1D2HA

Crystal structure of r175k mutant glycine n-methyltransferase complexed with s-adenosylhomocysteine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
252
structure length
252
Chain Sequence
b'TAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINE N-METHYLTRANSFERASE
publication title Mechanisms for auto-inhibition and forced product release in glycine N-methyltransferase: crystal structures of wild-type, mutant R175K and S-adenosylhomocysteine-bound R175K enzymes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 65
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 1999-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1d2hA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1d2hA02
3I5UA 1F3LA 1SQFA 4EKIA 2XYVA 4KIFA 3EVBA 3OFKA 1NW8A 1JQDA 3GGDA 5E8RA 1JQ3A 3OE4A 1HMYA 5B1SA 4DCGA 3I64A 4XCXA 3LX6A 3UJAA 2HR1A 5HILA 2ZFUA 5U4XA 1T43A 3BGVA 4KIGA 3DTNA 3ELDA 3GRUA 4X60A 3ANXA 4AZVA 3P9IA 4DKJA 3EVDA 2R3SA 5DXAA 3GCZA 3UJBA 1RJFA 4KW7A 2OY0A 5LQAA 4FSXA 3FUTA 4RTOA 3K0BA 2IIPA 5M5BA 3I58A 3DMFA 3M6WA 3TM4A 4POOA 3G8AA 4GC5A 2B25A 1R6AA 1VBFA 2F8LA 3JWJA 3NWBA 5E1DA 3TMAA 4RYLA 2HTEA 3DUWA 3KQPA 3TQSA 2Q41A 3GRVA 3GJYA 3KR2A 2HNKA 1RJGA 3EVFA 1O9HA 5EEHA 2IFTA 4E33A 2GS9A 1ZHFA 3EVZA 5IH3A 3UJ7A 1L9KA 1TW2A 5GM1A 5DM0A 1FJXA 3PTAA 2AOVA 4BLVA 2I62A 4HSGA 3JWGA 4C05A 2ESRA 4EK9A 5LQKA 3BWYA 1JTEA 3HCCA 3P9NA 4FR0A 2NXCA 4A6EA 1YFJA 3B3GA 3GRZA 4DF3A 3KQQA 2Y1XA 1L3CA 4A6DA 5E1BA 2AN5A 1QANA 1TPYA 1WXWA 3KPYA 2PXAA 4ER3A 3B5IA 2CMHA 3LHDA 4HGZA 2Z6QA 2FK8A 1NW6A 3EVAA 3F4KA 2JHPA 3MTEA 4PGGA 3M4XA 5EOVA 5EVJA 2ONZA 5K0LA 3L8DA 4RTPA 1YF3A 1IM8A 5FA8A 5HFJA 1X1BA 2AOUA 3A27A 4OBXA 1KXZA 2CMGA 2P7IA 4XUCA 2AOUB 4NECA 4RVHA 5DX8A 2OYRA 1O54A 4CKCA 1YFLA 1SKMA 1NBIA 3P8ZA 3ERCA 3KPUA 1VIDA 1WY7A 2B3TA 3THSA 2OB2A 4IWNA 1ZQ9A 1FP1D 1G38A 1XCJA 2QY6A 3MERA 3BKWA 3MB5A 3R24A 4PYLA 4YMHA 3GNLA 1EG2A 3DMGA 3KQYA 4KVZA 1AQJA 1VL5A 3VC1A 4FSDA 3FPFA 2IH4A 3C6MA 2JH9A 4OX9Y 3HEMA 3K6RA 4G56A 4IV8A 1O9GA 3EPPA 2DPMA 1JG3A 4P7GA 3X0DA 2ZZKA 4YMGA 2CL5A 3DH0A 1M6YA 2UYOA 1U2ZA 1SVUA 3OU7A 5K05A 3BWCA 1VPTA 4RTQA 4BP3A 2UYQA 2ZSUA 3UZUA 4FGZA 2BM8A 3BKXA 4DM3A 2OO3A 4RTRA 2Z6AA 2C7OA 4H0NA 4XUEA 1SUSA 2FPOA 2ZWVA 5FWAA 4BLUA 4CXMA 1G8AA 2P8JA 5C1IA 1ZG3A 3Q87B 1RI5A 5EIWA 2G70A 4AZSA 2YUIA 1BKYA 4OQEA 1KP9A 5T6BA 3KPJA 1EIZA 5EHGA 5GIPE 5T67A 2QYOA 3BXOA 2O06A 4IV0A 4P7JA 1KIAA 2YTZA 4LG1A 2H1RA 1Z3CA 5DRYA 5T64A 3NDJA 3HCDA 3FYDA 4EQZA 3G2QA 2QRVA 3DXZA 3ELUA 3VC2A 5KYGA 1AQIA 3LDGA 4C06A 2GB4A 2P3OA 2AOXA 1X19A 4PONA 4GEKA 1G55A 3QOXA 3DP7A 3EVCA 4Y2HA 2I7CA 3G5TA 4E30A 2AN3A 2AOTB 2IDJA 3H2BA 5CVDA 3AXTA 3UBTA 5EMKA 2ZULA 3M70A 4BY9E 3NW9A 3S68A 3DR5A 4E2XA 4OA5A 3ME5A 3TR6A 4E32A 4KWCA 1XCLA 1NW3A 3FZGA 3KQMA 2V7EA 3A25A 3JWIA 3O31A 4FT4A 4XUDA 4YV1A 5P8WA 3UA4A 2YR0A 4MIKA 2BH2A 5F2OA 3U81A 5GM2A 1QZZA 4EKGA 3PVCA 1UWVA 1INLA 2AVDA 5MHTA 4LWPA 2NP6A 3KPWA 3FRIA 3DXYA 2PT6A 1ORIA 2JHCA 3E7PA 1I1NA 5DRTA 1JG1A 2UZ4A 5FULA 5K0GA 1VLMA 4RTLA 2P7HA 1NW7A 4HG2A 5KVAA 3KR1A 3PX3A 4Z2YA 3NDIA 2PX8A 3UJDA 3AJDA 1JG4A 4E2WA 1YZHA 2P3QA 2NYUA 2P1DA 3DXXA 4RV9A 5DSXA 2NXJA 2YX1A 3G88A 5KS2A 5JUWA 5CVUA 5BXYA 5LQJA 3O7WA 4P58A 3UA3A 1WXXA 3OFJA 2ZBPA 5FQOA 4QQNA 5EIFA 5EMLA 5G02A 3SX0A 3HA3A 4RTNA 3ID6C 4QDJA 3SSMA 1QAOA 1EJ6A 5ICEA 5CIYA 4WXHA 3BT7A 5HIIA 2ZZMA 5F2KA 1I4WA 4GOMD 3BWBA 3CJQA 3LDFA 3OU6A 3SSOA 4E70A 1B42A 4RSRA 5ICCA 3VYWA 5LSAA 5CCXA 1X1AA 3C3YA 5FCDA 3FTDA 3KR9A 1SUIA 3ER9A 3BUSA 1KYWA 2EJTA 2PSSA 2ZWAA 3IHTA 3R0QA 3SXJA 3NMUF 3KHKA 3I53A 2OXTA 1BC5A 4AX8A 3EMBA 3UFBA 3VSEA 5FTWA 3THRA 4HH4A 5EKUA 2ADMA 1AV6A 4RVGA 4IKPA 1XTPA 3EEYA 1FBNA 2G71A 2ORED 5HIMA 3REOA 2CWWA 3TOSA 4KDRA 5DM1A 3P71T 1G8SA 3AY0A 4QQKA 1PRYA 3MQ2A 2NP7A 4RTKA 3EVGA 4RX1A 4U7TB 3CGGA 3P97A 2PJDA 3EGEA 1ZGAA 2WK1A 3SVZA 1D2HA 3CVOA 5DSTA 3RIEA 1RI4A 1JR4A 1I9GA 4YUYA 3M6XA 2G1PA 1XVAA 2VDUE 1KPGA 3PLAE 2VZ9A 4X41A 4ISCA 2Y1WA 4BLWA 1R74A 3OZTA 1DUSA 2H00A 3MTIA 2IBTA 3SGLA 2ZW9A 1RJDA 1AF7A 3B3FA 4HGYA 1KPHA 1Q0TA 2IBSA 4DCMA 5E1MA 4AUKA 4ER7A 5BW4A 5E2AA 5E9JA 3NTVA 5DTRA 5F2NA 5EQJB 2YVLA 4V0RA 1MHTA 2O05A 2PKWA 3FUUA 1KHHA 2FCAA 4CTJA 2AN4A 4E2ZA 4MWZA 2BM9A 5HIKA 1ZKDA 2IGTA 1NV9A 1WS6A 3SM3A 2OPBA 3R9XB 2ERCA 3G8BA 4YUVA 3WSTA 3NJRA 2YXDA 2ZTHA 3GRRA 2ZCJA 2EJUA 4C07A 4AZWA 2C7PA 4WVLA 4PYJA 3LCCA 4HRAA 4M37A 2PGXA 1XDSA 3PX2A 2ZIGA 2ONYA 4X1OA 1L1EA 3LPMA 2WA1A 3CJRA 1BHJA 3DLIA 3HP7A 2YQZA 4ER6A 3OE5A 4HTFB 2JH8A 1N7JA 3KU1A 5DM2A 4LWOA 4PGHA 3GXOA 2AZTA 4X63A 5K0CA 1WG8A 1NBHA 1L3BA 5EHIA 4PIMA 3PFGA 4DQ0A 2GAFA 3T7SA 1NT2A 2QE6A 3FPJA 3KQWA 4C03A 2Z6UA 3OZRA 5HZMA 3G7UA 1QYRA 3HCEA 4R6XA 3SR4A 9MHTA 2FHPA 5CVVA 5DTQA 8MHTA 2PBFA 5IKMA 3E8SA 4FT2A 5KQRA 2PWPA 1N2XA 2AOTA 2V74B 1EJ0A 3P9KA 3QOWA 2XVAA 4YUZA 5CVEA 5K0JA 4MHTA 2CKDA 3G5LA 1JG2A 3KQVA 4YUWA 2VP3A 4CKEA 3ELWA 2VS1A 5DM4A 5K8VA 5ICFA 1DCTA 1YB2A 3HTXA 2ZIEA 2PX5A 2NXEA 1R8XA 4CKBA 3UJ6A 1JQEA 3HCBA 3M6VA 4LECA 4QVGA 2IH5A 4PYNA 3KQTA 4BP1A 4YUXA 2OKCA 2GA9A 4L7VA 3SSNA 2ZZNA 2GH1A 3GWZA 