1D2HA

Crystal structure of r175k mutant glycine n-methyltransferase complexed with s-adenosylhomocysteine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
252
structure length
252
Chain Sequence
TAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCINE N-METHYLTRANSFERASE
publication title Mechanisms for auto-inhibition and forced product release in glycine N-methyltransferase: crystal structures of wild-type, mutant R175K and S-adenosylhomocysteine-bound R175K enzymes.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 65
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 1999-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1d2hA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1d2hA02
5EMMA 3DOUA 2ESRA 2JHAA 5FWDA 5K0BA 5DRYA 4DCMA 1FP1D 1P91A 4PYJA 3NDIA 4QVGA 4E2WA 4E2ZA 3DH0A 2ZSUA 5K03A 3CC8A 3HVIA 5LQJA 2GA9A 3DLCA 3G89A 4OA5A 5CIYA 2ZIEA 2G8NA 1N7IA 3L8DA 1Q0TA 2I6GA 3B3FA 4KW7A 3BWBA 3GNLA 2P8JA 4PYMA 5KYGA 2V7EA 4GQBA 4RVFA 2F8LA 3R9XB 2B2CA 1XDSA 2HMYB 3HVKA 3MAGA 5DSXA 4XCXA 5LQNA 4RTKA 1XVAA 1VP9A 4E30A 5JR3A 3UJAA 5IKMA 3NDJA 5E2BA 1B42A 2ZZNA 4BP1A 2NP7A 4M36A 2P3OA 3ANXA 3GDHA 4KVZA 1DCTA 2BR4A 3KPYA 2AN5A 3MTIA 4HGYA 5DM1A 1MJFA 3PS9A 1G55A 3M33A 3NTVA 1JG3A 1ZG3A 4PCAA 1VIDA 2V74B 3OZTA 5EIFA 4AZSA 5EKUA 5HIMA 1VP3A 4R6WA 5CVJA 3OFJA 5P8WA 2VDUE 4FSXA 5FADA 5EOVA 3T0IA 4QPNA 1Y8CA 3JWHA 4CKCA 5F2NA 3DXXA 2ZULA 5LQAA 2HR1A 3A4TA 3DMHA 3IEIA 4WVLA 5ICGA 3IHTA 3QV2A 3TLJA 5DRTA 1KIAA 1NV9A 3UJ8A 2OYRA 5FWAA 2C7QA 3P9IA 2P3QA 1ZKDA 2FPOA 4V0RA 2CMHA 2C7RA 1O9HA 2O0LA 2JH9A 3WSTA 4X41A 3LBYA 3DULA 3A7DA 4MQ4A 2ZZMA 3MGGA 4QVKA 2B25A 2LD4A 3KQVA 3K0BA 1ORIA 2H11A 2PVCA 2ZVJA 4RVHA 5FUBA 5HFJA 3HVJA 2P1DA 4RSRA 3LECA 3CJQA 1XDUA 1JR4A 3HCAA 5LQRA 1WY7A 2R3SA 2EJUA 1XCJA 3CBGA 3G2QA 3OCJA 4DF3A 4PIMA 1ZQ9A 1JSXA 4RV9A 3BUSA 1JG4A 5E9JA 5EZSA 4DZRA 2B9EA 3KPJA 3LCVB 3R0QA 3UA4A 3A25A 5EMLA 4OBWA 4PGHA 5CM2Z 1ORHA 1QAQA 1O54A 2DULA 3B3GA 4GUAA 4EQZA 5FCDA 2FK7A 1KYZA 1SQFA 3SMQA 3E05A 3OE5A 1NKVA 3TMAA 2PXCA 3TFWA 2YVLA 3C6MA 5EEHA 1X1DA 2QY6A 5FQNA 3P2IA 2PKWA 3Q7EA 1JQDA 2UYOA 5DX0A 4B17A 3O7WA 3LHDA 1X1CA 2VDWA 2ZW9A 3MERA 3KQQA 5E1OA 1IXKA 2Z6QA 2ZCJA 2QYOA 2VS1A 4OBXA 5G02A 2XBMA 2P3LA 2NNWB 3KR1A 4RX1A 5F2KA 3VSEA 4PYIA 3C3YA 3HTXA 3KPVA 1D2GA 1KXZA 2BH2A 3T7TA 4RTJA 2QRVA 4QPPA 3DMGA 1L1EA 1WXXA 4HC4A 4WXHA 2R6ZA 2IPXA 3HCFA 1D2CA 3PT9A 1N7JA 4X61A 5GIPE 2IDJA 3G5LA 1QAOA 3EVGA 3EPPA 5DSTA 2IGTA 2ZWVA 1VLMA 2PWPA 3R3HA 2XVMA 1BHJA 3TR6A 5KS2A 1RI2A 4ER6A 8MHTA 2AR0A 3FUWA 4E70A 4M7RA 3BWYA 5DX1A 4DQ0A 2PSSA 5B1SA 1NBIA 3G88A 5DTQA 3V8VA 3OE4A 3B3JA 3LSTA 1YB2A 3BGDA 3HNRA 3OU6A 2PGXA 2PXXA 4PWYA 4R8RA 4RWZA 5DXAA 4CXMA 2PBFA 1T43A 3I64A 2O05A 2ORED 5IH3A 3LPMA 5E1BA 3V97A 2E5WA 4YV0A 3G8BA 4RTLA 3CGGA 5BW5A 2Z6UA 5HIIA 2GH1A 3KQYA 1IY9A 3BWMA 3EEYA 3GU3A 4GEKA 1HNNA 3MTEA 4FR0A 1YZ3A 4RYLA 4Y30A 4E2YA 2P35A 1BKYA 3GWZA 4KDRA 2IH5A 5HILA 3E23A 4QDKA 2YUIA 3EGVA 3M4XA 5DM2A 3TOSA 3UZUA 3ERCA 4FGZA 5EHGA 5LQKA 1KP9A 5H02A 3UA3A 4KIGA 4CTKA 1L3CA 5FHRA 4RVDA 3SX0A 4GC9A 5FHQA 4HTFA 5EC8A 5FA5A 4YMHA 4PIPA 4E32A 2IH2A 4HH4A 5DTRA 3P9CA 5EG5A 3UJCA 4P7GA 1RI3A 4HGZA 4M38A 4HSGA 4DM3A 3BKXA 5EKXA 3AJDA 4C05A 3P2KA 1G8AA 1I9GA 3P9KA 3TM5A 3GXOA 4YV1A 2A14A 2BR3A 3G8AA 5E1MA 5CCXA 1SUIA 2BM9A 4PYKA 4R8SA 2Z6AA 2XVAA 2CL5A 3FPJA 5GM1A 3KR2A 4BLUA 3FTFA 4YMGA 2HV9A 1R8YA 1FPQA 3EVDA 4AUKA 1SKMA 4PNEA 1INLA 1R6AA 4CKEA 3THSA 2EJTA 2PT9A 5T64A 4FZVA 1KPGA 1P1BA 1EG2A 5E8RA 2B78A 3LKZA 2VZ9A 4U7PB 4XUDA 4AZVA 4YUYA 3PX3A 3SSOA 3AY0A 3FUVA 3UJ6A 3AXSA 4C04A 3TQSA 3GRYA 4RTQA 2AN3A 3TRKA 5HZMA 3OU7A 1NW5A 4PYNA 4C03A 1G6Q1 3O4FA 4NECA 1YFJA 3FRIA 1WS6A 3BZBA 4KWCA 4ATNA 2BZGA 7MHTA 1YFLA 2OKCA 1UIRA 5FQOA 2IH4A 2O07A 3GJYA 1IM8A 3DTNA 3FYCA 3KQTA 1FJXA 2IBSA 1EQAA 2GB4A 3FPGA 3P71T 3VC2A 4E2XA 2ZFUA 3I58A 1KPIA 3EVEA 1XCLA 4R05A 4BLVA 1G60A 5DT2A 4GOLD 2EG5A 1UFKA 4BY9E 4YV2A 3EVCA 3CJRA 2AOTB 3LCUA 5LSAA 1N2XA 2PXAA 5DLYA 4ER0A 1P1CA 3I9FA 3MCZA 1R00A 4O29A 1MHTA 3JWIA 3PFGA 4C07A 1ZGJA 2IIPA 3FRHA 2ZBRA 2O57A 2ZIFA 3G2PA 4KRGA 4C4AA 4CWAA 5HOQA 5LQUA 3SXJA 4MIKA 4F84A 2IP2A 2PX5A 4KIFA 1M0EA 3S68A 5E9WA 5K09A 3HM2A 3T7SA 1QAMA 2G71A 3UWPA 1X19A 5ICEA 2OXTA 5K0FA 2AOUB 2ONYA 2NXCA 3UJBA 5K01A 4RTOA 2C7PA 3DUWA 4OA8A 4ISCA 5FA8A 2ZLBA 4RTPA 1QYRA 1YF3A 4MHTA 4K6MA 4E33A 1D2HA 3LDGA 2OB1A 1KPHA 2NXEA 5HIJA 3EEOA 2PWYA 4CKBA 4PINA 3AWIA 3GIWA 3GRVA 3FPHA 3LBFA 1R18A 4C06A 2PX4A 5K8VA 3B89A 2YXEA 3IYLW 2GS9A 3AXTA 3FPFA 3LKDA 4Y2HA 3K6RA 2ZBQA 4EKIA 4MTLA 4FT4A 4ER5A 4A6EA 3TPZA 2HNKA 1G38A 4QDJA 3GRUA 3Q87B 2FK8A 2YQZA 1TW3A 3CKKA 4LWPA 5E1DA 4EKGA 1R8XA 2NXJA 4GF5A 5CVVA 5EHIA 1TW2A 2AZTA 2XYQA 1ZHFA 1PJZA 2G72A 3LCCA 5EPEA 4YUVA 3KQSA 1G8SA 4HRAA 3HP7A 2GAFA 1O9GA 3HEMA 3VC1A 4M37A 1P39A 2OY0A 4QQKA 2PV0A 2Y1XA 4PONA 3U81A 2IDKA 3M6WA 2DPMA 1AF7A 2HWKA 5K0JA 3OPNA 1VE3A 4C08A 3A27A 5E8JA 3KKZA 4OQDA 5EGSA 1SUSA 3BKWA 5EZQA 4V0QA 5EEGA 2BR5A 1JQEA 2AN4A 1H1DA 4E31A 5ERGB 1JTEA 3EMBA 1L3BA 2YXLA 3HCEA 1DL5A 3UBTA 4F85A 1VQ1A 