1PJ4A

Crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate malate, atp, mn++, and allosteric activator fumarate.
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
552
structure length
552
Chain Sequence
KEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords NAD-dependent malic enzyme, mitochondrial
total genus 188
structure length 552
sequence length 552
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pj4A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1pj4A01
3FCOA 3T7EA 4A73A 3ZWBA 4R4JA 4WCFA 5TRTA 1Y5MA 2FMUA 1I8TA 1FXSA 3KXDA 1XSEA 5FEUA 3EW7A 2LDBA 3IOYA 4TKMA 3ASUA 4XGIA 3DMYA 1UXKA 2D8AA 4YVFA 1MX3A 3CZRA 1TVEA 4BKUA 2WD7B 1P74A 4ZICA 4BNLA 1ISHA 2NLOA 3JCZA 3H7AA 2C20A 3JTMA 4EGFA 3CUKA 4BNGA 4IIVA 3WJAA 4D7AA 2VTDA 5AXBA 5KVVA 2EV9A 3AM5A 4UUPA 1E7WA 1D8AA 1LU9A 5JDCA 3TNLA 2PZLA 1DHTA 4FDAA 3DDNA 1JVSA 4XDYA 4CLEA 4O1MA 3HG7A 2JCXA 2EG9A 2X6TA 3C85A 3IJPA 1O0SA 1XCBA 3M1AA 1R15A 1PJCA 5DN9A 1UUFA 3SLGA 4CQLB 1YL7A 4O0LA 3AM3A 1LJ8A 3AFMA 3OECA 2E6UX 3ZWWA 4PG6A 2YZ7A 3F3SA 3GF4A 3GVPA 4BKQA 5A03A 4N5LA 1O8CA 1YOVB 1HDRA 4XYMA 1LNQA 1UP4A 2J3IA 1T1SA 3OEWA 2QZ9A 3R3JA 1E5LA 2P9EA 1N7GA 1Y5RA 1IZ0A 2X9NA 3OQ6A 1LTHR 4MVJH 1UDBA 2H5LA 3WJ7A 3ZHXA 1E7SA 4DQVA 1EK6A 3GRPA 3W8EA 3WIEA 4CL3A 3VH2A 5JO9A 2VWHA 4ZHSA 5CFZA 1VL0A 3D1LA 3OICA 1C1XB 3GT0A 4PFJA 3IIEA 3F4LA 1ISMA 4L73A 1IY8A 1PZEA 4Q39A 2C59A 5BT9A 3L4BC 4AJNA 4R1UA 3U62A 5IXYA 2NU6A 4E31A 4LCJA 2FPIA 1ARZA 2GSDA 4XX0A 4MJLA 1SB9A 1JTVA 1T25A 3GEGA 2DT5A 3GNSA 3KB6A 1EUZA 3BMQA 1XLTA 2D59A 1U4SA 2GD1O 1LDBA 2W2LA 4NPCA 3D4OA 2QYTA 1U28A 5FYDA 4BMNA 5A4DA 1HYEA 1WW8A 2CVOA 2VT3A 3FBGA 3RAJA 2H63A 1UZNA 1HTBA 5C5IA 4DLLA 3OBBA 3WGHA 3JQAB 3GK3A 1ML3A 2AEMA 1DXYA 4DWVA 1EBFA 5DZSA 3VH1A 2AEJA 3JQEA 1A4UA 4IJWA 3DFZA 2NTJA 5F1PA 1DIHA 5DP2A 2Q1SA 4NH4A 3ZW9A 4IQ0A 1ORRA 4J4HA 4CMIB 4UUMA 4LW8A 4A7PA 3O9ZA 4E33A 1GUFA 5AXCA 1QRRA 5FFFA 3E9MA 3WGGA 1BMDA 1X7HA 2O3QA 3JV7A 1DIBA 1E7QA 2X8LA 4IGEA 4RQTA 5JCJD 3Q1LA 1WPQA 5DDIP 5G0TA 3UGKA 1C14A 1PL7A 5EQFA 2JAPA 2X5OA 1EZ4A 5CDTA 4MP3A 3G1UA 4BO9A 4LVUA 2OMEA 3AI3A 2JD1A 2E48A 3QVOA 3QIVA 4BS9A 2RBEA 4WLNA 1NAIA 1F8GA 4WOJA 2PNFA 4XJSA 4YAGA 4HBGA 4BNYA 1KERA 4MDHA 1E5QA 5A5EA 1NASA 4DLBA 2VYND 3ONFA 4ALKA 4BO5A 5EPOA 3GPIA 2B36A 2D1YA 1SAYA 1YQGA 3RKUA 2Q4BA 4W82A 3RFTA 2DPHA 2DAPA 4FJ1A 4L0QA 5IN4A 1YVEI 5G4LA 1ZK3A 5C7OO 3GPDG 1V3TA 1GQQA 3W4KA 4QUKA 5CP8A 3PK0A 4YRDA 3WBBA 4R01A 3HE3A 1JKFA 1PS0A 2HMTA 1ISIA 3WBFA 4BNUA 4II2A 4RPGA 4PLFA 4L9RA 4RVUA 4B3HA 3O4RA 2OXIA 4RF3A 1F8FA 1DO8A 2I3GA 3K9QO 1Z45A 5T57A 1HE3A 1B3BA 5TX7A 4FJ2A 1KVSA 4MVJP 1SNYA 2XF8A 2EP5A 1O6ZA 4R5HA 4FS3A 4E21A 2W90A 2W98A 1SZJG 2WWRA 4E2YA 2EERA 2IE0A 4YA6A 4AL4A 1QKIA 2GZ1A 2O3UA 1R4NA 4R69A 2X5KO 3CPSA 4P4GA 3NUGA 5KVQA 3LT0A 5HTOA 3E9QA 4ILKA 1X0XA 3WXBA 1HE4A 4OKNA 2VWPA 4IBOA 3I3OA 3PJDA 4J43A 1EE9A 3JQ9C 4GPD1 3CEAA 4J91A 3PWKA 3E8XA 2W2LD 1GYRA 2X0IA 4EJ0A 4IDEA 2FOIA 3NDIA 1H94A 4TSKA 3DAFA 4EI2A 4RV9A 4PG5A 1UZLA 4RLHA 2AQ8A 4ROSA 3SJ7A 4M55A 1T1RA 1UXJA 2VRBA 3HFGA 4D3FA 2NM0A 1A72A 3E1KA 1UZMA 2J3HA 1WZIA 3WIDA 3B1JA 2ET6A 4L4SA 5HBRA 4FN4A 1U5CA 1RKXA 3DZGA 3T7CA 4AICA 3LQFA 4IZHA 2ZCVA 2PKQO 2A94A 3G1TA 1HKUA 2YV1A 3OQBA 5ITWA 3BTUA 3GGOA 4NU5A 3ZWPA 2BGLA 1PQUA 1RYEA 8LDHA 1LSJA 4XB1A 4GI2A 2YJZA 1E1MA 2V65A 3GGGA 3HWRA 5KJEA 1FDWA 1HLDA 4Y67A 4MKZA 4YCAA 1ENYA 2C7VA 5L4LA 2I5PO 1X7DA 3BMCA 1SB8A 3ETDA 4B4WA 2FPPA 4IY1A 1NX6A 3NTRA 1ISJA 4WNCA 2JKVA 1DIAA 5CG1A 1YOVA 1XKQA 3T4XA 3IKTA 5EN4A 3NRCA 2PY6A 2JD2A 5LCXA 1CJCA 3HSKA 4BGEA 1RYDA 4R1SA 2YFHA 4WEOA 5BSEA 7ADHA 4JP2A 3ZNPA 1EEHA 1VC2A 3DBLA 3ST7A 1M76A 1X0VA 2TMGA 1B26A 2CVQA 3L4SO 5KIAA 3TN7A 1DPGA 1N8KA 3MZ0A 3GUYA 4GAEA 1PWXA 1PEDA 2Z5LA 3EUWA 4MIOA 4Q3AA 4XQ9A 3ULKA 4DL9A 4RVGA 5DP1A 3GQVA 2OZPA 4FOSA 1JLLA 2R6JA 4BV9A 4CM8B 3VPSA 3GH3A 3CTMA 3GVIA 3KYBA 2D4AA 3ZHYA 1JKJA 3PHGA 4J7XA 2B0JA 2NACA 3GHYA 1EVJA 4MKXA 1R12A 3OFSA 1LSUA 1ZXLA 1I2BA 3TWOA 4YT4A 3WNQA 4BO7A 4GKVA 3HB4X 1X13A 2WMDA 3VZQA 2VNAA 3JQ6A 3LT1A 4OOEA 5BR7A 3FNEA 2NVUB 5BSHA 4WK6A 3KETA 2FSSA 2V6BA 1R16A 4WNIA 4LISA 1DRVA 4I8XA 5F5NA 1B14A 1ZEJA 2YDYA 3JQ7A 1HWYA 3LC2O 3RU9A 3UOGA 4DC0A 4NMHA 1CDOA 2PLAA 4WGGA 4OSPA 4XA8A 3UVEA 5CPBA 4HWKA 1MFZA 1QR6A 3LF2A 3B20A 3RFXA 4E5NA 3PLRA 4PLZA 1YO6A 5HA5A 2X86A 3JQFA 3WWYA 5F21A 3FF4A 1LBEA 4K26A 5B37A 3FI9A 2WE8A 2I66A 3F5SA 4UREA 1GEEA 5K9ZA 4CQMD 1BTOA 1U3UA 2FR1A 4CUZA 4G65A 1DB3A 2RIRA 4U0KA 2UDPA 4XQEA 1WMBA 3SEFA 4E30A 4EYEA 2DTDA 1YL6A 2ZIZA 4XR4A 3EC7A 4MO2A 3OJOA 4NBRA 1YRLA 3OH8A 4FCCA 1DFHA 1H9AA 1ISFA 3PQDA 4F6LA 2P9CA 2Q49A 4QQRA 3JD1A 4PLYA 1IPFA 1QP8A 7MDHA 1Q7BA 4YRAA 2Q1TA 3ZU2A 1L7EA 4BL5A 2Y99A 5LDHA 3JQFC 1I33A 3LLVA 3K6JA 2A35A 1MP0A 1GYPA 4I9UA 3TZQA 2J5RA 5TJ9A 3PHJA 2AG8A 2VUUA 3P7MA 3Q9NA 2JD0A 4CM6A 1QYWA 3GEMA 1BDBA 2HRZA 1WMAA 3ENKA 4H7PA 4EBFA 1DEHA 1V9LA 4W9NC 1KEPA 1ZJYA 4M86A 4AJ4A 2ILTA 3U4DA 5A9SA 4Q3NA 8ADHA 1HETA 4RVDA 4PLWA 1P0FA 4A10A 2ZK7A 1E1LA 1DRUA 5JCXA 3KLMX 3PHLA 1AN9A 5B12A 5B4UA 