1OBOA

W57l flavodoxin from anabaena
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
AKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTLNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLAVODOXIN
publication title How Fmn Binds to Anabaena Apoflavodoxin: A Hydrophobic Encounter at an Open Binding Site
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Electron transfer
total genus 59
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oboA00
1DX9A 1H66A 3OX3A 1QBGA 3QFCA 2MOKA 2QWXA 4R81A 4J8PA 1WSBA 2MWMA 3NHYA 1D04A 2D5IA 1D4AA 4XDHA 5LMCA 4YALA 2HNAA 1BVYF 1RCFA 1CZKA 4ZVMA 4PU0A 3ZHOA 5EAIA 4C14A 3FVWA 3O2NA 4C76A 2R96A 2HNBA 3W7AA 1NNI1 4N82A 2QR2A 3TE7A 2ZKIA 3NHRA 5A4KA 1C7FA 1GG5A 1C7EA 2OHIA 1T0IA 4H6PA 4ICIA 5B3KA 3W78A 2M6RA 1AZLA 3NHLA 2BPOA 3B6JA 2BN4A 1OFVA 3NLLA 3ES9A 2N1MA 2FOXA 2FVXA 3NHPA 5TGZA 1RLIA 3FJOA 4ZVNA 1CZOA 3U7RA 3P0RA 1FTGA 4FX2A 1AKQA 3W77A 3F2VA 1AKRA 1FUEA 1CZNA 2KLBA 5LJIA 4Y9UA 3EYWA 1ZWLA 3NHWA 3NHJA 2QX8A 4LA4A 3O73A 4HEQA 4PTZA 2AMJA 4YAWA 4QOEA 3NFRA 3GFQA 1B1CA 2FCRA 3OJWA 1FX1A 1XYYA 3NHUA 3B6IA 5LBUA 5NLLA 1ZWKA 4DILA 1XI2A 4QOJA 4DIKA 3N39C 2HPVA 3NHSA 3B6MA 3UXEA 1QHEA 2KQUA 3HLYA 1CZRA 1V4BA 5FUQA 5B3LA 5LJLA 4Y7CA 4M0CA 3OJXA 5ULLA 2MT9A 1J9EA 3OX1A 4H2DA 5EMNA 3OWXA 2QX4A 2BMVA 3L9WA 2QX6A 1YCGA 3B6KA 3OVMA 1KBOA 2OHHA 1JA0A 1J9ZA 4ZVKA 1SQSA 3KAQA 3D7NA 1OBVA 1E5DA 1F4PA 4LTMA 1AHNA 4F8YA 2X2PA 2X2OA 2FZVA 1OBOA 4CF6A 3NHKA 3L9XA 4DY4A 2XOEA 5FX2A 2WC1A 3FNIA 3GFSA 1RTTA 4D02A 1YCFA 1FLAA 3GFRA 1YKGA 2M6SA 2GSWA 1BU5A 3LCMA 2ARKA 2QX9A 2XODA 1QR2A 2F1OA 3OWHA 1FLNA 2Z9DA 4XDGA 3ESZA 1AKUA 2BF4A 1AG9A 2V5VA 2Q9UA 1RLJA 4FGJA 1XT6A 3K20A 4LTNA 3RPEA 1YRHA 3ESYA 3QFRA 2Q62A 5NULA 1CZLA 4U7FA 3K1YA 4HS4A 1AMOA 4BMPB 6NULA 1XYVA 4CETA 1FLDA 3F6RA 3SVLA 5F51A 5LLDA 2Z9CA 2FDXA 2Z98A 2V5UA 4QODA 3TZBA 4FGKA 2R97A 1X77A 3GAMA 5EA2A 2W5UA 1ZX1A 4C0XA 2FX2A 4Y9RA 1AKTA 3KEGA 1QRDA 1CZHA 4NULA 3OX2A 5LBTA 1I1OA 4NLLA 4ESEA 1JA1A 2B3DA 4YQEA 4LAFA 4U7HA 4N9QA 3FX2A 1CZUA 2V9CA 4QOFA 3QE2A 4BMOB 4PTYA 1SG0A 3TEMA 3JSXA 1AKWA 5F4BA 5JROA 1J8QA 3N3AC 4LTDA 3U7IA 4FGLA 5LVAA 4GR9A 1TLLA 4YAOA 5FA6A 2OYSA 1J9GA 4YAFA 5BUCA 2FAXA 3NHFA 2FLVA 3S2YA 4ZVLA 4GI5A 4YAUA 4GQIA 1FLVA 2Z9BA 3FW1A 1YOBA 1YDGA 3UXHA 1WSWA 4S24A 3LT5A 3R6WA 2MTBA 5F12A 1D03A 1VMEA 4N65A 1TIKA 1DXOA 3KLBA 3ESXA 3W79A 3KAPA 3HA2A 1T5BA 2BZSA 3G5MA 1DXQA 1KBQA 4QOIA 1YCHA 4OXXA 2A5LA 2QMYA 2QMZA 1H69A 3HR4A 4QOGA 3F90A 2RG1A 3F6SA 1AKVA 4C0WA 4U7GA 4QOHA 2OHJA 1FVXA 3EDOA 3N3BC 2FZ5A
chains in the Genus database with same CATH superfamily
1RQLA 1LI5A 1H66A 1YDMA 2DAPA 1SUEA 3OP1A 4JP3A 4OHMA 7YASA 2IGBA 4WLFA 3ZDRA 1PVDA 3KVOA 5D87A 5LQMA 1PZEA 4C04A 2C9BA 3PEFA 4ZCSA 5B55A 2AN5A 1JG2A 3UNXA 2YDYA 3QFCA 4ABYA 2OXRA 1HRDA 2AW3A 1C0KA 1VXRA 3QLEA 4HWGA 1VECA 1E3IA 2EZUA 4MB2A 6LDHA 5K03A 2BSAA 2VG8A 1IDN1 1KIAA 1T3SA 2FSHA 3HCCA 2R1TA 5JATA 1CUWA 5JJKA 1TUEA 3ODPA 4ZYXA 1E7QA 1QDUA 3QIAA 1JR4A 2C5SA 2QG6A 4MUAA 4XDHA 3RKUA 5IJ0B 3IIJA 5HKAA 2IYNA 3TQRA 1V9SA 3CM0A 3OQIB 1FS4A 2L18A 2ENWA 2WD8A 4CFSA 2PANA 1HT0A 3H4IA 3R5HA 4NV3A 4UFOA 2BFOA 3KHSA 3E84A 4GC5A 1XN1A 3QLTA 3KJEA 4KCGA 4URWR 5JSQA 2ATIA 2R96A 3HP4A 2IUFA 2BEKA 4W7SA 3V8BA 3GLHE 3RM3A 2V74B 4CU2A 5B3AA 3E4CA 4YX9A 1HFKA 3HRKA 2I8CA 4ZYYA 1UJNA 4D8UA 2PSHA 3T38A 1Q1QA 4ZGGA 4JN6B 3ENQA 1FQKA 4G09A 2YUIA 3KXLA 3WSTA 5L95A 1CS0B 3EUWA 3LUHA 2DECA 4KBFA 4JAVC 4WW0A 5KIAA 4BNFA 2Y6UA 4RA6A 3ZE6A 4AMZA 3GW8A 3OPVA 4RELA 2O0KA 3GAAA 3L1IA 3DBRA 4F06A 2X8JB 4BVJA 1LK0A 3HUEA 2I1LA 2QL5A 4KXMA 4AUNA 4Q9IA 2VSYA 3UJHA 1S2IA 3BWMA 4QBFA 1ODJA 3BQMB 4NCNA 3RVPA 3K2EA 4RNDB 1F6BA 2FRDC 2QL7A 3AHDA 1MOQA 1KNQA 2N1MA 1XD2B 1E5VA 1BDBA 2J9GA 1QOZA 2JCGA 3PCRB 4DSTA 5DN6D 2ZAIA 3O9MA 4EGFA 1V9LA 4NP6A 2IXTA 4I6JA 5AJWA 3TTVA 1R4NA 3I8XA 4U63A 3M3HA 4KO1S 5KO2A 2G04A 3TAUA 3DC2A 1MCZA 3ZWNA 4M54A 3DKRA 1CZOA 3T5MA 5C8XA 1BMTA 2HZBA 1FRZA 1KEUA 2I4MA 2OGSA 3I01A 2JAWA 4IRUB 4UUMA 2WFAA 2NLOA 3RS5A 4R05A 3EA4A 1UOQA 2W6JD 1USWA 4QSMA 2Z57A 2B5WA 4RV4A 2G1UA 4ID9A 3SDZA 1PL7A 2H4HA 2ZJ0A 1AKRA 2IF0A 3DC7A 4O4IB 1FFYA 3TQFA 2FLKA 3GO4A 1FSZA 4NYIQ 2BHLA 3JVEA 3GFBA 4ZOLF 5HIJA 4PX9A 5BQ5A 3AIKA 1E4OA 2X9VA 4IV5A 4CL3A 1DAGA 3F3MA 3UT5A 4BLRA 1PE0A 2C95A 1DTWB 1B26A 1N7JA 3BKWA 2DT5A 3CURA 1XQ1A 4L08A 4EELA 1PT7A 2DUUA 4LF4B 1Q16A 1YIOA 2J7PA 4BN4A 1EG2A 2QX8A 1RSZA 3IP3A 2DFPA 1KQGA 2EKPA 1EDBA 2NX2A 4BMCA 3PFFA 4WJKB 4EGAA 3Q0EA 4ETNA 3DLBA 1BW9A 1G5QA 3HWRA 4R9NA 2DEUA 1FSGA 1GUAA 2J31A 3BXPA 1A95A 2GX6A 2XKAA 4KXXA 1MC8A 1OILA 4BQFA 1N0IA 1UXGA 4RTLA 4Y6SA 2IXAA 1T8WA 4NABA 3ZU4A 4C06A 3CV3A 1OTYA 4RMIA 4YS6A 4TXNA 4GI1A 3SE7A 4P4GA 1JU4A 2D4AA 4A2PA 4F0JA 3LH5A 2EV9A 4M3NA 4I55A 1DO0A 1SB8A 1DQZA 3AOEC 3TZQA 3V34A 1TVKB 4RZQA 1Z06A 2ZSEA 1XDWA 3REOA 4UNIA 3RSSA 1T5IA 1LF0A 4URUR 4UXIA 2Y71A 3PWSA 5BUQA 2B1RA 1R9GA 3GZTB 1R4ZA 2RHWA 5J2UA 1A1VA 3QFTA 1TGYA 3B6IA 3UMSA 4HXEB 4AKEA 5JPCA 1KC3A 1L9XA 5KSOA 3W5JA 3E5RA 5IW8A 3G9XA 4X45A 4KVFA 3RU9A 1EP9A 3RVSA 3GBSA 2F55A 