1D2HA

Crystal structure of r175k mutant glycine n-methyltransferase complexed with s-adenosylhomocysteine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
252
structure length
252
Chain Sequence
TAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINE N-METHYLTRANSFERASE
publication title Mechanisms for auto-inhibition and forced product release in glycine N-methyltransferase: crystal structures of wild-type, mutant R175K and S-adenosylhomocysteine-bound R175K enzymes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 65
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 1999-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1d2hA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1d2hA02
5FHRA 3DXXA 3S68A 2AOWA 2JHPA 2NXNA 3DR5A 4FSXA 1XVAA 5DSTA 4OBXA 5CM2Z 4ER0A 3MHTA 3ER8A 4U7PB 1L1EA 3LDGA 3KR1A 3G88A 3LDFA 2BZGA 3FUVA 4FR0A 1M0EA 3CBGA 3MCTA 3FUXA 3UJ6A 2I9KA 3RIEA 1VLMA 4CKCA 1NW7A 5P8WA 2ZULA 3KR9A 2AOTA 4LG1A 2F8LA 4KWCA 3UWPA 1EJ6A 1XDZA 3OU6A 1NBHA 3PTAA 5K01A 3MTEA 4C03A 2NXCA 2VZ9A 1F38A 1VL5A 3MGGA 3BKXA 3PFGA 3HM2A 3PX3A 2BR5A 5CVVA 5DWQA 1ORHA 4MHTA 3B3FA 4X61A 3LL7A 2ZBPA 2NYUA 3KQTA 5DPMA 5E2BA 1JQ3A 1O9GA 2VDVE 3C3PA 3UA4A 4PIPA 3KR0A 2ZZKA 4HG2A 3VC1A 4BLUA 3EVCA 2JG3A 5EVJA 1RI5A 3CJQA 3M4XA 8MHTA 1D2HA 2H11A 5F2KA 4IKPA 1AF7A 4O29A 3KHKA 5E8RA 3BWMA 4PINA 1Y8CA 1JQDA 1FP2A 1RJDA 3OFJA 4QPNA 2HV9A 2PVCA 5C9ZA 2AR0A 1NW3A 2VDWA 4M7RA 4BLWA 10MHA 3ELWA 5FWAA 4KVZA 5E9WA 2PX5A 1P1CA 1G8AA 2YXLA 1NKVA 3CJTA 3GRUA 3PT9A 2XYVA 3L8DA 2FRXA 1TW2A 1JSXA 3R9XB 3G8BA 4PONA 4E70A 3E7PA 3TLJA 4E2XA 1WXWA 5DTRA 3GRVA 4OQDA 3UJBA 5CIYA 1BHJA 1O9HA 2PJDA 3K6RA 1PRYA 3ME5A 3FYDA 2O57A 3TPZA 1N7IA 4KRGA 5U4XA 3HNRA 4GOOD 4H0NA 3LECA 1JQEA 3GWZA 1NV8A 2ZFUA 1X1CA 2YX1A 5K09A 2XYRA 1R8YA 4HH4A 4Z2YA 3BXOA 3P9KA 3SM3A 3LCVB 1P39A 4RVGA 1UWVA 3EVDA 5LQKA 1VPTA 2OXTA 5DXJA 3DLCA 4K6MA 1Q0SA 2OB2A 5EMJA 1QAQA 3OE4A 2GS9A 1KIAA 5HEKA 4F85A 3EVGA 4L7VA 3KQPA 5HZMA 4QQKA 2OZVA 2ZBQA 3KQYA 5LR6A 2ZTHA 4PGHA 5EQJB 4GEKA 4R05A 3FTDA 3CCFA 4HGYA 3THSA 1FJXA 4A6DA 1INLA 1ZG3A 4C07A 5FQOA 5BP7A 3GIWA 2Y1XA 2AN3A 3NJRA 5GIOE 2XBMA 4CXMA 3HCDA 2P41A 2DPMA 4M38A 5DXAA 5DX1A 2IP2A 2VDUE 4MIKA 2E5WA 3TM5A 3TQSA 4P7GA 2IBSA 2P7IA 3FPHA 5K0CA 5HIMA 5DM1A 2XVMA 5EG5A 2OB1A 1ZQ9A 4QTUB 2C7PA 4XCXA 5LQUA 4GC5A 2CWWA 5JR3A 1M6EX 2CMGA 2V7EA 3GO4A 1DL5A 3P2KA 3UBTA 5FA8A 4DM3A 3EMDA 1WS6A 5E2AA 3D2LA 3V8VA 2AOTB 3LCCA 4PYKA 4U7TB 4AZSA 5D1NA 4RTOA 3JWJA 4P7FA 5BW4A 3FPGA 4C08A 3BT7A 1ZGAA 3KQVA 1XDSA 3OFKA 4XUEA 3LDUA 2P7HA 4YV0A 3DXZA 4RTPA 3ER9A 3I5UA 3KPJA 3AXSA 2IH4A 4PWYA 4CTJA 1I4WA 1P91A 2VP3A 3C3YA 3HCCA 4RTLA 2IH2A 2GH1A 3ORHA 5M5BA 2G71A 5ICGA 4E33A 1NW6A 1QZZA 4YV2A 5ICEA 1FP1D 4YUWA 1NBIA 5E9QA 4RTSA 3B7PA 3KPYA 3KQSA 3OCJA 3OZRA 1NT2A 5FADA 5KVAA 2OYRA 5EGSA 3IV6A 1VBFA 3UFBA 5DTMA 1NE2A 3EEYA 5C1IA 5LQAA 3NDJA 4RTQA 3WSTA 3EVBA 4A6EA 5E8JA 2JHAA 4Y30A 2UYCA 3G2PA 2WK1A 2HNKA 3PVCA 4PYLA 2IDKA 3DMHA 3LKZA 2PLWA 2BM8A 4GBED 1R74A 1BC5A 7MHTA 4RTNA 5K05A 3B3GA 2Y1WA 2B2CA 5K0NA 2ESRA 2P3LA 3HVHA 4QDKA 2HR1A 2JH9A 2PWYA 4RWZA 3TRKA 4X1OA 3E05A 2GPYA 3DULA 4JXJA 2JJQA 3LBFA 5ICFA 3TKAA 4RTMA 3HCBA 5CVUA 2B9EA 3HCAA 3P71T 3EVEA 3GXOA 4CWAA 5EMKA 1QANA 4V0QA 5GP1A 3GU3A 1YZHA 5HILA 5LQJA 2C7OA 1YB2A 2PGXA 2I7CA 3A4TA 3I64A 3LGAA 3Q87B 3NVMB 5HFJA 4FGZA 2PXXA 1VP3A 2ZWVA 3PX2A 3BGDA 3G2QA 3GDHA 2ZSUA 2QRVA 3CVOA 3F4KA 4Y2HA 2PT9A 5K0LA 1YUBA 3TMAA 4YUYA 2ONYA 3EPPA 5GWXA 2AN5A 4WVLA 3UJ8A 2HMYB 4PYNA 1KYWA 1EQAA 4ER3A 1MJFA 4GOMD 3LPMA 2JH8A 3ELUA 3M33A 1G38A 3LHDA 3MCZA 4X41A 3EGEA 1R6AA 1VQ1A 2O0LA 4QQNA 5DTQA 1JG4A 5K0FA 3JWHA 3NWEA 5CVDA 3SGLA 3GRRA 3TOSA 2CL5A 3T7RA 2PX4A 1XXLA 2IIPA 5K0GA 5DM0A 4GC9A 4R6WA 4PCAA 5EHGA 4PIMA 4X60A 3HCEA 5KQRA 1Z3CA 3SMQA 3SXJA 3UA3A 1L3CA 1EIZA 5FHQA 2O06A 3TFWA 4YUXA 3NMUF 1WZNA 5CD1A 5FUBA 3QOWA 3I53A 1RI3A 5EIFA 4DQ0A 3SSNA 3R6TA 1R18A 4BP1A 1R8XA 5F2OA 2GA9A 1KPIA 2HTEA 1G55A 3MB5A 2PXAA 4DZRA 4RTRA 4OQEA 3T7TA 3DLIA 3NW9A 3I58A 2ZWAA 4KIGA 4RV9A 4QVGA 3V97A 2G72A 5T6BA 2Z6QA 2N47A 3HA5A 2AS0A 3KQQA 5F2NA 3LSTA 1AQIA 4R8SA 2WA2A 3E8SA 5KYGA 2FYTA 3K0BA 2EJTA 3DXYA 5CVJA 3ELYA 1IM8A 3E23A 5E9JA 5KQSA 4PGGA 4C05A 4C04A 5FA5A 1JG3A 4FT4A 3ID6C 3UJ9A 3SX0A 1KXZA 5DX0A 3FPJA 2BH2A 1DUSA 3G7UA 3RW9A 3FUTA 4E2WA 2EG5A 2VS1A 3G5LA 5MHTA 1SUSA 3PB3A 2PX2A 3BWBA 3UJ7A 4DCMA 3JWIA 5C0OE 4IV0A 4CTKA 1JR4A 2V74B 2O07A 5EZQA 5B1SA 3A7DA 1QAMA 4IWNA 4NECA 4G56A 4P7KA 3NTVA 1ZHFA 2FCAA 3ERCA 3AWIA 1X1AA 4E32A 3KQOA 2BM9A 3HVIA 2Z6AA 5K0JA 2O05A 4XUCA 4GF5A 2NNWB 3CC8A 9MHTA 2JHCA 3CKKA 1UFKA 3IEIA 5ERGB 5DSXA 1G8SA 5GIPE 1WG8A 3BWCA 3I9FA 4FP9A 5CVEA 2ZLBA 4HRAA 2XVAA 1SUIA 1YZ3A 4AX8A 5FULA 4E30A 1V39A 3P2IA 4GUAA 4ER6A 4E2ZA 1D2GA 3P97A 3DMGA 4YMGA 3GRYA 2PX8A 2NP7A 1ORIA 5EPEA 5GOZA 2QRVB 3EVAA 1B42A 2ORED 3B5IA 3GCZA 4FSDA 4PYIA 1QYRA 2PXCA 4GOND 2ZIFA 5JUWA 3FTCA 2AZTA 3SR4A 4RVHA 3DTNA 3RODA 5E1DA 4UOEA 5DRYA 2C7QA 3VSEA 4LECA 1PJZA 1YF3A 3OE5A 5G02A 4AUKA 4KDCA 4PYJA 2ZCJA 3PLAE 3UZUA 3LKDA 5HIIA 2PSSA 2GB4A 2ADMA 