4TYQA 2YOFA 4YO8A 3D59A 2PX4A 3RVPA 1G18A 1UKVY 5FWYB 1RXUA 4CL3A 3WQQA 3K05A 2ZRNA 4RTLA 3NHBA 5AM1A 2VP4A 4L5CA 5J59A 3RT1A 1UBSB 4D25A 3AJDA 3IV7A 5J1SB 4BO2A 1G60A 4QVGA 3A6PC 2FWMX 1BD3A 4B0PA 4LFBB 2QNBA 3J7TA 4N40A 2OB2A 4NPAA 4Z7OB 2P9EA 2BL4A 1ZD5A 2VF4X 4PLYA 1LJLA 2X4IA 2ZSAA 2QMHA 2WU1A 4DJ5X 4XR4A 1WW2A 5AM3A 3DV2A 2GBFA 1N3LA 1K9VF 2WP8J 1RHUA 1T5LA 2QEQA 2D54A 3W5CA 2XV1A 3N6RA 1IUKA 2AUTA 2DUMA 1RYFA 3O3CA 3EMKA 2IYRA 2WKPA 3FUVA 1XP5A 2Q9CA 5LYJB 1P0PA 2XR1A 2XQIA 3OCUA 2PX0A 1BHQ1 4HB0A 1EAMA 1SD1A 3A3PA 3PYMA 4TRNA 4EFLA 1LCIA 4QTTB 5E1MA 2DPYA 2FUNB 3W3AA 3ADOA 1DTWB 3F74A 3U3JA 4ARSA 4B5KA 5K0LA 3CN9A 5L7WA 5DX1A 1M34A 1Z83A 5CNKA 4Y2PA 4Y0VA 4EQ6B 1FK8A 2JGKA 2NT4A 2FHPA 2NTYC 2A9FA 4N18A 5CDUA 5JXJA 2Q6IA 5DCLA 2BUAA 4AF7A 3N76A 2WB4A 1C7EA 3D6TB 1CY1A 4KC0A 3EF0A 4KG7A 1A97A 4P5DA 5A7GA 3DE3X 5FLXA 2JAUA 3ZN2A 4FONA 5LU9A 3WLFA 4JSYA 3FCOA 1DKNA 1X1SA 1YASA 4W82A 2BI4A 2ADFA 4OIMA 1QV6A 1Y9EA 1OFGA 3X1DA 1COWD 1P5JA 2DP4E 2LD4A 3HKBA 5JROA 4RD4A 4HGNA 3TW8A 2A59A 4LZJA 5HE8A 1CR2A 2EYUA 2C4WA 3AP2A 2E4XA 1IXKA 3U60B 4MKXA 5DNVA 4LRSB 5TJHA 1I3CA 1I36A 4OPMA 4U1RA 4A5OA 2XKAA 1ZK4A 2I6QA 1GNVA 3OE7A 1VSBA 1I4EB 1MA0A 3K9NA 3N8IA 4RPJA 2VO1A 4IV5A 1EP3B 3GIDA 1BQEA 2JVJA 2RGDA 2WG0A 2CFSA 4DHWA 1ZH2A 3DF7A 3D3NA 5C8DA 1Z2NX 2QY6A 2QAGA 3SBXA 5IN4A 5J4HA 5IKPA 1RLMA 2XQJA 3OLXA 3VNBA 2F3UA 2DY1A 2OCGA 3A2MA 3P2IA 4YMVA 5KJCA 2XE8A 3E9CA 2C5FA 2NZWA 2QN2A 3FPEA 4LBWA 3IEIA 4TMWA 4W9RA 5JG7A 2BFPA 2I67A 2WVJA 5ERXA 3ELWA 2HZBA 4W5RA 1CUZA 4DSTA 3S4YA 4EEZA 1E94E 2DLNA 3K2QA 1V16A 3TRKA 1QG0A 2VT7A 4BKQA 2Z9BA 2G4CA 2IHYA 2PGIA 5KWIA 4HTFB 4BVLA 3VKUA 1JR6A 2Q7XA 2JI7A 5JANA 3WR5A 1XNGA 3IEVA 2R44A 