2CHFA

Structure of the mg2+-bound form of chey and the mechanism of phosphoryl transfer in bacterial chemotaxis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY
molecule tags Signal transduction protein
source organism Salmonella typhimurium
publication title Structure of the Mg(2+)-bound form of CheY and mechanism of phosphoryl transfer in bacterial chemotaxis.
pubmed doi rcsb
total genus 47
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1994-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2chfA00
4G0XA 4H60A 1JHZA 3CFYA 3CLKA 1L5ZA 2MYUA 2IPAB 3OQMA 1NXXA 3SY8A 2ZWMA 3HUUA 2DRIA 4YP9A 2QVGA 2YHBA 1J56A 4FE4A 4JOQA 1FFSA 4RS3A 5TPWA 4WT7A 3TMYA 3GV0A 1SD5A 4MLCA 3KYIB 1P6UA 3Q41A 2WJWA 4ZYLA 5T7BA 3OQNA 3DGEC 4JAVC 1BDJA 3O1IC 1PEAA 3QLVA 4KZKA 5IUKC 1NTRA 3LMKA 2FKAA 5FBHA 3T38A 1KRXA 2PJUA 4YR7A 3FFXA 4DQDA 1A0OA 2MYNA 4IF4A 3EDCA 4MS3B 1YMVA 4TLLB 3UK0A 3SNKA 5CHYA 4IILA 1YIOA 5FBKA 5JNSA 3QLUC 2IOYA 5KC9A 4NCBA 3H5IA 2M1ZA 3F6PA 1Z25A 4ZPJA 5CNIA 4IMJB 3KHTA 3Q7TA 3LTEA 2PKXA 3OLWA 4NICA 5CNJA 3A10A 4MPTA 1DBQA 2E4WA 2QSJA 4W5OA 3S99A 1OXBB 4F8JA 1BAPA 2NZVG 5KC8A 1FFGA 1AB6A 3H5OA 4JP1A 3W9SA 4KPYA 1RXIA 3G1WA 3HSYA 1IIBA 1F4VA 3NNSA 1RPJA 4EY3A 4MR7A 3BRQA 5TQJA 1APBA 2IPMA 4ZMRA 2F8SA 5GQSA 3ROFA 1MIHA 1Z18A 2AYXA 3CS3A 3JTEA 3DLHA 3H5LA 3N6VA 5IULC 3OO1A 3BRSA 4DADA 4EYOA 3HDGA 2TMYA 1K68A 3HK2A 1MVOA 1YMUA 1VPWA 4TMYA 1M5UA 3LKBA 3RVMA 3T95A 2WY2D 8ABPA 3TO5A 1EHCA 4N0PA 4PE5B 4XLTA 1BVHA 3OM1A 4RDCA 3KKEA 1ZAYA 5F64A 1XWWA 4ZJPA 4JB2A 3KSMA 4RKRA 4G0ZA 3H1EA 4PICA 4TLMB 3EQ2A 2CHEA 4H3HB 3RQIA 1RZRD 1JFSA 1B00A 4L4UA 2FMIA 3EJWA 3KJXA 1JFVA 3M6MD 3LFTA 3F73A 2IYNA 2FQWA 1TVMA 3MIZA 5JNWA 1U2PA 2FLWA 4YLEA 4JB0A 1R8JA 1RZRA 2I6FA 4KQ9A 4MR9B 4YGXB 3N53A 2GX6A 3KTOA 5IC5A 5TQ0B 4DN6A 3ILYA 4MQFB 4XASA 4CBVA 4P1ZA 5KQMA 1NXPA 1DP4A 3BILA 1DC8A 2IDMA 3M9WA 3H5WA 1DCMA 3Q15C 5EWLA 4L85A 3TB6A 1M2FA 1USIA 3RVNA 3CKMA 4N76A 1JH9A 1YS6A 2FMKA 2QR3A 3JPWA 4G0QA 4XFKA 2E4ZA 2ID7A 5BRJA 4Z4CA 2PL1A 5IUJC 1QO0A 1D2AA 3H75A 2CWDA 3CHYA 3H5VA 5EWLB 2FVYA 3ROTA 4KREA 1JYEA 2IPNA 4G0MA 4ZMSA 1ZGGA 4KRFA 1W9HA 4GPAA 3FMVA 3FGZA 3N0WA 3TX6A 4N0QA 3H1GA 1Z13A 5DTEA 1PNRA 2JVIA 3OLVA 1NXVA 4UHJA 4Q7EA 3OLXA 3N8IA 9ABPA 1U2QA 3CG4A 4UHKA 5TQ2A 4RY8A 1NXSA 2L18A 1XHFA 2WJAA 4FE7A 4MS1A 1MAVA 3GA5A 1AB5A 4OLBA 3C97A 3GL9A 3OLYA 2JBAB 2OQRA 4G86A 3HV2A 4QYWA 4Z4FA 3N0XA 3D8UA 5ABPA 5TPZA 2A9QA 2A9RA 4JASB 1JFTA 1CYEA 2WMYA 2FMHA 4WZZA 5BRAA 4EUKA 5GOTA 3OMWA 1GUDA 3O1HB 3NBMA 2GI4A 4HNQA 4EVQA 3H5TA 4D6XA 4KVFA 2RDMA 3O75A 2L19A 4N41A 1VLZA 2LP4Y 1D1PA 2QW1A 4QYMA 2L17A 4F11A 3HXMA 4N03A 3T6KA 1LJUA 2QZJA 3O1JC 3TD9A 5FWXB 2W42A 1Z2EA 1ZDMA 3HZHA 1E6KA 3B2NA 1C4WA 1SXHA 3QEKA 4WUTA 2FQXA 1Z17A 4PYRA 1BDHA 4W5QA 4LDAA 2R48A 1TLFA 3GWGA 3RVLA 3OO0A 2M98A 3LOPA 3RVQA 2VUHB 1YTUA 5HSGA 4B09A 3QK7A 3HDVA 2PMCA 3N75A 3MMNA 3O74A 4LE0A 5IX8A 4RK5A 3P9YA 1PEYA 3HO1A 4OG2A 1PHRA 3R0JA 1QQAA 4Z9AA 3I5AA 4RK6A 4RK4A 3RVKA 3RH0A 2MYPA 4O1IA 4HYEA 4EYGA 2LBPA 4FB4A 2H3HA 2RJOA 5TQ0A 4G0YA 5IBQA 2FQYA 3E61A 4E7OA 4RY0A 3HM9A 1D1QA 1ZH2A 2WRZA 6ABPA 3T8YA 2JVJA 3FFTA 3NNDA 3Q7RA 3RVRA 2MSLA 2QU7A 5DLEA 2NT4A 2ID9A 1P2FA 3KLNA 3JS5A 3CRNA 1WETA 4H3KB 4Q6BA 4ETNA 3MYYA 3HEBA 3IP5A 3A0UA 3MQ4A 1DCKA 1KGSA 2AYZA 5KWSA 1KRWA 3IP9A 2FN9A 1U0SY 3HS3A 3KG2A 3DZDA 3O2JA 2NZUG 5JNRA 2QV0A 1U04A 4HNRA 2IKSA 1FQWA 4O5AA 1FFWA 1NY5A 2R25B 4YRZA 4W5RA 4EVSA 5TPZD 3A3KA 1DG9A 5TPWB 3MA0A 5KQLA 3A0RB 2HQRA 5JNVA 2JRLA 3I09A 3QX9A 5DCLA 4Q6WA 3KYJB 3RVPA 2FEWB 4F12A 1LK0A 1TJYA 1BA2A 4OATA 4RZSA 2PUEA 1A2OA 4LZLA 1QPZA 3M9XA 2WB4A 4WXEA 4EYKA 3SQNA 4Y9TA 3LUDA 2PUBA 5JS2A 3QEMA 1Z16A 2RJNA 4W5NA 2E4UA 4RSMA 4XAQA 5TE9A 3DBIA 1QO0D 1ZITA 4O1HA 1QP7A 1JF8A 1MB0A 4KK3A 2BGGA 2PUGA 4Z0NA 1NXOA 3UKJA 1ZVVA 2KYRA 3G85A 4MR9A 3LUCA 4MRMB 3BREA 5FWYB 7ABPA 2E4XA 4ML3A 3FFWA 3EQZA 1ISRA 1U8TA 2VUIB 1EWVA 1GUBA 3UUGA 3K4HA 1DRJA 1BDIA 1GCGA 4MR7B 4NQRA 1L5YA 3NHZA 4RK0A 2PLNA 2MSWA 1UDRA 1JWLA 4RV5A 2PE5A 1QMPA 3QLTA 4YCSA 4KFCA 1PUXA 3JVIA 4MS1B 1CEYA 2O20A 4RXUA 2FW0A 1EWKA 3C3MA 4JA2A 2LPMA 3O21A 1OXKB 2J48A 2GKGA 1P8AA 2JCGA 3JVDA 1ZHHA 4XARA 1EAYA 3LUGA 4EYQA 2JVKA 3IDOA 2PUCA 3EAFA 1CHNA 3CTPA 3SG0A 3QELA 2HSGA 5T3YA 1GCAA 5KQGA 4MS3A 2B1JA 4WXMA 5DKFA 3SM9A 1E6LA 1NATA 2P4UA 5E3JA 1USGA 5EWJA 1ZH4A 1LBIA 1I3CA 2P9HA 4S05A 3JY6A 5FWXA 3OMXA 5JNUA 4YWHA 2FLKA 3F7NA 6CHYA 3QLVC 1C0EA 1QP4A 1ZESA 2CHFA 3LKVA 2WWVD 4RXTA 2FTKE 4PEVA 3O2SB 4NCAA 3I42A 1JYFA 4MAAA 3BBLA 2ZAYA 4Z4IA 1QKKA 4M88A 4D6YA 1QQBA 1VKRA 4RU1A 3CU5A 3H6HA 1ZGZA 1D5WA 3EGCA 3LUKA 1URPA 3L6UA 4Z4GA 4YS6A 3NHMA 3H1FA 4Z9BA 1Z12A 4LRQA 1E2BA 3IP6A 1Z15A 4QICA 1EFAA 2GBPA 1T34A 3EULA 3ILHA 2CD7A 3NNNA 5KQPA 3F6CA 2MSKA 2RGYA 2LIVA 3L49A 4LX8A 4IRXA 1Z2DA 2B4AA 3Q7SA 1W25A 1LJLA 2FXIA 1DJMA 1ABFA 1DRKA 1SXIA 5TQ2B 5JS1A 1K66A 3C3KA 3H6GA 2OENG 5CNMA 1YK1A 2FEKA 3GBVA 3QX8A 2A9OA 3GYBA 4KMRA 4RXMA 2PUAA 4EGSA 4Z99A 5FWYA 1YS7A 4XXHA 3C6QA 4MS4A 2JB9A 1SRRA 2MYTA 4RWEA 5BR1A 3OLZA 1Y1LA 4TN5A 2E4YA 