1OBOA

W57l flavodoxin from anabaena
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
AKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTLNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Electron transfer
molecule keywords FLAVODOXIN
publication title How Fmn Binds to Anabaena Apoflavodoxin: A Hydrophobic Encounter at an Open Binding Site
pubmed doi rcsb
source organism Anabaena sp.
total genus 59
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oboA00
5FX2A 4DILA 5ULLA 1RLIA 4C0WA 5JROA 1T0IA 4ZVNA 1FLAA 4CF6A 4ZVLA 4FX2A 4YAOA 1AKQA 3FW1A 3QE2A 1CZNA 1VMEA 3EYWA 3HLYA 4S24A 1H66A 3TEMA 1CZHA 2R97A 4LTNA 1FLVA 1YCFA 3JSXA 3KAPA 5B3LA 1GG5A 2M6RA 1X77A 4M0CA 1F4PA 4N9QA 1XI2A 3NHFA 5B3KA 4GQIA 4HEQA 1NNI1 1D04A 4BMPB 5EA2A 4ICIA 1CZLA 1JA1A 3OX1A 2BZSA 1KBOA 3NHKA 1BU5A 1BVYF 1YDGA 5FUQA 3B6JA 1CZUA 4YQEA 5NLLA 2FCRA 2QX6A 2ZKIA 4FGLA 1C7FA 2MTBA 3OX2A 1KBQA 1FX1A 5A4KA 2FX2A 2XODA 1TIKA 1AKTA 4FGJA 1WSWA 1YKGA 3HA2A 4U7GA 4C0XA 4D02A 4BMOB 3F6SA 3FNIA 4QOJA 2FZ5A 1AKVA 1D03A 4N65A 3D7NA 2W5UA 3B6IA 5NULA 1D4AA 2FAXA 3NHJA 1OBVA 1JA0A 5LVAA 1QHEA 1AHNA 3W79A 3HR4A 1FVXA 1ZX1A 2Z9CA 2Z9BA 5LJLA 2WC1A 1DXOA 4F8YA 1FTGA 4NLLA 1DXQA 3EDOA 2RG1A 3K1YA 4LAFA 4DIKA 4N82A 3ES9A 3R6WA 2KLBA 4R81A 2MWMA 3OWHA 5LBUA 3B6MA 1CZOA 2FLVA 2AMJA 4QOIA 4LTDA 3GAMA 2B3DA 2XOEA 1RCFA 4YAUA 4HS4A 3KLBA 4LTMA 3G5MA 3FVWA 6NULA 1J9GA 3O2NA 2QX8A 4PTYA 4H2DA 3OJXA 1CZKA 2V5VA 2BF4A 3ESXA 1YOBA 4GR9A 5F4BA 5LBTA 1AKRA 4Y7CA 1SQSA 1FLNA 5F12A 1FLDA 3NHWA 3OX3A 4YAFA 1AG9A 3NLLA 1V4BA 1ZWLA 4QOEA 1T5BA 1AKUA 3U7IA 1B1CA 3L9XA 2A5LA 3W7AA 3GFQA 1YCGA 2MOKA 2MT9A 1J9EA 1YRHA 4U7FA 3K20A 1CZRA 4OXXA 2BMVA 1XT6A 2D5IA 3F6RA 3B6KA 3NHYA 1J8QA 4NULA 4QOFA 4PU0A 4LA4A 1XYYA 4YAWA 4XDGA 2FZVA 2ARKA 2BN4A 3NHPA 3N3AC 1J9ZA 4C76A 4PTZA 3KAQA 2QR2A 4QOHA 2QX4A 2R96A 3KEGA 5F51A 2Z9DA 3TZBA 1E5DA 3P0RA 1AZLA 3NHSA 1DX9A 1WSBA 3W78A 4DY4A 3OVMA 3N3BC 3U7RA 5LMCA 2QMZA 3F90A 1QBGA 1FUEA 5FA6A 1TLLA 5LLDA 5EMNA 2Q62A 2N1MA 2HNBA 1OBOA 4H6PA 3W77A 2QMYA 3NHLA 1QR2A 4ZVMA 2QWXA 4GI5A 5BUCA 1QRDA 3UXHA 3UXEA 3ESYA 1AMOA 2F1OA 3NFRA 5EAIA 2X2PA 5TGZA 1RTTA 2V5UA 2OHHA 3QFRA 2FDXA 4QOGA 3S2YA 3RPEA 3LCMA 1AKWA 3FX2A 3FJOA 3GFRA 3L9WA 4C14A 4Y9UA 1SG0A 2HPVA 4CETA 2FOXA 3OJWA 1YCHA 2M6SA 1ZWKA 2HNAA 3LT5A 2GSWA 2QX9A 3F2VA 2OHJA 2KQUA 2OYSA 4QODA 3ESZA 3O73A 1H69A 4U7HA 1OFVA 4XDHA 2BPOA 5LJIA 1XYVA 3TE7A 3ZHOA 4FGKA 4ESEA 2FVXA 4YALA 2Z98A 1RLJA 4J8PA 2OHIA 2V9CA 1C7EA 4Y9RA 3GFSA 4ZVKA 3OWXA 3QFCA 2Q9UA 3N39C 3NHRA 3NHUA 3SVLA 1I1OA 2X2OA
chains in the Genus database with same CATH superfamily
1KMHB 4MW9A 4EGSA 4ZT7A 5AUQA 1U0GA 2C61A 3EPJA 3IMEA 2WIAA 5SZHB 2JA1A 4K46A 1J33A 5FA8A 2O9JA 3AR3A 3TOSA 2Q50A 4OAPA 3HB5X 2I8AA 1HF3A 3OY2A 1UJCA 3H8JA 1YZHA 4G1UC 4Z0HO 4ZVNA 2BL4A 4QLBA 5LM3A 1YA6A 2P40A 4N40A 2IOHA 2CJXA 1YH3A 4D3FA 2P30A 2WWIA 4YK7A 4R98A 3CNBA 3OEHD 4YAOA 5CB0A 1U3WA 1LBIA 5KKCA 4DJ5X 1F0KA 4GW3A 1LNQA 2VP2A 1Y42X 4MWCA 3R09A 3GF4A 5KI6A 3BCRA 1G5HA 3N8IA 3AVXA 1II9A 3ND7A 2C99A 4QEZA 3INRA 3OFKA 1Z73A 3TMYA 3C3EA 3IAUA 3DLPX 4J0JA 1RQXA 5GV7A 3T99A 3I9LA 3EARA 1CVLA 3VUFA 3Q8MA 5HUJA 1NUSA 3SQOA 3MB8A 4MQEB 1YFKA 5CU7A 3ZBQA 3EPLA 1ETUA 1NXQA 2XNDA 3NIGB 4K6KA 2D4HA 2H2IA 4BNNA 4QRIA 3EG9B 3W06A 3OEYA 1OIXA 1LPMA 3WOHA 1FJHA 4H7DA 1ML4A 4XOUA 5EJ9A 4DG9A 2BJHA 2PAAA 3SXUA 3PHCA 3E2PA 2C84A 5KTOA 4KIGA 1VLHA 4A16A 3L8EA 4KGZA 1TQHA 3AFGA 2BRUA 4QQNA 4WN9B 4UZSA 2ZRPA 3OLZA 1OA0A 2HA7A 3PVZA 4UCQA 1OGIA 2I78A 5D3KA 5KDOA 5BQPA 1JIIA 3A28A 4RA9B 4TQGA 3EXIA 4NYJQ 3S28A 1JHXA 1LCIA 2JAWA 3BL6A 1MMFB 3QX9A 2NUAB 5AUOB 2A6PA 2HCJB 2EBUA 2PLNA 2XYGA 3BD6A 4JR2A 5BV8A 1IOLA 4FFRA 4FOPA 3NZEA 2R2AA 1SHJA 2AMVA 2VUSA 2CNBA 2VT2A 3C39A 3DZ8A 3PGLA 2QUBA 3M83A 1BMTA 2VHUA 4I7EA 5BUSA 2WTXA 3E61A 3FFAA 1UDWA 3RD5A 3KWLA 4QRDA 3T0FA 3VPFA 3HY6A 1K75A 1SBIA 1AX9A 1J7JA 1UAYA 1E3LA 3LA8A 4V38A 4YONB 4G1VA 5B2FA 2FR0A 4HVAA 1PYGA 5CGQB 1IH8A 2ZITA 3BA1A 4CF5A 4FFLA 3WMFA 1OZHA 2WAXA 3HDTA 4CUJA 2ZTVA 3HDVA 4NQZA 3BREA 4FJ2A 5EGSA 1NUHA 3B9PA 1E1QD 2H31A 2HBRA 2GTHA 4DC0A 2AD5A 5JQGF 2F8SA 5I9SA 4F6CA 2G0TA 2EJWA 4JI7B 1K6JA 2QD2A 5BY2A 1QTQA 2XTZA 3FVVA 2IHJA 3CB2A 3QYJA 3A6LA 3R7WA 1DAPA 3T9BA 3KSAC 4IOJA 3I5YA 2HPZA 3T5BA 2HPHA 3TWOA 1E7SA 5AW6A 5C34B 4BU0A 3PRYA 3S2SA 1DO2A 2G17A 4V0MA 2EFGA 3LPMA 1J0DA 1JEOA 3PHIA 4KQIA 1M2OB 4WNAA 1XNQB 4OBBA 4MQ5A 5DYTA 3WNCA 1A8IA 4LZWA 1P5FA 1WDTA 1CUYA 1JAIA 2OCAA 2P4EA 2R1TB 2VWQA 1SVLA 3QY9A 3AF6A 2QJRA 5U4QA 1DI0A 2IXGA 3KQOA 4E33A 1IIBA 1XZLA 1QWSA 3IOEA 1ZM3A 1G4AE 1KGDA 3N0TA 3C0KA 4PQRA 3JQCA 3G5TA 3D5TA 2YC2C 3KWMA 5DK4A 3WAKA 3ZCVA 2GMWA 2HKIA 1V8OA 2OVBA 1I6WA 4HDRB 2RGXA 4URHA 2YJ4A 3IP8A 3KUCA 4N76A 1VGVA 2E87A 3I4LA 4CTOA 5CDFE 1WQ4A 3PT9A 3EGXB 3LT2A 3GDWA 4LECA 4B6GA 2DQKA 1GFZA 3HVIA 1NBWB 4K86A 4CFSA 1LJUA 2GWRA 5I8WA 1M33A 4MV0A 4U7GA 4OQMA 4N1AA 1NJFA 4DS3A 4WNIA 4B6EA 3MELA 4Y6PA 5BN3B 4I5GA 4UD2A 2P35A 5KNBA 2XMGA 3KQPA 2ZVDA 2GETA 1NXVA 1R6TA 3TTVA 4Q4DA 1TQ8A 3P1JA 2XMZA 2HNKA 3CBQA 4G0QA 4RJTA 