1GG8A 4YJ3F 1CUDA 4BB6A 2JEOA 1F8YA 2IYTA 3TNJA 2HA2A 1JQEA 3NETA 5ALMA 1CG6A 1CUCA 4KTTE 5CCBA 1V3TA 2HRRA 2OMKA 3HCPA 1IHDA 2AX3A 1AZSC 3C5EA 3RC3A 2I67A 3OM0A 1XOIA 1PR6A 2Y1OA 3TW4A 2RDMA 3ILYA 4Y7CA 2W4MA 1QSGA 5EQFA 3U09A 3SP1A 1BEUB 4ED9A 4F9TA 2BKAA 2Z83A 3QKUA 1PZFA 3PUVA 1RWKA 1R8SA 4JVSB 3PVCA 2G7ZA 1CUUA 3GPCA 4WNIA 4Y9TA 4CIDA 3VHRA 4FUTA 1P1HA 1VFPA 4FS8A 3LP8A 4KQ2A 1IXRC 4X7RA 4JHXA 3NHAA 4O4JF 3AV0B 2JGEA 3CLKA 3D0RA 3WSVA 2ZTLA 2ZSUA 3GLGB 4MRMA 4FYHA 2BEUA 1WPQA 3ML1A 4Y7DA 4KMMA 2CMKA 3IA2A 4HLDA 4E2WA 5JTTA 621PA 1FS5A 5CG2A 3P4XA 1J4AA 1Z4NA 2ID7A 5GJVC 2YJGA 4GZLA 3SS8A 2WM8A 1C41A 3TLMA 4XCQA 2CT8A 3V48A 1NVEA 4HQNA 4RKQA 1EZZA 3FBTA 4TXHA 2ZROA 1V8DA 4M38A 1QHXA 4F72A 1WZNA 3OC6A 1C9JA 3K9QO 1V26A 2JGJA 3RSQA 1H8HD 2DVMA 3HEBA 4AZTA 5KJCA 1CRPA 3BMQA 1T24A 2YWEA 1OY1A 4HHEA 2O2JA 2VNAA 3IC5A 3VV2A 4D3YA 1P9NA 2ZPAA 2X2OA 3QVGA 5CNMA 3TKLA 3DHYA 4X41A 1QX3A 2GN6A 2IYRA 4GP9A 4CF6A 5IABA 2AKEA 4GI3A 3DM9B 3NANA 3RS8A 3KC2A 4LECA 2PXCA 1Q7RA 2OK8A 5JHHB 1CVLA 2AFIE 3NBAA 3EAQA 4GE3A 3LFUA 3OQBA 4R7ZA 4AWBA 5BN5B 4DV1B 5A9RA 5IZCC 3D3NA 3RFUA 3LX5A 3U56A 4W6QA 4Q7MB 3VA7A 1ILEA 4MV8A 4BUZA 2IWRA 2ODEA 4D7AA 3OIWA 4MPPA 4FNOA 1L3BA 4MAMA 1CTQA 3U2QA 1F2UA 4U0KA 4JLOA 3AERB 3ME5A 1R74A 2M6SA 2HQSA 3PHLA 3A4VA 3RIHA 1QE3A 3MTJA 3QVJA 2FH5B 1EWVA 3LUBA 3JQAD 1RAEA 1RW4A 2RGAA 4ZXFA 4XM0A 4ASUD 1M2HA 2H2FA 3AR7A 5DOZA 5CDGA 2JJ8A 4RY2A 3ZJ4A 1TXGA 4Y2GA 4TWAA 1EQAA 2ODBA 1K86A 1APBA 1H8HA 4MSUA 3TKAA 1ZUNB 5K6AC 4UOEA 2JLZA 1IOLA 3SYNA 3A6HA 2I34A 1IU9A 1MQ8B 4WCVA 5EKSA 3WKDA 4DSUA 3GJRA 2MHCA 3OE7D 3RR2A 1GGVA 2EIHA 4LOAA 1NM5C 4D25A 4R3WA 1D2RA 2XCLA 1I36A 3SMQA 3EGCA 5TY0A 5FNVF 2XCRB 3A58B 4A0HA 4IHQA 5CNIA 1VGRA 1WDLA 3MD0A 4Q24A 3ESZA 3VDXA 4WVFA 4RD1A 2IYEA 2OCAA 4GR4A 4Z7QB 5K99A 1YXMA 2HM7A 4JA0A 4ZYTA 4JQYA 1XNRB 5LWQA 2VF8A 2JLCA 5UKDA 1E1LA 2AD1A 3I09A 6PFKA 4FT4A 1ADJA 4HWSA 5E3JA 1KYWA 2DPLA 1G8FA 1YS2X 2QRNA 3FMFA 5FIUA 1NVXQ 2PQ6A 4TTTS 4OK6A 3BCUA 1RPJA 3JQAA 3R3SA 3OTQA 1CZLA 2VHZA 5DSZA 3FYUB 4EB8A 1P0FA 1EFPA 3ZC3A 4YUWA 3E03A 4AJJA 5LQCA 4B3BA 3QPVA 2GD6A 4QLOA 1TQDA 4FZVA 1VJRA 3S5JA 2V4UA 1JG7A 3X1ZA 1RABA 2G5TA 2OQ2A 3B48A 4X8OA 1ONBA 5D6NA 5AHWA 4YA6A 3PPYA 3SVLA 4HB4A 3NM6B 1A8SA 2V6JA 1XA3A 3A6ZA 3AFIA 3KB8A 2A5YB 3MOIA 4P4SB 2CJWB 4XSHA 5G40A 5LIRA 3Q2KA 1X2BA 2YX1A 1R18A 4TN5A 3FDXA 2ZYUX 2O0LA 4RJKA 4DDKA 3A05A 2OBBA 4DCNA 4CW7A 3NW9A 5AW5A 1I1QB 2ACKA 1Z34A 2VDWA 1CJCA 3E23A 4ZC8A 3RUFA 5IKEA 2FMTA 1HQYE 4G63A 3ZI7A 3E9QA 4BIMA 4GOKA 2XEDA 4XR4A 1H5UA 5J9FA 5L7YA 2ILTA 3QSGA 4M9XA 5JADA 4U7PB 1XMPA 3KEOA 1EBBA 3EISA 2QTHA 5A62A 1DWPA 4GGPA 2Y0CA 2ZAGA 3TXAA 1XP8A 2CHUA 3OQJA 2W5UA 1VKNA 2OXTA 3ZCQA 4ONEA 3IKLA 3OU6A 4DCUA 1ZX1A 1UXOA 5C8YA 4AKIA 1UXKA 1KR5A 4C0XA 5BO5A 1B15A 3NIBA 1Q91A 2NV6A 3A6LA 2MJLA 2JEYA 2YFKA 4UASA 4I1IA 4B3GA 1IYZA 2JGDB 3EY9A 2YRXA 1FDIA 3ANTA 4CMCA 2ZYDA 4YIHA 2FJUA 2WHQA 5J4LA 2PFKA 4JC0A 2GK3A 1NKSA 4C6HA 3AU9A 4HRYA 1JA1A 4ZT3A 4ZTZB 3EQ8A 4GFDA 3VAZA 1TEXA 3QELB 2PXAA 5AW2A 4R5HA 4TMYA 5IT9A 1KMIY 5FEUA 2OLKA 1D1SA 3CUEF 2B36A 4QHYA 5CLIA 3K70C 4LX8A 3MBIA 1T1GA 3SQOA 3NXKA 4TOIA 3ZHZA 2QROA 3PNOA 3LO8A 3R3UA 2HPAA 1G1MA 2F2TA 2QRVB 4XVCA 2JZOA 3DEAA 3HZOA 3VX3A 5KX5A 1YKSA 3ESQA 3L4BC 5BSRA 5KOJB 4FW8A 2G72A 2QDXA 2X22A 3HEAA 5L40A 1KDYA 4AX8A 4G26A 3OETA 1YCDA 1Q14A 4KHPB 3LOPA 3GRZA 2D1QA 1KH3A 1QFXA 4M1MA 1PWHA 1A9QA 2O52A 2W43A 4FONA 4HDKA 4C22A 4ZO8A 5FOSA 3MWGA 4ZOEA 5I7EA 3GLIE 2O8BB 4LHVA 3AY7A 1XQ9A 4NF2A 3UG6A 2P3OA 1R2QA 1E9RA 4WECA 5JFTA 1SCQA 2WJVA 4OSOA 4AO8A 1I32A 4E08A 3H7AA 4MV7A 4NAHA 2GRJA 4AUMA 3GWGA 4E11A 2FLVA 1LF5A 3H2YA 5E6SB 5EP3A 2PU5A 1IUOA 3R3XA 1A2QA 3A32A 1R6XA 1RNLA 2R6R1 3GGJA 4ZQIA 3WIEA 2DPGA 4R83A 4DAOA 4NBWA 1XQYA 1VZ3A 4HQRA 1MOSA 5JDCA 1JAXA 3SDSA 3VR3D 3MC1A 5CBPA 4EA6A 4ARBA 1M6VA 1XKXA 2FR1A 3EZXA 3KTOA 2VZEA 2VXOA 5TPZA 3VH3A 4AX4A 2FK8A 2UVPA 3ZWOA 4GOOD 4E12A 5FDFA 3FW1A 2ZJZA 4JIGA 4UE3S 4Y0AA 4HYEA 1MHTA 4L74A 3VNBA 2BEVA 3UYKA 1XTSA 1QANA 5B1HA 3TKYA 4BFXA 4ZJYA 2VTBB 4TTQA 4XGKA 4M0UA 4L4UA 1R0WA 3K9WA 2FMXA 4TWJA 4C43A 1G0OA 2V1UA 3VSBA 5JH7A 1OC4A 2C31A 5D7BA 1JBQA 1OYVA 1E6UA 2NSDA 2GESA 4OI2A 3IBGA 2JD0A 2A0XA 5HHTA 2I7VA 1TNDA 1U02A 4I99A 1RAIA 5CIWA 3F5FA 4WK6A 2AYYA 5HOEA 1DINA 4TV8A 5EJAA 4CR8A 4C6TA 4BC1A 2I6UA 2CLSA 2JAHA 3UM9A 4IEFB 1GZDA 3DGFC 2NZ2A 2VN8A 2YWRA 3BA1A 5AIAA 1C3EA 4YP6A 3SI7A 3HU1A 4W9NA 3AP3A 2ADMA 4PG5A 5K0LA 5KYGA 2FW1A 2GJSA 1P33A 2IYVA 3JYQA 4GT1A 4UZFA 3C6BA 4WUTA 4XWAA 3FNHA 1L5KA 1R9MA 4J75A 4BX0A 1SUCA 2PVCA 5KI6A 1KEEA 1XRQA 3KDSE 1A7KA 3IAFA 1DXQA 4FHFA 4NYMR 1C9MA 1DXHA 2A9VA 1DJOA 2H9YA 1DDGA 3C3XA 4PC7A 1Y8RB 3C3MA 1U0HC 1UIRA 1U1EA 3R8CA 1NSTA 3I12A 4KRXA 5GZ6A 5SY4A 3NHZA 2P9TA 3LK7A 1DCKA 4I4TA 5I9NA 3FDZA 3T3IA 1BN6A 1QXSA 3HR4A 4BNYA 3BZWA 3RSCA 2IP2A 3U26A 1YFLA 4N76A 1OW3B 5DMXA 1HYQA 4NPCA 4PG8A 2ZUDA 3UGKA 4IXNA 3PRYA 4BJ3A 1H6CA 1W59A 1UOOA 2ETXA 5E6UB 5LPNA 4GWGA 3RS7A 3DKPA 3ERCA 2Y0PA 2WPNA 1JZSA 5JD3A 4G56A 1YBMA 1XTRA 3OZBA 4L7VA 4ZO7A 3VGJA 4CMIB 