2WMDA 2VZ0A 3IERA 1E58A 1EDEA 1IATA 1LBIA 2PKQP 1IN5A 1GLVA 2Q1WA 4MJ7A 3LDAA 4LYDA 4MQEB 5K0GA 4DV5B 1DKPA 1KH3A 1Y42X 3GNQA 1NQXA 3FI9A 1ULUA 4DIEA 2A30A 4HMPA 2QN6A 3WYFA 1RAFA 1WB6A 3LT0A 5BYJA 1OI3A 2CHUA 4AL4A 5A3QA 3GLHE 3DOIA 3CEAA 1M2EA 1TRHA 2V7EA 1YZNA 2B8TA 2R8EA 3FPCA 4P4UA 3W7VA 1BCRB 2ZBVA 4KAAA 2NTEA 3KT0A 3ZOKA 4W5NA 1T0UA 3HVHA 2ZR8A 1VIDA 3DF9A 3PVSA 4JP2A 5FA5A 2HBZA 3CVVA 3UB3A 3CXUA 1KC1A 3BRCA 2JBAB 1PJLA 2PT9A 4PZDA 3K70B 4YUVA 3FJYA 4BDTA 4L6CA 4C0KA 1ZBDA 1Y1TA 3NEAA 4ZZIA 4DANA 3R9XA 5SYMA 3R8XA 1Z37A 2XRZA 3WICA 3G68A 3JALA 3RYCB 4FDAA 3EDOA 3KWLA 1H3FA 4MWZA 4LF5B 2IYOA 1XTBA 3EXEB 2FN8A 4QATA 1O5TA 2AXPA 5LP6B 4AMVA 2FXIA 3PFKA 4DZRA 5HSGA 1GPMA 5I48A 3TGLA 3Q3CA 1PR5A 2VHZA 4QUAA 4BRWA 4ZI3A 1J1ZA 3C6KA 3DTVA 1MU0A 1E59A 3UOAB 1DFIA 3W8RA 3NEJA 4HBZA 3V1KA 1MOSA 1QB7A 2DBYA 1N57A 3HB4X 4RA6A 4UNQA 3GGOA 4UPDA 5FIUA 1FFEA 4JI8B 4KXLA 1HFJA 2O8FB 3WV5A 3N3BC 3KR9A 4EDFA 3MFQA 1P81A 3WK9A 4X8MA 3OKFA 1TPZA 4WY5A 4D92A 4I5GA 1YCHA 3VZQA 5ICFA 3VSCA 2H2IA 3JQ8A 1NKTA 4XD7D 4MUEA 3VVBA 1BNCA 2BZ0A 3ZHTA 1YZLA 4RK1A 4KXWA 3TGPA 4GC5A 2ECOA 2EJWA 1WZIA 2GZ2A 2Q2WA 3G1WA 5T7BA 2WJZB 2O3SA 2G77B 1AGXA 2GS9A 2AF3C 1YR6A 3R3VA 1DJNA 4IQ8A 2WG2A 1B73A 2XCRB 1Q84A 3F9CA 1NNSA 1CZKA 3FOEC 3U7QA 3ANTA 4I55B 3HY3A 3U44A 4EWLA 5IC6A 1FXUA 4KIFA 1DKOA 3G23A 1J56A 5G0VA 4IJWA 1DUIA 3DMRA 3FDJA 2IBSA 3PXEA 1R8XA 3PSAA 3R9IA 3KPVA 1THMA 4NFYA 3EE6A 4FSXA 4ZAWA 3TR6A 1C7IA 4WK0B 1QX4A 2RJOA 4BAUA 4CXMA 2OFXA 4C06A 2LIVA 2WWYA 2CMGA 3FHTA 3L79A 1L8LA 4RM3A 4P83A 1M72A 4DNOA 1GQOA 3MERA 2IE8A 1WO8A 3BMNB 3GFRA 3JYPA 1EGMB 1EXMA 1NXPA 1TT5A 1ZW6A 2IHVA 5BN3A 2CNNA 5AM5A 5ENVA 2CKDA 2FQYA 2YIJA 4YRTA 3S2IA 4NCJA 