3QPDA

Structure of aspergillus oryzae cutinase expressed in pichia pastoris, crystallized in the presence of paraoxon
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
187
structure length
186
Chain Sequence
LTGGDELRDGPCKPITFIFARASTEPGLLGISTGPAVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIAEAQGLFEQAVSKCPDTQIVAGGYQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQERGQIANFPKDKVKVYCAVGDLVCLGTLIVAPPHFSYLSDTGDASDFLLSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords Cutinase 1
total genus 68
structure length 186
sequence length 187
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qpdA00
2VJDA 1CR6A 3LCRA 5K3BA 3G0DA 4FNMA 1DTEA 3K2IA 3L1HA 1AMNA 3G9UA 1F0PA 1ZI9A 2PPLA 4Q3KA 3AZOA 1HLGA 1JT2A 1FFBA 4AN1A 4FLEA 3R3WA 5ALQA 3F96A 5D3ZA 1P0IA 5BV7A 4H7IA 3PE6A 4XIIA 1IZ7A 4E11A 2HRQA 4X92A 1R4ZA 3DJYA 1U65A 1VJ5A 2O7RA 1U8EA 4ROTA 5JAPA 1CUAA 5J3JA 3JWEA 2BAGA 1BRTA 4V2IA 3V9AA 3ZPXA 1ACLA 4EY7A 2WM2A 1QLWA 3ANTA 1XFDA 5ALSA 3QZUA 3HRHA 5LZ9A 3WK7A 4UFPA 3FAKA 3C43A 1GZ7A 2FJ0A 3QPDA 1BCSA 4UFNA 1MJ5A 2VJBA 2BUBA 4W1RA 5HCUA 3V1LA 5CW2A 3WKBA 4DSAA 5JADA 4MXDA 2FUKA 1CUUA 4B84A 5JANA 3EQ7A 5AOCA 4BYMA 2XQJA 2ZSIA 4GWLA 4I4CA 3R3ZA 3I2IA 1MNQA 3ZLTA 2GYWA 4FBLA 1WB5A 5E2IA 4E46A 4UPDA 1YA4A 5LZ2A 3ESBA 1BEZA 1X2BA 1UXOA 3CN7A 4CIBA 5AIBA 4A23A 1CV2A 2BUAA 5JAHA 4FFWA 4QDUA 5T4EA 1ZI8A 1WHTA 4L9AA 1N5MA 2OQIA 2R11A 2EEPA 3UUFA 5DTIA 3NUZA 4H0CA 1L7RA 3F97A 1R88A 4B0PA 3F98A 4G1FA 1LPPA 3N2ZB 5AKLA 3M3DA 4EY4A 1QIIA 4Y2RA 4BTLA 4HS9A 5AKGA 1CUYA 1QFMA 3BL8A 5JZ9A 4G8CA 4X6YA 1ODCA 4J0JA 3DLTA 2C0PA 2P8SA 4G5XA 3H2HA 5AK3A 1MX1A 1UOPA 4Q82A 5DNWA 2WUGA 4GW3A 3PF8A 3STUA 1QIJA 4CG1A 1H2XA 3SWWA 4AB1A 2XB6A 1UT6A 3GBSA 3WA6A 5C7YA 5ALLA 2PKYX 3WIBA 5IKXA 5CXXA 1ZIXA 3OG9A 4IO0A 2O2IA 2H7YA 3D2BA 4LKOA 5K3AA 1FFCA 1DQZA 3ZLVA 5HF9A 2BJHA 2OAGA 2XUQA 2AJCA 3CXUA 3E3AA 5DJ5A 1ACJA 2QMQA 