3QPDA

Structure of aspergillus oryzae cutinase expressed in pichia pastoris, crystallized in the presence of paraoxon
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
187
structure length
186
Chain Sequence
LTGGDELRDGPCKPITFIFARASTEPGLLGISTGPAVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIAEAQGLFEQAVSKCPDTQIVAGGYQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQERGQIANFPKDKVKVYCAVGDLVCLGTLIVAPPHFSYLSDTGDASDFLLSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords Cutinase 1
total genus 68
structure length 186
sequence length 187
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qpdA00
1VLQA 1IVYA 2BJHA 1EDDA 4P08A 4AO8A 3CXUA 1WPXA 5ALFA 1VKHA 4UHBA 4G8BA 4MXDA 2IITA 2Z8ZA 5JIBA 4PNZA 2C5GA 4H35A 3W9UA 5HF9A 1UFOA 3F97A 4B85A 3O9MA 2VJAA 4XVCA 3S2ZA 2DHCA 3WK8A 5BWBA 1ZD5A 2H1IA 1BU8A 4XX1A 3DDUA 1WB5A 5JYCA 4HVTA 5BWCA 2XMGA 4B80A 3JWEA 4G1FA 3E3AA 2XQIA 4OPMA 2OAEA 1LZLA 1AZWA 1QGED 4G4IA 1GKLA 1ZGCA 4UHHA 3PI6A 5FV4A 5AKIA 4IHAA 3D2BA 4P92A 3VDXA 2X5XA 4C4XA 4DTCA 1U4NA 3I2GA 4DSAA 1BROA 1FFDA 1SCKA 4IQ4A 2ZJFA 3ANTA 4YK7A 2QUAA 2HA0A 1XLWA 1GGVA 1XZBA 5CT6A 1BCRA 2HU5A 1FFBA 4FLEA 3DS8A 5DNUA 5HF6A 1LPBB 4HXGA 2W22A 2CBGA 3I2FA 2OCGA 5C81A 2WUGA 3P2MA 3H18A 3C8DA 3IULA 5T4EA 2PBLA 5ALLA 4LYEA 1WB6A 4DSZA 5ALIA 2B4KA 3JW8A 5CXXA 3SK0A 5I7UA 2PL5A 4RE6A 1XRRA 3HYSA 4KR0A 5LKAA 5ALQA 3PUHA 3UUFA 3DLTA 4FFWA 5FPQA 4H7KA 1TRHA 4D9JA 1QIDA 3PFBA 5AK3A 1HLGA 3H2GA 3WKBA 4F21A 1JFRA 1MU0A 2JGLA 1SCIA 4QDZA 2WFLB 1XFDA 1K63A 4UFNA 5DJ5A 5AKGA 3STWA 1MX9A 3BJMA 3CCCA 1JU4A 4J0JA 4H7DA 5IKXA 1A8SA 5CW2A 4LIPD 3HJUA 3DQZA 1EX9A 4QLOA 1K5PA 2V97A 4OSEA 5KWIA 1J1IA 3IUQA 5JALA 4ARBA 4HTAA 1W75A 2QOEA 3WKAA 2HA5A 1B6GA 4DNOA 5LZ4A 3D7RA 3WKDA 1EB9A 4WCVA 2I3ZA 3WL7A 4YASA 1UK7A 3FYUC 2GBGA 3ZLTA 4J0CA 4X91A 5CT8A 1QIJA 1QONA 3G0IA 1EXWA 4KEAA 3VVLA 5ALDA 4X6XA 4EB0A 1D07A 3R0VA 1CQWA 3G0GA 5AP9A 1DQYA 1CUCA 2HFKA 2VAXA 1Q83A 5AKLA 1CEXA 2IX9A 1XZEA 5AKYA 5AJHA 4X71A 4E11A 3W04A 1LPAB 2HA2A 1YAHA 2GBIA 4XJVA 2DQYA 2RHTA 1YSCA 3FYUB 1MX5A 4X90A 1GQRA 3FCXA 4AZ0A 2ONCA 1HBJA 3K2IA 4PO3X 1WPRA 1FFAA 2CKMA 4BATA 1N8SA 4WDRA 1F6WA 4Y2YA 3Q8WA 3MUNA 4MWTA 3G0BA 4FOLA 1DWOA 2HRRA 4PV7A 2ZSIA 3C5VA 5ALEA 2WUEA 1GXSA 1CVLA 2PSFA 1XZDA 3AILA 4H7FA 1CQZA 4UBMA 2OLEA 4X95A 4FDMA 4INZA 3R3YA 2J3DA 3BJRA 3BF7A 1GZ7A 1L7AA 3B12A 4N5HX 5D7BA 3WQHA 1AURA 1UOQA 2V98A 1CR6A 4ETWA 3QYJA 4AO7A 1DT5A 3ESAA 4JYPA 1CUVA 4OB6A 5DYYA 3IUMA 1IUOA 5CURA 3AZOA 3WYDA 4UFOA 2WTNA 5AM3A 3W06A 3A2NA 3C6BA 5LLSA 2GBFA 1DWQA 1DQZA 1RWQA 2OGZA 1IMJA 1UOOA 4FTWA 2CEKA 1UXOA 5EFZA 5EHQA 5K3CA 4Y2VA 5EIHA 2ACEA 5D6OA 4FBLA 3QPCA 2V96A 1TQHA 5LIPA 3OOSA 3V1NA 4UPDA 2QR5A 1H2XA 3ANSA 4BRSA 4CCWA 3WL5A 1DX4A 2AJLI 2PVSA 5ALTA 3KOOA 4AZ3A 3FAKA 2WM2A 5DTJA 5K3EA 4K2AA 1GKKA 4AB1A 5AKHA 4BAGA 3HXKA 5AI8A 4PSUA 1MN6A 4EZIA 5IVIA 2J4CA 4BDTA 1XRLA 2QUBA 5K3FA 4G9EA 1GT6A 2XDWA 1E8DA 4EY8A 5AM4A 2PSEA 1NU6A 1UZAA 4IH4A 1HDEA 3JYHA 1QTRA 4LHEA 2ZSHA 5HFAA 4O08A 2WHQA 2HA7A 1JJFA 3VJLA 1K8QA 1AX9A 4C87A 4CIBA 4X97A 2QM0A 7YASA 5LZ9A 3M81A 4MWSA 1M33A 3R3UA 4C89A 2PUHA 5AHXA 5AI0A 4C4ZA 5JAOA 5JAPA 1ACLA 1WM1A 2Y2UA 3E4DA 2VAVA 5E2IA 4YX9A 1CUUA 2VJBA 3FCYA 4FBMA 2XMSA 1OCEA 1TCCA 4QE3A 4K6HA 3V9AA 1P0PA 2LIPA 4V2IA 1MTZA 1VE6A 4F5ZA 1YA4A 5DWDA 2JGKA 3D59A 4BVKA 2J3QA 5CH8A 1SCQA 2C7BA 1UK8A 5HK9A 4F0JA 4AQDA 1GQSA 1CRLA 2EDCA 1ZIXA 5FUMA 1YB6A 2HU8A 1XZLA 3VJMA 3LP5A 4B0OA 5I8PA 1LNSA 4JEIA 4DMFA 2I78A 4G4GA 3HZOA 4L3WA 3C6XA 5AKZA 2YH2A 3QMMA 4BDSA 4W1RA 3WA7A 5J3JA 3HI4A 3WJ1A 3E1GA 2D0DA 4W9RA 2B61A 1X70A 5AM1A 4ARAA 1MO2A 4I4CA 2C4HA 3UMJA 4J0GA 4KAFA 5AK6A 2H7YA 1EI9A 2QS9A 5E4YA 3QPDA 4WY5A 5IH7A 5ALPA 2WIKA 2O7RA 4HRYA 2CMFA 4Y2JA 1CFJA 3DYIA 4B83A 4H7JA 1BE0A 1IUNA 4L0CA 1H22A 3I6YA 1GPKA 3WL8A 1H2YA 2XQKA 2H7CA 4J3JA 3RLIA 3FVRA 3GZJA 4Q3OA 5BV7A 1N1MA 2OAGA 1R9NA 1BRTA 4HXFB 3F96A 3OURA 1T4MA 3AZQA 3F98A 5DNVA 3IIIA 4UHDA 1XZHA 1ACJA 5ALKA 3A2LA 3WJ2A 2OCKA 3K6KA 1CUWA 3ZI7A 5FLKA 4L9AA 2R11A 1W1IA 1LPNA 2XQJA 1CUXA 4B82A 3I2HA 3F67A 3AIKA 1A88A 1X2BA 4GDMA 2WIFA 3ICVA 4BVLA 3OM8A 4K6KA 1LBTA 4AN1A 1YB7A 4LXHA 2XQGA 2PSHA 3M3DA 5ALJA 1DINA 1YS2X 4PW0A 4NVRA 4LXIA 1VA5A 3Q0TA 4DYHA 3HSSA 2FX5A 2WSLA 3C70A 4KE8A 5EIAA 5JAHA 1AQLA 1OXMA 3WK7A 3QMVA 1EHYA 1LBSA 1ZGBA 1QO9A 1QIFA 2X76A 3O0DA 3C5WP 5CMLA 4AN0A 4EY7A 2Y6VA 1G4HA 1MT3A 2Z3WA 3O4JA 3ZLUA 1WHSA 1BN7A 3DOHA 4MEAA 3FBWA 3B5EA 2WUFA 2WHRA 1XLUA 5K3BA 3AUKA 2DR0A 3D4LA 4A16A 2ROQA 3IB3A 2XLCA 5AK5A 2EEPA 5ALRA 2XUIA 1QIHA 3HACA 4HZGA 4BYMA 5BOVA 4LYDA 4TGLA 4DM7A 1MX1A 4C6HA 3AIMA 2IIVA 3GA7A 1U8EA 3I1YA 4G8CA 5KBYA 4CCYB 2WG2A 3WK5A 1XQXA 1LPPA 2RONA 2B9VA 4C88A 3RKSA 4G8DA 3DKKA 3EF3A 4X6YA 5C8ZA 2ZVDA 2QZPA 4OB7A 2OCIA 5AOAA 3WI7A 2RIPA 4X85A 3D3NA 4S0XA 1CLEA 1MNQA 1PJAA 4X3CA 3G9ZA 5A7FA 1MAHA 1WB4A 3O4GA 3V1KA 4XIIA 4BC0A 4HAIA 1PV1A 2ZJ6A 4RPCA 3VXKA 4U2CA 4KACA 3AJAA 3G02A 1DT3A 5EHZA 3D5EA 4GBGA 5LP1A 1ZIYA 3STYA 5A62A 4U2FA 4CCYA 2AJBA 3I6MA 3NUZA 5FDFA 4Y2SA 5K3DA 5KWJA 3IUNA 4FMPA 2Z5GA 3GUUA 3E0XA 