1PJ4A

Crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate malate, atp, mn++, and allosteric activator fumarate.
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
552
structure length
552
Chain Sequence
KEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAD-dependent malic enzyme, mitochondrial
publication title Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 188
structure length 552
sequence length 552
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pj4A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1pj4A01
1MV8A 4BNTA 2ZK7A 1LDGA 1LX6A 4ND2A 4CQMA 1DIGA 3DOCA 4PLCA 3PEFA 4GI2A 3ETEA 2XXBA 3ICCA 4IDEA 4F6LA 3GPIA 1R6DA 2J5KA 3PJEA 1ZUD1 3GVIA 2HUNA 2B0JA 3DAFA 3ZW8A 1B8PA 3GUCA 4TZTA 2Y66A 3RU9A 4E0BA 4IPTA 4NIMA 1CDOA 4BB6A 3CMCO 1ZO8A 1P0FA 4PVCA 5CDGA 2IXAA 1LA2A 3GG9A 2EXXA 2FR0A 2ZTVA 2WYWA 3TNLA 3V2GA 3WNQA 2Y93A 1W8DA 1WLYA 1HLDA 2JD0A 1V0JA 1AXGA 1FDWA 1IYZA 2A9FA 1LU9A 1Y6JA 1VC2A 3TOZA 2FSSA 4II3A 5IFLA 4K26A 3VH2A 3EVNA 3Q9UA 4RQUA 2PD6A 3D3WB 1YRLA 2XOXA 3JQEA 3L4SO 3P7MA 3PLNA 3QVWA 2D4AA 4QT0A 2AA3A 4MVJM 4DIFA 1M66A 4F6CA 4OXYA 3WJAA 2E49A 3LYLA 1KVUA 3HSKA 4Q3EA 2YY7A 3PQEA 3G3EA 4J0FA 3GAZA 3RUCA 1GQ2A 2FY8A 1JAYA 3GOHA 1ULSA 3JD1A 3OECA 5HM8A 2HJSA 3LVFO 5KVVA 5CG2A 4E32A 2QYSA 3QV1A 3PIIA 3ZHXA 3DWFA 3I6IA 4NHEA 4AJOA 1B26A 3IUSA 4OQYA 2AE2A 4NFSA 5ES3A 4URFA 4X54A 1Y8QA 1NBOA 3VZRA 3A1NA 3UH1A 2Y1OA 4XGKA 2Z1MA 2Y68A 5AXDA 5L7WA 1K6JA 4IDAA 1NP3A 2C59A 4NJMA 3PGJA 4JQCA 4CM5A 2GASA 5LC1A 1P1IA 1T2DA 1UAGA 3UCEA 4BNHA 4P4GA 2Y0EA 1G0NA 3EUWA 3M1AA 1B7GO 1XQ6A 3M2TA 4FJ1A 3VVCA 1LNQA 4NJOA 3D1LA 4L0QA 2CF5A 5G2OA 1T25A 1Q0QA 4WLOA 1VSVA 2WD7B 4N5LA 1E6EA 4NMHA 1B8UA 3Q0EA 1QKIA 3RUEA 4D3FA 4BMNA 1BW9B 1IY8A 3AUAA 3PQDA 1RWBA 3ONDA 3OIGA 4IIUA 4Q39A 5TRTA 4W4TA 4O63O 5A3JA 4GL4A 4D43A 4E2ZA 3V8BA 1JA9A 4KWHA 4J3FA 1DAPA 3RBXA 2AG5A 1F06A 3QWAA 3FF4A 1ZFNA 3I4CA 2HK8A 2TMDA 5AYVA 1X1TA 2VTEA 3NJ8A 3JQAA 3S8MA 4YJHB 3PZBA 2O50A 5T5QA 2QYTA 2V6FA 4BNGA 2HLPA 4K6FA 5HRUA 1WVGA 4Z9YA 2ZCVA 5L4LA 4XQCA 3WMXA 3IQDB 5I7SA 4IGFA 5BNTA 2EKPA 2DC1A 3H9GA 3ZWOA 2X86A 4GSKA 4ZRMA 3SJ7A 4OXKA 4DVJA 2Q1UA 4KQXA 2YYYA 1PJTA 3X2FA 3C7AA 4DTIA 1XA0A 3ZV5A 1QG6A 1BMDA 1FK8A 7ADHA 3OFSA 4A27A 4LRSB 5B4UA 4IUYA 2W4QA 4R9SA 2OXIA 4ZN6A 1HDCA 4INAA 5FEUA 4R9RA 3K2EA 2ZTUA 5EJ2A 4J7XA 5CPFA 4RPLA 1B3RA 1V6AA 3KXDA 5JC8A 5TNXA 2EHDA 1PSDA 3FSRA 4QSMA 1QYCA 2X1HA 1K6XA 3H6KA 2DBQA 3DBHA 5DCUA 1E0DA 3VDQA 4AJEA 4YACA 1I8TA 4IBOA 4ZQHA 2QRLA 4R5HA 4F3YA 2NVBA 4J6FA 4OSOA 2AW5A 2VRCA 1UR5A 3HN2A 3JD3A 1UZLA 1X7HA 4WOKA 1YQGA 4MVJE 1HEUA 1EDOA 1YBVA 5CFZA 3JSAA 1MUUA 5JFOA 4TRMA 1U1IA 3V2UA 3JQFA 2GDZA 3K92A 1N7HA 3PYXA 1C0LA 1HE2A 4WK6A 4RPJA 1LTHR 2QIOA 1E1MA 1M6HA 4GGPA 2NUAA 2DUWA 1MFPA 1RM0A 2YW9A 3KB6A 2POQX 1JVSA 2RHCA 1A71A 3FTPA 3W6ZA 4PG6A 2CDCA 3DAPA 3H9QA 4N54A 4NZ9A 5EQDA 4BO2A 2C82A 1Y8RB 3CSDA 4B3HA 4E21A 2NWQA 4EUFA 3P19A 1H5QA 1DIHA 4E12A 3O9ZA 1YOVB 4RO0A 5TQVA 4IJVA 3GHHA 3Q1LA 4CMEC 3C7CB 1PZEA 1A4UA 4BIIA 3H2ZA 3QW2A 1BXZA 1MC4A 4QFCA 5F1OA 3I52A 3NDIA 4XQEA 3SVTA 4BNLA 1R15A 2QQ5A 3HE3A 3BMQA 3JQ8A 2X9NA 2PY6A 1MXHA 1N92A 2Y1FA 5F21A 1HDOA 2PGDA 5A3VA 3SXPA 3UCXA 4CPDA 4RJTA 4FJ2A 1C1XB 4KDEA 2NVUA 4K6CA 4FN4A 4FPXA 4CLOA 3R3JA 1DSSG 5U1PA 1D7OA 4PLVA 1PJBA 4MIOA 2HRZA 3GF4A 4P22A 3TZKA 1SPXA 1B3BA 2G5CA 2BGLA 3T4EA 3UN1A 3LU1A 1PJLA 3BMNB 3GH3A 2C0CA 3CEAA 3K31A 4UEOA 2PH5A 2EF1A 3ON5A 5KVQA 1U3WA 3I4FA 4I08A 5FYDA 3AOEC 4LSMA 4Z9FA 3FHLA 5EN4A 2YQ5A 3DFUA 1HSZA 2PNFA 3FBTA 4NG5A 3QVTA 2VYND 4ZQEA 3JQGA 4Q3BA 4CLXA 1BRMA 1ZIDA 3AUTA 5DNAA 3ROQA 1U3VA 1ZK0A 3WIEA 1EUCA 3DDNA 4ND5A 1I32A 4RLSA 2O3UA 1M2WA 3HB5X 1Y7TA 3DZIA 4PZEA 5KWEA 4R1SA 3Q2IA 3JYOA 1YB1A 2C29D 3GZNA 2BGMA 1NPYA 2VNSA 1CWUA 4XIJA 1QXSA 5DP2A 1LQTA 4GX0A 4IM7A 3WWZA 1BDBA 2X5JO 1PGNA 1HRDA 5T8KA 1LSUA 3H3FA 4HWKA 5JCJA 1HZZA 3DFZA 1WZEA 2GNAA 4XYMA 1D3AA 4N18A 3UKOA 1YH3A 4MVJP 2EP7A 2OL4A 5MGBA 2R2GA 3DR3A 2X7HA 1YL5A 3ENNA 4BKPA 1QRRA 5L7YA 3QWIA 1BXGA 4OAQA 2Y0CA 3F46A 3DTYA 3GY0A 5AXBA 1SEVA 2YV2A 1JKJA 1E7QA 3U62A 3WGTA 1HWYA 1GADO 1GPDG 2HMSA 4N5NA 5CEEA 4GX1A 2UV8A 3TOXA 2AXQA 1DOHA 1N8KA 2NTVA 1PJQA 2JAPA 3U4DA 4TRJA 3CH6A 4KUGA 4RF5A 3C8MA 3A06A 1ML3A 4BNMA 1I3KA 1KS9A 1T2CA 1ZSYA 3UW3A 2X22A 4UULA 1JWAB 4XYGA 1NXQA 1DC4A 2FZWA 4YJGB 4WEOA 3ZV4A 3HADA 4Z0HO 2HMVA 4YDRA 4CV2A 1GY8A 3MWDB 4ONEA 2D2IA 3WICA 3AU8A 1NASA 4BO0A 4GX5A 3UF0A 2PFGA 2OO5A 1LDMA 4MVJI 7MDHA 1E7RA 2DT5A 3JCZA 4WCFB 2Y1CA 9LDBA 4NQZA 4DA9A 4JP3A 4KP7A 1SCUA 4R5MA 5CDTA 3B20A 1ONPA 1GZ3A 1N9GA 4PFJA 1D1SA 4TROA 5G4LA 1LDEA 1KETA 4L4SA 4UUPA 4DMLA 3JD2A 1ISGA 1P9LA 2ZJ0A 3UGKA 2UVDA 2E48A 1Y5RA 2PZLA 3EZLA 4YJFB 4CV1A 2GF2A 5ENVA 1X1EA 3MJ4A 4XKJA 1XDWA 2I65A 4RVHA 2GN4A 4CMAA 2BFOA 1A9YA 2C2XA 3W6UA 3TRIA 3PTZA 1KERA 4AJ2A 4GMGA 3X2EA 1BVRA 5IDQA 4CR6A 4XB1A 1LC0A 2O23A 3Q9NA 4GSLA 1TB4A 4PG4A 1NAIA 4D79A 1EMDA 3FBGA 1GR0A 1UXGA 4RDHA 4GMFA 1NHWA 5GZ3A 4BV8A 1O0SA 3ENKA 4K1LA 1L1FA 3WFIA 1GPJA 2PKQO 2VOJA 5JSFA 2D5CA 3FR7A 4PZDA 2Z1NA 3IUPA 4Y6PA 