2CHFA

Structure of the mg2+-bound form of chey and the mechanism of phosphoryl transfer in bacterial chemotaxis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction protein
molecule keywords CHEY
publication title Structure of the Mg(2+)-bound form of CheY and mechanism of phosphoryl transfer in bacterial chemotaxis.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 47
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1994-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2chfA00
4XARA 1R8JA 3A10A 3DBIA 3B2NA 4LE1A 3TMYA 1IIBA 2QSJA 1JF8A 2MYNA 2NZVG 3Q7RA 3SNKA 1NATA 2M98A 5DKFA 4N0QA 3RQIA 3O1JC 5ABPA 1DC7A 3HSYA 1A04A 2QZJA 3N0WA 3JTEA 3QEKA 3ROFA 1E2BA 3QLUC 4LZLA 4MS4B 3TD9A 4MYRA 4LDZA 4D6XA 1MIHA 3DZDA 5IEJA 3DLHA 3QLVA 4RXMA 1FFSA 3QX8A 1SRRA 1NXPA 1F51E 1Z13A 3JPWA 1D1QA 2FQYA 1MB0A 3CHYA 4JASB 2L18A 4PYRA 2L19A 3E61A 1PUXA 5KQLA 5BRAA 3SAJA 3Q7SA 4W5RA 3CG4A 3HUTA 2GKGA 1EFAA 2PUAA 3RVQA 3RVSA 1DJMA 4RDCA 3N75A 4RXTA 2HJ9A 1Z25A 2ZWMA 4RU1A 1ZHHA 4P98A 4RY9A 4TN5A 2RDMA 3JY6A 4JA2A 4YV7A 1TM2A 2GI4A 1XHFA 4G97A 3O2QB 1MVOA 4UHKA 3MIZA 3CS3A 3LUGA 3QX9A 4N47A 5DLEA 1JHZA 1NXWA 5C5EA 1VPWA 3DGFC 3KS9A 1C0EA 1JYEA 1NTRA 5BRJA 1K68A 4OATA 4PICA 5GOTA 2VYCA 1I3CA 1QO0A 3LUCA 2WB4A 1NXVA 3OQOA 4N76A 4EYOA 1NXTA 1JBEA 4RS3A 5TPZD 3T95A 3O2JA 4W5QA 3JVDA 5BR1A 2PMCA 5CNMA 2LPMA 3O74A 3OLWA 3K9CA 4G86A 4RK4A 3EAFA 4YP9A 5IC5A 3VNAA 4ETIA 1BVHA 3GWGA 1W9HA 4F06A 2LP4Y 1JH9A 3HVRA 3URMA 4Z0NA 2QW1A 4MS3A 1EAYA 1U04A 3KLOA 3QELA 1PEAA 2HQOA 3BBLA 4LE2A 1LJUA 1A2OA 2NUBA 1YVUA 1DBPA 1GCGA 3KYIB 3N0XA 4F3TA 5EWJA 4D74A 4ZMRA 4YCSA 4LX8A 5HQJA 2FTKE 3HEBA 4D6YA 2VUIB 1USKA 2QR3A 4MR7A 3S99A 1RNLA 3LTEA 2IPAB 4KFCA 2PE5A 4MS3B 2RJNA 3QELB 1DRKA 2L2QA 4G0MA 3HDGA 3CLKA 3OQNA 1ZH2A 1ZAYA 1QKKA 5EWJB 4MR8A 3RVJA 1URPA 3HS3A 4WXMA 4Z4CA 2E4XA 1YS7A 2QV0A 3KSMA 2A9QA 4MR7B 1JFTA 3NHMA 2LIVA 4RSMA 1TMYA 3HUUA 1Z18A 3G85A 4KZKA 4RZSA 3C3KA 3TB6A 5IEBA 3N53A 1ISRA 4OBBA 2R4QA 2QVCA 3RVOA 3MYYA 4JP1A 2A9PA 2R48A 3GA5A 1EHCA 3LUHA 4MR8B 3NNDA 4KPYA 1JL3A 4JOQA 5DCLA 4NCBA 1Z26A 4RXUA 5IUJC 1M2EA 2ID7A 1QQBA 1BDJA 5ED4A 2E4UA 2F8SA 2JVJA 1SXGA 2MYPA 1VRVA 3LFTA 1Z2EA 1QO0D 1CEYA 3HXMA 4IILA 2OENG 1QPZA 3Q7TA 3ILHA 2HQRA 7ABPA 3GBPA 4QICA 4WXEA 2MSWA 5GQSA 2VK2A 4GNRA 2PUBA 3TO5A 3OMXA 4LE0A 5DTEA 3N0RA 4Z4GA 1FSPA 3F73A 4YO7A 2FEPA 2XDYA 1P2FA 4IMJB 4FE4A 5DGCA 1LK0A 2JVIA 1ZGGA 4MS4A 4YS6A 1ZH4A 3GT7A 1DP4A 1USIA 2B1JA 2GBPA 3F6CA 4ETNA 4FE7A 3KTOA 2YHBA 2IKSA 4OTZA 2A9RA 3O1IC 3ILYA 1J56A 5IUKC 1ISSA 3EGCA 3LUFA 2PL1A 1MB3A 4ETMA 5CNIA 1P6QA 4H3KB 4JAVC 4MS1A 1D1PA 1DG9A 6ABPA 5JS1A 3OLYA 3KLNA 3R0JA 3RVKA 1TVMA 1W25A 3KKEA 1Z2DA 4PEVA 3O75A 1NXXA 3FMVA 4RY0A 4G0OA 3MQ4A 1DRJA 2FMHA 1BA2A 1Z12A 4NV3A 2LBPA 3E3MA 1JDNA 4HNQA 3C3WA 5T3YA 3EJWA 3HV2A 2WRZA 1Z17A 4MS1B 3NNSA 5HSGA 3BILA 2WMYA 1ABFA 1WETA 3LKBA 1JFVA 1SXHA 1UDRA 3I42A 4F11A 1E6MA 3H5WA 3T6KA 2FXIA 1D4ZA 3GYBA 1ZVVA 1ABEA 1TLFA 2FMFA 5KQPA 4NICA 5T7BA 3M9WA 5TQ2B 2FEWB 3JVIA 3LOPA 3P9YA 3QLTA 5B3JA 3EODA 3OO1A 1SD5A 2W42A 3IPAA 3JPYA 1YK1A 3RVRA 3M6MD 3NBMA 2F8TA 4H60A 9ABPA 2QU7A 1LJLA 1VKRA 2NT4A 4Q6BA 1D5WA 4EVQA 2JB9A 3QEMA 4EUKA 5FWYA 4OLBA 1PNTA 2PJUA 2FLKA 3N8IA 1QMPA 4F12A 4G0XA 2AYXA 4XLTA 1M5TA 1JFSA 1KGSA 3CKMA 2N9UA 3CG0A 2Q5CA 3EULA 5HM6A 3F6PA 3QEMB 5CNKA 4ZJPA 5KQMA 4N41A 1DBQA 5FWYB 3L6UA 4IGAA 3TX6A 5KI6A 3KG2A 1E6KA 2E4ZA 3HZHA 3OLVA 3UUGA 2IPLA 1U2PA 4MRMA 4ZPJA 4GPAA 2AYZA 3BREA 4Q7EA 1RZRD 4WZZA 3O21A 2P9HA 1ZESA 1ZN2A 3K4HA 2MSLA 4W5NA 3OLZA 4CBVA 1JDPA 4XASA 2L17A 4O5AA 3C97A 2QXYA 1EWVA 1HEYA 5TPWA 4P1ZA 1VLZA 3QLUA 4O1IA 5KC9A 1AB6A 4B09A 3A0RB 3H1EA 4XAQA 3M9XA 4L4UA 4MRMB 4QPJC 1E6LA 1K66A 4YRZA 3H75A 3H1GA 3H5TA 2NZUG 1LBIA 2E4YA 3QLVC 4WUTA 1PEYA 2GWRA 3RVLA 3NHZA 1FFWA 3C3MA 2IDMA 3LUJA 4Z4EA 3HM9A 4ML3A 4TMYA 3H6HA 5TPWB 3LMKA 1DCFA 1XHEA 4JB0A 4MPTA 1L5ZA 3W9SA 3IP6A 3CTPA 3A3KA 2IPNA 4Z9BA 2RJOA 3G1WA 4KVFA 4ZMSA 3H6GA 1BDIA 2V0NA 4QYWA 5TQJA 3OM1A 4F8JA 3SQNA 3IP5A 5EWMA 5KQGA 3EDCA 5I4CA 4HNRA 4TLMB 2JVKA 3MM4A 3CFYA 5FBHA 4RK6A 2CHFA 3GRCA 1RXIA 3KYJB 1ZDMA 2WJWA 2RGYA 1U8TA 2YHAA 4G0YA 1P6UA 3I5AA 2CHEA 4DN6A 4EYQA 2IYNA 2PL9A 3I09A 4W5TA 2R25B 5EWMB 1JYFA 3RVPA 5JS2A 4OG2A 3H5IA 2E4VA 3HCWA 4Z9AA 4MGEA 4YWHA 2FMIA 4PE5B 1M5UA 1YK0A 3RVMA 3VNBA 1GUDA 4G0ZA 3HK2A 3RH0A 1DZ3A 1RZRA 4KK3A 1QNLA 1ZGZA 3HJFA 3O1HB 1KRXA 3QK7A 5C5CA 4S04A 2JBAA 2ID9A 2PAFA 4NQRA 3NNNA 4MQEB 3IPCA 2PUCA 1DC8A 3H1FA 3KHTA 1QP0A 5FWXA 4KQ9A 2PUEA 6CHYA 4E7PA 3H5OA 5TQ2A 3GBVA 4OLAA 3IP7A 8ABPA 3FDFA 3T8YA 3L49A 4QYMA 2ZAYA 2MSKA 1BAPA 4JB2A 4RKQA 3GL9A 2BGGA 2JBAB 1YIOA 1FQWA 4RY8A 4EVSA 2GX6A 4TLLB 4N0PA 3EQ2A 2PUFA 2E4WA 2KYRA 2H3HA 2PLNA 3MA0A 2WWVD 5CNJA 4RV5A 5FWXB 3LUDA 4N03A 3SY8A 2M1ZA 1GCAA 1KRWA 2FLWA 3Q9SA 1CHNA 4RK0A 3D8UA 1PHRA 2CWDA 2JCGA 4KREA 3MMNA 4Y9TA 4RK1A 5D2CA 2JRLA 4RK7A 3CZCA 1NXSA 3Q15C 2O20A 5IUNC 4Z4FA 4LDAA 3SM9A 4XFKA 4DQDA 5JNRA 3GV0A 2JK1A 2IPMA 5E3JA 1RXEA 1JWLA 3T38A 3LUAA 4RWEA 1P8AA 2X7XA 4O1HA 4MAAA 4EVRA 1DCKA 4LRQA 