2CHFA

Structure of the mg2+-bound form of chey and the mechanism of phosphoryl transfer in bacterial chemotaxis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Mg(2+)-bound form of CheY and mechanism of phosphoryl transfer in bacterial chemotaxis.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signal transduction protein
molecule keywords CHEY
total genus 47
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1994-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2chfA00
4OLBA 1DCFA 4RK6A 3F7NA 5JNUA 3UKJA 3HZHA 4P98A 3HVRA 3I42A 3JS5A 4G0OA 4KQ9A 3L49A 3F6CA 2E4WA 4DADA 5CNIA 1JX6A 3QLTA 1VKRA 1DJMA 4N76A 2PKXA 3LUCA 3QK7A 3O2SB 1QPZA 4RXMA 3SY8A 1EHCA 4MS3A 1ZVVA 1EWVA 3T38A 3QEMB 4TN5A 1K68A 3SQNA 1ZESA 1ZH4A 2A9RA 3UUGA 4ETNA 2J48A 3OMWA 2FW0A 4PYRA 1PUXA 2PLNA 4OBBA 3LFTA 4MGEA 4LX8A 1ZGZA 4MR7B 2FMFA 3C3KA 5E3JA 2FQYA 2PJUA 2WB4A 4MR8A 3IP9A 1ISRA 2ID9A 3CLKA 2AYXA 1DCKA 3KSMA 4HYEA 1PHRA 3NNSA 5IULC 3LUHA 1U2QA 4WWHA 3RQIA 1ISSA 2M1ZA 1LBHA 5FWYA 4F3TA 3DLBA 4G0XA 3LUJA 3LUAA 1L5ZA 2QXYA 3O1JC 4W5NA 3MA0A 2FXIA 2JBAA 4G0MA 2CWDA 4Z4IA 3FFTA 1ZN2A 3HS3A 1JDPA 3R0JA 2FQWA 2JCGA 2MSWA 3N0WA 3IP5A 4HNRA 1U2PA 2HSGA 1R8JA 4N47A 4RK4A 1TM2A 1W25A 1JLKA 4O5AA 1YTUA 5EWLA 3Q41A 3K4HA 2HQRA 3CRNA 5KQPA 4KV7A 5DTEA 1MB0A 1SD5A 3H1EA 3OM0A 4XASA 3HDGA 3IPCA 2IPNA 4RY9A 5TQ0B 4Z4GA 4LDAA 4Z4HA 5FWXB 1WETA 1BDHA 4MRMA 2FMHA 5D2CA 3LMKA 3OMXA 3H6HA 4YLEA 1B00A 3IPAA 3S99A 4YS6A 4EY3A 2AYZA 3M9WA 4KMRA 2RJOA 3T6KA 1QO0D 3Q9SA 3EJWA 4RV5A 4YCSA 4PZ0A 3HCWA 4D6XA 2QSJA 3NBMA 2WMYA 2XDYA 4KVFA 4JB2A 3TX6A 1DP4A 4OATA 3H1FA 1Z17A 2LIVA 2N9UA 1EWTA 1URPA 4OLAA 1BVHA 3A0UA 1M2FA 1KRWA 3KLOA 4MR9A 5EWJA 1LJLA 2E4XA 2LPMA 5TPZA 1PEYA 4PICA 5C5EA 5GQSA 4QYWA 4H60A 1CYEA 2JVJA 4TLLB 2OQRA 1EFAA 4TMYA 3KKEA 1QQBA 4YP9A 2QVGA 1TLFA 3KLNA 1PNRA 2IPMA 2R47A 1C4WA 1FFWA 3EAFA 4EGSA 3OLWA 2PMCA 4DQDA 1Z18A 4RK1A 3HUUA 5FBHA 3O1IC 4NCBA 2CHEA 3JVIA 3RVRA 2R25B 1M2EA 3TMYA 2NZVG 3QX9A 3GV0A 1QO0A 1JFSA 3KG2A 4OTZA 1S8NA 5GOTA 1AB5A 3CG0A 3HV2A 3NHMA 1DC8A 3C97A 3G1WA 5KC9A 2HJ9A 2PL9A 3O21A 1QQAA 4RU1A 1Z2DA 2LP4Y 4XFKA 4WZZA 1ZDMA 3ROFA 3RVKA 3C3MA 1F4VA 3D8UA 3KJXA 4S05A 1BDIA 3DZDA 5C5CA 4HNQA 3OQOA 2PUBA 4Y9TA 3EDCA 1FFSA 5IEBA 3URMA 5CNKA 3TD9A 4PEVA 5CNMA 5KQMA 3OLYA 8ABPA 2FSPA 4IMIB 5TQ2A 1NXXA 2FMKA 3QLUA 4D74A 1KMIY 2MSKA 4PE5B 2GI4A 3QELA 1YVUA 2A9PA 4XARA 2MYTA 1QP4A 2JK1A 1NTRA 5JS1A 5KQGA 5KQLA 1K66A 1RXEA 2PUAA 1MB3A 4M88A 4W5QA 4Z4EA 3SG0A 3N0XA 3BILA 1YS6A 4MQFA 2W42A 3H5TA 4RDCA 5TE9A 1GUDA 2QV0A 4H3HB 4RWEA 2B1JA 4DN6A 2NUBA 1JFVA 3UK0A 1DBWA 3JY6A 1D4ZA 3MF4A 4Z9AA 4QICA 4G0YA 3HM9A 2VUIB 1A2OA 3Q7SA 1ZAYA 1HEYA 3K9CA 1DZ3A 3T95A 4F11A 4W5RA 2BGGA 1JDNA 3KHTA 4RY0A 3CG4A 1SXHA 3IP6A 3O1HB 3EQ2A 3FFXA 3ILYA 1TVMA 3H75A 6CHYA 3F73A 3CZ5A 1M5UA 2PUEA 1J56A 4IILA 4MS3B 4EYGA 3QEMA 4ETMA 3GL9A 5TPWB 5HSGA 1GLGA 3H6GA 4JA2A 4B09A 4XLTA 4ZMRA 1BDJA 3LUDA 2RJNA 4MYRA 1KGSA 1QP0A 2FEPA 1LJUA 3OLVA 3NNDA 1JYFA 1Z25A 3VNBA 5EWMA 3IP7A 4QYMA 4MR8B 2FLKA 2HQBA 4MQEA 4F06A 1NXPA 3TO5A 3LTEA 5ABPA 2PUCA 4LZLA 1DBPA 1P6QA 1NXVA 1TJYA 2FLWA 3OQNA 3CKMA 5TPZD 3RH0A 1PEAA 3SNKA 4MLDA 3A0RB 1FFGA 3MIZA 1XHEA 2FN9A 5FBKA 4HNSA 5F64A 2JB9A 2VYCA 4RK7A 5T3YA 4EYKA 1AB6A 2LUOA 2WJAA 1L5YA 4UHKA 1U04A 2KYRA 4XAQA 5HM6A 5T7BA 1H9CA 5BRJA 2WRZA 1RPJA 4YR7A 1M5TA 2H3HA 3BRSA 1USKA 5B3JC 4W5TA 3T8YA 2E4VA 1DRKA 1A0OA 2GKGA 3ROTA 4WXMA 4EUKA 4KREA 2QVCA 1E6LA 2QU7A 1SRRA 1D2AA 1YIOA 3CFYA 1NATA 2O20A 4O1HA 4KK4A 4D6YA 3GRCA 2M98A 4MS4B 1C0EA 2V0NA 4H3KB 3LKVA 3L6UA 4MR7A 4G86A 4N0PA 1YMUA 3O74A 2GX6A 4UHJA 4RZSA 4Q7EA 3RVQA 5FWXA 1NXTA 3DGEC 1Z16A 2HQOA 3Q7RA 3OQMA 3FGZA 1Z2EA 3I09A 1P6UA 4ETIA 4KZKA 1U0SY 5KI6A 2IPLA 1FQWA 5DLEA 1YK1A 2ZAYA 3HEBA 3O2QB 3H5VA 3LUKA 2R48A 4LDZA 5FWYB 3RVOA 1UDRA 3NNNA 5DCLA 1P8AA 1VLZA 5KWSA 1Z12A 5IUNC 4EVRA 2JBAB 3O2JA 5JNWA 1MIHA 4ZPJA 1QP7A 1YS7A 1E6MA 4KK3A 2YHBA 1Z26A 2PE5A 2PAFA 4O1IA 4LE0A 3QLVA 1NY5A 4RKQA 4EYOA 3CHYA 5IX8A 1D1QA 2IKSA 2PUFA 1JH9A 2L19A 4MS1B 3IDOA 5EWLB 4KFCA 1APBA 1KRXA 4YGXB 3LUGA 5IEJA 3HUTA 1GCGA 2DRIA 4ZYLA 1JBEA 1LBIA 1DCMA 1SXGA 1YMVA 4JB0A 5DGCA 2IOYA 2IYNA 4Z4CA 3CTPA 4RS3A 3N53A 1I3CA 2VK2A 1Z15A 5HKOA 3JPYA 3TB6A 1MAVA 3EGCA 4W5OA 1ZGGA 2RGYA 4RY8A 1DBQA 4Z0NA 4EVQA 5BR1A 3FDFA 2QW1A 3KCNA 4FE4A 4Q6WA 1CEYA 2JVIA 4JAVC 3EQZA 4F12A 3I45A 1VRVA 4IGAA 1FSPA 1NXWA 2I6FA 1D1PA 2YHAA 2IDMA 2P9HA 3CS3A 3G85A 2P4UA 3P9YA 1F51E 4N0QA 1E2BA 1E6KA 3MM4A 1D5WA 4MR9B 5EWJB 1RZRD 4XXHA 4FB4A 4MRMB 2MYUA 2FN8A 3GWGA 2FKAA 3KS9A 4GNRA 3HK2A 1BA2A 3LKBA 2F8TA 3A10A 2ID7A 2ZWMA 4JP1A 1YK0A 3EULA 3QX8A 2NT3A 3O75A 1MVOA 9ABPA 3HO1A 1NXOA 3OM1A 2R4QA 2PL1A 2TMYA 3JTEA 4WUTA 2IPAB 3MMNA 4KPYA 2FEWB 3HJFA 2WJWA 4IF4A 4MQFB 1QMPA 1A04A 3DLHA 1Y1LA 4L85A 1PNTA 3VNAA 4MAAA 3N0RA 5HQJA 1LK0A 2WWVD 2PUGA 3RVLA 1IIBA 3RVJA 4RK0A 4E7OA 1JF8A 1OXKB 4NQRA 3B2NA 3SM9A 2MYPA 4Z9BA 5BQ3A 5TQ0A 1SXIA 5IBQA 3N6VA 2NZUG 1JHZA 1XHFA 1Z13A 3H1GA 3D02A 3I5AA 2E4ZA 3KTOA 7ABPA 4L4UA 1EWKA 3F6PA 3A3KA 4YO7A 5KC8A 3JVDA 