3QPDA

Structure of aspergillus oryzae cutinase expressed in pichia pastoris, crystallized in the presence of paraoxon
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
187
structure length
186
Chain Sequence
b'LTGGDELRDGPCKPITFIFARASTEPGLLGISTGPAVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIAEAQGLFEQAVSKCPDTQIVAGGYQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQERGQIANFPKDKVKVYCAVGDLVCLGTLIVAPPHFSYLSDTGDASDFLLSQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cutinase 1
publication title Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 68
structure length 186
sequence length 187
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qpdA00
2VAVA 3D2BA 1AQLA 3PI6A 3GFFA 3FYUC 1WPRA 3H1AA 4TPKA 4N8DA 1GQRA 3ZPXA 4G9GA 4H35A 3STVA 1IUPA 3G7NA 3IB3A 2JBWA 5DNVA 2O7VA 3ED1A 4OU4A 3HLKA 2R8BA 4C6HA 5AKLA 3FSGD 1O6GA 2OLEA 4UBLA 1XQVA 2QM0A 4X6XA 1N8SA 1BEZA 3WKEA 2PSEA 3T4UA 5EIAA 5F4ZA 4AZ3A 3F67A 5ALIA 4WJLA 1QO9A 4HTAA 4Y2UA 3WA6A 4LYEA 2ROQA 4KE7A 4ZXFA 2PUJA 4AZ0A 1G66A 4ZRDA 5T4EA 3VJLA 4L0CA 1MPXA 4BP8A 1HDEA 4GXNA 2HA2A 4PSDA 4Y2SA 1T4MA 4B80A 2HA3A 1GQSA 1BEEA 2HRQA 3V1LA 3I2HA 3GROA 5DNWA 1JU3A 5AIBA 4EA6A 2QUBA 4JH0A 4C89A 3N0TA 3HABA 2DSNA 4AO8A 5HF6A 1JU4A 2FUKA 3I1YA 4RE6A 4QA9A 2VJCA 3E4DA 3L1IA 1WB6A 3LCRA 4JNCA 4QDTA 5LZ8A 1Y7HA 5CH3A 2XMQA 2WILA 3O0DA 4DMKA 2WTNA 2ZJFA 1VJ5A 3C6ZA 5CH5A 3FLEA 1C7IA 1IZ7A 4X6YA 4BCCA 2PPLA 3JW8A 1THGA 5AM2A 1XZBA 3FSGA 3RLIA 2WUEA 3HC7A 2OG1A 2WTMA 1XRQA 2Y1KA 3ZLVA 4CCYA 3FBWA 4UHBA 2IX9A 5C8XA 3PUIA 2OCIA 4B85A 4BVJA 4P08A 5AO9A 3C8HA 1DINA 3FLBA 4G9EA 1VZ2A 5EIEA 3MVEA 1ODCA 4KE9A 1W6RA 3PUHA 3DNMA 4NZZA 5ALJA 4CCYB 3FWHA 4PW0A 1YSCA 4GLBA 1FFCA 5AOAA 5FDFA 3BXPA 5JZBA 4B0PA 5JIBA 2K2QB 2XQGA 3UUFA 4BC0A 3G0GA 4X71A 2BJHA 1XRPA 3HYSA 2GYVA 1IMJA 4KRYA 5LYYA 3AFIA 4U2CA 1FFBA 1LBTA 3D2AA 1LPMA 3WJ1A 2QJRA 2RONA 2QXUA 5AH0A 3LP5A 1L7QA 5ALPA 3CCCA 4GWLA 2Q0XA 1PV1A 1BE0A 4F21A 1MN6A 5FXMA 1ZD5A 4XVCA 2H7XA 3C5WP 4W1SA 2PM8A 3O95A 3AIKA 1BS9A 5HK8A 4N8EA 4YASA 4UBMA 1F8UA 5K3BA 1DX4A 5EHQA 5C81A 5AK5A 2VAXA 4D9JA 3W2TA 5AI4A 3QM1A 3L1HA 3BL8A 2XMSA 5ALTA 2EEPA 1GT6A 1GXSA 3ESAA 3QITA 2ZYSA 3PF8A 1Q0ZA 2WJ4A 1LPNA 1ISPA 1N5RA 5ALEA 3R0VA 2BUBA 5IVIA 4CIAA 5AKHA 1XZGA 4OUKX 3WMRA 4CG2A 1SOMA 3DOIA 3C43A 3G0DA 4E14A 5K3AA 3KOOA 2XLCA 5JAOA 4GW3A 4BTVA 4KAFA 3JYHA 5K5EA 2VQ6A 4J0JA 1NU8A 4B81A 5HK9A 1CUUA 4BCBA 3PICA 3A2MA 3FVTA 4V2IA 4AO6A 1MNQA 3IUJA 2HADA 5I9IA 2YXPX 2QMQA 2JF0A 4U2BA 1IUNA 3STUA 1ZJ5A 3QMVA 4FLMA 1GPLA 1CQZA 2XLBA 4BVLA 1BN6A 2WUFA 1QIJA 2OGZA 5DTJA 1UT6A 1T2NA 4ARBA 1ZICA 3I2KA 2XUGA 3WK4A 2H1IA 2XE4A 5CXXA 4AX4A 3G0BA 3AILA 4DNPA 1QIKA 3D5EA 3H17A 4DLNA 5JYCA 3VKFA 4JYPA 1EX9A 5AKXA 1EINA 1EDBA 4HXFB 1GPNA 4J0HA 5ALDA 5D7BA 1XZIA 2WM2A 2RAUA 3BDVA 2G5PA 4LHEA 1WCYA 5CBKA 1DTEA 1XZJA 2ONCA 4X95A 5AICA 1DQZA 2JEYA 3D0KA 2JGLA 4DIUA 5DTIA 2GZRA 1LGYA 3IVMA 4LXIA 4MXDA 3M82A 4AMZA 2D0DA 4JUIA 1YA8A 2WFLA 2JGJA 3STTA 4K5QA 4DMHA 4H7DA 1JJFA 2PSDA 4J7AA 4MWSA 2BCEA 4PNZA 1BU8A 3H2GA 2XDWA 1PFQA 2ZJ6A 5KWJA 2OAGA 2RGUA 3WIBA 2WFLB 4W63A 4FFVA 1LLFA 4FOLA 4IH4A 5AI9A 3C6BA 2JIDA 1X2EA 2J4CA 2GBIA 3DL4A 5CH8A 4F0JA 4EB0A 4Y2VA 4H7HA 1YS2X 2E3JA 3HJUA 4ZV9A 2OQVA 3LS2A 3BDIA 3KSRA 1EB8A 5FOQA 4BDTA 5JZSA 4KEAA 1I6WA 4ITVA 4QWWA 1WHTA 1XFDA 2CUTA 3G9TA 2OGTA 2WU4A 1MX1A 1VA4A 3N2ZB 4EY8A 3NWOA 4UHCA 3STXA 4N8SA 3ICVA 4X00A 3W04A 4BRZA 4DMFA 3BF8A 3I2JA 4AB1A 1HKHA 2QR5A 2XUAA 2WUDA 2DQYA 1ZGBA 4ZGBA 3G9XA 1ZIYA 5HF9A 3AZQA 2XUDA 4WY5A 2XMGA 3ZV7A 1EDEA 3C8DA 1A8UA 1K63A 1NX9A 1EHYA 4Y2XA 3PDCA 4OSEA 4A16A 5KREA 1OILA 5FV4A 1EK2A 1ZI8A 1EK1A 3O4IA 3R3XA 3WWEA 4KJXA 2WU3A 3T52A 4DM7A 4QDXA 1CUAA 4LXGA 2DQZA 4K6GA 4BBZA 2FX5A 4WFJA 3FVRA 1YAHA 3WKBA 1BCSA 2ACEA 2WFMA 2Y2VA 4U2FA 4X85A 4KE6A 5AM5A 3I6MA 2VATA 3F98A 4MJ3A 3WWPA 3WQHA 5EFZA 3H0CA 4BRSA 4DSZA 5JZ9A 1KEZA 5ALNA 1CUZA 3FLAA 1XKLA 1K8QA 1EDDA 2XQFA 5ALVA 2X76A 3M83A 5HCUA 4B7ZA 5CXUA 3IULA 2QXTA 2C0PA 2XUOA 3VVLA 2PBLA 1VE6A 4DNQA 2FJ0A 4UHDA 2WUGA 5ALFA 2HHAA 4PSCA 4F5ZA 4G4JA 5AM0A 2X5XA 4QZVA 2NW6A 3NUZA 4K6HA 1CUWA 4YPVA 2BGNA 3IUNA 1JJIA 4UUQA 1SCQA 3Q8WA 4BB0A 4WDQA 3O9VA 3E1GA 2VEOA 3H2IA 1YR2A 5C8VA 3DQZA 3O4GA 2CEKA 4WFKA 4WCVA 4GECA 2VT7A 1XZLA 1AURA 1YAJA 3WYDA 4EY4A 1MX9A 4CFSA 1QFMA 2QRUA 2D5LA 1Y37A 4G8BA 5DYTA 3WKAA 1J06A 2FJPA 5CMLA 3TRDA 1QE3A 4X7BA 4CI9A 4CG3A 1XRMA 3VXKA 3WYNA 3ZI7A 4B84A 3AZPA 2XUHA 4C88A 1UKBA 4LKOA 2HFKA 1A7UA 1ZD2P 4C01A 2WHQA 3PFBA 4IH9A 4RGYA 2O2HA 2XUKA 1MX5A 3AJAA 2PSJA 3CXUA 4UHFA 1AZWA 1ZIXA 1WHSA 1XLWA 3LIPA 3ZLTA 4AN0A 5BV7A 1WM1A 5HQ3A 1YB7A 1CUXA 3V48A 4OB6A 3WL5A 2B20A 1YA4A 4OD0A 1QJ4A 1H2WA 3BJMA 3D7RA 5HQ3B 1J1IA 1CUHA 4MYSA 4MQMA 1A88A 1XRLA 3S8YA 2AXEA 1CUDA 4Z49A 1ZD3A 3UUEA 2XUQA 2Z3ZA 3GBSA 4PV7A 1CUJA 5IVKA 3BWXA 1ODTC 1XQXA 1QTRA 2V97A 2XT0A 4M0EA 2XQIA 1LZKA 3FOBA 4IH1A 3BF7A 3TJMA 4J03A 3QMWA 4GBGA 3EQ8A 1UKCA 3ZWQA 3WL6A 3FAKA 4J0IA 1TCCA 5I7UA 3I6YA 3WZMA 1U2EA 3QYJA 4UBIA 4CG1A 4FBMA 5CT8A 4Y2RA 1ZJ4A 2WIDA 3SC2A 2XI4A 1TRHA 5AOBA 1ZI6A 2O7RA 4KAJA 