2IDJA 3THRA 2AVDA 2UYOA 3G8AA 3HVKA 3CJRA 5FQNA 2R6ZA 3DH0A 3TKYA 4QPPA 2LD4A 1I1NA 2IBTA 3KPWA 3EMBA 3M70A 4AZWA 4B17A 1ZGJA 2NXJA 3EVZA 3HA7A 5CUQA 5K8VA 4FS8A 2YXEA 3P9IA 3M6UA 3M6WA 2IH5A 3PS9A 3JWGA 5EOVA 2AN4A 1G6Q1 1X1DA 3GRZA 1FPQA 2G70A 3C6MA 2PY6A 3MAGA 4HGZA 5K0EA 1D2CA 3C0KA 3AXTA 2I62A 3EGIA 2H00A 2YVLA 3B3JA 3HVJA 5E1OA 2NXEA 3NWBA 4E31A 4POOA 1M6YA 4ATNA 4WXHA 4QTTB 3MTIA 3AY0A 4BY9E 2YXDA 1SQGA 2BR4A 4OA5A 4V0RA 2G8NA 4EQZA 4M37A 1VE3A 3KKZA 5EMLA 4YMHA 4AZTA 5H02A 3O7WA 1X19A 5DX8A 4RX1A 1EG2A 2R3SA 3M6XA 3T7SA 3SSMA 1DCTA 5D1HA 1KPHA 1T43A 3HA3A 3KQWA 3P9NA 3A25A 3QV2A 3HP7A 2YUIA 2ZW9A 4HSGA 4LWOA 1UIRA 3IYLW 3FZGA 4LWPA 1NV9A 3FYCA 5DRTA 3R3HA 4RVFA 3FTFA 1RI2A 5K03A 1AQJA 1F3LA 2ERCA 3SSOA 1EJ0A 4ER7A 3FPFA 2QYOA 4CKBA 4EKGA 3R24A 2YTZA 5LQNA 4OA8A 4BLVA 3GNLA 3BUSA 2UYQA 3BZBA 2PWPA 1U2ZA 3BGVA 1FBNA 4PYOA 3PFHA 5E1BA 3T0IA 2ZVJA 1JG2A 1KYZA 3ELDA 4XUDA 2WA1A 3G2MA 5EHIA 5HIJA 1JTFA 3G5TA 1JG1A 1RJEA 1XTPA 3BGIA 2Z6UA 1JTEA 4DF3A 1YFLA 2P1DA 3HEMA 2P35A 3H2BA 1RI1A 5EEHA 4BP3A 2P3QA 2C7RA 2B78A 1XJ5A 2B25A 1N7JA 3C6KA 2K4MA 2P3OA 3G2OA 4C06A 3VC2A 4HTFA 2OBFA 1HNNA 1HMYA 2AOUA 2AOXA 2AVNA 2QY6A 3P8ZA 4FZVA 4P7JA 3U81A 2NP6A 3OPNA 2ZZMA 1IXKA 2YR0A 1OR8A 4EVIA 3NDIA 3EVFA 2PT6A 1NW8A 4ZTBA 1I9GA 1L3IA 1TW3A 2OKCA 2XYQA 4EK9A 4P58A 4RTKA 3DOUA 1YFJA 1R00A 4X63A 3HTXA 5EMMA 2AOVA 3LCUA 2I6GA 3FTEA 5DT2A 5GM1A 4R8RA 4RVDA 5LQCA 3NVKI 3KQMA 1XDUA 5LQRA 3UJCA 1QAOA 5DM2A 5KS2A 1AV6A 4KW7A 3A7EA 1VP9A 5IKMA 4F84A 4F86A 4R6XA 2GLUA 2KW5A 4HC4A 1O54A 2OY0A 3KPUA 3SVZA 3TR6A 1ZKDA 5EEGA 3A27A 2QM3A 1KHHA 4PCLA 3OU2A 2Q41A 3OZSA 3REOA 5GM2A 5T67A 2ZIEA 1XCJA 5K0BA 1BKYA 5FWDA 2FK8A 5EIWA 1EAMA 4YV1A 3GJYA 4PNEA 2ZZNA 5GINE 3DUWA 3IHTA 3M6VA 4KIFA 1G60A 4RTJA 3LX6A 3DMFA 3FUUA 3KU1A 5BW5A 3UJAA 1VIDA 1TPYA 2IPXA 3BWYA 2FK7A 2ONZA 2PBFA 2CMHA 3ANXA 4IV8A 5EC8A 5FTWA 5BXYA 2OPBA 5CCXA 2UZ4A 3G89A 2B3TA 5EZSA 2OO3A 5E1MA 4RYLA 4GOLD 4YUVA 3O4FA 4DKJA 3BKWA 4ER5A 1WXXA 2EJUA 2A14A 4ISCA 4GQBA 5EKXA 3UJDA 5ICCA 3KPVA 3FRIA 1RI4A 2H1RA 1IY9A 5IH3A 2FPOA 2UYHA 4YUZA 3QOXA 4OBWA 3OZTA 1JSZA 2EX4A 3B89A 5FCDA 4E2YA 3AJDA 2PV0A 5EKUA 2BR3A 2ZIGA 3FPEA 3FUWA 3HCFA 5CCBA 2HWKA 4MTLA 2G1PA 1P1BA 3P2EA 1WY7A 2GAFA 3DP7A 1XCLA 1KP9A 3GGDA 3P9CA 1H1DA 1SG9A 2PKWA 4RSRA 1SKMA 5DM4A 3Q7EA 2P40A 4MQ4A 4QDJA 4PYQA 2CKDA 2YQZA 4AZVA 4DCGA 2EFJA 3EGVA 3MQ2A 4PYMA 5T64A 4EMSA 4M36A 4CKEA 1KPGA 3CGGA 1MHTA 3R0QA 2IFTA 1SQFA 4FT2A 1N2XA 5DLYA 2FHPA 3KR2A 4C4AA 3EEOA 5LSAA 4DA4A 4DMGA 1SVUA 3VYWA 4EKIA 3TM4A 3LBYA 2ZBRA 4HTFB 3MERA 1BOOA 4OX9Y 3X0DA 3OU7A 4MWZA 3A26A 3O31A 2DULA 2IGTA 2AOUB 3FRHA 5HOQA 2QE6A 1L3BA 2P8JA 1L9KA 5HIKA 1X1BA 4KDRA 4QVKA 1NW5A 1RJFA 1Q0TA 1RJGA 1KR5A
chains in the Genus database with same CATH superfamily
2Q3JA 3QTBA 1FMFA 1T3TA 5J40A 2DUJA 3GZTB 5BYBA 1QHXA 5GVSA 4I36A 1EHYA 4TLCA 4D9EA 5BUSA 3N59A 5AVQA 5EIHA 3U49A 5A06A 2FLWA 2P30A 4N0QA 2EL7A 3ND7A 4V0LA 3HBJA 3QVLA 3BE4A 4O4IB 2CSXA 4IIBA 2BEKA 3FAKA 4J1NA 1A4XA 3GLIA 1LLCA 4ZYWA 2GN1A 3RAEC 2CYCA 2H2DA 3U4IA 4ESHA 4UBLA 4XVUA 3F7NA 3DF9A 4BLTA 3JYLA 3RVDA 3GF4A 4K46A 5IG2A 1UDBA 1G2QA 4NBLA 1G5HA 4PN3A 1CUGA 4C03A 4HVCA 2AFIA 1W75A 5L6MB 1V9LA 1TD9A 1CB7A 2AW5A 2BR5A 4G9GA 3UT0A 4JUIA 4EJ2A 5DHPA 3DEJA 5BSMA 4B3XA 3M3PA 1U3FA 3QKSB 4FDUA 5D87A 5KX5B 3D4IA 4NZOA 5FL7A 1NBOA 4YY3B 1OZAA 4MVJM 3RHZA 4FONA 4KWEA 1DC6A 1DPGA 4UZFA 5EVJA 2PVPA 4BBZA 2JJ8A 3L7KA 5SZJA 7ABPA 4Y1RA 1E6KA 4X9XA 2FPWA 1O1YA 1WDTA 3NDBB 3KM0A 4HB2A 3CKYA 1YDGA 2WU0A 4MUJA 2G77B 3O2QB 1IIRA 1BA3A 1UBMS 3IVCA 3MSXA 4E03A 1MFPA 4GP9A 4AL4A 1KYQA 4EA7A 2PVCA 4RIFA 5MGBA 1ZCBA 1IONA 3MN1A 4JLKA 3RIGA 4CIBA 1XLUA 1VE7A 3B1WA 1QTNA 2GARA 5DGDA 1AKYA 3WK4A 3ZJYA 8ADHA 2LKCA 5FWAA 4KVZA 4LQLA 5DK4A 2NU6B 5SY4A 1FSFA 3KYBA 4TSRA 3V1MA 1J0AA 2G4CA 1DC8A 4EY3A 1M76A 5J4KA 3IDZA 1FRQA 3G8BA 3D7RA 3TL2A 1HWYA 3VKWA 5LB2A 2PKEA 2X2OA 1JAIA 2D06A 2IYVA 2W6JD 1RMTA 2AJCA 2O57A 4II2A 3SM9A 2XDWA 2RIRA 3BYZA 1LVGA 5U4XA 4EUEA 1TIKA 3KJIA 4Z9AA 1DJNA 3IAAA 1KSGA 2ZIXB 3N05A 1U90A 3EA0A 1KKMA 1D6NA 1VG0B 2IEZA 3ORFA 1VJ1A 2C58A 3PUWA 1BVUA 4HH4A 1MGPA 2HXSA 4QSMA 1JU4A 4RMNA 4CG2A 1FDWA 1UWVA 3W34A 5LQKA 1QZTA 3ESBA 3T5MA 1UFRA 1GCAA 3DLCA 1QHHB 2OGSA 4FFVA 4K6HA 1NRIA 1XZKA 5BSVA 4BKQA 1HFWA 4I1VA 2IEIA 2VOEA 3B2EA 1MPXA 4H4EA 4IDOA 2BDEA 3CEMA 4QYXA 4DBVO 5AHWA 1IY1A 1LSOA 2BI8A 2PIDA 3CSSA 3LFHA 4FEGA 1ZVMA 1CQJB 3NH6A 5DNVA 3UHOA 1FBTA 2A9VA 2BKEA 2EZUA 2V98A 3D6VA 3QJ5A 3URKA 4DSTA 5HJ7A 2VEDA 4KN8A 4YJHA 2C2XA 1INLA 4MHOA 3CY6A 3S7ZA 3ER6A 1ZCAA 2RI0A 5L53A 2WG2A 3AF5A 3ZBPA 5DXAA 4YP5A 4ZKEA 3TM5A 4CETA 2E5WA 2XYGA 4UNQA 5FWYB 2WILA 1TA9A 2WV7A 5CLLA 3Q0TA 3V32A 3VVBA 3B1YA 3E82A 3I6ZA 1VJ0A 1REQB 3MD0A 2ZE7A 2L2QA 4R71A 3VR5H 1M6EX 3DEZA 2CMGA 4UZSA 2LE0A 4OREX 1AZTA 3AGQA 2WYWA 1RZUA 4F3CA 3D2LA 4TYYA 1E3WB 1U1IA 2AOTB 1HE5A 2BFNA 3OCYA 4FHFA 5AH0A 1ZUNB 4L3WA 4K9RA 4WY5A 2VAPA 2PUVA 3CNOA 3KQVA 3T9CA 1NDHA 1UPTA 3SQLA 5C1OA 3TL6A 7REQB 1UMDA 1O5OA 2V45A 2F43A 3CF4G 2MSLA 3CF0A 1O5IA 3IDOA 2JK1A 2OENG 3DWEX 2WJJA 