1D2HA

Crystal structure of r175k mutant glycine n-methyltransferase complexed with s-adenosylhomocysteine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
252
structure length
252
Chain Sequence
TAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms for auto-inhibition and forced product release in glycine N-methyltransferase: crystal structures of wild-type, mutant R175K and S-adenosylhomocysteine-bound R175K enzymes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords GLYCINE N-METHYLTRANSFERASE
total genus 65
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 1999-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1d2hA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1d2hA02
1RJGA 2YX1A 3BGDA 2EX4A 3GXOA 3HNRA 3JWHA 2FHPA 3E7PA 2Z6UA 2BH2A 3P9NA 3FPEA 2ZBPA 4HTFA 3DLIA 3PT9A 4E2YA 2IBTA 1F3LA 1G8SA 3GCZA 5DX0A 4DMGA 2XVMA 2AOWA 4PNEA 2B2CA 4AUKA 4GOND 3KQQA 1XXLA 4PYOA 3G8BA 3TFWA 4GEKA 3LKZA 2PBFA 3UJBA 5K0EA 2ERCA 1JQDA 3OZTA 2PWPA 4ER5A 1BHJA 4QPNA 3LCVB 4IV8A 5BXYA 5JR3A 1R8YA 1L3CA 1NV9A 3FPGA 3TMAA 4DA4A 1DUSA 1JTFA 4M37A 4PYIA 1JQ3A 4X63A 3UJ9A 1FP1D 2XBMA 1MJFA 5EMKA 4HG2A 3EVCA 2H1RA 4GUAA 5ERGB 2IGTA 3A27A 3NWEA 4GF5A 5T67A 4BP1A 4UOEA 4RTOA 4OX9Y 1N2XA 3R6TA 4RTLA 3ELYA 1AQIA 2P3QA 2C7RA 1G8AA 1HMYA 3KPYA 1NBHA 1JQEA 5CM2Z 5IH3A 4PYQA 2PX4A 2O06A 3AXSA 3T7RA 2VDUE 3LKDA 4LWPA 5FA8A 3KPVA 3U81A 1RI1A 3LCCA 5KQSA 3ER9A 3AJDA 4RSRA 5FQOA 1DCTA 4PCLA 2IH5A 3FTEA 3GRZA 4EQZA 4Y2HA 5E9JA 3ME5A 3FUWA 4KDCA 3EMBA 3CKKA 1FPQA 3MQ2A 4AZWA 5E1OA 3EVGA 3GIWA 5CVUA 5EC8A 3EPPA 3JWIA 2HTEA 4IV0A 3UJCA 4RTSA 3EVFA 4YMGA 2PX8A 1NW7A 3X0DA 3M6XA 3MCZA 3KU1A 4KIGA 3LPMA 5BW4A 3G7UA 1R6AA 2JHPA 4U7TB 2YUIA 4FR0A 1XDZA 3LGAA 4PYJA 3DXYA 3DULA 2ZZKA 1VLMA 4OBWA 5EHIA 4YUWA 1JSXA 3TRKA 1KPHA 2ZBRA 5K09A 3D2LA 5HIIA 4ER3A 3OE4A 4DM3A 1MHTA 5T6BA 2JHCA 3KQYA 2NXCA 1YF3A 3KQPA 3OU2A 3R24A 2NXNA 5EEHA 1G6Q1 4OQEA 2Y1WA 3DMFA 4V0QA 4EVIA 1WXXA 2ESRA 4R8RA 2PJDA 3LBYA 4JXJA 3FPJA 4OBXA 4WVLA 5KVAA 2H00A 5LQNA 1ZKDA 2ZTHA 5FHQA 4RV9A 4BLUA 1M6YA 4RWZA 2FRXA 3O4FA 3SSOA 3LBFA 5DRTA 4FSXA 1NE2A 3DTNA 2JH8A 1NW5A 3L8DA 4FP9A 4QQNA 1I9GA 1N7JA 4IWNA 5LQRA 3IV6A 1SG9A 5CVJA 2FYTA 1D2HA 2R6ZA 5P8WA 4F84A 3P9IA 1UIRA 3AY0A 3M70A 3HCFA 3ORHA 5FWDA 3UJ8A 5CCBA 5CCXA 2ZBQA 3B5IA 3LX6A 1KXZA 3O31A 2PKWA 1KPGA 3IYLW 5E1DA 3QOWA 1JG1A 4F86A 3I58A 3OE5A 1FP2A 2YTZA 2AR0A 2A14A 4GOLD 4QPPA 3NMUF 3PS9A 4AZTA 2AOVA 3K0BA 3UFBA 3REOA 3NW9A 5ICFA 3JWGA 3C3YA 4OQDA 2PGXA 1RI4A 1XVAA 2P40A 3FZGA 2BZGA 5EEGA 2OZVA 5EZQA 3VYWA 4CKCA 2LD4A 2O0LA 5DTRA 1WZNA 5HOQA 5LR6A 4ISCA 5EIWA 3GRVA 2CKDA 4P7FA 2P41A 3TQSA 1TPYA 5F2OA 1VQ1A 2ZLBA 4QTUB 1RJEA 3KHKA 1KIAA 3KQTA 5ICGA 2N47A 1RJFA 4MIKA 2OXTA 4PYKA 5EOVA 2QM3A 2KW5A 5FULA 3CGGA 3TLJA 3PTAA 3P2KA 3BT7A 3UWPA 3NJRA 2P3LA 3EGIA 3FYDA 3LDFA 3HA5A 2V7EA 2ORED 3LSTA 3OU6A 4PGGA 3T7TA 2AN3A 5KYGA 1P91A 3BWMA 5M5BA 3GRYA 2C7PA 4X61A 2VP3A 3QOXA 1IY9A 5K8VA 4RTKA 3G8AA 2O57A 3UJ7A 2XYVA 3SX0A 2ONZA 1I4WA 1INLA 1ZGJA 2I62A 4NECA 3EVEA 3MGGA 3M6WA 3PB3A 1WXWA 3LECA 3OFKA 5DX1A 5FTWA 2XYRA 5DSTA 3UZUA 3PLAE 4BLWA 3G5LA 2WK1A 3O7WA 2OB1A 5C9ZA 2BM9A 5E8JA 5G02A 2UZ4A 3FUTA 4LECA 3HVJA 3HCEA 5EKUA 3VSEA 1IXKA 4YUZA 2ONYA 3EEYA 1U2ZA 5K0JA 5LQKA 1BOOA 3I9FA 3DR5A 3Q87B 3DH0A 3HA3A 4GC5A 2DULA 2FK7A 3IHTA 2C7QA 3ID6C 1X19A 4AZVA 5F2KA 3OPNA 3C6KA 2VDVE 3CVOA 4HSGA 4RYLA 5EZSA 4E2ZA 2IP2A 1FBNA 3BWCA 2P35A 4K6MA 2VDWA 9MHTA 5H02A 1G55A 2PVCA 1UWVA 2GH1A 3K6RA 2OPBA 5FHRA 2ADMA 3DXXA 1H1DA 2ZZMA 5BP7A 4E30A 1EJ0A 2QE6A 5HILA 5MHTA 1D2CA 3HVKA 4ER6A 5JUWA 2PLWA 3IEIA 3UJ6A 2QY6A 1O54A 3FUVA 2PT9A 1EG2A 3ELWA 4RVFA 2UYQA 5DXJA 4HRAA 4C08A 4EKIA 3KQMA 5DPMA 5KQRA 4M7RA 4CXMA 4YV0A 3HTXA 3NDIA 3CJTA 3C0KA 2NXJA 1YZ3A 3KPUA 2PXAA 3M6VA 3Q7EA 3UA4A 2NP7A 2JJQA 2BM8A 2ZWVA 5HIJA 3HVIA 5DSXA 5K05A 1QYRA 1QAMA 1NW6A 1JSZA 2QRVB 4ER7A 4KWCA 2AN4A 1B42A 5FADA 2Q41A 5K0LA 1XCJA 1SKMA 1QAOA 3NTVA 3OZSA 4CKBA 4EKGA 4DF3A 5LSAA 2K4MA 3PFHA 4RVHA 5GM2A 4MQ4A 2P7HA 3VC2A 2JHAA 3HVHA 10MHA 2HV9A 3S68A 3HA7A 2AN5A 1RI3A 4C03A 5DXAA 8MHTA 2PX5A 1M0EA 2PT6A 2XVAA 2NP6A 1NV8A 2UYCA 4RTNA 3EGVA 4FGZA 3GGDA 4AX8A 3NWBA 3B7PA 3PFGA 1RJDA 3H2BA 3PX3A 2YVLA 4A6DA 4M38A 5LQAA 3HP7A 3UJDA 4P7JA 2PXXA 5E9QA 5K01A 3TM4A 3SR4A 3C3PA 1X1AA 3PVCA 3R0QA 4MTLA 2AVNA 4QDKA 5DLYA 3GRUA 1RI2A 3G2OA 4PONA 4OA8A 5GOZA 4ATNA 4IKPA 4PYMA 3I5UA 1L3BA 3HCDA 4RTRA 1V39A 3EGEA 4Z2YA 5DM1A 1F38A 3FPFA 4ZTBA 4R6WA 5DRYA 4C05A 5HZMA 2P7IA 4RTPA 2AZTA 3A26A 1QAQA 1VBFA 4QVGA 3DLCA 5GIOE 4Y30A 3FUUA 2G71A 4C06A 1EIZA 1WY7A 4HGYA 1QZZA 5EIFA 2PXCA 4GC9A 1L1EA 1XDSA 3GRRA 3BGVA 2H11A 5IKMA 2AVDA 4YV2A 3ER8A 5EG5A 4HTFB 5EMMA 1RI5A 2QRVA 2AS0A 2QYOA 2I6GA 5DM0A 5LQCA 4PYLA 2B25A 2EG5A 4KRGA 2G72A 3TPZA 1VPTA 3KQOA 4E32A 2ZCJA 2R3SA 2GPYA 1JTEA 2FK8A 3DOUA 2GB4A 4C07A 1O9HA 5E1MA 5DWQA 1NT2A 3MB5A 1G60A 1QANA 2CMGA 2EJTA 2UYOA 3CCFA 1R00A 5CUQA 3WSTA 4C4AA 4E2WA 5B1SA 3HEMA 3RIEA 3SGLA 3SSMA 3GJYA 1EJ6A 4H0NA 3TKAA 3LHDA 1JG3A 4MHTA 3GU3A 5EMJA 2XYQA 2OB2A 2V74B 5U4XA 4EK9A 5F2NA 2VZ9A 