2X7XA 2PUDA 1QNLA 1ZH2A 3E61A 2FMIA 3GYBA 4E7PA 1BAPA 4WT7A 3JPWA 3QEKA 1VPWA 4N41A 1DC7A 2FQXA 3NHZA 5IC5A 3SAJA 4RKRA 4YV7A 4S04A 1ZY2A 2OENG 1GCAA 1USIA 3FFWA 4MQEB 4G0ZA 4ZMSA 6ABPA 5CHYA 5IUKC 1U8TA 5PNTA 5TQJA 4NICA 3N75A 3RVMA 2QZJA 3OO0A 3OO1A 2F8SA 3ILHA 3OLXA 4RXUA 5JNSA 2GBPA 3OLZA 3C6QA 4JOQA 1QKKA 1ZHHA 3Q7TA 4MPTA 4NCAA 2A9QA 1USGA 2E4YA 5IUJC 4GPAA 5BRAA 3DBIA 2B4AA 2E4UA 2H0AA 1TMYA 4KQCA 4YRZA 5ED4A 2FEKA 2Q5CA 3GBVA 1GUBA 3RVSA 4IRXA 3H5WA 2FVYA 3QLUC 3BRQA 3KYJB 3HSYA 3N8IA 3LOPA 1XWWA 1ZITA 3MQ4A 5JNTA 4RXTA 5JS2A 4YWHA 2MYNA 2WY2D 4FE7A 2GWRA 3RVPA 4P1ZA 4Q6BA 4F8JA 3HDVA 5I4CA 1ABFA 3QLVC 4OG2A 4TLMB 4Z99A 3H5LA 3CU5A 4G97A 4LRQA 1JWLA 5EWMB 4KRFA 2L18A 2L17A 3M6MD 2A9OA 4G0PA 2NT4A 4ZJPA 1EAYA 2VUHB 1JYEA 1T34A 4ML3A 3H5IA 1RNLA 3CNBA 2L2QA 2FTKE 4RK5A 3C3WA 4WXEA 5JNRA 2CD7A 3E3MA 3M9XA 3W9SA 2RDMA 3FMVA 4MLCA 1W9HA 1DRJA 1ABEA 3H5OA 4NV3A 5TPWA 4Z4FA 3LUFA 1RXIA 2QR3A 3Q15C 5CNJA 3MYYA 3RVNA 4KNYA 2LBPA 4IMJB 3GA5A 5JNVA 3KYIB 2JRLA 5TQ2B 3EODA 1NXSA 1OXBB 5B3JA 3CZCA 3GBPA 3GT7A 3QELB 3BBLA 1JL3A 3DGFC 4G0QA 4QPJC 4RSMA 4EVSA 1RZRA 4EYQA 5DKFA 4LE2A 4JASB 1CHNA 2CHFA 2JVKA 2HPHA 4LE1A 4MS1A 1JFTA 3HXMA 3BREA 1P2FA 4MS4A 1DG9A 4N03A 2MSLA 4CBVA
chains in the Genus database with same CATH superfamily
2NZ8A 5K0TA 1EJ0A 4JJIA 4YWJA 4B8YA 3U81A 3Q0TA 3FKSA 4AK9A 4YCMA 3ZKWA 3DC7A 4A8JA 3HN7A 4WY2A 3ANXA 4EPXA 2BONA 2C77A 4X3CA 3JZDA 3KZOA 2QRKA 5LJLA 4HX2A 2FK8A 3VA7A 4OJNA 4EAAA 2QAGA 3KSAC 3RBZA 3C74A 1Z7BA 2FX5A 2X7JA 1QF6A 2YRXA 4DE5A 1LTKA 2RK3A 4MWZA 1FFDA 2ISQA 3L8ZA 3A28A 3COVA 4A0QA 4LF5B 3ISJA 4IQGA 4FZ3A 1UXOA 4L50A 2GLUA 4L4XA 1WRBA 2IYSA 3U26A 2OBXA 4E1BA 4H1WA 2CMDA 4YONB 1U80A 4L8LA 4OBBA 4MGEA 2C5SA 2VOJA 1YHZA 5G4KA 4NJEA 4BKRA 5T4FA 1G66A 4RELA 3GAFA 3KEOA 2QPAA 5IC6A 2DEUA 1LB1B 3CR8A 3AUUA 3SYKA 1TU0A 4QXMA 4BWYA 3I0MA 5L6LB 2PJRA 1EFCA 1DCKA 1GNLA 1RMQA 1G98A 1G1AA 2XV1A 3ZV5A 4NXNB 1VJCA 4JXJA 3PQ4A 2HHCA 3PI6A 4UREA 1JQAA 4ZICA 5L95A 3NIGB 4DR3B 2A9KA 1IHYA 3O8QB 4AICA 2PMBA 1Z3IX 3CSSA 4P3NA 5JASA 1Y33E 1I8TA 4NCKA 4CQJA 4LZPA 4C08A 4RLHA 2I4OA 2OBYA 3DEKA 4WJKB 1VKJA 4PCAA 4RQBA 1P3DA 3UV6A 4Z4IA 1KAOA 2DZDA 4GI5A 2FQWA 3F8SA 1WDLA 3QEAZ 1TOAA 6LDHA 3GFSA 1NUTA 2G1UA 1BYUA 3V33A 3A27A 1GA6A 4KWTA 2P9GA 2F4VB 2GO1A 3NFRA 3GY0A 4OLHA 4OGWA 2C2OA 4PC3A 3I2YX 2DH5A 4JYBA 4TXLA 2O8DB 2ZS9A 1JR3E 3F9CA 5E1DA 1Z45A 4OOFA 2D0OB 1DMRA 2P11A 1SBYA 3RJMA 3UHPA 4W6QA 2IIQA 3VHQA 3RV3A 4JBXA 1E3SA 1PEDA 2BGUA 5ALZA 3ZNOA 4DRXA 4QOIA 4XYBA 4J94A 5EPEA 4QARA 1X7HA 3DAOA 3C1AA 3K94A 1LDEA 3WYCA 4BBJA 1SCBA 1TEXA 2FRDA 4EY3A 1ZLXA 2BDEA 3L7LA 3QMPA 4U02A 4JJFA 3ND6A 3D6TB 4AP6A 4E4TA 5CTJA 1AMUA 5JISA 2GFHA 4ZGBA 2NU9A 3OE1A 5ADUS 3DF9A 1FFXA 3G8BA 3EVZA 3B3QA 3L5KA 2CC2A 4WY8A 4AYXA 4CMIA 4GGMX 5IK2D 2G5PA 3L6EA 4KOAA 1A9YA 2LIVA 4K9OA 3FPJA 1O9HA 2YH2A 2WG0A 1XK6A 5ESRA 2FN3A 4QT4A 3JWPA 1J23A 3SYNA 2B6HA 1VSBA 1WZUA 2WEKA 4JNCA 4RL4A 1BO6A 1PEYA 4YFYA 1QK4A 1TKRA 1FE8A 2J3LA 2Z04A 2W2OA 2G5GX 4IIVA 3IP8A 3OE7A 3PNVA 1O6FA 3TZ6A 4D0GA 3COSA 2I55A 2V3VA 4YQFA 2DQSA 3KKEA 4ZT6A 3V80A 1QRTA 4WXYB 1CX9B 1E96A 4PANA 4MW7A 3Q5EA 1UBTS 3CKLA 5I9IA 1ZONA 2H48A 4RCYA 4TWAA 2GF9A 5DGIA 4ECEA 5L3SB 4EP1A 4G65A 3OLWA 4WZ6A 2WHYA 4UE6A 4YMLA 5JS8A 2CDBA 4OHMA 2PJDA 3OJFA 4B83A 5EFOA 3TGPA 2C9DA 1GUFA 2WF9A 1JHPA 3CX3A 4XQ0A 4UVHA 3NP7A 2W4IA 3E9EA 1ZVJA 4GR5A 1T2CA 3KYDA 4OQNA 4BB5A 4NFYA 3CUEF 4BWVA 2AGVA 2PL9A 1UPXA 3ZQKA 3EWSA 1CPYA 2WZQA 1JSCA 1E61A 2IIPA 3NPMA 2CMHA 1L4EA 2OOKA 2AWNA 1YZHA 1QGED 3D8UA 3HCAA 4ZU3A 1BDIA 3DZDA 2ZSKA 3BGSA 2DFDA 3D2CA 1UDXA 2WJGA 3E8XA 2UZ0A 1D6MA 3ZYCA 2ZBQA 2CXTA 1Y9AA 4ZOBA 1NBAA 2BFCA 4ROTA 1OMOA 5HKKA 2I3DA 2Y05A 4G09A 2G67A 3U3JA 3V4VB 3NHKA 5IN4A 3HP4A 3UA4A 2QE7A 3ZZTA 4IXMA 4TVSA 3FWNA 4YC7A 2QOEA 1AGXA 5CLQA 3CKKA 2AUMA 1KVSA 1WUTA 4ANFA 1BXRB 3FJYA 1VE5A 1USWA 3TNDA 2BKUA 1RU3A 5EG5A 4DCGA 2FUG1 5F5XA 3GUYA 2ZQZA 4OFZA 2JIOA 2MWMA 4DF3A 2H5IA 4Z4EA 1TRKA 5C18A 4K9PA 4AIIA 2P41A 1DI0A 1PWEA 1SY7A 1MJHA 1TQ6A 2GN1A 2PGXA 5BQ5A 2PVSA 3PC8A 1GUDA 3DNPA 2AKAB 2ZB3A 1C8LA 4MUJA 4RWEA 4CM4B 1V7PC 2QORA 4QLOA 1GKIA 1BEEA 1DAPA 3WDKA 1QIFA 5CT4A 1EHIA 1E1QD 5K0JA 3K9CA 3W3AA 4TXJA 2WG1A 1RBQA 1UQTA 3UY4A 1G7SA 4EK9A 2YY5A 3TD6A 3IP6A 4KQWA 1O4WA 3P97A 1OI2A 1SOAA 4GM4A 4Q93A 4YCCA 5K0GA 3ELBA 3STTA 4PSKA 3WWZA 1G20A 1E1RD 1RTTA 4WUVA 4DLPA 2IYVA 4C05A 4EEXA 1O95C 5KNCH 2J0SA 4G89A 1XRMA 1ZSYA 4OGLA 3RRZA 4F9EA 1PFGA 4H27A 4EQ6B 2EW8A 1KXJA 4LGMA 4BP8A 5IVPA 3AL3A 3G6KA 3KEQA 1ZA2A 3LPLA 2G9QA 1SQ6A 2VRCA 3VPAA 1YA6A 1X3SA 3L7AA 4HAXA 1UCFA 3DBRB 3MIIA 4O3FA 2J07A 4Q9HA 1THTA 4BV2A 5A0VA 1HBJA 1ECFA 3RAJA 2IY9A 2PEZA 3FJ1A 3VZSA 1TJYA 5CBPB 4HDMB 1NGSA 4LJ7A 1EUZA 4XGKA 3KHSA 4LCJA 4MROA 4TTRA 3SNKA 2V7QD 3GVCA 1N3IA 4RTSA 3DOIA 4Y67A 4YMSA 2R7MA 4IIEA 3T9FA 1RLJA 1GZSA 5FT9A 1JIKA 4FFLA 4YJ2B 4C7XA 4PW0A 4HSGA 1ZR4A 2WJAA 4CUKA 1H9CA 5BRJA 4X71A 3RU9A 4AQDA 2N1MA 2VDRB 1H1DA 2VEOA 4BV3A 4YR7A 1KWKA 3QE3A 3IAEA 1D9ZA 1UP6A 5EJMA 2G9VA 3VHRA 1IY2A 3HB0A 1RBMA 1U0FA 