4II3A 3ZI0A 1PJ3A 5KTKA 4E2XA 2NVUA 3FN4A 1U2DA 4BNNA 1JN0A 3VZRA 4PCVA 1H6DA 2G17A 1JU9A 1L7DA 5IDYA 1DAOA 4OAQA 1B2LA 4EUEA 2HUNA 2ZATA 1XQ1A 3CZMA 3QWFA 4CL8A 5HRUA 3VPGA 4JIGA 3W6UA 2EP7A 1QORA 2HCTA 1UP7A 4B4OA 5L4NA 3GG2A 1NFQA 1W6UA 3RJ5A 5JAZA 5ICSA 5ENVA 1U2GA 3D4PA 3NJ8A 3R6DA 3VVCA 4WLUA 5K6AC 5TS3A 4KOAA 1OC4A 1IOLA 1GZ3A 4JCOA 5K6AA 3UCXA 5JYEA 1Z82A 4FIZA 3TF5A 4YJHA 1IHYA 3ZWCA 1T2FA 4YJGB 4WCFB 1F17A 4NJOA 4NNJA 4HADA 2OP1A 4CM9A 1JW9B 1P1HA 2G1UA 1JWAB 1UP6A 3E5RA 4F45A 3QY9A 2HDHA 2HK8A 3DWFA 4KQXA 1B0AA 2RCYA 4RJTA 1E3IA 1V35A 3JQAA 5CEFA 1V8BA 1KVQA 4MP6A 1HE5A 3TZ6A 3O26A 1BDMA 1MFPA 1PGQA 4DA9A 4CUKA 1BVUA 5JDIA 5A05A 1RM0A 1ZK1A 2J3JA 3U4CA 5EQDA 3ANMA 3MTGA 4PZEA 2HJRA 1BSVA 1E6WA 1L1FA 5I7SA 2XXJA 4ALJA 1ZCJA 1U3WA 5L7WA 2B37A 4PIVA 4MVJM 3JQGB 3UF0A 1ONPA 1DFIA 1ZKMA 4L8VA 3DONA 3HDQA 4YQYA 5JAMA 2WYWA 2Q4EA 1VJ0A 3VH3A 2WJPA 5C3MA 1HSOA 1LDGA 3PPIA 2EF1A 4N5MA 3DBRA 4J16A 1XG5A 1TEHA 3GMDA 4NBWA 3K5PA 3KRTA 5ENDA 1E3JA 3RU7A 3W8DA 1PS8A 2HMSA 1U4OA 2P68A 3OIFA 3RSHA 1I5RA 4RPKA 4E13A 2AG5A 1NVGA 1NPTO 2VT2A 3WSVA 3H9GA 4NG5A 1AXGA 2OGUA 3PIIA 2I3AA 2I67A 4XRGA 4AG3A 3KUXA 1TXGA 4CLRA 2HKIA 4QTZA 4M54A 4ZRMA 3DZHA 2C5EA 1B3RA 4IDGA 4C7KA 2YW9A 3HDHA 2O7QA 2ZTUA 4R9SA 4GVLA 1RM4A 4K6FA 5CEEA 5GZ1A 3GAFA 4MINA 1DOHA 1PQPA 1Y8QA 1JKIA 4BO3A 4QFDA 3G49A 5A9TA 3IS3A 1EDZA 1DJNA 4FC6A 1B7GO 5CDYA 1NBOA 1A9ZA 1PQWA 1LLDA 2PZKA 3NJ4A 2FWMX 4Z3KA 4AFNA 1E77A 3WR5A 4Z9YA 4AJOA 4PG8A 3KM0A 4URFA 3Q2KA 1D3AA 2IYOA 4WLVA 1PJ4A 3AY7A 5JY6A 1Y7TA 3WSWA 4EEXA 1GZ4A 1YQDA 3TOZA 3RROA 4M87A 2Y0DA 4D79A 5F1OA 1E6UA 4DBZA 1PIWA 1R0LA 1HDGO 3DEYX 4QSMA 4BO1A 3VPFA 4FSHA 4OXYA 4HFJA 4D0SA 1BG6A 5JLAA 3X2FA 4OXNA 3I23A 4Z9FA 3SJUA 4EUFA 2W2KA 1WDMA 1PU2A 1IL0A 1JAYA 5G0WA 2PKQP 3OJLA 5G0VA 5IXSA 1KC3A 3OJEA 4NFYA 1S7CA 3VVBA 1Y9AA 3M6IA 1Z74A 1R6DA 5JDCC 2NTNA 1ZSNA 2B5VA 2O2SA 4PRLA 4X54A 4XGNA 5L9AA 4LSMA 5TT1A 1E3WB 2ZB8A 1MV8A 2B69A 4Y8VA 1HYHA 3QHAA 3ADOA 2DVMA 4GX5A 4OMUA 3TL3A 1WP4A 5G0SA 1WLYA 3L6EA 4BNTA 2WD7A 4R16A 2P5YA 1PL6A 3BHJA 1QYDA 4AJPA 5IDQA 3QLJA 5TNXA 4O59O 4GQAA 4HUJA 1IE3A 1Y6JA 3O8QB 3EMKA 1YB4A 3UXYA 1YDWA 1LDNA 4AJEA 3WQQA 1ADFA 1N7HA 1LC0A 4B7XA 3AI1A 3PZRA 1GTMA 4Q3CA 1H0KA 1TT5A 3L9XA 4BNWA 2ZYDA 4XIJA 3F47A 3ZWOA 1WDKA 4XJTA 5ES3A 1KIFA 4XYLA 1WWKA 4WE3A 2J5QA 3BMNB 4B79A 4DMLA 1PGOA 3QWIA 3RUHA 2CF6A 3K31A 2VN8A 1BXKA 3RCBA 3FR7A 3ZU5A 5JMWA 1OBFO 4J6FA 2BFAA 3NDRA 3Q11A 1R66A 2PKRA 2XOXA 4MVJD 4ZQBA 5IZCC 1CQJA 5T5QA 1M2WA 2UAGA 5JS6A 3QV1A 4R1NA 5GZ3A 1H2BA 1PTJA 1HDOA 1BGVA 1ADBA 2Y68A 1HEUA 3JYPA 1LI4A 1PZFA 4PRKA 4D41A 5C7IO 5DULA 1NNUA 2EW2A 3EAGA 2I6TA 3LLSA 3E9NA 4Y6PA 4XYEA 2X0JA 4U6QA 5A9SB 1E7YA 1EVZA 3ZDFA 4DRYA 4BIIA 5TIIA 1YWGO 5AVOA 2HQ1A 3UCFA 4XYGA 1LQUA 5DBGA 4YT2A 3CKYA 1T2CA 2QZZA 1QYCA 1LQTA 4XZ3A 4XCVA 3HDYA 1OZAA 3WLFA 3B70A 2VZ8A 1NFRA 1U3TA 1TLTA 3GGPA 1E0DA 4UVGA 4NI5A 1J49A 3Q6IA 4YJFB 2Q50A 5I9LA 3WYEA 4NJMA 4IDFA 1JQBA 4BGUA 3ZHZA 1EFLA 1DC6A 2UYYA 2YDXA 2ZCUA 2ZJ1A 3PI7A 3PLNA 2GF2A 3PGJA 3H9EO 2GUGA 4BO4A 2GGSA 4YPOA 3ZWVA 1ZXBA 3QA9A 4BNKA 1P9LA 3OIGA 1ZIDA 4EUHA 4PVCA 1YBAA 1OC2A 2EHDA 3LC1O 1ID1A 4K28A 2PH3A 4UUOA 1VKNA 2PGDA 1LLQA 1Q0LA 4QT0A 3V1UA 2QQ5A 2FN7A 5I8WA 5JNLA 3ITKA 4QX6A 2VUSA 4B3IA 4BHTA 3GDOA 4BGIA 3ENNA 2IODA 4WCFC 1EVYA 3L6OO 2BF7A 3H2SA 1SOWA 2VOJA 1XWFA 4ZU3A 5T6BA 1Z73A 1GUYA 1QLHA 1YDEA 4UEJA 3H6KA 1UXIA 3DZJA 1IULA 4PLVA 4S3MA 2NSDA 3WS7A 3GUCA 4CR7A 1U1IA 3IC5A 4E5YA 5HM8A 3AJRA 3SVTA 2FZWA 3DOJA 2VZ9A 3AOEC 4U8GA 1DRWA 4OHUA 4BB5A 4CMHA 2YQ5A 3WFIA 1D1SA 2O3TA 1J4AA 2RHCA 1A7AA 1ZFNA 3LT2A 3A28A 3P2YA 4I5EA 3D5QA 1PWZA 4R68A 3C8MA 2Q2VA 3FHLA 5KJFA 1H93A 4P38A 1E7RA 1QMGA 3JQBA 3KV3O 4Q3EA 4FOOA 4U5QA 1RWBA 4PVDA 3WLEA 2Z95A 3F4BA 4Y6RA 4LSWA 4HY3A 3FSRA 1Z75A 3LSYA 3GVHA 2P4HX 4NK4A 4R5MA 3JYLA 1F0YA 4MVJA 4XIYA 4TZKA 4TRJA 2FPGA 1E3SA 1LSOA 2CFCA 1GEGA 1G6KA 4R9RA 2O3JA 5A3VA 4NDNE 3STHA 5ICMA 2I99A 1SMKA 4O63O 4UVIA 4B8WA 1YE3A 2CNBA 5JO0A 1ZEMA 2IXAA 2NU8A 3TOXA 1GDHA 3S2FA 4FFMA 3I6QA 5ER9A 3FNGA 1HT0A 3K96A 5EINA 1LXCA 3E18A 4TRNA 2Y0EA 4QXMA 5C37A 5JSFA 1UXHA 4CR8A 4IDBA 1BWSA 1XIVA 1H9BA 2FZEA 1HDCA 2BI8A 5ILGA 2EKQA 1PJ2A 3V2HA 3WICA 3ON5A 5I9NA 1UAYA 2X58A 1YL5A 1I0ZA 3C7AA 3KEOA 4U0JA 1SEVA 1AHIA 1R0SA 2C29D 4AJIA 2O4CA 3KTDA 3RD5A 3HFSA 3ZGYA 3Q0EA 3QW2A 4CMJA 1N9GB 5U9CA 2GO1A 2JL1A 4I5GA 1CYDA 2X4GA 3NEPX 2GERA 1MC4A 1QLJA 4ID9A 1MXHA 2B4TO 2GDZA 4GX1A 5HS6A 3VPXA 4I1IA 3NGLA 1VM6A 4E5PA 4MVJI 4GX0A 4G81A 4QEDA 4XB2A 2X9VA 3D3EA 3UUWA 1ZK2A 3PYXA 2OP0A 4OSOA 2VWGA 2IRWA 1KOLA 3ZNOA 4A5OA 4CMEA 4CQMB 3WTBA 1BW9A 3IP3A 3K73O 4BO2A 1DAPA 4B4UA 3RBVA 5TC4A 1M6HA 4ZGWA 1A9YA 1CF2O 5DCYA 3CMMA 1ZK0A 4NU6A 5JE8A 4BKOA 3WNVA 4BQPA 2YHIA 1I01A 2Y1CA 3AM4A 1PGPA 3ZV5A 3BMOA 3H5NA 3DBLB 3SC4A 4FC7A 3RUEA 2PZJA 2B83A 2JFGA 4CLRB 3BYZA 2ZB3A 3OIDA 4UVEA 1UR5A 5L4SA 4XDZA 1NAHA 4BMVA 2X23A 2G5CA 1OFGA 1E1KA 4A2CA 3IUSA 4INAA 1GCOA 4DLAA 2BRUA 4J1QA 1NWHA 3ASVA 3D3WA 3D3WB 4OXKA 1B15A 1ZW1A 3GMSA 1BVRA 1DBVO 1FF9A 1ONOA 1QG6A 4YEDA 1CETA 