1D2HA

Crystal structure of r175k mutant glycine n-methyltransferase complexed with s-adenosylhomocysteine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
252
structure length
252
Chain Sequence
b'TAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINE N-METHYLTRANSFERASE
molecule tags Transferase
source organism Rattus norvegicus
publication title Mechanisms for auto-inhibition and forced product release in glycine N-methyltransferase: crystal structures of wild-type, mutant R175K and S-adenosylhomocysteine-bound R175K enzymes.
pubmed doi rcsb
total genus 65
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 1999-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1d2hA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1d2hA02
1JG1A 3A27A 3V8VA 5EQJB 3M6UA 3OU2A 1JG2A 4A6DA 4EKIA 3EVCA 5EKUA 1EG2A 4MQ4A 5E9WA 3G2QA 3T7RA 4GOND 4E30A 5EKXA 4RTNA 3MTIA 4XCXA 4YUZA 5MHTA 2I62A 2OKCA 5EPEA 4HRAA 3HNRA 2PWPA 3MTEA 4CKCA 2P3OA 3RIEA 1KYZA 3O31A 4AZTA 4DKJA 4K6MA 3P9CA 1SQGA 1F38A 2JG3A 2NXEA 5E2AA 1WZNA 4V0QA 2JHCA 2WA1A 7MHTA 3E05A 1XCJA 5EEGA 1KIAA 4QQKA 1T43A 2QYOA 4U7PB 3UZUA 5K0GA 3P2KA 4MIKA 1FPQA 2XYRA 2PSSA 3M6XA 3MAGA 3PT9A 2WA2A 5C0OE 5FTWA 3UJDA 3KPYA 3JWJA 4RVGA 1NV8A 2Z6QA 4RTKA 3LDGA 2IBTA 1ZGJA 4IV0A 1XDSA 5FWDA 2BR3A 4XUDA 3TLJA 5DX1A 3BWMA 1JTEA 1NW7A 4XUCA 3E7PA 2ZWVA 5EOVA 3KU1A 3SSMA 3DMGA 4OA5A 3P2IA 1MJFA 3NMUF 1YZ3A 2OZVA 5GM2A 4DMGA 1X19A 3C3YA 3CCFA 4C05A 2EX4A 2XVAA 3HM2A 2FK7A 2H1RA 3JWGA 3KR1A 2O57A 4RWZA 3UFBA 5GOZA 3FUVA 2YUIA 4P58A 4ISCA 5HIIA 5T64A 3GRVA 4C03A 5E9QA 5D1HA 5DTMA 1JG4A 1Y8CA 5CVJA 2PT9A 3TKYA 3FTEA 3VYWA 5LQUA 5P8WA 2IFTA 2O0LA 3HCCA 5CM2Z 4OQDA 2C7RA 2BR5A 3CJRA 1NKVA 3EVZA 2QRVA 1VBFA 2FHPA 3G7UA 3GWZA 3LHDA 3KKZA 5FQOA 3C6KA 4F86A 3M6VA 3T0IA 1RJEA 2VDVE 3FPEA 1UWVA 4HG2A 1G60A 2G70A 2GA9A 3ANXA 3AY0A 3FRHA 4R6XA 2UYCA 1RJFA 1QAMA 1ZG3A 3KQSA 1D2GA 3IEIA 4KRGA 2QM3A 5DXAA 5K0EA 3V97A 1AF7A 1X1BA 3U81A 1EAMA 1PRYA 1Z3CA 2BR4A 4BLUA 3BGVA 3TFWA 5EMJA 5M5BA 3GJYA 4O29A 3NJRA 3EEOA 2YXEA 5DPMA 2P8JA 3D2LA 3G2PA 3LSTA 2PKWA 5LQKA 9MHTA 3G2OA 5HIJA 3EPPA 4XUEA 3HVHA 3KHKA 1KR5A 2AOTA 3CC8A 1VLMA 1IY9A 1YB2A 4GUAA 4RVFA 3VC1A 4HH4A 3A7EA 3M6WA 4KDCA 4ER3A 2UZ4A 2FRXA 3EGIA 5H02A 5DX8A 5FWAA 5KQSA 2VDUE 3T7TA 4GEKA 3KR9A 2JH8A 3DULA 5EVJA 2Y1XA 1EJ0A 4Y2HA 3C3PA 3O7WA 5FUBA 4PONA 4PYNA 2AS0A 1YUBA 3LECA 3TKAA 2HMYB 2PX2A 2R3SA 2ZSUA 3NDIA 4HTFB 1MHTA 2ESRA 3R6TA 3GRUA 1TW3A 3NVKI 4FP9A 1IXKA 1VPTA 2ERCA 4FR0A 4HTFA 5KYGA 5CVDA 3VC2A 5CD1A 2IPXA 2XYVA 2ZBQA 4FGZA 5EHGA 1R6AA 4IV8A 5DM2A 4DZRA 3E23A 3G88A 3NVMB 4U7TB 1KPHA 4E32A 3FTDA 2PGXA 5DWQA 5GIPE 1H1DA 2YTZA 4OBXA 2EFJA 1SVUA 2P3QA 4KW7A 4DCGA 5HEKA 3E8SA 2B9EA 4PGHA 4HGZA 2OYRA 3GDHA 2CMHA 1BOOA 3TRKA 2Q41A 3LX6A 3P97A 4MWZA 4ER0A 3PB3A 2NP7A 1WS6A 5K0CA 4GC9A 4M37A 3SGLA 4PYMA 5EZSA 3VSEA 3NWEA 3EVBA 2ZFUA 1R8XA 1DUSA 5KQRA 5C9ZA 3M70A 2H00A 3GRRA 3MGGA 3KPJA 1I4WA 1KP9A 2JHAA 5ERGB 1NW3A 5KS2A 5KVAA 4QPPA 2YXDA 5GINE 5LQNA 3UA3A 4C04A 2JJQA 1FJXA 4GBED 1R00A 3KPWA 3P9IA 2PX4A 3FTCA 1IM8A 3FPHA 3UJ8A 2HV9A 5BW5A 3FTFA 3KQWA 4M36A 5E9JA 2ZBRA 2IDKA 1R74A 2GLUA 4PGGA 2QE6A 3MQ2A 5K0LA 1KPIA 4FSDA 5FULA 2ZZNA 3ELUA 3NTVA 3ELWA 4MTLA 10MHA 2HWKA 3OCJA 4OQEA 4PYJA 5EGSA 4R05A 1DL5A 1XDZA 2F8LA 3AXSA 4KIFA 2ORED 4X61A 3B5IA 5DTRA 3SX0A 3BZBA 4AZWA 5IH3A 3GRZA 1YF3A 3REOA 2BH2A 5K09A 3JWIA 1VIDA 4Y30A 2OB2A 1WY7A 5U4XA 3HP7A 1UIRA 3KPVA 4H0NA 1R18A 5FADA 2ZTHA 2DULA 3LL7A 4KIGA 2I7CA 4ER6A 5K0JA 1BHJA 1VP9A 2XVMA 3I5UA 1DCTA 1O9GA 1QYRA 3HVIA 4M38A 2OO3A 4RTMA 2EG5A 1TPYA 4LG1A 5D1NA 2ONZA 1VP3A 4GF5A 3UA4A 1RJGA 4C08A 3GIWA 3OZRA 3I58A 4RVDA 2N47A 1UFKA 4CTKA 4P7GA 3L8DA 5DM4A 4PIPA 2FPOA 3B3GA 4QDKA 1M0EA 3DLCA 4C07A 3OU6A 5EG5A 4PYKA 5EZQA 2IP2A 4AX8A 3SR4A 3AXTA 3B7PA 1RI4A 3G5LA 3ORHA 5GWXA 2A14A 3FUUA 2G72A 5CVEA 3HCAA 2OPBA 2QY6A 2P3LA 2PLWA 2PXCA 2YVLA 3GNLA 3OFJA 4AZSA 4E70A 5ICGA 4HSGA 2NP6A 3OU7A 4RTPA 1SG9A 3PLAE 1INLA 2AOWA 2BZGA 4B17A 2AN4A 4BLVA 3HTXA 3LBYA 1JG3A 2PVCA 5K0FA 3NW9A 5LR6A 1P1BA 3LCCA 1O54A 4QDJA 1U2ZA 4QPNA 1JQDA 1NBIA 1JSXA 4YV0A 3Q87B 2C7PA 3CGGA 3ERCA 1XTPA 3LDUA 4AZVA 3DR5A 4EKGA 2OBFA 3UJ9A 5JUWA 3OPNA 1O9HA 5CCBA 2P7HA 2Z6UA 2NXCA 5DM1A 5EEHA 2ZIGA 3TOSA 4RTRA 4IWNA 5LSAA 2C7OA 3THRA 4PNEA 3HVKA 4PYIA 1XXLA 3GCZA 3HA7A 2Z6AA 1NE2A 1L3IA 3GO4A 4Z2YA 1AV6A 2PJDA 4A6EA 4QTUB 1EJ6A 1ZGAA 2HTEA 2V7EA 3AJDA 3R3HA 2JH9A 1JR4A 4CKEA 3HEMA 4KVZA 4ATNA 3EMDA 5FHQA 3TM4A 1NT2A 1WXXA 4OX9Y 5DM0A 3TPZA 1G38A 3M33A 2I9KA 4MHTA 3LDFA 2ZVJA 3R9XB 5FA8A 5IKMA 1P91A 3G2MA 4P7KA 2FK8A 1I9GA 2NNWB 2PX5A 3HVJA 4X60A 3UWPA 2VS1A 3FUWA 4L7VA 4F85A 4RTJA 1G6Q1 2XYQA 3KR2A 2AOTB 1N7JA 3OE5A 4WXHA 3GGDA 3A7DA 3SSOA 5HZMA 2GS9A 3EVAA 2NXNA 2CKDA 3Q7EA 5EIWA 5EMMA 5HIMA 2AN5A 2CWWA 3A25A 3I9FA 3IV6A 4GQBA 4HGYA 5E8RA 5DSTA 4PIMA 2VDWA 1M6EX 3LKZA 3P71T 1XVAA 3A26A 3NDJA 3TR6A 5T67A 3UJ7A 4RTLA 3GXOA 2JHPA 1FP2A 3CJQA 3F4KA 3I53A 3FUTA 1YFLA 4FS8A 2AOUB 3PS9A 4BY9E 1P39A 1SUIA 4E2XA 3ELDA 5K8VA 2P35A 2AR0A 5DT2A 5BP7A 2B25A 2UYQA 3TQSA 2ZIEA 