5F64A 3ROTA 4EY3A 3CNBA 3HO1A 1BDHA 5IULC 1U0SY 1A0OA 3KCNA 1ZITA 4ZYLA 4IF4A 2HSGA 5KWSA 1H9CA 4KQCA 4MLDA 1LBHA 2FKAA 3HDVA 4RKRA 3OLXA 3UKJA 2QVGA 5FBKA 1PNRA 4WWHA 3CZ5A 2DRIA 1JLKA 2FEKA 5TQ0A 1JX6A 4WT7A 2PUGA 1FFGA 2MYUA 1YMUA 1C4WA 2FQWA 1AB5A 1S8NA 2OQRA 3BRQA 4S05A 2I6FA 4NCAA 2WY2D 3UK0A 3CRNA 4KV7A 1EWKA 2MYTA 3D02A 4YGXB 1KMIY 4UHJA 2A9OA 2VUHB 3A0UA 1OXBB 3RVNA 3FFXA 5TQ0B 4Z4IA 3DGEC 3N6VA 3OQMA 5JNUA 1ZY2A 4Z4HA 3H5VA 2CD7A 1U2QA 2H0AA 2FQXA 1XWWA 4EYKA 1YMVA 4MLCA 1USGA 2FMKA 4IMIB 1F4VA 1NY5A 3EQZA 3FFTA 1QP7A 2IOYA 1YTUA 4EGSA 2B4AA 4E7OA 3F7NA 3SG0A 1Z15A 2FN8A 3FFWA 3FGZA 4KMRA 1QQAA 3IDOA 1DCMA 2TMYA 5JNVA 2FN9A 3MF4A 5IX8A 5HKOA 1M2FA 2R47A 1GUBA 4KRFA 4G0QA 2FVYA 5TE9A 5JNTA 1NXOA 3LKVA 4G0PA 1GLGA 2HQBA 1CYEA 5B3JC 1B00A 3CU5A 4PZ0A 5IBQA 3BRSA 1EWTA 5CHYA 1YS6A 2FSPA 5JNSA 3IP9A 2WJAA 1TJYA 5EWLA 3C6QA 2P4UA 1T34A 4EYGA 4HYEA 1Z16A 3I45A 2HPHA 4FB4A 5JNWA 4MR9A 3OM0A 4MQFA 2NT3A 3OMWA 1RPJA 1L5YA 4IRXA 2J48A 3DLBA 1OXKB 3Q41A 3OO0A 4Z99A 4RK5A 2FW0A 4XXHA 4W5OA 3JS5A 1MAVA 4MQEA 4Q6WA 1Y1LA 3LUKA 1D2AA 3O2SB 5EWLB 3KJXA 4H3HB 4M88A 4YR7A 4HNSA 5KC8A 5TPZA 4DADA 4KNYA 4L85A 4MR9B 4MQFB 5PNTA 1APBA 1QP4A 1SXIA 5BQ3A 2PUDA 4KK4A 1DBWA 2LUOA 3H5LA 4YLEA 2PKXA
chains in the Genus database with same CATH superfamily
4U02A 5JFGA 4MHTA 1SRQA 4OUKX 2ZIXA 2ZXEA 3QA3E 3QBJA 2NYUA 3MZ0A 3RSHA 4J7UA 3ZJ5A 3JQQA 3I8XA 3TD2A 1FXUA 5AJZA 5D00A 2EBUA 2Q0QA 3TZ6A 3GQBA 4BJ3A 3O1JC 2H6EA 1NLYA 2A33A 3UANA 5K8VA 4XD7A 2HNBA 4RTQA 4MKHA 1YT5A 1R7RA 1SKYE 3D4NA 3W1EA 1NT4A 1ZD9A 5EUBA 4NMHA 1KFEB 3ABOB 5JZMA 1MUUA 3WLMA 3QE9Y 3VU3A 2PGXA 1I2DA 4MWZA 1VTKA 3T5DA 4BNNA 5DM0A 3F8TA 2G82A 4XJVA 3U17A 4B2PA 2ADOA 4IX9A 3ITNA 1NXPA 3NR2A 3ZIAD 1T35A 4RIHA 4D0NA 2AJ8A 5KNDD 4FCCA 4L0MA 5D1HA 1AF4A 2L19A 3CLVA 4TV9F 5ENDA 4B3IA 4C4YA 4DMGA 3L4EA 4HN4B 4DNPA 4H59A 5FHQA 4EL5A 4BLPA 2DM6A 4PLCA 2PUAA 4RW0A 4EKYA 3EGXA 2TECE 1WUIS 2JEOA 2P4SA 1RI2A 2BN4A 1EDDA 3EZFA 2HADA 2PO5A 4GC5A 2R1ZA 5GJWC 3FHTA 4UBMA 5JHGB 4M87A 3MRSA 4WNYA 1NUQA 3SHWA 1E62A 1TYCA 1FS4A 1GA6A 1IHYA 1U7WA 2YJ3A 5EZYB 1KMCA 3E23A 1BS1A 1OREA 1OX4A 3GJ8A 3NDPA 3PUJA 3K0FA 3KS9A 3PYLA 4XA8A 4RTSA 2ZPUA 5EPEA 2GA8A 5DCWA 1CZUA 3JQ9A 2BY4A 2GF0A 3R7WB 1QO0A 4QUGA 3K35A 5L3RA 1GVHA 5B4TA 3SHVA 4DDTA 5DI3B 4ITVA 2XWBF 2XUIA 2DQZA 1I1HA 4OHPA 5EFOA 3WK9A 3TF5A 4G6ZA 2VTEA 3U4MA 5CNMA 2JFPA 3FBTA 5LU8A 3K9CA 4YP9A 1VPDA 2P6UA 3A4NA 4TTAA 2Z8YM 4C3VA 5K8TA 1USWA 2J6HA 4ZZ0A 5BR4A 2IH4A 4D98A 1FW6A 1N3IA 5IYZB 5JAOA 4C3OB 2GZ3A 1W49A 4XGNA 1V9LA 5HEKA 3WGNA 1FYFA 4DIUA 1JKIA 2X3YA 1UT8A 1JJFA 3OE4A 4KQHA 4GICA 3WP0A 3QTLA 1FNCA 3ONFA 1T3ZA 3TZHA 5A6SB 2Q5LA 1AN0A 2R8BA 1VLJA 3OOEA 3QUTA 4PS1A 3ZNOA 5BUCA 3ZX5A 4D6YA 4US0R 1HE3A 2OZKA 2Q5FA 3CZPA 1FS6A 2GM5A 2H29A 2H3EA 3B3QA 5IAAA 1A9QA 4U7HA 3QELB 3GGGA 4ATNA 4O2LA 4CTKA 3HWSA 3MWDA 4B3RB 2Y1GA 1V3UA 1FPQA 1QKKA 1S2MA 4U9UA 6REQA 1Y6FA 2PIAA 2PRKA 1GEEA 4X44A 4Z4QA 5CVCA 3GP3A 3RIXA 1CDZA 5KNDA 5E9JA 3ZD9A 1ONOA 4M9ZA 2C97A 4RSMA 3W5JA 4J2TA 2Z30A 1RZVA 4NAHA 4ID9A 4ZQEA 1ICIA 4HAXA 2Q4BA 3TB6A 4B0PA 3LGAA 4UM9B 4LHYA 2DCUA 3HMKA 3T1YB 2O7VA 5DWQA 2A9PA 3TECE 1OMOA 2EFYA 4BE4A 1ESEA 4UC0A 3O83A 1Z2PX 3O4VA 2FUG1 2ID7A 4O4HA 3K0HA 2C9CA 2IXGA 2ZFUA 3LI2A 3BIWA 5JAHA 1KI3A 1CY0A 5GM1A 1QZUA 4W1QA 2GTIA 3HXMA 2Q1UA 2BTEA 4PHTA 2PX6A 4LJ4A 4ND8A 2YUTA 1RAHA 5FFFA 1MLDA 1QPZA 3QVOA 5KVVA 4QGGA 1NUSA 1PQ4A 1F2TA 2ZUSA 4YQEA 1JECA 1JDVA 2YHIA 4I2VA 4IYRA 5B1HA 1R8SA 2XLCA 2C78A 2XUDA 3C48A 1B7GO 1NF9A 3CWZA 3F47A 3R5SA 5DOVA 3SJ7A 4B76A 4P92A 4ENPA 5K7SA 4YXFA 1Q12A 4AM8A 1LFDB 3G2LA 4G5OA 1RE1A 3I3SR 1Q6YA 2CLIB 1JDZA 4MUNA 4V02A 1Z28A 1YL7A 3LL7A 2FSIA 3OPMA 3G7NA 2HPAA 4K3VA 3RBVA 2UYCA 9MHTA 1Z73A 5H4HA 2GPTA 2JGEA 2QROA 1UBSB 4IJKA 1N2SA 4RF2A 3C3PA 4PZYA 1GCUA 1MZVA 3COPA 1GXSB 1JDBC 1HSZA 1SUPA 3EGCA 3HSSA 3P0EA 3WFZA 2PL1A 1Q11A 2VZEA 3D5TA 3J80A 4PN3A 2CVHA 3Q2OA 4K28A 4L16A 5F9MA 5BSGA 4QTXA 4R3WA 3VZCA 3TPCA 4C29A 1OI2A 1RLOA 3A3PA 4QBKA 2R4UA 3GVIA 1DFGA 1EK2A 2ZSBA 4BLVA 4YCJA 2XRFA 4OSOA 1JAIA 4PLHA 3X2FA 1CQIA 4C76A 5HFAA 1UIMA 2PGOA 3MK31 3ZY5A 3ET4A 1JEQB 1C9NA 2IP1A 4IFBA 1KO1A 4PQFA 1KZ9A 1PJQA 3TQTA 5L6MB 1Z12A 4QTTB 1DIBA 2ZCUA 2XNDA 3GXOA 3DR3A 1JJVA 3T3PB 3VH3A 5BOVA 3E9RA 3U09A 3C3WA 3QXSA 4G4GA 3L07A 3T1NA 4JBIA 1TUBA 1R88A 5BSHA 2QAJA 2OC4A 4FS8A 1WETA 1HFKA 2IEIA 4DEYA 4EFKA 4NNJA 3PDIA 4M53A 1E3MA 1ABEA 1TLFA 2HF9A 4DCOA 5KTRA 2D5CA 1H6AA 4Q24A 1TECE 3HRKA 4DAEA 4DLKA 5U4XA 1UJ2A 4CIBA 2CLEB 3LOPA 4TZKA 3P9YA 3PJFA 1QIEA 1QPBA 2GYYA 5DXJA 5ADWA 4YP5A 1OV4A 2YN4A 1ECLA 1HFWA 4RCYA 3ZN2A 2W6OA 1D6SA 1EQUA 1HBJA 1N8TA 2V45A 3EXIB 4XIYA 5LQSA 1KJJA 2I65A 2E82A 1K63A 2HSJA 1LJLA 5KJEA 1Z35A 4Y1FA 1VIMA 3C7TA 1D5WA 1OLUA 2ZB8A 4JUFA 4KKXB 5A2QA 4OLBA 2JFVA 1PNTA 2A92A 3M89A 2A5FA 1SBQA 3DHNA 1KA9H 2HO4A 4LRXA 3BSWA 4JNKA 1TEZA 1KAMA 2R6JA 2W2QA 2AYXA 2GRAA 4NONA 4OQQA 4Q7MB 4UCFA 5H3LA 3RPEA 5K3OA 2PBLA 1ECPA 5I8ZA 3JAWA 2MMGA 3TKYA 4EZIA 2O3QA 1WHTA 2H5EA 4LV6A 4ZZIA 3ABIA 5DI9A 4BTEA 3AESB 4DGQA 1GAJA 