2ZJAA 4GYYA 4PC3A 2X9LA 2R7KA 3I2FA 4WHMA 5T67A 3WOHA 4XB1A 4UHFA 4X3OA 4DADA 3QFRA 5D5QA 1MV8A 1WSWA 4HGZA 1OPXA 3QF7A 2C83A 4M0DA 1EA7A 1FLDA 2B61A 3NH9A 2HA2A 4HAOA 1UEIA 2WMNB 4NYMQ 2B98A 4IMIB 4H7JA 2FPSA 3OBIA 3BWEA 4H3VA 4QDJA 3RQSA 2Z56A 4GX5A 5AJUA 4CTKA 4AROA 4DNFA 2GCGA 4BUJA 3HNOA 4DBZA 4A6PA 1QGUA 2P9CA 3OF5A 3QFFA 4EHJA 1IRIA 4XJSA 3FMGA 4HAUA 5CVUA 3U7JA 1K4YA 2Z8YM 4OQPA 1ZM2A 3RASA 1GCGA 2P3SA 3VUFA 4BY9E 3MWFA 1W88A 1V8FA 2XECA 2WHXA 2ZJ8A 4MIKA 3SLRA 2CVZA 1HM5A 2BDUA 4JODA 4LRUA 4OMCA 1BJRE 5FBLB 3SZLA 1ZITA 4JH0A 1RPAA 1Y48E 1KY4A 1Y98A 2YWFA 4JEMA 4GI2A 1BMFA 3WL8A 4TWBA 1OE0A 4KO4S 1Z68A 1NP6A 4LHZA 1ORDA 4IFEA 4EA7A 5AOVA 2CLOB 3GU3A 5AKYA 2FVXA 4P33A 3BGSA 4KQIA 1MDBA 4JGGA 4EGFA 2JJ2D 2XI4A 3IL2A 3U7FB 2D2IA 4L5AA 4QDZA 5BN5A 2FX5A 3SY8A 5H02A 4AS1A 2DUUA 3C1UA 5AK3A 3O2QB 4KRXA 3ZD8A 1W44A 2QRQA 1H6CA 1I4LD 1UAYA 4FWIB 1H5NA 1S0UA 3N59A 4RZ2A 5ELMA 1K5PA 3GY0A 2QL7A 1F2UB 2HA3A 2LGJA 2ZCUA 4IEFB 4MYDA 4KN8A 3CRMA 2DETA 2F43B 2H8KA 4IDDA 4BRZA 5LDHA 4C2UA 4M0KA 5J2TA 3DBRB 5BW5A 4GPZA 4FD3A 4HWPA 5TT1A 2MCFA 3ZWCA 4RJTA 1KVQA 1OH6A 2XGOA 1O0BA 4XDZA 2ZIVB 1P74A 2A1TR 1ISSA 3RODA 2VYVD 3ABSB 4LGVA 1E7RA 4M1ZA 1PEKE 2G9QA 5LZ8A 2KPOA 1FC0A 4C0XA 2AK2A 3W2TA 2V9CA 3E0XA 2PAFA 1E0SA 1KFKB 3QE3A 4DQVA 2W7TA 1EJBA 3FHJA 3G2MA 4FU0A 1KPGA 4PS1A 2WLSA 1VSUA 2VSFA 4JT2A 2YVAA 4FR5A 1GQYA 3PC8C 1QRRA 4JBYA 2QYHA 1JR3A 1HETA 3ISTA 4QQFA 3LL4A 2F9LA 3UAOA 1CHNA 1EEHA 4CR7A 2KHZA 3GEDA 5DHPA 1MV5A 3EEYA 1J0BA 5DHAA 3BQNB 4LF8B 3LAWA 1I4OA 4B8ZA 5JH7F 1PIWA 1HMYA 4KIGA 4FX5A 4G1UC 5E6SA 4OL9A 2BELA 3LS2A 2PZJA 3I8OA 4WOBA 4EYKA 1R00A 2FFQA 2IOFK 2NVUA 4YJGA 4KTTE 2Z6VA 4NFSA 5DWQA 1UUFA 2GFQA 3F6PA 4N6NA 4E03A 