2H11A 2AZTA 3EVEA 3KPUA 2OXTA 5G02A 1KYWA 4YMHA 5GIOE 2YXLA 2B3TA 5F2OA 2ZBPA 3LBFA 3KQPA 4PINA 1P1CA 4DQ0A 3BUSA 5K0BA 1NW8A 3KQMA 4PYQA 2WK1A 3DH0A 5FA5A 3EEYA 2G71A 5F2NA 1RJDA 2EJUA 1AQJA 4UOEA 5K03A 5ICFA 3OZTA 2CMGA 3DOUA 2P41A 4NECA 4QVKA 5CUQA 1VL5A 2AOVA 5FQNA 4GOOD 2AN3A 4JXJA 5E8JA 3LPMA 3P9NA 5EIFA 3DMFA 1Q0SA 5LQJA 2AOXA 3OZSA 3H2BA 3C6MA 1BKYA 2ZZMA 1NBHA 2PY6A 3GU3A 4CXMA 1RI5A 2O07A 4X41A 3PX2A 3B89A 3DXZA 5DSXA 2FYTA 1G55A 4KWCA 3HCEA 3P9KA 1KHHA 3G8AA 5CVVA 5LQRA 2P1DA 1L9KA 3EVDA 4OBWA 4X63A 3S68A 3R24A 1SKMA 4YV2A 3B3FA 2IIPA 3GRYA 1X1DA 2B2CA 3K6RA 4FT2A 4GOMD 4C06A 1ZKDA 2ZULA 4P7JA 3OFKA 4FSXA 4YUWA 1N7IA 4YUXA 3ME5A 1ZQ9A 3DTNA 4RTSA 2ZWAA 1D2CA 3FUXA 2IDJA 4RYLA 1D2HA 5K05A 4V0RA 3KQVA 1QAOA 4G56A 4E2ZA 4RVHA 1Q0TA 5EMLA 4PWYA 1BC5A 2ADMA 2O06A 2IH5A 2GB4A 1XJ5A 3FYCA 4EMSA 2HNKA 2O05A 3EGEA 3SMQA 4AUKA 2IH4A 3EMBA 1NV9A 3SXJA 2XBMA 5FHRA 5C1IA 3ER9A 3HA3A 3BGDA 2VP3A 5E1BA 4GC5A 4RTOA 1HMYA 1I1NA 1TW2A 2UYOA 5DTQA 3A4TA 3BGIA 1F3LA 1AQIA 1L1EA 3FPFA 2AVDA 4R8RA 4R6WA 2C7QA 2DPMA 1JQ3A 4YUVA 4IKPA 3SVZA 4EK9A 2G1PA 3QOXA 2R6ZA 3BWCA 3IHTA 2BM8A 3X0DA 1ZHFA 3FPGA 3KR0A 1FBNA 1NW5A 4QTTB 3UJBA 3BT7A 4RTQA 3UJCA 4E31A 1R8YA 3HCFA 4P7FA 3BWYA 1G8AA 2BM9A 2ZW9A 4YUYA 2IBSA 2FCAA 5GM1A 3UJAA 4LWOA 3UBTA 4EVIA 2AVNA 4RX1A 5HOQA 3MERA 5DXJA 3MCZA 3QOWA 4FT4A 3BXOA 4KDRA 3LKDA 2OY0A 3CJTA 5E1MA 5LQAA 5DRYA 1L3BA 5CVUA 3DMHA 3EGVA 3JWHA 3BKXA 2IGTA 3DXYA 1FP1D 5JR3A 1OR8A 4PYOA 3UJ6A 1EQAA 1SUSA 1X1AA 2I6GA 3MB5A 4FZVA 5E1OA 3SSNA 4EQZA 2GH1A 3G8BA 3PTAA 4E2WA 3PFHA 3DUWA 3O4FA 3RODA 5LQCA 4YMGA 1B42A 4QVGA 3CKKA 4PCLA 3M4XA 5ICCA 2ZZKA 4RV9A 4BLWA 4C4AA 3EVGA 3NWBA 4BP1A 4CWAA 4DM3A 4PYLA 4ZTBA 3TM5A 4YV1A 2OB1A 1JTFA 5CIYA 1KXZA 3QV2A 2GAFA 3ER8A 3ELYA 4RSRA 3G89A 3ID6C 3PVCA 4HC4A 5HFJA 3WSTA 4BP3A 2G8NA 3FYDA 2PXXA 3BWBA 3PFGA 3KQOA 5F2KA 3DP7A 2VZ9A 5FCDA 4E2YA 4CKBA 8MHTA 2E5WA 2HR1A 4ER7A 2CL5A 1QZZA 5BXYA 3G5TA 3FPJA 1JQEA 3LCUA 2PV0A 3P8ZA 5K01A 1NW6A 4POOA 1RI3A 2YX1A 3DLIA 3I64A 5DLYA 1XDUA 3K0BA 2PT6A 2NXJA 4E33A 2P40A 3CBGA 2NYUA 5BW4A 3EVFA 1JSZA 5T6BA 5GP1A 3HA5A 2Y1WA 3BKWA 4PCAA 5EC8A 3C0KA 2B78A 3KQYA 5ICEA 2LD4A 1WXWA 1EIZA 5E1DA 5HILA 3MHTA 4GOLD 3KQQA 3T7SA 1PJZA 4DCMA 2AOUA 3PX3A 4WVLA 2P7IA 2ZLBA 4X1OA 2IH2A 4DF3A 4LECA 4ER5A 2K4MA 2PXAA 4F84A 3KQTA 1YFJA 5E2BA 5EMKA 4OA8A 2YR0A 3HCDA 3R0QA 5DX0A 2PX8A 2GPYA 1RI2A 1XCLA 5HIKA 2KW5A 2ZCJA 3LCVB 1L3CA 3MCTA 2V74B 5K0NA 3THSA 5EHIA 3FZGA 1HNNA 2UYHA 1RI1A 3CVOA 3FRIA 3P2EA 3DXXA 1QANA 2PBFA 1YZHA 3OE4A 3RW9A 1SQFA 4R8SA 1VE3A 4CTJA 1ORHA 3TMAA 2ONYA 5DRTA 3HCBA 3IYLW 3B3JA 2QRVB 5CCXA 1M6YA 4QQNA 1WG8A 2ZIFA 5B1SA 4DA4A 4M7RA 1G8SA 1ORIA 4LWPA 2YQZA 3AWIA 3LGAA 1QAQA 1VQ1A 2EJTA 3SM3A 2PWYA 1N2XA 1X1CA 1V39A 1KPGA
chains in the Genus database with same CATH superfamily
1OFHA 1GXSB 1T0PA 2J6HA 2PMKA 2WUFA 4LDNA 3V34A 1V95A 2B21A 1KIMA 1KI4A 2IGBA 3JQ9C 3HKDA 3I04A 3C8MA 3LDHA 4G5QA 4XCVA 4YMWA 1GLGA 1Y3IA 2FEMA 1ZM3A 4LNUA 4YUZA 1RWKA 4ID3A 1KXJA 3QXJA 1QIFA 3A2MA 1NG1A 5C7OO 5CB6A 2A67A 1X7XB 2JHCA 3QPDA 1U28C 5A5VA 3F4LA 3RAEC 3A6DA 3VYTB 3BG5A 4UNQA 5A5FA 2ZT6A 5DTIA 3F6CA 2PUEA 4MEJA 1QP8A 3IVMA 3VTKA 2F4VB 1VIYA 4CG2A 3X1YA 3JWJA 3GPLA 5FBWB 3KEMA 5MF6A 3D64A 4IUCS 1CQZA 2Q6KA 1ZGJA 3GLIB 4BO4A 1YCHA 4XUDA 4YECA 1NW7A 1S2NA 3K2BA 4LK3A 1ILEA 2PJRA 5DLDA 3NMUF 2NZUG 3N7AA 1CXZA 4OJQA 3SBDA 4EG7A 2IEYA 1I4TD 3VGJA 4FJ1A 2E1PA 1OA1A 1FXWA 4PYRA 3ZNOA 4GVXA 4CIBA 3KR1A 1BRMA 5K8TA 3DTYA 3O84A 4DBLC 2YUIA 3E9QA 3EVNA 5HPYB 1TA0A 1N2ZA 1ZOPA 4GWGA 3PITA 3VPBA 5B53A 4JFRA 2HD4A 5JHGB 2E4YA 3ZIAD 1EE2A 1CQJB 1THZA 3OEHA 3DBLA 3I0NA 5AI6A 3MSCA 3VR3D 3QEMA 4BFCA 4JCCA 1QRSA 1GFWA 1CZUA 4KQMA 1ZXLA 1N1EA 3D2AA 4Z4GA 5ANRB 2BR5A 2HL6A 3CJRA 3G5AA 4BMVA 4U7FA 1TTTA 4IXNA 1X7DA 3FMFA 4BAUA 4B7ZA 2ZI7A 2H1SA 3GZTB 2PMCA 1KJNA 2XB4A 1U3VA 3BD6A 3LRXA 2DPYA 3AILA 2F7SA 2CFOA 4XEHA 3OPVA 4L75A 1YSCA 3NASA 3W5DA 1UZNA 1PW7A 4CM7A 1Z3CA 2GMWA 2UZ1B 3FF1A 2FE1A 1JDBC 3CW8X 3T52A 3DYBA 4ZEMA 3TQFA 1GDHA 4BNKA 1O5TA 5LU9A 1OWMA 2X77A 3KQLA 4F3TA 3NRCA 3G2OA 1XV5A 3E7FA 3DKPA 2JIZA 3EPPA 3WDLA 1E3TA 1F1BA 2C7OA 2E5LB 1PUXA 3PSAA 4M89A 3QFTA 1KQOA 4MCHA 2DCMA 3AR4A 4ER3A 2ODTX 1GL9B 4ESVA 1FW8A 2AMLA 4QX6A 3HKEA 2Q5CA 4JBHA 3OM9A 4XE5A 1YDFA 3DKRA 4Y2HA 4A0SA 4JP8A 3L6RA 3ZDEA 1V8PA 3LECA 4GI3A 4YHBA 4RIGA 1G3QA 3EPLA 1KEZA 1TW3A 2IHVA 1P9OA 2QD2A 2XTAA 3CZ9A 1W5SA 3KDPA 3NNSA 2BLLA 5AUPB 2J9XB 1VHWA 3CZMA 4O6VA 4OM7A 1E1QD 2VEDA 4IKEA 1XNHA 1V16A 2I2FA 5KI6A 4XR9A 1U8YA 2QR5A 2AFHB 4G1UC 2RH4A 5CR9A 3VNQA 4GD3Q 1SA0B 3ND5A 3FTDA 2OFXA 1OYYA 2ZIAA 1C8VB 4ZVLA 1PT8A 1TAQA 3N2LA 4LXUA 1E7QA 4P5DA 1NDQA 3W90A 2CHGA 1SHKA 1UXOA 3D6VA 3W8RA 1Y5IA 1O57A 4DYVA 4YDQA 2JIOA 3CUUA 5DNYB 3WLPA 3L4BA 3QTTA 2ZJAA 4PN7A 2Q41A 2YWCA 4I5DA 1YU9A 4BL5A 5K0CA 4Y9TA 3DKKA 4BB9A 3OFVA 3ORSA 3RVBA 1N2BA 3PQ4A 4CG0A 3NWEA 1Z4LA 4XB6B 1EPUA 3DB1A 3BEDA 1PZEA 1TZBA 3M70A 1GQRA 2L2QA 2PGLA 3ZUPA 4BVGA 4FYJA 2MSLA 2EKPA 3LQ4A 5J58A 3MT9A 4YRPA 1KNQA 4N03A 2ZJ5A 4FMDB 3H0EA 3EH2A 1EGMB 4KWTA 5GQSA 2HF9A 2OLKA 