3QPDA

Structure of aspergillus oryzae cutinase expressed in pichia pastoris, crystallized in the presence of paraoxon
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
187
structure length
186
Chain Sequence
LTGGDELRDGPCKPITFIFARASTEPGLLGISTGPAVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIAEAQGLFEQAVSKCPDTQIVAGGYQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQERGQIANFPKDKVKVYCAVGDLVCLGTLIVAPPHFSYLSDTGDASDFLLSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords Cutinase 1
total genus 68
structure length 186
sequence length 187
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qpdA00
2WQZA 2ES4A 1U8EA 1QGED 4BAZA 1T4MA 4UFNA 3R41A 2BUCA 2WSLA 3HC7A 4WY5A 1IMJA 3H19A 3O4IA 3G0GA 1CUHA 5HF8A 3HLKA 3G0BA 1ZJ5A 1P0MA 4K2AA 3D5EA 5CT8A 3FNBA 1NX9A 3GFFA 1GKLA 1UOQA 2W6CX 1QO9A 4K5QA 1QIEA 3H04A 4B9AA 3IURA 2JF0A 5AKHA 2G63A 2GYUA 4MWTA 1DX4A 4K6GA 4W1PA 3V1LA 5K3EA 5K5EA 5A7GA 3D2BA 4LXGA 3F67A 1WB4A 4QWWA 5AM2A 4QDTA 1QJ4A 2UZ0A 1GKKA 4C88A 2WTNA 2QJWA 3MUOA 1YB6A 1E66A 3NUZA 1XLWA 5LZ4A 4ARAA 1ORWA 3T4UA 5EFZA 3ESCA 2Y2VA 4FBMA 3EQ9A 5AM4A 1LNSA 4F21A 2DHCA 4QZVA 4J0JA 4H18A 3C87A 1F0PA 2BGRA 2H9YA 3I1YA 2XMSA 1CFJA 4UHEA 1EK1A 4FLEA 2XT0A 4UUQA 3H1AA 4M0FA 2HIHA 4N5HX 3X3HA 3IVMA 4CIBA 1N5RA 1JJIA 1XRRA 1QONA 4GLBA 3RARA 3DDUA 4DYHA 3WWOA 1XZDA 3I1IA 3QM1A 2WTMA 2IIVA 3O9VA 1EH5A 5ALDA 4C4ZA 2ZYRA 1FJ2A 4DGQA 1ODCA 1MJ5A 2EDAA 1JT2A 4KE8A 5AIBA 4MYSA 4OYLA 5AM3A 2DHDA 1R50A 3BJMA 4YX9A 5JASA 2WIJA 1LZKA 4U2EA 1PJAA 1FFBA 5LLSA 4IHAA 5KWIA 2XUJA 1ZIXA 1XQXA 3IUMA 2QR5A 2PSDA 3PICA 3WIBA 3BXPA 4IO0A 4XVCA 5T4HA 3IB3A 3IA2A 4AO6A 2OCLA 4AXBA 3F9CA 5CW2A 5DTIA 1W6RA 5HQ3A 4OUKX 2CBGA 3MGAA 5ALUA 1SCIA 2H7YA 3BDVA 3I2FA 2WFLA 4BYMA 4QE3A 3HSSA 4KRXA 2VJBA 2XUKA 4DMCA 5JYCA 3SX4A 2V96A 1E8MA 3ANTA 4X92A 4X6UA 5F4ZA 4H7HA 5C8XA 5EHQA 4L3WA 3B12A 3R3UA 2WJ3A 1DU4A 3O95A 1PV1A 4PO3X 4B82A 5JZ9A 3WKDA 3WL8A 1MN6A 1CUDA 3CCBA 5ALXA 5T4BA 1OXMA 1QTRA 3FLBA 2X76A 1BEZA 4KE6A 1VE6A 1N8SA 3FVRA 4IH1A 4N8EA 1XZEA 1QE3A 2OCKA 3IIIA 4J0KA 2HRRA 1EHYA 1TRHA 5E2IA 3FAKA 3A2NA 1AURA 1ZD5A 3IUJA 1ISPA 5FUMA 4QEKA 2HDWA 3FYUA 1UWCA 2RHTA 2YYSA 1QIJA 4Y2JA 1EA5A 3GZJA 2XMGA 4XWGA 4B85A 4LIPD 2WUFA 3E4DA 4P9NA 3OC0A 1FFEA 3LP5A 3HZOA 2RAUA 1XZMA 3TJMA 1X2BA 1EVQA 4RE5A 2G5PA 3KSRA 5FRDA 3N0TA 1N1MA 1BRTA 3C45A 3G02A 4KYVA 1K4YA 1Q0RA 1R1DA 4P08A 2ZJFA 2XUOA 1ZD3A 2V9ZA 2YASA 3FOBA 1UK6A 4W63A 2CKMA 2XLCA 1QIGA 1ORVA 4HRYA 4LYEA 5ALQA 2FJPA 2HA4A 2WIFA 5JD6A 4MYDA 1LPBB 5LZ9A 3BIWA 3DCNA 1XZBA 3GELA 1UOOA 4FMPA 1ACJA 5K3AA 5IH7A 1R9NA 4CG3A 2QMQA 5ISMA 1H22A 2C7BA 3WK4A 3AZPA 5ALOA 5LYYA 4BZZA 2OXEA 3EIOA 4F60A 3QMVA 1QFSA 2VA9A 3C43A 3I2HA 1SOMA 3E0XA 4G8BA 3STYA 2QRUA 4KEAA 1F6WA 4AMYA 1QFMA 3V1MA 1TCBA 5AKIA 1TQHA 2JGLA 1GPNA 3MVEA 3WL5A 5DYTA 1WB5A 1CUAA 4G4JA 4AO7A 4I19A 5HFAA 5LZ8A 1FSSA 2AJBA 4FLFA 1MX1A 4NMWA 1LGYA 4EA6A 2BGNA 2OCIA 1WCYA 2J3QA 4J0CA 2XMQA 1CEXA 5KBYA 2ORYA 5DNWA 1LPMA 5CXXA 5DTJA 1EDDA 4PSUA 3WK7A 1DQYA 4BE4A 4A16A 4KAJA 1CUEA 1QIMA 2RONA 3O4GA 2XUIA 2NW6A 3RM3A 4E14A 2J3DA 5DYWA 2J4FA 4GXNA 1DWPA 3C8DA 4X3CA 2AJDA 2JIDA 5ALJA 4QDOA 3FWHA 5FP0A 3EQ8A 4FKBA 4WY8A 2OG1A 3D2AA 2Z8XA 3O9MA 4X7BA 5SYMA 5HKAA 4X00A 3DYVA 2ZVDA 5JALA 2ZYHA 2QJRA 5ALKA 2WIKA 5EGNA 1E89A 4DLNA 4KACA 4GEGA 3WA7A 1LPPA 3ZLUA 1DQZA 3WKEA 5AI9A 5AP9A 4BCDA 1KEZA 2WILA 2ZSIA 2IX9A 2PUJA 2XUAA 3IUQA 5D6OA 2XQJA 4YASA 3Q8WA 1UFOA 4Y2RA 4GECA 3DKRA 3R3YA 3W05A 5IVKA 5AOBA 4Y2SA 4Y2VA 2O7VA 2XDWA 3F96A 1GXSA 4HZGA 4QDUA 5IVHA 1H2ZA 2OAGA 1H2YA 2YXPX 3FCYA 3QVMA 4N5IX 5ALNA 2XUHA 2WIDA 4MEBA 1JMYA 1J1IA 4BVJA 5ALHA 5ALPA 4BCCA 2DHEA 4BAUA 2JGMA 1ZI9A 3DOIA 3AZOA 5HQ3B 2G5TA 2ACKA 2BKLA 2B20A 3QPCA 4XX1A 1X2EA 1CUGA 1BU8A 5LZ5A 1K8QA 3LIPA 1EB9A 5A7HA 5IVIA 5HK8A 4B9EA 2XUGA 2WKWA 4Y2XA 1JJBA 1A8SA 2CEKA 4HXFB 3FSGA 4Y2QA 1IUOA 2Q0XA 4P93A 4W9RA 2HU7A 3HYSA 5CBKA 5JAPA 5ALEA 4W1QA 3M3DA 4Q3KA 2CZQA 1CR6A 1AGYA 1RWQA 1XZHA 4CCYA 1KU0A 5K3CA 5ALMA 3IDAA 1IUPA 5EHXA 2XUFA 3KXPA 3W2TA 4BRSA 3R3WA 1Y7HA 4U2DA 1QOZA 2OGSA 2C0PA 5AICA 4JUIA 5CT4A 4H7KA 3BE8A 4OB7A 1HPLA 1EINA 1NU8A 3W06A 3DYIA 4Q3OA 4DMKA 4ITVA 2VJCA 4CCWA 1TIBA 2ZSHA 4BP9A 2CMFA 4DM7A 2DR0A 3D7RA 1QIHA 3WK5A 2QM0A 5K3BA 5AOAA 4X93A 3LS2A 1U2EA 2HFJA 4H77A 2RI6A 1YAJA 3WA6A 4O08A 1VXOA 1QLWA 5C81A 1WB6A 1DWQA 2LIPA 2YH2A 1HLGA 4RGYA 3ZLTA 3HI4A 3RKSA 4UFOA 1R4ZA 2OGZA 3VJLA 5ALRA 3WI7A 2JBWA 2VAXA 3WYNA 4AO8A 4E11A 4G8DA 1THGA 1XROA 4CG1A 2DFPA 2XMZA 4MQLA 3PUHA 4J0GA 5A2GA 3G9UA 1WHTA 4Q05A 2WFZA 3I2IA 2PSJA 3FYTA 3D4LA 5EHZA 3AINA 5AH0A 2PPLA 2O7RA 5CH3A 1J07A 2EEPA 3VDXA 3OPMA 4AQDA 1F0NA 1A8UA 2BUBA 1MU0A 1TCCA 3F97A 2QXTA 2ACEA 4Q82A 2PSFA 1JFRA 4W1SA 4INZA 2QTBA 1AKNA 3O4HA 5K3DA 1G66A 1UK8A 3C6YA 1XRPA 5EIAA 3CCCA 4J7AA 4GBGA 4CIAA 4G4IA 2QVBA 4X95A 1ZGBA 4X85A 1CRLA 3WJ2A 4AN1A 1XZJA 3H2GA 4H7FA 3BIXA 3PI6A 3WWEA 4GDMA 3H2JA 1CUJA 1W1IA 3H2HA 3ZV7A 5JAUA 4Q34A 1VKHA 5DJ5A 3Q0TA 4DSAA 4OB8A 4DIUA 4ZV7A 4H7DA 3LIIA 2QUAA 3R0VA 1ZIYA 4X94A 5A6VA 4EHBA 4UHBA 1YA4A 2OPHA 5AK4A 1YCDA 1CUSA 