3PIDA 4U6SA 1PJTA 2PD4A 4N18A 4Q3DA 4ZRNA 4M1QA 3NT2A 4KMSA 3BMCB 4HFNA 2NQTA 3ZWNA 3MJTA 2O23A 1RM5A 3ZNQA 4E2ZA 5BNTA 4HNHA 3L4BA 4GGOA 4WPGA 4BO6A 2B35A 1LEHA 1GQ2A 2VHYA 2UV8A 5JC1A 1ZUD1 4A03A 3L0DA 3R3SA 4L4XA 4CUJA 3OA2A 2Q3EA 1PS9A 3KOUA 3LVFO 1B16A 1H6CA 1PZGA 2J8ZA 4HNGA 4DIFA 4DTIA 3FTPA 2IZZA 3ZNNA 3PEFA 2NTVA 5JBIA 3DAPA 1QYVA 2GR9A 2VOEA 4A0SA 3RUFA 3B1KA 5EL0A 2OBNA 1CERA 2BI7A 2XPCA 4IDCA 2HJSA 1VJ1A 2PFGA 3H3FA 4OL9A 4RZHA 1JWBB 3D4NA 3WWZA 2IZ1A 3EZYA 5JDIC 3RUAA 5JW6A 3ZZNA 3M1LA 5AYVA 3I83A 1B8UA 2EKLA 4PLTA 5CEJA 6ADHA 4HFRA 4DGSA 1KVUA 4TVOA 1NTOA 2EJVA 2O50A 2HMVA 3GZNA 3DZKA 3AY6A 3HNPA 2X5JO 4M49A 4TRMA 3TL2A 5KWEA 2JCVA 2ZYGA 2DFDA 2P5UA 1K0UA 3ZWXA 4CMGA 3AFNA 1M6WA 3BMQB 4I08A 5JYDA 1I24A 4GWGA 3DB2A 4CLDA 1V3VA 2E37A 3H5AA 4QFCA 1NPDA 2Y1EA 5KOIA 1B8PA 3U4IA 1WVGA 4XWYA 3DL2A 4LRSB 1K6IA 3K8ZA 1E3WA 4BQRA 2QYSA 4AJHA 5TSDA 3I9JA 3S2EA 2GNAA 4GVXA 5ER6A 3ZWYA 3MTJA 2IEDA 1PGJA 4TZTA 1J5PA 2CDAA 4E5MA 1E92A 1VSUA 2GN9A 4PLPA 3MOIA 4A26A 4RPLA 5H81A 1SCUA 2AXQA 3S2GA 5MDHA 1EFKA 4KUEA 2NU7A 4N54A 4NJMB 3G0OA 4ZA2A 2AHRA 3PXXA 3Q3CA 3UFXA 3SBOA 1GY8A 1GD1O 3V1YA 3F9IA 1OI7A 4FD3A 4B4VA 2NADA 4CM5A 3RBZA 4PG7A 1D4FA 4CV3A 1EUCA 3PFFA 4YJHB 3TRIA 1O89A 1E6EA 1HRDA 4IJKA 3HQ4O 1CQIA 1HSZA 2PTGA 1PZHA 1VL8A 2H6EA 2BFMA 2Q1UA 5FI5A 1LDMA 3GOHA 3NTQA 4FFLA 1WDLA 1HZJA 2PK3A 1A5ZA 3I9LA 3RUIA 1YJ8A 1U8FO 3HDJA 3WG9A 1D1TA 1DIRA 2ZQYA 4NK5A 2NU9A 3DO5A 4J0FA 1QYXA 2GRAA 5CDGA 4P4NA 3KLPX 3UAGA 2R00A 4CR6A 3WYBA 1XELA 3H9JA 1U7TA 4O5OA 1HF3A 3TSCA 3H9QA 3GR6A 2IYPA 2ZTLA 4JBIA 4EJMA 1MG5A 4BMSA 2OO5A 1P1KA 5F5LA 1IZ9A 4CODB 3JQ7B 4YB8A 1EE2A 3RASA 4DQUA 2NQ8A 3U5TA 3DTYA 1DLJA 5EERA 4YJFA 5B4VA 3JQ8B 3JQ8A 3K2EA 1YBVA 5JCJA 5L3ZA 2VHZA 2A4KA 1UXGA 1TT7A 3I4CA 3FPLA 3DHYA 2POQX 1VSVA 5G4KA 3A9WA 2NUAA 2YQ4A 5G4KB 3WB9A 2CUKA 1EBUA 2B5WA 2FRDA 3NAQA 3R0IA 3I1JA 3EY4A 5GZ6A 5KVSA 4RZIA 1VLLA 4BNMA 3GG9A 4HXYA 1K2WA 2DUWA 1Y8RB 5TT0A 3DBVO 3NT4A 3JQGA 1TI7A 4Z0PA 4K9DA 4CLXA 1P0CA 1LLCA 5AXDA 4DIOA 3LZ6A 1UDCA 2AQKA 2GN6A 4GGPA 3B6ZA 1DSSG 4UVDA 4BO8A 2JFHA 1I3MA 3DR3A 3V5NA 3EDMA 5L51A 1G1AA 4KDFA 4TVBA 3QQPA 2Y66A 3VOSA 3RC7A 1FJHA 3NTOA 2NV6A 1QSGA 3KHUA 3I5MA 3SLKA 4D3DA 5KJ6A 1ZZEA 4EEZA 3UHAA 3CXRA 4H16A 1FK8A 1W8DA 2BHLA 4Z9XA 1SPXA 4L4RA 4OM8A 5A3JA 3ZH2A 3HADA 4O6VA 4ND1A 3ZWAA 1MUUA 3ROQA 4F3YA 1VKOA 4MP8A 4R41A 4KDEA 1KVRA 4B7CA 3DC2A 1RPNA 4K6CA 3TZHA 5IF3A 1EQUA 3WX0A 4B8ZA 4Q3BA 4D45A 3BHMA 4EJ6A 3L9WA 3C7CB 5COBA 4J1SA 3FTNA 4UEKA 3DMTC 3I9OA 3WQRA 1IYZA 1OOEA 1BXGA 1Y8QB 3P19A 4WLOA 3W6ZA 1DC5A 5IZCA 5L45A 4RO0A 4YACA 1N5DA 4WEQA 3TDKA 2VTEA 3ZCXA 2G76A 2YY7A 3IJRA 2E49A 4YAJA 3A14A 1KBZA 2C2YA 1T24A 4OIMA 2OORA 4KTTE 3O03A 2CDCA 1NR7A 4L74A 4NR0A 4W9NA 4MVJF 3EZLA 3WFJA 4PZDA 4W6ZA 1UDAA 5DOZA 3BAZA 3PHHA 4J7UA 4ONEA 3FD8A 1H2HA 4IS2A 4Z3DA 3VHRA 5JAIA 3Q9UA 4KWHA 4ALIA 2QW8A 5TGDA 4D46A 1R37A 1T2AA 2XXBA 3B1FA 1YONA 4JJGA 1FDSA 1NHWA 3C7DB 4IXWA 3UKOA 3BMOB 2D2IA 3PYMA 2DLDA 3JQCA 2HMUA 1K6XA 5A1TA 2C2XA 2HRBA 4FFOA 4E3ZA 2Q46A 1ENZA 3RFVA 3DZBA 4YRBA 2VHWA 4CM9D 3H5RA 4CV2A 5I7VA 4MVJG 3FNHA 3E6AA 5AXAA 1X14A 3FRJA 3BIOA 4JGBA 2TMDA 3VTFA 2BELA 3RJ9A 2PH5A 3MJSA 4Z0TA 4XQCA 1UH5A 4RVHA 2ZTVA 3ORFA 5KJ1A 1A4IA 4P8RA 1BXZA 3MCVA 3JQ9A 4W4TA 1Q0QA 3ZV3A 1RJWA 1PJLA 4MIEA 1PJSA 5CDUA 4Y6SA 1N9GA 4FGWA 2GZ3A 1SEPA 1YB5A 3AOEA 4NFSA 4DPMA 4KWIA 9LDBA 4FFNA 4DXHA 5T8KA 2RH4A 1KEVA 4E2WA 4DMMA 1N2SA 2ZYAA 4RPJA 2YV3A 2G0TA 3FR8A 3GC6A 4LN1A 1U7HA 1Y81A 3AWDA 4IQGA 4YT8A 3FNFA 5U1PA 1ZO8A 1U9JA 3V1TC 3LF1A 1MA0A 2EKPA 4J0EA 1TB4A 5A02A 1DJQA 3JQBC 1EMDA 2IXBA 5TQVA 2V6GA 5TF4A 2OHXA 4ZN6A 4TRRA 2JHFA 3JQAD 4RLSA 1GPJA 2WYVA 3RC9A 2J5KA 4WCDA 1AE1A 5MGBA 4CV1A 5C7LO 3EVNA 4NBUA 3CINA 1FDTA 2BD0A 3EGOA 1ENPA 1U8XX 1XA0A 3SX2A 1YKFA 2CVZA 3DHEA 4TQGA 1D7OA 4MVJE 1GADO 3HHPA 1LDYA 1NVMB 5IDWA 4M8SA 1U5AA 2RHRA 4BNZA 3HJAA 4BNXA 3OM9A 3KVOA 1NYTA 2Q99A 3QVWA 1V6AA 1UJMA 4EDFA 2FSVA 1GFSA 2VYVA 3HZZA 3S8MA 3D0OA 2AQIA 1P33A 5L7TA 5THQA 4FGSA 4OH1A 5JXWA 3O8QA 1GV1A 2C7GA 3DQPA 3NKLA 4HKTA 3RC2A 4I9HA 3I52A 2IDZA 1ZMTA 1C0KA 3AUAA 5BNFA 4ITUA 4D0RA 1A71A 4JBHA 1P44A 1F06A 3C1AA 3AOGA 3BHIA 3MWDB 3OJFA 4IMPA 4OQYA 4D44A 4DREA 4NFHA 1U3VA 4YR9A 4BKPA 2D0IA 1SOVA 1JVBA 3RUCA 4D3SA 1ULSA 1T2DA 1P3DA 3KZVA 4HP8A 4XEHA 4BO0A 5B1YA 4F46A 2P91A 1MGOA 4K1LA 4HFMA 1W0CA 2IEBA 3QJ5A 4J4BA 3G79A 4CQLA 4KUHA 2CY0A 2V7PA 3MJCA 2VNSA 2LDXA 3DZIA 5A06A 3I9NA 1NPYA 1GPDG 6LDHA 2VRCA 5BSGA 1XU7A 2X0NA 3DOOA 4RF4A 2WE7A 2CD9A 1DC4A 4LGVA 1PSDA 2AQHA 4FJ0A 5I7FA 5GMOA 4XGKA 3GZNB 1DHRA 3PRJA 1I3NA 3PDUA 5I7EA 1FDUA 3U09A 4CJXA 1LA2A 2GYYA 1HL3A 2X1HA 2DBQA 2DTXA 1JDJA 4IDDA 5L95A 2Q2WA 3WOHA 3AU8A 4ZQHA 5BSFA 3PWSA 4IJVA 1YXMA 2CMDA 2X9GA 2HK9A 1BRMA 2PGLA 2O3SA 5EJ2A 2J3KA 5KCZA 3JD3A 3S1LA 4BNFA 1ONNA 4CM1A 2V6FA 2ZB4A 3H2ZA 5EMHA 3GN2A 3ONEA 1M66A 3CSDA 3KSZO 4CMAA 4XD2A 4CLOA 2O3RA 2OL4A 9LDTA 1AXEA 4BGVA 2O4UX 2ZQZA 4E32A 1EVIA 1LX6A 1N1EA 4IZIA 3NGXA 3WTCA 1N1GA 3ROMA 4AJ1A 4J1NA 2D3TA 1AHHA 1MLDA 2AE2A 2WD8A 3AY3A 3C3XA 