4WTOA 3AV0B 2FG6C 2G0TA 5AKEA 2MR6A 5CDFE 3GNSA 1PL7A 3N74A 1CIJA 2V45A 5HJ2A 2JB9A 4KQFA 3HEAA 1G7TA 2G1UA 3AJ9A 4D81A 1Y8AA 4DIDA 2VFAA 1W581 4DGQA 3WS7A 3IMCA 5AVOA 4BB6A 1KO4A 5A7FA 2PGNA 1F0PA 3B1VA 1P5ZB 2PIDA 1XOIA 2W6QA 3BZBA 3KTDA 1F6WA 5HWSA 3TQTA 1N78A 3VYRB 1JEDA 1SC6A 2DQKA 1E2MA 1H65A 1VI5A 2JZOA 5DIFA 2OD9A 3IE0A 4IVPA 3E4DA 4KAFA 2EFGA 3FNIA 3OIWA 3PC8C 2MSWA 3JS5A 2P9BA 1CW2B 3KZNA 4DLBA 3VKGA 1P2VA 2H7VA 2CLFB 5EWJA 3KHTA 4WXPA 5JU6A 3LD9A 2RHMA 1UK6A 4EI9A 3AL2A 1K6IA 2ONZA 1VP3A 4IGAA 5K8JB 3Q2OA 1H8EA 1GZHB 1LH0A 1XZNA 2QUHA 1SCAA 3D7RA 1GZDA 3D6AA 4C3VA 4BQEA 1AHIA 4MRMB 4X3OA 2APJA 3NIWA 2C3YA 3ZNPA 3S2IA 1RABA 5DW3A 2RBGA 3EXFA 3RSOA 4YPFA 4UUAA 5GWXA 3QPUA 4KQWA 5CFLA 4OOEA 3V1KA 5MGNA 5TIIA 1IJBA 4YO8A 2PLWA 2P3LA 2IV7A 3IIIA 3ZV5A 4F4DA 4OHBA 4DDKA 4YCLA 3QF7A 5JRZA 3LKVA 4C43A 1NUUA 1ECBA 2G8LA 3FGZA 3GT7A 1HFJA 5L51A 2G6TA 1S4MA 1SIOA 5C1BA 1P81A 2XRZA 3WLEA 1JQDA 1NBIA 4J7XA 1PQUA 1ND6A 4L4SA 2GKOA 4ND8B 2D7JA 5DF1A 3M5CA 4ZHQF 2BEVA 1OC4A 1VLLA 2HRDA 1P1RA 5LKAA 4QPCA 2VF4X 1H23A 2PDAA 2PX0A 4C6SA 5JPDA 1YA4A 1Q3TA 4JI2B 1XXHA 2FG5A 3K8ZA 3HKBB 3DZJA 2BHRA 5FPHA 5T7BA 2Z6UA 1KU0A 1ZC3A 1MXHA 2YDXA 4M0PA 4P83A 5HE8A 4Q9AA 1JSLA 5MHTA 4RZQA 3CN7A 2ZREA 2RGNA 1TVEA 2VBCA 3HXTA 3B6KA 1T25A 2QU8A 1X7GA 1OLXA 3A1UA 5BUCA 2HCRA 2P5SA 5K3DA 2EX0A 1NUQA 2V7BA 3V7UA 4G0UA 2VXOA 3D3WB 1CQXA 1G38A 5FP0A 2YJZA 4J16A 1BDJA 1Q1QA 1ZN8A 3QUSA 3HFGA 4KNYA 1NN5A 1BGXT 1FDUA 5A05A 5AI8A 3GXBA 5AHWA 2QN2A 4F2HA 2CXHA 1ZRNA 4MUHA 4O4IB 4IVNA 2AOTB 1ONPA 1UMKA 1UT8A 2C4VA 3A7DA 3L0SA 4KFUA 4L5IA 1K9VF 2XCUA 1J0EA 2YUTA 5EPUA 4BWFB 1QKKA 4WJLA 3ZGLA 1D4OA 4JLPA 2J8ZA 1HT3A 5ICFA 3SC2A 3ZHSA 1XTUA 3DWFA 3TSWA 1YMQA 5AKXA 4KR3A 4J4BA 2QLFA 3DLBA 5DEIA 4I50B 3UJ7A 4EFLA 5I01A 2JEOA 3HCRA 2HQOA 1U0NA 4JUIA 2ZRLA 1B3RA 2AQ8A 4QFCA 1TFRA 4HPWA 2JHPA 1V5IA 1JIXA 4FI3F 2IVZA 1Z37A 4MKFA 3A3PA 3NO4A 4HPXB 5AKLA 2WWVD 1WPQA 1YFLA 3EVTA 1YH3A 1P4JA 2QQGA 2WIDA 4QHYA 5I3ZA 5K3OA 2VBIA 2VT2A 4L27A 5HKKA 3N0TA 1IY1A 2R47A 4YMHA 1RAFA 5EFOA 4K3UA 3ILSA 1P1CA 3LLCA 1UMCA 1RJ9A 9ATCA 3QLVC 4YBZA 2WR8A 4Q02A 1CX9B 3OFNA 4OL0A 2QEQA 4NCNA 1XFDA 4NBUA 3S2UA 1DQZA 3WE7A 4A92A 1KYQA 2Z2XA 3FMVA 1FYFA 2AG1A 3OZXA 4L5JA 2WHPA 2VBFA 3DOUA 3O83A 2F64A 4LHVA 5TNXA 1UMBB 4DRYA 2AXEA 3MOGA 2O4UX 4KWHA 1K2WA 3SR3A 3WOVA 4S3MA 4BWVA 2FI1A 1NP6A 3D7KA 4HJXA 5AOVA 2W8ZA 3P9NA 1JPNA 4TV8A 5EIFA 3DW1X 3NG1A 4RK7A 2HMWA 5GV7A 3GDWA 4JD5A 4U7GA 3RVOA 4AG6A 1I4LD 2M32A 4WBXC 1AVTA 5BWMA 3WRYC 4X94A 5BRAA 2OGTA 3RVPA 3L7JA 4S1NA 1EGVB 2NVUB 2YMLA 2Y1OA 3MG9A 4N1AA 3T54A 4HCJA 2BKAA 4BNJA 1GTL1 4X63A 2E48A 2IYEA 3O3MB 2NTEA 4WZAA 3UMCA 4QGGA 4BGUA 4P3NA 3L93A 4L15A 5IJXA 1VJ5A 3A37A 3F9RA 3QVWA 2F00A 4JENA 1I2ZA 1TUGA 2B5WA 3AEQB 4MTCA 5HFAA 3OETA 4CODB 3ROGA 2H3HA 1FQKA 2RGEA 3C85A 3IQIX 1MFZA 4IJQA 3SHQA 3W1WA 2IH5A 1SCNE 4ALJA 5L6MB 5AVZA 4U3JB 3SMQA 1V7QA 1VC2A 2W43A 4KI7A 1GWNA 3OX1A 3SC6A 4Y9SA 2IXBA 3WGZA 4AZ3A 3AG5A 3GUHA 4XDYA 5K2MA 3T34A 2QMUA 4DJJA 4PVDA 2IU0A 1RM0A 4Q18A 2P9JA 4QIHA 1US8A 1XI2A 2P0YA 3ZGZA 1GPNA 1D04A 1LXCA 1TT5B 3BBPA 3FPKA 3PUKA 4Q37A 1T0JB 4UD6A 1YJQA 1Z7GA 2C96A 1NHGA 1F2UB 2ETXA 3H2IA 3V2IA 2OD7A 5JJBA 5KVVA 1CR4A 3KB8A 2J4FA 4TYWA 4DXAA 1DAEA 2WHXA 3IHTA 3T5CA 3U4HA 1KDOA 1MTZA 2IH2A 4NQZA 2JKZA 3R5HA 2GHQA 3NUZA 2BI8A 4HDOB 4RXTA 4DG5A 3T99A 1ZOLA 2P2ZA 2C61A 3LQ1A 4TRNA 2I80A 5IAGA 1BU8A 3S2SA 3VKUA 2PHZA 4FBMA 3W6PA 4QJ3A 5JY6A 4LGCA 4PFSA 4PTZA 1ORTA 1TADA 1VMAA 2OQRA 4M1EA 4TRJA 4EVIA 5BQ5A 2X5KO 5AESA 3V8RA 1JIVA 4RH1A 4AKIA 4C7JA 1JQLB 3H11A 3D31A 2E4VA 4UHFA 4UDNA 4WT7A 4PPQA 2E0IA 2WV7A 1VBNA 1QKJA 4O4LB 5CVUA 4CQJA 1VPWA 1WOMA 1FP1D 5K4AA 1COWA 2B8TA 1HRKA 2J7PA 4FOOA 1DC7A 3LT0A 4NS1A 5BO5A 2Y0BA 3ONWA 3TK1A 2ECQA 1GYQA 1P4HA 3UNXA 4PF1A 1P7CA 4Z53A 1QMGA 4ILEA 5B58T 3O8NA 2ZUSA 5KHAA 1QYIA 3C8ZA 3DUWA 1Y80A 4I5EA 1GDDA 2NUPB 2BHTA 4FZRA 3UH0A 4QVGA 4EKYA 3OWXA 4IJKA 3OQNA 3ZCQA 2VQEB 3A6EA 3C5HA 1IZZA 4PTYA 2WOJA 2IPNA 2OQIA 1FFCA 1QQ7A 1CZOA 3ITKA 1R4AA 1W4RA 1NA5A 1Z75A 2FETA 4HQLA 2QG4A 2F3RA 4XPIB 5EJFA 3F8TA 5EMHA 1IVYA 3T3DA 4AWAA 1SXQA 2E4XA 4CIYA 2O8CA 4KAXA 1XTVA 1XVVA 1LDEA 1GZ6A 5BSHA 1RM4A 2GJAA 3CPHA 2Q8NA 5FO1A 3RF7A 2D5AA 4D3DA 2E5WA 3LPLA 1KO1A 1L7PA 1U3WA 1U7HA 3BBLA 1VL6A 2JGMA 4DDWA 3NGLA 4Q4HA 4R7ZA 2FHSA 3F4BA 1MIOA 1RI3A 1T1JA 3RTAA 3LUJA 1DHRA 4C9BA 2Q5EA 2BISA 4HKTA 1QZXA 4L9SA 1LLUA 4BTLA 4QICA 1YZQA 4MKIA 5LPNA 1NE7A 2GO1A 5HXAA 1P0IA 4EFNA 2AE1A 3HY6A 3P5BA 3I9V1 1IBKB 1NVVR 2M6KA 3RIYA 1A7JA 4W5TA 1RYDA 4ECEA 2CLOB 1QNFA 2FPWA 3HDJA 3SC3A 5DNCA 3SJZA 4BX0A 4BFYA 2PS0A 1S2DA 1FNMA 2A5GA 2QR3A 4PBRA 2QN9A 4CLOA 2ZS9A 5BW6B 1LBIA 5D5HA 4I2NA 4PRKA 3JXEA 1ABBA 2K4MA 4IL5A 1T24A 3BTVA 3UB2A 1C3EA 2VUUA 4BO1A 1EVKA 4I6JA 3MTGA 3FMOB 3NH9A 4MARA 2QTNA 2ZI3A 3ESQA 1SVNA 1YQWA 2HRZA 2Y0DA 1ZJ4A 1P7VA 3JQAB 4J2HA 4MV1A 3NFYA 4RKFA 2NMVA 3FXAA 3UG7A 1AGYA 4PLTA 1XP5A 3DXXA 3WYBA 4Q4DA 4RDCA 5BQPA 5ITZA 1AM4D 1NYRA 1O96B 1OF1A 2Z1NA 3IERA 1V11A 3N0VA 1GUFA 3AFNA 1RPAA 4JLMA 5FWYB 3UXHA 4JY7A 3RUPA 2VTKA 3VYSB 4AROA 4QQNA 