4DIOA 3STHA 4WPGA 3GEGA 2Q2QA 3SC6A 4ZQFA 5DULA 4CMHA 3AM5A 4J91A 1RPNA 3RFXA 5JMPA 3F9IA 5A5EA 1Q2XA 5CHEA 6LDHA 4Y6RA 3WQRA 3V2HA 2NACA 1P1RA 1I2ZA 4JN6B 1B16A 2CY0A 2HQ1A 5ENDA 4AVYA 1JAXA 2E82A 5TSDA 2Y1EA 3GQVA 1W6UA 2SCUA 3PJDA 5K9ZA 3K2BA 1N1EA 4EYEA 3OEWA 4UUOA 3NT5A 1U4SA 4GWKA 4Y6SA 3WB9A 5KJ1A 2VHWA 4PIVA 4JJIA 4XZ3A 3GDFA 1BSVA 2D1YA 4M1QA 3IAHA 4EI2A 4RZIA 1XU7A 5K0ZA 4CLDA 4EJ6A 3OF2A 3LC2O 4G2NA 4R16A 3RSHA 1EDZA 4F46A 5BSEA 3HDHA 2BKAA 4A03A 5JNLA 1MP0A 4JJGA 4QQRA 2Q4EA 2HCTA 3RUDA 1HE3A 1CRWG 5F1PA 1KY5A 3E03A 1QV6A 3GNSA 1R4NB 3WG9A 2C5AA 1R16A 4FBGA 5DZSA 4EDFA 2P4QA 1I2CA 3E48A 4E5MA 2ZTMA 2RCYA 2B83A 4EEZA 3SBOA 3U4CA 1ISIA 3CINA 2CDAA 4DRYA 3W4KA 3ICPA 3U3XA 3I9JA 3WQQA 5LDHA 3QE3A 2NV6A 4TVBA 2V6MA 1UJMA 3WGQA 1MG0A 3AY3A 1TXGA 1Q1NA 3ITKA 3JD4A 4DYDA 4FS3A 3I6QA 3D4NA 4BMVA 2GN9A 3ZWXA 2FRDA 5EL0A 5GZ6A 3D3WA 1B2LA 4WGGA 2OBNA 1K0UA 4WLFA 2V65A 4DPKA 1JKFA 3EVTA 2J3HA 4ALJA 1I30A 5JY6A 2A4KA 3PJGA 1IUKA 1NX6A 4WEQA 4U5QA 4CLHA 2J3JA 2B4RO 3FR8A 2V7PA 2VYVA 3JV7A 4E2WA 3ZWAA 4U0KA 3GMDA 3S2EA 4XIYA 1ID1A 2IZ0A 2EEZA 2DFVA 3GR6A 4CM9D 4KUEA 2NNLD 3OEYA 3I1JA 1T2EA 4B8ZA 4RF3A 5BQFA 3GDOA 4UREA 2OZPA 4GWGA 4CQMD 4XYBA 2ET6A 1CERA 2GERA 1Z45A 5TT1A 2VUUA 5AOVA 1GTMA 1PS9A 2DTEA 4IMRA 4RV9A 4ZQGA 3U5TA 3WFJA 3RC9A 1VM6A 2QHXA 1NR7A 3I9KA 1V9LA 4FFLA 1BGVA 5EINA 4YQZA 2P4HX 3PGXA 4BO8A 1YDEA 1P77A 5A9RA 2H6EA 1JDJA 2IZZA 4FIZA 4YCAA 3WGZA 3DBLB 3LT4A 1KOLA 3TSCA 3UFXA 3WQSB 1KEPA 3KYCB 2WD7A 4CMIA 1EK6A 4CM6A 5I7VA 3HDJA 3VHRA 3PHGA 1D1TA 1NPTO 1QLHA 3T7CA 2G82A 2ZYDA 4AJJA 2YHUA 4FFRA 1T24A 4W6ZA 3WIDA 1O9BA 1IULA 4RQTA 1RM5A 2EWMA 1ZSNA 2CZCA 1U7HA 1MLDA 1EUZA 1VJ0A 4RPGA 1AXEA 5KVSA 1IL0A 4L75A 4E5PA 1ZW1A 1OI7A 4RL6A 4NBVA 4YJHA 3H9EO 3M6IA 3UHAA 4PLZA 4D45A 5A9SB 4TSKA 3ASVA 4CLRA 2WE7A 4MIEA 2A92A 2FHSA 3E18A 1Z7BA 4B7XA 3KZVA 5JAIA 3OMLA 3PHHA 4YAKA 4KMSA 5JDIA 5BT9A 4B4OA 1J5PA 1TA4A 2WEKA 3RKUA 1E3SA 5G0UA 3OJ0A 4AJ1A 2IEBA 4CM3A 3OQ6A 1I24A 1LRJA 1P44A 4J7CA 3ETGA 5CDSA 1SZJG 4MP8A 1H6AA 1GEGA 2P9GA 4XGIA 1HLPA 1LSSA 5AXCA 3JQFC 3JQ9A 2Y05A 1U5CA 4YRDA 2YDXA 5FF9A 2Z95A 1FDUA 3H7AA 3IL2A 1EQ2A 5B4VA 1HYGA 5F5LA 4E5KA 1OZAA 1KEUA 3QVXA 1MB4A 2X9GA 4CL8A 3LT0A 4CR8A 2EW2A 2H5LA 3NAQA 5DOVA 5LDGA 1A5ZA 1YE3A 5A1TA 1EFLA 4JROA 4IY1A 5HTOA 1J6UA 1XHLA 4XQ9A 2VWHA 4Z0TA 1Z75A 3JQAD 3L9XA 1A9ZA 3WYCA 3PPIA 2PZJA 3ZHYA 3C1TA 4DMMA 1T1RA 3OA0A 4RPHA 1E1NA 4ZRNA 3ULKA 3RBVA 2NU6A 4WASA 4HV4A 1QYWA 4Z3KA 1P33A 4A26A 3U9LA 4AJKA 3R6DA 4Y9DA 1O5IA 4EUHA 1KIFA 2E37A 3BTUA 2IEDA 4P4NA 3Q6IA 4NNJA 1P74A 1U8FO 3ZU3A 3VH4A 3GFBA 5IDXA 4M86A 2RIRA 4YT5A 1EZ4A 4ALMA 2VHVA 4OKNA 2OGUA 1DEHA 1NFRA 1XKQA 1GQYA 3GG2A 4ALLA 1Y8RA 4WNIA 1LDBA 1P45A 2C7GA 4XDYA 2BFMA 1GZ4A 5BSFA 4WLNA 1ADCA 1YOVA 2J8ZA 3LF1A 1EUDA 2D5AA 1HDYA 4U0JA 4ZQBA 3G17A 4ALIA 2EGHA 1I36A 4BGIA 3NT2A 3WLEA 4AJIA 3QJ5A 5G0WA 2EKLA 4KTTE 1NFQA 2O4UX 1HKUA 2IYPA 1GV0A 2HMWA 5L4NA 1DC3A 1DB3A 3K5PA 3T7EA 3TL3A 2FZEA 3ANMA 4GLOA 3ZU4A 1C1XA 4FFMA 3TZ6A 1EE2A 1H0KA 4J4BA 5EIOA 5JMWA 2NU9A 1ONOA 4GAEA 4CM8B 3ZH2A 4B7CA 3W1VA 1PL8A 3GFGA 2VRCD 3CE6A 3GRKA 3ADOA 3BMNA 2OORA 5IZCA 4I5DA 4NBWA 4CJXA 1SNYA 2GGSA 5KIAA 4BNNA 2EW8A 2EJWA 4K9DA 1R0LA 4RZHA 1DLIA 1HDZA 5JAZA 1UDCA 2E4AA 2FSVA 1GDHA 1I0ZA 1W0CA 3FRJA 4JK3A 2AQIA 2W2KB 2W98A 1YDWA 4PLGA 2AQ8A 1JWBB 5CAEA 4BHTA 3AOGA 3QIVA 3EY4A 1DHTA 2AHRA 4PLFA 5T8KC 5IN5A 2PA3A 1H94A 1KC3A 3QA9A 3ANNA 4P4LA 1PS0A 2LDXA 4J4HA 1MA0A 3D5QA 4HXYA 2QRJA 3H2SA 1Q0LA 4XEHA 4BQRA 3V1YA 1VJTA 4DPLA 2QG4A 3CPSA 5I8WA 1YB4A 4DQVA 4KOAA 4E3ZA 2W2LA 1ARZA 2ZATA 5ER9A 5HS4A 3VAZA 4G65A 1O8CA 4H15A 2AE1A 3HFGA 1ZBQA 4D0RA 2P5YA 3VDRA 4F45A 1X14A 4BKUA 1V35A 4IS3A 4WLEA 1Z82A 5JC1A 4AL4A 3BIOA 4OQZA 5IAAA 1S6YA 3FWZA 2ZB4A 1UDBA 5TX7A 2D0IA 3GA0A 3U0BA 3JQ6A 2X23A 3ANLA 4JBGA 1H2HA 2O3JA 2P5UA 4GPD1 1K3TA 2VUSA 5ICMA 3PLRA 1EE9A 1ONNA 5TS3A 1QLJA 1SO8A 2BI7A 3TJRA 1SB8A 4BNIA 5B1YA 2VTDA 3PHLA 1AGNA 4J2HA 2JHGA 5A04A 1EQUA 4IXWA 4DLBA 4YBZA 5T57A 3GVXA 3TN7A 4DLAA 2DPGA 1XU9A 1RM4A 3MJVA 3DZGA 1E3WB 4BKOA 1GL3A 4R51A 4H7PA 3K73O 1WDMA 3LT2A 3AM4A 4TRRA 4YJGA 1B0AA 1HYHA 5FI5A 1NQAO 1ENYA 2PH3A 1IE3A 1XSEA 2Z5LA 1ENZA 5DCWA 1B14A 1CF2O 1NWCA 3AI1A 1GYQA 4WCFA 3IKTA 4UVGA 3WTCA 1C3VA 5A05A 1KEVA 1LC3A 1T4DA 4B79A 5C7IO 4XD2A 5JW6A 5JYEA 2WMDA 1DRVA 1GYRA 3AI2A 3WGIA 3A28A 4ALKA 5JCJD 1ZZEA 3G0OA 1FJHA 4YJFA 1QSGA 2EKQA 3A14A 4R69A 1UZNA 1ZEJA 4TWRA 5G0SA 5ILGA 4MKRA 3WJ7A 1U7TA 4YAIA 2YHIB 2DAPA 4HFRA 3K6JA 3QRWA 3VZPA 1PTJA 2ZQYA 3KEQA 5I7FA 1YS4A 4CV0A 1DO8A 1LRKA 4O59O 1E3EA 1ADFA 3QWFA 2WD8A 1EVIA 2AQKA 3KYDB 2Q45A 1H6DA 3N58A 3QSGA 4AICA 5B4TA 1LI4A 2H1SA 2VT3A 1J0XO 4CQMB 2I76A 1DC5A 4RVUA 3RI3A 4NBTA 2NU8A 1LEHA 4CMBA 4B8WA 4OOEA 5T64A 4PRLA 5COBA 3F5QA 3HN7A 2Q2VA 1H93A 3C1OA 2NQ8A 2UYYA 2Y1DA 8LDHA 3KSDO 4J1QA 3PQFA 5IF3A 1EVZA 2RH4A 2LDBA 2X0RA 4DPMA 2PK3A 3HNPA 3IC5A 3RFVA 2VQ3A 2X5OA 5DP1A 1CYDA 1Y1PA 2WDZA 2OOSA 4TMFA 3VOSA 3M2PA 3JYPA 4MINA 4OGWA 2ZYAA 4IJKA 1J49A 3ASUA 2B37A 1T1SA 2ZJ1A 3SEFA 5L9AA 1LLQA 2JFFA 3FNGA 3RJ9A 