5DOZA 3CH4B 2OGZA 1ZUIA 1U6KA 3GAZA 3HKEA 3L4BA 4WZBB 5GVRA 4ZVOA 2I62A 5I9NA 3X44A 1UPAA 2XMZA 1F8UA 1R64A 3GPCA 3VVMA 1L3BA 3B3JA 1RQGA 2IRWA 5I7HA 2XVXA 1LRLA 4HP8A 4PG7A 2I1QA 4FILA 2Z1NA 3QXGA 3KQHA 3KLNA 2UXBB 4KI7A 4U0JA 1BXGB 1Z34A 3JWJA 5I3CA 1GP2A 3HWSA 1U3TA 4M9SA 2DT8A 1VGQA 4MWBA 4TKMA 2Q0XA 4I50B 2WIDA 4CBVA 2C2OA 5JLJA 3C7KA 4FGJA 4DCSA 2A67A 3I1YA 1S1MA 4TV9F 1IZ9A 2FPPB 4NR0A 5IBRA 4C7BA 1XD2B 4I66A 4ODIA 3GAFA 3AIOA 1FYWA 4O0MA 5GWXA 5D86A 1YF3A 2VEDA 1V3VA 1NI4A 4YIKA 4M36A 2JIZD 4OFBA 4NBRA 3ZCVA 4FQ5A 4I9HA 1SIWA 2UV8A 1A8HA 4Y6OA 5AKIA 1W5BA 1I6LA 4X7PA 3V4FA 3LLSA 2BCGY 3A9SA 3G49A 1Y81A 1W8DA 5K8VA 2Q4RA 1T9DA 1JLHA 1V4NA 2UVQA 3O2JA 4FLMA 3ORFA 2YJ5A 3GJRA 1WNTA 5E1BA 2V7GA 3ZS8A 4RGVA 1GPAA 2VDQB 1W7AA 1GSHA 1MORA 1XK7A 4AJHA 3B53X 3BJIC 1GKLA 3KZMA 2I4TA 3LTEA 4NDAA 3ZCTA 3IR5A 1H4VB 2GM3A 3FNBA 3ZW9A 1QRDA 5KOJB 2Q2NA 2O0JA 2R97A 2W83A 3M4XA 4XTCS 1V7ZA 4ZXPA 3SS7X 1RQLA 2R6CA 2GKOA 1KNXA 1BYIA 2LCFA 1GUFA 3BFVA 1TU3A 5FL3A 2NXWA 1OX6A 3LHFA 3H9BA 2DQYA 2JEYA 2F67A 4G0UA 2GVDC 4PZEA 3GJ4A 4KK4A 2BIFA 3U2QA 1C30A 1P9WA 3C7AA 3K0FA 4Q7KA 3MT7A 4AULA 1KOLA 2ZATA 4MUYA 4ZOCA 2A7XA 3T9DA 5DMXA 3ZI0A 2G8LA 4LWQA 2I2CA 3UW1A 2N47A 1N0WA 3O8DA 1GQSA 1H42A 3Q7SA 5J43A 1YS1X 2MU1A 3IHWA 3EQZA 3V1UA 2CLSA 2DE0X 3V8QA 2ZRAA 5I01A 1U2GC 4CM3A 1WKVA 1KQGA 5FEMA 3H99A 3ND5A 1I3OA 5KQLA 2BFWA 4EOGA 3HCRA 4QYWA 1O77A 5CNIA 5A2QA 3AVYA 5FOSA 2WOJA 1W85B 1E66A 1XCMA 4ZTBA 1SWWA 4CKEA 3HUEA 2PUFA 2PEYA 3FPGA 4MP6A 2CMDA 5LSAA 3M89A 5LZ9A 3IR6A 1NURA 5IKOA 1S3FA 2D1FA 4BZQA 3IPYA 4IDBA 5HG0A 4QXOA 1CZOA 4F3TA 2IU3A 1E89A 1TCBA 3FPKA 3S55A 3GMIA 2CE7A 4LI0A 4CQLA 2QK4A 1E9SA 4IV8A 4XSGA 4CF6A 3WLMA 2CD7A 3IEXA 