2IUYA 1DRKA 2B4TO 2QIPA 4P93A 1T9HA 1P9RA 1Y3CE 1O0SA 1ZMXA 4KX5A 3KQKA 4FTWA 2HV8A 2VDPB 2HXYA 3IKVA 4RM3A 2FSVC 2I67A 2NSJA 3T7KA 4C03A 1HYBA 3F9IA 4C0LA 4L28A 2M98A 3BXFA 1RWQA 4IOJA 2BZSA 4E2ZA 3OBIA 4Q3KA 1AA6A 4EFDA 1SXJD 5JQWA 4KIFA 3WDMA 1TMGE 2B3TA 3GT0A 2OFWA 1UMBA 3MWEB 3DWIA 4NY1A 4KGXA 1SUIA 3D3EA 3U16A 4QFMA 1XNQB 3TMKA 3ZGXA 1TZCA 1PEKE 1SWWA 1PW5A 4KZKA 4GWLA 4LZWA 4PNPA 4EB6B 4URXR 1U7OA 4RHFA 3S55A 5ITZB 2NPOA 5JANA 1P80A 2NXEA 1X7ZA 1DOAA 1OXMA 2AMFA 1ISMA 3I58A 3H5VA 4GZ5A 8OHMA 3RVOA 4JI3B 3DS8A 5LBTA 1VLZA 4KKXB 5DGHA 2AIRA 2JBAB 3O2JA 4LRTB 4S35A 2QBYA 4KQ2A 1TCCA 3GD5A 2WAOA 1E6MA 3RR2A 1QP7A 1HE8B 4KXFB 3VR4A 2H1RA 3EW7A 5G3ZA 3UXMA 1MV5A 2X76A 1X1DA 5EJ6A 4OPMA 4YY3B 3NKVA 3THOA 1YS1X 2QG9A 2Q2NA 3VJLA 5K3DA 2CNBA 2PLRA 3CMCO 2XITA 4MKIA 3H9QA 1H2AS 1M2GA 5EIAA 5GOZA 2PGOA 3W6OA 4XRGA 4KFCA 7MHTA 5EN4A 1KRXA 4CFZA 1GCGA 1SCKA 5JEEA 1ZGCA 1NVAA 5B7NA 1JG6A 1QU2A 3QF4B 4V0KA 3FOFC 4ODIA 4RS3A 5EGSA 3J81k 3DCNA 1S5PA 1AS3A 2CLIB 2R84A 4JK3A 1ZINA 2Y1EA 3GGOA 5E7QA 2AN5A 2CB0A 1WQ3A 2UVQA 3GN2A 4Q4DA 3T34A 3VKVA 4E13A 5HKOA 4QQKA 2C8LA 1G7RA 1FTGA 2H9IA 3NHRA 5FPKA 3S68A 3Q3JB 1T8PA 1XDUA 2BI4A 2BVNA 3AI7A 1ZGGA 3BC1A 2FFQA 4JR0A 3T7RA 1L7OA 1P4HA 1M34A 1JEYA 5BRNA 1XU9A 4EG3A 5KWVA 3CF6R 4TKUA 3ZBUA 2XCQA 4FE4A 1RHQA 2YX1A 3I45A 2EKDA 4RA9A 1SURA 4BS9A 5JZ9A 1XO1A 3UUWA 4QYTA 1BFKA 1ZW6A 1ZXBA 2ROQA 1KAGA 1IBCA 1E6KA 2FSFA 3OOJA 1NR5A 3GOHA 4MR9B 1VKNA 3WJ7A 3ONDA 3FUCA 4N3NA 1DQPA 1YB5A 4X3OA 4EAQA 4MRMB 1IN1A 3OFSA 9GPBA 3PVCA 1KU6A 3KT3A 3LECA 2B4QA 2QYOA 5TS3A 3KS9A 1GA4A 4R6XA 4TLEA 1XYVA 1JFLA 3R3JA 1TM1E 4RTMA 1EGVB 3IIMA 2PFSA 4MH0R 4BB0A 1Z73A 2WKQA 3LY7A 2ONKA 3A3YA 2BMAA 1YK0A 1Z4NA 1IE3A 3PXCX 3QPBA 1PJQA 3B3FA 1YXMA 4P53A 9ABPA 5HIAA 4JOSA 2V6MA 4GKKB 1GZHB 1K7YA 3PX2A 2O2SA 3V32A 3VZPA 2EATA 1FDWA 1Z82A 3OJWA 5KB3A 2G4LA 3GNLA 4GMFA 5HZHA 1V35A 3EZXA 3FPBA 4MVJA 2X3UA 1JIUA 1QGZA 4GBED 4N8EA 1KI8A 1UEIA 2GNPA 3NDJA 4BTEA 5AVKA 3OA2A 5ECWA 3AVWA 3GRFA 4G2NA 4Q4JB 2FPGA 2V9ZA 3JARA 3UM9A 5BWOA 5G0SA 4XGQA 1Q11A 2IZOA 4PYMA 2R60A 4JT2A 1WXFA 4ZGWA 5BQ3A 4LYGA 1RXVA 3HP7A 5TQ0A 5LLSA 2FMXA 1GU7A 1X7XB 4JLKA 1ZM3A 3RUCA 2PXCA 1EGAA 4EW6A 5J5VA 3KB6A 2QLJA 5GZ3A 4HLQB 1N92A 2PT9A 1EMDA 3KPYA 3LHIA 1MR3F 5DP2A 4AKTA 3GNTA 4EG8A 1DL5A 5FUYA 5KC8A 5KINB 1XLTC 2QVBA 1U9JA 5LC1A 3GJ5A 4Y2QA 5THXA 4E12A 3G17A 5EZSA 3FVQA 2WJ6A 1W5SA 2I7TA 1EESA 1DEXA 1GZ6A 3WXBA 1DU4A 2QE6A 3UJ9A 3D31A 4PAOA 4B3MB 4G0ZA 3HRKA 3DYVA 1K5DA 4WV3A 3V8MA 1T5BA 1KEEB 3IJRA 4N39A 5D87A 4Z8YA 5ALNA 1I33A 1ISPA 2MMGA 3GMSA 2NO1A 1QQTA 3WYEA 3Q7TA 2EJWA 1VPTA 3X2SA 3EPRA 5KU1A 3WIDA 3ZW9A 1CQJA 4MV7A 2BFMA 3WHIA 2VRNA 1VC2A 1VYUA 2O06A 4UNSA 5FI5A 2OV8A 4M0PA 2VJNA 1ZJ6A 3FZNA 3ZGVA 2QVLA 2H0AA 2NP6A 3DOCA 2GEDA 3QPAA 4QQFA 3CZMA 1E9RA 3A6GA 3OURA 4UBNA 1HORA 4MUFA 5CURA 3IBTA 3NBUA 3MQ4A 1NM5C 1WSWA 1IJEA 3UAWA 3W34A 1PVVA 4Z3KA 4Q9AA 2HWXA 5LA6F 3ZW8A 2UUAB 5DHPA 2GKOA 2H2HA 4WGFA 5CA0A 2O8CB 3JRXA 1ZEMA 3TLEA 2PZFA 3H17A 4H6PA 4ZTUB 1EWRA 2OMEA 4TLMB 3GZ4A 3KBBA 4LRQA 2GEKA 1D2MA 3AUXA 3K5WA 3JATB 2JCSA 3MWLA 4YBRA 3G2KA 3GJ8A 1B15A 4MMYB 5DBIA 5A4FS 2YZKA 4OQ4A 1JUDA 4B5LA 4WBNA 3NYIA 1U7HA 4NR0A 4U7HA 2DH6A 4HXYA 2I71A 5JRDS 3AHIA 3ETDA 1Q83A 5ES3A 2OGZA 1GRRA 4MMZB 2X0FA 1DRJA 1UBEA 4EELA 5K01A 2YVQA 3S7TA 3SC2B 1OFVA 1WW3A 2I4MA 1FP6A 5ENVA 2GERA 5IMSA 2QI9F 3L05A 4ICIA 1A77A 4V38A 3WC4A 3CX6A 4UEWA 2C9OA 4PG7A 3UOAB 2NAFA 1CUFA 1H2XA 2V58A 5JPIA 3VM6A 1CJSA 5MFPA 3EHDA 4IPTA 3WZ2A 4OX9Y 1I94B 1QE5A 2ZJAA 4LYEA 4Q4LA 4RDIA 1FMLA 1MAAA 4BO1A 4C06A 2AFVA 4UU7A 3ZBTA 4LJ6A 5JJBA 3AVXA 3LBHA 3SIPA 1QDUA 1BD4A 4MP6A 4MS4A 4JQOA 2QRLA 2C00A 4QGHA 3A1WA 3ZHYA 2MSLA 1BGXT 4R8RA 2DFVA 3UKOA 4C29A 3BPSA 4D6YA 3FZQA 2YW2A 4EHNA 3TRFA 1KZ7B 3P4YA 7YASA 4F4IA 3RG8A 2HF2A 4J16A 4RTQA 1XTPA 2G07A 4G67A 1OZ0A 4NRDA 2W2PA 4WKGA 1G6HA 1PR5A 1RHMA 1WZEA 3PSHA 2P9BA 3AR4A 1VRWA 2VPIA 2UXBB 1KDRA 3NEYA 1FX1A 2CFIA 3C5CA 4UTVA 3O91A 1LNSA 1ORTA 3KWJA 2FNAA 3S1AA 5LBUA 1F5NA 1AY0A 4LFBB 1YRBA 2PCJA 3LCCA 2ZVJA 1N8TA 3V8NA 4MDHA 4N54A 3AI1A 1PUXA 4QD3A 1JE1A 4M9RA 4TRJA 3FVVA 3UHFA 4DG5A 3BEOA 1BMFA 2FUCA 4O3MA 2C7PA 2RSLA 2J3HA 4Q9DA 1DUSA 3GGGA 4K8RB 3TZEA 4YCLA 4EKDA 1CRPA 4HAIA 2AI3A 2Y2VA 1WUYA 1ISRA 1C9NA 3LPMA 3OTOB 3DBLB 3WTBA 1NP7A 2JH8A 1V9LA 1PHRA 1YUBA 3E9DA 1LPOA 3F9RA 5CX4A 4EATA 2C29D 3NZEA 4M0DA 4YJ3A 4NF2A 2CK3D 2WIKA 2YWFA 4ADSG 5FWYA 4BU1A 1P9LA 1CUAA 4PINA 4EF5A 2Q41A 3I9OA 1L5ZA 3SS9X 2YIJA 4I6GA 3TPCA 5F9MA 4ZCLA 2XVZA 1D6NA 3IJ5A 3QIAA 2FFRA 1QIHA 1PZEA 1WLYA 4HRVA 4CM9D 5JMTA 4IJUA 3MAGA 1JEQB 4HNRA 1GTJ1 5L3VA 3RCBA 4DT1A 3Q5DA 2ISCA 2CFOA 1PDVA 1SH7A 2OCBA 3FZGA 3VGJA 1CLEA 1EGQA 2JJ1A 1XNRB 1YTUA 4NWIA 3TLKA 1NWHA 3M8KA 2FKNA 5KWIA 2BHRA 2F1HA 3DZJA 2NADA 2QX6A 2XE6A 4URYR 2P40A 4HXFB 4S2UA 3WMWA 4BO2A 1L5KA 4GT1A 4Z4GA 1Q77A 5IM4F 1I4OA 2JHGA 3FRHA 4I5FA 4BVBA 3IIEA 1AUPA 1E7QA 3MWEA 3GF4A 3Q3VA 4GR4A 3PE6A 4PO9A 5D2CA 5JPCA 4R0NA 2B8JA 3KEGA 4YHHB 4EO9A 4LYDA 3E9ZA 3UTCA 3IUYA 4TV8A 1BWSA 1Y7TA 1R5JA 3HCWA 1VP9A 3KXLA 