5AIBA 4RE5A 4KYVA 1Q0RA 2WIDA 3EQ8A 1ORVA 3VJKA 1QO7A 1YCDA 1G5FA 4KRXA 3IVMA 4H77A 1RP1A 1LLFA 2WFMA 3WWOA 2DHDA 2V9ZA 4DGQA 3WWDA 5AM5A 5ALHA 1USWA 3LIPA 2VT7A 1H2WA 4L72A 4W63A 5JD5A 2XUAA 3S8YA 4KRYA 5CTAA 2OCLA 2YYSA 5K5EA 2O2IA 5DTIA 5LZ7A 4BRZA 4HS9A 3HC7A 3R3ZA 3V1LA 4Q82A 4UBLA 2O7VA 4GI1A 5EIEA 3FLBA 5E4TA 4JUIA 1SFRA 4G9GA 2AJDA 2XUJA 5AO9A 5ALVA 1K6EA 4BTLA 2G4LA 1UT6A 4MYSA 2VQ6A 1WCYA 3YASA 3A6ZA 5FXMA 2WG1A 4Y2RA 2HA6A 4BP9A 1GPLA 2ZYHA 1L7RA 4AO6A 4BZZA 5DNWA 5CBKA 1UKBA 4UFPA 3C87A 4F60A 2PU5A 4EY6A 4UHFA 1AGYA 2AJ8A 2H7XA 1XRQA 1UK6A 1N5MA 3GBSA 1VXOA 4HRXA 5JATA 1QTIA 5ALGA 1E8NA 1C4XA 3GROA 4Y2QA 4W1SA 4WJLA 1XRNA 1Y37A 4W1QA 1CUSA 3NOXA 4J03A 4WFJA 4Y7DA 1QZ3A 4Z49A 1CUAA 1W76A 3WWEA 3ESBA 2BFNA 4Y2TA 2DQZA 2B20A 2QRUA 3GFFA 1Y7HA 4BCCA 4Y9SA 2WKWA 1QIGA 2PPLA 5A6VA 4TVKA 2DSNA 4BBZA 5C8XA 4CG3A 4OYLA 3M82A 4QDTA 1ZI9A 4TPKA 1LPOA 4ZREA 5AIAA 1R4ZA 5LKRA 4PQEA 1XZAA 3R40A 2I03A 1O6GA 2HL6A 1VOTA 4ZXFA 5ALNA 3QBJA 2QTBA 3ESCA 4N8EA 1X2EA 3H04A 3BL8A 2QT9A 3STXA 4C01A 3I2IA 5JASA 1KU6A 3D0KA 1WOMA 4FLMA 4E46A 5FRDA 4GLBA 2PX6A 3DL7A 4FNGA 4Q3LA 1ZD2P 5DYWA 5EI5A 3PF8A 1XZJA 2XUFA 3I28A 2WUDA 3G9XA 3AFIA 3WK6A 5AOCA 4U2BA 2Y6UA 1ODSA 3QITA 2OGSA 3WZMA 2JF0A 4ZRDA 3FLEA 2WQZA 3R3VA 1XZFA 5FPPA 4OUKX 3H1BA 4G5XA 3EQ9A 2VATA 5CRIA 5AI9A 2HHAA 3BE8A 2X8BA 4QWMA 2JBWA 3AIOA 5HCUA 5D3KA 2VTVA 3AINA 5EGNA 3OC0A 3WIOA 2H9YA 3WL6A 4IH1A 4FKBA 2XMQA 4DMHA 5ALYA 3WK9A 3KSRA 1E89A 3W2TA 3STUA 1CUZA 1YS1X 5ALWA 4B6GA 2ZJ7A 1L7QA 2WFZA 2DCMA 1THTA 1YAJA 1TCAA 1XKTA 2XUGA 4J0IA 5CT5A 1E8MA 4PSDA 1JI3A 4QWWA 5HKBA 1K4YA 1BN6A 3H0CA 5A71A 2JGEA 4U2DA 5AI4A 5AOBA 2PSJA 3W9BA 2PU7A 3DEAA 5HF5A 3HABA 3O95A 5AH0A 3CN9A 2VJCA 3NWOA 2ES4A 3WKCA 2C5FA 2WIJA 1CV2A 1CUFA 3DJYA 1J07A 1XQWA 2O2HA 1GPNA 4GEGA 4ITVA 3WIBA 2WIGA 3C6YA 4DLNA 3IUJA 3U1TA 1DU4A 4OD0A 1FFEA 4DNQA 4JYMA 2G5PA 3WZLA 1PFQA 4DMKA 4NMWA 4E14A 4KE9A 4J0HA 1QOZA 1XRPA 2AXEA 4OB8A 3BF8A 5K3FB 1HKHA 4MEBA 2CUTA 3IBTA 2VT6A 4BC1A 2GYUA 3T52A 3I1IA 2VEOA 4H0CA 1XQVA 4QLAA 3H2HA 1CUHA 4FWBA 1IZ7A 3BIWA 4LXGA 2DHEA 1BEEA 3LIIA 2ORYA 3DYVA 5HF8A 3LS2A 3G0DA 1EDBA 1MNAA 3KWFA 3R3XA 5HZGA 1TKRA 2BGNA 4BTVA 1TIBA 5D3ZA 4H7IA 4N5IX 1NX9A 4M0MA 2W6CX 2WG0A 3H2JA 1QFSA 1ZOIA 5CH5A 1U65A 3RM3A 5AM0A 4BCBA 1JJBA 3UUEA 1VZ3A 4B81A 2XI4A 2Z3ZA 3LLCA 3H17A 1QIKA 2QVBA 4RNCA 4KAJA 3O4IA 3WYNA 1C7IA 4EY5A 6YASA 5LZ2A 3I2KA 5IVHA 4ZGBA 1LPSA 3C6ZA 5CXUA 1SOMA 2XMCA 3VVMA 1ZJ5A 1QJ4A 3KWJA 1P0IA 4Y2PA 1TCBA 5A7GA 5HFNA 3RK4A 1ZI6A 3O9VA 3OTQA 4BAUA 4E15A 3QPAA 4GW3A 1UOPA 5ALSA 1HL7A 3FSGA 1ZD3A 5K3AA 1XZCA 2Q0XA 1JJIA 1WHTA 3A70A 5LZ5A 4JH0A 5ALOA 3QVMA 2ZYRA 2OGTA 1G66A 4MYDA 4B7ZA 3PDCA 1EA5A 4H7HA 3ZPXA 1R50A 3T4UA 4CI9A 1JMKC 1C7JA 4DIUA 1IZ8A 4N8SA 3STTA 2WHPB 4WFIA 3DOIA 2ACKA 1NU8A 3K9BA 4X93A 2HA4A 2VSQA 3H19A 2BGRA 1R9MA 5CH3A 5HK8A 3L1HA 3TJMA 4MJ3A 2Y2VA 2FJ0A 4NZZA 5ISMA 4U2EA 5JAUA 3H1AA 5HKAA 2BCEA 2QMQA 3ZV7A 1VA4A 4I3FA 5JANA 3HEAA 1R88A 3WWCA 1QFMA 3DKRA 3IURA 3SWWA 4PSCA 3BIXA 5AKJA 4U2GA 2EDAA 2YASA 2XB6A 3TRDA 1XZKA 5H3HA 3HLKA 1VJ5A 2XLBA 4FFVA 2JGMA 3U0VA 4EY4A 4FNMA 4A5SA 1CUJA 4CG1A 5T4BA 4EBBA 4I19A 4H18A 2XUQA 3FSGD 2RHWA 1BS9A 1J2EA 3ED1A 4OU5A 3B3QA 4QNNA 2XT0A 3ZLVA 5SYNA 2HM7A 2WJ4A 2VA9A 1XZGA 2GYVA 1W6RA 2JIDA 3R41A 4AMYA 3I6ZA 2ZYIA 4M0EA 2BUCA 3KD2A 5A7HA 4FHZA 4BE9A 5LZ8A 4RGYA 5IVKA 5AI5A 4Y2UA 4KE7A 1CIJA 1P0MA 5AI6A 4M0FA 2JGFA 5JZBA 1DTEA 2WFLA 4QA9A 3I2JA 2GBCA 4DNPA 3IDAA 2QKYA 5JARA 2XMBA 4NS4A 2WLSA 3FVTA 4MQLA 4Y2XA 5AKXA 2PM8A 2OQIA 1ZJ4A 1VE7A 4X94A 1ISPA 3DCNA 3DD5A 3PFCA 1Z68A 3G8YA 3D2CA 3STVA 4PF1A 4IH9A 2R8BA 1XZMA 3QM1A 4Q3KA 1QLWA 2PUJA 2XMRA 4B9AA 1E3QA 1R1DA 1S8OA 4H7EA 3N0TA 3OG9A 5FOQA 2XMDA 3WKEA 5AKEA 1G42A 4ZI5A 2GZRA 3BWXA 5ALUA 5F4ZA 1HPLA 1CUIA 4UBOA 1E66A 1FSSA 5EHNA 5A2GA 2XUOA 4K6GA 4EHBA 2Y1KA 4J7AA 1YA8A 2BKLA 4ROTA 1W52X 4UUQA 2WJ6A 4DMCA 5JZ9A 3PICA 4QZVA 3M83A 1CUBA 1DX6A 1B41A 1LGYA 1QIIA 1EDEA 3LCRA 3DL4A 3RARA 4W1PA 3WK4A 1H2ZA 1HQDA 1RYYA 5E4JA 5KREA 3A2MA 4BAZA 1ORWA 3F9CA 5JZSA 5ALMA 2DFPA 1Q0ZA 2HA3A 3DNMA 3MUOA 2C58A 4BE4A 4K5QA 1JT2A 1XKLA 2OPHA 1EB8A 5FP0A 2HDWA 4UHCA 2PKYX 4QDUA 2WJ3A 3G9UA 5AM2A 4WY8A 1AMNA 5ALXA 2HADA 2VJDA 3FWHA 2CZQA 4OU4A 2WHPA 1ETHA 3MGAA 4QDOA 1CPYA 2BAGA 3EQ7A 1J06A 1F0PA 1A8QA 3WLAA 2HRQA 2JGIA 4X7BA 2XUHA 2XUPA 2GZSA 2WTMA 2VF2A 2CJPA 2PSDA 4BP8A 1CUDA 1YR2A 4CG2A 4UHEA 1I6WA 3ILSA 4GECA 4X6UA 5LYYA 3EIOA 1N5RA 2QJWA 1DWPA 2HIHA 5JADA 2RGUA 3C8HA 4J0DA 1E5TA 4LKOA 4P93A 3VISA 4C4YA 1TK3A 4BCDA 1OILA 1ODTC 3IA2A 3G9TA 3C43A 2O2GA 1XZIA 2WU4A 3PF9A 4X92A 1BCSA 1QE3A 4P9NA 1XRMA 2G63A 2I3DA 2NW6A 2XE4A 4ZV7A 2AJCA 5IVDA 5FKJA 2FJPA 1VZ2A 4AMZA 2QJRA 5T4HA 4B9EA 1A8UA 2J4FA 1O6FA 3V1MA 3KXPA 4YPVA 3WWPA 4UBNA 1CUYA 3X3HA 3CCBA 2K2QB 2JEYA 1CUEA 5EHXA 4X00A 5CT9A 4G4JA 3W05A 3C45A 3BDVA 1W4LA 4UBJA 1P0QA 1KU0A 5AKKA 1QIEA 4BVJA 1FFCA 2QXTA 5T4FA 2P8SA 1KEZA 3QMWA 2OG1A 2OXEA 5JD4A 3ICWA 3BXPA 2ZYSA 1MJ5A 1VXRA 3MVEA 3OPMA 3TEJA 1UKCA 5C7YA 4WFKA 1ZD4A 3BDIA 3KDAA 1ZICA 2WILA 3G0CA 4A23A 2Z8XA 3NGMA 