1XTPA 3VC1A 2Y1XA 1KP9A 2IH4A 3EVDA 4GOMD 5CVEA 4V0RA 3EVAA 5EGSA 3GDHA 4BP3A 4U7PB 3P2IA 2ZW9A 3AXTA 2ZIEA 3B3FA 4CTJA 5HIMA 5EQJB 4DCGA 4MWZA 4WXHA 2O05A 2WA2A 2Z6QA 2PSSA 3GNLA 4PWYA 1X1DA 5CVVA 3DUWA 3KR1A 4R8SA 3DMGA 2UYHA 3FTFA 2FCAA 3BWBA 5K0CA 3LDUA 2B9EA 4GOOD 4RVGA 5K0BA 3CJQA 3P97A 3MERA 4AZSA 5D1NA 5HEKA 3HM2A 4RX1A 2OKCA 4PGHA 4QVKA 5K0FA 1YFLA 3UBTA 2OYRA 3SM3A 5BW5A 3DMHA 4BY9E 3ERCA 4CWAA 3M4XA 3OCJA 2HMYB 3FTDA 2EFJA 4E33A 2C7OA 3G2PA 4DZRA 3BKXA 3P9KA 4X41A 2IBSA 1ORHA 3FRIA 3BXOA 2OO3A 3BWYA 2AOXA 3MCTA 1Q0TA 3V97A 1ZQ9A 1P1BA 2AOTA 1VP3A 4YV1A 4R6XA 3TR6A 5K0GA 1PRYA 2HNKA 1I1NA 3KKZA 3RODA 3KPJA 4L7VA 2VS1A 2HWKA 1R8XA 3M6UA 5DTQA 2NNWB 4M36A 3FPHA 3R9XB 1Q0SA 5DT2A 5KS2A 4C04A 5E9WA 1X1CA 4R05A 2F8LA 3B3GA 3C6MA 3P9CA 4QTTB 5CVDA 5T64A 3FRHA 4EMSA 3FUXA 2G8NA 2O07A 1WS6A 3OU7A 4PINA 3MTIA 3SMQA 4ER0A 2NXEA 1SUSA 1DL5A 2GA9A 2YXDA 4A6EA 1AF7A 3SXJA 5GIPE 1SUIA 2IFTA 3THRA 4F85A 2IH2A 4CTKA 4FSDA 2AOUB 4FZVA 4E2XA 3A7DA 3UA3A 5FA5A 1YFJA 1EAMA 4O29A 4P7KA 3GO4A 2PX2A 3I64A 5DX8A 1JG4A 5LQJA 4XUCA 3LCUA 2I7CA 3EVZA 4X60A 5FCDA 3B89A 2GAFA 2IIPA 4PYNA 3OZRA 5EVJA 4B17A 1ZG3A 4YUVA 2YR0A 1R74A 3MAGA 5DM4A 5FUBA 2PV0A 5EKXA 2AOUA 2ZZNA 5FQNA 3NVKI 4HGZA 1SVUA 1XJ5A 1XCLA 3BKWA 5EMLA 4HH4A 1KYWA 1VL5A 4HC4A 2BR5A 4KW7A 3BZBA 4KDRA 4PCAA 1NW3A 5K0NA 3A7EA 5GWXA 1EQAA 1WG8A 1O9GA 3TKYA 3T7SA 3G2QA 3LDGA 3P8ZA 5DTMA 2IDJA 3THSA 4P7GA 2FPOA 5E2AA 4YMHA 1T43A 5ICCA 3E23A 5D1HA 1AQJA 2JH9A 1P1CA 3CC8A 2PWYA 3G5TA 1YZHA 4KVZA 4GQBA 1VIDA 2ZULA 2I9KA 1R18A 2BR4A 3ELUA 1KR5A 1KHHA 5DM2A 2IDKA 4XUEA 3KR9A 2ZVJA 1X1BA 3FTCA 3SVZA 4BLVA 1TW2A 1UFKA 3RW9A 1G38A 2Z6AA 3ELDA 3E8SA 1JR4A 4RTMA 3TOSA 5HIKA 4OA5A 3CJRA 2CWWA 5E1BA 1OR8A 2P1DA 4XCXA 3DP7A 3E05A 3NDJA 1FJXA 4LWOA 1L9KA 5GINE 4FT4A 2PY6A 4YUYA 3B3JA 4GBED 3KQSA 3TM5A 4FT2A 3UJAA 3ANXA 1HNNA 5EHGA 2DPMA 2OBFA 3G89A 4LG1A 2OY0A 3F4KA 3OFJA 3HCBA 1IM8A 5C1IA 1ZGAA 2E5WA 1XDUA 3V8VA 1AV6A 2YXLA 4E70A 2B78A 5CIYA 4PIPA 3EMDA 1NW8A 1YUBA 4QQKA 1Z3CA 4XUDA 3R3HA 4X1OA 4POOA 1YB2A 2YXEA 2ZSUA 3SSNA 1KYZA 4RVDA 3KR0A 1Y8CA 2CL5A 2AOTB 2BR3A 3FYCA 1KPIA 2IPXA 3AWIA 1ZHFA 3P2EA 4PIMA 3EEOA 1M6EX 1JG2A 1BC5A 5GP1A 3BGIA 3BUSA 2NYUA 4CKEA 5LQUA 5CD1A 1L3IA 4RTJA 4E31A 2WA1A 3A4TA 3GWZA 1NKVA 2ZWAA 4DKJA 1VP9A 1N7IA 3A25A 2CMHA 3CBGA 5HFJA 4KIFA 4RTQA 7MHTA 2P8JA 4DQ0A 3EVBA 3M33A 4QDJA 3HCCA 3I53A 2ZFUA 4FS8A 3LL7A 5EPEA 4DCMA 3MHTA 3DXZA 1D2GA 5C0OE 1SQGA 1BKYA 1SQFA 3JWJA 2G1PA 1P39A 3QV2A 1PJZA 3G88A 4G56A 5K03A 3KR2A 2HR1A 2B3TA 1ORIA 3KQWA 3P71T 5E2BA 3KQVA 2P3OA 3T0IA 5FWAA 1NBIA 3HCAA 3PX2A 4P58A 2GLUA 5E8RA 5GM1A 3NVMB 2JG3A 2ZIGA 4YUXA 3G2MA 2GS9A 1TW3A 2EJUA 2ZIFA 3MTEA 1VE3A 2YQZA 2G70A 3KPWA 5ICEA
chains in the Genus database with same CATH superfamily
3SF8A 2QD2A 1GFZA 2PGOA 1HEYA 1RJGA 2INGX 3DAGA 3L77A 5IMBA 3TGWA 1OZFA 2EX4A 5DB4A 4LOAA 4GQAA 2H2HA 1TC2A 1GGMA 3E7PA 4HXYA 4NTZA 2FEPA 4WK4B 3WKBA 3GDGA 4F06A 1GIAA 1I2DA 3FDXA 3SU8A 4ENRA 3PE3A 1PWHA 4OSEA 3HACA 1AGYA 5CIQA 3WZ2A 3ZX5A 4CKZA 5AVYA 1O96B 1U2EA 2RG1A 4BIIA 2OHVA 3QKUA 2IOFK 2I6UA 2PBFA 2WJYA 1BKDR 4FQ8A 2E85A 3H1FA 3MWEB 1XZDA 3O1JC 5NLLA 3T1NA 3TCKA 3W5VA 2YN4A 4CF3A 4CDGA 4XYBA 2IV2X 1U5AA 1ZUHA 3DD5A 3T5AA 4M89A 4ANFA 2F3QA 3KV1A 4D0LB 1H8EA 4M1OA 4YMWA 3HI6A 3L8EA 4EVQA 3KOMA 3DL7A 4OD0A 2VJPA 1KJYA 3P5BA 4COKA 4HG2A 5K3EA 3DD1A 4ERNA 3BVPA 1IB6A 3FCSB 2D59A 2DTEA 2ZAIA 5KHLB 4QXMA 2CV1A 1ADFA 3KPYA 5IH3A 4M7OA 1DQYA 1GAQA 3CUEF 3VI4B 3ST7A 2C2XA 1P1JA 1Z16A 2WC1A 3GWGA 4FIZA 2C4TA 2PZBA 3FMVA 3KYDA 2XHZA 3A9TA 3MD9A 1O94A 4RQAA 4LJ7A 4MUHA 4TMTA 3VZBA 2VH5R 4Q9HA 1UJ6A 5AIBA 5AXAA 1MOPA 2MCFA 5EHNA 3BWVA 3H5VA 4CI9A 5E9JA 3UXYA 1A50B 1L7DA 5EE5B 1KYTA 3EVGA 2BUBA 2WWHA 5CVUA 5G3ZA 5IF9A 2PL9A 4GKVA 5IYZB 2VJKA 3CPJB 4OEHA 2HWYA 5JD4A 4J0FA 2HHJA 2ZRAA 4I50B 3JALB 1EXNA 3T7CA 1DTSA 1U0TA 4YONB 1C9JA 1C30A 1VG8A 2QU7A 2VF5X 4M60A 4PX2A 3DONA 1EP1B 4Z0TA 1IQPA 1PGJA 2CFRA 2QN7A 3KLOA 3ONWA 4G26A 3KKLA 4G6ZA 4I19A 4XQGA 5FTLA 4OBWA 3QEMB 2AMLA 4LZAA 5SICE 5EP1A 1WAMA 2VBFA 2VHXA 3FZNA 3R3ZA 3RSFA 4EB6A 5T6BA 2NXCA 4WOBA 1GU0A 3ZXIA 3BOSA 4EUFA 4BNIA 3RYHA 4RJ2A 3DQPA 3WGKA 3FGOA 3TVDA 2B2NA 3DMFA 3G2JA 4GX2A 1VMKA 4AMUA 1WXXA 5THXA 4Y1RA 1PCXA 4QPJC 3NAMA 3HO8A 4OBXA 2VNAA 3C43A 4BTVA 3ZKWB 4V1CI 3RS3A 2J9FA 2CB0A 2NUPA 3D5QA 3F7TA 4TT3A 1VLHA 3A32A 3TIVA 4WZAB 1ZVKA 1Z2EA 1R0LA 3F0TA 4LXQA 4WLFA 5EFOA 3S6JA 1O6BA 4QSHA 4OOEA 4ASUD 1BE1A 2MSDB 3VVCA 3F3SA 4XQCA 2Y1FA 1DWUA 5DHPA 2RJOA 5AK4A 1P9LA 4HNRA 3UHPA 5K4HA 1KDRA 1OFVA 4B3MB 5CYOA 4XPIA 5FWDA 1UWCA 1N8KA 1RD4A 3R41A 3JQ7B 1U2SA 4LC9A 1VYHA 4U5XA 1FNSA 3ZPXA 4QXRA 1ILEA 4S12A 2YOFA 4ZQGA 5B36A 3ZDDA 1LBTA 4GLFA 5SY9A 4CTNA 3QUAA 4U2GA 1YS6A 2I2WA 2VYFA 2J3LA 3TEJA 1U1EA 4Q4AA 2YHUA 2KLBA 2WU3A 4MK4A 3ZWXA 1IBKB 3BMNB 2BZ0A 2SICE 2E3JA 2V9ZA 1MHPA 3CKLA 3NIBA 4YJ3A 5AW7A 1RI4A 4JYMA 3NUZA 3QTLA 5HOQA 3HO1A 2WTEA 2EWVA 1ZI8A 2WZDA 5AJYA 2A7QA 3U0BA 3ZD9A 5DCWA 2AFIB 4AN1A 4NE7A 4EBBA 3WXBA 4V0ME 5BO5A 3O8RA 3O73A 2P41A 1XU9A 1TPYA 1U02A 2VPZA 2QVXX 1JFVA 3Q3CA 