2ID8A 5HMLA 4BNDA 4F4UA 4MW2A 1DEKA 2DQ4A 2HF2A 5C8YB 3KQYA 4P36A 2JDIA 3LT0A 3H1GA 2GCIA 2J0UA 1EB9A 1I14A 3CJTA 3CN7A 5ALUA 1JH9A 5D3ZA 1YWGO 2F43A 3ELYA 1Q16A 4RW0A 4JU8A 1JR6A 2CDAA 2E4YA 2WWFA 1E1RD 2A5YB 4Z4GA 4NJMA 1QU3A 4E1VA 3HK2A 2R8PA 4NR0A 3RFXA 4G0WA 2RHLA 1V5WA 1ONNA 1NKSA 1VMKA 2PY6A 4HNSA 5DXFA 1IQUA 1EFHA 1OWPA 3L7IA 4FIDA 2OBMA 4MGHA 3NBMA 3QI2A 4I5EA 3RHZA 3DYVA 5KQMA 4XCXA 4KQCA 4JUBA 2AE1A 2ZKLA 3NBKA 2WK1A 2OZEA 1EEHA 4UVHA 2ZWAA 4V0NA 3EFOB 4G1CA 4HWOA 5KQPA 4B79A 1Z26A 1WF6A 3ZJ4A 3HBMA 3JD4A 2CXQA 2GJ4A 1UPFA 1DX6A 2RKBA 2YYYA 3G8YA 2Y2VA 4GAEA 4MWTA 4NNPA 4LMAA 4TVBA 4E7PA 4F3RA 1H8EA 1E3WB 1WSDA 4L2IB 2C4UA 1NW3A 2HU2A 4GYKA 1MVLA 3W5IA 1W36C 3U3MA 2FHSA 2N3ZA 2QMUA 4EAQA 2ZAIA 5K6AA 2JATA 1Q7GA 1GL9B 4U9UA 4UDOA 4EX7A 2ZRNA 4AS2A 3R9XA 1TTHA 5EWLB 3CNQS 4OOEA 2JCSA 3SSMA 2BKUA 4E3WA 4MB6A 3MWJA 2WG2A 3M6IA 4IKOA 2CB0A 4NCNA 3QNUA 4UTZA 3PCRB 1NBME 2G1AA 1AB5A 1YONA 4JCCA 1YS4A 1L5NA 3ROEA 5DE3A 3T15A 4XX0A 4NV3A 5HOQA 1PTKA 1C9KA 2FEWB 2Q3FA 4FI3F 1XTIA 2W4MA 3NDJA 1EVYA 4G25A 4ZZ1A 5IT4A 4C4SA 2XKAA 4HL6A 3ZLBA 1SQGA 3D8UA 1E2DA 4LZNA 4XQ0A 5CT8A 3RVMA 5DT9A 4E03A 1J4AA 4BJHB 2O5EA 3GBPA 2GFQA 1HK7A 3L77A 1CUVA 1QVVA 4E7OA 2VNKA 3ITKA 5HE8A 3G5MA 5KAPA 4EA9A 1OROA 1DAIA 4F96A 3QEAZ 2QMHA 3CVOA 1MVOA 2PQ6A 3BFKA 4RV9A 1I7PA 2ZRJA 5GMOA 2XCTB 3L0OA 3DW1X 1W96A 2G88A 3THYA 1JNYA 4KO8A 3RUDA 5AVZA 3VOAA 1A5BB 3IEXA 5LN1A 2GWHA 3DUFB 2UUAB 2GESA 2H2GA 4BS9A 1C1DB 2Y9MB 2WJ3A 2HIGA 3MRTA 3EASA 4RXUA 2PUHA 4A23A 4EMTA 4RPIA 1D6NA 2J6CA 5JBNA 4MYDA 2DY0A 1ZIDA 2OUKA 1KVQA 1JWAB 1XQXA 2A0YA 3FHCB 3G2LA 2VNIA 5LBTA 1HKUA 5C3UA 3TI9A 5TPZD 3OOSA 1SKQA 5ELMA 5G4KA 5CT5A 4B4OA 4CKEB 2CL0X 4K87A 4UAGA 4BB0A 1VE3A 2GA8A 4WKOA 3NHWA 4R8KA 3C48A 4KXUA 4PRKA 3LPCA 1J24A 3OX3A 1RI5A 1TW2A 1YB5A 2DC1A 2OCDA 3UJ3X 3O95A 1Q0SA 1L7RA 1RRGA 1XMPA 2B7LA 2RH9B 3TQHA 1WDKA 5JXJA 4F92B 4KRGA 3C45A 5JNRA 2NO1A 2QZZA 4RS3A 3A2MA 4R9VA 1Y4DE 4Z4CA 2CXRA 3TLYA 3PR2B 3W4IA 3DHNA 2GAAA 5L53A 3ADBA 3V1UA 3U3OA 4LQLA 3ZHUA 1MC4A 4HN9A 5LQUA 4DQVA 1DSSG 3CQ9A 1XTQA 3UC5A 2QT1A 1NU6A 1XQWA 1Z6YA 2I2AA 1WPGA 4BO6A 3WICA 1YCGA 1NI3A 2C2GA 1T1SA 4KIJA 1J9EA 3F6EX 2YXDA 3MILA 2R44A 2H51A 1JLKA 2NPIA 4ZV4A 4XM1A 4WD3A 4WOKA 3DZCA 2P3SA 5CLQA 4BV8A 2VVTA 5AJVB 1WXHA 3O2QB 1CQPA 1QFJA 2WWRA 3AG5A 3C7TA 3LO8A 4UTXA 4HK4A 3Q40A 1QDUA 2C42A 3L8CA 2VLBA 1XNHA 1FFDA 3FPSA 3KZMA 1Z5PA 1X0XA 1TCBA 3Q5DA 3G9QA 1TO2E 2OXFA 3MRSA 1XYYA 1N7GA 2DFDA 1V7ZA 3GMIA 2C97A 3H2GA 5T41A 2DUWA 4YAKA 3FKQA 1R6VA 2ZPAA 4MWDA 5DGCA 4ZCQA 2F90A 3N8GA 3FAZA 3ROKA 3UHJA 2WUWE 5LYJF 2QV7A 1TT5B 1PGPA 3SYLA 4G8BA 4LEIA 1QC5B 2Y66A 3FZEA 3LUBA 4Z0TA 4PS1A 2WF8A 4WERA 3E3MA 3UQZA 2ZSEA 4CL3A 2FY8A 4I3HA 4ENRA 4CTKA 2PIAA 3C3CA 1ZGJA 2EFHB 2GGSA 4B46A 2OZKA 2Q8PA 4IIUA 3WK9A 3OZWA 3MCZA 4RENA 5DYWA 4FCWA 1CS0B 1ZBQA 4FMCB 2K6GA 1SVKA 4FDAA 1XZJA 3DXZA 1LPPA 2QVYX 3QTLA 1SK8A 2EF1A 1LTQA 4ZYUA 3E9RA 2F9FA 5DHRA 5WRFA 4B31A 3PGXA 3TL3A 4G4SO 3T4EA 3TD2A 4AZ0B 2G1UA 3I8XA 3GOHA 5AVWA 3I37X 3CNNA 1A5ZA 1SUBA 2IEAA 1VBKA 2OV3A 5H3CA 5BW8A 5BNFA 4KFCA 2X0NA 2PUGA 1SWWA 2B37A 3R40A 4WZ6A 3PC7A 4X9XA 2CMFA 1G17A 3W2GA 2ZIEA 4B3FX 4BMYA 5C4IA 1G21E 1XROA 3L7DA 3DDSA 4PX2A 3UHFA 4EY5A 4CIBA 3KYCB 5IPFA 4KXXA 4DQUA 1QNFA 2B2CA 5C31A 3COVA 3AT1A 1YI1A 3TZLA 2X19A 1NVXQ 1TU3A 4EL5A 1XFDA 1ISMA 2XTMA 1WWKA 2WWWA 2R65A 3KTOA 1V3QE 3C85A 4Y0NA 1E9BA 1KK0A 4Q9JA 3NOQA 1S2GA 1M1ZA 4UU7A 4DRYA 5IXSA 1GYRA 1V3TA 3H9CA 1CDEA 1RC1A 4F4IA 1ZIXA 3TUZC 1AS2A 2QA5A 3ESQA 3PUVA 4YCMA 3A2LA 1IAQA 2EZUA 3LXMA 2OBXA 2BBOA 5EMNA 3BRQA 4WBNB 2ZM6B 3EPHA 2R79A 1QX4A 3JATA 5H7XA 3SWWA 4OMFG 1L5YA 4BLOA 4FQ5A 1QOQB 4BQOA 4YRGA 2CFTA 4QGFA 3JWIA 4G81A 4P7FA 2V6JA 3FUWA 2IZOA 2FNAA 3WBFA 3QPAA 3RLIA 5F1KA 3DHWC 4HH4A 1GTJ1 3AETA 1BHO1 3V3KA 4JYAB 4X95A 2GERA 4YJ2B 3GMTA 1E2FA 2W6JA 5K20A 1IHPA 1KZ9A 4KKVA 3HEMA 3BRWD 3KUUA 3JALA 4UFNA 5ITZA 1P2DA 4EYGA 3CIFA 2HJHA 3IOMA 3IV7A 1G9XA 1UP4A 4DNXA 3HCFA 3VGJA 5IU6A 3IL2A 4X8OA 2PFSA 4URUR 2M6LA 2G9QA 4M8SA 1UT8A 1WV1A 5JANA 1V4NA 1K89A 1X6VA 3K35A 2V98A 1K4KA 4CLDA 3EBLA 4ZVSA 4EW2A 5JY6A 4BKMA 4JXJA 5GONA 4K03A 1BROA 4HDKB 4IBOA 1LJ8A 4YP5A 5FWDA 5CVTA 2VCYA 2QTCA 3Q10A 2CHEA 2ZAYA 1GNLA 2JGDA 1OB2A 1U3TA 1SXHA 1T9BA 2OHHA 4FYPA 2A92A 3I0NA 3H9BA 3NAQA 1WMEA 2CFIA 3H5IA 3JD3A 1JTFA 4EB0A 1K2VN 1Z38A 5HILA 3TMKA 4KLAA 4CLRA 3BHJA 1RI1A 2VHXA 4JN6B 1Q95A 2P62A 4QU9A 4ABYA 2DCMA 2FZGA 5A9RA 5EG5A 4QTYA 4F72A 2PBRA 2NU9A 3IT3A 3PJFA 4JEIA 4C1BA 4PZ9A 4DOMA 5LP6B 3GJXC 3PX3A 2JBAB 1OLSA 5LR6A 2XXBA 5LNK6 4L6CA 3MT7A 4UATA 5HJ2A 4PX3A 5IXJA 1Y6FA 5ENDA 1I4LD 2J3MA 1WXEA 2B92A 2QM8A 1YT5A 2WDZA 2ZEJA 2RI6A 4WZZA 5LA6A 4AK9A 2XLBA 5EQFA 4F2PA 2WG0A 2C82A 1AE1A 1PNVA 3FCXA 2VAXA 3DVLA 3KELA 2XSZD 4KRYA 2AG0A 3V3TA 1NX6A 3WWOA 3U6BA 5C32A 1RWNA 4QWWA 3U7JA 4PY2A 4CQJA 3P9CA 2JHPA 1VBNA 2K87A 4CFYA 3VNUA 2FSUA 2FZEA 2J9FA 4QTZA 1UC4B 1QH8B 2I4TA 3QKRB 4WVLA 4IVNA 1XNGA 5ESXA 3QPWA 1O0SA 3CPJB 3PC8C 2IHVA 3D6NB 1U7UA 4MV6A 2EJBA 3NUGA 4XDHA 3THOA 1G5PA 5AK4A 4F93B 1UADA 3LDAA 