1R18A 2PV0A 3P2KA 2NNWB 4R8SA 3T7TA 2XVMA 3D2LA 1EQAA 3FPHA 2FK7A 5FHQA 1P39A 2PX4A 4GC9A 3RODA 3MCTA 1OR8A 2G8NA 4ER5A 2B78A 1UIRA 4PINA 4GQBA 1XDUA 3BWMA 3FPGA 4FZVA 4OQDA 2JJQA 3FRHA 2DULA 3DULA 2IPXA 2K4MA 1Q0SA 1QAMA 3I9FA 4GOOD 2C7QA 3OU2A 2C7RA 4RVDA 1P1BA 1DL5A 3ORHA 4QTTB 10MHA 2OBFA 4FP9A 3IYLW 3FUWA 5GINE 3E05A 5FA5A 2BR4A 1KPIA 1SQGA 5LQCA 2XBMA 2XYQA 3C6KA 4MQ4A 3G2PA 5E9QA 5K01A 3CKKA 1YUBA 5EMMA 4E31A 1RJEA 1YZ3A 4JXJA 2KW5A 2PWYA 1RI2A 3G2MA 4PCLA 2N47A 2YXEA 5CUQA 5KQSA 5EKXA 3LBYA 2IH2A 5DTMA 5DWQA 4AZTA 3DMHA 4F85A 3B89A 5EMJA 2O0LA 3FTCA 5EZSA 2PVCA 4DZRA 4RTMA 2UYCA 1X1CA 5CM2Z 2O57A 4QPNA 2PX2A 3KQOA 3PFHA 1M0EA 1QAQA 3GDHA 1ZGJA 3HCAA 5C9ZA 1VP9A 3A7DA 3O4FA 1PJZA 3T0IA 1P91A 3EGIA 3G2OA 3LL7A 4EVIA 5CD1A 2YXLA 3NVKI 1BOOA 1WZNA 2OB1A 2AVNA 2AR0A 3P9CA 3HVKA 4QVKA 4GOND 4U7PB 4QPPA 2R6ZA 1NW5A 1G60A 4ER0A 7MHTA 3UWPA 4X61A 2QM3A 3AWIA 1IY9A 4FS8A 2IP2A 3HVIA 3PB3A 5BP7A 5CCBA 4RTJA 3IV6A 3FTFA 4HC4A 3P2IA 5GP1A 5LQNA 1NE2A 4QDKA 3TPZA 3E23A 1H1DA 5DT2A 3LSTA 3B3JA 5K09A 4R05A 4GF5A 1IXKA 4C04A 3FTEA 1N7IA 4CWAA 2GLUA 4P7KA 3TFWA 4GOLD 4C08A 5ERGB 4DA4A 3SMQA 3V97A 1MJFA 4V0QA 3UJ8A 3FYCA 5K0EA 3HNRA 3TM5A 5E1OA 3HVHA 1R8YA 4K6MA 1KR5A 3RW9A 1Y8CA 5GIOE 4ATNA 3GIWA 3LKZA 3HA7A 1D2GA 3GU3A 5FHRA 2EX4A 5FWDA 4RTSA 4GBED 5DLYA 5E9WA 1VQ1A 4R8RA 1R00A 1L3IA 4KDCA 3CCFA 1JSZA 3T7RA 3MHTA 3UJCA 4QTUB 3PT9A 5CVJA 1XXLA 2BZGA 2PXXA 1JTFA 1KYZA 2E5WA 3JWHA 2BR5A 3LDUA 4PYOA 2ZBRA 4C4AA 3KKZA 5H02A 5BW5A 3DOUA 3LCVB 5K0BA 1F38A 2FRXA 4O29A 2A14A 4YV2A 1JSXA 5EGSA 3CJTA 2I9KA 3OPNA 2G72A 5FQNA 4ZTBA 3A7EA 3ER8A 2ZIFA 3OCJA 3KPVA 2O07A 2OZVA 4HTFA 3TKAA 5LQRA 3G89A 2AOWA 1VE3A 2VDVE 5K0NA 1NKVA 1UFKA 5EPEA 3MCZA 2PT9A 2PXCA 5LR6A 2XYRA 4B17A 4F86A 4PWYA 1TW3A 4PIPA 2P35A 2IDKA 1FPQA 1SG9A 3Q7EA 4P7FA 3EGVA 4R6WA 5EZQA 2ZBQA 3M33A 3HM2A 5JR3A 2H11A 5FADA 3LKDA 5HEKA 3C3PA 4E2YA 3CBGA 5D1NA 3R6TA 4PNEA 2JHAA 1V39A 5DXJA 5EC8A 1FP2A 3KR0A 3GRYA 1P1CA 3OZSA 3BGDA 3EEOA 2FYTA 3MAGA 5K0FA 3GO4A 2VDWA 3NWEA 5DX0A 5ICGA 5GWXA 2I6GA 3LCUA 5D1HA 5E2BA 4F84A 3FPEA 1NV8A 2EG5A 2B2CA 3KQSA 5EG5A 1ORHA 2HV9A 3NVMB 4KRGA 3P2EA 4PCAA 4Y30A 5DX1A 2BR3A 3TKYA 3ELYA 2PY6A 5K03A 4OBWA 3UJ9A 2ZVJA 5GOZA 4PYQA 4PYIA 4YV0A 4RWZA 3DLCA 2HWKA 3LGAA 3LECA 3FUVA 2QRVB 3AXSA 3BGIA 3C0KA 3FUXA 4UOEA 1D2CA 3PS9A 5LQUA 5C0OE 2LD4A 1X1DA 4MTLA 4DMGA 3V8VA 2NXNA 4M38A 1VP3A 2GPYA 3TRKA 2JG3A 2HMYB 3A26A 3EVEA 4CTKA 3EMDA 3LBFA 4PYMA 4M36A 5DPMA 1RI1A 1HNNA 3B7PA 5HIJA 2P41A 3R3HA 1G6Q1 2B9EA 3MGGA 3HCFA 5HOQA 2UYHA 3IEIA 3M6UA 4EMSA 2P3LA 1XDZA 3A4TA 1EAMA 1RI3A 2EFJA 3CC8A 3QV2A 5E8JA 3HA5A 5EEGA 3HVJA 4PYKA 2P40A 4OA8A 1M6EX 4RVFA 3TLJA 2AS0A 1XJ5A 2ZLBA 3BZBA 5FUBA 4GUAA 4M7RA 2WA2A 2PLWA
chains in the Genus database with same CATH superfamily
4G8JA 2Q3CA 1WMBA 4CN8A 2XYVA 1WUIS 1T2NA 2OR3A 2ZRJA 4IKOA 2IV2X 1ACMA 2COUA 3GGDA 1T2CA 3GP3A 4XYMA 3RS8A 3VYVA 1ITZA 2ROQA 3OKFA 3U62A 5ECWA 3VRHA 4ILEA 1CUCA 3RSZA 4P36A 3Q9UA 4NESA 4ZVSA 3VTFA 5IDWA 1Z7YA 3ND9A 2VSQA 4QYSA 3QWAA 3IVGA 3DEZA 2MJLA 4OXQA 4MLDA 4GYYA 3DDZX 1KYIA 1JSLA 4ZC8A 5JFOA 1P8JA 1N36B 1T3ZA 2O4UX 1QBKC 4AMVA 2JDIA 3EF1A 4XLLA 1DSSG 1SKYE 3RSFA 3L6BA 2V6FA 3R44A 1U8CB 4CCSA 2ASEA 3RVLA 3Q3CA 1UBUS 2F9MA 1L5YA 2PLFA 1P31A 1YZNA 3P9SA 4GZLA 1U02A 1WWKA 1LRJA 2F1OA 1M2WA 1N92A 1U94A 3HS3A 5JD4A 2V9CA 1OH7A 1PT6A 4NC9A 3ZUGA 5ALQA 4DR3B 3U4QB 2D7DA 3S7ZA 1O9HA 4E33A 1ZGBA 4PC1A 1OHHA 3G9UA 3Q8KA 3T35A 1I5RA 5TX7A 2PN1A 2PD4A 1FSZA 2P9ZA 2WFLA 4HVLA 1MAUA 4YAUA 4GH5A 1H42A 1EWVA 2QF7A 4LHZA 4M9XA 1AKUA 3QX9A 1PWHA 1BGVA 1Z0SA 2R84A 4B1FA 4BFXA 2NXCA 2VEDA 2D2IA 3NP7A 2BUCA 2JA1A 3INYA 4DRXA 1JGTA 4W9NC 2OZLB 1RRCA 3TJZA 2Z58A 3CRMA 3BH6A 3NX4A 3PFWO 4LTDA 3UENA 2Z6QA 4BZQA 3PJEA 4MV6A 4N7RA 4WL0A 4D0LB 2O2DA 4E5MA 5J4HA 2GWHA 1TC1A 3MTEA 4CR8A 5J1TB 5FA8A 2V6JA 3L5OA 4NYJR 1BMFA 2PKRA 4X44A 5AH0A 5DTJA 1TO6A 1IOZA 5E9QA 1SKMA 1KK1A 4IX9A 1S2DA 4QJ3A 3P8ZA 4WVFA 4FFRA 1DDOA 3PC8C 3IUSA 4RE6A 3UC5A 2H2FA 1FP1D 1QFJA 3LXRA 2QY6A 5KYYA 4LV6A 1NF3A 2J5KA 2D8MA 1EG2A 2AEEA 1EM6A 1S2NA 5EIXA 1N3LA 2Q9AA 4YY3B 3WP1B 1EVQA 2QKYA 1QLJA 5CLGA 5CRIA 4G56A 1ZA1A 3K6RA 4POAA 5F77A 3JY6A 3V4PB 5FAXA 1CX9B 4URUR 2WF9A 3C3CA 5H9WA 2OFFA 1BS1A 4ZZIA 4G9GA 3O6VA 4HO1X 4LYGA 4U9UA 3PHCA 1E3LA 3IKJA 5IVIA 1DI0A 3ZWVA 1XZGA 3EIFA 3WLMA 3DMTC 4RTRA 4H59A 3U3MA 4A0SA 1LUAA 1N5OX 4M0EA 4C0WA 4QZVA 3AYXB 1UKVY 3PNVA 3SK0A 1ZQ1A 4Z51A 4U7DA 4U1RA 1UJ5A 4OQNA 3H1EA 2I54A 2NO4A 3CZ4A 3LPAA 1AY0A 4Z53A 2IYFA 5KHLB 4GVPA 3BFPA 1VRCA 2QTAA 1FFYA 1DKMA 3ENNA 1RCFA 2HGZA 2JGEA 4I4TA 4LV8B 1EMDA 5DZSA 4DCVA 1X7ZA 3FAZA 4H7FA 2BFBB 2NZVG 1SFRA 2QYSA 4XYLA 1FOEB 3ELUA 1JKMA 1K66A 1AQIA 3DFIA 3PNSA 4ZCTA 4AKIA 3H13A 2H7CA 3HL0A 3OLCX 4BVGA 4M9UA 1E9AA 1CEEA 1EPUA 2IP4A 5DWDA 3EDRA 3JZFA 3GRKA 3OPYI 3WHLA 4CM1A 16PKA 4HRXA 2HU8A 1Z74A 1DWPA 1RLJA 4CLHA 3EPKA 4DR4B 4KR6A 5C8XA 3QQPA 1P6UA 1ZL0A 2WOJA 3AT1A 4YRMA 3MWGA 1UWLA 2BZSA 1OQAA 3H4IA 3PXBA 5LZ8A 3EODA 3QPWA 2POCA 4HADA 2CMFA 1FFXB 4G0OA 1GNRA 4JEIA 2DWCA 3F9IA 1T5TA 4EKGA 1VYTA 3BMNA 3N5KA 