2G07A 5KQMA 4FOTA 2BTQB 2NX2A 1HH4A 5HBGA 1C8LA 1IB0A 4HDSA 1E6KA 2E1RA 2IZZA 3TLGB 1ZOLA 2IPLA 2VAMA 2PO7A 3OH8A 1CUVA 3S70A 4XPIB 4Q4AB 3EVBA 3O21A 2DFNA 4RSGA 4W5WA 1ZG3A 4AXBA 4D4LA 3ZK8A 3E9QA 2ZE5A 4ZKEA 4YDRA 2G8NA 2QRNA 1Z5VA 3ESCA 4LGVA 5GJCA 1EWVA 1O95D 2QUKA 2ZRKA 1QTIA 3DOCA 2YJ6A 2OCPA 3GEIA 2Q9BA 4PG7A 3UWOA 4F86A 1MXFA 1AB6A 2JIQA 2QD5A 2VJMB 3HZRA 3JW8A 3PSHA 5FAXA 3DSRA 1JQJC 4YRZA 1S89A 1SVNA 4PBSA 5JZBA 2YC2C 3AHEA 2DKFA 3GA7A 4JY7A 1MP0A 2E4YA 1JDBB 4RL6A 2Q5QA 1CY7A 2I3GA 3SC4A 3AUUA 5IH7A 4F0JA 4Z4EA 1ULZA 2ZRBA 1QB7A 1XMOB 4EJMA 3BXZA 4HTAA 4LY9A 3H8VA 3DZKA 1G0NA 3WISA 4N6GA 4I5EA 1RXYA 4L8LA 3A3KA 5T4FA 1W4BA 3ACCA 2E5WA 1X9IA 4UATA 2WKRA 3CR3C 4LS3A 2D1SA 3E8SA 3URKA 1M8PA 4MW9A 4B1FA 4AUNA 2O0MA 3G79A 4C4XA 3KJEA 3OHMA 5TJHA 4YUWA 2I5PO 2JAXA 2AXEA 1PTJA 1VHWA 1DQRA 1M1YE 1U3WA 3F90A 5GONA 3T7SA 1Q0HA 1JXOA 3CISA 5LOVA 1V95A 1ENOA 4KOEC 4JQCA 1N32B 3EZ9A 2HLPA 4R2WA 1NQAO 3ABZA 4DIFA 3IBSA 1M0EA 3ZDRA 1F0NA 3WQHA 2PGNA 5BQOA 3PF8A 3WYDA 4F7DA 2XOXA 3K1ZA 2JA2A 4H0NA 4DCVA 3FM9A 1JYFA 1WMBA 1HC7A 2R00C 1AKYA 1IY8A 2VAWA 2VO1A 4AWXA 1J8MF 2BGMA 5B12A 2KWIA 5E2IA 4JXKA 3EGWA 2VHWA 1DHTA 4RJTA 2WR8A 3DDUA 2GASA 2ZWIA 3D6NB 3HU2A 2ZJBA 2CFIA 4GXRA 5E1MA 3CUYA 5ISMA 1SJ9A 2EFEB 2JFZA 3AW9A 5EZ5A 1HSOA 1NV9A 1GOTA 3MRVA 4E08A 4QL3A 4U4AA 5THXA 2ZE8A 3V48A 5EP2A 4FYIA 3EA5A 1IOWA 3TZEA 1TMKA 1U28A 3WNVA 2IHKA 3DO8A 1BVYF 2PCLA 3I62A 1KL7A 1FJXA 1IN5A 4KPGA 1RRCA 4KK3A 3V42A 3F6YA 3RSZA 3VDQA 2R1TA 3G0HA 1CKEA 1Q0PA 1X2EA 2GPNA 3LY5A 5JSYA 3V4SA 1TCBA 3T94A 1NBIA 4XX1A 2DFTA 4NQRA 5SY9A 2J3QA 1PV2A 4ER0A 1CNMA 1O95A 2R11A 4LZPA 4WBNF 1AKVA 1DC8A 3EB9A 5M5BA 3TLMA 1QP0A 2PUEA 2P6RA 3PLAE 1H5QA 3K6SA 3VKFA 2P1ZA 1Z6GA 3BD9A 5KCZA 4FR2A 3GJQA 1ETUA 2VT3A 3MBIA 1YASA 1OB5A 1P62B 3D7MA 2QUHA 1IXKA 2VTBA 1UDCA 1XXHA 4Z53A 4F3CA 3OPVA 1W4AA 3OQVA 5FXMA 2FU5C 4DIOA 4DNXA 3AEQA 3ZE6A 2CNOA 1K06A 3MA0A 3FSGA 4BKUA 4B6RA 5KKNB 1NYLA 2C9BA 2GEJA 3GZ4A 5F21A 2OT3B 4DA4A 1GT6A 1GO2A 4RF3A 3EG9B 2XZOA 4MPJA 4FCWA 3TK1A 5BN3A 2MSNA 2QRVA 4I4LA 3C70A 4ZVNA 2CY0A 3V8VA 3EPPA 2PUWA 2REXB 2BKAA 3HCBA 3L6CA 2PNFA 2PXAA 4UKDA 2JRLA 3MGGA 3L77A 3OA0A 4MAMA 2XVAA 4LNUA 4H17A 2PTGA 4HLUA 2AOTA 1O8CA 2II6A 4IJVA 4JBWA 2C2HA 1WCIB 4W9NA 2IPMA 4H7KA 3RKSA 1L9KA 1VE7A 3ID6C 3OIWA 1CFZA 3RR2A 1UMBB 3FSRA 4FDVA 1DTSA 2KBFA 4LK2A 1PWEA 2J3HA 3ROTA 4AZ0B 5FOQA 1GAXA 3HCNA 1H2AS 2GCIA 2GJSA 2Q50A 2QN9A 1VLMA 3BG5A 4MV7A 2Y3IA 1W46A 3O4GA 3HVJA 4JBXA 4QBGB 2OCIA 3X1MA 1K97A 3DM5A 1EK0A 1OW3B 2GK7A 3H2SA 1JLKA 1XVAA 1YE8A 1SC6A 3D4IA 3WB0A 4I46A 1BH6A 1WPQA 4URHA 3FYDA 2XGMA 2XYHA 5ES3A 5J4HA 2A2ZA 5TDHA 1ABBA 3A6JA 1BEEA 2IX9A 3AUTA 5C18A 2HWWA 1TZKA 3BE5A 4NXMB 2JFHA 3CRW1 3L0CA 1J6UA 3GGCA 1U94A 2I6FA 2Q3LA 1HDIA 4TYMA 1I6KA 4L78A 4NCAA 2XAUA 5JMPA 1WDKA 3UHPA 1XALA 2H5IA 2O8DA 1WW8A 4OGWA 1OXBB 1JU4A 3V80A 5A3RA 4DIKA 4L9SA 4ZV7A 2BMVA 3D6UA 4OV6B 3I8OA 1KI6B 3TS1A 3GELA 4NZYA 3S40A 4KR0A 2VP0A 1VBMA 1WPXA 3DE4X 1WXEA 4ZJUA 2OHFA 1U2QA 1WVIA 2FQXA 3FPEA 3LBYA 4MB2A 2F1IA 3ZBTA 3ZDCA 3RRNA 2KQUA 5E95A 2KX7A 3GAZA 5T6BA 3V1YA 5CCBA 3WI7A 5JWRA 5HHTA 5K1ZA 3PVSA 1OVGA 4IIHA 1LSSA 1PS0A 1YL6A 3BT7A 4B83A 4RHUA 2ZYIA 1MQAA 1G5IA 4Q37A 5JALA 3GPLA 1O0CA 2B4AA 4ZQBA 2VTKA 5FV4A 1Z15A 1VYHA 2H2IA 3T1HB 3RV4A 5M29A 1SD1A 1CJUC 3EPRA 1E2UA 1A1SA 4DNOA 2ODWA 5EIBC 2AQ8A 3DHEA 4IDQA 1CJVC 2DQYA 4UEWA 2W83A 4P5EA 1XMIA 2LCFA 3V1NA 1NXOA 3VAZA 1AQJA 2J0UB 5JZVA 4B85A 4PZ0A 3WZLA 4QG3A 2X14A 2QAIA 2VSXA 3MWLA 3MAJA 3R5XA 1UJMA 1U3CA 4FEGA 3OZAA 3WQSB 4JLVA 4O4HF 2OPHA 2FAXA 3I45A 3DMYA 4NJOA 4JX9A 1P8JA 1CQJB 3OMWA 3H17A 4GKBA 5F33A 1NVDA 3DZBA 4GKKB 2BFBB 3Q41A 2J9GA 3PQ3A 5MHTA 1O54A 2BWJA 2R65A 1E3TA 1AQIA 4XTCS 5IAJA 3WGJA 5TXGA 3K0AA 2CVPA 1ZRHA 1HUQA 1KHHA 4ZVVA 3IALA 5FOSA 1YR2A 5EE0A 2Y71A 3BK2A 1DBVO 1Z37A 2C03A 2IKQA 3HKEB 2J85A 1UL1X 3L4BC 1JKFA 4NDAA 4F3NA 3NRJA 3N28A 3GLHE 5PNTA 4DNFA 2I67A 4WECA 1ZH0A 5EZQA 1K9SA 3IEIA 3QKIA 3RI3A 3RVDA 2JAPA 3S2ZA 1NLMA 4LHXA 3HL4A 3P2IA 3SYLA 3HXOA 1HNWB 4FWIB 5DOZA 1A27A 2MSCB 4B0OA 3S8YA 3C1AA 1T4GA 2QT0A 3EEBA 2C00A 3ZZUA 3HC7A 3JWEA 1SIUA 4GR4A 5EXTA 4AJOA 4BO8A 2EX4A 2W90A 4F45A 3L6EA 5JJ5A 4OU4A 5DBHX 3NGXA 4Q9LA 3REQB 2WTXA 1V3QE 1HNZB 4AO6A 5D6NA 4JI6B 3P19A 1YNSA 1LS6A 3ZW8A 4ND6A 3F74A 3ZHBA 2EJVA 4GOXA 5K0CA 3VDRA 4DLSA 3KVYA 2IP2A 2BDTA 2NAPA 4KXNA 4OYRA 4OIFA 1FFSA 3C2QA 3OCZA 3GJ0A 3T5PA 3SIRA 3TRJA 5J3JA 3ENQA 3GDFA 1GL6A 3CHYA 3N8DA 1NY6A 4EJ2A 3KDAA 4WNAA 5HE9A 2D3TA 4EEXA 2EDAA 2DR3A 2PH3A 4GECA 3NWEA 5CM9C 2WLSA 5FOWA 4HH0A 3KXLA 4L0DA 1IQ0A 4YT8A 4JYPA 1JYSA 3ZHUA 4CKZA 1NRIA 2R5WA 3DEZA 4J1SA 4NEQA 1DJMA 5JQWA 1KSJA 3BCSA 2GAIA 3NM5A 3W6OA 2GLTA 1RMYA 3AYZB 1ZIPA 1C0PA 1WS6A 1DEOA 3JY6A 1TM2A 5AHOA 4CFZA 5A7FA 3HN6A 4CU5A 1GG8A 4U3JA 4MHSA 2MCFA 1FP6A 3GLGB 3UGTA 1R50A 5AOBA 1NVWQ 1XDWA 4E3WA 4B34A 7YASA 1KVQA 4QQRA 4NJEB 1C3OA 3JXEA 1SCBA 1THTA 3OTIA 3P71T 1M6VA 1XGKA 3BJRA 3L6RA 3K1AA 1Y4AE 1KZ4A 2QHXA 3VYUB 4B43A 4ZIRB 1OBHA 1JB9A 1T5OA 2FZ4A 4NENA 3A3YA 1Q0SA 1SHKA 1K7FB 5JD5A 5KPDA 