4A8JA 4D26A 4NAHA 4YTEA 1F0YA 5HZHA 3AVQA 4G81A 5IJZA 2CGEA 1A98A 3H9UA 1Y7LA 4JLPA 4MVJD 4YAWA 3T9BA 4XKJA 4FR2A 1IQPA 1T8UA 3MCVA 2H51A 3AONB 4I3GA 2FPIB 1AGRA 4DNQA 2PMCA 4B71A 4LYEA 4JCOA 9ABPA 4CEIA 1VKZA 4DLPA 1NFRA 2P5YA 3TQQA 1JB9A 4J7AA 3E8MA 2YHAA 1WNFA 1Y4DE 1HR0B 3R77A 1SA0A 3RSCA 4F5EA 4LY0A 1YS7A 2TRSB 3SQDA 4BNHA 4D9BA 2F9MA 2CJWA 1N6KA 4PY2A 1CT9A 2YHUA 4POAA 1V48A 4INOA 1T35A 4TTQA 1QDEA 1P5HA 1U0NA 4FEGA 1JG3A 1LX7A 2AE2A 2CJPA 5F2OA 1RPJA 3U6KA 5FB3A 1BSVA 1H6DA 1W5SA 1UFRA 2E85A 2EJBA 3M6WA 3OIYA 3UJ8A 3ZGVA 1CIPA 3UMMA 3TRJA 2O3RA 3L8ZA 2JDIA 2NLOA 3N3AC 4Q47A 5C4MA 1DBSA 5HCNA 4RULA 2RGRA 4J0DA 1QQBA 3LPCA 2G4LA 1P2DA 1XQ6A 1RCFA 1UM9B 1RE1A 1GG9A 3M4ZA 1KI6B 1KR2A 1XQWA 1F17A 2P68A 2GZAA 3QQ5A 1BA3A 1S8OA 4H1UA 4KVGA 1KTVA 3QLTA 2DZDA 2BM0A 2O57A 4RY9A 2EJCA 3L0SA 2H5JA 1AO0A 2O2IA 2QI9C 5J4VA 3RFFA 3P2KA 2VNIA 3AIMA 4PIVA 1B43A 1YI8A 5FOVA 4RSMA 5CFPA 3KYIB 4GMXA 4ZQEA 2DSNA 3EVBA 1GTG1 1YUMA 1KZ7B 3IKLA 2WUWE 4ED9A 1UL1X 3QU5A 2B4KA 4OBXA 1SVMA 2HT6A 4QWWA 2VZEA 2JIPA 3EIFA 3SXPA 5F1KA 4ZCRA 1WX1A 2OUKA 3DE7X 4D81A 1B23P 3CW8X 4HRVA 3GJ8A 1IZZA 4M76B 3DBOB 2VQFB 4ZZ3A 1WEHA 4RH0A 4ZPXA 9LDTA 4GXTA 2XA1A 1WDLA 2B4TO 1QFJA 2ZR0A 2OZEA 4BE4A 2AXNA 1ZMXA 1AURA 2ODQA 4BXOB 4CN8A 2QNRA 3EVTA 4HV4A 3W7AA 4AF8A 1GZDA 4JWTA 2CZGA 5IJXA 2GNPA 1XYVA 1YBAA 3L7DA 3AHFA 4IVQA 1UJMA 4CKXA 4DQLA 2VDOB 4RHEA 4RNDB 4CR6A 1KA9H 4FC6A 5B12A 2F9FA 3KV3O 3G0OA 4QTZA 1C3JA 1CX9B 1ZN2A 4CEJB 1HL3A 5DBFA 3E9DA 3LYLA 4OJYA 5DDIP 2L17A 2YOHA 3MTIA 1DX6A 1I5RA 4S0XA 2AG1A 1XN4A 3VOSA 3A28A 4AYTA 3WTBA 1W5FA 4JSRA 3RB8A 2ZM5A 1VRCA 5I3ZA 3RH0A 3EASA 4B6SA 3D6HA 1EFVB 3W6NA 2QYOA 2XXAA 2E49A 2RI6A 3GZNA 1NJ5A 3QX3A 1DHRA 