1IVYA 1USWA 2WG2A 5LZ5A 3C70A 3D3NA 4BC1A 1B41A 5KBYA 4MEBA 5K3EA 5FLKA 1PJAA 1JFRA 5E4JA 5DYYA 4EUSA 1QLWA 4F60A 3IBTA 1QIMA 2C58A 1VZ3A 1YCDA 2QT9A 4Y7DA 3WWDA 2OCLA 1P0MA 3LLCA 3WL7A 1E5TA 1VA5A 5AM1A 1E89A 1XQYA 4WFIA 5DWDA 5ALYA 5AKZA 1UOOA 4C87A 2BAGA 1M33A 3B5EA 1DU4A 3R41A 4YX9A 5FUMA 2HA6A 4Q82A 1CFJA 5A71A 1CUCA 4OU5A 3EQ9A 3WI7A 1CUIA 2OCKA 3NGMA 4DGQA 2JGIA 1CVLA 3WK8A 3U0VA 1AMNA 4PF1A 4GHWA 5K3FA 1MU0A 1W75A 4DYHA 2WSLA 4LXHA 3D4LA 1YS1X 4UHEA 1MT3A 1DX6A 1WB4A 2VA9A 1K4YA 4PQEA 5K3FB 4RE5A 5LKAA 4FHZA 3G0CA 1FFDA 5CT5A 3R3VA 4FDMA 4QLOA 2ZVDA 3ZLUA 1ZI9A 1GPKA 4TGLA 4H77A 1QIHA 2C7BA 3WK6A 3EIOA 3C87A 2GYUA 4H7KA 5C7YA 3FYUA 1XLUA 1RWQA 4XWGA 3CN7A 3VISA 3KWFA 5CRIA 1QOZA 4BCDA 4KE8A 4UPDA 5FKJA 5EHXA 1W76A 3DYIA 3FYUB 1AX9A 4QLAA 1Y7IA 4KR0A 4PSUA 4Y2JA 3DYVA 2PX6A 3R3WA 5SYMA 4A23A 1VLQA 4X97A 3F96A 2R11A 5ALWA 1CEXA 1MTZA 1CLEA 3R3UA 1XRRA 3WA7A 3I2IA 3MUNA 1QIDA 3HRHA 2H9YA 1RP1A 2DR0A 4UBNA 2HA0A 2IITA 2WG1A 4OYYA 5JAUA 4G4IA 2G5TA 1XZMA 2DHCA 2Z5GA 2GBFA 3C5VA 3H18A 4W1QA 5IVHA 5HKAA 4XIIA 5ALOA 1LNSA 1OCEA 3H2HA 3A2NA 5JD5A 3DEAA 4BAGA 1H23A 1UKAA 4G1FA 5LZ2A 1OXMA 4KYVA 2WG0A 4G8CA 2XB6A 5FPPA 4H18A 5ESRA 3IUMA 4P93A 5JAPA 4ZREA 2JEZA 4BE4A 4INZA 1C4XA 1CUGA 1XQWA 1VXOA 3CN9A 1MAHA 3V1KA 3BIWA 3C6YA 4A5SA 2CBGA 3TGLA 1UK9A 2UZ0A 1TK3A 3DJYA 4G4GA 4U2GA 4BAUA 2DHDA 1F0PA 1EVQA 5HFNA 5SYNA 3ANSA 4RNCA 2ZYHA 5AI6A 3I1IA 3IDAA 4BTLA 2QVBA 1EH5A 5HZGA 4ETWA 5AKIA 2QOEA 5AKGA 3ESDA 4UHHA 4AO7A 1ZGCA 1E8DA 4EHBA 1XKTA 5JD4A 4J0GA 4P9NA 1Q84A 3QMMA 3FYTA 3CCBA 4NVRA 4BDSA 4X93A 2ECFA 3H1BA 5AK6A 5T4FA 2RIPA 4X90A 1SFRA 3HSSA 2GZSA 1LPBB 2AJCA 5DNUA 3VVMA 2JGEA 5E4TA 2CB9A 3FCYA 4WY8A 4QDUA 3VDXA 1QIGA 2Y6VA 1LPPA 4X91A 4MEAA 3YASA 1BCRA 2BUAA 4S0XA 2AJ8A 4HZGA 5JADA 2V98A 5D6OA 4FKBA 2ZSIA 2HIHA 3EBLA 1NU6A 2RHWA 3I2FA 5DLPA 5EIHA 4NS4A 1W1IA 2HU7A 4QDZA 3AZOA 4CIBA 3KDAA 5LZ4A 2HDWA 4E46A 5AIAA 2B61A 1H2YA 2BKLA 2QS9A 3DKRA 1LPOA 1JJBA 4B9EA 4EY6A 4BATA 1XROA 3OURA 4KAAA 4AQDA 1DT5A 1QIIA 5HFAA 4FFWA 2HA5A 3ESCA 1UK7A 5H3HA 4Q3KA 4Q3LA 1UFOA 1CUEA 1ACLA 3B12A 4QE3A 4NMWA 3HACA 5FPQA 1MJ5A 2ZYRA 1CUBA 4OPMA 1BROA 1EB9A 1XZKA 1R9MA 1Q83A 4FBLA 1CRLA 2WQZA 5AI5A 1A8SA 5IH7A 3V1MA 4ZWNA 5JD6A 2QUAA 3H04A 4FLEA 6YASA 3WIOA 1S8OA 4I3FA 2ES4A 3IURA 3ESBA 4UBJA 1P0PA 3HXKA 1AKNA 1FSSA 1CQWA 4IHAA 5AP9A 3OM8A 2DHEA 1L7AA 2C5FA 1W4LA 5C8ZA 4Y2QA 1WOMA 5JATA 5A7GA 3QBJA 1XZFA 1FFEA 5D3ZA 4Q3OA 1KU0A 3V1NA 4MYDA 1QGED 4QNNA 3SK0A 4W1RA 4Y2YA 2AJLI 2PU5A 2WFZA 3BE8A 5BWCA 4L3WA 2XUJA 3DCNA 1CV2A 3KWJA 5FP0A 2QKYA 3DKKA 2VJAA 2GBCA 2RI6A 3HZOA 2O2GA 4UBOA 2HU5A 4DTCA 2WJ3A 4Y2PA 4HVTA 2VTVA 4FNMA 1XZCA 1YASA 3ANTA 4X6UA 4BYMA 3K2IA 1EXWA 2C0QA 2CJPA 3H2JA 4MWTA 3NOXA 2CMFA 4QDOA 1F6WA 1JI3A 4UFNA 1E66A 2Y6UA 3GA7A 3H19A 5A62A 3AUKA 4MQLA 5CT6A 4IQ4A 4U2DA 3WKDA 3WZLA 3A2LA 2W22A 4CCWA 1H22A 1HBJA 3WK7A 3X3HA 5LIPA 3W9UA 1DWQA 5AI0A 5JARA 4ZV7A 4JYMA 5ISMA 3QPCA 1ORWA 1XZHA 3OC0A 3WWCA 3OOSA 4OYLA 3DS8A 5T4HA 1UK6A 4EY7A 2PUHA 4G5XA 1THTA 4B82A 3R3YA 1UK8A 3RKSA 2BGRA 1CUSA 1CUVA 2Z3WA 1ODSA 1DT3A 1HLGA 4HXGA 5ALZA 1VKHA 4J0CA 4ARAA 4QEKA 2JGFA 5EI5A 2GBGA 3LIIA 2RHTA 1H2ZA 2J3DA 3B3QA 1ZD4A 5ALQA 1JT2A 1P0QA 3AINA 1R1DA 5IVDA 5FRDA 3STWA 2XMDA 1QO7A 4W9RA 3DL7A 4I4CA 4DNOA 3MGAA 1O6FA 3O4JA 3A70A 2O2IA 2YH2A 1U65A 3VJMA 1TAHA 2P8SA 4K2AA 5I8PA 4L72A 4HAIA 2XUFA 1QIFA 3FCXA 4Q05A 5IKXA 2WIFA 3IIIA 3A6ZA 1E8NA 2OXEA 3RM3A 2WIGA 1CUFA 1YB6A 4BZZA 5JASA 2WIKA 5AKKA 5ALMA 2VT6A 5KWIA 2XQJA 3GZJA 4KRXA 5JANA 1QONA 2BUCA 3MUOA 4B6GA 4KACA 3WWOA 1TCBA 3F9CA 3QZUA 5ALLA 1C7JA 1EI9A 2Z8ZA 1HPLA 5HF8A 4J0KA 3QVMA 1ORVA 2HU8A 4QWMA 2PSHA 4K6KA 3OTQA 3STYA 2PKYX 2X8BA 1JKMA 2HM7A 4ROTA 1ACJA 1MO2A 2I3ZA 2B9VA 2CKMA 5DYWA 1CIJA 3U1TA 2CZQA 1LZLA 2XMZA 3ICWA 2DFPA 1VOTA 2OCGA 2H7CA 2IIVA 3F97A 2ZYIA 5ALUA 3KD2A 5AHXA 7YASA 1ETHA 5EHNA 2AJBA 5AKYA 5A7HA 5JALA 1UZAA 2HL6A 1QTIA 2I78A 4N5HX 1N5MA 1WPXA 1XZAA 5ALSA 1QIEA 3E3AA 4OB8A 5T4BA 2WIJA 4AXBA 4JEIA 4EZIA 3WKCA 3TEJA 1LPAB 2WJ6A 1E3QA 1TCAA 4Q34A 4AN1A 2YASA 5BWBA 1G42A 2OQIA 2EDAA 4HRXA 1DQYA 1L7RA 5K3CA 4YK7A 4W1PA 2V96A 2PSFA 2G4LA 2ORYA 3IA2A 4AMYA 5A2GA 3C6XA 2VSQA 2V9ZA 2QZPA 3R3ZA 2C5GA 4UBKA 3G02A 1UOQA 1R3DA 3DOHA 2J4FA 1B6GA 4GI1A 2I03A 4M0MA 5HKBA 2BFNA 3C45A 3WK9A 4WDRA 3SX4A 3WK5A 3L1JA 2PL5A 4H7FA 5J3JA 2XQKA 5LKRA 1VE7A 5AOCA 1FFAA 2GYWA 5LLSA 3HI4A 5AK4A 4C4ZA 5E2IA 2PVSA 3K6KA 3W9BA 4OB7A 3PFCA 2JGMA 2VF2A 4Y2TA 3W05A 1R50A 3WL8A 1GZ7A 1TIBA 4BVKA 2C4HA 3K9BA 4B83A 3DD5A 5AJHA 5ALGA 4DNFA 2WKWA 3WJ2A 4XX1A 3QPAA 5LZ9A 1X70A 2EDCA 1GGVA 2LIPA 2XUPA 1KU6A 2PU7A 1RYYA 1UXOA 1QZ3A 2B4KA 1DWPA 3KXPA 2HRRA 5D3KA 5DJ5A 5LZ7A 4N5IX 4FTWA 1XLVA 5JAHA 5CURA 3Q0TA 4PO3X 1ZOIA 3GELA 3OPMA 2ZJ7A 5ALRA 1Z68A 4UFPA 2QTBA 3O4HA 3I6ZA 1BN7A 5CTAA 5AM4A 2XMBA 1BRTA 1CPYA 2HA4A 2DCMA 4IO0A 5AK3A 3QPDA 1XZDA 4BP9A 4EBBA 2I3DA 2QJWA 1IUOA 4FLFA 1CUYA 3DDUA 1A8QA 4P92A 4UFOA 2JGKA 1G5FA 1UOPA 3S2ZA 1AC5A 2WHPA 4X92A 5BOVA 4BAZA 5A7FA 4X94A 1U4NA 2OPHA 5ALXA 1F0NA 3W06A 2WHRA 4BZWA 4HXEB 1LPSA 2VJDA 2HFJA 3WLAA 