3OQOA 3CZQA 3L3BA 4PCUA 3C8DA 3HXTA 1K8YB 1K2WA 3WKCA 3N87A 1NMZA 1NVVQ 1PDOA 2P9JA 2PMCA 3WDKA 5FBVB 1GQOA 2HT6A 1A72A 4G86A 1HETA 2CLLB 3HEMA 4IHJB 5IC5A 3VYSB 1X6VA 1GKKA 2XCLA 5F12A 3OZVA 4KPUA 1EXWA 5LUBA 4PZCA 3LAWA 4EY6A 2PRSA 4H27A 1N8NA 2ENWA 3AV3A 2QWXA 4FR0A 4MA5A 3OIDA 1EFDN 1R27A 3KYDB 5BSFA 4S0ZA 2REQB 1NZJA 1EFRD 1T3HA 3H1AA 4A0QA 2QRUA 2ZT7A 4HS4A 4UTVA 2C4UA 1QCYA 2WJ4A 1UPFA 2JPDA 3DFFA 3PNVA 3W9UA 2RAUA 5FNVB 4E46A 4P4GA 1V45E 4TSRA 2F3QA 3HEBA 1KJQA 1FL9A 1EU1A 1V9CA 4X92A 4BZQA 1CJBA 1NG1A 2X2EA 4EG8A 4ZEVA 1F4LA 2TS1A 5BWBA 2AH5A 1MNAA 4UBIA 2HMSA 4IIJA 5K0ZA 2CL6X 5IJ0B 4N40A 1B0PA 1R0RE 1JKXA 1KVSA 2DFLA 3RVJA 5BWOA 3U7EB 4BFVA 3VSCA 1NPYA 5KMGB 2E4XA 4L02A 5KTNA 2Z5GA 3GUYA 5I6DA 1NVGA 1ZJZA 5EINA 1D04A 1U8CB 3K1TA 4CFSA 3QTBA 3UWPA 4A4DA 2JANA 4PYIA 4JBHA 3U4QB 1Z6TA 2HEGA 3DKKA 3SC2B 1I4DD 2FG5A 3B1ZA 5IHPA 2HTFA 3AETB 3LHSA 2HFKA 4MR8B 3M81A 3EUEA 2VN8A 3NPAA 4J43A 2FR8C 3HKCB 3LVRE 4M86A 1WOMA 3H42B 4DLPA 1BCSB 5KREA 2O3SA 3QVKA 5CDFE 1XIVA 4UULA 1NM5A 4ECAA 5CDYA 5ED4A 1SXGA 3R7FA 4PHGA 1VRVA 3EA4A 1FXWF 3LFTA 4HC4A 4WKBA 1K27A 3G9TA 3FD8A 4OHMA 1YJ5A 1P17A 1S4MA 3NETA 2XXJA 4L51A 4NYIQ 5FFNA 2GEVA 1ZP6A 4AP5A 4W4TA 4JI5B 1ZU4A 4CDRA 2WIBA 3O7WA 3OQ1A 1TYEB 2FOXA 3JRXA 4I14A 1UXKA 2H4WA 2JARA 5CW2A 2OY0A 1QLJA 3N2KB 2HYIC 1N6IA 3LHDA 1YBMA 3BMQB 3QMWA 1C9KA 4GOLD 4QUKA 5BRNA 1J33A 1ESZA 4BNMA 5JU6A 5THKA 1UPTA 4BQOA 4XOUA 1BROA 4UDNA 3ZWPA 3R7NA 2CYCA 3C3EA 4QOEA 2IKSA 1LDNA 1V3VA 3ZWKA 3LECA 4ZARA 4E88A 4ER3A 1IN6A 1VMEA 3A06A 1T2FA 2FYTA 1ADCA 3EYWA 2GBFA 1XOIA 3P32A 2YWBA 2AWNA 1YA4A 4K8RB 4MUMA 2IP4A 3VOTA 1QRSA 1PSZA 4V2IA 5ESXA 2IH5A 2QTFA 2X42A 1YJBA 3VV3A 1SH7A 5C32A 5DWVA 2DR0A 4R31A 1EHYA 5T8KC 4CKEB 1SCUB 3G8DA 1O97D 1NX9A 3HRIA 3WXMA 2EF1A 4DCTA 1CUHA 2MR5A 4UREA 4ZZ3A 1NXXA 3FMVA 3ASZA 3ISVA 4RTPA 4UXHA 3FPAA 1M1YA 1PGNA 2B8TA 2VAXA 1U0OC 1YR3A 4QU9A 3L04A 1G4HA 2W71A 3LOQA 4HADA 4O4LF 4LTMA 4O4JB 4R9UC 4ZT3A 3PLNA 5JPIA 5JXJA 5EP4A 4TTIA 1ENZA 4LDNA 5EJMA 4JL6A 4UQPA 2ZJAA 4LXGA 3U0BA 1P3JA 5BV2P 2QRGA 3MS2A 4MV8A 4PYQA 1KAQA 1U3FA 1E9VA 3OLQA 2GEBA 1TA4A 4PG4A 1ONBA 3H9CA 4X8MA 1COWD 1TYAE 1FRZA 1ZWLA 4EFLA 1Y8RB 5DN9A 1TK9A 2P2GA 3SYTA 3B6KA 4CTNA 5B7GA 4BZPA 2WG2A 2CHQA 4QXAA 4DBLE 1AHNA 3LZ6A 1CP2A 1U2ZA 5K0FA 2WFAA 2DCMA 3D59A 2ACVA 1TU4A 3DCIA 1JUDA 2VH1A 1XCPA 5DBGA 1B6GA 1XYYA 4G5QA 2VP6A 1P1FA 1F6WA 3TQOA 3H4VA 5KJ1A 4DJDC 1UDXA 2NACA 3W6ZA 4V0ME 4EUKA 3QITA 4KSYA 4E21A 2R6ZA 4EELA 2D2XA 5ALMA 1MW8X 3V8RA 2FXVA 1T2CA 1PU2A 3D6VA 3DT6A 4R68A 1L5FA 4CFYA 1H5UA 1K7XB 4WK2B 4FNOA 4NARA 5LC1A 1YDGA 3SXPA 4RL4A 4HVCA 5E6UB 4FN4A 4PGMA 2A84A 1REQB 2IE8A 4INPA 3KYBA 4ZJPA 4AY3A 4TMTA 1TKBA 2YJTD 2YWCA 4HCJA 1UBRS 3JARA 2FUCA 4TXNA 3MLBA 1XFAA 4GPAA 4MX8A 2V7VA 5TF0A 3ESXA 2OO7A 4ZOBA 1HG0A 1RJ9A 1KBZA 1JALA 2C8KA 3NORA 2I4NA 2XMZA 5DRYA 5TX7A 1BMDA 3L7YA 1YAHA 3T9BA 1N2CE 4O5AA 1R0YA 3JAKB 4KVAA 3AQIA 4MVXA 1GL7A 5KVSA 4XEUA 1SVMA 1XQXA 3RYFB 4WK0B 3QPVA 1WPGA 3DZCA 3FPFA 3FWNA 3R6WA 3FHJA 2H0RA 1Y9EA 5ADHA 3E7XA 3FPKA 3L46A 4XVUA 3GN2A 4X54A 4WUTA 1UOPA 2GWRA 1FXSA 5AI0A 3AVVA 5JQGB 3L7LA 1I1NA 1H4TA 2B82A 3BGVA 1N5IA 2K4MA 2F1HA 1BX3A 1N7HA 3GX1A 2R751 1OWNA 1XCJA 3NIWA 4WKGA 1E9FA 3OSUA 1QIGA 4XQ9A 5TT0A 3T7AA 2NP7A 4QZVA 3K30A 4JI1B 2J45A 3JYHA 2IPNA 3AVOA 4TT8A 4Q9IA 5L53A 1U1DA 2RJOA 1KH2A 2FDXA 3D2AA 1DDOA 5ALNA 2ORWA 3JTMA 1TT5A 5D3MB 5FAKA 4I4CA 5CH5A 5CIYA 2BFAA 4NY1A 2Y1XA 5HVNA 2DAPA 4TLMB 3KJFA 1XA0A 2CV0A 4RCZA 3BL8A 3U9SA 4FNGA 3HVHA 2WHEA 3KT0A 2QM3A 1WD5A 4JJKA 3WKEA 4DCUA 1SB8A 3JWHA 3RBZA 1JPNA 1R5NA 3HMQA 1KQPA 1YC5A 3K96A 5FYQA 3OM9A 1NA5A 5K8JB 3I09A 4CE6A 4QTZA 1ZD2P 2HIMA 2V6BA 2ZSUA 3E4DA 4JU9A 1XEXA 3IIIA 3AUFA 4H6PA 4OG2A 3ETNA 2B3DA 4A5OA 2OHVA 2XDQA 1P5ZB 1S2DA 3F8SA 1H9BA 1TB4A 2E4VA 4MV5A 4QDXA 3T0GA 3T5GA 1NFQA 5HCNA 1OE0A 1OU0A 2YXPX 1IK6A 1KAGA 3OQHA 1YK0A 4ESOA 5TV2A 4GOKA 3IDSA 3DTTA 4HRAA 2PS1A 1CD5A 1LNSA 2PZAA 1ESDA 4NV0A 4QNNA 1GV0A 4WOCA 3OIYA 2QY6A 1VGQA 2VH5R 2DHEA 4AZVA 4ZI7B 1B93A 3HNOA 2QGFA 1EA5A 2VNHA 4AG5A 3RAPR 3KSAC 4A2WA 4MKXA 3LP6A 5KKCA 5B7NA 1NVUQ 1DQPA 4MCJA 3AVYA 3GFSA 5FTWA 4GFDA 1UOEA 1OQAA 3B9PA 5BQ5A 1NVVR 3HCPA 1GQYA 5D5PA 4E7PA 2H48A 3A4IA 3GEGA 3TRHA 1PS9A 2J7PD 5DYWA 1H2YA 1Q0ZA 4Q4JA 1P2VA 3FDFA 1IB6A 2PH5A 4KGVA 5I7WA 3R0ZA 1BFUA 1E92A 2JLAA 2XMSA 1FRQA 4I3FA 1XBTA 2G9VA 1Z82A 5KYWA 2W43A 1X8LA 2PKEA 1GA1A 4OCZA 5GZ1A 3W3ZB 2LVBA 2WJVA 1BZYA 2YXLA 3F96A 4TM7A 5GTDA 4BUJA 4CLOB 1NSTA 1R6BX 4BKQA 2KW5A 2QD1A 4JJEA 4W7IA 3NDJA 5ALHA 4OMFG 2HRBA 1HE4A 2ZQZA 2G72A 1VXRA 3VR2D 4Q21A 3L0PA 2QX9A 2OMKA 1IPEA 4KTTE 3RFTA 4BVAA 4K8OA 5JH7B 5BW8A 3QX3A 2QRMA 3EXFB 3ZD7A 4Y2VA 5EL0A 3AYXB 3GLHA 1WCV1 5D2CA 4LSZA 3JD1A 3U3XA 2CCJA 1OFTA 2J33A 3Q15C 1IVNA 1DLJA 3O3CA 5ESWA 1XTQA 2WQZA 1EGMB 2IYWA 3QVLA 3L4KA 1O94A 4HZUA 1E0KA 1E2LA 3LSTA 4BCDA 2B6HA 4UQOA 2DPMA 4AK9A 2OBBA 3G3EA 3TAXA 5JD3A 4EMUA 3D3JA 3KIPA 1NI4A 1B74A 2BH9A 3QUBA 1OR8A 1T8UA 1ZM4A 2F64A 2ZCVA 3BJZA 3CZ5A 2DRIA 2Q6KA 3GFGA 4YJKA 2PFKA 2P78A 2QY9A 2GXQA 2QM0A 