3HB5X 1ZH8A 2QIOA 3F46A 4XYBA 3WYCA 2AW5A 4FR5A 4XKJA 1ZK4A 3BTVA 4BVAA 4YXFA 1PL8A 1LUAA 2HLPA 2H9IA 3NT5A 4N5NA 4ALNA 3PFWO 3DHNA 2NVWA 2DBZA 3UW3A 2JFFA 5L40A 3DZFA 1XGKA 1O95A 3IQDB 4R3WA 2Y1DA 4QECA 1M67A 4J2HA 3VAZA 2WDZA 1GU7A 3OJ0A 1HDXA 4D43A 1ADCA 3WGIA 3DBHA 3VKVA 5IN5A 1PJQA 1XQ6A 1Y9EA 3MWEB 1WNTA 3GZ4A 2W8ZA 5TJHA 5ITVA 4OOFA 1ZVMA 3H8VA 2CDBA 2CF5A 3RVDA 4RDHA 3KYCA 4BNVA 3JD4A 3RBXA 4GBJA 3GDGA 4R1TA 4UEOA 2E4AA 1OMOA 3X2EA 4YJGA 4Q9NA 2UUPA 2VQ3A 4OYRA 4HV4A 4NQZA 1H6BA 3QWHA 4WLEA 4PN3A 1HYGA 1KY5A 1DDOA 4IXTA 2G82A 1VL6A 3F5QA 2CSUA 1S6YA 3KYDA 3FPCA 3QP9A 4BNHA 5DNAA 1T2EA 1EK5A 4L75A 1NR1A 1ZNQO 4MPDA 3VC7A 3NV9A 5DBFA 3CE6A 4E4YA 2QRJA 1ENOA 4QO8A 2VZ0A 2GN8A 2PWZA 2WM3A 2QRLA 2B4RO 4KQWA 2ZJ0A 1NXQA 3C1OA 1KY4A 1Q0HA 3S2IA 2I65A 4ALLA 1Q7CA 4D42A 4DIBA 1PX0A 3U9LA 2QX7A 2Y67A 2VHXA 3GVCA 3LK7A 2RAFA 1F12A 1KYQA 4RF2A 3GFBA 4ZQGA 1Z7EA 3ZV4A 4OKIA 3DTTA 1F14A 4ZD6A 1JA9A 1GUZA 3R1IA 1I36A 2DBVO 3GN1A 3PP8A 4RVSA 5LDGA 1XDWA 2YYYA 1SO8A 3P2OA 3GHHA 1NFFA 2NNLD 1ZSVA 3INTA 5HWSA 5J23A 5I9MA 1DFGA 1T26A 3SC6A 1E3LA 3VTZA 4CM8A 3RC1A 3O38A 3DBHB 3A1NA 3DAGA 1BHSA 3JSAA 2C07A 4GSKA 1I3LA 1SC6A 2Q45A 4P4LA 4GLLA 5A5FA 3BTOA 1G0OA 2X7HA 3ROPA 1KVTA 3KYCB 3TQHA 5FF9A 5GY7A 4JJIA 4XQGA 3QSGA 1YS4A 3TPCA 5K0ZA 1P1RA 3IUPA 1DLIA 1LRJA 4ZJUA 3D5TA 1EUDA 1LDEA 3PDJA 2DUUA 3PYLA 1FDVA 1GYQA 4EZBA 1MB4A 4ESOA 3KEQA 1MC5A 2P2SA 1MG0A 4TKLA 3WGYA 1XHLA 2PV7A 4BUCA 3IL2A 4YAIA 1TT5B 1IUKA 1SBYA 1YQXA 2C54A 1ZBQA 4G5HA 3ETEA 4C7JA 4E5KA 3QE3A 2IZ0A 5IZ4A 4GX2A 2Y05A 3ZHBA 4RGBA 5KNLA 3UICA 2HU2A 4YDRA 5IJZA 4GH5A 5KVCA 2ZKLA 1C0PA 1HDZA 1X7GA 4YYZA 4W7HA 4CQMA 2R00C 3E5MA 4YAEA 1BXGB 3DMTA 4LRTB 3U49A 1O5IA 3G17A 1XU9A 4TWRA 4OJNA 3EVTA 3H3JA 3QWAA 2YFQA 4B7UA 1KETA 3V2GA 2Y1GA 3GEDA 5EESA 1I10A 2YHIB 4FQ8A 4MIYA 3MJVA 3OETA 3ROKA 1BW9B 4KTVE 4GKBA 1I32A 4CM4B 1P1FA 2P4QA 2HAEA 1MXFA 4R54A 4WLFA 4A27A 2SCUA 4R51A 3LU1A 3UH1A 2HSDA 5DF1A 4IINA 4Z6KA 1NQTA 1A7KA 2D5CA 2C5AA 1W4ZA 2AEFA 2BFOA 3JYNA 3PQFA 3KSUA 5HS4A 1UAGA 4IDAA 3LYLA 3M2TA 3PTZA 1JAXA 2BFPA 2JAHA 1V0JA 4DYVA 1GR0A 4N7RA 2A9FA 4PLCA 3RI3A 3BTSA 4TMFA 4IPTA 3BXXA 4OGWA 5CG2A 4CPDA 3KBOA 3ZV6A 2P9GA 4AJ2A 4PLHA 5IFLA 5KJCA 4Y98A 5LC1A 4ALMA 1C0LA 2BGMA 1HLPA 2F00A 2ZB7A 3DFUA 3OA0A 2YHUA 1X15A 3QVXA 2X22A 5A04A 2AMFA 1DIGA 5H83A 4DBVO 1C3VA 4MOWA 2C82A 1GV0A 3N58A 4CM7A 3OMLA 3WGOA 3AU9A 1RM3A 2Q1WA 4L76A 3GRKA 4WECA 1CIVA 2PD6A 1P77A 5THKA 2GPTA 3ABIA 5JMPA 4KZPA 1VI2A 1CWUA 3PQEA 5JFOA 2AA3A 2OOSA 1PJBA 1B8VA 2B4QA 1A27A 2YV2A 5FI3A 3GY0A 3WGZA 3AK4A 4CM3A 4RPHA 1X1EA 2GASA 1P45A 2QRKA 3K2BA 5DBIA 4IJUA 4XRRA 3GFGA 1HZZA 4I5FA 5ILOA 2WEKA 4JBGA 4S1VA 3MOGA 3U0BA 1KS9A 1CEQA 1C1DB 2ZTMA 3AUSA 3COSA 1XEAA 5JPIA 1EQ2A 1LRKA 3GAZA 4J4TA 1YBMA 3RQSA 4J90A 4PLGA 5H82A 3AI2A 4OQZA 3ITDA 4Z0HO 2DU8A 3E82A 1V3UA 3EK2A 3A06A 3INRA 1ZSYA 2UVDA 3M2PA 5AOVA 3RIHA 3VDQA 4E6PA 3JYQA 3W4IA 3CIFA 3I6IA 4XR9A 4JROA 3GLQA 2Y1FA 2VYNA 4RORA 5JAQA 3AUTA 5CPFA 4YBZA 4OO3A 1I30A 3A4VA 4JN6B 4RL6A 2HMWA 3GNTA 4CMIA 5COQA 3PWZA 1G0NA 5L7YA 1YH3A 4J9VA 4BNIA 1LC3A 5F1KA 4LMPA 2UUOA 2F1KA 3HN2A 3ONDA 3LT4A 4I9NA 3WDSA 5KKAA 4FFPA 2V6MA 5B4TA 1M75A 4ZVVA 4JJFA 2OUIA 3L07A 4AJKA 1ZJZA 3KSDO 2DQ4A 4GMFA 3SXPA 1GQYA 3ZN2A 3QVTA 1KC1A 3E48A 2BLLA 4JX8A 5F3RA 3WMXA 1ISGA 4CMCA 3WGTA 1NQAO 5CHEA 5AQ1A 1HE2A 1WXDA 3NX4A 4YJDA 5G0UA 1IPEA 1XYGA 4JP3A 3VDRA 5BNIA 3TFQA 2I76A 1Q1NA 4RDIA 5COAA 5DCUA 3HN7A 4FBGA 3L6DA 1C1XA 1K89A 2Y0CA 4JK3A 4LCEA 3GA0A 4ND4A 3H4VA 4NBVA 1H5QA 2H1SA 2JJYA 3W8FA 1R0KA 3K30A 4IQ8A 5DT9A 2GZ2A 4J2OA 3IDSA 4DQXA 5IAAA 2HK7A 3HUDA 2Q2QA 1GCUA 2GN4A 1P1IA 4LVCA 2FY8A 1Z6ZA 4CMEC 4BOYA 4CLOB 2WSBA 1TA4A 1VRWA 1Q7GA 3IP1A 2EGHA 3KYDB 3TZCA 2NWQA 4J1TA 1K3TA 3TJRA 3MJEA 1K5HA 4IMRA 4DYDA 1YB1A 5FWNA 1HDYA 3IAHA 1LRLA 1R4MB 3ZWMA 5CAEA 1PR9A 4NIMA 4R3NA 3ZU3A 3T4EA 2EIHA 3PHIA 1NWCA 5T8KC 1K6JA 4E12A 2NVBA 2WTBA 1I2ZA 3OQ1A 5T64A 3UCEA 3WMWA 4GMGA 2YUTA 5CDSA 4UULA 1VE9A 1N92A 2JCYA 2D5AA 4YTEA 2EW8A 2VYVD 4P22A 1T4DA 4G2NA 4UVHA 3FBTA 1I3KA 2OBYA 2Z1NA 5JY1A 3PGXA 4IIUA 1O94A 2FP4A 3OHSX 4U7WA 4W7IA 4RF5A 1NP3A 3V2UA 4GSLA 3CH6A 4JLWA 3INGA 1Y1PA 2R2GA 4ZQFA 3F1LA 3AW9A 1LLUA 2O48X 4GL4A 2BGKA 5IDXA 1OAAA 4E0BA 2GCGA 3NDJA 3RKRA 4ZQEA 3LDHA 2GLXA 2PA3A 3QVSA 5EIOA 4RCVA 5JC8A 2OFPA 4DVJA 3JD2A 3KO8A 1HXHA 5KKCA 3NYWA 4PG4A 1EDOA 3DXFA 2VRCD 3GDFA 3VH4A 2VWQA 1NVTA 4I5DA 2WYUA 3PVZA 2EGGA 1P1JA 1WAMA 4WKGA 2FR8A 2JHGA 1J0XO 3U3XA 1QV7A 4JXKA 4M89A 5G2OA 1NQ5A 2HO5A 3I4FA 3OSUA 3OP4A 4DPLA 3PJFA 4GLOA 2RH8A 5DCWA 3D7LA 1GZ6A 1KEWA 4ND5A 3H65A 1CRWG 1E3EA 4NZ9A 4WOKA 1XR3A 3L77A 3RWBA 1PR3A 3F1KA 4IUYA 3VKUA 2O2YA 3F6YA 3BA1A 2DBRA 3OEYA 4BNJA 2EXXA 3CMCO 3UN1A 4EITA 4DC1A 2VHVA 1LSSA 4WJZA 4QO7A 1QV6A 3V8BA 1O9BA 1R4MA 2Z1MA 2VCYA 3AUUA 1VJTA 4NBTA 4WASA 2PR2A 5A9RA 1E1NA 2EJWA 1C0IA 3TZKA 1NM5A 3QRWA 1ULUA 1ZMOA 4JNKA 2FR0A 4W99A 4FB5A 4MKRA 1R4NB 1Z7BA 2PGJA 1W73A 3IKVA 1ADGA 3DBRB 4BV8A 2DC1A 2I9PA 3I9MA 3PJEA 4KUGA 4UUNA 3U4HA 5ADHA 1H6AA 3WQSB 3JQDA 4BKRA 1YJQA 1Y8RA 