5E4JA 2B4KA 3AINA 4DLNA 1ISPA 4JYMA 4C87A 5IVKA 2JEZA 2YH2A 2ZYHA 1EK1A 3WQHA 2X5XA 3OOSA 4QLOA 3HEAA 3H17A 3H2KA 3O4HA 1H22A 3STTA 5FV4A 1HKHA 4UHFA 4FOLA 3DNMA 2V9ZA 4INZA 4BC0A 2AJBA 1H2WA 2HA0A 4S0XA 4GLBA 4W9RA 4X85A 3C6XA 1A8SA 1BN6A 4BAUA 3FCYA 4OSEA 4A5SA 4BRZA 3FYTA 4PF1A 1JJFA 2PM8A 2VJAA 4W1SA 3WK9A 1GQSA 1LZLA 2GYUA 2JGMA 4H7DA 4J0KA 4FTWA 2XMSA 1E66A 1EA5A 1YR2A 5CT4A 5JASA 3DOHA 1QFSA 2PL5A 5JATA 2Z5GA 3C70A 2WHPA 1UWCA 2XUAA 5KWJA 2WFLA 2ONCA 4QWMA 3G02A 1CRLA 1X2EA 1TCBA 2H7XA 3B3QA 3WL8A 4WCVA 4U2BA 2G5TA 1M33A 4WFKA 3AILA 1HDEA 4K6HA 2ACKA 5EGNA 4BZZA 1QE3A 5HF6A 4MJ3A 4CG3A 4IH9A 3ZLUA 1W1IA 4MWSA 4KRXA 2VJCA 2XE4A 3PF9A 3FLEA 3W9UA 4H7JA 1GKLA 4ZREA 1W6RA 5AI4A 1L7AA 1MU0A 4YX9A 5YASA 3F67A 3T4UA 4XWGA 4P93A 1IUNA 4U2EA 4QDTA 1YB7A 1XZAA 3L1IA 3O0DA 5D3KA 5BWCA 1QJ4A 3NOXA 3WL7A 2JGJA 4L72A 3AIOA 4N8EA 1R9NA 4HXGA 4N5IX 3OTQA 3IULA 1UZAA 3G0IA 1XQVA 3DQZA 1ORVA 1CUBA 2JGLA 4WY5A 2HM7A 4GHWA 1GPKA 3RK4A 2OPHA 1DWPA 5JD6A 4Z49A 2Y6UA 3C6YA 4QEKA 4KR0A 2VAVA 3CN9A 1C7JA 5AK5A 1XZIA 1UOQA 4BDSA 6YASA 4IQ4A 4KAAA 2HIHA 4WY8A 5A2GA 3PI6A 3DL4A 1XKTA 2DHEA 3TGLA 1XZGA 5IVDA 1ZIYA 4F60A 4BCBA 3HXKA 5F4ZA 4C6HA 4FBMA 1LBTA 2VT7A 4WFIA 5HZGA 1CIJA 3T52A 5A71A 3QMVA 3I2FA 3G9ZA 5FUMA 1U4NA 3PUIA 1A7UA 2VSQA 3ICVA 2B61A 5T4HA 4NS4A 1FFEA 2WTMA 2J3QA 3O4GA 4H7FA 5CBKA 3IUNA 2RHTA 4YK7A 1JI3A 1ZJ4A 4EB0A 5ALEA 5EIAA 4N8DA 1LPMA 1QIDA 5AKZA 3WMRA 4Y2XA 3H1AA 3WZLA 2HFJA 2UZ0A 1D07A 1UKBA 4KE6A 3FCXA 2CKMA 4KJXA 1QTIA 3D59A 1TKRA 2WLSA 1BROA 4K6KA 1GPNA 3F9CA 3AZPA 4B85A 2RI6A 3IB3A 3WKEA 2O2GA 3C8HA 3C5WP 3FSGA 2XMDA 3G7NA 1QIGA 2WIDA 2JF0A 3BJRA 4L3WA 5T4BA 4N8SA 3R0VA 1EVEA 5CT9A 5DTJA 5EI5A 2AJLI 4AN0A 2I78A 4F0JA 3CCBA 1T2NA 2XMQA 3DKRA 4FMPA 4J0HA 4EY5A 2PSDA 4QDZA 5JZBA 1VZ3A 1MO2A 1Y7IA 3MUOA 5JARA 5CMLA 4FWBA 3WK5A 5BOVA 1Q0RA 1SCQA 4C4YA 1ZJ5A 1W76A 2PX6A 5LIPA 4BCDA 2QJRA 2Q0XA 3TRDA 