2ZSFA 4BATA 1SK8A 4YDHB 2YWFA 4UHFA 1HEUA 1RJFA 2AI1A 2IXEA 3I1IA 2QM3A 3PTZA 1CP3A 5EZYA 3FMPB 4OLJA 3CF6R 3KVNA 1XROA 4DR4B 1T5OA 1WP9A 2GJ4A 2C07A 4GG1A 5LYJF 1LA2A 3KM0A 1JF8A 4RVNA 4Y2GA 1JP7A 4BAGA 5DBFA 4BNDA 4NU8X 3AI3A 1EDBA 4TV8F 5EXPA 5COQA 1O95D 2C4KA 1F0PA 4D4JA 5DHQA 2QTBA 1NSTA 3PB3A 5FTWA 1WXWA 2NSDA 3LECA 4G4GA 3UT6A 3TDMA 4CMIA 3B70A 4D92A 1P5HA 3UMYA 1DKUA 2O3UA 2R6DA 5G02A 4TV8B 2ID9A 3ICQB 1LDYA 1BWRA 2ORYA 2QNIA 2GJ8A 4S24A 3VZPA 3D0OA 1KA9H 3GJ4A 2C7QA 3ZDQA 4J6EA 3WGVA 1TUGA 3N2KA 4WLEA 2N75A 2G8LA 3KYCA 1BWPA 4PLGA 2X13A 4AP5A 2ZYTX 2A1TR 2DC1A 1PHRA 1G55A 2ANBA 3N74A 1FTYA 1W88B 3U3KA 4E5SA 1VKZA 4LYAA 2OPBA 4YDRA 1EXDA 5M29A 2ZVQX 1C3XA 3GFQA 5IT0A 4C14A 1D2CA 1U0GA 4LSGA 3EPKA 1G8MA 1WXFA 3MWDA 1PAUA 2GYWA 2XB4A 1A9RA 1OWNA 4OB8A 1NI4A 2VT6A 2WNHA 4QJIA 3NVKI 3AVXA 5K3FB 2ZIAA 5DT9A 1EDOA 3UA4A 3IEUA 3ED1A 1KDPA 1YNSA 2FPMA 1FU8A 3DE0X 3HBAA 2XHEA 4MR7A 4NG4A 3DHVA 5AR1A 4I3HA 4PS1A 1NVWQ 3AH8A 4J9VA 5LXTB 4QJBA 3CW9A 1FDUA 4PPNA 1SKMA 2FUCA 3HCOA 1SUPA 4OYHA 1KOLA 3C5VA 5GM2A 3VNAA 5FEUA 3D8NA 3RAEC 2JHAA 1VXOA 3UC5A 1KEKA 4JCCA 3ZYZA 5AVXA 2VSOA 2D00A 1NVBA 2BFBA 2PX5A 3G23A 1G2PA 3LLSA 4EJ6A 5CDFE 3F49S 3PV0A 5LM3A 4MGIR 4IZHA 2UDPA 5BW8A 4ENSA 1FFHA 4BV2A 2HCFA 2CLSA 4YRFA 1I30A 3IEKA 4B80A 3HEAA 2PX6A 3B7WA 4HP8A 1V8ZA 4KNYA 1UAAA 4XM2A 5DULA 1HNZB 1BXZA 1DBVO 4V38A 2XUKA 3RBZA 1CVLA 5K5EA 3M3PA 5C8YA 3AVUA 1C9DB 2ZBEA 4ATNA 5IJWA 4HDQB 4JSRA 5K3SA 5JADA 3IGFA 5CITA 3DV2A 4KGVA 5AVSA 1QRUA 3RARA 4BJ1A 2YY5A 4DR2B 4U2FA 2P9EA 4DQUA 2VHTA 5IBRA 1EX9A 4E5MA 4LGMA 3HSYA 3K92A 5KTPA 3A26A 2BHLA 3FI0A 2O54A 1WULS 1RPTA 3OQIB 4HDNB 2CT8A 1ZSNA 3HXPA 3LBIA 2I91A 3MA0A 3Q5GA 3WL4A 4ZYVA 3PHLA 2ZANA 1FYDA 5KSZA 4GE0A 2QRVA 3A31A 121PA 1SHJA 4CEJA 4AKIA 2AZXA 5HGJA 1EXWA 1MZPA 4X8HA 2P79A 3EZXA 5AW4A 1MIHA 1JQLB 4LJRA 4OHVA 1XUOA 4LKOA 2YNMD 1Q15A 2BH9A 2D1SA 5EESA 4M0DA 4QIHA 3IR5A 3ZHTA 3O8BA 1AQ6A 2RHOA 1C7JA 1OZ0A 3F97A 1QS0B 4JJ6A 1DUIA 4A82A 3TCXB 2PBZA 2JD0A 4HLCA 4BNKA 2W58A 4ITVA 3X1ZA 1TMGE 2DU8A 3MBIA 3O21A 5JPDA 4RMJA 5HTOA 4QWMA 1YJ8A 4A4DA 1FF9A 2XMQA 4F3YA 4GL2A 3RRMA 1YDFA 1QQ6A 1WU7A 4ZD6A 5M7EA 1PT5A 1YCGA 4URYR 5A0VA 5FXMA 4BO7A 3IPYA 2VUIB 2JDIA 3ROGA 1NNI1 5J2TF 4PG6A 1J8QA 3JATB 3U9TA 5E7MA 2GVDC 1WA5A 1ZNXA 2IKSA 2GD1O 5GMOA 1KSHA 3TLYA 3ZBUA 4FC6A 2GO1A 2VYQA 1JIKA 3E27A 4MWZA 3NP9A 1ZK3A 4Q12A 3RFTA 4F6RB 4IKOA 3GNLA 1BS2A 1YRYE 4OHKA 5FTNA 4X1YA 4MMZB 2MOKA 3JASB 3GJ7A 4E1VA 4WW0A 4ZO8A 4WFIA 5J58A 5L4NA 3VZDA 2I99A 4QU8A 3RVPA 4EB0A 1R12A 3A2NA 1GTSA 3MGBA 1FTNA 2HCTA 5K3FA 3WQRA 1VRWA 3K5HA 2GOYA 4PGHA 2CXXA 3LF1A 4KWTA 4F3CA 1O3YA 3U0VA 4FBGA 1I13A 3I04A 1DEXA 2A0XA 3JVEA 1KJ9A 5JCJA 1DAHA 4RD6A 2B1JA 3DYVA 1E9EA 3ZE0B 1NFFA 1LZKA 1TU4A 2D5BA 2WE7A 2ECOA 4NQRA 4D4GA 5A2GA 1RXYA 2X76A 3BKXA 2JVJA 2M2IA 2CB9A 3WL8A 3SDBA 4B44A 4ZQIA 4QDOA 3VMFA 4K9DA 2PUAA 3WWEA 2OGTA 1Z4KA 3AL3A 4ARUA 1ZLYA 3WL3A 1E3EA 2XNCA 2VDJA 1PX0A 2Q7DA 1LY1A 2QT1A 2K2WA 4X54A 2D1FA 1QV6A 2P0YA 4KTTE 3ZK8A 2UYYA 1O9BA 2C3OA 3MLEA 2OQIA 2P1RA 3TI9A 4FW8A 1HFWA 4FWTA 2B4TO 2J3MA 3CR3C 5DBEX 3QBTA 4OFZA 5L7TA 1KDOA 1UZNA 2C7GA 2YVAA 3ONEA 3ELBA 5HRCA 2PGJA 2W5UA 2WBLC 2VSFA 4K9MA 2XB2A 3QBJA 1USUA 1V6AA 5J4YA 4OSPA 2L19A 3A70A 2J46A 2OXIA 1L5NA 3T7IA 4KPGA 3JARA 5JCZA 1MO5A 2O07A 3IA2A 2I6SA 3MSXA 4CEIB 4EYOA 3NC4A 4K9LA 1AF7A 3K4PA 4G65A 5EZYB 4JBHA 3UB2A 3LFUA 3U2QA 3N2IA 4RF3A 3RAFC 2E1RA 3A1UA 1E32A 2QJFA 2UV8A 2V9PA 4MCIA 4OQ4A 4YDSA 1XTIA 5ALTA 4OHYA 4YVFA 3B89A 6NULA 2IIPA 5KMGA 1M54A 5EZYF 4YUVA 4N8DA 2CV2A 3WDMA 5CD9A 2XZPA 1C8KA 1P1HA 1ZHHA 1DCFA 2Y0BA 3LI2A 4IIUA 3PDUA 5F76A 2MYTA 3TW8B 2XNHA 5LZ8A 1KEVA 3SJUA 1H1TA 1NJ8A 1PX2A 5GY7A 4D4KA 4MMYB 1ZGCA 4O4IA 2P2LA 3D3QA 1NR7A 2WAOA 1E6CA 3MJ4A 2NO4A 3HR7A 1AQLA 3DKRA 4A1FA 4PNZA 1IC6A 1U8ZA 2CD7A 4YT8A 2EDAA 2F43A 1ODIA 1N2GA 1BOFA 2FW7A 5CJJA 1UM9B 3REQB 5JJCA 4M6WA 2YJ5A 1E9BA 1T15A 5AUQA 1Y7HA 2BMWA 5DM2A 2EKZA 2ZUUA 3RBVA 3DUFA 1X1BA 3EBPA 3T9DA 4Q1EA 3WQBA 3IAAA 1QYXA 4AFNA 3LKVA 3PQ3A 2BI7A 3HL4A 4RUKA 1YOVA 2WJZB 4I8IA 4HSEA 1JE0A 4MW5A 3FA2A 1LI5A 2F3SA 5CR9A 1BKSB 3JRWA 2QR5A 1AXGA 1HL3A 2HN9A 1PT6A 2J31A 1GYPA 5FORA 1DBWA 1GFSA 1GCIA 2R7AA 3NDPA 2I55A 3Q0TA 2JZOA 1G5HA 1V3UA 2FJUA 1RZRD 2IZ6A 3K9GA 1X7YA 5C7OO 1RYFA 1J07A 3SEQA 1X9IA 2Q3FA 4PZ9A 1IH8A 3K7EA 1W1WA 4OXKA 2E5WA 1KAQA 2JLBA 3QUBA 4FMBB 4LJ5A 4O2AB 3SC6A 3LQYA 5TVKA 4DL9A 4L0CA 1GZ6A 1VE5A 3MXTA 4YQZA 1O97C 2IEBA 4W5TA 3SJAA 2DMRA 2HAEA 5M2QA 3R7BA 2B5WA 2J7PD 1U5BB 3DZDA 5E4FA 3L7NA 2BBWA 4MI1A 3LG2A 5CA1F 3FWKA 2ZR8A 2HQ1A 4GRIA 4BQSA 4M0PA 4D44A 1SZPA 3IVXA 4LJ4A 1A5ZA 2JGRA 1D0VA 3KJNA 3O84A 4Q15A 2A6PA 1CIVA 3DDOA 1YS1X 4G1FA 1CT9A 1Z68A 2EKBA 4I55F 3PD7A 2PIAA 4TTRA 4TPKA 1E9VA 5HUQA 3AI7A 3HXQA 4IQ8A 2HEGA 4FEEA 4Y9RA 1ZRNA 2H16A 2VTKA 4ZDJA 1U7UA 4C0BA 3QV2A 3V7NA 3RU7A 1LTHR 3EPRA 4BP8A 2GPTA 5JPCA 5E2BA 1QIHA 3T0IA 1NBIA 5GM1A 1SVOA 2W0SA 4XLLA 4GBGA 2FFRA 3SQLA 2EZ4A 1ZW1A 1YA8A 3TQOA 1B23P 4GMDA 4R1UA 3ZDAA 4FC7A 2ZIFA 2H5JA 4M98A 4X90A 5DEIA 1C1XB 1YDMA 3B1VA 1UKAA 1ZLXA 3FJ1A 