3KLOA 3RVOA 3GBPA 4P98A 2HJ9A 1XHEA 5IEBA 2FSPA 3VNBA 2NUBA 5HQJA 1P6QA 3OQOA 1F51E 3HCWA 1H9CA 3LUJA 2PUDA 3RVJA 1DBWA 2GWRA 3N0RA 4NV3A 4RK7A 1QNLA 1KMIY 3IPAA 2NT3A 1M5TA 3C3WA 5B3JA 4KK4A 5PNTA 4MQEB 4S04A 4IMIB 2E4VA 1JX6A 4MS4B 3E3MA 3HVRA 2Q5CA 3LUAA 3QEMB 4G97A 3QLUA 4Z4HA 4PZ0A 4MYRA 2XDYA 4LE1A 2VYCA 3QELB 2PUFA 5ED4A 2IPLA 5B3JC 1QP0A 3O2QB 4D74A 1PNTA 4OBBA 3RVSA 1DC7A 4GNRA 3MF4A 1ZY2A 1S8NA 5C5EA 1FSPA 4KV7A 1USKA 2FN8A 3DGFC 3VNAA 4QPJC 2FEPA 3I45A 1JLKA 1RXEA 3HJFA 3K9CA 1E6MA 3D02A 3EODA 1ISSA 1VRVA 2HQOA 4MLDA 1JDNA 4RKQA 3FDFA 4ETIA 2JBAA 2PL9A 1A04A 2QVCA 3LUHA 2VK2A 4MQEA 2R4QA 5IUNC 3KS9A 5C5CA 5EWMB 2FMFA 3CNBA 5D2CA 3CG0A 3IPCA 3CZ5A 4MR8B 5I4CA 1TM2A 1TMYA 2H0AA 2N9UA 4KQCA 5HM6A 4G0PA 3GT7A 1LBHA 4YV7A 4W5TA 3IP7A 1YVUA 3Q9SA 5CNKA 4OLAA 4YO7A 2R47A 3LUFA 1Z26A 2F8TA 3MM4A 4MQFA 4F3TA 1GLGA 1DCFA 4N47A 1HEYA 4RY9A 5KI6A 3OM0A 5DGCA 1YK0A 4LE2A 4Z4EA 2HQBA 4EVRA 1JDPA 5EWMA 4MRMA 4E7PA 3HUTA 1DZ3A 1NXWA 2V0NA 2JK1A 1EWTA 4WWHA 2YHAA 1M2EA 1ZN2A 2LUOA 4G0OA 3GRCA 1SXGA 4LDZA 4RK1A 3DLBA 1JBEA 4MGEA 5BQ3A 2L2QA 5JNTA 3JPYA 1MB3A 3KCNA 5IEJA 4KNYA 3CZCA 4MR8A 3URMA 2HPHA 2X7XA 4ETMA 4F06A 4HNSA 4OTZA 2A9PA 1NXTA 1RNLA 2QXYA 1ABEA 1JL3A 1D4ZA 4IGAA 3SAJA 5HKOA 2PAFA 5EWJB 1DBPA
chains in the Genus database with same CATH superfamily
1MXHA 2FJ0A 4NMHA 4YJHB 3ZWAA 2P3SA 3E81A 2VVTA 1C1XA 3DG9A 2NVUA 1Z2AA 4Y2VA 3ZVNA 2C83A 2JI6A 3L1JA 4ZZ1A 4ND6A 4YP7A 4A6EA 1V8FA 1ZUNA 3P4YA 3T7CA 2ZSJA 3GMIA 2QK4A 4YDRA 1NLZA 1LSOA 1B14A 4Q9DA 3EFBA 1CZOA 3FOCA 3A70A 4PO9A 5K4HA 2V7WA 1PT5A 1MORA 1X8KA 2FFBA 3LF1A 1WIWA 3EMDA 5DK4A 1KPIA 3VMFA 1J90A 2DJIA 4B6FA 3U3ZA 4DNFA 4DQUA 1QFSA 3SEAA 2ZJ8A 5AXBA 3JQAB 1DKRA 4W5WA 4PG4A 1U7HA 1WRBA 4IIBA 4DQDA 1BMDA 1T13A 4ER5A 1Y0BA 2AEMA 2FG7C 2VJKA 5JALA 3GFTA 3QM1A 4C88A 4WINA 2XUGA 1VE7A 1ZI9A 5JJBA 1IONA 1DXOA 1ID8A 1WXFA 3VHXB 3X0DA 5A4MS 2R4TA 1DARA 2WA2A 3FAKA 4QTZA 2QAGA 4N39A 1RZUA 1AC5A 2QLBA 4YRRA 2JGMA 3JATA 3VOSA 4CT5A 4P35A 4CL8A 5IM4A 5DPMA 3M6LA 3GO4A 1YOVB 2X14A 4L0DA 3S3TA 4B71A 3LQKA 5ALGA 1DHTA 1HM5A 3RAPR 4HWKA 1WCIA 5ICSA 3RHSA 2O3SA 1OWPA 4JYCA 1RBMA 3S2GA 1QV9A 4FGJA 3PKIA 3PRKE 3PUVA 1SQFA 1M8PA 5TQJA 2D8MA 1APBA 1GXSA 1DV2A 3P9SA 1O9HA 1SC3A 4X9XA 1SC4A 1IVSA 4PV7A 4Y7DA 5AH0A 5ITVA 4HD8A 2PGNA 3QU4A 4PPFA 1HETA 3JASA 2ZJ7A 1M1NB 4QE3A 2DGDA 3AINA 3FNEA 2BGNA 3BXFA 4JLOA 2FR1A 1V43A 4TMYA 1M5UA 3NOXA 4HDNA 1VPWA 4A1FA 1DUIA 1NVVR 3FPSA 1UL1X 2EEZA 3AR3A 1E1KA 3EVCA 3CXRA 2GTHA 3U81A 4Y9DA 4LC9A 2AC2A 1RQ7A 3RV3A 3B6IA 1H3NA 1N1EA 1EB9A 2I54A 1CEEA 3V33A 3OUZA 4FFLA 3KB1A 3MTGA 1LZKA 4UE3S 3WIUA 4CCSA 4H7KA 5B64A 1V8BA 5KINB 4PSVA 2JEOA 4A8JC 1ISPA 2P6RA 3QX7A 3R3XA 2B35A 4JJGA 4UUNA 4WBNB 4RFLA 1RAFA 2DX7A 4M0UA 4H4CA 4I0WB 4TYNA 1CJUC 2GUWA 4LWQA 3ZWNA 2NN3C 2IUSA 2VL7A 1TM7E 4A16A 2BRUC 4MUHA 5L3QB 3ENQA 4N3AA 1RWNA 3REQA 3NHJA 4R5MA 4PIMA 2IOHA 3SOPA 5FI5A 1OKKA 2ZZNA 5DW3A 3RS7A 4C14A 2F67A 3IOMA 3K30A 3JALB 4QTXA 4L85A 2DYKA 2Y93A 4FR0A 5KYXB 4LYJA 4QT4A 2OBBA 2FKNA 2H1RA 2QR3A 2A0FA 2YHIA 4LVUA 2XEXA 4QQRA 4Z4CA 2X5OA 4YRCA 5ALIA 5BT9A 4BV8A 2BSXA 3ONVA 5EZYB 4IL5A 1YZ3A 3REQB 4E1AA 5EC8A 2GVNA 2M1XA 3ZHXA 2XGSA 3BQMB 4XVCA 3U9TA 2W0SA 1Z39A 2JVIA 4JH0A 4PGAA 1XRPA 2DH6A 2SICE 1P45A 3OLXA 1OA1A 2FDRA 3PGJA 2QBYB 3LP6A 4IQ0A 1TNDA 2J3EA 2DY1A 3CTMA 3DZJA 4XEUA 1LZLA 4ZIRA 1FVFA 2A3NA 2X76A 4RY8A 1QVZA 1XD8A 2D2FA 2WJAA 3TINA 4PGHA 5IXSA 3EVTA 4J2OA 5K8JB 3LZ6A 4OLBA 4BVFA 3GL9A 5AVUA 2C5SA 2X42A 4DUYB 3ANNA 4D8YA 3ZHQA 4BN0A 5EZYA 2B94A 4HDMA 4OH7A 4QYWA 1GUFA 3GLFE 3QPUA 4MJLA 3LECA 4B9EA 1SA0A 1W36C 1GTSA 1T8YA 1Y6ZA 2JAWA 4QRHA 1EFVB 2WC1A 1GUDA 3SSAA 4BX0A 3SJAA 5KNCD 3S2IA 4BJ1A 1SC6A 4L0CA 2WJ6A 4F7WA 5A4FS 3D7NA 3WGGA 4MIEA 1DPFA 1YC2A 2OXCA 3OEYA 2J6CA 3RUDA 5IT5A 3C48A 2BHTA 3OA0A 3OCWA 1MJGM 2L17A 4NOMA 4M2LA 2FFAA 4ZQBA 5K0NA 4MPJA 4QLOA 3WYEA 1AN0A 3EH2A 2G3YA 2IYFA 2WIDA 3I37X 1Q6ZA 3B2NA 3F1KA 3K0FA 1UJ5A 1ZJ4A 3M5WA 3R3SA 4QEDA 4EY7A 2RGRA 4Q3AA 4MWTA 3ZDBA 2GTIA 3CEJA 5P21A 2PO7A 1MW8X 3UPDA 3IVAA 4LZWA 3RVLA 4UEJA 3WYDA 3ADBA 3PFKA 3OF2A 4E33A 2XB4A 1RMQA 5IDQA 3M2PA 3OQIB 1DINA 4W1RA 3F7TA 1N4AA 2DU8A 4RK5A 1KWKA 4HMPA 3GCZA 4PQRA 2QU8A 3WZLA 4HHEA 4HAIA 3Q72A 4PFQA 3U3JA 3U6KA 4JI1B 3T3MB 4BMYA 4RK4A 3RVKA 5CVCA 4CRWB 1EDBA 2EKZA 2G0TA 2IHTA 1Q0RA 2NSLA 2QAGB 3QWFA 2GJSA 4FD3A 4EYGA 5I4BA 1VB3A 4ZO7A 2XB2A 2W2OA 1VMDA 2Z58A 3CONA 3WIBA 1S8FA 2O2HA 4BO4A 4AN1A 4EBBA 2HF9A 4LZNA 2ZYHA 1ISFA 4WZBA 4BFUA 2EP7A 2Q5EA 4FR5A 3WLJA 2FPPA 2C92A 2ZWPA 5TB5A 4JLDA 4YXFA 3CUYA 1KRWA 3TI9A 3NIBA 4OHBA 1XFDA 2O8DB 1AS0A 2QROA 3CUKA 2IYQA 4DC9A 4KO4S 4HNRA 5SZIA 4ARZB 1JXAA 1P7WA 5CH5A 3ESCA 1H2WA 5CX4A 4CG3A 1ZUHA 5BMOA 1N34B 4C5AA 3BXZA 4NENB 3FUWA 4OA8A 2ES4A 2QMQA 1ADJA 1CJKC 2QDXA 4BP8A 3RW9A 1JIQA 5DXAA 4AJJA 3KXDA 1XDDA 3UXYA 4LFCB 3WIDA 1FW6A 1ZKDA 3BJIC 4RD1A 4AZSA 4J0GA 5GONF 4I8XA 3AEZA 2B4TO 4GOLD 4CF5A 2ORWA 3OCCA 1QG6A 1O6CA 2WUEA 5TMEA 4CG2A 2E55A 4GD3Q 1N5KA 3LZDA 3OKPA 1PYOA 1RW4A 4JJ4A 4NS4A 3UNXA 1E7SA 1FOEB 2HXSA 3L9XA 1KTVA 2AZ4A 