2C5FA 1G4HA 1BS9A 4EBBA 3ANSA 1AC5A 1WPRA 3TRDA 3GROA 2Z3WA 3WYDA 4JH0A 2H1IA 1YR2A 1UXOA 4H7EA 4X91A 2FJ0A 1OILA 4XIIA 1SCQA 1YS1X 1THTA 2O2GA 3KWJA 1EVEA 4TPKA 3WK8A 3FVTA 3KOOA 5LKRA 2HA5A 4A5SA 4BAGA 4F0JA 2PU7A 4FFVA 4BC1A 5ALTA 1FFCA 2O2HA 2VATA 4C4YA 2QOEA 1DINA 1CUIA 5C7YA 4WJLA 5FPPA 2WG1A 3PDCA 3OM8A 5JAOA 2X8BA 4B6GA 1YA8A 3PF8A 3JYHA 1RP1A 3PF9A 3BWXA 4EY4A 5BWCA 3I6YA 4BRZA 4OSEA 2XQGA 4X97A 3V1KA 1H23A 4K6KA 2WHQA 3DS8A 5BV7A 1R3DA 4HVTA 1E8DA 4CI9A 5FOQA 1CUYA 4FFWA 1LPAB 5HZGA 1QIKA 1XKLA 3BF8A 3DJYA 5JZBA 1XLUA 4FHZA 1EXWA 3BL8A 3HJUA 2XQFA 6YASA 1R9MA 2XLBA 1ACLA 3QBJA 1XQYA 5ALVA 3EBLA 3PE6A 5JAHA 1C7IA 1B41A 5AI5A 1QIDA 4FOLA 2XMRA 4KE9A 3C70A 2JGJA 4Y2PA 3VJMA 3BF7A 2R11A 4MJ3A 1W52X 3WIOA 1GPLA 1Y37A 4DNOA 3I6ZA 2ONCA 5A71A 1D07A 3ICWA 3NWOA 2PVSA 2GZSA 2PUHA 1T2NA 3ESBA 4G5XA 3WZMA 3D0KA 5ESRA 3WKAA 4F5ZA 1XZIA 5JZSA 1TAHA 5ALIA 5HFNA 1A88A 5ALYA 3DD5A 2WJ6A 4DTCA 2R8BA 2DQZA 3HACA 4GWLA 1QIFA 5FLKA 4CCYB 3VJKA 2WFMA 3G9ZA 4BVLA 5HCUA 4TGLA 2E3JA 3GUUA 3K6KA 4X90A 4Y9SA 4MQMA 1GGVA 5ALSA 1XZFA 2Z5GA 4FTWA 3HABA 3C6ZA 1MX9A 2PBLA 2Z3ZA 3WQHA 4PV7A 3DL7A 1MT3A 2Y6UA 5DNVA 2OGTA 3UMJA 1N5MA 3HRHA 1EDEA 3D2CA 2DSNA 2B61A 4B0OA 2XUPA 4Y7DA 3N2ZB 3H0CA 2VTVA 5HF5A 4KR0A 2K2QB 3WK9A 5I8PA 5AKZA 2HA6A 1CPYA 5ALLA 2JEZA 5LKAA 1AX9A 1UZAA 5AJHA 3RLIA 2FX5A 5CTAA 4DSZA 3BDIA 3OTQA 4X71A 2GYWA 5IVDA 4J3JA 4QNNA 5I9IA 4QDXA 3VISA 4NZZA 4IH9A 3C5VA 2B4KA 2ROQA 5EHNA 3WKCA 3MUNA 1CUUA 1H2WA 2QS9A 4OCZA 5I7UA 5T4FA 5LIPA 5E4JA 4G9GA 5KREA 1O6FA 3LCRA 4G9EA 2ZJ7A 5AI6A 1Z68A 1E5TA 2OLEA 5JD4A 5ALWA 4C4XA 3WL6A 3QMWA 5A7FA 2B9VA 5AHXA 3OURA 2ZYIA 1JI3A 5FV4A 2I3DA 1O6GA 2WUGA 4Q1VA 2VT6A 3IULA 2EDCA 1AMNA 1WHSA 5CURA 2WM2A 4H0CA 4Y2YA 1DT5A 4J03A 1CQZA 1KU6A 1BCSA 1BROA 3STVA 1ETHA 4H7IA 3RK4A 4CG2A 2CJPA 2WFLB 4WDRA 3STTA 5AKEA 2Y1KA 1L7RA 1GT6A 3C6BA 1RYYA 2QT9A 4H35A 4X6YA 2XQIA 1W75A 3ILSA 4DNQA 2HU8A 3G9XA 1TCAA 4BVKA 2I03A 3IUNA 2WUDA 1XZLA 4H7JA 4HRXA 1YS2X 3PFCA 4ZRDA 4DMHA 3VKFA 4S0XA 1VLQA 4FNMA 4AX4A 4AZ3A 4BATA 1G42A 2HFKA 3R40A 1R88A 4U2FA 4GHWA 2VEOA 1BE0A 3DQZA 4WCVA 4PF1A 3WMRA 1VZ3A 3ESAA 2WU4A 1AQLA 1MTZA 4EY8A 1K5PA 5EIHA 4HXGA 4KE7A 5LP1A 1P0QA 4BC0A 2BCEA 4UBNA 4PSDA 3OOSA 2CUTA 3UUFA 1ZGCA 3I6MA 4ROTA 2HHAA 5HK9A 1UK9A 3DL4A 3QPDA 1SC9A 2VSQA 1IVYA 4MWSA 4U2GA 5E4TA 2QZPA 5YASA 3I28A 1E8NA 3HEAA 1CUBA 3AFIA 4AB1A 4C6HA 2WLSA 1SCKA 2XUDA 3M83A 3FLEA 3G7NA 3I2JA 1CLEA 1VZ2A 1L7QA 2PX6A 1VA5A 3T52A 4JNCA 1MNAA 3AIOA 3W9BA 1H2XA 4HAIA 4UBJA 4ZI5A 1CUXA 2BJHA 3M81A 1LLFA 5FDFA 4C89A 2PKYX 2GBCA 5CT9A 2QUBA 5IKXA 3A70A 2HRQA 3I2KA 5JD5A 1YASA 3D3NA 1FFAA 1ZICA 3E3AA 3SC2A 5DWDA 4UHCA 4A23A 4QLAA 1XKTA 3DLTA 3D59A 3O0DA 4B7ZA 2GZRA 5JANA 1MPXA 3DNMA 4PQEA 1F8UA 4HS9A 1IZ7A 3A2MA 3UUEA 1UK7A 4I4CA 1Y7IA 4V2IA 3STXA 4BE9A 1IUNA 5AI4A 1QO7A 2C58A 4FWBA 2JEYA 5AM1A 3KDAA 4QWMA 4I3FA 1CQWA 3TEJA 3ZWQA 3SK0A 2ZJ6A 1EK2A 1AZWA 4UBLA 4XJVA 3NOXA 1IZ8A 1XZCA 3AUKA 4L72A 1HDEA 5D7BA 4C01A 1J06A 1LPNA 1VE7A 2AJCA 4G1FA 1ZD4A 4UBMA 1LZLA 3W9UA 4WFIA 5D3KA 1ODSA 2O2IA 4D9JA 1ZJ4A 4N8DA 2BUAA 5AM5A 1JU3A 4WDQA 2RHWA 1P0PA 2OAEA 2QKYA 3K2IA 1UOPA 2HM7A 1XZAA 4WFKA 4NS4A 4WFJA 1XRNA 1Q0ZA 2DCMA 2HU5A 3EF3A 3FYUB 3QYJA 5AK6A 4ARBA 2XUQA 2WIGA 4M0MA 3G9TA 3VVMA 4G4GA 5CT6A 4KAFA 4GI1A 3EQ7A 3JW8A 3S8YA 3DEAA 3OG9A 3VXKA 3U1TA 2WHRA 3AJAA 1WM1A 2GBGA 2VAVA 3GA7A 1CIJA 5CH8A 1DWOA 4EUSA 1CUFA 2IITA 4EY7A 1I6WA 4QA9A 2XB6A 1VJ5A 3BJRA 2VQ6A 2PM8A 2AJLI 1TK3A 3TGLA 3QMMA 1OCEA 1A8QA 4IH4A 4OPMA 2D0DA 2V98A 1LPSA 2XQKA 4AMZA 4G8CA 1MX5A 3G8YA 1XZKA 1QIIA 5T4EA 4RE6A 2DQYA 1U65A 2ZYSA 5BOVA 3L1IA 4UHDA 1U4NA 2HL6A 2VJAA 3V9AA 4X6XA 5K3FA 2JGIA 1XQWA 2QXUA 4HTAA 3WKBA 1PFQA 3G0CA 1MNQA 3V1NA 3PUIA 1YB7A 4DNPA 4UBOA 3QH4A 3ICVA 5J3JA 4Q3LA 4Y2UA 1UKBA 4PNZA 3A6ZA 5DYYA 2J4CA 1HBJA 1AUOA 4FDMA 4BDSA 5FPQA 1K63A 2XMBA 1HQDA 4LXHA 4KRYA 1WPXA 3G0DA 3PFBA 1DTEA 5AKXA 1G5FA 1DX6A 4ZWNA 1VXRA 3A2LA 3E1GA 4PW0A 2OQIA 1CUCA 3R3XA 2BFNA 1GPKA 3H2IA 3C8HA 5C8VA 3VVLA 4LXIA 4FBLA 5ALGA 5AI0A 4ZREA 4B80A 4B0PA 2JGKA 1QTIA 1M33A 4N8SA 1S8OA 1L7AA 4OB6A 3WLAA 4Y2TA 3H18A 3W04A 4UPDA 1VOTA 4BZWA 1JJFA 2HA0A 3HXKA 4EB0A 1VA4A 2VF2A 3QZUA 5CT5A 4ZV9A 2HA3A 5AOCA 2VJDA 1CV2A 4CFSA 3B5EA 4BDTA 4ZXFA 3F8SA 5AK5A 5D3ZA 5AKGA 3DKKA 1YAHA 4RNCA 3AZQA 1BN7A 2VT7A 4IQ4A 4ETWA 3KWFA 2XI4A 3O4JA 1JKMA 4KAAA 1ZD2P 1UT6A 1XFDA 5KWJA 1ZI8A 5AIAA 3R3ZA 4OU5A 4KJXA 4LYDA 4U2BA 1BCRA 3R3VA 1YSCA 2BAGA 4FLMA 3V48A 2H7CA 3F98A 1ODTC 4HXEB 1MO2A 2WUEA 5FKJA 3FLAA 3DOHA 1NU6A 2GBFA 1XQVA 2X5XA 5AKYA 3IBTA 2WG0A 1UKAA 1W4LA 2W22A 4TVKA 3L1JA 1C7JA 4BTVA 5JARA 1DT3A 2WHPB 3CN9A 4UHFA 1XRQA 2GBIA 1K6EA 3P2MA 5JATA 1CUWA 4LHEA 4BBZA 3L1HA 1QZ3A 1BEEA 5BWBA 5ALZA 4Z49A 3ESDA 4OU4A 5ALFA 4MEAA 4B81A 4EZIA 1Q84A 2XMDA 1W76A 4BTLA 4DNFA 1CVLA 5H3HA 5HKBA 4J0HA 5AO9A 1P0IA 5LZ7A 4UBIA 1JMKC 3G0IA 3CXUA 4PSCA 4L9AA 4K6HA 1EI9A 3FYUC 4P92A 4BP8A 2PU5A 4QDZA 3WWDA 3STWA 2G4LA 4BCBA 2Y2UA 1SFRA 1UKCA 4ZGBA 5EI5A 4J0DA 2PL5A 4UHHA 4RPCA 2GYVA 3AIMA 4OYYA 3WWCA 3H1BA 3CN7A 2C4HA 5AM0A 3M82A 4QLOA 