1IXRC 3P9RA 5I4BA 4ALKA 1QVZA 2PRYA 3WNDA 1K9VF 1SEPA 4ND3A 4TLLB 3Q10A 4WBXC 4KODA 4IAOA 2PRKA 3PR2B 1EB8A 3KQHA 4L3WA 2J1LA 4R51A 3SSAA 3FPEA 3WHLA 4IP0A 2IBTA 4K03A 2V45A 3CVVA 3I6QA 3IBTA 1MV8A 4QBHA 3ZS9A 3DF9A 1E2LA 3H17A 2HU2A 5B55A 5C8ZA 5CYGA 1H2BA 4RAQA 4TMXA 2OWEA 4TXLA 2W2QA 2GN6A 1GPLA 3DBRA 3IOBA 1G7TA 1PWXA 2ERCA 1T8PA 4BNFA 5C1OA 5C53B 3ETEA 1BHJA 3FDJA 3I1FA 4JN6B 3IKTA 4RDHA 3FPGA 1SWVA 1F51E 5BUCA 5LOVB 3STYA 1N6RA 1XU4A 4Q1VA 3PPXA 3A3PA 3OPYA 4LXXA 4W4TA 1OD6A 5F5NA 4FNAA 4CT5A 1FXUA 5EMKA 3ZNQA 1R0WA 4AMZA 1OX4A 4M0MA 4NU5A 2EV9A 3IPAA 3FOFC 1OOEA 1P5FA 1ZJYA 2ICAA 3H4IA 1W0KA 4O4HB 4F3RA 5E6UA 4FN4A 5I9SA 2ZJ8A 2IIVA 1GCGA 2J87A 3HWWA 3L06A 3R5HA 4Q3NA 3LZCA 4QXQA 4UD6A 3DV0A 3RC3A 4YREA 1XP8A 1G4AE 1SCDA 3AEUA 2OBYA 1MX1A 3K1JA 4PCLA 1B6RA 1JR3E 1Z0IA 1ZMOA 3FKSD 3GRZA 4N3CA 4WL0A 1P5JA 5FFFA 4A6PA 2VAWA 4DW8A 1KC3A 2B92A 3CRQA 3CS3A 1PV1A 1YQEA 5DV9A 3RS0A 4IIJA 4ZHQF 4E6PA 1K68A 1XN1A 3OPVA 1W25A 2WYIA 1CZNA 4I9NA 1ZH0A 4PAOA 4WOCA 1JILA 4CLRB 1XLWA 5I4CA 5BW4A 4KIGA 2OK8A 1IVSA 4XR4A 4UMEA 1FIUA 1GADO 2J6CA 4C4TA 2E4VA 1P17A 2VAXA 2YUIA 4FR0A 4HGNA 1VDZA 4NYJQ 1OFIA 2QMHA 3W5BA 1RYBA 4M8KA 3EN0A 1LQUA 1MB2A 4P22A 2JA2A 2PFKA 3GFGA 1QORA 1J39A 1ISFA 2VUSA 4R01A 1FLAA 1T0JB 2GN1A 3WLMA 4YYZA 2JHCA 2REQA 1PTJC 4KYUA 3K9FC 1UC8A 4IUDS 3ZLVA 3N58A 3ZD6A 4LY9A 2SECE 1UC4B 4YGXB 1NY5A 2IY8A 3AVOA 3C7CB 4BQNA 2EXXA 2ESRA 2G36A 3LBYA 4YEDA 1A27A 1Y9JA 3TSWA 2F4VB 2B5OA 2OBBA 1RTKA 3WBJA 2IHJA 3FIJA 1U3WA 3SC2A 2FWPA 2QYSA 3SZRA 4FWIB 4WV3A 3B1XA 4KREA 1S96A 3VNSA 4IF6A 1CUBA 3IUQA 1XTUA 3L8DA 1UT5A 3IR7A 3R5XA 4JI6B 1F5NA 3CZ9A 1TCVA 1Q21A 1RBMA 1KH1A 1QH1A 4L16A 2GWRA 1SQ6A 5P8WA 4C4XA 5JANA 1DPGA 1EE1A 2ZE7A 5DYTA 2FMHA 4G4SO 4QFMA 3LK6A 1ML4A 4DM3A 4H1VA 2XKKA 3SIRA 1R9NA 2QS9A 4Y2YA 5ESXA 1PLLA 5REQA 2C57A 2XD4A 5JMWA 2H1OA 2R8YA 4QLBA 3RBAA 3WL5A 1YTLA 4YRQA 2H0AA 2L2QA 1YVRA 4FE4A 1V9CA 3E9DA 1Z2DA 5A6SB 2RIPA 4GM1A 4UNIA 5G41A 3BDVA 4CKCA 3I61A 2HMSA 3GLRA 2ZQZA 3K16A 5C3MA 4EHBA 1FP7A 1VLJA 2OO7A 3MCAA 4Q3EA 1YKFA 3DT8A 1EFRA 4FDMA 3SLRA 4LMAA 5DNEA 1YR1A 3F5MA 5LFAA 1RM5A 4HWKA 1KIAA 1K0FA 4XVRA 2ODPA 4GBJA 5C4IA 2Q5JA 4NK5A 5L4SA 3GC6A 3SBOA 3FYDA 4HWRA 1LTKA 2Y1KA 3DGFC 3LSTA 3PFCA 4K88A 4CVNA 3ROTA 4G0VA 3TOXA 2IEGA 1I2ZA 4URUR 4INAA 3A9CA 4D2IA 5IUKC 3OSUA 4ALMA 1EIWA 3QOXA 2XT6A 5K8UA 4QOFA 3FNHA 1K6MA 5TMEA 3B6EA 2XTNA 5CG2A 2VHYA 3GEHA 1ZGJA 5HK8A 3HWX1 2V98A 3A06A 2HMUA 4JYAB 1Q0UA 2G5TA 3F98A 13PKA 4CYMA 3PLAE 1E2KA 1NUHA 3MM4A 3MRXA 4FE7A 1IULA 2QIPA 2C03A 3OLZA 1L5YA 5PGMA 4OM8A 4A8JC 3RC8A 1RKXA 4JJ4A 3V8EA 3OMLA 4X1IA 1XRSB 1CXZA 1QLHA 3GROA 3I9FA 4P98A 2ZU6A 4LYDA 3WFJA 4EAQA 3QG5A 1JR2A 1KY2A 3JX9A 6LDHA 5LB4A 4AZVA 1U0LA 4JASB 1P81A 1RC1A 1W59A 5IANA 1XDGA 2KQUA 1G3UA 2OZEA 4B47A 4CRWB 5LZ4A 2P35A 2VLBA 4Z9AA 4EKYA 4AI6A 9MHTA 4I9HA 4QEDA 4QYSA 1EZ1A 1ZIXA 2H5LA 3KJEA 4DPLA 4Z9BA 3U7QA 1ADJA 4IL5A 3OC0A 4HWGA 4A2QA 5KKCA 3OIDA 3R09A 4M1TA 2ZRJA 4RH1A 5THKA 1O54A 3EH1A 3OQMA 4RVFA 3HJHA 1IBRA 4CIYA 3OVMA 5HM8A 2DUWA 2NSJA 2NXJA 2OV6A 2PKEA 4RK7A 4Y2VA 5ADUS 1DQNA 1NVKA 1SCJA 1F4LA 5CTJA 3ZJ4A 4F1KA 1F0YA 3WDLA 4GNKA 5HIJA 3OOHA 3HVIA 2GHQA 3ENZA 1W0JD 5IC6A 1NJFA 2XE8A 4PV7A 4R1SA 2DKFA 1Y3HA 2JLRA 4KWHA 2QSUA 4IDOA 1XL1A 1PSZA 3BRCA 5BT9A 5BYKA 3NTVA 4CKBA 3VKHA 3THYB 1DCMA 4ZEMA 1D6JA 1Z38A 2QZPA 3OP1A 5I6DA 2EP8A 1PE0A 1I0LA 3HA7A 4ND8A 5B30A 3DJFA 4XR9A 2PT6A 2XVAA 5KYUB 3AFNA 2ATXA 4KQIA 1XLUA 2P65A 5TS3A 4FGZA 3PA8A 621PA 5LKAA 4JL8A 1Q3KA 5AW6A 4F7WA 2PD6A 1JLLA 4HYYA 5EQFA 1ISGA 3QKSA 3S7ZA 3FHTA 2XZLA 3PKJA 3RIYA 1JDBC 2XWQA 1K8YB 1KY4A 3GCGA 2XCSB 5ALKA 5CRIA 3PVCA 3KLBA 3QVTA 4N3BA 3QEJA 3SZLA 1GG5A 1DAPA 2AA3A 2LV8A 5F3RA 4LQDA 3X1YA 2X5XA 3MMZA 5E6SB 1OVMA 3CNHA 1XZKA 1Q7BA 3F6PA 5JAZA 3WKEA 4D9FA 5B7PA 2P7IA 4NMLA 2ZRIA 1Q74A 4G0PA 3O5AA 1BROA 3K31A 1NLUA 2BAGA 2DFPA 5L3QB 2B36A 2W2NA 3TTXA 4Y30A 1XRQA 3Q0EA 2WYOA 1KYXA 1QZZA 4CR7A 2VRCA 4ZT7A 2OORC 4PGFA 5KX5A 4W9NA 4IHAA 3W6ZA 4LV8B 5TMDA 4HTFB 2HHAA 1GSHA 3NUQA 4D3FA 5AUPB 5KQGA 1RYDA 5BWBA 1AK9A 2NG1A 4ONEA 1FYVA 2FB9A 1O5TA 1GNLA 1DO0A 2OMEA 1IY0A 1DJNA 1NYQA 3QEBZ 4D02A 1O5IA 3CN9A 4J75A 5DM70 3RDPA 3ADKA 3G9QA 1JT9A 4K9SA 4LJYA 1Y1SA 5JXHA 3OY7A 2QQFA 1J20A 4NZYA 3DOUA 4G0UA 1QDEA 2J59A 4JA0A 4NJMA 4EJSA 5FYDA 2Y71A 4NG5A 3WLAA 1G60A 1KQOA 2QLMA 4NENA 4FEGA 3COVA 2FG7C 3K0CC 1BE6A 4O2LA 1L7NA 4LX8A 2ZPAA 5DISB 5LIRA 3GU3A 4YAFA 4D4MA 2Y1XA 2E5FA 4B3IA 4TVBA 4N18A 2QOEA 3T1VA 2WFAA 2G5CA 4BP3A 3CLSC 3P2IA 1Z9BA 3AXTA 2GYYA 2HLNA 2I22A 1RHJA 1W4AA 1CEXA 1L5SA 1ECBA 1A2QA 2XYGA 4CKCB 1Z33A 1Q12A 1SBQA 3E48A 5FPKA 2PZJA 1RXUA 3N28A 3GP8A 2XYPA 4FHCA 4IIYA 2NYAA 2ZJ4A 2FN9A 3PC8C 4IQFA 3CJQA 4W9NC 5AHOA 4A9AA 4Q7QA 4L3OA 3B3QA 1BX1A 3T4PA 1SC1A 1QMPA 2BEWB 3KB2A 2ODEA 4RPCA 4D9JA 3DMHA 2Y1OA 4BY9E 4OGWA 4PHCA 3BXZA 4CWAA 1R0KA 2AC4A 4CF6A 4EKDA 1RHKA 4LY3A 3DZBA 2GKOA 1BQ4A 4V0LA 1GZSA 4Y2UA 5AK5A 1G3MA 4J7AA 4ZOCA 3TDNA 2GBIA 3HCPA 2G80A 1PWEA 5J1TB 3BWYA 2AOXA 1HDGO 4Y0VA 3PGLA 2P6RA 1DINA 3FHLA 2WSLA 1VSUA 1WZ2A 3OM0A 1E3JA 4JKOA 1N8NA 