3GO4A 2OZVA 3FTCA 3LGAA 4HTFB 3G7UA 5HIKA 5KVAA 3MCTA 4DKJA 4IWNA 3UJ9A 3ER8A 1JG2A 5EMJA 1XXLA 2G70A 3OU2A 2I62A 4P7FA 1DUSA 2ONZA 3BGVA 3OFKA 1JTFA 2QE6A 4ER7A 1FBNA 1SG9A 2UYQA 3EVZA 5LR6A 3DR5A 5KQSA 3ID6C 3EVFA 5E9QA 4P58A 2UYCA 1EJ0A 4GOMD 3OZSA 1VPTA 2Y1WA 5DTMA 2C7OA 2PJDA 4DCGA 4FP9A 3F4KA 4PCLA 3KPUA 4ZTBA 4P7JA 4A6DA 3BXOA 2UZ4A 3KQPA 4LWOA 3O31A 3ORHA 1Z3CA 2OB2A 3KU1A 1YUBA 3LDFA 3M6UA 4X1OA 4OX9Y 3HCDA 3JWGA 4OQEA 4YUXA 2FCAA 2EFJA 2FHPA 2KW5A 3FZGA 2ZWAA 2PT6A 3C6KA 1YZHA 2Q41A 1RI4A 3PTAA 2EX4A 3KHKA 4QQNA 5CCBA 2OPBA 4P7KA 1Q0SA 3SVZA 3SSNA 2P41A 2O06A 1SVUA 2H00A 4F86A 4GOOD 3LDUA 1EIZA 5CVUA 3DLIA 3SM3A 2WA1A 5BW4A 1M6EX 5K0EA 3MB5A 4RTNA 5BXYA 3HA7A 5HEKA 3A26A 5EMKA 4MWZA 5K0NA 2NXNA 2GLUA 3CVOA 4G56A 4YUZA 4RTRA 3M6XA 3P8ZA 3ELUA 5D1NA 1QZZA 1EJ6A 3KR0A 3NJRA 4EMSA 4QTUB 2JHPA 4FSDA 4GBED 2VDVE 4PYOA 3G2MA 3I53A 3KPWA 3CJTA 1F38A 3P2EA 1RI5A 4XUCA 2AOWA 5DWQA 1WXWA 4LG1A 4LECA 3ELYA 3KQOA 2NYUA 3GRRA 3H2BA 4X63A 3E8SA 1NBHA 2ERCA 5M5BA 5GWXA 3EGIA 3REOA 2BM8A 3UJ7A 5MHTA 3FTEA 1RJFA 5EQJB 3QOWA 3X0DA 1AQJA 4DMGA 3ELWA 1NT2A 3P97A 1I4WA 3EMDA 4PYLA 5C1IA 3R24A 3VYWA 9MHTA 2VP3A 3BGIA 5CUQA 2ZIGA 3SGLA 1RJGA 3FYDA 2I9KA 3I5UA 3ME5A 3UJDA 4POOA 2OO3A 5DM0A 4RTSA 3FUUA 3C3PA 2CMGA 2ZBPA 1QANA 3NWEA 5BP7A 2AS0A 1XTPA 5DXJA 2AVDA 2N47A 1X1BA 1V39A 2YR0A 2JH8A 4PYQA 4AZTA 2K4MA 4GC5A 3GRZA 4U7TB 3RW9A 4EK9A 4KDCA 2IFTA 2UYHA 3NWBA 2QRVB 2ZTHA 1RJEA 1RI1A 1KHHA 2JHCA 3GCZA 3KR9A 5ICCA 5KQRA 1NW3A 2QM3A 3G2OA 1BC5A 4DA4A 3TM4A 2FRXA 2HTEA 2JJQA 3FUXA 5F2OA 5GOZA 3A7EA 5GP1A 5FULA 2CWWA 3PVCA 3G5TA 1OR8A 1AV6A 3HCBA 4RVGA 1NW6A 5EVJA 1NW7A 4FT2A 3IV6A 5T67A 4UOEA 2AOTA 3C0KA 3EVAA 3HVHA 2WK1A 1ZGAA 1NE2A 1NV8A 5DPMA 3HA5A 2PX2A 3RODA 3BT7A 4IKPA 1WZNA 3FTDA 2PLWA 3CCFA 2I7CA 3DMFA 2YX1A 5C0OE 1X1AA 3B5IA 3BWCA 1L9KA 2WA2A 5K0CA 1M6YA 3LX6A 3P9NA 4FS8A 5K0GA 3KQMA 4QTTB 1F3LA 4AX8A 1FP2A 5LQCA 1VL5A 5K05A 3PX2A 4Z2YA 1VBFA 1XDZA 2ZZKA 1JSZA 2AOVA 4H0NA 3JWJA 5CVDA 2AOUA 3DXYA 3NMUF 2OBFA 3KQWA 4BLWA 4IV0A 1I1NA 1U2ZA 3RIEA 2XYVA 1AQIA 3DP7A 3HA3A 3HCCA 3M70A 5DM4A 3PLAE 3OZRA 1PRYA 2PY6A 3PB3A 4HG2A 4CTJA 2YTZA 3TKAA 4JXJA 2IBTA 2AOXA 5K0LA 2GPYA 4XUEA 1JG1A 5D1HA 4AZWA 4BP3A 5JUWA 5GIOE 3EVBA 4YUWA 2P7HA 1RJDA 1XJ5A 5CVEA 3R6TA 5E2AA 2PX8A 3ER9A 3PFHA 2G1PA 2CKDA 4RTMA 1BOOA 3ELDA 3MHTA 1KYWA 4ER3A 3UFBA 3QOXA 2NP6A 3FPEA 1HMYA 3EGEA 4L7VA 5EIWA 3NVMB 2XYRA 5U4XA 5CD1A 1UWVA 3FUTA 3SSMA 3B7PA 4IV8A 5GM2A 2FYTA 1L3IA 4R6XA 3MQ2A 4X60A 1KR5A 2ADMA 1WG8A 5FTWA 3T7RA 1NW8A 3LL7A 3M6VA 4EVIA 1EAMA 5ICFA 10MHA 3NW9A 3GGDA 4PGGA 2P40A 1JQ3A 1SQGA 3THRA 5T6BA 2P7IA 5GINE 5C9ZA 2AVNA 2B3TA 5DX8A 3D2LA 3TKYA 1R74A 1TPYA 4GOND 2YXDA 3NVKI 2H1RA 3E7PA 3SR4A 2JG3A 3DXZA
chains in the Genus database with same CATH superfamily
3MWGA 1ZSYA 2FPWA 1V35A 3DOUA 4WXMA 2IS6A 3LG2A 4U0KA 2FG7C 2HK9A 1FP1D 4I99A 3ESXA 4YPFA 3PHJA 5AI5A 1CJSA 3UMYA 1ODKA 1D6NA 2WPDD 2P5YA 1QH0A 4YGYA 3RVQA 4G0ZA 4E5NA 3STTA 2DH6A 5EE1A 4ETIA 1CKEA 1ZH8A 2MWMA 4K6KA 4HAZA 4RPKA 1NNLA 5JV5A 5AVZA 4ZZ1A 3HB1A 3K70D 3GRAA 1P1FA 4J0KA 1E1MA 3NTXA 4B47A 1NSYA 1ZYUA 1A1SA 4PLYA 1WA5A 4GZLA 3A6KA 3V8NA 3ZHUA 4ESHA 1U3UA 3AILA 1KDTA 1SHZA 2IEIA 3NDJA 1IONA 1O77A 2I4NA 3A9WA 3BMQA 5CYPA 1US8A 4F5DA 1DCTA 3LU1A 5HK9A 4AD8A 3HGMA 1C80A 1JXQA 2ODNA 4H31A 3QGMA 3EWNA 4MB6A 3OAAD 4O3MA 1W19A 3EQ6A 4FCCA 4G97A 2J5RA 1QTIA 2HQBA 3QUQA 3HVRA 4MW0A 1ZCFA 1OAOA 2ZPTX 4P82A 4QPNA 1R0RE 2HNBA 2VUUA 3DC7A 3WOVA 3PNMA 3A4TA 3HG7A 4KKVA 4KQ9A 4R2WA 4XSHA 1RIIA 4G07A 1C0EA 5AW4A 5EJEA 1Q1QA 2XDQB 4YR9A 3CKYA 3IKJA 1OXXK 4DR5B 4A1OA 5DE3A 2MSCB 2IUTA 5IDXA 2C9ZA 4XVUA 4YUWA 3FA2A 1AKNA 3DG9A 5K3BA 4D5EA 1J90A 1ENZA 2DR3A 2OT3B 2W37A 5FPHA 1XKXA 1K63A 1T2DA 2EJBA 3OZ7A 3PD1A 2OORC 2YMQA 2WWIA 4TV9A 3H1FA 4B9AA 5C4IA 2BE9A 2BUBA 2EBFX 3LYAA 1QYCA 4D25A 2ZATA 3DCNA 1ULHA 2OCXA 2V9ZA 2AW3A 3L43A 2C5EA 2HBZA 4NOLA 1ZQ9A 4PIMA 5DHRA 1O0BA 4NFYA 4RV9A 5E9JA 4A0QA 3RUPA 3I28A 3NM4A 3QVVA 5HCNA 3ZGVA 3JQ8B 4HGQA 1FU8A 1YR2A 2I4LA 4NCKA 3KLOA 3MT9A 4AQ7A 3KX2A 4GBGA 2VUIB 4S1WA 2F62A 2DULA 1S96A 4MI6A 1DWPA 3BRQA 1O6BA 2AI1A 4X94A 2PCJA 4WNAA 5A6SB 1VRWA 3TMAA 1XPJA 2VTBA 3BHMA 1QCCA 4HN9A 5AW9A 4DMUB 2LDXA 1IG3A 1W5AA 2A9JA 3K1AA 3DGFC 1EGQA 1WCWA 2ISSD 4PQRA 5FUWA 1XDBA 3SYNA 2HXYA 3ZIAD 5BQOA 4NU6A 4PXAA 4GKJB 3ETNA 2B4YA 3FNEA 5G3ZA 2Z8ZA 1G5QA 3AHGA 3NZEA 4H77A 4QU0A 3UXMA 3VFDA 5I7VA 3JD2A 2OM6A 1DFGA 5HTOA 1HNZB 4L1KA 2P79A 2ZSFA 4DDWA 2F1HA 1BG6A 4R8MA 2MINA 4J29A 2W48A 3IJRA 4JB3A 2OBLA 5DHUA 3VSEA 1GM5A 1KXZA 2A0FA 4I5IA 4UNIA 1H65A 3EG9A 3TBKA 3EGXB 3VJRA 3ZJ4A 3QI2A 4YRMA 4B85A 1MDBA 3I6IA 4CT5A 4N9WA 1YC5A 3INYA 2FWBA 5L9AA 4YMWA 3AWDA 4PTZA 4A82A 1VLMA 3TDKA 4BB9A 2XVMA 3QYFA 1HEYA 3NU1A 5DDIP 1ISSA 1C7EA 3KLBA 4DA9A 1ZJZA 3C3KA 1VKHA 4CCYB 3BL8A 3W2TA 4L4XA 2DWQA 4M7RA 2CVZA 5ALIA 4BTEA 2QRPA 3HUFA 4Q3AA 2C0PA 1JQBA 4BLQA 4HNHA 3KYCB 3IDAA 4FFMA 3OE4A 4YDQA 3QTLA 2CUKA 1V8DA 4AY5A 2B5WA 2HU7A 2BIFA 2UVPA 2WF6A 3CRW1 3D8NA 3TXAA 5A0TA 1CZUA 5F3RA 3GLGE 4FK8A 2C3UA 3OLXA 3ZDFA 2OMKA 4OB6A 2LUOA 1T2EA 