1XRLA 4E46A 1X70A 4JEIA 4BB0A 5CRIA 3AIKA 3AILA 3H2KA 3I2GA 1WOMA 4B83A 2XMCA 2PSEA 1GZ7A 3H17A 2OQVA 1XZGA 1XLVA 3C5WP 1HL7A 1FFDA 5CH5A 2WJ4A 3ZI7A 1A7UA 3WWPA 2C0QA 5AKJA 4U2CA 1LBSA 3WL7A 2D5LA 2PSHA 3S2ZA 3LLCA 3ZLVA 4UFPA 5A62A 3FBWA 5DNUA 3FSGD 3QITA 1EB8A 1ZI6A 1MAAA 2I78A 5JIBA 4GW3A 4LKOA 2Z8ZA 4YK7A 5C8ZA 5EIEA 3QPAA 4AZ0A 1JU4A 3FCXA 3YASA 2H7XA 5AK3A 3SWWA 4FNGA 4JYMA 2I3ZA 2JGEA 5AKKA 2RIPA 4AN0A 4L0CA 1E3QA 5CXUA 5CMLA 5JADA 2OCGA 3WJ1A 4EY6A 3ED1A 3KD2A 2C5GA 2V97A 5DLPA 2RGUA 3C6XA 4C87A 2WU3A 4M0EA 2HA2A 1LPOA 1USWA 1GQSA 2AXEA 1XRMA 4J0IA 3U0VA 2P8SA 4JYPA 3WK6A 1LBTA 3WZLA 4E15A 1Q83A 1J2EA 5LZ2A 3STUA 2JGFA 3ZPXA 1MAHA 5SYNA 1EDBA 4MXDA 5HF6A 2WG2A 5FXMA 4YPVA 1GQRA 4W1RA 1TKRA 1EX9A 4NVRA 2WHPA 1CUVA 2Y6VA 5AKLA 1C4XA 2AJ8A 2ECFA 2CB9A 3JWEA 2XE4A 1HKHA 3NGMA 1B6GA 5AI8A 5E4YA 4B84A 7YASA 5K3FB 4EY5A 2FUKA 3K9BA 3GBSA 2HA7A 1CUZA 5HF9A 4DMFA 4OD0A 1ZOIA 4UBKA 2HADA 1BN6A 3B3QA
chains in the Genus database with same CATH superfamily
2D1TA 3KFXA 2E7ZA 3ORHA 1KPIA 4MP8A 1A4RA 1R0ZA 2Y93A 4KSBA 4YHHB 4ODIA 3PIDA 1JR6A 5TMPA 1Z6GA 1Z4NA 3B1VA 1KI2A 1U8EA 1QGED 5I45A 5IVKA 4UUAA 2PAAA 3I5AA 1G3RA 1NNLA 2NUPA 3JATA 1EYZA 1HE2A 2O2CA 1D04A 2X42A 1TQ8A 3FVQA 1TDJA 4CQMD 3RC8A 1GTJ1 3R41A 1DKRA 3OT1B 2J67A 4L2IB 3GYGA 4DSNA 1WDWB 1OAOA 2M6LA 1PGQA 3HJRA 5DYNA 4FSDA 1QDEA 1IMJA 4BWYA 2MYNA 2ZVPX 3VZRA 1QP0A 3LOQA 4HVCA 1NASA 3E1KA 3IQFA 1EZ4A 1TMOA 4WIAA 5IVPA 3GLIB 3LI2A 2GZ3A 2P9TA 2QSZA 3USCS 2H11A 3JASA 1IC6A 3D5EA 5JEEA 2F4VB 3DXXA 3HJBA 4Y98A 1NX9A 1AF4A 2GNAA 1SUIA 3WNDA 5G53C 3V1YA 3QLTA 3ZQ4A 5FOTA 2MMCA 1X0VA 3QUCA 5T5QA 3V8NA 4C2UA 5JJBA 1JPUA 2HB6A 4LW8A 1HX7A 1BMTA 1FDUA 3HEMA 1RAAA 2PY6A 2XDYA 1QZUA 1S0UA 1QIEA 1NMYA 4M4SA 1QH0A 3RYCA 2BHTA 1Y1QA 2R2AA 4CPDA 2BSAA 3ZH2A 2ODAA 2W0MA 2H8KA 3CFYA 4LHSA 4H27A 2JF0A 4TROA 3VNRA 3FB1A 3TE7A 2YBEA 3HNRA 1TMGE 2WB4A 5AKHA 2LDBA 1XDWA 1Z6XA 4ZI7B 1AQIA 3OMLA 2A4KA 4K6GA 4W1PA 2Q7DA 3WGKA 5JRDS 5K5EA 1T8SA 1MH1A 1SXGA 4R51A 4NXNB 4A8HA 2NV0A 4FXOA 4CETA 4L07A 2Z8YA 2D3TA 2ZR8A 4LBZA 5E1OA 1FQWA 3CQ9A 3IA7A 1KEEB 2JH9A 2CZCA 2RHLA 4GNRA 3UHOA 2VDPB 3U39A 1L4EA 2C88A 1GKKA 3GLTA 2B21A 1RPNA 1PO7A 2WTNA 2PRIA 1XKQA 2O05A 1J1UA 1VGQA 3MUOA 1MHPA 3GGSA 4KMMA 4DC1A 3K4PA 3NAQA 1YULA 1NWHA 3P2KA 1BXGA 3TK1A 4F3CA 3QTBA 1QMGA 2JVKA 2ZRBA 2I2WA 3CTMA 3QYFA 4KXXA 3ZWDA 5B30A 3JRWA 2CFCA 2WE7A 2QQEA 3QNWA 4ENRA 1DAEA 3AFOA 4BVGA 1E6UA 3IL2A 3DP7A 3K0BA 4PLGA 2Y67A 4ALJA 1QO0A 3FRJA 4CGZA 3AONB 3HN7A 3EG9A 5CCEA 1L7PA 3QHPA 4L8LA 4PG7A 4FEAA 3VDNB 4NC9A 4Q4CA 4CEIA 3D8HA 4UKDA 3PDJA 2CUKA 4EYQA 3KV3O 5BSVA 2FEOA 4OQXA 3TLXA 4F21A 2CBZA 3H6KA 4U7GA 4M1TA 1A9XB 2DHCA 3AV3A 3EC2A 1H8EA 3V2IA 3FJYA 1STOA 3B8HA 2DLDA 3O75A 4H3SA 3T3MB 3K8YA 2P5TB 3I1YA 3UATA 1C7ZA 1MC4A 1XTKA 4NEHB 3JYNA 5BSEA 2XT0A 3TOSA 1CS4C 3OTOB 2GX6A 2FEAA 1GA1A 2RHCA 3ZWOA 2GPJA 3TIGA 3WY9A 1B0PA 3RAEC 3X3HA 2C4KA 2NUTB 3FPJA 3ZNNA 3NIFB 1SHTX 2ZRDA 2E1PA 4IOKA 3PGXA 4DYDA 1P1CA 1XRRA 3A1VA 4ZV4A 1PT9A 1Z34A 3FFBA 3ANMA 2VTKA 1QONA 2IQIA 1NYLA 3DFFA 4GLBA 4Y1RA 1CC1S 4IHJA 5BYJA 4RA6A 1E7QA 1U0TA 2YHIA 4DSTA 5K9ZA 2I76A 5K3OA 3I1IA 3E8MA 4HDRA 1Z62A 3U4HA 3LCUA 4CQMA 5LP6F 1RZ3A 3K92A 1DG3A 3O3MB 4MWCA 4QXQA 2K5UA 4JP5A 1EH5A 4A27A 1KJIA 1UBGA 1SC3A 4Y6RA 1D2HA 2OB2A 2ZYRA 3NNDA 4HQRA 1FJ2A 4MYUA 3CLRC 2J5XA 1UJBA 2CNWD 4RD1A 3VTFA 3B6EA 4DXDA 1YMVA 3KSDO 1T0HB 3VSAA 2F43B 3JWGA 1UMDA 1RCUA 2EDAA 4EW1A 3H2YA 1TC1A 5AIBA 2DB3A 3SX0A 3LUBA 2QRNA 3R0XA 5GJBA 1R50A 4BLTA 4X61A 5CD9A 2AVDA 3I52A 4YX9A 3KELA 2GRJA 3IKVA 5JASA 5LYJF 1LZKA 4HNGA 2PLRA 4UCWA 1FFBA 3K2BA 4IILA 5LLSA 4OBEA 3U3JA 1Q14A 3FNHA 1ZIXA 4KIGA 3WS7A 5JDIC 1DRWA 5EJ7A 3A1EA 2IRWA 3MWGA 4M54A 5EINA 3VU3A 1A5SB 2QR5A 5KTKA 2PSDA 5KQGA 2RHHA 2ZYUX 5KNDD 2YWXA 3WQSB 1CS0A 3DF7A 3QKSA 3WIBA 2I7VA 2W9XA 1I6MA 2ODPA 4KLCA 1KAMA 1COWA 1BD3A 1T0UA 1Z83A 5BUZA 2EFHB 4BCBA 5JXIA 5D85A 1UKEA 3D5TA 2FEMA 2E5FA 3TVTA 1UIMA 2AZMA 4AN4A 3E5HA 3ZUGA 4MUNA 1SH7A 3UJCA 1K8RA 3F9CA 3R77A 4PIVA 5CW2A 1X1QA 3HRIA 4S35A 1LA2A 5FFNA 3G3EA 3KR1A 3HU5A 4BZQA 4EG4A 1ECFA 4MUKA 4KQ9A 1SCIA 4BGUA 1QWSA 4FB5A 1VCIA 4TXNA 3SBOA 1TF5A 2EWVA 1EHIA 4G0NA 3PYMA 4YMHA 1CRWG 2D5CA 1KO1A 1OLUA 2AW5A 1J4AA 2XVZA 3IDZA 3O31A 4MJLA 3RFUA 1HNWB 3TKAA 4KBGA 3PQFA 2B92A 1ISRA 3K9QO 1VJTA 3HSSA 4MW6A 3DMFA 1DAPA 2Q4RA 2VJBA 2XUKA 2RGWA 3HE3A 4GQIA 3RU2A 4WLOA 1BTOA 5I7SA 2CT8A 2VT3A 3O74A 3EEYA 1ZNYA 1PTJA 3Q41A 2V96A 4JDPA 1QGUA 3WGYA 3BA1A 3GZNA 1EUCA 4X92A 1BHJA 3MA0A 4X7PA 3NVKI 5F4ZA 2V7QD 5IF3A 2G1UA 3OT1A 5C8XA 3CWCA 4P3KA 4BGVA 1C0KA 5J4HA 1GZVA 2X1VA 2QTTA 3K31A 2Q6TA 5G0TA 5C53B 3JQAA 3IMGA 3NHAA 3K5IA 1M1NB 4HQLA 4RORA 3IQZA 1R16A 2E4ZA 4COKA 1ZFNA 3ZZMA 4NMMA 3M1LA 1RZUA 5JZ9A 3BAFA 5E9AA 4H08A 4BNFA 2MSLA 3NJ8A 5L95A 1TLTA 4WKOA 5TGDA 3MGGA 1CUDA 1I8TA 1LXCA 1OYYA 1SCDA 1SBZA 2AW3A 2FZVA 2QI9F 2YMLA 1HETA 4MV3A 5IAGA 1N5JA 1ZHFA 5AW7A 4DV0B 2BMVA 1RADA 4RXUA 2FQYA 4JASB 1R15A 1MO4A 1A8HA 2X5OA 4KE6A 4FP9A 3IHLA 2WWYA 1N7JA 1WSAA 4EJSA 3H5LA 5LCXA 1VE6A 4G0ZA 3ENQA 1N8SA 3ETEA 4IQGA 1NTRA 