4LZAA 4QUHA 1G6OA 4CM4A 3VTAA 1C1YA 4TT3A 3SK0A 2QI9F 1K7EB 1IZ8A 2YIDA 4BUCA 5BNTA 2ETVA 1UWVA 1RBMA 2UVPB 1CUIA 3OPYI 4BQPA 3FR8A 4UD6A 2JRCA 1F6DA 1S3FA 1ZQ9A 1J5XA 1W2WB 1KH1A 2YX1A 2V9CA 5KSWB 1IBLB 2QRNA 3VKFA 4XFDA 2ZJFA 1Q50A 4R8SA 4C3UA 1NHWA 3QWAA 2Z3VA 3GT3A 3UA3A 5JTTA 4X1KB 5AW0A 1L2TA 3ZZTA 4DLVA 2G70A 3RFCA 1QK3A 1I3MA 3T5CA 3I58A 4MRPA 2VJMB 4UW9A 4FHFA 3KKOA 4EZBA 2ICAA 2PXCA 2XDAA 1VI6A 4UM7A 2HRBA 2P77A 3HNPA 3SCZA 3U5ZB 1YB1A 2ZI5A 4PZ0A 1S6YA 4C89A 3BZWA 3K1AB 1FUUA 1CQIB 4BLVA 1J20A 1ZA2A 2IPOA 1VE9A 1C14A 1KYWA 3LDUA 2FRXA 3I9NA 2GR9A 4BNKA 2RBGA 2HSGA 4L9AA 2NVOA 2EGUA 2HV8A 2IOYA 4LK3A 4NMHA 2Q5CA 4YECA 4KPFC 4MLDA 4RMNA 5FCDA 1Z33A 3T7CA 4CMBA 1W48A 3JU3A 4XXHA 5HEKA 2PMEA 1DX4A 4IUYA 1POXA 4NU8X 2Y0EA 4TKUB 1CZHA 3TEMA 2WQ6A 4AMBA 4I1RA 5DWVA 4BL5A 1E20A 1XCPA 4IJWA 4MMZB 4YCJA 5AKYA 5FI5A 3CONA 1U8FO 5IULC 3GP3A 5IASA 1Z35A 1DBIA 4D6XA 2WJWA 2IGTA 4N6GA 3AC0A 3H2YA 1W0JD 1ZYUA 4E5YA 2HMAA 1N5KA 4OXKA 4EF6A 3M6VA 2H4YA 4TOIA 3S1AA 1VLVA 3NTUA 1ZQ1A 4BZPA 5I47A 5K8IA 3GWGA 3R3HA 5D5PA 1CRLA 4LI0A 1JQAA 1G7RA 1MKYA 4DCTA 2H1CA 2HHJA 2EBWA 4L7QA 1GXSB 3KWFA 4IIVA 4D99A 2LCIA 1QJCA 3DKIA 4O25A 4B4WA 1QIFA 2AOUA 2JEYA 2K5UA 3T7DA 3VO1A 1X94A 3KQKA 4XUGB 2WYUA 5L4NA 4ZU6X 2RHDA 2V6MA 3MD0A 4MIKA 1WDWB 1TAGA 3M89A 4UBJA 1NMSA 5TNXA 4ZHQA 1SC1A 3TZHA 1M72A 1UWLA 4WZBA 5F5XA 2EZ4A 4EHFA 2E4WA 1L8LA 4IDBA 4IOKA 4XOIA 4AJNA 1PR2A 5JSZA 2GJ9A 2PJDA 2ZDGA 3L8FA 5ADWA 1CUHA 4KV7A 1VE5A 3T52A 3Q9NA 1V4VA 4M1OA 1JW9B 1YD7A 2B4TO 3GLVA 4IHJA 1E2HA 1Q0RA 1T9GR 1YDGA 5K4AA 3ZGLA 2H1HA 4NV1A 5DDIP 5CM2Z 3AG6A 5CIYA 3KCQA 1JHMA 1BRTA 5AESA 4ZK6A 4RD4A 1NNLA 1FMFA 2AEFA 2FCRA 2Q6IA 1IQ0A 1RC0A 1YR9A 2VUIB 2ZTLA 3BXPA 3LF2A 1YBMA 2UKDA 3MG9A 3IA2A 1ORRA 1SU8A 5ECDA 1GNSA 3K70D 1XTBA 1TC1A 4YUAA 1EK1A 5AUPB 5HG0A 1PD1A 4ND5A 2PKYX 1UMDB 5B4UA 1T3TA 1SQ5A 3KC2A 4G01B 5AJWA 2G9RA 4W8GA 3RSCA 2NLOA 1EZ1A 1JLRA 1RVDA 2H2HA 1NQVA 1H5QA 4GP6A 3TLBA 4D8VA 1GTL1 2MYTA 5FULA 2EDAA 5SICE 3FHJA 4FR2A 4BFZA 3UBTA 3PJGA 1Y8ZA 1JKMA 4U9HS 4N3BA 3RT1A 3ZH2A 3ZTTA 5JS1A 3FWZA 4OYYA 2B4QA 2ZYWX 2DSNA 2JIQA 4YI5A 4BKQA 4MRSA 3WLOA 1PR1A 2BSAA 4BZQA 1TJNA 1DLJA 2NYRA 2BGLA 2NT3A 1KS9A 1NQ5A 2KPOA 3DDWA 3KTFA 2ODTX 4I4IA 1DEXA 1IL0A 1NDUA 3M2PA 3QP9A 2WIFA 4HNAA 2QL7A 4C43A 1QP0A 4U7PB 3GP5A 5EY5B 2ZW9A 4L95C 1NN3A 1SBYA 3SBXA 5HKKD 7AT1A 2JBWA 2GFIA 3R1IA 4JT4A 1JG4A 3RBXA 3UEOA 3I9JA 2YHBA 1TM5E 2X0FA 3LSYA 3BERA 3O4GA 3PXAA 3PYXA 1V1MB 2OV2A 3MF4A 1L5WA 1BJTA 1PV1A 3E3AA 2W5UA 4JP1A 1PWYE 1CG6A 3G2KA 2JFXA 4G4JA 4MUGA 4X8MA 5F3DA 1E7YA 1U5BA 3WGNA 4PPQA 1GILA 4TKMA 1XBTA 2GZMA 3CKLA 5CBKA 1E89A 1M2JA 4TWZA 5DBFA 1XMOB 1JHAA 4BP3A 2GZ1A 2HFJA 3EIUA 3TW4A 2NXJA 4KJXA 3T4PA 2ZIVB 1OBHA 3MGBA 5AXDA 1YMQA 1Z22A 5BN5A 2VTBA 4TZ0A 2VXCA 3PXEA 1D6SA 1FB5A 1WW8A 4BN5A 4CZ2A 2NO9A 3E1GA 3QA3E 5JQWA 5HCIA 1KZYC 5DSZA 3SR4A 3VZSA 1CEEA 4MV7A 1MXHA 3SNHA 3M6AA 4OFBA 3RRBA 5A4FS 3E8MA 2I6GA 3H1AA 1ARZA 2JI4A 1TOAA 2HMSA 3CMMA 1WTAA 3PG5A 4QGHA 5CVEA 3ABOB 2VF7A 1KWGA 4ZANA 2VP0A 2BI8A 3BM5A 2JFPA 4B32A 4D0GA 4HVLA 4S2EA 3IE2A 1E7MA 2Z57A 4FQ8A 4CG0A 1QH1B 4DG8A 4MUBA 3QJYA 1JJVA 4C1NA 1DJMA 1Z4IA 1KDZA 3KEQA 2AOTA 1VHLA 3FI0A 1TECE 4DMUB 1R00A 2GBGA 3LX5A 1LPAB 4P53A 3U5TA 4LYYA 4DEVA 1GGFA 1TQ2A 1TUBA 3A0UA 1B6TA 5E4YA 1UMCB 3OA0A 2UZ1B 4CT0A 2QM3A 1ZMXA 3AH8A 4JJAA 4R1PA 5FA5A 2BFDA 3TTYA 5E3HA 1VGRA 2I91A 4CLHA 2DR3A 3ESAA 4JYPA 1JEDA 3GYGA 3K4QA 4UCXA 2W6IA 3DAOA 2YBDA 1E2UA 4PGGA 3AB3A 2DHEA 2SKCA 3ZQ4A 4YUWA 1UOEA 3S4YA 3VH3A 2BDUA 1S9DA 3OTHA 3SYKA 4WK6A 1JJAA 3N0WA 4TS1A 1QGYA 1ODJA 1H0KA 4MVCA 4N0DA 2P5SA 3SBOA 1ZU4A 2Q2NA 2RAUA 3GAZA 3H84A 3L8DA 4F9GA 5A2GA 3ZVMA 2QORA 1VGQA 4Q48A 4WE3A 5DYGA 3PFIA 1NOJA 3P2YA 2J7PA 2O2XA 3V7YA 1BMFA 1RQGA 5LZ7A 1O9BA 2LIPA 2DWPA 2AXNA 4ESVA 2QE6A 3ANNA 3A6ZA 2BGGA 3RYIA 2X3YA 3K2BA 3AUJB 4FFWA 2R8XA 1TD9A 1I3CA 3ECSA 4PTYA 3SJZA 4AS3A 3U44B 5GVSA 3OJXA 2FK7A 1H9BA 1OIWA 2IZ6A 1B6SA 3D6MA 3DKPA 4L27A 3OQ1A 3TQCA 3X43A 4E1AA 3K73O 2QLBA 3O1HB 3I2GA 1EVJA 4ACAA 1JV2B 3QFFA 4DR2B 1ZNXA 1K6XA 4W6ZA 5DOZA 1RE0A 3JYPA 2D2IA 3UWPA 1M2EA 1JEQA 1H2EA 4GXQA 1E3TA 3RSZA 3G79A 4YJ3A 3AVWA 2DJ5A 2GEFA 2XY4A 3NOVA 1OPRA 3WRYA 1HGXA 1LBTA 1Z25A 3A06A 2GHTA 1WHSA 3PVSA 1JFFB 4MROA 4OAQA 5EUMA 3BE4A 4IVRA 1SJ9A 2F8LA 5JDIA 1MW8X 4WJZA 1X7XB 3FCEA 3WLQA 4AJ9A 3FCSB 4QGGA 4KHPB 3BMOA 4BKRA 2GVNA 1AZWA 2FPLA 4IAOA 5J4KA 1KH3A 1ZHHA 5DNAA 3O38A 2C5GA 4ESHA 4ETMA 1NONA 4LJ8A 3RU7A 2PG3A 1E1KA 2GPBA 3OI7A 2OCKA 1RQNA 2I9PA 4B2LA 2Q5HA 4AKHA 2GD1O 3HE3A 4LZJA 3BJRA 4J0FA 4D8UA 3SC2B 3A2NA 3JQPA 1NRIA 2E18A 3E0XA 1CF9A 3R74A 1YNOA 2ZS9A 3RASA 1JDBC 1H6AA 1CZRA 3LGSA 3IX7A 1FDVA 2BMVA 4RXTA 4DE5A 4LDJA 4O4JF 3C2QA 2IXBA 4M9SA 3V2GA 1QR6A 3C3WA 3VYVA 1W34A 3KT0A 4OHCA 3KOUA 2ESRA 1C41A 1YZUA 2PZFA 3DM9B 3OZEA 2I3DA 2OBLA 4G5GA 4NBVA 3WGTA 5J5CA 4Y67A 5TQVA 5FUMA 2CLOB 3AM1A 5CH5A 3RB8A 1KR2A 3W34A 3C3JA 3NPMA 1JAZA 2EARA 4FE7A 2JFYA 3FTNA 1ORDA 1MH1A 4X44A 2HZ7A 4D41A 4QXAA 2JASA 2YYSA 3C8UA 1U2GA 2BDTA 4WXMA 4OHRA 4ZP1A 1KDVA 4MITA 3SEFA 