2GF9A 5L3QA 1XMIA 1WY5A 1XROA 3J81A 2XRZA 5CLQA 3A9TA 1E9SA 3S5JA 2YZKA 4BVEA 5ARBA 2CNDA 4WBXC 2IH5A 1C9YA 2GBFA 5DHAA 2QMOA 4GLBA 4WIAA 3C3XA 5DBIA 3TTWA 2G25A 3O4HA 2I4TA 3A6GA 4NBNA 1U5BB 5A4IS 3DE1X 3MYYA 1SUEA 1TEXA 2CUZA 3WGUA 1I32A 5LQKA 1OTXA 2REQB 2XQKA 3NT2A 1NKTA 3N2KA 4NNJA 2WP0A 1FP4A 1JJBA 2VJLA 2WWWA 4Q93A 1U8XX 4NCAA 3GLGA 5EZYB 4Q4HB 4BLOA 4ZO6A 3ILSA 2DKOA 2GCGA 1MX5A 2BY4A 1Z82A 4R9NA 1AK9A 1ZVKA 4RHEA 1IY0A 2XZTA 2YH2A 1LSJA 4HFNA 1SHKA 3H7AA 3VC7A 1RBYA 2JKYA 3DOFA 3NUQA 2H1SA 1QKJA 4YB8A 1QK5A 5DN6D 3V1KA 4PYKA 3E4CA 4BMOB 4KQWA 1WUKS 1W93A 3WYNA 2CL5A 2TMDA 1N9GA 5BSKA 2XUGA 1EG7A 1T2VA 3WNVA 3WGYA 3OPMA 2M9MA 1CE8A 1R6AA 1Z47A 1HOXA 4A5OA 4TV9F 1OV4A 1SKAA 4FD3A 4C4SA 4JNKA 5AW6A 4HVAA 4KLZA 3NM6B 3LKVA 1DG1G 3N6RA 4KV9A 1P60A 3GBPA 3T0GA 3TFOA 5BN5B 1ZK4A 2A1TS 2ZP1A 3AP3A 2AN3A 3A36A 3FDZB 4JQCA 1NW5A 4LY6A 4TUYB 1CRZA 2VEOA 3MWJA 2WYVA 2QN1A 4JY7A 5JJBA 4F7WA 1YZNA 4RAQA 4DA6A 1MVOA 1R0SA 2IY7A 1Z4JA 2NUPA 3DTNA 1XLVA 1X7ZB 3KBBA 2BUCA 2ZIVB 4CPDA 5JROA 1HO3A 2MHCA 1RWOA 4AF6A 3L5KA 4JLUA 3EGDB 1G2IA 4GOLD 4HN4B 2CHEA 4NG4A 1U7XA 4V0ME 1YRYE 3DE3X 5JTTA 5AJXA 2H7YA 3I9JA 3L8HA 4Y7DA 1H0KA 1DEAA 1H4TA 1T9BA 1Q12A 5J43A 4JBGA 4EYGA 2GN0A 2ZJ5A 3PRYA 3NHFA 3RRBA 2C0QA 4KRGA 3S2GA 1ZAYA 2FZ4A 4M9UA 3W2EA 1PG0A 1UMBA 1Y9ZA 1SD2A 3FF4A 1F2UB 2XIJA 3PICA 4LDZA 3U7RA 2JGEA 5L45A 2P30A 4BBZA 1EDEA 2FE4A 1U31A 4CI9A 4ZCTA 1NXOA 3BWDD 5EIHA 4YPVA 2JJ1A 4UQOA 4KWTA 3FNHA 5JZ9A 1H85A 4TLEA 4ITVA 3WKBA 4DE5A 2XDQA 3MWDB 4V0MA 2W2MA 2VF5X 3D4OA 4P93A 3THXB 2H4FA 1K6EA 4RAOA 3E5NA 4XVHA 4YP5A 1T3HA 4UULA 1AK2A 4UMDA 2RGGA 2VAPA 4JLNA 2AMVA 5AK3A 4I55A 5AUQA 1F9AA 2W7TA 4BRSA 4XR9A 2GMWA 4NEQA 3B85A 1Q0PA 1GVHA 4PZLA 4EECA 4EEZA 5LMNB 2HNKA 5JNVA 1A9TA 1LCIA 2PVPA 3WYEA 3NTLA 3Q7RA 1AU9A 2O7QA 2VHWA 5CVVA 3V4LA 4R40A 4B76A 4IXWA 4NCNA 5TSDA 2AZTA 3HFSA 4J3JA 1J21A 2PRKA 4DWOA 2JBHA 4YUVA 5CAEA 1I7DA 2AW5A 2QUKA 4G5XA 1B8PA 2H9AA 3FIJA 2WU3A 3JQ8A 1P39A 3K9HA 3RS8A 5KJCA 1R66A 3CNBA 1ADCA 4JASB 2DERA 1OLUB 2ECOA 2ID7A 3E48A 1K2WA 3B1VA 4N8EA 3VSBA 3ZS9A 1RBZA 3E2MA 4M8IA 4OOFA 2W2XA 1GRVA 1L4NA 1YI0A 2RIRA 1DJQA 2X8JB 1IN8A 1E3LA 3FVTA 1SUSA 2QR3A 4OQDA 2JI9A 4EYKA 4B3GA 1EHCA 4XQCA 2YZGA 4YBRA 1EP9A 3RYTC 2ZRBA 4IHKA 4FWTA 4FFBB 1R50A 1KQNA 3AY6A 1TKAA 2ZSIA 2VHEA 2B30A 3CF6R 3GUVA 3VVMA 1M6VA 1Q57A 1UXKA 5FI0B 5B4VA 1N2GA 3UBTA 4F85A 1BH2A 1SQ0A 2R8RA 4F96A 5K5EA 1GN8A 3GF4A 1K6MA 5LZ7A 4A2WA 3H4IA 4DKJA 3O75A 2YWDA 4QYTA 4EKDA 4US2R 1U8YA 4UBMA 1HQCA 2G70A 4EY8A 3O47A 5CPBA 3H0CA 1KYXA 1ZS9A 2ONZA 3EGXA 5HX7A 1KJWA 4NZMA 4W82A 1Q7GA 4E1BA 3BQMB 4P4TA 4UNPA 2GZMA 3F6SA 1P0PA 3QWBA 2BW0A 5LZ5A 5DP1A 1KMIY 2BJWA 3GNSA 1Z56C 3VU8A 2QAGB 5M29A 3RIHA 1WMFA 5CNJA 3G8CA 1X9HA 4BTVA 4CCYA 2ZUWA 3GP3A 4FBGA 4V02A 2F1IA 5LZ2A 1T0IA 3KYCA 5LMCA 4LA4A 2PQ2A 3A9UA 2JLQA 1ULUA 2OB2A 1DC6A 2JIBA 3E9NA 3EIOA 3EBOA 4LZPA 4QEDA 5TDHA 3ZDYB 1WDMA 1TD1A 3VGJA 1V9CA 1E64A 4QGFA 2ZWAA 1I33A 1Z9BA 4GL2A 1RADA 1BRMA 4OF4A 1UXHA 4FEGA 4X1IB 4D56A 1KL7A 1U2TA 1T1EA 3EODA 4D9GA 3U17A 4KQ6A 4Y9UA 4CETA 3TEFA 2FFQA 2B5VA 2EQAA 2ZDQA 3TINA 1SCAA 5J2UB 3T5GA 3ED1A 3BILA 5JDCA 1DTWA 1M6EX 1VKOA 4U7GA 4EI9A 2QN8A 2XQIA 2E82A 3TSCA 4BFLA 5K0EA 2Q0XA 1U5BA 3QTBA 3OBIA 3JQPA 6CHYA 4HWTA 3PEUA 5EN4A 3TLZA 1WV0A 1IBRA 2D3WA 5DOZA 5ERXA 3VBCA 4FFOA 1UBFA 3P8ZA 3GA5A 2O3RA 2V8OA 4NBLA 4NFSA 3C4JA 2C1ZA 2PCLA 1XYGA 4C22A 1B2RA 2YQ5A 2HHCA 2DBQA 2EKPA 1QH9A 3KTOA 1B15A 4FINA 3HLTA 1L4HA 3KPWA 2W00A 4Q4HA 3GJ8A 4HGNA 3TZQA 3W4JA 4E13A 2O5EA 4LW8A 5INTA 1BGWA 3ZGYA 2D1TA 4CL0A 4UFNA 1W4RA 3F7MA 3PCTA 2CNKA 1U8FO 1NBHA 5D00A 1OC2A 2J59A 4CKZA 2H0RA 2PMKA 2O7VA 2CVOA 4D0NA 4AVYA 2GDZA 3B8EA 2WMNB 3QW4B 4I55F 4B4DA 3G5AA 4PF1A 3PC8C 3JQ9C 3DM5A 5LBTA 1KMHB 2ZRJA 1NBME 1CUAA 1EK1A 5A03A 3UQYS 1JPNA 2A5FA 2AUTA 2JK1A 1N8SA 4HOYA 4KKXB 3L0SA 4IX9A 2GN4A 1G2OA 3R3VA 3X1MA 4C88A 16PKA 2CVFA 3HUTA 1EZ4A 5GONB 2P9BA 4EW6A 1GCAA 4RJKA 5BN5A 4F92B 2WG0A 4FI3C 2D4HA 2ZAMA 1PZGA 2VHCA 3VYRB 4ENWA 2IFTA 5K8LA 4TUYA 4WSOA 4KACA 3WY9A 2GYVA 1KHHA 1ORWA 4HL6A 1NW3A 2VLBA 1FX0A 1QQ7A 4J6FA 4CM4B 3HXQA 4XX1A 3BMXA 2I8AA 3H1EA 5HFNA 2P5UA 3BXGA 3NBYC 4FM9A 1VDZA 1MB4A 1X7ZA 1ZXXA 2C5SA 3ABQB 4XLLA 4YROA 5GOZA 3RTCA 5GP1A 5JC8A 3WGVA 2CWWA 1P5HA 3EHDA 3BF8A 3EGDA 3F8WA 3T06B 1NBMA 5KNDD 1NW7A 3UV3A 2QIPA 4DTIA 5LZ8A 4HYEA 2IYUA 4C4PA 1H6DA 2EFHB 1NV8A 3WLKX 4IKPA 1P5FA 2OGSA 4FFRA 2I55A 1M67A 5H3HA 1MA0A 1SU4A 2AMJA 2VKTA 2ZCUA 3OIUA 4UTZA 5K0GA 3FLEA 1XGKA 1RKXA 1F3LA 1QZUA 2EV9A 3NM5A 3PUZA 4UD6A 2WI8A 4ML3A 3HZHA 2VAMA 4QXQA 3RJ9A 4PHGA 3AJAA 1F2UA 3H86A 3ZGNA 1D1QA 1OFGA 1UFOA 3M1YA 1D5CA 4HEQA 1KTIA 4EATA 2YJ4A 2AYZA 3A4VA 1RP7A 2F4VB 2IYLD 1X13A 1NTRA 3EZ7A 2OBFA 1Y82A 3AZQA 3HL0A 1XEFA 1LDGA 2ZJZA 3BGOS 4RNDB 1PFVA 3MUOA 4RHYA 5E4FA 3WNZA 4BLWA 2XZLA 3MWDA 1AQIA 2QV7A 1LBIA 2HLNA 3HCCA 3THXA 2C4UA 4KO1S 4BTLA 1AA6A 4QZVA 4MCJA 1UKVY 4XUEA 3JAKB 1EFCA 4DUYB 2H1OA 1PT7A 2I2AA 1FXWA 4EO7A 2WNIA 3I9NA 2WWGA 1P7VA 1O5TA 1OYWA 1ZD8A 3PSHA 2CKDA 4UUOA 2DQ4A 1I1OA 4MX8A 4WOBA 1PX2A 2Y27A 4XXHA 