4RBNA 5G41A 4X66B 2PT9A 2PT7A 3IR5A 1W36C 4G37A 4QGGA 4E5KA 5F5NA 3OKAA 1E0DA 3UK2A 3DD1A 1ECJA 2FGJA 2J08A 2UZ1A 4BJ6A 1PCXA 4IDDA 1DQSA 4JBHA 4UHKA 3NNSA 2VH5R 3EQ7A 4J2HA 4E5DA 5DNVA 1S02A 4N3NA 1FZQA 1H2ZA 2EKDA 2OCDA 2HHJA 3FVQA 3TINA 3DKKA 1B42A 3VR1A 2QZ4A 1RE1A 4RTOA 4A0FA 4CKBB 3BAFA 2WM9B 1WXGA 3GMSA 5L6MB 2PLNA 3FBWA 3U4IA 3LC7O 3QF4B 5IU6A 1Z36A 5EJ6A 2JLQA 1G59A 3FPKA 3EGDB 1FNCA 1MJHA 2CXOA 4JOCA 4UKDA 4F3CA 2IEGA 2D5IA 1USGA 1NW3A 2R00C 2R7NA 2NADA 3DEYX 1Z8DA 2AMVA 3LKVA 2TRSB 1KVTA 1CJBA 2QE6A 1VL1A 4KQFA 1A5BB 3QEMA 1YDEA 2XA2A 4HPWA 4PLYA 3T1TA 1DU4A 1SHKA 4QVIA 2I4LA 3O94A 2ZDQA 4MTCA 4CKYA 1E2KA 2Y4NA 3DG9A 4M21A 3S2EA 3NJ8A 1HQDA 3KOMA 4CFZA 2GTIA 3MUNA 4N6GA 2VPYA 4ER3A 2HSWA 5DI9A 3W7AA 3CCFA 5P8WA 2V0NA 1SEPA 2AMYA 3IE0A 4GIBA 1JIXA 2H4JA 4L28A 4M8LA 4OQZA 5GOZA 4PYJA 3IJRA 2DJIA 1D6NA 1WW3A 4JJ8A 4OUDA 2ZKIA 4NMXB 4QE3A 3VTAA 2WINI 4E7OA 2FZKA 2VCYA 4NZPA 1D5WA 2ZI7A 1RQ2A 5I45A 2G83A 1QHFA 1WVMA 3PHIA 4GXQA 4PS0A 1YT5A 4YAKA 1V48A 2XUZA 1WCIA 4ESOA 3KPJA 3ZU3A 3RYTC 5A3RA 2VJMA 4RNCA 3B7WA 3NBMA 1GT6A 1FDSA 2EATA 1Y1PA 2NXWA 3RIXA 3IUEA 3AFGA 1SELA 4RO0A 1RQNA 1NUQA 4A0RA 4EA8A 2QGFA 5SZHB 4JKYA 5IT0A 1PJTA 3MAAC 2E2WA 2OV4A 2B1IA 3DQPA 3D7RA 3ZX5A 1X1EA 4AJKA 1H1TA 4UTNA 2I78A 2P4UA 2QJTA 1JQBA 2WWWA 3KDAA 3R3JA 4UM9B 3TIVA 3T5PA 3LW7A 5KOHB 1W0JD 2BM1A 1I0ZA 3V7UA 5DXAA 2P11A 5BXYA 2QSYA 1DJQA 4F5EA 4I14A 2NMVA 4BP3A 2BEWA 4DLZA 4QQRA 3W77A 1D6MA 1V7CA 3E05A 1ULHA 4BFUA 7REQB 5FFFA 4YCLA 2OBXA 1YULA 1JIVA 1TRHA 2VAWA 3LWNA 4LOIA 5ITZB 2QTVB 4F6RB 2O3TA 1QC5A 4UAJA 1ORVA 4OQQA 3B51X 1O0CA 5C5IA 3MCAA 1XQXA 4MWDA 4ZVVA 4A8PA 1GGKA 5AVUA 4NFYA 2J9XB 3SU8A 3DMDA 2J5XA 3NHWA 3HDGA 4PGMA 3VHXB 1GO2A 1VPEA 4FN4A 2NZWA 1JR2A 2O7RA 4LA4A 2C9YA 3G0HA 4QQ8A 4PTZA 1T91A 3IQZA 2ZRKA 2VJKA 3N0WA 3A9UA 2PKYX 2PKRA 4UBMA 4R1UA 1YS4A 2W2QA 3RF7A 1UODA 3HVKA 3T52A 4R5MA 5A3JA 3GPLA 4Z3OA 1G5RA 2H6EA 4W9RA 4Z4EA 1MIOA 2F48A 3NFRA 4GI7A 4ZVOA 4Z9BA 3TZKA 3BBLA 4OXQA 1GCGA 1EH5A 1A2BA 2OM2A 2VPIA 4NAVA 2JA2A 3V1MA 5IARA 2GBFA 3H2JA 5FEMA 2L2QA 5U1PA 5KQRA 4GI2A 4ARIA 3EGXA 3IPXA 3C3PA 3ZLVA 1L5OA 4N3GA 5DCWA 3OJWA 3ADDA 3ZS9A 4FSXA 4JASB 4HXYA 1FXUA 3PNMA 4D80A 2BFCA 4IFIA 2YYYA 4JUBA 1UBNA 4G0QA 3TDMA 3AHCA 3GWZA 1ZITA 5AXAA 1HOXA 1ZRHA 3PFHA 2X0EA 4F1JA 3LWDA 4HYYA 2LGJA 3TXXA 4P3NA 2PJRA 1ZOIA 5LYJF 2GASA 3FN4A 2WK1A 3GN2A 4JI7B 3L1UA 3ZCPA 3B9RA 1YJCA 2PVSA 4ADSG 2BGUA 5BN4B 4Y2XA 4RTRA 4DG9A 4JXKA 4L7QA 3EIUA 2Q6OA 4QFDA 5ULLA 1TVMA 1X14A 2X13A 4RANA 4B4VA 1ID8A 5JNWA 3BH6A 4R41A 4K0KB 2Z3ZA 2XMPA 2IGTA 2QQ5A 5JQGF 1WBDA 5H4HA 2X9QA 2V7GA 2O3SA 3NVAA 3I2KA 1PUIA 3WLRA 4W1RA 2R66A 4L2IA 3SLKA 3BM5A 1NQXA 1K92A 3OVMA 1P0CA 3QX7A 4EY3A 3LTEA 6ADHA 3KBOA 1OWLA 1V8FA 1B8VA 4NVRA 1VKZA 3UWMA 2AE1A 3LDFA 2DFNA 3Q15C 4R0NA 2OCKA 2QMQA 3ZPXA 4CMGA 1EUQA 4MWCA 2PX6A 2QP4A 5T5QA 4EW3A 1ESDA 4RVUA 4EJSB 4CQLA 2BL4A 5LP6B 3KZNA 2H92A 4MA4A 4OFBA 4V2IA 5CDFA 1M0EA 1HDGO 4GMXA 4B2IA 2XAAA 4KMOA 4AXXA 2GAOA 1P29A 1JFFA 4IZHA 3QVMA 4X1YA 2BGWA 4NBTA 1GZ6A 2EEZA 1SXJB 3OJFA 2E18A 1N6KA 2IYAA 1RXCA 2SHKA 2ZR0A 1FFXA 3HBFA 1SH7A 4JGGA 3F71A 2P1ZA 4K6GA 3OE4A 5BY2A 2C82A 1L5YA 2F9FA 3LQ1A 4U6NA 2Q6TA 1VE5A 4OGWA 1T36B 3L9XA 1GSAA 1PEAA 1Q15A 1RCUA 1YQWA 2FWIA 1Y5MA 1U0FA 4LNAA 4WN9B 2O2YA 4C2AA 1T9AA 1CUIA 3FKSA 5AW4A 3CVJA 1ZD5A 1B3RA 1U6JA 4EG6A 1TGVA 2ZT6A 3WG9A 1CP3A 2Q1WA 3U3XA 4B7UA 4OYRA 3PX3A 4M7PA 2C3UA 4KB5A 1ZKDA 2YICA 3D8BA 1ZXXA 5EERA 5BQPA 2E5FA 3AEYA 1GPH1 5KJ1A 1WUKS 4J9VA 2I80A 3NBYC 4BFVA 2DCMA 5EXPA 2HCBA 4Y9DA 4B6GA 2C57A 1NUHA 1Z5ZA 2Q45A 2QN2A 3AIMA 5KNDD 3JQ7B 1F9EA 3HJCA 2JATA 2QMEA 1MT3A 1ODIA 3F1KA 1PGOA 1SVWA 4P98A 1B16A 3G0IA 4AMUA 1K6MA 4MDEA 5F3WB 1P77A 1KAGA 5F33A 4G0WA 3HFGA 3C48A 4MRPA 5I9IA 4YQYA 4EKIA 2E48A 3EC7A 1ES9A 2P35A 4WFJA 2RHMA 3SJZA 2E0IA 3EEQA 4GZ3A 5IEJA 4L76A 4MVJG 4WPGA 5AK4A 4YREA 4GMGA 4EJFA 3MNFA 3MIIA 4ZPXA 2W2XA 1XLVA 1EVKA 1YHZA 3INYA 1QQBA 1RRKA 3N87A 5DHTA 2V5VA 1X9GA 2Q9UA 2D0PB 1ODSA 3C6ZA 3KFVA 5A4MS 3MYRA 2AOWA 3R7AA 4IRMA 1WY5A 1UCFA 3RH0A 1DG9A 1P74A 2B6HA 1DJNA 1J25A 2ZB4A 1BJRE 3K5HA 4W8GA 2WYHA 3EWNA 1RHKA 1PL0A 3NNDA 3BMOB 2ZSJA 2ZUTA 4P4UA 5KNDA 4QWWA 2DE0X 4JLAA 4RXTA 4D8VA 5LKRA 4TQGA 1PQUA 3SC2A 4X1IB 1CT9A 5EQJB 4QAJA 1DBQA 2FTKE 2Q0HA 1ZK3A 3DZ8A 3EMVA 3FWZA 1I4DD 2EFEB 3BWYA 4JA2A 1AURA 1U2QA 2J1LA 1XTTA 1ZOPA 3W4KA 1ZP6A 2J3IA 1BA2A 3OE5A 3M81A 1M1YE 1N3BA 3PPIA 2F1HA 4GD3Q 4N54A 5L3QA 4EUFA 2BGJA 2P6MA 4IDEA 3AVQA 2W2VA 5AKXA 1YVPA 3IMEA 4LJ9A 1GKUB 1QV9A 5IVIA 1NA5A 4ACAA 5CFQA 1Z29A 3DDCA 3IEVA 3S40A 3TOSA 4AURA 5ISMA 1WXQA 1D7AA 2WZBA 1ONOA 3MAJA 2EW1A 1TMYA 1W5SA 2QZ9A 2YQZA 4JB0A 4DRYA 1ADFA 3MSXA 3ZK7A 1E18A 5K09A 2VKQA 1QQAA 4PLHA 1A5SB 4N9WA 5DE3A 1EWRA 5CH5A 2ZT5A 3AG6A 3KHTA 2P27A 3QNWA 4WBNF 3TD6A 2L69A 4BAZA 2VAXA 4ZI7A 4JSRA 3PQEA 2X6RA 4MVJE 4DMLA 221PA 1EK1A 2B8JA 4NV0A 1CD5A 4B6PA 1VQ1A 1QHNA 1OA0A 4IXDA 4BFCA 3IH5A 4WUVA 1RYBA 1QB8A 2J5KA 2XRFA 3A1UA 4ZOQI 3BJEA 3T1QA 4B3FX 1U0TA 3K9FC 2D5AA 1NMZA 2Q0XA 1IEVA 2FW6A 3WAGA 3RT1A 1GGJA 1I1OA 2DCUA 