3VU0A 2PZBA 5JCXA 5MFPA 2R6HA 1BMTA 1CDZA 4PPNA 5CA1B 1ML3A 4NLLA 2G8LA 3ZN2A 4LCEA 2ID7A 3MN1A 2A0YA 3Q9SA 4LY9A 3JQBC 4ILKA 2VSOA 2ZITA 3KAKA 2BHLA 3UJDA 2R8XA 5CLQA 1AZSC 3PXUA 4OQXA 1O5TA 2JGNA 2GESA 4BP9A 3MS7A 4RV9A 3FYUC 1OX4B 3HWRA 3M2PA 4GLFA 3JRXA 2HF2A 1P45A 1T9ZA 2GTPA 4HEA1 4RCVA 5JLJA 2YWDA 3QLJA 4GG1A 4JY7A 4N18A 1PNRA 3ZCQA 2DXIA 2F4VB 3QG1A 3B38A 1Z6QA 2EZ8A 2BYTA 4B6FA 1JA9A 4KR0A 2XTJA 1H9CA 4WXHA 3RS4A 1J5EB 3CO0S 2FRDC 3K8QA 4DMMA 3K7EA 1AZWA 1YJXA 4EKDA 2FUG1 3PR3A 5HKAA 3ZJUA 4CQJA 1U0SY 5LSAA 1NXXA 3Q9LA 2OMEA 4NP6A 1K7FB 3EH2A 4O4JB 4QX6A 5B7NA 4ON9A 3L01A 1I4OA 4NHOA 1XUOA 3WBJA 2ZYHA 4EG8A 2HPAA 3HJCA 2CKMA 4C78A 1Z8FA 5JBNA 2JGJA 3U49A 3DWGA 2OQRA 3L1JA 3P45A 4ZVRA 4HXFB 5C8YB 1WF3A 3JQDA 4N39A 4TRMA 4BQNA 4DCUA 4QGSA 5HIMA 3SS7X 3HPRA 1SCNE 5I4IA 4RPGA 4U2FA 1MC8A 2V0NA 4OUDB 5T5QA 2Y67A 2NP7A 1NSFA 2YJNA 4QUDA 3K0CA 3CLSC 3HRKA 4IRMA 4MV8A 4D8YA 3BRCA 3CBQA 1E7RA 1UZUA 1XNHA 2QAIA 3DJYA 3IJRA 1SZCA 2X3YA 1ZNXA 1SXJE 2X14A 5F33A 3BL5A 1DHRA 1L8OA 5KI6A 1KEUA 2YC4C 5HZHA 3PLAE 3Q0EA 2YIMA 4L0DA 4R9RA 1MBZA 2JFQA 3L7DA 1J0BA 1DUSA 2JJ8A 2H00A 2WB2A 4AY3A 4BFLA 5FOSA 1OV4A 5TXGA 4ZV4A 5K51A 1J8YF 4I55F 2JI4A 5E1MA 3SKVA 4IWYA 3ZZNA 3COPA 4CV2A 4H1HA 5FBLB 3OQVA 2HCFA 2PZGA 2FMFA 2GHIA 4FMBB 4J2OA 4MWDA 2X6TA 4Y8VA 4KVFA 5HTKA 3NBZC 1BOFA 1WCV1 3SLKA 4Z4IA 5AHXA 1OAAA 3G8BA 1SVKA 1BDBA 1RWOA 2ABWA 4FHZA 4KAJA 5KSWB 4KPYA 1KEEA 5DOVA 3ND6A 1U3TA 4FHGA 1QLWA 2EJUA 1OD6A 3V5NA 4K3UA 1BXKA 2JAPA 3ZWYA 4Z4EA 1VLLA 3N7UA 2GA8A 4QHTA 2PGXA 2C5LA 1ESMA 1JHDA 5JNRA 3UYLA 3WK7A 1XD8A 3O8RA 3D8UA 3RC3A 1W48A 1B8UA 2IYNA 4EJMA 1WBBA 2Z2YA 3FMGA 1Y7HA 4FCTA 3Q41A 3L4EA 4PIMA 5J2UF 2GAFA 1Y6RA 4CIDA 5A3QA 4N0PA 4KREA 4YJFB 1K89A 3UEOA 4NS1A 1XX6A 2N75A 3PSHA 5LBUA 3T5AA 3CWQA 3LFTA 2IUEA 1GKYA 4MS4B 5JARA 2Z9CA 4H7KA 4ZVPA 2NV2B 1U6KA 5GZ3A 5KQRA 4MKRA 2FHSA 4LIPD 1GYPA 1YJBA 5FTKA 2QLFA 2EW1A 2I2AA 1U0JA 3FSRA 4LRXA 2FPWA 1OYYA 3DNPA 4XD7D 5FFMA 1TQDA 3HKCA 4CDMA 4D46A 4YUWA 1T5BA 3OHSX 5DM4A 3SOZA 4TYYA 4W1RA 2YASA 3I2IA 5TEWA 3E2PA 2NXEA 3HGQA 4ZREA 1QNLA 1R7RA 4ZJZA 4NBVA 4Q7MB 1W44A 2VQSA 2X1VA 3QU5A 2V7QD 5IM5A 1WXIA 2QORA 3COJA 1B73A 3UF0A 1TIKA 1U9CA 1T36B 3WVNA 4IDFA 2R68A 1E6UA 2BHNA 3SSNA 3W2EA 2PV0A 1DEAA 5KEIA 3DE6X 1W4RA 4ND6A 4QXQA 2VWGA 3M9XA 3V7WA 5CFRA 5AIAA 3G7NA 3LI2A 2FR8C 2CWDA 4ESEA 5HGXA 4LTNA 1G3IA 2AC7A 2OCLA 2VYVA 4R68A 1XDUA 3QXXA 3LC2O 1UAAA 4JK3A 1NQTA 5HNKA 4PTZA 2HYIC 1V2HE 4WK0B 2PO5A 4RFLA 2UUPA 5G0WA 4FDVA 2LCFA 4B84A 5JNLA 1CTQA 3BHIA 4RZ2A 3EXHA 3FM9A 1EWQA 4JV5B 3ND5A 2NU9B 4R31A 5JQGB 1U7XA 2DKFA 2ZUEA 3QP9A 1SC9A 3OM8A 3T3IA 4CZ2A 1WUHS 3CEAA 4H16A 5J4YA 3ICWA 3ZU3A 5A4DA 4FTWA 5J47A 3W5CA 2RSLA 1YZ3A 4TL9A 4HS9A 1E0KA 1GFIA 5CH8A 4EI8A 2QUBA 3A4IA 1QG2A 3NIDB 3G8DA 1UP4A 4AP5A 3U3KA 4X91A 2ZBUA 4F85A 2MYUA 1UT8A 3DNMA 5FPTA 3LRTA 5KYXB 1ECJA 2CZCA 3B70A 1JEYB 5IDXA 2VBGA 3C5EA 1RWBA 5CB4A 3VR6A 4E7OA 1QZXA 2GF9A 2C31A 1UEJA 3PJDA 5HCNA 5C9ZA 4LQCA 2X19A 3C5VA 4Q3NA 3V1NA 3DVAA 5FRDA 4PAQA 3V8BA 3KC2A 2GAJA 1JECA 3QUCA 1BOOA 1Q0QA 3EHDA 4B3FX 3RYCA 3HVKA 3RJ5A 3I9OA 5CU7A 2MTBA 4PO3X 4D9CA 4CLRA 1NW5A 3D1VA 5FLYA 4YRJA 4DLXA 4X61A 1P5ZB 1C3EA 4E22A 4EYKA 1FNCA 1SCQA 3ANNA 4RACA 5JZOA 1VSBA 4KOEC 2FGJA 1EX7A 1Z12A 1M3SA 4BO1A 3RRNA 4B43A 1ATZA 2C4TA 1SA0A 4M1SA 5I8WA 1M1YB 1KU6A 2XA9A 2ZR9A 5DT2A 3S2EA 3LSTA 4PZCA 1D4FA 3ZY5A 4NDNE 5A4KA 1MJNA 2I8LA 3FF1A 4RMIA 3R7DA 4CIVA 3FTEA 4JDPA 1V6CA 5BUQA 2HNAA 4P7KA 4HAZA 3WHIA 1OLUB 1XVIA 1FFCA 1X8JA 3FYCA 4QYTA 4KV7A 3WJ1A 3BE8A 3T4EA 4XGQA 3PQ4A 3JALB 5TQVA 4CT4B 1JPUA 3C6BA 4I9HA 3VPAA 1J99A 3K9CA 2PL9A 3NKFA 4B7XA 1LXCA 1RM0A 2WJ4A 5FHRA 5IJ9B 2V7UA 3V32A 4LGMA 1L3IA 1LLFA 1LPOA 2AC2A 2O0KA 2CD9A 3KJXA 1CJCA 4KDCA 2HK9A 3W7VA 2W6PA 2PXXA 1Z5WA 4LCJA 4D3DA 1IQ0A 2PZ8A 3SFVA 5HYVA 4HLDA 3TD9A 2F9LA 3HKEB 3NPMA 5EHQA 1OFUA 2I76A 1T1JA 3F74A 3M6LA 3PC4A 1UFVA 4O29A 3SFZA 2XD4A 2GVZC 3DT8A 3LIPA 4CL2A 2AF3C 3OPNA 1A72A 3PIRA 3DDOA 3OCJA 3FIUA 2XOEA 5GJCA 4CUKA 2PT7A 2ZRDA 2NUPA 4JITA 1ENYA 1RHJA 2C2GA 1OBHA 4RD6A 5AOBA 4BU0A 2TMKA 4CKXA 2OENG 3BE4A 1QDEA 1WMEA 2W4QA 2H31A 1TW3A 3K96A 2O8BB 3WAKA 4R6WA 2WPDA 2I2DA 1O3YA 2F90A 1R6UA 2Y4OA 1KOFA 2HA0A 2IHTA 2P27A 2PKEA 3KYBA 2CEAA 1MVNA 1U0FA 5FADA 4JDUA 5CTAA 4PNEA 1H4QA 4WNYA 5AP9A 4CT5A 3KSAC 3WGTA 3AHFA 3V4FA 4C29A 4DMHA 3C6XA 3EEOA 1IBRA 4BJ6A 1U7ZA 2IXFA 4FFNA 5IZCA 5MGBA 4H3KB 4KXLA 3QKRB 2DTEA 2H2GA 3AVOA 5A6VA 1Q6ZA 2Q4DA 3PICA 1ZJJA 1YD7A 4MQFB 4XX0A 5EG5A 2YMMA 1IXYA 2FW6A 1VL1A 3K0SA 2BFCA 4BZZA 4CLXA 2YUTA 3I12A 1YE3A 3RSCA 2PJUA 4P3PA 1U8YA 1P18A 3PE4A 5GOZA 8ABPA 2R1UA 8AT1A 4E4RA 2CL0X 4EOGA 3A8TA 3C0KA 2FPSA 3D7KA 1D8AA 2OD7A 4M1TA 4XWTA 5D85A 3WA6A 4DCPA 4IR7A 2PUVA 4DWOA 4FYYA 3NBAA 3R4VA 3U44B 1O97D 1EBFA 5AI4A 2NXNA 4IWXA 2GN4A 2ZYTX 4OI1A 1A4UA 4D4GA 2HMYB 3A26A 4M36A 4KO1S 1KS9A 3QVWA 3GIDA 4M1QA 2QN7A 3PC6A 3EOBI 1D6MA 4S35A 1V9CA 1XRRA 1ZUNB 3L7NA 3OT1A 4HP8A 2W83A 4PQFA 4U7GA 1XGKA 3U09A 4MKFA 4L4YA 8ATCA 2NIPA 4MUNA 4PYKA 1RVDA 3FDJA 4HGPA 1ATIA 1CY2A 4HYYA 2FG6C 2XY4A 1ZJ5A 