2ZJFA 4GECA 1NU6A 4EA6A 2C5GA 5FP0A 2X76A 2VT6A 3WKAA 4BZWA 1CUVA 2WTNA 5ALNA 2WG2A 4LXIA 4Y2UA 2XLCA 1QGED 2QTBA 3U1TA 1CUFA 1R50A 5EHNA 3HACA 3JW8A 1N5RA 4X6UA 4ZRDA 3QYJA 1EDEA 2Y2UA 5JD5A 3V48A 3WKDA 4AMZA 3H1BA 2BGNA 2R8BA 2WUDA 5JZSA 1Y37A 3GELA 1QIMA 4X90A 4RPCA 1EINA 1AUOA 2RONA 2VQ6A 4CIAA 5K5EA 1EH5A 4M0EA 1DWQA 4RE5A 1IVYA 2QUBA 5ALFA 4DMFA 2VATA 5HFAA 1PJAA 4HZGA 1Q83A 2WFMA 2G4LA 3GROA 1CUSA 2HA7A 3FWHA 1FFDA 4X97A 5CRIA 3C87A 5I9IA 4B80A 3E1GA 2OXEA 2GZRA 4BVLA 1TCCA 1K6EA 4ZXFA 3HC7A 4KE9A 3I28A 1XLUA 5ALMA 5ALTA 3HZOA 1NU8A 4Q05A 1B41A 5AHXA 3WLAA 2GBFA 4Y2SA 1XQXA 3D2AA 4AO7A 3QPAA 5AKXA 1CVLA 2CEKA 4EZIA 1GT6A 3C45A 4UHEA 3R3YA 5A7HA 2QR5A 3A70A 3QPCA 1LNSA 2JBWA 3H19A 4JH0A 4QLAA 4B6GA 5AM3A 1K63A 4J7AA 1VLQA 2DHCA 5JAUA 4E15A 2EDCA 1XQYA 1UKCA 2JGFA 1EI9A 1CUCA 3FYUC 3IUMA 1YA8A 2HA5A 4I19A 3U0VA 2VEOA 2VTVA 1N8SA 2WIGA 3I2KA 4MEAA 1DX6A 3WWDA 1XRLA 3EQ8A 2Y6VA 1X70A 4FHZA 1TRHA 4D9JA 4BB0A 3VDXA 4H18A 1VE7A 4BCCA 1EDDA 4X93A 4LXHA 2G63A 1CUXA 3G9TA 3HABA 3HI4A 3HYSA 2JGKA 3H18A 2XT0A 1BU8A 3BE8A 1J06A 5CT8A 1G4HA 5ALHA 2WIFA 5CH8A 4H7EA 3PFCA 2HU8A 4F5ZA 2J3DA 5CT5A 3C8DA 4CCWA 4PSDA 1BE0A 3R3XA 1CUIA 2C58A 4B7ZA 3RLIA 2C7BA 1GQRA 2PBLA 1GPLA 1E5TA 5ESRA 2Y2VA 4Y7DA 1QIKA 3W04A 3VJKA 3WL5A 5DNVA 5FLKA 1WPRA 1CUWA 1OCEA 2HA3A 3JYHA 5IVHA 2O2HA 2YASA 4GEGA 2EDAA 1S8OA 3GZJA 3BJMA 3B5EA 1YAHA 1QZ3A 4JNCA 3W2TA 3O95A 4E14A 5H3HA 2HU5A 3ED1A 3VXKA 1MAHA 3DYVA 5ALGA 4FNGA 1JU4A 3A2MA 3D3NA 2QVBA 3E4DA 5AM4A 4U2CA 3IBTA 1DT3A 1YCDA 5EIHA 3OPMA 4LXGA 2FJPA 3STYA 5ALJA 5CTAA 4DYHA 1XLVA 2WHQA 1K5PA 5JIBA 3K9BA 4ITVA 1ZICA 4YASA 1W52X 1O6FA 1CEXA 4OB6A 4ETWA 2ACEA 4CFSA 1DT5A 4U2DA 4MYSA 1F8UA 2XUDA 3D0KA 4Y2QA 3AUKA 4QA9A 4UBKA 1UK8A 2PSHA 1LGYA 1WB4A 4HAIA 4UBNA 4WDQA 3FVTA 4UFOA 5FRDA 5CH5A 3IIIA 1LPAB 2H7CA 4HVTA 3A2NA 2VF2A 3ICWA 2WHPB 1BCRA 5FOQA 3RM3A 5HK9A 3WA7A 5AP9A 2Z3ZA 