5FBWB 1PGPA 2QSJA 2ZYSA 1E2EA 1N7JA 3RAFC 1ZCZA 3QNMA 4FFDA 3LWDA 2WSIA 3SLGA 4TZ6A 1GZ3A 1HX7A 2C7QA 3FHJA 3NWEA 4DMUB 1RQNA 1WV0A 2HA4A 4R8VA 2XD9A 3PEWA 4MCAA 5GAJA 2Q29A 2OHOA 3UB3A 4J0IA 5LWHA 3K9HA 3ITDA 2IX3A 3Q9NA 5JXJA 2AJDA 5TPZA 3KKOA 2JHPA 2YFQA 1U81A 3X1ZA 4D42A 5FUWA 1PUIA 2NO0A 3HR4A 3LT2A 4H7IA 2Q50A 4IEEA 2HJGA 2PX5A 2IHTA 4PAQA 5F78A 3LTNC 2J5RA 3ZWKA 4DHEA 1C3JA 4QULA 4C20A 1A4RA 2C07A 2ZUVA 1B8UA 2YN2A 2XJ4A 4YVFA 4W7SA 3GEMA 3VOBA 1PNRA 3ECSA 1XGKA 2F9MA 4R1NA 2PMCA 3GUZA 1QDEA 3QYFA 3ZY5A 3NWBA 3BCHA 3OC6A 4PXYA 5EQFA 3TFWA 4EA6A 4PFSA 5FCDA 5F9HA 1M2EA 3LHKA 2D7DA 5LXTA 2P1DA 2WJPA 3UQYS 3WGVA 3C48A 4ARCA 2QLTA 3RE1A 4BGVA 5KC9A 1VKOA 1QZZA 3P2MA 4G1UC 1ZRSA 2I2CA 2OXRA 3HXLA 2RFLA 1MAHA 4KLRA 3LQFA 5LZ8A 4JI4B 5DTRA 3CLRC 2OLKA 3OMLA 4G6ZA 1HY3A 4JX8A 1UJNA 1DXYA 4PQEA 4XFKA 1XG5A 3C7DB 4FNGA 4WMLA 2XCLA 3K0SA 4MVJI 1EXWA 1F4VA 3T3MB 3DLTA 5CYFA 1SD1A 1NONA 4M98A 3JASA 3RI3A 4O2LA 3NTXA 3ZK7A 1XZ8A 4EA8A 4AWAA 1FCJA 2IXEA 2NACA 4ZO9A 3T7IA 2YXPX 2HU8A 2ZRPA 4FSXA 1WU7A 3TD9A 1ONPA 3F46A 3LZDA 4XB6B 3KZVA 4CM5A 2MCFA 1UPTA 2Z57A 4IMIB 4ZO4A 4AG6A 1OLUA 2RGCA 4CMCA 3G8CA 2PA3A 4QATA 4XARA 1QX4A 2BFEA 4RY2A 2ESRA 2RG7A 1KDOA 2P6NA 1Z0DA 3DVRX 1J9GA 3HYLA 4PTYA 2I78A 2E55A 5P21A 3DFZA 3DV9A 1PWZA 2BKEA 4LSGA 4GS5A 2BZ1A 3D3KA 1E0DA 5E8JA 5LN1A 1RACA 1MJGA 4RZ2A 3SCZA 3UXYA 5KPDA 2JLWA 3C3AA 3JR3A 3KHKA 4X20A 3K2BA 4M6WA 1H9BA 2OD9A 2IE0A 3BSFA 1H1TA 4TM7A 4Z2YA 2V7BA 4EGQA 1T8UA 4BAUA 4G1VA 2XGOA 1UWVA 4EO4A 4RTPA 1Z37A 2RI6A 3D3NA 4QDTA 2CJFA 5I48A 4N49A 1GPWB 4U2CA 4Q9IA 1QTRA 1QHGA 2A1UA 3S2IA 2GA9A 3LY8A 5FQNA 5DIFA 2O59A 1UMKA 3H8WA 2VUSA 10MHA 2ACEA 3B52X 5EIBD 5MN6A 2ZK7A 3IHTA 3VNRA 2OCAA 3NEJA 1W85A 2Z1NA 5LZ5A 2O0MA 3MNFA 1O96B 1YVEI 3IAS1 3QEMA 3R3ZA 4MEBA 4MX8A 4X45A 5JYDA 5KNLA 1SQSA 5KTMA 4JXXA 3DTTA 2FEPA 3ZJUA 1YASA 3GNSA 4R2HA 1P0FA 3GLIA 1QIIA 3W8EA 1QBGA 3ZDYB 1G2QA 3OJOA 4RVCA 3N8DA 3WX0A 4OKNA 1AN9A 4XX0B 2FLKA 1PR3A 1M8GA 3PQCA 1YQQA 1WXDA 3PV0A 2OK7A 3LTEA 1ST3A 4LV8B 1D04A 4XR4A 5HDQA 2IWHA 2PUCA 3DE1X 2ZAIA 5DM2A 2IBMA 3NV9A 4PSCA 1WXIA 2XTMA 3OIYA 4WCFA 3EPJA 1UXIA 3MIZA 3UMJA 4ZIRA 3CZ9A 2FN9A 3QSYA 3QVSA 5ENZA 2YYAA 4RKWA 4B3FX 1M8PA 3MTDA 4E2YA 4NCNA 4YRLA 5I3CA 2O57A 3MXOA 2WRZA 5K8CA 2XGJA 4NU5A 3LO8A 1PSZA 5EXPA 4QUBA 3BRSA 4W5TA 4ARIA 2J4FA 3FBWA 1NE2A 2E4VA 2OGTA 5K3FA 1Y6FA 4QRHA 1PTKA 2XQKA 3SJUA 3QVWA 4KB5A 5FLYA 3TIGA 1NF8A 2ABWA 2PX8A 2XGMA 1J20A 2FSHA 4TMZA 1KTVA 2I2BA 5KNBD 1XEWY 4BX9A 2V59A 1NQAO 2DQZA 2EDAA 2JJ1D 4BC0A 2RB4A 1AS0A 3VQTA 4H3KB 4LGCA 1H94A 3ONWA 4P0QB 1B0ZA 4G86A 4WLFA 2XODA 3K70D 3Q8WA 4XVCA 3K1AB 4Q7EA 3ZVMA 1Y6QA 1Z16A 3IUBA 2OG1A 4XH9B 3A3NA 1Y1KE 4CLDA 3I28A 1OYOA 1Y8CA 1LRLA 5A1JA 3CGGA 4M9QA 2P91A 1P6UA 2JATA 5EZYB 2BGTA 3AR3A 4YAUA 5M2QA 1I0ZA 3U09A 2C96A 3LA8A 1ATZA 2G7ZA 4AZ0A 4EYEA 2ONCA 1UBKS 4KVZA 3VYTB 3QENA 3ZHRA 3A4YA 3BTSA 4ENWA 5AOAA 3AOEC 2HV9A 4IFEA 2VT2A 2PTGA 3VBCA 2CXSA 5IU6A 2YZ2A 4YP5A 5IUNC 2E21A 4ZFNA 1CY8A 3MJCA 2R8PA 5IYZB 2XCIA 3PD0A 3KU4A 3NIFB 3PQEA 4Q34A 3DMPA 4CR8A 1X7DA 2CHQA 1Z7WA 4YALA 4L8GA 4O4LF 3ZDRA 4DSOA 1JH9A 1QGDA 1IUKA 1YTLA 2HPVA 2WR8A 3F49S 3Q1LA 3WRXC 2E6KA 4MV3A 5K51A 1O87A 2EHJA 4CM1A 4EKYA 4QBGB 3Q12A 2X4LA 2OXFA 3RFTA 5SV2A 4CM8A 5AVSA 1XZKA 3HUTA 4TV9F 3ASYA 3QVKA 2V7WA 1KSFX 1US8A 2JS7A 3Q88A 2IOYA 3FZYA 3UT5A 1BVUA 1NVGA 2KB0A 2WJ4A 3GP5A 4TL6A 3UGTA 4DXAA 5MF6A 2DERA 5JY6A 4HWOA 3LHFA 3G88A 4YHBA 2DBRA 2J0VA 2QPTA 1NI5A 3DE6X 4FBLA 5BN5B 5ITVA 3PIRA 2WTUA 1DUIA 2X7HA 3CUTA 2W2MA 3LYAA 1OC2A 3H3XA 3RC1A 4TYPA 2BKVA 3I6QA 1CERA 2FZ4A 1F0KA 2O4UX 3ASUA 1FNDA 1FFXB 3BD6A 4P32A 3HP1A 1N0IA 3NVMB 5HHTA 4PGAA 2I87A 2RGWA 4PGHA 2XYHA 4W7IA 4DANA 1HLGA 4BNNA 1F51E 3W0LB 5CUQA 3MM4A 2XTZA 4O2RA 3L79A 3HRIA 1VGQA 2W58A 3TZBA 1LTQA 2EG9A 2MYUA 1G38A 4JLSA 2IS2A 2Y67A 1LWNA 4AO7A 5LL6P 4I9UA 4X61A 4TTSA 2XOXA 3KQMA 4LRUA 4IVNA 3OCZA 4LI3X 3M2TA 4Y2PA 4RVDA 4WNCA 3D6AA 3AIKA 3R9WA 2NTNA 1PT5A 3DT9A 3KVOA 3L7NA 5GGYA 5LQCA 1I5OA 4P4SA 5AXBA 2G9NA 3ZS9A 4DSTA 3O8RA 4MVJM 1EFTA 1RI5A 1T4MA 2WD9A 1QK5A 1GPMA 1P29A 2X0NA 3QXJA 4JWTA 2D0PB 2P30A 3AIIA 3EXHB 4MIKA 4Q7KA 4R01A 3BL6A 2FPLA 4YRBA 4IF4A 4IRUB 4B4KA 4U0KA 2FP4A 2PFGA 4HVCA 4KO4S 4AMVA 1TD9A 5C1BA 1DIRA 1ZIOA 2ZVQX 3VZDA 3K0BA 1E2FA 3DXXA 2ZIUB 3LXRA 4M8LA 1K97A 1QP8A 4QC2A 4KYVA 3T4EA 4D80A 5DI3B 1VBFA 1DQNA 2ZYUX 3MAAC 3M3DA 4YRAA 3D4OA 4YROA 1JHZA 4MVYA 4MP3A 3KIPA 3I5UA 4KBYA 2G8NA 5KDLA 5TX7A 4BMZA 5AD1A 2A0XA 4WLOA 1HZJA 1XYYA 5DM70 4OX9B 3D3JA 5CPFA 2X7XA 3GG2A 1A9QA 1PX0A 2XHEA 1TIBA 2BMDA 4GI3A 4Y1RA 2FSIA 3DPUA 3B78A 1IXKA 1R0YA 2YR0A 2O6LA 2NU9B 3WGIA 4N41A 1DC7A 4XWGA 1EE2A 1PL7A 2VJKA 4YV7A 1VFNA 2OENG 1C30B 4Q4AA 1TVCA 1TIPA 3DEYX 4WLNA 3X2FA 2AHRA 1NKTA 1Y8QA 3SSNA 1JEOA 1Z6ZA 2Y9MB 4NICA 5I7FA 5K6RA 5CVUA 2I29A 1UBSB 3EA0A 1L7XA 1PF7E 2F3UA 4NU6A 4MIYA 5BSMA 3RROA 3S29A 2BIFA 3PJGA 4JOQA 2Q5JA 4ZCQA 4EYSA 3CH7A 3FTDA 1R6XA 1TEVA 2ICAA 3IEIA 3NYQA 4PC1A 3GAMA 1K98A 4UQPA 4FDAA 1WL8A 5J40A 4AY6A 2FQQA 3BB1A 3VZBA 2FWJA 1R0CA 1JEJA 5EQJB 