2PFSA 2QN1A 1XQVA 1EI9A 2VATA 4F96A 5AKYA 2QTCA 1AG9A 1DC3A 3M34A 3OIUA 4BNDB 4S04A 4WNAB 5BMVF 1TUBA 1V5WA 1SXIA 3ZR4B 2EIHA 1PFKA 5I8ZA 4WJLA 4ASUD 2IOHA 2MR6A 3P2OA 1P1KA 1VKZA 3TRDA 5EAIA 1SOAA 3TNDA 2IF2A 1CQJA 2D1RA 4NONA 3DTNA 2JF0A 3MJVA 2JKZA 2QZPA 2F1KA 2BCGY 1QVVA 3NIGB 4BAUA 1RJFA 3MTAA 1OU0A 3VHXA 4WN9B 3FBWA 3UW3A 4RTOA 3K0BA 4EEKA 4EPVA 2BLLA 3SEFA 1ZVQA 3MCWA 4DR2B 4Y0VA 1T35A 3OCXA 2I67A 3NEAA 1K88A 4GC5A 5JMOA 3G23A 3FZNA 3QHQA 4L02A 2A5YB 3G0BA 4DDUA 4FR5A 3U4QA 1WA5A 2Q41A 3GNSA 4RA9A 5I9BA 2DYKA 5E7JA 5KKCA 1KJJA 4Y6PA 4OHMA 4QNRA 3WK4A 4NV0A 5IH3A 1COZA 2WTNA 5J23A 1FYEA 2J45A 4LZZA 3UKOA 1ZNWA 4XQ9A 2G1UA 3IR6A 2QR2A 3NU1A 3E5RA 1LWNA 3W3AH 5A6SA 1Y5LA 1VL6A 1YH3A 4U6QA 4IGIA 3TB4A 3BWYA 2P1RA 1IN6A 1WZUA 3M0EA 4O0LA 2UV8A 4PC7A 2C92A 4UHBA 4P0QB 1FQKA 2FN3A 2OZLA 2PLRA 4Q4DA 1FUYB 1JB1A 2HU5A 2ZETA 4O1IA 1S96A 4PX3A 1H5NA 1NVVQ 2F3UA 1ZR2A 4MKXA 4HGZA 1NNUA 3QBJA 1TVMA 1UPFA 2CLFB 3QU9A 4QUGA 5LLTA 4KFRA 3B6EA 1Z2CA 3I2HA 1BJTA 3WMEA 4EUEA 3UM9A 2O3RA 4BMPB 2JGAA 1TMGE 3FI9A 1R4AA 4B40A 2VJOA 1M0EA 3E9ZA 3STTA 3UNXA 1NF2A 4B2YA 2JJYA 1XLVA 1WD5A 2QTMA 3E1GA 2P9JA 2RBEA 3G1WA 3LH5A 4RA6B 1JNYA 2GZ1A 3QWHA 5AUPB 5BRJA 1SOUA 5AM3A 4J3FA 2QTTA 1G38A 3W3AD 1DPGA 4HEJA 1W47A 2A0KA 5HZKA 3RBVA 4IIJB 3I3OA 2YWFA 2H57A 3SF8A 2JH9A 5B58C 2JFXA 3HEAA 4XM1A 2XZTA 1ZZEA 5BN5B 1SM4A 3UN1A 4P7GA 3RFFA 4YMGA 4E6EA 2JBHA 1RNLA 3EIXA 3OO0A 5TS3A 3QX3A 3P0EA 4BO7A 1P62B 3BZWA 2UYQA 3D3WB 2EC5A 1DAEA 2EBHX 4MI1A 4N0QA 5DHFA 3CN7A 5BVGB 2I78A 1ZC4A 3K2IA 3LQFA 4ZAYA 1MC1A 3WKDA 4DUZB 2GKOA 4O2BB 3C3EA 2PL5A 3DAOA 1XELA 4GBGA 5AYVA 4BFCA 5DCUA 1PL7A 1BVRA 3WJ7A 3ZE2B 4DJJA 4V1CI 4L3WA 4X3CA 2PQMA 1RI5A 3BD9A 1NRIA 1RIFA 2FFQA 1BKYA 3BS4A 3AH8A 1VIVA 3KPJA 4BNUA 5CFLA 2C3UA 4UTRA 1KIAA 1JDVA 3G9QA 3WNDA 3HCDA 4N41A 1JWBB 1U1DA 2BFBA 3HNOA 1MG0A 1JQ5A 1SVIA 3DXZA 4S1PA 3TINA 1L4FA 5CGZA 5KYGA 4C06A 3U26A 3IEMA 1P9OA 4RV4A 3GLHA 3EVCA 4Y2HA 3I9KA 3EGDA 3TNYA 1Q0PA 1DCMA 4GI7A 1TYAE 3C8ZA 3H2BA 3PQ5A 4U00A 2IVZA 3IE0A 3KDAA 4F4UA 1N2SA 2AFIE 4JT2A 3QE0A 4ZT3A 4B4OA 4ZCLA 4ZKEA 4CTNA 5CP8A 2WD9A 4CPDA 4KUGA 5EWLA 4FFPA 3I01A 5CXUA 3PR2B 4YV1A 1FLNA 1W0CA 4G5OA 4EWLA 3ZXYA 4CG2A 3A28A 2Z2KA 4X62B 1H93A 2B4QA 5AW3A 3PE3A 2KQUA 2VRWA 5CA1A 1RRKA 2IYWA 1SBHA 3KUKA 2QIPA 1IMOA 2PT6A 4NQZA 5H9VA 3Q3HA 4G09A 3D59A 3R41A 1KO4A 4RTLA 3IEPA 2CUNA 4M0KA 4F56A 1D2NA 5I8PA 5ALUA 3BF7A 2DR3A 4AUNA 1OZFA 2B5OA 2YFQA 4JBLA 4W9RA 4EARA 4J49A 3P4UA 2I0FA 2X9QA 3ST7A 3PCXA 3H2IA 4TZKA 4HR7A 4Z0NA 1L5WA 1U8XX 4DLPA 4KQIA 1L5GB 1XZMA 4FUQA 4CM8A 3BAZA 4QYMA 4RF3A 1JN0A 2IPLA 2AI3A 3IPRA 5CHEA 1PU2A 4JBYA 1PUXA 2Q49A 1P7CA 5AI8A 5CDFE 3BERA 4J9VA 3DT9A 3NHWA 1QAOA 4RC9A 2BOVA 1AM4D 4F92B 3IP8A 1SNYA 1DEOA 3RS0A 3B6KA 3ZDXB 3TG8A 1AHIA 3BRQA 4RVUA 3LDFA 2IPAB 3CJQA 3JQFC 4GX2A 1OXMA 4HXYA 3V7NA 2HWWA 2X1MA 2ZS9A 4O4JA 3O2QB 1UJMA 2C2KA 2C3MA 3PK0A 4QDZA 2OZEA 3SHOA 3IHTA 3WP0A 2ZWAA 2G5TA 1Q1QA 4DLBA 1R9JA 2IEDA 4E5NA 4NDAA 2Q45A 5SICE 1E5VA 4IYJA 1IHYA 4AX8A 1CZHA 2M32A 5CVCA 5HA5A 3CZPA 3CE9A 5ALXA 4KR2A 1MW9X 5TQJA 4F38A 3KJZA 1G5TA 3C14C 3ORRA 3UH1A 4F93B 2XRFA 4GGMX 2EP5A 5C8YA 4DLUA 2C07A 3KAPA 4DPLA 2XRMA 1QU3A 2G71A 1QM5A 5JCOA 2WU3A 2VNIA 2QNIA 4KDRA 1E2HA 2L2QA 4G9BA 5TGZA 3UCEA 1LDGA 3A1TA 1Z7EA 4AULA 2WB4A 3SVZA 2V0GA 3NAZA 5BYKA 4HQRA 1XZAA 1K2VN 2VP6A 4JOCA 1APBA 5COAA 4N5MA 4G5HA 4BX0A 1G4AE 1A9OA 2GYYA 2QR5A 2HPZA 2R5FA 3AERA 3AC0A 3FJYA 4EMTA 3ZE6A 2F8TA 4DA8A 3OZTA 3DUFB 4TROA 2GSWA 2I7XA 2HU2A 3AEXA 4MKHA 4XVQA 3U80A 5KTKA 5EJ5A 1KDYA 1RRMA 1Z5OA 1XD2A 3B3FA 3CH7A 4PGMA 3VR4H 3Q3IA 4EYGA 1EUCA 1ONSA 2FSHA 3TLAA 5JEEA 3WRYC 2PE5A 5GJBA 2B2XA 4PFSA 4EPRA 3U5ZB 1AIPA 5AXCA 1PLKA 3AM1A 2WFZA 2OE2A 4Y2QA 3BJZA 2DBQA 2WF6A 3WLNA 4BMCA 1FMLA 3T3PB 4C6HA 5THKA 4F2WA 2JJ1D 1B8PA 3L8MA 3RS5A 3IMEA 4KB5A 4P3YA 4WIAA 4TX1A 1FF9A 3G02A 1NM5C 2KMLA 1W36C 1UKBA 1ENPA 2ZTHA 1ZLYA 2Q8PA 3F5QA 4EKYA 2FMHA 3GDOA 1OGJA 1NLFA 2DU8A 3LF1A 3IAS6 5GV8A 4Z54A 1L7VC 3NDRA 4ND2A 3VHRA 3E7XA 5KTMA 5BWMA 1BDIA 3INNA 3Q10A 2CBGA 3FHCB 3IH5A 4MUJA 4YECA 2AA3A 3QUAA 3MTDA 1SG0A 1RYZA 1AA9A 2CEKA 1ZA2A 1ZD5A 2C2OA 2LNDA 3QELA 3F5SA 1W1IA 2XHEA 3KCQA 4GRDA 3EVTA 1YBFA 3IUMA 1RAGA 3EMKA 5TQ0B 1YQUA 4RGYA 4ZRNA 3T41A 1KU0A 3V3TA 2V7VA 3RVBA 2EV9A 2GEJA 5AHOA 3HCEA 3I5XA 2W00A 1QUFA 1J49A 1FS6A 5BQXA 4EAAA 1PQYA 1NDQA 2YN2A 4FT2A 4QFDA 1YR7A 4TTAA 5CYFA 2YNMD 4TWZA 3CVVA 1L7NA 3JU3A 2LCQA 4JNCA 5K0JA 2UUCB 3AVTA 4U6NA 1KEWA 3GP8A 1VIAA 3R4CA 1ZVMA 3G0GA 4Q48A 3K92A 4W1PA 2I3BA 1Y4SA 1DCTA 1BVHA 1P72A 4ZI7F 3IQZA 1HYBA 1XJWA 2WKRA 5G0TA 4E09A 3R5SA 3UQZA 5EQFA 4OH7A 1GV1A 4F1WA 4ZYTA 4CL3A 2WQ6A 5AW8A 4N8DA 4P7BA 5AHWA 4D6PA 3IKTA 4W5RA 2ACWA 2PV7A 2XDAA 2BZ0A 1ZXXA 3FCCA 3LBHA 3RCBA 1EQAA 4OHBA 1NMSA 4INJA 3ZBQA 4EKEA 4YDSA 3PPYA 1PDVA 1WIWA 2C59A 3MCTA 2AKYA 2DQKA 3I2JA 3GJ5A 3QPCA 1JKIA 4MR9B 3TTXA 4KH0A 4LJ5A 3ZJ4A 1KI6B 1TKAA 3SHWA 3WA7A 2JJQA 4YCLA 3K16A 2DULA 1QAMA 3RREA 1CUAA 5D51S 1L5QA 4MGHA 5G40A 4LXTA 1W94A 2NU9A 1XLTA 4RSMA 5ES3A 3W8EA 5FV4A 3OF5A 3VR4A 1I7LA 5BV7A 2GBIA 5IMBA 