3H9UA 4WUVA 4FW8A 3ADPA 2FHSA 4EW6A 3Q2IA 2QG4A 4AJLA 3GVXA 4BB6A 3W4JA 1AGNA 2DPGA 4YAKA 4J7CA 4DUPA 5BQFA 2C0CA 4Y9DA 1NHGA 2EEZA 2J6IA 4FFRA 1YGYA 4JQCA 3TFOA 4NHEA 2A92A 3C1TA 2X0RA 1C1DA 4CV0A 3ANNA 4CM4A 4UAGA 2CZCA 3VZSA 3JD0A 3WGQA 4B3JA 2PZMA 1GL3A 1AUPA 1VPDA 3K92A 4IGFA 3VZPA 4AJJA 2W4QA 1IB6A 4YQZA 2AE1A 5IG2A 5DOVA 4IM7A 3W1VA 4HX5A 2DM6A 3JYOA 3N7UA 2EWMA 3C24A 4H15A 4RQUA 4CMKA 2PD3A 1E7MA 3ZU4A 3FWNA 2BH9A 1IHXA 2DKNA 2O7SA 3PJGA 4C4OA 4TROA 3MJ4A 5T67A 1NQOA 3EYWA 3OF2A 1GAEO 1DC3A 2Y93A 4CLHA 4IS3A 1FMCA 4LK3A 1Q2XA 4YT5A 2BKAA 2DTEA 2XAAA 4AVYA 5TLSA 3ICPA 4GWKA 4ND3A 1P31A 3PZBA 4KP7A 3QWBA 1WZEA 3IMFA 4PGFA 4CMBA 4H3VA 1KEUA 3E03A 4FPXA 4F6CA 5I8ZA 4ND2A 4PZCA 3BMNA 3EHEA 4YWJA 5L53A 3I9KA 3ZW8A 3N74A 1I2CA 3DOCA 3MEQA 4J49A 2W2KB 3LC7O 1PGNA 4J3FA 3VPHA 3G3EA 4RVFA 2VUTA 2Y1OA 4LMRA 3S55A 4DPKA 1T4BA 2QHXA 2DFVA 1X1TA 2BMAA 2E82A 3FWZA 3BZUA 3ETGA 3ICCA 3P5SA 3RUDA 1QXSA 4J9UE 5U4QA 3GNQA 1J6UA 3ANLA 3D64A
chains in the Genus database with same CATH superfamily
4RFSB 5JNVA 1G9TA 4R4JA 2PKXA 4CIVA 1Y5MA 2FMUA 1I8TA 2HIHA 2V4ZA 3DOFA 5LP1A 1WUJS 3UGQA 1OYYA 3K0KA 1PJ8A 2GBLC 2VF2A 3A58B 3EW7A 4Q4HB 4DS3A 2OQVA 3S8EA 5CX1A 3R4VA 1CR6A 2D8AA 3RU3A 4YVFA 5BOSA 1KZGB 3CZRA 3RDPA 2HQOA 4BKUA 4RA9B 2QGFA 3S1AA 1X9HA 2O5CA 2GVDC 4CI9A 4D81A 4L16A 1ISHA 2J67A 2NLOA 1NUSA 4EGFA 1IQPA 5K09A 3CUKA 1PI3A 1KJWA 3GFFA 4BNGA 3WJAA 4D7AA 2VTDA 2B61A 2CYBA 2XYPA 4HNAB 1PKXA 1CZKA 4UUPA 1IN8A 1LU9A 4ZPJA 2YIMA 5KOJB 2QXUA 3AR7A 4PSCA 3BSYA 4UD6A 2I91A 4I3HA 1ILEA 1ML4A 4FDAA 1QB7A 5KMGB 3ZXXA 4O1MA 3H1AA 5K8VA 2EG9A 2X6TA 5EP2A 2WABA 1ZRSA 1A2QA 3FTQA 4HLDA 4K9SA 3OM1A 4KG7A 3J80A 1Y7PA 1G55A 2CLOB 4DLPA 1UUFA 1D4ZA 2BGUA 1X42A 4K6GA 3QVJA 4O0LA 1GNVA 3SHVA 2E6UX 2G1AA 2PLRA 2VP0A 2GZHA 2ZSEA 3MS7A 4C1BA 3GF4A 4NMXB 4B6JA 3PR2B 3LSTA 4OX9B 2FH5B 1OI3A 2IEZA 3FPBA 4N5LA 3HYSA 3TH5A 1Q83A 1HDRA 4TKUA 4UOZA 1AZLA 1QFZA 2XMQA 5DASA 4HB2A 4RHXA 1ZH0A 1XTBA 3AR8A 1WMDA 2GCIA 3N2YA 4DV5B 4BJHB 5D3ZA 4JP8A 2XOKA 2O8DB 1KAQA 2CFSA 2JKYA 3A9VA 3OCYA 3BF8A 4YLGA 3WJ7A 3ZHXA 4C7MA 1E0AA 2PX6A 1D2NA 3LUGA 2X3YA 3ABZA 4LAFA 4CL3A 3KT6A 3KWMA 1OIXA 3AF2A 4GPZA 4LWOA 5H5JA 4ZHSA 1HQYE 3TXAA 1EQAA 5FUYA 2ADOA 2XRYA 4I4NA 1WXXA 3D1LA 1GRCA 5CDFE 2NZUG 3CNBA 2FOLA 1EH5A 1LPBB 2VSNA 2K87A 5KWVA 1QVWA 1VSTA 3SC2B 1DXQA 3KQPA 5KAMA 1GM5A 1SCJA 4FCWA 1S5PA 1PT7A 1MEOA 1RWNA 4LFAB 1G8KA 3AFOA 1G5IA 1OA0A 4G36A 2P1RA 5DXAA 2W83A 3WL7A 3MTBA 4DG8A 2FPIA 1ARZA 3K6RA 1RXCA 1M6YA 3GNSA 4OAOA 2PX2A 3HEAA 5J2TB 1WZCA 3VYSB 2EC5A 4GICA 2AN5A 3NBKA 2EWVA 3K0FB 2D59A 1U4SA 1LDBA 2G88A 2QYTA 1U28A 5A4DA 1WW8A 1SUCA 5DBOA 1AS0A 1HTBA 3OBBA 2IPNA 3PIRA 5EAIA 1N33B 4DWVA 1OBCA 2L69A 3COVA 4IQ4A 4V38A 1E5TA 2AI2A 3A9TA 2X6RA 3DFZA 4PGHA 3SYKA 3UA4A 3A27A 4LJYA 3RLFA 2LGJA 2HYIC 1ORRA 3G9ZA 4IL5A 4LZJA 4RE6A 4UUMA 3JPWA 4DIKA 1EUYA 1GUFA 3OESA 4PSKA 1H22A 4L8LA 5ELMA 1N25A 1FCJA 3M33A 5FFFA 1XN4A 3WGGA 1I7PA 3S2ZA 5DJ5A 4JL8A 1UBUS 2GD2A 2IZ5A 5E2AA 1DIBA 2X8LA 3RKSA 4IGEA 2NO0A 2QTZA 4HZGA 3CEPB 1WPQA 3V33A 4TS1A 2Q5HA 3FOBA 4GM0A 2H5IA 4M0EA 3NMUF 3LPCA 4MP3A 3WB1A 3DPIA 2PBFA 3G1UA 3MTIA 4NQRA 9MHTA 2QLMA 3TINA 2E48A 3K9CA 4MHSA 1KZ4A 4MTLA 1VPTA 3CJRA 3QIVA 1N2HA 3R3ZA 1F8GA 2FN4A 3MW8A 2QG9A 1GQFA 1N78A 3DR5A 4XJSA 5E95A 3WMEA 4YAGA 2QP9X 3AGPA 3ESYA 1KERA 4Y1RA 2ISSD 3HY4A 1E5QA 2NP6A 1TM7E 4LY6A 5BW4A 1LK5A 3GXOA 3TJMA 2IPXA 3P0EA 4G0ZA 2R8ZA 1UMDB 3HWSA 4EP1A 3EPRA 3F74A 4C3ZA 2NXWA 2Q4BA 2VHCA 2DPHA 2VNKA 3C39A 1VIDA 4FJ1A 5DO9A 5JD3A 1K4YA 2JI8A 3AIKA 4IJ5A 4J7AA 3Q8WA 4I19A 1GKLA 4KGVA 4R01A 3D7NA 2LCQA 4PINA 4KQIA 4ZGBA 4URWR 1QHXA 3F0TA 3HCBA 4D9NA 1IUOA 4L9RA 2ZYSA 1QWSA 1E2JA 4UEWA 1CZLA 3THWA 3PUVA 4RF3A 1F8FA 5EIXA 2GK4A 1DO8A 2QTNA 2I3GA 3UWMA 1Z45A 2CBGA 5K03A 5TX7A 3R5JA 5FXMA 4TM8A 4CT0A 2DZDA 2JGLA 3RS4A 3SF8B 4HH0A 4CBVA 3G85A 3HGTA 1TZKA 2A9VA 3E2PA 4QC2A 4BO2A 1SZJG 4D92A 5ITZA 5ITZB 2EERA 1D2RA 5AVJA 5HQ3A 4P2GA 1QKIA 5SV2A 4FGKA 1R4NA 6NULA 4R69A 4J0KA 2H3HA 2X5KO 2JFQA 2R6HA 3PCRB 2CLKB 1VPLA 4D4HA 4KVGA 4OK6A 3NUGA 3BT7A 1KEZA 4DT1B 3I2IA 2VH5R 1E1YA 4OKNA 5A5DA 1VMAA 1RSZA 2ZT7A 2ZVDA 4C20A 1N0WA 2Q2NA 3WMFA 4B73A 3R5FA 3CEAA 1SIWA 2F9MA 2W2LD 4PO3X 4K9NA 2O5RA 3HU5A 4G37A 3FCAA 4IDEA 1XLVA 4OVKA 4TSKA 2PV0A 3DAFA 3OHMA 3Q3VA 4IVNA 3QU4A 4CKEB 1CS0B 4RV9A 2FWAA 4P83A 1FMTA 3MRSA 1UZLA 2WKSA 3LFTA 3N5CA 4IWNA 3SQXA 3TW8A 1U2SA 3B1XA 1SFRA 3IQGX 3R41A 3DV2A 4X66B 3FNRA 2NM0A 1A72A 1LPAB 4D3FA 3FOAA 3E1KA 5JZBA 5AVYA 2J3HA 4G1UC 1PR2A 1Q22A 1IN6A 2F3PA 5HBRA 4EHHA 4MHTA 2PGAA 3DZGA 4EZIA 1Y48E 2EYUA 3T7CA 4E22A 1U0JA 4HLNA 4GC9A 1F4PA 3EWAA 3K9NA 1T36A 4PXAA 3TQQA 4LF4B 1JQKA 2B30A 4TV9F 1RZ3A 2PEZA 1EXNA 3FFXA 3OQBA 4LECA 2VL7A 7ABPA 2IYVA 1WRBA 2GT1A 4B6EA 4DIUA 2M1XA 3LQ4A 1NDUA 3OCZA 1DS6A 1E8NA 1XXLA 2BGLA 2IHVA 2QL5A 4QJ5A 4BAUA 1Z0UA 3I45A 4F5WA 2Q2OA 3QFSA 4PIPA 1CUDA 3VPCA 3T38A 4MARA 2V65A 1L7RA 4PYOA 4Y67A 3H2HA 4MKZA 2JDID 3DCJA 1U0OC 5ALRA 4BZZA 1HX7A 2DR3A 1JR3E 2D74A 3BIWA 2C7VA 3L46A 2I5PO 3EYAA 3HUFA 3HU1A 5K3DA 4K3UA 