4ZV9A 3FOBA 5AK4A 4KJXA 5ESRA 3FLAA 4UBIA 1EVEA 3FYUA 1FJ2A 4Q1VA 4KAAA 5C8VA 4B84A 2RI6A 1JMYA 4BB0A 1A7UA 3AZPA 3CN7A 1F0NA 1TAHA 1EINA 4J0KA 4EUSA 1MAAA 4Q05A 4CFSA 1H23A 5JD6A 3HRHA 3H2IA 3TGLA 2XUKA 4GHWA 3FNBA 1IUPA 1JKMA 2D5LA 1MPXA 2HU7A 2JGJA 3D2AA 1F8UA 3G7NA 5CT4A 5YASA 4GWLA 1EK1A 5DLPA 2XQFA 2RAUA 4GXNA 1Q84A 2CB9A 4AXBA 1AUOA 1SC9A 4ZWNA 4DNFA 4B0PA 3O4HA 5HQ3B 1ZI8A 3EBLA 4QEKA 3WMRA 4FLFA 1UK9A 4Q34A 2G5TA 1Y7IA 2XMZA 5HQ3A 1THGA 4HXEB 2WU3A 3L1JA 1UWCA 1BEZA 2C0PA 1EK2A 3ZWQA 3FYTA 1LZKA 3ESDA 3SX4A 3QZUA 5AICA 2OQVA 4OYYA 1LPMA 1QIMA 1YASA 2E3JA 4MQMA 3L1IA 5DYTA 2UZ0A 3PUIA 1ODCA 4BZWA 3PE6A 4EA6A 1T2NA 3SC2A 4XWGA 5ALZA 2FUKA 5SYMA 2QXUA 2YXPX 4N8DA 3R3WA 1XROA 4JNCA 3GELA 2JEZA 3N2ZB 1U2EA 4WDQA 1XQYA 1CUGA 1AC5A 1UKAA 2C0QA 1XLVA 4AX4A 5I9IA 4UBKA 1AKNA 3H2KA 3WA6A 3V48A 4KE6A 2BUBA 4QDXA 3F8SA 2GYWA 4OCZA 4CIAA 2ECFA 1EH5A 1R3DA 2HFJA 1JU3A 2BUAA 3QH4A 4IO0A 3VKFA 2XUDA 1EVQA
chains in the Genus database with same CATH superfamily
3C8MA 1DWUA 3L43A 1LU9A 2VS1A 3FGPA 3U17A 1SVOA 2GEKA 3BHIA 4IXWA 5FIUA 4AO8A 3EFOA 1UIMA 3CXUA 1TVKA 3PI7A 1WPXA 3CBQA 3IMCA 3QLJA 3SM9A 3V8BA 2VHJA 2CLHB 1PYDA 1B42A 2ORED 3ZGYA 5JO0A 2OHHA 2P6RA 3AH8A 3PE4A 3K71B 4A2WA 1OX5A 4XQ9A 1X6VA 1X15A 4G8BA 4MXDA 1NRXA 4TZKA 2F7SA 4EX7A 4QUDA 3GVXA 3ANYB 4UXHA 3RPEA 4ICIA 3L0CA 3VR0A 2ZTVA 2POQX 1OI4A 1M1NB 2CFIA 2WYWA 4HAXA 4I1VA 3SQWA 2CJWB 3NBQA 2LBPA 4O4LF 2VDRB 4JT9A 4CMGA 3KVRA 1YUBA 3BXZA 3CWCA 4NR0A 2Q6TA 4OQPA 3E2IA 3RTBA 4C2AA 4WBNB 1JR3D 2PS3A 1OC2A 4CF5A 1WJGA 2VP5A 1QF9A 1B74A 1UFOA 3GNSA 1SRRA 3K09A 4HADA 4O1IA 1TVMA 3I5UA 4JKIA 1FK8A 1EEXB 1ZVQA 4ZU3A 4B85A 1NT2A 4XVCA 4JP8A 1ZD5A 3KAKA 4HAWA 4XX1A 2H2WA 4F04A 3DDUA 3B1KA 4DJDC 1QS0A 4HVTA 4DE5A 1KYIA 3V32A 4OKSA 1UC8A 3QVXA 4RXTA 4RADA 4LHVA 3SXPA 1F6DA 1R5JA 2HJSA 5AVYA 1TFUA 4P22A 4NBTA 3JY6A 1HLFA 3LYHA 5IW8A 3GGOA 3E3AA 4OPMA 5IT0A 2OAEA 3K94A 3VI4B 3K0AA 1I4EB 4ESHA 4K9RA 5HOEA 1EWQA 2DULA 5IUKC 1O1YA 2F17A 2F9LA 2PV7A 3A0UA 4N40A 3KM0A 5EJ4A 3DPIA 3ZK8A 1T10A 4FONA 2HK7A 3V9PA 3NLLA 3KKMA 2XBUA 1JZTA 4UHHA 3PI6A 1TUGA 5FV4A 2AVNA 4K1LA 3FWZA 1IPFA 1D2NA 4RGBA 1H2FA 1LTHR 2E4YA 3T3OA 3TQOA 1NLFA 1OYVA 3VDXA 2IBSA 3MBOA 4C6SA 2X5XA 3LUGA 3PFFA 4C4XA 5L8VA 1XDBA 3PJDA 2GAIA 4DSAA 4AMVA 3SX0A 2XDQA 2BGUA 1XU4A 2Q5JA 3LUCA 4RK5A 1FFDA 1SCKA 1NP7A 3EIEA 5AW0A 3DDOA 4FD2A 1QTQA 3ANTA 3IEMA 4KNYA 4YK7A 2QUAA 2RHGB 1U5BB 5CAEB 3RAGA 4BQOA 1QP4A 2JCVA 3PVZA 1G2PA 5DNYB 2ZS8A 1SBZA 1XLWA 6Q21A 4DIEA 4BFXA 1NOIA 2HNAA 3AF0A 5A1TA 1U3TA 5CT6A 1BCRA 2CK3A 4YCNA 3DS8A 3P0JA 1JVNA 5JYDA 1SXJA 2XYPA 3UJCA 5HF6A 3IHTA 4HXGA 5HYVA 3L9XA 3ITKA 4HHEA 1QVZA 2CBGA 4O2AB 1ZRHA 5M29A 3X1JA 2REQB 2I2FA 1XDWA 2CXPA 2OCGA 2EXXA 3CISA 3DC2A 4JX9A 2WUGA 3P2MA 4RJ2A 3RK0A 3UQYS 4H27A 3W8NA 4HDNA 3C3BA 2PGOA 3C8DA 4JQZA 4Y6SA 3RYIB 4TT3D 1SB8A 4ZEMA 3DTNA 2BRUA 2PBLA 5L53A 3A3OA 4IOKA 4MVJM 5A4MS 3LUDA 3I0NA 3RS7A 3WB1A 2BBOA 4TL9A 5KUTA 5T57A 1FUUA 1WB6A 1XKQA 2ZKLA 3R5TA 2X0FA 5ALIA 1W48A 3UBMA 5K6AC 2IYPA 3BWYA 4JI6B 1YIOA 2ID8A 3SK0A 5IF3A 4YLYA 2G7MC 3D0QA 3WMGA 3B48A 5IANA 3X1MA 3C4QA 3DF9A 3LLSA 3CLUC 4IQ8A 1RKVA 4MW1A 5C7LO 3RAPR 2XPCA 1UKVY 2QQFA 4H7KA 3T5DA 3IVXA 3OJLA 1DC4A 2ONJA 5EP1A 1Y7PA 2BFBB 4Q02A 1TK9A 5KNBH 1CY0A 1HLGA 4KQKA 1WQ4A 2HLHA 1G9SA 4LNUA 1JFRA 4NQRA 4AJNA 2CVHA 1SCIA 1JEQB 1R4NB 1FMCA 2WDPA 2Z5FA 1CG6A 1K63A 2ZIAA 3BKXA 4KGDA 4MDFA 3OU2A 5CA0B 4UFNA 1X87A 2H65A 2AI1A 2JDIA 3H3FA 1DFIA 1PUXA 1MX9A 3B7PA 3PUZA 2HQRA 1QE0A 3CCCA 1CR1A 4YP9A 4PRZA 6AT1A 2CXXA 1NJ1A 3SFVA 1SBNE 1NAIA 3NAQA 4Q48A 4EENA 4CGYA 4QXOA 3B9PA 3WMFA 4AZTA 4LIPD 3H97A 2RK6A 4LWQA 3LUAA 1NF8A 1P4RA 4G97A 2IHNA 3OF3A 3DH0A 1A1VA 2GHIA 1QP8A 2XBLA 2YQZA 3N8GA 4YFYA 1AA6A 4KIUA 1EDZA 4KP7A 4LKRA 3VJRA 1GSHA 2YR0A 2B4RO 3WNDA 5C4MA 4I5GA 1NG1A 2AE1A 1YDGA 1DIOB 2W58A 3KAQA 1R2QA 2QJTA 5TSDA 3OM0A 2AG1A 5TB5A 1VSVA 4QPZA 3U60B 2WDZA 3NJ8A 3KQNA 2KPOA 2ZG6A 2AKEA 1DDGA 3GXBA 4QT0A 4X41A 4HTAA 5E6UA 3TTTA 1QPBA 2FR8C 2OXRA 3A58B 2I7CA 2A9JA 4F86A 1QC5B 4MKGA 1EB9A 3OETA 1E3LA 3WKDA 3E0QA 3DVRX 1ZUHA 3JALA 3NAZA 2A4KA 4B6OA 3E4CA 1JPNA 3AI1A 4D4HA 2NUTB 4FR0A 2YUTA 1PLJA 3GBPA 3KZKA 1QH1A 4QOJA 4H08A 4FOOA 3OQ1A 3RANA 5LU8A 3ISJA 5AFSA 4I1IA 2XX3A 4MIKA 5CT8A 2WF8A 1UKEA 2XWSA 1JLMA 4BN4A 3SOZA 3H5WA 1YZUA 4C0QC 5ENVA 4ZDKA 1ZFNA 1XVTA 3ZW7A 4N0EA 5TQ2B 4E51A 2NZUG 2QTAA 2I3BA 3DXZA 4KEAA 4RVFA 2B8WA 3OPQA 3VVLA 5L9AA 4Z4QA 2PS9A 5DOVA 4P4TA 3UV3A 4AJ9A 4R5HA 4BL5A 3L7AA 4DPMA 4YXWD 2FSVC 4V1CA 1XU7A 3K53A 3EGDA 4XFDA 5BV2P 1CUCA 4H1WA 1NP3A 2O8DB 4CKBA 2FE1A 4BNJA 1Z2OX 5JCOC 5FWDA 1GQQA 3A25A 3O91A 1B0PA 4FE3A 5FTKA 1XTSA 4DV2B 1V3QE 3AEKA 3F7TA 2VQFB 2BZSA 2AOVA 3RE1A 4C7JA 3WLTA 1LSUA 2PN1A 4H7PA 4IDFA 4TKMA 4ZI7B 1OH7A 3N8DA 1SOAA 2H51A 4WKGA 3SJUA 2JHAA 1RXIA 3W04A 4V0KA 2DGDA 3QEBZ 3CLKA 4ZC8A 1PX0A 4YJFA 1B2LA 1Z8HA 3A11A 3DOEA 2GBIA 4X1IB 5LUBA 3IV9A 5L3QA 2A9KA 3L7CA 3R76A 8ATCA 4Z4FA 4EZBA 4U7HA 1JTVA 2UDPA 2WAMA 1TL7C 1MIOB 1GOTA 4JFAA 1R8YA 1U81A 1HBJA 1C1DB 4ZJPA 1U7PA 4RQBA 4TKUA 3WYCA 2G7ZA 2CKMA 1FFAA 