3MMZA 5ESXA 1L1QA 1HBJA 4FGWA 4HQOA 4I50A 5FADA 1UXIA 2NVUB 4UOZA 3HDTA 2XGMA 3MGCA 4BV3A 5DM0A 3GA0A 2NACA 3F4BA 5LZ5A 2JHCA 1BX3A 1L5MA 1G9SA 3HJAA 3SXUA 2FZCA 3ZE7A 1O95C 3JATA 1CZUA 1ECPA 1ZK0A 2HEGA 1S4MA 4Y1GA 1W2WB 2RB4A 2F8MA 3I5UA 4NI5A 4YQZA 4EPYA 3E3NA 5L3SA 5ED0A 3HU5A 3WIVA 1LK7A 3HUUA 3MJFA 3H5NA 4LY0A 2VYFA 4GS5A 2NU8B 3ZUPA 4H7KA 3IEMA 1JEQB 5A7HA 5J3JA 1XXHA 3L77A 2DC1A 3JWPA 2HGZA 1CK4A 2ZUSA 3AX6A 3HXLA 2CE7A 5KINB 4BUJA 2FFAA 5TQVA 5EUMA 3UAGA 1Z4QA 2IY7A 2C3PA 3NC1C 4HMPA 1F17A 3NPAA 3TYXA 5CLFA 1XZEA 4CKWA 3OEHA 1Q7EA 1MORA 4FGLA 1CF9A 1XTPA 3WHKA 3ZQ6A 4DLTA 2C8KA 2OFWA 3EAGA 3G5TA 3SHVA 3PDJA 3JRNA 4FI3F 4OB8A 3SHFA 3O8DA 4MW7A 1Y9JA 1U94A 1XKTA 2E49A 3DBLB 3FGNA 3T41A 2VQDA 2YHAA 4N4AA 1QZXA 1PD1A 1QYCA 1TRKA 1VA4A 1L9KA 3CIFA 1ISMA 2PZKA 3CUVA 4KDCA 4U4AA 3OTOB 1Q0PA 4LCEA 4FYJA 3ID6C 5GADl 4XASA 3KM0A 1ZNXA 3LHSA 3O4HA 3NP7A 4KO8A 4ND5A 4CV3A 1H2WA 1Z9BA 3KUUA 1RLTA 2H0AA 4CM6A 2XX3A 4MVJP 2DX7A 2GXQA 4HH4A 4OFZA 5A4AA 5CPFA 4V1CI 4LIPD 3W5VA 5HIAA 2CMGA 4MCJA 4UPEA 5KU1A 2G63A 5TMEA 4D43A 1TZBA 1UUFA 5EKDA 3O2SB 2ATXA 2QL9A 4PIVA 3UXHA 1WB9A 1BWPA 1GLGA 2GJKA 5JXIA 3WQQA 3T5GA 1U90A 2BFFB 1VCMA 3GI1A 4S24A 3HDHA 4WT7A 4AG6A 2G06A 4HNGA 2MMCA 5KYYA 1XN4A 3E61A 3EMBA 4JGIA 4QXAA 5C7OO 1PHPA 1TW3A 1YR8A 3S2UA 1G5IA 4PN3A 2J41A 2P2CA 1GGNA 2I03A 2V7PA 3RBAA 3RUDA 2O5EA 3FSRA 2Z5VA 3GLHA 3P4UA 4KREA 5ETJA 5K2MA 5GWXA 3ER6A 4WOCA 3W79A 2XQIA 2DLCX 3A6EA 1Z0IA 4OL0A 3RVMA 3QJYA 3THXA 4XCVA 3R20A 4YCAA 3BB4A 3ICCA 5AMXA 5COAA 2QLBA 1T4BA 4ZOCA 5FI3A 4WD3A 4F3NA 4PGAA 2ZRQA 3BA6A 2PZJA 3MQFA 3S81A 4HX5A 3TPFA 2FQQA 2Y67A 1KYXA 2J3QA 3D64A 4UBIA 2A88A 4QULA 1OLSB 3PNKA 5C34B 1G18A 1US8A 1OCEA 3RYIB 3U4QA 2BGIA 4YWHA 2LPMA 3LT1A 1HURA 4B2LA 3OLXA 3DDSA 4YRQA 1NQ5A 4Z4GA 4RU1A 5AW1A 4ARCA 4INJA 3O3CA 4ZVTA 3ANXA 4RK7A 1Z88A 1IG0A 3G02A 2AK3A 1F2DA 1QQTA 2I66A 1OQAA 2WHPB 4EJ0A 4L9SA 2F62A 4W5JA 3G0BA 4FI3C 5SV2A 1J0EA 3B3GA 4ENWA 4YCSA 4WA8A 2WA2A 1ML3A 5KKCA 2V45A 2I6SA 3R0VA 5LDHA 5MGBA 3W3ZB 1ZL2A 5CDHA 3HG7A 1SZDA 2XKKA 1QF7A 2Q21A 3FPBA 3M1IA 1LWNA 4R8KA 2XDQB 4RZIA 3TD2A 3HGQA 2FPIB 1RYYA 2C5HA 2A0FA 2JGFA 2B98A 4WLUA 1UWKA 1J39A 3TE6A 2JLWA 2C2GA 4XYEA 3AUTA 4FOTA 2C5LA 3UJPA 3FAZA 3MOGA 3GB9A 3T1VA 2FWMX 1C80A 2NNLD 4HWPA 2C8VA 4GBGA 2H2IA 2OD2A 3DLIA 3KPWA 3MBKA 2P1DA 3OE1A 2H1OA 1UJ4A 2PN1A 3PXUA 4LF9B 1Z0SA 1ZU5A 2BFBB 5G0SA 5IXYA 1MA0A 2ZBUA 1A96A 1PP4A 2V6MA 3HE3A 3DW3X 1DKMA 4DUYB 2WSIA 3DCIA 2D62A 4K3UA 1XD9A 1KO5A 4XFDA 3O8RA 2B6NA 3RAPR 5AKHA 3CWZA 1FBTA 2R1UA 2BE9A 3K6KA 3L8GA 4QT0A 3H8WA 4Y1RA 1S01A 2W6CX 2H4YA 1OU4A 2ZW9A 3ABOB 3D4LA 4N0MA 2FN7A 2H8GA 3PIDA 3QWAA 2IXDA 2REBA 4LXGA 5DP1A 3ZWPA 2ZANA 3UY4A 3ELDA 4YCBA 1GDTA 5SZJA 2BKVA 4URHA 3TD9A 4B6OA 1B76A 1NXQA 3DDWA 4PHHA 1LRLA 4UBKA 3Q1KA 3T06B 1XPRA 3JALA 3R09A 1BKYA 3BXEA 3C3DA 4HPJB 4QBGB 5A6SA 4F21A 4OATA 4MK4A 2R60A 2CV1A 4MITA 1ZN2A 3SICE 2WD7B 4XUDA 2FVYA 2QTGA 3O6VA 3ZW7A 5IYZB 3D4NA 3PHHA 3DFUA 3G8CA 2J33A 4DNOA 1IN5A 3L01A 4R3UC 1P2TA 4GEKA 4K8RB 4D44A 3D6JA 1YZKA 4PPNA 3IJPA 2PUFA 5HMLA 2HRCA 2HWYA 1M5UA 1JIUA 2NM0A 2PGXA 1KY2A 3GJ6A 2J0EA 3TW0A 3DDHA 2WMDA 1NGSA 2PR7A 3L8CA 1MLDA 4TLCA 1IVYA 1KSHA 1GV0A 1LJLA 2OHIA 3K1AA 5JD4A 1AO0A 4YI3A 4O59O 3RE1A 3EHDA 2H52A 3FUTA 1HF3A 2HKIA 3N2NA 3TX6A 1Z6TA 3WGHA 3DT6A 2EOAA 3OAAD 4QWMA 2CNKA 2XVYA 1P73A 1L5NA 1SXPA 1SIWA 4WESA 1AZLA 3D2BA 3NHLA 3CB4A 3O38A 2YOFA 2NVOA 4BMYA 3QQ5A 1B00A 4ZMBA 1KZGB 3QMMA 4IDAA 2BN4A 4AJLA 2V96A 2W2OA 1P31A 4E5MA 4E51A 1C30B 3QENA 4PSUA 4K05A 3A4LA 1Z18A 2NU9B 3M4ZA 1RWOA 1BX1A 4JX8A 4QFCA 1DBVO 2NTNA 1R4NB 2EKBA 5F2OA 1EE2A 2P69A 4N5LA 3TAXA 4OLHA 1EZ4A 4E1VA 4FOSA 1L7MA 3ABQB 3IBSA 5TGZA 5EQTA 5FOWA 4UMEA 1AU9A 2C7QA 3ZD6A 3BRWA 3STYA 4Q34A 1PYGA 1A50B 1GPAA 4NG4A 1KFEB 2HF8A 4BFZA 3CRMA 4AJ4A 3V6LA 5IDQA 3O47A 1GNSA 5BWOA 4MEBA 4DV7B 3O03A 1LVUA 3AB8A 3DHVA 3MIZA 1A7UA 3Q8MA 1Q3HA 2V65A 3N6VA 1O0SA 4YYZA 1GUZA 2GARA 2BBWA 1IPEA 2FWBA 1EP2B 3T5TA 3DOIA 3SNKA 3IP8A 3SQXA 4EARA 4YR7A 4YUVA 2WDZA 3VU0A 1G6OA 3LPDA 2LP4Y 3OTWA 4DNQA 3L40A 1PD0A 2ZWVA 5T6MA 3DKIA 4HDOB 1ENZA 1RKQA 1I1NA 2I3DA 4PZEA 3WFIA 1FYWA 4ZZ3A 2PD3A 1K6IA 1P2BA 2AFIA 1PFKA 2I6TA 2RGNA 5HOQA 2P6RA 1LSSA 1XEWX 4FEAA 4M2LA 1Q0ZA 1GA1A 5HA5A 5F2EA 3IAXA 5BW6B 1E7WA 1OV4A 2R7MA 4W6ZA 4DGQA 4CE6A 4PS1A 4N39A 5H02A 3VV3A 1NVMB 1MABA 4PO1A 2WYIA 1T1EA 1LKZA 1R7RA 3EH1A 1KAHA 4X97A 2WSMA 1ZJ5A 4HZUA 3UJ8A 5EJ4A 1JBKA 1UPTA 2YN2A 3MRTA 1RHQA 2C4MA 1N32B 3JTMA 2CDAA 4BXOB 4EWLA 3NTLA 5DT9A 3KJIA 1NU8A 2DETA 3M6VA 1QG6A 3WGUA 4PO8A 1I51A 3I6BA 4PX5A 3K16A 2D4HA 5H68A 3TQCA 1PQPA 1ST2A 2ZJAA 3MUEA 3MW8A 5J2UB 3DONA 1KH1A 2MSDB 4NQRA 1NF3A 1GL3A 2HDHA 3TNLA 2RGGA 3S4YA 2EHJA 3VYTB 4Q21A 3D1JA 3EJ6A 1X7YB 1X3LA 4CLOA 2OB2A 4XYLA 3DULA 2QUKA 4JKIA 2IPLA 2HJRA 5C81A 3WFZA 1T9GS 3I32A 1WMAA 1FNBA 5AW0A 4N0DA 3OPNA 5A5GA 5FOUA 3UENA 4OX9Y 2WUVA 1N0HA 1TZ2A 4G4JA 4YP0A 4D4KA 4MS3A 1YR3A 4DQLA 1V71A 2C0QA 4MOWA 1P0IA 3ACDA 1OUMA 1PR2A 1Z2AA 2J87A 1T5HX 3M3PA 3FYCA 1ZBQA 5HVNA 5G4KA 3PC8A 4RV5A 5LJLA 2QVLA 