3EZFA 4ZI3A 2HK6A 1NOJA 2X7XA 3RSOA 5CG1A 1ORVA 1TF7A 4L8YA 3D59A 3HB0A 1XKQA 2CLCX 1Z0JA 1Z8FA 4YRKA 1VIMA 3NRCA 2PWYA 2V4MA 5I5GA 4R1QA 1DQYA 1XK7A 3QX9A 4JUDX 3M6WA 2ASVA 2YXPX 4TYPA 4OUDB 2YFHA 3PGA1 4WEOA 1WS6A 1RR6A 4A8PA 4H6WA 4D8WA 2Y76A 2Q9BA 4TMXA 1GPBA 1OROA 1YHYA 2IV2X 3WLTA 1BEZA 3DBLA 4B6RA 4ZHQF 3IP9A 4TV9A 4QVGA 2TMGA 2CVQA 4UCXA 1Q7RA 5B3LA 5C5CA 1KTIA 5TY0A 3CUEF 5CFPA 3GUYA 4E5MA 1PWXA 3ULKA 2VJMA 3EUWA 4MIOA 4OFWA 3N05A 4JR0A 4RVGA 1LJUA 1EFDN 5KQGA 4CEHB 2R7KA 3DT8A 5AIBA 1FSGA 1IHUA 5A3QA 3GH3A 1J2JA 1V11B 3TGLA 2HTEA 2ODNA 3ZI7A 1H0RA 1IJKA 1EVJA 1HM5A 4HQLA 2H4YA 4MW2A 4PO1A 4ZP1A 4BP1A 2C84A 4Z1MA 4U2EA 1HOXA 2VDNB 3H1PA 3PB3A 3CUYA 1AUOA 3JARA 3TWOA 3ZCTA 4YT4A 3HDVA 1JIIA 3UPTA 3T06B 3HB4X 1X13A 3D0QA 3MCUA 3JQ6A 3JX9A 5DNVA 4FEAA 2QV0A 2DFKB 4IHJA 3F6SA 5D1NA 2ZT5A 2ZZNA 1C41A 1VKZA 3PXDA 5BWOA 3C4VA 1FFAA 3CONA 4DC0A 3OOJA 2OVFA 4RHEA 1V3QE 2C4TA 3CNOA 3MRXA 3DUFB 3IAUA 1SU4A 4OSPA 2I7TA 2W0MA 5CPBA 3UVEA 4HWKA 5A5VA 1F5NA 4BQEA 1T36B 5C2JB 3CVVA 3B20A 3P27A 3T15A 2Q4RA 3RNOA 1O0CA 3TW0A 4RM2A 3AF4A 1FXUA 3QI2A 2XODA 5HA5A 2X86A 3HMQA 3O93A 3FUWA 4WY2A 1NONA 2NOAA 2ZP1A 2WY2D 3Q6NA 4A0RA 3TX6A 2WAMA 2PH7A 4ZT2A 5KWJA 5DEIA 1GEEA 5K9ZA 5KSPA 1KKMA 1V7QA 3FW1A 4F4UA 1DB3A 2NO5A 4PQYA 3H2IA 3IH5A 4YV1A 5LQRA 4Q5IA 5GM2A 2HTFA 2W43A 1WMBA 4KN6A 3IVRA 4OGKA 4E30A 4EYEA 1RAFA 4KE8A 2CHUA 3DT9A 1RLJA 1VYHA 5A4KA 3EC7A 3GT3A 2WIAA 2BBOA 1H9AA 4UTNA 1IIBA 1UXOA 4FE3A 3E7XA 2Q49A 2B8TA 4IIXA 4GOJA 3KXLA 3EXEA 3F6BX 1QP8A 821PA 3VO1A 4R8SA 1AD2A 1WW2A 3WNCA 4YRAA 3DKKA 5HIMA 3ZU2A 2FZVA 4BL5A 1W0JA 4CG2A 4F04A 1MAHA 2ZBUA 3BDVA 1Z36A 4EGSA 4RM3A 4FCTA 3U4QB 1NR5A 2CJWB 3U4QA 1Y1QA 2P2YA 1E0KA 3FJYA 4FYXA 1B23P 1U0RA 1ZD2P 5PGMA 2NYAA 5CVCA 2X7JA 1K0FA 2PVPA 2ENUA 4G1BA 5FBQB 7REQA 7REQB 3CKMA 5JD6A 1SHKA 1C4WA 2H1LA 5HPYB 1IXYA 2OGSA 3M5PA 2R6DA 2A78A 1NDHA 4D99A 2BMJA 3ESRA 3GEMA 4K6MA 4KOEC 4YV0A 3O74A 4C3VA 1DEHA 1FJ2A 2HCBA 2ZANA 4W9NC 5HKKA 1ZJYA 1M0SA 4CMEC 4DMCA 8ADHA 2GPBA 1P0FA 3R8FA 1KYXA 2CBZA 1HPLA 3SI7A 3HRKA 1DRUA 3AB3A 2MMGA 3PHLA 1UBJS 1HZZC 2JPDA 3DL4A 4P84A 5LLSA 5C4GB 1KI7A 1PJ3A 3IUNA 4INAA 4A3SA 3FDJA 2R62A 2C3PA 5BSUA 1NMZA 4BZXA 5C7YA 1E1CB 2A3NA 3GWGA 2QP3A 1RI1A 1JN0A 4KREA 3DLPX 4BPBA 4EAQA 3DYIA 2XDQB 2N46A 2PTHA 2QKYA 1GFIA 2OEPA 1VHTA 1PFQA 1EFTA 2HCJB 1UK6A 4OAQA 1Q20A 1RQ7A 4KODA 4RZQA 5FOTA 7AT1A 1F8UA 1HDIA 3U7QA 1YRYE 4EUEA 4FYVA 3EEYA 5DBEX 5JVDB 2PYIA 3O8OB 4DMUB 5LQJA 1O6GA 1P73A 4Z2AA 4F1KA 2P6RA 1U7WA 2O1XA 3P97A 5ARCA 1T4CA 2WJ3A 2ADMA 3PC8A 2OGZA 2EP7A 2Q8PA 2XKAA 3KT0A 4FLFA 4K2HA 5HIJA 5J47A 5L4NA 2HQSA 3GG2A 5JAZA 1W6UA 5HJ5A 5FDFA 1TCCA 3P4YA 4PYJA 3ZE9A 5ENVA 1B0UA 1NSYA 3R6DA 4UE2A 4BFYA 4DA6A 1KU0A 5I4IA 1OC4A 1YZ3A 2RI0A 4TTTS 4U2KA 2WG0A 4RPIA 4RZUA 4V0OA 3S28A 5K6AA 5K3CA 2H8GA 5JXIA 5JYEA 3MIZA 1I3CA 3GAMA 4K40A 4NATA 1EXVA 2LIVA 4ZCPA 3COPA 3MYRA 3ZWCA 4WCFB 5FPPA 2SKDA 3BSFA 4LYGA 4MGKR 4CM9A 1JW9B 1QF9A 2XMGA 2C4NA 1XWIA 3BGOS 1Y6GA 2G1UA 1RYYA 2COKA 4INPA 3IPRA 3BD8A 3J7TA 2IEGA 2UZ4A 3QY9A 4GQBA 2H2DA 2J46A 2NV0A 4YROA 3RNLA 3AUXA 3R0VA 3EA4A 1ZIXA 1KMNA 3IV7A 3NU1A 3LUHA 1KZ6A 6ABPA 5JZSA 4JYZA 1GSOA 4W5TA 4MKHA 5DLQC 2G9QA 4EL0A 2EX0A 4AWXA 1YNOA 2AVNA 5FTJA 5DE3A 4FQ5A 1OJLA 4DA9A 2FPWA 2I7XA 2VKTA 5A05A 3NHUA 3VSCA 5EQDA 2BR3A 2HREA 3HBLA 3OX4A 2CGEA 2HIMA 4CTMA 4ASUA 2WM8A 2ZBGA 3CZ9A 2HJRA 2R6GA 4EHNA 3K35A 2DLCX 2CL6X 3USES 3G2KA 1TZBA 3EPPA 5I7SA 5I3ZA 1NNSA 5JJ5A 4XVCA 1ZCJA 1LD3A 4GYYA 1VG8A 3M6UA 2HPVA 1FPQA 4NSNA 5BN3A 1DT3A 1U3WA 1HNZB 5L7WA 4QA9A 4EUKA 1JNXX 2A5LA 3AZPA 3JQGB 1DFIA 2QQEA 3RYTC 4RTLA 1H23A 1Z25A 1NT4A 3QU7A 4YQYA 3NHSA 2PUFA 4KKVA 2WYWA 4B82A 4NVRA 1XZHA 2Q4EA 2WF9A 2XCIA 4OA8A 1WHSB 3TJZA 1IRIA 1SR8A 4JA0A 4L0CA 2IX9A 2G5PA 3VV2A 1YI1A 1UMCB 1GXSA 4N5MA 3U4MA 2H16A 1XG5A 3QLVC 4QTXA 1DXOA 3GMDA 3MIIA 4AB1A 5KX5A 1T8RA 5J4LA 3EJWA 5LD2C 1Q1EA 3RU7A 1T43A 1U4OA 2P68A 3OIFA 4V3BA 5L3SB 3AEKA 5L3SA 2QMZA 4D9CA 1IZYA 4RPKA 4ZHQB 4HTAA 2AG5A 2HH9A 1RNLA 1NPTO 4PFQA 3OEED 2VT2A 1NE2A 1CE8B 4IG9A 1N77A 3N2KA 2IL1A 5J3JA 3TQIA 421PA 3JATA 3PIIA 3L05A 4N8SA 3CUWA 2RHLA 1TXGA 4HNAA 5KOJA 1M2KA 4FIDA 4OXXA 2YW9A 3SEAA 1NW7A 4R9SA 5GZ1A 1H2FA 3GAFA 4H4DA 3LL4A 4MINA 1DOHA 3EQ2A 4TTVA 3B9RA 3TAXA 2RFLA 4MS3B 2HN9A 5B58T 2P4UA 4TL8A 3SE7A 5A9TA 4JXZA 1EDZA 4O3MA 3D1JA 5CDYA 1WTAA 1A9ZA 1JE0A 2PZKA 1QGUA 4JC8A 1GNPA 4GSKA 1XDGA 1E77A 3HCPA 3WR5A 1DBQA 4KI0A 1C8KA 4Z9YA 4CHGA 4ZYVA 1CIPA 4YR7A 4DR1B 5JUWA 1JR2A 4LHVA 3I32A 4JLJA 1W25A 2CHVA 3ZBQA 5ALKA 3JWJA 4AO7A 1Q7EA 1PFYA 5FI0B 1PJ4A 3F6CA 2W2PA 2YWJA 3IPCA 1ESCA 1YQDA 2R8XA 1SXPA 4JL5A 4MS1B 4M87A 1F8XA 4DUYB 4KPUA 4D79A 1JQ3A 2H06A 3IA2A 3QVGB 1CEEA 1PHPA 4X95A 3EAFA 5F1OA 4DDTA 3CURA 3DEHA 4I1RA 5KTOA 1VJCA 1NQXA 1II8A 2IIBA 1IWBB 1OREA 3ZOZA 3KXIA 4QODA 8OHMA 4FSHA 1KK1A 4OXYA 1J99A 2QYHA 4D0SA 3DMHA 4OXNA 2AXPA 1M1NA 3I23A 1KDRA 5DTEA 4O2RA 4LF6B 2MINA 2B6NA 1ODJA 5DHAA 2JI6A 3W1WA 4AU1A 2ZIXA 4JC4A 3OJLA 5H3CA 5IXSA 1EFRD 1HMPA 1L8QA 1MF7A 3NVKI 1HKHA 2QAGC 3CEHA 5T7BA 5L3RA 