1HM5A 2GQ0A 2J6HA 1PR3A 4HNSA 1CRWG 2ORVA 3IT3A 4J90A 2XWPA 1K5HA 2FW7A 1GEEA 1GEGA 1GZSA 1OLSB 2BEUB 3C3BA 3F73A 3LBYA 4GDFA 4LJRA 1R6VA 2VNAA 4RAQA 1RADA 4U39A 1XA0A 1YQTA 3OCCA 4FWIB 4G23A 2HZ7A 3DEAA 2YC2C 5EUBA 2W6ZA 2O57A 2BFDB 3Q8WA 4BJHB 5D01A 2R60A 3AJRA 1JAHA 4HQOA 4OMFG 4PVDA 2FOLA 2FF5A 1PHPA 4B83A 3SJAA 2PKQP 4FBGA 2J6BA 4M86A 1OFVA 3G2OA 3HUDA 1X70A 1C7JA 3EZ2A 2DY0A 1TVCA 3KQNA 4YAOA 2GK3A 4QVKA 4E51A 3ICEA 1P9LA 2X9NA 2XUOA 2ZRLA 3OPYA 5JVDF 5J40A 1IVYA 1WNTA 4G25A 1E92A 4BNWA 5KQPA 2BUBA 1C3OA 4HNUA 1KVRA 1IQUA 1TQ8A 2HZBA 3CW2A 3N28A 3OESA 4F3YA 4EGFA 4MUGA 3FOEC 2BGTA 4KZKA 5AJYA 5JWHA 1TZJA 1AURA 4L57A 4ES6A 2A5LA 1DQPA 4P4TA 4LSGA 1IXKA 2Q3LA 2GSDA 4AJEA 4BHTA 4F9FA 2FXVA 1O94C 3ESAA 4A7PA 5A5VA 1Q12A 1IE3A 4J16C 4KXXA 1HDCA 4G4JA 3TM5A 4D3XA 3ELBA 1M83A 1KR5A 2EJVA 3C3DA 4XFJA 3HJFA 3HBNA 3K9WA 5IJ9A 3PHJA 3C43A 3KB2A 5AVSA 1WTCA 2F1HA 2XWBF 4KX3A 3T7RA 1OH5A 2FP3A 1ORWA 1KZYC 2PAAA 3ET4A 4R8RA 1LC3A 1TEXA 3IKLA 1I3CA 3ULKA 2E5WA 3HKEA 4M22A 2I6XA 1S3SA 2PEYA 2WAYA 4MH0R 4QQ8A 1OWNA 3TJMA 3IUEA 4C6TB 5BW5A 3DD1A 1F38A 5IM4A 5A7GA 1UP7A 4H3VA 3SNHA 3U5TA 2W2OA 4OP3A 4Z2AA 1GITA 4O02B 1J8DA 1BQEA 1TM5E 4TLDA 3D43A 3JD2A 2QUHA 2L42A 2H08A 2HDNB 4G26A 3RGWS 5LQRA 1DWOA 2G67A 1F7VA 3QYPA 4GYJA 4ZQIA 2O59A 2ZXEA 1UFKA 3LP5A 2VAMA 1OYOA 2C83A 2O8BA 1WTAA 3NRBA 3PCTA 3L7BA 4UFPA 4M8KA 1OC4A 2P90A 1FTGA 3EGVA 1YNOA 4YH1A 5ALDA 4EUFA 3ITKA 4FHCA 5EZQA 1ABBA 1CR6A 3K0HA 2FEWB 1K0UA 2EARA 2P2CA 2UYYA 2W98A 4GIBA 1GRVA 2QRGA 2XV1A 2JI7A 5AQ1A 4EY3A 4RVCA 2J7PD 4FNGA 3ZD9A 2FYTA 1BN6A 4UDNA 5CX1B 2IDMA 3QKRA 3QFFA 4GX1A 1S2MA 1QTQA 4QYIA 3FF4A 2HRDA 2AEFA 2HQOA 3LT0A 2JVJA 3FVQA 3NHKA 1H3NA 3MT7A 4LMAA 3DKKA 4DGQA 4UC0A 5FAKA 4LOLA 2CV1A 1TZKA 2YHSA 1Z0FA 4F06A 3NORA 1RIIA 1GPJA 2ZVJA 2FLVA 2PLNA 4LDPA 5DGXA 3DT6A 3CVWA 5C5DA 2VA9A 4FJ1A 5AUNB 4K26A 1MT3A 1XVVA 2QRVB 4KE7A 1UJBA 1LI4A 4G8CA 4BC0A 5EJ6A 3R5HA 1OBFO 3RSQA 3K31A 3ZD8A 5DIZA 3CN9A 3MWEA 1QCCA 4NKRA 1OFUX 3G5UA 3AHIA 3E3OA 3UWKA 3P2JA 2EFDB 2D5AA 2VJMB 3DV9A 3B7PA 3SZUA 3EOAI 2C0PA 1E2LA 3Q2OA 1ZUNA 3G2IA 3E03A 4Q82A 5HIJA 4IOJA 1W6RA 5BSUA 1PJ4A 3GZ4A 4Z1OA 3B51X 1OA1A 5F4BA 4ZO4A 3SZRA 4Q5IA 3WI7A 2WY2D 4GPEA 2NPOA 3KYDB 2LR0A 3TSOA 4ZAXA 1M6EX 1PT8A 3FFBA 3AI7A 2ZLBA 5LL6P 4FDMA 3T8YA 4RGVA 1RSZA 1V3VA 2Z2XA 3OX2A 1YFZA 3I5UA 4YYEA 1O95C 1AHPA 4CTOA 5ECGC 2C3PA 1SUDA 5BQ3A 2G0AA 1M6HA 1QP7A 3N8DA 3QMMA 3W5AA 1P7WA 2ZFUA 5IBCA 1C7FA 2P91A 3HFRA 3AW8A 4FN4A 1UC4B 3JS5A 4FDUA 3BYZA 4F5EA 3W4JA 3GRUA 1E20A 4UM5A 4YVFA 3CKMA 3ESQA 3IR7A 2V4ZA 4DBLC 1W0JD 1WUKS 3A9WA 1USWA 2BCEA 4C9BA 1X39A 3UJBA 4ENWA 2NM0A 4KW7A 2XLBA 2J0UB 1DIGA 2ZSHA 2JS7A 4FSXA 1FZQA 2R8BA 3LV8A 2W6JD 3QKSA 5HF8A 1LB1B 5M5BA 3JXEA 1IHOA 5IT4A 1DJOA 3AG5A 1FTQA 3TEFA 3PPVA 1C1XA 1SOWA 2XGMA 3JWJA 2OCYC 4LNAA 2D1QA 3DBLB 3QJ5A 4RK5A 1N2JA 3ABOB 4XQCA 4BZPA 2WP0A 1EA7A 5JS8A 3IR5A 2GFQA 1SCKA 3JCZA 3L9XA 1ZN8A 3NOXA 4ZMSA 1G2PA 2E9SA 3GUUA 4JT9A 4O8CA 4YNBA 3BIFA 2Y9PB 1E2EA 1Z8HA 3KHSA 4IIUA 1GZUA 3CB2A 4KLZA 4PV7A 2QLTA 4FFBB 5TE9A 4CMEA 2VF5X 3KQQA 1TF7A 2VHWA 4BN0A 2MR5A 1X42A 1C3VA 3QFSA 4N82A 4IGAA 4DMLA 4EATA 2O7QA 4EYOA 4CCYA 1TUGA 2PS9A 1J25A 4QTYA 1Q74A 2O4CA 2GT1A 3H5LA 4JLAA 1DZIA 3L8DA 4M1OA 3VPSA 2CSXA 1XKTA 3MZ0A 2P68A 4N47A 3EA4A 4YEDA 3SDZA 4CKCA 3GG9A 1X6VA 3C4QA 1P9RA 3IOMA 4G0WA 1PX2A 3LKVA 4RA6A 5E7QA 5ESXA 3IOBA 1YS7A 2B3TA 2I4NA 1U6IA 2YV3A 2RMKA 5A71A 1W0JA 2QRJA 3B85A 3R24A 4YMHA 2HRRA 4KQ2A 3ZCXA 2PSEA 3DLBA 1KZGB 1DFHA 1I3MA 3KQYA 1OW3B 2Z57A 1WMFA 1Y3CE 3U1TA 5M04A 3HU2A 4LF9B 3B1FA 4YJ2F 1J2YA 2NO7A 3K8OE 4FSDA 2EU8A 1QYVA 1R6XA 1OE0A 2R62A 3JVDA 5TMDA 1R4NB 2NZXA 3SXUB 2JJ2A 4YPVA 1BCRB 4EG4A 2NACA 3IXLA 1SIUA 5LP6A 1M6YA 1SVUA 1DRVA 1QVAA 2XYPA 2DQYA 3C3MA 3GUYA 2FPUA 3KJQA 4JYMA 5BVGA 5DNUA 1Y4UA 4N3BA 3WL8A 1V25A 3UTCA 1L5RA 3DL4A 4TSFD 5HZGA 2XUAA 2DERA 1BDMA 3B9RA 1ZU5A 3UXYA 3W5HA 4ETMA 4MWSA 2X2FA 3Q87B 4LNUB 4GOXA 5J2TF 4WOPA 3ONWA 3AOGA 1KP9A 1W25A 5J58A 1U7WA 4E03A 4GZ6A 4OB7A 4AMYA 4QM7A 2QYOA 3BXOA 2O06A 3R7WA 1P29A 4FC6A 2JFHA 5C37A 5J1SB 4HEQA 1NJSA 4INOA 4B0PA 1E3EA 1SCAA 3AF5A 1EE2A 4BXOB 2GB4A 4G0NA 5I5EA 3A6GA 3ZWMA 1HX7A 4WSOA 4J1TA 2HHLA 3GLSA 4CF3A 3GLIA 1UEXC 3X1JA 3WLOA 4ENPA 4BB0A 3QF7A 4I66A 2AN3A 1G291 2XI4A 1FP4A 1WPXA 4MVJE 1YRWA 1WOMA 4LBYA 5SZIA 1QHXA 2ZIZA 4LC1A 2OA0A 4RAOA 3ZOZA 5IMSA 4J0JA 3E22A 1M2EA 1C4XA 2C4MA 2BFFB 1XCLA 3JR3A 2V7EA 3FNFA 3L6DA 4Y9RA 5AR1A 5JI3E 2D00A 4B4WA 5FPKA 3WXBA 5HPYB 1BEZA 3H84A 1A5ZA 2PAFA 2REBA 3VNAA 2WJIA 3S2GA 3T12A 3Q8MA 2F62A 4PR3A 1I1NA 2OWEA 1U4NA 4UZSA 5DIFA 5HOEA 5KVAA 4BCCA 3PX3A 3I09A 4OK6A 4DIBA 4TSFA 4WXPA 5LXTF 3VR5H 4IHKA 3QUBA 4ZAFA 2ZYUX 2NXJA 1HZJA 4MIOA 5EJ8A 4QU8A 5C7LO 5JUWA 5CVUA 5D6NA 5F78A 4C22A 5BXYA 3CG0A 5KU1A 2HLNA 1XMJA 4GKBA 1Q7CA 5G02A 1GNSA 1UBTS 4JUAA 2FDCA 1Z4PX 2E7ZA 2V58A 3HA3A 4JSTA 3WYAA 1G63A 4JHXA 1NOKA 3ZDZB 4G24A 2WG2A 1TM3E 2ECQA 1XU7A 2WG1A 3VJLA 3ICOA 1RZRA 1LJUA 4YCJA 4UOZA 4BEJA 1QYXA 3OU6A 5K3SA 5ELMA 1K7EB 1ORTA 3EIQA 3F3SA 2JVKA 4MLZA 5FBZA 5TVGA 4MCAA 1A88A 2O2JA 3E8MA 