5ALYA 4G8BA 3RARA 1IZ8A 1CUJA 5AKJA 1BEEA 1FSSA 3YASA 4P08A 3G0CA 4CCYB 4HTAA 4DMKA 1GGVA 1YS1X 5LZ8A 4BRSA 1ZOIA 3BDVA 1P0QA 1XKLA 5DWDA 2XI4A 1E3QA 1XRRA 2XUJA 1LZKA 1W4LA 5FPPA 4QZVA 1J07A 3BF8A 1FJ2A 4DNOA 4OB7A 4H7HA 2DHDA 4QNNA 1VA5A 3C6BA 2HA2A 1CLEA 1Q84A 3WKCA 2B9VA 4EHBA 5HKAA 4Y2YA 3DKKA 3KXPA 3NWOA 5HQ3B 1RYYA 5AK6A 4RNCA 4H35A 4J0GA 1TAHA 3AJAA 4BVJA 5AM5A 5CT6A 2OCIA 4BP9A 1JMKC 2QJWA 4OYLA 2Z8ZA 3GUUA 4DGQA 1MAAA 2OAEA 4JYPA 4MQMA 2XMBA 4AX4A 1YAJA 2J4FA 5EFZA 3DOIA 5C8ZA 2WU3A 2ZJ6A 4UHDA 3EQ9A 5JALA 1VKHA 2BUCA 2QKYA 4WJLA 3LLCA 2ROQA 3B12A 2E3JA 4BAGA 4CI9A 2XUGA 5A62A 3O9VA 5AH0A 4EBBA 1CPYA 5LKAA 5DYTA 1ODTC 4LYDA 3Q8WA 3L1JA 4TPKA 4KYVA 5ALDA 5KBYA 3WYDA 1F0NA 3BIWA 4UHHA 3KWJA 1MNAA 1J2EA 1MN6A 2XLBA 4JEIA 3HJUA 3K6KA 2XMZA 1HPLA 3ZI7A 3E0XA 2FX5A 1EDBA 4LIPD 1XZDA 1KU6A 5C8VA 1VZ2A 3AFIA 3IDAA 1U2EA 4UHBA 5IVIA 5DNUA 3H04A 4XX1A 3VJMA 1HBJA 2DFPA 2XQFA 4M0FA 4X91A 4C01A 5K3FB 1P0PA 3W05A 3STXA 3KWFA 1CUGA 1HQDA 3DEAA 3KD2A 5EHZA 4DTCA 3FOBA 4PSUA 3DL7A 2WFZA 1XZEA 1ODSA 1ZGCA 4HRXA 2QXTA 4OU4A 5DYWA 1VXRA 1CQWA 4BE4A 2OCGA 3O4JA 1A8QA 2PUHA 4C89A 3W06A 2XDWA 5AKIA 2QOEA 1ZGBA 4FLMA 4Q3OA 4HRYA 2J4CA 4DM7A 3PDCA 4KRYA 3QM1A 4Q3LA 5AO9A 2VAXA 2GBCA 4ZV7A 2WU4A 5HK8A 1JFRA 5A6VA 2IIVA 5HF5A 1XLWA 1A8UA 3WWPA 4W1PA 1OILA 1P0MA 3AIKA 2D0DA 2WQZA 4OD0A 1EXWA 2PU7A 3DS8A 1G5FA 1W75A 5AKHA 4YPVA 1TCAA 4JUIA 3I1IA 2PUJA 3KDAA 4BDTA 1MX9A 5I7UA 5AI9A 5LLSA 3AZQA 3KSRA 4B9EA 4G9GA 1WHSA 4OPMA 5AM1A 2WUFA 4U2FA 4K5QA 4AO6A 3D7RA 1E8NA 1HL7A 2RGUA 3WWEA 1E8DA 1EB9A 1DU4A 2O7VA 2JGEA 2XMGA 4BBZA 4PNZA 2H9YA 1O6GA 5HQ3A 1MT3A 4J03A 5ALUA 4FLFA 4GXNA 4GBGA 2YYSA 3I6YA 2B20A 3X3HA 1SCIA 3R40A 1R1DA 1PFQA 5JAOA 4B81A 2IITA 2WIJA 1XZHA 1ZD2P 3FNBA 2WKWA 5KREA 4DIUA 3O4IA 1XZCA 4OYYA 3V1NA 2HRRA 4J0IA 4KAJA 1MTZA 1AQLA 1CQZA 2XUFA 1ORWA 3ANSA 2HA6A 3FYUB 3FLAA 2I3DA 1H2ZA 4P92A 4XVCA 2VA9A 3QMMA 