4E6EA 2ZFUA 2AZTA 4OUDA 4FGWA 3EF1A 3ORQA 1KNXA 1LC3A 1FJXA 2P5TB 3AERB 3IA7A 4JJKA 1X42A 1P9OA 1MB9A 5FBVB 1WJGA 1H2RS 1RSZA 1JVNA 2O7RA 2QNIA 3EC2A 2HWYA 1C4XA 2OORC 3DTYA 3DVLA 4L9WA 1PGQA 4TV9A 4CFYA 5A9SB 1TT5B 3DMFA 1IJFA 4HWPA 3VGPA 1D4AA 2PUJA 4QWWA 1FYXA 4BX3A 4GIBA 4QA9A 3SU8A 4OK5A 1M3SA 2HCTA 2XB6A 5CB4B 4LJRA 1N4DA 3UC9A 3L7JA 3DSRA 3L6DA 3TSCA 5DEIA 3B60A 3JRNA 3T9AA 3TNLA 3TSZA 4A0FA 1I2CA 1MQ9A 2QMZA 1AV7A 4JUCA 2IDJA 2OBNA 2OHIA 3V7YA 3BXHA 1F0NA 5E2AA 3L8FA 1KI6A 3G2LA 5F52A 5LCXA 2PZJA 2VPQA 2XUQA 3TX2A 5L51A 3K0FB 1HYQA 1W5BA 1VJGA 1OX5A 3BIWA 3IL2A 5CDHA 1RC1A 3JSAA 4HY3A 6GPBA 1MORA 1RXIA 3UMYA 1WW2A 2BHNA 4F7DA 3OWOA 2QJTA 3WLPA 3PFGA 5M7EA 1D0VA 5HNKA 1E4YA 2I6TA 4R2IA 5TMDA 1Z38A 2EGGA 3VXKA 1XF1A 3PICA 5KMGB 3AVYA 3NH9A 3OOSA 5EY5B 2Q0XA 3N1UA 2W5UA 4YJ2F 5AJVB 1AXRA 1FNBA 2Q8QA 4G25A 5JQGB 3MJ4A 4RPLA 5B1DA 4XQEA 4JI5B 1NURA 2WIGA 2HBRA 3L77A 2QM7A 4QWMA 3F67A 3HXMA 1KFEB 5K6AC 3PHBE 2H63A 3TNYA 2WV9A 2IS1A 2FUG6 3ZW7A 5BR4A 2FRXA 4X8HA 5CFPA 3OZDA 1E6EA 2I0FA 3N5CA 3RK1A 4MV6A 3F3SA 2OZKA 2P2ZA 5JNUA 4Q1FA 4KXVA 1QHHB 1HUQA 3SFTA 4D92A 2INGX 3PCRB 2EJVA 1EXDA 1V39A 4EJSA 1MG5A 1VBKA 3GIWA 1OXVA 3IULA 2I66A 4U2BA 3VPHA 3W7AA 3T5PA 2Q3LA 1A7JA 2QN3A 1SU6A 4QBFA 1BMQA 2X6TA 1EWVA 3TIIA 4BKUA 3UTDA 5MN5A 5GP1A 5BW4A 3ICQB 2XUPA 4S1WA 1KJIA 3K0EA 2A3RA 3BZUA 1VE3A 3R3VA 2PLNA 4KXYA 4EW2A 4TYYA 2BEWA 3ESQA 4G5QA 1ZGZA 2HM7A 2FPKA 4YUWA 3PHLA 2CLFB 3VAZA 3AB7A 4DLUA 3IP9A 4P7FA 3NBXX 2ID9A 1KKLA 4D3YA 1IN4A 2IY8A 4NFSA 1Z2AA 2LZ0A 5IULC 1GNPA 2IHYA 2W2LA 3ENWA 4PO1A 4B47A 5CT5A 2HRCA 3SDBA 1NRXA 3ZE9A 1GSAA 4OHUA 1DLIA 1MF7A 2R4TA 2ZDQA 1MABB 1QO9A 4GKVA 1KU0A 2FYTA 1O57A 2Q3FA 2XBLA 3FCOA 5LDHA 2GETA 4F3TA 5E9AA 2QTZA 2BAGA 4H15A 5AVQA 4P4SB 4L0CA 5EHNA 1E63A 4YCSA 4RD1A 3AOEA 4KE6A 4QPCA 4JIGA 1JHYA 1GXSA 2W6NA 1HGXA 3MFYA 4D1YA 3T54A 1GRCA 3HGMA 4HMQA 4DRYA 5KYUA 3N2EA 2C9YA 3KSZO 5BQFA 1Z83A 2P67A 5IASA 1S01A 4WN9A 2PZLA 1R8JA 1V5GA 3EUAA 1EEHA 1XELA 4RDHA 4AIRA 5JD5A 3I5YA 2ACWA 2GYVA 5FKJA 2ERCA 3DHEA 4TTAA 2FMUA 4L15A 1UZUA 3CRNA 1PYGA 2F4NA 2PMDA 3HBAA 3NHWA 1VJ5A 2ODTX 3B9BA 2X1HA 5DTEA 3X1XA 1ISJA 1SD5A 4X90A 2IPNA 2BFNA 4WGGA 4BNTA 3DFUA 3AUFA 1JIVA 1A27A 1O6BA 3R20A 1ENYA 3BSWA 4N8SA 4O4JB 4FCTA 4CEJA 1WPRA 1L8XA 2H2FA 1XZEA 1Z5NA 3W9UA 4Q7JB 1RBYA 4US2R 2G0AA 1QO0D 3MG9A 5GJCA 1C9EA 1FA9A 1MQAA 4EUNA 1U8YA 3K15A 1U6JA 4LVUA 1XUOA 1E92A 1BE0A 4HXGA 1GJRA 3PHIA 7REQA 4CEIA 4OH7A 2C8KA 1UMCA 1H85A 4Q1VA 2DY0A 1V1MA 3MS2A 1GPH1 4NOKA 5HVNA 1V9SA 1KRWA 1L4BA 1E0SA 2XQFA 3C3EA 4F5ZA 1A50B 2KS6A 1HF3A 3QY0A 4PLYA 1AHHA 3WIOA 4FHZA 5L3ZA 4AP5A 1PT8A 1U63A 1BN6A 1W88B 1DHTA 2FZCA 1KWGA 1TVEA 1EZZA 4QYWA 3EGXA 3VPXA 3QG1A 5AI0A 1XVVA 2HK7A 1XNJA 3ZTTA 3CVVA 1PR2A 3X1JA 5A4IS 3R9XA 2LV8A 1E1RA 1ELOA 1R8QA 2RBGA 3IX7A 5TMPA 4Q03A 1RI3A 3THWB 2XB2A 2X58A 3NONA 5EZ6B 5FEUA 4URWR 2D0DA 2Z1DA 4RYDA 4EGSA 1F1BA 3WJ1A 2PWZA 3L9XA 1P4RA 2UVPA 4EPVA 2Q0QA 1IM5A 4ZA2A 1ZWLA 4DMCA 1BXGB 4O4IF 1MN6A 4XZ3A 2VDOB 2FZVA 2VF8A 4IEIA 2WYWA 2Y68A 4R16A 5EUQB 3SE7A 2E1PA 4DIDA 4H59A 1L5VA 1OI3A 2PRKA 5GOTA 4C4RA 3I23A 4HNAA 4U1RA 3TLYA 2AC7A 3ML1A 1JJFA 3QI2A 2P8JA 4JQCA 1B93A 2DLNA 1U02A 3MSCA 3HJRA 4R2WA 4RU1A 4EY4A 2ZJ2A 3KKZA 2WFZA 3SE0A 1QYDA 1R5BA 5KBYA 1SUCA 3TMAA 1DG1G 1FXUA 2IF2A 1U3VA 1IQUA 1O8CA 3DT8A 2IP2A 3JAKA 1VPEA 2EHDA 2QQEA 2F1KA 2Q1TA 1ZZGA 3DLCA 1ODIA 1GGHA 2VDQB 3P9XA 2W0SA 4HNQA 3VSAA 1XTVA 4FT4A 1VYHA 2DQYA 5CHEA 3C2QA 4Y2SA 2SNIE 3QFFA 1E5QA 1L6IA 1QDLB 4K9LA 1VIYA 4OI1A 5FH9A 2V0GA 1ADGA 1SG0A 1EDDA 1II9A 1MC8A 2XUZA 4D74A 3HB9A 1WAMA 1AX9A 1OWNA 2A9PA 2GDJA 1YZUA 1Q0QA 2JK1A 4NZOA 1PGOA 1RMYA 1AF4A 1CULC 1JAYA 1SVUA 4PZPA 5EVCA 1MT3A 1CJMA 3BORA 3EEOA 3MEQA 4JYPA 4F91B 5LQMA 4TRRA 1F38A 4LFAB 2VCEA 2DBVO 2HCRA 4HK4A 3CC8A 4DV5B 1MA3A 4EGJA 3OU2A 2VHXA 4ITVA 1NMZA 2ISSD 3EIEA 4ERXA 1V3UA 5JAMA 2B1JA 5G0UA 4R0MA 3ITKA 5CFMA 5HYVA 3JQBA 3OPYI 1KEZA 2SICE 2AEFA 3OCCA 4G0YA 2ZVPX 1CS4C 1L8LA 2HA3A 3MWYW 3PJDA 1DIBA 1P74A 2HAEA 4PLVA 4Q19A 1DTWB 3KHTA 2ID4A 3KZKA 3HQ4O 1HNNA 4LMAA 5K0FA 5K8JB 2J31A 4NE9A 4Y7DA 1MIOA 1UBGA 3E05A 3ZY3A 1XPOA 4MEJA 2GGSA 5ARBA 1ZVKA 2QAGB 3F73A 1KPIA 3C87A 2XCOA 3CZ5A 3K0KA 2PUEA 4NDZA 2HJRA 3GR6A 4O4LB 4AN1A 5HUJA 5I51A 3M70A 2H8KA 4XM0A 1YRWA 3DAHA 4CDMA 3ETGA 4CYMA 1F12A 4BFTA 1ECLA 5IW8A 1BDJA 4Y1RB 1MT0A 1Z0SA 4RH3A 2MINA 1UXHA 5JVDB 4EG1A 4D7AA 4KR6A 4CUJA 1CU1A 1QPBA 1SULA 3WFIA 4DWWA 1V1JA 1M6NA 5DHAA 1D2HA 3WDLA 1CRWG 2ZB4A 1N57A 2ZRDA 3BE8A 3R3UA 4NBSA 2JEZA 4FI3C 4O2AA 5EEGA 2UDPA 2PCLA 1VKZA 2ODPA 1H2BA 3PC7A 5AQEA 1CDOA 3L6CA 4PZZA 3WL6A 1U2SA 3EZNA 4E5DA 5M5BA 2P4HX 2ZAOA 4RULA 1NI4A 3N6RA 5CD9A 1UBJS 3KSRA 4OYRA 2CWWA 1LD3A 4JMLA 4OF4A 4PRKA 5DLQC 4NATA 2PHZA 4OFXA 4EYKA 1QH1B 1Z0IA 1E5TA 3ADPA 3MS4A 3BFXA 4EEZA 1OZFA 3KT0A 4REOA 5B1EA 1XA3A 1IBSA 3GGDA 4IVRA 3OSUA 4JFRA 4ZQFA 3BK7A 1OF1A 5LD2C 2ZRBA 3CJTA 4OB6A 2W11A 4HDNA 4WZBA 4DC1A 2LNDA 4F4HA 3DONA 3VOAA 2CD9A 4HAYA 3K8ZA 4S3MA 5KYXA 3A2KA 1M8FA 2OECA 1MOPA 2VJDA 1KQOA 2NQTA 1NATA 3BX1A 3HVIA 2DHCA 