2ACEA 4QQ8A 3AZOA 1JBQA 4NECA 3BKXA 1WUYA 3NKFA 2XMQA 2IK8A 1E1YA 4UUMA 4ZVKA 1UEJA 4DCSA 2EVWX 3SHQA 1TOAA 2I6XA 2IT1A 3IPLA 4BQSA 2XTAA 1G291 4BKRA 1E1LA 4YGXB 1P2SA 2VTVA 1OT5A 2FK7A 1UXJA 2FVXA 4FNAA 4Y18A 4D0RA 1QHSA 4J07A 2PZMA 4PM4A 1Q0UA 2C2GA 4ZT2A 1K08A 1RYDA 4CM9A 4D9GA 1X1QA 5E0OA 2DGDA 2BC9A 5IJ9A 2A0YA 4GDFA 3TIGA 2O2SA 4KOAA 2EDCA 4JI7B 2DQ4A 1T9GR 2N0SA 1PYDA 4J16A 3AOGA 2C95A 3IVGA 4N3AA 4XGIA 5K3EA 5KS2A 4O02B 3ELWA 2B1RA 1XWWA 1SIWA 1KHTA 3FF4A 2RK4A 1W1IA 5JSZB 1ZUIA 3ZNPA 4HUTA 1MH1A 2FMKA 4OXIA 3REOA 3DDCA 2PX8A 4Q9JA 3RS7A 4L08A 3SKYA 3DTVD 1I1QB 1Q0QA 2J5BA 2HIHA 2Y1FA 4N1AA 4CMHA 1LW6E 2HUNA 1KMMA 2VJLA 4E31A 4DHWA 4E4RA 1RYFA 1DX9A 1YCHA 1O5IA 2VDVE 2G9NA 3ONNA 1X38A 1UC9A 4QSHA 3P9CA 1CE8A 4BE9A 2AC4A 2DC1A 2QTRA 5JJIA 9LDBA 1T5DX 3BS4A 3HFGA 4OUDA 3IKLA 1NFRA 1E7QA 1U11A 2QP3A 3UHOA 4F4FA 1VLLA 2QD3A 1QO7A 3HACA 3VOSA 1V5EA 3IT2A 1JI0A 1C1XB 1NN0A 4OL9A 5G0TA 4EI9A 2Q8QA 5JPDA 4WFQA 1RRFA 2ERXA 4LHEA 3KELA 2E85A 4B31A 1WZ2A 1WW3A 4R4JA 2GZ2A 4GIBA 1DOZA 1KOFA 1L5YA 3O8OA 1QHXA 2J48A 4JGBA 4LQLA 4WQMA 3Q2KA 4R0NA 5U1PA 1QG0A 5CBPA 5ALZA 3GA0A 1MPXA 2YY7A 1H4VB 5EQTA 1QS0A 3WQQA 4BX0A 2QX4A 3OWOA 5KWVA 5A62A 3N86A 5CA0A 3SF8A 3TX2A 3O73A 3EPKA 4DFDA 4HH4A 4MRNA 2C5GA 2XCOA 1Q20A 1O6BA 2QM8A 4KNYA 4BX8A 4C43A 4IHAA 1TZBA 4YRCA 1DQZA 4GZ3A 5AVKA 2WIKA 3DBLB 3OX2A 1ZR2A 2BMWA 2FNAA 5F2KA 4BHTA 4ZVPA 4HEA1 5DGXA 4LE1A 5KAMA 1DEXA 2X0KA 4BIIA 4C22A 1Q74A 5HA5A 4OHZA 1NJ5A 2F1RA 3BM5A 3H05A 3Q7RA 3QUQA 4JLDA 5LFAA 2BP7A 1R9JA 3QMVA 4HUQA 4IG4A 4MGYR 3H8WA 2ID4A 1F0KA 3VPHA 3ROFA 3SMQA 1J25A 3GCZA 1ZX1A 2CW5A 2EP5A 4IGIA 1YDWA 3IUQA 4GI5A 4CKCA 4D96A 4ACBA 4B2YA 1VFPA 3OJCA 3WGYA 1WTAA 4X41A 3UB4A 3JSXA 4I5IA 1TKAA 1RYNA 2J3MA 5CDFA 3UMSA 3ZDZB 1UP6A 1CUAA 2COUA 2WVAA 1E4EA 2WFLA 3DZDA 1YZVA 3PT9A 3RASA 3RWOA 2ZUCA 3UV3A 1OVMA 2BMDA 1GRVA 1YULA 2NXWA 2XE8A 3DTVA 4PANA 2CDCA 2WTNA 4JT9A 2FQYA 3ZWXA 3BD8A 4M7WA 5A6VA 1EUCB 4B17A 2QVXX 1KY3A 5J1SB 5LBUA 2ZG6A 1K6EA 3TOXA 4G4SO 1K6JA 4R98A 1MJNA 5IM5A 1Z36A 2HMAA 1E2NA 3HDHA 3G7SA 5F1KA 1YCDA 4LMRA 3PSAA 1CRZA 1PV1A 2HLNA 2ODTX 1FNDA 1VSUA 8LDHA 2CL0X 1YL5A 3GPCA 3MJEA 6AT1A 2GM9A 2C82A 2EIXA 2P5UA 1I2ZA 1HYGA 4N47A 1RM4A 1IEWA 1MQ9A 2GUGA 3BMNA 2PSEA 4QNMA 1WWKA 4J94A 3S2YA 1B0ZA 2IIPA 4H1WA 1PO7A 1Y89A 1Z5WA 1WXXA 1T0UA 4IIUA 4GX1A 5GOTA 3TWOA 2C31A 5THQA 1V11A 4OJKA 3NUGA 2VAVA 5T5QA 5JUWA 2NSLA 3O2JA 2X77A 2XWJI 3TDKA 3IP1A 3HN2A 4XFDA 1HOTA 3MWFA 1VP9A 4RK4A 1R0BA 5G0UA 3EXEB 2A86A 3R3XA 4M22A 2AN5A 1VCHA 4GPTA 1GQSA 1H2XA 3TAHA 4X93A 4PSVA 3OTOB 3Q9LA 1WDTA 1Y33E 1LNZA 2BEVB 2RHJA 3VDMA 1LPNA 2JIZD 1Z7YA 2F4NA 5C8YB 1SUFA 5AI8A 3H3FA 2OCGA 3BYZA 4MVJM 4PC6A 4WFKA 2OE2A 1AY0A 4Y9RA 4JFAA 3BTOA 5FBRB 4K0RA 3V8EA 1M7BA 2JI6A 4R2HA 4X1IA 3ZY6A 4HLDA 1XXLA 1P4RA 1Y80A 1CIPA 3A6DA 3IE0A 4PGAA 5LZ5A 4YCSA 4ZN6A 4ZMRA 5L7TA 5AQ1A 1ZK4A 3UPTA 1L5HB 2EKDA 3KZ1E 4TKUB 1PDWA 2RKOA 1ND5A 1U0FA 1B76A 2GPBA 3GJRA 5CT6A 3SF0A 4TWJA 1C80A 2AGVA 1GVNB 3W9BA 5BWNA 1XWIA 2I3AA 4GMXA 3ROXA 3TFOA 2W2XA 2H9YA 2RHHA 4YP1A 3ORRA 1UBMS 4IDAA 1RC8A 3PGKA 5ITZB 3QU7A 4AD8A 1O5TA 5E1DA 3KJNA 3MLAA 3AWDA 4O4IB 4PXAA 3WLJA 4P0QB 1NSYA 4LF6B 3WLSA 4UUNA 1JFTA 3HBMA 4KR2A 4XDHA 4HS9A 3UAWA 1MA0A 2FRXA 5JYBA 4V0MA 2X23A 2Q2QA 3TEJA 1LSUA 5HG0A 2OORA 2Q1WA 1FFDA 4OAPA 4D5EA 1BHSA 4NDNE 2XYRA 4PWZA 3OPYA 2V9PA 3NJ8A 1G5HA 4POOA 4HPJB 3GT3A 3SM3A 3WNBA 1SCIA 2VG8A 1UANA 3UWDA 4FYJA 5AHXA 5DHPA 5E1BA 1ID8A 1L2TA 1JG7A 1UBLS 2NZWA 2P0AA 2YL2A 4LF4B 1Z2EA 2H1SA 2XQVA 3T0IA 1EK5A 2P2SA 1I30A 4QRHA 2JLYA 4O8CA 3MMZA 3IGFA 2VOJA 5IKXA 2NO4A 4BU0A 3IUBA 4AQYB 1XNJA 1UFKA 4LXUA 3WADA 4TS4A 3LOUA 4WK6A 1AGPA 5I7UA 2EV9A 4EW1A 2BFFA 2O1XA 1C1DA 2HPZA 4CDNA 2LKCA 2P2YA 3H9QA 4RGVA 3X2SA 5JAPA 1BSVA 4ER5A 3F73A 4YRJA 4F3YA 1N2CA 1X7WB 4JJZA 1DPFA 5CFOA 3UUEA 4B74A 4ENTA 2DFVA 3BMCA 4PC7A 4TZ0A 2O3UA 1VLVA 4P7KA 1L4LA 4GBGA 3GG9A 1CIJA 1XN4A 2OBXA 4KE7A 1Y1TA 1J9ZA 3C7KA 4KLAA 5BQFA 1RYZA 4WZ6A 1YACA 4YJHA 1U1GA 3IAS1 1WG8A 2NTYC 3DVAB 3U19A 3N2NA 3WJ1A 1IM8A 1Q1NA 2A4KA 4WCVA 4X85A 2XMGA 2GF9A 2H1FA 3CH7A 1Q0TA 1V9SA 2P9FA 2NLOA 2ZB2A 4B4VA 1LV8A 4OJMX 4HJRA 3A6KA 2G25A 3GOQA 2EG9A 3GLFE 1CFJA 1K3TA 3DVQX 4QVGA 4QT0A 2E3JA 2O3TA 2YVKA 3HO6A 4IOKA 4LWOA 4NBWA 5FKJA 1DI0A 2IOQA 1Y5NA 3O9ZA 5DNWA 3CR8A 4GPBA 4QA9A 3Q9UA 2IYVA 1E1QD 2W2KA 4MUEA 4P86A 4F4JA 4GKJB 1LWOA 3PXEA 3PVZA 1W59A 3NT5A 4EX6A 1GLVA 3PEEA 5DPMA 5LP6C 2H7YA 1FRFS 1WRBA 4DR2B 4X97A 3DA8A 4OXQA 4DR6B 1I5OA 2BGLA 1IH8A 5AJHA 3UKOA 4DDVA 1IONA 2NV6A 3HFJA 3PFWO 3NHYA 1VHDA 1J0CA 2IWHA 4O25A 3NYRA 2AG1A 1AU9A 5REQB 1YRHA 4NICA 4AMZA 3E7DA 4LGCA 1GGMA 4OGGA 5COAA 5FJIA 4IJUA 5JZSA 1THGA 1WULS 3GEHA 3VUEA 4LF8B 4LA4A 4TWBA 2GB4A 2ID8A 4ZDIA 2ZRHA 2EWVA 1BJRE 2MSEB 4R5HA 2ZSJA 3JPYA 2IIVA 4UNPA 3HKDA 5AESA 1AA6A 1ZD5A 4NHOA 3LA8A 4H60A 3SYNA 1AD2A 2O0JA 4QEKA 4NCNA 1JW9B 3SSNA 1KS2A 3B1VA 1HNXB 5KNLA 5IKEA 1CF9A 1KK1A 2QN1A 2CV1A 2G63A 3PK0A 1D4OA 2F9MA 1MW9X 4RV4A 4TRRA 3EQ7A 4P35A 3QSGA 2DFKB 1QH0A 1Y5IA 3SS8A 3T4EA 5IABA 1A9ZA 3CIFA 4EHIA 3A4LA 