1TZCA 2P6MA 3UTDA 2ODBA 1C7ZA 1B00A 1LI4A 3H6HA 4Q3DA 2ARKA 3KHSA 1KS2A 5ALLA 1EQAA 2FMHA 2LPMA 3A9UA 3HFGA 3IHLA 1GFWA 3R41A 4LCJA 2BI4A 3BF7A 2ZRFA 3VR5A 4W7HA 2LNDA 1AO0A 5E0KB 1FRVA 3KAJA 4DY6A 1U2RA 3VU1A 1QCZA 4WZAB 1SKBA 3VR3A 4B6PA 4ES6A 1NBMA 5HBRA 2IDJA 2W2LD 2W22A 4ME6A 1EWTA 3ULKA 3SZUA 1P75A 3T5MA 5KTYA 1QRAA 2UVQA 2WF5A 3SBDA 4K1LA 1PFUA 5BN4A 1KJWA 1JEYA 1VYHA 5CG1A 1TZJA 1EK2A 1V5EA 2HSJA 1DELA 1ZUNA 2R8BA 2ZRBA 4KX3A 4AJLA 4M22A 4AXXA 3DZBA 1KTIA 1KJ8A 3CLRD 4LHYA 4P35A 4YCBA 1LTKA 4RGVA 2WKPA 4YEDA 5AW5A 2Q4RA 3TZBA 1VDZA 2P4QA 2GCPA 4UE3S 1Z7YA 5GWXA 3Q7TA 5J5VA 4US2R 5IDWA 5C2JB 3DEAA 2Q5OA 1DX9A 1ECLA 3GJ6A 2A7QA 4O2AB 4QU0A 1Y1TA 3EZFA 3HKDA 4NEHB 2HUPA 5DMHA 2GJSA 3PE3A 2G9NA 3V8PA 1Y9JA 2OM2A 5TSDA 3RIHA 4B3HA 2WU1A 4LE0A 3V8VA 3MWEB 2C20A 3JR7A 2GYUA 4MV1A 5B7GA 5DNEA 1RYMA 3A6DA 1XB2A 4E5KA 1JU9A 2CXTA 3MUOA 4QAQA 1N5DA 1NE7A 2ZGVA 5A6SA 2ECKA 1JRLA 1CY6A 1XOIA 3CEMA 3AEUA 4GPEA 2E2WA 2G9VA 4OI0A 2DR2A 2YINC 4C29A 3ZLUA 3VNAA 4D4GA 1Y5NA 1QS0B 4B3RB 1ENYA 1Q7EA 3E1SA 7ADHA 1N0VC 4MTCA 2OSVA 3JAKB 5DFAA 1M8GA 1BWRA 2C3PA 1TEZA 1VFNA 2AWNA 2QN3A 5ALTA 4DNPA 2WD8A 4FFNA 4EY3A 1GUZA 4CN8A 1AKNA 2RFLA 3VBCA 1O7JA 4WBSA 5AK0A 4IF6A 2GEBA 2ZYSA 5ETJA 1NT4A 4AKEA 3N0RA 3C98A 1GAXA 1I30A 2VT6A 3MK31 4WOBA 1PSZA 2AWOA 5DMXA 4NU6A 5AI6A 3T3DA 4W9MC 4XPZA 2BEUB 1UAAA 4B5LA 2PGLA 2YHAA 3E9ZA 5A04A 3ESBA 1K3UB 2HXYA 2BEWA 4I2VA 1GA1A 1ZJ5A 1PWXA 4M0DA 3OC6A 1MOZA 1P60A 2H7YA 4MW4A 3ELWA 4BCDA 5LXTA 5CLFA 2VEOA 2XE8A 2KW5A 5IAEA 4O3FA 4R5HA 5KJEA 4Z53A 3BIWA 3ZCUA 4HMPA 2NX2A 5F5LA 1VL5A 3BIXA 5DCUA 5KOHA 1L7PA 2FMUA 2P9GA 3K9FC 4X90A 2XUDA 5D01A 3T35A 1EDDA 3WLKX 5DXAA 1UPBA 2C3MA 4RD3A 4TWRA 4BGVA 2I54A 1I1NA 3DTTA 2OGWA 3O8BA 4OUDB 5ALMA 1FVOA 3K9LA 4KIWA 4Z0PA 3SXPA 3OLYA 3EQZA 4CM6A 3HNRA 5FB3A 1O0CA 4DQLA 2TSYB 2BFBB 5K1ZA 1ZJZA 3TI7A 1DMRA 1ANKA 2XVMA 3HS3A 3L82B 4FOLA 4DSTA 2DPYA 2VCEA 4GVPA 1B2RA 8AT1A 3TTUA 1ZWKA 2F1IA 3GNQA 5A05A 4TTQA 1UIMA 2P5TB 1RPZA 4A8HA 3E8SA 4RTKA 5M29A 1USUA 4HTFA 1WMSA 2Z2YA 4PAGA 5BYJA 3V8EA 5CLGA 3OCUA 2P3LA 1T36A 2OZPA 3A1CA 3WWCA 1BAPA 2PVSA 2RCNA 5B1DA 3A9TA 4ETIA 1QQ6A 4YI3A 4P4SA 5FL3A 5CA0B 5EXSA 3ZY6A 2UXDB 4MUNA 4UPEA 3ESZA 3LW7A 2WF6A 3KD2A 4LRWA 5G0TA 1ZJ4A 3LC2O 1E9DA 2F67A 4CQLB 4Q18A 1BE8A 1ZVJA 2EX4A 1JE0A 3RVLA 2OFOA 4AKTA 2ZE8A 4E51A 4KMOA 1U0FA 3ZHOA 2IS2A 1ZNYA 1AN9A 4DZRA 2ECFA 1ABEA 4EGJA 1G21A 2IELA 1V9SA 4FFSA 2B25A 2K2QB 4HKTA 4MYUA 3ZXUB 5H3HA 1I3LA 4XTCS 4YALA 3QHAA 4O8CA 3W2EA 4A1FA 3ZDAA 2XRMA 4HGQA 3C4QA 1DJNA 4B0PA 2ADFA 1UKYA 1FFXB 1ISIA 4NYIR 3SGLA 2J59A 5DLYA 1C3OB 1GPH1 2C8JA 2XNKA 5HM8A 5K0CA 3ZYZA 5BR4A 1D2HA 2XIJA 2ZB8A 4L4ZA 4RHEA 3ZG6A 1QVZA 2JFVA 3QE4A 4RHYA 5EPUA 2HHAA 3JQAD 3IVGA 4MQUA 3ZCPA 1NMEA 2Q7OE 3QVSA 2OBYA 1G18A 3C8MA 1ZW1A 3L8GA 3GNLA 2BCEA 5EP1A 1QKKA 1JXQA 3JQ9C 4ADSG 3ICVA 4V0SA 3EHDA 3SHVA 2GHIA 1UBGA 3W6PA 1FTWA 3O94A 4OEHA 1ODLA 1CY1A 1HLGA 4AJ4A 5FADA 2VPPA 3IJEB 2PXAA 4FGSA 1NJ6A 1KOLA 3B52X 4KI7A 1AMUA 4JD5A 3PPVA 2K7FA 5JU6A 4X64B 4H31A 5BV2P 2YJ6A 1RAAA 2GN6A 1R0XA 3DDHA 4GOJA 4NQRA 1D2RA 1CZNA 4Y2QA 3SC3A 5BQFA 1VRCA 2N42A 3FWKA 3KOYA 3PICA 2Q2OA 4QYTA 2W2OA 1CJCA 3NP9A 3A6JA 4NRDA 3CTPA 4PYRA 3RVJA 2Q5IA 3ZNPA 5KQRA 4O4LB 1DBWA 3FKSD 3KKQA 2QLLA 3DHYA 4LSGA 5ADHA 1ONOA 4US1R 4A0FA 4GKAA 2DX7A 2PSSA 2ZPUA 1DTWB 1SUFA 2D5AA 2NO7A 1BYUA 4MA0A 4MUHA 5FOUA 5EJFA 1RWKA 2OLJA 3JQRA 4NMWA 3KJHA 1PX2A 2ZZMA 3JSXA 1IG0A 3DZHA 5GY7A 1OGJA 2W6ZA 3HABA 4OI4A 1UKEA 2NZ8A 1S2IA 7YASA 1X77A 2XBUA 4ZYYA 3OMWA 2H0QA 1E3EA 5CFQA 2FTKE 2QQFA 1SUWA 2PBFA 3R6GA 3CXRA 3R3WA 4AYWA 3AV3A 3IXQA 1DO0A 2XUFA 4O1IA 5BUZA 3Q8KA 4QT4A 3E9QA 1YV9A 3CNOA 3HEBA 5AW9A 5F23A 2HX1A 4IO1A 1U0SY 3HJNA 3W5CA 1QOZA 4HQ0A 2PRIA 4JZKA 2IUTA 2C8VA 2OG2A 4BMPB 1EVLA 3RIMA 2GBFA 1QOPB 1E99A 4RGQA 1C50A 3ABQB 1AKEA 3DBRB 1XD8A 1ZKMA 2CNDA 2Y1EA 1VI2A 1NN1A 1OV6A 2HT6A 3IILA 3MTEA 4KRFA 1ESCA 1HNXB 4O2BB 3LUGA 4HEJA 4NNOA 4FBMA 1KVTA 2YNMC 4MO9A 2P9QA 2RGCA 4J7UA 1VLJA 5KJ6A 2YWGA 3HKCA 1IBCA 3K4HA 4HB3A 4BLPA 4W5HA 1G4UR 1H23A 1ETHA 1DZIA 4W7IA 5ALSA 2B82A 4HC4A 5DV9A 4EI9A 2WVHA 1PTJC 1B16A 5F7ZA 1MX5A 1KSFX 3IT2A 4G84A 3BMCA 1MB2A 1UBEA 2Q49A 3H13A 5T6MA 3UGQA 4B6SA 4MW7A 4C6SA 2ODWA 4R2XA 3TLJA 2FPGB 4ZGBA 1JDZA 3I3SR 3WLAA 4AY5A 1M6HA 3BHMA 4X00A 5E9AA 2FMFA 4FI3C 3ZX5A 5BSGA 1O58A 1XNJA 1DS6A 3GEIA 3DVRX 2QLNA 2ZETA 4ND8B 3R8CA 2CFCA 4LQDA 3DT8A 1FEZA 1L3CA 2BMEA 4ITVA 3OY7A 1YBAA 4F2HA 5ITWA 3U3XA 3UPTA 2H9AA 3OPXA 1NR5A 1FJGB 1EVKA 3BVPA 2HXGA 4DMHA 2P2DA 2ET6A 1BDBA 2J3KA 5ALIA 4KGDA 1KBQA 2ZJ0A 1WKVA 5A4KA 3AHHA 1XJWA 2FX2A 1R10A 4AMYA 2HJRA 3ENZA 3OFND 2H6EA 2ZRMA 1IK4A 3L7BA 1N77A 4GXNA 2ZCJA 4MWGA 2MINA 4WEQA 2KBFA 5JALA 1Z6TA 5C1BA 4K0KB 1XDZA 4RS4A 1UM8A 1NVDA 3QXHA 2XUJA 4ZAGA 3UHPA 3MWDA 4S1VA 3F7TA 2YFKA 2G83A 5HDBB 3N86A 3GN2A 1SC6A 1VE7A 1MDBA 3U4GA 2AHOA 3AI3A 1V1RB 2W71A 4TS4A 1ESEA 3NJ4A 5SY9A 3MNFA 4N3AA 2VATA 4QHSA 3KJGA 3GFBA 3P9PA 4W63A 1XZHA 4JI8B 2D74A 3IV9A 4OH7A 3K9HA 1EX6A 2PEYA 1TCUA 2FR1A 2I6XA 4PX9A 4WSOA 5GAJA 4KFUA 4CCYB 1W75A 1W36D 