1Q0LA 3H2SA 4MVJG 2R68A 4DPMA 4PCUA 3GK3A 3NHLA 3EPKA 3EJ6A 4LYAA 1COZA 2CXPA 3AZQA 1OIVA 2C5BA 2PNJA 2FW9A 3O5AA 3NVDA 1E2NA 1N2JA 3RD5A 2HRDA 1I2DA 3V8VA 4ZK2A 2NVWA 4BNMA 5LP6A 3WNQA 4H1HA 1I2ZA 4U0JA 4GZMA 3OQMA 3NWPA 3UJBA 1VDMA 2ZCVA 2X3FA 3IVRA 3OPYA 1UJ6A 5AVTA 1A8IA 1JNXX 3LW8A 4ETIA 3R44A 2Z30A 4PV7A 1JB9A 1JQEA 4YJ3B 4B9EA 2AZXA 5A7GA 1V11B 1B0AA 3ZCSA 3N2IA 3AKZA 2AJCA 1OT5A 3O38A 4NP6A 2AVNA 1U2DA 1EFRA 2JLZA 2YHUA 4DMLA 1NM5A 2NTJA 3O4VA 2EIXA 4FDVA 2DUMA 1BDBA 2XUIA 3E9QA 5JARA 2YHBA 4WK0B 5K8VA 3NJRA 4P86A 1PKXA 3CRZA 4QBTA 1FZTA 1K2WA 3KE9A 4L3VA 4AB1A 4CWAA 5DF1A 2O2JA 3G7SA 3VU9B 3A1SA 2P90A 3SPXA 5HR5A 2WA1A 3LXUX 5A4MS 2PUWA 2Y0CA 3ANMA 3WGLA 3LDHA 4RBNA 5FFNA 5F5LA 1PKEA 3C4QA 3LQ1A 1P1BA 1PRYA 3DTVD 4GPD1 4K8OA 1QB7A 4LY0A 1NJSA 2WIJA 1U5BB 3IHKA 3VPGA 3O8OA 4IICA 1JBEA 1OHHA 2XQVA 3OA0A 4JB0A 1GRNA 1WHTA 4KO1S 1GPAA 4ZYXA 1PW7A 1DAIA 2VYVA 3K96A 4C4TA 4K7JA 4TUYA 2PEYA 3LUBA 2Y0EA 3IUMA 2ZDGA 3K53A 4I1IA 4GXNA 4YN3A 2XGSA 3TB6A 2JCBA 3N05A 4RLQA 5I9SA 2VK1A 1A8UA 3CEMA 3O93A 4GPBA 3TTVA 5I8WA 5IKXA 4GX0A 1KIAA 4L22A 1QIMA 3TLAA 2VS1A 2WFAA 1Q1GA 2FXVA 1UOPA 4P3OA 4AD8A 2ZZMA 4XLLA 1CF9A 5DT2A 2FQ1A 3SMVA 3H6KA 4LKOA 2G76A 1TJ4A 2YHAA 4H0FA 3CN9A 3HSSA 5FYDA 1SK8A 4WDRA 1EWQA 2Q6LA 4GP9A 2BV3A 3MYRA 3LYHA 4V1CA 3ZD9A 3I39X 1KKUA 1P7VA 3FYDA 3MCTA 5EYPA 1TQHA 3F4LA 2JCXA 1MKYA 1P3Y1 3BL5A 2KLHA 2JGDA 1ZNXA 2WTAA 3HEAA 3RK4A 1CB0A 1MHTA 3OVMA 2F8TA 1O9GA 3QIVA 4BN4A 1L4GA 2LDBA 1B43A 3O2NA 1N78A 4B17A 2N42A 3KD2A 3NM5A 1PGNA 1WSBA 2FG6C 2R7AA 5LMUB 1VA5A 4PTLA 3C39A 2REOA 4O4HF 3LIIA 5ARCA 1KDTA 4Q37A 1TYZA 2RGRA 2Y2UA 4CG3A 4D3ZA 3HJFA 4J6FA 2ZI9A 3P45A 4OGGA 1H2EA 3UMVA 3S1AB 1OBOA 5FV7A 1JV2B 3SQDA 3GFVA 4LXHA 1KJJA 1FMTA 2VHEA 2WUGA 3D9QX 3GLKA 1EM8B 3WLMA 5HQJA 2ZWOA 1QG6A 3QJYA 3WYFA 2WWVD 1JZTA 3I8SA 5EXTA 4WK6A 5BSKA 2PUGA 3EZ2A 1RP1A 3VHXA 4LIPD 4LQLA 4J1TA 3V34A 3P5SA 5GVSA 5E0OA 5EKSA 1VMAA 4LZZA 1IOVA 1F8YA 2ODQA 1MX9A 4PYQA 2JFNA 3QUTA 4P5DA 5CFLA 3H1GA 1DKRA 2QM8A 2VXYA 4WCDA 1QONA 2I4TA 3HA5A 4HDKA 5GV8A 3FSJX 3ZCUA 1GP2A 1JQLB 5E4YA 3KSDO 3A3KA 2HA2A 1RYDA 4XRRA 1BKDR 3HDYA 1OB5A 2BLNA 3PGMA 2AEEA 3ME5A 2OUIA 3AK4A 3OFKA 3PNKA 4WT7A 4BWGA 3G2PA 3QEKA 4QQRA 3RF7A 3A70A 5B3LA 4QZVA 1N2CA 2O5RA 4H7JA 3IUEA 1V8ZA 2GHTA 2BFEB 3P9RA 3VH1A 2JI9A 2OM2A 3DT6A 1IZYA 2CSUA 1VZ2A 1CUBA 2GZ3A 2QGNA 3MJHA 1DOZA 3IMGA 2J9ZB 1W34A 3DW3X 4OQQA 3OIVA 4I1RA 3CUWA 4MPDA 4OQMA 1KYZA 4UASA 3WA7A 5IDXA 3VR6D 3GLGE 1D3AA 3FOWA 2QD2A 4QNNA 4GPAA 1MNAA 1E18A 1TM7E 2KW5A 3EVAA 4P54A 1Z08A 4NJMA 4MGYR 4DV7B 1TMYA 1JDUA 4LV5B 1PK9A 4EI8A 1NZDA 4BQNA 1PIWA 4UBKA 1CIJA 3A4NA 4PQFA 5K45A 1Z4QA 2R8OA 2QHXA 4QJ5A 3D8RA 3L7YA 4TL9A 3NHFA 4YT4A 4MICA 3QPWA 3GLHA 4LGYA 3GNQA 4QT0A 1M76A 3I2HA 2QN8A 1VG1A 5SY6A 4RPKA 3S2SA 4FW9A 1W581 1EVKA 2GYWA 3RC2A 3ZWQA 4MRPA 1A9OA 3JQ7A 1MX3A 1GUZA 3IDAA 1KP9A 3NBQA 2GD1O 4HDAA 1MIOB 2HFKA 3F8WA 3CPSA 3EA4A 4R54A 4UW9A 3EN0A 3R7NA 4M8KA 2RDMA 3RC3A 3CXRA 3W9SA 2C5EA 2IDKA 4Z4FA 1I3OA 3B8HA 4DA7A 2J09A 1KZ6A 2BM9A 4IMJB 1MJ5A 4XD7A 3DE2X 3PEYA 2QT1A 3I2JA 2JRLA 1M8KA 4TMVA 1V1RA 3S4YA 5LM3A 2DFLA 5JCOA 4ZV9A 1ZD1A 2EZ4A 1FSGA 1JWAB 1CRQA 1BG6A 1AS2A 3MRVA 5DKFA 8LDHA 4PYKA 5J5AA 2C54A 5FAXA 3T5DA 1J0DA 5KNBA 1MPTA 4R7GA 4ER0A 3G2NA 1JJVA 3KKPA 4IV5A 4D3SA 5KAMA 2W9XA 3VDNB 1RPAA 1K0UA 1XTRA 1AGPA 3FSGA 1MDBA 4F3CA 1VHQA 1NBMD 3E3NA 4IKOA 1PS9A 4UDOA 4V02A 3ETHA 4I4LA 3V8QA 2VHJA 4FYKA 1SBTA 4CBVA 5LZ4A 2EX1A 4I4TA 1Z5VA 4PSAA 4EA9A 4RGYA 5HM8A 3RUDA 1EK1A 4M87A 5KUTA 1KMQA 1F06A 3HHEA 1T29A 2NGRA 3DPIA 4L08A 5DW0A 2YWXA 1RWVA 1N5RA 5BNWA 1NN3A 5ULLA 2HUPA 3RODA 1EZ1A 2PKXA 3UYLA 4ZI2A 2E5LB 4PFQA 4DC9A 1NLYA 4DJAA 1F0YA 3BVPA 2R9VA 1SHLA 4HTFA 3T38A 4DV6B 2P6MA 2X42A 4LRSB 2EW1A 3ZVKA 1IUPA 5DI9A 4RO0A 4R81A 3VTKA 3IBYA 3ROQA 1NYRA 1YDGA 3THSA 1PG5A 4BFVA 5T6MA 3CQ9A 2MT9A 4ABTA 1FFAA 2FI1A 3D1VA 3P19A 3RFFA 4EVIA 4GICA 4WKCA 4ZXFA 2GBLC 3DV0A 1TU4A 1WEHA 3HNOA 5G40A 2C92A 1U9IC 4MB0A 2WWXA 4C0XA 2H08A 4R9UC 3GLGA 4DDWA 1ORRA 3R0IA 2QY6A 5LU9A 4K26A 4BQIA 1GTL1 2JGEA 2OCDA 3O82A 4FGLA 3BRWA 1KA9H 3PXDA 3TQFA 1H3NA 2VR1A 3OLQA 3RQIA 2QTMA 2W6ZA 1W94A 3MT9A 4F2WA 3RS2A 1Y9DA 1EX1A 3Q0IA 4CV2A 4XYLA 5KDOA 2XLBA 3L4JA 1HRDA 1NVBA 3FUWA 2I2DA 2REXB 1LW7A 2QTFA 4O8ZA 3PZBA 2H7CA 5BQOA 3VSCA 3CTMA 2PKQO 5HTOA 5HW0A 4L02A 3AM5A 3TF5A 1W1WA 2OE2A 3KKKA 4DM4A 3IMEA 4PIPA 1P39A 4XDZA 2R00A 1G291 3OIFA 1O58A 3DD1A 5C3UA 4YAWA 1CJBA 5FFFA 4UMEA 1FNCA 5EWLA 2BGRA 4BLSA 2AUTA 3NV7A 5G0VA 2EKPA 1OLXB 2QDXA 4PZAA 2FSGA 3B6MA 3N3BC 4U4AA 3U5ZB 2Z56A 5AHOA 2GYYA 5PGMA 5EQDA 4Y6PA 1SBHA 2R4UA 5ALJA 3HDGA 1CLUA 3DO8A 1PWHA 3QA9A 2AT1A 4HNHA 4K88A 4F38A 5CA1B 4ONEA 2EXXA 4TS3A 1PZGA 3CUVA 3I6IA 1U65A 1Q0HA 1M2HA 3RRNA 4D45A 2BJWA 4L4RA 4ATNA 4NENB 4RDXA 1O5IA 3R3XA 4MWTA 2C94A 2HYDA 3BMCA 1XLTA 3EJWA 1M7HA 1IEWA 3RHFA 3VO9A 2NU6B 3AG6A 3C6MA 4YRIA 2WSSD 3VNVA 1CUDA 1LLUA 4XYEA 4L3WA 5TLSA 5JMOA 1SUFA 2J3EA 1L5QA 5JC1A 1EWTA 1J07A 4W5JA 3AR5A 2W0MA 1FTQA 1R0RE 1TYCA 1XZGA 3C14C 3FCYA 4IFBA 1QQ7A 4LWPA 4MR9A 