1XZLA 4IHAA 2HFKA 2WJ6A 1AURA 3D5EA 5EIEA 3N0TA 2OGSA 2WJ4A 5I8PA 3AIMA 2ZSHA 3IUQA 3C5VA 4CCYA 5ALRA 3H2GA 3BIXA 1CUDA 2V96A 4NVRA 4Y2PA 3EF3A 3ILSA 1BN7A 3FYUA 3OC0A 2HU7A 4W1QA 4Y2TA 2C0QA 5ALKA 5AK4A 2C4HA 5SYMA 3QH4A 4HXFB 4ARAA 1TQHA 2OCKA 2XMRA 4WFJA 1AC5A 2PSFA 5AKYA 2K2QB 4QE3A 1UFOA 2DR0A 1UOOA 2Y1KA 1Y7HA 2D5LA 5ALWA 2Z3WA 4PSCA 4KE8A 1KU0A 3ESDA 5AI0A 3WK6A 5AI6A 1VE6A 1JJBA 3KOOA 4NMWA 3GFFA 4Y9SA 3WIOA 4F21A 1SC9A 1DINA 2CB9A 1QOZA 2XUHA 4Y2VA 2V97A 4Q1VA 2XQIA 2OG1A 4BTVA 5HF8A 1WM1A 2HADA 3H2JA 3IURA 4U2GA 3VKFA 1IUOA 5A7GA 3WWOA 4DMHA 1T4MA 4ZWNA 1XQWA 7YASA 4G4GA 5AIAA 4J3JA 2QT9A 3WK4A 2HL6A 4N5HX 5AKEA 1LPSA 2BCEA 5AI8A 1GXSA 3R3UA 2ZYRA 2W22A 1XZBA 2BFNA 5LP1A 2HDWA 4Y2JA 1LLFA 3STVA 4PO3X 4MEBA 2PSEA 4KE7A 2QUAA 2WIKA 1FFAA 3WJ2A 1NX9A 2XUOA 3MGAA 3H0CA 4H7KA 1I6WA 1L7QA 3VJLA 4X7BA 3RKSA 3STWA 2QXUA 1ZD3A 2RAUA 5LKRA 2BGRA 4AZ3A 4ARBA 4B0OA 3D4LA 4A16A 1TK3A 3G0GA 2XUPA 4C4ZA 1H23A 5FKJA 4X3CA 4L0CA 1KEZA 4LHEA 2CMFA 2OLEA 1LPNA 1YSCA 2AJ8A 1ZI6A 1SOMA 3G9XA 1DX4A 4BVKA 1QO9A 5AOBA 4MQLA 5EHXA 1QONA 2BKLA 4FKBA 4GDMA 5ALIA 5AM0A 2OCLA 2ECFA 3LP5A 5BWBA 3V1KA 1XRQA 1EHYA 1JKMA 4GI1A 5AJHA 1ETHA 1MPXA 4DNPA 3P2MA 1QIHA 1WCYA 5K3FA 1A88A 1CUZA 2PU5A 2CBGA 3QMWA 4PQEA 3DD5A 4OB8A 3QVMA 5ALOA 1XZMA 2XMCA 1E89A 3UMJA 2WFLB 1K4YA 4WDRA 1VOTA 2WG0A 4IH1A 2G5PA 1XZFA 2XQGA 2CUTA 2HA4A 3DYIA 3OURA 1XZJA 4KAFA 1AGYA 3C6ZA 2DQYA 3PICA 1GKKA 1BS9A 4EY8A 3VVLA 1WB6A 1CUHA 4X00A 5LYYA 3R41A 1WPXA 1THGA 3IVMA 4C88A 5C8XA 4RE6A 3SX4A 4BC1A 4G4IA 1OXMA 1QIFA 3ESAA 2WSLA 2ZYIA 3UUEA 4P9NA 4TGLA 1IUPA 5FDFA 3I6MA 4KACA 1EVQA 1EB8A 2GBGA 2HHAA 5FXMA 3IA2A 4B82A 5ALZA 4QDXA 3I1YA 3D2CA 4K6GA 4W63A 3M82A 4PV7A 5EHQA 4KEAA 4UUQA 3VVMA 4UBMA 1EK2A 5ALXA 1C7IA 5AM2A 3PFBA 4DNQA 2XUIA 3WWCA 5K3EA 1LBSA 2YXPX 4UBOA 3EIOA 5C81A 4UBJA 3NGMA 4DSZA 1CUEA 3TEJA 1THTA 1YB6A 1SCKA 5CURA 3MVEA 3M81A 2QZPA 5JYCA 