4I19A 3P2MA 2Z8XA 2WHPB 5AKJA 3D59A 4FWBA 3HEAA 1GKKA 4B0OA 2XUIA 5E4YA 3EQ7A 2OGSA 1E8MA 5AI8A 3O9MA 2HA7A 4Q1VA 1SCIA 4ZI5A 1VXRA 3E0XA 5YASA 1AUOA 2Y2UA 1HQDA 4BE9A 1P0IA 1GKLA 4HS9A 3G0IA 4DSAA 4M0FA 5AKEA 4E15A 3FNBA 1X2BA 1K5PA 1QFSA 1Q0RA 4H0CA 3PF9A 2OAEA 2G63A 4J3JA 1HL7A 2J3QA 3F8SA 5ALHA 2ZSHA 3IUQA 1R4ZA 1W52X 4HRYA 2AJDA 1K6EA 3R40A 3H2KA 3OG9A 4U2EA 1R9NA 5LP1A 1MNAA 3PE6A 4H7IA 5CT9A 4EY5A 1EA5A 1JMKC 5AM3A 1XZEA 3G9UA 4FMPA 2VJBA 3SWWA 1U8EA 3RK4A 3M81A 1D07A 3BIXA 5K3DA 3G9ZA 1IZ8A 1TQHA 3ILSA 4XJVA 1J2EA 1WB5A 3AIMA 5CT4A 4C4YA 2H7YA 3UMJA 3QH4A 4O08A 4LYDA 5A6VA 4FNGA 1H2XA 2YYSA 2XMRA 1LBSA 5HF5A 2ACKA 4H7JA 4OCZA 4J0DA 4TVKA 3I28A 3BJRA 5EGNA 4L9AA 4B9AA 4RPCA 1SCKA 4GEGA 3EF3A 3G8YA 2WLSA 3DLTA 3M3DA 4H7EA 5ALKA 1XRNA 1TKRA 1J07A 3VJKA 1JMYA 4G8DA 4Y9SA 5CW2A 4E11A 1FJ2A 3AIOA 3JWEA 1R88A 1AGYA 3D2CA 4DMCA 1EVEA 3RARA 1UWCA 5EHZA 2W6CX 1G4HA 3I2GA 1DWOA 3GUUA 4LIPD 2XMCA 1MAAA 4C4XA 3V9AA 4GDMA 1CR6A 1SC9A 1N1MA 4X3CA
chains in the Genus database with same CATH superfamily
1PFYA 3OI7A 5E9QA 3MT0A 3FI0A 3HMKA 1AQLA 1CX9B 4ATNA 2AZDA 4YIHA 1LF0A 3I9NA 1JE0A 1UAYA 3CUYA 3R77A 1XFAA 4UZSA 4HNUA 1G3IA 1LQTA 3BK2A 3INTA 2EBHX 4N8DA 4WPGA 4QYIA 5F33A 4BJHB 2WM9B 3MXTA 4XQGA 1I3NA 4HOYA 1IUPA 4LMBA 4KQ2A 1RTKA 4YRLA 4Z4CA 3SAJA 2RJOA 1A4XA 3NHKA 1XMSA 2EIXA 5C80A 5E1MA 1EMDA 2FP3A 2BEKA 2E5FA 4BO1A 3CB2A 1G9SA 3VHRA 1NDHA 3OQJA 3A4YA 2RKBA 1VB3A 5J1TB 3ZK9A 1KMNA 4Q9KA 4MA5A 1PRYA 1NIPA 4PSKA 2G9QA 2PZMA 2XKBA 3GEHA 1UPUA 4XD2A 4C6HA 1NGSA 2V6IA 4QBKA 5AKLA 4H1WA 3OO1A 3BGWA 3B5JA 2HLDA 1NKTA 1Z35A 2OPBA 4NOLA 4A2QA 1O6GA 4JOBA 4EO7A 2GEKA 3N58A 3DJFA 5K01A 1Z13A 2ESRA 3IOYA 3T3IA 1AVTA 1B6RA 1PW7A 2BHRA 2QLLA 2YN4A 3QX8A 3ZE2B 4MKFA 4TXHA 4DOMA 4HQRA 3UAOA 2JJYA 4EEZA 4MPDA 1T0PA 1M67A 1QZTA 1BEZA 3KUUA 3LG2A 1VLVA 1QORA 2Z6VA 2PSEA 1S01A 3QWAA 4HMPA 3T4UA 3W3ZB 3JQ7B 4KFUA 2DULA 4DMRA 1M34E 2J87A 2BCJQ 4G0QA 4HNAB 1EAYA 3CPSA 1OBVA 3SIWA 1Z8NA 1G8JA 5F4ZA 1K7XB 1SB8A 1EK5A 3SLRA 1ST3A 2HIGA 4Q3EA 3ZHQA 3EWSA 3SGLA 2LCIA 5K45A 1WUHS 5BW4A 3P5SA 1AS2A 1Z36A 3RBVA 5GTDA 2ZRIA 2L69A 5H4HA 4DLSA 1NJGA 1HORA 1ISHA 4RENA 1FL9A 3L43A 4HO1X 2VRCD 4HTAA 4Y2UA 4LBVA 3WFZA 5C5IA 2IBTA 3NP9A 2FWJA 4LGVA 1AB6A 4M1SA 121PA 4QRHA 2J41A 3FZNA 2PUJA 4G2NA 3H0EA 1UBNA 4JB3A 3OQPA 4RFVA 1TW3A 2IYEA 1U7DA 3BFKA 2NSYA 3ZQUA 1QNFA 2B37A 5KQSA 2ODEA 2WVHA 3AP2A 1Z0KA 4X3OA 4MI9A 3UMSA 4AZ3B 5T4EA 2QNRA 3VJLA 1ZJWA 1BKYA 4ND3A 2AEJA 1KZ9A 1U2PA 3C4QA 2HA2A 2WWHA 5DP1A 3MMNA 1GAWA 1RYFA 2D1RA 3VYTB 4B80A 1TOAA 4AKTA 1K8ZB 1Y3FE 1GQSA 5LA6B 4PLCA 4L27A 2BHTA 2R79A 3K9HA 3NKVA 4NYJR 4CM4B 2O8CB 3H5AA 4O4HA 1CDOA 4JR2A 3W6PA 5LU9A 4PANA 4J2OA 4CLRB 2WVGA 2YVAA 4K28A 2HRQA 3MT9A 5AVVA 1YONA 3UBMA 3QWHA 4AICA 1D8TA 3T1NA 1DE0A 4N49A 1M6HA 3I2HA 2IJGX 1THZA 2OGWA 2VNSA 4W9MC 1V47A 4LG1A 1F4VA 1FP4A 2JFFA 2YDXA 3GROA 3QVOA 3OEED 1QH1A 2IP4A 4RLQA 2B9EA 1ZM9A 3GXOA 4XVHA 3U3XA 3R9WA 1TYZA 3PJRA 2UUCB 2OQ2A 4JH0A 5K4AA 5TC4A 1RQRA 3DZ8A 4R8MA 5G0UA 3K0AA 4KIFA 3R76A 3OPYA 1R8YA 4YQZA 3I5MA 4LHWA 2FXIA 1JU4A 1EHCA 1WRBA 4WKGA 4YCCA 2FUCA 3TSCA 4DLAA 7ABPA 4RE6A 10MHA 2QR2A 2EX1A 3JY6A 4M86A 2QN2A 2QF7A 4ZI7B 2ON6A 4WLFA 3GT7A 1MIOB 4WE3A 4WECA 3N6XA 4FQ8A 1AV7A 4DV4B 2RCYA 4NICA 2PQMA 5AVSA 1CWUA 4NS1A 4OQPA 5LZ8A 1SD2A 3AW9A 4MI3A 4UNQA 4DMKA 2ZJFA 3C6ZA 1VHDA 2P9JA 1XDSA 2VAWA 2H07A 3IIEA 3ZE1B 4O4HF 1JQJC 4EPRA 1IZ7A 4X6YA 3PEEA 5EZYB 4IFEA 4BCCA 2HCTA 1L4UA 2V7QD 2ZE6A 3HKEB 1SR8A 2ZIFA 1VJRA 1TM7E 1ZOPA 5BN1A 3JW8A 2C20A 1H8ED 4LRTB 5EQJB 5AM2A 3G8DA 1JPNA 2C4KA 3F7MA 3FSGA 4KO1S 5CLFA 1RR6A 4RFSB 2WUEA 1NX6A 2XT6A 1C9DB 4PR0A 1QZXA 4Q7EA 2OG1A 3NT4A 4J1TC 1BXKA 1J21A 1ESZA 2WTMA 1UBFA 4LAFA 1SHJA 1O5OA 2O6LA 4EIWA 3DEIA 2GTPA 1AKMA 1L8LA 5ICSA 1U2ZA 5C8XA 3KZOA 5IUKC 2QV7A 5SZIA 4B85A 1Y89A 2HY7A 3MWFA 3MS2A 4PYKA 3GFQA 2A5YB 4TWRA 1ZM7A 4C4PA 4IMRA 4G9EA 4G36A 2EYUA 3QYAA 5FNZA 2GM5A 4DCSA 4B2IA 4D3SA 4ZMRA 2GLXA 3A10A 3INRA 4PINA 1WPQA 3LFTA 5EIEA 3NXKA 4KE9A 1R4NA 2AR0A 4PIMA 3L46A 5I6DA 5IJ0B 3TLAA 1GG9A 3G49A 2C4UA 4H1HA 4Q9HA 4GGMX 5ER6A 2JJ2D 3E7PA 2EJTA 4BQIA 4YBRA 1T2UA 3ND9A 2BR4A 1YD7A 4B4KA 2COEA 8GPBA 3KJEA 3URMA 4E03A 2GNPA 4BWFB 4R2JA 5FB3A 5FDFA 2CYCA 4WADA 3EVTA 2DY1A 3LU1A 1E3DA 2Q5CA 4RS3A 2G8NA 3C39A 2VK1A 2RBKA 3CZ4A 5IC6A 4C7MA 3GP8A 2IS4A 1CB0A 3G6KA 1N2IA 1KH3A 1IG0A 2XQGA 5BYKA 3VHLB 3ANXA 3ZU4A 2C4VA 1SJ9A 1Z88A 3GR6A 1Y1KE 4NOKA 1O95A 1UPBA 1QGAA 1DBWA 2GK7A 2ILVA 2YVUA 4ZQHA 2ZIWB 4KX5A 2P67A 1OWNA 2NNLD 1JFFB 3LC7O 3P32A 3OKFA 3S27A 4RJJA 2V0GA 4LCJA 4IRMA 2CHVA 2DTDA 2GYVA 3K8YA 2DY0A 4JP5A 5KYVA 1M3SA 4GNKA 1PT5A 4C4AA 5LYYA 2XCSB 1B8PA 1E2FA 3AFIA 5B3JC 1FBNA 1PLJA 4LJ7A 1FFBA 3MOIA 1PQ4A 3ISTA 5DN6A 2OCYC 3D2AA 2XYPA 3HGQA 1MGPA 3MJDA 3R5FA 1LPMA 1N9GA 3CY6A 1E2QA 2FP4A 4MV9A 3WJ1A 3IQFA 3C3DA 4UU0A 1PEKE 1LVUA 2MWMA 4F8JA 2RONA 2R6GA 4I9UA 3VYSB 1V8OA 4HDSA 1YRAA 3EDRA 1MEEA 3PFGA 4GWGA 1FNSA 1SQ6A 1HT2E 2CHGA 3IQGX 4OHZA 3BMCA 3MWKA 4X60A 4WBNB 5KZMB 2W0SA 4N82A 1JIXA 3GJ4A 3C6MA 2ET6A 5FWDA 4BJ5A 3EZ2A 3QKIA 1ZESA 2XA1A 3NT2A 