1GRNA 4KACA 3QBEA 1NMXA 1R0LA 4WJKB 2YQZA 5CT9A 3N2YA 4NFSA 1JHVA 4MLCA 5C5EA 2ISQA 2V4MA 2DRIA 4UQLA 4KIUA 3C5CA 3WOHA 1RXWA 2EFCB 3RSGA 3LLUA 1Y1TA 4AF8A 1OU0A 1UPFA 1TZMA 3BAZA 3V8VA 1BDMA 2WTNA 4ZXFA 3W7BA 3QTLA 5EKUA 4BUJA 2PZBA 3A0UA 3W8DA 2DCUA 2ILTA 3L77A 5F12A 1T34A 1GTRA 3MTIA 4FWBA 3L4SO 4HRVA 4JOSA 3TLKA 5J2TA 3HM9A 4UATA 2VDWB 4FFNA 2Z30A 3DW3X 3IIEA 3LQRA 3BK7A 1SQSA 3ABSB 3IP9A 3SFTA 4D44A 3H17A 4CR7A 1EEHA 4ZIRA 1PT9A 2AQKA 2WTEA 3AM4A 3E05A 1EG7A 2QYOA 1E0SA 5LDDC 3PNVA 1DBRA 2W6ZA 1ZOIA 2HRCA 1O77A 3HUFA 3BRCA 1JHUA 4RVGA 3QVGB 4PRZA 4BLPA 1WF3A 2BD0A 3CRRA 4KGXA 1HH4A 2JFBA 3PQ7A 4W5QA 3ABZA 3R1IA 4KSYA 4XARA 3CNBA 1HT0A 1SU4A 1W59A 2BTQA 3KU1A 4TL6A 3W9BA 1Y1LA 4V1CI 2D4HA 3NCTA 5I9TA 4M0UA 4OUDB 3W7VA 2FSGA 4R41A 4RWZA 2EJWA 5IJAA 2WU3A 1TI7A 3IBGA 2HZBA 3BN3A 1D5CA 2C8KA 3PR1A 4ITUA 4OK5A 2I4NA 3RYFB 2ZRQA 3DHYA 5A1JA 2BONA 2IOFA 2PRSA 1C7EA 4TLLB 5COQA 1U80A 3TKYA 4P3XA 3O8RA 3P9RA 3IAS1 4K6GA 1RCUA 5LA6A 3MRSA 1X7WB 3T7CA 3OG9A 3SE7A 4CUKA 4X97A 2FUCA 2CY0A 3JQBC 4F86A 1E1YA 4F3NA 3H42B 3DOFA 4D8XA 3QFCA 3WYDA 1RJEA 2DHDA 3VOSA 3HO6A 3CF6R 2PO5A 4GGMX 3AY0A 4Q3CA 5ALQA 4FYKA 4RQBA 4E5UA 2KYRA 2LBPA 2QMHA 2QNRA 3FGPA 3H3JA 3QX7A 1U2EA 1JDVA 3I04M 4FMDF 1UKCA 3ESBA 2VJAA 2H07A 1HYQA 2I2CA 1ZP6A 1QH8B 4TVOA 4LJ7A 1NVBA 4TLCA 3EUWA 3RC2A 1Y7HA 3QWAA 3KZ1E 1PTJC 2X6TA 3ELBA 4K86A 2R8EA 1TC1A 3CC8A 2Y05A 4O0LA 4U2KA 3RTEA 4KDCA 2Q9UA 4N7MA 3EGIA 4KKVA 4MRSA 3ZG6A 2XMDA 3WRVA 4UJ5A 2H29A 3U4QB 3DE6X 4ZEXA 5DBEX 4C0AC 5F7XA 2ZRKA 3CBQA 1DIOB 3C3PA 4AD8A 2CXUA 3QVLA 3IEXA 3DDZX 4LNUB 5B37A 5JJIA 4MPDA 5KNBH 1B6GA 1NKTA 1Z07A 3WYAA 3GRUA 1Z2PX 2Y0EA 3IT2A 4DJAA 3CRNA 2NSLA 3F9CA 4L4YA 1FDWA 1X7XA 2BCEA 5ER9A 4NCXA 4TYQA 5EMNA 5CAEB 3LUKA 1T0HB 4M7PA 1WULS 4IZOA 1GSOA 2C3OA 4TSRA 5DEOA 3LHKA 4BRSA 1VE9A 2DR0A 3MMXA 2YL2A 2GZRA 2RGGA 2O3SA 1EX1A 2ZYDA 3GJ7A 4O4LF 4H0CA 4RZSA 3SI7A 4AC9A 4DRZA 4E5NA 4E32A 5C51B 2HOQA 3V8BA 1G5HA 4OJKA 5IWCA 1T4CA 4NPCA 3PDIB 4C4XA 1KI9A 3U3ZA 5J40A 3ZU4A 1JT2A 5EIXA 1WUYA 1E6CA 2XI4A 1SKAA 4RMGA 3GDHA 4BJ3A 3S5JA 1PT5A 3CLSC 4YRFA 2G7MC 1LF0A 1KVUA 2E49A 1K3TA 2GWHA 3OTGA 4EFKA 2WJHA 2P27A 5EZSA 3TN7A 5KX5B 4M98A 4QXOA 3GP8A 2FZEA 1HDRA 3D3EA 3ILVA 5M7EA 3LCMA 4B47A 2NU8A 1PDWA 5CDHA 3NHWA 1W5AA 3DOEA 4DDVA 2EP8A 2X6RA 3GDFA 3NB0A 2FY8A 1OWLA 3WLKX 4EMUA 1NW9B 4H4EA 3G82C 4MVYA 2QM0A 3R75A 1DOHA 1SVLA 4TXHA 2FN7A 1YXMA 3GZNA 3OP4A 3QKRA 3R0XA 1GCIA 1DAHA 4NV1A 3RG8A 3V4RA 4RQAA 4X8HA 4JJZA 1G7SA 4H60A 2RGUA 2E82A 2SCUA 5FAKA 5E6UB 1KP2A 1ADBA 4NE9A 2EF0A 3R5TA 1G63A 2A9OA 1TA4A 1XFAA 2ZSBA 3NNNA 3OEEA 4OJNA 4R83A 3BM5A 5FULA 2DUUA 3UWDA 5IT5A 3WZLA 5JXWA 4HB0A 4X61A 4C1NA 2Z04A 4JLOA 1BVHA 5SY9A 3F0TA 3GRZA 1WHSA 3TVYA 2VPQA 2Y67A 3TLZA 2P6UA 2V5AA 4HJRA 1DS6A 4XCQA 1T10A 2RGXA 4QPZA 1W49A 1A1VA 1JRLA 5EJGA 1GRQA 1N33B 1R18A 5FADA 4FZ3A 2D4AA 2ZTHA 5FPTA 2JIDA 5NULA 2W0SA 4AMVA 1ZD1A 4IOKA 3ZV4A 2P30A 1C3OB 2OO3A 2QTTA 1H3NA 1NYTA 2Q6VA 2AH5A 3MJSA 3PLRA 4ZO8A 3DMNA 2Q3FA 3GIWA 3H6KA 1OD6A 3OEHD 4HB3A 4KVGA 4F93B 1G41A 4UTNA 3KXIA 4PLFA 2FPOA 3EHEA 2FPKA 4L51A 3RM3A 4BNXA 2E6UX 3AP2A 1FX1A 3ZQKA 4CMGA 1BFUA 1E2UA 4WINA 4BFLA 4UFOA 5EZQA 4WERA 4R9NA 1KTVA 4BBZA 2HQBA 3D3QA 2V6GA 3NIBA 2DWCA 3N86A 1OJ7A 2OC4A 2QPAA 3F1KA 5AKGA 4Z4EA 3X1WA 1D9XA 2Q5IA 2OPBA 2W0MA 1JZTA 3BFXA 1IWBB 4UKDA 4C88A 4EY7A 5LMUB 1ECGA 3WWDA 3IPXA 2LR0A 2GVNA 1HZZA 4A73A 1UP7A 3L6EA 4AJPA 1V71A 2I7DA 3OZBA 2HUNA 3Q3JB 2BKEA 3ICWA 3OOHA 4B4KA 3L0YA 5A06A 1JPJA 5LOVF 3KT6A 4TX1A 1P1BA 4RLQA 3WV5A 3S81A 4F96A 4YV0A 4IMPA 4C4SA 3BC1A 3MINA 2MU1A 2HIHA 1HDGO 3GOQA 4WASA 4QKQA 3ERCA 2W6IA 3RIHA 5JIBA 2O50A 3DSRA 3FYUC 3VPAA 3GV0A 3TJZA 3FSGA 4MVJG 4EA6A 4R1SA 3OPNA 4MS3B 3PFCA 2FWAA 4XLZA 1MV8A 4Y2YA 3G5MA 4Q9JA 4I19A 4AF7A 3IVRA 3FMPB 1EJBA 2AW5A 2Z6AA 1XXLA 4MJ7A 2I3ZA 4TLDA 1XMVA 1Y81A 3JVUA 6AT1A 1DJLA 2QOEA 1M2JA 2C3PA 1HQKA 4QBKA 2JH9A 2JNWA 2GX6A 3M7IA 2OG2A 4CKEA 3N39C 2HCFA 4HQFA 3GLGA 5FHQA 4BLSA 3OZCA 4WCFC 2WSIA 5DM0A 1JDBB 2A9VA 2QSJA 5AW3A 2PTHA 3LC1O 1Y4AE 5KNDA 4JT8A 1KC3A 3G2MA 4DIFA 3FUWA 1DC8A 2RAUA 4RTJA 3E8MA 3A3OA 5J2UF 4NONA 1X9IA 3ZDBA 3ABOB 1Q7EA 2NYAA 2WZCA 3EGWA 3NEJA 1OXSC 4QTXA 3PDCA 1N34B 4FEYA 3UMYA 1NQWA 5E7IA 1TKCA 2H9AA 5DYIA 2G1JA 4MMZB 1M9NA 5FAXA 2P6PA 3OJFA 4ZI7F 1XU4A 5JANA 1HT2E 4D82A 3BZUA 3NM6B 5H59A 1XRMA 2NTVA 2OXIA 3UMFA 2VHWA 5FLYA 1RHMA 1M6VA 2QVCA 1CUYA 3CS3A 1L7AA 2AOUB 3K4QA 4B3CA 1A8PA 2R00A 2W83A 5C8VA 8OHMA 3GBPA 3KQNA 3AEXA 4OGGA 4FGKA 3Q9UA 3ZIAA 3DAOA 4BEVA 2CL7X 4KXVA 2VEOA 4XYEA 1VRWA 1UKVY 5KWIA 4H4CA 2R66A 3GJ4A 4NQRA 3IV9A 3O38A 3ESAA 4YJHB 3AQ4A 1CG6A 3DYVA 1ZNQO 5K0BA 1GRRA 1R12A 2GJ8A 2PCLA 3KZKA 5CYOA 3I1IA 1KR2A 4ALIA 1TCCA 2HLDD 3B20A 3LCRA 1F0YA 2JI4A 2CL6X 1FU4A 4YRJA 2G71A 3JPWA 4EPXA 2HA4A 4ZI3A 4KLRA 4TYPA 3Q7RA 3KX2A 1GILA 4PAGA 5AOCA 3SIXA 1D1QA 4CMHA 2WAXA 1JEAA 4EY4A 4DDUA 1I4DD 1U9IA 2XNJA 3FYTA 3F7TA 4J3NA 1KFEB 2ZK7A 2DLNA 2CFIA 2C2ZA 4LI3X 3RUEA 5DK6A 5CLHA 1YR2A 5JFTA 3HNOA 4MUIA 3HVRA 3Q72A 1N0IA 4BN5A 3ORQA 4BNNA 2A33A 3KOYA 2XUQA 2I3BA 3H5VA 4IRUB 3QBDA 