5AFSA 2GJ4A 2AFRA 1YZVA 1O9BA 3UATA 3FYUB 3WMXA 4WVFA 4LI3X 3BJMA 5EMNA 1ZZEA 2XZTA 2ECQA 3QJGA 3UB2A 4D8VA 3KLMX 3DCIA 1ZKDA 4B1FA 1GCIA 1NX6A 3BD8A 2ZANA 4LXTA 2C4HA 1OUMA 3FR7A 1V26A 2BEVA 5LYJF 2XWBF 3AZOA 4ABYA 3BCSA 1RC8A 5GJCA 5JARA 5DYYA 4P6VF 1M2VB 1QUEA 4G1CA 2HUNA 3QVVA 4GDFA 2GN4A 3VR6A 5FWYA 2I80A 1KIMA 2ZP1A 1WMSA 1Z4QA 3RIGA 3ZTWA 1KRWA 3OICA 3JWEA 1UXJA 2ZE7A 3NVAA 5TB5A 2B4YA 2C59A 1GADO 3H5IA 3E3OA 4IIUA 4TTJA 1AHIA 5DI9A 4WI1A 421PA 2O6HA 4DCUA 3WGYA 1R8QA 3MRTA 3DAPA 1ENYA 2FLKA 2W6PA 2YV5A 3IEMA 2A5GA 3WIOA 4ME6A 1A9QA 1HSOA 2ZQZA 3GWGA 5KO2A 4OP3A 4HWRA 4RLQA 3PZRA 1KAQA 1TMYA 3JQGA 3RVOA 2F1IA 2K87A 2PBRA 4R8VA 1JHDA 5AKZA 5E4JA 3VKHA 4E31A 2XT9A 2WHEA 3VYWA 4YT2A 1PWXA 2NQTA 1ZZGA 5CCDA 3R40A 2XB9A 2JJYA 4KQHA 3O74A 5KSPA 1G16A 3SVZA 2CNBA 4RV5A 3WLEA 4B48A 4C1NA 4D9KA 4DTCA 2AH5A 3D3WB 2EG5A 5GV8A 5TQ0B 2ADMA 4YEDA 1OBVA 1QTNA 1DTWA 2W2XA 4JS0A 4FTWA 3ER6A 4MIYA 2QGFA 3KVOA 3OPQA 3Q9SA 3OOJA 2G40A 4ZIRA 3LT5A 3WIDA 3NEYA 1JLLA 1Z6ZA 3WQRA 4HT3B 1NU8A 4BFXA 4EQ6A 1E3TA 2CXRA 2NPIA 4LS3A 4A10A 4J1TC 3O6VA 1DAOA 1DINA 1G8PA 521PA 3GDWA 2IIQA 1T3LA 2WFLB 5FHQA 4C4SA 1KDPA 2YVLA 3N5CA 1XWFA 4A1OA 2DSTA 1VLQA 4WBSA 3TJRA 3JRXA 2ZSJA 1C9YA 5F2NA 1TTHA 2ZFUA 1KVRA 5EIFA 4MIEA 3TL2A 4ZHSA 1DFHA 2GARA 4R3UC 3A1DA 5JMPA 5LM3A 2JFNA 1WDTA 5LPNA 4ZMRA 1GQFA 1H6AA 1SCNE 4OAOA 3GNLA 2UZ4A 3V32A 1Z5OA 2WAMA 3VZRA 3FETA 1C3XA 4LVUA 1TAHA 4OQNA 1PU2A 2QYSA 2WIAA 3E2PA 3L7CA 1M76A 4G8BA 4PC6A 3F78A 1AB6A 1J25A 4OM7A 3GLGB 1EP1B 1HDCA 3OY7A 3FFAA 1MENA 5L7TA 2GK3A 4JI7B 3MAGA 4TV8B 1NWCA 1Z5WA 4KOAA 2XKJE 1JMKC 4GOOD 4HDSB 5AIBA 1Q44A 4ERXA 4XQ9A 1KIFA 4L57A 1SNYA 1CJSA 2CMKA 2CDCA 3ZXSA 2WHPA 1UJNA 3ONWA 1QHYA 