1XEFA 3VYRB 3D6TB 3NIDB 1G7SA 1Z25A 4OL0A 1C0IA 4HFRA 1F2VA 4U1RA 3RODA 4UFOA 3HR4A 4JJEA 4MQLA 2VS1A 1FRNA 4OLAA 1KQ3A 1RFGE 4B2LA 5DZSA 3IOMA 2BJVA 1KK0A 4M36A 4ZALA 4ZJZA 4S1VA 4WKPA 3SYTA 1VJDA 1IY8A 3U3RA 2WD7B 3T41A 4HKTA 1ZRSA 4C04A 2FZ4A 1A76A 1P44A 2YHAA 3PUVA 3PUHA 4DNPA 2PMEA 2HU7A 2ZM6B 4R2JA 3DBOB 5BT8A 1E8NA 5DNCA 2H9IA 4PS0A 4LI0A 3QF4A 4OK5A 3ZW7A 1ZH6A 3KAJA 4C89A 4YRKA 1FFEA 1FYXA 1WZUA 4TXHA 2NUTB 3OCUA 3BQMB 3WGIA 1OMOA 3F6YA 2GEBA 3T34A 1X7WA 3M3DA 4DUZB 4B6QA 1O6FA 4O0MA 1FFXB 1YFJA 1CZHA 3QWBA 3RV3A 2A0YA 4F04A 2BZ1A 1WZCA 3NIWA 4CFYA 4TWZA 2R00A 3NJ8A 2COKA 1AIPA 4AS1A 1RYMA 1XQ1A 3HJCA 3UFXA 4E2FA 4EW2A 4R81A 2ARKA 2X9VA 2MINB 4XJXA 1WSBA 3GR6A 4WMLA 3MAGA 2CEAA 3VNBA 3LJKA 1YB7A 1O4WA 2L17A 4JBXA 1Q3TA 1GTJ1 1BCRB 2FQXA 1VHQA 2V7WA 2YV5A 5KJFA 5D51S 3VTAA 1WVGA 5IJ0B 2EYUA 4NFHA 3QOYA 4M1QA 1K7FB 4KLRA 4D3XA 3LQ1A 4PQYA 3CT6A 4YCDA 4Q4JA 3ORYA 1FDVA 4YMHA 2KBFA 3H8JA 2Q0XA 1UFVA 3ZH9B 1P1RA 3REFA 4P1ZA 2POCA 2DY0A 1YS9A 1WBBA 1WOMA 3MN1A 1VKRA 4OSOA 2GPBA 1WQ4A 3LOPA 3W06A 1TNDA 2AJBA 3DTYA 1Y1KE 4MULA 5CLHA 1LQTA 1UBMS 2P4QA 4HBGA 3GN1A 3L43A 3PZBA 2ZYIA 4U2BA 4B3JA 4BE4A 3J81k 2J0VA 3RSSA 1IJEA 3NHAA 3AQIA 4WN9A 2P1DA 1HDYA 3OTQA 3DP7A 3QUTA 4WD3A 4ZI7B 4UZEA 3NDJA 4EHFA 4BFWA 4EG1A 3NTUA 2NU6A 4Q3DA 5J5VA 3B9PA 1H0KA 5AUNB 4C7OA 4HB4A 2DWQA 2BBOA 3JQ9C 1I7LA 5IM4F 4OXIA 4TMZA 4XVHA 5JW6A 2NPFA 1OLOA 1XZGA 4YAOA 4WNIA 3USZA 3EXEB 1TXGA 4HDMA 4I3FA 4I2VA 4L4ZA 4WRRA 3ZCPA 3O91A 4G2TA 2CCGA 2UXCB 4GP9A 1LLUA 4C0HA 1GL3A 3TTWA 1RNLA 2XJ4A 2JLWA 4V0KA 2FMXA 1KYZA 2QX8A 1QS0A 3IAXA 3FAKA 3R3VA 4TLBA 1X3SA 2P27A 3H2KA 1KPIA 1QF9A 1TA9A 2IPXA 2WD7A 4IRXA 1C8BA 4NONA 1T0BA 4CM4B 5KTKA 5GP1A 3BGIA 3BUSA 4CKEA 1M8JA 3FPAA 2JANA 1W6UA 1P3DA 3WX0A 3QENA 5J5CA 1TZBA 2HWUA 1HQDA 2I6QA 1N7IA 1CFZA 4ZPJA 5JDCA 4GLBA 3A11A 3H3JA 4JC5A 5G2OA 3TIXB 1HDOA 3PI7A 4BB9A 2B7CA 4GOJA 1X7XA 2AC7A 5EPEA 4FS8A 4AG5A 4FFDA 1H94A 1R4AA 1GU7A 1RHQA 2VC2B 4XJVA 3ZU3A 1R5OA 1PVVA 1RCTE 3T3MB 4AROA 4QG3A 1ZVVA 4KPYA 1MW9X 1PJZA 1G0OA 1N2CB 3BF8A 3G88A 5ECGC 5FWXB 2B3TA 1ORIA 2J9XB 2PUTA 4OHPA 4EJ2A 2D62A 4P0PB 5I48A 1F60A 4M1EA 1ILWA 3ZWDA 1I2BA 4CCYB 2ZTMA 4WJKB 1NLFA 4ZCIA 2X22A 3T7AA 4WBNB 2OUIA 3C7AA 1M73E 3QUQA 4S1OA 2ROQA 3LQ2A 2Q3JA 5JSUA 3R8XA 1QHHA 1TEXA 3EEBA 3VR1A 1NURA 4W5QA 3K70C 2QZ9A 1MT0A 2D7JA 2PM8A 1G8YA 3BCUA 3IAFA 3S0JA 1CRZA 1T8SA 2VRWA 3L0PA 5CLLA 2ID4A 3SD7A 5F7ZA 4R9UC 3WLHA 5IAAA 1T6YA 1SC6A 2CNNA 1JB1A 4X66B 4M88A 1UCFA 4CIAA 3B6KA 4XSHA 5CM9C 4COOA 5H16A 3N5CA 4M7PA 2CXUA 2FDRA 2J0UA 1IJBA 2ZAMA 2AK3A 3T3HA 4DDUA 2ZJBA 2WSMA 4LXUA 2GXQA 3RVKA 3OZTA 4EHNA 3ZE1B 5HF8A 2J9GA 1E2NA 3I9OA 1QFYA 2WAAA 2C1ZA 2DWPA 2P4HX 4B84A 4YIKA 2BSQA 2H51A 1XPOA 1KI2A 3CRW1 3P2JA 3PUIA 4NF2A 3VVMA 2IY9A 1OXTA 2BZSA 3CO5A 4B32A 4PEVA 1C2YA 4ED9A 1IUPA 1Z0FA 4ALIA 4EW1A 5L40A 1U99A 3VUEA 5LXTA 2C3MA 1A2OA 3KFVA 1RLUA 1XYYA 1QB8A 1K7CA 2G9RA 5DGDA 1ZD5A 3GUCA 4KC0A 4V1CB 2ZXEA 3ND5A 3MT7A 1RAEA 4CM1A 4H16A 3DA8A 2ZB2A 1QB7A 2AGVA 3D3EA 4U6SA 5FQOA 3CCCA 2NU8B 2R4TA 1RWMA 1ICEA 3QTBA 1VCNA 1EVKA 2XUOA 1K4KA 3ZE8A 4LA4A 4BMSA 5A5VA 2R8ZA 5GJVC 4HGQA 3G1WA 4RTSA 3QVUA 4E5VA 4REQB 4ZVMA 2HO4A 3AEKA 4AUMA 3KYCB 1K2WA 5FL3A 4XEUA 1MORA 1C1DA 3G7UA 1VLZA 2QTGA 3L4EA 3MJRA 5JQGF 3ZLJA 2PH3A 1R6UA 2RBGA 2X8BA 3SZOA 3IPXA 3HYTA 3BS4A 4L9RA 3JPYA 1HDCA 1GEEA 1DELA 1NATA 2JFNA 4AYTA 4NPHA 4EFLA 5JQGB 1Z5GA 3CLKA 1X42A 2KM1A 1A7AA 1Z7YA 1I4LD 16PKA 1FU4A 1XG5A 4HEQA 5AP9A 1N25A 1NI3A 2HRDA 3NANA 1QV9A 4JUDX 3U3ZA 3O1LA 3PCRB 4BFXA 5EEHA 2DFDA 2E55A 4UBIA 2PUBA 2C5BA 1DSSG 4ARBA 2YJZA 4RHXA 3RHSA 2RJNA 4D3DA 4EG6A 1PR0A 3MFQA 4F1WA 4WVLA 1ZKDA 3JZMA 4V2UA 4QQ8A 3OWOA 1GZ3A 3GAMA 1Y3CE 3O4FA 4KQ1A 5EL0A 3RSCA 1NE2A 1HT2E 4JWTA 4KK4A 5A71A 5D3ZA 2X5NA 4IX9A 3KVRA 1JNYA 2A33A 3K2BA 3VNVA 5JJLA 4ECAA 4V0MA 5H59A 3KXDA 4DMHA 1AD2A 2LCIA 5FOVA 3GRFA 1VCOA 4OPMA 2PKXA 4A2PA 1QGAA 2ZBQA 3PG5A 2I7VA 4H0FA 2PKWA 3GEPA 2A8YA 2AFIE 2SHKA 4BB5A 4CCSA 3MUEA 2ISCA 4QDTA 1F8FA 5DI3B 3T52A 3D3KA 3WJAA 2ZI4A 3R6DA 4WY5A 3O8LA 5C46F 4AZ3A 4GOLD 4I5DA 2ZIVB 3M82A 5SY6A 4E13A 2OTCA 5A6VA 1WXQA 4MVXA 4TRJA 3R7WB 1U7DA 5ICCA 1KEEB 4NAVA 3PQ2A 2BZGA 3CG0A 2WFLB 3U6KA 2XYHA 5LR6A 3DMTA 4HRYA 2CXNA 1ICIA 3SHWA 1N6KA 5I7AA 3QPBA 3ZW8A 2MU1A 1ZO8A 4RIEA 5IX8A 3CPSA 5JAQA 4LDPA 5AM3A 1WLYA 1OZGA 5F2OA 1TVCA 2VUHB 3TJMA 1RJEA 2P68A 5BN5B 3B48A 1D8AA 5G3YA 2AQIA 1Y6GA 2NW6A 2GNPA 2DTDA 2KW5A 2PKQO 2XUDA 4I4TF 3LHFA 3ZGZA 2J5BA 3G0BA 5AH0A 4ZI2A 1Z8HA 1YTUA 1OGJA 1E9AA 1P91A 3OLYA 3HHEA 4RYDA 4MZXA 2HSDA 4QBFA 5BVHA 4IGFA 3G8AA 4DUGD 3LA6A 2VZ0A 2ONZA 5JO9A 2XMDA 4IH1A 1ISJA 2D06A 1IXYA 5DHSA 5IT9A 5BV8A 3GH3A 2EJVA 1J22A 4GOXA 3LLCA 4JEIA 1EI9A 3RKUA 3ZJUA 1QF6A 4J03A 5A4DA 4BNUA 4NARA 5GJWC 4PG8A 3QLVA 7ADHA 5E8JA 4BNLA 4DMCA 3NJ4A 2F9MA 4IQ0A 4OMFG 2IHVA 5LQKA 3IO5A 5ED0A 3TTTA 2PJZA 3Q87B 4NDZA 2EFHB 3AZPA 4LC1A 2GZAA 2FWBA 4V24A 3OMWA 5AKXA 1X19A 3SKVA 1DIOB 4AG3A 4BNVA 1QUEA 3DOFA 4PLZA 5HRUA 4HSGA 3RG2A 4A23A 1GG2A 2V6BA 3THOA 1YE8A 3UAGA 4D25A 2ZKIA 1V2HE 3GAFA 5C34B 2OXEA 4L5JA 