5BRNA 4FZVA 4GVXA 1PG2A 1V43A 1VP3A 4WDRA 3RSFA 4XWOA 1ZK4A 3HFGA 4E5NA 1X13A 2D1QA 5JLJA 4B3BA 2WINI 4AUMA 3ACCA 3Q8WA 2UAGA 3DO6A 3EOZA 4CZ2A 2NVBA 1T8TA 4MWTA 3RG8A 3KAJA 4K0RA 2C9YA 2PD4A 3T99A 3RS9A 4CUKA 1RQ7A 3AJRA 5K2OA 2ZSIA 2L82A 2ZWIA 3PR3A 1ODIA 2ZR8A 2CJFA 2C5LA 2JIZA 1RNLA 4Q4JA 4TVSA 1GXSA 1HTTA 1VMDA 3QKRA 3DMHA 2ZUFA 4M9QA 3CX3A 3PEFA 3ZU4A 4H7FA 3R6TA 1JR6A 2OLEA 9ATCA 3R3YA 4TMWA 1SOVA 4KPGA 2P78A 5HDQA 1M1YE 2W2TA 3BJRA 1Y34E 4B34A 2AV6A 3MTAA 3UUGA 3ZD7A 2GF2A 4IAOA 4J16C 5DSZA 3FBGA 5DYGA 4CF7A 1G4UR 2FYTA 4F3NA 4HRVA 3HPRA 5F2KA 4MI6A 5K8VA 4C4SA 3NHFA 1Z37A 3Q5DA 1KWGA 1UOQA 1RCFA 3AR9A 1U94A 2V98A 1CR6A 1T0UA 2OOSA 1WXIA 3HFJA 3QKTA 4LJ9A 4U7DA 3QOFA 3C7TA 4AO7A 2GXQA 2C99A 5LQDA 3JQQA 2PO7A 1CUVA 3N7UA 1X8JA 1IUOA 5COAA 1E6UA 3MIZA 5CURA 5CB4B 1OH5A 4UFOA 1V9SA 4E4RA 5KU1A 2Q45A 4E0BA 3HKDA 4AP6A 2VA8A 4KXFB 3W06A 4DDWA 2OT3B 1J20A 1FDSA 1YR6A 3FDZA 3ROTA 3HCCA 5LLSA 5G4KA 1DWQA 2P8JA 1RWQA 4AJOA 2GESA 3GWZA 4BFLA 5CYPA 1J97A 1W96A 1UXOA 2IXBA 4N0DA 4QOFA 2QVZX 4TYMA 5EFZA 2QL5A 4CQLB 2CNWA 1ZITA 2QF7A 1TUEA 5D6OA 3SJCA 1C0KA 2V96A 2GRJA 3CLRC 4RETA 3RJ9A 4OOFA 3DFMA 2IYFA 4MUMA 3GEDA 4Y1FA 3TQHA 4KITB 3ND8A 2AD1A 1O5IA 1Y1RA 2NYAA 2HCJB 2R1ZA 1V8DA 2V4UA 4K7JA 1VIYA 4IIDA 4OQFA 4QOEA 1XA3A 2Q5EA 4EO4A 3MMPA 4AZVA 3KQOA 2AJLI 2Y4NA 2PVSA 3KSMA 4ZT6A 5KKNB 4RTPA 4GP9A 1PQWA 4X45A 1DBPA 3C4VA 1IEXA 2VH1A 3AK4A 1X77A 3KOOA 4N65A 4S2EA 2YWJA 5JE8A 5EWMB 1M83A 5K0EA 3GCXA 3NOVA 1YI8A 4BLRA 2WM2A 1N6OA 1Z8FA 4ZYXA 2VHZA 4NENA 1XGKA 2VHXA 4BAGA 1ONSA 4TUYF 1KOGA 2QRKA 1NMYA 1PNQA 2N1BA 3W6NA 2PYZA 2HYIC 2VUUA 1YB1A 2QL7A 2VOEA 3R6DA 2JKZA 3DFKA 4FFNA 4U3JA 5CK5A 1TX4B 5IJ0A 2WOOA 1F2UB 3RIXA 4CFYA 4IZOA 5E1DA 1KP2A 1OMOA 2HJHA 3NGLA 4MS1A 2YHAA 5AM4A 2PSEA 1Z07A 1UFQA 3AXTA 3S44A 1NM5C 2N47A 1L5OA 4IH4A 1HDEA 3KAPA 4HQ6A 4JR2A 1VECA 4RIIA 2GWHA 3G49A 3ZGVA 1P8AA 2A6PA 3N86A 4NU0A 5J63A 1OLXA 4BQSA 1MLDA 4EKNB 2BFFB 5FAKA 1ZX1A 1DCFA 4F97A 2J5BA 4PC1A 1AZLA 2WFAA 2HA7A 4UZSA 4XLLA 1UPCA 4CW7A 4DRYA 1YBAA 1JJFA 2O07A 4P32A 4PZDA 2FUG1 5HGXA 3VSBA 2RBKA 1AX9A 3P7MA 4JC0A 3QENA 4YACA 3WGNA 2BHRA 4P4SB 1Y4DE 2OHIA 3EMDA 4FDVA 5KTRA 1EFKA 1UBHS 4X97A 4WQMA 4MV7A 1S8AA 3M81A 3DDWA 4MWSA 3GAAA 5CFLA 1P7PA 2QV7A 1FF9A 3F6BX 5JAOA 1UQRA 3A28A 1M73E 3JWJA 4ILEA 3LCUA 4MW4A 1KPHA 1KMHB 1Z88A 4CMEA 2BTEA 1Q11A 1WM1A 2JGAA 2D1YA 3ONDA 1ZC4A 1N3YA 2X1HA 2GCOA 3TLMA 3E4DA 4BJHB 2HSJA 16PKA 3LPAA 3UCEA 2VAVA 2KI5A 1ZGJA 3QGMA 4YX9A 2VJBA 3FCYA 1CS0B 4IEEA 3IAFA 4UEKA 4FBMA 3G79A 3W5UA 3PTAA 3SNHA 5EIXA 1I3MA 2RGXA 1HDOA 1I10A 3AR4A 3QELB 3JRNA 3EODA 3DMTA 5ICCA 2XMSA 2H7VA 3U44A 4CHTA 5JWHA 3ZQUA 1OCEA 5EPEA 4R1UA 1QDUA 5LR6A 5FX2A 1PIWA 5FH9A 3OPYA 4BFYA 1P0PA 2ODEA 1YS7A 3OZSA 4JVLA 2PXAA 4BQRA 1VE6A 5IF9A 4E13A 5DWDA 1RAEA 1M2FA 1DC3A 4LNUB 1M0SA 2OR3A 5DX8A 1P5HA 1Z0AA 2HC9A 4LSMA 4P0PB 3VU8A 4AJ1A 4BVKA 4L51A 4MUEA 2C0CA 4IG9A 4ZC1A 3ZHZA 1A2QA 5B4VA 5HZHA 1SCQA 4W4TA 4DIKA 3PB3A 2V7QD 4KQ9A 5KTOA 4EF6A 4FNAA 2J33A 2E5WA 1YL7A 3B53X 1P73A 3NDIA 2O8CB 2KW5A 4IJ6A 4WNIA 4F0JA 3LI2A 1CNMA 3TRHA 3EEIA 1CRLA 2UZ1A 2C7VA 2YWHA 3BMCB 4FDUA 3OLCX 1RJ9B 3H1TA 3J7TA 4KXWA 4NF2A 2BHNA 4FYYA 1CZOA 1W4BA 2X6TA 4YRBA 3ZBQA 4E08A 2GEUA 2AX4A 1ZVKA 2O5VA 2ZUTA 1A8PA 4PIPA 1QG2A 3B6JA 4IMJB 4QHYA 3OESA 4CV0A 4D82A 3KETA 1L5VA 3MTIA 1G8YA 2I78A 3HZOA 3B3FA 4G4GA 1QK5A 4QU0A 2N42A 4XDGA 4ZO7A 4F4JA 4UM9B 4JXJA 5TJHA 3QOYA 3C24A 2OZLA 1PJ2A 4WV3A 1AVTA 1UBOS 1JVSA 3G2KA 3OJ0A 1Z0FA 3ADDA 1B23P 1OBHA 4LV6A 4R3NA 4W1RA 3WJ1A 3WQQA 5LMUB 1Y1KE 5FOSA 4EJ0A 3E70C 3MSCA 5AW9A 2D0DA 2ANCA 4FPXA 5TGDA 2EC5A 2CK3D 3K20A 4QNRA 4W9RA 3PQCA 2K7FA 3HVHA 3KJQA 3AL2A 1XCMA 1QUEA 4EF5A 1RSZA 5AM1A 2CJYA 4QU5A 3SLGA 4ARAA 1ADCA 1ZLYA 3IQGX 3P96A 3E18A 3DHEA 1O8BA 4GMKA 3FNRA 2ZUEA 4TV8F 3HCPA 1DKLA 1Y7TA 2J08A 4IHKA 4RVDA 1JA0A 4NECA 5JD3A 3KJHA 2P9ZA 4IEFB 4J4BA 4REQA 2ID9A 3DZCA 4FDLA 5AK6A 4D99A 4AY6A 3DD1A 2QS9A 1Z2AA 2EP8A 3K9LA 3V33A 5BSHA 5E4YA 3QPDA 3RBZA 4DMRA 5FOWA 1JHQA 1RKBA 3VPDA 2JI9A 4PBTA 4EJFA 1QB7A 2D0OB 3GCDA 2WTXA 3OHPA 4TMZA 4OQYA 1E9RA 4QUAA 3G68A 4IIUA 5E9WA 3ZDZB 4EUEA 1YB5A 1UM9A 1FDUA 3OUZA 4UXIA 1BE0A 4NDAA 2Q5HA 4L0CA 4IMPA 5FADA 2CCGA 2X40A 2QN8A 4LVNA 1G3IA 3UV7A 1BS2A 3TUIC 5B3JC 5JS2A 4NPCA 3EN0A 1Y89A 3MWJA 4EYEA 4TROA 1C7ZA 4LF8B 1PCXA 2OBNA 2WMNB 3CLVA 4LCEA 4KIJA 1H2YA 2XQKA 3LUKA 5EZYA 4J3JA 2C2WA 1U0EA 1DX9A 1N1MA 2EFEB 4JEUA 2OAGA 3W2IA 1S7GA 2PRZA 1CD5A 2ETVA 5TX7A 3P2IA 2ZIZA 5T6MA 1N2GA 3F96A 3NBMA 4LX0A 1D0VA 1CF4A 3CIOA 2PUGA 3N5KA 2XAUA 4GSKA 4EECA 4RM3A 3NT2A 1NQUA 1NW4A 1L5GB 4X8MA 2PBRA 3L8GA 1DEHA 2O0HA 2KX7A 2B99A 1GCUA 4L7QA 4FQ7A 1VHTA 3IPLA 5D5QA 1TKCA 1ACJA 1RCTE 2BP7B 3KTDA 3RSLA 4P34A 2DKOA 2JCYA 1S3FA 1CUWA 1KAGA 2M32A 2YKGA 3EQ6A 5FLKA 1KZ9A 1CRWG 1DKOA 2O23A 4L9AA 4B47A 2J6IA 5ICGA 1W1IA 1Z6GA 3IKLA 4D0LB 4NOJA 3PR1A 3ONVA 2ALJA 2CJWA 3HZZA 1G6Q1 1WWKA 3OFJA 4HSGA 1C2TA 2HPZA 3RUCA 3VA7A 1PQ4A 4B82A 2P6MA 3QU5A 3OZIA 3I2HA 4QG7A 1ZUNB 3RIEA 3CVJA 4L4YA 3ED5A 4DA9A 1KY4A 1O95D 4J3FA 4PBRA 3VU9A 3DHYA 4F1KA 3HDJA 