4GWLA 4IMIB 2W93A 3FOEC 3H7IA 4KODA 2H1SA 1XZ8A 4Q1DA 4R05A 4JP1A 4F2DA 4LRWA 1PV1A 4IDGA 2NZXA 3VDQA 3HP1A 1ZR2A 5DBFA 4AZVA 4F21A 2ADFA 2YJ4A 3ZJTA 4HUQA 5FXMA 2VDUE 3FF1A 1AHNA 2Z1MA 5EHGA 4E5DA 1A96A 3QU2A 5EGSA 3ZWXA 4BECA 5BSUA 2XRFA 2FPIA 3ICPA 2IWHA 4HWSA 2BHNA 5MF6A 2Q4EA 3C5WP 2PM8A 3O95A 3TMKA 3ZN2A 3UC5A 1O58A 1NWCA 1TNDA 3SXUA 2BGUA 3KAJA 3COJA 2XGJA 4CV3A 3M6XA 2QVXX 1XCOA 1P9WA 2VCYA 4MW1A 3AHHA 3HDTA 1CHDA 1EEXB 1FXUA 1N8NA 4MLZA 3AHDA 3HSYA 4RIGA 5K8CA 5KIAA 2C7PA 3CVVA 1JDNA 1KC1A 1YBAA 1I9GA 1VBKA 1P2VA 2GM9A 3NCTA 2AYZA 4RZXA 4DGSA 2I0FA 3FUTA 5D85A 4JLJA 3A9CA 4JY7A 1F8UA 1LB1B 1JDTA 2FPRA 2I2DA 1H1LB 1NTRA 4EDFA 1ONSA 2CXNA 2GAAA 4JI5B 2WPDA 4S1VA 4XD7A 4RSMA 3RVOA 5BYBA 2IXBA 1KO8A 2QLTA 3OA0A 5ERGB 1E7WA 3TG8A 4C78A 1WNFA 2VAXA 1YB2A 3A3OA 5TLSA 3ZI0A 1NUPA 2CXHA 3I6QA 1AQIA 1W6UA 2BLNA 1S3SA 3BL8A 1DQNA 5H9WA 3PHBE 1QLHA 2WJPA 2P6MA 4LFAB 5HVNA 5E8JA 1BVYF 3TLCA 5L7TA 1CF9A 2RGNC 1Q1BA 1GXSA 2V0NA 3A9VA 3OCUA 2ZYSA 4BQOA 1W5AA 3ABOB 5JO9A 1NBEA 3K72B 5E2BA 2IS2A 1N5RA 5A9SB 2C94A 1WVGA 3H3XA 3R0VA 4FP9A 2PT9A 2IYQA 2X22A 2BUBA 4DBLE 3DO6A 1XKXA 2XRZA 1SVMA 1XZGA 1YULA 5GVRA 2O2ZA 4K05A 4PN3A 3F2VA 4D8UA 4EK9A 3ILHA 4C0AC 1IZZA 3ER6A 1A2BA 4HG2A 3GDWA 4OHKA 5REQA 3CH6A 1MXFA 1II8B 1E7SA 2VDNB 2D8AA 3W2EA 1UQRA 1GLVA 1P7WA 3LRTA 4FR0A 4HNSA 4RDXA 1I1NA 1G64A 3JYHA 4XARA 4COOA 4QYMA 5IEBA 4IGIA 2ZYGA 2GHIA 1EFHA 1PZXA 4AG5A 3FBGA 4BGEA 4AUMA 2JRCA 1BU5A 2WBLC 3GFGA 2EP5A 2XEDA 3IE0A 2XX3A 5DGTA 1T2EA 4AP6A 3RFUA 5HK9A 3OZDA 1OTYA 5BN4A 1F9EA 4E4TA 4BCBA 3LGXA 4NMMA 1B1CA 3VO1A 3RNOA 2JHPA 4M4SA 1B14A 1WXDA 4MMYB 5T5QA 2RK4A 3WWZA 3OOJA 1F5SA 2WK1A 1HNWB 2E6UX 4G25A 4O4JA 3VHQA 4MYCA 4QT0A 2XYVA 2NV6A 1G2IA 1L5WA 1F5NA 2FW0A 3NALA 4JBGA 2HADA 3EYWA 2DJ5A 1UM8A 4XM0A 5I9IA 4HMOA 3OF5A 2QMQA 4LDPA 3VC1A 1XXHA 2XDAA 2JF0A 1YIOA 3DGFC 4U2BA 1IUNA 4HDNA 2B7LA 3CZ5A 2CHQA 3JQFC 4GZMA 2NU7A 4JEUA 4IILA 4IIFA 4NRDA 1AKEA 3N2KA 4JIGA 5BPHA 4M1OA 3VZRA 2C7VA 4MVJP 3QMVA 1PUXA 1E99A 1CQZA 1B0UA 3DE6X 1BN6A 3F8TA 4TROA 4U7FA 2PCLA 2OZEA 4ARUA 4BVLA 3F73A 5HRCA 2PKXA 1P2FA 3HPRA 4Q12A 4GQAA 1OMOA 3HJCA 3SR0A 4KR9A 3HVJA 4INOA 4ZVRA 2DFVA 2JLSA 3W8RA 4ZCIA 2ATIA 2R6R1 1T2NA 5KNLA 2KSQA 4GLLA 2CGEA 3QG1A 5DCLA 3D0QA 1EUDB 1B1AA 3K70C 5JY6A 1NXXA 3WK4A 4C4SA 4EGCB 5K0CA 3V1UA 4YP9A 2RH8A 1BG6A 3VBCA 1AQNA 3V5NA 2GFHA 3D5EA 4F06A 3U6BA 3D6UA 3DVAA 4AKEA 4F2PA 4IWYA 2J6HA 2XJ9A 4ZCMA 5DNYB 1EFPB 5LVAA 2JH8A 3LBHA 1TK2A 2IEDA 4MV3A 4NARA 2PGNA 3V2IA 3VKFA 3PL5A 2C5AA 2PZLA 3VR2A 1EX9A 4A9AA 4YCNA 1YE8A 2ZJZA 4O4JF 4PQGA 1EINA 1WLYA 1O9HA 3NJ8A 2P5SA 2C00A 2P8JA 4LHVA 3ZBQA 3CNQS 3O8DA 1FNMA 1B74A 3CLKA 3I92A 4MV4A 1LDGA 5FAXA 4J0HA 5E3HA 5ALDA 4CHGA 3T5TA 3IAM1 1PK8A 2VCHA 1H94A 3G2HA 3H5WA 5D7BA 4YMVA 2OT3B 3I76A 4JCCA 3LC2O 4ZJUA 1XJWA 3HN2A 2HR1A 1G5QA 1G2OA 2PZKA 2Q3CA 1WEHA 3O8BA 3K09C 1GKYA 2WKPA 2GA8A 1SXJB 2LV8A 1AGRA 1NR1A 3KUXA 3AFHA 3NAZA 3L6DA 3QKTA 3CGWA 1W2WB 2B3TA 3BMQB 3TOSA 4U63A 4TMXA 1NMEA 4PSAA 4V2UA 4D02A 1KAMA 2N75A 4PO9A 4Z4IA 3L4BA 2ONCA 1G60A 1L9KA 3CPJB 1FMJA 1UEJA 2E4XA 2WNSA 4ND4A 4URYR 5AICA 5FL7A 4EFMA 3FZQA 3P9XA 3Q2KA 4CLDA 3GCDA 2YS7A 1Z2DA 3ZYZA 2W6ZA 3KSAC 1I4DD 3K5IA 2VH5R 4B3SB 5JSFA 2YVLA 5HJ5A 2QN8A 2VWGA 2V5UA 4MXDA 2W0MA 3F3YA 1KQGA 1G63A 2FMIA 2PWPA 1AIPA 3LWZA 5DYIA 1J5PA 3V7UA 5DTMA 1YA8A 3IUPA 3N2LA 5F1OA 1Q6ZA 4NJEA 1QK4A 2JCXA 1N2JA 2XWSA 3A1FA 4YECA 4ZEOA 5BQ5A 4DMHA 3BE5A 1IOVA 5GM1A 3HO8A 1WMAA 3ECAA 2PYDA 1JJFA 2HF8A 1GGFA 3K1ZA 4CQLA 2WQ6A 1NATA 3L2OB 3H1PA 1BU8A 3OZIA 4PNZA 4WH0A 4F56A 4OJTA 2QPAA 3NGXA 1DAEA 3CUKA 1EP1B 1TLFA 2ADMA 3H2GA 4CIDA 4E7OA 1IXYA 3ZNPA 1WCIB 4NIMA 5KWJA 3AL2A 4PQFA 5KJEA 4AM8A 4DV2B 2H5LA 3AKZA 4KU4A 1KJWA 1NVGA 1HZZC 2N3ZA 3CR7A 2EBUA 4FOLA 1Z6AA 3C6BA 2HQBA 4YCJA 1P4AA 2JIDA 1NBMA 1YV9A 2YMQA 3C6QA 3MPOA 4RMJA 4BQQA 2PKWA 4OHYA 1XEXB 3DOUA 2GEBA 3CLUD 4H7HA 1PI3A 4MVJE 2GUWA 2JH3A 3EMDA 1MDFA 4XFJA 1E5VA 1YS2X 3SMVA 1PL8A 2VP2A 3CPHA 2GCOB 4OO3A 3HCWA 2FPUA 2R6HA 1HLPA 1U6KA 1GCOA 3KOWA 4DJ5X 3IODA 3ROQA 4GI2A 1PQWA 1KPGA 2OORA 1EB8A 5JS8A 1XMXA 4PG5A 3AVOA 1JLLA 3V4PB 3NANA 3DWFA 4P3YA 3ZIUA 5FOQA 1P0FA 5C2JB 4BDTA 5JZSA 5EWMB 5HQTA 1PBTA 5A3VA 1E5QA 4ITVA 5FI0B 5ITVA 2REQA 3DEFA 5BSEA 2FN9A 2WIAA 3N8IA 3SSOA 2JCGA 4OJNA 3CG4A 4YIKA 4ZIRB 2IT1A 4IM7A 2CUTA 4GUDA 4PHGA 2UZ3A 4D4MA 3M1AA 1RNLA 3G9TA 4AI6A 4TV9A 1K27A 4YMWA 3TAUA 1G1MA 1KQ3A 2EERA 3IDSA 1KK3A 1IHUA 4GIBA 4JIMA 2C83A 5DNEA 1I7SB 3GN1A 1HE3A 2E49A 5JDCA 4YC7A 5LMNB 3IOBA 2Z98A 2ZYWX 1YBMA 2QVLA 3N2ZB 1XN1A 4UHCA 1ZAKA 4Y0AA 5FFNA 2IV7A 2QHXA 4X00A 4HX2A 3W04A 3GFBA 1R0RE 3LZ6A 3BF8A 4DMFA 1ZCFA 1WHTB 3PGLA 1H6AA 1T0UA 2HUPA 1HKHA 3IILA 5EVJA 5IABA 1JIUA 1CT9A 5EMNA 2IOQA 2XUAA 2WUDA 4QXRA 1YZUA 4LRXA 3VU1A 2PWZA 1ZGBA 3NZEA 3HCNA 4NK5A 5HIMA 1QYDA 1I10A 4YGXB 3ZR4B 4L07A 1DJMA 1QO0D 3U80A 4R0MA 3KQUA 2FGJA 4AROA 2EFEB 1OE0A 3D2LA 3OO0A 3AZQA 4KKVA 3FDZA 4MO2A 4N3AA 4F4CA 5HKKA 3O8QA 3QNMA 4B3JA 4LOJA 1D03A 1GCGA 2C8KA 3NASA 3LPMA 4UTXA 5LMCA 1A8UA 1X0XA 3GLUA 2YYZA 5CLHA 3TFWA 3UT5B 3LKVA 4YT8A 1JKJA 