3LBAA 4YX9A 1NYTA 2GD0A 3RB8A 4E30A 5HW0A 3AZOA 1IZZA 3GRPA 3V7FA 2PT9A 1M6HA 1ULUA 1RWOA 2GK7A 4KPUB 4MR9A 4W82A 1L4HA 4MWDA 2N46A 3BSWA 4L8WB 2WVAA 4Y2RA 3S70A 5BOVA 4R71A 4GM0A 4NABA 4X20B 1JEEA 4MRVA 3CN7A 1DC5A 1V71A 2VJCA 3OCWA 1SC4A 2FEAA 2ZSHA 2GZ3A 4KWCA 4PZAA 1HFKA 4R54A 4KMSA 3OZSA 3TEFA 3PFWO 4Z49A 4WXPA 4AAYA 1J42A 3KZCA 2QZ4A 5C1BA 4GGOA 2VPXA 2PMBA 3N70A 3WICA 1C7QA 1B41A 1NL3A 4RD1A 2WJAA 1FFAA 4OGFA 5EY5B 5CW2A 4OMCA 3SPXA 3Q7IA 3ZCQA 3A14A 4DCVA 5IZCC 1F8YA 2LCQA 3ZHZA 1MDFA 1I6LA 3D3WB 1Z35A 5DBHX 1YFKA 4D4LA 3O74A 3R0XA 4EG7A 4F12A 3WL6A 4YT4A 4Z53A 3NYIA 4FGKA 4D41A 4J76A 4YCSA 3B6IA 5JS6A 1L5WA 4PSKA 5CT9A 4P3NA 3ZTTA 5CCEA 3EFHA 2OM6A 5E9QA 3M1IA 4XQ0A 1SBIA 3K8QA 4CDNA 1R4NA 4LJLA 3K0AA 2AVNA 2IYFA 3JQQA 5LMZA 4KACA 2IOFA 3SDZA 3N6RA 3T9FA 3HCDA 4RDXA 4Z2YA 3HXMA 1QP7A 3OIFA 3QMWA 1AG9A 3AHJA 3BWEA 3EZ9A 2CLOB 3ZZMA 5JH7F 2YKGA 4LN1A 1IAVA 4MYSA 5CFLA 4RA9A 4MQFB 5EWLA 3SIPA 1Z5WA 4YXWA 1S1CA 3N1UA 1XGKA 2P9HA 1RQGA 3NBZC 2PS3A 3GUHA 3Q6MA 4K86A 2GLXA 2C5GA 3V32A 5H83A 1Y9DA 3M49A 4MARA 4DWWA 3ER8A 2AD5A 4YV2A 1UWLA 3KYBA 1RRVA 2QI9C 3IBYA 3VR4H 5AD1A 4BLOA 4C3VA 1GGFA 5DDIP 1XI2A 4IUBS 1KEEA 4JQOA 4ND1A 1XTKA 1N7GA 2P11A 3HBNA 1H5QA 3LX8A 1T29A 4A03A 4CF7A 4KRGA 3DVQX 1IONA 3RK1A 4TTQA 2Z4RA 1E6UA 3I6ZA 3H1TA 4R1QA 3N8KA 1YRWA 1J5XA 3A9RA 4HUJA 5LU9A 1Y7LA 5IBQA 3CLRC 1QGDA 1YCDA 2VPQA 2FK8A 4UU8A 2ZWMA 3WKCA 3CF4A 3TLAA 4PZLA 1RMTA 2CMGA 2Q2NA 1P4JA 4IFBA 1TCAA 4IICA 2GAIA 3KVVA 4A5SA 5B1IA 2P9YA 1T8YA 4GUDA 1BMTA 1E3WB 3ZI4A 4EK9A 4JLNA 1CJBA 1YMUA 3ZNPA 1JZQA 4W5RA 2QRJA 4LGYA 4BKUA 3F8SA 4BVJA 2V03A 1B93A 3GDHA 1D9ZA 3HSSA 3IJEB 1IBCA 1U2QA 3GLSA 1SUBA 2C78A 3DTVA 3HMKA 4RC9A 3VPHA 4UXIA 1OF1A 3WRYA 5EHZA 1ZWLA 4PTYA 5JO0A 1P0FA 3I8XA 1XDWA 2R25B 1UKVY 1VBNA 2BTOA 3IAM1 3KL4A 3VJMA 1ZICA 2V0CA 2O5RA 5ITZA 2QZSA 2RK6A 3CNEA 4JU9A 1XVUA 4E5KA 4C0WA 3JQGB 3F8WA 1E1CA 1TM1E 3EXIA 1LDEA 4R68A 4QVKA 1C1XA 3QVMA 4NYMQ 4DHWA 1WDKA 2ZUWA 4XM0A 2V7TA 3PR1A 4PN7A 2FSFA 3OQVA 5LYJA 4IBOA 3NWOA 1K6XA 2EX0A 2XE4A 4UUBA 5LCXA 2QHXA 1GILA 1NJ5A 2O19A 2A9VA 1TK2A 3PVSA 4PO1A 2VNSA 2XRMA 1HDRA 2Y9PB 3J81A 3JQ6A 1K5PA 3CIFA 1DWOA 1S3GA 2VWQA 2V65A 2ZWOA 1MX9A 4CL2A 5LWQA 1HI9A 3MYYA 3PCXA 4CLOA 3RU3A 4C0QC 2IF2A 4FXPA 4N48A 3S2EA 1XKLA 3KPJA 4F46A 4I3GA 3HYCA 2PUCA 3NXSA 1GDTA 2BFFA 3M6UA 2X0NA 2H0QA 3TPFA 1TIKA 3VDMA 1NIPA 4C5CA 1ENPA 4KL8S 1FVXA 4J0JA 2BSAA 3ZBPA 3QVWA 3KXIA 2JI8A 3H2GA 4JLSA 4KTVE 1G21A 1GKUB 1VRVA 2RHWA 2CLEB 4UTXA 4AT1A 4BVFA 1J5PA 3CKMA 5GJBA 1A4UA 1EUDB 2M32A 2P2DA 3KQUA 1Z63A 4M8SA 3BIFA 5ILQA 5K20A 3T61A 2AQ8A 4PC3A 1WMAA 2QAIA 1C0EA 1YR7A 3WIEA 3T7DA 3VSAA 4EGAA 4ER0A 1SOWA 4F5YA 1IOVA 4G86A 1QH8A 2GA9A 2PR2A 2YZGA 3BXPA 3EB9A 4PF1A 2IDMA 4YN3A 2X1MA 1XZIA 1I80A 3A7DA 1NFQA 3EWSA 1R37A 3CO0S 3E3AA 5DGIA 5EVCA 3DXFA 1GV0A 2PX2A 1WZEA 1EFAA 1MIOB 4B8ZA 4D0GA 2WWFA 5M34A 3HZOA 4JSTA 2OKGA 3G0CA 1A2BA 4RDIA 5FCDA 5FPPA 4CMHA 3O2SB 2ZTLA 3S4YA 4M8IA 4RPKA 3SHOA 4AY5A 1SD1A 1XD9A 3BWXA 3O94A 3U1BA 2ZZNA 1XEXA 3IP9A 3PWZA 3ZQKA 4NP6A 3TLXA 2PMDA 1ENYA 3UTCA 2N1MA 2PZAA 1OU0A 1VGQA 1CJMA 2IU4A 2FRDA 1ULTA 3DUFB 3GNTA 2VNKA 2OV8A 4LJSA 5BN1A 2XCTB 2ZRCA 5GWXA 4O4IF 1CZUA 3GX1A 2QL7A 5FUXA 3W3ZB 4K6OA 1W48A 2IYQA 3W1WA 2BFAA 2BGNA 3REQA 1W30A 5D1HA 5B3JC 2PWYA 3ETJA 4G89A 1FUUA 4WI1A 3D4OA 3NZEA 1CUSA 4HAXA 2BR4A 1RYHA 1W93A 4FD2A 3EJ6A 1ITZA 2OFWA 2IELA 3GLTA 4B9AA 5J4LA 2RGNA 3QVGA 2NZVG 2WZBA 2C31A 4PX3A 2NO1A 5TGDA 4JXZA 2PEZA 1JR4A 3K94A 1JXOA 2F3RA 1TQ6A 3B5EA 3PU6A 2GESA 3QNMA 1LNSA 4OA5A 3VPDA 3B9QA 4JC0A 2IS1A 2BISA 3DMYA 2XMPA 3I6IA 4DB4A 2JK1A 4IOJA 4PC2A 4DXDA 4ZMRA 3MCVA 3RTCA 1BRMA 2J67A 3V6MA 4HPJB 1FCJA 5EIAA 5L9AA 2YIDA 1O6GA 4QE3A 4ES6A 2IWHA 5IABA 2EZ9A 2I1VB 4DM4A 2DHQA 5MFZA 1YBMA 1GLGA 2FP4B 2GRJA 1U1IA 2CFIA 2R87A 3IBFA 3K09A 3QFSA 4IIBA 5EXEA 5INTA 4QYXA 2H5IA 3T5GA 1TECE 1ZGGA 3SQDA 1K6IA 3BD8A 4AICA 2K87A 1FRVA 5D3MB 2YXLA 4LRXA 1NAIA 2CHGA 2A9JA 3E81A 2C59A 3CHYA 3LQ4A 4IMPA 4QTZA 2K7ZA 5LP6C 4F71A 2R1TB 4DQDA 2PNFA 3AJ8A 3VU3A 4JI4B 1TZ2A 4R4JA 2I4IA 2HX1A 3KSZO 1Q0HA 4X7MA 1L7EA 2W2TA 3E3LA 3SSNA 4NS1A 3WK5A 2WVGA 4F21A 4MDFA 4WA8A 4CM3A 6ABPA 2IIQA 2B4QA 3UKOA 2GX6A 4CKWB 4PIMA 3W0LB 3L4KA 4IZ6A 2VEOA 2ZRLA 2W2XA 2JIPA 3CMMA 4NH4A 1WU8A 2YDYA 1I9CA 4HX2A 3A4TA 3FB1A 3TECE 3C3JA 3PGKA 2RARA 1HT1E 5A0FA 1E3MA 3IEPA 3A37A 2LNDA 4J1TC 5A3RA 4JUFA 2IS4A 3GYGA 5H68A 1KO4A 3A3NA 3CZMA 3OLVA 1N1EA 5BOSB 3EVBA 3I34X 4WZBB 4YQFA 2Z9DA 5LBIA 5K3OA 2UZ1B 5C0OE 3E22B 4BMZA 3MD0A 5J23A 3PQ8A 1E5XA 3GT4A 4BRSA 4UM5A 4CL3A 4P35A 3H5OA 1N9GA 1GUBA 1WMDA 4TZTA 2VIIA 4X65B 1WEKA 3CZPA 1G8PA 1Q7EA 1I6WA 1QP8A 1BX0A 2C0CA 2WB4A 1U7WA 1DXQA 3ASUA 1IY1A 3QVXA 4JP5A 4BNTA 1GR1A 2BMFA 3A36A 2JAUA 1LV8A 1U2GA 2PBLA 4DBLE 4YJ2A 2UUOA 5JVDB 3PPIA 1IN4A 4N76A 2Z2YA 2OYSA 1RKBA 1NQTA 4C6TA 3HXKA 2HZ7A 3KDAA 1KI3A 3RTAA 2YX1A 3COYA 3BGDA 5ALFA 4Z4FA 3JQFA 3HNRA 3KJFA 1YZVA 3L7MA 3V8NA 3HUDA 2MINA 1HZZA 1JUDA 2O2JA 4ALNA 3GCZA 2LKCA 1RXVA 1OXMA 3DEYX 4FFBB 4LOKA 1GPNA 3HL0A 1R0XA 1CERA 1MZVA 3RLIA 2VJLA 4KIUA 3VJLA 4Q1AA 