4I4TF 3KOZA 2YCBA 2QTVB 2QZ9A 3JWPA 3I1YA 3MELA 2LPMA 3SXJA 3TL6A 3FDZA 3VGPA 1DJMA 3KHKA 2OG1A 2Y0PA 3I53A 3ZDBA 1GPLA 1H8ED 4C6SA 4IH1A 4ZEVA 3EMBA 3T1YB 1YMVA 2Q6TA 1KZ1A 3OX3A 4DREA 3FVVA 2JAOA 5BSHA 4Y2TA 4OYLA 3V4RA 2GK7A 3OIYA 4M1EA 5CLJA 2Q1YA 4C4ZA 2OYSA 4L9WA 4UATA 1DKNA 3OO1A 4U2CA 1U3WA 2YV5A 3N87A 2CWWA 4MRNA 1XL1A 3ZWCA 3OQ1A 4QPDA 5LQSA 2WJPA 3Q0IA 4XQEA 5IANA 2YBEA 1CJBA 1E58A 4JFAA 1ZW6A 4OJKA 3D3NA 1C1DB 2DF8A 1MZVA 3SIWA 2GM3A 4KN5A 5CLHA 3C7DB 5BWNA 2OPHA 2Q1WA 1P0MA 4K6KA 1U2RA 2OAEA 5HG0A 3LUDA 4ZVVA 4L9AA 1XQXA 3WNVA 4DV7B 3LE8A 1A5SB 3AY3A 5AW6A 4YRSA 1OTHA 4KWHA 2IZOA 4CT0A 3WXMA 3QPUA 4EUNA 3O38A 1KAOA 1KPHA 3GVHA 2Q21A 3E82A 4QHSA 1OASA 4V0RA 4RQUA 4UJ3A 1T9GR 2BD0A 2EYUA 3JAWA 3HHEA 3D5EA 1ZCZA 3IPAA 1ZKDA 2IZ5A 2TMGA 1FNDA 5AJWA 3IAXA 1PTKA 1WABA 4K9PA 4IO0A 1Y81A 5CX4A 5BV2P 3OJLA 1GSOA 5TPZA 4QECA 1RKBA 3M1YA 3Q3JB 5IVDA 1BQ4A 3EARA 1SURA 4MSUA 2AQIA 4C3VA 3H86A 4ZHQB 1QCYA 2GBPA 3F6YA 5HJ2A 3I0ZA 4TMXA 4JYAB 1N1DA 5DYWA 5KZMB 1R0XA 3H6GA 4KH1A 1TECE 2MOKA 2HBRA 2ZE7A 1JLLA 2WBLC 3VR5A 4ZOBA 3AL0C 2V7TA 2OXCA 3F98A 1VZ3A 4FGSA 4HRYA 4B4VA 1MABB 1WBDA 3A9RA 3FTNA 1JFLA 1WM1A 1E9VA 2YBDA 1I80A 1SXJB 5C4GB 3TX2A 2EL9A 3D4BA 4BBZA 1KGSA 1FXSA 5TQ0A 1M73E 4GLJA 4M7OA 2QE6A 4DM4A 2OXFA 4ZARA 3HY6A 1AN0A 3U4HA 4NEQA 2HCBA 3DGEC 3MCAA 2IS4A 1QYRA 1WB4A 4KOAA 5F9HA 4Z7OB 2AQHA 3IUNA 3IEUA 2GWRA 4HB0A 4FB5A 5JZVA 2E18A 4TS3A 3W77A 3ADOA 3O4VA 2DZDA 3CEMA 3MWDA 1H8HA 3RYIB 4CL8A 1G3QA 2PWPA 3MOSA 1UKAA 1CY6A 2OD9A 3K8YA 3VOSA 1C7QA 2AFHE 5AFSA 2SBTA 1JF8A 4KJZA 4EUKA 3BIOA 4WADA 5DBGA 2UVPA 5JAHA 1LZLA 5HQTA 4YIHA 4EG1A 4G1EB 2PX5A 5TV2A 721PA 1SBTA 2DBZA 2FLKA 2GPAA 3AF2A 1US8A 4MUYA 4O2RA 3M6VA 2XQJA 3N1UA 4PLCA 3HYCA 4WFJA 3TDKA 1WCWA 2QDXA 1JEOA 4HF7A 4P32A 3I39X 4NCNA 1RP7A 2MYPA 4L7VA 2RFLA 1EFCA 1ZUHA 2DH5A 4G6ZA 2NNWB 3CRRA 3E9DA 2X2EA 3SOPA 1UDBA 4K81B 4MIYA 4HWKA 1Z08A 3JQ9A 1X1QA 1KO5A 2G8NA 2XADA 1VI6A 1D4AA 3NJ4A 1UIRA 4JZKA 4M55A 2JIZD 3IMKA 4KIWA 4Y98A 5J3JA 4BNXA 4X1IB 1GNVA 1T6YA 4PPFA 3FTPA 1KSFX 1Q0SA 1W87A 3K9NA 4QC2A 4R7GA 1DRJA 1IFXA 3DC2A 3OU2A 4MAMA 2O20A 4YAFA 5KNDH 3AETB 1GDHA 1IXSB 4IIFA 2JARA 1U1GA 1T2DA 3IQHX 5GINE 3HZRA 1T0BA 3VYRB 1M6VB 1YFKA 4WZBB 1X7YB 4YAJA 1KK0A 4EFMA 3WRWA 1E94E 3IBGA 6PFKA 1DU4A 3NUGA 3SJUA 1NDHA 4F6CA 2BEUA 1QH1B 1ZCBA 3H42B 3KYIB 4CF6A 2VUIB 4OXYA 1UAYA 5FNVA 3UBMA 4V1CA 2B5VA 1EFVB 2E5FA 2Q1SA 1ZM4A 3DMHA 4FR2A 4JUFA 5DXFA 2PRYA 5B3JC 5H16A 4B3SB 2QD5A 2BFDA 2HJRA 1F8YA 1M1NB 3C24A 3CHYA 4O4HA 3AF4A 4QPNA 3U0VA 3VH1A 1ZXBA 3HZZA 1W6UA 1FMJA 1F5SA 4OATA 3PJGA 3UW1A 4A5OA 4CM9A 3B5EA 4NBSA 1G6OA 1TYZA 1C9JA 3NWPA 1XXHB 3WYCA 1JLRA 2QRHA 3T7CA 4EVIA 1BSVA 2YXLA 3NHMA 5KNDD 1F2VA 3NALA 3Q7SA 4AJNA 1E4VA 2JAQA 1KAMA 5I9TA 1DAFA 1LW7A 2PPVA 4EPWA 3VYTB 1XVUA 1A4IA 1C30B 3ZDAA 3BMCB 2YWXA 3WE7A 1WKCA 2WTEA 4QA9A 4NXMB 2N46A 2VXCA 1JKFA 2MSWA 5H68A 1KI8A 2JIZA 4M99A 1QUEA 4DEYA 2VLBA 3WIEA 4FWBA 1RW4A 1U2QA 3PLNA 1ZHOA 1X1SA 2F1JA 3AUAA 4DNXA 4OQYA 4EYQA 1R4MA 1WXQA 2V7XA 1IHDA 4JODA 3N2ZB 4MLCA 4ZD6A 5EYPB 3LA8A 3NRCA 1VE1A 5DF1A 4AYTA 3PBKA 2D0OB 1T6NA 2UXDB 4MPDA 3ZKWB 4MRSA 1XZBA 4R2MA 3HVHA 4BKMA 4RK6A 1TIPA 3KAJA 1FNMA 3I52A 3B82A 1JEQB 4EF4A 4FINA 5KVQA 5JNTA 1L5FA 2WJHA 1M5UA 3AWDA 3RUIA 1QQ7A 5DGTA 5IBPA 4RTSA 4I1OA 4JI4B 4QBFA 2A35A 4JA0A 3MJHA 3S81A 5HFNA 3GLFB 2WVGA 5H3HA 1JTFA 1PR2A 4YRNA 2G1KA 5BSEA 3JZIA 4KV9A 3WLSA 1DADA 1HT3A 3VKWA 3OWXA 1I6WA 3IPYA 4M89A 2C2WA 3DOUA 5AOAA 4W5OA 3OG9A 4KQ9A 5JHHB 2XVYA 4YV2A 1JSXA 1GPH1 2C2XA 2VT3A 4IIGA 4S1TA 4TWIA 4Y7DA 3R8XA 2PUGA 3AIMA 4R83A 4IQ8A 4CG0A 4GSYA 5G41A 2R751 3MGCA 1CE8A 2QNBA 4MA0A 3EIUA 4OJYA 3WDMA 3U3DA 3V1UA 3PGXA 5KNDA 4LZJA 3LUCA 2Y27A 1Y1QA 2WILA 4Q0MA 1M34E 2BFOA 1F0KA 4PIPA 3KUUA 3JAKA 4UBKA 3TKLA 2B4AA 3EFOA 3I1FA 1XQ9A 4ARAA 5I7VA 1Z22A 3I4FA 3W06A 4WY2A 5K8IA 4EMUA 3EQZA 3G0HA 5JAIA 2NO5A 1U90A 4UTXA 1DXHA 4QJ4A 3NONA 1AO3A 1SHJA 2Q3EA 1O6ZA 5CX1A 1P7ZA 1M66A 1Q22A 4ALMA 1LK7A 4OKIA 1GPYA 3M4JA 2XOKD 5E2BA 4HXGA 3RVDA 1QRUA 4Q7QA 2ZPTX 3QNUA 1IBLB 1V26A 1EE1A 1RWKA 2HV9A 3RVOA 1LTQA 5P21A 1ZJ4A 3SDBA 5BNWA 1E1MA 1OPRA 4Q47A 3C41J 4YMSA 1TJPB 4MP6A 4DG8A 2FW9A 4LJ7A 4C2AA 5K03A 1ISGA 1G20E 3P0RA 4LMBA 4WDQA 1CEYA 2ZSFA 5G0VA 4MK4A 3AEKB 5EFZA 1P60A 1X1RA 3C85A 3PFBA 2XMPA 3BGIA 2EKZA 5I7SA 1KXJA 1N3BA 1ZD4A 4OHKA 4N5DA 2IY9A 4B32A 2VQ3A 1X1DA 4NULA 2YYZA 5C8VA 4ZMRA 2Z08A 3ORYA 4ZI5A 2QX4A 1FIUA 1JQLB 3TIVA 4BBAA 3HYLA 4KDFA 2ZRNA 1C1HA 2P5YA 3VR3A 1JT9A 3GJ8A 4PYMA 4DLKA 3INTA 1UCFA 2Y0CA 3K2BA 4QAJA 5EJIA 1ZBQA 1KSJA 1D8TA 1OBVA 1T9GS 2DWPA 3O47A 4MKZA 5D8DA 3TI9A 4B33A 1ISPA 1EAMA 3AR2A 3KYDA 1BJRE 3BDVA 3GC6A 3EUFA 2NUBA 1FVXA 4H6WA 2J1LA 5FO1A 3U7GA 1HUQA 3DE3X 2GEKA 5FUBA 3IQIX 1SKUA 3T15A 3A1WA 4CEJB 1AH2A 1FVOA 1XTTA 1O97C 2FH5B 1SR8A 2JCGA 3ESCA 4V0MA 4WASA 4A15A 3KTAA 2WE7A 4ABTA 4OLFA 4YJKA 4LF6B 1KDOA 1IULA 5KNCH 4X8OA 5B1SA 3O1JC 4DWVA 4NU6A 2ZIXB 3I64A 1J2RA 3BMOA 3PRHA 5L4LA 4Q1FA 5HILA 2Z3ZA 3AZQA 4OB6A 5JYCA 4C0LA 4R40A 3GGOA 2A9OA 2WM8A 4L07A 3RS3A 4ADSG 7ABPA 1N6RA 3BIJA 3UMMA 