4G2TA 1OIVA 4RZXA 1Z13A 2J8ZA 4M0CA 3KOWA 1OI2A 3UMFA 1FTYA 1VLMA 4ME6A 5DX8A 4BNLA 1F4VA 5J1TB 5EMNA 1QH1A 1VB5A 2IHYA 3PFKA 1AQUA 2UUPA 1Z37A 2BMVA 2KB0A 3T9BA 4JJKA 4NCKA 3ZHSA 5L53A 4KXWA 4OQEA 2PQMA 1XZQA 1R0XA 2BAGA 4PFSA 1XTKA 3HVIA 4ZD6A 3VC2A 3K9BA 1ULUA 2YOGA 1J99A 4K9QA 1OWNA 2WAMA 2WIBA 5AI0A 4R40A 1ND5A 5E9QA 1XF1A 2FMFA 2Z56A 1EFAA 5JMTA 1UOPA 3PGXA 3W5DA 3TL3A 4NOLA 1DARA 4LXHA 1IIBA 2QP3A 1NBOA 2ZIGA 3A0RB 1J20A 3LHIA 1UWCA 4TLAA 2Q1SA 4BV8A 2IK8A 3UT0A 2I2WA 1L7OA 2B69A 3BMQB 4Z5XA 5FD8A 4URYR 1UJCA 4DEVA 3RTGA 1DIRA 4EFNA 2NWQA 1ZHHA 5K8LA 1HDYA 1CUBA 3ZTTA 1ZVVA 1LK5A 1X0XA 3HB5X 1YU9A 2YW2A 2HUPA 1GEGA 5FPPA 3REFA 1NXSA 3U39A 1X80A 3UW3A 3ZGOA 1KMMA 4E70A 1N8NA 1R3UA 2X2EA 4B6FA 4G1VA 3RK1A 5JT1A 4RKFA 4HD8A 5BOVA 3WDKA 2C29D 1IOVA 1EIZA 2RHDA 2PZ8A 2B8EA 1KSGA 1EDEA 2H1HA 3FPGA 2DULA 2Z5GA 4IQ4A 2YCBA 3KUCA 1YRQA 4AU1A 3PQFA 2X7HA 1F2UB 1SU4A 4AKHA 1WHSB 2IXEA 3ORYA 3FI0A 4MVXA 4BFWA 3E5MA 2O1EA 1H2XA 3BDIA 3LY5A 5HF9A 2AT1A 3ZW9A 4UNPA 3DSRA 4Q9NA 1ZU4A 2H5EA 1W85A 3OSUA 4C7MA 4I5IA 1ISSA 1FFGA 4IM7A 4DMUB 5GONA 2A3RA 1K75A 4J1NA 1CUZA 5B5SA 2BCGY 3ZKWB 3RWBA 4NHOA 1MENA 5KVCA 2XZLA 2V97A 3F6YA 2R7KA 4H4DA 1P7ZA 1R8YA 1WU7A 1Z08A 2TSYB 3R7WB 2W6QA 2WV7A 1ADYA 3PICA 3QY9A 1E9CA 3KBBA 1FP1D 2FEOA 2X6QA 2IJGX 3FTNA 3CE6A 4DCJA 4B3MB 4X7MA 1C50A 4PYRA 4XOIA 4IMIB 2PBZA 2QNRA 1ZCZA 1VBKA 2VYVA 3SEAA 3TSCA 1M0SA 3VC1A 3MFYA 3A0UA 2HY7A 3BRCA 4MROA 1BN7A 1HDRA 1NXXA 1U80A 2TS1A 1FFWA 3ONWA 4L72A 4NATA 5KYWB 4CQNA 1Q77A 3MA0A 1YGYA 1G2PA 2HOQA 3L0CA 3MJHA 4FFNA 5IBRA 5T3YA 4YMTA 1DQNA 1W52X 4IF6A 1XT6A 1QDEA 2H08A 2QJOA 2GXSA 4HUQB 1ZDMA 3NBFA 2Q3DA 5CX1B 2QIPA 3C6XA 3NFYA 4GBED 3C43A 4I4CA 2PM8A 1BWRA 521PA 1O4VA 2OZVA 3KZOA 3KJNA 3OJEA 3NC0C 4REMA 3UH0A 3THYA 3DMFA 4I5GA 2BTQB 1NLYA 2B4KA 2X9LA 5J63A 1THTA 3HY3A 4Y2UA 4FB4A 5E7MA 4C4TA 1YHNA 5E4YA 3LLUA 4DEXA 1D2NA 1VTKA 3OT1B 1KHTA 4H6WA 1F8GA 1LUAA 2C84A 2JCBA 1RYMA 3HN6A 5KTNA 1NMQA 2E4WA 1HNZB 4WIAA 3PT9A 1QPGA 4KBGA 1E9AA 2WR8A 4ARUA 1LPOA 2WTBA 4PG7A 1MFPA 3SJCA 4AN4A 4K6OA 1KZ7B 1X15A 1U0RA 2FSVA 1EBFA 4JB3A 3PXBA 4WACA 5K0EA 2BSQA 4ZIRA 1ZJWA 4D4GA 4H4EA 2YZKA 1EVEA 4JELA 3CRW1 3NMUF 1Z39A 4ND8B 3QVUA 4QRIA 1DPFA 5U4QA 2ROQA 3VPDA 4MJXA 4RPJA 2E82A 5IH7A 4AS2A 5LCXA 2XUIA 1OVMA 5JSFA 1YA8A 2WG0A 5CM9C 3BCRA 4TLBA 5JXHA 3L8EA 5ADHA 1XMQB 3OEED 4QELA 3JR7A 1GQYA 4FN5A 2DFLA 1XLTC 1H2RS 1ZCJA 2QG9A 1V16B 4P2GA 5INTA 2WTAA 1PYOA 2DUWA 2OR3A 3LOUA 3ZV5A 1QFMA 3KYCB 4JJIA 1HDEA 1M73E 1RZVA 1TEHA 1SFRA 4YRRA 3QXGA 1K08A 4L22A 1Z2EA 3NUQA 4HJXA 1D2GA 3CWQA 1A9XA 1AKTA 4IQFA 3UC9A 2PXXA 5I4IA 3ZWKA 2CL5A 4HN4B 4IH4A 2WY2D 4LF7B 3KSZO 3OX2A 2FZGA 4OREX 3HSKA 5CT9A 5F64A 2UYCA 2OFXA 1B14A 3HCRA 5LUBA 1SR8A 2MR6A 1LVGA 1QHIA 3L92A 4FK8A 4XEUA 2BI7A 1JPJA 4BV9A 3EGVA 2C59A 1J2RA 2NTJA 2PZFA 1KZHA 4GMHA 3EVEA 2EZ4A 4EHDA 3RBXA 3IQEA 2OYCA 3KYJB 2XLCA 4CV1A 1ZIDA 4KPFC 1RT9A 1XRNA 1K97A 2ZIVB 1KDVA 3VU3A 4D45A 3CRVA 4X6XA 1P2UA 3KB1A 1ZGZA 2X8LA 3RVJA 1F20A 1NIPA 4CUKA 4PTYA 4Y6QA 3UHAA 2WIJA 3GCZA 3IDFA 5HUJA 1GXSA 2NT4A 1I7LA 2X41A 3DXZA 4ZZ0A 2P4EA 2QRHA 4RQAA 2HREA 1EJ2A 2RGDA 4JUDX 3EXEB 1D4OA 5TVGA 5AW3A 4DQ0A 2W42A 1CYEA 2AFRA 1BO6A 1RYDA 1XHEA 4QBTA 4Y6GB 4A10A 4E1BA 1DV2A 4C2BA 5JSYA 2OCXA 2QLLA 1AUVA 1YDWA 2J3LA 4B7CA 5JJIA 4TV9B 1ESZA 4NYMQ 5JXJA 1R6AA 3G0GA 5FA6A 3PQ2A 1R50A 3FCEA 4CKEA 2JGKA 3AEQB 4YAFA 1QV7A 3PQ5A 3E1GA 2YIMA 3R5SA 4MP3A 3ROQA 3KD2A 4G8CA 3WKEA 4RTPA 1FL9A 3AHEA 5JWRA 3L7OA 2EVWX 3L1VA 3O3NB 3CRNA 1Q0SA 2VRBA 1LD3A 1U7ZA 2HLHA 2NGRA 3D6TB 3QKWA 4LS3A 3S2GA 2WWYA 3L8HA 3D43A 4M0LA 4OQ4A 3KQQA 5CBPB 2IE8A 4KDFA 4B2PA 2TMDA 4QQNA 4N41A 1XU9A 3U37A 1F38A 5A9SB 3PKIA 1VHWA 5IF3A 2UVPB 2X1HA 1A3CA 1I6WA 1S1CA 4V24A 3DS8A 4X20B 4NWIA 1JIIA 1U7OA 4GAEA 4I3GA 5TJ9A 2BEVB 2X8WA 1N8SA 4L4ZA 3SFVA 3VHQA 1G8SA 1T5DX 2ZRDA 4GUDA 2VDUE 4WLOA 4CEHB 2OUIA 3I34X 1X1SA 3GQBA 1QKJA 1RXEA 2BDUA 4MS4B 2FPXA 3PP8A 4Z7JA 1T8SA 4LYDA 5FR2A 1E3EA 5JH7B 3NM4A 3QBVA 5JMOA 2SKCA 2R7LA 4Q4AA 1P4SA 2EQBA 5M7EA 1LPAB 4MW2A 3TFWA 5JCZA 4KHZA 1P1JA 1VPLA 2PAFA 4I4NA 5JQWA 2C2XA 4DLLA 3I6QA 1XMSA 4KUEA 1KETA 1Y8QA 1QTNA 3A14A 4LOJA 3FSEA 3NT4A 4QU9A 1PKXA 4TV8B 1LDGA 1J23A 3LG2A 1I4EB 4WA7A 5ANRB 2G76A 5IJ9A 3ISJA 2O3JA 5ITWA 5JIBA 1K7FB 3QA3E 3HNOA 2ZRBA 4CHGA 4KLCA 3AKZA 1DCTA 1EYZA 1EFTA 2MYNA 4Q1EA 2PT6A 2ZK7A 1YRYE 3I04M 5EJGA 5A4FS 2EF0A 2ZIUB 3RVLA 1JFVA 3GJSA 5LD2B 3T4UA 3DYVA 3PDCA 3TOZA 2Q5CA 1JLKA 1TCAA 2YVLA 1BGWA 2XYVA 5LB4A 5CX4A 2DJ5A 4HUTA 2AN1A 4B45A 5JZOA 1UXHA 1XZPA 2P6OA 3L7BA 3CB2A 4JXJA 1X9HA 4JLVA 4EJ6A 1WXDA 5HJ7A 1ABFA 3CONA 4IFBA 2ZBVA 3URKA 2ENUA 4OXRA 4J76A 1EXWA 2CXXA 1OAAA 2I3ZA 3AIOA 3C7CB 4HNSA 3FCOA 3FDZB 4MR8A 5HIKA 3H65A 1DAOA 1KK2A 3VR2A 4BNWA 3DQZA 5FULA 4B71A 5A1JA 4TLDA 3SM3A 2X5JO 5KQLA 5H83A 2P78A 1Z5OA 3I1FA 1OA1A 4YV7A 4ZVRA 3F74A 1GKYA 1O94D 2Y1DA 3HCWA 3PF9A 3R6TA 4GRAA 2G1PA 3KTAA 2B34A 3FWHA 1H6AA 1IK6A 2QZZA 4MQ6A 4YJFA 3RAJA 4C0WA 5L9AA 4DB4A 1B2LA 5IDVA 4KXFB 2OHJA 5LZ8A 1PNOA 2E55A 3QLUC 1PUXA 2O2XA 4HB2A 2O54A 4CM7A 2MINA 1X19A 