3GMDA 4E15A 2GF2A 2N46A 5AKLA 5DM60 1EFDN 4Z2AA 2NMVA 1RWVA 1LLQA 1R4MA 3LT2A 1YU6A 2JHAA 4LRSB 5F5LA 2RJNA 4TL8A 4B7CA 5DNYB 1J20A 3PFHA 5GZ1A 2YYSA 3SF8B 3L7YA 3O8NA 1VSUA 1QO0D 1ZM9A 3NPAA 5GJCA 5THKA 4NU6A 4EDFA 2C8VA 1FNBA 4CLEA 5JXJA 1GEGA 4AECA 1GGJA 4MARA 2ZGVA 3EUWA 2KYRA 1UQUA 4XPIB 4I3HA 1WB4A 3EVEA 1L5LA 7ABPA 3G2LA 2QN9A 5T3UA 1R12A 4QBFA 5CCXA 3KLPX 1ISRA 3PVZA 2P3OA 5AKYA 1Z47A 4ZEXA 4IVRA 2FSUA 3M2TA 1VZ2A 4MV9A 2WSBA 4Q01A 4YQEA 4W9NC 4U0JA 3RU9A 1UODA 1T6NA 4NV0A 1DRJA 1IZ7A 1OFUA 1L5YA 2I8CA 4FDTA 4RK0A 3DMNA 2AV6A 3P96A 2IVZA 3KLBA 5FUWA 3ROKA 3GLIA 1KKUA 3JQDA 1Y3HA 2X1VA 2BMAA 5CYGA 3SK0A 4H7HA 3H0EA 4MS1B 3R3WA 4QULA 1A4UA 4UCQA 2XTAA 4AMZA 1YJXA 3HJCA 4WESA 2BVNA 4ISBA 1P77A 1TYDE 3GJZA 3RJTA 1XK7A 4OXQA 1BXZA 1NPDA 2GKGA 4CLOB 2B0CA 2VJBA 4RORA 2C61A 4NNJA 5A06A 1R5JA 3HM2A 2G71A 4S2EA 1EEHA 5KTRA 3O4GA 4TZTA 2P6PA 3DMDA 1Q15A 4D3YA 1Q1QA 2P6NA 2OPBA 4NJEB 4PHCA 5HBRA 5T3YA 5LOVA 3TL2A 3JD0A 3GGDA 1XTIA 4H7EA 1OV6A 1G6KA 3DM5A 4HTFB 1HOXA 1XTBA 1TCCA 4RTJA 2HDOA 3DFZA 3BE4A 4CNBA 4G1BA 5BYJA 1F9EA 4BNMA 4C08A 1UEXC 3HB1A 4CTNA 2J0VA 2Y0BA 2IF2A 5AIBA 1KO5A 2MU1A 1A5TA 2B2XA 3PVCA 4CIAA 3P2IA 3VV3A 5AJYA 1V41E 2QTBA 1JQLB 2N1BA 3HP4A 3FYHA 13PKA 4DLNA 2YVUA 4E46A 5F98A 1MA3A 3P94A 1IQRA 1ZCZA 5B4UA 5FTLA 2DTXA 3BULA 3K2IA 3C3PA 2HLDA 4JENA 3W7AA 1C9EA 3D8HA 1KVRA 5D84A 1SKAA 3LUKA 3V00A 2DPYA 4IMRA 4Z4GA 2GERA 3EZGA 2C4VA 3NRJA 3W3AD 2NP6A 1Z08A 3H1FA 1G9XA 1QQTA 1D0IA 2YJ6A 3WGVA 4BU0A 3WE7A 2WG1A 1CUGA 1M34A 2JAQA 3IUSA 1VP3A 4U00A 4YRMA 1GU7A 3GAAA 3OFND 1TF2A 4JMLA 4OO3A 5IYZB 4FGSA 3OOSA 4QDZA 2E2WA 1GPAA 4JYZA 3I62A 3ZH2A 4PC1A 5A1TA 1N6OA 3PNMA 1XRQA 4QQ8A 5JO9A 4LY0A 3FLBA 1R6AA 4BZQA 3IQFA 4CZ2A 3R3UA 3R7AA 1Z6QA 3PNLA 4Q7LA 2G9NA 4E94A 1KP3A 1Z8FA 3A9UA 3ADKA 5ALDA 1ZVJA 5BR8B 4CODB 3FUXA 1UOPA 4Q7JB 5EYPB 4LKOA 1E8DA 1B3RA 4R68A 3VKWA 2YNMD 1HYHA 3OICA 4OJTA 1WPRA 4BNVA 3JYLA 3V7NA 4AS2A 2E5LB 4KC0A 3ZHSA 1GTL1 1L4HA 2AX3A 1WDLA 2A5JA 4RV4A 3W5BA 5CIYA 3EMVA 1FMJA 1IRIA 4B7XA 1DTWA 3B60A 2NUBA 2VNJA 2W37A 1JDVA 2ARKA 3UB2A 4H1HA 2B8WA 4DVJA 1BQ4A 3SBOA 4AROA 1FX0A 4BY9E 3L4BC 2LKCA 2AB0A 1DIBA 3C1OA 3CC8A 2A7XA 3KYBA 4YK7A 5DSTA 1SOWA 2PX3A 3L77A 4HDQB 3WY9A 1QE3A 3OU7A 2HA2A 2Y1LA 2G40A 3PFGA 4UTNA 2WJ4A 4DREA 3W4IA 1MUUA 2G7ZA 3DMTA 1O7JA 2QTFA 1WDWB 3LUAA 2O8VA 2XWQA 3PCXA 4QJ5A 4OI1A 4Z4HA 1NL3A 4RPCA 2OGTA 1EGHA 4HAYA 5ALUA 1W47A 2QTVA 4C78A 3E8SA 1CUDA 1R6DA 2IPLA 4FQ7A 4ZYWA 3O2QB 4PG5A 4HWPA 3LO5A 4AULA 3KD2A 1G5RA 3G0GA 5K0BA 5IC6A 4RQBA 2NO4A 4A2WA 4HEA1 4B82A 5JAPA 1ORDA 4LXIA 1HDYA 2KMLA 4OKIA 3T7DA 2XCQA 3NFRA 4L4ZA 3QXJA 4JJ6A 4KIFA 4F6RA 1USKA 3DGFC 4MUXA 4IWNA 3GI1A 3RADC 1L4BA 5FTNA 4KAAA 3VA7A 3DKPA 1RXEA 1K06A 3G0IA 1DJNA 1LPBB 3O94A 4ITUA 2ZBUA 4M55A 2NWQA 2VEDA 3FKJA 5EERA 4URYR 4BAZA 1D6MA 5A1JA 3M6XA 2GPYA 1MCZA 2RGWA 5EFOA 2PUWA 1QKJA 4WZBB 3CZMA 4L2IA 2PL9A 2JH3A 2D8AA 1MNAA 5LZ7A 5HOQA 4RPLA 2E4AA 2QTNA 4PWZA 2FPSA 3K0HA 4HVTA 4GX1A 1KSFX 4FLMA 1T8RA 3NKLA 1ABBA 4GMHA 1FSZA 2JJ8A 2NTYC 4TMFA 4KYIB 1RXYA 2HRRA 3NOVA 3S1LA 3QBTA 4CM8B 1TX4B 4Z3KA 4LAFA 2XMCA 2VKQA 3IVGA 2BSQA 1JAYA 3PLRA 1KAHA 5E1DA 3ICQB 1G21A 1T6XA 1NBMA 2HA7A 2PQ6A 2WYIA 3GCGA 1ADCA 3GH1A 3MM4A 3Q9NA 2A1UA 1TTTA 5AW6A 3BZBA 4X3CA 3FWZA 4NOKA 3TCXB 2ZB2A 1GG5A 3OM0A 2G08A 4P31A 3EZYA 4UOEA 1MENA 4LE2A 3T54A 4U2KA 2V6FA 1U0HC 2JANA 3UT6A 4D9FA 1Z0DA 3OIUA 5KKNB 2ZRCA 1NXWA 5JWRA 4PC3A 1FVOA 3G2IA 2YS6A 4CLXA 4PM4A 1SBHA 1UBLS 2ONZA 2QW0X 3KXLA 1O0SA 2C0QA 5CDFA 3ILSA 2P0EA 2G25A 2H2AA 3ASVA 2R00A 5FUYA 3TLBA 4LYHA 1TYBE 1Q6YA 1Y37A 2HSJA 3WDMA 1HORA 1E5VA 1S6YA 4GZ5A 4EQ6A 5ADWA 4XH9B 4GVPA 3C4QA 3F67A 3AR8A 2VDJA 2I4TA 3P9IA 1L7VC 3VU9B 2SCUB 3W2IA 2QLLA 2FSVA 3ESQA 1X2BA 2XUAA 3V1YA 2WWRA 1KDVA 2J6HA 2P2NA 5FFNA 2VRNA 2OKGA 3FPFA 3RSOA 3F90A 1TA9A 2PYZA 3MUEA 1PQWA 3T7AA 3TL3A 3SYLA 2UUOA 3WIEA 2CNKA 3DWEX 1ZSYA 2C5FA 1C9KA 1V4NA 4HPJB 4QOJA 4DAOA 1GQQA 3LGAA 3NBXX 5A0TA 2C3YA 2IEYA 1QIFA 2Q9AA 1ZIXA 3OFKA 4DA0A 2QD1A 5DO9A 1PJ4A 2JARA 2RAVA 2VQ6A 1QIEA 1FUEA 2PXCA 2X4LA 3B8HA 1OHHA 3G68A 1Z4OA 1GKLA 2BKVA 2CKDA 4R1UA 3TMYA 2CV0A 5I9IA 4MVJI 1ORHA 1BJTA 2IXDA 3FMGA 4PLFA 5EKSA 1K5HA 1GTMA 2WHPA 4RNCA 4O2AB 4MWSA 1EK1A 2NAFA 2B2NA 2P1DA 1M6YA 1UDBA 1Y4DE 2YIVX 3ABQB 3AH8A 3MGCA 3VR3D 5HVNA 1C30A 3HBLA 3P4UA 4EO4A 4TQUS 3VUFA 5DGHA 2JLWA 1UH5A 4C3VA 4HDRA 4U02A 5GAJA 2B1IA 5G1NA 3HCPA 3ZE2B 2AI2A 4FFNA 5DM4A 1T3HA 1Z2CA 5EEGA 2ZSAA 5ERXA 2LZ0A 1U7WA 4H0NA 3ZY3A 2WF5A 1MC1A 5FBKA 2B8TA 4CWAA 5KC9A 3NALA 3ZKAA 4G41A 5HIKA 2WT4A 1OX4A 4TXMA 3ED1A 4DUGD 3R74A 1YF3A 1QRDA 4IMJB 4MB2A 1LSJA 2WKQA 4R2MA 1HMPA 2XZPA 3F5DA 4KLZA 3WZ2A 1K8XB 2I3AA 4CMEC 4R1SA 3QNMA 3DLAA 2QSJA 1TO1E 4OI4A 3ZW7A 4DR2B 3WK7A 2V6BA 4N7RA 4CXMA 3EGDA 1OU4A 4EY5A 2ODBA 3AVWA 4PG8A 1Q0SA 4RUKA 3DLPX 5EHGA 4ZAZA 1QH1B 4OB6A 4EKNB 3BRQA 4KITB 2O8DA 1K2WA 4NV1A 1EFVA 3IBSA 5E7JA 3X1KA 4CU5A 1G3IA 3UENA 4HF7A 3JTEA 4WBNA 5BN3B 3BT7A 4J0HA 5ALOA 4PSDA 1ACLA 4WADA 3RAGA 4PAOA 1XD2B 3GNQA 1CULC 3T5PA 1L1EA 1SG6A 1YFZA 1Z5NA 1JHRA 3A32A 