4IJVA 4FYMA 4UUPA 4KXLA 4EUHA 2WK1A 3C0KA 1H0HA 4HB4A 1IE3A 4G1EB 1FTSA 1P2DA 4PAMA 1OH6A 3S7TA 2GKOA 2G72A 1B93A 1MORA 3KOZA 2VK2A 1TRHA 1BAPA 5E2IA 1BYUA 1XYVA 1Z4IA 3PNQA 3M4JA 1JJ7A 3TQOA 4KSCA 3K6SA 5DW3A 4HYEA 3FAKA 4FWTA 3EXHA 5L6MB 1W5FA 1IQRA 4JVMA 3VAYA 5B36A 3SGLA 2O2JA 2VRCA 2WNIA 5EPUA 4AJJA 3A2NA 4MWDA 1V47A 2YWBA 4FT4A 4CF5A 5KYNA 3G6WA 5CB4A 1LS1A 3GUHA 1RZRA 2XXAA 1R5NA 2H2DA 1ISPA 2XNDA 3CB2A 4U2KA 4ZQFA 2A94A 4C29A 3OHMA 5IXJA 2I7TA 1C1HA 1SM4A 4J2TA 3ABIA 4U3JB 1O0CA 2AG5A 3Q7SA 1UWCA 3PPVA 2ZUSA 5LDGA 4DT1A 3T3OA 3U7GA 5JO9A 2RHTA 1RU3A 2YYSA 1W7AA 1RI4A 1I2DA 4IG9A 1QIJA 4R2JA 4TZ0A 4GKAA 4LECA 3VHLB 2J3KA 4BUZA 1X94A 4JI8B 1H0RA 1DEOA 1RMQA 2BE9A 2C3UA 3K0FB 5IFLA 2QIOA 3IDQA 3SHOA 1L5WA 4B85A 1Z9BA 2VZ9A 2RMKA 5HKOA 1GRRA 2CLOB 2Z5LA 5EZQA 1T6XA 2WUFA 2OFFA 5BR8B 4P9NA 3JQFA 4L75A 5IJXA 2CHVA 3GPBA 3OC0A 5DT2A 3IE1A 1ABFA 5EZYA 1ISHA 1IQPA 1PDOA 4G6ZA 4OJKA 4J91A 2DGDA 5EZ5A 4BJHB 4URZR 2RAUA 4CTNA 1XZMA 3WB1A 1MGPA 2NYVA 4KQIA 2PXCA 1ZM9A 4QBTA 4E22A 1EVQA 1FK8A 4IHQA 5M34A 3O93A 5GZ1A 3KSRA 1NP3A 4OG2A 5FRDA 3KOMA 3WLEA 1J56A 2LE0A 5D7NA 1FRZA 5J2TA 1N1MA 1R00A 2BMWA 1Z3IX 2ZJ3A 1GNPA 3M9LA 1LWOA 4GNKA 4KYVA 4CN8A 1Q0RA 1R1DA 5K09A 2ZJFA 1OFVA 2KB0A 1W1UA 2YW9A 1MB9A 1ZD3A 1M6NA 2PWAA 2W6ZA 2OBFA 2YASA 4GXTA 3UWSA 2BVNA 4N7BA 4EX6A 5AQ1A 4A0GA 4I9FA 3VC1A 5DNYB 1PR5A 4HSGA 5DVZA 1DAKA 1YL5A 4L8WB 1KAEA 2FGJA 1P7VA 1L7VC 1NG9A 3LF1A 1LSOA 2XTNA 1KY4A 1ORVA 2G1JA 4L4XA 2XVAA 3LT5A 2G40A 2QRZA 3UAGA 5LMUB 1EGMB 2WIFA 5AUPB 1FFWA 2ZUCA 4FI3F 3N2KA 5JD6A 1LCIA 1M10A 2G8NA 4J43A 5FHRA 4MYDA 5C1IA 1ES9A 4CW7A 2BELA 2GK6A 5HQTA 1LPBB 1ULAA 2Z4RA 4NCKA 5EWJB 2X2FA 3BIWA 4DWWA 2GJAA 1KKUA 3DCNA 4CLHA 1ONNA 3GLFB 4WEQA 3EXFB 4N65A 3RF7A 2R84A 3QW4B 4IUBS 3S1LA 1O54A 4F06A 5CBPA 5BW5A 1F3LA 3S2IA 4FGWA 4MVJM 3U9TA 1D09A 4PSAA 4TTTS 5K0EA 5KTPA 1BNCA 2EV9A 5C8DA 1NURA 3PEUA 2V7XA 3RREA 3LQRA 1T5DX 4I6JA 5C0OE 2WWTA 2Q2VA 4D8VA 3AYXB 1GSIA 1UL1X 2YHIB 3TMYA 2BFEB 5ISMA 3IXQA 1NQAO 5CD1A 4YREA 3LPDA 4ARCA 1Q50A 2C9MA 4PIPA 3V55A 3C3WA 4B2LA 2HKIA 3DAOA 2QL9A 1UWLA 5ALOA 5EFOA 5LYYA 4NCAA 3M4NA 3VBEA 2OXEA 4X1KB 4RGQA 3WHLA 1TCUA 1XDZA 1NI4A 3CNHA 1C5KA 1JA9A 3B1FA 3STYA 1RFLA 3E0XA 3QBDA 2YRWA 3TPFA 2ZJ8A 1H6DA 5HZHA 2QRUA 5CCXA 1UMDB 1WCWA 2QSJA 3SSNA 3A6HA 1KEUA 3NETA 4KXQA 1P7YA 3N2GA 1NQTA 4E30A 5BV8A 4C21A 3DFIA 5JO0A 5AKIA 1NVAA 3IOMA 1TQHA 4EFLA 5KVSA 1JPVA 1E1YA 2O5CA 3KJXA 1W8DA 2VRBA 1HZZA 3BSYA 3GGCA 3W8NA 2BC9A 3B3GA 3VDMA 4TMVA 1DFHA 4QGAA 3WL5A 2VDWA 4GSYA 1Y6JA 5FLEX 1RBZA 4N5DA 5T8KA 5C8YF 2DY0A 1P91A 2QUZA 1N2OA 3QELA 2J32A 3QKTA 3HKCB 2CMDA 4YJFA 1P1IA 3QIAA 4PPFA 2OV1A 5HFAA 4BJ3A 3U7JA 2FW1A 2EHJA 1M2VB 2QR2A 3A3NA 4LTDA 2VF5X 1W87A 4EZEA 4AQYB 1H6CA 2WYVA 1QCYA 3EMBA 2OC4A 1E9DA 4IMIB 4MKZA 1JHXA 1SUEA 2QRKA 5GWXA 3L8MA 3JQ8A 1LV8A 3UK0A 3WXBA 4RQAA 3EG9B 3N8GA 3OZ7A 4ZAFA 3ZWNA 2OV2A 2YMQA 2VR1A 1CEXA 3I53A 2OHOA 4RIEA 5CB4F 5K0BA 5KBYA 4PG8A 2VXCA 1KQFA 2Z6AA 3HL0A 4H0NA 4TWJA 1ZJWA 1DZ3A 2ORYA 3MOIA 3KQWA 1EDDA 1R5BA 3GK3A 3AK4A 4UMDA 1OZGA 1KR2A 1YB5A 3E1SA 3T1NA 4A16A 5JI2E 3ASUA 4TWBA 1QIMA 3CPEA 3T35A 3E8XA 3QKRB 2RG7A 4E5PA 3ACCA 3GPDG 2D1FA 4LRXA 5KC9A 2I4LA 5G0SA 5IUKC 4EA8A 1WPGA 3PNMA 4D4KA 2B1QA 4I5FA 1GU0A 3RGWS 4TS4A 1OVMA 1RYFA 2ZREA 1BQEA 5I3CA 5JFGA 3GF4A 3OJLA 2J3DA 3OTWA 1VLVA 4OQNA 5LBTA 2WUVA 3T3EA 1VM6A 1L4BA 2FK7A 5CA1B 3G2JA 4B3DA 2OCAA 1ZOLA 5J5CA 1UBHS 1OKKD 1BX3A 3P0JA 4HX5A 3FJ1A 3RSCA 3K35A 2VPQA 3OHSX 3CLKA 4LNAA 2JLQA 3EQ8A 4NYMQ 4TL7A 3AKYA 2Z8XA 3OPQA 1TK9A 1M6VB 1OQAA 4MR8B 4H1VA 5KSOA 2JFXA 5HKAA 2HBRA 5DM0A 4LJRA 5AJUA 4IOJA 5JALA 1K7SN 1NXOA 2PT9A 2YWCA 2WC1A 2ZYHA 3ITNA 5IWAB 3PB3A 3F5QA 1FBNA 4G56A 4P36A 1E1RA 3HNOA 2GNPA 1NMSA 1YRYE 3U9LA 1R0LA 4DLNA 4UUMA 4G07A 3QFHA 3GJTA 4AVYA 4R7ZA 1V96A 2WTXA 3HJHA 1I7NA 3KWMA 4PHGA 5F7ZA 1LTKA 1GG2A 1Y0BA 2V74B 3MWYW 4BN0A 1ICIA 1YQUA 1FTYA 1C9JA 1I3CA 1UR5A 1YVEI 5LWHA 3ZXSA 1KYZA 3L01A 3KPUA 4RHTA 1NV9A 1KEZA 4GU5A 4XKJA 2VAMA 2W00A 2GERA 3SD7A 1LDEA 3W7AA 3ZEAA 2RKWA 3L92A 4U0KA 2WILA 5ICFA 1IXKA 1K7FB 3ZI0A 3J81k 4A0QA 3R3SA 4HJXA 4Y18A 5KHOC 2CXNA 3NHPA 4CF3A 4FYWA 2CXHA 3DZDA 4NNOA 2QVLA 2R6JA 5K8JB 5EIBC 4CDMA 2EU8A 1IFXA 1AS2A 3EXIA 3H8WA 3IUQA 4C04A 1O03A 2D1RA 4IKPA 4INJA 4WUVA 4CV0A 3Q8WA 2EW8A 2JKZA 4PYOA 1Z6QA 5LYJB 1SEVA 2EZUA 4UVHA 5KYWA 4U7HA 4UQPA 4GECA 3DKRA 5HR5A 3TKLA 3W05A 2HSDA 2IYPA 1M0EA 2ZS9A 3D7KA 3I9V1 1OWPA 3KZ1E 2XCUA 4OKNA 2G88A 2GM4A 1EFUA 3AR5A 2NLOA 2FZEA 4EJ2A 4QXOA 1QC5A 5CVEA 3F96A 4IBOA 3G8AA 3K0FA 4I9UA 4N49A 4YMIA 1Y5NA 3CEMA 3K0CA 5TNXA 5IULC 4JL5A 1Z73A 3A9RA 1DQSA 2AX3A 3ZV3A 2AEFA 1G5IA 3WAKA 1WKCA 2EYUA 2X5JO 3A9SA 5K8UA 4TYNA 1Q0TA 3LC7O 1J1IA 2W6ID 5AUQA 5JY1A 2ZITA 5CR9A 4BVJA 4CKYA 3IIJA 2LXNA 2PGDA 621PA 2NU9A 2G9VA 2AOWA 2XEDA 3O38A 1XMOB 1O58A 3GQBB 1H9CA 3RT7A 1K0UA 3AUAA 3UJPA 3RJZA 1OA1A 4BAUA 1TYDE 3ZHVA 3DOIA 4M7RA 2XA9A 4XCVA 1KERA 4MPRA 1I2ZA 1XIVA 4CT5A 2ODEA 4X20A 1SVWA 3T7DA 3WYAA 2BMJA 2H3HA 3C1UA 4UZFA 5BWNA 3G0OA 3TD6A 2OESA 3ZJUA 1GUYA 2REBA 5HTKA 2CNBA 3P9IA 4QXRA 