3FD8A 3EIQA 2WTAA 5FYQA 2IPMA 5DM4A 4AO6A 4L3WA 2Q3JA 4O4IF 5CLGA 4B4WA 2HJWA 1KVSA 3X1WA 5CDGA 5J58A 4ILKA 3R76A 5KAPA 3TOSA 4FXPA 4TMYA 4GKVA 2EZTA 2VWPA 3PX3A 3HJAA 4KLNA 2V7QD 4MQEA 4CLXA 5LP6F 1FXWA 1I3MA 2X4DA 4GBGA 3L0CA 1QS0B 3BAFA 1JDPA 2AOTB 2R47A 4G65A 5HPYB 1FYFA 3ME5A 3Q3IA 2HNAA 3C14C 4BQEA 2ZSFA 2QR2A 1VA4A 3GUCA 3OSUA 2IYXA 1FCJA 1XAJA 1C7JA 2C4NA 5AI4A 3LY8A 1NBEA 3DS8A 1MC1A 3STUA 3SZMA 4NEGA 1K5HA 2DVMA 1XE3A 1N2CE 4MVJH 3KYJB 1FX0B 1CR4A 3DSRA 3WGHA 4U7JA 2QROA 2Q3HA 2ZRBA 3RADC 2VAPA 3PKJA 1WU8A 1TJPB 2MSCB 1X8LA 4K7JA 3ICCA 4O4IA 3OOSA 3EZYA 2YNMA 1PGJA 1AZWA 1VJRA 2IFTA 5FNZA 3UFBA 5LLSA 5T4BA 1OAAA 4LMRA 4R6WA 2XUIA 2V1UA 4B75A 4H6XA 3E9ZA 1GCUA 3NYIA 4JLBA 1YO6A 3G5UA 4MV1A 2HLHA 2PJUA 3DKPA 4Q05A 5LP6A 1LPAB 2JRLA 3E3LA 3FHOA 2ZIWB 4BN4A 3OA0A 1NOJA 2C7QA 1UXHA 4GOMD 2W00A 4EA9A 3MCUA 5KVQA 2DM6A 1DX4A 2ASEA 2CNDA 1BU8A 3I30X 2BBTA 2P78A 3R0QA 3TJMA 5IJ0B 1SO8A 1G8GA 1FSGA 1V71A 2R6JA 3CINA 3JZIA 1P9LA 1UBKS 4Z2YA 5C4GB 3ZX5A 3UJAA 4BKUA 2I71A 4WZZA 2JARA 4IFBA 3D0QA 1A2OA 2Q5OA 4FX2A 2EERA 2GZ3A 4OA5A 4C6TA 3UV7A 3HUUA 3MMSA 3IODA 2REOA 4GU5A 1QIEA 3WQSB 1QTIA 3HI6A 2DJ5A 3EK2A 3D2LA 3INRA 5ALZA 5DNAA 2Q99A 3PQCA 3RHFA 4DZZA 3P9IA 4G56A 4RTJA 1DUSA 2DWUA 4JVLA 1HQCA 1DZIA 1R4MB 3GDHA 1D1SA 4WLEA 2IOFA 5ALRA 5JNVA 4OJNA 2PL3A 3LKDA 1VLMA 2RHGB 5KQSA 3DNFA 1F2TB 2HUPA 3X2EA 4WOJA 3RV4A 5J3JA 4ENTA 1ISMA 1H1LA 3S1AA 2GI4A 5BSKA 5B1IA 3GT3A 4OTZA 3F4BA 2HK9A 1BGVA 1XTRA 4MKGA 2UYCA 1HE2A 2B2NA 4O6VA 4X1IA 2QMQA 4X94A 3HJBA 3TMKA 2A9RA 5H5JA 2R6FA 1XROA 1SVWA 1R15A 3GMSA 4H7PA 1U9IA 4YI3A 2D5BA 1XZDA 4ZI7F 1ZNWA 2O5RA 2QLTA 3CF0A 3IAUA 3ITNA 3LK7A 4CGYA 4G07A 3VO1A 3DYBA 1EHCA 2R5NA 5FULA 2PYDA 5FR1A 