4GDMA 4INPA 2GXQA 2Z4SA 4MNTA 5GINE 2BYTA 3W1WA 1E1QA 1LWNA 1NIJA 1VOTA 1KFKB 4YV2A 2DKNA 2J6IA 4KXMA 4NBLA 1IN5A 1O95D 4RBNA 5BN3A 2XZLA 2G76A 2VF8A 4N18A 3WKDA 3AI1A 2JJ2A 2XWPA 3VAYA 3KQTA 4B85A 1NVUQ 1T6ZA 5HF8A 4E4RA 1YXMA 5KJFA 2I9KA 2X0FA 3L7OA 1CDZA 4ZC8A 1ITZA 1EJ2A 1M33A 5FUQA 1YL7A 3KL4A 1YUBA 1BHSA 2PKQP 3F73A 1OWLA 1G17A 1YCFA 2IW3A 3E0XA 4OB8A 4ALMA 3K2EA 4DDHA 1Z7EA 4N48A 1F60A 4IBOA 4TRNA 2IQIA 3FROA 4RADA 2OO5C 4MI3A 4N0DA 4UNIA 1JTEA 1JR3E 1PX2A 1TAQA 1NXPA 1RWXA 3H5WA 3JXEA 1A76A 3M33A 1O08A 1O97C 2P91A 2RGNA 2J3JA 4E2YA 4IFTA 1VLVA 2OUKA 3PE3A 1XD2A 1CSEE 3ABIA 3BQ9A 4J07A 1RP1A 4X8OA 3KVOA 4PW0A 5T8KA 2RKOA 1FL9A 1Q50A 2Z8YM 4L75A 4P33A 3WB0A 3RSHA 3UUFA 4BMXA 4FZ5A 5AJZA 5DCUA 5DGTA 1JYEA 2Q6OA 5ED0A 5C34B 5KWVA 2IUEA 2ZYRA 3OOYA 5CIWA 1J70A 2FE4A 5EN4A 3L01A 1N2CB 3PCRB 3N0WA 4KAFA 1MOSA 4MAMA 4U3JB 1Z13A 2AR0A 3DEHA 4OJMX 1AH2A 1Z5UA 3DZKA 2G9RA 3LBHA 2R6ZA 5L7TA 1SNYA 3L06A 4R2JA 5DVZA 1U2QA 4CI0B 4HXFB 1GAQA 4ND8A 4WLVA 2ZUFA 3H2YA 4OSOA 3TNDA 4G0NA 4B2IA 2BKXA 2EBUA 5JMPA 3AB8A 5TSDA 3DSRA 4I55B 1X8XA 2NXEA 5AHWA 3FXAA 1IZYA 2ATCA 5I9LA 4NZMA 5F21A 2A9RA 2W71A 3PUHA 3ROXA 3VSDA 4WZZA 1R9GA 4K26A 4B4DA 3QSYA 1U9YA 3GFFA 5TF4A 5DSZA 5ALJA 4DMMA 1WNTA 1JN0A 2O2YA 2X1HA 3EZ6A 3IA2A 3DL0A 5IN4A 1OPXA 3N7UA 3R7BA 1TRKA 4HB2A 4KFUA 5ESRA 3R4VA 3CUWA 1NU8A 3F74A 3NAGA 3NW9A 4EWLA 2ZK7A 3I0ZA 2ZB3A 3HXMA 4EMSA 2QZJA 4NU5A 2PVCA 2HLPA 1C0LA 1JLLA 1T8PA 3E7DA 3ON5A 2FWJA 4S2UA 5IJZA 1GQ2A 1GZ4A 2W8BA 1KSJA 2YY7A 4M0FA 2XJ4A 4PANA 1HNWB 3KKOA 5JUWA 3EEBA 1A5SB 3AY6A 5GM2A 1ZD9A 4TXLA 3PT5A 3AHDA 3DWFA 3E27A 3D8BA 3OD5A 1N3IA 3KE9A 3NDPA 4QVKA 1FNSA 1E1CA 3W5AA 5BW4A 1Y89A 1YS9A 2DBRA 1Z5WA 1YQXA 3IXMA 4LJ5A 2AD1A 4RZ3A 3CR7A 4C5CA 1IBSA 2N3ZA 3ADDA 4LYAA 2R6DA 3LC0A 1W87A 3BX1A 2M6SA 3I28A 4O4JB 1MT0A 1WZNA 5L3VA 2VTVA 10MHA 4W4TA 2LBPA 4BECA 1FBNA 1YRWA 3F5MA 1PGJA 1RC0A 1QQ5A 4C89A 3WRVA 4D45A 4YMIA 1I01A 1UMDB 3GRYA 3TIFA 4XD2A 2ECOA 1D5CA 4E7OA 2VSXA 1OGYA 1NN0A 5DIFA 2D7DA 1Y9AA 1T5LA 2DQ4A 4UM9B 3RYCA 2VYQA 2WM2A 2P0AA 3K94A 2ID9A 3PQ3A 4WZAE 2IEZA 1RWMA 4Q6BA 2W2KB 2X0DA 4G26A 1VI2A 1GPLA 1YA6A 1HKHA 4WNYA 4S1OA 3CVWA 1G7CA 2A30A 3DZDA 3MGGA 4JQYA 1W1UA 2EF1A 3U40A 4QM6A 3MWDB 2OQVA 1FQWA 1K97A 1NNUA 1CZUA 1PGQA 2ENUA 1T0UA 1YS2X 2PM8A 3GJ7A 3WNZA 1C7RA 1LKZA 2RIRA 2WVAA 5JSZA 4PYIA 2ASEA 5TPZD 4C4PA 2BD0A 2AMFA 4HG2A 2FFRA 4L5YA 2ZT6A 3IE1A 4QUGA 4ANFA 1CJCA 2F43A 5PGMA 1PG0A 4G4GA 2F2TA 2RHTA 5BORA 2IYYA 4AJOA 5JNVA 3B3JA 1MH9A 3PWTA 1ZXLA 1J8DA 4IKPA 4INAA 2X15A 5CIQA 5DCLA 4O3MA 5JAZA 2FEWB 4TN1A 1V3TA 3CZAA 4LWOA 1Z6PA 3W9UA 2BFFA 3K4QA 5GVSA 3GU3A 3ELWA 2OHXA 7YASA 4DLXA 3KPVA 4B6GA 3X3HA 4Y9TA 3UFBA 4CIXA 2I33A 1X92A 1UPCA 4DSAA 1RVV1 3PX7A 1E20A 1AA9A 4MMZB 5HM8A 3C8ZA 2Q1XA 1LBTA 2I7DA 3AERA 1KE1A 1RPTA 1MB0A 2GYYA 3EVZA 4FI3F 1BKSB 3GBSA 3G23A 1GSOA 3FTQA 3LPNA 1KL7A 3OPYA 4GWGA 2XQGA 3NAMA 1O58A 4YIHA 3WLKX 4OUDB 3WLHA 1THZA 4L8LA 1E1RD 1GUAA 1OC4A 2VSYA 1KFJB 5BOVA 3RIEA 3SBXA 4AQYB 3C6MA 1NW6A 3OZXA 3STYA 3MWKA 1T8UA 5CRIA 5B4VA 2JFWA 1NUTA 1XZEA 3A9CA 4KFCA 4EW3A 3QLTA 1II9A 4EB3A 1JZQA 2JZCA 2W83A 4YCSA 1ZWLA 3VTKA 1U4SA 1CVIA 4HWRA 1CIVA 2LPMA 3OZGA 3RG2A 4DIEA 3HLTA 2A86A 3VQTA 2E82A 3ACCA 1PU2A 2GBLC 4LWZA 3NC1C 1NM5C 2ZVQX 4X6LA 4W9MC 3QYAA 2CFRA 2GEVA 4N7JA 5FR1A 2EIHA 5KNCA 2VDKB 1K2VN 5JXIA 2PFKA 4HAXA 5AVZA 3VHXA 1EZZA 3CH4B 5GPBA 2I1WA 3C5HA 2D7CA 2IWHA 1D7OA 2DSTA 3HWWA 3UJ3X 4C03A 5JS6A 3B9BA 3NDBB 1WWKA 3IUYA 3MOIA 3TPZA 1G4UR 4MGHA 5AUNB 4V1CB 2FFJA 5B12A 3PIRA 1NATA 2W4IA 4DMUB 1WE2A 5IF3A 1KU6A 2JGDA 1EXVA 3AY7A 2G6BA 2PGJA 4QRDA 4C3OB 4E1VA 4F2HA 5CDUA 1FJXA 2C3UA 4Y2GA 4LJ9A 2WTBA 2FWIA 1R9NA 2CD9A 5LBTA 1CQJB 4RXTA 3V4FA 5G0SA 4NBRA 1J5EB 5IVHA 1ZZEA 3BBLA 2JD1A 1RTTA 4LOKA 5DXJA 1V11A 4BE4A 3NQ41 4EB0A 3B7PA 2VJOA 4IMPA 4LHSA 1YA4A 3KR0A 1PD1A 1ZGZA 4FYWA 5C4MA 3KQYA 4V0KA 1NR7A 4RMHA 5EYPA 2QM7A 4EPRA 4ES6A 4LHZA 3TJRA 2VWQA 1EXNA 5A5GA 1Q17A 4NTZA 4Z9BA 4B6RA 1JILA 3C3JA 4NDZA 1FNMA 2M32A 4CM3A 5C8ZA 1TUGA 3PJDA 2BM9A 2I2BA 4ZI3A 5I47A 5E0KB 4ZJUA 1T34A 2FGJA 1E0KA 3GDFA 3W2FA 1FYFA 3P9ZA 2QTWB 4QOHA 3N8NA 4JHLA 3A6LA 2IXTA 2QGFA 2RARA 2DBZA 2IW1A 4U3JA 1IZ0A 2KLHA 4IRXA 2XSZA 3GLIB 3O90A 3OM8A 1N57A 3Q7SA 2VNHA 4R1NA 3V2GA 3EIOA 2AMJA 4GKKB 1OVGA 4AS3A 2OGWA 5HUHA 1DE0A 1PZMA 1VKZA 3ORRA 5AQEA 4M0CA 3U9SA 4P0QB 5T4BA 4A6DA 4DPMA 4ESEA 1NF3A 4IX1A 4M46A 4P7FA 1P1BA 4NP6A 2PUAA 1XMVA 4GKJB 2O8CA 1K7SN 1FK8A 1O5OA 2FQQA 2WUVA 1N0VC 4QPPA 3JZFA 1I51A 4L0QA 3ZY2A 3OLZA 2CXRA 1N5JA 1Z0SA 5MGBA 2WU4A 5HIIA 2E4YA 2QZSA 4RZIA 4XGRA 1T36B 4XVRA 1JPJA 4C1BA 5BMVB 5LPNA 3ADPA 4YCNA 4GC5A 3WKCA 3T7TA 1VG8A 3ML1A 2V6MA 5A2GA 8AT1A 3AUXA 4KXFB 4X92A 3A7DA 3SC4A 1Y3CE 3KAJA 4RVNA 3RVJA 1US8A 2GWRA 2M6LA 1J9EA 2XYQA 4K1LA 4PQFA 4RK7A 4BRZA 4MIKA 2AUMA 4JP2A 5PNTA 1OJLA 4KPUA 4UBMA 1XPUA 1H9AA 1RI1A 1CRQA 1JIXA 4BGEA 2X77A 1U28A 4H1WA 1L7EA 3E3MA 4AG5A 1SJ9A 4ARIA 1ESCA 4IGFA 2FWPA 4W82A 1O9GA 4EW1A 1R4NA 2GGSA 1VLJA 4H2DA 4BUJA 5BSEA 5ES4B 4NEGA 1UK7A 4O0MA 1XTZA 1KORA 1BMQA 3UO8B 4LJYA 