2XAUA 1AF7A 3VV2A 1U7HA 1FSZA 1YIDA 3FMFA 5DOZA 1KJNA 1UP7A 1KHHA 1ZI8A 3B1VA 3M33A 3VR6A 1E2IA 3V4ZA 1GPH1 4DF3A 4F71A 2UZ4A 3UAYA 3H65A 3EXG2 4QJ4A 4TV9F 5GM2A 1QRSA 4U7PB 1YUNA 4S04A 5FI5A 4IQ0A 4A82A 1CHNA 3CINA 3P9YA 4OI2A 1CUAA 3T5DA 1I1QB 3TLGA 2OFWA 4BBZA 2YJZA 1Y81A 3ABZA 4HAXA 4K9KA 2WTBA 4WFJA 1OFUA 1SO8A 2PVCA 1J22A 4XVUA 5AFSA 3BXHA 3ZVMA 3H16A 3VSCA 5B3LA 1UXGA 5EWJB 1P9LA 1T9KA 4Z2AA 2R0QC 2J48A 2Y2VA 4L7QA 3SE7A 3VYWA 4X85A 2GSWA 1I5EA 3U62A 2NU9B 2IKSA 1JG4A 2CL6X 2ILTA 1DELA 1GU0A 1MP0A 2QPTA 5EWLA 5IK2D 2X14A 3I6MA 5JYEA 1W36B 1MB3A 4L8VA 3RFFA 1U0HC 3EN0A 3GQBB 4HR7A 3UV7A 4IJMA 1NJ1A 3N9IA 5D7NA 2HU2A 2L0XA 2P69A 2UVDA 2XY4A 4Z9FA 2GWRA 3WWPA 1CRQA 3RC7A 3PE3A 4HEA6 1WXGA 3ESYA 5EFZA 3RFTA 3HLYA 5JZ9A 4WUVA 1KEZA 4AZWA 1AF4A 2V7BA 3R24A 3I39X 1BIFA 1LNZA 3JQEA 3WGHA 1EXDA 5CCBA 2XHZA 3PUXA 1FXWA 2IC5A 1U90A 1KO1A 3R4CA 3U4QB 2CFCA 3M83A 3PLNA 5DISB 5CXUA 1K6MA 2C0PA 3HO6A 2PZGA 3WBFA 3KHUA 1E3WB 3AU9A 3AB7A 1TCVA 3ETGA 5AW5A 9MHTA 4XOIA 3T4PA 1Z08A 1M7BA 4L2IB 2IRWA 4YA6A 2AQIA 3EZNA 2HHAA 5TJHA 4AS1A 4TTQA 2E9SA 2AI3A 4D46A 3EQ6A 5JAIA 1A1VA 2RI1A 2VHWA 1AHPA 2P77A 1VHTA 4F5ZA 3JZFA 2Y1DA 4R83A 1XD2A 2VL7A 4PYLA 5IM4A 3A6FA 1SVIA 1OYWA 1GL3A 2AFIE 3IR7A 2MSNA 3DBHA 2GCGA 3LQQA 3ZDAA 1E69A 3KOZA 3EC1A 3F4LA 1ZK1A 2BT4A 2ZI3A 3KPVA 3D6HA 4KQWA 3K92A 5AM0A 2C59A 3WHKA 1TTTA 4Z1MA 1RI5A 3KPWA 1ZSYA 4QZVA 3ZD8A 2CSUA 1NDQA 4R1SA 2P2SA 4I6GA 2QL6A 4QUKA 2FU5C 1L3IA 3RS4A 3U4DA 3U1VA 3INGA 4BMNA 5HZHA 1CUWA 2C5EA 3AETB 5KJCA 3IUNA 3DAPA 4UUQA 4HGYA 3GLFB 2R6DA 1H3NA 3QJYA 5CJJA 4G5YA 5B4TA 1SCQA 4TKMA 1C2TA 2XXAA 3E3OA 3ORHA 1Q91A 4K03A 1MGOA 3PC7A 4JI2B 1H0RA 2RGYA 3ZBUA 4RD0A 4FHDA 4WLUA 4XYMA 3O9VA 2X19A 1GGHA 1Y8RA 3PVCA 3HB7A 4XM1A 4YWHA 1RXEA 3KYBA 3BL6A 2WZDA 3ANLA 1YR2A 3ZY4A 5CB6A 3UC9A 2G1KA 4WCFA 5GIPE 1E59A 3F6EX 1XLTA 3BDAA 4L51A 5EHIA 2CEKA 1T8RA 4MROA 4WFKA 1DKUA 5AHRA 3ZKWA 4LXQA 3ZQ4A 2GN2A 2JB9A 2IX3A 5I9MA 1CS0B 4MKGA 4WCVA 2RC6A 2EKLA 4GECA 3GJXC 4BASA 4O4IB 1D7OA 4F9GA 4R1TA 3ASYA 4N9QA 3U40A 1AURA 2K5UA 3AJ8A 3VO9A 1XC7A 1Y80A 2WAAA 2WT9A 2C2MA 4PIPA 2O50A 1LKZA 4FQ5A 4JUAA 2X0KA 2ZCUA 3RAPR 2P11A 4D9EA 1KGDA 4ALJA 2ZR0A 2OFOA 3MWGA 4C3VA 4CEJA 3UGJA 4OHPA 2N9UA 3OTHA 4FFLA 1E3MA 1Q44A 3UAWA 1J06A 1SUIA 1E9VA 2FJPA 5CMLA 2GMWA 3TRDA 3V1TC 3ZQ6A 4CI9A 3GZTB 2JLQA 5AW0A 4FSDA 1J5EB 2BH9A 2P0YA 3U31A 4C2UA 1VPVA 5GY7A 3EGOA 1AXRA 1LFDB 4D9HA 1XG5A 3RVSA 1L8AA 1MUUA 4LKOA 3TW6A 3ZQJA 4C88A 5AW3A 3A1NA 1IULA 1ZD2P 2WHQA 4PRYA 3UT6A 4DKJA 4XYEA 4D4LA 5ULLA 2VRWA 4LISA 1X8KA 4MO9A 3DTYA 3H3FA 5JSZB 2R87A 3AJAA 3NBKA 1WO8A 2BRUC 2Q0QA 4V0KA 4PYIA 4ZQFA 1NMSA 9ATCA 3PJEA 3LP6A 3KAKA 5COQA 1TIKA 4OXQA 4REQB 3EC2A 1FFHA 4OFWA 3LM8A 1KAQA 1A9RA 4IVQA 1VKZA 4XQ9A 3ZLTA 2XRYA 4A0HA 3K5WA 4DXHA 3VMMA 1AN0A 2PUWA 3JVIA 2PKRA 2C3MA 3GJQA 3VC3A 4LWPA 4L85A 3TZBA 1N2XA 1PTJA 1WM1A 4BX2A 3IPXA 4CT5A 5HQ3A 3TD6A 1H8HD 5MDHA 3RANA 4TM8A 4DNXA 4N5NA 2QIPA 2G40A 4Z8XA 1AS0A 2ZSBA 3DBOB 2UVPB 3ORSA 4M0CA 2AVNA 2JCBA 2B30A 3EE6A 3L7DA 3W5SA 2X4IA 2NADA 1M2NA 1PGNA 2VNJA 2QNBA 3GMDA 2GEFA 4CL8A 4C04A 3DEJA 4FGUA 3W1WA 4JQSA 1YA4A 3H2BA 3X2FA 4BPRA 1YDHA 2PV7A 3VOAA 1E1KA 2X3FA 3TPFA 3FHTA 2GVNA 5G41A 5JQGB 1G16A 3WLIA 4X61A 5B1EA 2NV0A 1NXQA 3BJMA 3CVWA 3VJRA 5JS6A 1SUBA 3UWDA 3HVHA 2L82A 4MQMA 1A88A 3PQ3A 4ADSG 3OX3A 3RO7A 3ETDA 2NSHA 4YBZA 3ECCA 4BKMA 2DR3A 3W79A 1ZJ6A 4Z49A 4MRNA 5E0OA 3QE2A 4RD1A 2HXGA 2A0KA 2YV5A 1M6WA 1CFZA 3U3ZA 2QJOA 4V0MA 1IN1A 2ZJBA 3OZ7A 4KZPA 2B8JA 4JT4A 4XI9A 4U6NA 4MW7A 2FHSA 5IVKA 1VB5A 2CWWA 2D00A 3IQDB 2F1HA 4B6RA 4J3FA 2OHIA 3Q87B 5BYJA 5IMSA 1E6LA 4AX8A 4F4HA 4MW4A 4WNAA 1SCBA 3FOFC 2P7IA 4Y0NA 2WQ7A 3RSLA 1W29A 1QTRA 2XOKD 2PV0A 3KETA 4JT9A 2XT0A 4M0EA 2B69A 3AM4A 4YRFA 1RXSA 3FOBA 2ZS8A 4BU0A 1OH6A 1TEVA 2Q1TA 1M2GA 1P1CA 3UK1A 2P9CA 3OBIA 4RKYA 4J03A 4Q9AA 3QMWA 1EVZA 2EZUA 4DT1B 2AXPA 3JS5A 2IDMA 3PQ6A 4WACA 5IJAA 2ZUTA 3Q9NA 3M9XA 1ELOA 5EG5A 4ZK2A 2UXCB 3CLRD 3P97A 1Z0DA 3U3KA 3JD3A 5CVJA 2L18A 2PL3A 3UPUA 1TCCA 2FJUA 3A31A 1YKSA 4QVKA 1P1HA 2F7SA 1X1BA 5I5EA 3D3KA 1VKOA 2DWCA 4EWLA 4EABA 5I7UA 5EXDA 4WZBB 3M5WA 3P9KA 5IDWA 4UPVA 5K7SA 5SZJA 4UBIA 5CNKA 4CEIA 4FBMA 2QTGA 2Y0CA 4JMPA 1BMFD 3ZEIA 1ZJ4A 2WIDA 3F49S 2XI4A 4B6EA 4XDZA 2O2CA 3RAGA 1ESCA 2RJNA 4RA9B 2CDRA 4I4TA 5AOBA 5L4LA 2WWYA 2V4UA 3RTDA 2BCGY 1C4OA 3JWGA 2B34A 4EG7A 1GQOA 3R5SA 4N0DA 1YL5A 2UUOA 1UBRS 4X84A 4NHEA 3PUJA 1JIVA 5IAOA 2O8DA 1CZNA 1L1EA 3HCRA 3FPBA 1ES9A 1OFIA 3MIZA 4IJWA 4JAVC 4A8JC 1EWKA 5KBYA 2Y99A 3EH2A 3PX2A 2C4TA 2QN7A 4FEEA 2HV8A 4EVIA 4F4IA 2JD1A 4WKBA 2JJ1D 1HNXB 1U9IC 5H3CA 4BN4A 1F14A 3FNHA 2JJMA 2QRNA 4GPD1 1LEHA 4M0UA 3RFXA 3KXDA 4EUSA 2FI1A 4MVCA 1JKIA 4H16A 1U0GA 4PZDA 4XW2A 3MD0A 3MD9A 3K0HA 4RV5A 4WQMA 3W0LB 4MJLA 1B3BA 1KYXA 4X3PA 4DLWA 4CKWA 2QT9A 2IUFA 5EZ6B 3R0QA 4CCAA 5BURA 2OCLA 2AT1A 4YUAA 4NATA 4JL6A 4RMGA 3UHOA 4Z0TA 2JA2A 3ZBTA 1CZLA 3V4LA 1IQ0A 5AM1A 1U7WA 5C1OA 1QHHB 1KYVA 2QGNA 2QY9A 1PWYE 1C9MA 2BF7A 2F59A 1J2TA 5KYGA 1L3BA 4AY3A 4I4TF 5DGDA 3A3YA 3PC8C 1UOOA 3AM3A 2SNIE 3HCFA 3OFVA 1MEOA 