3BDIA 1AKNA 5ISMA 5CXUA 3WL6A 5ALVA 3WI7A 3MUNA 3DCNA 4IH4A 3FVRA 2PSJA 5ALPA 3F8SA 5DYYA 3O9MA 1VA4A 1G66A 1E8MA 1R3DA 4AMYA 5HKBA 4J0DA 4DMCA 4OU5A 1EX9A 2C5FA 3WJ1A 1VXOA 1H2YA 3QITA 4X6XA 4ZV9A 4EY6A 4B9AA 2Z8XA 4X95A 3WYNA 2V98A 2WUEA 3A6ZA 2JIDA 2QS9A 2WG1A 4CG2A 1RWQA 4HXEB 5K3CA 4LYEA 1QIEA 2CZQA 2ZYSA 1DWOA 2GYVA 4C4XA 1J1IA 1ZD5A 2DQZA 1RP1A 1XRNA 1QO7A 4RGYA 3HSSA 2JEYA 2GBIA 4BAZA 4BE9A 1MX5A 3TJMA 4AZ0A 2AJDA 1PV1A 1UK7A 1XZKA 2DSNA 2RIPA 5K3DA 4QDOA 3HLKA 5AOAA 4FFVA 1YS2X 5AICA 2XUKA 5T4FA 2AXEA 3WZMA 1AZWA 4M0MA 3QBJA 2ZVDA 3SK0A 3FSGD 3PUHA 5AI5A 2LIPA 3VISA 1YASA 3OM8A 4AO8A 3IUJA 1B6GA 1XROA 2X8BA 4ZGBA 4QWWA 4OCZA 5LZ7A 4PW0A 1UKAA 5AKKA 4G4JA 5D7BA 3I2HA 5CH3A 1Q0ZA 2OGZA 2CJPA 2WHRA 4I3FA 3ZV7A 1G42A 1UK9A 1XRMA 2WILA 4AXBA 1K8QA 3GA7A 4K2AA 3LIPA 3WK8A 5SYNA 3M83A 2W6CX 1USWA 3Q0TA 2PVSA 4UHCA 3CCCA 1DQYA 5A7FA 3BF7A 4BATA 5KWIA 3S8YA 3A2LA 3ZWQA 5D6OA 2WJ3A 3S2ZA 1AX9A 2I3ZA 2I03A 4X71A 1R9MA 2GZSA 1SFRA 1CFJA 5JD4A 1LPOA 2JGIA 4O08A 3LIIA 4G8DA 5FPQA 4AQDA 1JMYA 5IH7A 5DLPA 1LPBB 3G0BA 1TIBA 4EUSA 2H1IA 3I2GA 3I6ZA 4XJVA 1F6WA 4MYDA 3G8YA 3ESCA 2OQVA 4MWTA 2IX9A 1WOMA 3FBWA 4NZZA 2XQKA 4UBIA 1IMJA 1JJIA 4Q34A 3BXPA 5LZ5A 2DCMA 3DDUA 2NW6A 2RHWA 1UK6A 3LS2A 5HFNA 1ZD4A 2QRUA 2OGTA 3FLBA 5E4TA 3BWXA 1QTRA 3H2IA 4OUKX 3SC2A 3R3VA 4ZI5A 4B83A 3V1MA 4DNFA 2ES4A 1C4XA 4J0CA 4BP8A 4UBLA 5E4YA 1Z68A 5LZ4A 4H77A 4FDMA 3I2JA 2ORYA 3EBLA 2ZJ7A 4G9EA 4TVKA 3W9BA 1XRPA 2QM0A 1N1MA 4X94A 1JU3A
chains in the Genus database with same CATH superfamily
2ZRCA 4KYIB 4M7WA 1Y3HA 4YP7A 3ILHA 4CFZA 4JSTA 2WU1A 3V80A 1SOVA 2FUCA 4NK4A 1JG2A 1UBFA 2XNJA 4EKYA 2I1QA 4JQYA 4CQMD 1FDRA 3L1HA 3JYLA 3K6SB 3QPBA 1F0PA 1ZI9A 1F9AA 3DKVA 4CDRA 2ZJ3A 3AZOA 1RYDA 3A4TA 1GEEA 2RAPA 1JT2A 1FFBA 4AN1A 3QVSA 2ZR0A 4PAMA 4DJTA 3QMPA 2ZIUB 4G0ZA 1Y9ZA 3P0IA 2DUWA 4K9LA 4D5EA 3ETDA 1O08A 2FEXA 1FVFA 5FQOA 4AWAA 4P58A 