3ZDFA 5LZ5A 1G2OA 2IXEA 3JQRA 4IKOA 2FUG6 2P2LA 3LIPA 1EB9A 5LQKA 3PJRA 3AEYA 4AKGA 3LMKA 5HK8A 4B48A 3DMDA 4A1FA 3LWBA 4XWAA 3RKUA 5CK5A 4OQFA 2G71A 1E63A 1WSBA 1F14A 1WPQA 3LFUA 4H9GA 4QBGB 1X8JA 4EW6A 2QENA 2YS7A 3HM9A 4ZTUB 1G8KA 1TQ2A 1VC2A 2ONJA 2PUBA 2GFHA 2RH5A 3NNSA 4C9BA 2QL6A 3WNVA 3ZW8A 3UNXA 2QTVA 3KU4A 1S3FA 4CM8B 2HK6A 2YVKA 4J4BA 4FEEA 5C7LO 2QORA 5LNK1 4P93A 2HU7A 2R00A 2IYUA 3FHOA 3SEFA 2NZJA 2Q4EA 4V0QA 4ZQEA 4QPCA 1JHRA 5EWJA 2F3UA 2CDCA 3G5TA 5EKXA 3ZVLA 3KYDA 1A77A 3P0IA 2WOOA 4BVBA 3FOEC 2PUFA 3K4QA 4PO8A 2JAPA 3EOBI 3EN0A 4CCYA 1V7PC 1TU4A 5J2UB 4TL9A 2JFGA 4Q4LA 3CB4A 2JGDA 3MJVA 2VJNA 5IRCD 1T0PA 4BKQA 2BFCA 4NEQA 4R1SA 3MBIA 4GICA 4LC1A 3KXPA 4BU0A 1LRLA 3SU8A 3G2NA 4MYCA 3CH5A 3P9KA 3W9SA 4ETMA 4TMXA 3ZK9A 2G04A 2C0PA 4X66B 2YS6A 1PFVA 2C5AA 3DMHA 2O5VA 1GUFA 4NESA 3Q8XB 3N9IA 3G79A 5TPZA 3ZWVA 3MD0A 4QPNA 4DG9A 2P77A 4TRNA 2O8EA 3E6AA 3OX2A 1XEWX 4HJRA 3HDVA 3WADA 2CXTA 3DHEA 3SICE 5HKKD 1G8HA 4DMKA 5ETJA 2JDID 2VDOB 3GJ3A 4OTZA 1D2EA 1U7TA 1ISFA 1Z4JA 2VFAA 2VJCA 2WAMA 1TIBA 3F47A 4JLAA 3TX6A 4TZKA 2FG5A 3ZWKA 3OFVA 4Q37A 5JSZA 4EHKA 4JA2A 4Q24A 2JI7A 5BSMA 4N76A 4TKLA 4DHEA 4BU1A 2BGUA 2JVJA 3RO7A 4RM3A 4B71A 3IIEA 2VKTA 3ZDBA 1BDJA 2PSSA 4F93B 1P75A 5AXCA 1QIHA 3CRVA 2WQ6A 4G5RA 5P21A 2GJ4A 3IO5A 2F4NA 4MDHA 3CURA 3PD7A 5K3BA 3QLVA 4X93A 2FSVC 1EUDA 2AOUB 5I7FA 2CXSA 2QNRA 3RWBA 1NOKA 4J90A 2WZQA 2HFJA 1JE0A 3BQ9A 2Y3IA 2IY8A 1REQA 3LDHA 2PN1A 5UKDA 1YAJA 4PNPA 3QFTA 5HCIA 3TWOA 4UPEA 3IOYA 5HDQA 1WDLA 1KWGA 5FFFA 1QLWA 1YC5A 2ZAYA 4PBRA 3AM3A 1WB6A 2FWNA 4DCOA 3WHPA 5FD8A 3LBFA 4IR7A 4B7CA 1T8RA 5TIIA 1L5QA 3IJPA 3U3RA 5A1TA 2Q21A 2IZ7A 1D4ZA 3CIFA 1QNFA 2OGZA 3UCXA 4B8ZA 4DWVA 2VP4A 2ZSDA 5ALRA 4GEKA 4RETA 5AQEA 2Y66A 4DR4B 3WB0A 3VA7A 1DJLA 1ESDA 2I6UA 2QG6A 3KO8A 3UW3A 5LOVA 5DBEX 3RSZA 4MO2A 3WYNA 4AO8A 4F12A 2WSSD 2D54A 5BMVF 3LECA 3KD3A 4ARVA 4JJFA 1IBLB 1THGA 1XAJA 3AHDA 1MB0A 3FSRA 4HDOB 4CG1A 1OX6A 4EZBA 1ODKA 3EUWA 1GU1A 3OJFA 4PM4A 5I7VA 4B3RB 1WXEA 3N05A 1VL1A 1ZCAA 1U3GA 4XUCA 4GL2A 5BV2P 2FW8A 5H81A 1SK9A 2H65A 2JANA 2JCYA 4ZA2A 5CA1A 3FCUB 1W6UA 2PSJA 4R0VA 2F8MA 3CZAA 3W6UA 3LYLA 2CV1A 5JYEA 5B37A 2V0NA 2D2FA 2YXDA 4XD7D 4PC3A 1WP9A 4IIJF 1QHSA 5KX5B 1JAIA 1VJ1A 2PPLA 4MR7B 1EX6A 5EVJA 3SKVA 2VXBA 4BEJA 2IYQA 3UXHA 2IOHA 3KZNA 4CQLB 1A9QA 3MB8A 1NW3A 1VL8A 1NBME 1RMTA 2EZTA 1JLSA 1UBTS 2GKSA 1M0SA 1SHUX 1ZCJA 4RJJA 1FX0A 2A0WA 4PX2A 3U4QB 1Y3BE 4TTQA 1I36A 1MU0A 1I3OA 2ZSBA 3I37X 4ITUA 4IXMA 2C1XA 5JPIA 1DKQA 1FSGA 1LRJA 1Q2UA 4DV7B 1TCCA 3A4NA 2ZUVA 1Q0SA 1XJWA 4LCBA 4XB6B 2ACEA 1Y6QA 3UN1A 4Q82A 2SKEA 4LY9A 4OJYA 3O91A 3NANA 2EBUA 2NO5A 3AO0B 4INZA 2AJTA 4Z2AA 3GCGA 1G66A 1GV0A 1UK8A 2WYOA 5EIAA 5K0CA 1NW5A 1URPA 4LBVA 1FYWA 5JMOA 1QR2A 4BLRA 4G25A 2VSXA 2QZZA 1O9BA 3R9KA 2PZ8A 2NGRA 4CM5A 4G4IA 1I14A 1Z33A 5KNBH 1UANA 3FWYA 4X85A 2GF0A 3A1WA 3CISA 1YIOA 5AVYA 1ZLXA 3H2GA 4C6SA 2P41A 3EZXA 5TT0A 3B38A 1X7ZB 1NI4B 2QN2A 4H7FA 2PVCA 3BIXA 3BTVA 5G2OA 4OHXA 4R3UC 2DKNA 2JEOA 2ZIUB 1Z4LA 2BH9A 2HMWA 2ZJ2A 3FWPA 3RJTA 4A26A 5KCZA 1XNHA 3GYBA 4H6PA 1HYQA 5A4AA 4TMFA 2LV8A 2BI7A 1HEUA 3GRCA 1JIKA 3H5TA 2PVPA 1RYBA 3NAZA 4FHFA 1ZJYA 3JAMA 1K3TA 4WECA 3AIIA 2VYQA 3BMXA 4TTAA 1W5EA 2CFTA 3L7YA 3L7NA 2IZ5A 3OCYA 4F4FA 1VKHA 3KVNA 4HDCA 2FSFA 4DIUA 3C7KA 4D3SA 4YWHA 1E94E 1U0RA 1RHKA 2IY7A 3LIIA 4KI0A 3U4GA 4JN6B 5A1JA 3MS2A 3UEOA 3F9RA 1TU0A 2FV8A 3VR6D 3W2GA 4WT7A 1VJGA 1ZIYA 3R0VA 1H1LB 4D9BA 4EHBA 2BGIA 3H5NA 5LC1A 4EI8A 2BWJA 1QRRA 1YCDA 2NZ8A 3QFRA 2R8XA 5JSUA 3L07A 1WCV1 1G4HA 1PR0A 4OHRA 4G23A 1FS4A 1T1JA 1OFUA 4G0OA 4D8UA 1O95C 3GT4A 2BEVA 3UZUA 4KWHA 2OSVA 2EP8A 4LDZA 4JAVC 2FMIA 3GDOA 3JV7A 4L2IA 4MJ7A 4MVJI 4N3BA 3WYDA 1CY0A 4RVNA 1XTZA 3RIYA 5JCJA 2GEUA 2Q0SA 2Q50A 1NUSA 3GLHA 2XF2A 2HRZA 4IGFA 2JB9A 4MB0A 1M6VA 4RV4A 3LUFA 3JASB 2H1IA 3FYCA 5AWFC 1UIRA 2IFTA 3FJOA 1E2PA 3WIEA 3IUPA 2X0NA 4NEGA 4LF4B 4RBNA 3EIHA 1E5LA 1N5LA 4YP1A 1YB2A 4UC0A 1OILA 2FMHA 2ZBDA 4W5JA 4XIIA 5DYIA 4AT1A 1QO0D 2VZLA 3D6TB 2J6HA 2P5SA 4HUQB 3LA8A 3LX4A 3TBKA 2M9MA 2GXUA 2QUJA 3DW3X 3LPAA 4AYTA 2J5KA 5H5JA 3U4DA 1FFGA 2GM5A 2YJ4A 1XTPA 2XRFA 1V8OA 4WI1A 1UBCA 4LZAA 4RU1A 4GD3Q 3WSVA 1JEQA 1G8PA 3ZGNA 1KQGA 1NN3A 4DANA 4ZMSA 5TR9A 4X1IA 3AU9A 5ALTA 1FFCA 4H0FA 3JZAA 1EUYA 4C4YA 2FPGA 1DINA 3CVOA 3D4NA 3KYDB 4G24A 5H70A 3DC7A 4YV0A 5C7YA 3KBOA 2O8EB 3F4BA 3TIIA 5DHPA 3EVNA 4QX6A 1RZVA 1HORA 5KNBA 3DB1A 4I55B 2X8BA 1VI5A 2COEA 1GN9A 2WU0A 3FI9A 3OI7A 3JYHA 4LYHA 1RP1A 1XF1A 4LZNA 4R84A 2NXCA 4BV3A 2WPDD 4XIJA 4EY4A 4Z4FA 1NDHA 5BWCA 1I33A 3X0DA 4XFKA 3FDZA 3UV7A 2I80A 3FPCA 2O3UA 1HY3A 4KQKA 4OSEA 5FWAA 3DGFC 3PWZA 1PYDA 4I5GA 2ZKLA 4PG6A 4B6QA 4ER6A 1CP3A 2NV2B 1PX2A 3RYIA 2A9QA 1HT1E 3V1KA 4EGFA 4EW3A 4J9UE 3TTVA 1TJ4A 2R5WA 2QPLA 1W30A 2WD9A 1G21B 4L6CA 2EKQA 4K6KA 4LWPA 5LQDA 1ENPA 1QC5B 1R3DA 2GFIA 3PKIA 1G4AE 3M4YA 2HRCA 4B6EA 3DVRX 4PAGA 4CI9A 3OQOA 5MF6A 5FULA 5T3YA 1KIFA 1AK1A 5EG5A 5HZGA 4Q5IA 4XCQA 4LRSB 1JU9A 3DHVA 3O3OB 4PSKA 1C7FA 1DJPA 5EXDA 2PX5A 4KG7A 1WHSB 2XKKA 1EXWA 2ZR0A 4FS3A 3BL8A 1A9XA 4TYMA 