2FF7A 1B73A 4J7CA 4EG4A 3CWQA 3VDMA 4N0MA 2QRVB 3PWKA 1QQ5A 1WPXA 5EIBC 5LD2C 4B6FA 1YK0A 2AEMA 2ZTMA 1XKTA 4Q05A 3BFXA 5FBKA 4YCNA 1JA0A 3CYFA 5CD1A 4P82A 2O7SA 2QRQA 3MJTA 1H0RA 3IEMA 2IY7A 4DLNA 1C80A 3JQFA 3P9YA 2X5OA 1GWNA 5DGXA 4IJ5A 3SI7A 2C1ZA 2DLNA 3V7NA 2A9JA 2PWYA 3ETNA 3HWX1 4L5AA 3U3DA 1L7DA 1T8WA 4OM7A 2PPVA 1P29A 1FRZA 3QE3A 3D8BA 2Z9CA 5FPSA 4HLCA 4EATA 1UMBA 3PIRA 4K9LA 4G5RA 3NTXA 1DC7A 5AHOA 3F5DA 1P31A 2QRPA 2QAGA 5GJCA 4CR7A 3LBYA 4YPOA 2B1RA 3GLIE 2HSDA 5KVVA 2WBLC 1FTGA 5I7AA 1RRCA 2HN9A 3K92A 4I4NA 3TAXA 3EDOA 1APBA 1A7UA 4XIGS 2OORC 4NU5A 2JGJA 3IQIX 2YUTA 3CG0A 3B1ZA 4MAAA 2CXNA 1JIXA 3ON5A 4Q3KA 2HPAA 1B41A 3EUWA 4FQ7A 5KYWA 2CK3A 2XQGA 3O83A 3OTOB 5A3VA 4XB2A 3T3EA 1E6LA 4BQEA 3CX8A 5EHXA 1GNVA 3DSRA 1B43A 4KPUA 4CM7A 5LZ4A 5CX1A 1BVHA 3F9CA 3B6MA 5DULA 1IRXA 4N47A 1YQXA 4Z1MD 3H2ZA 3L3BA 1GJRA 1QRRA 2J7KA 3H97A 4NJEA 2FPPA 2GM4A 4GLOA 1T15A 2G8LA 1RCFA 5TY0A 3VYTB 4L57A 4QQ8A 3WL8A 1O4VA 3KPWA 3WQHA 3Q1KA 4AJHA 5I4BA 2ZT8A 3CXUA 1GFSA 2XB9A 1W2GA 2YWJA 3NUQA 1GIAA 1OMOA 4H15A 4TMYA 1F0YA 4B2PA 5B1SA 2WNHA 1Z16A 3MD9A 5C1IA 3TDKA 3HMQA 5GJBA 5CDYA 3NU1A 3INYA 3UK7A 5KTKA 4LPKA 2CLMB 4L5CA 2QD1A 3MZ0A 4LOJA 2WE7A 3KHKA 4OATA 5HZHA 1P9LA 5HKOA 1YR2A 5HRAA 3PQ5A 5IVHA 4LI3X 3TJMA 1JE1A 1T2CA 3E03A 3F96A 4KTTE 1EXNA 4YS6A 1HLFA 3H0KA 1C3LA 2L2QA 4XGKA 1SQSA 4KQ2A 3CHYA 5I4KA 4DLSA 2CVOA 3AJ8A 2OXIA 3FSGD 3TFWA 2YW2A 4UTRA 4M49A 4AF7A 2R6ZA 5TJ9A 1ST3A 4Q1FA 4TKVA 1AG9A 3MBIA 1ZM7A 3D1JA 3P4UA 3QXXA 5K6RA 4EPRA 1OTYA 2DAPA 2QPAA 2B35A 5A3JA 1AMNA 1LI5A 1T5BA 3U7IA 3SY8A 1N1MA 1VHJA 3I64A 5E1BA 3WLIA 2HU5A 2HV9A 4MI6A 1R0KA 4E12A 4J1SA 2IBSA 3QELB 3QYAA 3OCXA 5EIEA 3A1FA 4FIZA 4H16A 1A04A 1JZQA 4H1TA 1TKAA 3R9KA 3JQ8B 1QO0A 1H1TA 4OF4A 3NEAA 5JZMA 4LF4B 5B6JA 5F2EA 1K68A 2HK8A 1E1YA 3GEMA 5IX8A 1WCIA 4LXUA 1U3DA 3OX4A 4JC4A 1Y4UA 1ISHA 1RABA 1RAHA 1B93A 3DYIA 1W52X 5HTOA 5A9TA 5DM60 2CMGA 4Q9IA 4YPFA 3VDXA 1X70A 2HIMA 2XT6A 5DO9A 1QIDA 5LIRA 4D81A 2M2IA 2ZS8A 1EGHA 5LQCA 5A71A 1YQUA 3G3EA 2IV7A 2IYXA 4DA7A 3L0SA 4MEJA 4UM8B 2F3SA 2UZIR 2WWGA 4IXWA 3WLTA 3ZW9A 4AJEA 1JHRA 1VSUA 1EHIA 2EBFX 1P7YA 2G04A 3MT8A 1ORHA 1Q92A 5JBQA 4GNRA 3FLBA 3V4VB 3PS9A 3EJ6A 3LF1A 1NL3A 4NE9A 4HQOA 2OV8A 4R83A 2EU8A 1NX9A 2CV0A 4XSVA 4EKDA 3NANA 1WDLA 1KVSA 3PZRA 4M88A 3COPA 3I1YA 3CZQA 4RY9A 4D8TA 3AV0B 4JVSB 3VR2D 3ILYA 2YQ5A 3K0BA 1XZMA 4WKPA 5DNVA 4YRMA 3AHDA 3R7SA 1RE1A 5AKJA 4ND2A 1N6PA 5FR1A 3WGVA 1H1DA 4QC2A 2GZAA 3HYTA 3NDRA 3EWNA 3PWTA 2ZUTA 1FJXA 1V2HE 4H7KA 1Y4AE 2YRXA 4F04A 2RK4A 4YRTA 1CSEE 3DLHA 4O2AF 2RIPA 2GPAA 1E9FA 5E4FA 1X0VA 4MW1A 5I7EA 1W93A 2E6KA 1E5DA 3KJZA 3O03A 3B70A 3W2TA 2QTVB 3M5PA 1T5TA 1G8JA 3PF8A 4LSZA 3LYLA 4JX8A 8MHTA 2OV1A 3FGNA 2RGWA 2VP6A 3CO5A 3EB9A 5DASA 4CKYA 2WIGA 4TWAA 1ESMA 3QWBA 3STVA 3ZGNA 1R5NA 4P83A 1MT3A 2V3VA 4TYMA 1Y89A 3S2FA 4ZYVA 1JHYA 2HC9A 4HAOA 4JJIA 4PRYA 4F21A 4FONA 1W9MA 5BT8A 5LMCA 2QI9C 1W581 3H2BA 4JV5B 3ZY2A 5DW3A 1WSAA 2Y1DA 4OYLA 4WCDA 3LW8A 4K3UA 4J07A 5T4BA 4U0KA 5A6VA 3EIOA 3LVBA 1WB9A 4NCBA 2PJRA 3W2HA 4MJ7A 2NSHA 4B74A 2JIPA 3ANSA 4MKXA 1RZUA 5IBRA 1XCBA 3WL7A 1BD3A 3Q7IA 3T94A 4F3KA 1OBOA 4AULA 3DTYA 4MR7A 1V6SA 5AM1A 4DV6B 2ZAMA 4U2EA 3KXKA 2I3ZA 3OCVA 2R8ZA 3ZQUA 2H5JA 2QWXA 2Q0XA 1C7QA 3DBLA 3UANA 2H2DA 4L0CA 5BUCA 2OC4A 2X3FA 5JD5A 4S05A 5G0VA 4JY7A 5IH3A 3G5AA 1ZU5A 1J39A 2YFQA 2QYSA 3EE6A 1YR8A 3T41A 4BP8A 1RFGE 4Y6QA 5KC8A 2Z83A 4XRRA 4IQGA 1QIHA 4MH0R 2J4CA 4POOA 2JJ2A 5FORA 4BX3A 2A1IA 2NNLD 5F98A 5CB8A 2G67A 4DARA 2XCRB 2YWXA 4HSGA 1PSWA 4KVAA 5ESWA 4U3JA 4N39A 5EXTA 5EZ6B 3F6CA 1M0SA 2XSZA 3OZTA 3UWOA 1A2QA 4AF6A 1VB3A 5IUKC 4EHHA 5BW5A 1MRSA 1NVAA 3CMCO 1JFTA 2JLXA 4KYVA 5KSYA 3ZLTA 4YHHB 1OJ7A 3JQGB 5DISB 3VKUA 4CV0A 4LY9A 1E4EB 3QZUA 3FPAA 3A3OA 4LCEA 5TGZA 1IPEA 1RYYA 3W04A 3A05A 3CLUC 4GH5A 1X8LA 4ER7A 1R16A 2IC5A 3BPSA 3KB8A 3PQFA 5JNWA 2P8JA 4DLKA 5JJCA 1BW9A 2B8TA 4Q21A 2FPMA 4REQB 4I4TF 1GQYA 4TL8A 5HQ3A 1NAHA 3N5KA 4WRRA 3H04A 1EUYA 1KSJA 3ASYA 3ZDYB 1PT6A 1F9EA 1P5ZB 4AYTA 3G5LA 4TX1A 1W5SA 1MX3A 3IIMA 4PYMA 3EF0A 4P98A 3D3WB 4MI9A 5CNMA 1YAJA 4MRAA 2RGNC 2ZBFA 3THWB 3WSTA 2M1ZA 5KYUA 4AO8A 4OQYA 1MENA 4CETA 1IB0A 2FLWA 3JVUA 1SVIA 3OOWA 1PRYA 5DNUA 3NIBA 1GCUA 2IHBA 4RV5A 3E5RA 3W1VA 5IHXA 1U3GA 1R4MA 2IDMA 2IJGX 2C4VA 3H7IA 3MB5A 1M76A 4OG2A 4EPVA 1A9XA 4DXAA 5JATA 2OYSA 2JIBA 3H4MA 3Q15C 2Y92A 4R41A 3OTGA 3FTCA 1C30B 3OJEA 2QBYB 3L49A 3RUHA 5DT2A 4EI2A 1RHJA 4ZYTA 1EMDA 3K2IA 1IEWA 1P8AA 2C9MA 4X8LA 5KNDA 4QVIA 1HEIA 5EXDA 1XU9A 4PC7A 1G41A 3C97A 4KQWA 5KYVA 3W9YA 1GPDG 2I6SA 5TE9A 4C7OA 3FNEA 2BPOA 4W5QA 1OAOC 1ISFA 4TLLB 1U0OC 4FGKA 1P1FA 4K9QA 3UOAB 1KOJA 2DB3A 4UU1A 2O07A 3MSCA 1NA5A 2QD3A 1ZP6A 2CCGA 3WP1B 4JIMA 1XF1A 2QRGA 5E8RA 2FRDA 3RFTA 1LQ2A 2JI9A 5K0JA 3LTEA 4H1HA 4J0QA 1G5IA 5G41A 3KR0A 5IZCC 4XM0A 2WUFA 4I9HA 5IEJA 4BFYA 3OLQA 4QXOA 1IMJA 3BH0A 3X1MA 1YB4A 3H5WA 3KIPA 4ANFA 3U7HB 4UREA 3OOYA 3QFCA 5B5SA 2O8EA 1L6IA 1HL7A 1W0JA 2QMQA 1RTKA 3AL0C 4AKGA 3T9EA 4RDHA 3EZNA 3ICPA 2R7NA 1SHUX 1I0LA 4HFJA 2GHRA 3LP5A 3REOA 4DILA 