3INYA 2ABWA 4DM4A 2TMDA 4AJ9A 3V1KA 1H4SA 3FPKA 4A2QA 5ICGA 1GZ6A 5CDHA 1QZZA 2GT1A 3H13A 4K6KA 1FP1D 5FI3A 1C4OA 4AG5A 3U3DA 3IA2A 1NXTA 3BRQA 3OCJA 5ADVA 4CEHA 3D6MA 3QLTA 4UCXA 1XEFA 1II8A 3WBKA 3DVQX 1SGWA 2O19A 4TL7A 2CFCA 3R0XA 1BQ3A 3TW0A 4W6ZA 3WSTA 4MROA 3E7WA 4HDSA 4HLUA 4QJ5A 1SBZA 2E1PA 3AR8A 3O0TA 3PVCA 4KE8A 2YXBA 2DT8A 4Q12A 1X8LA 4CZ2A 3AILA 3DYVA 1JN0A 1LF0A 4OLAA 4F7WA 1I5OA 2HCRA 4Q3AA 4JI7B 4DG5A 3RJ5A 4IFEA 1OLUB 2R65A 4G9BA 1XMXA 2ESRA 1GPAA 4N1AA 1WHSB 2C2GA 1S02A 3WMWA 2UU9B 3VH2A 3O1LA 4EHFA 1RXIA 4OH1A 2I6SA 4OF4A 3QHAA 3TKLA 4JXJA 3IUSA 4EIWA 3EXAA 4URXR 4TLMB 1N9KA 2J4CA 1GNVA 1GP2A 1BEUB 1LSJA 2VK4A 4G5RA 5CM9C 3OH8A 1B8PA 2MR6A 3U6BA 5BR4A 1UKEA 5EMKA 2Q5JA 3N2IA 5AW7A 4CRWB 2PSDA 1Q3HA 1SOUA 2R7NA 2RHLA 3ZGOA 4WD3A 3EXFA 3CNLA 2BMVA 2PGLA 3MWDB 3X1ZA 5JYBA 1D2EA 5KTMA 4HSEA 1J09A 3TIFA 5I8WA 1PJ3A 2ZS8A 1L7BA 2X5KO 3D3QA 3EXIA 1N6OA 5L3QA 4HGRA 1KYWA 1NF8A 4XSHA 4LZNA 4P7BA 4PZ0A 2JH8A 5BPFA 3B1ZA 3M33A 1KEPA 4UEJA 1E9AA 1E5VA 4HEA6 4B3MB 2F1IA 3SD7A 4D3DA 2AJBA 2YYYA 4N54A 2V9CA 2VAXA 2L17A 3SQDA 3AVTA 4JP5A 4LY6A 2W2NA 3UXYA 5LOVF 3SFVA 5IVPA 4DIUA 4GX1A 1JSRA 4NBRA 4PCAA 3RWBA 1UFQA 3F6PA 3SQOA 4WASA 2B8EA 3M5WA 3E70C 2A92A 4Z4QA 3QXJA 3QYAA 1ENPA 3NHFA 3ZLUA 4EGCB 4ZZ2A 2VA8A 3D1LA 3EOAI 4JELA 3ZVRA 2C5SA 4XB1A 3PNMA 4JXKA 3RVRA 1O58A 1QHGA 3JQGB 2OC9A 3CZCA 1GEEA 2AMVA 4TS3A 1PJSA 2YZ7A 4XM0A 1SQ6A 4OL9A 2VNHA 1T1GA 1U04A 5FBVB 4XB6B 3DLIA 4BVHA 5G0TA 1L8OA 3LX5A 5CA1B 4MPPA 1DIOB 2CKMA 2P6NA 3EF1A 3EIOA 1E6EA 3V97A 3PJFA 4L4UA 2K7FA 2C94A 3VR2D 2PBLA 1H0SA 1N5DA 3WADA 4S1WA 2VO1A 1J07A 5EXSA 2VSYA 2IQIA 1PT6A 4LXGA 1LEHA 4KHZA 1DRKA 3TCNA 2YBEA 1FDTA 1LZLA 2GJ9A 4IRUB 2ZJ3A 2FPUA 3JAMA 1Z2NX 3ZJTA 3H3XA 3GV0A 3MPUA 1JH9A 1R6DA 2ACKA 2ETXA 2B8NA 2GVZC 1HNWB 4ENSA 3O4RA 1UM9A 1ZN8A 3QMWA 4J76A 5C0OE 5JJLA 1AZLA 1V5GA 1G0OA 1YBFA 3LCRA 4IOLA 1IMJA 1IAVA 2HT6A 3C3XA 2DKNA 2J6CA 2XMRA 3LZCA 4L4XA 3COZA 3Q5GA 4EFKA 3E1SA 1HR0B 1BH6A 3DCIA 1UJ2A 1DO2A 4WECA 3MJHA 5AKJA 4YQZA 4M1MA 3RVSA 4FW8A 4TTIA 1CF2O 4B3IA 4JP3A 4LI3X 2EAUA 4D0SA 2VTDA 3LTNC 3DZHA 2YVKA 3K9BA 4RLFA 4R7GA 4YCBA 1YZ3A 3BXGA 3O74A 4GUAA 4FLMA 4NZZA 4OK3A 4QOHA 2A5DA 2P91A 2PKQP 5FF9A 2VCYA 2HEGA 2D1YA 1YRHA 3IUPA 4LJLA 3AUYA 1Z4LA 2HAEA 4WNAA 4HJXA 4EBBA 1Z17A 5JYEA 3LL4A 1ORIA 1P5JA 1RBZA 2QRVB 2XTAA 2ORWA 1AQYA 1SOWA 1BHSA 2GK7A 1HLGA 1YDWA 1J1ZA 1DWQA 4Y9SA 1G2PA 4ZYTA 1C30A 1PZGA 2FSPA 4HLUC 1GKUB 2W4MA 3AQ4A 2R47A 3WISA 4ZVMA 2V5VA 2WZDA 3O3OB 1C1DB 4S2EA 2GAIA 2YN4A 3D7MA 1PSDA 5C35A 2H9YA 5I3ZA 3FWHA 2QN6A 2ZYRA 3DYIA 1L4YA 1SWVA 4KFTA 3GY0A 4OHVA 3PKIA 4QPPA 4OQFA 1JVBA 4QSHA 3WBFA 4AZWA 3T3HA 4DSZA 4GFDA 4ZCRA 4GRDA 1GUFA 3VR5D 4D8VA 4C14A 2PVSA 2RKBA 2AEMA 4AWAA 4RJTA 2IITA 4B4UA 3BH7A 3J7TA 1KMNA 1O87A 4FD3A 3BBLA 3FWNA 4J16A 5EOVA 3BGWA 3WP0A 3EUEA 5K3EA 1FPQA 1XCOA 2ZTUA 2QRJA 3HFGA 1P29A 1JJIA 5TS3A 2FZ4A 3KQNA 4DJ5X 1J49A 3HVJA 3NHSA 1I2BA 5TB5A 4B6FA 3FFBA 4QUBA 1N0WA 3L77A 1QOPB 1LLQA 4BN5A 1AO0A 3KXDA 2EZTA 2JB9A 2PM8A 1XELA 1VKZA 2XR1A 2H1WA 4FB4A 4L7QA 3T9EA 3RS8A 1Y7HA 1YFZA 3A04A 3LXRA 3K05A 1GY8A 2XB9A 5J4VA 3CCCA 3ZDAA 1LS6A 1N0HA 4UD6A 3W5VA 1C29B 4RZQA 5DLPA 1QV7A 4GE3A 5EZ6B 4EEKA 3B20A 1U3CA 3FZGA 3IBSA 3IPCA 3MTQA 2AN9A 4HQFA 5K99A 2ZUFA 4CYMA 4RVFA 1U2DC 4E14A 1X7XB 2PZJA 3F4LA 1ZM2A 2X19A 2Q6TA 1NN3A 2ZSAA 2FMFA 4MKFA 3Q7QA 3CLRD 3OD5A 5AJWA 2TECE 4DR6B 1W0KD 4ZPXA 4PW0A 1XMVA 1LRJA 3A3PA 2OECA 1VMKA 3QW2A 4G9EA 4O25A 2GF2A 3M1AA 5DLQC 2QTFA 3GGOA 3LT5A 3SF8B 3GA5A 4B6SA 1SPBS 1H8EA 3HEMA 3EQ7A 3N2KA 1MIOB 3E2PA 1M5RA 3RKSA 1F9AA 1UZAA 1LSSA 2RC5A 2XYPA 4Y0NA 5J9FA 1C9NA 2GJAA 4BVBA 1Q7CA 4U5XA 1XMIA 4YXWA 1JR3D 3NO4A 1UWKA 4FZVA 5F12A 4AY5A 1QFSA 3UMBA 4NHOA 2HU2A 3CIOA 5KYXB 3EY9A 1E92A 1YVDA 1EYZA 1PNTA 3I2GA 3TDMA 2CHUA 1EIWA 1GAEO 4JU8A 3G0IA 4MWBA 1MV8A 1U5BB 2EF0A 2NU7B 1U28C 4AY6A 2XEXA 3CZPA 1YQ9A 2H85A 5EA2A 3A6DA 3EIFA 3UW3A 1AV6A 3ZE0B 3TJZA 2FFBA 4PGFA 5REQA 4G0VA 1P18A 3B82A 3JQ7B 3I9MA 4G24A 4H6XA 4B48A 2FE1A 2B36A 3DPUA 1YJCA 2GLUA 4LRSB 4OO3A 5LA6F 4DJJA 1FQWA 4HNSA 3O7MA 4JR0A 2QBYB 4ITRC 5A7GA 2IKQA 3UMJA 4GT1A 3L4BC 5FL7D 3KWLA 1E0JA 4MAMA 3GFQA 4KO1S 5AI5A 2HM7A 3W9UA 2H5JA 3H5OA 2ZIUB 1JDZA 3FDFA 5EIWA 2C4TA 1U65A 3MFYA 5B3JA 4PNEA 5KNLA 2IZ7A 2B8JA 5F3RA 1LTKA 4BWVA 4Z51A 2AKEA 1A98A 2IYXA 3EG9A 1UBJS 3NAQA 3WLJA 2Z5GA 4JX8A 4AD8A 3BCUA 5HCNA 4B81A 2O4CA 5EC8A 4FILA 4HQLA 4IFIA 5FOUA 3U31A 1Q1NA 5COBA 2OPBA 1H6DA 4J94A 5A5EA 1F3OA 1UC8A 4XKJA 4PXYA 5E1MA 1Q2XA 2WHXA 5DLDA 4RYLA 2JIBA 2LIPA 3QHQA 4PLFA 1K8YB 3C8DA 1E0KA 1ZBQA 3MTDA 3ZW7A 4EJSC 4CTNA 5JO0A 5D3KA 1X74A 1UDXA 2C59A 4RPLA 4UHEA 4X84A 1RI4A 5FI5A 5FA6A 2FPMA 4BP9A 3B6IA 1X1SA 1QIKA 4B3HA 4ZQEA 4MUEA 2VT3A 4MS4B 1ZN2A 3Q3JB 3OZTA 1I1HA 4OBWA 3C1OA 3UJ3X 1DC7A 2AC7A 2J0VA 3AEQB 2WV9A 3CG4A 4EJFA 2RGRA 3FUWA 1XDDA 5C3UA 2DJ5A 3ZU2A 3P2EA 5I9NA 1MVNA 1XTQA 1RWBA 3TB6A 4Y2YA 4ZZIA 2QP3A 3PQFA 1BW9B 1PR4A 3DHEA 2O54A 2PSFA 4AO7A 1OXTA 3GZNA 2IZ1A 1X1EA 2YQZA 4ZZ3A 4TMWA 1L7XA 2BSAA 3BTOA 4N7JA 2ORIA 2Q9AA 3PA8A 2YICA 5EN4A 4ZVVA 9ABPA 4PE5B 