3EIXA 4CM9A 1YQEA 3DXZA 1N6OA 4Y0VA 5L3VA 4JI7B 1UP4A 1KOGA 1PKEA 3JD1A 3V3TA 3VO8A 4F5YA 1Q6ZA 2GJSA 1KJJA 1FNDA 1ONNA 1VJTA 3PQ5A 1JA0A 4Z6KA 2Q5LA 2CV1A 2PX3A 1M1XB 4BNHA 1XD8A 2G04A 4RJTA 3GFFA 5F98A 1QHSA 3KUKA 3DHVA 4IIEA 3L04A 3DTVB 3N9IA 1VMKA 1A2QA 3DTNA 3G1TA 3JAWA 2CFSA 5F1PA 2GCNA 4QJBA 2GZHA 3USES 3HHPA 2XNHA 4URYR 1PJAA 1ADGA 3GJXC 4PWYA 1B6TA 3PQFA 4L2IA 3RUAA 3EFBA 5IWAB 1XJ5A 1YB7A 2H1HA 1YFZA 3VAYA 3EGEA 5K3SA 2QQFA 1WX1A 5ALNA 2YJ4A 2I91A 5KYYA 4Q9DA 3IRVA 4IF6A 4ENPA 2Q5HA 3TBHA 5A4FS 2Z83A 2JZNA 2QTGA 1LK5A 1PYDA 3OLXA 1I1NA 1NUAA 2X1HA 2NT4A 5TT1A 3GX1A 4XWOA 2C2KA 3ETGA 2GN1A 2PKXA 1GGJA 1VLZA 4B7XA 1L1EA 4MYTA 4B3HA 2FEXA 4NKRA 4FBLA 1I32A 4L4XA 4MINA 1C4WA 4GI2A 4H1UA 3ZCPA 4E5KA 3VNUA 3EGOA 5H83A 3FFTA 3GFBA 2JFZA 3HWSA 3G0HA 2V9PA 2PL3A 3JARA 2BKVA 3BT7A 5CM9C 1W0KA 3HGTA 3DAYA 2P8SA 2PD4A 1M2FA 4RF5A 4UTXA 5GOTA 1W2HA 3CVYA 2FCAA 3T1QA 5GTDA 5HOQA 2AVNA 1H1TA 5JVDA 2D8AA 3T0FA 2OUIA 3FYUB 1KE1A 1ZINA 1GITA 3TSAA 1P1HA 5COAA 5K01A 3BGSA 1CKEA 2GYYA 3GDGA 3MOIA 4KQ6A 5CMLA 2IGTA 1TQ2A 2Q1TA 4B6RA 4LWZA 4FZVA 1OCEA 1V1MB 1JLRA 2XUKA 3G8YA 1SVOA 5IDYA 1XN4A 4ZHSA 3R7WA 1O5IA 1QIHA 2ZRAA 5JE8A 3H5IA 1B42A 1T0IA 4QPDA 4UUPA 1EJ2A 5IUKC 4KXMA 4EBBA 3PGKA 2ZIXB 2NO5A 3FPLA 4F2GA 1QO9A 2QA5A 3O95A 4DM3A 3S2FA 1W9MA 3BIJA 3ENZA 3L92A 4Z99A 4BC0A 1YQ9A 1R0RE 1HDYA 1FFDA 2Y4NA 1KQNA 3Q6NA 2YHIA 3KB2A 3G89A 1C0IA 4RESA 5FOQA 2FSVC 3GEGA 3OJXA 3I3OA 2WZBA 1PSZA 4II2A 4P8RA 1RRPA 4D0RA 2AMYA 4F5DA 3PJRA 2C82A 3IP8A 1JIUA 2YCLA 1QX3A 3D4OA 3W1VA 4F97A 3HDVA 4LY3A 8MHTA 5F5XA 4QLBA 4ARAA 3G9QA 4AUMA 4DWWA 3WP0A 3AHDA 4IFBA 3ZIUA 1FYEA 4UUOA 3VBEA 3I01A 3QELA 5JZMA 4A8JC 3GLHE 1HRDA 5LM3A 4EGAA 3E53A 1XWWA 4YJKA 1FP4B 3ZE9A 1O95A 2XF8A 3OLVA 3L0CA 5CLJA 2W2VA 3KCNA 2M9MA 3I8XA 1MRSA 3UFXA 2O23A 1JFSA 1U98A 2Q3HA 1NBAA 3KYIB 5A0FA 3OLZA 1FDSA 2C54A 1ZUNB 2JC3A 2QDKA 1WTCA 3AETA 3BILA 4FQ7A 2YINC 5HQJA 4I81A 5I7SA 5IABA 1B8OA 1NJFA 1RC1A 2V7QA 4UBLA 3T7SA 4RFVA 4PC3A 3ROQA 1BJTA 4FUTA 2RDMA 2XGJA 4F0JA 2PS9A 2JJ1D 1NXXA 4DF3A 5HJ5A 3TRDA 2Y8EA 4LV8B 1GPH1 2XDQA 4BMCA 2FGKA 4IOLA 3HCDA 1KJ9A 4HVAA 5AW4A 2GPYA 4EUKA 2F1JA 1ZPDA 4Q6BA 1SBNE 2FEPA 2JLYA 2V74B 2Q99A 3D4IA 4MICA 1OYVA 1RYNA 3EIHA 5EAIA 3STYA 4XM2A 1G2PA 3FFWA 3LUCA 5BSUA 4GNRA 4MNTA 1SU8A 3CG0A 3GEBA 1YZHA 4TL8A 3FKSA 1T6NA 1NR5A 3GLTA 5D86A 2VCEA 3ENKA 3WR5A 3HG7A 4ML3A 3UT5B 5HVNA 4AY6A 1GAQA 1GPWB 3DL7A 3GLSA 3HVUA 4WJZA 3VAAA 4I8DA 2WC1A 4P86A 2CYCA 4ABTA 2C2YA 2VSYA 3BWVA 1LF5A 2GEFA 2FF5A 1DT3A 1ZR2A 2Y68A 5G3ZA 3W6ZA 3PEUA 1EFLA 2GCPA 1V39A 4JN6B 4KPUA 4TWAA 3OD5A 4B45A 4X92A 4TT8A 5FI0B 5HS6A 5BN3A 3D02A 1XPUA 2RKBA 2ZPTX 4C0XA 4CM5A 2YXNA 3ET5A 2FFAA 1V48A 2I62A 2YZGA 3ONNA 3NHBA 2G5PA 1JFFA 1V4VA 2PZFA 4WZBE 4CDMA 4D98A 5F1YA 4DBVO 5ARBA 1NBOA 1Y6QA 1G8HA 4K6MA 4UM5A 1B1AA 1SZJG 1XEAA 2PNFA 3MD9A 4LOLA 4TN5A 3BDIA 4UEKA 3COYA 1N2CA 2ORWA 2D1SA 2R2GA 4C7KA 3IBSA 5JQWA 4XPIA 4AYTA 2IUUA 4NYJR 5KYTA 1KQ3A 1NV8A 3QA3E 3KL2A 4AXXA 2XOEA 3L7YA 3NGXA 2B3DA 6GPBA 5JDIA 2ANBA 2ZB4A 4ZVKA 4ZVPA 3RRZA 3BJIC 1QQAA 1AJEA 5EOVA 3VR4H 4YACA 1XJCA 3BS4A 3E3AA 4MYHA 2MTBA 1JLSA 2LV8A 2QXYA 3H87A 4JU9A 1KDTA 4PSAA 3QI2A 4OHZA 1KS2A 1TDJA 4HL6A 3L4EA 3E5MA 1FMCA 3H7IA 1HDCA 3CSSA 2HA6A 2J41A 3VR0A 4RSHA 4TQAA 1QYVA 1RU3A 3EY9A 2KE5A 3C3JA 3FWKA 3N05A 3RVSA 5D1HA 2E87A 3RABA 3WBBA 4N7JA 4IRXA 4NBNA 5LLTA 3NHJA 2QB5A 1BTOA 1HYEA 1T6YA 2H5JA 2XTMA 4N0PA 2CLSA 2QZSA 2WE8A 4EP1A 4K9SA 4QUEA 4AN1A 5KNLA 5H9VA 3KYCA 3JY6A 3LMKA 5FQOA 3ZZNA 2FJ0A 1FA9A 3TR5A 1JAXA 4LVNA 3NUGA 2ENWA 2OR3A 4B6OA 1QVVA 2I29A 1WPGA 3UGQA 1ETUA 1SXHA 2HU2A 2Z2KA 4IQ4A 5BNZA 1MCZA 2GA9A 3FRHA 5DVZA 2FQ1A 3GLKA 4IUBS 5BV1A 1WMFA 4NZ9A 2ZWIA 5L4SA 3ADDA 3BSWA 3T61A 3EXHA 1SVSA 4WX2B 5KYUB 4TUYB 2W2NA 3IVAA 3RBVA 4HH0A 5DI3A 3DTTA 4DG9A 3VI4B 3GEMA 5FWYA 3F5FA 1IN4A 2QJTA 4GPIB 3DBHB 3GJYA 4P1ZA 5DGCA 4BNUA 1LNSA 3LSTA 1U5CA 3QITA 4JCOA 1MOSA 2NVWA 4XA8A 5GZ3A 1XJWA 1KMIY 4FYWA 3WK9A 5JXHA 2IZ1A 3ZQ4A 5G4LA 1I2BA 1K7YA 1PJBA 3AVYA 4RZXA 5IBCA 3SFVA 3BRWD 3Q7PA 3AF6A 1ZU4A 3OC6A 3GEEA 4HVTA 4WLOA 1PWYE 2H7XA 5DHSA 3T7TA 4N5DA 4OH1A 2JH8A 1ZN9A 4KO1S 7REQB 1EJ0A 3T6KA 2RGAA 4RIEA 5FUWA 5BUSA 1G9XA 4PYNA 3VHRA 3H2KA 4GNKA 4R1QA 3JW8A 4GGOA 4BN4A 2BFBB 2ACVA 4CCWA 4W1QA 3K1AB 4W8OA 1A8HA 4YDHB 2FSFA 1WB9A 4RXMA 1YCGA 5E3IA 3KVVA 3EK2A 3TUIC 1U3CA 1T0UA 2A1TS 4MW6A 1WQ3A 4GM4A 3E23A 4FEGA 4J76A 5AVJA 3WGNA 1ZD2P 5LMNB 5EJEA 4ZCTA 3LO8A 3U7IA 2JA2A 2JVKA 3NBUA 4I1SA 1QG0A 1JQJC 2EYQA 3UHPA 2PGJA 2J9YB 2OHJA 4NSNA 5EIOA 1CVLA 2ZWPA 5HM6A 3K9WA 5I7HA 1QQBA 4KW7A 1AUXA 4NBSA 1AKQA 1OGIA 2NSJA 2GKGA 3AHEA 3B9RA 3U6KA 5D8DA 2QYHA 2J0UA 2ISCA 3CNEA 4AJOA 3NVDA 1YL7A 3I28A 4F2WA 3PYLA 5JWHA 1UKBA 1X3LA 2DKFA 4QYIA 1DUSA 1GGFA 3QU5A 4PXYA 1T9AA 4E7PA 4YP5A 1Z68A 1P17A 4D42A 5FA8A 3F3KA 2XTZA 3EXEB 2HLPA 4JR2A 3FHCB 5KVAA 5F9FA 4IDEA 2CT8A 3AU8A 5DJ5A 1NBEA 5L4LA 1G4UR 2A0UA 4MA0A 1QNLA 1XKXA 4IXMA 1U4SA 4ZVOA 3CPEA 4HTAA 4WFKA 3PK0A 4Y6PA 4RD1A 2IEAA 2QMOA 3O1HB 3H1TA 4Q0MA 4ZA2A 3UOGA 2HV9A 3VR3A 5FBHA 2ZANA 3PQCA 4AN0A 1BXGB 5KOJB 4PZDA 