4AXBA 5JJKA 3OMWA 1ADBA 3LXUX 5BWLA 3FPCA 5KJEA 3ZHQA 3NNNA 4ND2A 1CUEA 3WK4A 4JLDA 4HRYA 4L85A 1I14A 3HR7A 2R4TA 1VG8A 3G1TA 4L7VA 5EIWA 4LGVA 5FTNA 1SRRA 1NUHA 1AHPA 3IE0A 1U4SA 2FPUA 5E6UB 1WG8A 2IZZA 2FSVA 2X4DA 1UZLA 4NRDA 5AOAA 4BMXA 5IAGA 2FMTA 3GGDA 1ODTC 3KXDA 3HBLA 5T6BA 5CFNA 3GJ0A 5I8PA 1OLUA 3I2HA 3D8BA 3MB8A 4U0JA 4Y0AA 3X1XA 4QTXA 2BGKA 4BV9A 1GZ6A 2X8JA 1NM5C 2H0QA 2BBTA 4Y6OA 4BN4A 1LS1A 2XNKA 3IIKA 4FFBA 5IMBA 2IPLA 4MUBA 3S2YA 3NDIA 3Q2OA 3ZXYA 4BWYA 4E2ZA 1FOEB 1JBKA 2ATVA 1I7SB 4EH1A 4CM7A 5AVXA 3R3SA 1QF7A 2W5UA 1EP2B 4YCSA 4NXMB 4O0LA 4IJKA 1U3GA 2B2NA 1GNQA 1PE0A 1ZNXA 4MP3A 3WB0A 4Q18A 2WYHA 5AI0A 1N6PA 3HZZA 4N0EA 3PUKA 1TMKA 1KI7A 2VH5R 3CH7A 4PLFA 5DNDA 1F8XA 1GGMA 2CLLB 2AJDA 2E2WA 3CO5A 3WWDA 5IKMA 2IU0A 1JXAA 2OXEA 1N3LA 3X2EA 3A31A 1A9YA 4KLCA 2A9FA 4I9FA 3ZWKA 4QULA 2ZANA 3LY8A 1XCGB 3IMEA 1QP0A 4MHSA 2QAGA 2HBYA 1R0XA 4GKVA 4F4CA 3NRJA 5D51S 1YQ9A 1CJUC 3OZCA 3H0KA 4JHXA 5ICGA 2E85A 3GGOA 3HDJA 4JLOA 4Q6WA 2TRSB 3FMFA 4BBPA 1C9DB 1CRQA 3T9AA 1UMKA 1Z06A 2VT7A 5TC4A 2OYRA 1GEGA 2KI5A 2CZQA 4I1YA 1PGQA 3UNXA 4C2AA 1NP6A 2OZLB 3AU8A 4R51A 4MMXB 2VHTA 4V0RA 2I7XA 3N0WA 4AO6A 5IFLA 4TM8A 4G1MB 4JSYA 3IT2A 1UCFA 3KSMA 5JD6A 3DULA 4HWPA 4AP9A 521PA 5KDDA 1BYUA 3MNFA 3IQEA 3LL4A 5CLFA 2EL9A 1KWKA 3SQMA 4RVHA 1N7HA 4D4JA 4QSHA 1EFKA 4PX3A 4NESA 4OGGA 3ENNA 1M54A 1TTQB 2O2IA 3W78A 3WBKA 3DE2X 1S8NA 2C04A 2C5AA 2R79A 2WSBA 4WOKA 2R3SA 4HDAA 1N6LA 1RYMA 5J1TB 3KJGA 3WISA 5IX8A 1ZMBA 2AWOA 4WZBB 2SECE 3ROGA 3PHGA 3NAMA 1QCYA 1QB7A 2H1CA 2I3AA 3EIQA 4WBNA 3LCJA 1EEXB 5I9TA 4LS3A 5T6MA 3U9LA 3BXZA 2G76A 1ORHA 5DMHA 4WD3A 3P4YA 3MTJA 4P3PA 1O54A 1GTMA 1YNOA 2QSZA 3A2NA 3RRXA 4UAJA 1W0CA 1XTSA 1FS5A 3VR0A 5BW8A 4H7HA 5CITA 1QHHB 2VK8A 3KLNA 3ET5A 4D8XA 1WBDA 1S1CA 1FXWF 3ESQA 5CBPA 5C5CA 2Y67A 1KMHA 1RM5A 2PKWA 3PJDA 4BB5A 1JQDA 2GKGA 2PUWA 3QUAA 2D1RA 2CMKA 3B70A 2ZQZA 4TKLA 4ALKA 1OGIA 1Y1LA 2IYAA 4RJLA 4BO9A 2DUWA 1IXKA 2NW6A 5KNBH 1WCV1 4C0AC 2ZCJA 1IZ7A 5GONA 4YJHB 5EGNA 3ZBTA 1C50A 3F78A 3U7QB 1AQNA 1QF9A 2Q6KA 3LQRA 3VO8A 1ZLYA 2YV3A 4HLDA 2Q3HA 3KD2A 3O8LA 1D0IA 2EP5A 1S0UA 2XOXA 1VMAA 3QITA 4HFMA 1N0VC 2VK4A 3Q9NA 1PV4A 2B4QA 4QPJC 2CFTA 1BW9B 2JI8A 1Z7GA 1NVMB 2WMOB 2DQKA 1Y4ZA 5FP0A 5HOEA 1BQ4A 2HT6A 1BVUA 1DX9A 3ZWWA 1H8HA 2A5JA 2F48A 2VA8A 3D8SA 4QT0A 4E5VA 1Q14A 1TKCA 4BB0A 4RDCA 4QXOA 1SXIA 3RJTA 2RD2A 4DQ0A 1P44A 4NE7A 2Q5CA 4L0CA 3O92A 4B84A 4Z9BA 1K9SA 2FKAA 3FYSA 1Z22A 3L4EA 1DELA 3KB2A 3GZJA 4PG6A 4HXFB 3KT6A 5A4KA 2R47A 1XZPA 4Z9AA 1A9XB 1QYWA 3HJGA 1BE1A 1ADJA 1Y3BE 1X2BA 1O94A 2CNBA 4NV0A 4L75A 4M22A 4OHOA 1FYWA 4RZIA 2UYGA 3DF7A 1H2EA 4LHVA 1TAUA 2YJ6A 1WBBA 4RESA 1V4NA 4GEKA 4V0NA 3ASYA 4CKWB 4P33A 4DJDC 1BKYA 4LOHA 1ZN7A 2PH5A 2BP7A 3E03A 1ETUA 3DF9A 4KH1A 2X8WA 4RK6A 5HILA 4KMOA 3R0VA 4YPOA 3HRHA 3TOSA 1FDUA 3K2IA 3QPUA 2IYQA 1LC0A 4UHBA 3WQHA 3QOFA 1JPUA 1VBMA 3PE3A 4AJ9A 3JAKA 3SDZA 4PRYA 4LC9A 1O03A 1B41A 4G5YA 4KOEC 3FXAA 2FLWA 2V7QA 1QHFA 3KZ1E 4G9BA 4B4VA 3QVJA 4MK4A 4TYNA 2DBVO 2PYDA 3CLSC 2C2BA 3E5MA 4YCBA 5AJVB 5JVDA 3O1HB 3LX8A 4HSGA 4POAA 1P4GA 4ZCLA 4EO9A 3T1TA 1F6DA 1FFSA 1WPRA 1ST2A 2NV2B 5ALZA 3RVOA 3IP1A 4H6PA 4KK4A 2PSFA 3IV7A 2CBZA 3ENVA 3IE2A 4D1YA 5K8UA 4ND8B 1Z7EA 2DKNA 1EUYA 2W71A 5E6UA 1Z0DA 1JDTA 4LFCB 4BLUA 1UFRA 4D6YA 2B92A 1XLWA 2C2GA 1R8YA 3Q6MA 4Q1FA 4EY5A 1UT5A 1BWQA 3R0IA 4MLDA 2OMEA 3N5CA 2XZDA 2R2AA 2CLCX 4KU4A 4U2KA 3PPXA 4XWAA 3CY6A 5H4HA 4AZ0A 4UE6A 3BFKA 3CGWA 4J75A 4I0WB 3W5HA 2IUYA 4IL5A 5KYWB 1OTYA 4R16A 3WO1A 5BT8A 2NIPA 3TL6A 3EXHC 3UGQA 5JCPA 1QGDA 3O4FA 4NECA 2QRZA 1C2TA 3U7IA 1IN7A 2H5LA 2YRXA 2N9UA 4ATNA 1TCVA 1WEKA 2YWJA 1MW8X 4QLAA 3TCXB 4IDCA 3UQZA 4HDSB 4UM8B 4F2WA 3C5CA 3L40A 1OYYA 3KB1A 3NTOA 4B6OA 4OVKA 2ZFUA 1ISFA 3IP3A 1IJEA 1H2RS 3O93A 3O8CA 5ER9A 4NARA 4QJIA 3IVCA 2R6R1 3Q9SA 4W5HA 2M6SA 1P9LA 4XWGA 4A6PA 1Y3DE 3LPCA 4IMRA 3V5NA 4A16A 2FR8C 5BWOA 1PJCA 1MV8A 1G20B 1P1CA 1P75A 1SCIA 3BE4A 3G9XA 3I9FA 3SI7A 5IVPA 3HKBB 5BRAA 4BMZA 2PKCA 3D2AA 1WSAA 1K0FA 4TWJA 4YJDA 2P2ZA 3RS5A 3CSUA 4K3UA 2OEPA 1K27A 2C58A 2NU9B 2IQIA 2EBWA 3NHPA 3OOWA 1O9BA 3BFPA 2H8GA 3OX2A 3P0IA 4K7JA 4ACAA 4ZMRA 5KWVA 3ESRA 1T5TA 1X19A 3FWNA 3HE3A 5TPWA 5EXDA 3M4YA 1R6XA 4Y2YA 1JI3A 2EVWX 3ONDA 3T7EA 1H23A 5LPNA 3JQAD 3GPLA 4D4GA 3B48A 4WZBE 2LBPA 1FNNA 1KP2A 1W88B 4BVKA 2X7XA 3ZOKA 3LI2A 3NBFA 1M72A 3AWIA 4FOOA 4C06A 2OZLA 5JECA 4JP8A 4WZZA 4ZT3A 1Y1RA 1RSZA 2YXEA 1P19A 4WLEA 3T34A 1LBSA 4TM7A 2RHLA 2RHBA 2Q5QA 4EJSA 1Z2NX 2IV7A 4D9JA 1J4AA 4F9EA 3OHPA 5JG7A 5H9WA 2AX4A 4DNXA 1WMBA 2GT1A 4I5EA 3QUTA 5AVJA 4NKRA 2F1KA 3FOBA 3UT5B 3BIXA 3ZDEA 1J0DA 4WT7A 2NU7B 5DHQA 2Y76A 5LM3A 2J3DA 4IUYA 1QP4A 3GHYA 4O1IA 3L05A 4WZBA 2JKZA 3AHFA 1KRHA 1C8KA 2OO7A 3D8HA 1NYLA 3SE7A 3STYA 4D46A 1KJ8A 1LF5A 1Y6JA 5KWJA 1ZWKA 4BNIA 4GXQA 2B3DA 1B3RA 3Q3EA 3GWGA 4NS1A 3WLPA 5JAUA 1WB9A 3SZ3A 4JJ8A 2MT9A 4GOXA 4A73A 1AGXA 2EZ9A 4AF8A 4V0QA 1QHHA 4TX1A 4R1TA 1U0TA 1ESCA 3UC5A 4ZOLF 4B7AA 5EHXA 2AN4A 4DL9A 4PGAA 2J5QA 2C4TA 1JALA 3EMBA 3IBCA 3LGSA 5JVDF 3ZUPA 2GEDA 1VL0A 1S5PA 3AIMA 4JVMA 4HTFB 4FS3A 