2FF7A 4MRMB 3WMWA 5JLAA 1FUUA 1G1AA 1M7BA 2AI1A 2DKFA 2JLCA 3IR5A 5NULA 1VMEA 3VA7A 4DV2B 1IZ7A 1U7XA 2H8GA 2Q7XA 4AJKA 1U1GA 4NPAA 5EG5A 1PGOA 2ZR8A 4ZU6X 1PWYE 4E11A 3WQBA 4RPIA 4YAKA 4TT3D 3UJ8A 3KYDB 2HRQA 1QRUA 4I3GA 1H42A 1N9ZA 3P0EA 4ZVSA 3U7EB 1SKUA 5CAEB 3T5TA 2RK6A 4PTZA 1AY0A 1U65A 1VJ5A 3CURA 3QWIA 4FZ5A 1R8QA 5C1DA 3ZD7A 1TQ6A 3N6RA 5F7OA 1KMMA 1PEKE 5BN5B 3GUHA 4MV4A 1JQBA 1MQSA 4NZNA 2YL2A 1QCCA 1HDGO 1XMPA 3AHEA 3LT4A 3EIFA 1WXWA 2X58A 1KO8A 1Z18A 4PZLA 2EF1A 3PYMA 3ZGYA 3BWDD 4KNWA 1OZGA 2G5GX 3HKBB 4N0DA 4S24A 3V9AA 2C2MA 4LNAA 1DDOA 3I4CA 1NC1A 1MEJA 4WKBA 1UM8A 4BNNA 4ZVTA 2B7CA 3CLKA 2ZWAA 3D3WB 4P4LA 5ALSA 5H80A 2ZVPX 5JCXA 3I01M 3IR7A 3I39X 1U3VA 2CLKB 3QZUA 4HAYA 4R9NA 3HRHA 2KLBA 2XGJA 3M4ZA 1H69A 2DPYA 3M6IA 4M86A 3ZBUA 1UBTS 1D03A 1SOWA 1UDCA 1HNNA 1DKQA 1WW8A 1ZK3A 3D8RA 4WBNF 5FT9A 1QGYA 1IE3A 2NO7A 1XYYA 2OECA 1OSNA 2ZUEA 1ZBQA 1MJ5A 2ZU6A 3L8GA 4L50A 3MN1A 2FH5B 4RY9A 1AKWA 2QN7A 1JAHA 2VQEB 1SZPA 4KIUA 4TMXA 3T99A 3DBOB 2NG1A 1E0AA 2PZJA 3ZHQA 1K9VF 2B5OA 2YYAA 3HCCA 3PL5A 4HATA 1FYWA 1CRQA 4P86A 3FTPA 4MIYA 5JQGA 2QAJA 1WZNA 2FP3A 2XZPA 4YGXB 5LB4A 1F2UA 2DHQA 3VU1A 4NBNA 4EG5A 1X9IA 3GP5A 1H2EA 4I4CA 3V4FA 4W7HA 4O1IA 4MUKA 1MVLA 3G0HA 4GR9A 4KQGA 4TWBA 3KQTA 4NYMR 3KR1A 1RWNA 2CNWD 2IYQA 3KAPA 5FUBA 4PX2A 2QSJA 3OFNA 2IEGA 5GM2A 4ZJUA 1J1ZA 1U9ZA 2G72A 4AY6A 2GCOA 4US1R 3LW7A 3JWGA 4YT2A 3CNHA 4MW4A 3IVGA 1JIQA 1WB5A 4NR0A 4ARSA 4E4YA 3KYBA 5A4JA 3GLVA 4EPVA 4RTSA 4K8OA 1OW3B 4NYJR 3P2IA 2FPGB 4G0QA 4URVR 1BEZA 5K4HA 1SKMA 3MINB 3SR4A 1AK9A 2W2KA 3IQXA 2HK9A 4H16A 5H0IA 1XN4A 1KEUA 3ENQA 4D5GA 1W4BA 1N5DA 4R68A 1L6RA 5E1DA 3D8NA 1QMGA 4NDNE 2BUAA 1CJKC 5A3SA 5JAHA 1XI2A 3JD1A 3TIVA 5K0SA 4QM6A 3UT5A 2WT9A 3OO0A 1UFVA 1VG1A 2G6TA 4XUDA 1Z37A 1ZI8A 2Z2KA 4FKZA 4L9AA 1XJ5A 1YTLA 1G59A 3RVQA 1XRJA 4YCDA 3HKEB 1STOA 1VHTA 4ZAGA 3UUFA 4YYEA 2UAGA 3FMPB 3CA8A 2FN7A 