4D3DA 1H2BA 4BNJA 2P68A 2YDYA 2NVWA 2XXJA 3PRJA 1LLUA 5G4KB 1XQ1A 3L0DA 1BWSA 2EP5A 3D0OA 4YAGA 2AEMA 5KNLA 1CIVA 3OQBA 3MZ0A 3ZGYA 2ZB8A 1FF9A 2O48X 1ZXBA 4QXMA 3ZWVA 2NLOA 5CDYA 5CPBA 3TZHA 3VZSA 1PX0A 2PGJA 3NUGA 4YYZA 2R6JA 1NFFA 2PKQP 3AFNA 4IGEA 5EQFA 1UDAA 3H5RA 1GUYA 2FWMX 3V1TC 1R4NA 4YT2A 4FOOA 4I8XA 2DM6A 2GZ3A 1KC1A 1Y8QB 4E5YA 3WMWA 4A5OA 5K6AA 3BTVA 4R3WA 1O6ZA 4CV3A 4E33A 1AN9A 1CQIA 3G79A 1PJSA 3VVBA 4WECA 5CDUA 2BLLA 1YL6A 2DFDA 4PG8A 1ZK1A 3KTDA 4XR4A 4E30A 3F3SA 4BO6A 4U6QA 4WE3A 4BO5A 1A4IA 5IXYA 5JO9A 3L6OO 3GUYA 3E9NA 2DTXA 5TJHA 3DONA 2QX7A 2JCXA 3ZZNA 4OM8A 5TF4A 2BHLA 3DMTA 2HK7A 3OM9A 4G81A 4BGEA 4EJ0A 4OXNA 3FCOA 5CG1A 3DZKA 3FN4A 4JNKA 4N7RA 5H82A 4A73A 3U09A 1IHXA 3OH8A 3QWBA 3AJRA 3JQAB 1P1JA 1HZJA 2JJYA 3GAFA 3TWOA 2RH8A 4PCVA 1C0PA 2V6GA 3RWBA 2C07A 3LSYA 5AVOA 4NH4A 3DBRB 5L3ZA 1PGPA 1YWGO 2VN8A 4O6VA 2I5PO 1EEHA 1F8GA 2FR1A 1LLDA 2VZ0A 3DMYA 2O3QA 3LT1A 3AUUA 3LLVA 1J4AA 2B69A 4IJUA 1AHIA 1HDGO 4KQWA 2D8AA 2PKRA 1R12A 4M54A 2X4GA 2D3TA 3JQDA 2AMFA 1U8XX 3E82A 4QX6A 4J1SA 1DPGA 3OJEA 5JCXA 4BV9A 3NTRA 3OIFA 5U9CA 5L51A 1F14A 3C3XA 1XYGA 4AG3A 2Q99A 2WYUA 4I5FA 1E77A 1ZJZA 1ZNQO 2AG8A 1C1DB 4YTEA 1GU7A 2TMGA 3VPHA 4ZHSA 3FI9A 3JYNA 4BKRA 1PGQA 2HU2A 4U6SA 1H9AA 3B1FA 5EPOA 4HP8A 3DBLA 2CNBA 1KEWA 4LN1A 4J7UA 1QYXA 2YZ7A 2DKNA 4M49A 1GUFA 1MXFA 2Y0DA 3ORFA 5JAMA 1S7CA 1DFGA 4G5HA 1ZVMA 3U4IA 5JDIC 3ZV3A 2E6UX 5DF1A 4I9HA 4I9UA 1X13A 1UZMA 3UAGA 2Q1SA 6ADHA 4KWIA 1NAHA 4YR9A 3C7DB 3RBZA 3GGGA 3NJ4A 1U5AA 3RUAA 5COAA 1QV7A 2YFQA 4WLVA 3W8EA 4IXTA 2OP1A 4CM7A 1YKFA 5A9SA 4QECA 3JQ9C 3H3JA 4C7JA 1LSOA 1E1KA 3VPFA 3O8QB 4HUJA 1ZCJA 4II2A 4DBVO 4CQLB 5IZ4A 3LF2A 3ZWMA 1M6WA 1ZH8A 1SC6A 1UAYA 1VPDA 1DBVO 4AJPA 1VRWA 3PI7A 2HKIA 4QTZA 1OOEA 4PG5A 2NADA 4WKGA 5JXWA 4FJ0A 3AW9A 1F8FA 3ONEA 1ULUA 1JKIA 1U28A 4FCCA 3PIDA 4XYEA 4RVGA 3D5TA 3DEYX 1TT5B 4NPCA 3QY9A 2J3KA 1O94A 3QVSA 2CMDA 4L76A 4EUEA 1JU9A 1Z7EA 4FFPA 1WNTA 4BNKA 4YRAA 3MJCA 2GPTA 4IQGA 2IE0A 3JQ8B 4NFHA 2Q50A 5KJ6A 3TFOA 3W8DA 1EBUA 1W73A 3CZRA 4FD3A 3LDHA 1ENPA 1JTVA 4ZD6A 4CLOB 2O7QA 4YB8A 3OETA 5HWSA 1F0YA 3EW7A 2X58A 1H6CA 3DZHA 3OP4A 1ISFA 4DL9A 1PIWA 3TQHA 1NVMB 1GD1O 1E7YA 4BL5A 4ALNA 2CVZA 3ZI0A 3WGOA 4A10A 3UOGA 5ADHA 1T2FA 1EBFA 1IZ0A 4C7KA 1M75A 4N5MA 3VPGA 2WSBA 3NTQA 4PLWA 4ZU3A 2X9VA 3Q2KA 1NR1A 4LGVA 2G17A 5C7OO 3LC7O 1QYVA 1UP6A 4J9UE 1ADGA 1Q0HA 1ZEMA 4D44A 5BR7A 4E5NA 4XYLA 4IZHA 2AQHA 2IYOA 1YJ8A 3AY7A 3WXBA 1Q7BA 3EHEA 3NDRA 5I9MA 4XR9A 3RCBA 3RQSA 1F12A 3JYLA 1LLCA 4YEDA 4BNWA 3IMFA 3NV9A 4J1TA 4LMPA 1HXHA 4ESOA 5IZCC 3S1LA 2BGKA 2PR2A 3IKVA 3FNEA 4WCDA 4UUNA 1I5RA 5THQA 3RVDA 5KJEA 1RYDA 4OKIA 1MGOA 3JQ7B 5BNIA 2RBEA 2WYVA 2J3IA 3DHNA 3H8VA 4DUPA 5F3RA 1I3LA 4XGNA 1HT0A 1IPEA 1ISMA 1U3TA 4HBGA 4OJNA 4XX0A 1WDKA 1N7GA 5F1KA 1PEDA 5KTKA 3O26A 3F1KA 2D59A 3WNVA 3KSZO 4ZA2A 3PJFA 2CVOA 3JTMA 3VKUA 1N1GA 4R68A 5KOIA 4BNUA 4PRKA 2JKVA 1KVRA 4UEKA 1ZK2A 4MVJG 1D8AA 4AFNA 4CM8A 3IJRA 4R1TA 4ND3A 4NK4A 5A03A 1BXKA 1WAMA 2VCYA 3H9JA 4W7HA 5KKCA 3HDQA 4IDBA 4Y8VA 3GEDA 4JXKA 3ZU5A 2XPCA 4PZCA 3PDUA 1WWKA 2W2KA 3V1UA 1Z6ZA 4FSHA 3ZU2A 2HMTA 3FWNA 3ROKA 5JBIA 4HX5A 2IRWA 4LSWA 3D4PA 4K28A 5FWNA 4O0LA 3OIDA 1Y81A 3RIHA 5C3MA 1T4BA 2DBRA 4AJNA 1C0KA 4OOFA 5G0TA 4RF2A 2YFHA 2BF7A 3PFWO 4CM4B 1UXIA 4O1MA 2GLXA 2YV3A 4DXHA 4YAJA 3MTJA 3GVHA 2A94A 2GN8A 3R3SA 4OYRA 2ZTLA 1BW9A 1PGOA 4NFYA 1Q7GA 4RVDA 4BUCA 2A35A 4PLTA 3H4VA 5GMOA 2I99A 1HE4A 1NQOA 5ICSA 1VKOA 1JQBA 2O4CA 5H83A 3PXXA 4E4YA 2JFHA 1GV1A 4S3MA 1OBFO 4XB2A 2WJPA 1NVTA 3COSA 2PZMA 1TT7A 2WWRA 3DBVO 1CETA 4CL3A 5C5IA 3CXRA 3G49A 3O03A 4IIVA 4LCJA 1GEEA 3WR5A 2AEFA 3NRCA 4C4OA 3F6YA 4CMCA 4Q3DA 2IODA 4D0SA 1R4MB 3D64A 2HK9A 5TIIA 3ZNPA 1XEAA 2NTJA 4GVLA 3V5NA 4ND4A 4WCFC 2FR8A 2CUKA 3KHUA 1TEHA 3H9UA 4BB5A 4YRBA 5JS6A 1E3WA 2BD0A 4BNXA 5TC4A 4CUJA 2PV7A 1YL7A 4KDFA 4YQYA 1UXKA 5JY1A 1E1LA 3QP9A 1NWHA 2OFPA 1PZFA 2VWPA 3CKYA 4WNCA 2HAEA 1DXYA 4O5OA 3JYQA 4HFNA 5AQ1A 2X0IA 3G1UA 4IS2A 4BO9A 4OO3A 3ZV6A 2Q3EA 3INGA 4YA6A 2WTBA 1YBAA 4R3NA 3WX0A 3VH1A 2YUTA 1A72A 1PQUA 3U49A 1I01A 4I5EA 2JCVA 2QZ9A 2W2LD 3ITDA 1HETA 3AY6A 3TDKA 4QFDA 3WDSA 5JYDA 3TL2A 1KY4A 1XR3A 3ZWPA 2GZ2A 2JD1A 3FPLA 2Q2WA 1LDYA 2FOIA 2BELA 4UAGA 4PGFA 3RUIA 4BMSA 1HSOA 3PWKA 4OH1A 2IDZA 2JHFA 3OA2A 4EW6A 4B3JA 2O2YA 1OC4A 3H5NA 1PS8A 1B8VA 2O3RA 4JBHA 1DAOA 3E5MA 5JAQA 4XDZA 4ZGWA 1ZSVA 3KYDA 4YT8A 4J4TA 1VI2A 1G0OA 1YVEI 3F47A 3C24A 1NHGA 3NKLA 4JJFA 3WS7A 2H63A 3SX2A 2JD2A 4YPOA 2BFPA 5I8ZA 3BMOB 4D42A 3DZJA 4GVXA 3OQ1A 1HE5A 1V3VA 3FNHA 2OMEA 3T4XA 1VKNA 3I83A 4CLEA 1DIRA 4E13A 3DTTA 3HB4X 1YONA 2DUUA 2HDHA 1LUAA 1KVTA 3I9LA 1FDVA 2O3TA 1A7KA 3GDGA 3P2YA 1BDMA 3PHJA 3N7UA 1NNUA 1XLTA 4J16A 2X0JA 1RKXA 2W8ZA 3F4BA 2NTNA 3OHSX 1ISJA 3BHIA 3GRPA 4DLLA 2IZ1A 4LMRA 1SMKA 1Y9AA 3QHAA 1TVEA 2DU8A 3VH3A 4DBZA 2ZKLA 4IMPA 5KCZA 4J9VA 5K6AC 1IOLA 1ORRA 4LRTB 5DCYA 4J49A 5G4KA 5A4DA 1N5DA 3SLGA 3MTGA 2XAAA 2Q1TA 5DBIA 1R37A 4L74A 1UP7A 2CD9A 1AUPA 3C1AA 4TRNA 3VTFA 3ZN2A 4XRRA 2EJVA 4CMGA 2IXBA 3ZWNA 1GZ6A 2JL1A 2G1UA 2ZB7A 