4NBKA 2XXJA 3O8QB 3VR5H 4W5JA 4E15A 1PT6A 4B80A 4CV2A 3N2GA 1R9NA 4O1HA 1B8OA 4JC0A 4R3WA 3A37A 4RVSA 3U7QA 3WZ2A 5IF9A 3DVAB 3SS7X 4HN2A 4B1FA 2V6GA 1BW9A 1O7JA 3Q4GA 2PZLA 3LRXA 5M04A 3TAUA 3IERA 2NNLD 4D44A 3W7BA 1E59A 4NZ9A 2G67A 4Q21A 1QHXA 4OXKA 3FWHA 1JU9A 4UNQA 1K1EA 5FUYA 5DGTA 2QXYA 1JFLA 2Y1WA 3CUKA 2FF7A 1E1RA 1RHKA 3C16C 3EUEA 4LJLA 4TYPA 4B5LA 3U44A 3GMDA 3OUZA 1NQOA 4YUXA 3UATA 3GP5A 1L5LA 2ZJ3A 5CEFA 1A9XA 1M2HA 1GUFA 3JU3A 1SIBE 3QX7A 4K81B 4H7JA 1U5CA 3GX1A 1YUNA 4ZP1A 5EJIA 2EX4A 1JLHA 2GYWA 3HV0A 1CVLA 2P67A 2VYQA 3I45A 4RGQA 3LOPA 2G8LA 4CKWA 3EISA 3SSNA 5KWIA 5AIAA 4FBLA 2WICA 1SN7A 2H0AA 2YW9A 4YCMA 3RIYA 1Y63A 3DE4X 5E4TA 5DSZA 4Z4QA 5BXYA 1AZSC 1UF9A 3BFJA 2Y92A 1NQTA 3BMOA 3ZQ4A 2VT6A 4OK6A 4RJIA 2PZAA 5BY2A 3MVEA 3PXUA 1PTKA 4R54A 4TSFA 5CDUA 2HZ7A 2ECKA 4MB0A 6REQB 5HZMA 1Y5MA 3HBNA 1W4CA 2YHUA 1ZPDA 3P52A 4LKRA 3FOFC 1K5HA 4J07A 2CYCA 3FBTA 1IXSB 2ZRFA 4QFDA 1JI0A 3INRA 2I5PO 4MGZR 2R8YA 1GDDA 1WHTB 3DEHA 4TWZA 4W8GA 5SV2A 4QVIA 1FMCA 3HSSA 4CLRB 3TGWA 5LKRA 3SN6A 1THGA 2RGWA 2VYNA 5EKSA 1IFXA 1WZIA 3X0DA 4CQNA 2R7KA 3RHSA 1T3SA 4Q4DA 2REXB 3PIIA 1BMFA 3SNHA 3D6HA 2JEZA 4OHWA 5F52A 5AVWA 2KLHA 4OFZA 1T6YA 3R24A 1NOIA 2Q4BA 3BGIA 3D4IA 4Z99A 3ZDQA 4DWJA 4XGKA 5C18A 1OXMA 2A86A 3QG1A 1T8UA 2QVYX 4O2AB 4Y6QA 1ZD5A 2Q5FA 4GWKA 2FF5A 3E0QA 2CN1A 1G20E 4J16C 1THTA 3D02A 4OFXA 4O0MA 5CHEA 5CRIA 5D6OA 1QZ3A 4DSTA 4AZTA 2R1TB 3DXFA 4DCSA 3QPBA 4K0RA 1JHRA 3GRZA 5KNBA 3QKIA 1WMSA 4EK9A 5KWEA 4IIJB 1AY0A 1Q0QA 1Z35A 3FM9A 4KIJA 3OMXA 3CSSA 2F3SA 3KR9A 4JX8A 1J39A 2J6HA 2A6PA 3HSKA 4KITB 1BMTA 2WF9A 4D5GA 3ZPXA 4D97A 3D8RA 1FYXA 1ESMA 2W0SA 4FMCF 1UDWA 1VE6A 4EKYA 5JTUA 2PLNA 4PZEA 5HF9A 5T67A 5MGBA 3QKWA 3HVHA 5EP3A 1PKEA 2IIQA 3IOYA 1ZINA 4JB0A 3RDPA 1J0BA 1SOMA 3MUNA 3IUMA 1G20A 1X7YB 2QA5A 3C7AA 4RMNA 1PWEA 3HKBA 5K0CA 1M6YA 1IN4A 4FZJA 2BMVA 5G1OA 3AZPA 3W79A 4Z54A 3FR7A 4I5GA 3ZY6A 2NU9A 2XHZA 4I50F 3AHEA 2PQMA 3KZCA 2AFIB 2SHKA 2ZYWX 3ASUA 1T9ZA 5TQJA 2X5XA 1H3NA 1ZD2P 2QG6A 3C8ZA 5DH9A 4ZVUA 5L3VA 2BKXA 3AUYA 5C8VA 4MUHA 1MEJA 4OAOA 1W88A 3RIEA 3V7YA 4DSOA 3Q11A 3GGGA 4B74A 1KFCB 2D5AA 2VTVA 3MK31 4LGYA 2FSUA 2H17A 4JXJA 3ADDA 4CV1A 5AXBA 1LNSA 5AJWA 3IOMA 4Y2TA 4B6JA 2GVZC 1BWRA 4O4JB 1BJRE 4MRMB 4UUPA 5FL7A 5ILGA 4CMEC 1MOSA 5FOUA 4PO3X 3RK1A 3UT5A 2Y2UA 1FRQA 2PFKA 4TRNA 4YRNA 3CU5A 1H5QA 2BSXA 4RD2A 3TBFA 3U61B 4D0SA 2CLHB 1XIVA 2PJZA 2X23A 3E53A 4A27A 4XWOA 2HC9A 2YYSA 4GI7A 3O4VA 1UBSB 4JL8A 1M1XB 4KGZA 1YFZA 4ZVNA 4BX3A 5ICFA 3AVTA 1GARA 1ZM2A 3OP1A 4MV5A 4DNPA 2VJKA 2GEBA 1Y7LA 2VF2A 3FYUC 3G3EA 2B35A 1FRVA 2GSDA 1Z0JA 2R84A 4N18A 2IZ1A 2YICA 2B3TA 1P7WA 1UKAA 5ALFA 3TRDA 3PHCA 1KSGA 3FI0A 4UDXX 3TRHA 5DK6A 2DP4E 1NFFA 1V96A 2HSZA 3GGSA 1YFKA 3TPZA 4TKVB 1YZQA 3THOA 2JG3A 2JHAA 2RGXA 4NEHB 4OV6B 4ZQEA 2HKIA 5DEOA 4GG1A 2PZMA 2B0JA 1P91A 2GNAA 1OU0A 2BVNA 3CLVA 3OKCA 4MCAA 2WSIA 2BDEA 4BE9A 2EYUA 4DDMA 3NTQA 4CBVA 5BO5A 1UM9B 2EKBA 3BCHA 2CV0A 3L9WA 2VXCA 5CIYA 3REQB 2ZOSA 2G9QA 3B51X 2C7BA 2XSZA 3O8QA 4F8EA 3OQ6A 1Q0TA 3OQ1A 1W85B 1CZNA 3GD7A 3HB7A 4M0FA 4PYMA 4A2PA 2RB5A 1V2HE 2PH3A 2XT9A 4HDMB 4C4ZA 5LLTA 1T26A 1HFKA 3PIDA 4E03A 4DMHA 1ZH4A 1DINA 1H4VB 1Z0AA 2K7ZA 4OK5A 4WTOA 3DVAA 5REQB 1J9ZA 4UQPA 2FZWA 1Q17A 4R3NA 1Z0SA 1AA9A 3OEHA 4G6ZA 5SZJA 4KVZA 1BFUA 3ANXA 4G63A 5MFPA 3AKZA 2VATA 3CISA 2EZ4A 3CRVA 3KKMA 4QHTA 1QO9A 4NONA 2V8BA 4EMBA 3OCYA 2FNAA 4BZXA 3FSEA 2AQKA 4PHFA 3W06A 4F71A 3BTSA 1GTJ1 2VZLA 3K2BA 3UMMA 3MRXA 5I7OA 1NMEA 3RTDA 2GCNA 1GPWB 3PZRA 3MLEA 4X7MA 2NU8B 4C3OB 3CG4A 3IEIA 3HV2A 3DJYA 1RXSA 3M5DA 5JZBA 4ZRMA 1T4CB 1KGDA 1B74A 4WNYA 1SXPA 1TVMA 4MQUA 1ABEA 4X6LA 2GO1A 5L7WA 2XCQA 3SX4A 3UHJA 3ZD6A 3IBYA 1CETA 1TQ4A 1JQAA 3PCXA 2ZRPA 3CUYA 3W5JA 1QIKA 4P81A 3IPAA 3UO8B 3L0YA 1Q44A 3S1AB 5KQGA 1XTQA 2VWQA 3OM8A 4HNTA 1L5ZA 4ENUA 4I36A 1C3EA 1NR7A 2ZBFA 4C3ZA 1YA6A 2ZVJA 1A95A 2P9TA 3KWLA 3L8ZA 3PQ4A 4HQKA 2AJTA 4PM4A 4RSRA 3LECA 4U5XA 5AJUA 4RNCA 4E08A 1SM4A 2ZJ4A 3K96A 2BFPA 3HCAA 1X7GA 1SU7A 2NO7A 4KSBA 5LQRA 4B3DA 3PGVA 1ZK3A 1W6RA 2VK2A 3H9CA 1ZGGA 4L51A 2I6XA 4RK1A 1WZEA 2ERYA 6REQA 2QG9A 1A2QA 1R4NB 4XH9B 3WGJA 1HDIA 2B9EA 2HQOA 1M66A 3ZJVA 1OLOA 2Q3LA 2A9VA 2J9RA 1UBKS 1ZSNA 1Z63A 1ESEA 2PGLA 2H48A 4J76A 3F3KA 3TLEA 4EMTA 1ZGZA 3QE4A 5L4NA 4NP6A 5LNK1 4EQZA 3FHJA 1BDMA 1BZYA 1WHTA 4E1VA 4CLRA 1H2XA 5T57A 2RKBA 1OGJA 1P1IA 3ZK7A 2QTFA 4ZD6A 1KHTA 2H5IA 1DKPA 4RFSB 4O2LA 1MAHA 2J31A 2O1EA 3NKVA 2QQFA 4FE7A 1UM8A 1D1SA 4MLPA 1EWVA 1IDOA 2PNFA 3SVLA 1SVWA 4ROSA 4O2AA 5A71A 4WXRA 4I6JA 3MERA 3ZY2A 1N8TA 2OA0A 3WOHA 3Q8XB 5G02A 2Y6UA 3VR5A 2R1TA 4G5SA 1E3IA 2R4UA 2VXBA 3ANYB 2FJUA 4IIJA 5E2IA 1WXXA 2D62A 3G2LA 2ZROA 2Q4TA 4A5SA 2R6ZA 1DO0A 4AYTA 4TWAA 1L6IA 1B1AA 3ZTWA 1BHQ1 3A04A 4M7OA 4MO2A 3L8FA 4LFAB 1ANKA 3CPJB 3A8TA 5ARCA 2CWDA 3QHQA 1OWMA 5DMXA 2IV2X 3BXEA 3G59A 1UBCA 3OJOA 1YB2A 2QTVB 4I1IA 5TIIA 1A72A 5BSVA 2E7ZA 3DEZA 1YMQA 1T43A 3CHYA 1PEYA 4I3FA 4J43A 4R1OA 4DLSA 3K09C 3GAMA 3GRCA 4JUDX 2BKUA 1CUFA 1N2CB 2W6PA 1QWOA 1OWNA 4IIGA 3KQYA 1SCJA 1KOLA 3HNOA 1IM2A 2RAVA 5BOVA 5LWHA 2P35A 