1EZZA 5M7EA 4FX5A 2BGWA 2CE7A 2XYHA 3A2KA 4HVLA 1TYZA 4E08A 2C84A 3GOHA 3TM4A 1U02A 3NHZA 1AGXA 2R48A 1BOOA 2X1VA 5T4HA 3AUKA 2P78A 1UFVA 1ZOOA 4E51A 4Z9BA 1JU3A 3DAPA 3K0AB 1SVKA 1XAGA 5CNJA 5HIKA 4DJAA 4XGIA 4QEZA 2YWCA 3CA8A 2PLAA 2GERA 2QVGA 4R3WA 2AOWA 4C3UA 1R27A 3LLUA 3ZTYA 4TV8B 3M49A 5BMVF 3FE2A 2X8BA 2F7SA 4D26A 3USES 1EWTA 4IDBA 4NS1A 3Q3IA 1XPJA 4A8JC 1XRNA 5CFNA 2D74A 3IC5A 3NALA 1FLAA 3EXHA 4D46A 4EPWA 3P2OA 4CQMA 2CCGA 2FA9A 3LO5A 1U1FA 2NWQA 2RAVA 1QV9A 2QVZX 2RHDA 4JCCA 4QDUA 4MVCA 4D98A 4ADSG 1WY5A 5JIBA 4G86A 4Q3BA 4XCVA 1JBKA 2FCRA 4BNLA 3L5OA 2OM2A 3WP1B 3WNZA 3NWPA 4ZYVA 1VG8A 3N6XA 4LOIA 5DN9A 3CPSA 1NOIA 5CFRA 1VMEA 2JATA 2H9AA 1VL5A 3LI2A 2JVKA 1H6BA 3PFGA 4B2IA 3F49S 4ZV4A 3P9SA 3KDSE 2PUFA 4MHTA 3GUHA 2WUFA 4UEKA 3BB1A 4KKXB 3RB8A 2BZ0A 4DR3B 4MW5A 3H5VA 1LJUA 2GQ0A 4U3JA 4TL9A 4IJQA 1O9GA 3VNBA 4HRXA 4ND8B 3NB0A 5E6UB 2B69A 4UNPA 3PI7A 1DCFA 1K0FA 3B53X 4ZOQI 4WZ6A 3K1YA 1QKIA 2CB9A 3WIVA 1ADCA 2FWJA 3OPYA 3LQYA 5FOSA 4NAVA 3RUIA 1RJDA 3MOIA 3GMSA 4LSZA 1CUEA 2WF6A 3ULKA 3A58B 3IODA 1K7EB 3C1AA 5K3SA 5IAKA 2ZWPA 4BLWA 3NX4A 5ALJA 4OXRA 1OWMA 1IPEA 1E3IA 2IHUA 4UHFA 3W90A 1XJCA 3CJTA 4V2UA 4AT1A 1MXHA 4F4HA 5KTOA 1K88A 1Y81A 4KO2S 4LTNA 2C7BA 3JQDA 4YJ3B 1K08A 4E3WA 1KFCB 3DE2X 3GLKA 1TTPB 2VBIA 3EUAA 2DRIA 2VC2B 3A0UA 3EWNA 3PGKA 3QY9A 4I50A 1OXXK 1ZU5A 4EYQA 5JZBA 2XXAA 1WM1A 4HX2A 4UHBA 4AF6A 3UCFA 1O9HA 2X9QA 1GN9A 2QQGA 2PUBA 1XMQB 3PXAA 3HNRA 3UPUA 2BFBA 3DQPA 1E62A 1OXVA 1Z4PX 3AQIA 1T5HX 1AUXA 3NM6B 2WJ6A 5FBZA 4ZT2A 4CMKA 3STHA 4EI2A 1KHTA 1TCCA 1K0UA 2YNMA 1U3WA 3UANA 4WPGA 4LMPA 4ZJPA 4DR4B 1CJTC 4PTYA 2Q4TA 1WA5A 3PXGA 2X2PA 2ZVDA 3A9SA 5DXJA 3UWSA 3R8FA 3FVQA 1BE6A 1O96B 2IYQA 4KO8A 2VRCD 4ND7A 1T8UA 3P1JA 4H0FA 4MVWA 1V1JA 3OQ6A 5FKJA 3ZTWA 1RPTA 5IEJA 2AWNA 3GJ6A 2Q8PA 1Y1TA 3AR3A 3AVXA 3OBIA 4MQMA 4JNKA 2OGWA 2QXTA 5GZ6A 4D3XA 3HXMA 3KG2A 4YP7A 2W71A 2P1RA 3OCWA 1DZIA 3VMFA 2CFTA 3WGQA 4E11A 1WKCA 5I01A 1F12A 3OEWA 2B30A 4FFDA 4G5GA 5AM0A 3VJKA 3SXUB 1EVJA 2ZXEA 2P9BA 2QRNA 2A88A 2JGEA 2M6LA 2GFIA 4CCSA 1HDOA 3GFGA 2WM3A 3QQPA 4NFLA 1M75A 4MA4A 2OB1A 4V0OA 1T2UA 2QROA 4IVNA 2XGJA 4QKQA 4DHEA 4GC5A 5GZ3A 3CX4A 1Q7TA 1GZDA 2AEJA 2FW1A 2V7EA 3BIFA 3MWEB 2PKQO 2NGRA 3AHCA 4FLEA 3LPCA 4YRSA 5D3MA 3RRYA 5A4KA 3BDAA 1H69A 3U0VA 4W5WA 1FX0A 1KAHA 5C4MA 3THXA 3GJZA 4KXLA 1DIRA 5DHAA 1QMPA 5JZ9A 5KOHB 1EXDA 3CONA 3FYUB 5ENZA 1NJ6A 1T0UA 4QT0A 5M2QA 4GX0A 4IIHA 4RTPA 3NFRA 2D4AA 1K7SN 3RQSA 5KDDA 3MS2A 4RTLA 1H23A 2IZ6A 2VNSA 1E0SA 3ORHA 4TS4A 3ZZTA 4NH0A 2L42A 2GZ3A 4IIUA 2JBHA 4J7AA 5F9MA 4YV2A 1LDBA 3UJPA 2IBMA 2VOJA 3GOQA 3H5IA 5KVAA 1TVKA 4PIVA 4OXIA 2GBIA 2XX3A 5D6NA 3IOBA 3ZS8A 3H5LA 4FI3F 2VYND 2ECQA 4N5NA 4FQ5A 1ONSA 3Q0EA 4V2IA 4KFRA 5E8JA 1JTVA 3I42A 3UAOA 4OYYA 2P2GA 5BWBA 4IIJA 1QR2A 2WD7A 1KFKB 2PLWA 6ADHA 4LMRA 4D4GA 1USGA 4ALMA 2CZGA 2XQVA 3NWJA 3M1LA 3L92A 1BO6A 1AGYA 1TNDA 1NL3A 4BMYA 1GU1A 2ZTLA 4J43A 1TF5A 1SC6A 5JFGA 2JCVA 2HLDD 1K7XB 3ZE8A 1NVXQ 3FJYA 4E15A 4OATA 4I3HA 1XZAA 3IIIA 4HFRA 1I6WA 2YWHA 3QFSA 4C22A 3UGQA 1GNQA 3NGLA 4KN9S 3LSYA 3Q10A 2R1UA 3F0TA 1GKLA 2P0AA 1YZHA 1IG0A 4X24A 2C7OA 2HJGA 3A3OA 3V48A 1MW9X 3L02A 1NOJA 1ISRA 1CY6A 1VP3A 3MQFA 1Q74A 3RSLA 3BGDA 1I5EA 4I08A 5TJ9A 2C5HA 4J7XA 4GGOA 2OG2A 1W4ZA 2XIQA 2P4QA 4ZIRB 4I14A 1ZGBA 1E96A 1EQAA 4MTCA 4ASUA 1M0SA 1TMYA 3QWFA 3ZQUA 4HKTA 1PVVA 2FW7A 3NIGB 4Y9RA 1ELOA 2XSZD 4KNYA 1R6AA 4Z4GA 4NMHA 1KKLA 3ZWQA 2QYSA 1DP4A 2HK9A 1NHWA 4NATA 4GAEA 3R9IA 4EG7A 4ZK6A 1L8XA 4B1FA 1PR2A 2CL5A 2R7MA 2RAUA 3R44A 3R6LA 4BV8A 3CLKA 3HK2A 3GFRA 4HDKB 4NYJQ 4J0KA 2X6QA 1U1GA 5FUXA 1KARA 4KXMA 3HCEA 2XGOA 4MVJH 1TLFA 2ZQZA 3PNVA 2GR9A 4JLUA 5F73A 4KV7A 9GPBA 2LR0A 4M6WB 4BNNA 4BRWA 3STTA 3V80A 5CD1A 3U40A 1W87A 1GO2A 3MF4A 2R6DA 3DF7A 3MXTA 5F1OA 1T91A 3X2EA 1TA0A 4ZTUB 4C2BA 1FTSA 1G59A 1ADYA 1KO7A 4O4JB 2YJGA 5AVYA 4RORA 5DT9A 2X5NA 1Z0SA 1E2IA 4UEQA 1P0PA 3CNQS 4NJEB 1V3UA 3GNQA 1G55A 5L3RA 4L6CA 3I2HA 3HJGA 3T7TA 1E1QA 1NNUA 2JAWA 3EEFA 4TQGA 3U4QB 2G72A 2V5UA 3D0OA 1R6UA 5CX1B 2F8SA 4R8SA 3LPAA 1Q21A 3E8SA 3JQCA 4LX0A 2JI7A 1NN1A 4FFRA 4RNCA 5CVJA 3RTAA 1BYUA 2ENUA 5K2OA 3L01A 2BY4A 1XFDA 2XKBA 3L8CA 1N2BA 4FFNA 4BO5A 1JG3A 3CSUA 3AJAA 4X90A 4BO8A 4XQGA 1F51E 1KDTA 1PWXA 3ABQB 5IBPA 2BH2A 3ZS9A 2BF7A 3OJFA 4JBNA 3ORYA 2XOEA 4MPDA 1BMDA 1VE6A 3AEZA 1GZ3A 3DCJA 4Y98A 3TSZA 4B80A 1H8ED 3BXXA 1UWCA 4UMVA 1QQAA 4EB6B 1QC5A 3VJLA 4ZO8A 1OD6A 1D7OA 2JAUA 2ODBA 1EDZA 2WU1A 2VP9A 3ANTA 4BMVA 3U56A 4XPIA 4G25A 4HDRA 4UXJA 4GEGA 3P9PA 4K81B 4JBWA 4WK6A 2PUTA 3QVGB 4E32A 2OYSA 4CMGA 2E82A 4MR8A 1KZ7B 1XQWA 4QNRA 2JVJA 3N2LA 4RH3A 1YA8A 1KVRA 4MQ5A 3O8RA 1KNXA 2WSIA 3EDOA 3F8TA 4OIMA 3C8MA 3R3ZA 3KOMA 5CVEA 5FBWB 2AX3A 3TS1A 3PHJA 1GGJA 2R7AA 2GD6A 4KYIB 2BFDB 3P2IA 3KCQA 4GBGA 3E5RA 1GCUA 3CMMA 4RA9B 3PENA 1HTWA 3CTMA 3O8QA 5KVQA 4PFJA 3GRYA 3VU8A 1CVLA 2FMUA 1QF7A 4KO3S 1B42A 1OZGA 3Q9UA 4F8EA 3GH1A 2HMTA 2Y05A 3JQEA 4L73A 3BN3A 4M9RA 4OKNA 3VM6A 1T8SA 1CF9A 2WIDA 4QYSA 1T3GA 1E9SA 4N49A 4CHGA 1FMJA 1MMFB 4QPJC 4ZHQA 3FNQA 1BWPA 1WXEA 2V5AA 2NU8A 