4ALNA 2J0VA 3MT0A 4LF8B 3ICQB 4EG8A 10MHA 1WKCA 1PNQA 3OTQA 5EGSA 3BIWA 4I14A 4Z49A 2QRGA 1JF8A 3QNMA 3WYGA 1EX9A 4WCFB 2E4UA 5HF9A 3SQDA 4RQUA 3VVMA 5F7JA 2ILVA 2P69A 3GBSA 5EERA 4DNXA 3S7TA 1HDEA 1QTIA 3D8UA 4J0CA 2AI2A 4A8JB 1YVUA 4YRZA 2J4CA 2Q2VA 3KZOA 4O63O 4MW4A 4HDRA 5KIAA 1H5UA 4DADA 3UAGA 2Z5FA 4XFKA 5H0IA 4HBGA 1CDZA 4X1YB 2IEBA 1V8BA 1Q22A 3FCYA 2QAGA 2VYND 2X15A 3EIEA 1B41A 3PGJA 2PRKA 2ECPA 3QX8A 2N47A 4IPTA 3CVJA 3NVAA 4FE4A 4MGYR 5IDVA 4DSTA 2QRPA 1HNXB 2HNBA 3ZZTA 3ZD8A 4M49A 1B23P 3O91A 5KOYA 1KOLA 3NEAA 1B73A 1QFMA 4FFPA 1JQBA 4BE4A 5L3QA 4UOZA 1LDGA 3CF4A 4BLQA 1K86A 4RVNA 2PNJA 4JP3A 1XDWA 2A14A 1C8LA 1JGTA 5HSGA 4Q9NA 1J39A 1XQVA 4QAQA 2H4WA 3X1XA 2PH5A 2LPMA 2WJYA 1DJQA 3HP1A 2RAFA 4HSGA 1CK4A 4DUGA 2J9FA 3GQVA 1C1XA 5FLXA 2R6GA 3COZA 1BQEA 4P5PA 4O1MA 1CS0B 4RA6B 3U1VA 1MAHA 2HKIA 3IP7A 3IL2A 1QRUA 4RIHA 5FUYA 3JZFA 1T4CB 1M8PA 1C7JA 1P31A 1HKUA 3PHJA 3GLFA 5IC6A 4URVR 1ICEA 1W52X 2A30A 4OB6A 1HZZC 2O2ZA 4FXOA 4KODA 2J3HA 2HDWA 2QS9A 5T4EA 4EPVA 1ZSYA 1Q50A 4D4MA 2UZ3A 2HEIA 4QPJC 3RTDA 1A8IA 5CB4F 2X4DA 3LNTA 1E98A 4KIWA 1VHDA 1Y1SA 4O4JA 3OBBA 2X0IA 5HX7A 3IOYA 3ZU6A 4KQ9A 5GV8A 4ZTUB 3K0EA 1WXGA 2R9VA 2O5CA 2B8NA 2EEPA 2NO7A 3FZEA 1YB4A 4WA8A 2XZDA 1VE5A 3W5CA 3T3NA 1IN5A 3CV3A 2ZT7A 4MO9A 2AQHA 2P6OA 2HJHA 4O2AB 4RA9B 1AMUA 1GTVA 1DG3A 3HVJA 2O8VA 5FL7A 2P4UA 4Z3KA 1VIVA 2R7KA 2QWXA 3UK2A 2A4KA 2PS3A 2F8MA 4CVNA 3KFVA 3S8YA 3N87A 5E7MA 1FVHA 3H1GA 4BX9A 2BKXA 2Y4OA 4MUBA 2GILA 1KZ4A 1Z5WA 2R1TB 4QO7A 4TSFA 5DSTA 3UC5A 5EJ6A 4X65B 3A1VA 3AVXA 2EL9A 3BEOA 4QATA 5FOUA 2F67A 4M76B 4Y1FA 1TM3E 3KUUA 4W63A 5DBIA 3TR6A 3W3ZB 2FMKA 1U8AA 3JVDA 4WBSA 1LQ2A 3WYFA 4DARA 5KDOA 3IEVA 4OLBA 1M72A 3GJ0A 2Q3DA 1F1JA 2NZYA 4A8HA 4E2XA 3C45A 5C2JB 5JH7F 4XH9B 4V2IA 4L8FA 4Z7QB 4QULA 1VG0B 1SG6A 2RHRA 2B1GA 1U9CA 1ES9A 5D01A 2ZIEA 3KPUA 4YA6A 2VHTA 2XMGA 2Y71A 5UKDA 4X62B 1KYWA 1GZVA 3ASVA 1ZA2A 4W5JA 2MR5A 1V25A 1P1FA 3CUTA 1QC5B 4PO3X 1R0XA 1RHRA 2ZBPA 3TOZA 4Z4HA 2VWQA 3G7NA 1L7VC 2PJZA 1K97A 3K8YA 4EYKA 1FX0A 1Q57A 1H8HA 2G76A 1N5LA 3FLAA 4RFSA 4L0DA 4P5EA 5F2NA 1HURA 2J6CA 2HFJA 2QUBA 4YCJA 1E0AA 1FXSA 4HRYA 4I55B 4CM4B 2F48A 3P9QA 4QFBA 2PBZA 4GOOD 3LWZA 5AICA 5FQNA 1AC5A 3ZGXA 3ZWAA 7MDHA 2O8BB 3TI7A 4WCDA 2WJ4A 5CGQB 5KTMA 3W9UA 3LL4A 4OQ4A 3V7WA 4JV5B 3JATB 4V38A 3FFXA 4HADA 1GPKA 1SHUX 3NYIA 4C6RA 1VIMA 3I9NA 4PV7A 1DAIA 1IY2A 2GPNA 2FZKA 1Q11A 4OSOA 4YIKA 4WBNA 1XZIA 2IHJA 4I9HA 4OFXA 5EWLA 4YRSA 1IH8A 4M9CA 2ZWOA 4MQUA 2XH8A 3LT5A 1K6JA 1YJBA 1R66A 1E9EA 1M7BA 4QUDA 4F21A 3NGMA 4B6PA 3Q6IA 4KX3A 1SKMA 4EB6B 3QLUA 4RSGA 1MQ8B 1KJQA 1TD1A 4NRDA 2ZUDA 4NV3A 4PLCA 1N7IA 4MRRA 2E4WA 1MO6A 2DETA 4HMPA 3LWBA 2EKQA 4ARZA 2POQX 3VV3A 3EAGA 1QE5A 4MQEB 4W9NA 3RSLA 1CV2A 3DFUA 1JA1A 5I9BA 4DZTA 1C81A 4YROA 4F4FA 5CVTA 2WB2A 4GBJA 3FJYA 3I9MA 4AUKA 1A0OA 1F60A 2HM7A 3PFWO 1NV9A 1I13A 3L7MA 2XNCA 1GSHA 2FPPA 3HLTA 3TZCA 1E66A 1LTHR 1ZD9A 4DB4A 4EYEA 2CMDA 3BULA 2AWNA 4BU0A 1NI4B 1NOJA 1RYHA 4R6WA 3DLHA 4LOHA 4EK9A 2QVYX 1ZMBA 4PPYA 4W8GA 1KTIA 2O9JA 3QOXA 5DHPA 4BO3A 1PFWA 1JU3A 3G0CA 4YDRA 4FNAA 1XZ8A 3EA0A 2XWJI 1P4SA 4FMCF 4YRBA 1G3MA 4YQZA 5KTRA 2WFLB 4YUAA 4I9NA 2QHXA 3VZRA 3ZVMA 2BM9A 1Q7CA 3BH0A 4HFNA 3GPDG 2BBTA 3CRMA 5LZ8A 1J5XA 1G8KA 4TS4A 4CM3A 3FOEC 3J81k 3ED1A 1O0BA 2XRMA 4WEQA 2V3CC 3OM8A 5C3MA 2OY0A 4OQFA 4DWVA 5FH9A 1TRKA 1ZJJA 2VJMA 3NM4A 3SQMA 4EHAA 1PS8A 3ANLA 2GAJA 4OV6B 3ZW8A 1OGYA 3AW9A 2UUBB 4DV2B 2V6BA 4IJVA 3PCRB 1NM5C 4NU5A 3G8BA 4BS9A 2FDXA 3PFHA 4A0QA 2VNIA 1ODKA 1UQUA 2DFPA 4IIFA 3E2PA 1J2YA 2JAQA 3TB4A 2P67A 5GGXA 4BRZA 1X2BA 4GSKA 4YWJA 5KDDA 1DUVG 5U4QA 1QOPB 2GYUA 1CR0A 5JISA 1OHHD 2JATA 3MM4A 3D8SA 4AU1A 1Z4JA 3P2OA 3ZHUA 2QXTA 4DREA 2C7VA 2ZRBA 3CH4B 1NHWA 1PZNA 1ZMTA 3D0RA 3WSTA 3DEYX 2VNKA 1NZJA 1D1SA 3VU9A 4TWBA 2QJFA 4HNUA 2RI6A 2HCTA 3I73A 1RMQA 3RKUA 2VTBA 1Y8RB 4R0NA 4X9XA 4Z4CA 4R5HA 4WXYB 2NTNA 3G5TA 1LWOA 2GN9A 4CQLB 1RLOA 4A0RA 2O8EA 2ZRIA 5ALJA 4BV8A 2QX9A 1XTJA 3PNMA 2FPIB 3OWHA 5BOSB 3FWNA 3UATA 4R1OA 2H1IA 1VLJA 3CWZA 4KMRA 2BMVA 1YONA 4M55A 4OQXA 2X5NA 5TPWA 3SC2B 4DMFA 2RJNA 4PC6A 5C5IA 2HGSA 3NBFA 1CUVA 3NBKA 4AY3A 2JFNA 2JDIA 4QYSA 3SP1A 2FGJA 4D92A 4DBZA 2B5VA 4RY8A 4S2EA 4D0NA 2YNMD 3HBLA 2RK6A 1WKBA 2B8JA 2H4YA 2MSNA 2YFHA 3B6EA 4CQMD 5CITA 5FX2A 2ZUFA 5TQ0A 3NTUA 4X1OA 3CLVA 4B3DA 4LECA 4ER5A 2QRHA 3FG9A 1C9YA 5K8IA 3KQTA 4FCCA 1FNNA 3ZU5A 3TFOA 4AP6A 2Y1FA 1JJ7A 2Z4RA 2KW5A 1G2IA 1TTQB 2FFQA 1CSEE 4I4TA 5DYNA 3THSA 3I76A 1ODJA 1PQWA 1QZUA 3ZE0B 1N6PA 4YC7A 3SIWA 1AH2A 5C8YB 1CYEA 5K99A 4XRRA 5HUJA 1EXDA 5DRTA 1N2IA 3LA8A 4PLYA 2CHUA 4GSLA 1G8SA 1QHGA 4RKWA 2EL7A 4FUQA 1O6GA 4TWIA 2VNSA 4ANFA 1I2MA 4FNOA 3MOSA 1VQ1A 2GRAA 4HOYA 4AKSA 4AXBA 3C5VA 1ESZA 3FKJA 3UAZA 1AURA 1KK1A 1JAYA 2BKLA 1EFVB 2KWIA 5JZBA 1PLJA 2QM8A 4JSTA 1LPBB 1TK2A 3ESYA 2Q1UA 3G2QA 2H18A 4NBLA 3LK6A 3P0FA 3TGWA 4BVFA 3RYCB 2IY7A 3VPFA 4EUNA 1ZOOA 2G9ZA 1TJYA 3OFND 4I99A 1QP7A 4J1TA 4BFSA 2VJNA 4KX5A 4L5CA 1KP3A 3OTIA 5KPDA 2AX3A 5DSZA 5JH7B 3GFTA 4V0QA 4TWRA 4O59O 1T43A 3B6MA 1QMPA 1NMSA 3RRFA 1L4UA 3UENA 4XVQA 