5TDHA 2ONZA 3EIXA 3REQA 4BX9A 3GLIB 4RCVA 2RCNA 3C24A 3B5EA 4IV8A 4LMPA 3ROXA 4AUEA 5BSVA 4BLRA 4R98A 2BTQB 3GMIA 1CFJA 1Z0AA 2H1RA 3D81A 1GTVA 3WI7A 1IE3A 3GBPA 3GF4A 1PLLA 1ZWLA 2H1CA 2P68A 3ZBPA 3NGMA 2IY7A 3A6HA 3FUUA 4DGQA 1KYYA 1Y34E 2IPLA 4ZOAA 3TD2A 3LJKA 1GAEO 2EP8A 3U0VA 1AMNA 4PF1A 4EQZA 2B25A 2OZLB 4GHWA 4WESA 1GQFA 5FTMA 1FYFA 1W75A 4QXQA 4LYAA 4TLLB 4BFXA 4CMEA 4DYHA 1X7YA 3AO0B 2GLUA 4Q4CA 2R4TA 4PAWA 2OVBA 1DO0A 4P81A 4M9RA 1L5OA 1U6JA 1FS5A 3JWHA 4M9QA 3S4YA 4OBXA 3RV4A 3C1OA 3CNBA 4AMVA 1PS9A 3DFKA 4C22A 2OAP1 1Q1ZA 1MC8A 2V7QA 1WB4A 2SICE 3EVBA 5FYDA 3DMYA 1UKEA 3CEPB 3SEAA 1RTTA 2C5SA 2JIBA 1CJTC 1MA0A 1C5KA 1H8EA 3DPUA 3RC8A 3W2IA 2BMAA 3VOBA 2O7SA 3RSHA 5GONA 1K86A 2KQUA 4MRMB 4FHZA 5LWQA 1XDBA 2GETA 5JFTA 4ESEA 8LDHA 5JSHA 3JASB 5CCXA 3W90A 2WSYB 3HUEA 1SURA 3VR6H 2IUTA 3KVRA 2CW5A 4L0MA 4EG5A 1XDWA 4MUBA 4UMFA 1EBUA 1YZNA 2NPOA 4ZT3A 4QOGA 5I8ZA 4MZDA 821PA 4BWVA 4PLTA 5BMVA 3N53A 4H77A 2C9YA 2RGGA 4JBWA 4Z2YA 3HRIA 1FX0B 5FLYA 4K2HA 3FOAA 2AOVA 3FGZA 1P1KA 3L6CA 3EIOA 4PZEA 5DEIA 3E35A 2YRFA 2GYUA 5C7YA 4ARZA 3HCDA 1F2VA 5TPWA 2JBHA 3TS1A 2J9FA 5KVSA 1ZJJA 1TCUA 3QUBA 4I2VA 1UFVA 4BNFA 5AVWA 2J1LA 4XWGA 5FNVB 3PFIA 4JJKA 2FFQA 2DPHA 3G23A 2G06A 5CRIA 3WGOA 4HN4B 3RSZA 2PX4A 2R25B 2QN3A 1YZGA 2FYTA 3M5DA 5BVHB 5IYZA 3KLMX 2YFYA 1QXSA 4EL5A 5FR1A 1QUEA 4TOIA 3DYIA 3A6GA 3UXMA 1WCXA 4GXRA 4XLTA 4DA7A 4DXDA 3BBLA 1WE2A 3RT7A 4RORA 1Y7IA 2FWIA 3QXHA 4RMNA 2ZIGA 4CL2A 1NW5A 5GONF 2BGIA 1O1YA 1G5TA 4L73A 1VPWA 1E6KA 2GRAA 4KR0A 3ZDXB 4KBFA 2PY6A 4G0NA 4PSUA 4ZVSA 4POOA 4L78A 3AB8A 2HWYA 5JJLA 3OHMA 1L5HB 4JA0A 3CRVA 5ALWA 4WZZA 2ZAMA 1FY2A 1PHPA 3DUFA 3BMOA 3Q3EA 3ZHOA 1KRHA 4BLVA 2E21A 2CC2A 3MINB 1I7NA 1LV8A 1HDZA 3MUNA 2CDAA 6REQB 3EZYA 3JVDA 1F1BA 5ENVA 1HFKA 2QMOA 5F7ZA 4F91B 4US2R 2ZBPA 3EAQA 2X58A 1CG6A 1YOVB 3SE0A 4LYHA 3Q8LA 2HA0A 3HN6A 3ZV4A 1RSZA 1Z63A 2NZ2A 1OW3B 1V3UA 2WG1A 3BXZA 3SQNA 1XIVA 4RBNA 5DLDA 3NTLA 4NU6A 3MTIA 1V6SA 1QKJA 4UU8A 4XIFA 3RABA 1PLKA 4E3ZA 2G5TA 3ZOZA 2YWXA 2BHSA 2QYTA 4UQOA 4F8YA 1CDDA 4CVNA 3C5VA 4WN9A 5IYZF 4ZQIA 2HMWA 4E4YA 2AUTA 4AKIA 2NVUA 8ADHA 1WP4A 2PLRA 2QTWB 3SQMA 4D74A 5IVHA 5AVYA 3NIBA 2K4MA 1EU1A 5C81A 5IARA 3D6NB 3MWDB 1EFLA 1KEEA 3H0KA 1VG0B 1CE8B 3H2HA 1ZGHA 3PHLA 2RK3A 4NI5A 4US1R 4KJZA 2JLXA 2OO5A 4S0ZA 3QEAZ 4BAGA 2J0SA 4WZAA 2C8VA 1RZ3A 5BN3A 1OXMA 3O5AA 4DCMA 3VAAA 3KLBA 4PHTA 3B36A 4IF4A 4P32A 1NN1A 1O89A 3B20A 4I99A 2FE4A 1QR6A 1IWOA 1PE0A 3WGMA 4M46A 3IP9A 3IUMA 1RM4A 2PBZA 3CVOA 4G5RA 4RJ2A 4O2BA 2NUAB 1OGYA 2HCFA 2JEZA 3PSHA 4LYJA 1KDZA 4DDKA 4OX9Y 1G291 3KJZA 5K0LA 5CA1A 1T8PA 3CN9A 4MW6A 5B1IA 4UCWA 2VZ0A 3DTTA 2BBWA 2FZLA 2YV4A 4FGZA 1JTEA 4ZVOA 2X5JO 4NAVA 5JAQA 2H9AA 3GEMA 2DXIA 2IK8A 3GA5A 3N1UA 4F92B 1GM5A 4HYQA 2V59A 1N5JA 1SWVA 2H06A 1UFQA 3L04A 3OT1A 1I01A 3KEFA 4OOEA 4Y18A 4IIBA 1GL7A 3DJYA 4G4GA 3GJSA 1IWBB 1BHJA 1F0PA 2DHDA 2EHDA 3AWIA 2FPWA 4FR2A 4L9RA 3Q5GA 3R7SA 2A9RA 1P5FA 4NOMA 1VIAA 2VQSA 5EP2A 1OIWA 2DUUA 1C81A 1P6QA 3T9BA 2O5RA 5LNK6 3VR0A 4KYTA 3DDCA 1QU2A 3I1IA 2IHNA 4L1KA 4CKCB 3JRNA 1G21B 1KMCA 2EZTA 2Y9PB 4KHZA 4TKUB 3RQSA 2W2VA 5AVKA 1KY4A 3PYXA 1EH5A 3Q6MA 1SOAA 3B2EA 1UMBA 2XR1A 2A78A 3WISA 4ETWA 1T6BY 1EFVA 2FZCA 1EDOA 1LK5A 1V11B 2QVYX 5DYGA 5AKGA 3NYRA 1B6SA 3BMNB 2R4UA 3EJWA 3FTQA 4G37A 4O2BF 4OQXA 1UMKA 1ZINA 3O8OA 4L8YA 4RXUA 3K5PA 2IV3A 1RZRD 1ZGCA 3HU3A 3DMGA 1CQIB 1L5RA 2HXYA 1YR1A 4ON9A 4IUYA 5F64A 5KYYA 3NNSA 5ENZA 5CA1F 1Y1LA 4LJ9A 1XKTA 2QX6A 2VG8A 3ZCSA 3JYLA 3WNDA 1JHRA 1YVDA 4OA5A 4KLZA 3UJ7A 1X7ZB 2WEKA 1DJPA 4IKOA 4ZT7A 4W5TA 3RTGA 1F4PA 1U81A 2RHMA 2Z2YA 4NVRA 3T3PB 4GDFA 1Z5VA 2ZB8A 3WRVA 3C1UA 4X93A 3GRRA 2OCDA 2QQGA 3AVPA 4IKEA 1HKUA 2F8MA 4MWGA 2AF3C 4B3MB 2D74A 5P21A 1VE9A 2H5IA 3EW7A 3VPSA 1AKVA 1PN3A 1XMVA 4B8WA 4CTOA 3GLGE 4PFJA 1KK0A 2EFYA 2CFOA 4QTXA 1ZLXA 3ZVLA 3B6MA 3E9YA 3Q88A 1NLMA 1NJ2A 1LPBB 2A5DA 3CR3C 1Z7EA 2OUIA 1L4YA 1YDGA 3V7FA 1WZ2A 1NVWQ 1DV2A 2QUKA 5DP2A 5UKDA 2JGEA 3NM5A 4EKGA 2CVPA 3PRHA 3OQ1A 3WOVA 5KTRA 4QG7A 4E33A 2CB9A 3FCYA 3FRJA 1Z38A 4QDUA 4RVNA 3VDXA 3S0JA 4DWVA 5BRJA 4MEAA 2PKQP 4G01B 4JGIA 2RH4A 4PSVA 1XZNA 4M53A 3KAPA 2UZAA 4FT2A 4KQ9A 3AKEA 4RD4A 4TTTS 5FIUA 4BX0A 3I9LA 5JADA 4EPYA 3W5CA 5I7SA 1KDOA 3QYFA 1VPTA 2ZSIA 2HIHA 2WJHA 2X23A 4JI0B 1XSEA 1NU6A 1U99A 1YXMA 1GDDA 3I2FA 4HGRA 4C30A 1PP4A 3SR4A 3AF4A 2NYVA 4UOEA 5DSXA 4CKEB 4PZPA 4EKYA 1Z34A 4XIJA 2PLAA 1Y3BE 1W1IA 3KQWA 4QDZA 4YQEA 3Q15C 3UHJA 1C0IA 3EVGA 2VC2B 3HKDB 2NSDA 3N7UA 1QGZA 1US8B 2ANBA 3ERCA 1GOTA 1BCRB 1Y5LA 1OC2A 2BKLA 1SC6A 2QS9A 1N6OA 4Z9XA 2QRHA 5E6SA 4EY6A 2FUEA 2GD1O 1ZHHA 1GKUB 1SUPA 2GO7A 3G2LA 2X7HA 4YRGA 1Q1QA 2QTMA 3M8KA 4KAAA 5J59A 3RSQA 5EP4A 3WB0A 5EIBD 1ZNWA 3HJTA 3GBVA 3Q7EA 3QG5A 1SCUA 5ANRB 4P36A 3DFIA 1O57A 1DT5A 1U98A 1QIIA 2X1LA 1JEYB 4RS4A 1YU6A 4OBWA 5HFAA 3GQVA 3MAGA 1IVNA 1OWOA 4YDQA 4G5HA 1ZUNB 1L1FA 2PGLA 2EQAA 4XH9B 1QG4A 1MO4A 1ZIDA 1O95C 2P2DA 3AY3A 4DLUA 1KI8A 4ZU1X 3WLTA 4EUEA 3ESCA 5H3HA 4XE5A 3ELWA 3TDNA 3U7HB 1RLUA 4QNMA 2V5VA 1UKYA 2ZRDA 3LGSA 4JVOA 3DUWA 2XE6A 5I45A 1Z6ZA 4KL8S 