4JLVA 3L6CA 1OXBB 5LA6F 4DM4A 2YUTA 3BRWD 1E9EA 5CDFA 4DA4A 3PCRB 1DC7A 2FX3A 4P7BA 5ILQA 2HOQA 1DBQA 2BEUA 3MSCA 4JB8A 4RWEA 2DUWA 1XQYA 3BIJA 3QBJA 5DM60 3PE6A 5ALVA 5IKMA 3PEYA 3H97A 4HAOA 4POAA 2Q2WA 3LHDA 1C7IA 2V6JA 1B41A 3NPAA 3C4QA 4DJFC 4HH0A 4DQKA 4WKGA 1GUBA 4R81A 3GEGA 2XMRA 3DMNA 3HWX1 3Q6IA 4H4DA 1FSZA 1G19A 1FFSA 2JGJA 3F4KA 3TRIA 1HT3A 1Z8FA 3NBAA 4NPAA 4J0EA 3RS9A 4RH1A 4A82A 1BQ4A 3BHIA 1NVVQ 3VJMA 1NXTA 3ZEIA 2GLUA 1IPEA 4CM9D 5A3RA 4Y67A 3WIOA 1QXSA 1GPLA 1Y37A 3C5CA 4NJMB 3SIRA 4DNOA 4CM8A 5KU1A 2IH5A 2I99A 3T0FA 2ONCA 3BHJA 3SPXA 1P2GA 4FGZA 3W5JA 2DY1A 4DLLA 4BGDA 3UXYA 1OC2A 1XD2A 5DRTA 2PVSA 1PRYA 4HMOA 2JFYA 2GM3A 5TQ0B 3MQ2A 1A9TA 3RC1A 3RUIA 1F60A 2H3EA 1WLYA 5ESRA 1RLUA 3BTOA 3GLKA 1E0KA 3VHXB 3VX4A 4CE6A 1UMCA 2RD2A 1NF2A 2JKVA 2WJZB 2X77A 4NOMA 3K0HA 1G20E 1MC8A 3DBHA 4M89A 2QMYA 1O97D 4IJ6A 3GJ4A 3VOSA 2LZ0A 4RKQA 4MV5A 1ZA2A 1SU6A 4AF7A 4P2GA 5AW2A 3LCCA 3ZWBA 1VCNA 5ALIA 3MMSA 3EIFA 3HCEA 4CDNA 5CX1A 5L7WA 1A88A 4II3A 5JNLA 1X1TA 3AOEC 3M4XA 1FDSA 4B44A 2M98A 1Z7EA 2NTYC 3GH1A 4U7FA 1H6AA 1UQRA 1DQRA 1E98A 1A50B 4AZSA 1R4NA 2DULA 4FEYA 2ZSAA 2C4UA 4UEJA 4HWTA 1Q7BA 4GWLA 3F49S 3JX9A 1Z36A 4LE2A 4KH0A 1ZSNA 3ZH9B 4B5KA 4J1QA 1U0EA 1HRKA 2AN5A 3ZW7A 2KE5A 3MQ4A 4CCYB 4D3XA 1BX1A 1KDPA 1LUAA 3CMCO 1IWBB 4M8NE 2XNKA 1U11A 5DASA 3PQ3A 1ZK1A 5FWXB 4BVLA 5JAZA 4Q12A 4TGLA 2OP1A 3UFBA 3TLYA 4X90A 4U7DA 4YJKA 3TPZA 4A6DA 5TQVA 1ESZA 4MR9A 1C8KA 4MVJG 3DTVB 4MQMA 4C30A 1SHZA 1ZRMA 2VJOA 3ROXA 5ALSA 1SK8A 1XZFA 3KOXA 4EHIA 3OA2A 3T9FA 3HABA 3C6ZA 3DR3A 3DUFB 4Z54A 4V0NA 1MX9A 5DNEA 5IASA 2GGSA 5C5CA 2PBLA 3QVXA 1JDPA 3WQHA 3DKVA 5L3RA 5E3IA 1Y3AA 1T24A 1MT3A 2Y6UA 3D6VA 3Q4GA 4RDHA 3UMJA 5B57C 4MA0A 2IKSA 1GQ2A 1N5MA 4QYTA 2P11A 3TLGA 5FI1B 1E3JA 2DSNA 3C3PA 4P0TA 5BWMA 3KUUA 2FB9A 5KQRA 1OBCA 1ONOA 3N2ZB 1S2GA 4H1TA 3H0CA 2VTVA 5KNCD 2MIIA 1U1FA 4KR0A 2W0SA 4TTSA 4Z53A 1XL0A 4KQMA 1V39A 3JZMA 1MOPA 1QYIA 4IWNA 1DXHA 2E87A 3KLBA 5FLXA 5AW3A 2I55A 1XAHA 1W9MA 4JT2A 2HHJA 4PTZA 3ZBQA 5GINE 4M0LA 5CLIA 4JC4A 1K68A 1Z4QA 2JARA 3EYWA 3BWMA 4QYIA 3L43A 5DGCA 4I3GA 4G0VA 4Z9FA 1H2EA 2N9UA 4X71A 4YRQA 3SKXA 3USES 2D06A 2QJTA 3VDRA 1V9LA 1TAGA 1ZM4A 3A6GA 2BCGY 4YUYA 1VYTA 3CC8A 3TCNA 2I1QA 3NOQA 1WD5A 3GLGE 4IH9A 1JDUA 1GGHA 4O1MA 3UT6A 3JAWA 2B4KA 4HD8A 3H83A 3WKCA 1ECBA 5K8CA 3M6LA 4LCEA 3VSDA 4LY0A 1H2WA 2NQ8A 3LX5A 1M2EA 4PLWA 1U8YA 4XYBA 1W48A 2HU2A 2QTWB 3AL0C 5JTUA 3OM0A 2QT1A 3MILA 1GPH1 1D2GA 2FEPA 1C9KA 4HXYA 4LCJA 3HFRA 5IP5A 5E4JA 2C7GA 1A5TA 1S3GA 1NQWA 1DOZA 4OXNA 2GILA 2NG1A 3JQQA 5KREA 5D5QA 3LCRA 4CZ2A 1ONPA 2J5QA 4IXNA 1H4TA 1MABB 2FQXA 2PDAA 3T5AA 5KNDH 5KZMB 2P90A 2CC2A 2GFQA 4MARA 2OG2A 1ZH4A 4LVUA 3QMWA 1NVDA 4EL0A 1AS3A 1DIRA 3I8XA 4OGKA 4EF4A 2J3IA 3OBBA 1NFFA 2A1TS 1KBZA 1T9BA 2W2OA 3LNCA 3ND9A 4NYIQ 2PANA 1CDEA 3IHWA 1C9YA 2FWAA 3HBJA 3X2FA 1Z7WA 2I33A 2I3DA 2W2KB 3G23A 3KZVA 4G5QA 5HE8A 3RS0A 3CT6A 5DNDA 1PUIA 2N0SA 2R7NA 1PR4A 3LX8A 3RFXA 3UWDA 2Q7OE 1C9MA 1TA4A 3RNLA 2RE8A 1OX4B 3C3XA 3IULA 4JWTA 1BVHA 2UXDB 2BY4A 5K8TA 2NSDA 3LZCA 5M3BA 3TZEA 4ZDIA 3HXQA 3MJRA 3ZD7A 3SDBA 1VSUA 1OAOC 3TNYA 2OV4A 3GJSA 2FUCA 1MR3F 2UVPA 5AK0A 2IYSA 3RFFA 2XVMA 2AGVA 4MKFA 4GKJB 2A5YB 1Z47A 3OPVA 4UDNA 5FNZA 9LDTA 2KMLA 5JDIA 5JMPA 3QOYA 2AN4A 4LTNA 3TTSA 2HQ1A 2IHYA 1JKIA 1HDZA 1MO5A 3IEPA 2B4RO 3G88A 4MVXA 4BLQA 4DG5A 1PGJA 3S68A 3QEJA 1GT6A 1JDBC 5FTJA 3BHMA 5IKPA 1L5RA 3E3OA 2ORWA 1FC0A 3CX3A 1E1NA 3HN6A 4H35A 2J3JA 4EKIA 5KQLA 5KYTA 5HVNA 2D1QA 4BFCA 1MGOA 1LF5A 1VCHA 3UQYS 2EKBA 4BVKA 1UADA 2QUHA 1JFVA 4RPLA 1NUTA 1Y7PA 2BEVB 4MCAA 2UXCB 3H1FA 4C3VA 1GDDA 4Q4JB 4IV0A 4UAGA 5LP6C 3L6EA 3PFCA 3OTHA 4RTQA 4CDGA 3R7WB 3HXTA 3ZZUA 2LD4A 1E7SA 4GKVA 3D7MA 4QOSA 2AD1A 1FFXB 4EI9A 2VYVD 4E5KA 5LXTA 4ZYXA 4UVDA 1R88A 3FPHA 1BKSB 1R0YA 5KAMA 2I22A 4KVGA 2HREA 3O1IC 4NDAA 221PA 3AKDA 2VEOA 1FPQA 1N2CE 1BS1A 4PF1A 3I45A 4IUYA 2Q9BA 4L57A 5DULA 5KYXB 4CEHA 3BCRA 1TCVA 1DEXA 2BBSA 3WAGA 1M8PA 1N6LA 4RHYA 5BURA 4YQYA 1JYFA 1AQLA 1N2EA 3FTQA 1K5PA 5B4UA 3MJTA 4GZLA 2Z04A 3H87A 4LRUA 4QL3A 4MIOA 4HXGA 4KE7A 4PX9A 5ECYA 3RABA 4DS3A 1QG6A 2A14A 1I1HA 1P0QA 1Z13A 1E6MA 4RLFA 3PX7A 4M99A 1VI2A 3CR7A 3FFWA 3CLTC 1U7HA 4BC0A 4LJAA 2HHLA 4MPDA 3RT9A 1A76A 4GPTA 4UBNA 2AD5A 4LMPA 4R98A 5HIMA 1B2LA 3DE4X 1NM5A 2YQ5A 4YJDA 4PCLA 1AG9A 2DBVO 4TSKA 3WLPA 4O5AA 5IXSA 1SO8A 1VMIA 4FHCA 5HDBB 3KFVA 5BQ3A 4N39A 1W5BA 3FE2A 3UUFA 2OHXA 1RXSA 4EYEA 3KEQA 3UGJA 1QK3A 1VE3A 2XWPA 4MR9B 1OAAA 3I6MA 4DBZA 2IYRA 2V1XA 2V3CC 4HB0A 1T4CB 4CKCB 2AE2A 3AUSA 3QVGB 1QAMA 2OBXA 2H48A 3I58A 1ORDA 5DHSA 3TF5A 3H9GA 3IDFA 1R6DA 3KLOA 3H16A 3K0CC 1PD0A 2ZE5A 2PH1A 2P6MA 3FKSD 3I9MA 2GETA 2X5KO 3DL4A 4KGZA 4MLDA 4K46A 4ER7A 5F7XA 3AERB 2YOFA 4AUKA 1E1RD 1L4MA 2AK3A 1X1RA 2VTEA 3AWDA 3PPIA 4QPZA 3PHJA 5F2NA 1IVYA 3RRBA 3K32A 4IAOA 4U2GA 5E4TA 2I91A 3VNVA 1KK3A 2VUIB 4HB2A 3EVEA 5ENVA 4KR9A 2ZJAA 5CVTA 2ECOA 3HKEB 4Z4EA 1PUJA 1EX7A 3C15C 3I28A 3ROQA 1E8NA 1JEDA 1RAGA 1RPAA 2AUNA 3WOVA 5E6UA 2Z5FA 3FMIA 4TUYA 1THMA 1FXWF 1CUBA 3PPXA 4ZQHA 3BYZA 1D8AA 1T29A 2C4VA 