4HVAA 2CY0A 1S0UA 4HZGA 4Q5IA 4WOKA 1FP6A 2XCIA 4YRKA 4C7MA 5FOTA 4J2OA 2BAGA 3BTSA 3G0CA 4US1R 2OWDA 3BJEA 4XARA 2GMWA 2WT9A 4GNRA 4LTDA 5A3RA 1WUJS 2KI5A 3ACBA 1XZHA 1RU3A 1T24A 1FDOA 3HL4A 1SHKA 4E4YA 3GDFA 4MUAA 1YBHA 4EJMA 3TZCA 4H7EA 4DVJA 3DZFA 1K3TA 4A3SA 1YBAA 2DC1A 2WG1A 1WIWA 3RYCB 3RTEA 1I2MA 3DO8A 1NDUA 1T2NA 2R8XA 4U4AA 5CM8B 1ZXXA 3LOUA 2FZCA 2VXYA 4P4TA 3BSWA 4FS3A 1AGRA 5FBQB 4BRUA 1T9ZA 2A5FA 1HYEA 1EG2A 3R7DA 4M54A 3W6ZA 5F52A 1DCTA 4OP3A 5DHFA 2WNSA 1JHXA 1NM5A 4O4HA 3AINA 3RS4A 2VCHA 1IN4A 1FFSA 1GNTA 1C3LA 4WEQA 1WDMA 4G1FA 3PEFA 5KDLA 5ALVA 3A14A 1E3LA 4ZYLA 1EEXB 5AJYA 3N0WA 3FUCA 4OUDA 2EATA 3ZK7A 1Q15A 2H4XA 3N53A 5BVHB 1R4NA 2DPGA 2JGAA 3BZBA 2PWPA 2WUVA 3HYRA 1FBNA 3HQ4O 4PYOA 5E1BA 2BYTA 1UPXA 2BE9A 4IIDA 3ELDA 4PLZA 5AJHA 5HHTA 4MAAA 4OFXA 4UJ5A 3H8VA 2R751 1YJ5A 2FHSA 5CIWA 1XTPA 4KQFA 3HLTA 3LAWA 3ZOKA 1MAWA 4X8LA 3VHXB 1O4VA 1HDEA 2QTBA 5J2TB 1IVNA 1TT5A 3P7MA 3O1HB 2FRDC 3PR2B 1UBHS 2P1ZA 4YMWA 2OORC 3PUIA 2R11A 1M1YE 5IUKC 5H9VA 3IURA 1Y6JA 2G06A 4KQHA 1J0EA 1JFLA 1U9ZA 1YB1A 3F2VA 3MGKA 3BHIA 4FKMA 4WX2B 3O3CA 4YCAA 4FZ3A 3WDMA 2JIDA 4N3CA 4XWYA 4GGMX 2WM2A 2V1XA 3SC2B 2CVQA 1CUIA 3PC6A 4B7XA 4EG6A 1OR8A 3FHTA 1ONBA 1DOHA 3O8CA 1L4HA 1W4BA 2VP4A 5JNRA 2QE7A 4FINA 1C8BA 1XAJA 3K0EA 1U31A 4HNAB 4P4NA 4RMHA 1BXKA 2XLBA 3TBHA 1CZUA 1D4FA 1V3VA 1LDMA 4IZHA 4RSHA 1VZ2A 4J49A 2OCPA 1KMQA 1GDDA 1J97A 3NV7A 4R2KA 4R8RA 3RBXA 1X8KA 1A7KA 3KQMA 4NABA 4OI2A 3A1FA 1SH7A 1QAOA 1S3FA 1TZBA 2R2AA 3PFWO 4WIAA 4EPTA 4BLOA 421PA 4TMYA 5ALDA 1SZCA 1QRUA 5IKMA 1IZ0A 2WU4A 4QPZA 2KW5A 2VBFA 3EGXA 4BXOB 1E60A 3GJSA 2OLKA 3NIBA 4OQNA 4OU4A 3VNQA 3W06A 3GL9A 1W8DA 4GMGA 2PX6A 4HX5A 4O2AA 4Q05A 2CMFA 4NBNA 3KOXA 4M87A 4QG7A 5LQDA 5DP1A 2VUSA 3GJYA 5CDUA 4CMIA 3HEBA 4P84A 4KHPB 4Y6RA 5CAEB 4KQWA 4EW2A 1GCIA 1SQ0A 2HO4A 4PLHA 2XRFA 2P9GA 3MJSA 4DV2B 1SCBA 3BWYA 1L4FA 2YJ6A 1E7RA 5CCXA 3EPJA 1BTOA 1Q12A 3F9CA 3B6ZA 4W9NC 5EZSA 2YWDA 2DMRA 1YKFA 4AJLA 3FG9A 1GUDA 1ZIXA 2XY4A 1T0HB 4LIPD 3PQ6A 5EKXA 1PT5A 2XKAA 4R7ZA 4A4DA 2ROQA 5FFMA 4BL5A 5EXPA 1LVHA 5IUNC 3P0IA 1TGVA 4L4RA 5ILQA 1K1EA 5DYIA 3PC2A 3CEAA 2OV4A 2OAP1 3HCFA 4U2CA 5DHTA 5CCBA 4M60A 1KL7A 2G1PA 4OLBA 3SYMA 4G07A 2HHJA 2W2QA 3FN4A 3Q5DA 4NEGA 2CFSA 1PR5A 1RHKA 1UWLA 1K2WA 1OV6A 1N2CE 1Z5VA 1WTCA 5GGYA 1GL6A 1WF3A 2AHOA 4MRMB 3UPDA 3SOZA 1E2BA 2FUNB 1RMQA 4FT2A 3KQUA 2N42A 1J1UA 4C0KA 1T9BA 1L9XA 2WU3A 1PCXA 2XUGA 4IGFA 4F5WA 3KR2A 3SBDA 1RMYA 4O8ZA 1NVTA 1AS3A 4XLLA 1OFUX 4AZ3A 4DMGA 1JIKA 1P1JA 1SVUA 1UIMA 3GWGA 1EHCA 2I4LA 4G1MB 1YQQA 4RLHA 3ZZNA 2VSFA 3EDCA 4EKIA 2ICAA 2NPFA 1NLUA 1XXHE 2Y68A 1EK1A 3OQHA 3T3MB 1K4YA 2CJFA 3TW4A 3VNSA 3TL3A 3TQQA 5H82A 2E49A 3UMMA 1YQUA 4JA0A 1POWA 1SPXA 2BMEA 2BKVA 5FPHA 2C96A 1BMFA 1ZD2P 5TVGA 4WJLA 2AXQA 2I1VB 3DBLB 2W2VA 5CDFE 1KR5A 1TMOA 4F4FA 1I7DA 4BZXA 4D9GA 2HA5A 1ZR2A 1FFBA 1XZBA 3UY4A 1UAAA 2GD0A 4HRYA 1Z2DA 2YH2A 1KQOA 3KE9A 4EY6A 1HDYA 3D3WB 5EKSA 4EB8A 3R3VA 4KCGA 4PVCA 2XZOA 4REMA 1US8A 4L95C 4NZ9A 5AOBA 3MLEA 3REGA 1JQJC 1LPOA 2PZGA 4MMYB 3WA7A 3E9DA 5KYWB 1QUEA 3HKCA 2IE8A 1YRWA 4BPRA 3GR6A 4ZVQA 3I9JA 4HS4A 2QN8A 1DO0A 5ALUA 5JWOA 4YALA 5ELXA 3FCXA 4L0CA 1ISSA 1JKJB 3DKPA 3HLKA 5JD4A 1Q1ZA 1ZCZA 1HDXA 1UBKS 4ZCSA 5CYOA 4CF5A 2JLSA 2CV0A 2WABA 5BSHA 3VJMA 4MV1A 1IUKA 1KDYA 4MV5A 3AVWA 1CUXA 3HSSA 3KQTA 4TQUS 1F0NA 2C99A 3EZLA 2DBQA 2G9VA 1WUHS 1O5TA 4PZPA 1LV8A 5DZSA 3U4CA 2A1TR 3ZZUA 5AUNB 1U1EA 2D2FA 3ZWDA 8MHTA 1BWSA 5EHNA 3D64A 4GDMA 4TUYA 3MJDA 1BKSB 1R8SA 5E8RA 1Y1LA 3EGDA 1JQLB 4HADA 1DAIA 2REOA 4RHFA 1PX2A 1JQDA 2R00C 3AL3A 3VH3A 3WLQA 4EZBA 1PDVA 1TU0A 2ZT6A 1EWKA 1D8TA 2XA9A 3OQMA 5ARBA 1NUQA 2J5RA 2J7PD 3ELWA 3L0IB 1ODIA 3PC8A 3AR5A 5FWNA 1YA6A 10MHA 3CUUA 1W94A 4Z1MD 2ETVA 2XJ9A 2E7ZA 2XXBA 3DUFA 3N3AC 3EBLA 5EWMA 1PKEA 1SUAA 3I8OA 3L7LA 2D5IA 3EZNA 1UP7A 1YSCA 3PQDA 1E2KA 5EERA 1A9OA 1PGJA 2WJ3A 1D9XA 3HCOA 4OMCA 1WXWA 3KKQA 4YEDA 3VH4A 2ISCA 3U9TA 3GRVA 1UKZA 1ZRMA 1UDCA 2RH4A 3V46A 1YWGO 3TPZA 3CHYA 2BL4A 3FYDA 4DDKA 2VF8A 4KRGA 6REQB 2NP6A 2EDCA 4MKZA 2JAXA 1QLJA 2QJRA 2R60A 1XV5A 1WDWB 3RUEA 2JCSA 2R1TA 3ZQ6A 1R8YA 1YB5A 3AR7A 1ZY2A 3SM3A 2CLCX 4UOZA 4ZGWA 1GGKA 2Q2NA 2HMWA 2I55A 3ENNA 4HQKA 1XAIA 1E3DA 3CUEF 3FBWA 2WNHA 3KALA 2WIBA 1XMOB 1N5RA 3O6VA 4ASUD 4LQ4A 4RZIA 1QFMA 5LOVB 3TLXA 3NBMA 5DI9A 4YRQA 1W5SA 2QT0A 4QBIA 4DMFA 2AEEA 5LKAA 2PE5A 5FDFA 1P3DA 1HE1C 5HQ3A 5IXJA 3GD5A 4GECA 1WE2A 3RTGA 2I66A 1LQUA 3NUZA 4OHPA 3TSAA 2A9KA 1OTXA 1ZG3A 5FQOA 1CFJA 5BRJA 3ISJA 2O7SA 3F3SA 2OCDA 3QF4A 4H08A 1K7YA 4XX0A 1NZFA 2GCOA 5TVKA 2QIPA 2WVHA 1F4VA 2HN9A 1PVDA 2M32A 2YZGA 3PL5A 4HWKA 4R1LA 2HT1A 2AE1A 5JMWA 3OZBA 3USZA 3KKLA 4Q16A 2YWFA 3OFNA 4FCVA 1V2GA 2QY9A 4EH1A 5DFAA 3CPHA 2JGIA 4PHGA 5KNCA 3LFUA 4LKRA 3IOEA 3R9KA 4AFNA 2EDAA 2JA2A 3RJMA 3TINA 1ISHA 1CNMA 1A9PA 1Y48E 4KR3A 1II9A 2ZJAA 3FMPB 4R1NA 4ODIA 4CMBA 3ORQA 1EFKA 4EQ6A 1ZGAA 1TYEB 3BWDD 4ZO7A 1J21A 3I34X 5LWQA 3ZR4B 2ZPAA 3T15A 2O6HA 2H2IA 4CMJA 1P91A 3TZ6A 1SBNE 1Y4DE 1KJIA 5JD3A 3TTYA 4S1PA 4XR4A 1SVIA 2HJWA 3GN1A 2C1EA 1J90A 1Y63A 1Z15A 2DZDA 2O48X 