2QT1A 3HHEA 5A9SA 2FMTA 1L7OA 2X3UA 4KO3S 1QVVA 1SBZA 4KXLA 3SR0A 5FWYB 1NW4A 2VRWA 5ERGB 4K9KA 5B30A 2V3WA 2HWKA 3ITEA 5FPPA 5C3UA 2CJXA 2CV2A 1U2PA 4DA7A 4DR4B 4EGFA 1KI4A 2MTBA 4BMPB 2IXAA 3BIXA 1Y6GA 3OLZA 5KOHB 3H11A 3C85A 2NU9A 4BBJA 4CV0A 2AXNA 5KOJA 3L6DA 2KHZA 3E3LA 2C0CA 5DSTA 3I12A 2EEPA 4RTJA 1PR0A 2B37A 4EY7A 1EMDA 3EFOB 1U0GA 4YRLA 1DXHA 3M9XA 2J5KA 3KQTA 1EJBA 3ZG6A 2PS3A 4KE8A 2BHTA 1OH7A 4ABTA 5EPOA 4CT4B 5FUVA 3LNCA 4NFYA 2FSSA 4KIFA 1KR5A 1YZFA 3GUVA 3RVLA 3TLEA 4BO3A 4D6PA 1MZPA 1M7HA 5K8LA 1X1TA 4ZAFA 1FNNA 2RGRA 1UXOA 2V9CA 4ZGGA 5TPWB 1RCTE 1DO8A 3AW8A 3BMOA 1NBOA 3KAPA 1U7TA 1NJFA 1ZXBA 2W2PA 3CE9A 3CEJA 3LW7A 1VGRA 4AECA 1W48A 1VPTA 2CJYA 4ENRA 1YAJA 1KMNA 5K45A 3NCHA 2PVPA 3FMIA 5E2BA 4F5DA 2O5CA 1YQXA 2V0NA 5H16A 3HDYA 5FL7D 2H00A 4LJLA 4D9HA 4ZANA 4LDPA 3U3DA 5LP6B 2WYUA 2G1JA 2J7KA 3KXKA 3MEQA 5CTJA 3FOEC 4BN5A 1LA2A 2H2AA 2CHFA 2WT9A 2YVUA 4XDZA 3PC6A 2IY9A 4DR7B 2YJNA 5DM60 1A2QA 1ST3A 3L1VA 4OYLA 4OXKA 4NMXB 5F1PA 4NS4A 2FDCA 1M7GA 5G1PA 4XH9B 3ZPXA 5A9TA 4EA7A 4W5TA 1U8ZA 2FW9A 2HK8A 4RYLA 1SZPA 1VHJA 2E0IA 2ATXA 4TVOA 1NNI1 5CLQA 4QTYA 4D42A 3JQDA 3G2QA 5HYVA 1U5BB 1SK8A 4RZIA 3GMDA 4Z9AA 4YWHA 2LRHA 2ON6A 3CUTA 3K7EA 2GOYA 3HO8A 3KX2A 5KINB 5KYGA 3FWKA 5KO2A 1NU8A 2QXUA 3HB1A 3LWDA 4LSGA 5CB8A 2ZBGA 1OH5A 3B6IA 3NAZA 4M6WB 4B75A 1F0PA 2FHSA 3QWIA 1RXSA 4MK4A 2HWXA 5G4KA 2H07A 3ZWQA 5AW4A 1AO0A 2WC1A 3PBKA 4S04A 5LQNA 4G26A 4U5QA 2GDJA 3JU3A 1C9YA 1JDTA 2QF7A 4L75A 3ENNA 3TTXA 2FSHA 4ZYZA 4IQ8A 3H2HA 5BNFA 3ORFA 2ZRNA 3UJDA 5C2JB 4F92B 3ESAA 3LXMA 3GEMA 3MCTA 3D8BA 8ABPA 3MIIA 4BUZA 4FYVA 1MEJA 5ENVA 4ZU6X 2PMBA 4I2NA 3QKSA 1IK4A 2JBAB 2BGGA 2G4VA 2VRCA 2GX6A 3TW6A 4D25A 1HFEL 2FGKA 4N3NA 1F0YA 4NATA 3BSSA 3QYJA 1NP7A 2GSDA 2JFFA 2Y6VA 1OHHA 4DA0A 2OM2A 4WOJA 1JTFA 2PLNA 2QLFA 5F3WB 3G0DA 1X1EA 4HRXA 1R5OA 1YDEA 4UMFA 2P65A 1D7OA 3DB2A 3SY8A 1D1SA 1TM4E 3D6JA 5CIWA 2DETA 4JP3A 4YRRA 1N5OX 1XNRB 3AVUA 3DV0B 4Y6SA 1Q3HA 4QOSA 4DMHA 1CHNA 1OAKA 4N6NA 4Z54A 1ZMTA 3LQ4A 2W2NA 3L93A 2JCGA 1W8DA 2D06A 5BVHB 1E3DA 4OF4A 4OM7A 2JI8A 4U00A 3ZQ6A 3CUSA 1E1KA 4OOEA 2VJYA 3KQPA 4RK7A 1OH6A 1XJWA 2WAMA 4BCBA 1A96A 1L0BA 2ZKIA 4ETWA 3OZFA 2GNPA 5JISA 2JJQA 1G2QA 1TCAA 2JAHA 1MG0A 2FWNA 4MWBA 4PF1A 4UBLA 5DNYB 2D5LA 4CTOA 2GM3A 1DCKA 4UCQA 3OZTA 4EY3A 1RC1A 2Q3EA 1NJSA 4EYEA 2NUPA 4G2NA 4BFSA 3RS0A 1TDJA 2PY6A 4F4CA 1JAHA 3D4OA 4WX2B 3EVGA 3S2EA 2YICA 3A9SA 4LY6A 3LPMA 3T1OA 2QJFA 2G77B 3QEAZ 1SZJG 4P8RA 2QAGC 3KAJA 2SBTA 2RHWA 1C4WA 3OZIA 2J6IA 2FQWA 4K87A 2D2FA 2HF2A 1AB5A 1KO5A 2B4QA 5I5GA 4YMIA 5SY6A 4BMVA 4EJSC 4HH3C 2B1IA 5AVOA 1G8MA 2HMVA 2IITA 3L9XA 2WSMA 3I9V1 2XITA 4IDDA 4IJ5A 3PDUA 1H94A 2Q2WA 4FEAA 4R8RA 1X7ZA 1FP4B 1TXGA 3ZYZA 3RVBA 3E2MA 5AVSA 2D1FA 5JW6A 4HNVA 3JZIA 4X45A 1W1UA 2IA5A 2PD4A 1VJRA 2ASEA 2WAYA 4NBKA 3I1YA 5DK4A 1KDVA 3ZZNA 4AC9A 4BFTA 4CM8B 5JNUA 16PKA 1Y6JA 1JLLB 3Q0IA 3UTDA 1GKLA 4G8BA 2ZUTA 1GTSA 3RBXA 2ZU0C 3C3CA 3PZRA 5KYXA 4BRZA 3Q4GA 5DNVA 3GR6A 1BE8A 1Z0AA 2OOKA 1T8RA 3TMKA 1F4VA 3FGNA 1E9RA 4NHEA 3NP7A 1U9ZA 2JD1A 1P80A 1JN0A 5TARA 2IOYA 4GSYA 3SIPA 1CU1A 3KCQA 4Q3CA 5A71A 4EATA 4N5DA 2IX3A 3WL4A 5F52A 4QM7A 1MFZA 3COZA 4GGOA 1E1MA 3TLCA 2TMYA 3NDIA 3WB9A 4A92A 3BE4A 1ECJA 5LD2B 1RLIA 1DX4A 3QVSA 5C1BA 4QDJA 1UF9A 2GZ1A 2P41A 1FC0A 3BCRA 1T9BA 2FPPB 3OT5A 3PJGA 3RO7A 4QT4A 2DLCX 3ONWA 4NYMQ 2FPIA 2CMDA 4NZNA 1BDBA 3KTAB 4ZDWA 1YI1A 3N9IA 3TUZC 1LLFA 1TKRA 2IS4A 5IF9A 1KU6A 4YH1A 3TJMA 1EP3B 1ULTA 4DHEA 2CK3A 3T5BA 2DE0X 4M36A 1XAJA 1TRKA 2VJNA 1L4UA 4FOOA 4QGBA 3JQ7A 1VPVA 3I9NA 1AUVA 4KO2S 4ZQCB 1Y1LA 3HG7A 3UAZA 1T4DA 1DUVG 3JALB 3DO6A 3O8LA 5D7NA 3D3NA 3DEYX 3U4AA 4WOPA 3ZS9A 4RNDB 1PEKE 3ZIDA 1KWGA 2DPGA 1V37A 2IHBA 3EAQA 3KYCA 4NQZA 5AVZA 4MYUA 4JSTA 2JLQA 4FFLA 2DH6A 3QOFA 1TYDE 4QYWA 2AOXA 5K0LA 1Q2XA 3PUZA 4ZEMA 1TU0A 2ATVA 4N7JA 3ASUA 3GJZA 5FUWA 4Q18A 1N2IA 1ZRNA 3ZEIA 4WEOA 2BKXA 1KIMA 1UPCA 4FJ0A 4OJYA 3JWJA 5CTAA 2TMGA 4QXQA 5CB0A 1KIFA 2Z04A 5AM4A 3QEKA 1UQRA 4C7KA 4S12A 1H9AA 3FKSD 2QAGB 3Q85A 2Z4TA 3R2JA 4PS0A 3H2YA 3JR3A 4C4PA 4BNIA 1YQTA 3VJLA 3U5TA 3QLVA 1SHZA 4EBFA 2C4KA 3QX8A 4EJSB 3DWFA 4GWLA 5E8JA 3GZNB 2CBGA 3DKVA 4FGWA 1CETA 1VBKA 2PSFA 2P9TA 3T52A 4HQOA 3UFXB 1T1SA 1HM5A 1OFIA 5BRAA 5JECA 2IBTA 2O8VA 5EZYA 3SU8A 1UWCA 4BMOB 2X7HA 1PVDA 3DTYA 3IA2A 2GKGA 1U0RA 2RB4A 4FFNA 4V38A 4W9RA 3RKRA 4X84A 1NJ1A 1R2QA 2OBNA 2JIOA 3R7WA 4Y3UA 1Z25A 1C7RA 1TIPA 4EBBA 4KCGA 4LF5B 1LRKA 4ALJA 3ZLTA 1SXJC 1U90A 2HGSA 2YDYA 4PFJA 3WYNA 3EVNA 2AQIA 4GQAA 1ZZEA 4TV9B 4P82A 5DXAA 5EIWA 5FOXA 4Y0NA 1KEKA 4HXYA 3PD7A 3B7PA 3RK4A 4EKIA 5C7IO 3KOYA 4PSKA 5EHNA 1A5TA 3GRRA 3JZMA 4L5JA 4GZMA 3O03A 1Q83A 2WB4A 1L9XA 2R6HA 2QZ9A 4O33A 3GLUA 2VOEA 1VB5A 7ADHA 4LGYA 5BSEA 2O2YA 3QWHA 3GLFA 3CF4A 2DWCA 3MD0A 3T3EA 1DS6A 1UAYA 4FDLA 3PE4A 2Q3CA 4PCVA 1IVYA 3ROQA 4BB0A 1S3FA 3KFXA 2GJ8A 3DE6X 4NCHA 5A6SA 1OCEA 4FKZA 2VHXA 4D26A 1BVHA 4QPCA 4UAUA 1P7WA 2C9DA 2CZQA 2ZJYA 4BDTA 5AUNB 4B3SB 5ECWA 4F06A 4DILA 1CHDA 2ENUA 2PR2A 1E7RA 2HWUA 3ZQKA 1GZUA 1XTRA 3QELA 1M72A 4BGDA 3X1JA 