3ICVA 2RAFA 3ETDA 4JLBA 4HSEA 3ST7A 3GG2A 4YJFB 3OM8A 3OY2A 3LM8A 1DLJA 4OLJA 1PS0A 1UBFA 1GGHA 1UJ2A 4Q1EA 5ICMA 1M74A 1YNOA 3TFWA 4YBRA 4OFXA 3VU9B 2XQGA 4DWOA 1PK9A 3P9PA 2JD1A 2C20A 3WBJA 4F45A 4GXTA 1DINA 1QF6A 2V1UA 4B87A 2A1TS 4IDCA 4ESEA 4ZICA 1L8OA 4BY9E 3R2JA 3ZG6A 1M1YA 4RNDB 1BKDR 1E2JA 3Q0TA 1QX3A 3U4IA 4OXIA 1Q7BA 4RF5A 2IYEA 5LQSA 6LDHA 1WPQA 3FPJA 2RB4A 3G1UA 3MJHA 1UMDB 4YR7A 5E6SB 3KNZA 2Q4OA 5FTJA 2ECKA 2FX5A 2WSLA 3LPDA 3OCXA 3ZHXA 4I1PA 1YS4A 2E4WA 1GN8A 4FGJA 3IT3A 1Z0UA 1P9OA 2OXIA 3WK7A 1EHYA 1HFWA 3MGBA 1SG6A 1ZGBA 1QO9A 4INAA 3TQQA 2A2ZA 2ILTA 3ENWA 4K6FA 2X76A 4OXQA 4KQ1A 4CT5A 1XO1A 2BHLA 3ASYA 3C5WP 4AN0A 4IZ6A 3QWIA 4RGVA 4OEHA 1C2YA 3DAOA 1LDEA 2GBPA 3Q98A 4I0WB 2DXIA 2FMXA 4P81A 2OUIA 5FULA 3FBWA 3T38A 2WUFA 4JLPA 4KN5A 2R6CA 5IUNC 1YDEA 1WUTA 3NEAA 1XLUA 1B8NA 1ZD9A 3Q8XB 2YVQA 4UDNA 3K8ZA 5J4YA 3N9IA 4D8YA 5T7BA 5DHRA 4ERXA 5EEGA 3IV7A 3ORRA 2R8YA 3ECSA 5DISB 3O5AA 5GONA 3SPXA 2XLCA 1TYCA 4RJKA 1W5EA 4IVRA 4KVFA 4WKBA 4CNQA 5K0ZA 2EEPA 4KODA 3P9RA 2XCLA 2XUIA 3FDFA 5A4FS 1QIHA 2QU8A 4BKUA 1W34A 2CE2X 4HZGA 4TLBA 5BOVA 3UJ7A 3CEHA 1XKXA 3B1WA 1FXSA 1UXHA 1XVVA 3RSCA 3INGA 3GGSA 4MV9A 4DM7A 3A14A 3GLTA 1P5ZB 4Q3EA 8AT1A 5JBNA 3SN6A 1WIWA 1UIRA 3I9KA 5K4GA 4DXDA 2PWPA 3MMZA 3ZVLA 3ABRB 5AVXA 1ZSVA 4ABTA 4HDMA 4KYTA 1J8MF 3FSRA 3L46A 1SXJC 3P4UA 1L4NA 2EFJA 3I1YA 3R5XA 4MYUA 1I0ZA 2CXUA 1LX6A 1UZNA 4WXPA 4FX5A 3RS0A 2NP6A 4FHEA 4CIXA 4DG8A 2BMAA 3W2EA 5DU2A 1R6XA 3LCJA 1BDIA 2FPGB 3N75A 3WYFA 1T1EA 3EXG1 2Q2WA 3WLRA 2WG2A 4HNRA 3G0HA 2VPPA 4PEVA 1A9PA 1CR0A 4RZXA 3S0JA 2RONA 4M9CA 2JCSA 1X7GA 1FLAA 3QXXA 4R0NA 3ZWDA 3PUVA 1KO8A 3FDZB 1DKRA 2I6FA 2QMUA 4UTOA 3WMXA 3RC2A 5GIPE 2MHCA 2LGJA 4R7TA 1QQBA 4N76A 1EM6A 4UHKA 1R6DA 2X9VA 3RHZA 5FPKA 1IBKB 1ZEMA 3KT3A 4YLEA 3HJTA 1WDKA 2FZKA 3I0ZA 4X6YA 1DBQA 1Q16A 5T3YA 4DEXA 5EYPB 4K9SA 2HW8A 1KY3A 2IY8A 1US8B 1YBFA 1ISJA 1ZNXA 2QM7A 1I2DA 3QX8A 5HILA 4ESVA 4TTTS 2F62A 4YT4A 3RVNA 4TXNA 3NRJA 2P9CA 3OLZA 4QODA 5HKOA 1N2JA 5BR1A 4S0XA 5CHYA 3EZGA 1KJZA 3QUAA 4RYDA 3WLQA 1GYRA 3TLZA 1JR3A 5BVHA 3F0TA 3OLYA 4NMMA 1N6HA 4F3TA 1ZMTA 3EZLA 4KLAA 4BC0A 1XXHE 4HAIA 1HE2A 3DAHA 3ZE1B 3C8UA 4PVDA 4XR4A 1QGDA 2ZJ6A 3C3JA 4HS4A 4QUKA 5MGNA 1N33B 5TQVA 2BEUA 3ORYA 4D79A 5KB3A 1A0OA 3AJAA 1Y1LA 3CZMA 3LO5A 2R7MA 5CCEA 4GNKA 1GPH1 3I01A 1NQAO 3GX1A 4EI7A 4Z3OA 3RAFC 3X1WA 2ZAMA 3K0KA 2ZTHA 1YFKA 1Q6YA 1WZCA 1XXLA 3OBBA 2VHCA 4GBGA 4XWYA 3VRHA 2QAGA 3ZC3A 2F8MA 1NN3A 5GVRA 3CRRA 4LF7B 1N2BA 1ZIYA 4LZAA 4CT4B 5H02A 4KLCA 1KL7A 4I1YA 4MLCA 4L16A 4MUNA 2Q7OE 3BJEA 2DOKA 1RHRA 1LBHA 4ND8A 3ZNQA 2AJBA 3N8IA 4H4EA 3L4JA 3ZDCA 3VNVA 3QELA 3QG5A 2WD7A 1ND6A 4LCJA 4KYIB 3N87A 1Z47A 5K6AA 4XQGA 1KFJB 5LL6P 4BZXA 1YC2A 4JGIA 4TLLB 4Y2SA 2B30A 2Z1DA 3Q41A 4DJTA 2RH4A 1RRVA 1SHLA 3NYWA 4L3OA 3JVVA 2RGYA 4PFJA 3V8EA 2O3QA 3NT4A 3OZDA 1H85A 1RRPA 4RCZA 3KQUA 1MOPA 5F23A 4JQYA 1NL3A 2C7RA 1GA6A 1OD6A 4L1KA 1G0NA 1YR1A 4RU1A 2GTPA 4KYVA 5IXJA 3UT6A 2X2OA 1Z39A 2YZNA 3EZNA 3VM6A 4COOA 2UYGA 2VP4A 1ORVA 1QZZA 2O5CA 1UP4A 2CHFA 4I4TA 1BFDA 3Q7PA 1Q1BA 2ZVPX 1LDYA 1NHGA 5E7QA 3KZMA 4GOJA 1G5FA 3AG5A 1Q5PA 3PYMA 4KRXA 4PX5A 3WFZA 4WBNA 4Z99A 3NXSA 1ANKA 3H5IA 2W6JD 2Q3DA 5TMPA 4MWDA 3L6DA 1LLFA 3BMNA 2PX5A 2DHDA 2QQEA 3I3SR 4RPKA 4TSKA 1E3SA 1TECE 4RKWA 5TV2A 3WWDA 1MXHA 1ML3A 4LDPA 2H2IA 4WLVA 3OPYB 1YVEI 1IG3A 5TY0A 2ZRQA 5TNXA 2W6JA 1CR4A 1GHTA 1L3CA 2BEUB 1W87A 1X9IA 1OHHD 4YP5A 2VEDA 3IT1A 5JS6A 1T43A 3DFIA 4BV8A 3OZWA 2HJVA 3SCZA 4ZOEA 1YOBA 2NVOA 5IFKA 1XELA 1OTHA 3E9QA 3M33A 2ZYWX 5FYQA 4GKAA 3FWPA 4NJEA 1B2RA 3IO3A 3GJYA 4BRZA 4HS9A 1E96A 1KJWA 4KXNA 4MS4A 3SZRA 5LMNB 3IP8A 3HC7A 3R3ZA 4UBLA 1ZNQO 3AB7A 3VU0A 2AOTA 2XF8A 4YAUA 4RD4A 3KOZA 1X0VA 3L1KA 1NQXA 4GI1A 4ZEOA 4AS3A 3QX3A 2IEZA 5E7JA 4E22A 3O1JC 3OUUA 3PPVA 2ASEA 4O6VA 4DWWA 4IIJB 1XCJA 2WWFA 4Z9FA 3OPVA 1NUSA 2OBYA 4KTVE 4KLRA 2XUJA 3CUWA 3F5QA 5KCMA 5AO9A 3J80A 1R9GA 4EVSA 1HA3A 4O4HB 4PGGA 5TEWA 4A0SA 4YUXA 4HYQA 1K6EA 4UATA 4Q15A 1A50B 2PTHA 1LH0A 4XW2A 4TZ6A 2MMGA 9LDTA 1USKA 3NG1A 4YAWA 3IAUA 2VQ6A 2II6A 3UJ6A 1SB9A 5J4LA 1CP3A 1SG0A 2VNSA 2VT3A 6NULA 1X1RA 3GG9A 1JDPA 1Q92A 2K87A 2Q6KA 1E3JA 1PS9A 3MA0A 4UMEA 4XD2A 1UMCB 2HA6A 1EG7A 2CNNA 3OZUA 1JQ3A 3FLMA 4BP9A 3VYWA 3HRKA 2H5EA 4NABA 3G8DA 1U1IA 3S8MA 5G4KB 2GPNA 3R23A 3T3IA 1G0OA 4BZZA 2TMDA 1YQTA 2QHXA 1W19A 2ACVA 3HKDB 4RCYA 1HEYA 1DRVA 1SVLA 1AA9A 2H07A 1MHTA 3R7DA 3ONWA 4HC4A 2F2TA 1L4LA 4ND2A 1V1RB 1HF3A 3BMXA 4BMCA 3NP7A 1E20A 1RC0A 3AQ4A 4EY6A 2HX1A 2DY1A 3HCAA 4DC1A 4D7AA 1T36B 1GKYA 2VCYA 1UK6A 4W6ZA 4QXRA 2QTHA 1A5SB 2VDVE 1UEJA 3V1UA 1IDOA 5HF8A 4AF6A 4PYNA 4DLBA 3GBSA 1HG0A 5JATA 1Y3CE 2FSIA 4IIYA 2HMVA 4LMPA 4HLQB 1U9ZA 4AWBA 4BFWA 4Q9HA 1GUAA 5I7VA 1JQLB 4LMBA 1DEKA 3W7BA 3NOQA 3ZWOA 4WJLA 2C3PA 3PXBA 4XDZA 4BVBA 4YRJA 1I6LA 4KREA 5TVGA 4MV0A 1CUSA 2HUNA 2LIVA 4YUZA 1QQAA 3W8FA 3GFBA 1FFGA 1QZ3A 3NALA 2C8VA 3FKQA 1WZNA 1CUAA 1W76A 5DNAA 3WWEA 3ESBA 4R98A 1Q14A 4EPVA 4PLTA 2H08A 2UUAB 3RC8A 3OX1A 3P20A 3OFSA 2SKEA 4Y2TA 4YTEA 1HE4A 1KC1A 4MWZA 4MRVA 1U1CA 3CW8X 3SI7A 