1PL8A 3R0JA 1ZC4A 5H7XA 2NZUG 3GT4A 4U9IS 4KI0A 2BEWB 2I7VA 2ARKA 4FGZA 1IVSA 3KOWA 4RW0A 3EVTA 3EAGA 3R8CA 4UATA 3L4JA 3QLJA 1KSFX 3H7IA 2GVDC 4RVDA 1K7FB 1QYDA 2B5OA 2FWJA 4TLAA 3GJ5A 2C4NA 1CC1S 1H6AA 1DC3A 1MO5A 3DONA 4O4JA 2XDWA 2ZKIA 1OKKA 4PQGA 5DTRA 1W94A 2ZRGA 3ETCA 4QO7A 4P7GA 4M38A 5DM70 1U2GA 3H4TA 3JQ9A 5JRDS 2NG1A 3VYUB 4DC1A 1G8AA 2P9FA 2ZREA 1F12A 2FW7A 3QTTA 4BE7B 1JIIA 2A14A 4EL0A 5BN1A 4XQGA 1F8UA 2WFAA 4DREA 4AURA 4CV3A 3MRSA 4R8SA 5KWSA 1XWIA 5IZ4A 2XVAA 2AEMA 4MICA 5T4FA 5KTNA 3BK2A 1UC5B 3IMCA 2O2HA 5K51A 3L04A 1PVOA 3FMVA 1M8FA 4QPZA 1SKMA 1Z4MA 2ZJFA 1EVJA 3RF6A 1VMEA 3THSA 2I54A 2RG1A 3CRRA 3KDSE 3QEJA 4L5IA 4C6TA 1GSOA 3QPAA 2P6MA 2B94A 2X0JA 2HWUA 2B78A 2G09A 3ACDA 3U62A 3WGGA 2OG2A 2IV3A 4TKVA 3AY0A 3BE6A 3NEAA 2KBEA 3BN3A 3AXSA 4PU0A 2GQ0A 2BGRA 1ZO8A 5ADWA 3M8KA 3QPDA 4XWYA 4J94A 2AKYA 1WAMA 3NDBB 4DA8A 1GXSB 1OYVA 2IYNA 2O2EA 2XPCA 4LGMA 4LX0A 4NDZA 1XOIA 1G5PA 3P7MA 1YR6A 4Z0TA 1UM9A 4B2PA 1CLEA 3VH4A 5IJXA 4B8ZA 5E3HA 3REQA 4R7ZA 4C7OB 2JLRA 3D54D 3TQIA 1XQWA 2JGFA 3RS9A 2C4WA 5F1PA 4CZ2A 1FJXA 1EQAA 2P6NA 5FR2A 1IEXA 1W85A 4G8DA 3WRWA 1XCLA 1FQOA 1PJRA 1IRIA 1FL9A 5DKFA 2EG5A 1P0QA 4HDMA 1W581 3CJRA 2AOTB 1GCIA 3LZ6A 4GI5A 3DUFA 4ZYWA 4C01A 4OLAA 2V9PA 4RV5A 5REQA 2CC2A 3WICA 1FW8A 1PG2A 5H81A 1MUUA 3P26A 3GQBB 3M3PA 4FCVA 1T9HA 3LFUA 4GM1A 1RYBA 4TTSA 5IJZA 2WTMA 3ZWOA 3NWOA 5FOTA 2AE1A 1WLSA 1PJ8A 2MR6A 1SCQA 2GILA 1CFJA 2FDRA 3PUVA 1PZFA 2YIDA 3I01A 5E9WA 2Z5LA 2WBLC 2IZ0A 4IIJF 3M89A 5K0FA 1K08A 3AI7A 1YZYA 3H1AA 4ZVVA 2NU8A 2B37A 5FA8A 3U26A 3UBMA 1D5WA 3CW8X 5EJMA 4E33A 1T4CA 5HIJA 3DAOA 3AFIA 2IF2A 3HO1A 4ZXFA 1J0XO 2IEZA 3DZHA 3UT6A 4WRRA 1Y42X 3WHKA 5TVKA 4FEAA 1W35A 1DRKA 1FNBA 2GS9A 3S1AA 4DEVA 4QTYA 3DE5X 4NZOA 2CVPA 4AIRA 2ZBQA 4MTLA 1LBEA 4FYKA 4ER5A 1CIVA 5I45A 5NLLA 3H3FA 1RDFA 4XVRA 1T8TA 4Q7LA 2EIXA 3RV4A 4JH0A 1JR6A 2M1XA 2A58A 1ULZA 2ZT6A 2HF8A 1BXZA 2ZU0C 5E7JA 3PZBA 1RWKA 1PIWA 1II8B 2WPNA 6GPBA 2GBCA 2OUKA 1EFUA 2RKOA 1R4NA 3D3NA 4I9UA 5SZHB 2ENWA 3V42A 5BVGB 4BNYA 4YACA 4N65A 3EXHB 2OY0A 1KQFA 3ZWDA 4IM7A 4LZOA 4EW2A 1MOPA 2HH9A 3IUSA 3U31A 1B73A 1T9GR 4PG8A 1ODFA 1QXSA 4WBSA 3QVWA 5L8VA 3Q8MA 4R1NA 3ON5A 5SY6A 5I4IA 1KERA 2P4UA 3RYHB 5EXXA 4E7OA 3VKFA 1ZZEA 2QGFA 3F5SA 4RM2A 4BXOB 5IUJC 2M2IA 1EFTA 3OWOA 3GZTB 2JS7A 4L6CA 4JGGA 1DL5A 2CV2A 1VHJA 3RYIB 3CBQA 1AUQA 1XTJA 1HYHA 1NVEA 4KXXA 5DIZA 2Q62A 5CEEA 5HVNA 2HMWA 1IY2A 2A9RA 2BEKA 4YXWA 5M7EA 4I1UA 3OG9A 4MRSA 2ZJ7A 3AJRA 3QELB 2J09A 5HPYB 2I62A 5FXMA 4K6GA 1WF6A 4DIOA 2CNLA 1D03A 1NC1A 3AI3A 1VCMA 4AY4A 3LYUA 2POCA 1N2CE 1A98A 3HDGA 1PEAA 2QE6A 2VQSA 5DNVA 1FBNA 5JBQA 5JWHA 4ABTA 1QTRA 1XN1A 1VG0B 2FPIB 1OD6A 2JCSA 2PUVA 2JAPA 4D9FA 4MUKA 1QZTA 2XCUA 2ZB4A 4TMFA 1P81A 2AC4A 4C7XA 4CMKA 5BR8B 2UYCA 5T5QA 2JJMA 2QKYA 2IEDA 1XRPA 4D41A 2C7OA 1BCRB 2IE8A 4JBHA 3SBDA 3F4KA 3KEGA 4K8OA 5TX7A 4QXPA 1Z0FA 2F17A 1H8HD 2KWIA 2QTVA 2ZTVA 3DWIA 3PD0A 4BVBA 1QHGA 3CEHA 4X1OA 3KQKA 3AHHA 4EUHA 2ZYDA 3A9VA 4J0IA 3PRHA 5DHSA 5A6VA 2FCAA 2G0NA 2HBQA 3VDQA 2HJSA 2KW5A 3FZGA 1GDHA 1M2JA 1U98A 1UXJA 4HX9A 1O0CA 1ULTA 1N2CA 4DDUA 3HDHA 3DE6X 1W75A 4GX1A 1LSUA 2YY6A 1YB7A 2J4DA 2G7ZA 5DW3A 4DQUA 1E1CB 3WKEA 1R1DA 1PD0A 3BL6A 3P94A 1NXWA 1O94D 1ECPA 5CH5A 3ROXA 2L69A 2OCKA 5DI3B 4EI7A 1VB5A 1UPUA 1FUIA 2Q7XA 4H1HA 4KGXA 2H1FA 2QR2A 1T0PA 3GG9A 3IVMA 3OT1B 4J6EA 2PG3A 4LE2A 2FFAA 2X6QA 1YDEA 2B36A 2GLUA 3OI7A 4O4HB 5AOCA 3DVLA 3AV3A 3M6XA 1CQPA 4XQ0A 4W5RA 4L07A 1TT5B 3PUJA 1X70A 1OPRA 1OPXA 5I47A 1RLJA 4V0KA 4YWHA 4EEKA 2EJWA 2KYRA 2ZRAA 5AD1A 4K6HA 5DHFA 5DF1A 1JKMA 4MV7A 1MHPA 3UMSA 5GZ6A 2H8KA 4D82A 1M75A 3V4FA 5FH9A 5BORA 1AN9A 2AFVA 3LT4A 3W9SA 2EYQA 1O0SA 3R6LA 2QTHA 2XADA 3E8SA 1QZXA 2Q9UA 4IQ4A 5M5BA 4TS1A 3L8CA 3HABA 1EFPA 1F4LA 1FYFA 2P0YA 1WL8A 1QLWA 4HYTA 4ZAZA 1ML3A 1AKMA 1RJFA 1XZEA 4CL3A 1MJHA 4M1WA 3UXHA 1NR1A 1EX7A 1Q1GA 2B8EA 3TCNA 3EW9A 3HFGA 3FVWA 3SZGA 1VJGA 4PYLA 2F3PA 2VSOA 5KI6A 5BUQA 4QC2A 1I94B 1XALA 3I12A 3UJDA 1IJFA 4R7TA 1QQAA 4GICA 4JBIA 1TIKA 1QJCA 3Q88A 1X9GA 1E3WA 1MPXA 2H92A 2AVDA 3EIEA 4P6VF 1Z74A 5ALOA 1N36B 8ABPA 2NZWA 1L5HB 1E6LA 3PGJA 4LJYA 4Q7JB 4HDRA 1I10A 3GQVA 4EOGA 1GXSA 2ZTHA 1RJEA 4V0OA 4JJFA 3UXEA 4OM7A 2VJMB 1C1XB 1F1JA 2QOEA 2KSQA 4TLBA 4Q9KA 3QEAZ 4C7OA 5JQGB 4JKIA 3RGGA 1NVXQ 3RSGA 1E1DA 4MV9A 2RAFA 4J7UA 3OC0A 4TXJA 3CXUA 4BVAA 4KNVA 4J4HA 1JR3D 1IJKA 2DTXA 1SG0A 3L0DA 3PRJA 2OLEA 3KVVA 4RVGA 1IJBA 2OGWA 3DNFA 3M3DA 1M10A 3MAAC 2AOTA 1W5FA 1ZGAA 3G2HA 4NAHA 5AICA 1T36B 3GGCA 2RAPA 4BWGA 3CG0A 2WILA 4WKBA 4IDGA 4F3RA 4ZAGA 2IYFA 3GJ6A 3H3JA 1ZGCA 1K3FA 3GQBA 3B5IA 3S2SA 2ET6A 2KB0A 1R6UA 2XMDA 1OREA 4TMWA 5DTJA 3RVPA 4CM1A 4DYDA 1XJ0A 2O52A 3R75A 3U3MA 2X3UA 2O6HA 3HK2A 1VLJA 3AIKA 4JP5A 2GARA 2BTEA 4KAXA 4A23A 1G66A 1ENYA 2EDCA 2W0MA 2W6JD 4NX2A 3RFTA 5I7HA 4JKOA 5D3QA 3L6UA 5HR5A 3O8RA 1U2ZA 2Z2ZA 4QXMA 5IBPA 1XZQA 2XYVA 3FGPA 3N3BC 4EVRA 1YOVA 2FE1A 5BYBA 1YU6A 4O8CA 2WJZB 3WGTA 4HFRA 1EWKA 3R76A 3CFYA 3EQ2A 3HACA 1USIA 1YJ8A 1PO7A 4G67A 3ZLJA 3MPOA 4OI0A 1MQ9A 2B4KA 3PEWA 3LUFA 3WK5A 1IOLA 1QBKC 