1Q1GA 1R18A 2VS1A 4C21A 1DBPA 1RXUA 1RHRA 4U9IS 3VR3A 3FLEA 3DMHA 4BMCA 2A8YA 4Z86A 3EIWA 2B25A 2VUIB 1N77A 2GZHA 2DUJA 4KC0A 1BS2A 4R2IA 4D8XA 5EC8A 3HP1A 2O2EA 4F85A 1B6RA 4FK8A 2IPAB 3RRYA 4QGFA 1P1KA 2PXHA 3QKWA 4QRDA 4DQXA 2R1UA 4EHAA 3FKSA 1MOQA 2UKDA 5G40A 1C1YA 1GPJA 3PJDA 4I3GA 2P9YA 3OPNA 4YUZA 2XX3A 3OFNA 4XPZA 3RRZA 3L5OA 4FJ1A 5BUSA 2B36A 1ULAA 1YS7A 4YRSA 4MEAA 2PZLA 5CXQA 4UBOA 3NHMA 3KL2A 3HUUA 4WVFA 1Z18A 3C3YA 1Z7GA 4MRVA 2B83A 2GA9A 2IEGA 3PNPA 3RFXA 2BH2A 1WLSA 4PO3X 1ODCA 5IEBA 4IDPA 1QX3A 3KSZO 2YQZA 3FCYA 1DL5A 4KXUA 3SCZA 2B3TA 2HM7A 2Y92A 3G23A 1WXWA 3SZLA 3GWZA 1RI4A 3IYLW 1VL8A 2W98A 2JG3A 1JILA 3PXAA 3WGTA 2CF5A 3KTFA 4AVYA 2MT9A 2GJAA 3I0NA 2AHOA 4R51A 3B1WA 3CINA 4WLNA 4C7VA 1JE0A 1HYHA 3NB0A 2X6QA 1J8VA 4QWWA 1CEYA 2ZSHA 2XECA 2IXTA 3HJGA 4BP1A 5KTYA 2MOKA 1SC4A 3GH3A 3L8HA 2G5CA 1J39A 3CSSA 5BSKA 3GLGE 1TF7A 3FUTA 1JLHA 2EL7A 2XVMA 4CIDA 5IVIA 2VK2A 2P79A 1ZFNA 5E6SA 4F5YA 2QN6A 3DD1A 1GXSA 2XCIA 4KNWA 2X22A 1V47A 1Q44A 1XU7A 1QH1B 1X8XA 2C4VA 2F2TA 3G2OA 3QOXA 3I6MA 3ETGA 3H83A 2VLBA 1QYVA 5EUMA 2DWQA 3S44A 1W9MA 3OF2A 2I34A 3AV0B 4K40A 1BFDA 1SXJB 3M4ZA 1CJSA 1L4EA 4HQ6A 5INTA 4OH7A 3BHNA 2JGDB 3O6VA 2WZBA 2OGUA 3KTOA 5AD1A 1X86B 1NW8A 1TEXA 1HLPA 1UDBA 4OKSA 4B4OA 4H1TA 1SVSA 1CNFA 4NKRA 2E21A 3H5AA 5AJVB 3MN1A 1BJKA 1OTXA 3SXJA 1VE6A 1JSCA 2KLBA 1JEQA 3D0OA 2D62A 1RKQA 2OVBA 3FLBA 4NEHB 4G37A 1JNXX 3DOOA 4Q82A 2Q07A 1ZNYA 2GPJA 3GRAA 3K9HA 3O4JA 4Y0VA 1MX1A 4GMFA 2A0WA 1Y6ZA 2HD4A 4P3NA 4AMUA 2C7RA 3TNYA 4EG5A 5IFKA 2XV1A 2P9BA 5KSPA 3KKZA 3ZHVA 3D7SA 3W2TA 1RBYA 4F56A 5KEIA 5C52B 2GBLC 3OVMA 2ZP1A 1W36C 3TL2A 1Z5NA 5F2OA 3GXBA 5AI9A 3VU1A 4F96A 2UZ4A 5CYPA 3O26A 5KWIA 3UO8B 3EXIA 2WHXA 1SXHA 4IIGA 5AOAA 3FPJA 1Z2CA 3ZEAA 4EY5A 5MDHA 1NE7A 4LRUA 4Z0PA 2GVDC 4ZI5A 2YWXA 3SICE 2V98A 1QOPB 3ZCTA 1L1FA 1EQAA 3GG2A 4YIHA 5IJWA 2I6UA 2A59A 1J4AA 4BWVA 4LDRA 4LOAA 1HYBA 3BA6A 3HWX1 3BWCA 3VYVA 3B1JA 2ZTVA 4RULA 2C9OA 1PJ2A 3BK7A 4YJ3F 2P4QA 3HCEA 1DKNA 1BXGA 3F3YA 3OE5A 1GDHA 1VJDA 3I23A 4BVHA 9ABPA 4WY5A 5JANA 4AN4A 3QJ5A 3GJYA 4EVQA 1OXSC 3ZCUA 1ZBDA 1PT6A 2BTQA 1KY5A 5DGHA 4CNQA 1QYDA 2CLOB 5B58T 4A0GA 1JEYB 5AKJA 1JHUA 1V8OA 1UK6A 4XPIA 3BORA 4DUGA 2QG4A 3TRIA 2ECKA 4HEHA 2QMOA 5L9AA 5HPYB 2CJFA 1AKUA 3CEPB 1FYXA 1P81A 2ZJ8A 1GQRA 3LGXA 5HF6A 3THXB 1BEUB 2DMRA 2Q8NA 2ZWAA 3EULA 2Q3HA 4JZYA 4MSUA 1PJCA 3G8YA 5DTQA 5F78A 4N41A 1DBQA 1X1SA 4IV0A 3GK3A 4PFKA 3GF4A 4DJFC 2VJMA 3KG2A 4LZJA 3BVPA 4QU5A 2BHRA 2IELA 1N9GB 4RJ2A 1YRYE 5JASA 1TNDA 4L9RA 1Q14A 5KUTA 3SZRA 2NTVA 1WMDA 2VUTA 4I81A 2Q41A 3PJRA 4CBVA 1X70A 1ZD8A 2E55A 2RGBA 3NGMA 4E2ZA 4JJGA 4PQGA 3ND8A 1YZUA 5I9IA 3LZDA 2B92A 1F1BA 1JT9A 2BKVA 2QTNA 3NHBA 1L4FA 4KAFA 4KLCA 4NZMA 4IX1A 1IXRC 5JV5A 1VHLA 4L4UA 2F67A 4N5NA 1OX6A 5ICCA 2X15A 3DOIA 3SIXA 5BV0A 1FDTA 5L3QB 4KG7A 3L7JA 4WXHA 2K6GA 3C3MA 3IUSA 2DU8A 1TQDA 2X3FA 1JFRA 4IGEA 4XJTA 3MILA 2NN3C 1XHEA 3K16A 4K26A 5F5XA 5FOTA 1IQUA 3TW0A 2XYVA 5JCJD 2O2HA 2G4CA 4PY2A 4D0GA 1UEXC 1JG3A 2JD0A 1W5SA 4EF6A 2RI0A 1HDOA 2APJA 1T1RA 4HDRB 3A36A 3NGLA 4NFSA 5DX0A 2O5VA 4L76A 3S7TA 3ZI4A 1RHKA 3EDCA 2OB1A 2XXBA 2M6KA 3GRYA 3ZE1B 3PEVA 2F55A 1N0UA 1RQLA 2IVFA 1QIJA 2ZRQA 3EFEA 3FFBA 3SC3A 3ZE9A 1PLKA 5A3JA 4YCCA 3TLAA 2Z5VA 3H99A 2C04A 1NHWA 1RWQA 2RGYA 4DT1B 4E13A 4CIYA 4GEKA 5ARBA 1GRRA 1P6UA 3U3KA 3D4PA 1V25A 2YY6A 4M76B 3JQ9C 5IWCA 1JHDA 1TMOA 1YZQA 4U1RA 1Q0LA 1UJCA 5EQDA 4HAVA 3NIGB 4AJLA 3K5HA 4JC4A 1T13A 5JS2A 3PI7A 4L4YA 5ECGC 1XLUA 3NVMB 4ZI3A 3PKJA 1L7PA 2FEXA 2SNIE 1QO9A 4OX9B 3S8MA 4D3FA 1G9SA 2X13A 3COWA 4PE5B 4YAIA 1E0DA 1L7NA 3LQQA 5FI1B 2TRSB 3RVMA 3TGPA 2J0VA 1RTTA 3L92A 3THXA 4Y67A 5JYDA 2B21A 3IIEA 1WCWA 1QRRA 3HBAA 4UBKA 1LY1A 2PYZA 4Y0AA 2Y4NA 1EJ0A 4HQRA 1N5KA 4BC1A 5K0EA 3ENWA 4K9RA 2RBEA 3FZNA 3H3XA 3KWLA 2HA6A 2QPTA 4BVEA 4YDSA 1B16A 2GLUA 3IMCA 4LHWA 3WKAA 3LRXA 2PUCA 1J0XO 3IEXA 3DLCA 4P9NA 4KQ9A 1MIOB 1E1RD 2D8MA 1AKWA 2W4QA 3AK4A 4R8KA 3OM8A 3STWA 1XF9A 4DUPA 2IYZA 1YKFA 1YB4A 4QXRA 3SZOA 1Z6QA 3EGIA 3EG9A 4ME6A 4BX9A 1ILWA 4FYHA 2WWIA 5AXBA 2EFJA 2ZDQA 4GP6A 2O2JA 2BL4A 1KE1A 4F3RA 1CERA 2ZIXB 3GZTB 3NTLA 1UH5A 4JITA 5F4ZA 4IV5A 5JCJA 4MQMA 4WXPA 1U6JA 1GUFA 2YIVX 1QCDA 2B2CA 4MVCA 4RV5A 1JJBA 3GQBB 4WBNB 3FSEA 4KNVA 2HREA 5KNBH 4IJQA 3ND9A 2ZVQX 1KYYA 2FLWA 1UMBA 1RWMA 3GRKA 4RK0A 1QANA 3UQZA 4AZ0A 4KUGA 1DMSA 1MN6A 1W6UA 3AKEA 3JQ8A 2M6LA 4AROA 3F71A 3LIIA 3QF4B 4G5YA 4DV0B 5KPJA 4X00A 4XQCA 5AVUA 3UQYS 4D3YA 4EB8A 3DMRA 3WRXA 5IUNC 1BWSA 3LLSA 4OFBA 4K6HA 2O8FB 2WYHA 2QVYX 2YBDA 5IT9A 4UZFA 1W4RA 3CN7A 1RYHA 4KQ6A 1J2RA 4P3OA 4FEYA 4B40A 4I1UA 4CCAA 4Y2GA 2HI0A 3RK0A 5GVRA 2AVDA 2W8BB 2JATA 1G66A 3B13B 5AXAA 3ENZA 3G13A 1FLVA 1P7CA 3CZRA 3ZDFA 1R37A 1U8UA 3OEED 3K2EA 1GQFA 2XMDA 4CQJA 2R00A 2VP4A 1I13A 3GVHA 1ICEA 2DUMA 1RPZA 4BIMA 4DM3A 4UOEA 3CB2A 1H1DA 1RRPA 4YRGA 2QP4A 4FSXA 4DRYA 5L4NA 2H4ZA 4NVRA 3HCCA 5K3CA 2J67A 2R68A 2J9FB 2ZIWB 2GO7A 4CW7A 3N1UA 2FPMA 3AT1A 4HYQA 4KV7A 2NPFA 1SCJA 2LDBA 3HDQA 2BAGA 3DYIA 1AKNA 1HGXA 3TZKA 3ELYA 2WJIA 3RVNA 2NSYA 3IP3A 