4A8PA 1TQ6A 2HSZA 5AW0A 1CUAA 4F92B 1XD9A 3AB3A 2WVHA 1YUMA 2DFLA 3I30X 4GMDA 1XZ8A 3ETEA 5CK4A 1PGNA 2AZMA 4CL3A 1B8UA 1CTQA 3FPGA 3N0TA 4I6JA 4J49A 5DOVA 2EJVA 4YWJA 1Z22A 3AR6A 3PQ2A 4AZ3A 2IBMA 4HAVA 4NPHA 4OPMA 5KKAA 3QPDA 2IU0A 2C2YA 4RZQA 1XDWA 5AP9A 4BX2A 2P90A 4JSRA 3I2IA 1RYEA 4TYYA 3EXEA 2F8MA 4E21A 1AUXA 2WNIA 2OY0A 4MQEA 3TZHA 3OTGA 4QEKA 3WTBA 5KYGA 2ZTUA 2FMFA 1FSFA 4QUKA 3HABA 1K92A 1Y6QA 2GCNA 3G5LA 3UXEA 3VU9A 4BWVA 4DIDA 4EG6A 1JAHA 2A6PA 1OR8A 2H0AA 4H7IA 4QWWA 4RL4A 5LB4A 3VBCA 4YRAA 3HKCA 2H29A 2OD7A 1XCOA 1AUVA 3Q9SA 3NEJA 4J7CA 3ZE6A 1I80A 3ESYA 1WZIA 3OWXA 3LXXA 1ODIA 2R6CA 3OQIA 4UUPA 3BMNB 5BPFA 5EUBA 1E69A 3UYKA 1SC1A 5K5EA 3OJ0A 4UFNA 2B25A 3I8SA 1MO5A 1YR2A 5C7YA 4RKYA 3IOEA 5K0ZA 3FWYA 1K7EB 4K88A 1U3VA 4U4AA 2O7NA 3JX9A 2LW7A 4HZGA 3RF7A 3T9FA 4ZI5A 1M2EA 5FBVB 3PB3A 1FYEA 2IBSA 1AKQA 1SMKA 4D9JA 2YY5A 1G21B 1MOZA 2IIBA 4QBTA 3CO0S 1M2VA 5BQ3A 2C2WA 1G7SA 2HFKA 2ZJFA 1KVSA 3WGKA 3QKRA 3ACDA 1P4GA 1W0JA 5D6NA 5DIZA 3WAGA 5HBGA 2G80A 3N74A 4EA7A 4H1VA 1JTFA 3AG6A 4LA4A 4LK2A 4MHSA 4ETMA 5F7OA 3TDKA 4I50A 3GFQA 2QZZA 2XYRA 4H4DA 2J9FA 4HNAB 4EG7A 3R0QA 4ITRC 4M86A 3MYRA 2C98A 1YBMA 2X22A 3EJ6A 3HH8A 3O3MB 5DNDA 3U7HB 1P5FA 3ZYZA 1JHZA 5KNBA 2IPAB 3DW3X 3LO8A 2NUPB 3PWSA 4QQKA 1MEEA 1PG2A 1F6WA 2VJMB 3BB4A 3LKZA 3DOFA 2QD4A 5KDDA 4RS3A 1Y3FE 4YVFA 1NNEA 2O2SA 3S7TA 4AX8A 1REQB 1ETHA 1RQRA 3FJOA 1QGAA 1H6DA 4N9WA 1DO8A 1N33B 3ZGNA 4HB4A 3RGWS 4NE7A 1SULA 2J9FB 1PFVA 2JGFA 1T9GS 1Z5PA 3QLVA 1DAEA 4JK3A 5FQOA 4BVBA 2GOYA 3ZDDA 4EJ2A 3Q88A 4JGBA 1HDCA 2GEBA 3R5TA 2G5GX 3DO8A 1XVIA 4BB5A 2XQIA 5G0WA 3WLFA 1L9XA 5C1BA 3EF0A 3A4YA 4DABA 1QF9A 4EF4A 4NMLA 4HC4A 4GZ3A 1GA4A 4BBZA 3NUQA 3DDWA 3W3AA 1O97D 1MC8A 3LXUX 2XKBA 3P27A 4MKGA 5G3ZA 6YASA 4AU1A 4DCNA 4MUMA 1MZVA 3I92A 3EC1A 4ND5A 4PCVA 3HJGA 3IALA 3UMBA 2D5AA 3OUUA 1C7JA 4H7JA 1CUJA 4Y1GA 3EIQA 3IKLA 3ISJA 2CL0X 2R6AA 2NIPA 1W46A 5DLYA 4Z49A 1KYXA 3N7TA 4YXWD 4RTNA 4M98A 4XSHA 3FSEA 1KF0A 3SEFA 3R20A 4N6OA 3WGOA 3B7GA 4CMJA 1F4VA 3NAQA 2C9OA 5CXSA 5C32A 4FOPA 2PZAA 4I1YA 3WXMA 4YMHA 3A25A 1NNLA 3EEYA 3KTAA 3ENVA 1OXMA 3VTZA 1MJ5A 2AFVA 5HK8A 1KMHA 1LSSA 2ZRDA 1M7BA 4W1QA 2XE7A 3NYRA 4KP7A 4BO6A 2ATVA 3HDGA 1YKGA 1G20B 5B1HA 3TZLA 3B82A 4WQMA 1CJVC 5AVWA 3LC2O 2XNCA 3I9MA 1EIWA 1S7GA 3AONB 5LLDA 2OA0A 2WR8A 1LGYA 1E1NA 2PSJA 4RLFA 2IYOA 1M2HA 4JWTA 4XLTA 1TTHA 4RDCA 1DKLA 1MABA 4PLWA 2CY0A 3O91A 4NZPA 5I01A 4EUNA 1ZD4A 3AKZA 1ESDA 1WMEA 2XITA 2QTRA 4FZVA 5JROA 2TSYB 1PJ8A 1X14A 2JHCA 2I6QA 1JFSA 3KQPA 3V2UA 5IZ4A 4QKQA 3IO3A 4AY4A 1U0EA 3HRKA 1ML4A 4X24A 5B2EA 2FRDC 2DLDA 5ITSA 3M6MD 3ZY4A 2HH9A 1JLSA 5SY9A 4OHPA 5JNWA 2XSZD 5BN5B 4PLVA 4JB0A 2EW8A 4WV3A 1F1BA 3BHIA 3IIEA 5K99A 2JA2A 1JEEA 2P40A 4EI8A 2O3RA 4IXTA 1XN4A 4PRYA 1KH3A 4QYSA 2PNJA 5IABA 1XVLA 3EIFA 2VHVA 4G8CA 4BVEA 2UZ0A 4LNHA 1JVSA 1VSTA 2FHPA 2IDMA 3HHPA 3RJ5A 1P2SA 3DVQX 2QKYA 4UHFA 1EVEA 5CVEA 3WK9A 1JTVA 3D81A 5FWDA 1Z4NA 4WX2B 3LLUA 3QKSA 5BSUA 1F9AA 2M6RA 4NCIA 1QOZA 1P7VA 4R2KA 5BP7A 3OETA 4YCLA 2FDXA 5SICE 4CUZA 2Q3MA 2FPWA 3KSDO 1DQZA 2H0RA 5KYYA 4NY1A 1RYHA 1TUBA 4WD3A 1IIRA 1QAQA 1XYGA 2PMBA 2ZUDA 1UINA 1LTQA 2XADA 3AGQA 1W0KD 3EZ2A 4EPTA 1E96A 1M10A 3R4CA 3WMFA 1WMBA 2FPGA 1Q16A 3JYNA 1P19A 3WHLA 2FW7A 1SZPA 3ZGVA 3OIVA 4WACA 1NJ6A 3FPBA 3N8IA 3IVMA 4FEGA 5DBGA 5TEWA 4JDUA 4UHKA 2H00A 5E1OA 2UYYA 4EITA 4EKEA 3UGTA 2DPLA 3KJHA 4LI0A 4B8WA 3OOWA 1R00A 1ULTA 3OIWA 3R8CA 4UXHA 4QIHA 3OTWA 5LZ5A 4Q4HA 2BFCA 1PTKA 4D99A 2SBTA 2HD4A 2CDCA 3M49A 2XYGA 4I4TB 4N12A 3VSBA 2Q5HA 3DS8A 5EAIA 2WF6A 7AT1A 2FZVA 3G2OA 3B3GA 1D2HA 3UJHA 3O1HB 2GHTA 4ND4A 1XTSA 2PCJA 4OM7A 4RFSB 1KS9A 1K7YA 4N5NA 3H5TA 4GM1A 3U7EB 2A5YB 3FUCA 4JODA 2ZZMA 3B9PA 3E53A 3JD1A 4W1PA 4BGDA 3UHFA 1U9CA 2P9ZA 2WIKA 4DR5B 1VPLA 4M0LA 4I4IA 2P1RA 1C0PA 2QG6A 3ZIAD 1JW9B 4RMGA 3DAFA 3BKXA 2YV3A 2BGMA 1TUIA 1VYUA 1XZCA 3V3TA 3TE7A 4GP6A 4R9NA 1XKLA 1PDVA 1TLFA 3FYDA 3INTA 3K32A 4N0MA 1G8AA 4L51A 3UATA 2CE2X 1H6CA 3LGSA 2EQ5A 2HC9A 1OWOA 1IEWA 3C3BA 4MW5A 1B2LA 1M0SA 1RCUA 3MJCA 3SNHA 3CM0A 1MKYA 3MMNA 4LV6A 4N6NA 1EKXA 3UOWA 1SIWA 4OG2A 4I1RA 4PX3A 5J2UB 3CY6A 1RLIA 2AVNA 4JP8A 4TV8F 2XXAB 1T2NA 2NXCA 1PEKE 1V7ZA 2FCAA 2JI8A 2VAXA 3I5AA 3LRTA 2MYPA 4RPGA 4MCIA 2GJ8A 3U5TA 2WQ6A 4FP9A 1L5OA 1J5PA 1KK3A 4MRAA 2QVLA 2C97A 2CXTA 2XVAA 5B30A 5H9WA 3KYDB 4O0LA 3GN1A 5IVDA 3KCQA 1E4OA 4RY0A 4RTOA 2Y1WA 3SR4A 3T8YA 4LMAA 2FWMX 2PZJA 2YV4A 2VEOA 3UWKA 3PPWA 1SXJD 1LDMA 2J1LA 2B9EA 2NT4A 3CUTA 2Z6UA 1Q0UA 1R6XA 3V8MA 4B7UA 2W8ZA 3B6ZA 4FKMA 3A0UA 3GRZA 3HS3A 1VJ1A 2A0UA 4C0AC 3AKDA 3LXMA 4UAJA 4JLPA 1PWHA 1L5HA 3DZBA 1KEWA 2Q6IA 5AUPB 4QLBA 1SK8A 2DWCA 1HE5A 3N1UA 3FY4A 2XE8A 3TOCA 1IPFA 3C14C 5J23A 4OUDA 2XCLA 3LYLA 2EW2A 4FYPA 3IUQA 4REQA 2PA3A 5JZSA 3CX7A 2Z6VA 1SKYB 3DMYA 1XBTA 3P8ZA 1E6WA 4KGZA 3K9GA 2X0NA 3SS7X 4GXQA 2O3QA 3H1BA 3KZNA 4DC1A 3EOBI 3D7MA 1A2OA 2EDAA 3GNSA 3WSTA 4DMGA 5IASA 4LZLA 5COBA 5FX2A 3VDMA 2B92A 1IXSB 3C6XA 5CGQB 4QUBA 4D3ZA 3E3OA 2FU5C 1GJRA 1L7XA 3LUDA 4KKVA 3TIXB 4P2BA 3V1UA 1PKXA 4X44A 2OHIA 1X1CA 1CF9A 