4R1NA 4MVJA 5TT0A 1E5QA 2DPHA 4EGFA 3RFTA 2FPPA 3RUFA 3EMKA 3UCFA 1MX3A 3LK7A 4HY3A 2B35A 3WSWA 1XG5A 3EK2A 4DWVA 4BQPA 3DMTC 4W9NA 3MJTA 1UXJA 3D7LA 4MIYA 3IDSA 4Z3DA 4BO1A 1GQQA 4I1IA 4WUVA 2CSUA 4EJMA 2ZB3A 3AK4A 2B5WA 2NU7A 4FC7A 3EAGA 1E3JA 4CMKA 4DGSA 4NBRA 2OP0A 4TQGA 1SBYA 3DXFA 1O89A 4NU6A 5IXSA 2EGGA 3CZMA 3GNTA 2CDBA 1ISHA 2GO1A 4QO8A 2JFGA 2XF8A 1NM5A 4CMIB 4JX8A 4M89A 4R54A 1VL6A 4D46A 3AU9A 4EITA 4BO7A 3WLFA 3KETA 3BA1A 1VLLA 3QWHA 4XRGA 4ID9A 4OSPA 2UUPA 3MJSA 2C20A 4RVSA 1Y5MA 2F1KA 3ZDFA 4UVEA 1CEQA 2ZCUA 4ROSA 4IDFA 3PVZA 4FC6A 5JPIA 3RJ5A 3F1LA 4YT4A 3E5RA 3Q11A 1Z74A 4PLYA 3ZW9A 2FPGA 1E6UA 3NX4A 4GQAA 2VUTA 4DYVA 1WZIA 2CFCA 4BNZA 3L4BA 1DLJA 1P1HA 2OBYA 4CLRB 4GLLA 1V8BA 3MJEA 4L8VA 3DBRA 1YB5A 4CR7A 2HMUA 3RC1A 2I67A 1MC5A 1WPQA 2DTDA 3KLMX 3DAGA 3JQBA 1E3LA 4KUHA 1K89A 1DIBA 2R00A 3K96A 1QR6A 2PD4A 3DZFA 1E5LA 3VZQA 3TF5A 3PFFA 1A7AA 1F17A 5AXAA 3E6AA 1CJCA 4AJLA 4MVJH 4XJSA 1PZHA 3HG7A 5EESA 1GCOA 4B4WA 3FTNA 4GGOA 1C1DA 5DT9A 2FMUA 3VPXA 8ADHA 3VC7A 3D3EA 4HNGA 5JO0A 4U8GA 1I33A 4GKVA 3G1TA 3BMCB 3K9QO 4BGUA 1DJQA 3HUDA 1M76A 4IINA 4RF4A 4WOJA 3MEQA 3I23A 1IZ9A 3PWZA 3GN2A 2GD1O 3S2FA 3P2OA 3I9NA 3R1IA 4KTVE 1X7DA 4ZJUA 3L07A 1U2DA 4QEDA 2WM3A 5DBGA 5G0VA 3E8XA 1VJ1A 3EC7A 1E7SA 1C0IA 1LRLA 3BTOA 1R0SA 3INTA 4NK5A 5DOZA 4MKZA 1L7DA 1FDTA 4R1UA 3I5MA 4H3VA 3GZ4A 3BYZA 1VL0A 2I9PA 1FDSA 2EV9A 4M8SA 1X15A 3LLSA 1R66A 3ST7A 5JDCA 3EYWA 4IQ8A 3K30A 4FB5A 2VNAA 1SOWA 2YV1A 4OL9A 3C85A 1ZXLA 1U4OA 2O7SA 1FMCA 1VL8A 3L6EA 2Y1GA 3OJOA 1PR9A 2BMAA 5I9NA 3PWSA 3O8QA 1GFSA 3NYWA 1Q7CA 1L7EA 1KBZA 5KKAA 4CQLA 2YJZA 3QQPA 3PP8A 2I3AA 2Q1WA 5L7TA 3LZ6A 1PWXA 2FPIA 4FR5A 3W4JA 4A7PA 1C14A 2I66A 2QW8A 3IS3A 1T2AA 4J90A 1E6WA 5F5NA 5FI3A 3LC1O 1U2GA 3DO5A 1OMOA 4BS9A 2VHXA 2RAFA 1QP8A 3O4RA 1O95A 1QORA 1TT5A 5A5FA 2BH9A 1EVJA 2PGLA 3SJUA 2V6BA 4LISA 4MPDA 4YAEA 4A2CA 4B3IA 4EZBA 4H16A 5HA5A 1GAEO 3BHJA 4TKMA 3PHIA 3B1KA 5IN4A 1DFHA 2P2SA 4TZKA 4DQXA 4J0EA 3GLQA 1PU2A 4UEJA 2DQ4A 2PD3A 3E1KA 4NBUA 1P3DA 2ZQZA 3OJLA 5C37A 4OMUA 3M1LA 2FP4A 2W90A 1RM3A 1NQTA 1VE9A 2JCYA 2C54A 3ONFA 1DJNA 4XCVA 1NYTA 2C5EA 3L77A 4NJMB 1TI7A 4CM9A 3E9MA 4I9NA 4HADA 4DQUA 2C2YA 1UH5A 1LSJA 2NM0A 5BNFA 5BSHA 3KVOA 5COQA 1Y9EA 1OFGA 5H81A 2CVQA 5C7LO 1P1KA 2RHRA 1UUFA 4M87A 4MO2A 1DRWA 5B12A 1DHRA 1IHYA 1W4ZA 3WTBA 3WYEA 4FFNA 4J1NA 4ZVVA 2J5RA 3H65A 5JLAA 2OHXA 4NU5A 3PYLA 1ZK3A 2OUIA 4HNHA 1JLLA 1DRUA 3CIFA 3INRA 4MJLA 1BG6A 3ZHZA 5T6BA 5A9TA 1QMGA 1ZJYA 1PJCA 1KVSA 1SAYA 2DBZA 1EVYA 3K8ZA 3NGXA 3JQ7A 4LVUA 4ND1A 1SEPA 3GVPA 3KLPX 1K2WA 2PTGA 2X6TA 5A06A 3NDJA 1MFZA 3HFSA 1E7WA 4XJTA 1HTBA 4FQ8A 5FFFA 5HS6A 2J6IA 3ZNOA 1KYQA 3OSUA 3I3OA 4ILKA 1CQJA 4NR0A 1SB9A 4YJDA 3ZNQA 2DVMA 3AFMA 3PZRA 1I10A 1JN0A 5CP8A 2DLDA 5IJZA 4LCEA 1I3MA 3VTZA 2CF6A 1U3UA 1M67A 3EGOA 2QZZA 3KO8A 5ITWA 1HYEA 4QUKA 1UP4A 5JE8A 3S55A 4UVIA 4IZIA 4LK3A 4S1VA 1HF3A 3PYMA 5I9LA 4OIMA 2X5KO 3KM0A 3ZCXA 3ZWYA 4AJ4A 1PJ3A 4JGBA 5U4QA 1G6KA 1HDXA 1LBEA 3GNQA 2X0NA 3Q3CA 4EEXA 4JBIA 1WMAA 4ZICA 2WE8A 2GCGA 4QO7A 4Y67A 1DFIA 1ZMOA 4EBFA 2NSDA 5L95A 1XIVA 3ETDA 4U7WA 3S2GA 4CM4A 1DIAA 4RCVA 4HFMA 2I6TA 2Q4BA 1GYPA 3KYCA 3UICA 1I2BA 3AWDA 3DBHB 3VKVA 4RVFA 4B7UA 4MOWA 4KZPA 3VPSA 1P31A 4BO3A 4IJWA 4NDNE 3TFQA 4CM1A 1E92A 3ADPA 4Q3NA 2G0TA 2UDPA 4DREA 2GRAA 5ILOA 2HSDA 2PLAA 3GEMA 3WBBA 1NPDA 3WSVA 2VYVD 1YXMA 5A02A 4YVFA 1N2SA 2H9IA 4LVCA 3KSUA 5TLSA 3ZHBA 4AJHA 4BGVA 3HJAA 2Q49A 3AM3A 1NTOA 4PN3A 3NEPX 4IDGA 1FXSA 3DQPA 3BTSA 4YXFA 1EK5A 2GSDA 3RASA 3GVCA 1R4MA 2VYNA 3WGYA 4E2YA 4Q3AA 3QVOA 1R0KA 4P8RA 4D7AA 5L45A 2P91A 3W4IA 4XQGA 1TLTA 1JW9B 3JD0A 3HWRA 2B5VA 2O2SA 1WP4A 2I3GA 1DDOA 2VOEA 3ZWWA 1OC2A 1RYEA 3RROA 3NGLA 2GN6A 3FD8A 2GUGA 4FW8A 3B1JA 3I9MA 1BVUA 1EFKA 2EIHA 4Q9NA 3RAJA 4BOYA 3DHEA 1QYDA 3EZYA 3BMQB 3DHYA 4MDHA 2EERA 2VRBA 3HQ4O 3A4VA 4JIGA 4ITUA 5KJFA 1I3NA 3PDJA 3RUHA 4CODB 4UVHA 2NVUB 2ILTA 1X0VA 1YGYA 4NI5A 4W82A 1Z73A 3AUSA 1H9BA 3RC7A 3ROPA 1GCUA 3TZQA 2B36A 1YQXA 2QRKA 3NT4A 3R0IA 3RKRA 4XA8A 4Z9XA 3MOIA 3UUWA 1G1AA 3MOGA 2Y67A 3B70A 5I7EA 5B37A 3RD5A 4L4XA 2P9CA 2GR9A 5TGDA 4CMEA 3RC2A 1OAAA 4J2OA 3WGGA 3HDYA 3GPDG 2GZ1A 1HDRA 1IB6A 4Y98A 1T26A 5L40A 3TPCA 3F5SA 4W99A 2VWQA 3GGPA 4PVDA 1E3IA 4WLUA 2HRBA 5IG2A 1X7GA 4L9RA 1PL6A 1H6BA 3O38A 3JQGB 3CUKA 4B4UA 3IIEA 3ZNNA 3DB2A 3FPCA 2X8LA 3WGHA 1UXHA 3JQCA 1P1FA 4GX2A 3GN1A 3WOHA 2Q46A 5EERA 1ZMTA 1K6IA 3DOJA 4HKTA 4FGWA 1XGKA 4Z6KA 1PL7A 3BMOA 5L4SA 1YO6A 3QLJA 4TKLA 3GZNB 2VZ8A 4IDDA 1D4FA 3GHYA 1WW8A 2BFAA 3AOEA 3S2IA 1NVGA 4FOSA 3AI3A 1BHSA 3CTMA 1NQ5A 4RGBA 3ROMA 1IPFA 1PJ2A 5ITVA 4FDAA 2BRUA 5IDYA 3NTOA 2P9EA 4RDIA 3WBFA 5BSGA 1KVQA 4JP2A 5L53A 2UUOA 3PK0A 3GMSA 4Z0PA 4XWYA 3KOUA 3U4HA 1BXGB 2O3SA 1B15A 4W9NC 1YBMA 4FGSA 2ZYGA 3BAZA 4D41A 4D3SA 4PLHA 2F00A 4GKBA 3DL2A 5DDIP 5LCXA 4DIBA 5HBRA 1PGJA 2PWZA 4PLPA 1WDLA 2VZ9A 5KVCA 1PJ4A 5DBFA 1ZKMA 4DC0A 5CEFA 2NQTA 1HL3A 3B6ZA 5EMHA 4MP3A 4RPKA 3DOOA 3RU7A 4B4VA 1ADBA 1YQDA 2HJRA 1PR3A 1MG5A 4UVDA 5GY7A 3IJPA 4I5GA 3KBOA 5MDHA 3HZZA 2B4QA 3BXXA 5DN9A 3IP3A 