2D7JA 4UAJA 1QZTA 5DYNA 1RXCA 4WFIA 1UFVA 1E1RA 2FPUA 1SVUA 1R9MA 1O5OA 1MMFB 3DPIA 5E2AA 2BGKA 4DLUA 4E5NA 4J7AA 4JWTA 1NYQA 2NUAA 1OI7A 2Z2ZA 3FPSA 5FX2A 4A6DA 5KSYA 2LV8A 3AJAA 1Q3TA 3H2BA 4KYUA 2J0UA 4NU8X 3B6MA 4G07A 4I0WB 2PUVA 5C7OO 4MMZB 4A26A 1KAOA 3F5FA 1Z88A 3O8CA 1ZJ4A 4M2LA 1BDMA 2FN9A 1NZDA 1JQKA 1Y8QB 3KFVA 3MF4A 2DFPA 3MPOA 4N3GA 4YCBA 1CQJA 1ZJYA 3M6LA 4WCFC 4CV3A 3ZJUA 5KDDA 1GPWB 3M6UA 4K1LA 4R9RA 4IIFA 2BFBA 4N54A 1N6HA 4R8VA 5ALPA 4C6RA 1Z3CA 2Q5HA 2HGZA 3WDMA 1IVSA 4G0NA 5AM5A 5KYUA 4YGYA 3C6ZA 8MHTA 4KAJA 2ZRPA 3GT4A 2VKQA 3JYOA 3R3WA 5AW6A 3RJZA 3LIPA 2G1UA 5AJXA 4AS2A 1GTMA 5L4SA 3QKRB 1OC2A 4IRXA 1A7UA 1ZIYA 1GGHA 5IS2A 1BH2A 3DD5A 3PEFA 5E6RB 2XSZD 2ZSIA 1TW3A 4B6GA 2XXAA 1UDAA 4G36A 2FX2A 4KAAA 3OEEA 4ILKA 1Z0SA 3R5HA 2EAUA 3BXGA 3D4BA 4MYDA 4O4HB 4YIKA 1ISGA 1Y9DA 1EGAA 3REQA 2DHCA 3HRHA 4LWQA 2ZANA 3G5UA 4DQKA 3R5TA 1SXIA 4HX2A 3ITDA 5B1YA 4K9LA 1R15A 1RWPA 4OHVA 1E5DA 3WR5A 2W2LD 4YBRA 4KZPA 1DWPA 1G6Q1 2I6QA 2JRCA 4TSFA 1KDTA 2FF5A 2DG2A 4ISBA 3T4XA 3J81k 1F6DA 4NYJQ 1K5GA 2XWSA 3BXPA 4OBWA 3WNCA 1MAHA 2X4DA 1NATA 4NOJA 4N0MA 4N0QA 3WRYA 1PK9A 2KB0A 4FXPA 4H18A 3WLRA 1GU1A 4YRDA 4H6XA 3C3AA 4OH1A 1T3LA 2WM9B 4OAOA 4BBAA 3JTEA 4RUKA 1AKRA 2CLMB 3VNVA 2XIQA 4LJ5A 2R87A 2DSNA 4HG2A 1U0JA 3Q11A 4FQ7A 1OASA 4IOJA 5G02A 4XB2A 1Y3IA 1UKVY 1ZQ1A 3H87A 1GZSA 3L8FA 2VPWA 1LVHA 1GPDG 3G49A 3KB6A 2WTMA 5NULA 4J4HA 1FIUA 4LHVA 8ADHA 3GLGA 3KHUA 2I4TA 1XTVA 4M1OA 9GPBA 4IUDS 5JROA 4BV3A 3KQUA 4HFRA 3DYBA 4V0QA 1TUGA 4NJEA 3WBJA 1U0BB 1EJ2A 2PX3A 4MVYA 4YUYA 4ZIRA 2HJ9A 2ZUDA 3AUSA 4PLWA 4WACA 1R74A 4O29A 4P98A 3ZE8A 1CQIB 1K7YA 2R2AA 2G70A 4TMZA 1G4AE 1FFEA 4OQYA 3CY6A 5EIOA 4ESHA 1TW2A 5IC6A 1Z2NX 1G7SA 1PTJC 1TC2A 2C9YA 2CSUA 2HXSA 3R0VA 4IHJA 4NL4H 3RFFA 2IYQA 4PXSA 4CIXA 3U1TA 2JCVA 1AX9A 1TL7C 2ATEA 2RBGA 2KPOA 4H6VA 4UDOA 2X0EA 1QGED 4OBXA 3WGGA 4EOGA 1ZK1A 5A02A 3KUCA 1I3CA 2YZKA 1Q77A 5EXSA 3KQNA 4OYYA 3ZDAA 4KR6A 3KYDA 3PDIB 4N76A 4PAMA 3UJAA 4WCFB 4RIEA 1FMTA 2EQ5A 4ALIA 4OMDA 1TQ2A 1LCIA 1D4FA 1BXZA 1NP6A 2RHDA 2VDWB 3I1JA 5FNVA 1RQNA 1Q5PA 1FFAA 1LH0A 3Q72A 4TL7A 2H4HA 2AYYA 2O06A 2OXFA 1KPHA 4ABYA 4HOYA 5FUXA 3ZWCA 1JH9A 5HBRA 2I1WA 3SJUA 3AONB 2P1RA 3OEYA 4YAUA 3UMYA 4YWJA 3L4BA 2W2LA 4MIEA 5CX4A 2DKNA 4FWBA 2NXJA 5IJ0A 4QDUA 1LJUA 2NUBA 5G0VA 1U28C 5TC4A 1Y8CA 3KYIB 1OLUB 3VU8A 1HTBA 3ROKA 5AKEA 3LDFA 3DUWA 1HT0A 2JIPA 5CT5A 2XJ9A 5EG5A 5SYMA 3WXBA 2P68A 3H2IA 3UY4A 3ZJYA 5A2GA 5C53B 4AY6A 3TOZA 1U80A 3A7DA 3P8ZA 4CUJA 3BXEA 1O95C 1VIYA 3HP7A 1W47A 3DKIA 3IOBA 3MS4A 1WZIA 4B8WA 3PC7A 2V74B 3SC2A 4ZT4A 4MDHA 4LFCB 2F48A 4MR8A 3VO2A 2G17A 2PYIA 1HXHA 3JCZA 3W6PA 4FB5A 4BFUA 4EPRA 2VYND 3WFJA 1V41E 1XMQB 2PD3A 4INAA 5DHAA 1BCSA 2XTMA 4POAA 3RIGA 1X2BA 3VMMA 4KU4A 3AINA 4I50A 3C74A 2RH9B 2ZBEA 1CBUA 3AHIA 1AV7A 4RZSA 5DE3A 4YV0A 3HYNA 1RAAA 1K7EB 3OHSX 4CMCA 4Y30A 1QIMA 4Z1MA 1CB0A 3RUFA 5KTPA 3LXXA 1L5LA 4FYWA 3WV5A 5CB4F 4DPMA 2AEFA 2X8JB 2JZCA 5EEGA 1DKQA 4NS1A 3Q40A 3N2KA 1U9IA 5IUJC 1QTNA 1SUIA 3U7RA 1E9SA 1YQEA 3IIMA 1A9TA 2ZSDA 4J2OA 4LI0A 4UM7A 1N0WA 4P93A 3S29A 3X43A 1E4YA 2ZE6A 1C9JA 1N25A 2OK7A 2WKPA 3NH9A 3B3GA 1GN9A 2IUUA 2OV8A 2Q0HA 4UAVA 4R8LA 5JCXA 3FMFA 2P5SA 3ILHA 4GKAA 4HLUC 2C3UA 2WF6A 1PHPA 2AF4C 2EX1A 2JW5A 4H7HA 4MMYB 2ZYTX 2JKYA 3TTSA 1IWOA 1VCMA 1ZCJA 4GD3Q 3QVUA 4CQMD 5J63A 4OJQA 221PA 3HQ4O 4FILA 2NSJA 4E5MA 4RELA 1SBNE 821PA 3FMOB 3M5WA 1AS3A 1XLWA 2CXHA 1YRBA 3R3SA 5DGCA 4RHEA 2DHRA 3FRIA 3KQMA 1ZH4A 3DW3X 1NQUA 4JC5A 4UNNA 4YBZA 3I30X 4UUOA 3JVEA 5JS6A 2B1JA 2GBPA 5IBPA 2IY8A 4XZ3A 3RIHA 1XDSA 3KUKA 1KBQA 2JIRA 2FPRA 3BBPA 1SCUA 3VZSA 5P21A 4LAFA 3TE7A 1Y81A 2VYVA 1BVUA 3EH2A 1J06A 4B4DA 3O38A 4C06A 1BMFA 2O8EB 5CFPA 3IH5A 1P91A 4PRZA 3RLIA 1SCDA 1DBSA 1LW7A 2H1RA 3OZWA 2AHRA 4H6WA 3C4QA 3CE6A 1XZ8A 2FJUA 2YOHA 3WIOA 1LQ2A 2B2NA 1KI9A 1WHSA 2FQQA 3ACDA 3EZ2A 3GCXA 3PXXA 4K6OA 3TR6A 2JJ2A 5JS1A 1QAMA 1YUNA 3H2ZA 4TM8A 3BWMA 3MB8A 4IDEA 1HF3A 1VPEA 4CL8A 1H1TA 1VDZA 1Y8RA 3ST7A 1FMFA 4H35A 3SQOA 4J3FA 5E8RA 2EFHB 3BGIA 1JDNA 2Y1KA 3LUPA 5GY7A 1O08A 3IQWA 4TVBA 2ZAMA 3OJXA 4AO7A 2X9LA 3IXMA 4LVOA 1YB7A 3VGJA 3KEGA 2Y99A 4X8OA 2ET6A 1HDGO 4RQBA 3AVPA 5L45A 1PBNA 1P31A 3DHVA 3MJDA 4C4ZA 3FAZA 1SUSA 4PC2A 1Z5UA 2PFSA 4YPFA 3UA3A 2VZ8A 3OD1A 1ZIOA 3P2MA 2R96A 3W7VA 3I9JA 4ZQFA 3DT9A 1IBSA 3JVIA 2Z4SA 3MBKA 3UOGA 2QRQA 5JDIA 4O4LB 3NOXA 4U2EA 1XE3A 4IDBA 2HR1A 2QMQA 3OPQA 4IYJA 3WTBA 1WL8A 1XI2A 4RFLA 1L1RA 2ZJ4A 3AU9A 4PO9A 3RVRA 5E6UA 3IE1A 1P0CA 1G16A 2BONA 4LVNA 2ONYA 3PGJA 5IAEA 1QIDA 3IX7A 1YQQA 2C9ZA 4KIJA 1REQA 1YXMA 2NT4A 3AUJB 4X60A 3DBOB 2JB9A 3IQFA 1VG1A 4FIZA 5EXDA 4JEHA 3THOA 5C37A 5KNBD 4RGBA 5ALKA 4V0LA 1ZIDA 2PMWB 3K0CA 2Z57A 4HVAA 4LXXA 5FT9A 5HJ2A 3U7HB 2ZK7A 5K01A 3NHKA 3OOHA 5H5JA 3VTAA 3W78A 3ZZMA 1MAAA 3AY0A 4CQLB 4RZXA 4DA8A 2YS7A 2YZ7A 5JMWA 4B81A 4D9CA 1JAXA 2CBXA 4KYVA 3VVLA 2C8VA 3JAKA 2P67A 1EFCA 2LW7A 2Y0DA 3DC2A 1P4GA 3IP8A 4G41A 1D3AA 1WCXA 3JRNA 3PC2A 5KI6A 3K9NA 3IL2A 3CRVA 2WOJA 3WDSA 1IXZA 3BXOA 1C41A 1YZYA 3LA6A 1KEEB 5LLDA 2AI3A 4J0QA 4FFBA