1ZR4A 4GEKA 4DEYA 4YJFA 4WDQA 5AI0A 4QL3A 3FUCA 3EW9A 5D84A 4MLCA 2DT5A 2FW8A 2XNSA 3JWPA 4WZAE 2Q8QA 3M34A 4HR7A 4JB3A 1D04A 5A7GA 3AR7A 2HU8A 4KFCA 3OZFA 5D3MA 3ZVKA 4TRMA 3QEAZ 2JEZA 4NV0A 1UOQA 3Q7RA 4RIHA 3K8ZA 4RJKA 3FYUA 3II6X 4NEQA 3QXSA 4RLFA 2R6GA 2X9GA 1A0OA 1N4DA 1V7ZA 4X71A 3VKVA 1KWKA 3EW7A 1W52X 3P4YA 3R5FA 4XVCA 2XDWA 1VPWA 1HG0A 2ZS9A 5EWMA 2I0FA 3WMRA 2CZGA 2PN1A 2RAPA 2D1YA 4F11A 3QIVA 1E8DA 1U4SA 2PX4A 4DLAA 4FFWA 3TIIA 2XQFA 2Y0DA 5KQSA 4D26A 4D5GA 3B1ZA 1LPAB 4EY5A 3IVCA 1NSFA 2B4AA 2EL9A 4ZEXA 4Y98A 5IULC 1DCTA 5LL6P 1Z8FA 1M2VB 3C8HA 4CLEA 3LS2A 4G09A 4OVKA 3K1AB 1LJLA 4E09A 5IDQA 2VP4A 2GEKA 5JMOA 4AJLA 1V16B 3ENVA 1UBRS 1UK6A 4BEBA 4BMYA 2ZWIA 1E9DA 1R5JA 1AA6A 2NVBA 1L5QA 1OXSC 3JWIA 1V3VA 1CP2A 4AJJA 4JQCA 5HX7A 2PGDA 4DCJA 1H42A 3ILYA 3HE3A 3KU1A 5IP5A 3MOIA 4BPBA 1A8UA 4U7TB 3G2HA 1A8IA 1U6KA 1AF4A 2GHRA 3EZ2A 2MMCA 1GNTA 4I36A 4Z6KA 1Z0UA 2DETA 1VLMA 1N78A 1CJSA 1DC4A 3CVYA 1P2DA 1MO4A 1CUAA 3CB2A 3EEIA 5JMPA 2O6HA 4WE3A 4FDLA 3OE4A 1AKVA 1HYEA 1OJ7A 1GTL1 3KQYA 4RF4A 5DHTA 2J3DA 1Q7CA 1P5RA 3G79A 1ZH2A 1R6VA 3HO6A 2PMCA 4NV3A 4OQEA 2WLTA 1TAGA 2ONJA 3EOZA 3IIJA 3KUUA 1JHOA 5JALA 3AR8A 2IITA 3H1GA 2RONA 4N1AA 4TKUA 3AVTA 1KKLA 2F9FA 2HPAA 2JPDA 2ZTHA 2RAUA 4EB3A 2JFPA 4UUAA 4U5QA 2EFDB 3ANSA 5DRTA 2WWRA 2JH8A 4PZEA 4FP9A 4X64B 2VJQA 4PNHA 4D46A 4BC0A 3ZCSA 3O6VA 2W71A 4BVGA 4U7WA 3P9IA 2WMOB 5MF6A 4WT7A 4AJ2A 1CF2O 1NVDA 1UFQA 2DT8A 3SXUA 3B5IA 2WTMA 1KXZA 3OEYA 2CDBA 3QOWA 4F86A 4O6VA 3L6OO 3TBHA 2JFUA 1DDOA 1JHVA 5FRDA 1KOGA 2GCOA 1NQUA 2ZAOA 1KZYC 5ALVA 3BXEA 3K6JA 3I39X 1ODTC 1LVGA 4NI5A 1V4VA 3HUUA 3AR2A 3X1XA 4EHHA 3O3CA 1ID8A 2P40A 4N5LA 5TQ2B 2X9LA 3A6LA 1GZVA 4JGGA 4K6FA 3ZQUA 1R9GA 3QA3E 4BV8A 3FF1A 2MDTA 2OZLA 2W6CX 2XQGA 4AQ7A 1B43A 2IUSA 3AF0A 3FY4A 2I4TA 2YHIB 3AI1A 3JAWA 1NBMA 2HXYA 4MQMA 2JJ2D 4X91A 1PNOA 2R1VB 3UY4A 4P2BA 3VR0A 2FMUA 4DV3B 3RRBA 3WGYA 3ZGOA 2B99A 3LZ6A 4NBRA 5CA1A 1N2OA 1UBUS 4FZ5A 4FOOA 4WCDA 1PFUA 4BLRA 3CUUA 2W42A 3RVBA 1NC3A 1WSAA 2A94A 4M4SA 3DWIA 5IEBA 3GBPA 4JXXA 2ORED 3T3OA 1ORDA 3EIXA 4A0SA 4UUOA 3BE8A 4O2RA 2XMZA 1CDOA 1YBFA 5TE9A 4Z4HA 5JS1A 4OY3A 2KWIA 1CW2B 5C51B 2VAPA 3ZVLA 1P45A 4UHDA 1NRIA 3OFNA 1I4WA 3PQ7A 4IEFB 2VZ8A 4F96A 3EVEA 1GRRA 5D3KA 3RABA 2Y1GA 4ENTA 2XYRA 2EBFX 3FGZA 4G84A 2IYVA 3BRQA 3E5RA 3DQZA 3MXOA 2I3ZA 2OQVA 3B6JA 3GMDA 1H05A 4BCCA 1OV4A 3HVJA 3I6YA 1EWQA 1T2FA 1TD1A 1U2ZA 2G9UA 1BOOA 3A04A 1KI8A 2D2IA 3FB4A 3MNFA 5HF9A 3HA3A 1E3WA 3ROMA 1NF2A 1T5IA 4LVOA 5LA6B 4ND8B 1I01A 2OAEA 3C6KA 3ISTA 5EXSA 5LD2C 4R2XA 4C30A 2VA9A 3CNOA 1NNUA 4Y1GA 3I0MA 2YBEA 3AJEA 3ORQA 2VRCD 2YWDA 2MHCA 2BRUA 2XDQA 3GXBA 3JQEA 4HFJA 3VKGA 2ADMA 1OWOA 4PG7A 4LYGA 3GFRA 2HZBA 1SRQA 1YZKA 1EG2A 2HA6A 3R76A 4HRAA 4EF4A 4CXMA 1EFVB 1I3LA 4M7RA 2QM7A 4UCXA 1VPLA 2C2HA 2VRNA 1HYQA 3PIDA 3CZ4A 4KUGA 3DOIA 4RNDB 1PK7A 4C5AA 4C88A 1R4MB 3NWPA 2ZWVA 4GGMX 3IMCA 8GPBA 4FMCF 2JLUA 4PIVA 1QAMA 1NW6A 4P53A 1E4YA 1WX1A 1K8QA 2C2OA 3R44A 2DFKB 3U7QB 3NB0A 2XNDD 4AS3A 2G3YA 2AE1A 2Q41A 4ZYZA 1XCJA 2AHOA 1TKAA 2Q6TA 1SA0A 2V6GA 3NKFA 4XWAA 1T1EA 3L40A 4N8SA 4FDVA 1W8DA 1F3OA 5SYNA 3WLNA 4EG8A 3GEBA 1I3OA 2AN5A 3P2OA 4CW7A 3P96A 4DRXA 2K2QB 1Y8AA 4RF2A 4YACA 2DH6A 3MPOA 4H4CA 1ULAA 1MXHA 4YA6A 3KSUA 3NWBA 1YQWA 2DHRA 2TRSB 3SBEA 3ADDA 1ABFA 4D56A 1QONA 4ZKEA 1ZNWA 2ZJ2A 4M38A 2WU8A 3A4YA 1KR2A 3WAKA 1AK2A 2MR5A 4HUQB 3DYBA 2XCOA 4Z8XA 1W0JA 4KXMA 2BJHA 3D3WA 5TXGA 2ZAYA 5EJ6A 2Z09A 1L3BA 1CQJB 1EQ2A 2VFAA 3NGXA 1E61A 3PF8A 1CNFA 4F5WA 4K6CA 4YMLA 4FKZA 3JXEA 3FDIA 3ZZTA 1C30B 4MUBA 3OE7D 4JLKA 4HYTA 4EH1A 4KRXA 1XMPA 4RV4A 3MMPA 3NQ41 1QAQA 3G8CA 4MYTA 4QYTA 5H3HA 5AVQA 1KK3A 3D8RA 4R8LA 4BVKA 1EBBA 1Z39A 3Q3IA 2LDBA 2QTLA 2ZRMA 5SY4A 4DMUB 4GP7A 1QM5A 2IF0A 3PRJA 2OVBA 1NW9B 3CT4A 5EG5A 1MJGA 2D2XA 2GXAA 1BDJA 3WOHA 5FLXA 5GONA 4MYHA 5L51A 3ORRA 4B74A 2WJ3A 1B26A 2QW1A 4I4TB 2HJSA 2JA1A 4L2IB 4EFMA 3SZ3A 3CU5A 5C31A 1VL2A 4NHEA 3MS4A 4KPUA 2WMDA 2ZCJA 1U81A 3G5AA 5CJ2A 1MKYA 3RR2A 3U44A 4E5PA 2GB4A 4BNNA 3UNXA 4GPD1 4LRYA 5DWQA 3WHIA 1POXA 4B6EA 4MRRA 5JT1A 2VQ3A 2JVIA 4G9EA 1TIBA 4N41A 2W6ZA 1EJ6A 4INJA 3C5HA 1NVMB 4U2EA 1V5IA 4FDUA 3RRZA 5IN5A 1OKKA 2J7KA 2VVTA 4J4TA 5JV5A 5CVEA 3EVAA 1G41A 1UDAA 2X4LA 4U00A 3OZAA 4Z3KA 4M9QA 1XZCA 1XNQB 2X8AA 3GZNB 1E7YA 4H3SA 1XAGA 2PSSA 3PNQA 4JXKA 2H2IA 1X1DA 4Y9TA 3VDQA 3E03A 4JQSA 3WRXC 5BPHA 1ZUNB 2LUOA 3LLVA 5DYGA 2B9EA 4MV3A 4TUYF 3SHQA 4FINA 1V1RA 4B34A 1NX9A 3PIRA 4M3NA 4TLAA 4F38A 3BRWD 1ZVJA 1PJQA 2D4HA 4B3XA 2VI5A 4JQYA 1OH7A 2X2OA 1KMMA 2BKLA 4YB8A 2PG3A 1C41A 1CDZA 3OCJA 1FDRA 1B76A 1XEWX 4ZC1A 1JSLA 4BBZA 3GLFA 3EHDA 5BN5A 4GM4A 5CFOA 3A9SA 4MS4A 4F9TA 1TKBA 2VHUA 4ZAZA 2BC9A 2BBSA 2O50A 2C83A 4ZCRA 5B3AA 2W8BA 3MW8A 5FPYA 3THXA 4HCJA 1IATA 1JB9A 3L7OA 1KAGA 3KKZA 1K7YA 5LYYA 3FKQA 2OHGA 2QKYA 1MJNA 4CIWA 3THXB 3OE1A 1ZR2A 3UCFA 1B8NA 1PJSA 2QQEA 4QRIA 1GUFA 3BGSA 2XXJA 1B8OA 4BL5A 5FP0A 3I92A 2I34A 3F7MA 4RU1A 4QHSA 5IJ9B 4NCIA 4YAKA 5J2TB 4RXMA 1B00A 1KP3A 5H81A 4AM8A 3DO6A 1U28A 1GDHA 5TDHA 2W6ID 1GVNB 3OSZA 2CW5A 3BTUA 4G4SP 1BFDA 1V45E 