2FN7A 4E6PA 9LDTA 3F4LA 3A9WA 4PG7A 4R01A 4HFJA 2GYYA 2B4TO 1AHHA 3CMMA 3KYBA 3ZWCA 4BKQA 5THKA 3N74A 3EDMA 3FNFA 1P0CA 4IDCA 4OHUA 1LQUA 3W8FA 3SLKA 3I9OA 1N9GB 1XCBA 2G76A 3OBBA 1A27A 3E9QA 3KUXA 1X0XA 3L4BC 5ER6A 4WJZA 5KJCA 3WWYA 4M55A 2HO5A 4RORA 3GGOA 1VSUA 5TJ9A 2ZIZA 3UXYA 4BNVA 3JQBC 2VT2A 5CEJA 4FFOA 2R00C 4J43A 5T67A 4R41A 1DC6A 4JLWA 3P5SA 4TVOA 3BZUA 3GT0A 1LXCA 3L9WA 2DBVO 4MKXA 2VHYA 1XELA 4L4RA 4W7IA 1WMBA 5J23A 3KRTA 4Q3CA 2JAHA 4YWJA 3DC2A 3GC6A 2YQ4A 4IQ0A 3GK3A 2C7VA 2BI8A 2Y99A 3WYBA 4A0SA 1GUZA 1PWZA 4MVJF 3MCVA 4MVJD 1V3TA 4BVAA 1ZK4A 4L73A 1SOVA 1PZGA 1PQWA 3MWEB 3IOYA 1XWFA 4CUKA 4UUMA 1E7MA 1K5HA 3BHMA 5GZ1A 4GH5A 3DZBA 4E2XA 2EG9A 3UVEA 3OICA 3IP1A 4RLHA 1WXDA 1U9JA 2AEJA 4MP6A 4BNYA 1V3UA 2UAGA 1LDNA 3D4OA 2J5QA 2VWGA 4DC1A 3ABIA 4CUZA 3L6DA 3TZCA 5JDCC 4CMJA 3KEOA 4BNFA 3BMCA 3LQFA 1LJ8A 1YJQA 4JCOA 1PQPA 3SC4A 1BTOA 3H5AA 3OJFA 2PZKA 2VHZA 1RJWA 3HHPA 4E31A 3KV3O 1JVBA 2YHIA 4LW8A 1AE1A 5IDWA 4P38A 4R4JA 4GBJA 3ZWBA 1ENOA 4BO4A
chains in the Genus database with same CATH superfamily
4AW9A 4IV8A 3PD1A 2P2CA 1F8UA 1Y3HA 4BQSA 4MW6A 4UD6A 1E4OA 3GRAA 2GT1A 4DQDA 4BVGA 1DIGA 1KI2A 4NOJA 4E88A 5JNUA 3PQ2A 1L5RA 2WZCA 4GI2A 3RSOA 3SICE 3LCUA 1UPTA 4IDEA 1ZU5A 2J5KA 3PJEA 4W7SA 3NHLA 1BDJA 3E9RA 3DAFA 2B0JA 2ZYRA 4ND7A 2BLNA 1II8A 1DEXA 3QE0A 4JD5A 4A2QA 5HM6A 4P32A 4UHKA 2JHPA 2Y66A 2C96A 1CJSA 4E0BA 2C9BA 4HGQA 2ISSD 3D4LA 1ETUA 1XO1A 3DW3X 4FONA 4H4EA 2HEGA 1VJGA 5FWDA 1YA4A 2ECPA 1P0FA 2N9UA 3IQIX 1AKYA 1PK8A 3GG9A 1YR1A 3LFUA 2ZTVA 1E69A 3RRYA 2E4UA 1XHFA 2RJNA 4RW0A 1W8DA 4JODA 1U02A 3FTCA 1AXGA 4H17A 1IYZA 5ANRB 5EWLA 5DM60 2H4HA 2A9FA 3OE1A 4RMJA 1Y6JA 4RWZA 5DXAA 1DCKA 3TOZA 3THSA 4H60A 4X90A 3Q9UA 3B7WA 3GJ0A 2PD6A 3L41A 4RK6A 4EARA 1M0EA 4C2TA 4PAOA 4B85A 1M7HA 2E4YA 2B30A 3PLNA 4QNMA 3LCCA 2B8TA 3QOFA 3C6QA 3NFYA 1UJNA 2OHVA 3TMYA 4MVJM 4RKYA 4F6CA 3GJZA 5EJ4A 4MUAA 2G4VA 1TTPB 3GAZA 3CLRD 1E9BA 4UMDA 1OYYA 3WWDA 1PR1A 3J7TA 4UFPA 1WUHS 2PWPA 3BXFA 4JBLA 3DMRA 3IURA 1FUIA 3CC8A 3JD1A 1A7JA 3OECA 4NZOA 2BV3A 4QATA 5JZBA 1ZVJA 3LVFO 5KVVA 3ZVMA 5KYTA 2C1EA 4KN8A 2XYHA 4C0HA 3UJ7A 1HA3A 2UVPB 3DWFA 2D13A 3MAGA 4OQYA 1E61A 1Z0ZA 5CLHA 2A84A 1I4LD 4X54A 1U5BA 3GOQA 2OVFA 5IFKA 1NBOA 5AKJA 2KHZA 3A1NA 3UH1A 3AFHA 3X1DA 1ZI6A 2Z1MA 2JFQA 5J2TB 5L7WA 1L7AA 2HT6A 1L5NA 3FHTA 5CLFA 3HXTA 3NWEA 4IDAA 2C59A 4JQCA 1KHHA 2HLNA 3H05A 1PSZA 1P1IA 2QI9F 5JAHA 4DKJA 2ZXFA 1UAGA 5I48A 3I6BA 5H7XA 2DJIA 2J3EA 1EP3B 3ZWKA 4XD7D 1G0NA 3RVMA 4P7BA 3ORHA 2VCHA 3N2EA 3N28A 2WHXA 1XQ6A 5IP5A 4N47A 4MAMA 5BSTA 3B2NA 1MX9A 1WCXA 2BM0A 2CF5A 4L0QA 2VSNA 2NPIA 4JJ4A 3THXA 4DZZA 2GRUA 4RIHA 1QKIA 4MARA 2YVQA 1L4BA 5A5DA 3MRSA 5C8VA 1OLSB 3UGTA 4ZK2A 3ONDA 4IIUA 4M0KA 3PC3A 1P39A 4OK5A 5P8WA 4GL4A 1SCDA 2PPLA 1L1RA 4EI9A 3V8BA 4GRDA 2CB0A 1J42A 4TVKA 1H4VB 5J5CA 3NLLA 4J3FA 1L4NA 2GD2A 1BHQ1 4ZO9A 3EA4A 5CM8B 2OYRA 4BBPA 4ZDWA 3TD9A 1G5HA 2B8JA 3TGWA 4C5BA 1GT91 1XB2A 4JVNA 1A69A 3QWAA 4I1RA 5LYJF 4QRDA 3L1UA 5AYVA 5A6VA 3U6BA 2GXUA 3DEZA 3WK6A 4FNMA 1ZAKA 1A8QA 2QLJA 4NEQA 1DWUA 2H65A 2O50A 1XEFA 3E61A 4NJEB 5FWYB 5T5QA 3W7BA 3COJA 2QS9A 4YCMA 5KC9A 4JFRA 4K6FA 4U1RA 5TMPA 2YJGA 4QYIB 4Z9YA 2ZCVA 5L4LA 3VV3A 1JEQB 3C39A 5C8ZA 1E2DA 1JEDA 2A7QA 3L06A 3BHNA 2IHKA 3FXAA 5BNTA 3KK0A 1QANA 2DC1A 2F1HA 4XFDA 2J9RA 1BU8A 5E95A 3T5BA 4MYCA 4GR4A 2X86A 2YWDA 3SY8A 4DVJA 2HA4A 3SJBA 2YYYA 3X2FA 2A5LA 3C7AA 3SGLA 1ACMA 4DTIA 4LX8A 2YRFA 1F4PA 1QG6A 2EL9A 2W42A 4Z7JA 3A1EA 1FK8A 4FEAA 5LQNA 3OFSA 4PINA 2O5EA 4LRSB 5B4UA 1WOMA 2R8RA 1U81A 3B5IA 4ZN6A 1M0TA 1HDCA 1CDDA 2QQFA 4K05A 4NKRA 1MX1A 1MENA 4R9RA 3ICEA 3K1AB 4P98A 3K2EA 1HR0B 1J5XA 2G9QA 2ZTUA 2WW8A 3HDTA 1ADYA 5ALUA 5FIUA 3TMKA 5CXSA 4ZGGA 4WKNA 1V7ZA 4YPFA 4ZMSA 1QF9A 3KQOA 4RPLA 4UFOA 3GLIE 5TNXA 1G17A 2N75A 3FSRA 4WHMA 3SQMA 1PHRA 1QYCA 3CONA 2FPRA 4BE9A 3H6KA 1E0DA 3N76A 3B2EA 2YVUA 3A3YA 4YACA 4IBOA 8ABPA 2GK6A 3CRW1 4KXYA 4R5HA 4F3YA 3HY3A 4OSOA 3RSFA 2RGAA 3ZWDA 2YXBA 3E1SA 1UZLA 3T7IA 3K1TA 1TECE 4JSTA 4OQPA 4I55A 5AVKA 1QU3A 4HDKA 4YUAA 1KYIA 3KR9A 2PDAA 3G8CA 2FW7A 5CFZA 9GPBA 5K5EA 3S81A 4Y2HA 5GVRA 4TRMA 2NU6B 1HRKA 2GDZA 3PYXA 1A9SA 2R751 4UUAA 4MV3A 3JVUA 5A0VA 1C0LA 1OQAA 2G8LA 3IHKA 3LOUA 1WSBA 1KSFX 3OAAD 1HE2A 1D7AA 2IHTA 4PPQA 4RPJA 4OMFG 5F73A 4YCBA 1TKBA 1W88B 2FLWA 2XVYA 4GGPA 4AAYA 4F4DA 5K4HA 3ILYA 2NUAA 1MFPA 2QUIA 2VAWA 3E81A 4H1VA 2FEPA 4PG6A 4N54A 4R7TA 2NTYC 4X1YB 2C82A 4NMLA 5B7QA 4MCIA 2NWQA 4L07A 4EUFA 4DBLE 3KOZA 5MF6A 3R7AA 3Q72A 4OB6A 521PA 2WQ6A 2ZSJA 4UAJA 1EUDB 4NPAA 2VK2A 1JQ5A 4CMEC 3Q1LA 3WNDA 1R50A 1YZLA 1A4UA 3NFRA 3H2ZA 4BIIA 1Z4KA 4QFCA 2ZJAA 3FDZB 5CVUA 3NDIA 4AMUA 2HBZA 4DR7B 3EZ2A 3SVTA 4HJRA 4MSUA 4IDNA 2QQ5A 5GOZA 4TMKA 3NNNA 2D74A 3W90A 1F7VA 2X9NA 2PY6A 4S2UA 3UCXA 5A3VA 3RYHA 3UEOA 3FKSA 3HMQA 2EFDB 1C30B 1VB5A 4L08A 5TB5A 2NPOA 3WK8A 2Z6UA 2NVUA 3T3OA 1QM5A 1DZIA 1ODCA 1XFDA 3PR1A 3R3JA 4R2XA 2NU9B 4F2HA 5KBYA 3A10A 1UADA 3ESAA 4ZO8A 3NKFA 5ALZA 2HNBA 4AWXA 2CHGA 3H83A 4TTRA 1PX2A 3M4NA 3HVRA 3NM5A 1PJLA 1W46A 2DX7A 4N7JA 2ZR9A 