3C74A 2FP4A 4HWTA 4WXHA 3FFBA 5FFMA 2VR1A 4FMDB 1WETA 1FPQA 1Z73A 3U81A 7MHTA 1FJGB 2EG5A 5BSWA 1QWOA 1WU8A 1NJFA 1R6VA 2Z1DA 3IDZA 1NN0A 2PSJA 2VOJA 1WKCA 2ZJYA 3ASVA 2IPAB 4RKRA 1JB1A 1ZEMA 1ZKMA 3JYPA 1G3IA 3QK7A 4MKFA 2WKPA 1GPDG 4MW9A 4BPRA 3H18A 3HBAA 3H9CA 4EATA 1P19A 2FFJA 2DFDA 4MVJM 2QWXA 1Z0ZA 3R76A 1QP4A 1CE8B 1ZNQO 3AOEA 2X0JA 1Y6ZA 4JEHA 2JGLA 2WAOA 4M83A 5TC4A 4D9FA 5LIPA 4DR5B 2ALJA 3CLHA 1DFHA 2X1MA 2PX3A 3IAEA 5TT0A 5EJMA 4HKTA 2AR7A 5ES3A 4OKNA 3PEVA 4KVAA 2GEKA 4TKVA 2DBYA 5B4UA 4WNCA 4ZVSA 2HWWA 2AFHE 5KYXB 2IE0A 4MRVA 1PSDA 4F3KA 1O4WA 2WKWA 3BWVA 3PJEA 5CFZA 4R2HA 4MDFA 3CX8A 3ETGA 1ZJZA 3EVAA 1PK8A 4GYKA 3T9FA 3WZ2A 3ZHOA 1XVIA 4I08A 1QFYA 4KPYA 2ZYTX 4MGKR 3A6KA 3DD5A 4TL8A 3V3KA 3EDYA 3I6IA 1E3MA 5KCZA 1T6NA 1M2KA 2NZXA 3P0IA 4Y2HA 2ZUFA 1H8ED 3PCTA 1AM4D 4ROTA 5T64A 3UUWA 4RS3A 4JFAA 2B3TA 2GKSA 4G86A 1E0KA 2AX4A 2DZDA 3HJRA 2LZ0A 3KJQA 5LDGA 2JRCA 1BE0A 1G3UA 2PL1A 2ZQ5A 4DHWA 4I4LA 2QTBA 2I3AA 3V1KA 4ALJA 3KSBC 3ISVA 1DQRA 5IAOA 2Z3WA 2ECKA 3PLRA 4M8SA 1T0IA 3L0YA 2ZFUA 2VJMB 4WBXC 4AFNA 1RC8A 1QK5A 1A7AA 1Y1KE 1DRUA 3EXHC 4ZOLA 1PS0A 1EJ6A 1AQJA 1SO8A 1NURA 1C5KA 3KKNA 1FMTA 4CLEA 1A77A 2WSSA 3EGEA 4X71A 4LJRA 3S28A 1OLOA 3L1JA 2W9XA 4A0SA 3FFWA 3GGSA 2O8DA 4Q3AA 1LSUA 3TVYA 3IVGA 3P9KA 2YINC 3WISA 1G7SA 3EEBA 4ZMSA 3H5LA 1X7DA 4YCNA 1AV6A 4MQUA 1RJEA 4D82A 1FX0A 4HS9A 4JBXA 4WY8A 4DIUA 4DS3A 5ELXA 4A4DA 2Q41A 4NCXA 2WMYA 2FOXA 3R44A 2C3YA 2HBQA 3KQYA 4CYMA 2WSYB 4WI1A 3REQB 2K5UA 3STXA 2DLDA 2GN8A 3WX0A 5T4BA 1J0XO 2FJPA 2FUG6 3F6EX 5CM2Z 3SKVA 3TGWA 3Q2OA 4XUCA 4C0LA 2BEWB 1D2MA 1UJ2A 3GJQA 5CVVA 4PG4A 3RYCB 3GJ8A 3Q98A 5LQRA 3KUKA 4EKDA 1OAKA 3E18A 5FV4A 5LP6F 1RXUA 4BU1A 5LQSA 4DJFC 5EMKA 1YACA 3M9LA 5IZCA 1AE1A 4JLBA 3WKAA 3PUXA 4BNUA 4YCCA 1VBMA 2GO1A 1UMCB 4TKMA 4TYPA 3CT4A 3NIFB 3OUTA 2XB8A 2X3UA 2C2OA 3WB1A 3WGMA 1IPHA 4WY2A 5FTWA 3WNZA 4OQMA 2NYAA 1V96A 1PFGA 4YJ3A 3IMFA 2AUNA 3WRWA 2ORED 1X7XA 2GN9A 2HQBA 1N1EA 1QTRA 3NHJA 1HDCA 3U40A 2XVXA 3RU7A 3UOWA 2VI5A 1M34B 2GI4A 3CLTC 4DARA 5K6AA 1Z6GA 3EW9A 2D1SA 4F3TA 4BVHA 2K7FA 2DU8A 1JVSA 5CLHA 1PL6A 1WUTA 2AXEA 2RH5A 2FEAA 3JYOA 1NM5A 5TRTA 5CDYA 3Q7EA 3N05A 2DWPA 3LHFA 1Q1EA 4ZJPA 1HORA 1C9YA 1UBTS 3DZBA 3LBNA 3ZWYA 2PDAA 3U44A 1SJ9A 1XRLA 4FD2A 2O6HA 4LXUA 4KK4A 4O25A 3UB3A 1BXGB 2R8ZA 3ILHA 1MJFA 1SD5A 4ARSA 2F8SA 2PKQP 2R6AA 1N5JA 1PUJA 2HADA 2QI9F 4GSYA 4KIJA 4O4JA 2NTVA 2XMRA 3ZJTA 4Y6LA 2BE7A 3QMVA 1KQ3A 4FXOA 2GOYA 1FMCA 4NJEA 3GZNA 2FCRA 3T1OA 3RVOA 4Q7KA 4BQRA 3A26A 5EESA 2PRIA 1ZWKA 3DTNA 3L7IA 2GO7A 3AEKA 3NXSA 2PKCA 1BHSA 1PJBA 3L7AA 5F9MA 3BWCA 4HDNB 2AHRA 4EHLA 3B6MA 4YO8A 2FR8C 4RABA 3X2FA 1XR3A 1FZTA 5CVJA 3QE4A 1VHDA 4ZV4A 1PR3A 5YASA 1MR3F 4B80A 3PZBA 4B44A 3BWEA 5M3BA 4BBAA 4EL5A 5C1OA 2CDBA 5SZKB 2QGNA 1T2VA 3OU7A 3DAHA 1NOIA 4NARA 4W99A 1XZAA 2CLOB 4DMKA 1CYDA 2D5BA 2ORWA 5ICSA 5GINE 3FOZA 2OBLA 1BGVA 4H35A 1KYYA 1DC3A 3WI7A 4PF1A 2R0QC 4J4BA 1UXJA 4PSKA 4TX1A 4JSTA 4OQNA 2HQ1A 4GR5A 5LP6C 3NGLA 3ZHRA 3K70D 2QX6A 2W2NA 2V7QD 4YP7A 1YCGA 3ZGYA 4ZVPA 4KGDA 1NLUA 3EIWA 1SXJC 1M1YA 1RWVA 4KLNA 5FWYA 1WJGA 4GHWA 2B92A 1WCYA 5FJJA 5HJ2A 5I7RA 2H7CA 2ODPA 1FTWA 3FVVA 3VRHA 5FHRA 1WWKA 4IGEA 4DJAA 1QIFA 2JBHA 2NO1A 3ELUA 4ZVKA 3S7ZA 3IQWA 1XNQB 2PTHA 4DSOA 3RVKA 1GPLA 3A1SA 5AM3A 1JFFB 3LXUX 5HM6A 1O96A 2P8JA 4KX3A 5BSEA 4DM3A 1OBVA 2H16A 3L8MA 3CX7A 5DNYB 3NIWA 2Q3BA 3CLRC 1SKQA 2O14A 4QPNA 1WQ3A 3VR4H 5F1YA 4D8TA 4EGJA 5K8IA 1V1MA 5FNVA 1X39A 3D8NA 3S0JA 4H3VA 2DHRA 1MKYA 3ZK8A 3TUZC 1E96A 3GUCA 3H0EA 1KE2A 3EPKA 1VLZA 4Z1MD 2M9MA 2WLSA 1DOHA 2OVFA 3A3OA 1JDZA 2QYOA 2QI9C 3GVXA 2P5SA 2RFLA 5TQ2A 5BSVA 3U0VA 2FZEA 4Z49A 1TCVA 1R9JA 4D02A 1E1RD 2QUIA 1VMIA 3TXYA 3QFSA 5IZ4A 2OZKA 3V1TC 2LIVA 4XWYA 4K6KA 1GNPA 2B0JA 2VBGA 3TTWA 3BMCB 4TMWA 4X5OA 3HVUA 4JK3A 4BN0A 1MG5A 3LZ6A 4B3JA 1CKEA 2G4LA 5EUCA 1V3QE 4MV5A 4BX9A 5LOVB 2Q5QA 1ZR2A 4ZO6A 4HLQB 4IOLA 3R41A 4PC2A 1DL5A 2D2EA 5D1NA 1ZSNA 2H8KA 4EBBA 5BXQC 1JHRA 3ZI0A 4H1UA 1X1TA 4D8YA 3CSUA 3DPIA 3B5JA 3EFEA 1CR6A 1O54A 2FHSA 4H7IA 5DM4A 1NULA 5A9TA 5HUQA 4FZ3A 2NN3C 3LX8A 4A1FA 1SKMA 3FLAA 1IQPA 4Z1MA 2ZXFA 1QG0A 4BNIA 1UPXA 2DUMA 1KJZA 2NZYA 1S8NA 3SF8B 2CUNA 4RKWA 5I7WA 2RG7A 4JL6A 3ZXYA 4QQFA 5EWLA 5EXTA 5EWJB 4E2FA 4HNQA 4P0QB 3THOA 3ZNPA 1JKJB 2J4FA 4QL3A 1TM2A 5AJTA 5AM4A 3WV4A 1AUOA 1KK1A 2F3SA 3TLKA 2I9KA 1XB2A 4UE2A 4E2YA 3MN1A 3HWSA 4HI0E 4ITRC 1XRMA 1M66A 2ID9A 4KPUB 3MELA 4HAXA 1H2AS 4KPGA 2YJZA 3ND7A 4DQUA 1LNSA 1Z74A 1JH9A 2LTAA 3R4VA 4U02A 1UC9A 2BHNA 2FCAA 2ZI3A 4O0MA 5IC5A 1C1XA 4DR4B 2XA9A 2G8LA 4JI8B 4PBTA 4XPIB 1II8A 2G40A 1ZINA 2BRUC 4BYMA 4XYGA 2HSEA 2ICAA 3SZGA 1ZW1A 3QX9A 1FLDA 3OCYA 1IEWA 3TM5A 3H0CA 3HM9A 4TYYA 3FTQA 4Q0MA 4H18A 2BHSA 2CLCX 3C97A 1L4GA 2H4XA 2HFJA 3G85A 4PRKA 3DAOA 4Q1AA 2X42A 5B1YA 3G9TA 4QODA 5DNCA 2CHEA 2B21A 3N0RA 1OX4B 1UKVY 1XNJA 1VDMA 1YH3A 2G6TA 2OHXA 2QZJA 2VP4A 3EXG1 4KNVA 3WMWA 3ECSA 1W36D 1MB0A 2YN0A 4Q3EA 4L3VA 2B94A 4R2IA 1X77A 3LLMA 2ZOSA 4XXHA 4KL8S 4FR2A 2IELA 3SC4A 1UAGA 1X74A 1PZMA 2GHTA 1KORA 1PTKA 2FPGB 2Q1UA 5KU7A 