3EZGA 3GFPA 2CZQA 4J2TA 1VJCA 4BKRA 4ZVOA 1L7VC 4N3NA 1Y7IA 2VL7A 2Z1NA 2Y0EA 5DTEA 2IV2X 4HUQB 4CIWA 2GPAA 5DM70 1J9ZA 1ZOIA 3KDAA 4RYDA 2CVZA 5GONF 4EHNA 1N6PA 3IALA 1E59A 2QZ9A 2XUQA 1ESNA 1SXJA 3AVUA 4YCDA 1RYYA 3D5EA 3HM9A 2BZ1A 3SFZA 2OZLB 4BFVA 5BN3B 4XXHA 1UODA 3R74A 1YOVA 5BSKA 1E4YA 2RJ3A 2C57A 2FKNA 1SZDA 3ZN2A 5KDOA 4L57A 1D4AA 2DCMA 3RUPA 3A4YA 3U3MA 1P4JA 2Y1WA 3LW7A 1E99A 1FL9A 4V0ME 3CZRA 1XEXB 2HO5A 2V4ZA 2VHQA 3AHIA 4F45A 5NLLA 3JQ9C 3ODPA 1NJSA 1N57A 2QLFA 1CSEE 6Q21A 3G5MA 3OZEA 4X45A 5CB8A 3CURA 3E48A 1PYDA 3GCGA 2X22A 1ATIA 4GP7A 5BOSA 4BB5A 5C5CA 4IIGA 1APBA 4RF2A 3JVUA 2FW6A 3FWPA 3WWPA 3Q87B 2V6IA 1OX4B 3SYNA 4FGZA 3KOUA 2RIPA 4H3SA 3HYTA 2B4KA 4L27A 2IXAA 2DVMA 5GZ1A 4KN5A 1SA0A 4QU0A 3WGLA 4LJRA 2FUCA 1NMZA 1I1QB 3PC8C 1DBQA 2NUPA 2JKVA 2QR2A 2QN9A 3T7KA 3GEBA 1RCUA 3I5XA 1QH0A 3H8SA 1C5KA 3V3KA 1ES9A 2PWZA 3ZHXA 1JG4A 4AO8A 1PUIA 4FOTA 5K0FA 2YYSA 2D0PB 1HT1E 4RANA 2FMIA 4ND3A 1UJMA 1VSUA 3G8YA 1SNYA 1XXLA 4X91A 3E9CA 4Q34A 4R6WA 1VPEA 5EHGA 2HA6A 3M6MD 4UAVA 5C5DA 4X60A 3EG5A 5MN5A 4TX1A 5A3QA 3L1JA 3K96A 1UKCA 2ZI9A 2O06A 4DYDA 4ZOBA 4HXYA 3AERB 4E13A 3PXCX 1PYOA 2JHGA 3WMEA 3H9EO 1GXSB 2H92A 4DA8A 2A5JA 2D8MA 2VLBA 2EKZA 3GRKA 3R6TA 1E5QA 3TLBA 5F7XA 1T4CA 1QR6A 4LJSA 2JFOA 5EY5B 2WOJA 4DZRA 1PDWA 4DCSA 4MRPA 1QO7A 2C2HA 1B8OA 2GXSA 4A10A 1CS0A 2RK4A 5F1PA 4KIGA 3WLIA 4PQRA 5AD1A 5JV5A 2B5VA 2W2OA 2ZJ0A 3H9CA 2OV1A 1Q44A 1U7OA 3HA5A 1QJCA 3PPYA 3UOWA 4CLRB 4PLCA 4P34A 1B8UA 1EDEA 3D7KA 4LZJA 5HWSA 3DXYA 4TMFA 4K87A 4G0YA 1KEUA 4LZPA 4QXMA 4LSGA 3RVBA 3SYTA 2I3AA 1E64A 1EK2A 2RFLA 3WYDA 4HDQB 1E7QA 2IY9A 1A4RA 5JADA 3BL6A 1UXKA 2O2IA 2OA0A 5JALA 2IP4A 1ACLA 4FPXA 4MRRA 1RWWA 4UCWA 1G4AE 1MPTA 5BSRA 4KXXA 2MSWA 4RFVA 5AVSA 3NEJA 3O83A 4QO7A 2OR3A 1L0BA 3RDPA 1ZSYA 3QQ5A 2VTEA 3UJ7A 2TMKA 3W5CA 1P1KA 4MULA 4TZTA 1KZYC 1FNMA 2FZEA 3S2ZA 4D9JA 5JS6A 4UC0A 4OXKA 1Z6AA 3KZ1E 4CHTA 1G8FA 3K0FB 1Z5PA 4L0QA 4P7KA 3VU0A 1YZLA 2O0MA 3L0SA 1TUBB 3EODA 3A36A 3K70C 1E7SA 1RYZA 4G0PA 5KWJA 5TF0A 3W04A 2FSSA 3ZHZA 2Z6AA 2XCRB 3S5JA 5K0JA 2XUOA 3BA1A 4JYMA 1PD1A 4XUCA 9MHTA 1I80A 1EUYA 2XD4A 4IKEA 5DJ5A 2PMCA 5DE3A 4GZMA 1E5LA 4PHCA 5I7OA 1SUIA 4XW2A 1XZDA 3AFHA 3C6YA 4IHQA 4YLEA 3VHQA 3FXAA 1K2VN 1QQ5A 3T7IA 1G3MA 2VUUA 3P9XA 1KI1A 3WS7A 1WHTA 4KPUB 2ECPA 2HCJB 5ARDA 2IYFA 5G3ZA 4DYHA 2AXEA 1I4TD 5LA6B 3Q2OA 1KE2A 4NOMA 2NU9A 3WMXA 1LBIA 4PG5A 1EK6A 1AX9A 3LA6A 1SCKA 2QAJA 2W6IA 3MJFA 3OP4A 5LLTA 3U5ZB 3GCZA 3K0HA 1PJLA 4FSDA 2FFHA 4JWTA 4MVYA 4PYIA 4IF4A 4R1OA 4RA6B 4XEUA 3VTFA 5L8VA 1PP4A 3JARB 1UQUA 3RVKA 1CRPA 2QQFA 3U9SA 2QJFA 4K8RB 2GZDA 4HMQA 1C81A 3E5MA 1GV0A 3HRKA 1DQNA 1N6LA 4U2KA 3SXPA 1E98A 3W05A 4KFCA 3ACDA 3LVQE 2SBTA 5E4YA 3SE0A 2ZAYA 2H4FA 4QJIA 5HM6A 1DSSG 4XA8A 3RSCA 4CEIB 3G2NA 2LD4A 3KKNA 5AKKA 3DE1X 2WJZB 3NYRA 1KH1A 2FKAA 4G0UA 2WFLB 1KQ3A 1P80A 3P9IA 4PGAA 1ZMTA 4B76A 5B6PA 2R87A 5CG1A 4UVGA 2UDPA 3E22A 4WA7A 1A7JA 2J1LA 4O4LF 5K0EA 3FLEA 1E9DA 3MJRA 4X54A 2YUTA 1WXFA 1Y1RA 2B1JA 2EQAA 2FZ5A 2QTVB 1GOTA 3H42B 2YFQA 4HLDA 4PCVA 3TEJA 1W30A 2ZUSA 1X7HA 3MMZA 4NWIA 3EDMA 3ZZMA 3PYMA 3D3JA 2NMVA 5ARCA 3FF4A 2YXDA 2DQYA 2NUTA 1LZKA 5CDGA 1KY2A 4OAPA 4MWCA 4M37A 1XGKA 1ZH6A 1PFUA 4FW9A 2IEDA 1JNXX 3AR4A 3VV3A 4EF6A 5DXFA 4C5AA 2FTKE 1GLVA 5F23A 1AKWA 4REOA 3UHPA 4Z8XA 1RWVA 3I2FA 5IVIA 2D5BA 1FFXB 1UT5A 3EAGA 5FB3A 1A88A 2ZYIA 5KREA 2FLKA 2IC5A 1EJ0A 4KQGA 3E1KA 4ER7A 6NULA 1P0MA 3MSCA 5DISB 2RG1A 1V26A 2YTZA 4ZC8A 3GFTA 4MLCA 4LWQA 1G20A 3DLTA 3K35A 3IAHA 4QLAA 4CL8A 2XMZA 4GMDA 5ALWA 2BSXA 3B5JA 3A6KA 2I8LA 4D57A 2SICE 4OGFA 4US0R 1T5TA 3HXLA 4NESA 3OLZA 2PUWA 5EIBC 5JG7A 1AKTA 4N3AA 4BV9A 2P3QA 2ZUTA 3WFJA 4YDQA 5BMVB 4FJ1A 1K4KA 2K4MA 2HNAA 4B83A 4R1SA 3RKUA 1R9GA 1DS6A 4O02B 5EXXA 4BGVA 5K20A 2JLCA 3R8CA 3BE6A 1JPJA 5C5EA 3IEPA 4NICA 1AQUA 1ODKA 1RTKA 1SEVA 1VJRA 2Q5EA 2RHOA 3MUNA 3O2JA 4CG3A 4FYXA 4IVQA 1SVWA 2WF7A 1QP8A 2FR1A 4KRXA 5H3LA 2YFKA 4MWEA 3QUAA 1HK7A 3N8KA 2WIKA 3NZEA 4RTKA 4LOKA 1TE2A 2PR7A 3CBQA 2JJ2A 4F12A 1LPSA 3C87A 3Q1KA 1SU4A 2EU8A 4B3RB 1RAHA 2HGSA 4NDNE 5C37A 3OIWA 4KAJA 2QJOA 3T0GA 4D8XA 4G1UC 2ZRHA 4EUNA 1THZA 1DQPA 3EASA 4Q00A 5KI6A 3TXYA 3S2IA 1YD7A 3ESZA 4QM6A 2QXYA 1XA0A 2HL6A 5FLYA 4DVGA 2EZ4A 3GUUA 4M21A 2E55A 2X40A 3BXHA 1QGOA 3HI6A 3OZSA 4YQEA 1UBFA 4B87A 2ZIEA 1XCJA 2WNIA 4CMAA 4OQQA 4MW0A 3GARA 4F9EA 2FK8A 2I22A 1EAMA 5JQGA 2C78A 3L8HA 1I30A 3O4VA 3WGHA 3IOMA 4BWFB 4FXPA 2JAQA 4ZJZA 1JMYA 1Q0PA 3JU3A 2ZSFA 1A2QA 3M6VA 1GTG1 3BD7A 3JXEA 2OXCA 2HREA 3MLAA 4DOMA 3MMNA 3L46A 1PSZA 4EM6A 3KFVA 5KSPA 1YE3A 2M1XA 1QG0A 1YTLA 3UXMA 5A5FA 2RHBA 3MGAA 4AP5A 5EHQA 2R8OA 4C78A 3DT9A 3KETA 1P7YA 1GQOA 1NASA 2UZ4A 1V11B 1M2GA 2JFFA 1FCJA 1I3MA 4ZVTA 5HMLA 1I4EB 4BQQA 3TGPA 1W9MA 1OFVA 3K30A 1S4MA 1EFTA 4XD2A 2XUAA 5A2QA 2PG3A 2SKEA 1T4BA 2PDAA 1T6YA 3RC9A 3DM9B 1IY9A 1K27A 2WD9A 5HFNA 2JANA 4Y6QA 1X7YA 5BWNA 2UYHA 5LBTA 5T8KC 4YRDA 2H7YA 3UAXA 3A1UA 1QVWA 5JLAA 5EJ2A 1TZMA 2ZPUA 4LYJA 2G1AA 1HKHA 3I6BA 4N6NA 4CKBB 4C6RA 3L06A 5CYGA 821PA 3MXOA 3P9CA 2X4GA 5JY1A 5DM4A 2R66A 1YR8A 3HWWA 4UPEA 