3WAGA 1RC1A 4P7FA 5ADVA 3CEAA 3W3AH 1WXXA 2V54A 4UNRA 3K6KA 4FW9A 3KTAA 4U7PB 1R6UA 2PNJA 2ZKIA 3KVNA 3M33A 1SOMA 4MYHA 1YZHA 3MS2A 2OLEA 2QN2A 1QAMA 5TDHA 4CG0A 4QUEA 3B7GA 5KVQA 2KI5A 1UKZA 3DMDA 3Q6MA 1SVMA 3G5TA 2EW1A 4O1IA 1MCZA 4KO4S 1HT2E 4DJJA 2OSVA 4LSMA 1ZN7A 3DFMA 3EMBA 3OM8A 4A6PA 3EN0A 3FHLA 2FK8A 1ZD8A 3GBVA 4RH0A 5H1YA 4D1YA 3NW9A 5BO5A 2GS9A 1EXMA 3FBTA 4DQLA 3KQQA 2ZM5A 3DVLA 1J5EB 2VYND 2AX4A 2P67A 2WIFA 3FTDA 3JQGA 4CLXA 2HSGA 4UQOA 5DMXA 1HBJA 4LF6B 2XCOA 5C0OE 3B9BA 3H3XA 4ND5A 1NUUA 3S1AB 4ZVMA 4XASA 4PCUA 1J2JA 2IYVA 3VV2A 4ZEMA 4MDEA 4YIHA 3P45A 1KNXA 3X1KA 2QV0A 4GPIB 1SGWA 4HQNA 2BZ1A 1FNNA 2E85A 4X6UA 3LIPA 5BQ3A 4EAAA 1OH7A 1YZKA 2R1VA 3H0CA 4IGIA 1WMDA 3GZNA 4KIGA 5FULA 5JOQA 1JHYA 4Q4HA 3ZXXA 1UBOS 1NPYA 3G23A 1CWUA 5FTMA 4AQYB 3DEFA 1N6RA 1J99A 1L5ZA 1PJ8A 3ROZA 4DCCA 3WWZA 1Y8ZA 2YIJA 1JP7A 3NHAA 1LSUA 1RBZA 3H3FA 4URHA 5JCJA 2D2XA 1GN8A 2QDKA 2GNAA 4GVPA 1D3AA 2PUJA 4M60A 3UKOA 4DA0A 1UWCA 2VJYA 4UPDA 4UOEA 2XDYA 2E1PA 4DT1A 5REQA 1A3CA 2UYQA 1H4TA 1EP1B 3MQ2A 4Q05A 1N4AA 4LYFA 3UT0A 4EY4A 2AKEA 1FDIA 1T3SA 1XC7A 5BOVA 4FDUA 3VOAA 1E2HA 1G9TA 2IIPA 2YV2A 1I4WA 1E7QA 1SC9A 4D74A 2HBRA 1HWYA 2RHTA 3QPDA 3FFTA 4CQNA 4N5NA 4OHOA 5T4EA 3KEGA 3LZDA 3QTBA 3RNOA 3TOXA 5EJGA 3STUA 3R6LA 2Y9PB 4MS1A 3EASA 3U4QA 1PJQA 2JAPA 4TS9A 1J22A 3CH6A 3DV9A 4KFUA 3A06A 3HKEB 3B1XA 3HU3A 1KS9A 4RE6A 2VDVE 4GE3A 4NL4H 5FPYA 4NHOA 3BKXA 2QXYA 4UULA 3UW1A 2QTHA 3EPKA 5CVEA 3AB3A 4ZREA 4Z0HO 5CXUA 4YDRA 4CV2A 1QNLA 5C8XA 1GY8A 4RFSA 1ECJA 1C41A 2A9PA 2HDOA 5AW3A 4R9UC 4YMGA 2Q8QA 1XK6A 2PFGA 2ODTX 1JS1X 3SX4A 2JW5A 2XE6A 3U56A 4K8RB 3OZBA 3NR2A 3GLGE 4OIFA 3JCZA 2Y1CA 4NQZA 4I2VA 4G8BA 4LAFA 5DM70 3KCQA 3WAKA 1OGJA 4I5IA 4JQSA 4JJ6A 3VR0A 3B20A 5LR6A 2YINC 4ZT3A 5CRIA 1FEZA 4PFJA 3TB6A 4YNBA 2YNMA 1LDEA 1KETA 2OFWA 2PVPA 2VJDA 3V6MA 4BLRA 1RRKA 1AZLA 4DMLA 5ELXA 1NVVR 3HO6A 2ZJ0A 5CFNA 3JVIA 4QDXA 3RTDA 3ISJA 1Y3CE 3EZLA 4YJFB 5ENVA 4MR9A 2WY2D 3FBWA 3IPAA 2I65A 4RVHA 1SHTX 2AFIE 1JHXA 2C2XA 2EZ8A 2J46A 4JC0A 2IPNA 4KPUA 3TRIA 3BH0A 3W6UA 1BXRB 2HU7A 4DCVA 1XMIA 3SFVA 5IDQA 1XCLA 1RRCA 4CR6A 4XB1A 3BK7A 1LC0A 3ZH9B 1WX1A 5DNWA 2G9VA 2WJ4A 1WU7A 3A9VA 1NAIA 4GXQA 3V8NA 5B30A 5ADWA 1GR0A 5F52A 1UPCA 1V1MB 1C3XA 5HZHA 4Q47A 4BV8A 3EFOB 4I6GA 4ZQIA 4BFTA 2P27A 4CT0A 1L1FA 1KRWA 3F7NA 3O8NA 5DNVA 3FR7A 3IHTA 4YRGA 2Z5VA 4MR7A 4QU8A 3T94A 4U2DA 1CP3A 4DIOA 2CLLB 5AO9A 3I53A 5TPZD 2B1JA 2J6HA 3AIKA 3GEGA 4W6QA 5EVCA 4ZQFA 1RRFA 5DULA 5AMXA 3AM5A 2ONKA 1MU0A 3FDJA 3QXGA 1CJUC 1P4RA 3OZ7A 1S8OA 1TKRA 3V00A 1TAUA 1IJKA 3HDVA 1VMKA 2OXCA 1SQSA 1QIJA 3O47A 1J0AA 1NURA 2XUIA 5CHEA 6YASA 4JYAB 1W581 3V2HA 2IOHA 2O8BB 3SYNA 2Z6AA 1LI7A 4MB2A 4OUDB 1G7CA 2R6AA 4UFNA 1GAWA 1NN5A 1G20E 3NTXA 5ENDA 1JAXA 1TRKA 4L4ZA 4YGXB 4B48A 5JISA 2XTNA 5BSVA 4JJKA 3LHIA 2K2WA 1FLAA 2O6HA 1NUAA 3BWXA 3D6VA 5K9ZA 5L3QA 3FOEC 3K2BA 1G8PA 4FLMA 4LI0A 3T61A 3O90A 3UYKA 3SYMA 2C61A 1X8KA 3EOAI 1U4SA 3NT5A 6AT1A 1IQPA 4OXQA 3SIXA 5KJ1A 3PFGA 1QOPB 2C97A 5KDDA 3GDFA 3L84A 1YJAA 4M1QA 4BVLA 3AKCA 5KNDD 4EI2A 5C4IA 3I05A 5K0ZA 4UEWA 4G2NA 5IJXA 1X7XB 1EDZA 1TCCA 3GI1A 2FWPA 3IR7A 1CP2A 1GFZA 1ZM2A 2IZ7A 2BMEA 3Q98A 2BKUA 2BUAA 3GIWA 3HDHA 4GW3A 1IVYA 3S4YA 5DYTA 3RUDA 1WEKA 3OZEA 4B35A 3VNAA 5L3VA 1L8LA 2XUKA 5FFMA 2XDAA 2H7VA 3AZQA 3E03A 4KWTA 4Q7KA 1R4NB 3M5DA 1W1UA 2ATXA 4EDFA 5KKNB 3SHWA 2P4QA 2H17A 4DJ5X 3IEUA 5DI3B 4V24A 2J07A 4EYSA 5CA0A 3IT2A 5KYKA 3HR8A 4MA0A 1QH9A 3M9WA 4MW0A 4QOGA 3CNNA 1I7SB 5LDHA 3QOXA 1E6KA 3G9UA 4MWGA 2VPWA 1BJTA 3NUZA 1JDSA 4J3JA 3WGQA 5EIFA 1U0GA 3PPXA 1UC9A 3FPAA 3WYNA 1KJYA 3MD9A 2XUGA 5FNVB 4PYQA 7ABPA 3A1FA 2CLMB 3JD4A 2CHQA 4DYDA 4PZAA 4JT4A 4FS3A 3F96A 2CMFA 3I6QA 3LRPA 3N2KB 2ODWA 3P9IA 3G2PA 3QKRB 4PPYA 2E4WA 2FRDA 1EH5A 5GZ6A 3Q9SA 2WU3A 2MSEB 2NQ2C 4PHGA 4RBNA 1US8B 2O06A 2OBNA 4DPKA 1JIQA 2PL3A 2FQQA 2P3OA 4E4TA 1I30A 4B7ZA 3NHMA 1T4MA 3AESB 1R5OA 1WMSA 1T35A 3GFVA 2QRUA 1KKMA 1M7BA 1NVUQ 4JBNA 1SBIA 2HQSA 2PWBA 4MQLA 3WQBA 3VR6H 3C6ZA 4L5YA 4JUCA 1YI8A 4C3UA 1B2RA 5BWBA 5ESWA 1LPOA 4RK5A 4B3CA 5T6MA 2VS1A 5EMMA 3TR0A 4C29A 1ZRMA 3V7UA 2ZFUA 5EHQA 3WNCA 1ID1A 1AHNA 1YQEA 1NYRA 2NNLD 4KUEA 3ZHUA 4DRZA 4K5QA 3DLIA 2CBGA 3PWTA 3G2NA 4ICIA 4MGEA 3Q3EA 4F9EA 3CVXA 2JBHA 5BVGB 5D00A 1ZBDA 4GRIA 4KVZA 4R05A 5KYVA 3AFOA 1INLA 1QVZA 4O4LA 4XYBA 1N6KA 5KYUA 3VI3B 2VJBA 3WWCA 1CERA 4GMDA 5D51S 4ZK6A 3BQNB 4LS3A 3DE0X 2AD5A 2P30A 2Z98A 3R9IA 4EA6A 1B8OA 1ADJA 2WSSD 3U5TA 1L4KA 1R88A 3WFJA 5HKAA 4DV7B 2I6GA 1Z4PX 4G0MA 2Z56A 3MUOA 3U81A 3I9KA 4MPTA 1DCMA 2FPUA 5EINA 3GEPA 2PRKA 3D7NA 2QTNA 4M6WA 3LP8A 4YQZA 3PGXA 4QICA 2W2MA 4XSVA 1AB5A 5E2BA 3WZ2A 1P77A 4HGYA 3C14C 3U1VA 3ZTWA 5A9RA 3BB3A 2UYOA 4BMZA 1C9JA 1T6BY 3HGMA 1EFRA 2BGUA 1KOLA 2PMFA 4BAUA 1IG0A 1OXVA 3WQSB 3U5ZB 1E2MA 1UQUA 4CMIA 1EK6A 4H77A 4P93A 4Z4FA 1JDTA 2P9ZA 4K6KA 3HDJA 2DFKB 4NYIR 3VHRA 5JI3E 2Q5EA 2IH5A 4YFVA 1D1TA 1XHEA 1UPXA 3PNVA 2G82A 2FFHA 2ZYDA 1I7LA 1NOKA 2BR4A 2Q0XA 3N5CA 5FWXB 1DZ3A 2GA8A 4RQTA 1R5BA 2EWMA 1W1WA 1SZDA 1ZSNA 3A9CA 2CZCA 2B2CA 3ZLTA 3FYSA 