4A6XA 4DCMA 1GPMA 1X1BA 3SJAA 4AB1A 1SCKA 4C7MA 2Q7XA 2ZGVA 4UNQA 3GHYA 2YQ4A 4E5UA 5ENZA 2BR3A 2H7VA 2HMVA 3M6UA 2DWCA 5K0SA 3V2UA 1Z0AA 1KDRA 3TLEA 4L4RA 3CO5A 5LR6A 2YZ7A 2UYGA 4FHDA 4YRZA 2DWOA 3EZ7A 3RYHA 2NO0A 1I3LA 4CLOA 2EJCA 2BGJA 2GK4A 3QI2A 5DBGA 2CLFB 5FBWB 4WKPA 4DQLA 3GUVA 2C3OA 1W73A 2B8TA 4UBJA 3C16C 5TGZA 3PRHA 1Q2XA 4LYFA 5CLGA 2VK8A 3HSYA 2HW8A 1BOOA 2CDAA 3M81A 1LLFA 4Y6LA 4N47A 1J33A 1JBQA 4Z51A 4FFRA 1UKVY 3OCJA 2GBCA 1ZAYA 2YYZA 1RHMA 2NYAA 4DRXB 721PA 1ADGA 1Z7YA 4Q9JA 2RGCA 2I8CA 1VJ0A 3INTA 4JODA 4QDKA 5IKXA 1X92A 2O20A 3CGGA 2QJOA 2AF3C 5B7NA 5D84A 2K6GA 5EVCA 2H9AA 2Z0MA 2XHEA 1I4WA 3M5DA 1AY0A 1SIOA 3P26A 3EYAA 4S12A 4A2PA 4F9EA 2X9LA 3E9EA 1E4OA 2ONKA 2RGBA 4ZCSA 1KGSA 3GPCA 4MP6A 5KOHA 2ZSJA 1H4SA 1SXIA 1X86B 3B36A 1ZJJA 3FUTA 3EXFA 1GFIA 3TRFA 1X7HA 4IX1A 3LWZA 5JZVA 2XTMA 2Y0PA 4QLAA 5HA5A 2JRCA 1FZTA 4MWEA 1F48A 5L3QA 4KXFB 4ND1A 5HYVA 5IWCA 3Q3GE 1YUBA 3DLTA 1UJCA 1ZMBA 3B70A 3GCXA 4RMGA 1PJRA 2WAXA 2WF6A 4N5LA 2O8BB 5JANA 5CFOA 1G1AA 1CY8A 2P2SA 1DIAA 1IZ7A 3K0SA 2A2ZA 2VH1A 2VHQA 3A2MA 3D3WA 4Q9DA 3UUEA 2QMZA 4I4CA 1MRZA 4TMWA 3TUZC 3BXHA 3VHQA 4V2IA 3STXA 4I7EA 1ZGHA 3EZGA 4HWSA 4C1NA 4BE9A 1IUNA 4TVOA 3ESQA 3LU1A 3OLQA 5AI4A 1W36D 4NCBA 4R9NA 3SIPA 5JBIA 1X42A 1FNCA 5IDXA 1N2SA 4GVPA 1EBFA 4DKXA 4LXYA 5AJWA 5LVAA 4IIXA 5BVGB 1CQWA 1P1BA 4UE2A 1G38A 4A03A 1TW2A 3KXKA 1OGIA 3AYZB 4TRRA 5T3UA 1F7UA 2IYWA 3P97A 1ZO8A 1XWFA 1J8MF 1U28C 2WSIA 2ZB3A 1XCLA 3BMCB 4L22A 4XJVA 1KVTA 4BMZA 5CLJA 1QVWA 3E2PA 1T1RA 5IJ0A 1NZFA 2BFEA 4JP2A 4D44A 2QB5A 2XNCA 2KLBA 3EF1A 1E2MA 4GH5A 1M66A 2P8JA 4RPGA 2DQSA 1LNQA 1ZKDA 5L6LB 2PR2A 3EIXA 1UBUS 1GCOA 2P40A 3FKSA 1LPNA 4R2KA 4YJFB 4JU8A 5F9FA 1J5EB 3DO5A 5DGIA 1U0OC 4LQCA 1WUHS 2PRSA 1NC3A 5E6RA 3W77A 1VL2A 4PGFA 1U04A 5JR3A 5DX0A 1YTLA 4CU2A 3GNLA 3T38A 3OFSA 2NU8A 1XMVA 2R3SA 4JSYA 3IBFA 4U00A 2IX3A 2HLPA 1RWPA 1Z56C 4W4TA 1TEXA 1ODSA 5F2EA 4WLUA 1GLGA 4CM7A 2COUA 3OAAD 1GADO 2NAFA 3E35A 5JNUA 1PW5A 2P9EA 3Q5GA 2VPTA 3K5WA 2BUAA 4WOCA 3DVAB 3OA0A 4BFUA 3IOBA 4JBYA 1Y1KE 3AOEA 2DJ5A 2UZ3A 4WDQA 5JCJD 3WSWA 3AY0A 3TD9A 1ADYA 4S05A 3MQFA 1UEXC 2QKYA 1D4AA 1BHSA 3FDFA 4ZTZB 3QELB 4AQ7A 1WO8A 1HTBA 1I4DD 2J48A 2RGGA 2XGGA 3B1WA 5EPOA 2C9YA 1GSHA 3O1LA 3L49A 3KQHA 1V37A 2NSLA 1P80A 4TQAA 1WZIA 1FJXA 4KQ6A 1DXQA 4JB3A 4TV9F 4NS4A 1T8TA 2I6GA 2JAWA 5EY5B 4WFJA 1N0VC 4BASA 4Q4AA 3EF3A 1L7MA 3Q5DA 3KPWA 4I46A 4KLAA 1OFIA 1SHKA 1QQ6A 1PT6A 1LX6A 1YNSA 4Y1FA 3LC0A 4PO1A 3TD2A 2OXTA 2A4MA 4UM9D 1NAIA 1ZBDA 4UU7A 3RI3A 4CF6A 3CUYA 4Q9IA 3U7HB 1P77A 1ZOOA 3OZEA 3HUDA 3QU5A 1LDMA 3O8QB 3N3BC 1GQQA 4LNUB 3CLRD 1T5BA 4RZHA 1V4VA 2G17A 1JG4A 1O94A 2P1DA 3D4OA 1WXHA 4M0MA 3LLSA 1M6WA 4MS4B 3KUXA 3PT9A 1ZOSA 1JG3A 1JEJA 4GZ5A 3TLZA 2R96A 4IGEA 5IANA 3QE0A 4DCUA 4XZ3A 1BHO1 2WFAA 1FP4A 1HG1A 1TUGA 3EQ7A 2GUGA 3M1YA 4WFQA 2P35A 2PUTA 2X9GA 5FBLB 1GGEA 4W6ZA 3RVBA 2ZE6A 5E0OA 2VS1A 4O2AF 3JWHA 3SEZA 5KUTA 1Z75A 2EJBA 3NT5A 1W34A 3W5VA 3AC0A 3EGIA 3DEAA 1J0DA 1CFZA 1N7HA 4FYXA 2PEZA 3B1XA 3RC7A 3VXKA 3AJAA 3VZCA 1Y8RA 2GBGA 4F4UA 2PX0A 2Q5LA 3BRSA 4PZZA 2V4MA 2Y1EA 4BMVA 2EF1A 2GCNA 4QRDA 5BYKA 1Y9ZA 3FYSA 3DL0A 1DWOA 5CH8A 4EUSA 1QFXA 3HBLA 3ZZ0A 1CUFA 3TNDA 2GO1A 3PZBA 1YS6A 4GF5A 4B2YA 1P0FA 3G1UA 2BTQA 3TGLA 2LTAA 1ZW6A 1OCEA 3IR7A 4AKSA 1E62A 2XECA 2WTEA 4GKBA 3MUEA 4JVNA 3HA3A 4LMAA 4OPMA 3W8DA 4HS4A 2FUNB 2V98A 1MABA 1KL7A 3FTFA 1QVAA 2ATVA 2XQKA 3HCPA 1CZOA 3BWCA 3HBAA 1EBUA 2FFRA 3LQFA 1Q57A 5TMDA 5JSKA 3SDSA 4AKEA 1FMFA 3S2UA 1D2AA 2EFJA 4AZTA 3I9OA 4DIEA 1PT5A 2A9KA 4PCAA 4R1MA 3UJ9A 3FRHA 3OJXA 2YVUA 5B3AA 4C5CA 4DPKA 4QLBA 1EXNA 1N1DA 1QIIA 4LX0A 2PR7A 2UUAB 3EX7C 2C3PA 1IY0A 1FUEA 3VV2A 3LF2A 1RDFA 2HCFA 2ZTUA 5KOYA 5JSYA 2C59A 2Q4TA 3U60B 4UHDA 5ES3A 4DRXA 2HL6A 2OM2A 3V9AA 5B7GA 4YRLA 5IABA 1BYIA 1SD5A 1U90A 4Q47A 1FQOA 2JGIA 2F00A 4XYEA 3L0DA 1EFRA 5JNTA 1NOJA 1U7DA 3FUCA 3AEUA 3KJZA 3T9DA 1DOAA 4HTAA 4C6TA 2J30A 3OLXA 1K7XB 4LGCA 2PT6A 1PKEA 5IJZA 4KU4A 1AD2A 3OY7A 1YZ3A 1KKMA 3RUDA 3EGCA 4DNPA 5C1DA 1JG1A 1FQKA 1GVNB 3JY6A 3KZMA 1YI8A 1KZGB 4S2UA 2CNWA 3ICVA 3R74A 4DUYB 2H07A 4KQCA 3N70A 4OJNA 4RV5A 2WB2A 4GI7A 1GDTA 4Q3LA 4Y2UA 1RHJA 3L0PA 3WLNA 1H65A 2OECA 1UKBA 3RRZA 2XD4A 3VI3B 5C1BA 1AZTA 3MLEA 4MHOA 5BN5B 1LDNA 2CGEA 3A6ZA 3GRVA 3O4VA 5GM1A 3KRTA 1HBJA 3ZE9A 4R9UC 2G1KA 3HNPA 4FDMA 1JZSA 1LRKA 2GBLC 1F8XA 4O1IA 4YP6A 3OJCA 1GPWB 2BTOA 1CE8A 1OW3B 2GPAA 3N1UA 4NPHA 3BOSA 2A3RA 4LXQA 3VTAA 4IIGA 5KVCA 1GPUA 5DOZA 1Z0SA 5G4KA 1HQDA 2I71A 2PMEA 3UB4A 4CMEA 3T1TA 2WINI 4OFBA 2E82A 4ER0A 1WU8A 3HCCA 2GD0A 4TMKA 1N2XA 3QVOA 1VB3A 2AMFA 1VIDA 3NP7A 5KNDA 3CR8A 1VXRA 2CFSA 1DKLA 1RS0A 1JR3E 3A2LA 4NONA 3MT8A 3ANXA 1T9GS 3RFVA 1Q22A 3KBBA 4J2OA 5JHHB 2OQIA 3ZJYA 4CMBA 1J2RA 3KG2A 2D2VA 4UAVA 3H2IA 4E70A 5A6SA 3UQZA 4EA9A 5C8VA 2R5NA 4RC9A 3U6BA 1P17A 4GPBA 2AXNA 2BDEA 1ZGAA 2OCYC 1MZVA 3DDOA 3DEJA 3NBZC 3ZHOA 1AXRA 4E31A 1C8BA 1KXZA 1LFDB 5ALGA 5AI0A 5J1SB 3QEMB 4UZEA 3NT4A 3PDWA 1J2YA 4A10A 2X3YA 5BR7A 4MO9A 3OPYI 2PX3A 4Z4GA 2CXUA 1V4NA 1GLVA 2I2FA 3EGEA 2X7JA 4N8SA 5KTYA 1S8OA 