1OX4A 2ONZA 1HDEA 1HE5A 4JYZA 3VHXB 2BFFA 3OO0A 3E22B 4JB8A 4TTAA 3B36A 5AVVA 3VJRA 3NPAA 2PUEA 4GKBA 3VR1A 1SQ0A 2ZT6A 2C7QA 3GN1A 1EHYA 3F4BA 3NNSA 3EWAA 4NICA 1GSHA 3D2LA 2OZVA 1XTPA 1I3OA 1DRWA 3IV6A 1YBHA 4FX2A 4G4SP 2XTJA 1RIIA 4Q7JB 4PV7A 3EOZA 4J7AA 3MWFA 1TJYA 3C5WP 4QJ5A 4JC0A 3BC1A 2PX5A 1VMEA 4KQKA 2WF9A 4B9AA 3HLYA 1NVFA 4I9NA 3QIVA 5AVTA 4G2NA 1IUKA 4EHIA 4D42A 4IVPA 1NY5A 3R44A 4LGYA 1PI3A 1GUDA 1TZBA 1HE4A 2J0UB 2GEKA 4MVXA 3IBTA 4OMUA 3U48A 2H0RA 1JFRA 1CP3A 1N3BA 1X3SA 2OCGA 3OF5A 1R18A 1J2RA 3OKCA 1EWKA 2I7DA 5CDGA 2WJPA 4J0CA 3FD8A 3Q87B 4NJMB 2PZEA 1K63A 1ZH6A 2HF9A 1B76A 2PGJA 4IOMA 4L78A 1WU8A 2V6GA 3GRCA 4P54A 1HSZA 1KEVA 4B6RA 4U39A 1S2LA 1Z5ZA 3LIPA 2BR4A 3MTGA 4IJUA 3YASA 3G6KA 2NZJA 4HAXA 2C7RA 2C9DA 1N32B 2JH3A 2Z2KA 2VHEA 3PQ7A 4RANA 4YJHB 4QPZA 4Y0VA 2I33A 3NASA 4EO4A 1GGMA 3SIXA 3FGPA 2OAEA 4GWGA 5DX0A 3A37A 5EQDA 5LQRA 4GI3A 3KQVA 5KCMA 3GEDA 2RHBA 3BMNB 4EDHA 4MI1A 3HKEA 4TMFA 3TB4A 4O2BF 5EA2A 3PK0A 2O8DA 3WDLA 5GGXA 3HCOA 5C1DA 3BTOA 4GOLD 4GQBA 2UXBB 5COBA 4IIJB 2RC5A 4JHXA 3IEVA 2QQEA 1P2UA 3Q3JB 1U9IC 3IUJA 1M73E 1QRUA 1IFXA 4RZIA 1LW6E 2R84A 1N2HA 4MKFA 1UZAA 1J1UA 1TJ3A 1N6RA 4R1TA 4DIOA 2G5TA 4ZI2A 3SR0A 4S1WA 3PA6A 4OQXA 3W5HA 1GV0A 4BCBA 4CDMA 2V4ZA 4DA4A 4UHFA 1UR5A 3T38A 4XX0B 3ZNOA 2BEVB 1S8OA 2J6HA 3STUA 3VH2A 4JSYA 3M1YA 1RLUA 2QHXA 2J9ZB 3N8NA 4MS3B 4PYKA 5D1HA 3LX8A 4BCCA 1W4ZA 5HKKA 4XLLA 3B6JA 2PGAA 3GBVA 1V5GA 4OV6B 3T12A 1ILEA 1I2BA 2PUDA 1XJ5A 3D4PA 4RPCA 3HVHA 1NW6A 3ND6A 5TC4A 1Q22A 4I08A 4CG2A 3FKJA 4FGLA 4MQ4A 3PUXA 4DA6A 2VJLA 2JKYA 1TJ5A 2ANCA 4D8YA 4YYZA 4N7BA 2WWXA 4PCLA 1FU8A 4BE4A 5K8LA 4IZOA 5HF9A 5B58C 2WVAA 2JLAA 5EWMB 3RS0A 1ZRHA 3RK1A 2CLFB 3I9FA 4DJFC 2VTKA 1IK6A 4W1SA 3IODA 3SQWA 3K9QO 1N25A 1HSOA 1YUNA 3ICCA 1FX1A 3MGGA 4OFZA 5IN5A 4PG8A 4TRJA 3LC0A 2ACVA 2YDYA 1RWPA 1UBHS 3DMGA 3GQVA 3HSKA 3HU3A 3L06A 4IXDA 4M9UA 4F2DA 2ZI7A 3WWZA 4A73A 4IIGA 1ENOA 4ER3A 4B71A 2OCBA 1ABBA 1MZVA 2VR1A 5I7OA 1GZ3A 1JEAA 3KYJB 5A9SB 3LKDA 1E9EA 4ZEOA 4EA7A 2HDNB 5M04A 1NHGA 1OSNA 3K1TA 1XC7A 3GEPA 1FYVA 4RLQA 2XJ9A 1RSZA 5KOJA 1XDUA 5FBLB 3IA7A 1UDCA 5BSUA 5JG7A 3AQ4A 3L6RA 4LV8B 2YW9A 1THGA 3OZCA 2Y68A 4OAOA 5AHKA 3FRJA 5EP2A 3SMVA 4XWWA 1S2DA 4W5NA 4L8GA 5CK4A 4MO2A 3WGHA 3CKYA 2VPYA 4F06A 5D51S 4RWEA 1ZJWA 1QGUB 1H2RS 1Z5WA 1J7KA 1W5BA 2O6LA 3CA8A 1JLSA 1OTHA 2PQ2A 2VJPA 4CKXA 3IVMA 2P1RA 2HRCA 1W8IA 1X15A 4W1PA 5BYBA 3WB1A 3ZV6A 1FDOA 1E5TA 1A9QA 1GGEA 2WD7B 4H59A 4I19A 4ZOLF 3MINA 3BXXA 1T8TA 1JDPA 1U9YA 3T95A 2GT1A 4DGSA 2ZR9A 1YF3A 1PS0A 3UFXA 4ZEMA 3SQDA 2OYCA 1ACLA 3FUCA 1LBQA 1P2VA 2DR0A 1TF7A 5FNVB 4X65B 1E3SA 1QCYA 1TQ4A 2D3WA 1QP8A 5YASA 4TXJA 4MVJA 4RK6A 5FLXA 4RHXA 3BFPA 1Z5OA 2JFWA 2R3SA 1WOYA 3I28A 3KTAA 3V7UA 1MORA 1PKXA 5TQ2B 3IHTA 4RTQA 2NU7A 8GPBA 1C0IA 4BY9E 2HI0A 3T3OA 4ARCA 2G82A 1RI3A 4HVTA 4AMVA 5K3FA 4C6RA 4P80A 3KOXA 3I1IA 3TKYA 1M6WA 3IUBA 2ZI4A 3PD7A 4UXJA 1DU4A 4J16A 3KKEA 1O95C 4PVCA 5BQ5A 2B69A 5BSFA 1MIOA 3B12A 2PRKA 3TK1A 1K7CA 2XHZA 4ETWA 3AJ9A 2VBGA 2OD2A 1G8MA 1YQGA 4II7A 5IHPA 3MEQA 3RJ9A 4JLBA 1T13A 1Z0ZA 1DXQA 1U5AA 4QRHA 1UZNA 2ZUDA 3K32A 1KO1A 5F73A 4L9RA 4ZZ2A 4CIAA 2G09A 2Q9AA 3Q3GE 1N8TA 1S2MA 1JHPA 1ZJ6A 3R6WA 3RI3A 4CQMA 3TH5A 1PQYA 4BVHA 2P9CA 3WX0A 4ZGGA 3WP0A 2P6NA 1OPXA 3TOVA 3ZU6A 3CLSC 4MIYA 4B3DA 1ADCA 1N57A 2JCVA 4XPIB 2G1KA 1Z82A 3PDJA 2LGJA 3Q7EA 4H35A 3O9ZA 4G89A 4Y9TA 5EHZA 3LHSA 3BGVA 1I36A 4KVGA 1KDPA 4S1PA 5K0LA 5L3SB 1E6MA 1VG1A 3V48A 5F7XA 3QRWA 1KE2A 4DR1B 1KH2A 1DEHA 6REQA 1V8DA 4MW5A 5CA1F 1AQUA 1J23A 4LSWA 4CR8A 5LUAA 2I3AA 1UBLS 1FMCA 4HUQA 3UKOA 2H1LA 2XOEA 4IMRA 4M0EA 3ZDEA 5FR2A 3ORYA 2QLMA 5KTSA 4ZT3A 3PHHA 4IQ4A 2VZ8A 2D62A 4TTSA 1ZK2A 1O8CA 3WQBA 1M0EA 3B53X 2ZM5A 3PEEA 1T3LA 2VDKB 1D6MA 1GGJA 1WZEA 1N0WA 3K1ZA 4UZFA 1NBAA 1TQDA 4KQ1A 1U8TA 2YYZA 4MPPA 3MW8A 1NJGA 3NBFA 4AKSA 3HBNA 3VVMA 4JHLA 5EKTA 3DFIA 4KOEC 1CZKA 1NBOA 1KP3A 2VDMB 2DRIA 1MRZA 1N5RA 3SKYA 2PGNA 2YZGA 3ZJ5A 1ODFA 3JATB 4HDSA 4ZCIA 1ODCA 4W7SA 3P96A 5ALEA 4I6EA 1FFBA 3AWIA 3PR1A 3C4JA 1EHCA 3FWHA 1YVRA 4E21A 3PFNA 1QP4A 3TTWA 5FPQA 3U39A 4P22A 3GJ8A 3QUTA 1SIOA 5CTJA 1XO1A 2CD9A 3JAWA 4O2RA 3ZY5A 4BYMA 3VDNB 1OYWA 1RP1A 5JI3E 1A2KC 1IATA 1X1EA 2XUGA 1CBUA 1J8VA 1X7GA 3GPCA 3SNKA 3AVOA 3QOYA 1XWFA 4BJ6A 2BEJA 4LF5B 1XZBA 1EFPA 4OLAA 2GUWA 3B9RA 4YPVA 2GZHA 2JK0A 2VAMA 1PT9A 1JJFA 3MJ4A 4KV9A 5TR9A 3BKXA 3FVQA 3COZA 4BZZA 2ORIA 3OFSA 3DBHB 3CEJA 4QYXA 1ECPA 2NVUB 4GE0A 4KVZA 3PJEA 3I1FA 3M9WA 4V03A 4J94A 2EIXA 2QP3A 2JAUA 4MCIA 2ZULA 3C1TA 4QWMA 2IBTA 1SA0B 4NC9A 5G4LA 1JKIA 1SVWA 2AFIB 2D7CA 3JV7A 2FE4A 4RELA 2P2GA 4TV8B 1S01A 2OPHA 2EF0A 5E6UA 2GAIA 3LX4A 4MI3A 3PC4A 2QN6A 2IYWA 3V2UA 4DR3B 3GZ4A 1Q14A 2WTBA 3GJ4A 1Y6GA 1C1XB 3MAJA 2R1UA 2RHJA 2RBKA 4GXRA 3EFHA 4BFXA 5CEJA 4DLTA 4UPDA 3GLHE 4WXHA 2NW6A 1H85A 2VAWA 1RDFA 3QKUA 4HHEA 4GEKA 4QOFA 3CRRA 4XUDA 2FEOA 2NU9B 3S6JA 3OIWA 1FFCA 3ZQKA 3GHHA 3M0EA 3SHWA 2XUOA 3GLIA 3PX7A 3IULA 2I2CA 2V1UA 4BQIA 3C6YA 1DPGA 2BVNA 1P2GA 2DECA 3HDGA 4O59O 4TKZA 5LP6C 4E2YA 1B6GA 5LA6B 2MR5A 3RRJA 