4F4FA 5IPFA 5HBGA 3EARA 3S1SA 4E7PA 1DO2A 2Z5GA 3IELA 2QL9A 1HQDA 4MAFA 5JSZB 2OCPA 1ZK2A 4GI2A 5HUJA 5TMDA 1XRLA 1HMYA 3FNIA 4ZOCA 4CQMB 1SVLA 3K1YA 4FB5A 1BVYF 3UW1A 1SCKA 3OTGA 3URMA 1PJSA 1K8QA 2JEYA 4YR7A 4N5HX 3DL4A 2UU9B 4P3KA 1II8A 3T7RA 4FNOA 1RTKA 2FPMA 2X5NA 1VDMA 1FQKA 1WXGA 5IW8A 5BVGA 2W6CX 1HLFA 1NN5A 5J58A 3CVJA 2XNDA 3KFXA 2CLFB 5TR9A 1SQGA 3THRA 4ZRDA 5AESA 3COJA 4X20A 4XJTA 3A9SA 1ISPA 3KOYA 1U7UA 3QJ5A 1KE2A 3RREA 2WUWE 5HUQA 2W43A 2X3YA 2F43A 2N42A 2FEMA 4H27A 1M2OB 2YJGA 4II7A 2GKSA 4LEIA 1J42A 1JMVA 4IH4A 3JQEA 3P19A 3QVUA 4JLMA 1W36C 1BDIA 4CF6A 1THMA 2YJNA 4AP6A 3F71A 3V33A 1YAHA 4YCNA 3GFQA 2GA9A 5A9RA 1DAHA 1XU4A 2FWIA 1ESNA 1FZTA 1EP3B 4OA5A 5JCOA 1YR1A 4UMEA 3RYIA 2C9OA 1OF1A 2FR8A 4ZK6A 1URPA 2FGJA 2I6SA 3ICPA 3HJFA 1NYRA 5CNIA 1G8MA 2JAWA 2J1LA 3M5CA 3QELA 3THWB 1QG2A 2HF9A 2D7DA 4LBVA 2XUPA 4AY6A 4YAEA 1XQVA 3PQ8A 4BO8A 3NT5A 4DY4A 1YRBA 4XR4A 3GUCA 4F6RB 2YZMA 2O50A 1U3FA 4QT4A 1JVSA 2FPIA 3RVLA 3FGNA 1JMYA 2CL6X 1K7XB 4IDDA 1YO6A 4QAQA 3MTAA 4OJTA 1MJFA 2R6CA 4IRUB 4UHFA 4ZVRA 3RI3A 1UEIA 4QOHA 5AJZA 3V1UA 1NBEA 1VIDA 1MG5A 2PD3A 2I1VB 5JD3A 3SHWA 1BCRA 1FFWA 1SKQA 1T25A 3A0RB 3D6NB 4IJ6A 1UDXA 3MOGA 1NX6A 1BWPA 1TEVA 2Y1CA 2PDAA 2ZXFA 3EXFB 3HUEA 3PNVA 4HHEA 2H6EA 4JITA 4G0WA 2I4IA 2I29A 3QVGA 3L77A 6ADHA 4F56A 3CX3A 4R83A 4AS1A 1QMPA 2OGUA 4GECA 4OHZA 3S2FA 5K8IA 3BB1A 3IOEA 1UZUA 2PS3A 4QECA 3R7LA 1ONPA 2WE7A 2YC2C 3STXA 3I1FA 3JZIA 4B5KA 4R71A 1W1IA 3F4LA 2CXQA 3NG1A 3CF2A 4G81A 3L0CA 1E1CA 4TOIA 4UDYX 5C51B 1LSSA 3GFFA 4MQ4A 3MGGA 2PU5A 1VECA 2UZ1B 4OREX 3W5IA 3AONB 4HQNA 4UJ3A 1ORIA 5DI3A 5CXUA 1B16A 1J8QA 3KYDB 3LO8A 4O4HA 3KCQA 3OT1A 3OSUA 3N7TA 2WV9A 3FYUB 3T3IA 1I2ZA 3B7WA 4II3A 4TMXA 1EK2A 5H68A 1K2VN 3OY2A 1KETA 2EJUA 1XCJA 3RE1A 1SKBA 1QIDA 2NO0A 3KQHA 2H54A 5F21A 3V2GA 1TT5A 3WMXA 4DCUA 3O9ZA 1GU7A 2V1UA 2M6LA 3ZV7A 2NU6A 3R0QA 3ESBA 4M1ZA 5CDHA 1YDGA 2A5LA 1X7XB 4OAQA 4TXNA 1Q7BA 4ZC1A 3I8XA 4IDPA 4OGLA 4V2IA 4YH1A 3IVGA 1MXHA 4JXXA 4S12A 3B3GA 1E62A 3TUZC 2YOHA 5AIBA 4R9SA 4DIEA 1SQFA 4R69A 4MEJA 3FLAA 1XCBA 2BFFB 1RRMA 2DX7A 3V48A 2YV2A 4ILKA 5C8DA 5JW6A 4NQRA 2FUEA 3L7AA 3K4QA 5FLXA 3OD1A 2ODEA 2F3UA 4C4RA 4OHVA 4H3SA 1Q7TA 2JHFA 4Q9IA 2FSPA 2ISCA 3W0LB 5DCUA 5A5VA 3N2NA 3WQBA 1IHDA 2VYND 1K8XB 1OX4B 1ZC3A 4W99A 1Z0KA 1AURA 4B48A 3F4BA 3G0HA 4AL4A 3FIUA 3HI6A 4CUJA 3HY4A 4OBXA 1SY7A 1KDRA 2NT4A 1L5HA 5K7SA 1DEXA 3HTXA 2ZYTX 1HG0A 2UVDA 1ISMA 3E1SA 3OMLA 3FBWA 1B76A 1DT3A 2OGZA 3IMFA 5D3KA 4BO5A 2AQ8A 3HP4A 4Q9NA 3SIXA 1OXSC 1RCTE 1V11A 3KTAA 1C1XA 5DK4A 3PT9A 2ZUEA 2WSLA 3UAZA 1WOYA 5CFPA 1PR1A 1QAOA 5AMXA 4XGRA 4FHZA 4BJ3A 5JQGA 5KNBD 1V4VA 1XD9A 1E77A 2BFOA 1WO8A 3C48A 4V1CI 1RI2A 4XTRA 3R4VA 1D4OA 2XRYA 1DFIA 5FL3A 3NYIA 4WN9B 1T36A 3OUTA 2C5LA 4LQ4A 4NR0A 3BEOA 4AYWA 1BHSA 1VJCA 4Q1EA 5DXAA 1L7BA 1U2DA 3DL0A 4O33A 3L3BA 2PTHA 3V8EA 4DHEA 3KM0A 1GHTA 5JO0A 1T8RA 4F7DA 3TNLA 5CB4A 4U9UA 2LZ0A 4IIXA 1CWUA 2X19A 4YV0A 2QZSA 1SPBS 3AFOA 3HMKA 1L2TA 1IWPB 1S1MA 3OZEA 1KXJA 3AR4A 5E7MA 1JDPA 5HIIA 4DBZA 1DC7A 4DNQA 2IHJA 5ALWA 1R9JA 2AK3A 4E5KA 3NGMA 1BVRA 3ZVRA 4TL7A 2E89A 1IOVA 3I9V1 1JE1A 3TRJA 3LC2O 3G9TA 4NOKA 1FB5A 2CXXA 2HADA 3IKLA 1WB6A 3QE0A 1GKUB 3GEGA 1ZH0A 3ZE1B 4W6QA 1MXFA 2MDTA 4X7RA 1ZRHA 3D7NA 1QU2A 3H75A 2XIQA 3QG5A 4IO1A 1Q0LA 1VKJA 2XT0A 2IYSA 3JYHA 3TK1A 1NR5A 1H42A 1B1CA 5ALEA 1GUZA 2P3SA 5CCEA 5JMTA 2OENG 3BKXA 3H17A 1PQUA 3AF4A 3CRZA 4YRRA 4UNSA 1RXIA 4WNCA 3L7KA 3ZV6A 3P9KA 1HE4A 5FL7D 5JPCA 5E1MA 4U8GA 4AKGA 2J5BA 3COZA 4BO3A 2Z8XA 3BK1A 3K8OE 3UAWA 1JL3A 1NJSA 4J16A 4Q7EA 3R7BA 3KR2A 3JTEA 3UYLA 5JATA 5JADA 1AB6A 2WW8A 1FPQA 2I91A 3U3RA 3I42A 3H1GA 5E6SB 4O4HF 4MQFB 4B0PA 3SNKA 4W5QA 3TSOA 4MJXA 3NS7A 1JECA 2A78A 4REOA 5E4JA 4AN4A 1XTZA 1M2OA 1Z0ZA 5K3CA 4MAAA 3UJ6A 4Z9FA 2GFHA 4E5MA 2VF4X 4JP1A 4CF7A 4JI7B 2Y2VA 2FFBA 4W9NC 5TT0A 2ZVDA 3VR6D 4IIFA 4FDAA 3VPBA 3R0ZA 3PVSA 3PQ5A 4PSAA 3AJEA 1TD9A 1LXCA 5D7NA 2P4HX 2MSKA 2D2IA 4QLOA 4I9HA 3VC2A 4Q3OA 5KKCA 1J5EB 4MW2A 3ABZA 2W6OA 4UFOA 4QXAA 3THWA 1L4GA 1RKVA 1UFKA 1IN6A 3AUAA 3KG2A 4PVCA 3GUZA 1U7OA 3TOZA 1QYIA 2XSZD 4L3VA 4MW6A 4YYEA 3WIVA 5CXQA 2QLJA 3ZHYA 4JJ7A 4FJ0A 1QQ5A 1VIAA 3CLRC 3D6FA 3GCDA 2COKA 4EFMA 4F6RA 2PSHA 2UV8A 3UT0A 2GN2A 3MHPA 2IEAA 1XKLA 1N3IA 1RM4A 1V5EA 3E8XA 1JSLA 2YW2A 4Z86A 3SKVA 1IL0A 2C8KA 4QOGA 4N03A 5E4YA 1QVAA 4J0EA 3I8SA 5ICEA 5EXPA 2C7PA 1D4FA 3BRWD 2Q28A 4YTEA 3HJNA 3WJ7A 5KYYB 2JIDA 4L5YA 1CB0A 1Q19A 4BLRA 3I52A 4BB6A 5C4MA 4J1QA 3WKAA 2DM6A 3T7IA 1HQKA 4B7ZA 1DKQA 4EMUA 2QQ5A 1XMOB 2PX0A 1E9VA 3C6BA 4FLMA 3PQ6A 4OXQA 2H2IA 3GVXA 4O59O 3LKDA 3OVMA 2VSYA 1NN1A 1GT91 4BMSA 4MYHA 2UZ1A 2VCYA 2LDBA 3VPAA 2EDAA 3T1OA 3KYDA 4CLOB 1CS0A 3T52A 1QIFA 1XSEA 1T1JA 1NBAA 4QDJA 1MIOB 5CB4F 3PGLA 4OJNA 2YQZA 1KIMA 1WHSA 1WVMA 1VPDA 4RPIA 4EHLA 3GUHA 1YBHA 1ESDA 2JAQA 5AHRA 3T3HA 1VFNA 4BNUA 2BD0A 5EHIA 5FI5A 2O5CA 5T4HA 2G72A 4R01A 3MT0A 4JNCA 4L6AA 3BDAA 1ZEMA 2ST1A 1N2BA 1XRJA 4ZDKA 5CBKA 2PKQP 3I2FA 1X7XA 1CZHA 3D3JA 1NDHA 3OTWA 4KFTA 3C39A 2JLXA 2WMYA 1VE3A 4Z1MA 2LP4Y 4C08A 1APBA 5FR1A 1IK6A 3KKZA 