2D2EA 2ZJ2A 4DXHA 2OV1A 1UIMA 4M1KA 3DNPA 1JIKA 3LDGA 4ZANA 4RDHA 4CQMB 3K71B 1VI2A 1A9YA 4JQYA 2WSMA 4RYDA 4WESA 3TLJA 1CEXA 1K6XA 2E2WA 2FA9A 3FETA 3K9BA 4G01B 2MSDB 1CU1A 4XYMA 1PLLA 2OM6A 1MORA 4AN4A 1ZVMA 3W5SA 1DJNA 1EK5A 3DLPX 2EX4A 1SOUA 2ZYGA 3G17A 5AIBA 4OI0A 2RFLA 1ZO8A 3OEYA 5EWMB 4WLEA 4P58A 3FRJA 1XQ6A 3JSAA 3PA8A 4U6SA 4YALA 3ZWWA 4ONEA 2HYIC 4NEHB 2IHKA 3CCBA 2KI5A 1W19A 2XUZA 1ZA1A 2NGRA 4J9UE 3V33A 4EMTA 1QGYA 3FTEA 3VYWA 1RRFA 1E1CB 1U0LA 2FFHA 3KTFA 5HBGA 5GJCA 5FEUA 3NKLA 3C41J 4IHJB 4CT5A 3KSUA 4GT1A 1C1DB 4ITRC 4DTIA 2CXNA 2QRVA 1VBFA 3BZWA 4FKZA 4L4RA 1E3WA 2B1RA 4WH0A 4M53A 3H5WA 4J0FA 3M0EA 3UIEA 3GVIA 1A88A 1EP3B 4G0OA 5IYZB 1HV8A 2IOYA 1G60A 1BXZA 2YYAA 1UJ6A 1XF9A 5FBVB 4S05A 3H04A 4JI3B 2OKGA 1IBCA 4Q1DA 4P0QB 1V5EA 1JR6A 2J6BA 4IHKA 3LVFO 5F7OA 1XVTA 4MV7A 1DNPA 1ENYA 3C5EA 4IDQA 4C6TB 3I5YA 1JIJA 2BR4A 3DVSX 4ZOEA 3B7WA 4P54A 3WFIA 1BYUA 1OUMA 4FFBB 1R8SA 1ZUHA 3ISTA 5L95A 2RBEA 2YZ2A 4J0KA 4TPKA 1E99A 3P9XA 3A4YA 1U11A 4BVLA 4RTSA 2GT1A 1EDEA 4JH0A 1F8YA 3M6WA 4EB0A 3OIGA 1TJNA 1U02A 4D57A 3WRXC 1AGRA 3KT0A 1QORA 4BQOA 3B52X 4HMQA 4RAQA 1AQLA 4OU4A 4TMTA 4BBJA 1L7MA 1C0LA 3H97A 1PJ8A 3SF8A 4C0JA 2D1TA 1H4TA 3W06A 2A35A 3N2IA 5CYPA 3OMLA 4G6ZA 4QHSA 2GLXA 5IZCC 2H7YA 2PUTA 1BVUA 4YB8A 3L4BC 1NN3A 2K87A 1GU1A 2YRFA 1T9BA 1GO2A 5A3RA 1Q1NA 1JS1X 1HXHA 1TU4A 1VPTA 4HTFA 1O5OA 1Q1BA 4QSMA 3QMPA 4BRWA 1F8GA 1YAJA 1H1LB 3BQMB 3DAGA 3E1SA 3V9AA 2JLVA 1EIWA 1QZTA 3J7AC 3W77A 5JSZB 4MR7B 5T4BA 1FFGA 4HLUC 3WIOA 1M1YA 4G2NA 1E5XA 2XQJA 1MVNA 2X0JA 1NXQA 5G0SA 1KPHA 3EIFA 1P9NA 3C1AA 2VWPA 4ADSG 2DT8A 3B78A 4URHA 3Q9SA 4F60A 1I7PA 4CGZA 3E84A 1GNPA 1XA3A 2ERXA 3L7LA 1YZLA 2DBYA 1XKTA 2GUWA 3PHGA 3HSKA 5ECDA 4BZWA 4CMAA 1SUEA 2OV8A 2QW8A 2WKRA 1NQUA 1U2TA 1GAWA 1JT9A 1WUTA 3ZDDA 3H16A 4Y6OA 3WGHA 5E0KB 2DU8A 1EU1A 2ZVPX 1J70A 3I01M 3WKAA 1WP9A 3F49S 4RE5A 4EYOA 4MQFB 5JD5A 5HF8A 2WI8A 2XJ4A 2QR2A 3BFKA 4BOYA 3FA2A 5JXJA 4JI0B 5B64A 2R87A 2OHHA 2ZUVA 4XDHA 4DANA 1C3LA 1CLUA 4O25A 1JB9A 1E58A 3Q40A 1B76A 2NQ2C 2R1VB 1BU5A 1BEEA 2IS1A 2H1CA 2XE4A 1D2RA 2A58A 3F5QA 1YC5A 4OY3A 4ROSA 2R8OA 5ALPA 1K68A 1QK4A 2XA1A 5KNCH 1L5YA 1P80A 4Z1MA 1EKXA 4P80A 3KCQA 4KDFA 3TOCA 1Y8ZA 4DQXA 3TRIA 4M8LA 1YS1X 1HDOA 4QLAA 2ZYHA 3W2FA 4A2QA 1SCKA 3VZCA 4C78A 3ELWA 3MEQA 3H2ZA 3N8GA 3WFZA 3K35A 1IHXA 2ORED 3VZSA 2WWYA 3SX0A 5EJ7A 1NULA 3QQ5A 2I87A 1JEQA 4RQTA 1JALA 3REOA 1Y82A 3C3EA 4LCBA 4BASA 4GLLA 1RBYA 3I9KA 3RRYA 3UC9A 4B76A 4QRHA 2ZYUX 2WP0A 4WPGA 1Z74A 2IXTA 1PNVA 5U4XA 1YIOA 4BMXA 4MKXA 4A0HA 5BWOA 2FH5B 1T36B 3VJRA 4ER6A 4KIGA 3ZW7A 4C30A 3DO8A 3TNFA 4Y6QA 3ICOA 1VDZA 3ROTA 3RS5A 1YTUA 1JX6A 3LVQE 3UA4A 3K8QA 2C5SA 3ZWBA 3NATA 2RK3A 2PM8A 1FQJA 2AFIA 3AHHA 3DCJA 3DQPA 2PRIA 2FRDC 3EEBA 4I46A 4D74A 1XVLA 2ZQYA 4K0RA 1XPJA 4NZOA 4AMGA 5FLKA 2PL1A 1HKHA 2YV1A 4G24A 2XNSA 4G5XA 5BWLA 2I6TA 2ZUCA 2BTQB 1I2AA 3OHPA 3OQBA 1GDTA 3C7AA 2HBZA 2JGRA 1XEXB 1EVZA 1M34A 2D0OB 3OFJA 4MI3A 1E7RA 2WYIA 8ABPA 5ICGA 3JQQA 2ET6A 4ARUA 3VRHA 3WL4A 1MPXA 4ALMA 4F84A 4KSBA 2CVFA 4F5ZA 2WTBA 5CA0B 3PE6A 2ZB2A 4RPHA 2A6PA 1F5NA 1XU9A 2ZR7A 3HTXA 3V4FA 5JV5A 2VK2A 5HZKA 1O54A 2CFRA 2Q3LA 4KFRA 3ZZ0A 5J23A 1WDWB 3RC1A 5HJ7A 4EG1A 1OLUA 3BMCA 1BW9B 2H92A 5LA6B 4ZYZA 4UZFA 1QHHB 2BGLA 4CEJA 1N2EA 2W6OA 3EF1A 2AB0A 2JASA 1WMEA 3BIOA 3EWAA 1YI8A 2VAWA 1D0VA 3O4IA 3DDOA 4QC2A 1HX7A 1WHTA 4YQEA 3ACDA 3H8WA 4D99A 4BGEA 1L4NA 4IWNA 5LSAA 4RVCA 1KAEA 4C29A 2JAXA 2ZT8A 1MZVA 1M73E 3E70C 4TQUS 4LC0A 4CL3A 3MJEA 2WIFA 1C7QA 5ECWA 4PSDA 3MWYW 1ZLXA 4EHKA 1LC0A 2IHBA 3ONDA 4JBYA 4F4IA 4BQFA 2OCIA 3GEDA 4CLRB 1GGNA 4OX9Y 3JQDA 4P0PB 1XMJA 1JR2A 2V0NA 4N5LA 5E4YA 2VNJA 1O8CA 2CLEB 3ZXUB 3GJTA 5EHNA 4EGSA 1TXGA 1XF1A 5JI3E 4OIMA 1XE3A 3BB1A 2Q9BA 3C43A 2X9NA 3DUFA 5AJHA 1JAHA 5BV8A 4WXHA 2Q0HA 5EVCA 1NASA 4NCJA 4E6EA 1CZNA 2JHFA 1L4FA 1QG2A 3QU2A 2PZAA 3M3HA 3TEJA 2VQFB 2H4ZA 4FZ5A 5CNJA 3CVVA 5E8RA 1I6MA 2XBLA 1T8WA 4CKCB 3F7MA 1XVAA 3A26A 1JBQA 2XDWA 3FIJA 3DWGA 1TJ4A 4JLKA 1UJ2A 1EK1A 4X1KB 1IUOA 1SBZA 1RWMA 3V5NA 5BXQC 1FP2A 3F4KA 1N57A 2OQ2A 3NBQA 5SYNA 1N6RA 3IQEA 3T94A 4BFTA 6Q21A 3IPYA 4LXYA 4MUAA 4D8UA 4YPVA 2VK4A 4BJ6A 2VDLB 5ITVA 4B3TB 1HOTA 1CLEA 1VRCA 1EBUA 1NIPA 3DOCA 3DMRA 4NCKA 3RK4A 4B2YA 4LRXA 1ZIYA 1ORWA 4OCZA 3UJPA 4BAZA 1E3LA 2FX5A 3PXGA 3B9BA 3TTVA 3LV8A 4HO1X 1EESA 5GONA 4KPFC 5SZJA 4PYQA 1NJ2A 1OZAA 1QG6A 4FOLA 1Y4ZA 2PGDA 3HZZA 1WMSA 3PDIA 3IA7A 3UANA 2X14A 4G84A 2RCNA 2OV3A 2Q3JA 2AOVA 2RMKA 1J8YF 3F8WA 4ZI7A 5AD1A 2VSNA 1SK9A 4HD8A 2ZJ1A 4PX3A 5CA1A 1R5JA 4D26A 4JLVA 1J2RA 2W4MA 3QKIA 1X2EA 3WL5A 3C4QA 3JQAA 2A4MA 1H22A 3ZE2B 3EPRA 3WL3A 2PEZA 2HRBA 2I0FA 2ZZMA 4F46A 1C80A 3UPTA 3D5QA 4M60A 1QRTA 2XUAA 5GJWC 4B7AA 3EEQA 3A9CA 3FHLA 5IARA 3WB2A 4CDGA 4FZJA 3HQ4O 3MUNA 2BT4A 1IEVA 3V1NA 1RRCA 3KFLA 4G4SP 3K6RA 4YS6A 4P6VF 3QPCA 1R6XA 4S35A 1QJCA 5F5NA 3TPFA 3HCPA 1MA0A 3NTXA 2OL4A 4AF6A 3CRZA 1RS0A 3Q9LA 3INGA 4XYBA 4DWJA 5AQ1A 1R27A 1BC5A 1G21E 3C3DA 1T9DA 3A1DA 4ZT2A 3EPHA 1EFUA 3L7KA 3EH1A 3HLKA 2H2AA 3P1JA 2B82A 4M86A 1KORA 3GAMA 3GNQA 1KZ6A 3AOEC 4FFSA 