3WV5A 3GOQA 1U0EA 4LE0A 3K1AA 2ERXA 4XX0A 3WQBA 1WSAA 4NMWA 4RY8A 2FF5A 4X8MA 4NCBA 1QBGA 3I4FA 4GZLA 3WHPA 5JS2A 4QUGA 4R1OA 2XTJA 2Y1CA 1CIPA 1IEXA 1R9MA 4MKHA 3FKQA 2AZ4A 2NO7A 2TECE 3ZH2A 2MYUA 2CNLA 1JEEA 1CRLA 4G0YA 4CV1A 2ZSUA 4QL3A 3DZDA 3C3PA 1T6XA 1HTWA 2V8OA 1NQXA 1NVTA 4NFLA 5CLQA 1N25A 2C3OA 1YJXA 3DW3X 3L8CA 5CPFA 3GLHB 2H2DA 3NXSA 3ODGA 4MPPA 4DDMA 4UTPA 1MLDA 4XVQA 5A4DA 4HWTA 3PNPA 3RS5A 2JRLA 4FLEA 4JUFA 4DCOA 3M7IA 1FK8A 5JVDB 5DASA 3OMLA 3W3AA 3WIOA 2JJ8A 1OLUB 2BKEA 1K97A 2CVHA 2OEPA 2VF7A 1S8OA 4DQDA 3WL4A 3S2YA 1SEPA 1Q74A 3P0IA 1E7RA 3IURA 4J2HA 4MRVA 5ESXA 3M5CA 5H59A 4EJSA 5IUJC 1A8PA 4GMXA 1PIWA 3HXKA 1TYBE 3BXFA 1GRNA 4PCLA 4PICA 1RLIA 3E48A 5AP9A 3VU9A 3W7VA 1U4OA 3UPTA 5HNKA 4UHKA 4B75A 1YO6A 2H4WA 4NZOA 2ZREA 1FS4A 2GT1A 3AOGA 4UXHA 4HGNA 2CLLB 2HJWA 3M4NA 1J1UA 1C1XA 1UL1X 1NVFA 4FHFA 4C76A 4HVLA 5JATA 4TVBA 2GBLC 1NNEA 5A7GA 6CHYA 3V8RA 3HYLA 3UGKA 3ANNA 4D7AA 3EG5A 1FA9A 1W34A 1UBCA 3N0XA 4E7PA 5B6IA 2QM3A 2ZUDA 4E09A 4OM7A 2QGFA 1AZTA 3SFTA 1WU7A 3PC4A 4FD3A 4AWAA 1QGED 4Q4JA 1U80A 3WNBA 3FPJA 5JTUA 1CR0A 5EUCA 4DR3B 3E9EA 4H3VA 5FA6A 1QX4A 3P9QA 3JWPA 4HEHA 4HFJA 1VMAA 2AJLI 3PNQA 4Y2YA 1CZHA 3ROMA 4I4LA 2XVXA 1TUBA 2B36A 2PU5A 3IEPA 3NVAA 4GOJA 3RIMA 5BWCA 1P5RA 4L3WA 1ICEA 5EJIA 3T95A 1PVVA 1U3UA 2JDID 4NV3A 1ADCA 2RKWA 4U6SA 5I01A 4JXXA 5DX0A 2FSUA 1FSFA 1FLVA 1NI5A 5LP6A 3IVAA 2XZOA 2QKYA 2D5BA 3MMZA 4OK3A 4IV0A 2XXJA 3PXBA 2RI6A 4JQCA 3P9ZA 5EUBA 3EZ7A 1W59A 4P0PB 5KNBD 1IDN1 1T5OA 4IBOA 1F0KA 4KPYA 4YH1A 2BMJA 1D0IA 3H5IA 5K8IA 1ACMA 2EJVA 1LDYA 2HU5A 3BBPA 4IIJF 4DV3B 2VUUA 4E5UA 5CA0A 5JU6A 2I6SA 4HVTA 2J0EA 1X7XB 5EXXA 1YASA 3QU4A 4HH3C 4FILA 4KNWA 5FBVB 3NRBA 4X6UA 1HGXA 1BOFA 3KJXA 2V1XA 1O96A 2ZWVA 1GY8A 2C0QA 3C7DB 4RANA 3TQCA 3PC6A 4MWTA 1ZDMA 4L75A 4M22A 1JI3A 1FUEA 4QDOA 2IHKA 1E66A 5EYPB 2X42A 3DZFA 3GA7A 4C0LA 4PLVA 4UNNA 1NI4B 2G9NA 5DULA 3AUKA 4I1VA 4PC1A 1RXIA 1TLLA 3KU4A 3IP7A 3PGVA 1T9BA 1FF9A 5BSTA 4IQ4A 1RI1A 2IUSA 4MJXA 3GL9A 3CO0S 1ULSA 3GHHA 4U2DA 2NQTA 3GA0A 1XYYA 4B46A 1Q0UA 2A0FA 3DHEA 4DV7B 4RX1A 2R1TB 4JLUA 3TKLA 2OB1A 2R8OA 4UAVA 3V4FA 4D57A 2W2KB 3WK7A 2W48A 2WWGA 2NO5A 4BNXA 4G1VA 3TTVA 2J0UB 2JGRA 2VZEA 5FL3A 2N47A 4PPGA 5KVCA 5JARA 1I6KA 5K9ZA 4ZV7A 1GNLA 3ZLBA 4E4RA 5TS2A 3E9CA 5EMLA 5A4FS 2R7LA 2PCJA 3QPCA 3TX6A 3VKWA 4IUDS 4F97A 2W00A 5FHRA 5GINE 5JYDA 5A5EA 4ABTA 3SVZA 2B4AA 4JLKA 4JWKA 4NR0A 3BG5A 4RY2A 3DR5A 3LY7A 2FWNA 4RJTA 3V42A 1KI3A 1LI4A 3UYLA 5CA0F 4M1TA 4LF6B 5AJVB 4UAGA 5EERA 3M1LA 3LKBA 4ZYLA 5B6PA 1LXCA 3R3YA 1RBMA 3EG9A 1AMUA 1ZSVA 3KTOA 3W9YA 1L4NA 3U5ZB 2BGRA 1DC7A 1S9HA 1CUSA 1JR2A 3OZVA 1W96A 3BWYA 3CLTD 5KHLB 1BGWA 1Y42X 2ZE8A 3ZS8A 3K9CA 3Q5EA 4BLPA 2ETVA 4C7OB 1Q19A 4OHCA 3AGQA 4YT2A 5A5GA 1JSLA 1DT3A 1T4DA 3FJ1A 1PGOA 3OQHA 4DDWA 1GGNA 5ALZA 1UWKA 5BXQC 3H11A 2FLVA 3ZIDA 3A9RA 4J0CA 3TOVA 3VX4A 4IF6A 3LPLA 5E9JA 3VR4D 3KQHA 2V8BA 3BN3A 3DC7A 4QEKA 2W2XA 2FKAA 4QBGB 1DEKA 1BFKA 2RI0A 1OVMA 1NJSA 2YJNA 1QCYA 2RHTA 5CDGA 1H2ZA 5CBPA 1E9EA 2M32A 4YV7A 1CSEE 2VYQA 2XKAA 1JT2A 1P0QA 4G4SP 4QAQA 3H8SA 4R5HA 4DPKA 3GGJA 4P5PA 5TSDA 4F04A 4QBIA 1P91A 2Z56A 3PD0A 4DLXA 2LPMA 2V4ZA 3IE2A 1R1DA 1IZYA 4OHXA 4X7RA 1S2OA 1AN9A 2IA5A 2XMDA 4RKEA 3SYRA 1H66A 3AUXA 3WSWA 2H9IA 1ZOOA 4W9RA 5ICMA 1E0DA 2A0WA 4GXQA 4MUEA 4FGJA 2FEXA 3CEJA 3MTAA 1R6TA 1O6FA 4HPWA 4KQCA 3O4JA 2VYND 1PYGA 1VBMA 3IXQA 3A70A 1S1CA 3KR0A 2O2IA 3MILA 1QAOA 4O1MA 2W2NA 4BVGA 3L4BC 4BNZA 4OFXA 1HH4A 1QH9A 2P6UA 2HI0A 5DDIP 4B33A 3HXOA 3FETA 4W5JA 1YHNA 3DC2A 4HJRA 4V03A 5GIOE 2QL5A 1GSOA 5I47A 4MKZA 3QVWA 4NX2A 1U7UA 5HJEA 1FQWA 4E5PA 1Q0PA 1IYZA 2QD4A 3MMXA 3PNVA 1W4BA 3FFWA 4DILA 5B7QA 1BSVA 1RJ9A 4PCUA 3ZV6A 1TF2A 2G04A 4YUVA 1GCAA 4NCJA 3HBLA 3VYVA 3U17A 2C54A 3RM3A 5A0VA 5G3ZA 3SZOA 4OHVA 1KVQA 5KOIA 1N2OA 2RHCA 2Q3HA 4MS4A 1RXYA 2G70A 1I0IA 1CUFA 1ZGJA 3O83A 1LS1A 5H0IA 1YB6A 4EB3A 5LLDA 3TG2A 4WERA 4JBLA 3UCXA 2IDJA 5JASA 4MDFA 2H0AA 2H52A 2WIKA 2V7PA 3U7QA 3W4IA 3WHLA 4CEHB 2WAXA 3NBUA 1KFJB 3SQOA 2OHVA 5BPFA 2PFGA 1J49A 1E1CB 3FTPA 2ZJYA 1KHTA 3G0HA 4W5NA 3QJGA 3FUVA 4HNRA 1XTBA 2YIMA 4DQLA 2OENG 3RUIA 3ZHTA 4MINA 1F51E 1FW6A 3U5TA 2CF6A 3T1OA 3BYZA 4QDKA 2ZXUA 1B93A 2J08A 2X2OA 5ECDA 1FQJA 3AF3A 5EN4A 4IMJB 3OJXA 3D6FA 1KZHA 1VJTA 2WU8A 1Y3AA 1Q0SA 2H92A 3PPVA 4L3VA 4WFQA 1KR2A 4DV1B 3QZUA 5CFOA 5ALLA 2OHGA 1P3Y1 4M8LA 5CDUA 4TT3D 1U8ZA 3GH1A 4X7MA 1SKMA 4GRIA 1ULUA 3K9QO 2R3SA 2OORC 3OH8A 1HPLA 5B2FA 3F1KA 2WB4A 4CLHA 5HF8A 2HU8A 1FRZA 2Q7XA 1Z7BA 1H8HA 1YUMA 2X4GA 2PKYX 4QHSA 1VGQA 1VBNA 1XVLA 1JKMA 2PQ2A 2ZWIA 3R6WA 4M9UA 4QUAA 4ND2A 5F51A 3A3NA 3EGXA 3R0XA 3SG0A 3KVYA 4QOEA 3RQIA 4N0PA 1PUJA 1R0WA 3NHRA 4F1WA 4NWIA 4QAJA 1MCZA 5AXBA 5KTOA 4JSYA 2CKMA 1YQEA 2EKQA 4KQJA 4JKOA 2JAPA 4H7PA 3SQXA 2CZQA 4JMLA 2L2QA 4LYGA 1V7ZA 3RU9A 2Q8PA 4EI2A 1ATZA 2AS0A 1M8PA 2VJPA 3L7MA 1SVSA 5JUWA 5C1DA 4HDKA 2DFPA 4HFMA 3EYAA 4UU1A 1VOTA 1Z4QA 3S99A 4IIVA 4IVNA 1ORTA 3A0RB 3UHPA 4EYSA 4QGSA 1MIHA 1VI2A 3DBLA 4P7BA 4UDNA 5BW6B 2B3DA 3O47A 2CLIB 2XCLA 1WR8A 4BZQA 4JDPA 4XQEA 4YAEA 2F3RA 3WQRA 5C4GB 3VPDA 