3LK6A 3V2UA 2V03A 2J0UA 4JP8A 3HU3A 5AVZA 3F8SA 3I5YA 1CF4A 3FUTA 5EJGA 1T26A 2B4TO 2QTFA 1UMDB 3G2KA 2QG4A 2NLOA 4DUYB 3DMFA 1MMFB 1J22A 1F6WA 1QIHA 1BVUA 3AFIA 3IAHA 3AEUB 4HVTA 4RIFA 5E1DA 3V34A 4Q4CA 3DBLA 3ZJTA 3ML1A 4PYRA 2QN9A 4IDQA 1UBFA 4O2AB 3TQSA 1VPWA 1IWBB 2FN9A 3OAAA 2W2TA 4ZQEA 3MD0A 3ZNOA 4LXHA 3UJ7A 4EGSA 4TV9A 1L5MA 1JHMA 2FG7C 1DG9A 5FPSA 3H65A 3UMRA 4AMZA 1JMKC 5KJCA 1T8YA 2XMQA 3IE1A 1X74A 4DN6A 1EUDA 2D7CA 5A02A 2ESRA 3AI2A 3WG9A 1HEIA 3N39C 3KG2A 2FWRA 2Q6OA 3EEBA 2C2BA 2IZ6A 2ZATA 4X7RA 4WHMA 5BV1A 1H5UA 1SQ5A 3FCAA 3DV2A 1PNQA 1RVV1 4XLZA 1E6KA 5J5AA 3CVXA 4B44A 4PG5A 1YL7A 5IX8A 3B5IA 3WYGA 3UJNA 4RVOA 4LJSA 4PLGA 2C5SA 5JXIA 3V8QA 1T4BA 1VE6A 3QFCA 4QGHA 3TXAA 3W05A 5B7GA 1VLHA 1QHSA 3TQQA 4PG8A 2LBPA 1X1BA 5IDYA 3ND8A 4XJXA 5K8JB 1JIVA 4OBXA 5BNFA 4BMXA 2BAGA 3V48A 3AL3A 5DCWA 3CXRA 3ISTA 4PSDA 5U4QA 3O84A 4X6XA 2R1VA 3DKPA 1Z07A 4FMPA 4OHCA 4A10A 4DB4A 1VIDA 3RVRA 1SGWA 5I7UA 2JAUA 2EFHB 2QL7A 2EAUA 4PPGA 2XT9A 1XCJA 3OJXA 1PLLA 1X38A 2D2EA 3DO8A 5SZKB 1E2PA 5D7BA 3KEFA 1POXA 1GUZA 1PEDA 1BX1A 2JLQA 1ZKMA 4FYPA 2FPIA 2CVPA 3FPFA 3TRFA 4DADA 3D0RA 2CYCA 3HA2A 1FUIA 2ZS7A 1V95A 3JR7A 1OI7A 4MYRA 1B8NA 3HN2A 4ROSA 4C0HA 4ARIA 1E5LA 1U0NA 3SJ7A 1RQRA 1YZLA 5I9NA 1STOA 1VPTA 4B80A 2RAPA 3GUHA 3BCHA 4C7KA 1LQ2A 1VI5A 4NU5A 4GXRA 5FOWA 5KNCA 2C7OA 4H0NA 3BN3A 1BHQ1 2RKWA 4A1OA 3K72B 3AUSA 4XH9B 3PT5A 5DLEA 2V54A 5A5EA 4IIDA 3IT2A 4B6RA 4UM7A 4B4UA 4PF1A 4A6PA 3DOEA 1RLMA 1BIFA 2GBCA 4L3VA 3MQFA 4ZAZA 3ZQJA 2ZB7A 1CUVA 1GQFA 3EC7A 3K0EA 3N8HA 4OHWA 4RDHA 5AKIA 3V1KA 4UUMA 4A8HA 3ZIAA 4FQ7A 5LB4A 1EVKA 2GXUA 1G55A 2LDXA 3O8NA 2R00A 1MU0A 1E6WA 4AURA 1KAQA 4PRYA 3D2BA 2G9NA 2NPFA 4RPCA 1N6IA 3A4MA 1O89A 1JHZA 1AUXA 2OUIA 3OM9A 1XDDA 3M70A 1FRZA 1NIPA 2Q6VA 3NFYA 4HDRA 5EJEA 1JIIA 1WW2A 4YRPA 4E2XA 3RVPA 4KAXA 3EW7A 1MOSA 1FJHA 1QHIA 1HE2A 4E32A 3KQMA 1Z39A 1EKXA 3O31A 4XIGS 5TRTA 3W9YA 4KXVA 5KTTA 4BVAA 2ZSJA 1NMYA 5G4KB 4HDSB 3NBKA 4BPBA 1CRZA 5EMHA 5CCDA 3TOZA 1UWVA 5TGTA 3C7CB 5MFZA 2YY5A 1IAQA 2NP6A 2C54A 2VHXA 1X9HA 1QGYA 3CCCA 2HHHB 4Q03A 1GG9A 2UZ4A 4L16A 1GDDA 2B1QA 2P7HA 2QTGA 5EJ2A 3TPFA 1ADCA 3HJTA 3AX6A 3KHUA 1H2ZA 3S8MA 4F91B 2OGZA 4R3NA 2RB4A 3GFQA 4XQ0A 1GPDG 4RNDB 2IK8A 1B93A 1IXRC 1RKVA 1U2SA 3UCXA 1JFVA 2H48A 3P52A 2BKEA 3O7WA 4P58A 4BV2A 3ETEA 2ZJAA 3LCJA 1C9YA 1OF1A 2JHGA 3I8XA 4KQFA 3A4NA 4NS4A 1J1UA 1P5RA 3IA2A 3U6BA 3T0FA 3ZY4A 4CKZA 1E0AA 2BY4A 4M1ZA 2KSQA 3IPCA 4ZTZB 3TUZC 3LX4A 3I30X 1NVEA 4OYHA 1Z3IX 4OMCA 2KI5A 4DYVA 3QBDA 4LKRA 1T6ZA 1W93A 4HDKA 4K46A 2FW8A 2QPAA 2Z2JA 3CRVA 1U5CA 4QOFA 4RSRA 2NQTA 1SUWA 3IXMA 2SKCA 3QE2A 2QTVA 3DWIA 3ND7A 1Z5GA 4K2HA 3TW8A 2DSNA 3I32A 3R0QA 4RZSA 1RYBA 1EXVA 1FVFA 2XKBA 4AWAA 2CFIA 3E9YA 4JLPA 4TT3D 4UAGA 3OE7D 2ZAMA 4BMDA 5PGMA 3C7AA 5CDHA 1QVWA 1JHRA 2ZIUB 4TKUA 1JB9A 1KVQA 1NXTA 2WIDA 3ZUPA 4CU2A 3FOAA 3BMQB 1RJ9A 3ZEAA 4K86A 5CW2A 3HE3A 1OZHA 1SXJD 2GAAA 4YMWA 1D7OA 4GXQA 1C50A 3N9IA 5AUOB 3C97A 1N7HA 1P2GA 2XUDA 3L0DA 1KH1A 2ZK7A 4XZ3A 3VDXA 4QQKA 4PBRA 3TI7A 4RTKA 1C1DA 2W2LD 2X42A 3OEYA 5ALRA 2DVMA 2HJSA 2XF8A 2C2ZA 5DK4A 5FD8A 4MQMA 4BKPA 4QEKA 2GBLA 1FUUA 3HCPA 1H22A 4TRRA 3SYKA 4S12A 2YZNA 2BKUA 3FCYA 1G0NA 4E4TA 2CLCX 4X54A 1E2NA 2VN8A 2GTHA 3BJIC 3EDQA 3OCVA 1KPGA 2GN9A 2IYPA 1EFTA 1I5OA 3CPEA 4PAOA 4QQRA 1Q3TA 4JUBA 3X1MA 3ZE0B 4GR9A 5FUQA 1TGYA 1ZGHA 5JLAA 4CIWA 2PK3A 3SGLA 5AOVA 4E5YA 1PJRA 3ZIDA 1AF7A 1H2AS 3BTOA 2IBSA 1VJDA 4XIIA 1U9IC 1X0VA 1YL6A 4PXSA 1TKCA 3REFA 3TTYA 3RF7A 1VYVA 2RBKA 5KJ6A 4NRDA 4DLVA 3H0CA 2AN4A 4D2IA 4E2ZA 4YAGA 1E32A 2F67A 4UXIA 3HCRA 3NT5A 4BN4A 4B3MB 4UTVA 2QVXX 3RAPR 4G01B 3DBVO 3RWMB 3GRRA 4ZIRB 2WV7A 4YQYA 1LKZA 1Q0UA 1GKLA 2MMGA 4KWTA 1XQYA 4W6ZA 4UNIA 4D4JA 4WVLA 5A3VA 4FFLA 1IBMB 1LNQA 2QQFA 1C9KA 1ECCA 1P77A 2GUWA 3LCCA 3OE7A 3R3JA 3I0NA 2A6PA 4FFSA 5KC9A 1E69A 1HE5A 2H85A 5ER9A 3CE6A 5K3FB 1T24A 2CBZA 2ERYA 3DEHA 2PD6A 1MABA 2W70A 3ZWBA 2YQZA 3T1TA 4R84A 1Y7LA 4X63A 3T9EA 4BFWA 4OV6B 3QLVC 3KELA 5KOIA 4NCBA 2K7ZA 3HBJA 5JOQA 5L3VA 2AG6A 2DUMA 5BQFA 2GAIA 1X9IA 2AE1A 3RABA 1IEXA 4KEAA 4BVLA 1V1RB 1E1RD 4LV5B 1OI3A 4UBOA 1TIBA 4N4AA 2O9JA 4LZAA 4O0MA 1PWXA 1CDDA 1EZ1A 2PBFA 4Y1GA 4HUQA 1CQWA 2JVIA 4GOJA 3MLEA 4BV3A 1U2GA 3SG0A 5CVEA 2Y9MB 1CKEA 4N49A 4CCWA 4D8XA 1N2CA 2Q9UA 2Y1FA 3ADBA 3INGA 4BUJA 2W48A 1W88B 2JGMA 1EE9A 2FF7A 3GJZA 1SU4A 4DQUA 4DSAA 5KWVA 2NWQA 2PGDA 1Y6FA 3QNMA 3AOEC 3DOOA 2X13A 3RASA 1Y33E 2J30A 5CLLA 3JYNA 4TYMA 2X7JA 4CKYA 4HOYA 1N77A 4I2NA 1RKUA 1E61A 4II7A 4AJ1A 4ED9A 4MWBA 3AI1A 3ZWQA 3IDQA 2XUGA 2GXSA 3EXFA 3UB2A 2YNMC 1ONPA 1VG1A 4R8LA 2PH7A 4CHGA 1W4AA 1FS5A 4BVEA 1PZEA 4BO0A 3EJ6A 3QI7A 2CXTA 1YVUA 4C5CA 4KL8S 4EG6A 4X1IA 1JRLA 4DAOA 3SHQA 5JNVA 1J20A 2OV4A 5DNWA 1JT2A 4LYHA 1P2DA 2Z98A 4BQQA 1NMXA 3KSBC 3AETA 5B53A 1QIGA 4PRLA 1BVYF 2J31A 3JVVA 4HNHA 4R71A 1JEAA 4B46A 4DT1A 1M6VA 3DEFA 3L7KA 4WZBA 1ODIA 1LZKA 2BP7A 3AV3A 4C0KA 5KDDA 2J6CA 2VPWA 3NUZA 4Q1CA 7YASA 1ESNA 8GPBA 3IE2A 3HVRA 4MGEA 4LDRA 4QWMA 4TTJA 3G2PA 3UJ3X 6AT1A 4W5TA 4G1BA 3GX1A 4TS9A 5DJ5A 1NP6A 5EMMA 2IEYA 1A9RA 3E9CA 