4JOQA 1XHEA 1Z5OA 2YS7A 5B3JC 1FUYB 2BFFA 3A6EA 3LC1O 4GDMA 3MBKA 1UMDB 1KSJA 1SRQA 2IELA 3T12A 2J0SA 2CHUA 4HXGA 3H11B 4YALA 2R4QA 4BMYA 1OX4A 1VQ1A 2JIRA 3P96A 1OA1A 1EJ2A 2VLIA 1GZHB 1TIBA 3RT1A 2ILVA 3VU1A 4NDAA 4AWAA 2C31A 4YNBA 2GBLA 5K4AA 1CB7A 3AESB 4IXNA 1TL7C 1LI5A 1NUUA 5DBOA 1LVUA 1P2VA 4TTQA 3TMKA 2V7XA 1L5KA 3SXPA 1L1QA 2VH2A 2XUDA 4OMCA 3PQDA 4BNGA 4Q47A 2E48A 3JRNA 2LWIA 3H9GA 1OFUX 1Z4OA 4PAWA 1TI7A 2P6RA 4O6VA 3EVFA 3MF4A 2WT8A 1RLMA 1XCOA 4MW9A 2Q3EA 5FI1B 1CF9A 1GA6A 4BFYA 3IALA 3OZSA 4NH4A 3UB3A 2OHXA 2ICAA 5DTMA 2PJDA 5IK2A 1YRHA 2XR1A 3AZOA 3KPUA 3L7YA 2RHRA 1P6XA 1SB8A 1N92A 3KQPA 4N5DA 3ORHA 4P84A 3FCAA 1G64A 5BMOA 1T6XA 2VKQA 3WIOA 4PIVA 1Z4NA 2R66A 1N3YA 4HMQA 4TPKA 1F20A 4XOIA 3UOAB 1JDZA 3KQWA 3PDHA 4OGWA 1RI4A 3BBPA 4OUDA 4ZQHA 5GVRA 5H3CA 3IC5A 2IQ5A 2ASVA 1L5NA 3VR3A 3OP4A 3BXFA 4HI0E 4BKPA 2QJRA 3EZFA 4ZYUA 2IYRA 2DPYA 1Q0SA 2YBDA 4KRYA 1PR9A 2B8WA 4K86A 2YMPA 4FILA 3V2IA 2DSNA 3P0RA 2XYPA 4JBLA 1EUZA 4UASA 5CVUA 3DLPX 1WD5A 2SCUB 5HKOA 2HJVA 1M7HA 4M8KA 1VCNA 1QFJA 2VPTA 3OF5A 1N78A 1Z39A 1YQWA 5HJEA 1FMFA 2LR0A 5C1OA 2SKCA 1G19A 2AC2A 3A1TA 2QMEA 3ADBA 4FMDB 5L3SB 1QHYA 3WI7A 1OSNA 1CUIA 1RI5A 4K1XA 2AOWA 3MGAA 2X1LA 5DU2A 4M9CA 4OIFA 1G18A 1LV7A 2O2JA 4TQ9A 3PHIA 2EBHX 3RC1A 2VHUA 4IQ0A 2W6QA 1QOZA 4K88A 1OKKD 3T4PA 5JALA 3ERCA 4RD3A 3REOA 2ASEA 1HYGA 5AH0A 3A70A 4YT5A 4WLOA 3FTEA 3HRIA 1LPNA 2ZQYA 1A97A 5I5GA 2XWPA 1NL3A 2JKVA 1HFEL 1E2QA 1N6NA 2B1RA 4D96A 1XMSA 4G4SO 4U2DA 4B32A 5JY1A 3OFND 4MLCA 4D9NA 4BZPA 2NXWA 4MQFA 4O63O 2GX6A 1E61A 4MWGA 4Q9HA 1Y5NA 2VUSA 3BSWA 4QGSA 2AS0A 5DXJA 1KZ6A 2IDMA 3GRFA 2GK6A 2H4YA 2JANA 3FFAA 3NC0C 5FOWA 5JPIA 2QW1A 5M3BA 1QG4A 1F06A 3RW9A 3UANA 5JXIA 5KQRA 2C2WA 3ES9A 3GCZA 3A3NA 3CZMA 1NU6A 4UD2A 4XCVA 3G2OA 2X8AA 5HCIA 1YI1A 2GJ9A 1J8DA 3TM4A 4KO4S 3ZV3A 1AGNA 2FZCA 4KTTE 2FRXA 3FUXA 3N2LA 3E9MA 1AKVA 1TDJA 6Q21A 1LLFA 2NSDA 4EGAA 1MQSA 3AF2A 3K09A 3FNBA 2XE4A 3IV6A 3NOVA 4NU5A 4PAQA 3SC2B 2UXBB 4M76B 1E98A 4ZWNA 4MWOA 3COPA 2B34A 1AE1A 3GFOA 3LLMA 4WCFC 1R5NA 3RRZA 4C7BA 3BF7A 1X1QA 5F3WB 1X8KA 1ZOLA 5BT9A 3DB1A 3RYFA 5JZSA 1LDYA 2NV6A 3W6UA 4GM4A 1QG6A 1QIHA 1QFMA 2FQWA 1DC8A 3OJCA 1G291 1GGKA 2LGJA 5K05A 2R8ZA 2G83A 1RQ7A 2Z56A 3BSFA 3LUBA 3NTRA 2EARA 5ECWA 5JISA 3LQKA 3NHRA 2XF2A 5DGDA 1COWA 4CDRA 2IPAB 4CIYA 4BKOA 4GGPA 2GEVA 4N7BA 4LF4B 4CN8A 4ZICA 1FP7A 1SFRA 4FUTA 4X97A 1FMJA 1GCOA 1P72A 4Q03A 5FFFA 3F90A 4LOKA 3O94A 2P4SA 3N87A 5HDQA 2ZR8A 5L7YA 3A6PC 3PLAE 4PAMA 5CTJA 4UU8A 2AOXA 1E8DA 2O2ZA 4ZQGA 2HM7A 1YS2X 3QXJA 4X66B 2R96A 5EQFA 5DGCA 4FEEA 5I5EA 1H2AS 4QL3A 1C14A 1Y7HA 4CEJB 3Q9LA 3A6FA 1Z8NA 2ZAYA 1NWHA 2VPWA 3C85A 2BELA 1ZMXA 2CXHA 5EUCA 4CLOA 5KTMA 3QOXA 1G9SA 3P9ZA 1MIOA 1ZH6A 2HEIA 2HDNB 3NHYA 4GGMX 4UW9A 2IXFA 4FCWA 3DOEA 2BM1A 4Y2JA 5LUBA 1NG9A 5J4VA 1JEQB 4TKUB 2IOQA 2CZGA 4IV8A 4DV1B 2PKRA 1E3QA 2VEDA 4NZNA 1R8SA 1T8PA 4RGVA 1NLZA 4Z7JA 4EVIA 1MT3A 2NAFA 2Q1UA 1QV7A 2HFJA 3DDNA 1WP4A 4K2AA 4NCJA 3C3CA 2P7IA 2YCBA 4W9RA 4MVJM 5DX8A 1P80A 4BN5A 1IDN1 4FX2A 2CNWD 1XXHE 5AKJA 1JYFA 4P4NA 1RXUA 4B3XA 1ZW1A 1CJCA 3UMFA 1FQWA 1HBJA 1YIDA 3HRKA 5DRYA 4Q4AB 2R6JA 3TCKA 1LLDA 4X6UA 1I2DA 2EF1A 3F0TA 5FAXA 2AD1A 4EBBA 3CXRA 1UMDA 1GPDG 3HH8A 4KODA 5FOVA 2BEVA 3ETDA 1J97A 3PYLA 4IR7A 4ZRNA 3IRUA 3TF5A 1TVEA 1L7PA 2OZEA 4KRFA 4PQFA 3S2IA 3VU0A 2G63A 3VAAA 3ZXXA 5TMPA 1GIAA 3B1FA 1FS4A 2DPHA 1Q3KA 1WMDA 2O5VA 1JAHA 1Z6QA 4KW7A 1KEZA 5ITZA 3GNLA 5MN5A 2V7EA 3AESA 3ACBA 3CSDA 3JZFA 3NBXX 1XDDA 1XDSA 5JBNA 4BJ1A 3PHBE 4C30A 1XXHA 2Z2KA 4KXUA 5YASA 1EDZA 1NXSA 4RLHA 1XNGA 3DT6A 4NYIR 3ZNPA 2MSEB 3BAZA 4M83A 4R5HA 4YP1A 2ZZNA 4BP1A 1LRJA 2C2YA 1JP7A 2YS6A 3IDSA 3G17A 4N7RA 2QUHA 1GNPA 1OJ7A 4QNNA 5CGZA 5C8YA 3KPYA 4BX9A 3AU9A 1JQKA 4R4JA 2P75A 3ZK8A 4YRAA 4DV4B 3KWFA 1EA7A 2D00A 3ML1A 1XEXA 3NPAA 1M2WA 2V74B 3OIYA 5KKAA 2ECPA 3WHLA 5CA0F 3FPBA 1VP3A 5KU1A 3OZGA 2E4YA 1LDBA 1CRLA 3F1LA 4M1MA 3JWHA 2GWHA 4J0CA 1BE8A 1J06A 1KAEA 5F2NA 5AK6A 1XU7A 4RVCA 2QRLA 1C5KA 1FLVA 1TAHA 1ZCZA 2QU7A 1GAWA 2QUZA 3B6IA 1XRQA 3H65A 3CEJA 3QFCA 4HNAB 4PG7A 4I5DA 1RHJA 3KFLA 3P9IA 3SJCA 2BHNA 4ARZB 4EBFA 3DVQX 2CMHA 3CUEF 5LXTB 1Y9JA 1JKJA 3PQ2A 4LRSB 3W1VA 2HHAA 4ICIA 1NAHA 3KOOA 2FEAA 4MQMA 1HT0A 1RKBA 3HBAA 3A7DA 4WOCA 2AZXA 2QG4A 4IWXA 1I51A 4BNXA 3HU1A 1JIQA 1ZU4A 4J03A 3SR3A 4EHAA 1GR0A 5IANA 2SCUA 3OF3A 1OB2A 2CVHA 4L57A 4EO4A 3B9BA 4F3CA 2QNBA 3MJRA 3GBVA 2D1YA 3CBGA 2WUDA 3DD5A 3F49S 4AM8A 4XPIA 2H4HA 1WUIS 2IKQA 2R00C 5F73A 1JSXA 4UM7A 3RUDA 4DC0A 5JEDA 4NATA 3OQMA 5L3SA 2XCOA 1U1IA 1W36B 2XUOA 1O95A 4GPZA 3LXMA 3OTQA 3G8YA 3IUNA 2HXGA 3V4SA 2CZCA 1XP5A 4GUAA 4G3XA 2PGOA 5F7XA 4ESEA 2PUAA 2PH7A 4I4CA 2YYYA 1JLLB 5IVDA 5HRCA 1RAHA 2QVZX 4DXDA 3ORYA 5HCUA 1F2DA 1NGSA 3C14C 1L5OA 1M1YB 5LN1A 1R88A 1PWZA 1X94A 4KXYA 1Z29A 1JILA 1WX1A 5EL0A 1L5SA 3ZHOA 4D0RA 1ZP6A 1X1CA 4YAUA 3AR2A 4UUBA 1YASA 4EFNA 2VI5A 3LWZA 1OE0A 4MR8B 4Q05A 3HM9A 2GLTA 1I2BA 1NJ2A 3AB3A 3AY7A 1J9EA 3P0EA 5J40A 3OJLA 5B1YA 1P2GA 4RHCA 2CHVA 3MW8A 1KH2A 1CQWA 2COUA 2I2FA 2JATA 5ECYA 1ACJA 1DFHA 1ETHA 3H4MA 4HC4A