3CGGA 4BJ5A 4CMCA 5K3OA 5B4UA 1T3HA 1NQOA 3AK4A 3HV2A 4RVOA 1KVTA 4GUDA 4C0LA 4DLUA 2GLXA 2RHBA 4JXJA 4ACBA 4AKEA 2VHJA 3PTAA 5DVZA 4FHGA 4LV5B 1FOEB 2UUBB 1P1IA 4PCLA 1QO0A 4K81B 3TVYA 2E37A 3SJZA 2IBTA 5FKJA 1DDIA 4G0PA 1OAOA 3P9XA 3OPMA 1U1EA 3MJCA 1GFWA 2P2SA 3UJ9A 5D1HA 5K0SA 3L9WA 3UJDA 1W1WA 2EBWA 1R12A 2JD2A 4PLTA 4BWGA 3R5HA 2KWIA 5KPJA 1PG2A 3CJQA 1RWMA 2AN1A 3SIRA 4Q1EA 2OHIA 3Q5EA 4DRXA 1PGNA 5G4LA 4YT5A 1YAJA 3EAQA 3QV2A 5CT5A 5TS3A 4ZI7A 1Q0HA 3AC0A 2O2XA 5GQSA 3WHKA 5HOEA 3CMCO 2A9JA 5CDTA 2FW7A 1M8PA 2ZJ5A 3KQWA 2PZEA 3UPTA 4ITVA 1HE3A 4L78A 5C5EA 4UUQA 1M2JA 1MAUA 5CH3A 2C97A 3C8MA 2FXVA 3F4LA 4C6RA 1RYDA 4E0BA 2ZWMA 2KLBA 1K97A 1VHQA 3TRFA 3E7FA 5EHGA 5F7JA 4WA7A 4MPJA 3OZBA 3PI7A 3ZNOA 2HZ7A 3BK7A 4C2TA 1G9TA 1TYBE 3VU9A 1B6GA 4F9TA 4P0PB 2JFWA 3F97A 1PI3A 4U7GA 5KI6A 1F5NA 3RKRA 1NJ6A 1JHVA 4DLZA 1RPTA 2IU4A 4GYWA 3S2SA 4EI2A 4KRFA 3FYDA 2XUPA 3GC6A 2L82A 1I80A 4QRIA 4R7ZA 4BQNA 1G8AA 1XF9A 2NIPA 4RSRA 4YAOA 4FPXA 2FMIA 3FCAA 1X1RA 4H17A 3TXYA 3V8VA 4B44A 3EOZA 3VFDA 5K8JB 4KBYA 1MG0A 1PLJA 1NW4A 1G20E 3KXIA 3O75A 3PC7A 2APJA 2YVUA 3QBDA 4RU1A 4DG5A 3GFTA 2WVGA 1LBQA 1K7CA 2WYOA 5D7NA 4B34A 2QTLA 4Q39A 5CB8A 2XITA 3RRXA 2D2EA 2NGRA 2ZE5A 4O8CA 2H9IA 1UZLA 4W5JA 5FPPA 1E2EA 1SN7A 2F43A 3IUQA 1E2MA 3NUGA 2X0JA 1E5TA 5GADl 2X1HA 1NE7A 1HH4A 1F48A 4GMHA 3DBRA 1EPUA 3G2JA 3TAXA 1J42A 1TYDE 3T7RA 3KJZA 1UFQA 2WJAA 4P2GA 4IVPA 3DAYA 1BG6A 2QVCA 3AVTA 6CHYA 5EZQA 5ER9A 4AIIA 1DAHA 2VJAA 2BE9A 2HIHA 3V9AA 3ZLTA 4YJDA 1NQ5A 2YIDA 1NN5A 3IUJA 4OHXA 2A9VA 2VF8A 4TYMA 5KAMA 4A92A 4CHGA 3OEWA 2J3KA 1HGXA 1QAMA 1KS9A 4I50F 3A1WA 4P86A 5BT9A 5KMGB 3TAHA 1J2JA 2DKOA 2IZZA 3GRUA 1NV8A 3IVGA 3IXLA 4LC0A 4XVRA 4Q4DA