4RTRA 4OI0A 4YA6A 5HUJA 3KKMA 1D6MA 1L7AA 4OB6A 2AA3A 4JI6B 2QW1A 3UMRA 3VKWA 4EUNA 1USUA 4RSGA 4JGBA 4KFTA 1HMPA 3H18A 3W04A 1K8XB 1VOTA 1P4JA 4BZWA 4KPGA 3PP8A 1AXEA 2YWFA 4MQBA 1J5PA 1EFHA 3U4MA 3EGDA 1PZGA 3QZUA 4U7PB 2IE8A 2C54A 1RW4A 1ZBQA 2HMSA 2I6TA 3LO8A 3QA3E 4KO2S 1JIUA 1VL0A 3H1GA 2HA3A 3AGPA 2P3SA 4OMFG 1EFVA 4BO9A 1V6AA 4S1TA 3NUQA 4QJ3A 5AK5A 5CXSA 2MJLA 5AKGA 3UYLA 1APBA 3A4IA 2EQ5A 3P27A 1CY1A 4RNCA 4E08A 4HDMA 2GS9A 5EL0A 1V7ZA 3NIBA 3R23A 3WE7A 2BFDA 2QP9X 1ZW1A 5A9TA 2RFLA 4NBTA 4IQ4A 5IT9A 1F12A 4ETWA 3KWFA 5T7BA 4A8JA 3VPFA 3L05A 2FH5B 2FN7A 4FR5A 1NBOA 4NBRA 5I01A 1JR4A 3GLUA 4KAAA 1D3AA 4M60A 2ZT8A 3OTGA 2A5JA 4WOBA 2HMTA 3NJ4A 1RMYA 2OO5A 3VR3A 1HR0B 1NJ1A 1NQOA 1UT6A 4IVQA 2VHEA 3VPCA 2JATA 2R6R1 1W2HA 1N2HA 2H08A 4FGLA 2ZUUA 4D8WA 1DP4A 2A86A 5EKDA 3GB9A 3IR5A 4OU5A 3RU3A 5ED4A 2R1TA 3OU2A 4LYDA 1FP6A 1OWOA 1BCRA 1W46A 4X54A 4N7JA 3SDZA 3DO6A 2BAGA 4FLMA 3IHKA 4FB4A 5JRZA 1V8ZA 3V48A 1BWSA 3B48A 3PRKE 4US2R 4R68A 1E96A 2QMEA 4R6XA 1MDBA 3F98A 1JB1A 4DIBA 2SICE 3L0YA 4OGLA 5LD2B 3GFRA 1T4GA 3FLAA 3RIEA 3MELA 1DAHA 1JHOA 1XQVA 2YY6A 3V4OA 5B12A 2D2IA 4WL0A 3DZKA 1GCGA 4E6PA 1Z7GA 4B33A 4IGIA 5AKYA 3QSYA 4OHKA 2Y99A 1OBHA 4Q4DA 4TVKA 4OHOA 1C7JA 4NPCA 3E7PA 5CFMA 2OCPA 9ABPA 4XE5A 2X58A 4GZ6A 4OHCA 3ZTTA 1N6IA 5AVQA 4RDIA 3LTEA 2GBIA 4QSHA 2WVHA 4YCMA 2C95A 2VBCA 1T0JB 1UC5B 2XB9A 1K6EA 2Q9CA 3IP8A 1A2BA 3OIFA 5CA1F 1SXJD 3QF4A 2G08A 2P5YA 3V1TC 2OV6A 1Q3TA 2GASA 3O1JC 5JATA 1YDGA 3BTSA 1N2JA 1Y42X 2BJWA 2FY8A 3NEAA 2V9PA 1W47A 5ALZA 4Z49A 2NU7A 2W6QA 3OHPA 2IIBA 2V6MA 4WADA 3GRKA 5ALFA 2OHGA 4UHJA 2TSYB 5F5NA 3TQIA 5LU9A 3N7AA 5BXQC 4B81A 1KY5A 4PZAA 2RGYA 1Q84A 1BA2A 1IIBA 2SCUB 2HJRA 2XMDA 3C3DA 4KNVA 4BTLA 4EB6B 1PSDA 4Y30A 4DNFA 1NLFA 3FFXA 4GGOA 4KO1S 1GYQA 1YJQA 3S40A 5ITZB 5KX5A 1WUIS 3BX1A 4ER5A 4IIVA 1P0IA 2P9QA 3S7ZA 3ONWA 2IYEA 4OFWA 4B6JA 3B78A 4O6VA 3VPXA 4KMOA 4YT5A 2YQZA 4E07A 1AN9A 4KVFA 2OMKA 4WA7A 4RJLA 1DRJA 3CXUA 4NMLA 1QPZA 7GPBA 1HNXB 1VQ1A 3LC1O 1U0NA 4DIDA 1OHHD 1AGRA 2EFDB 4KZPA 1VTKA 4UDOA 5DU2A 1DELA 3OIVA 4O5OA 4C6TB 1W36C 4CKZA 2O2XA 4YJHA 4QDZA 1RAFA 1RCFA 4LFAB 4JWKA 3KTAB 1HKUA 2DWUA 1K98A 3P4YA 3QOXA 2V6GA 2BSQA 4M0UA 3I2YX 4D4GA 4R8MA 4FE3A 4IJMA 4ZGBA 1MRNA 1P4RA 1GNSA 3UWPA 3VU0A 4BNXA 4YJ3A 1SCUA 5CVVA 3SZ3A 1T5LA 2DPGA 3AIMA 3SQXA 1PG2A 4OYYA 1I2AA 1TKCA 4WNCA 2EX4A 3WWCA 2GCGA 4S3MA 4YAUA 5JY6A 4L4ZA 1K4MA 4MUIA 1TB4A 2WWIA 1QRSA 1EP1B 3P45A 1ZH6A 4DLWA 3DZCA 4RMHA 1NVVR 4B4UA 3FPAA 3LUKA 3PBKA 3JAKB 1RQXA 3L7DA 4R1QA 3AIKA 4DA6A 1HDCA 1I4OA 2J3HA 1C2TA 1Q1AA 5EJ8A 2O52A 1CTQA 4YALA 1Z4KA 4PZUA 4OOEA 1P3Y1 2XKBA 3G2IA 4M9XA 4MQFA 4RF3A 1I32A 4HMQA 4P5EA 1GZ7A 2OQVA 4N0PA 3FZEA 1U7OA 1GZ4A 2CF5A 1EFCA 2AG8A 5KTRA 1S01A 2C57A 1ZLYA 3QUAA 2X19A 4QIHA 4S1NA 4AXXA 4ZPXA 2JI4A 5KSZA 4ZTBA 4YCDA 4R01A 1C14A 4UOZA 4GX2A 3HPQA 4WBNA 2C0QA 1L5YA 1KBOA 2HJGA 3M3HA 4U2CA 5AKJA 3WL7A 3CE9A 3IELA 1K3FA 4WZZA 3W34A 3S2ZA 3M34A 1PK9A 4E1BA 2UYCA 2C2OA 1R0SA 1T91A 3F8WA 4YP0A 5TVKA 4U6NA 2AWNA 1EB8A 2IODA 3QVSA 1UBKS 1Z6TA 3LUAA 1R8SA 5DI9A 3LDGA 1Z88A 1A27A 2FFAA 4X8MA 5JIBA 3B5JA 5ICGA 2IU3A 1Q1ZA 4EKEA 1UBEA 3K7EA 2J33A 5ABPA 1SWWA 5FBQB 1W94A 3TL2A 3UANA 3KQKA 2H7XA 2JFBA 3V7UA 1UZLA 3SWWA 1GL7A 4WLNA 1K9SA 4S0ZA 3CJRA 2OT3B 4QPDA 2IK8A 1KOGA 1VCMA 2H4FA 2Q28A 3P0FA 2RIPA 2YXEA 2BIFA 3WVNA 2AMJA 3KUDA 3N2IA 1NN0A 2BFOA 3FDZB 4HGRA 5CMLA 5JADA 4HDMB 4OV6B 3X1JA 2AV6A 2X0IA 3IV6A 5JDCC 2JH3A 4EY6A 4QYWA 3ROMA 4FOTA 4TV8A 5JVDA 2MSKA 1N0HA 4RIGA 4FSXA 1I24A 4P4LA 3CW8X 1P9NA 4D2IA 3C1AA 1RPZA 3Q7EA 4OQLA 3CRMA 3T0IA 1BMFA 2VNKA 2VSFA 1S7GA 2IWRA 5DLPA 2QRPA 3C6XA 4BNDA 4OL0A 4C0XA 1LQ2A 2IHBA 3LY8A 4L51A 1LPOA 2OBYA 1KZ1A 4PC7A 2G9NA 4CV3A 1RQ7A 1FU7A 1USWA 4FYJA 5C32A 2I4TA 3RADC 2P6NA 4Y9TA 3B82A 3JYOA 2AC7A 3LC2O 1R8QA 1YZLA 3M70A 2G83A 2PZKA 1ZH0A 3ZE6A 2P8SA 2MOKA 5I7EA 4CM4A 4NSNA 4E21A 1QQ5A 1C29B 3QFCA 1I0LA 1Q83A 3BVPA 3RE1A 1DEKA 1J2EA 3JQAD 4HAUA 4CHGA 1U7XA 4N6OA 1E1MA 1T9GR 1ZQ9A 4O2LA 4N0EA 4BWVA 2NMVA 4DIKA 2JNWA 1WWKA 1ST2A 3M5WA 3NHMA 4L27A 5D00A 4HNUA 3OU7A 3K1TA 4WXMA 3F2IA 4IKEA 1VBFA 4P1ZA 1QS0B 4QELA 2CVHA 5EJAA 4B31A 1V5GA 1EDBA 1PHPA 3Q87B 4MXDA 4ASUA 1NSTA 2D74A 4JB0A 4CMGA 1KC1A 3AVPA 3F5DA 5FXMA 5KQSA 5G02A 1P31A 1EX9A 2PHZA 3SMVA 5KNLA 3WJ7A 1CX9B 1MBZA 2FVXA 1CUVA 4PN7A 3Q1KA 3HDJA 5AKLA 2IXFA 1C4XA 2XYVA 1Z08A 2CY0A 1TTTA 5DBFA 1UBRS 2EEZA 2PXHA 2NV6A 2WKSA 4RW0A 4TTJA 2R79A 2VNIA 3QU2A 3C5EA 5A2QA 3DBLA 4QXAA 1RVV1 3ND7A 2JD2A 2XWQA 5HBRA 4UEOA 3ILHA 1HKHA 1IHDA 1RXIA 1B6GA 1SOAA 1FDVA 1U2SA 3CJTA 1X8LA 3DFKA 5AI8A 4F7WA 2E4XA 4GPAA 1EHCA 5I9LA 1XSEA 3MTQA 1W36B 2UZ1B 3KB2A 2NU7B 1OC4A 2B78A 4GMFA 2VHYA 4JLDA 4JP3A 3EISA 1SCBA 2B30A 2HSZA 1JQ3A 1QHXA 4ESHA 4NFYA 1XJ5A 3HCRA 3A9VA 4G1MB 1PK7A 2BP7B 2GJ8A 5GPBA 4IZIA 5HIIA 1L1QA 2G36A 2FQWA 3QE3A 2HA7A 3CZPA 2PUWA 1H85A 2J45A 1EGAA 1JF8A 5AJVB 5CX1B 3T5CA 3INYA 4CIDA 1IG3A 1XMIA 1FXSA 2W2KA 5G4KB 4DQ0A 2TMYA 3IP5A 4YWJA 2A59A 1V45E 5CVUA 1Q7GA 1H4QA 2JIBA 4BNWA 4FYIA 1H2AS 3X43A 1N2CA 1Y63A 1GWNA 3HUEA 1JUDA 4M7PA