1PLLA 2ZVPX 3HR8A 3VTAA 3R5XA 1Z2CA 3NTXA 2J59A 1NJ5A 5C32A 3L7BA 1ZIPA 1EFPB 1SQFA 1M7GA 1MC5A 1R0XA 3BS4A 2KBFA 1IZ7A 1F9EA 4MH0R 4RW0A 1U0GA 2P3SA 1V8ZA 1BAPA 4UHJA 1LC0A 4DV3B 1L5FA 2HHCA 3LDAA 2JJ1A 3KP1A 3X0DA 4ARUA 4A9AA 4X1KB 1CQZA 2IGTA 3K1ZA 4UASA 3FRHA 4W8OA 1A71A 4N8EA 4L8FA 3JD4A 1GV1A 2QXUA 2CD9A 4OHOA 3ZWXA 3RC8A 1RM0A 5A5DA 3T34A 2HLPA 2JHPA 3DR5A 3KDPA 1D2MA 3ZDRA 3S29A 4ZYZA 1MAVA 3IUYA 3LHSA 3OKCA 1K5HA 4RY8A 5EUCA 4BWGA 5JDIC 1ZNZA 3ZJ5A 2P4EA 2R85A 3E4DA 1P2DA 3I28A 1FLDA 1WW3A 3HPQA 5AHRA 3PVSA 5KNCD 4OB7A 4LY3A 1QVZA 2ZULA 3K70D 3KYDB 2YOHA 3D6TB 4Y9UA 3IJPA 1EJ6A 2WOOA 1X9HA 2HRQA 4Y2TA 2PEZA 4R3NA 4YYEA 4EZEA 1F38A 2JS7A 1E0AA 4K6GA 2VTBB 3JPYA 3REQA 2XTMA 3KT3A 3AB8A 2PD3A 1FZTA 4IDEA 3PHLA 3RBZA 5C8YF 2REQA 1EFAA 4PX3A 2CYBA 3KD2A 1QO9A 3OY2A 3WKDA 3U7GA 5JCJD 2ENWA 3C3PA 3IXMA 3F9IA 2PS3A 3KR0A 4FGJA 1DPFA 5CNMA 2GK6A 1VHWA 1OXUA 3OF5A 3ROQA 2O3RA 2VTVA 3ND5A 5F5NA 3LHKA 1UAYA 3U4DA 1CUVA 1GLNA 3CNNA 5JSKA 1RRKA 1TK9A 2R6R1 3R6DA 4J3FA 4DDMA 1FP2A 1T3ZA 2N0SA 3HJNA 3NORA 4I8XA 4IW3B 4I5FA 3PWKA 3WDSA 4D8TA 3H4VA 3VYVA 5ITSA 2EZ9A 3RSOA 3DS8A 4BVEA 4LXXA 5LDHA 2QMUA 3AI1A 1D6JA 3SX2A 3FY4A 4DSUA 4KAXA 1Y33E 4MVJG 2ZRKA 4EA8A 4MIYA 1G8AA 4RM3A 1WQ1R 2DAPA 2HJRA 5FOQA 2LUOA 2VQFB 1BCRA 4RM2A 4WBXC 1P2SA 2ZEJA 3RHSA 3I52A 3VKHA 1Q0UA 3E6AA 5AJTA 2XEDA 1RAEA 4FCCA 2QTZA 3BPSA 4FYWA 4OYHA 4RCVA 4ZODA 3DKRA 3UJHA 1OLXA 4GOOD 3ZBTA 4B3SB 5A6VA 2BEVB 4IMPA 3F78A 3PC4A 2ZDQA 4BIIA 4Z54A 2XYRA 1IOVA 3PDIA 4WXMA 2A4MA 3LPDA 3Q6IA 4MHSA 1JE1A 2Y0CA 4S04A 4N3GA 1AVTA 2IA5A 4KSYA 4LN1A 4BEBA 5J4YA 4Q4HA 4I55F 5J5CA 4OX9B 2RGYA 1RACA 5H16A 4HDMA 2ZUVA 2I2FA 4GE0A 1LWOA 2DWPA 4N0DA 2Q3BA 4JLVA 4NEHB 13PKA 1H5NA 2AH5A 4X3CA 1A82A 1VXOA 2J3HA 2PZ8A 4OQZA 3RQIA 3DT8A 3AV0B 4B4VA 4GR9A 2XV1A 2JI8A 1KORA 4H1UA 1X7WA 3W5AA 3E03A 3Q40A 5LUBA 3QPVA 1QHNA 2AE2A 4YP0A 5DIFA 3K2BA 2VH5R 3TIXB 3ZV7A 4DY4A 1O3YA 1TRHA 2Y93A 3OTQA 3GIWA 4MKIA 2PYDA 2VNJA 3BZUA 4J9VA 4CL0A 1OROA 2VPIA 4CXMA 5EJGA 4Z0PA 2VDUE 1NPDA 5JAIA 4Q1DA 4RPKA 1FP4A 1GRNA 4GUDA 2FR0A 5AW6A 2BKLA 3BMQB 1QPZA 5AW3A 5FOWA 1ORVA 2A7XA 1HZZA 3LUGA 1QVRA 4R84A 1CB0A 3PLRA 1XD2B 1ZD3A 1A9TA 3HCNA 3I6YA 5JHGB 2OT3B 2FFRA 4Q03A 5EIBD 3DFZA 1YQTA 4R8LA 2XLCA 1SC3A 2WAYA 3OPXA 4DCCA 2QD1A 4MR7A 3TNJA 4PYKA 4M7WA 2V7XA 5D1NA 3RIMA 4XQEA 2A0XA 2G80A 4UM8B 2DHEA 5JC8A 3NOOA 1RLOA 5AOCA 1G21E 1HQKA 1NQUA 2P7HA 1Q1AA 2FETA 4EUHA 3TI9A 1H2BA 2B82A 4JP8A 3RD5A 2FAXA 2YQ4A 4PFQA 1QCYA 4R0NA 3C8HA 2A30A 3QUBA 4G0MA 1KQFA 3AVVA 2GPSA 1L5WA 5DYTA 2PBZA 2CF6A 4D25A 4UTNA 3SBEA 1CZKA 1R2QA 3N6RA 3MWKA 1DAHA 1LQ2A 4R1TA 4ZANA 4KRYA 5E9QA 4NYJR 4II3A 1PSWA 1A97A 3KQSA 3AF3A 1AC5A 3BHNA 3AW8A 4UU1A 1V41E 2BKXA 1FX1A 4IDFA 3RJ9A 2AQ8A 4H15A 1VHQA 3EOZA 4S35A 4L2IA 1JMKC 1FYEA 3UO8B 1G19A 1N9ZA 1OH7A 1NBMA 2H3EA 4CDMA 2PFSA 1Y4ZA 4D0LB 3KAPA 1Z5UA 2A6PA 1NXPA 1ZKMA 4EL5A 4M1SA 4D4MA 5LD2B 4YRLA 1N33B 4I9NA 2JJMA 3WOHA 4F6RB 1B0AA 2Q0QA 4L0DA 2LTAA 1EQUA 4HWSA 4UNSA 5KYVA 1AK9A 1B43A 4GI1A 3K0KA 1ZK2A 1EKXA 1V4VA 3JX9A 3K0CA 4LISA 5AUOB 4KNVA 4TVBA 5JSUA 1D9ZA 4TQAA 3WFIA 3RTBA 5IJ0A 1S7GA 2GPYA 3I6QA 3QIAA 5T4EA 4DXHA 1N8TA 3QX9A 5IDWA 3EPHA 3KBBA 1EINA 4I9HA 1KYYA 2QRQA 3Q1LA 4M0DA 1EUCB 1OF1A 2WJWA 3DJFA 3SDSA 4YIKA 2GPWA 2WJVA 1JEJA 2ZR8A 2L18A 3ETJA 3KT0A 4MRVA 3IMFA 2CLFB 1BH2A 1GPLA 1ONOA 2W6ID 2WT4A 3NRBA 3IE1A 1ISPA 5HF6A 4J0FA 1DRVA 2ZSUA 5DYWA 4TVSA 4LA4A 5JCOA 2QMHA 3UCXA 5JO9A 2BBSA 1Q0HA 2J3IA 2JPDA 1DJQA 1HEYA 2UYYA 2X9NA 3ND8A 4NH4A 5DBFA 3EOBI 4C6HA 2P2SA 3W79A 1O8CA 2WWTA 3OWHA 3E9QA 3RAJA 3OZUA 4HV4A 1QU2A 2V4MA 4MB6A 3TRDA 1OGIA 4E7OA 4F1KA 1X9IA 3GP5A 1QDUA 2ZUUA 3NJ4A 4JV5B 2OCGA 1F7VA 4D3SA 1LNSA 3VZPA 3CR7A 2Z9CA 5BQXA 2EW2A 2IIVA 2KSQA 2FR8A 3N1UA 5JCPA 4NRDA 3THYA 3NHYA 3ZKWB 4BWYA 2I91A 2IRWA 3P9ZA 4WLVA 2ET6A 3MJTA 2GYUA 4JJ4A 3DO5A 2DFPA 4LYDA 3ZLTA 5KQPA 3AF1A 2WTNA 3CO5A 2P6MA 5EZYA 3ZWPA 1OQAA 4HDNA 1NN0A 3AP1A 4JBYA 3ONFA 5ALRA 2D1SA 2WF5A 4MQ6A 4QYIB 1EP2B 2X0DA 3HP4A 4PSCA 3RYTC 5LFAA 4UU0A 3H9JA 1EA7A 5LNK1 2QMQA 3MB5A 2IX3A 5FH9A 1RE0A 4URHA 3A1WA 3NIFB 3DHNA 1WO8A 1YQGA 2YOGA 3FVTA 4RK0A 2KWIA 5CT8A 1XL0A 1Z12A 5F2NA 3C3BA 1RKQA 3LSTA 1V16B 1BZYA 3AJ9A 1E3SA 1V2HE 1EMDA 5E9JA 4PR0A 3OUTA 5DGCA 2CLOB 5F51A 3PCTA 4M0EA 2GTIA 3BAZA 4D4JA 2EBFX 2G76A 4ONEA 1CF4A 1GPH1 4B6RA 2VNAA 2Y71A 5AIBA 2CNDA 5DMHA 3JALA 1W85A 4Q9JA 3IAM6 4DCTA 1QIHA 4IXMA 1BXGA 3NBAA 4LXYA 4YTEA 1BVHA 4M9UA 2GJ8A 4HD8A 3OMXA 5C8VA 3DZJA 3RG2A 3OECA 1QAMA 5A71A 2ZSEA 2BMFA 4FSHA 3C48A 3K1TA 5A6SB 1LPMA 1V8BA 3ERCA 4KLRA 2R8EA 3H04A 3WWCA 5DB4A 3RT1A 4CN8A 4HPWA 1U2TA 2R25B 4IXWA 1E9CA 5LYJA 3TFOA 2J48A 1YE8A 4YBZA 4DLPA 4ABTA 4W5NA 3HB5X 2VXOA 1RZ3A 3BWCA 1PO7A 4NYMQ 4FP9A 4GM0A 2IHVA 4Q4JA 4B09A 4DLUA 2MSKA 1XTSA 2R5FA 4DDVA 4CIVA 4B45A 3E53A 4WK0B 1BJTA 1J8DA 4PAGA 1MJGM 3CLSC 2PX8A 3V7FA 4TTPA 4PHTA 2X8JB 1AQ6A 1AS0A 1BS9A 4UNIA 3ZIUA 3DE5X 2O1EA 1XYYA 4AKGA 5H5JA 5ECWA 4V3CA 1GUYA 3R4CA 2ZDGA 4G41A 3TNDA 4F5YA 1VC2A 3COWA 2GZSA 4LRUA 5ETJA 4BGEA 4CBVA 3ZGNA 5E1DA 4Y2RA 5T4BA 4TV9F 2OGZA 2EW1A 