2GN2A 2NXCA 1QLJA 4UDNA 2V7BA 2PNJA 4WUVA 2IYNA 1T5DX 1JPVA 4HQFA 5H1YA 1KJ9A 1T91A 3HB4X 4YX9A 4BNXA 1CLEA 2A1UA 2QUJA 1D5WA 3L8ZA 3W6ZA 2C5FA 1RI2A 2Z8YA 4FD2A 4TRMA 4IQ0A 1IZ9A 4J2TA 3Q1LA 5KMGA 1GEGA 2R8RA 1NTOA 2MSLA 3EVNA 1GKLA 3NHPA 4B85A 4RFSA 1SZJG 3K53A 3REQB 1YGPA 3QNMA 3P4XA 3RRMA 3U17A 1BHSA 1EFVA 2QYOA 2DG2A 2H1WA 1XQ9A 3G2OA 4QJ3A 1ILWA 2CUNA 1QF7A 3KNZA 3FHLA 4R68A 1U6JA 1YR3A 3UK2A 2JHFA 2PH1A 2FWMX 3E9EA 3X0DA 1MO4A 4CEHB 1R0ZA 3A1VA 5LSAA 2VHYA 1DINA 3RF7A 2IYRA 1Q7RA 2DQSA 2TMYA 3T7IA 5CX4A 4CM4B 1C5KA 1JHDA 3AP3A 2Y1KA 3L1VA 2YV2A 3EOAI 4FWIB 5EZ5A 1H6CA 4YA6A 1AZLA 2CXXA 2C29D 4WK0B 1PF7E 3TIIA 2XQIA 3D4OA 4WV3A 5GV8A 5B1IA 3EZLA 3OAAA 2KE5A 3D6AA 2Q8QA 4H7PA 1XN4A 3D1VA 5JNUA 3VSDA 5K45A 3R2JA 5C8DA 3CVJA 5E2BA 3H7AA 1Y3CE 4EEXA 3PFBA 2NOAA 1QH9A 3FGOA 4KI0A 1GAEO 3EXHB 4M86A 6AT1A 2D0OB 1QV7A 4UTPA 1P0FA 3S0JA 2GCOA 1V45E 3ECAA 1K2WA 3NCHA 4QFBA 4L6IA 3VPAA 1GL6A 4P3NA 2O2JA 4ZJZA 3HXQA 1Q12A 2QN1A 3FBGA 2JJ1A 5G1OA 2CDNA 2AOWA 3UGTA 4DCPA 5LOVB 4TMZA 1OI3A 4C6TA 4LJAA 5A5VA 1I9CA 2O3SA 3GROA 4MS1A 4WASA 3IRUA 3UMSA 4K40A 2W8BB 3KSZO 1Z34A 1DFIA 4G4IA 1YUMA 2ZRHA 4G0ZA 1ZUWA 2UUPA 1CHNA 1X19A 2XJ4A 1NJSA 3MLBA 4MKRA 2FWBA 1FRFS 3O8NA 5CCDA 4UM9B 5BNIA 2ERCA 2V97A 5B55A 3GWZA 1XZNA 1X8JA 3AUUA 4J1TA 1LS6A 4B35A 4B8ZA 3WK7A 3LE8A 4FHDA 4HWPA 3GLFA 3W5JA 3H18A 3R3UA 4BNTA 3FROA 4F1JA 1AMOA 3R5KA 5BR1A 2FB9A 4F5YA 4AF8A 3P0FA 4E14A 1P61B 5ILOA 4NYMQ 1E4VA 1NVWQ 2N75A 2FR8A 3N2KA 1YDFA 3VU0A 4PNHA 5FOXA 2QP4A 4K7JA 6ADHA 1HRDA 3OSUA 1SB9A 2X2PA 2XF8A 2R8OA 2PKXA 3NC1C 7REQA 4E13A 2H4FA 3WV5A 2DULA 2YHUA 3F78A 4HUJA 2OBBA 1JQ5A 1XZDA 3CISA 1G8HA 1US8A 2ENWA 3S1AB 1NWCA 3PPIA 4YP6A 3H6GA 1PG2A 2BM9A 4IV5A 4EA6A 4EARA 4MUEA 4MRRA 4DXDA 1XPJA 2D59A 4LBWA 4INOA 2I76A 1X13A 4L6AA 2PWAA 2QD4A 4FFBA 4C4OA 3TCNA 5DEOA 3FMVA 3OPQA 3JYLA 2LRHA 1UXIA 4UVGA 1EUDA 3GFRA 1Z4NA 4QREA 3L9WA 4X20B 1EJ2A 3TLKA 2JGAA 4C14A 4FZJA 4KWHA 5G02A 4EJSC 1W85A 4HY3A 1D2GA 1UDBA 1ISRA 2CZQA 4RPJA 1CWUA 2GTIA 2L69A 4V0OA 3QEBZ 4KREA 1N6NA 1J5PA 2R7KA 4PTLA 3HTXA 5KWVA 4DRZA 2I1LA 1RKUA 1YOVB 4QPPA 1UBMS 3VPDA 4A8JB 1I4TD 2QZ9A 1UQUA 5JSZB 5IYZA 2JFBA 3IIKA 4UDXX 4E30A 3UJ7A 4HFRA 1UFOA 4OYRA 1EWYA 2BFWA 3NM6B 4QPCA 1VL2A 3A11A 2L82A 3O1IC 3ZW7A 2C2YA 1CFZA 3GRKA 1FMTA 4LWOA 5JSKA 1KERA 1NW9B 2ACKA 2BGIA 2FSSA 3IDQA 2X8LA 5L7TA 4NXNB 4XEUA 3D6HA 2P2LA 2M6KA 1UZMA 4HLUC 1P9OA 5AVOA 2DFLA 2HQSA 1E5QA 3CUVA 4YO8A 4JGBA 2BFMA 4L22A 1Z3CA 1SD5A 2W6CX 5KNCA 3VJMA 3DNFA 1KI8A 4JA2A 2CLKB 2MYUA 2EJTA 1LUAA 1XUOA 2WT4A 1W47A 1PCXA 2P41A 2WIDA 3BL8A 2OP0A 3DV2A 4IIYA 4QM7A 4Q03A 5B1HA 3O4RA 5GIPE 3LBHA 3FPHA 3RKRA 2OHIA 3ZZ0A 1BX0A 3JX9A 2ZFUA 3A1TA 4IIHA 4Y9RA 3FF4A 1TAQA 3RV4A 3VZCA 4BVEA 4R0NA 2IK8A 1YDHA 5CPBA 3OZUA 5BV1A 5LQAA 1Z28A 2XECA 1W7AA 3RABA 1Z83A 4N03A 2YJGA 4JT8A 4MDHA 5I7VA 1C9NA 4FNAA 2OHFA 3K4PA 3TLMA 1LK0A 3ZGVA 4FEYA 1RLIA 3KB1A 4Y6SA 1IAVA 3HSYA 2VWGA 3JQAB 5HIMA 4XIIA 1BCSA 3IDAA 1YS1X 3STYA 4MS4A 2AEJA 1B3RA 1GD1O 2H59A 4N5IX 4PR3A 4CDGA 4MZDA 4AX8A 5KYNA 2B1QA 4EOGA 3KQSA 3GGJA 4UHKA 1PSDA 3OIYA 1C9JA 4BO2A 2YOFA 3EPPA 4X63A 3TTXA 1KEEA 5T4FA 3CNLA 1ZITA 3VSBA 4AJKA 2A3RA 3DTVD 1K7YA 2GB4A 3B3FA 3ZNNA 3WLJA 3ADCA 1NDHA 1DKLA 1HDYA 4ZAVA 3OD5A 4ZODA 1RM4A 4S24A 3U3RA 1VPWA 1Q3TA 5LMNB 2I03A 4PCAA 4Z4IA 3GV0A 4Y2UA 5C8VA 1FYWA 3R5HA 3HJHA 1GKUB 3T3MB 3UPUA 1YRAA 3HEAA 4LNHA 2AEEA 1SZPA 1ZAKA 4TMKA 4EL0A 1T9HA 4HT3B 1UXOA 2QXYA 1II8A 2PAFA 3SM9A 5C18A 1KDOA 4DR6B 4M4SA 3I72A 2FW9A 5JVDB 2YNMD 2XCUA 2I1QA 1RJ9A 4EFLA 4ZYZA 3UUGA 1NI4B 1QORA 1C3VA 1EM8A 3HV2A 1ZMOA 2ERYA 3GFVA 4URZR 1ESDA 3KHTA 5EYPA 5TQ0A 3TRKA 5JS8A 1BGVA 3OCYA 1E96A 4YXWD 2V7VA 1XZKA 1NIPA 2W4IA 1R0CA 2HBZA 3BA6A 4M1KA 4N9QA 4HXEB 3L1IA 1COZA 4UJ3A 3PD1A 5AIBA 1LRKA 3NHFA 5EHIA 2ALJA 1JHUA 5C52B 2M98A 1OWMA 1N8SA 2DKFA 5HVNA 3KVOA 1XALA 1CIJA 1KFBB 2P79A 3AWDA 4DEYA 4LXQA 4Z2AA 5TIIA 4QDKA 1MB9A 2HTFA 4PS0A 3FOEC 3GA0A 1TVCA 3LYUA 5JJ5A 1U4SA 3A6FA 4V2UA 3ZVRA 2TS1A 4EJ0A 3HB7A 2ZI6A 1K7XB 1BTOA 1JA1A 1GEEA 4I4LA 3P7MA 4C87A 4D2IA 1V3UA 1ELOA 2BZSA 3NP7A 3B2EA 3ZHZA 4F1WA 1J1ZA 2WB2A 3X1YA 1DRVA 2IPAB 4KJZA 3WIEA 1LSJA 3SPXA 1VI5A 4RPKA 1Y37A 2HMUA 2JHCA 1CIPA 2PWZA 1G8PA 4OA8A 4QPJC 3MRXA 1M2NA 3H8VA 1PGJA 1E77A 3KLMX 1GQ2A 2BTQA 4RZHA 4AIRA 2EWMA 3RROA 1TDJA 4JLNA 1WW3A 4DCCA 2X0IA 3DWGA 3D8SA 3WFJA 5IABA 3L5OA 1XXHA 3P4YA 4CKCB 1RC8A 1G1MA 2A67A 1KEUA 3OG9A 2OMKA 4YMIA 5HF8A 2QX6A 4CW7A 4EF4A 1NSTA 3U9SA 4M99A 1BO6A 2V6BA 2B6NA 1XQVA 3WL4A 2Y6UA 1F9AA 1SXGA 5T8KA 5TGDA 1L8AA 4NCAA 4E46A 4P08A 3RSSA 3BJMA 3PJDA 1VQ1A 2QNRA 4OP3A 4PZCA 5AOAA 3ZHVA 3DCJA 2R6HA 3QOXA 4ZCSA 1LDYA 1F2TB 3I4CA 3NJRA 3UCXA 3AU8A 1U90A 3NWPA 1EXMA 3TPZA 1JJBA 3G7NA 1K92A 1SAYA 2OBFA 3ACBA 2YHSA 3ZGXA 4DJJA 1WABA 2VK4A 3K0CC 3BB1A 3LP6A 3HXTA 3B9QA 4MIEA 1FJ2A 5EIBD 1LSSA 5LPNA 4R1QA 1Y1RA 1NVKA 1KSHA 4OBXA 5E6SB 2AR7A 4XFJA 5LDDC 2GN8A 3EC7A 4TTVA 1XTRA 1ZGZA 3UCEA 2C4TA 3N2YA 4BDSA 5AQ1A 2Q5EA 4HQRA 4TMTA 1Y9ZA 2P1ZA 1CQJB 3V4SA 5K5EA 5C4MA 4Z2YA 1Y3DE 5EWJA 4OJYA 4XDZA 4S1OA 2A0FA 2GZDA 