2HCJB 1IWPB 4RF5A 1CXZA 3BWDD 1I4LD 5JVDB 3P9YA 2ZT8A 3S5UA 4J0DA 1CUSA 4RCVA 1DAMA 4M0MA 4Y9RA 1QOQB 3F3YA 3UAOA 2FKNA 1L1EA 4ZQFA 1PFQA 3VOSA 2WIGA 3FM9A 5C5CA 2PH3A 3GV0A 1BYIA 3DWGA 3C6QA 3E1SA 4IBOA 2AV6A 2GERA 4IUBS 3FHTA 4IQGA 4ALIA 2PL5A 4OHVA 4DUZB 2PRJA 2ASEA 2IZZA 2JFBA 5J5CA 1L4BA 4TQAA 3OPXA 1IQ0A 1P72A 3LUAA 2CBXA 4MQEA 4N9QA 1EGHA 4KXYA 3SXUB 3OZXA 2D1TA 1OR8A 1ZD9A 3E22B 2FX3A 3MTIA 4ND3A 4QUJA 2PZAA 1BZYA 3HMKA 1Y48E 3ZHQA 2PS1A 2ZAOA 1RPAA 1L7EA 2C9DA 2GK6A 1XLWA 1FUYB 2VDRB 3SQLA 3NI2A 3RI3A 1M6HA 4YQFA 1F0PA 2ZE5A 1KMCA 1XXHB 2CCGA 4N8DA 5LQNA 1SG0A 2RJNA 5KYKA 3ZNQA 4OYHA 1I1HA 2XWSA 5GJCA 4FS3A 4EHJA 4CKWB 3NM5A 3MMSA 4M1EA 5DHQA 1RJ9B 5GPBA 1ZMBA 2FX5A 4HZIA 2AQ8A 2X5NA 3A7EA 4LQCA 4C30A 1GNTA 3RYHA 4MB0A 5AVZA 3DE5X 4KN6A 5K4GA 3LKZA 1ML4A 5E4TA 1FFEA 4EI7A 4FYYA 4MQBA 4ZKEA 1TLLA 1MD9A 2GPWA 4IUCS 3IQDB 4DMHA 4Z4CA 2R00A 2AN3A 1XDZA 4XR9A 5JZMA 4KAAA 1DWUA 3DNPA 4RULA 4FX5A 5T8KA 1QF6A 3M2PA 2VPWA 3K7EA 5KQSA 1Y7IA 1DC8A 4BLSA 4H27A 1EK0A 4RFSA 3L7DA 5JNTA 1RFLA 2OC9A 2ZU0C 1G8JA 4L6CA 3LL7A 3G2IA 1ECBA 2NPOA 3L05A 2HT6A 3D2AA 3OZGA 3DM5A 3JY6A 1XDDA 2CMFA 1QIEA 5DHPA 3ZLBA 4DEYA 4W5RA 1I6MA 1UBUS 2UZ4A 4LI0A 3W8FA 2HMTA 3TTTA 3H2GA 3A1FA 3HYNA 3FHCB 1ZVMA 2C54A 3WLFA 3ZV7A 4AJOA 4YRAA 4LHWA 3SYMA 3SNHA 1RJDA 2O8EB 1WSWA 5KYYB 1I4WA 1WY7A 4N8EA 1FK8A 2CNOA 2DPMA 4QDTA 5LB2A 1JHQA 5C32A 2E9SA 2B5VA 3H4MA 1UBCA 1G6KA 3KXPA 1IBKB 3GLHB 3HTXA 1SOAA 2OILA 4NZYA 2IRWA 2G5GX 5IYZF 1M67A 1PR4A 3THXB 3BSWA 4QZVA 5JAOA 3JQ8B 4XSGA 3ORQA 3E9RA 4JSYA 2JFHA 5DBHX 4PICA 1QIMA 1V25A 1ZVKA 4Q03A 4JBNA 2O57A 2OENG 1U0GA 3U17A 1CLEA 3JVUA 3B85A 3K0KA 2ZJ6A 2OHVA 4CTMA 2QU7A 3VSDA 2XIQA 2AJBA 5J23A 3MERA 1US8B 2WZDA 3JQPA 1M1XB 4GWLA 3ESRA 5DWQA 4F60A 1E77A 1UM8A 1HT1E 1Y7HA 3FWPA 3OQ6A 4TXJA 2BHRA 3AHFA 4W8HA 1YO6A 4WV3A 4Q3KA 3CZPA 2CF6A 2VK4A 1TMGE 1M2JA 2VT6A 3KEMA 4US1R 3TK1A 2PYIA 3CJTA 5DTQA 3PQ4A 4OHCA 1NMEA 1XAHA 2P4HX 3OZ7A 3B5IA 3K72B 4O33A 4YECA 3NP9A 3GOQA 2ZIFA 4E0BA 1T0JB 1WDTA 2GRUA 1U2EA 2IEYA 4JB2A 3VU9A 4QDJA 2OZLA 4TLLB 5EE1A 4XPZA 5DF1A 1O6ZA 1P0PA 4G5XA 3ZLTA 3RK0A 2CKDA 2QV0A 3W2IA 1JE1A 3DB2A 3H84A 2OEPA 3V4OA 1UKZA 3OKPA 1MQAA 3PRHA 3GP5A 4BC0A 1TLTA 1NVAA 3OQMA 1OLUA 1FVXA 1Y1TA 2JFUA 1T4GA 1SXIA 3DFMA 3K0FB 3VO1A 5IT4A 1EWQA 3LC1O 4LBZA 4J6EA 2ZKLA 4UBJA 1SC3A 5SYAA 2AC2A 3D3KA 1LPNA 3FUXA 4BO8A 4EHNA 1R6TA 1M2GA 2G0AA 2P79A 4GH5A 3GQVA 2E4AA 2P9GA 4ETWA 5EHZA 5LM3A 3OQHA 1TOAA 3D6UA 4GOLD 3UPDA 4BO0A 4FQ7A 4DB2A 3OLQA 4C2UA 1K0UA 2N3ZA 2WF8A 3LD9A 3OX3A 4FYKA 4K9DA 2WMNB 4KJXA 3WNBA 3K0BA 3EXG2 3KWJA 1HTBA 2HPZA 1ILWA 1QIKA 3OLZA 2XYRA 2AZXA 4ZC1A 4MR7A 4DWVA 5CT5A 5A05A 4QYIA 2BGTA 1GG2A 1G21A 1KS2A 1Y1RA 4Y1RB 1JMKC 2H63A 3L1KA 5E1MA 1VE1A 4JC4A 2VUIB 1N5MA 4KR0A 1X7WA 1OX6A 2QGZA 3S8YA 1ZR4A 5FP0A 3OIYA 4EZEA 2GKOA 3IULA 2WTUA 1A4RA 2A78A 1DEAA 2WJJA 2HNAA 1JLLA 4C4YA 3K4PA 3QYFA 5B37A 2XWJI 3MMPA 3KJFA 2UYGA 5E8JA 2G9NA 4MO2A 3FGZA 1D2CA 2AVDA 4JXZA 1L7BA 5IHXA 4C1BA 1VIDA 4J7UA 1T4DA 3ZY3A 3OIFA 5MN4A 4W8OA 5J2UF 4PGGA 2WE8A 4AWAA 1WW2A 1GAEO 3FY4A 5ALEA 4CLDA 5CAEA 3X44A 1V3UA 4ZHSA 1QQ6A 5ALDA 1JMYA 1Q6ZA 4MJ3A 1VBNA 4K5QA 5LDDC 2AOVA 3WMXA 2NO5A 3L6OO 4D9CA 2GPNA 3CEJA 3K1AB 2H29A 4PSCA 4FQ5A 4RDCA 1WHTA 4KEAA 2O4UX 4URZR 2X0IA 1L5VA 2DQSA 4K87A 1F48A 1KZ6A 4RPIA 3WZLA 4HVCA 3AF6A 3DXYA 4QYSA 1KO7A 3WHIA 2H5JA 3A1CA 5TEVA 3FPJA 2I2XB 3V8VA 1DTEA 2NZ8A 2PU7A 2XZTA 3BOSA 3ZZ1A 3I61A 2GFHA 4N01A 1PDVA 1ONNA 1IY2A 1D9ZA 2ZI6A 1CQIA 1VLVA 2I2BA 3AJAA 3C6MA 3IPRA 1S89A 2FZ4A 2Z43A 3DEFA 4UU0A 4ZEVA 3VHLB 5HFJA 4X64B 4Z51A 2CBGA 3N7TA 5EIXA 4ZCQA 4O5OA 2A6PA 4WWHA 3VTZA 4MUYA 5DGHA 3VPSA 3V2GA 1QO7A 1XDBA 2FPPA 2WKSA 2Y66A 3A8TA 2XEXA 1U8EA 3VISA 2Q6LA 4NK4A 5IP5A 3SSOA 4BDSA 1P44A 2Y1EA 5DCUA 1AGYA 5G1OA 3E7DA 5AW7A 1RYHA 5IKPA 2I22A 4REQA 4U5QA 2PGDA 3D3EA 1L4NA 4P80A 8OHMA 2WSLA 2R6HA 1W8DA 3P0JA 5ALXA 1T3HA 3H7IA 4CR7A 2E7ZA 4XIIA 2FPMA 2RCYA 3AR5A 3U3MA 4BHTA 2R48A 3WLTA 3NVKI 2CFSA 2V58A 1C0PA 2C97A 3K9HA 1NRWA 1NW9B 1ZGBA 3BHJA 3DUFB 3C4QA 3HGMA 4OHPA 4ZJUA 1QHSA 1JG6A 2XWPA 4B33A 1FQOA 1H3EA 2OBMA 1VHTA 5AKZA 3WLQA 2IDJA 3GJTA 1YRWA 2IX9A 3CKYA 2PNJA 3GN1A 2EXXA 3RSOA 5LJIA 2PUAA 1E4EB 2VUUA 3TG8A 2MYTA 1YQUA 4PO3X 1Y3HA 1W94A 1DI0A 3K9GA 1Y42X 2X14A 4W7IA 3ZH9B 1I5EA 4HX9A 1WR8A 1FYEA 1ZM9A 3DE0X 4A92A 4FM9A 4GEGA 4WCDA 1KZ1A 1Q1NA 1MABB 2E37A 5LYJA 3UV7A 1D7OA 3OTGA 4NAUA 4MO9A 4R51A 4YB8A 3SOZA 4AK9A 4HZUB 3KS9A 1HLFA 1D6SA 3TF5A 4NCBA 2FZLA 3HU3A 2NG1A 4LPSA 1GPKA 1GT91 3CX6A 4FHCA 4PYMA 5H7XA 5DWDA 1V3VA 2EW2A 3QBDA 2ISQA 5JQGA 4IGKA 2A1TR 5GVRA 1E1DA 3ILVA 3DW1X 2AB0A 3WBBA 5FAXA 1J0DA 4W7HA 5IRCD 1B1CA 2PUVA 4UCXA 4GX2A 4LZZA 4AN0A 4NBUA 2GPAA 3JQBC 1HYEA 3Q7IA 1CF2O 3PK0A 2PZMA 4LW8A 4K2AA 5HKOA 2HA5A 4KFCA 1XI2A 1RYFA 1VHQA 2OXCA 4RHXA 4ZWNA 2I4OA 2YJ4A 4RHEA 5EHXA 4FDMA 5JUWA 3LBHA 1M6YA 2ZTSA 1S1MA 3MILA 3NEPX 2J59A 3PGA1 5DIFA 5JWHA 2QRUA 1JXOA 3GCDA 1NATA 4JYMA 3ITEA 4JUFA 3HLYA 4WZAB 4L27A 4F91B 5G4KB 3KU4A 2GLXA 2XGOA 3BGSA 1KU6A 1SXJE 1U28C 3HCEA 1IC6A 3OCCA 4QECA 2FZWA 