4OPMA 3ACBA 5L3RA 4H3VA 1CDDA 3D8TA 5D5QA 5TQ0B 2ZJYA 1PFUA 1U6KA 5LZ4A 3RT7A 4ZRDA 2EHJA 3OLYA 4M54A 3PEYA 4TTSA 2UYOA 3D81A 1DELA 4YCNA 3WAKA 4NYMR 4R8RA 5BSTA 5B30A 1FOEB 1T3SA 1CUCA 2X8WA 5JAQA 1V2HE 4RHEA 3SVZA 5I9NA 3R3JA 1T2VA 4XUGB 4P22A 1XHEA 1R0KA 1ZHFA 3KR0A 4K28A 1GA4A 1R9MA 1NF8A 1CQJA 3WHKA 1LSSA 4E03A 4HS4A 5L6LB 4P7FA 4TYMA 3GFOA 3ML1A 1TPZA 3PXAA 2Q6IA 5TQ2A 4F4CA 1N77A 4MJ3A 2ZS8A 3AFIA 1KFJB 4BYGA 1Z28A 1K2VN 2P0AA 9GPBA 2RCYA 3W8FA 4L22A 3AL0C 1MW9X 2XT0A 5FFNA 5C8ZA 2UYGA 1E2GA 1FRQA 2BFDA 4TRRA 1A5AB 4CCSA 2PMFA 2YN0A 3A1WA 1J33A 3EQ9A 4K9PA 4PU0A 4UBOA 1H0SA 5HK9A 4KR7A 1YE5A 4XWGA 1OR8A 3UCEA 4IUDS 3ZWMA 1E92A 3T4PA 5HZGA 2DZDA 4RK4A 4H1WA 4B85A 3RS3A 4AQ7A 4H1VA 3NAQA 3LOUA 5JCJA 4LX0A 2FW7A 2NOAA 2DG2A 5ICCA 3SJ7A 3S2GA 4NZNA 3OJCA 1PVOA 1AXGA 1XKLA 2L18A 4PYLA 3LHSA 1V3QE 3DC2A 4BV3A 3UWMA 2C4MA 4DMHA 3ENNA 3M4NA 3PVCA 4HC4A 5IM5A 4EB8A 2Z2JA 3VPGA 5I9IA 2O8NA 3EA4A 3EODA 1YMVA 5F2KA 2P91A 1SCDA 1ETHA 1FZQA 2W2PA 4HPJB 1YCFA 2CL5A 3M1AA 3ZQJA 1E63A 5EI5A 5TVKA 1UJ5A 3E58A 4DC9A 3DC7A 4IIXA 4QUIA 5FOTA 5F76A 1J06A 2AF4C 5FYQA 3TW0A 3ZBUA 3KWFA 1GQQA 1Y4SA 3M2PA 4MUFA 4J1TC 4IUYA 4LYAA 1Q15A 4MQEA 5KTOA 1U0EA 4JP5A 1IEWA 4F1WA 3U4QA 4B31A 2IELA 1ODFA 3E9CA 8AT1A 3C6QA 3PBKA 4PCAA 1M2VB 1HEIA 1PGOA 3TZQA 1AF4A 1H85A 4WZ6A 4ED9A 1M5UA 4YI5A 1LA2A 2BEWB 1U31A 4GSYA 4OQZA 5HILA 2WG0A 2XA9A 4DILA 2WAMA 3PX7A 2DUJA 4MI9A 2CD7A 1HY3A 1V47A 3KUCA 1XCGB 2O8DB 3F6EX 3X1MA 3FAKA 4TLAA 4AECA 4BNMA 2FLKA 3GGJA 2OCBA 1MTOA 1YD7A 2WVAA 1CZLA 1UPUA 4BEBA 3M89A 5CFQA 1CF9A 1VMEA 3CCCA 1WW8A 1RKVA 3E3MA 3OPMA 4I8XA 3RASA 1L5NA 3G85A 2ZBVA 3HU1A 1ZISA 3A9WA 3C4VA 3M9WA 3I34X 4I3HA 3RU3A 3ZBQA 1XNGA 3MRVA 2UYHA 3IILA 3H2YA 3KTAB 1NIJA 1U1DA 3HCOA 1KQFA 1OTXA 2H4FA 4Y67A 1NMYA 4Z9YA 1VXRA 2WU8A 2OOKA 1ORHA 3L8CA 4XKJA 3TIIA 3E7XA 4Y8VA 5EGNA 1WG8A 4Y98A 3QXSA 2Y93A 1JKFA 4EPTA 3LOPA 5AJWA 3DE2X 3N3AC 8GPBA 1XTIA 1HGXA 2YH2A 5D6OA 3S0JA 3A28A 1QAQA 2QTVB 3BE8A 1FSPA 1XELA 1FP7A 1M83A 1N2XA 2Z57A 2WYUA 1QRAA 4A4DA 4FOTA 4HGNA 5T4FA 3PRKE 3U3OA 3BDAA 3DBOB 1NVGA 4UXIA 4EKIA 1NVDA 1GQ2A 4DCCA 4BCCA 6YASA 3NFRA 5E9WA 5L7YA 4GOND 4IGIA 1LNZA 3LFUA 3M3DA 3TQCA 2XCSB 2PZLA 3KWJA 4XCXA 4BMPB 4EKNB 2WW8A 2OKCA 5AW6A 4A03A 2FPXA 1GUBA 1Z18A 3CH5A 4CKBB 2RHHA 2QI9C 4X44A 2C2MA 3W6NA 1DJOA 3E27A 1RJWA 1DRWA 3EZXA 1ML4A 3P9CA 4RPCA 4UUNA 5KEIA 2FNAA 1TCUA 3OA2A 4DIBA 1UZAA 1OU4A 3ZI4A 3MJDA 4Y2UA 5LQMA 2VDOB 1RBMA 1XZEA 4J6FA 4MIKA 1A82A 2PSSA 4Y0AA 4FGWA 4ARBA 5LNK6 3TWOA 4OSPA 1DKQA 5D3QA 1W5TA 5ECYA 2RGRA 2VJKA 4HGRA 1J42A 4TMYA 2JCSA 3PV0A 2HDHA 1NGSA 1V6CA 2C7BA 2FPSA 2FUEA 3OOYA 3FNFA 4PBSA 3JQ9A 4P38A 3RE1A 5B1DA 5K9ZA 1JTEA 1K7CA 3GOHA 3L01A 4NZZA 1NZFA 4V0LA 1U28A 2DERA 1GPJA 1FLNA 3ZVLA 3CKYA 4M9UA 1WD5A 3WKBA 3CCFA 1HWYA 4RHFA 1E1MA 4ND1A 1Z0AA 5IXSA 1C8BA 1LD3A 3GNTA 2O57A 5AK0A 4FE7A 5A4AA 4E5SA 3CUVA 2ORVA 4JEIA 3GLUA 5K5EA 5JZOA 4E4YA 3RBAA 1KSJA 4KXWA 4GH5A 2O5EA 3K70B 1ACMA 1Y8CA 2JCBA 1OKKA 2ZR0A 2RSLA 4EZIA 3I2JA 1EK0A 1I01A 1ISMA 2PPVA 4JUBA 4URZR 2L0XA 1QF7A 3MWFA 2Q1SA 4OXNA 4UE2A 5EY5B 1TMYA 2HK6A 2BFOA 1K5DA 1NKVA 3EVZA 1QP0A 3GUCA 3P4UA 1WUKS 3RHZA 3U4CA 2WIBA 3KV1A 3M6VA 4NMHA 3UQYS 4INJA 4PGFA 4PCVA 1LVHA 2WTMA 3GFSA 2Q62A 1USKA 3AIIA 4IX9A 5KNBD 1P62B 1S2MA 2UYCA 1X38A 2IE0A 3L82B 1DWOA 1W1WA 3ZEAA 3KQSA 5TQVA 1KNXA 2ZQZA 3IKLA 5KKCA 3TLYA 2CV2A 3F67A 3AOGA 3CZPA 4LGMA 4RPKA 5C8YA 3BSFA 4Q1FA 4URWR 1J22A 2V3WA 3U81A 1NR7A 3K94A 5M5BA 2BAGA 2V7QD 4HAWA 4QWMA 4MDYA 3U7JA 1IY8A 5KBYA 1PFKA 4M9XA 3V8QA 3IUSA 5ICSA 1Z7YA 5IZCA 2CNOA 2ZYSA 4Z3OA 3K72B 3SMVA 1AKNA 1M0SA 4PVCA 3KHKA 3KLBA 4HH3C 3WP1B 4B84A 4PICA 5BOVA 4AG5A 3EIUA 4TTPA 4Q47A 3LPAA 4PZLA 1KVSA 4FR5A 2J32A 3I8SA 4ZO4A 5ILGA 1VHJA 4II7A 1N6NA 4WKGA 3A4NA 3NDBB 5HJEA 3ND9A 3K6SA 1UKZA 4RULA 2FLWA 4MQMA 4NCBA 1GGMA 2HMYB 2R3SA 4A2CA 2A1UB 3D0OA 5HKBA 1EDBA 4G97A 1YHYA 1DIAA 2IT1A 5B57C 1MXFA 1GM5A 3UV7A 4BUZA 5H16A 4B4OA 3NVKI 4J1SA 5HKOA 2N9UA 2C95A 3U5ZB 121PA 4YWHA 2FU5C 2V65A 3PTLA 2P3SA 4FGZA 2VHJA 2WUDA 3HBJA 4JT4A 4QRDA 2GVZC 2GESA 4RW0A 4GYYA 5EZ5A 1C5KA 3RIMA 2AYXA 1GNTA 3W9YA 2CUKA 3EY4A 4YV7A 1WPXA 2MSKA 4UU8A 2KLHA 5D51S 1F8UA 5K6AC 2D2XA 2W2QA 4OBXA 2AMFA 3LGXA 1OVGA 3Q4GA 3MYYA 4MCJA 2QTHA 4DCGA 2WDZA 4U5QA 4Z4FA 3P0IA 4G23A 3N2GB 2XMPA 4GX5A 4RZUA 2Z3ZA 1EZ4A 4MWZA 1JAIA 4OM8A 4WK0B 1K0FA 2J3JA 1PJTA 1G5RA 2FR8A 3FNGA 3SK0A 1E3DA 2WD8A 4M37A 5BVGA 2GYVA 2MSCB 5HDBB 3DOJA 3EVBA 1N6KA 2FWMX 3AUKA 1U65A 3KJXA 3PNOA 4MAMA 5KQRA 1ADJA 3LSYA 4J75A 4LRUA 2VYCA 2XGGA 5ERGB 5DCLA 5C5CA 1TMOA 3V7NA 4BBPA 4E1BA 4H77A 4O33A 1NW3A 4KV7A 4BVBA 3IAUA 4CZ2A 1GPDG 3TW8A 3TGPA 1JEYA 4DT1B 4L3WA 4Q66C 3LVBA 3X3HA 3GPCA 1IB6A 1BIFA 3I61A 4LWQA 2VA9A 5HK8A 3HUTA 1YDWA 2EIHA 3MTDA 3FTFA 4OYYA 4G4SO 4ISBA 3IO3A 4LGYA 3W0LB 4B3RB 3LXUX 3IOMA 1J8DA 3JZDA 1Q14A 1WCIA 1UEJA 1XLUA 5K3BA 5BR7A 4J7AA 2HWKA 1G21B 3BE4A 4YN3A 5JASA 4H15A 1GIAA 5IBPA 2XB8A 4J49A 4JI5B 1DPFA 2MINB 3R5JA 4MLZA 3RV3A 2XGOA 3TZBA 1DT5A 1XTZA 4YTEA 4LSMA 4DA6A 2VSOA 3O03A 3O2QB 3DZ8A 2FE4A 8ADHA 2X8LA 2JHGA 4W5HA 3TQQA