4LPKA 1Y9AA 1Z74A 1R6DA 4WRRA 2NTNA 5CXXA 4I50A 1ZSNA 1XZDA 3D2LA 3LUFA 3ZBPA 1JZTA 4RTJA 5DYYA 1CQWA 2R2AA 4KFSA 3R9XA 2ORWA 5I5EA 1CJBA 1OPRA 4Y8VA 4FR2A 3KKPA 2C98A 2EKDA 3I6BA 4RSRA 1QKKA 1Z34A 5EPEA 4AXXA 3T7AA 2DVMA 4OMUA 1OKKA 1WP4A 4UTOA 2WU3A 3L6EA 3CW2A 4R16A 1XTTA 2JHCA 1XPUA 1SCUB 4AJPA 2RHGB 2BMWA 5FORA 3I5XA 4HAOA 1IE3A 1Y6JA 3PNBA 1FQKA 1YB4A 2HV8A 3EMKA 4FDLA 2A8YA 3T5GA 1CZRA 3Q7QA 4KWCA 1FU7A 1FBTA 4NNPA 1L4EA 1GTMA 5JS1A 4Q3CA 4RMJA 1H0KA 3I8SA 3BMXA 4AMYA 5EJEA 3L9XA 5CVUA 4BNWA 1MZPA 4XIJA 1ZCZA 3F47A 2R66A 1WDKA 3SQOA 2VPIA 2HHCA 4N12A 1Z12A 4XYLA 3TLZA 1XTZA 1BX1A 5JNSA 2ZZKA 3S5JA 3TM4A 4MV5A 4F2GA 1V8PA 4QLBA 4UARA 4P5PA 4DMLA 1PGOA 2CF6A 5GJWC 1JE1A 4QAQA 1QE5A 5EE9A 2W22A 3ZU5A 4KPGA 1Q12A 2I7CA 3QVKA 4OBBA 2ZROA 5JMWA 2HB6A 1HE1C 1Z0KA 3MINA 1K3FA 2BFAA 2VAMA 3IKMB 5TXGA 3NDRA 2PUCA 4KHPB 1Y6FA 5BPHA 4GE0A 4ZWNA 5LYJA 4F1JA 4MQFA 3K70D 5IKXA 1P91A 2DWQA 2WM2A 1X1SA 4C4RA 1RQ2A 3TD2A 1FMFA 2QLTA 3BL5A 4I66A 3IV9A 4GWLA 1CQJA 4O02B 2UAGA 4JUCA 4R1NA 3IQZA 2JFZA 5GZ3A 1RRPA 2AC2A 1L7MA 3L0OA 3PFKA 1YFZA 1HRKA 3PNPA 3U2QA 3WZLA 2JLQA 1UMDA 2IS6A 1L8OA 3K1ZA 4LJ6A 1TKAA 2Q3BA 4TUYA 3OE5A 1LI4A 3OI7A 5EZSA 1F5SA 1Z4PX 2WF8A 5REQB 5C7IO 5DULA 4DV4B 4M8KA 5ARDA 3LLSA 5CLIA 4CTKA 3AERA 2XZPA 3LX4A 5HF6A 5LLDA 2QR3A 2GS9A 1RMTA 3HWWA 2ODQA 3BEOA 4RTPA 1AG9A 1X9IA 1JEAA 4Q1EA 3VVMA 4UQPA 5DHRA 5TIIA 5AVOA 3UUGA 1NVEA 3D8UA 2HQ1A 4YH1A 2JEYA 1EP1B 4FR0A 4IH1A 2DBYA 4RNDB 3TB4A 4R8KA 2AJCA 1ZNWA 5DBGA 3CKYA 1QF7A 1T2CA 2LCIA 2X8BA 1EK1A 1QYCA 4BFTA 4ZCRA 5LQDA 1OFUA 2OAEA 1R6BX 2JFBA 3H86A 2WKQA 3O8LA 4F21A 4HRAA 2R68A 3KQQA 3UAWA 1TLTA 4M22A 1E58A 4W5QA 2B7CA 3NHRA 4NI5A 1K97A 1Z4QA 2C83A 3MBOA 4KQKA 4D2IA 5I9LA 4K46A 2BFEB 4C5CA 2QRQA 1OHHD 1NKVA 3PXEA 4BWGA 1XTQA 4I81A 3NFRA 2ZJ1A 3PLNA 1JNYA 5BUZA 1CY7A 5J4HA 4N5DA 1N1MA 3FRHA 1TM4E 2BEUB 2E89A 2GGSA 4QU9A 2F9FA 1M2OA 3QA9A 2WC1A 4IEFB 4R0MA 1AKVA 5AWFC 1K6MA 4DY4A 3V7UA 4YK7A 1OTYA 2Z57A 2EHDA 1KR5A 3LC1O 5F7XA 3SBEA 1DG1G 1PYGA 2VDQB 1JHQA 2KE5A 4IOLA 4Q12A 4ER7A 5EJ8A 2R6AA 4G2TA 4Y7DA 5G3YA 2PGDA 4LYJA 3LYHA 4NBNA 3SR0A 1Q0LA 1T5TA 3H75A 4JITA 3M3DA 3SN6A 3TR5A 3V1UA 4PANA 4B46A 4EB8A 4ZCIA 4K81B 2VUSA 4BHTA 3S8YA 1LV7A 1TRHA 3UK6A 3ENNA 4NYIQ 2RMKA 3SZ3A 1M1YA 3FVWA 5K45A 2PL3A 2XUOA 5FA8A 1OXXK 1CJUC 3FLAA 3H1EA 4M88A 1U3CA 4ZU3A 1Z73A 3URMA 1RI5A 3IRUA 5FL7D 3H6KA 2X3UA 3F6PA 1DJLA 1R3UA 2RHTA 3OJCA 1IULA 1QTIA 1W47A 2PA0A 1G21E 1NXXA 2PT5A 1ZHFA 4PLVA 4IXDA 4EELA 4ZZIA 1U1IA 4ER6A 4C76A 1AMUA 4H4CA 3R24A 2W2VA 1M34E 3P9YA 1MKYA 4C21A 4RBNA 5TPZD 1ZXXA 4ISCA 5EUQB 4BB5A 1NW9B 3NS7A 5TB5A 3NHMA 4F97A 1MU0A 1D1SA 1WD5A 2J4FA 1J4AA 1F48A 2RHCA 5FNVA 3IULA 3ZDZB 1E9DA 1DAGA 1JX6A 3QUQA 1N2BA 1YU9A 4HPXB 4R68A 2DRIA 2K4MA 3LQ1A 2QZ4A 3ZHTA 4QUJA 3FHLA 3OZWA 5F7OA 3NLLA 3HBMA 3LG2A 1QMGA 1KZ1A 1PZNA 3B1VA 1XMVA 1NVKA 1A96A 3FLMA 2XEDA 4Q3EA 4ZO7A 4FOOA 1VG9B 1RWBA 4YCDA 5D3QA 5BYKA 2CZQA 4ZEVA 2IITA 3O0DA 4UBJA 4Y6RA 2H4HA 4LSWA 3QXCA 3GNLA 3J81A 4US1R 2VJPA 4ARSA 1SXJD 4IFEA 2WM9B 4CT4B 3LSYA 3IPLA 4MYTA 5FCDA 4YCMA 2ZXUA 2BDTA 3EIWA 3RTDA 3IQEA 2XHEA 2EHJA 4XIYA 1NRWA 1V9CA 1NY5A 2FPGA 3PXUA 1E3SA 4HDNB 4OXQA 5DCLA 4CF4A 4HDNA 1V71A 4AS1A 4R9RA 2PNJA 5ICMA 3STHA 1M8JA 2IHNA 1SMKA 4KGZA 4OX9Y 1DARA 2PZGA 5JO0A 1DQRA 3Q7IA 4WERA 4Y3UA 1GDHA 2HBQA 2IXEA 2BM1A 3PNYA 4JAVC 1B41A 4C0BA 5ER9A 1P4RA 5JALA 1HT0A 1XMQB 3DGEC 2H07A 1XQ9A 2FW1A 4TRNA 2R5WA 2GMWA 3FLBA 3TIXB 1BO6A 1SZDA 1WEKA 3OVMA 5JSFA 3DF7A 4V0ME 1EK2A 1BE1A 4NEHB 4QLOA 4QTTB 1YQWA 1BWSA 1AMNA 3C97A 3EGWA 1DX9A 1H9BA 2FZEA 3LD9A 2IP4A 3LVQE 2EKQA 3PKJA 1PJ2A 5CM8B 5ILGA 3T94A 2X13A 3WICA 4R0VA 1GHTA 2IU4A 1UAYA 2X58A 1RU3A 1YL5A 1CSEE 1FVXA 3AT1A 3IR7A 1K5PA 3C7AA 5EUMA 2XQJA 1SEVA 4L08A 4N03A 1R0SA 2XE6A 3C1UA 2EBHX 3PQ8A 4D80A 2YJTD 4FE4A 1TU3A 4UDYX 3RD5A 5D2CA 4CMJA 4G1FA 3HXQA 5F9HA 2V03A 2JL1A 4I5GA 1CYDA 3C5EA 2FHPA 4ZVSA 1OLSB 4ID9A 2PJZA 1MXHA 1V8ZA 2O2CA 4HH1A 5HS6A 1MORA 3ZJVA 1BGXT 4TS4A 4ZZ3A 3OJXA 4IV0A 1TUEA 2X9VA 3PYXA 1FTGA 1LK0A 3DTVB 3DTVA 1USVA 1WV1A 1Z26A 2VWGA 3ZNOA 2R8PA 4A5OA 4DIDA 2FYTA 2QTVA 5J4YA 4KGDA 3BK1A 4MB2A 4CQMB 2B6HA 2VDWA 4D1YA 1BS9A 1DAPA 4NP6A 2Z2KA 1DWQA 1IY9A 1AX9A 1RVV1 1QH1B 1T0IA 1ZK0A 3CMMA 4NU6A 2C4MA 2VJNA 3BUSA 3WNVA 3MD9A 4PICA 4G4SP 1GLNA 4BQPA 5CT9A 2NG1A 1UJBA 2ZRFA 3EC1A 4MPTA 4QD3A 2P3SA 4ZJPA 3CX3A 3BMOA 3L06A 3QKTA 3VR5D 1NKSA 3GQBA 5K0NA 2PBZA 3LYUA 3HCOA 1CS0A 2J3LA 2PZJA 5CA1F 3Q0IA 1E4YA 2JFGA 2YZKA 1XL1A 4J07A 2B5OA 4CLRB 1UINA 4XW2A 3OIDA 1UM9A 3CF2A 5L4SA 3FROA 2O54A 3ZVNA 1JEYB 4BMVA 2Z4TA 4Q9IA 2HSGA 2GZMA 5DSZA 3IUSA 3G2LA 2HCFA 5IWAB 4JFRA 1G5RA 4QBTA 1X7ZA 1E79D 2GK3A 3SC3A 1C9MA 4F5DA 1ZM4A 1X9GA 4ROTA 1EDBA 3ND6A 3MG9A 1FF9A 1PVVA 3BD6A 3TEJA 5E6UB 3ILHA 4OG2A 1PJTA 1BS2A 4RA6B 3WDMA 4EBBA 4N18A 1QH8A 4K9PA 3AVWA 4D8UA 3QPUA 3H1FA 3LZDA 2O23A 3CCBA 3ZNQA 4E2ZA 1H4SA 2XJ9A 2FFHA 3KTOA 3LRPA 4B76A 4GGOA 1W36D 3VR3A 1GQ2A 4TZ6A 5JC1A 5KBYA 5HF8A 3VDNB 4DOMA 1NU8A 3L0DA 4L4XA 4LV5B 4CN9A 5SYMA 1ZAKA 1I1QB 2AYYA 4MV0A 1ZQ9A 5AJYA 4PPGA 