1IZYA 3NUQA 4IZIA 1Y7HA 3U37A 3FZGA 4AQ7A 4Y9SA 3CMCO 3W8RA 5ICEA 4DVJA 5JXGA 4LF4B 1QIGA 2QZ4A 4K86A 4PLYA 3HDYA 1X92A 3KEFA 3CEJA 1MO6A 4HN2A 2QX8A 1OLXB 3AM4A 3KYCB 3ETHA 2ECQA 4O1MA 1QP7A 2EIXA 4PAOA 4FQ8A 1M2VA 3QBEA 5DP1A 4O25A 4TVKA 2E1RA 1YGPA 2VXYA 3OTWA 3SZOA 2OK8A 2YNMC 5L4NA 2AOXA 4AU1A 3PNYA 3S2EA 3HN6A 1FTYA 2Z56A 1KQPA 2QNRA 3KFVA 2ERXA 4F6RB 3F4KA 4Q5IA 5B1DA 1T1JA 5C32A 4PZLA 1E2NA 1YB2A 2ILVA 3ZUGA 3AV0B 3U39A 4B3SB 3X1ZA 1KKMA 1T6XA 2XE6A 4COKA 2XB2A 1E1RA 1MG0A 2CFTA 1U7TA 2ZWVA 1H5QA 1HWYA 1U3WA 2GZAA 4Z0NA 4OHZA 1RE0A 1Z7GA 3D6AA 4UE3S 1MC5A 3KFLA 2XCOA 3QXJA 2PNFA 2DLNA 1S7CA 4MIOA 4V0LA 2EQ5A 1V6AA 5CNMA 1RRGA 2PMDA 3VTAA 4CHGA 4OMDA 3PNBA 3QUCA 1CY6A 1ZW1A 4Q03A 3GO4A 4G84A 3NRCA 1Y8QB 4B31A 1RW4A 4UEJA 1CRZA 1HMPA 1Y5IA 1OLOA 1F3OA 5IMBA 2DT5A 5C5EA 1KZ6A 3E1SA 3UGTA 2GF9A 5ALNA 5EXDA 2W2LA 3JARA 3BMQA 3IJEB 4OATA 2DUNA 4MHOA 4HJXA 4UCWA 4E5DA 3F8TA 3AVQA 4M6WA 4NCJA 1YRLA 5CNIA 1X2EA 2CHUA 2Z6VA 3BL8A 1E1QD 4WN9A 2FX3A 3UAXA 5K4HA 2G5CA 1ZHOA 3D6HA 2UUOA 1I2ZA 1TJ3A 5K7SA 1D2EA 4LNHA 4GRAA 5JASA 2IHYA 4JI1B 1K5DA 1HYBA 1WKCA 2I66A 2V6IA 4FLMA 4E46A 3FHLA 1WEKA 3CRNA 4BLSA 1ECGA 1LBQA 4PIMA 3T3PB 2G9QA 1GZ4A 5AJUA 3ZY2A 2HQSA 2I55A 4I5EA 5AUOB 2AQKA 1NUAA 3OQJA 5IAEA 1PL0A 5EI5A 3PF8A 1XZJA 4LPKA 4GF5A 1EQAA 1AKMA 1KNXA 3AR6A 3O1HB 3PNPA 1D2CA 1QV6A 4V0ME 3WK6A 3Q9NA 5JMTA 4DDMA 1G8KA 4X7RA 3I34X 3LHSA 5AOCA 3INYA 3GZTB 5HXAA 5KYYA 4D3DA 1WDMA 2VZ8A 4BB9A 1I7PA 3I05A 4IIXA 4TUYB 4JZKA 3PQFA 2ZTLA 4Z7JA 4PQYA 4L78A 4IOJA 2P4SA 4OJMX 1ODSA 2F4NA 2V5VA 4D1YA 4RD0A 4WLNA 2PE5A 2OGSA 4G0WA 4PYQA 4D96A 5SY9A 2JLAA 3C2QA 3UMMA 3FLEA 2QYOA 4IS2A 4LSGA 5E3IA 3VPSA 1QRTA 1CFZA 2WWGA 4PLFA 3I62A 5FO1A 2C5SA 3AR8A 4IW3B 1YZNA 1ZHHA 4AIRA 5FPPA 3GDGA 3R9XB 1JXQA 5DO9A 4JJ4A 4YFVA 1P2GA 3H1BA 3ORSA 3OQIB 2DQSA 4P53A 1H4SA 3EQ9A 1JDNA 3MS4A 4KQMA 5AI9A 2P5YA 4OH1A 3CONA 3JWPA 5FR2A 4D9NA 2HHAA 2YN4A 1AXGA 3BE8A 3EDYA 4G0ZA 3N0RA 4B46A 1IN1A 3QI2A 4CKXA 4NXMB 1MZPA 3Q9SA 3FI0A 3HK2A 3W3ZB 1JECA 4L22A 2I6QA 1FX1A 1L1EA 2VJOA 1U1EA 4L4RA 3ZBTA 5JQWA 3TD9A 3GNTA 4MVXA 3FGOA 5C5CA 5HCUA 2DC1A 4MEJA 4MKRA 1CULC 1ZIDA 5L40A 2X2EA 5A3JA 3AESB 2XOKA 3IBCA 1D4AA 3OC0A 3ZJ5A 4JP5A 1ZXXA 4OP3A 3F7NA 3ZWCA 4I50A 2ZJ2A 3WL6A 4IH1A 3QVWA 4GX2A 1R0CA 1KIFA 2PGDA 1EBUA 4EPYA 4YUWA 2AVDA 2CXNA 3WK9A 1ZU5A 2C88A 1RRMA 4XKJA 4HG2A 3NJ4A 3W2TA 3RS8A 4DOMA 5ARDA 3WFJA 3STUA 2FPIB 4F8EA 4RTRA 1LK0A 3L5KA 2XYQA 4MV6A 3KHSA 2QTVA 5CLFA 4G26A 1JEYA 1USUA 4E1BA 4FYIA 5G0UA 2B8TA 3SNKA 4JI2B 1G8FA 1THTA 4GLFA 4RH3A 1OWNA 3N39C 1TCAA 2V4MA 5FPHA 4ZEXA 3NVAA 3ZX5A 4EJSA 2XUGA 1IJFA 1R6VA 3UCXA 8OHMA 3T5MA 4BNDB 3SS8A 1KS2A 5HEKA 4YC7A 2ZYTX 4ENWA 3AKZA 2IDJA 3E03A 1MF7A 4I55F 5HKBA 2CXHA 2YHBA 2QTTA 5BMVA 4RZ2A 4YRCA 5FI1B 1BA2A 1I0IA 3R7LA 4AJIA 3HTXA 1PT7A 1DJMA 3Q7EA 4P86A 1I6KA 2D5AA 3BZUA 5AOBA 1A82A 4BQIA 1WXQA 2JCBA 3DEAA 3GJSA 2CGEA 4UMDA 5HF5A 3HABA 4RAQA 3VKVA 3DUFB 2J6HA 1RHQA 3FOAA 4HY3A 2VJCA 3NWOA 1NR1A 3PZBA 3C98A 4G0OA 4ZYWA 1H0SA 3W5BA 1CV2A 4LXUA 3Q7RA 4AMGA 1KZGB 1V5GA 4ZODA 2VWPA 4UU0A 1M54A 1YJ5A 3ZZNA 5C3MA 3DJYA 4FYVA 3W0LB 1HC7A 4R8SA 4ENVA 1YL6A 4RPJA 3CW9A 1BW9A 4UTNA 5KWEA 1XQWA 3EGEA 2O2HA 3RYTC 3SQDA 5D5PA 4ZYUA 4WFQA 4OIMA 4P3NA 4PTLA 3C1UA 3I4FA 3D6JA 4GEGA 2DF8A 4Y2GA 3LUPA 2V7QA 5IAKA 4EHJA 3WIBA 2WAOA 5KKAA 5KYXB 1A8IA 3U7FB 3ADBA 3S28A 1JJAA 2G0TA 1QHIA 2R7KA 3CFYA 3CT4A 1KJ9A 2XMPA 3U1TA 1QGYA 3KU1A 5KJEA 1A97A 4HH3C 2YJ5A 1X3LA 1C9YA 1D1PA 1GADO 2ODWA 2QTMA 3BREA 5JXIA 1NUUA 4JQCA 3OEYA 3WZLA 3HFRA 3QE3A 3OX2A 2G25A 1IBCA 4CTMA 2LKCA 4J0HA 1XDGA 1LTQA 2J32A 3N2EA 4PC6A 1CRPA 1WP9A 1P5JA 1R66A 2OWDA 3Q3IA 1UXGA 2O2SA 3CUVA 2W11A 3U1VA 1XWWA 4OB8A 3FMFA 4ND5A 4ZVQA 4NATA 2C8JA 4EG7A 1ZM4A 3QFTA 1XK6A 1OFIA 2ZETA 2XKKA 3VKGA 2W43A 3CZ5A 4RGQA 3UJHA 3VUFA 2VKQA 3W8EA 2CUTA 3TUZC 3DNPA 5CYFA 3KFXA 4MUKA 3W5HA 5ED0A 1KA9H 2GMWA 2Q2VA 3MPUA 5DSTA 4HDQB 5HG0A 2NSYA 3QEOA 5ADVA 1N57A 1BMQA 3UK0A 2DM6A 1A7JA 3GFSA 3ZV6A 1IY2A 4R8LA 5L4LA 2I1LA 3RRYA 5AHKA 3JQCA 3EPHA 4EUKA 1NTRA 4RTMA 4DJEC 1AMOA 2R6AA 2RH9B 1D5CA 2W0MA 3H2HA 1AOXA 3NBAA 3R3SA 1TAUA 2DJIA 1VPDA 1GPAA 1XHEA 1OIXA 2VDPB 3BIWA 3K0FA 4LXGA 5C3UA 4DCUA 4OLBA 2QEQA 2E4VA 3DONA 5HS6A 5B7QA 5I7AA 3NBXX 5IZCC 3WQSB 3DO8A 4Y98A 1OJLA 2HRCA 3A1CA 1XTJA 3KOUA 3AEZA 3LS2A 2GTHA 4O3MA 5BSGA 3G0DA 1F51E 2B2XA 4M8KA 1HGXA 3I9FA 3TRFA 3U3RA 4PG8A 3QNWA 5DHUA 2C4VA 3AG6A 1TKRA 2BZGA 4KKVA 5FBHA 13PKA 3RI3A 3NTUA 4HH0A 3UG7A 4B8WA 2C1ZA 4H7IA 4OY3A 4N5IX 1C3OB 4BP3A 4BZQA 2Q28A 3V1TC 4RX1A 5H83A 1K9VF 2OFWA 3HJNA 1JEQA 1R4NA 2ZBRA 4JGBA 3RUPA 1F60A 2R2AA 1GD1O 2PKCA 3L4SO 5SICE 2HH9A 3H2JA 2V6MA 4P33A 4UVEA 1QFSA 2WWVD 3VGJA 4EO9A 5AVTA 2CNBA 3G82C 3P71T 5CH5A 1FDIA 2AB0A 5HR5A 3HKEB 2VO1A 3F7OA 2AFHE 3GRVA 3AEXA 3CPHA 1DB3A 4GZ3A 1RRFA 1ZKDA 4XDYA 5AM0A 4F3KA 4BCBA 3FFXA 3MYYA 4Q4CA 1BQ3A 3TSOA 2B6HA 1QG0A 1VZ3A 3QFRA 4G0VA 3KKOA 3KT0A 2ZIXB 1P4SA 5JSZB 3LQ4A 2Z3ZA 4IP0A 4D3FA 3HWSA 4K81B 3CNBA 3PK0A 3ZDRA 4ZAWA 1D1SA 4Q4AB 3PGKA 3V3KA 4GGPA 2BGGA 4WJZA 4KAJA 3K4PA 2H2GA 4IRXA 1O97D 