4OHZA 1J8FA 5EE3A 3VR6A 4DIOA 2ZI6A 4QAJA 1SVIA 3WRYC 2CNDA 5B2FA 1D8AA 1UT8A 1QK3A 5C1DA 2G6TA 3QEJA 4GOOD 2WUEA 2NYUA 3OX1A 3Q10A 5BXQC 3O90A 5JFGA 3HKEA 2OQRA 3R40A 4PXAA 2C59A 5EIOA 4F21A 4GVLA 2IYOA 4Z1MD 1QUEA 4GOLD 1CY7A 4CIXA 4PX3A 1MOQA 1YCGA 2OCGA 1RCFA 5U4XA 3EB9A 1FFWA 3MUFA 4G3XA 1L4FA 1Z18A 1XZIA 1MAUA 1QZXA 3ND9A 3OKPA 1P7PA 1NUQA 3G2IA 4HB4A 2G04A 1Z0JA 4ON9A 4DSUA 1P0QA 1D4OA 2R11A 3LHSA 5AUNB 5LQRA 4IXDA 4DKXA 1KF0A 5AI9A 3V8PA 2CNLA 3REQA 4PG6A 4RQTA 3AR9A 3KG2A 4AW9A 1JFSA 5ICSA 4AX8A 5L6MB 2IHNA 3HB5X 3MXTA 2AJBA 2OMKA 1EGMB 4XJSA 4D6PA 3COZA 4LJLA 3HDTA 3ZCXA 1IM8A 2D00A 3D54D 2WT8A 4FEYA 4JKOA 5J4HA 3LLUA 1OYWA 2JIBA 1EJBA 1NYTA 1Z2DA 2FWBA 4OREX 3FI9A 4P4GA 1TA0A 2WP0A 2I6SA 5IG2A 3QPUA 5AW5A 3KVVA 2F8MA 3RIGA 2MHCA 1XCBA 3ASZA 1ULZA 2CMFA 3DOFA 2P7IA 1NBEA 2D1YA 3D4NA 3QKRA 4JL8A 5L7TA 2E82A 4K0RA 1ZA1A 4U6QA 2D2VA 1A4IA 4C9BA 1FFSA 5AP9A 2PSHA 3FLBA 1A9TA 2SKEA 2Y0PA 1GLVA 3CCFA 4RHEA 2GPSA 1V16B 1NXXA 1WBJB 4NABA 1PP4A 2NP7A 2ATXA 1AZSC 2VO1A 3DP9A 3F6SA 5I9LA 1UFKA 1VBNA 3TLMA 5DBGA 1J0BA 2JIZA 2PKQP 3N59A 3RREA 4W5QA 4GM1A 3QQPA 2ZTSA 1R64A 4M1QA 3BILA 1B41A 1EXVA 1C3OA 1JHRA 4JL6A 4GKJB 3SSOA 2QV0A 1LDYA 1P2UA 2HBQA 3S81A 1KH1A 2VBIA 3B5IA 1RWWA 2R8EA 4LHXA 3QEOA 2GZDA 2BM0A 2X13A 3DM9B 2VHUA 3HM9A 3TRKA 4JQYA 3CZAA 4KWIA 5DEOA 3I6ZA 3TRHA 1UC5B 3GJ4A 2QEQA 4CCWA 5KQRA 1G5TA 3VPFA 1C3EA 2DWCA 4YASA 2E5WA 4PZCA 5JSUA 3EGVA 1QJ4A 2D4HA 4Q3OA 5A3JA 2WYVA 4MCHA 4ZAGA 4Z1MA 1LK5A 5JDIA 4EYGA 5CEEA 2WWYA 3AERA 2OA0A 1QOZA 5ALOA 5K7SA 3FKJA 1PBNA 1PT7A 3CF2A 4N5IX 4W9NA 5B64A 4JA2A 3H6GA 4M54A 4WNYA 3L0BA 1GCIA 2Q9UA 1WXXA 2VQ3A 1KGSA 3R1IA 3SC2A 1NP6A 2GJ9A 4PRZA 4AFNA 5J2TA 1QZTA 3TVYA 1P4GA 4LGVA 2CMGA 1BMFD 2OV4A 1T9KA 2VYVD 3CWQA 4DLLA 3IP7A 3GJYA 1RQXA 5IAKA 4Q1EA 3T7AA 1QKJA 4XQCA 5JZMA 3BSYA 2XMGA 1NXPA 2R8XA 3EHEA 1MC4A 3EIWA 4LZLA 1Q15A 2I3AA 3UUEA 4TSFA 1R74A 3GA7A 2H65A 4I9GA 3CKMA 4MQ4A 4OP2A 4HF7A 1O08A 1XEFA 4EIWA 1QG4A 2WP8J 2F1JA 2ADMA 4UMFA 1ZI8A 1VCMA 1XEXA 1J22A 3O8QA 3Q9UA 3ZE6A 4C6TB 4X41A 1CS0B 5C1OA 3E9MA 2HLDD 4A8JC 1XMIA 4XW2A 1J33A 1W76A 4L2IA 4CF7A 1TF2A 3ZKWB 4IRMA 3VC2A 5T7BA 2HGSA 2R1TA 5KX5A 3O83A 4HRAA 4Y1EA 3UHOA 4CF6A 2AG1A 2GBIA 3RRFA 3FAZA 1NUAA 1Y6RA 3U7QA 3ESDA 5A04A 1JFFB 1R0ZA 5FA5A 1VG9B 3AY0A 3CNLA 2NXCA 4LHEA 1DXOA 4YCDA 2KHZA 2YCBA 4PAMA 1Y4ZA 2GBCA 2WAXA 3GLIE 1HRKA 4ZOCA 4REQA 4ND2A 1XZNA 4C87A 4NAUA 3RS0A 3HJAA 4BIIA 4L5IA 2YHIA 1PR1A 1OTHA 2QM3A 4Y0VA 2F64A 4S1NA 3DGEC 3HPRA 3PDJA 1GAEO 1RQPA 4NE7A 3WBKA 4DMFA 2JHFA 4ZEOA 3CBGA 3I04A 3BJZA 4PR0A 5ALPA 2J3QA 3PL5A 3SLRA 1I4TD 3TW4A 3SEFA 3G0BA 1YJXA 3PQ2A 4YJHA 1YZGA 2PLAA 3R0ZA 4GE0A 1YK1A 1IOWA 3ANLA 4MWOA 1GVNB 2QRGA 2VHCA 2ZIFA 3LUKA 4RTNA 1ISHA 2PVPA 1JSXA 3PRKE 5IVIA 5SZIA 1EP3B 3AFNA 3ICVA 1R0BA 5FAKA 4CHTA 2D6FA 1SELA 3I73A 1JZSA 1YS7A 1BWPA 1U99A 3DVQX 3H11B 3OF2A 1FZQA 3QTBA 4FX2A 1WCIA 3MHPA 5LQSA 4LE0A 2OEPA 3I12A 2H7XA 2YFHA 3AHGA 2PH7A 4HUQB 4Q48A 4X0EA 4P84A 2I6XA 5CMLA 3OQBA 1XXHB 1XJQA 4Q1AA 1FP7A 3RDPA 1UFOA 3SHTA 2EFDB 1QRAA 4FNMA 3LI2A 3T9EA 2W93A 3FHOA 3Q7IA 1PWYE 3A6HA 5B4UA 1CY1A 3FETA 3HV0A 4HRXA 3RTGA 1EE9A 4Z4CA 4L5JA 4OU4A 3HCNA 3IR5A 3UBMA 5BWBA 4DG8A 1D09A 2HA6A 2REQA 5IP5A 2IW3A 4Z49A 2FWIA 1DINA 2ZRQA 4MUNA 1U28C 1RTKA 4ZYYA 4CEHA 1ZGJA 3A9SA 3I1FA 2GD0A 3AF4A 4NH4A 5AK4A 5DGXA 1HM5A 1ZJZA 3T5BA 3CGWA 1NPDA 1ZMBA 2DKOA 4HI0E 4EHIA 1YQTA 3ZCPA 1S3GA 3AKEA 3RANA 1P18A 4HVLA 3QU2A 3JYQA 1G5HA 2XRFA 3SBEA 1I3LA 4XIYA 2Q3DA 2DMRA 1XRNA 5IAEA 4RHYA 4B6FA 2J5KA 4IHAA 2Q4TA 4FZRA 1UANA 3NALA 1V1MB 3EGWA 4YP6A 2IDMA 2NLOA 2RGNC 5FOSA 1K6EA 3VJKA 4QTYA 3I05A 3X0DA 1T2AA 1J0AA 1DIAA 1RC0A 2ID8A 1T0JB 4P38A 4TWRA 1C7FA 1Z29A 1RM0A 3TNJA 4DABA 2UXDB 3ACBA 1PD0A 1DV1A 2PKEA 4NE2A 1IAVA 1PFKA 1Z4LA 4TLCA 1L5HA 1UKYA 2A78A 2BEJA 3STHA 1CP3A 1Y80A 1D9XA 3IBCA 3L0IB 1RJDA 3ZIAD 1XWIA 4TV8B 2PGJA 1HE5A 2ID7A 3UF0A 1V2GA 2HWUA 4XCVA 2E18A 4TWBA 2IFTA 3WL7A 1J8DA 1F5SA 5A3SA 3UEOA 4K6FA 5FLEX 1NPYA 5F3DA 2YN0A 3JTEA 1D0SA 2FLVA 4KN8A 3VUEA 2ZPAA 4ZOLF 3SKYA 1K6XA 1RLTA 4JUBA 5TSDA 4H0NA 3L1HA 4R3NA 1QHNA 1PQ4A 3IC5A 1FYDA 1NQTA 5DBEX 3IOEA 4CM4A 2IUSA 3IR6A 4YB8A 5JD3A 1JALA 3VNAA 4AJPA 4BP1A 1CG6A 3AM4A 2XUGA 2ZUDA 3DPSA 3UZUA 1J8VA 1JILA 4NU8X 4XEHA 3T0FA 2OZPA 4JLMA 4MITA 1JF8A 4NQRA 4N5LA 4C7OA 4HV4A 1LS6A 4GOKA 4CMAA 3E9CA 3ETEA 2HPZA 2DHRA 2NZUG 2P2LA 1Z9BA 4O4HA 4AZSA 4DLRA 1NHGA 1XPRA 1OA0A 3PWKA 4L8YA 1GRQA 3OY7A 4NONA 2CJWB 2QS9A 1ECJA 2NUPA 2PGAA 2G08A 3H8SA 3FWPA 3QVLA 4UM7A 4G24A 4XB1A 1FYFA 1F17A 4RF5A 1CZKA 5LVAA 2PUDA 1S6YA 1X86B 5BV7A 1PZMA 1ZH2A 3E61A 221PA 4E7PA 2D54A 2BE9A 3JPWA 4RH1A 3R75A 5JJ5A 2C2GA 2WIFA 1GU0A 1K3TA 2JJ2A 4JU8A 1W0JA 1IH8A 3LY5A 2I80A 4N48A 2EFCB 2ZJOA 4J6EA 4HUTA 1OI7A 2FSVA 2IU3A 4J0GA 1RLIA 5IWAB 5LQJA 1U7UA 2R1ZA 3IHWA 3LQYA 4OSEA 1B7GO 4GW3A 4ZEWA 3ZUGA 3AUJB 4DG9A 5I9NA 2X5KO 1T8SA 5IDWA 3IDSA 2EWVA 2IQIA 5HWSA 3E5RA 3R5KA 5CG1A 4DV1B 2QRVB 2B69A 2LKCA 5IXYA 1L5OA 2VAPA 4ZODA 2C03A 1PR0A 2P9YA 1C80A 1CVIA 2HN9A 2QRUA 3DMTA 4HDRA 4HZUA 4CV3A 3FTEA 3AY3A 