1UKZA 2I80A 4HR7A 3VJLA 3CKLA 4LV5B 4MVJP 3ZK7A 3NVKI 1SXJE 4PIPA 1KMCA 3OZBA 3DZCA 3DBIA 1T29A 2ZWOA 2WJIA 5F9MA 2QSYA 3CWZA 2NUTA 4GKVA 1KBZA 4P4NA 1KFEB 2BGGA 3A31A 1M0EA 3QVJA 4LFAB 4JYMA 1NXOA 1VE1A 3G85A 4DJDC 2QX4A 3LUCA 3QH4A 2O05A 2R1TA 1N1GA 2R96A 3RYIB 3N2YA 2VHEA 4PZ9A 3ZDRA 5IXYA 1VSVA 2OZVA 1NZJA 1JR3A 5FH9A 4GDFA 5G4KB 1PP4A 1QDEA 1G20E 2E85A 1NI4B 1TK9A 3BUSA 4QOIA 3UUGA 1JPUA 1BYIA 1WCWA 2VHJA 2Z2JA 2LIPA 3MQFA 3NTXA 4H7DA 4NBNA 4L27A 4Y6QA 4XB6B 3RKUA 3DZFA 4P3XA 2AYYA 4BFTA 5BSVA 4CKWA 5JWOA 2ZYTX 5CVUA 3THWB 1OAAA 2ST1A 3WIVA 1N6HA 4IINA 4ZCTA 4F4DA 4AP6A 3BRWD 1U2ZA 3FFAA 1JECA 3GRRA 2X41A 2J9GA 2F1IA 2QUBA 1BCRB 1QVVA 3N39C 4KWHA 4P6VF 3G8AA 2Q0QA 5KSYA 4BMZA 3E58A 4WVLA 4DQLA 1ANKA 5DI9A 4OI0A 1L8XA 2EJUA 1DIRA 4OJNA 4DIFA 4EY6A 4JBIA 4JKOA 2RE8A 1BVUA 2XYPA 2YWCA 4WA8A 2Z83A 2ERXA 1RAEA 2CJPA 2DJ5A 1MRZA 2QORA 1PI3A 1JU3A 4P3OA 4Q1DA 1GFIA 2H48A 2QYOA 1TOAA 3HO8A 4KQJA 2Y1DA 5E2IA 4YX9A 3TMKA 2RK4A 4IHJA 5KTOA 4KR7A 1OD6A 4Y1EA 4LF5B 1S2GA 1TXGA 4LJ4A 3QV2A 4LF9B 1V96A 4N9QA 1W4CA 4YP5A 4CDRA 4JVOA 2ETVA 4K6MA 4F2DA 2QR5A 5EIEA 2WIAA 3KKLA 4OXIA 4OP3A 5CFRA 2XD4A 3LX4A 3IKMB 1FUUA 3MCTA 5F7JA 3F7NA 1H4QA 2FSVC 2GXSA 3QLVC 2IH2A 5HRAA 3EGXB 2RHCA 3PQFA 3QXSA 1ZESA 4JUIA 4ER7A 4GG1A 1BU8A 3WLSA 2IUUA 1NF8A 1OIVA 1VE3A 3CLTD 3R77A 4JFRA 5TEVA 4IXNA 2KB0A 1CXZA 3D2AA 5FTJA 4FOSA 1SB8A 3O7WA 4LF6B 1J00A 2ZAOA 1UIMA 2GZ2A 4JJFA 3GGJA 1C8LA 1U8EA 3RK1A 2WKSA 4U2BA 1D8TA 4UOQA 1R8YA 3CR8A 3MUFA 3ZHUA 3IP6A 4CKXA 1JHPA 4IIJB 2XJ9A 3MPOA 1ORIA 4ZIRB 2UXDB 2JRCA 2HF2A 1YR6A 5BSHA 1Z06A 5H1YA 3LIIA 3HJAA 3N2GB 2B9VA 1N6NA 2LIVA 2XDQA 3Q3JB 2CLMB 1FC0A 2BHNA 3VUEA 4HWGA 4ALNA 4B87A 5FAKA 4UU1A 2R00C 3BERA 1GU1A 2O9JA 5GMOA 4P0TA 1ABFA 1WP4A 2VBIA 4HVAA 2ACKA 1WOMA 5FI3A 2VJCA 4TYPA 1ZQ9A 2FEKA 2VPPA 1L5WA 3BGDA 5BR7A 4KPEC 4I1VA 3USES 4Z99A 1DWUA 3DL4A 3W5DA 2AW5A 2OWDA 1V95A 3VVCA 1A69A 2CNBA 5EA2A 1PDWA 2ET6A 4DSZA 4EUFA 2IS6A 1J39A 2GSWA 1JZTA 3NYWA 3ROMA 5KWIA 3WLEA 1U5CA 1QC5A 2JCXA 3AIIA 4PN7A 1N75A 3PX2A 2FPMA 3BJRA 2H4HA 4AP9A 3L0YA 4PGFA 4CIBA 1DX9A 3AI7A 1F51E 3HJBA 1DC3A 4IZIA 4KMOA 1IHDA 2FOIA 2GESA 1KBOA 5EQJB 1GT91 3IPAA 5FA6A 2X6QA 1M5TA 1T0JB 3TAHA 4NJMA 3M8KA 1S2DA 2GK4A 5FYQA 1J0EA 2IU4A 3BM5A 5DYNA 2YWGA 1UJCA 2PVSA 4QYIB 3C8MA 1N0IA 4LE1A 3QV1A 3ZE1B 1IE3A 4CIDA 4F5DA 3CVVA 2WD9A 3B20A 4AYXA 3HO6A 2UUCB 2R0QC 1L9KA 3NIGB 4UBNA 3HN2A 3OWHA 4ER0A 1C1DB 3KT0A 2QRNA 5JAOA 1NP7A 3BA1A 4KXYA 4P8RA 1ZY2A 4MWDA 1G8PA 1L5FA 4Z7QB 1T10A 5IJWA 3F4LA 5JZ9A 3PC4A 2GZDA 4W8GA 4Y1RA 5DBOA 4MV5A 1DOAA 3L02A 1EDDA 4UBLA 2AQ8A 2C5GA 1KKLA 3PICA 3ZI0A 3LT0A 3F46A 1GN8A 4R69A 3SIPA 3L6CA 4C76A 4RVHA 5DF1A 1AURA 2FN3A 3K9LA 2OZLA 1JDNA 4GI3A 4MLDA 4O1MA 4Y0VA 4QUHA 5FTWA 1EUYA 1IB6A 2YIDA 1MAWA 2H16A 1XPOA 2MSDB 4DIKA 2PUJA 5E2BA 1U6KA 2W5UA 4XWAA 1IUOA 2AH5A 4I08A 4WESB 3ZN2A 1XWIA 2W43A 3B52X 3I76A 4KJZA 1PJ2A 3K9HA 1GNRA 1QG2A 1X1QA 1FNCA 3OZWA 1RMYA 1V3UA 1UK6A 2EYQA 3GVXA 3TBHA 5C46F 4Q3DA 2JCBA 4LZPA 3QNUA 1DEXA 2BEVA 3G1TA 3OZDA 1ZHOA 2C1XA 5IARA 3EG5A 4MUGA 4J0QA 3BSFA 1SKUA 3D4IA 4ITVA 4JYPA 1SGWA 2Z5LA 1CUFA 2WSLA 3BL5A 5DT9A 2QT9A 5B7GA 3E5RA 4U7JA 3W9YA 3PEEA 5JMWA 1WPGA 4XQEA 5T4EA 1L8OA 1Z38A 4HUQB 3PC3A 2AD5A 4KKXB 1SCUA 4HYTA 4UUQA 5K0SA 1CNFA 4BCDA 1LQTA 2E1RA 3LBNA 3HXTA 1VL1A 4MQBA 3V34A 4AY3A 3ZX5A 2QM0A 1R8XA 1E7QA 4OL0A 1MB3A 3KCNA 5EJ8A 4J0KA 1IK6A 2HHCA 4KVGA 1LUAA 2D00A 5BSKA 1X7GA 1YBFA 1JWAB 1H2FA 2VCEA 2QRUA 1YAHA 3ICVA 1KI2A 4D41A 5CJJA 1FJGB 4U7TB 2EQBA 1DXQA 1KA9H 1NXTA 1JL3A 3LE8A 1DL5A 5CG1A 4TTIA 3ITDA 1T4BA 4H60A 5HK9A 1Z62A 5G0TA 5JVDA 1R0LA 3IP3A 3BE6A 1JNYA 5SYNA 5C7IO 3K6KA 1L7DA 2X9GA 4TLBA 3R3YA 5LIPA 4JVMA 2I8AA 3EZLA 4M6WB 2DRIA 2VDNB 1QORA 4UD6A 1ISIA 4TQGA 4YP9A 4B3HA 4RPIA 1JBQA 1E8MA 3IDFA 1W36D 4KXUA 1SUEA 3IEIA 2FPIA 3MILA 4DA4A 1YCDA 4JB8A 2V3WA 3WBJA 1CZKA 3KRTA 2A5GA 2ISQA 2Y1KA 3PGVA 4U7FA 4PO1A 3ZLVA 3K4PA 3ER6A 3ZC3A 3BF8A 1A2QA 1Y1TA 3DBHA 3AHCA 3CUEF 3O3OB 1D9ZA 5HE9A 4S1VA 4MPPA 1W581 3GFVA 4M1ZA 4HJXA 3HGQA 2R84A 3FLEA 4CVNA 2R7NA 1FF9A 3PDHA 2KWIA 3R5XA 2XUZA 3AP3A 5JISA 3E03A 1VBKA 3L8FA 5CEEA 4WK2B 1GILA 3F6PA 1BJKA 4TMZA 1Q2XA 1E1LA 5F51A 1MU0A 5E4FA 3TRFA 1XP8A 1NVDA 3Q7TA 2H9AA 1C3EA 1FMTA 2QG9A 2VP4A 1LI7A 3N0VA 4NYIR 5JVDF 3C7AA 2OFOA 1A82A 3OLWA 2O8EB 4NYJR 4XWKA 1T9ZA 4R3NA 2XQFA 3NT5A 3TE6A 2BEUB 2CWWA 3WLQA 4K0KB 4J3FA 2HSDA 2WJYA 2XCRB 1Y82A 1FFGA 2IU6A 4HDKB 3D3KA 4JP1A 3GMTA 2J5QA 5FNZA 2FG5A 3H7AA 4BB0A 3U0VA 1J97A 1G8FA 2RC5A 1BQ3A 2R6FA 4EY3A 3NJRA 5CA0B 2PSHA 2IS2A 5DBIA 1QPGA 1X1DA 4BNDA 3PQ8A 2WBLC 2WTMA 1DBSA 4AJHA 4UUMA 1XI2A 2C8LA 4FCVA 5DU2A 3RFTA 1R18A 6ADHA 1UZNA 4J1QA 4DADA 4P7GA 1U7PA 4WIAA 1EJ0A 2C7BA 3OJLA 4DV2B 3FCEA 3AY3A 5EQFA 1YE5A 4OF4A 1SO8A 1CUWA 4GE3A 1OBCA 2MJLA 1H0RA 4I5GA 4INOA 4KVAA 1V2GA 4AUNA 3OQHA 3H1PA 1S3FA 2XYHA 4I9UA 3FCCA 4JX9A 5HTOA 3FWHA 4UDNA 3A9SA 4C4ZA 1I9GA 2PSFA 5ALQA 3VR2A 5KWJA 1ZAYA 2O8FA 3U3XA 1E5QA 2DQKA 4JB2A 1I4LD 3Q12A 1JP7A 3EQ2A 4WN3A 3ICEA 1LI4A 4BNKA 2NACA 1UOEA 2CLHB 3CVJA 3R9XA 1DU4A 1JI0A 