4XUGB 1FRNA 5K3FB 3RU3A 4RVFA 3RKRA 2FPUA 3T94A 2JIBA 3GFPA 6REQA 4I6GA 3G2PA 1IHOA 1JLHA 1HLDA 3KE9A 1PKEA 4X9XA 1E4YA 5LQJA 4JBIA 4QG7A 2IV3A 2QN7A 3P2JA 2OWEA 5AXDA 3V2IA 3OWXA 2HT1A 3GRYA 1NBHA 3CVOA 1ZEJA 5EKUA 1MUUA 2AE2A 3VOAA 5COBA 2ISCA 1IY9A 1M7BA 3RUCA 2NNWB 1RP7A 2PKXA 3WGIA 4OMUA 1WXHA 1O57A 3KUDA 4HAUA 3FSGD 3T7RA 4LMPA 3L6UA 1Y6JA 4MA5A 4A6EA 3DTVD 4CG1A 1KNXA 3ETCA 3WNQA 4MHSA 1AQNA 1YQTA 3TSWA 4XGIA 3L7KA 2KX7A 3GU3A 4QU8A 4LJ6A 1BXZA 4YT8A 1PX0A 1UMBA 1IHUA 3MUOA 3VKGA 2KWIA 5FTJA 3EULA 1OHHD 3FYTA 4LXQA 4MEAA 3EVGA 2NOAA 3D7NA 3FHJA 3K2QA 1M83A 2GDJA 3K35A 3WGVA 3AL3A 3D8RA 2WU1A 3C4JA 1Q5PA 5EZ5A 1IQUA 2JA1A 1FDUA 1OLXB 1BOOA 2WUEA 3SM9A 1I2ZA 1VPVA 1JKMA 3D02A 1VIVA 5BT9A 2BT4A 4ENUA 2C4UA 2WAXA 3MTDA 4XGRA 5E4FA 1PAUA 4H1HA 1ZXBA 3DZDA 2IT1A 1TIBA 3TCXB 2JASA 2YOHA 1E3WA 3DXXA 4AG3A 3ZHVA 3AIIA 4C5CA 3NOXA 3VTKA 4CDRA 3CSSA 4KFTA 5CG1A 1E61A 5TEWA 1O95A 2LKCA 3KVNA 2VQSA 1TKRA 1RWQA 2OECA 3ZXUB 4WCFB 1BKDR 1W85B 1YR9A 2CCJA 3A3PA 3CEMA 4ZXPA 4YMVA 4JJFA 2LW7A 1TF7A 1B8PA 1D6JA 2VLIA 1JEYA 3T7SA 3GFRA 4L5JA 2EYQA 3UPUA 3FI9A 4X7BA 3DBHA 4OHXA 2PO7A 5T3UA 3C8UA 1PL8A 2CVZA 1DDIA 4AMYA 4R8MA 3HJFA 5EUQB 3UXMA 4I9FA 1QTIA 1SQ6A 2YIVX 2E89A 3E0XA 2B35A 1FLNA 2YZ2A 2J0VA 2Q49A 1CVRA 3BERA 1S0UA 1B2RA 4P36A 5DHRA 3SS7X 2GM9A 4LDRA 4P32A 3V2HA 4BMXA 3NPMA 1G63A 2NTEA 2VP9A 4KFSA 2HF2A 3NU1A 4P6VF 5CK5A 5I01A 1NF8A 3FMGA 3GLIB 3G5AA 3EOAI 3H5VA 1NR1A 4KAFA 3ZWVA 2ZVJA 4ZGWA 3D0OA 1RI1A 3RPEA 2MCFA 3SEQA 5JANA 2FW0A 2VTBA 3ICPA 3C7TA 3KPUA 4IGAA 4MAAA 4TV9F 2KSQA 1H4TA 2PGLA 3M0EA 3MRSA 1TKBA 4QNRA 5LZ7A 3RUIA 1W8IA 2FA9A 1NW5A 1PJ4A 2JD1A 1OV6A 5FWXA 5HE8A 2QPLA 2IBSA 2WF9A 5B6IA 3DLTA 3IUJA 1K3UB 3VYVA 4BMPB 4EHKA 3EFOA 4PLWA 1TZKA 3ADOA 1KEZA 2Q1TA 4OKSA 4ZIRB 2J3DA 3D7KA 3DOJA 3RSHA 5IWAB 3IVRA 1WVGA 1GDDA 2JNWA 2BFEA 2QAIA 4LK2A 2H9IA 1DDOA 3BC1A 4CTOA 1VLLA 2VF5X 3I8OA 2QV7A 3BSYA 1SXHA 2HSGA 2VPQA 3SR3A 5I47A 1SK9A 4EHBA 2PUTA 3WDMA 2VXYA 1F06A 3W6ZA 4EAAA 4OEHA 1I3KA 4B3IA 4I2NA 1LX6A 2Z6AA 4OBBA 1TC1A 1F6DA 3C5WP 4BJHB 1HEYA 3C6YA 4CKCB 4AY2A 1ATIA 2K4MA 2R97A 1ZIPA 3DEHA 3FUVA 3UJBA 4ND4A 3W6OA 5JH7F 3SZOA 3F1LA 1G9XA 1SCKA 1KTIA 3GJ0A 1OROA 2EKQA 4DUPA 1N5OX 5AJZA 3HUTA 4BECA 5F98A 3UJ7A 1JS1X 2GTHA 4H31A 1HO3A 2P90A 2WWGA 4TV8F 4NS4A 3COJA 3RC7A 4B43A 3EN0A 3EZLA 4JLMA 1CIJA 3A27A 3T5BA 4P08A 1UPUA 3L0SA 3ZBUA 2IKQA 1XJQA 1XVUA 5J2TB 1PHRA 3CH5A 1Y63A 3JD0A 1Z82A 4IGFA 3VKHA 3GJ3A 4QM7A 1DKLA 5D85A 1JL3A 2CKMA 3PQ7A 1O97C 1F4LA 3I53A 1LBIA 1FMFA 5ILGA 3BILA 2PH7A 1VB3A 4F2DA 3RODA 4KN9S 2WPDD 2WWFA 1O87A 1Q11A 4KVGA 4L51A 2OXEA 3P9XA 4I1SA 3K8YA 1G7CA 3G68A 5JMPA 4C21A 1D0VA 1DJPA 1KAOA 1WLYA 1Z0AA 3NBQA 5AICA 1Z4JA 1CRWG 2B4TO 4GYJA 3WWDA 2BZGA 2IS4A 4KWCA 2J48A 4N5IX 1A7JA 3OFJA 2GD2A 4QBIA 4PC3A 2OBNA 4B17A 5H9VA 5CITA 3U61B 2IWHA 4XVRA 4ISCA 2ZRCA 4RV9A 2HK6A 1GXSB 1PEYA 5B7GA 3BD7A 3PDUA 4DJTA 2PCLA 3KV3O 3B60A 4XUEA 1EMDA 2ZE8A 5ALPA 2P75A 1OZGA 5BOSB 2PA0A 1ORWA 3QJ5A 3IIKA 3OOWA 3R7SA 4CM4B 3PQCA 1GL6A 2WEKA 2Y05A 1T9DA 4RD0A 1NYLA 4KKXB 5IXJA 4BKUA 5I5EA 1U04A 1IUPA 1G9TA 1M0WA 4AULA 4UQLA 2WM3A 5KDLA 2VCEA 2CYCA 4FMDF 3V4VB 3PLNA 4KO4S 2HGSA 4QUBA 1NBEA 2XRMA 4TUYF 4X1KB 4J43A 4BCCA 1JHVA 2WPDA 4EMTA 3BMXA 2A5JA 3H5IA 3BJRA 1TD9A 4LVUA 4I81A 2GYUA 2HLPA 5IH3A 3ZIAD 3ZVKA 3ZCXA 4ND1A 5AFSA 3ANLA 1BJKA 2QORA 4JLWA 3VH2A 3E81A 5EPOA 3RCBA 1FJXA 3D7MA 2CUKA 1M2OA 1GGMA 3CCCA 3ITKA 3T4PA 5MGNA 2HCFA 2IS1A 4R6XA 1WTCA 1EXMA 1X3SA 2I2FA 4RK6A 4BASA 1J6UA 2OD9A 1JQJC 1XJ5A 4Z9YA 4ZRDA 4ZCLA 1DX6A 3ZKAA 4LFBB 1CS0A 2XTMA 3KKQA 2WNIA 5KVVA 3G7UA 3RUEA 1LNQA 2W58A 2QT0A 2WKRA 4P5PA 1NJ1A 4PZYA 3H19A 1KI7A 3OMWA 4GPEA 4JLNA 4NE7A 2N9UA 1YVRA 1XVLA 3ABZA 1NKVA 1G66A 2AFHA 2RHOA 2X8JA 3F47A 4RL4A 4V0OA 1U65A 3FB4A 2ECPA 3W4IA 2E4VA 1LDEA 1DRJA 2P4QA 3EJWA 3H5RA 1T2UA 1VI5A 1LI7A 4H17A 3LT5A 4YJDA 1U9CA 3UK0A 1QLJA 5LD2C 3VVLA 2ZI9A 5IJ9B 4I66A 5C46F 1YZHA 4NEQA 1DEOA 2VK1A 3ZU6A 3ZIAA 1TIKA 1Z22A 5LLTA 4TVOA 1Z45A 2HU5A 2PWPA 3ZHUA 1EFKA 1MO3A 1U9ZA 3I05A 3KL4A 3MGAA 3B38A 1VRCA 2C0CA 3EDQA 4YJKA 2DF8A 3SBDA 5F7OA 1JECA 1YD7A 2GPSA 2Q3EA 3P1JA 3RVBA 4HDRB 1YZGA 4O3FA 4PHCA 3BK7A 3PG5A 2B5OA 3V8RA 3WQBA 4DG5A 4JEUA 4E1AA 1RQXA 3LBFA 4L5IA 3FGOA 5DKFA 5H16A 3W9SA 4RDXA 3E0QA 5EJIA 5EHNA 4H1VA 3LYLA 3BJMA 1QS0A 3IMGA 3S7TA 1JHDA 1U5BB 2I5PO 3FXAA 4GM0A 4Q9HA 4CEIB 1WG8A 2ZXEA 4MR8B 5DXFA 5FOTA 1II0A 2POCA 4D6YA 5LU8A 1KYQA 4WOKA 8MHTA 4ENTA 3TRJA 2EARA 1YCHA 1DTWA 1XGKA 1MVOA 1L2TA 4HEJA 5TLSA 2VSNA 3H11A 4MQMA 4TMVA 3T7JA 2DMRA 3FRJA 4M1OA 4P34A 4UCQA 3C8MA 3KTAB 2Z5FA 4RSHA 2YWXA 1RM5A 2H1SA 3A1TA 4QOGA 2XLBA 3OHPA 2GVDC 4YJFB 4YFYA 5M2QA 2DR2A 2GDZA 1CCWA 1J8YF 3BREA 1OH6A 1KEWA 1FCJA 1NQTA 2FW7A 3QBTA 3E3MA 4YRLA 4B4OA 3KR9A 1P2DA 1ZUD1 2FP4B 5DYIA 1DV1A 3I5XA 1YAHA 3Q7SA 3LHKA 4XM2A 3WYDA 1CRQA 3KCQA 2KM1A 1QQ7A 5CCEA 2YHUA 1R5OA 4XIJA 4UHDA 3L7NA 1TVKA 4IH9A 3V9PA 1F0NA 4OA5A 4QTZA 1PT8A 3BICA 1ZA1A 3I2IA 2CK3D 2DPHA 4PONA 1H4VB 2IXGA 4ZCMA 1FDRA 1OFUX 4RDHA 4F4FA 3EIHA 4WRRA 2GYVA 4G8BA 1A04A 3A2NA 5IKOA