2DX7A 2GCPA 2XUJA 4GYKA 5C8YA 3V6LA 1NVEA 3BRQA 3ZHUA 4B2YA 1BE1A 1JLLA 1NQVA 4D0RA 1XQ1A 2EYQA 2QTNA 1W85B 2IXGA 3EPHA 3OOYA 1Q7RA 4XVUA 3U39A 2QYHA 1NAHA 3MJRA 2RIRA 4ID3A 3V1LA 5BSFA 3S8EA 4E5VA 1I6KA 2R65A 1AXGA 3INRA 4I36A 5AKJA 4BZQA 4OHKA 5D1NA 3HDVA 1TCAA 3L0PA 3U4HA 1ZOSA 3QLVC 4Q18A 5MN4A 2DPGA 2QL5A 4N18A 5FI3A 4IJMA 3HLTA 1QYRA 4HQKA 2QMEA 4TN1A 1Z5OA 1XVAA 2QX7A 3RPEA 4IQ8A 2ERYA 1FRQA 4DR2B 1GGKA 5HF5A 4AF7A 4EB6A 4Z0TA 1XZHA 3MT8A 4ZVOA 3RTCA 2F3PA 4PBRA 1CDZA 4R6WA 1DKPA 1ZXLA 3HUEA 4KYUA 1W87A 3AUAA 4WA7A 3PS9A 5SZHB 3NQ41 5D3KA 1E4VA 4A8HA 4B45A 1XAJA 3AV3A 5AUOB 4B87A 3MMSA 3L4EA 1K8ZB 4P3PA 5ECDA 5B3JA 5JAPA 1JAIA 2ZU6A 5KHAA 1VHTA 3TZCA 3DXFA 4B73A 1PK8A 4EG5A 3RRXA 1NQUA 5IVDA 4K9DA 1O1YA 4AXXA 4QBHA 1W19A 4Q15A 1K8RA 4J0FA 3BH6A 4MS1A 3VYSB 3RUAA 5HQ3B 4MINA 4UMDA 5DU2A 3W6ZA 4X95A 3UCXA 3NOOA 2AD1A 2XCRB 3LOUA 2I99A 1E7RA 2QQ0A 3M49A 4L5AA 3UG7A 3K5PA 1SBQA 2PO5A 3G2OA 3S2EA 5KOHB 4QELA 2OTCA 1BEUB 1VMDA 1XKQA 1U8AA 2WMNB 3CEJA 3FDZA 3OM9A 3A7DA 3ICCA 4ZYUA 4AJOA 1JU9A 1MGOA 1G21E 1DKQA 3SHQA 2Z83A 3FMOB 2Q6KA 1V5WA 5KOJA 3FI0A 4JUIA 4C3OB 4CW7A 2Q0SA 5FLXA 1ZD2P 1GYQA 4M9SA 1DJMA 3GJSA 4JEHA 2WU3A 1N6NA 1CFJA 2NQ8A 4X7RA 4E88A 1M0EA 4JU9A 3FNGA 1IHPA 3IP3A 4Y2JA 5BOVA 3WMEA 4BWFB 3PQ3A 3F2IA 1IUOA 4U63A 2QNBA 1A5SB 1S0UA 3QHAA 5ALLA 2ZR7A 1BFDA 1QF9A 2ECKA 3BF8A 3FPKA 2GTHA 3H7AA 3IAM1 4D3DA 3B3JA 3AUKA 3WB0A 4BZPA 2FV8A 2JAQA 3FPCA 3NTVA 1DBIA 1JDZA 4K86A 5J2UA 3FPHA 1KERA 3C8DA 3W2GA 2WB4A 1KJWA 1SVWA 3DXZA 3P9QA 3GEPA 1ZNQO 3CLKA 3EDQA 5JBQA 3QQ5A 2GM3A 2F3SA 4I8IA 3IA2A 4XQGA 2ADFA 1U0LA 4CM6A 5A6VA 3F3YA 1W7AA 5LQKA 1RP7A 5IXJA 1PLJA 1SEPA 3SJAA 3BK2A 5BV2P 4TTIA 1FP4B 1ITZA 2QTGA 3I9FA 3P0FA 5JI2E 4YRRA 1RFLA 3FR8A 5DIZA 1PN3A 2QG6A 2VHTA 2YNMD 1L8AA 3MT7A 1KGDA 2ZRLA 2A0YA 3G2QA 5FNVF 1P31A 1T3LA 3NBFA 4CRWB 3INYA 4JENA 3C0KA 3GU3A 3IP5A 4R1UA 3W1EA 2GK3A 3EEFA 5CCBA 4U9HS 3ADBA 5IVKA 3MRSA 4O6VA 3K9WA 4KQ1A 2VDJA 1OX6A 2VUTA 3GWZA 1Z4IA 4BEWA 5DSXA 1U7XA 2G6BA 3KV3O 1Z39A 4MAFA 4QPNA 1AZTA 3GRUA 1JAHA 2DPLA 4F56A 4L7QA 4Y6GB 5CGQB 4ZAXA 4GMKA 4ZVPA 1R4NB 4LDAA 4MV5A 2YOFA 1G5RA 1RRVA 4BVEA 1WETA 2VPXA 4N5MA 4Z7QB 1Q16A 2GFQA 3EAGA 3L7KA 1YQDA 1N6OA 2HHJA 1FDTA 1JIQA 2VYNA 3OHMA 1ILWA 3PT5A 3UJ8A 3WO1A 3ZEAA 5C7IO 2A5DA 5K4GA 4W8OA 1GZVA 1KEUA 4OYHA 2PX4A 4RV5A 5KOIA 4GWKA 5LD2B 4I9NA 4P4NA 3O0DA 1DP4A 4BO7A 5JC8A 2Z6UA 1R15A 4KHZA 3M6LA 1K5HA 1DPFA 3JWIA 1YDMA 2N9UA 4P3XA 1IQ0A 5T4BA 4Z51A 1A82A 1T1SA 1X7WA 4IQ4A 4HB3A 2EFYA 2DPXA 1G3QA 2FN4A 5LZ9A 1VSUA 2B2XA 4LQDA 4RV9A 4BCDA 4JC0A 3HI6A 2EBWA 2C1XA 2CHUA 1UK7A 3WSTA 1UC9A 5BSEA 3BS4A 4KJXA 2BFWA 4H60A 4Q4JA 1R6VA 1XRLA 5G1PA 1EFAA 1BDMA 3ND7A 3NMUF 3QEBZ 3GHHA 1TLFA 3DXYA 3IB3A 4JC8A 3ITNA 4LBVA 3ZWCA 1F48A 2R6GA 3FWYA 1C4WA 1ESDA 2QUIA 3MB8A 5JSKA 4MW9A 4HNVA 1ZH0A 4I4TF 4NESA 4FOOA 1Y3AA 2WFLB 4S1OA 4YP1A 5IBRA 3VISA 3JVIA 4AY3A 2ODBA 1VQ1A 4B76A 4EKNB 5KHLB 3BB4A 1NT2A 1V41E 4UBMA 3TJZA 4G01B 1TUIA 2VNKA 3FA2A 5I8PA 2Q6OA 2P79A 3A1VA 2EQAA 1BJKA 2GAJA 3IMKA 1SVNA 4I9FA 4KPFC 5ICGA 1U9CA 5T57A 4UTZA 2BLLA 3HGQA 4X24A 3HFSA 2ZUSA 3Q6IA 3TW8A 2SKDA 3RVKA 2PS1A 1WCYA 1L7MA 5BYAA 1COWA 1AD2A 2DTDA 1LZKA 1UDWA 2ZTLA 4RFSA 4U7TB 1U31A 2EFHB 2NUPB 4I1SA 1I4LD 4Z9XA 4BKQA 4IY1A 3T3DA 5E4FA 5CNKA 1WMSA 3HCOA 3LU1A 4XUCA 5EJ4A 3KZMA 3N9IA 2MSKA 1B42A 1L5MA 2ST1A 2XE8A 3ISVA 4PNZA 4RA6A 1V7CA 4WCVA 3R7WA 1WHSB 2C3YA 3RF6A 1CUYA 3ELWA 4WKBA 2WE7A 3MWKA 1TZKA 4OQXA 3U13A 1IQPA 3RNOA 2YZ7A 1VL5A 2NNWB 1P1RA 5REQA 2QR5A 3IUJA 5JW6A 4TMTA 1NVWQ 4P36A 2JEOA 3WWCA 4F2DA 5AWFC 3E9NA 2W71A 3PU6A 5AKIA 5MFZA 4HGNA 4AYTA 4RD0A 3MOIA 4I19A 4I4TB 4CG1A 1YFZA 5ESXA 3GGPA 1AGNA 4M8SA 4XX1A 4B6SA 4A8PA 4BN0A 5EPOA 1F4LA 3LY9A 4LISA 2J9FA 2H1SA 3D64A 1O3YA 4NZMA 4RY0A 4HZUB 4WXHA 4DSNA 3FMFA 2AZDA 4NBRA 4HT3B 3HWSA 1R6TA 3ILXA 3DZHA 1KOLA 1OH7A 3O1HB 4ILKA 2PBFA 3O4RA 5FOQA 2Q9CA 4GGOA 2ZYTX 3ZJ5A 2Q5OA 4MS3B 3O8LA 1WY7A 1A69A 1CVLA 3GL9A 5IJAA 2NM0A 2GRAA 3UAZA 5CFOA 4C3ZA 2Z6QA 4X6LA 3LIPA 1KBZA 2O0HA 1QH9A 4WAUA 5I5GA 1ZM4A 5IH7A 1IDN1 1E5XA 4UPEA 1C2YA 2J5XA 2MOKA 3L8MA 4KO3S 3VDXA 4O0LA 2VDNB 3PR2B 2PT5A 4EJFA 1MOSA 1DWQA 4OUKX 2PH5A 3TD2A 1FDRA 1KP3A 3HA2A 4PRLA 3QA3E 2ZP1A 4KBFA 3EIHA 5GJWC 1LJ8A 3WE7A 4CI9A 4PZ9A 1MU0A 3JZMA 4BJ1A 2VNAA 4HNSA 1ISIA 2JB9A 4RK7A 4TXHA 1HQCA 5EOVA 1Q12A 2O07A 4IDDA 4ZC1A 2BGJA 3CZ4A 5BSGA 2O1WA 3Q8XB 1WBDA 2G06A 2KYRA 2ZBPA 3ZOKA 2RCNA 3NS7A 4JSYA 1ZK2A 2PR7A 5BUCA 3FVRA 2VCHA 2QL6A 1R10A 1Z0KA 1JEQA 1X38A 2YDYA 3G0GA 4FFSA 1ULUA 5HE8A 1A0OA 5L3RA 3ZQ4A 2DBZA 3AVTA 3DWEX 3N2YA 4KREA 2HZBA 4WXPA 2UUOA 3O6VA 3OZRA 3U4AA 1QYWA 1YJBA 3IDQA 3K3PA 4Z4QA 1CZRA 3HYTA 3ZZUA 5BOSA 5FHQA 3R5HA 4E1AA 1GWNA 4P3KA 2YYZA 4FFPA 3CW8X 1X8KA 2J41A 4FNAA 4JP3A 5FB3A 3RUEA 2V4UA 3COPA 4DSZA 3L92A 1VCIA 2ZWPA 2ZUUA 3V8BA 2EVWX 4EKGA 3DLAA 4ZDWA 1Z4KA 2BE7A 3ICOA 4L0MA 2RHMA 3AEKB 3HDHA 4RVHA 4C5AA 1KPGA 1HT1E 1T4CA 3HLKA 5IJ9B 2OG2A 5FL7A 3E15A 4PVCA 4CDRA 5KMGA 5CVDA 4ZOLB 3RIEA 5FV4A 1GSIA 4CMEA 4INPA 2EL9A 3PF9A 1LK7A 4YXWA 4AC9A 4HBZA 1SUSA