2B25A 4RPGA 3R7SA 4EJSA 3TLZA 4C20A 1FJXA 2C3OA 3LHDA 4CCWA 2E0IA 3FFWA 2LRHA 4L75A 4Z7QB 4NBVA 1UJ4A 4CVNA 2XKKA 1TOAA 3I58A 4MIEA 4XM2A 1KSJA 2H4YA 3QVMA 3NNDA 3E18A 1Z7BA 1TAHA 3KZVA 4CF5A 2XCTB 4L3WA 4KQKA 1DVRA 1WW2A 3DZCA 3WMEA 3ZCSA 8ATCA 2IE8A 3A6GA 3M6MD 5AD1A 5LA6F 2O0MA 4W8OA 3H04A 4BX0A 4YRTA 4RTOA 3GMTA 1CRQA 1VBMA 3KU1A 2BGJA 3SF0A 2I4TA 1R9GA 3H9BA 5G0UA 1SUIA 2IEBA 5GJCA 4B3TB 3OQ6A 1P44A 2O54A 5D6OA 4CYMA 4WACA 5A2GA 4UNQA 1SZJG 2P41A 2PAFA 3OZRA 2BUBA 3R5FA 4HLUC 4MP8A 4BAZA 2CK3A 1H6AA 2F43B 4YJKA 2HF7A 1JPJA 4C05A 1KK2A 3JQ9A 3JQFC 2YDXA 5J4LA 3DUFB 1FDUA 1N2CE 5AM4A 2GZDA 4RJJA 5P21A 5LSAA 2X1MA 4O4IB 2FJ0A 5D87A 2R1TB 4R8LA 1GTRA 1EQ2A 3Q7IA 4KYTA 3E05A 2FPXA 2OD2A 1M2VB 3QE9Y 1MB4A 2CVPA 3GX1A 1ABFA 5EHZA 5KSPA 1I1HA 4IIJA 5A1TA 2QLFA 1V8PA 3UATA 4IY1A 5AVSA 3ZK8A 1DQZA 1U8EA 3AH8A 3EZXA 3A9UA 1XHLA 2GYUA 3L9XA 1A9ZA 2UYGA 4AQDA 1JSLA 3PPIA 4C4SA 3ZHYA 3EEBA 1O4WA 1VG9B 2M9MA 3OA0A 3GBPA 1E1NA 1W52X 3ONNA 5IJ0A 4IG9A 4ZWNA 2FMIA 2CMHA 5H9VA 4KSCA 4HV4A 5JH7F 2MIIA 4GG1A 1MRSA 1QZZA 1JU3A 1O5IA 2HIHA 5JQWA 3EE6A 5IAJA 4EUHA 1KIFA 3BWBA 3BTUA 3ZU3A 3LUBA 3Q6IA 1P74A 1U8FO 1OU0A 1FJGB 4UTNA 3OEED 3TRKA 3W06A 1X3LA 3N5KA 1HTTA 2R97A 3TQTA 2VHVA 4KQIA 1FX0A 4OKNA 3HBAA 3LM8A 5IK2D 3AERA 3N8KA 1GQYA 5JSZB 1OD6A 1YMVA 5IHXA 4PONA 1SXJA 2ZWPA 2B98A 4C7VA 4QODA 4Q6BA 1U3DA 2Z1DA 3BIFA 3ZJTA 4ZV4A 3FOCA 1QC5A 3LF1A 4BECA 3TQSA 3G17A 1JA0A 5E9AA 3RU3A 4HWSA 3PQ5A 3MGGA 2B94A 5FUXA 3TLBA 3QJ5A 4BGIA 3DMFA 4I66A 2VKTA 3VPBA 2EKLA 3FOZA 3V7FA 4KTTE 1WCV1 4UXHA 2RI0A 2P9TA 2IYPA 4Y6LA 4E22A 1MJFA 5CK5A 2GO7A 3EZNA 3CY6A 1T1GA 4LZLA 2NIPA 2PTHA 2YYSA 1EGAA 4N40A 4XX0B 3OPXA 5DI9A 4BZWA 4V1CB 3ANMA 1OXSC 1EG2A 3EZFA 1C1XA 4G1CA 1H0KA 3DNFA 5JMWA 5E4TA 2ZBEA 1RR6A 3MJFA 4FE7A 4P7GA 4HRVA 4QLOA 1ONOA 4GAEA 3OURA 2XUFA 1ZCBA 5F2EA 5EJEA 3ZH2A 4NNPA 3W1VA 4H2DA 2VRCD 1V16A 1VKHA 1Z5NA 2EDAA 3GRKA 3KALA 2OM2A 4I5DA 4NBWA 4KPEC 2RH5A 2FOLA 4PQFA 5EE5B 2K7FA 2PUWA 1VIAA 2EW8A 2FPOA 4JUIA 4RZHA 4BMCA 1YB2A 1DLIA 3Q87B 1VP3A 4XTRA 1OFVA 3I9V1 1W0CA 3FRJA 5HCIA 4RX1A 2Q7DA 4DS3A 5JRZA 4F4FA 4IVPA 1WP9A 1EZZA 2W98A 4MAFA 4Q3LA 4RANA 4XCQA 1OXXK 2O52A 3O2NA 4PX2A 3VGPA 4ARSA 5B57C 3IBFA 5LQDA 4Y2UA 4Q3KA 5CAEA 5KNBD 4XUGB 5LBTA 4RTQA 2PGNA 3OE7D 1DHTA 4ZPJA 2AHRA 3L82B 5T8KC 1Y7HA 5IN5A 1HZZC 1T5IA 3KFVA 4V38A 1N2BA 4D26A 4UU8A 3OOHA 3QX9A 4ACBA 2XZLA 1MA0A 3O94A 3MFQA 4BEJA 5AVTA 2PGIA 4QJ4A 2AMVA 2QRJA 1MKYA 4PNZA 4XEHA 2FFQA 4BLQA 3ME5A 5BW5A 2O0LA 1F6WA 3D6JA 4IIFA 4PYMA 4R8MA 3MVEA 2ZI9A 1QLWA 4YGYA 3N59A 5G3ZA 4KOAA 4HG2A 3SXUB 3IP9A 1U2PA 3AL2A 1TQ8A 1XCPA 3I9V6 4P7KA 2ZATA 3HB9A 3VAZA 4ESHA 2AFVA 5BW4A 1KYXA 2IS2A 3CNOA 5CH8A 4WLEA 1Z82A 4CEJA 3TAUA 4AL4A 5IAAA 3JYHA 2BGIA 3TCNA 2V0NA 5TX7A 2FZLA 3M7IA 1W35A 2D0OB 2X23A 1LPMA 1A77A 3ZKWB 3GGCA 2QTZA 2O3JA 4EG7A 4GPD1 3X1WA 1K3TA 3HR7A 1N4DA 4B33A 3TD6A 2VUSA 3V32A 5BV0A 5ICMA 1ONNA 2PJZA 2C94A 2R8YA 1KFCB 3MWGA 4EF6A 3X0DA 1SB8A 5B1YA 2VTDA 3AINA 5J4HA 4HWRA 2QEQA 1NF8A 1CUCA 1CQZA 2VLIA 4ZHQB 3GVXA 2XHZA 1FFHA 2YIVX 1TZMA 3N2GA 2EIXA 1YR7A 3CRZA 3PDWA 4ITRC 3FA2A 1FU7A 4N0MA 2W2TA 4JC5A 1E3WB 4BKOA 1SCKA 3COVA 3K73O 1XNHA 3B53X 4UUQA 4MKIA 3GLFB 3LT2A 2V7UA 3AM4A 2OLJA 2FWNA 3PEUA 3TBFA 1TO6A 2XVXA 2BBSA 1C3LA 1XSEA 2Z5LA 5SICE 4BJ3A 3MWDA 1OBHA 4RJIA 5KC8A 4WESB 3G68A 1JL3A 3VMMA 4QG7A 3T5TA 3C6BA 3L46A 5LXTA 3BE4A 3EQ7A 3EOBI 1B14A 2VA8A 4GXTA 1CF2O 4TVSA 1DXOA 2XD4A 3T3MB 4WCFA 1GYQA 2AC4A 3IKTA 3EGCA 3H1FA 3WTCA 5JD5A 1TQHA 2VL7A 3U26A 2BMJA 1PAUA 3MHPA 3MB5A 3NDPA 3EIHA 5LM3A 2GAOA 5LB4A 5JW6A 2OHIA 1A5AB 3RKSA 2RGCA 1U0RA 2CVHA 3SWWA 2AF4C 3B1YA 1BJRE 4M0PA 3WL4A 1RDFA 2G5TA 4I0WB 3MUEA 1ZZEA 3OU6A 3G0OA 2RMKA 1H8HD 2EVWX 2ZRCA 1R0ZA 4A6XA 4C08A 2C92A 1D6JA 1H2YA 1QDEA 1R64A 1ZEJA 2H2HA 5G0SA 2JLYA 2Z8YA 3HUTA 4EMUA 3HCRA 1NKVA 1T13A 1DWPA 1N3IA 3QRWA 5AJXA 1UDRA 1L7BA 1GTL1 2V74B 1UC5B 4TPKA 1ADFA 4K2AA 1EVIA 1NU8A 2R6FA 3QSGA 1CU1A 3WWEA 3X1JA 3OWXA 5B4TA 5TVKA 1LI4A 2XE8A 1QCYA 3KWMA 3DNMA 4RVUA 3ZXSA 2H4XA 4EUSA 2ENWA 3FIUA 3IVMA 1H3NA 4NBTA 2NU8A 1GM5A 1FFDA 4KODA 3JARB 4M0UA 4CMBA 1RAFA 1A8UA 4NZNA 2RI1A 3BQ9A 1EFDN 3GLHB 2HF2A 5JR3A 1QIKA 2PX6A 1VE1A 2UYYA 4B80A 3LP6A 4Z1OA 4FK8A 1N0IA 3EVCA 3KSDO 1RHJA 4P5DA 4Y2JA 1KEEA 2X0RA 1S01A 3L18A 2XRFA 2PYZA 2DCMA 5ELMA 2IS4A 1HNNA 2PK3A 3HNPA 3MMZA 5K8VA 1Z4LA 2A9VA 1CUUA 1Y1PA 2OOSA 3L7OA 4IICA 5E1DA 3LH5A 4MINA 3T3GA 5LOVF 1I6LA 3PITA 1N36B 4OGWA 2ZYAA 4IJKA 3AR9A 3DCIA 3ASUA 4BWFB 4ABYA 2XADA 1YD7A 5BUQA 5L9AA 2JFFA 4WFIA 1FRZA 4JL6A 4KXMA 1H2BA 3CRVA 4R2WA 2P68A 3UUEA 4TMYA 3DTVA 1TVKB 2Q4TA 5G4KB 3OTHA 1G9XA 1SJ9A 3D0OA 2AEMA 5KDOA 1QIIA 3B38A 1EA5A 1CIVA 2RJOA 4K86A 4RIFA 5DJ5A 1FJ2A 4AYWA 2FA9A 4HF7A 4JLMA 4BWVA 4QM6A 4EA7A 3R8FA 3TEFA 1XNQB 5CDYA 5CPBA 3TZHA 1E9AA 4C88A 1ZY2A 2PGJA 4GOXA 1FSSA 2HHCA 2OCBA 2R6JA 4NCHA 4TSFD 3UXHA 3ZD7A 2WF8A 1L9KA 1BHO1 1VLHA 2PKQP 3BRQA 5EQFA 1A9OA 5FQNA 2FWMX 4H6WA 5FUVA 1IY9A 4YT2A 4FOOA 1I4EB 1G4UR 2GZ3A 1G8YA 3RHFA 2ZAOA 4LJ9A 4TTJA 4HEA1 3AFIA 2P40A 2EYQA 2C31A 2ESRA 2QX4A 4B2YA 