4GXTA 2PHZA 4DPLA 2OBLA 2H57A 5AOCA 1BE8A 1PGPA 1X3LA 2ID4A 4NS1A 5I8ZA 3SFTA 4BLPA 4C5BA 2NU6B 1L7BA 2G06A 3L79A 3RBAA 3WHKA 5LDDC 1H1TA 2DFPA 1AVTA 3TVYA 4DR3B 4GZLA 3WX0A 2I5PO 2VA9A 3SQOA 1B3BA 3G9UA 4DEVA 4EGAA 2AFIA 4ARCA 1BS2A 1ZJ5A 2VR1A 2B83A 5H8WA 4B0PA 2I3GA 1J06A 1MX9A 4MCJA 3NUZA 4I4TF 3LL4A 3AOEC 4IQ8A 3W34A 1YSCA 4NYJQ 2JA1A 2PANA 3DO6A 1AGPA 4L4SA 4URZR 5EWLA 4UZEA 3UV6A 5ALVA 3JRWA 5EHXA 2B6NA 2H5EA 3CJTA 2YZ2A 3CKMA 4FN4A 1JH9A 3QOXA 3Q1LA 3FM9A 4KTTE 4WN9B 1FQKA 3NHPA 5BRJA 3PHGA 1JAIA 1SUDA 3B78A 1CKEA 2FVYA 1KFBB 2F9FA 5F2KA 1Z3IX 4NZ9A 1PBTA 3FVTA 4XUGB 5DB4A 1PJQA 4RE5A 5HE8A 2DKOA 4AC9A 3V8EA 4JI8B 1UC9A 4YP0A 5CX1B 4MB6A 3FHOA 1W59A 3OLVA 3OKFA 1GVHA 3NHKA 3OZTA 1Q44A 3R5KA 4Q7EA 1O2DA 3I39X 2GZSA 1V16A 4QPDA 4X61A 2R85A 3NV9A 3MWFA 4FHFA 3VM6A 1CR1A 1W5EA 2YFYA 1NWCA 3DEKA 1KZHA 3AF2A 3C97A 3OLYA 4OHVA 2CMHA 1ZOPA 2AIRA 3HV2A 4OHOA 3BB1A 4Q3EA 1YJAA 5GP1A 1CB0A 1WUJS 1K86A 3DQQA 3GZ4A 4YUZA 1AE1A 1RR6A 1A7UA 3OMWA 5JYBA 3NBMA 3NHSA 3EGWA 3UGJA 3ZJUA 4ZQEA 2PDAA 2ZSFA 4KE6A 2YQZA 5BR4A 1N77A 2P2YA 4ZOLF 1Q1AA 4PRZA 1C3JA 1SB9A 1XVTA 3T6KA 2IOQA 4E5PA 4NIMA 5AI0A 5HG0A 4MVYA 2OSVA 2ZYAA 4IG9A 4RIIA 1RFGE 1RZVA 1VYVA 2ERYA 4Y2JA 3VNUA 3ETDA 2HTEA 3KWFA 4BO3A 2CVFA 3JQ8B 4G5QA 2FP4B 3VDQA 3RVQA 1E1DA 3TFWA 3CLVA 1X3SA 1JFFB 1MBZA 1ZGCA 3V1NA 1P1JA 3HN6A 4IDQA 2I29A 1W75A 4C0QC 1WW3A 3RK4A 5DMHA 2RKWA 2PGDA 4U9UA 5KNBD 1DGQA 2JLYA 1NN5A 2JFYA 3I2KA 3LIPA 3NWEA 3PGLA 1YOVA 2ZQ5A 1UFRA 2X3FA 4OY3A 5E7IA 3JWPA 2NO1A 3LCMA 4O1IA 5JANA 5KKCA 2ZJ0A 2EATA 4OFZA 5LA6F 3L7MA 3H16A 4GQIA 1C50A 3U4QA 3S1SA 1SKQA 1VHLA 3A1VA 5KOJA 3LK6A 5HZMA 3GLGA 2JASA 3KVRA 1ZH2A 2GM9A 3KDSE 4G2NA 3OD1A 3PI7A 3KOOA 5CB4F 3CW9A 3OSUA 2AXPA 1SCAA 2Y76A 5C80A 1H3EA 3A6KA 3O8QA 1A8UA 3JTMA 3QPCA 4QUJA 1J7JA 3KUUA 1X1SA 3V8RA 5KO2A 2CCKA 3MYYA 4AVYA 3U09A 4UHBA 1IATA 3PXDA 1U0SY 3SEQA 3ODPA 1NE2A 1W2HA 1XZNA 2PX5A 1DC4A 2AWNA 4R2LA 2W6ID 1C0KA 2BJWA 2IKSA 1K5PA 2ZBPA 2WSIA 1I0LA 2OTCA 3DV2A 4NBVA 4D46A 1NY5A 2R25B 2XQJA 3TLGA 1YDMA 5F5XA 1GCUA 3I8OA 3T3OA 3TDMA 3WYCA 4MAFA 1DJQA 4K2HA 1KEEB 1N5IA 1HTTA 1JUDA 5EJFA 2CVQA 4ZZ2A 3EG9A 2JAPA 5K20A 4DQKA 3M4XA 1GRVA 1ELOA 1SUPA 1XZFA 3R09A 1MN6A 1SR8A 2FX2A 2XCOA 1W34A 2E87A 1DFHA 3SOZA 4YT2A 1ZQ1A 4Q9LA 2CUTA 4U5QA 3C8UA 3PPYA 1I5OA 4QGSA 2IYWA 3DOHA 1M7GA 5JZBA 1TGVA 1HYBA 3F3YA 4L72A 3IEUA 1W5BA 3ADOA 2OEPA 5JQGF 4QREA 3S81A 1DLJA 1GQSA 1WKCA 3SJCA 2IOFA 3OPVA 4V0MA 1G5HA 2IT1A 1JIIA 3CZRA 1XGKA 3ZHYA 4O1HA 1UBSB 4GGOA 1CD5A 1U1EA 2WYWA 3W2TA 4E6PA 4F71A 2W6JA 1USWA 2XMSA 3BFJA 5CFNA 3UKJA 1H8EA 4DY6A 3WGJA 2B69A 1F6DA 2VQDA 4OXRA 4BMNA 2OB2A 1IM2A 2GZ3A 5FWYB 4D0NA 4EA8A 4Q4CA 2WP8J 4C6SA 5IS2A 1M54A 1E2MA 4MITA 1UIRA 2CJWB 3I8XA 1WQ1R 2Z9CA 4RKWA 2P9YA 1W4RA 4F3RA 3FOAA 1N2CA 4ZT4A 3OZEA 1M2OB 1NLFA 2VJQA 4NQRA 4YQZA 3RNOA 3ZWKA 4ALKA 4Q5IA 5ES3A 4GYKA 4AKSA 4C06A 1FP1D 2O8CB 1NBWB 1F0NA 1Q1GA 3VPHA 2VCYA 4XLLA 4CMGA 2HHHB 1VM6A 4MXDA 1QMPA 1XJQA 2GK6A 3EGDB 4QU0A 4ZTBA 1QV7A 2H8GA 3KKKA 4RQTA 3X2EA 1EWKA 2DC1A 3L3BA 4YI5A 4B3IA 4RJTA 1JR4A 1PFGA 3UWDA 4V03A 4EYEA 2DQYA 5KUTA 4DF3A 4FW8A 4TT3D 2CDBA 3CPHA 4J1TA 4JJKA 4Q4JA 4OMCA 4FDMA 1PR2A 3ZQUA 3IE0A 1U5AA 4JYBA 4MWZA 4X71A 4OIMA 5L3ZA 1GYRA 1GARA 1O4VA 1XQWA 4LRYA 4GRDA 5AO9A 6AT1A 2WE7A 4Y6OA 2PUCA 1X6VA 5DOZA 3QELA 3B2EA 3AQIA 5M04A 3PI6A 4QUDA 3ZHRA 2BEJA 1UBNA 3UMRA 3G2KA 2WJGA 5C35A 2K2QB 2DFNA 1P3JA 5EWJA 1KXJA 4W7SA 2ANBA 4D3FA 4D9IA 1C3XA 1FE8A 1Q91A 2EFGA 2FE1A 3QHQA 3KZCA 2P2DA 3EK2A 1E3DA 3H7IA 5ALSA 3SKYA 1GKIA 4YROA 4RGVA 1NOJA 1S8OA 2NV2B 4HSGA 5H80A 1MHPA 2CHFA 2J0EA 3OURA 1SU6A 2FTKE 1VG1A 2VXOA 2XGMA 4NYMQ 2WABA 1EVIA 4E08A 3JATB 2AR7A 2CLOB 4IDHA 4K3VA 5IWAB 4G01B 3GUCA 2GPSA 1VCHA 3JWIA 4DYHA 3BIWA 1Y9ZA 4RD0A 2J0UB 2WEKA 2PLAA 4Z0PA 4X8HA 1VFPA 1MJHA 5ELMA 3H9JA 3UTDA 3EGCA 1TJ3A 1U5BA 2Q6VA 2VP2A 4AZ0A 1TI7A 4BXOB 3MD9A 4OM8A 1OQAA 4TKMA 4IY1A 3CF0A 3U4DA 4YRSA 1Z15A 4QICA 4O2BB 2JBHA 3IOCA 2ZI9A 2HDNB 3ZHTA 5K3BA 4D6PA 2B1QA 2ZULA 2O4UX 5DX8A 3T1VA 4F3KA 2EZUA 5AK5A 2QTGA 3ETCA 4IVNA 3L7LA 3MFYA 3CRVA 3EA5A 1T2EA 4WXHA 3THOA 2V9ZA 1I2MA 2AKAB 4IKEA 5AKHA 1NVGA 5FT9A 4M4SA 3NWOA 2AJDA 3QBJA 2W2KA 4RVUA 5DGDA 1YZFA 4D4GA 1C7FA 3OZVA 3FGOA 4QOEA 3VR3A 3ZD8A 2VYNA 1WB6A 2BBWA 4C4TA 1KI4A 3C6QA 5JAHA 2YDYA 4LQCA 2PZKA 3E9MA 4MS4A 5JY1A 5FEMA 2VQSA 3DOIA 4I8DA 5A3SA 3A06A 3HYRA 4N40A 1CR6A 5LQSA 5C8YB 1ZC4A 1MABB 2IYSA 2OD9A 3H0KA 4UREA 3LPDA 1C8VB 1FQOA 3GNLA 2W4MA 1TB4A 5CH8A 3OQBA 2JAUA 4AJ9A 4YUAA 2EKDA 2G4CA 3MSXA 3UK6A 1RWOA 2WICA 1DBWA 4LJ6A 3RABA 3TQSA 4II3A 4DNQA 5BW8A 3U39A 3TEJA 3AHHA 4LTMA 4PSAA 3R6DA 1PJRA 1OFGA 1ZK4A 4DA8A 2XNDD 3TLYA 1BVYF 1VXRA 3A1UA 4G4SP 5T57A 1KQPA 4KCGA 5CD1A 1GNSA 3CNEA 3QLUA 4Q37A 1XYYA 5H3HA 4UHCA 3DPSA 4GLBA 4ND7A 3AI2A 4M0PA 4AWAA 1JE0A 4R84A 3SBEA 3KIPA 2UUAB 3AR9A 2O1SA 1X7WA 1Q11A 1O6ZA 1TPYA 2HWUA 2O4CA 2R751 3WGNA 4U6QA 3UFXB 4DV6B 4P0PB 2YXEA 1Z8HA 1G8JA 2AFHA 1ECJA 1MC5A 2UKDA 4WKPA 2HCRA 2J5BA 3E7FA 4FHCA 1R0WA 4GLLA 4JR1A 4M49A 3UPUA 1RYMA 1KVTA 2QUHA 3KB6A 3WYAA 2HLDD 