4OI4A 3W7VA 1JXOA 1B16A 1H6CA 4HNGA 2YRXA 4DTIA 5K8IA 5KTNA 1UBGA 3SS7X 1YKGA 4K9KA 1E62A 3PENA 5JBIA 4MI9A 1Y7IA 2FVYA 3FUXA 1PD0A 1QU2A 4A0SA 5AM5A 3RUFA 4NMWA 4HX2A 2CB9A 1CERA 2XPCA 2JLYA 3U7EB 1DV1A 2COEA 1ODLA 3CN7A 3ZWQA 1XVLA 1XDZA 3EVBA 1NUAA 1P72A 2GYVA 3K9FC 4RZHA 1D9ZA 1N5JA 2XLBA 4FE7A 4I55F 3EZYA 3ROTA 2O8EB 3RUAA 3SJZA 3HGMA 6AT1A 2JGDA 2HQRA 3CWZA 3I83A 1W0KD 2EKLA 2VJBA 1NQUA 4PLTA 5CEJA 6ADHA 3LBIA 4DGSA 1NTOA 3WB0A 5C80A 2HMVA 3IUMA 3DZKA 3TL2A 5DM1A 1NG9A 1QH1A 2R48A 3A6PC 4B6OA 2ZYGA 5ICCA 1BD3A 4CIAA 1RHUA 3P9QA 2GKSA 3PC6A 2PGXA 2AOWA 1MIOB 2QQ0A 4GWGA 2M6RA 1V3VA 5IMSA 1GGKA 3BZBA 3QVMA 2PHZA 4ARIA 3U4IA 2I2FA 3BD9A 1T3SA 2VHQA 3H0KA 2BZGA 2PRYA 2ZUDA 4LA4A 4XWYA 1E1QD 1U9CA 1QE0A 2XW6A 121PA 3LFUA 4G0QA 4UMDA 3K8ZA 3ZOKA 3AVTA 4BQRA 4AJHA 5JRJA 3S2EA 3I9JA 5FV4A 3RYCA 4GVXA 1USGA 3KSAC 3LXRA 4WINA 1U4NA 3CW8X 1A9XB 3RSZA 3PC8C 3V7FA 2ODWA 2WWFA 3GXBA 4HB3A 4QWMA 221PA 4Q3LA 3M49A 1ID8A 4MO9A 3ZIDA 3AKEA 3ZY3A 4EECA 5CD9A 5H81A 1JDBC 2V7UA 5JV5A 4D3XA 3LWDA 4HWGA 5J2TF 5ICEA 2PSEA 1OIVA 3L5OA 4N54A 1K7CA 4JD5A 5TS2A 2QM8A 5BV7A 3H83A 3IJ5A 4FXOA 3Q3CA 5GAJA 1OBHA 3V1YA 1GD1O 4Z9AA 3OZGA 4JYMA 5SYAA 1TW3A 4ZVMA 1EZZA 5KSWB 1Y8AA 4FD3A 4B4VA 3LCVB 2CXRA 2D8MA 2OBXA 2P6PA 4P4SB 3TZBA 3F8WA 3PQ4A 5KYKA 1UJNA 3KLNA 1S2LA 3V8RA 1EUCA 2J0SA 3UHJA 1YZYA 1G8HA 4WDQA 4F0JA 1FFXB 3FKSD 1JFSA 3BDIA 2PRJA 4DV6B 4ZQCB 3EIEA 4G5SA 1HSZA 5JD5A 3CJQA 1PZHA 1E2NA 1VL8A 4IUDS 3DDCA 4BJ5A 1G63A 4GR5A 4DCUA 5FI5A 1A1SA 2PLNA 3GOHA 5GJVC 4FFLA 1JIJA 1HZJA 1A5ZA 3ZVRA 3KU4A 1U8FO 2G4VA 4LJKA 1D1TA 1EWVA 2GQ0A 2W2XA 5BW6B 5D86A 2FZ4A 4LNUB 4UHHA 1EGAA 3A6HA 1U8UA 2IGBA 2NU9A 2RJ3A 3UJ9A 4TYNA 2JGJA 1QYXA 2GRAA 3CRNA 4V0LA 5CDGA 4P4NA 2FLVA 1NNEA 1U9IC 1CTQA 3EOZA 3WIUA 3GGCA 4WBXC 2LZ0A 4JXJA 3PSHA 4QYSA 1ZA2A 3TNDA 4N82A 3CH5A 1X92A 5TR9A 2JGFA 1TO2E 4M0UA 5DX8A 3EAQA 4MCJA 3D31A 1WM1A 4QREA 4BWVA 5CB8A 1RBZA 4YLEA 4GMKA 5EIBD 3AVOA 1AIPA 2PSSA 3JPYA 4OHKA 5HOEA 1IZ9A 1OASA 2A5GA 3ICEA 4YB8A 2JLWA 1UODA 4RC9A 3NRJA 2NQ8A 3NIDB 1X8XA 3ZX5A 2C7RA 1U28C 3DTYA 3U5TA 1PW7A 5HYVA 5EJ4A 4UJ5A 3ZGZA 1PK7A 2FLKA 1AO3A 2OKGA 2P77A 5DMHA 4IHAA 4WJLA 1DEXA 3NBQA 5ALZA 3A7EA 3NYRA 4ZCMA 1ZNZA 2ID9A 3E9CA 4QYIB 5DBHX 1VSVA 2CFRA 3GROA 1M34B 2C9BA 3WB9A 2VJAA 1EBUA 3IIMA 3NAQA 4P31A 1GFWA 4MRNA 2WAYA 3EY4A 4Q4LA 4LSZA 2MSEB 1OSNA 2GEFA 1H2WA 2YWGA 3PNQA 4K2AA 5TV2A 5DRTA 3GG9A 1CUXA 4BNMA 4HXYA 1DAHA 4CDMA 4WSOA 3G5TA 3Q4GA 1Y3BE 1ESEA 3ROZA 2JGIA 3D7SA 5E1BA 4UOQA 3WWEA 4L95C 3X1ZA 1EX6A 1ZYUA 5B2EA 3EG9B 3VAYA 1XZIA 4C89A 1H85A 1N9KA 5LZ9A 3B8HA 3N7AA 3V97A 1R64A 1XJCA 5LZ2A 4ZVNA 2Q9AA 4G89A 4OL0A 1QGAA 4M4SA 1NU6A 4OTZA 2IZOA 4NX2A 3V5NA 5L51A 3KPWA 5DIFA 3AKYA 4KDFA 5BSKA 2IU3A 4U7TB 3FUCA 1C8LA 2NV6A 1QSGA 1VHLA 3IAFA 3NHLA 3NTOA 3RVLA 4NCXA 5ENZA 4RIFA 3EULA 3TQOA 4BQNA 5KJ6A 1ZZEA 2PZEA 5EUCA 4EEZA 1RWPA 1VCMA 4YRMA 2UUBB 3EFHA 4H16A 1FK8A 1W8DA 1JDSA 2BHLA 2PSFA 1BKYA 3DD5A 3L4JA 1SPXA 4OM8A 1JIQA 4IKPA 5FLYA 3ZH2A 1EFRA 2BTQB 1BXRA 1LPSA 2WG1A 4U2GA 3ZWAA 4AJ9A 4TQAA 2QVLA 1TAGA 3P0FA 5U4XA 1PYDA 4E51A 5A4IS 3PEEA 4CKBB 2KM1A 2IUSA 3LCCA 5GIOE 4QNMA 5ALSA 3TTUA 3DC2A 3AKCA 3FCYA 4MUJA 4PYQA 1YRAA 2J3EA 3LT5A 5B7GA 2IE8A 3GP5A 4GO1A 4R8LA 3U3KA 3L9WA 2AMYA 1EINA 1I80A 1NLUA 1ONSA 1SVSA 1V1RA 1V1RB 1NUTA 2H0AA 2QZJA 2VDUE 1YQTA 3BIXA 1APBA 1LBQA 1QOZA 2GCOB 1Y3HA 3RWOA 3ZE8A 2V7QD 2VP9A 3IODA 3W6ZA 4L0MA 5IZCA 1QUFA 1N5DA 1T6YA 3T7JA 1MVNA 1RT9A 2XOEA 3BQMB 3MT0A 5MN5A 1RYHA 3IJRA 1GSIA 3SD7A 1FXWA 2E49A 4YAJA 1E94E 3BK2A 2G40A 3V6MA 1UDRA 1Z8HA 3CLSC 2II6A 3O03A 5KTPA 4TLBA 1OLUB 2VLBA 1QH9A 2J32A 1J8DA 3AHJA 3O47A 3RT9A 1YS2X 2RK4A 3A4TA 4RSMA 4W6ZA 4J7UA 1XD8A 4Z3DA 2CYCA 2O2IA 2Y8EA 3LC0A 4MGYR 4ZOAA 2IYFA 5ALNA 5TGDA 2ZKIA 1CB0A 1CUJA 2A5FA 1PT8A 1T2AA 2XXBA 1K9VF 3B1FA 1QLWA 1FDSA 4BFLA 2XITA 4X8OA 4ABYA 2JIBA 4ZYWA 3UKOA 5J2UA 1RFLA 3PHCA 2FWPA 2KS6A 3KKMA 2D2IA 2FV8A 3A4MA 2DLDA 3JQCA 4QRHA 2XTJA 3CO5A 4G67A 2HRBA 3TIGA 3HJFA 4E3ZA 1ENZA 5JNUA 4MWCA 1EGVB 2OPBA 1UFVA 4YRBA 1MJNA 1CVRA 1CQZA 2AS0A 3PXBA 4HH4A 4MRMB 2OCDA 1RRMA 5AXAA 1X14A 3OQIA 3DO6A 3BIOA 4JGBA 3O4IA 4TMTA 1BH6A 4FONA 3VTFA 4D97A 3GFOA 2J6CA 3MJSA 4QGHA 4Z0TA 3RARA 4JJ7A 4IWXA 4HMQA 2XUIA 4RVHA 2ZTVA 1VCHA 2OCKA 4P8RA 4JDPA 5B57C 3SFVA 1BXZA 2QTTA 3MCVA 1DTEA 1QHFA 1Q0QA 4W4TA 1J90A 2XD9A 4NU8X 4Y2VA 4CIWA 1QJ4A 2G09A 2BYTA 4MIEA 5CDUA 1WU8A 3PXAA 4Y6SA 4Y9TA 4FGWA 1L5HA 2OOKA 2GZ3A 3LM8A 3MS2A 5JANA 3WHPA 5MFPA 4GKJB 1YB5A 4N7BA 3AOEA 2BFBB 4KWIA 1VE3A 4F60A 1QIFA 1TIPA 3WHLA 4ZT4A 3ZJ4A 1ULBA 10MHA 1SUAA 1XV5A 3LCJA 5HP4A 1N2SA 3Q87B 2YV3A 4OP3A 2B7BA 1XKLA 3ER9A 1MT3A 1J0AA 2YXNA 5E6SA 1ZO8A 3R0QA 2FFBA 3A1TA 1B6RA 2QLLA 3JRXA 3OMWA 1CF4A 1U9IA 2FWBA 1DJQA 1LBHA 2VPZA 1G2OA 4IHKA 5C3UA 4U02A 3WV5A 1GTZA 1EI9A 1U2DC 1XDUA 5K2MA 4B4DA 1XMIA 4RLSA 4QJ4A 1GPJA 2JJ1A 3RC9A 4UCFA 2DPXA 2UXCB 1QCDA 3SM3A 1XMPA 4JL6A 5KVAA 5MGBA 1IK4A 3CO0S 2VF7A 3ZU6A 4CV1A 5C7LO 4NBUA 1DUVG 3G2OA 1XA0A 1U8XX 3CLTD 4C0HA 1TPYA 4FD2A 4RFLA 1RBMA 2GUWA 4C30A 5BRAA 4MVJE 3HBNA