2ZJ7A 3PIRA 3L93A 3Q7RA 4HEJA 4BNYA 4XYLA 1K6IA 1YOBA 1GFSA 2QT1A 3UZUA 1YQDA 2R4UA 2XOKA 4Z9XA 1VCNA 4UKDA 1X9GA 4BB6A 1B6RA 1S01A 3MGBA 3DW1X 1D5WA 1HTTA 1U8EA 3EMBA 3PUYA 3TJRA 1WMAA 2I1QA 2V7UA 4H77A 1LBHA 4ZT7A 4BMSA 2A0WA 2GX6A 1WULS 2XUHA 1YMQA 4C43A 3Q6NA 1W1IA 5TGDA 4WLUA 3RSFA 3V2HA 4RE5A 4F2GA 1IXYA 1I7LA 1DAPA 2F1RA 1Z2OX 1E2HA 2YZMA 3WICA 1OFGA 1M6VA 3PJDA 2AV6A 4QBGB 3OOEA 1BDBA 1OI7A 2B4YA 3PUXA 4OA5A 4FYVA 4A92A 2G8NA 5JCOC 2E18A 1HDCA 1WUYA 4RJ2A 2ZBEA 4C5BA 1KWKA 2ASVA 2VDJA 4D3YA 3KLBA 2D2EA 5CFMA 3DVRX 3M6XA 3JQBC 2JCBA 5D1HA 3I39X 2H2FA 5DU2A 5LP6C 2PO5A 1Q92A 3BL8A 3L7JA 3DAHA 4MJLA 4LJ8A 5TQ2B 4PG6A 2WSMA 4ZK2A 4HL6A 4AYTA 4DMMA 1UJNA 4MI3A 4OHUA 4OHZA 1P0FA 3FFWA 3HZRA 3R24A 4R54A 4M1OA 4M9ZA 3TVDA 2VRWA 3NTQA 3C16C 2I4IA 1AV7A 1U2ZA 2BHNA 3A1TA 5L3SB 4WNCA 3EZ7A 5ALQA 2WA1A 1S2NA 1JTFA 3IRVA 4K9KA 1QYVA 2HX1A 1COWA 3AHHA 3NKFA 5K1ZA 2V97A 2W8BB 2OEPA 2C5BA 1N5OX 1JHDA 4Q47A 4EF4A 4QM7A 4DT1A 5EEHA 1EM8B 2W8ZA 2C20A 3I01M 4MGHA 5KU1A 4E1BA 3C3CA 1NBAA 4IQ4A 2PPLA 1AS2A 2GEBA 2HK7A 4DV7B 2JK0A 1EB8A 1BD3A 3ROXA 4BO1A 2GZ2A 2V7QA 2AOXA 1L5QA 5BN4A 1LVUA 2DFVA 3N87A 3PQ2A 2HWYA 3SIPA 1EFRD 2Y4NA 4KPFC 3R5KA 2XQIA 1TVEA 3CUYA 2B34A 4FFLA 4M1ZA 2VJMB 3FNGA 2C3OA 1RM5A 1R00A 2GHIA 1FUYB 2XI4A 4X93A 4LK3A 1PT7A 2X5OA 2WPDA 4LZOA 4DJDC 3M4JA 1E89A 1U0NA 4PXSA 1GZ4A 4TGLA 4RVDA 5LQCA 4O4IA 1L5SA 5AM3A 1SC4A 4R1QA 1J9EA 2QL5A 3ICCA 3OM8A 2ZUDA 3AW9A 3H16A 2GNAA 7ADHA 1ODTC 1PLJA 2XITA 3TD2A 3RGGA 4CR7A 1KERA 4Q4AB 2Z57A 3F90A 2WHQA 3IAS1 4LDPA 3SVZA 1XSEA 3GCDA 3ZE2B 1EFDN 4JOBA 3WGKA 1U9IC 2G6BA 3N5CA 4FOSA 3W6OA 2CB0A 2HHHB 2VH1A 3SLGA 2NG1A 5FWDA 4QAQA 5KX5A 2W2MA 1N2SA 3OG9A 4EGFA 5B58T 3SZ3A 2ZZNA 1E9EA 1M1UA 1QOZA 5IARA 3SJBA 3ETLA 4RDHA 1GQQA 4GVXA 4AB1A 4WJKB 3NBKA 4NE7A 5BPHA 3S3TA 4P35A 4CQNA 2PKCA 3LGXA 1EDBA 5EQFA 5JAPA 2WTUA 1VDMA 2FK7A 4KO4S 2EFHB 3HY6A 4BB0A 1I7PA 2BGJA 2GYWA 3LHIA 3ZV3A 3G89A 4I46A 2IXDA 3BCHA 3GDOA 2J5KA 3GPBA 2Q5HA 4GOLD 4IUDS 4QXOA 4JI5B 2ONCA 3U39A 4DAEA 2MSDB 5BQ3A 1MABB 4ZREA 2MIIA 1WV0A 2NU6A 1CLEA 5ICCA 4C7KA 3HXPA 5JFOA 2O0KA 1H2YA 1XLTA 2CEKA 2HBZA 3AVPA 6LDHA 4X62B 3AOGA 1Z5OA 3HHEA 3T1HB 4QU5A 3HB7A 5K6AA 2JIOA 4XSVA 1MQ8B 3FPEA 3QVXA 2NV2B 4DGQA 2GAFA 5FTJA 1VJTA 2XRZA 2QVYX 2BE7A 1B16A 1QWOA 5HUHA 1YQXA 4DLLA 3Q7EA 2C0PA 2CNOA 5JATA 5IRCD 2ZIXA 4FFSA 4QDJA 2A0UA 1GQFA 4PYQA 1TJYA 4FYPA 5DTJA 3TLGB 5HCUA 5EKTA 3ONVA 1WR8A 1EGQA 3MQ2A 4PYMA 5CHEA 4N7RA 3CGGA 5BSUA 1Q1QA 2IFTA 2OTCA 1QHHA 4JFAA 4LGYA 4YAIA 5GV7A 2XT0A 1QBKC 7AT1A 4ZOAA 4DA4A 3DV2A 5CW1A 1WB4A 1ZGZA 4N4AA 3GLUA 3LBYA 4RPJA 4WLEA 1EVLA 1QX4A 1CQJA 4FIDA 4HF7A 3B5EA 5DLEA 1M8KA 5TGTA 4EUSA 2C42A 4JP2A 3WYNA 2ODAA 3OUZA 1DG3A 5LBUA 2AG8A 4I5DA 2HK6A 1CUCA 4IEEA 1Y3AA 4JDPA 2C5EA 1J20A 1ZD8A 4I4TF 3SN6A 2VIIA 3JW8A 4HWRA 4UAUA 4NMXB 3LNCA 4AKHA 2BN4A 3LQKA 4K9OA 4ZI7F 5A9TA 3CUVA 2KMLA 5DWDA 5LC1A 2HUPA 3CMCO 4HAXA 1REQA 3G88A 1PZHA 2J4DA 2NAFA 1GRQA 1U7UA 3GHHA 3QMPA 2COUA 3TTVA 5AK4A 3ON5A 2V8BA 4PO1A 3RIEA 4HVTA 1ZEJA 1V9CA 3NTRA 4FHCA 2ZJFA 1E3WA 2AOTA 1W48A 5SZHB 2F8LA 4RVNA 3UV3A 1ZUNA 2YFYA 1W7AA 1ICIA 1PFGA 1RXEA 2VZ9A 3L04A 2ADFA 5AKLA 4NYIQ 4URZR 3TAHA 7REQA 3CLUC 3NHAA 1A8PA 5GONB 3D5QA 3KKMA 1Z4NA 2V65A 4DY6A 1UKYA 3L82B 1QGUB 3QJYA 4XOUA 5EIEA 4OI1A 4KITB 1JU9A 2Y92A 3FFXA 4HQ0A 3FTQA 1MO4A 4JHLA 5HKOA 5JTUA 1P8JA 3C3MA 2GZMA 2ZOSA 4PX5A 3OFVA 1NRXA 4MQLA 3RH0A 4TVOA 1OX5A 2OHJA 4XDZA 2ODPA 3KHKA 4UEOA 3RG8A 4B33A 2D7CA 1OYWA 3AUXA 1NBMD 1FDIA 4PINA 4J0IA 1WB9A 5AVKA 1QQTA 1ZMOA 2AR0A 2JGMA 4URFA 4W4TA 1J25A 1L4BA 5A1JA 5JPCA 2VDKB 4QXQA 1ZK3A 1MT0A 1WZCA 3Q3CA 3PT9A 1IY0A 1TCBA 1D6MA 3PC3A 1IB6A 1IHUA 1FTWA 1ULUA 2DY0A 4ZRMA 1EWQA 2OO7A 1OLUA 3OZWA 5DMXA 3SZRA 3IBGA 1WHSA 5HR5A 1BVRA 3O1JC 4GVPA 5JQWA 3TLYA 3ZWVA 1DKMA 2Z9DA 3L05A 3DE7X 1WZUA 4OQDA 3UB3A 5D6OA 3OP1A 4XM1A 2AEFA 1N7IA 4ZMRA 3D7NA 1NV8A 2GN9A 1ZH4A 3EF0A 1A9YA 1F8FA 3PXEA 3QE4A 4KX3A 4MPTA 5FPYA 1V6SA 1YNOA 2DFKB 2FMXA 2XUIA 4OYRA 1H4TA 1RLJA 3CH6A 1UK7A 1T9AA 4X20B 2W83A 1IHOA 3MWDA 5EMJA 1FSZA 4JJAA 2ID9A 4RLSA 1N32B 5ESRA 3MNFA 2ZIWB 4QL3A 4RHTA 3HUFA 3GLTA 3QE2A 5JXJA 1PE0A 1MQSA 2DPHA 1DTWB 1QK4A 3AR9A 3C5CA 3B38A 4O1IA 1XVTA 3V5NA 1JL3A 3BD6A 4LNAA 3HFRA 4MUBA 4GWKA 4M0UA 1D04A 3THSA 2R6GA 4TM7A 1TKBA 1GR1A 2X0FA 3JYPA 2FJPA 3P94A 1XLTC 2WFMA 2H8KA 1FNDA 3H11B 4I2VA 1AB5A 3ZD6A 2VSNA 5DW3A 2F67A 3ZCSA 1ACMA 1AA6A 3PNYA 1JHOA 4RH0A 2RGUA 4EGAA 1P81A 4AUMA 2TMGA 1P3Y1 3QXCA 4HAZA 4L1KA 1TGYA 5L4LA 4O6VA 2X0IA 1G9TA 2CWWA 1TJ5A 4IJ6A 2IYNA 4QELA 4IKOA 4DQLA 1DL5A 1AJEA 3EMDA 3JQGA 4UUAA 1J2EA 2PD4A 4UBKA 3EXEB 1ZOLA 1IOWA 4KFUA 5KMGB 2VXBA 4G09A 2Y99A 5JSYA 3I5AA 4AURA 4JVMA 4OAOA 4FUTA 3I0ZA 1D2AA 3ILXA 3FPGA 3A1VA 3GBSA 1XBTA 3O3NB 4GPAA 4RMGA 4MP3A 4JVLA 4WN3A 4YROA 3RC2A 5CA1A 5JW6A 4CEJA 2PZBA 3WZ2A 3ZCVA 1CEYA 3LDUA 1ZHOA 3V4OA 1OC4A 4NMMA 3UB2A 3AXSA 4KOAA 3SOPA 2HWXA 1I4WA 1MB4A 2IH2A 3KEMA 1EAYA 4JLBA 1DHTA 3U61B 3T3PB 2CDCA 4M0KA 1WNFA 3TG8A 3S1AB 2QS9A 2YIDA 3ZW8A 5KYUB 3DHYA 3IV6A 1ZS9A 1SKUA 1KGDA 2I2BA 2LVBA 4OQLA 5EE0A 4Q02A 3LCJA