2XHEA 3JQGB 3ECCA 3EODA 4KQGA 1NX6A 1MDBA 2A78A 3KV1A 2HU7A 4ETIA 5M5BA 2V0GA 1A04A 1Y8AA 3N7AA 1RQXA 4E3WA 1UM8A 4DMKA 2CXNA 1A8HA 5CBPB 1BX1A 3EOZA 3FF4A 2O1EA 1C1YA 3F8SA 3LVQE 4YI3A 1QUEA 1EDZA 2EZ9A 1W4LA 2J7PD 4Z0TA 5L9AA 2YXDA 3EISA 3NP9A 3ST7A 2AF3C 1ECCA 1KVQA 1YKSA 1PSWA 1PV1A 2VDWA 3UK1A 3BFPA 1LLCA 1P3DA 2QUIA 3JQ7B 3F5SA 4KXXA 1L4KA 1AIPA 3NVMB 1X7ZA 3VR6D 1LWOA 1D4OA 3GW8A 1QHEA 1Z26A 4GRAA 4GIBA 4BS9A 5F1YA 5J1SB 5AT1A 1L4GA 4D5EA 1W36B 2HWXA 4IUBS 4JVNA 4B81A 1HO3A 4FDLA 5EPUA 3ZG6A 3B1FA 4DANA 3SXUB 3QBEA 4GSLA 4YASA 2P6OA 3AF3A 1RHJA 2ZI6A 3PXEA 2UXCB 2COUA 4P4LA 1V2HE 4B7ZA 2OAEA 2O14A 3ABOB 2IZ5A 3OPMA 3IPXA 3FOEC 3HUTA 3IHLA 2UXBB 1IOLA 2N47A 2OCGA 3TQRA 1U94A 1EWTA 2ZIXA 3KE8A 1NYQA 4L02A 2CYCA 4ZOAA 3UMGA 1FRFS 1AKEA 1XMPA 5AVQA 1XZDA 4QODA 1IQPA 1F3LA 2C1EA 4DLTA 4YQFA 4CKCA 1KYYA 5IM5A 4ZZ3A 2JLQA 1YRLA 3W6NA 1F06A 1QYRA 2FOLA 2W6QA 3CNHA 4R1QA 4YPFA 5AUOB 3UH0A 2HOQA 2PTGA 3ZKWB 2VT2A 1RHRA 3C5VA 2QVZX 1W93A 5JSUA 1D4ZA 3U62A 4KFTA 4BNNA 4L3VA 5J2UA 1M1YB 621PA 2QPOA 3FNIA 5EWJB 4ENPA 4ASUA 1T5OA 1AQYA 2CL5A 2PWAA 2PY6A 2QUAA 2Z1DA 1YB1A 2DZDA 3E3AA 2NU8A 4AIRA 2JCSA 1I33A 3BRCA 5FBZA 3A9WA 3OCZA 4QO7A 2WHXA 4RJKA 5CA1A 1QU3A 2EL7A 2ZYGA 3W9BA 3BE8A 2ZKLA 4L8YA 3VR6A 4B76A 4JI7B 5C8YF 4R83A 3FMFA 4PNZA 3V5NA 4MTLA 2JI9A 3ECAA 4IDCA 4UNPA 3CKYA 2Y0EA 3TXAA 4DLWA 4ZVVA 4TL9A 3USCS 3WGLA 4LBZA 2NYAA 3CZQA 1JQEA 5MN4A 2CVZA 3AEKB 3L5KA 1LLDA 2OBMA 3SF8A 2LCFA 2PJUA 4YR7A 4LDRA 1NQTA 2BUAA 4G2TA 3UQYS 2VDQB 1YMVA 4BRSA 2WLSA 4ZOBA 1TQ4A 4LJKA 1Z0AA 2IRWA 1VCIA 4MW7A 3A4IA 4CCYA 3DO5A 3T4XA 2VH5R 2OORA 2VRCD 1KDRA 2I3ZA 3CF4G 3L0PA 2M1ZA 5BWLA 5EY5B 1YR8A 4NCBA 1NJ8A 3GGPA 3M7IA 2I4OA 4GI5A 3OT5A 3FZQA 3RCBA 1K7CA 1OI7A 1FP4A 3RTBA 3LTEA 1LC0A 2QRVB 5HGJA 2O5RA 5HJEA 2PKXA 4UTXA 1B15A 1WR8A 1CQXA 2BUBA 3OE7D 4PLTA 2I6XA 3UJ8A 4MKZA 2E4WA 3IT2A 5JY6A 1O54A 4AXBA 3UY4A 3ZK8A 1OXBB 3EDMA 3SI7A 1BAPA 1I4WA 4TOIA 4X1OA 5AOVA 1SFRA 4N3BA 4NH0A 2G8LA 4GC9A 3WQHA 1IG3A 3SR3A 1FP7A 1JIJA 4EK9A 2FN7A 4DZZA 4JI4B 4TTAA 3WADA 2WWGA 4ADSG 3QI7A 4QYTA 1PKEA 1FS4A 2H4WA 3BWBA 2AYXA 1BJRE 5SY4A 1WPXA 1VLHA 2H2FA 4H77A 9LDBA 4ZOCA 2VP6A 1KK2A 4DGSA 3HB5X 3C41J 4L5AA 3VSEA 5KYKA 1XUOA 5DM70 3VC3A 3LZCA 3LSTA 2WE8A 3DPUA 3HY6A 3NCHA 4ZDJA 2EGHA 1ISJA 3VRHA 1YMUA 1AGXA 3MTIA 4DJEC 3T95A 4OOEA 3WMWA 1O6GA 3PWZA 4R01A 4K9OA 5DNAA 3CKKA 7REQA 4OJQA 1KJYA 1TMKA 3IMFA 5I45A 1C81A 2Q27A 2QE6A 5THXA 3H1EA 1KO4A 4TLMB 2CZGA 1ZM2A 3EIWA 4V38A 2QRPA 5AXAA 2Y4OA 1CRZA 1R5BA 1X7WB 2PD4A 3L0SA 1OI4A 3NEAA 4S0ZA 5KCMA 1XIVA 3THSA 2SNIE 3EJWA 2UVQA 2IDKA 2Q6KA 3FWNA 3Q3HA 3MIZA 5F1KA 4XRGA 1JSLA 1S2OA 4LK3A 4TMXA 4WK6A 1R8JA 1V16B 2RGNC 3HZOA 3WLPA 1MDFA 4WKBA 3WWEA 3PC7A 4HO1X 3HFGA 3N53A 3CW2A 3VPDA 5ADUS 3GLGB 3K0CA 2XGJA 1BHJA 3EXIA 2Z09A 3WV5A 4MQFB 3ZD9A 2HRZA 3ZBUA 1EM6A 1BEUB 3B48A 5CJ2A 3KOMA 5FI1B 2JIBA 4R1LA 3PNSA 5B4TA 3DYVA 2KX7A 2W90A 2BLLA 3KR1A 1DADA 1Y3BE 2AKYA 1XEWX 4G67A 3TB6A 1XZHA 2P7HA 5IJ9A 3JQBC 1Z28A 2QGZA 2OKCA 2XD9A 3QMPA 2VTBB 1DS6A 1GCIA 2Z8ZA 1XRRA 2RGXA 2YWJA 1I13A 3K31A 3WJ7A 4PYLA 1FDSA 3AL3A 3C1UA 2OVFA 4KI7A 1U6IA 3T9DA 2VUUA 4LSMA 3W5IA 4B17A 4R98A 1KGDA 5HZHA 2QIOA 1ORWA 1D0VA 1QH9A 3KWMA 4GBED 4LRUA 4J1TC 1U9IA 4Q3KA 4Z9YA 3L8GA 1ACMA 4QQFA 3UBTA 1W0KA 1E2JA 1PTJC 2GBLA 1WSDA 4K28A 3SZRA 4Y6SA 5ENDA 3R0VA 4P84A 3GLHB 2C4KA 1XHFA 2OBNA 1U63A 2ZIVB 3CBGA 4DDTA 3O4RA 1KO1A 1MTZA 3RANA 1U31A 1I5RA 3PQEA 4IEEA 4RELA 5FXMA 4R0NA 1O3YA 4NLLA 4X8MA 1RADA 1KJIA 3L0OA 4RGYA 2PS1A 1UP4A 2JZOA 4ZI7B 5J5CA 1SHTX 1AHHA 3RJZA 3S2SA 2BP7A 2YHIB 1Z0IA 3IMEA 5GOTA 4KR9A 3C6KA 4IIDA 5FUVA 1EJ6A 3ELUA 4UTPA 1HNZB 3DMFA 3AEUA 1XLTC 1GLVA 2F59A 3F1LA 1FNDA 5L8VA 2IYAA 3P52A 5B7NA 1W5SA 4DDVA 2IEGA 4CQMB 2VZ9A 4TROA 1R7RA 2QRMA 3MMXA 4UBJA 5FWXB 3RU7A 4H27A 4S12A 4B32A 1AV6A 4D8VA 1JLMA 1SXHA 4FDVA 1BDHA 4K6CA 4NCNA 3DE6X 1G5QA 3TCKA 1Y8QA 2A1IA 3UAWA 5JSHA 2EHJA 4IH4A 5J4VA 2QI9C 3GWGA 1O57A 2HIHA 1BSVA 3OT1A 2H9YA 1GM5A 2BC9A 2A84A 1EGQA 1M74A 2W6NA 3L8ZA 3PP8A 1A1SA 3GT0A 2F3TA 3PEUA 5EKDA 2J3MA 2QM3A 2GF0A 1ONNA 2XF2A 4HPXB 1M75A 2Y0PA 3GZNB 3R0JA 1UMBB 1RI4A 2FWNA 4ZD6A 3ETHA 3K5HA 2C9ZA 4RK6A 2ZVDA 2ZANA 5HF5A 3MRTA 3BMNA 3IV7A 3UGQA 3VR4A 2QRVA 1GRNA 3AOEA 2JIPA 2VPZA 3O8DA 3FNGA 4IXMA 4P7KA 3ZVKA 1K75A 2V96A 3K0CC 3ZHZA 4PLPA 1AKUA 5DN6A 1TU0A 2ZJAA 6ABPA 2Q21A 4CM9A 4DCVA 2ATIA 4TSRA 3COWA 1KEPA 2PRZA 4MJ3A 2FETA 4JT4A 4I3FA 1I3NA 1WETA 4D26A 4XYGA 1UXJA 2DR0A 2XY4A 5B3AA 4EFLA 3DAOA 3QPBA 1DCKA 2JLAA 2VWGA 4J0FA 4WSOA 4D9MA 5KWSA 4P3KA 3IJPA 5H0IA 3A4NA 3D0KA 3EIHA 3H3JA 2WMNB 2BEVB 4L9AA 5T4HA 3SP1A 5C4IA 1E6EA 1A88A 1Z68A 3QKWA 3A3KA 2UZ3A 3RSLA 4AZTA 3IV9A 1D6SA 3GRUA 1OWNA 2HQRA 1IOZA 1XK6A 3N2KA 3NC4A 4R41A 1KU0A 3A36A 2UDPA 4F91B 1VPEA 5EL0A 2CKMA 1O89A 3N2LA 4JUAA 4Q1AA 1W88B 3B1ZA 3HVJA 4BO2A 5KDLA 3BL8A 4PSCA 3HACA 4BMPB 1Q1BA 4BVAA 4Z7NB 3SQWA 3K5WA 4N5HX 1IVNA 5AUQA 1NSFA 2ZDHA 3JQCA 1NY6A 1P2GA 2AUNA 4WEOA 3RYTC 1FYXA 2WOJA 4FYHA 4J16C 5CFZA 5HXAA 3PTLA 4RULA 3S6JA 1UJMA 1TZJA 4IDEA 4O5OA 1QMGA 5DFAA 3G0HA