1TA9A 3JU3A 5G53C 3R44A 1N6NA 4OB7A 1GGKA 2VP4A 3R3VA 3KX2A 5F64A 1AN9A 1JXMA 1PJSA 5T4BA 5CDUA 2A2ZA 4LOLA 1HPLA 1YUNA 3BORA 1JJBA 1H22A 2QPLA 3EQ6A 1NG1A 3H19A 1CT9A 1DI0A 4PG8A 4XR4A 1QTNA 3F3SA 2GD0A 4BO5A 3IQFA 4IX1A 4E09A 3WBKA 1BFUA 5FBZA 5IXYA 3L6OO 3OZWA 2I2CA 2Q6VA 3E9NA 3FMFA 1Y9ZA 3KR1A 5DISB 5B3KA 3BN3A 3DONA 1HDEA 4KXVA 2NUPB 3V8PA 5BMVF 4JU8A 4CF4A 2Y92A 1WUKS 2QX7A 1KZGB 3QENA 5J5VA 1BYUA 1QFXA 2VHEA 5A5VA 1E2BA 3GT4A 3OZGA 2Q21A 2B61A 2QTLA 1XD2B 3MGAA 4I4NA 3DMTA 3V9AA 3D6FA 2HK7A 3F7MA 1YB6A 3OM9A 3ONWA 4F96A 3GUUA 4IJMA 5AKLA 5ALQA 5B7NA 4EJ0A 4LDJA 4OXNA 5K4AA 3FCOA 5INTA 2DKOA 1TJ4A 4KJZA 5GGYA 4HGZA 1JKMA 2FPGB 1DT5A 2Q5JA 1F60A 3E58A 4GXRA 4TYPA 1HORA 1U9CA 4RHYA 1YF3A 3N39C 3ETHA 3AJRA 4B0OA 1QWSA 1WULS 4FBLA 4TV8F 3PFBA 2HT1A 2FPWA 3MBKA 2F90A 1ECLA 2GCEA 4XLZA 2RH8A 5D8DA 1BEUB 2C07A 3DAHA 3LSYA 3K9LA 1TQDA 2C7QA 4C76A 3RPEA 4O6VA 1AF4A 1FRVA 2I8AA 1VMDA 4KXQA 4MZDA 3HB7A 1F8GA 2VZ0A 5JCZA 4IIDA 5HJ5A 3UWMA 2HBYA 1PQYA 2E7ZA 1JG4A 3IESA 3EXIA 4P6VF 1Y5NA 3JQDA 3PLAE 2CHEA 3CRQA 1IH8A 4MCHA 2DT8A 1ZGAA 2X8JA 4J1SA 1PV2A 5FBKA 4Y1RB 4UM8B 1TUGA 4WD3A 4LHWA 3VVMA 3F73A 1O0CA 4GOND 2O20A 4QYMA 3VU1A 4QNRA 2HQOA 1C1DB 3CCCA 1KO8A 4ZI7A 2IBMA 3PDIB 2ZVJA 5E4YA 3S8EA 5LPNA 4L8FA 1DXHA 5C4GB 3VPHA 1EX1A 1P0MA 3JYNA 1F38A 1RZVA 3DPIA 5D85A 2HU2A 3MSCA 3B1FA 5EYPA 4DA4A 4JGGA 4HP8A 2YICA 4X8OA 3DT8A 2CNBA 4IZOA 4GZ5A 1J00A 2VBFA 1L4EA 4OAPA 2JEZA 3HHEA 3NCHA 5IARA 3T1QA 3TXYA 1ZIYA 2Y0DA 2WK1A 2XE4A 3GCGA 4LZJA 5J43A 1DFGA 3JWIA 1TL7C 4GQIA 4Z99A 3LXUX 4G5HA 2SBTA 3RO7A 4FGJA 3UHJA 3RYCB 1P6XA 3NAGA 3O8OA 1SUAA 3RT9A 2QV7A 4WXMA 3U0VA 1XAHA 4I9HA 5DF1A 3RYIA 1NLMA 4GICA 4HO1X 3ZBQA 4RHXA 4GKKB 1KORA 3IV9A 5CYFA 2VK8A 2ODPA 1UCFA 4YR9A 3C7DB 1C29B 2E4VA 4PANA 3GH1A 2PG3A 2XCLA 3GGGA 3Q10A 3RBZA 3RUAA 3I2KA 5COAA 2C1ZA 4HDSA 3IP5A 4WXPA 3FCSB 5CW1A 5ETJA 3T5GA 4M0LA 5E1BA 4L57A 4COKA 1MA3A 4QWMA 1T2VA 5I01A 4X1OA 8ADHA 3D8HA 3NHUA 4QECA 2OA0A 1V8ZA 2R47A 3H3JA 1LSOA 2JZNA 3VPFA 3LUJA 3MW8A 1AQLA 2RONA 4G4SO 2GBGA 5IZ4A 1J1ZA 1UJCA 1ZH8A 1QTIA 5CFPA 4MWBA 2WFLB 1MOZA 2QX8A 2OV1A 4QTZA 1UL1X 2NADA 3H8JA 4FCTA 4FJ0A 5JXWA 1U7PA 5I7OA 1FTYA 2R7AA 2HSZA 1JKIA 1ZH6A 4PIPA 5TEWA 1B42A 3PIDA 5JANA 4C5AA 1CJMA 4RVGA 1DKMA 4GP6A 1TT5B 5DIZA 4DCMA 3QY9A 4JLAA 4L2IB 1II0A 2HWXA 3R3WA 2E87A 2ONJA 1V11A 1FFSA 3B36A 2WFMA 1THZA 2BDUA 3QFFA 4IQGA 4I8DA 4NFHA 1QHIA 5FPPA 1P2SA 2FDRA 2HPZA 4GFDA 4O2AF 3IPLA 1BH2A 2WWWA 4O8ZA 1J70A 1Z8NA 2GNOA 4EO9A 3TECE 5SZKB 1BYIA 3ACDA 2W2XA 3BCRA 1KR5A 4KQFA 1RPAA 2O7QA 4M7PA 4P3KA 3ZX4A 3V33A 5HWSA 2NAPA 5F78A 1DTEA 1HDIA 4BAGA 1EM8A 1V6CA 1SXIA 4FE4A 2JCGA 3O1LA 1S02A 3ICQB 4INZA 1XVVA 1S96A 2FWJA 3EISA 4B6FA 1G38A 5T3YA 1TJ3A 3B1ZA 1PIWA 4LF7B 4G23A 4DSZA 1E7YA 4NE9A 4H7FA 5SZIA 3ZI0A 4NOMA 3LUPA 1NVEA 2O7RA 4PC7A 2AG6A 3UOGA 1T2FA 4QJIA 4DA7A 1IZ0A 4PHCA 4YQEA 4M22A 4N82A 1LTQA 1M75A 2XNCA 4AP5A 4RDXA 2X77A 2ORIA 2Q28A 2FE1A 2J0UB 3A4TA 1NR1A 4UHHA 2FPMA 2YZNA 4LGVA 3AF1A 5BMVA 1VKJA 1UP6A 3FCXA 1ZEMA 1Q0HA 2B9EA 3EXFA 3IR6A 4ZPXA 1P2TA 2YZMA 4LBWA 3OJCA 4D44A 3FSEA 4EW3A 5CB6A 1R10A 1LGYA 1U2RA 1YRBA 4MV4A 5HIKA 1Q7BA 2I3BA 2W6JD 2JEOA 4G63A 4MUHA 3T5MA 4JP8A 1L6RA 2JK0A 2R8EA 3KPWA 3NBUA 5HSGA 2JLWA 2IW3A 2V1XA 1CHNA 4RGQA 1N33B 1TVCA 4E51A 4JLNA 2JC3A 2OORC 5CT5A 4R1PA 5H02A 3IO5A 1DQPA 3V4RA 3IERA 2R1VB 3K9NA 1DIOB 5KTNA 2PGXA 3GL9A 4RXUA 1I5RA 4JSYA 3RVDA 2X4LA 4KE6A 3X2SA 5HYVA 2OV6A 3BGVA 5E7JA 2C1XA 3EFHA 1V2HE 3BJMA 3DHNA 5HK9A 2AEEA 3NWOA 4F5YA 2VYQA 4TZ6A 2D0PB 1SU7A 1HNWB 2GBIA 4OJNA 2A0WA 4YHHB 2CEAA 2D8MA 3F1KA 1LD3A 4ZA2A 1GARA 2XIQA 3VKUA 4DT1B 3CPJB 4JENA 1JLRA 1U0NA 4R68A 2ZIGA 3CUVA 4CM8A 4F97A 4HVCA 3JRXA 4B6EA 1V37A 2PMBA 1QVVA 1QUEA 3T3EA 4E7OA 4OD0A 3GJ8A 1BDHA 1XZPA 5KQSA 2EFEB 1CKEA 4W7HA 2XXAB 4QHYA 2ZUTA 1Y3FE 3RYTC 3SAJA 4LJSA 4HEJA 1X87A 4F3TA 4N3AA 3Q9LA 3GRYA 4Q37A 4C6RA 1I5EA 4MS1B 3U4QB 3HCOA 4PZCA 2VQFB 2QU7A 3PDUA 3PQ3A 1LS1A 1Z6ZA 2JGRA 3FWNA 2FDCA 1AK9A 2IRWA 4YLYA 3ZE9A 2BZSA 1KTIA 2FX2A 2G80A 2Q27A 4O0LA 1TFUA 1KI8A 1T4BA 2DBRA 4AJNA 1BMTA 5G0TA 4H18A 1KYYA 1MTOA 2QYOA 3F5MA 2YFHA 5CK4A 2CJWB 2J31A 2BF7A 4KAFA 3L7NA 1UXIA 4MIKA 3WRXC 1JNYA 2GLXA 1LNSA 3ISVA 4OJKA 1M7GA 3TXXA 2J6CA 2UZ1B 3HVHA 1NN0A 1R4AA 4TGLA 2ZQ5A 5EIBC 3L92A 3C97A 1MN6A 3LTEA 1PGOA 2Q4DA 4K9PA 4RVDA 3URKA 3ZK7A 4GUAA 4RULA 4PLTA 3H4VA 3Q5EA 1F2UB 5CJPA 4J07A 4DR3B 5EY5B 4Y9UA 2PXAA 3UMMA 4B3GA 1EFTA 5KZMB 3ITEA 4ZJPA 4EHKA 2JFHA 2QAGB 1FLNA 2VCEA 1ZR4A 1OBFO 1O6GA 4XB2A 2WJPA 3BE6A 2Y27A 2AUMA 2WU4A 2PZMA 1TT7A 1V1RB 4WDRA 2MYTA 4CL3A 3FETA 3OZTA 1T0UA 4LCJA 1J8DA 4BWGA 1QQ5A 3L7AA 2DWPA 3P0EA 2AEFA 5ALHA 1QHSA 2PLRA 4C4OA 2AVDA 3AUFA 4CMCA 2IODA 1LI5A 1R4MB 1TVMA 2G88A 2HK9A 2MR5A 2H48A 1KJQA 3T99A 1K8XB 3AVOA 4J8PA 1MPXA 1T1EA 4P80A 4PAMA 1VE7A 5DHRA 4OP1A 5JHHB 2AOWA 2FR8A 2PZGA 3K0SA 1XN1A 1OAOC 1BA3A 3IT0A 5BSWA 2PSJA 4LWQA 5JNSA 4DCTA 5JS6A 4MV5A 3CSSA 1PNOA 3F9CA 2HHLA 5KTSA 4X20B 4YH1A 5GONB 4CG1A 4DV1B 1L4FA 2XGGA 5DWVA 5TC4A 3ETLA 3O93A 2WMYA 1DTSA 1W4CA 1YL7A 2ICAA 5AI0A