4K9LA 4C0QC 4ZEMA 1CG6A 1E1RA 1PS0A 4MUIA 4CMIB 3L6CA 3NANA 4URZR 3KOXA 5EKXA 4AZ3A 3VZBA 5K6AC 1YB7A 2OXRA 4YC7A 2R6AA 2B3DA 5D00A 3GBSA 1M1NA 3I9V6 2H9AA 4IMIB 2AH5A 4EJ0A 4B9EA 5FL7D 2PX2A 5T4BA 4Z0HO 2H1HA 2JI8A 3UAGA 5KKNB 4D25A 2NUAB 5CLFA 3NHUA 4H7IA 1E60A 3N8GA 2YWBA 2YINC 1N6OA 4BDTA 1XXHA 4HUJA 1SC3A 4O33A 3HXMA 3FMOB 4G81A 1DEKA 4M1YA 3RYFA 3V4SA 1CUIA 3F67A 1OMOA 4C3UA 1KBZA 3B36A 3EWIA 2J3IA 1CUBA 4ER0A 4PZPA 4YHHB 4C4YA 1Z28A 3M6AA 1L5VA 3ZDCA 4ARVA 5HMLA 4PWZA 1EFHA 3NNDA 4H1UA 1W4ZA 3IV6A 4D6XA 3IEKA 5IS2A 1Z5ZA 2J4DA 2P9BA 3WADA 3LUKA 3E9RA 3MCVA 3QH4A 1KDTA 2QHXA 4HEHA 1A2BA 2XXJA 3B5JA 2IY8A 1XF1A 3ODPA 4CMAA 5LDDC 3C39A 3RHSA 1I1HA 1PFGA 4QOEA 1IB0A 5EYPA 1YJ8A 3KSDO 2R0QC 4CWAA 1LBIA 2GLUA 3TFWA 4K8OA 1HWYA 5LYYA 4GPBA 3ZKWA 3O82A 3M3PA 1H0SA 2ODWA 3VTZA 2PU7A 2YRWA 3GJRA 4Y2VA 4J0KA 1JEQA 2AZDA 4K6MA 4QU9A 2DR2A 1CQXA 2VO1A 1HG0A 3IOCA 4MV4A 4NDZA 2DFDA 1OIWA 3LTEA 1EDDA 2F4NA 3CM0A 3KHTA 3H2SA 4MYHA 4YRFA 2VDLB 2WWIA 3KXLA 4CQMB 4F9TA 1JWAB 5IUNC 2P9CA 1VG0B 1WMSA 2BR5A 4YJ3A 2HO4A 1YKGA 2GM5A 5H02A 4BVJA 1GFWA 1PP4A 2FRXA 3NEYA 2A9VA 1BA3A 1AKEA 4GVXA 4GFDA 3H1PA 4HGRA 4J0HA 3EH1A 5FL7A 3ER8A 3TVYA 1DQYA 1LU9A 4YX9A 1A0OA 2BBTA 1YDEA 1FFSA 2A5FA 4NZMA 2JLYA 1FY2A 5F1OA 3PLRA 2IYEA 4LZLA 1N33B 1M2HA 1MEEA 3FVWA 1GPWB 1LBHA 3R7AA 4DDTA 2EQ5A 2PT9A 2PXCA 2REOA 3U9SA 4KFTA 2FJPA 2V8BA 2ZWPA 4P7FA 4CDGA 3QKWA 4LHEA 3GL9A 3BRWD 3A9TA 3NT4A 4WUTA 1CUGA 1OJ7A 2C03A 4PO9A 3VMFA 3HXQA 2K2QB 4N65A 3DE7X 1JG7A 1NLMA 1EP3B 2OT3B 2DT5A 4FE7A 4PG7A 4UJ5A 4CV3A 1ZC3A 1O0BA 4CEIA 4ZRDA 3ECAA 2FB9A 5C3UA 4JAVC 3FPEA 1BFDA 1JH8A 2TMYA 4V0SA 3RS2A 2ZAGA 4Y30A 5MN5A 2X4LA 1FSGA 4KRXA 3IAEA 1Z4IA 2WJ6A 4LRQA 2XZDA 1MAWA 4EB6B 5TARA 2BC9A 4YJDA 2FOIA 4PYIA 4LE2A 4JL5A 2IUYA 1JS1X 4AN0A 1EVIA 3RTBA 4EJ6A 1G8JA 1TJNA 1TJ4A 2QM8A 5JAPA 2I7TA 2D7JA 3FNRA 2KE5A 3OFVA 2AL7A 5AI0A 2EG9A 2RGXA 4AI6A 2OCKA 1GNLA 5LOVF 2XYHA 5IRCD 2AZXA 2BT4A 3MG9A 4TL7A 4W63A 3AW9A 3ZY6A 1OFGA 1RI1A 4DIOA 4ETIA 5AKHA 1DX9A 3KEQA 1L5HB 1G6Q1 3MGGA 5T4EA 3H2HA 1R37A 2Q3HA 1WSAA 1XI2A 1LVGA 4DNPA 3QV2A 4H4DA 3HA5A 4UTNA 5IM4F 3QE4A 4CMCA 1U5AA 2XB2A 2D4HA 1QV7A 2V7BA 4Q1DA 4L8YA 2PPLA 1WRBA 2EXXA 5C4IA 4H6VA 4MCJA 1DX4A 1V7PC 1OAOC 2I33A 2WJZB 4B3TB 5I9LA 3PDIA 5A9SA 1GGNA 1IJKA 2ZIXA 2EJCA 5IAJA 4DCGA 3D4IA 5LNK6 2H0AA 4RZQA 4TSRA 5JBIA 2YRFA 3CLKA 3EWAA 4J1QA 2FQWA 3BGVA 2FSIA 1VHWA 2O7SA 3ELDA 2NOAA 3OD1A 2EGUA 4I55B 1K68A 3P9ZA 4J9UE 4KPUA 1M2NA 4PO1A 2QM0A 4BVHA 3GZNB 4KQHA 3OOHA 1K6MA 1QIEA 4ALLA 2OY0A 1T8WA 1OKKA 1UMDA 1Z25A 2FN7A 2IIPA 2IU4A 2JEOA 2ODQA 3HXLA 4LXYA 4QUKA 1AXGA 5B2ZA 4F4HA 1RYFA 1WUJS 4X85A 2UUBB 2P4UA 3AEUA 3ZS8A 4POOA 1R6AA 1ZP6A 3JQCA 3K1ZA 1V5GA 3H5AA 3QV1A 4FDAA 5I9IA 4Q6BA 3KQPA 4IUYA 3ZWDA 2HMUA 5F7XA 4M0CA 3COZA 1OSNA 1EFPB 5E0KB 2IFTA 4KODA 3EVZA 3TSAA 4LVCA 5BV0A 3SYTA 2GNOA 1ZIPA 3JQEA 3VZSA 5DM0A 1J39A 4HBZA 3F3MA 5LM3A 3COWA 3GT4A 3QSGA 4HSGA 1L4GA 2XF2A 3JWGA 5IW8A 3HJNA 3JQPA 5JD5A 2ZQYA 5TEVA 4W4TA 1QE5A 2AF4C 4ZQHA 5J2UB 1ZESA 3SX2A 4NFHA 3TVTA 4ERXA 3ESDA 3HDVA 3SBOA 3LHDA 3BB3A 3IRUA 3KT3A 2QSUA 1AKWA 3OEHD 3QYJA 4NHEA 3F4KA 4ZRMA 5HF5A 2IU6A 3MJCA 2ONZA 5F9FA 4HCJA 4X3PA 3PI7A 1Z18A 3IILA 3E1SA 2PZMA 4OM8A 2OK7A 1U9YA 4UHFA 5FB3A 3T3GA 1M6NA 3U3XA 1YFLA 3UGQA 4UVHA 4WLFA 5JDIC 1E79D 4RMNA 3RC2A 1U2DC 4RNCA 4L4UA 1KY5A 121PA 1R9NA 3KPUA 2QT9A 1Z06A 4KQ1A 4BGIA 4EY6A 2XTNA 1P6XA 3AHHA 4EIWA 1XWFA 1Z0AA 3CB4A 1Z37A 4CLOB 3VOTA 1QF6A 3ROPA 3KEMA 1CEXA 2DAPA 2JZNA 2WDPA 1KMCA 5MF6A 3QOFA 3U40A 4H6XA 4NZYA 4QGFA 5LD2C 4GE0A 5C2JB 1TRKA 1ONNA 2QM7A 1T2UA 2ECFA 4F1KA 1KVSA 1O9GA 4US0R 3KOMA 2WDZA 4UQOA 3TGWA 1KWGA 1BU8A 2HLDD 1E3DA 4LX8A 3LMKA 3O73A 5GGYA 1AS0A 1TTTA 1GM5A 4LYFA 2IUSA 3IELA 4NXNB 4DUPA 1S2LA 3CF4G 2MU1A 3ZZ0A 4B2IA 1A7AA 3AJEA 3ZBUA 4E88A 1UQUA 1G17A 3IDFA 1XPJA 1SUSA 2EZUA 3U7IA 5CPBA 2ZAYA 1MAVA 1MB4A 2AMFA 5EIBD 3T3MB 4LXXA 1C0EA 1HQCA 2W8BA 5LIPA 1X9GA 1MX3A 4LAFA 3H11B 4P1ZA 3ZZUA 4HATA 3OEHA 2R6R1 1PSDA 3ZVMA 4CJXA 2GYUA 3RKRA 3OQBA 1DCKA 2C42A 3DW3X 1LFDB 2B20A 3AI3A 1W5TA 2O6HA 2PKXA 5D3ZA 4BO3A 1G21A 3HADA 4M2LA 4FBLA 2M6RA 3DP7A 3A1NA 3ETJA 3P9PA 3L9WA 3L43A 4U4AA 2ZB4A 1A69A 1Q14A 3FNBA 1Q1BA 2HL6A 4JKOA 3VSCA 4S0ZA 2P2LA 4UVIA 3CH6A 2A84A 4J0QA 4MS3B 2CNKA 4FNAA 4OI4A 4WK4B 2MSEB 3X1XA 1SU8A 421PA 4AWXA 3KDPA 3H3JA 3NZEA 3T9CA 4CV0A 4HAXA 1QGUB 1D2MA 2BCJQ 1E1LA 2HWUA 3OURA 2JIOA 2QAGC 1K2WA 3FRJA 1XAIA 4XUDA 4J03A 3W1EA 2Q1UA 1IEWA 2Z1NA 3C45A 2R96A 2BN4A 3CURA 3TLCA 3E58A 1UQTA 2PKCA 4UCXA 1E3IA 1INLA 2X41A 4LWPA 2HLDA 2J09A 3A1VA 4FKBA 1QHFA 3FRIA 3SBEA 4EENA 1BDHA 2JHCA 3ETLA 2CXRA 3O4RA 3U0BA 1JG1A 1J23A 4ID3A 5DE3A 3ZHOA 4C0BA 5IK2D 4I5GA 5K0GA 2HLPA 2D4AA 2OBYA 3FMVA 1C7EA 1E0JA 3QY0A 4YPFA 4GL2A 1RHUA 4JVNA 3NDIA 2PX8A 4UUPA 4WOCA 1GNQA 3KE9A 5DULA 5FLXA 1DLIA 2GUGA 5JZMA 5EKSA 3RBXA 4IZ6A 2YX1A 4R1NA 2BFNA 2O48X 3BILA 5AKJA 3HLYA 2ERXA 3HUUA 2A57A 2E4ZA 3PA6A 5B4VA 1KZ4A 4FXOA 1XRQA 2ZBPA 3HWX1 1Z4OA 3SX0A 3WICA 4AS2A 2DECA 1XNRB 1OI4A 3RO7A 2OGUA 2BGRA 5KTNA 5CCXA 3N0VA 3PUHA 2ZJBA 1ODCA 4ENSA 3H2ZA