2NTYC 1WHTA 2Q2WA 1KIFA 2RDMA 2Z09A 4GC9A 3ZD7A 3OZVA 2V5AA 4BNUA 4N5LA 4W8HA 3X3HA 3ABRB 3G2IA 3WV4A 3L7MA 3TAHA 1PT5A 3FUVA 5IF9A 4NARA 1ZEMA 3W1EA 5FNVF 1KAMA 4NAUA 3HXKA 2BMDA 1QZZA 2Q21A 4EB8A 3F7MA 3P0HA 2YZNA 3I05A 3T4XA 4ZJUA 2KHZA 2V7WA 3EIFA 3L4BC 4DM3A 3A3YA 4F45A 5JH7A 4PSUA 2BP7A 3PDIA 4Q12A 2WJJA 4LBVA 5IAOA 1GLNA 3L1JA 5LVAA 3NHZA 4QTTB 4Z1MA 1UK8A 4UEWA 5F1YA 4BTLA 2WSBA 4LXIA 3IQHX 4RTJA 1XDSA 3I6QA 1XTKA 5KOIA 4P7GA 3VKHA 4D0NA 3TZEA 4DG5A 1FVXA 1FP1D 4AZSA 4AROA 1DAKA 2C2KA 5IJ9B 1U1GA 2VJYA 1QNLA 1KHTA 3QUCA 4MR9A 1NWHA 1QZXA 2MU1A 2PSFA 3WLEA 2HK6A 3QU9A 1M6VB 1XGKA 3GUYA 2I7VA 1HE1C 1MLDA 1Y8QB 3HC7A 4L4YA 1M0TA 1L7XA 2K7ZA 2ZIFA 3ADPA 4Y6RA 1PK7A 2D0PB 5JTUA 4RSGA 2E21A 3BJIC 3JD1A 2HJVA 1EE2A 1OB5A 1PV2A 2WM8A 4L0MA 1S3SA 2A9QA 3IKLA 1PE0A 2A0UA 4KSYA 3RG2A 3WDKA 4BIIA 2B61A 2RHWA 3PFGA 5J63A 4BEWA 1DC3A 3PNKA 1N0UA 2DGDA 3V8NA 3A1EA 2XLCA 3DE5X 2X9GA 2ZRGA 4AZ3B 3KB2A 1G20B 1T6XA 1U0NA 3GYBA 1GCAA 1T3SA 2IYLD 2XCQA 4HRYA 3HXMA 3RHSA 2E9SA 1U4OA 5HGXA 4RACA 3FNHA 3FSGA 3FZGA 3MFYA 2IV2X 1ZUNB 3ILVA 3RJMA 3RQIA 2VAVA 3SX4A 3UJNA 1FQKA 1GRVA 2J6IA 4IKEA 4R6WA 3AQIA 4ERNA 4PYNA 2ASVA 1DUVG 3MTQA 4W5TA 3KPYA 3AR2A 4HLNA 3UJDA 1R9JA 3KJIA 4C0HA 5BYKA 1W29A 2PGDA 2HGZA 3D2AA 4KFTA 3SFTA 4B4VA 3K5HA 3GA5A 2AXEA 3TW0A 2CHQA 4ER6A 5I9NA 5EUCA 1XP8A 1Z4JA 2ODEA 3TYXA 1JIVA 2Z8XA 2QL6A 1ZUHA 2Z08A 3HYCA 4M8LA 4R7GA 4X93A 3VGPA 3K8YA 4YRPA 5E7JA 3DL4A 4LJYA 1NFQA 3AW9A 2HA5A 3RODA 2C9BA 3VI3B 4EITA 2QGNA 2FEPA 2ZJ8A 1CVIA 5REQA 5K05A 2R6CA 4B1FA 4ZRNA 2BR5A 4KPGA 2VQSA 4GT1A 1QGDA 1R7RA 3AEUB 2V5VA 2LUOA 4EQ6B 3I01M 4YFVA 1QHHB 3E1KA 1YOBA 5F4BA 4ZCTA 5MN5A 4OXYA 1RMTA 1TVKB 2QV0A 3FB4A 4OHFA 4XE5A 3D43A 3DWIA 1U9ZA 4JU9A 1AKRA 2WAMA 1CC1S 2JI8A 4PCVA 1JIUA 4OB6A 5BSKA 4YC7A 1QMGA 2DBRA 3PUJA 4QTXA 4Y2GA 1FLDA 1JGTA 3DFMA 4O4IB 3LK7A 4BAUA 2OHXA 3WWEA 2C04A 3OFVA 5KWSA 1O9HA 1UJ2A 4IYRA 5G1NA 3SOZA 1K66A 4FZ5A 2QG9A 1S4QA 2YJZA 3GFFA 3CUEF 3O0DA 3QX8A 1U7TA 4X66B 1EBFA 1SZDA 2IH4A 3BIOA 2QGZA 3E7FA 3VSAA 1JQEA 1WQ3A 1RYDA 3EY4A 1AKUA 1R15A 3L7YA 2R62A 4P4GA 4NWIA 4YRIA 4BQRA 4UHJA 2ATIA 1PJ3A 1GSAA 3PGJA 1WULS 4EWLA 2AVNA 2NPFA 1EVEA 4BP1A 4X5OA 5A02A 3EPRA 1BNCA 3WZLA 1F2VA 4KU4A 1EUZA 2ENUA 2I4MA 3C6ZA 3ZPXA 1UBUS 2O3JA 3ZBPA 2V7XA 5G2OA 4BFSA 3U3KA 3TLCA 3O47A 2QW1A 1U6KA 3D6JA 1Z7EA 4WL0A 1TJPB 2XVXA 4F3TA 3O84A 1JLHA 2H8KA 2RHGB 4GUDA 5CLLA 4YT8A 5B6PA 1YFJA 3IS3A 4HH0A 4FINA 2D5IA 2Y0PA 2C3OA 2ZJBA 5B2EA 2ONYA 3HFRA 5DGTA 4KAXA 1DKRA 4JUFA 2WHQA 4MR8A 3AUXA 3MGCA 3GPLA 2AF3C 3AVTA 1YQ9A 1UBCA 4W9NA 3T7SA 5B3JC 5JC1A 5DI3A 2YHIA 4MPRA 5DTEA 5LA6F 2JIZD 2SECE 2H7CA 2Y1CA 3EUFA 2G9UA 4QYMA 4F97A 1RYFA 1DDGA 3D9QX 4LZLA 1MX1A 3SDBA 4JOBA 5IBCA 2HLNA 3HADA 3OIVA 4C9BA 2BKVA 4DHWA 2O19A 4LW8A 4KH0A 2FZVA 1D09A 1LX6A 2Q8NA 3KLPX 5JAMA 1IBMB 2NZUG 4U8HA 3UWSA 3FFBA 3RE1A 1H3FA 2XMQA 3E6AA 3HGQA 4KXNA 4JDPA 2MSEB 4KK3A 4EENA 4IXMA 3D3JA 2TMDA 1KTVA 5C1PA 3UB4A 3DPUA 4DAEA 4BASA 4CHTA 1P3DA 2N47A 3DOCA 2WMNB 3FWYA 4C76A 2J3IA 4V1CB 2BFEA 1MABA 2WUGA 3SIWA 2QR2A 1NTRA 1ZCZA 2ZJZA 1OQAA 4ERXA 2IYQA 3H8SA 2QX4A 1U1IA 3FNGA 3ILHA 3KEGA 4JOQA 1R6BX 2Z9DA 1JP7A 1U94A 3GX1A 4JI4B 4D9MA 1WBDA 4UNQA 4NBKA 2Q1XA 5JZBA 2QTBA 4F4HA 3L1KA 3PGKA 5H68A 2WWTA 3RSLA 4BFWA 5K3OA 2ZYIA 2MSNA 3E8XA 5HK8A 1VLMA 3LVFO 4ZRMA 4BB6A 1M2VB 2XDQA 3IPYA 4GZ5A 4DLRA 4EGCB 1P72A 1L9XA 1XEXA 4WCFB 3MN1A 3K1JA 1UBOS 3CY6A 4TSFD 5FOWA 5T5QA 4HAVA 4KHZA 1PJAA 3OC0A 3WNZA 3T1TA 2HBQA 3BULA 3HUTA 1MGPA 2IZ0A 3W7VA 1LKZA 2WIKA 2CV1A 1G9SA 1GQSA 1VCMA 5C3MA 4OHXA 1FUEA 1I24A 2Y0BA 1C8BA 3EEQA 1ODSA 3JARA 1CPYA 3TZCA 3EMBA 3UJPA 5FWXB 1XAJA 4UZEA 1F60A 4X45A 3FSEA 3CLTC 3A8TA 1N1GA 3SS9X 3PC8A 3TBHA 2QMYA 3CLUD 3I34X 5JFOA 1UC5B 3D6VA 4YGXB 4U2BA 1M2KA 3I2KA 4LE2A 4GI5A 2XXJA 4A0RA 2CNLA 1YKSA 2BM0A 1NRXA 2EIHA 4X8HA 3FMFA 4CM8A 1ICIA 1ZXLA 4O4HA 5EN4A 1UEXC 5JRZA 5IDXA 3K5PA 3VRHA 3D4IA 5DVZA 5IVKA 4HDNB 1ECGA 5D5QA 4DB4A 4YNBA 3CGWA 1J2YA 1EWRA 3ICWA 3PX2A 4HLQB 2QSZA 2H2WA 3R5TA 4RA6A 3L4KA 1N8KA 3KEFA 1DUIA 3OPNA 4MPJA 3K0KA 2EG5A 5TF0A 1GZVA 2PE5A 821PA 2VJAA 5AVKA 1T2EA 2PZAA 4KX5A 1AA9A 3AESA 2G3YA 2DKOA 3UW3A 2X4IA 3KXIA 3HY3A 1HZJA 2E4UA 1M1NB 3FSRA 3G88A 3C3DA 3O9VA 4FD3A 4JLPA 1RHQA 4ROTA 4MK4A 2X9VA 3GLHA 2JGKA 1JHZA 4E2ZA 1UMKA 3OSZA 5EE3A 1X7WB 3RM3A 5K7SA 5JDCC 4NP6A 4BVLA 5M5BA 1VMIA 1AQJA 5JD6A 1H1LB 3PD0A 2ZQ5A 2H1SA 2JGFA 2I3BA 2VDJA 3OUZA 4MUFA 4E88A 5JV5A 4LXGA 3SZMA 2R1ZA 5EE1A 4ZHQF 3OQBA 5EJMA 1RYBA 4EIWA 3P9QA 3RYTC 2F3TA 4RXMA 1RZRA 1T1EA 2LZ0A 1GZSA 3D7MA 2FE1A 5E7QA 1TU4A 3U40A 3QUBA 5H0IA 2O6HA 2DWCA 2FOXA 1U1CA 4O5OA 4K9PA 4Y1RB 3ER9A 2GK7A 3IDOA 4IHJF 2ZYUX 5IK2A 3FHTA 1FFHA 1RWXA 3OLCX 1TTPB 4K26A 3R6TA 2VDQB 4FC6A 4OCZA 3FUXA 5J4YA 1X7ZB 3C3YA 1GPJA 5KBYA 1IE3A 1WBBA 4TL6A 5FV7A 1Y7IA 3TMAA 3IHKA 5EE0A 1UAGA 4QBHA 4RSHA 4WOJA 3M4JA 1NU8A 4RQTA 2OHJA 3GLGB 1QXSA 1ZUIA 2X5NA 3KBBA 4N3GA 4GWLA 2CT8A 3H19A 4YWJA 4E07A 3LIIA 1RPJA 4DFDA 4PC1A 3CCBA 4QODA 2WP8J 3AUSA 1G0NA 4ZVTA 2NU8A 4CMEC 4DLYA 2Y1WA 3AY0A 3C74A 5AVXA 1KEKA 2EKBA