2P6PA 4HD8A 4E4YA 1NHWA 2EEPA 3O75A 3AM1A 4P3KA 3S1AB 3W5IA 2ZSAA 5F77A 2VJMB 1PJCA 1MP0A 2IH2A 3LPNA 3W6OA 3F74A 3HB5X 5CVTA 1U8UA 4KLCA 1C5KA 2GN9A 2OAQ1 4E51A 4KKXB 3Q7SA 1KH3A 3A6JA 1L7XA 4IVNA 3ZE2B 1PW7A 1BVRA 1EVEA 2RI6A 3CURA 3A4NA 3AQ4A 3EY4A 3OJFA 3HLTA 1X80A 3QLUC 2FQWA 4GWGA 3H0EA 4HGZA 1L5LA 4OGGA 3P52A 2QLFA 3ASZA 4H3HB 4KW7A 1NVAA 1NJ6A 2XD9A 4PCAA 4KRFA 2WIKA 4YRGA 1JMKC 2H2FA 5KYKA 1CR4A 3UJNA 4ARZB 1O9GA 1KJWA 2F59A 4MHSA 4YLYA 5JLJA 4CQNA 3PDIB 9GPBA 4ZU1X 4ZCQA 3D1VA 1S2GA 2PZFA 1V5WA 1K1EA 3C8DA 3F4BA 5YASA 2B1RA 3ESAA 4OUDB 4KVZA 4HGRA 4C1NA 4IQ4A 1LPMA 2ZULA 3I5AA 4LI3X 1Y8RB 4AUEA 4GI2A 1MX3A 4KO3S 4YCJA 4A7PA 5KSWB 5C4GB 3CF4G 4YWHA 1U7HA 2ATCA 4J2HA 5EIBD 3ZGXA 1XTJA 5AVOA 1ONPA 4R1MA 2NU8A 3LYAA 4EG4A 3MLAA 2NO6A 1QWOA 4HATA 3RS2A 4D79A 1OZHA 4J16A 1IJFA 1EP3B 4EY6A 1KI4A 1IWBB 3B85A 3BL6A 4FJ1A 1L5VA 1TZJA 3NM5A 2PY6A 2QDXA 4E46A 3OIGA 2OQRA 5ERYA 2E9SA 1RPNA 3AIIA 2OC4A 3ZJYA 2WKWA 2O0HA 1N2CE 3AOGA 3L4SO 4U9IS 1XNJA 2HUPA 4D8UA 4L7VA 1ZGAA 1M0SA 2CE2X 2SNIE 3E15A 2XUGA 2Z83A 4R8VA 1Y7PA 4ZQFA 3SHFA 1NRXA 3V8VA 5CIYA 1WWKA 1AUOA 4MLZA 3KT6A 4UNSA 1KIMA 1Z3CA 1M34A 1SHTX 3HJRA 1RCFA 4IDGA 4X1OA 3CLTD 1AKEA 3EXHB 3V8MA 2D5LA 2ZSUA 4AJ9A 1M2OA 3TRHA 1DC6A 2OAGA 3OZ7A 3K32A 1NGSA 5JRJA 3D6AA 5L3SA 2Q3BA 2GZMA 4GXRA 2IY7A 1MVNA 2Z1NA 1JG2A 5DHFA 2I2XB 2ZP1A 2FP3A 5I3ZA 5G1OA 5LQUA 2Y68A 2ZRFA 3AJ9A 2JARA 1ECGA 2FEWB 1HE3A 1W34A 2HWWA 4OKIA 3ONNA 5KNLA 1FFDA 4DIMA 1CQIA 1J8DA 1O95C 5HFJA 4B46A 2W11A 4FB4A 1WW8A 1OKKD 2IA5A 4GZLA 5JUWA 5BR8B 1NNSA 4EFNA 2AUTA 1U98A 3E2MA 1BKYA 1X7DA 1SQFA 1T8RA 3EZFA 3LX4A 3AVWA 2QAGC 1SQ5A 2QJOA 2YFHA 4B40A 5CNMA 4ZMBA 2OD9A 2P0EA 2H59A 3P71T 1A2KC 2J08A 4MPDA 2CLLB 2NSHA 5E8RA 5EMNA 2DY1A 1NUPA 5L7WA 5FWXA 4DV6B 1PV4A 3TDKA 2G28A 4Q3KA 4AVYA 5ALPA 5IKOA 3RYFB 1DWQA 4TMYA 3OF3A 1KTIA 1ORTA 2GWHA 5DGCA 1X7XB 1ADBA 3QE4A 4FEYA 2V54A 2YZMA 3LQQA 1VSQA 3ZY2A 4B82A 4KMOA 1HLDA 3FD8A 3O3NB 3NHLA 4MS1A 4QU0A 3JWHA 5HZKA 1WRBA 2NO5A 5LVAA 2V7QA 4M21A 5KMGB 1U0JA 4E2YA 3HUEA 1MNAA 5B6JA 3PFIA 2W2PA 2AYYA 4WHMA 2AEJA 3DE5X 4K8OA 5SZIA 2Y27A 2X0DA 5IARA 2DQKA 1R1DA 1NJ2A 2RGWA 3TLGB 2WTAA 3BREA 4IMJB 1PIWA 2CHEA 4RJIA 7YASA 3L41A 3H9JA 4F2HA 4JOCA 3GIDA 4YQYA 1W85A 4ZCSA 4B33A 4QUHA 4HK4A 1ZZEA 2H1CA 4I1SA 4DLXA 1BMFD 1O58A 1XCOA 5EJFA 3TQRA 1ZM7A 2R6CA 1F9EA 4TTTS 1BMQA 3PC2A 2Q8NA 4KP7A 3X2FA 1IWPB 2JH3A 3ADPA 3TQQA 3CPEA 2DSNA 3KT8A 2WRZA 4IDBA 2MSEB 1YQUA 5CX1A 1WZIA 4OX9Y 1OFUA 1TYDE 4JIGA 3O2NA 4C7OB 2XUIA 3H2SA 1AHNA 3WADA 4AKEA 5HCNA 1FTSA 1U8XX 2PWBA 1JEQB 2WYVA 3O8NA 3PJDA 4ZT2A 2AW5A 3D7LA 3EIHA 2G04A 4URWR 3TL3A 5KYNA 1DXHA 5I47A 2Z1DA 3GCWA 4OGLA 1HYBA 2AXQA 1MFPA 5B3LA 1XELA 5J2UB 1KVRA 3ME5A 4KDCA 2VTDA 2XUJA 3ABRB 5EWJA 2W93A 1CF9A 3A6DA 3ZWPA 3HY4A 1UOOA 2VJDA 3GIWA 3OD5A 1L8OA 3OPYI 3EF3A 1C4KA 2DFVA 2NZ2A 3HKCA 4YY3B 5BRNA 3M6XA 2B1IA 4I81A 4QA9A 4IZOA 3FSGA 3SR3A 3EAFA 2FJPA 4EHAA 3IPLA 2A9FA 3ED5A 2Q5QA 3OEWA 3OHMA 1YJXA 2PH1A 2YBDA 3H84A 2IZ7A 4M0EA 4N6NA 4PBRA 1KGDA 4E5YA 1N5MA 3VPSA 3PNKA 2DB3A 2BFDB 3HN7A 3CNLA 3K0FB 4YR9A 3M1LA 3D4NA 4PZCA 5EN4A 2Q1YA 2VNHA 3P0HA 3AOEA 5EPUA 3HJAA 1XA4A 3L6BA 4YMSA 1U0BB 2CUZA 2O2DA 3KZNA 5LJLA 1GT6A 3I01M 2REXB 3BMOA 1F4PA 1KYVA 1KO7A 5AJUA 3GGOA 1BDMA 2OOKA 4OFWA 4WLUA 4MKFA 2MSNA 3JQBA 3VPFA 1EVYA 1APBA 1Y89A 3CX3A 1Q0QA 3LX5A 3N07A 4RWZA 2PKYX 3G3EA 5EUMA 2V9CA 1X2EA 2Q7XA 4HQLA 3W78A 4GKKB 4M83A 1B73A 1GFWA 2YOGA 3TSCA 1J0AA 5AICA 1KEZA 3H5IA 4XWYA 2CJPA 2HYDA 4FKBA 1JQKA 3K30A 1T5BA 1V6SA 1NG9A 3GZ4A 1J9EA 3ODPA 4FR5A 4RPHA 2NZWA 1JJFA 1TLTA 2YYAA 4DA8A 3D8SA 1QG4A 5A4MS 1RHUA 5TQVA 1ZZGA 1FNDA 4R1OA 3ITDA 3GFBA 1FP2A 3L9XA 4RZUA 4OJYA 5KNBD 2ETXA 2TMDA 3TEMA 4FYHA 1LBEA 3ITNA 4X24A 5B7GA 4DCNA 4MWBA 5ENDA 4RXUA 3V4RA 1XT6A 4NBLA 1XVAA 1CY0A 3LYLA 2WMYA 5FT9A 2QTWB 4OOFA 3HCRA 5G4KA 1FW6A 1D4OA 1SVLA 1LPPA 3PXXA 4UPVA 3H4TA 4ETWA 3V8QA 5ALLA 4UUMA 4Q82A 4LYHA 4OM7A 2ZJ7A 3PLNA 3AUYA 5JSFA 2VPPA 4XTCS 3R77A 3R8CA 3WYCA 1D07A 1AU9A 1DAMA 1OGIA 1V16A 4BGIA 4ZEVA 1T2VA 4F3TA 1MO2A 1XLTA 5HMMA 3CGGA 3I32A 4IJKA 1QHYA 4MVJP 4EGJA 1EVQA 1T36B 1TUBA 2HGZA 4QXAA 4OXRA 4F6LA 2Z5FA 4NYIR 2IDZA 2PR7A 1COWA 4OMUA 2JW5A 2WT4A 5LC1A 2QUBA 3MUOA 4KBFA 4XLTA 1DEOA 4YJDA 1XNHA 3TLEA 1JFFA 5JMTA 2W90A 2BUCA 2PRZA 2GKSA 5C8YB 2WZQA 1C29B 2W6JD 1R50A 4IF4A 3Q7TA 2QTVB 1BGXT 4QOIA 2AJLI 1BG6A 2FUG1 3DYIA 4DIDA 5MGNA 1PU2A 2QXUA 4ENUA 3U62A 2XWSA 5DSTA 4K9NA 3ZVMA 2HD4A 3SQMA 3OZXA 5E4JA 3IE1A 1KY3A 3O3OB 2OB1A 1FS5A 3TZ6A 2G76A 3QVOA 2FWJA 2A0WA 3BK2A 3DFMA 4GRAA 2H4FA 2Y2UA 1KAHA 2QP9X 4KJZA 4EI7A 3T99A 2EF1A 3TVTA 3RT7A 5AOVA 4UEOA 4B7ZA 4G0YA 3BQ9A 4L6IA 3CVOA 1P6XA 4JBNA 3DHNA 2CE7A 3V7UA 1YH3A 4NV1A 5CBPB 4RA6A 1JDJA 1Z6TA 3U4IA 3ZDXB 3RV4A 4BQOA 3IALA 1L4UA 5FHRA 1T3LA 3BGWA 1Q1QA 4ZDKA 1DEAA 3GFSA 2II6A 3QI7A 5HILA 3VU9A 4BO5A 2PLWA 2G1KA 2E18A 1SRRA 1ULSA 4Q1FA 2QQ0A 3HBJA 2GM5A 3WIBA 1O77A 3K2EA 3O4GA 4J4HA 5JBQA 3JVIA 3K5PA 4TVSA 1H2RS 4F92B 3GUUA 3QWAA 2B0CA 2DJIA 1PG2A 3EIQA 1QQTA 4L95C 5E7IA 1ST2A 5H0IA 1U63A 1K63A 2BM8A 3BCRA 2C96A 4V2IA <