3Q0IA 1C7IA 1LDGA 2P4EA 3I39X 2Y9PB 4NZ9A 4TL8A 5J9FA 4B3XA 4D0GA 4EK9A 4J0QA 5IKMA 3I2KA 1OX4B 1YQ9A 2UUPA 2IZ1A 1Y4ZA 4HNHA 3A1DA 1LPSA 2XA1A 3O8DA 4FU0A 3BGIA 4RK1A 1DKMA 1P3DA 3GFPA 5DMHA 3U7QB 4HFRA 1IOZA 1J0BA 4U0KA 1L8XA 4IXTA 3CO0S 3EOBI 2W2QA 1ZXLA 3ORFA 3DBIA 3UXYA 3ZV4A 4AS1A 1Y1SA 4RDIA 3QXGA 1Z0JA 2KS6A 3O3NB 4QUBA 3Q6IA 4RV5A 4Y2PA 3RV3A 2K6GA 2FB9A 3WIVA 1TCBA 5CCDA 3GW8A 1B15A 5J2TB 1O08A 3JATA 3W5CA 5JSUA 3NWBA 3TJRA 3KXKA 1S0UA 1EWKA 3QLUC 5JNSA 3OFNA 2GEDA 4JL8A 1QH8A 4XUEA 1OI7A 4BNWA 3KL2A 3A37A 1BX0A 3EXHA 3CNQS 3K5WA 1KJ8A 4PAWA 2XT6A 2I62A 1Z8DA 3NFYA 4FOPA 1T9GS 2A5YB 2EJCA 1HL7A 5DX1A 4L75A 4DGSA 3D8HA 3ZVKA 2A86A 3H9CA 3K0EA 2DWCA 2G07A 1FYVA 1UZUA 2XTNA 2ZIUB 3U7JA 3WXBA 3BGWA 4C29A 1ULTA 5DV9A 4ES6A 1LFDB 5BN4A 1BXRA 2XR1A 4TLMB 6PFKA 1ZU4A 3ABSB 2HKIA 3D1VA 4Q3NA 3IAM6 1XZCA 4YCMA 1CZHA 1WHTA 4QASA 4K87A 1I36A 4O63O 2ZE7A 2IHZA 1M67A 3AYZB 3HU1A 1PGJA 1IOLA 4HGRA 1A7KA 2HI0A 4INJA 1LTKA 1PZNA 5ALOA 1NR7A 1SCUA 2OGTA 3NR2A 4DA0A 1R4MB 3H3JA 2W2OA 4O4LB 1C50A 121PA 3FAZA 4BVEA 1EA5A 2LCFA 3ZHCA 4MGKR 1ZJ6A 4MW9A 2ZSKA 4RTKA 3ET4A 3G5TA 1JAXA 3ESQA 1N25A 4OHXA 1JMKC 3L84A 1ISMA 1VJ0A 2CNOA 1SCJA 2O3TA 4L6AA 5U4QA 2A78A 4N8SA 1ZH2A 3DW3X 2RMKA 4O29A 2FG6C 4PFSA 4UEOA 1AN0A 2ENUA 2LXNA 3KYBA 1NU8A 2ZK7A 3P27A 4LCBA 3NZEA 5C34B 5HQTA 4RZIA 3E22B 1D6NA 2BGRA 1K6XA 3N2GA 4K88A 4IDDA 3PQ8A 5CH3A 3BK1A 3SKYA 3QA9A 2DY0A 3TNDA 2RI1A 2Y2VA 1DXOA 2Z8YM 3ZIAA 3ZWAA 2Q2OA 5LB4A 4YQFA 2VI5A 2DFDA 4AZ0B 4D26A 2ZYGA 2FJ0A 2X4DA 1Z13A 3MN1A 2NPOA 4GG1A 5C8YF 4RBNA 2NO6A 2B7BA 2PYDA 2QRQA 1XEAA 1E58A 2A58A 3UFXB 2I9KA 3WGOA 3HO1A 4U2EA 3ND6A 3ZIUA 1SC6A 3QFSA 1YI0A 5CX1A 3TSZA 1UINA 3KXDA 1TA0A 3ZHBA 2HU2A 2ZS7A 5CNKA 4DJ5X 5JANA 2FZLA 1QFMA 4YMLA 3VV3A 5JCZA 4KQEA 3V3TA 3SWWA 2IK8A 4IIGA 4PSCA 3ZTYA 4C7BA 3ITEA 3CVYA 1P2UA 1DXYA 2N46A 1RFGE 1WZEA 1X7HA 3AEUA 4RPGA 5DDIP 5IJZA 2XB6A 3JYPA 3IMFA 3MHPA 3UZUA 1F4PA 5IBCA 2C4MA 4FFBA 2HHHB 1H65A 3O0TA 4UNSA 1FNMA 2YV1A 1P7YA 4JOSA 1QTNA 1BS1A 1M1ZA 2UUBB 4LXTA 3GLIA 3U0VA 1I7NA 2MSEB 4EAAA 3CHYA 4FNMA 1CERA 1JQEA 3E2PA 5CA0A 1UDRA 3A1EA 1M2HA 4DV4B 3R74A 5F3RA 1ESNA 3N3AC 4NSNA 4CG0A 4CJXA 2G67A 2XEDA 4LFCB 5DW0A 2CYAA 3RREA 1ISFA 2I5PO 2JA2A 3I4CA 1GLVA 4HYEA 4JSRA 5CCBA 3LGXA 1MJGM 4Y3UA 1LRKA 4YRGA 4LZNA 4YJ3F 2RHWA 1BS9A 1Y5NA 2E82A 3TR5A 5I3CA 2Q1TA 3ED1A 4FEAA 3ZXUB 4QNNA 4B2YA 3C5CA 2XT0A 2QROA 3ENKA 5F7OA 1T8WA 2JVKA 2WJ4A 2VA9A 2Y9MB 3GGCA 3B9RA 4FEYA 5D86A 2XZDA 3IOBA 4WBSA 5LBTA 3T35A 1JEDA 4QQFA 2A0YA 3R41A 3QVJA 4LVUA 4R1OA 3SYTA 3I6ZA 5DTMA 4W99A 1MOZA 3IMKA 5A7HA 1U8UA 4HQKA 2AZXA 1GQYA 3S5JA 1I24A 4Y6PA 5GOTA 4D97A 4GL2A 1TW3A 3TD6A 5AI5A 4MGIR 1DJOA 4KE7A 2Z08A 4F93B 1J8VA 1P0MA 5AI6A 4DHWA 1H2RS 2JGFA 3IELA 2RHDA 5L7YA 1R0WA 3F90A 2N0SA 4HB2A 3UFXA 4GP7A 2WB2A 2GBCA 5L45A 2D3WA 3RVJA 3NPMA 1EK5A 3GRYA 1KQNA 5KX5B 4MQLA 4NFLA 4JI5B 4M1SA 4DVGA 2RGRA 2G71A 1E6WA 3GUYA 2QN1A 2WNIA 3TFQA 4D80A 1XALA 3GEGA 5KYUB 4F1JA 3MMSA 5JC8A 1NMZA 1J1UA 1NBOA 3ZIAD 3ONEA 5F1YA 2P3OA 3AXSA 4FKMA 4JWKA 3QI7A 3JZIA 4HNAB 2H1OA 2H92A 3H8SA 3G8YA 4TWJA 3DFFA 7AT1A 5PNTA 1Y7LA 3ZE2B 4BNYA 3O38A 3PDHA 4M37A 4RPIA 1DI0A 3QM1A 4NHEA 3REGA 1I5RA 4AN4A 4LG1A 3W1EA 4ZCIA 2GEVA 4M21A 2PD6A 3UA4A 4N49A 2R8PA 5A9RA 5DX0A 2NU8A 1FUIA 2FW1A 4M0LA 4RC9A 5KYKA 1JRLA 4OYHA 1R1DA 1BWSA 1Z45A 1PBNA 5JECA 1S8OA 1KDOA 1OLUA 1QYIA 3GAMA 3N0TA 4OH7A 3EWIA 2W4MA 4KB5A 5B30A 3RYFB 4RFVA 2E2WA 2R87A 4FYHA 5K0BA 4JK3A 1XZPA 3QJGA 3REOA 3SR0A 3KQHA 1WB9A 3T4PA 1AB5A 1KI9A 2X19A 1Y9ZA 2XKJE 3BWXA 3F5DA 2F90A 4TVBA 5DRYA 5ALUA 3RNOA 4B6SA 1AQ6A 2WZQA 4HB0A 2HSDA 2OOKA 1HPLA 3A3YA 4NJEB 4WZ6A 3WAGA 1JQBA 4C76A 1M3SA 2CBXA 4X5OA 2A0FA 1E66A 4S1TA 2PH5A 3AY3A 3DZIA 5EHNA 4A91A 4CM8A 3EMKA 3WLFA 4ON9A 1K2WA 2VHYA 1R0SA 2OCAA 3LE8A 2XQVA 3LHIA 3M6WA 1E2DA 2Y1KA 2ZATA 3K0HA 3T7KA 1O57A 3GJQA 5ELLA 1NKVA 3F3MA 3WIDA 2WJ6A 3UGJA 1UWKA 3PICA 3C7KA 4B6QA 3JZMA 4QZVA 4D41A 1QM5A 2RKBA 3QW4B 4ZU6X 1L4UA 2Q0HA 4LDZA 4BB5A 3IUSA 2IXTA 1JEAA 4HDKB 2O0JA 1ZZGA 3QVGA 4NZNA 3W34A 4OJTA 2HSEA 2GO1A 2X13A 4GRIA 2HMYB 4FSHA 3UO8B 1GGMA 3IBGA 4EPXA 4XEUA 1FE8A 1ZC3A 3ZCRA 5F12A 5CG2A 4LDJA 4W1PA 4HNAA 2BZ0A 2YZ2A 3HXPA 1MGPA 2XZOA 2AFIA 4JI4B 3JS5A 1RLMA 4JJ7A 1P9WA 5COQA 4RMIA 3E3LA 1DOAA 5SV2A 1HQDA 3I9OA 1L5KA 4CV3A 4DNXA 4GX0A 1NASA 1VJRA 2LWIA 5AMXA 1ZONA 2AC4A 1AKEA 1JNXX 1RQLA 3A2MA 3IBYA 5FB3A 4R6XA 2JLYA 4F5ZA 4R9VA 2WF5A 4HLDA 1ORWA 5JHHB 2WHEA 4G2NA 3TBFA 2FVXA 5I6DA 4ZOBA 2XOXA 3MINA 3NV9A 2ZRDA 4OXRA 2HA3A 1AQJA 5J43A 3GARA 3E6AA 5KNLA 3DNMA 1WCXA 3U81A 1QRRA 1RS0A 2LTAA 3LW7A 5A4KA 2RHHA 3ER6A 3Q7QA 2YOGA 4HTFA 1MFZA 4Z1OA 4LISA 3CURA 3I58A 1TU0A 3IAS6 2A3NA 2O57A 4EA9A 1I7LA 3QMPA 3UJ3X 3NNDA 4IUCS 3KB1A 3DVLA 5L3RA 1M7HA 4WY8A 2AWOA 4YMIA 3FOCA 2ODQA 4EPTA 4DV3B 1YQXA 1C0EA 4U0JA 1PTJC 1I6MA 1ZP6A 2HADA 3A4MA 5INTA 5DI3B 2VJDA 4L8WB 3SYMA 4OU4A 5KPDA 1TPZA 4OJKA 3N6VA 2XIQA 4DLZA 4R0VA 2YDXA 4M99A 3QWAA 1HL3A 3MGAA 3ORQA 4I50F 3VFDA 4QDOA 4FHCA 4BJ1A 5B4TA 3VNUA 1OFTA 4MMZB 5I9LA 1TM5E 5LXTB 3BFVA 3EVFA 3KSBC 4D92A 3OCUA 