3IAHA 5F5NA 4R51A 4PFQA 3TIFA 4BX8A 2ZI5A 2AJBA 5AUPB 1L3CA 2ZJ0A 2QN6A 3UNXA 4PZZA 4XA8A 2B6NA 4WJZA 3ROTA 4HEA1 2BFPA 3BULA 5BRAA 3U7JA 1VYUA 1CQJA 1Z28A 2I78A 3K6SA 3LHKA 1PX0A 4PLFA 3VPCA 3CLHA 2IPMA 2ZBQA 4BGDA 2IVZA 3LDGA 2AD5A 3GUHA 5IC4A 2IELA 1E1YA 2ZI4A 3DOCA 2C57A 3DCYA 2CN1A 4RCYA 4OB8A 2I6TA 5AJZA 3FCAA 2R6CA 1SCNE 2G9RA 5EAIA 2GVDC 4EW3A 5A02A 4I4NA 8OHMA 3S6JA 4NQZA 1ECPA 3QVGA 3GRFA 2GAIA 1G18A 1II9A 3NC0C 4OMDA 2LZ0A 5JWHA 5EIXA 4OVKA 1ZC4A 1N2EA 2XGSA 2ZAYA 3AXSA 2VBFA 3TNDA 1ZN9A 3UJPA 3VSAA 4EYQA 1TGVA 3HBMA 3BRWA 5B58C 2CV1A 2GFIA 4YJ3A 5D8DA 3QTBA 2ZDHA 3B2NA 4IJ6A 2QI9F 1N2BA 2VNIA 3E58A 1E2NA 1ZH6A 3B1KA 1QRRA 4MLCA 4NDNE 1TYDE 4J0FA 2VXCA 3KP1A 1J0BA 3ZWPA 1ND5A 5IZ4A 4ZTZB 1MABB 3SICE 2V96A 2XEXA 1FYEA 1QB8A 4FMCB 2X1MA 1DDOA 4B3TB 5CDHA 5U9CA 2QE7A 5A2GA 3C6XA 1GWNA 4LOAA 3R3ZA 1W93A 2C5GA 4PCAA 4UBKA 3RROA 1KY3A 1AKQA 1JAIA 1QV7A 1W9HA 2IYLD 1NRWA 4GOLD 1JEQA 3BEDA 4M9SA 2JLUA 1OXKB 3HTXA 2IUUA 4RZSA 4GI1A 4KXVA 4TYNA 1OZGA 1EKXA 4WKCA 1C9NA 3Q3GE 1DC3A 1KYZA 5I7RA 5K8JB 3DONA 4HUJA 5KU1A 3C45A 2YHUA 4G86A 1V41E 3WK9A 4BO9A 4WDRA 4E22A 3RYCB 1CW2B 2WJYA 3K2EA 4ZC1A 4GSKA 2OMKA 1HDYA 1W85A 1MO5A 1Y5NA 3RT9A 3AVUA 3JQ8B 3QHQA 3UJDA 2PJZA 5AOCA 1XPRA 4F2WA 1NN5A 3T9CA 1FFAA 1AO3A 3MJCA 1PT8A 1GPDG 4XFDA 1NXWA 2AWOA 4UVDA 4YJ3F 3W3AH 4IMPA 5E2IA 5CLJA 4IO1A 3EIFA 3PR1A 2YNMA 1IHYA 4R8LA 2VF2A 1DCFA 1GGMA 3NB0A 2QRZA 3PG5A 3W05A 4Z7NB 5ICEA 4KQFA 1ORIA 5FQOA 2QW1A 4WGFA 4L5AA 1P7VA 1I7DA 2HPHA 4PHHA 1RHRA 4RM2A 2OC9A 1RE0A 4NBVA 3VH1A 3DD5A 3DV9A 5AR1A 3H87A 1G8HA 1OZHA 3Q72A 5FBLB 2Z3VA 4X9XA 2OHFA 3IPAA 3ZJVA 3WJ2A 1JFSA 1IHXA 4R4JA 3UAVA 3K7EA 4CUZA 4M1QA 1Y98A 4XX1A 2VAPA 2JASA 4YYEA 3A9UA 4NESA 5M29A 1GGVA 3ENNA 1JLMA 2WVJA 4Y6SA 3WC4A 4CDRA 1O4VA 1T2VA 2JFBA 4FFSA 2CYBA 2P2YA 3PNSA 1QZ3A 3O8LA 4CTMA 1FMCA 4UCQA 3SN6A 3WMGA 5HDBB 4N18A 2IEGA 5DW0A 2IP2A 5E1OA 3IT2A 1G41A 5LUBA 3WDKA 1Q50A 4N9WA 2XNDD 1ZVKA 5CPBA 3L1VA 3FG9A 2ZULA 4QHTA 2HJGA 1DIGA 4WCFC 1GPAA 1T29A 1XLTC 1YVUA 1R4MB 1UJCA 2HK6A 1XYVA 2X6QA 3NUGA 4CFZA 4TQUS 2GRUA 5CNIA 3I5XA 4YJFB 3OPMA 2BP7A 3RS7A 4R2KA 2ZJ7A 1JHMA 1PQUA 1UJ4A 3A4TA 5CG1A 1SBHA 3LX5A 3ZGOA 3HA5A 2UXBB 3ORQA 1Z4MA 4OJKA 4RHFA 4UFPA 2EJUA 3L8EA 3QFRA 2I8LA 4J7UA 3WYGA 2H29A 2VHUA 3SZLA 4GMHA 2VDWB 5FPYA 1G20E 1CPYA 2OP1A 4M37A 4J0EA 3NTQA 4QPCA 4D9IA 1WMBA 3L0YA 5LYJF 5FOVA 3E9ZA 3NIWA 4DWWA 4DUGD 1CUYA 1HWYA 2QTAA 5E6UA 4P92A 2E37A 3WICA 2UDPA 1G0NA 1SHUX 2ZYDA 1H1TA 4R84A 2BGJA 1R10A 1G5FA 1AU9A 2PYIA 2Y1WA 3ONNA 4WXPA 4X92A 2HRCA 4CUJA 4FJ0A 1Q22A 1UT5A 5BWLA 3AT1A 3QWBA 1N9ZA 3MTJA 4AZSA 2BWJA 1EWTA 1QFJA 4U1RA 1ABFA 3GWZA 2OPHA 2O8FB 1NV8A 4S1PA 4X1KA 4YRQA 5ALXA 1B16A 2WHRA 2R6FA 3WGGA 1C0KA 4HXEB 1JKFA 5E6RA 5F52A 4GE0A 2E4ZA 5HOQA 4HDOB 4JFAA 1RJFA 3PR3A 4IDCA 1A27A 4X1IA 3UUGA 3EGDA 3JQQA 4DHEA 4EFDA 4GKBA 1PTJC 1I36A 1V8FA 2WHPB 4NLLA 3D59A 1E4VA 1Z6QA 3NH9A 5ECWA 2ORIA 1BXGA 2GF2A 2XUIA 3CMMA 5E4YA 3EQ7A 2PGAA 3NM4A 3IEKA 3KKKA 4RD6A 4UD6A 5AI8A 4U9UA 3ZI4A 1C8KA 2OBBA 2VLIA 3RIEA 2BW0A 2ZUVA 1KY2A 1NW7A 3PZRA 4IKPA 1SCIA 1XJQA 4A73A 1WUTA 3VH2A 2GAOA 2C8JA 1W36D 2VHEA 2UZ1B 3E23A 1NKSA 5U1PA 5YASA 1QGUA 2Y2UA 3LC0A 1E2PA 1DAHA 1PL0A 4IDFA 5I9BA 3CS3A 4RHEA 4OH1A 3RKRA 3RJ9A 5IAEA 1CYEA 5JROA 1VL8A 5AXAA 4C6SA 1GKLA 3KYCB 1L8XA 1GN8A 1NUUA 1E94E 2D06A 2IPOA 3A8TA 3D7LA 4JU8A 1U2TA 2A5JA 3NNNA 1YCFA 3S29A 3TLXA 5LJLA 3C5CA 4E15A 1PSDA 1G5RA 1KOGA 1AK2A 2I2BA 3FNBA 3G2NA 4C7VA 4R1NA 3K9FC 1RIIA 1LS6A 1OX4A 2GJ9A 4NXMB 2PMFA 3ENZA 2JFPA 3JZMA 3U44A 1Q0RA 3OECA 1NBME 1ULHA 1X7WA 1FX1A 4OQMA 1SQFA 3NKFA 1SA0B 2I1QA 1UXKA 2G63A 4P7GA 4U9HS 4YDSA 3AI2A 2NVWA 2JFWA 3A1VA 1GJRA 2OK7A 1DV1A 5ALHA 1IDOA 2ZSHA 1QCCA 3SF8A 2EIHA 3HJGA 4J4TA 4P83A 2NX2A 4DSNA 2JBAB 4ILEA 4JC0A 4IS2A 1F3OA 3HFSA 3ZZ1A 4ZJYA 2P40A 4RY0A 1KYWA 1W52X 3OETA 2PH7A 4CR7A 1O6ZA 4GKKB 3SHWA 1J23A 2XDQA 2YKGA 1RU3A 1BZYA 3ENQA 3UAXA 5LL6P 1MOQA 2KM1A 3IAXA 4PX2A 1DEXA 3OJOA 5JV5A 1L5VA 3ZQKA 3GPIA 1MJHA 2OGUA 3PXUA 2GCIA 4I5EA 6AT1A 3NWEA 1JALA 3FPGA 3PDUA 1GRRA 4LTDA 4A03A 1IH8A 5LP1A 2PR2A 3OJ0A 3PE6A 3FPCA 3NRJA 4R9NA 3GG9A 2Q7OE 2J3IA 1W1WA 3NG1A 5CT9A 2NPFA 3EX7C 2Y4OA 4UM8B 2PO7A 3FCUB 5J2TB 3MCTA 1MTOA 3L18A 4HPXB 3UJBA 3Q10A 2ERYA 3LY8A 2PX2A 1R64A 3A2KA 2D59A 2JD0A 2NXEA 1NZDA 3LW8A 1ECCA 4FGLA 3W5UA 2C9DA 1FNNA 2F4VB 1OLSB 1XQ9A 3M81A 4IHKA 1EIWA 2Q46A 1W8DA 3SBEA 3V2UA 1V16A 2PWYA 4YJDA 5LLTA 3RE1A 1VE1A 2HQ1A 3HCBA 1KP2A 2I1WA 3MMPA 4LCEA 1DX9A 1CY6A 4CQJA 5AUQA 3LLVA 3QEKA 4CQMD 4YMSA 3EFBA 4XWYA 5KSZA 3GPLA 2H85A 4F7WA 1WZUA 4RDHA 2JIQA 1T5IA 4LHSA 1Y5MA 3CHYA 1A7JA 1EG7A 4M83A 1MOZA 3DZGA 3IRVA 4UTZA 3W5DA 4JFRA 4HLNA 2OOKA 4OA8A 1AHHA 4UVHA 2Q3DA 2QAGB 3DKIA 3DE3X 4LYDA 3FTCA 3TSYA 4MS1A 1YCGA 4OYRA 1H2XA 4UUOA 3MWYW 3ROEA 4F93B 1Q1GA 4K40A 3IPYA 1D4ZA 1M1YA 4HQOA 1K8XB 2YYSA 4JL5A 4JA2A 2H8GA 2IZ5A 2QDKA 4M0PA 4P4GA 1GNPA 1LBSA 4ACBA 2FWPA 2BKUA 1ZAYA 4W5RA 1KNXA 4DLLA 3LE8A 1SNYA 2EQ5A 3DV0A 4J0DA 2OHOA 4TVKA 4RLSA 1RRFA 3X43A 1AKYA 4FOTA 1M74A 3BJRA 4NCKA 5EGNA 3EXHA 3BCUA 2BGMA 1MBZA 1RKVA 4UPEA