4F5WA 4NJOA 4RKYA 1FUKA 2J7PD 1SXJE 4MITA 4EMTA 5ITZA 3NDRA 1CY4A 3SD7A 1A8QA 3QYAA 3INNA 2ZI9A 1AF7A 4IOMA 3WLAA 1XD9A 2V3VA 4FGUA 1ST3A 4H0FA 4WCFB 5NLLA 3PVCA 2Q5CA 2C9BA 1DV2A 3L0BA 3LKZA 5CIQA 1IH8A 1DEAA 2P3SA 2COKA 3FFTA 1DIHA 4QJIA 2Q3MA 4ZARA 3G8CA 2CJPA 1K3TA 4KVAA 2KE5A 2FUEA 2ZULA 3HDGA 2EERA 2HIGA 5ECDA 1HURA 3EXEA 4IX1A 3CKYA 1KGDA 1ZH0A 3NCTA 3P19A 3WICA 1M10A 2F43B 1PTJA 4A27A 4CG2A 4UHEA 1JB1A 3WGZA 5JR3A 2IY9A 4U5QA 1PV2A 3ZOZA 1I32A 3ZY3A 5JTUA 3PNVA 5B7GA 1U3FA 4KXYA 2D7DA 2FRDA 3PD0A 3L7OA 2AOTB 4UE6A 3EIOA 3M6LA 5GJVC 2X0IA 4B76A 4F71A 3AVUA 2PZ8A 2FUG6 4TMXA 1NVXQ 3SIRA 1DBIA 3TQFA 1N5RA 2QJWA 1VLMA 1TUIA 2OKCA 2Y05A 1P77A 2X6QA 3HNPA 3K72B 3S1LA 1TQ6A 1L3BA 2P27A 2QN7A 4Z6KA 1P91A 2IE0A 3LL4A 1ZOSA 4QOIA 2GM5A 1OGIA 2YXNA 4QBKA 1E5TA 4HMQA 3SE0A 1G19A 1POWA 1BMTA 4JS0A 3ASVA 1PJBA 3Q2IA 5B1HA 1AKVA 3TDNA 4HNQA 2WWXA 4Y0NA 1DQSA 5F5XA 3V00A 3PHGA 4AICA 2P2DA 2KQUA 4EYQA 2BEJA 4MW7A 4Q1DA 1DKPA 2OEPA 1ZL0A 5LJLA 3JARB 4O0MA 1JALA 5EZYF 4TMYA 5L7TA 1IM5A 2D2IA 3EW7A 5CG1A 3IP1A 4EUFA 1K4MA 2R65A 3IA2A 4MRMA 4C2BA 4QG3A 4R2HA 5JWOA 4C7OB 5T8KA 1Y33E 2ACWA 3NFRA 5DFAA 4DYVA 5DIZA 1R4MA 4O4LA 1EP2B 1KEUA 2P2CA 5ERYA 2B1QA 3NQ41 5JJKA 3WHLA 3U0BA 3NX4A 2R62A 1HETA 1H3NA 5EZ5A 3ZE9A 1VRCA 2WWHA 2NAFA 1UXKA 3FNQA 3QLEA 1ADGA 3ENVA 1G4AE 4H3SA 3ZE8A 5B3KA 5I7EA 5KOHA 4RV4A 1QE3A 5K99A 4G2TA 3U80A 2RC6A 1B8PA 2XYHA 2GD6A 3UW1A 3JVUA 3FPAA 4ZV7A 4JUDX 5IVDA 4O2BB 1ABFA 5FKJA 5SZKB 1XTVA 1YE8A 2Y99A 5GIOE 2F1HA 1E61A 2M1ZA 1UC9A 3WIEA 3AFGA 1M34E 2ZCUA 3P5SA 1EUYA 1N32B 3EQ2A 4ISCA 1KFEB 3OIVA 1KH2A 1V1MB 3RO7A 2DX7A 2HRDA 3IVAA 1TGVA 1W5BA 4CV2A 3V1MA 4YPVA 4C78A 3LC1O 2NVUA 4TLEA 1NULA 3WWPA 3P2EA 1T8YA 5E0OA 5BYBA 5ADUS 5AD1A 4EPRA 4BPRA 3CCBA 4ZGWA 1WMAA 2JEYA 3GH1A 5TT1A 4A7PA 3AUUA 4YXFA 2L42A 1DAGA 1JR4A 2X9GA 4G23A 1Q7TA 4R8RA 5KNBA 3RJ5A 3C45A 1W4LA 2X5NA 5BUCA 4X9XA 4M87A 3BS4A 4UBJA 3QW2A 1KU0A 4RO0A 1TA9A 2QE7A 4NZPA 4LSZA 5HM6A 3UGQA 1XF1A 4CL2A 4W5QA 3AWIA 2HF7A 4IIVA 3LXXA 2HPHA 4DLXA 1ZNZA 2XTZA 1EX1A 4KDFA 5LA6F 1E1CB 3HYCA 1W93A 1SHTX 2IIBA 2H2FA 2X41A 3B2EA 3ECAA 4R1LA 2PL1A 4NU6A 5EWLB 4DLAA 2AGVA 3CG0A 3OAAA 5E38A 1TMKA 3ICWA 4HPXB 1OX4A 1B7GO 2AMFA 3QNUA 1MJ5A 1VXRA 4G9BA 1TVKB 3J81A 4ZAVA 4JIGA 1AB6A 3BRWA 3VC3A 4I7EA 3LW8A 4C22A 1J0DA 1ZD4A 3HVKA 1KFKB 5LQKA 4KR3A 2DTEA 1ZICA 1F9AA 3BMOA 3KDAA 3TZQA 1UP7A 2WILA 4K1XA 3FR7A 1KBOA 2EZ4A 1G8JA 3N0VA 5IXYA 2SKDA 1SR8A 4TKZA 2Z8XA 2XDAA 4H17A 5JVDF 2ZXUA 1A8HA 2R48A 1SBTA 2IOHA 4QGGA 1UH5A 2BD0A 3D81A 1T3LA 2QDKA 4Q18A 2GK7A 4YRMA 5AK4A 5BWLA 2FN9A 1H2BA 3QKWA 1IXYA 3DTVA 5ESRA 1EMDA 3EA4A 5KHAA 1EVEA 1AV7A 3E7DA 5FQNA 2WM3A 1NFQA 4JXZA 4H15A 4CIDA 1TZBA 5C8VA 2VPWA 3KHUA 2H29A 4WLOA 1FRFS 1V4NA 2PX0A 3F6YA 1EVJA 2P69A 4KV9A 4RY0A 3ZNPA 4ONEA 2WJHA 2WHXA 2LP4Y 2YBEA 1MZVA 4XX0A 3I92A 4M46A 4I14A 2QX9A 5JMPA 2GEJA 4CTNA 2PGIA 3QOXA 3ZY6A 5JU6A 3QHQA 4JEMA 4X61A 3CVUA 1PDVA 1AUPA 3Q3CA 2XVMA 3K1TA 4KGZA 4MP8A 1PR1A 2ZJYA 3NU1A 2V3WA 3FNBA 3LQ2A 1TVEA 3Q5GA 1I2AA 1G6OA 1HQKA 3SBDA 2AQHA 5KYYB 2NZ8A 4G1VA 3P9ZA 1TEVA 3LUHA 3MOIA 1B8UA 2HU7A 4HDMB 4V24A 2ZJ0A 4UM9D 5E6RB 4ZHQA 1S3IA 4AKSA 1LS1A 3G7NA 4ZIRB 5YASA 2BEVA 5CYGA 1CSEE 1CKEA 1EK1A 2GZ3A 1AJEA 3V8NA 1O6CA 3WOHA 4F4FA 1QRAA 3L0IB 2V1XA 1Q84A 5E6RA 5GGYA 2O14A 5EJFA 1YA6A 1P9LA 3AOEA 2RJNA 3P8ZA 4PCUA 3EMVA 1X7YB 1LBIA 4WN9B 3W6OA 5KNDA 4GSLA 2P4QA 2D06A 4YNBA 1XLTC 2A9OA 3TX6A 4DBLC 4G37A 4JC4A 1RZ3A 2Q0QA 3TFOA 3WMRA 1CB7A 2R47A 3HN2A 3HRIA 1FSZA 2E9SA 2VSXA 4PYRA 3C1OA 2PQ6A 2YFYA 3HVIA 1VHLA 4LHSA 4Q34A 1EUCA 4M0PA 2O3RA 4NMHA 3IQZA 1Y7IA 3ILXA 3QHPA 1C1XB 2XMZA 3FIJA 5SY4A 4DMGA 3MT9A 1W29A 3RC1A 3AVTA 5AJTA 1G1AA 2PT5A 2PT9A 5JAQA 1AHPA 1BE6A 4WEOA 4B43A 1EK2A 1C4OA 2ATVA 3B6MA 3ACBA 3FYTA 3MCAA 4RIFA 5GM1A 3ZWQA 1YZFA 1WUJS 1PQUA 3VOSA 4BFZA 1MJHA 2HCRA 4M1YA 1IN6A 1X8XA 1BCSB 2E0IA 3K5PA 3R24A 5TT0A 2PKQP 3N28A 3QIVA 3Q1LA 3SYKA 1NZFA 3WYBA 3K4QA 3UJAA 1UWLA 5KTKA 1ZNYA 4J1NA 2GN8A 4GBMA 3GAZA 3JYNA 1LVGA 5AICA 1DEXA 2OQVA 3BTSA 3MXOA 4CL3A 3THWB 1QIMA 2PZJA 3NDBB 3QXCA 3AI3A 1ZEJA 2XDYA 3L1IA 8ABPA 3C15C 4R2KA 5KTSA 2PUFA 2UZ0A 3C7AA 5CDFA 3CUUA 3KQSA 2OSVA 2Y1EA 2SBTA 2BR5A 5E8RA 1I7QB 1X3SA 2GK6A 5B3LA 2HYDA 3VZDA 2AMLA 1ODCA 5HRUA 3KKZA 1T3TA 1II8B 3ACDA 4XQCA 1HDXA 4E5MA 1T2NA 3W2GA 4G1CA 4TQ9A 2Y68A 1Z4KA 2ZRAA 5SYMA 1L5YA 3GLGE 3QXHA 4GZ5A 2G9ZA 2I6SA 3GELA 3Q0EA 1QVWA 2JEZA 2AMVA 1DARA 1MHPA 2VUHB 4GPZA 3V4ZA 1YCGA 1CDZA 1ZAKA 3GXOA 3OWHA 2VYVD 4GZMA 1AC5A 2JFOA 1JNYA 2CLOB 3ETCA 3LGAA 3QWBA 4V38A 3THXA 4L4SA 1PJ4A 2C0QA 2IZOA 1R6BX 3USCS 2DBVO 4GAEA 1E62A 2A5LA 4EG6A 5LLTA 4DJFC 1V47A 1NA5A 4HGYA 1M5RA 1BHQ1 1I51A 5J47A 1TYBE 1IEWA 2IE8A 3OQHA 1AKNA 2BISA 2YJ4A 2G1PA 3JZAA 2A0KA 3TVDA 2R44A 2CKDA 3AFMA 4WNAA 2FQWA 4RD1A 4QECA 3V48A 1IXZA 5B4UA 2FXIA 2QX6A 3GA0A 3F73A 1H2AS 2XIJA 2OHXA 3FTNA 1DHRA 1WKVA 4EJSB 3CWQA 4LRWA 1QYDA 4ZANA 3JQAB 2OWEA 4LK2A 4OCZA 2IP1A 4A8JB 5AVUA 1JIUA 1YBMA 4HX9A 1HZZC 1JI0A 1UBRS 3TW0A 4F9EA 4XRRA 4A03A 3U61B 3WO0A 2GXUA 4YI3A 2F3TA 2GNPA 4GBED 4YVFA 2ANBA 2HFJA