2MT9A 1V48A 4RMNA 4CM4B 4X20A 3F98A 4TKVA 5JSFA 1H3EA 3QBDA 4BTLA 1R0SA 2GCOB 1MQ9A 3HN2A 1J7JA 1IH8A 2NUTB 4C7OA 5JR3A 1KEEB 2BW0A 3PX3A 2O3TA 2RKBA 5D00A 5DXJA 4EJ0A 1UKZA 4TXHA 3K1AB 3AR3A 3BDAA 5JNVA 3ZUPA 3BL8A 4K8RB 4P34A 4RKQA 3GJQA 4G8CA 1VJGA 4X6YA 3QSYA 1WBJB 2M1XA 1BVYF 1FNDA 1XX6A 3CKKA 4IGFA 4J0JA 1LRKA 1RDFA 1YC2A 1UXJA 3DLTA 2P8SA 2I2FA 4HMOA 1N78A 4G5XA 3DTTA 4PYKA 4EGJA 1I01A 3H2HA 5AK3A 4CGZA 2Q7DA 2PYZA 2IOFK 3OQ1A 4U7FA 1FP6A 2Q99A 1NX6A 2O6HA 1UM9B 2J9ZB 2WUGA 3BGSA 5D5PA 4YUYA 2DLCX 3C7CB 3IH5A 2ZAYA 4MRSA 3IQZA 3SWWA 1U7DA 4MRMA 3SYKA 5FI5A 5F7XA 1XF1A 1SBHA 2CHVA 2G83A 4BNKA 4HAZA 1M1XB 2P11A 5I5EA 1FP1D 2PL3A 3HSKA 4KN6A 4F04A 5BSFA 3P97A 4MUBA 2PX2A 1C50A 3GVIA 2PKYX 2PX8A 3W5SA 3IEVA 2QD2A 2VCHA 5J4KA 5IKXA 5CA0F 4MMYB 4JLOA 3VR2A 4OLHA 1VJ0A 4E5KA 3UZUA 3ND6A 2XYGA 1K27A 1YDHA 5CYFA 2FSPA 2PTHA 3L8FA 2YQ5A 2EWWA 1XFAA 3D8SA 4IO0A 1WSAA 1GNRA 2J3KA 2VJLA 4OH1A 3BQ9A 3T06B 1PTJC 4BB5A 3ZDEA 4AWXA 1CX9B 1Q1QA 5L45A 5C53B 2DLDA 2QIOA 2HT6A 2ISSD 1C80A 2B8EA 3LQYA 3N2YA 4RWEA 4S35A 3UVEA 2CW5A 1DQZA 2YZKA 3AERB 1T9BA 4HDAA 4JMPA 4WINA 3W4JA 5F7JA 4C29A 5CDTA 2XZTA 3RHZA 3G1TA 4MINA 3A6GA 1DRUA 5L40A 2XUQA 3HYCA 2KSQA 1G6Q1 3NJ4A 3OLYA 1VM6A 2DH6A 5FA5A 1B6SA 1R0KA 1XAJA 5B3KA 4ZCIA 2NYVA 2ST1A 3L0IB 1NN1A 3U39A 4H1WA 3ZVNA 4UVGA 4L78A 1F2DA 1U94A 3CLSD 4PC1A 5E4JA 3AINA 5AHKA 1AHNA 2AG8A 1XPUA 3BIJA 3L77A 1GIAA 1ZXBA 2O4UX 1REQB 3DVRX 2W6IA 2Z2JA 3G13A 3LDFA 4MI3A 5HE9A 2CLFB 2JCSA 4CDMA 3S1AB 4B3MB 4MVJM 1T6ZA 2X2OA 2X5XA 4M8LA 4PG4A 1RPZA 3VMFA 3D6FA 1DEAA 3TSOA 3VU9A 3QOYA 1XTZA 1HKHA 2FMFA 4UM5A 3AUUA 3RYFB 3SYTA 2PUBA 4UHFA 1ODFA 4UNPA 3SIXA 1M7HA 1QOPB 2WPDA 3LX4A 2V9ZA 4GYYA 4INZA 2ZJ4A 3JYPA 3KHTA 1Z2DA 5DBHX 1Z39A 2HA0A 3VSBA 4HLUA 1OV4A 2Q6OA 4N01A 4OGLA 5E7JA 3Q3GE 5CITA 3P0JA 3ND5A 3DNFA 1NC3A 2Y1WA 1OX4A 2QLNA 3MCWA 3QWFA 4HRAA 1QAMA 3TLKA 1DCTA 1EQUA 5DBFA 1U0JA 3CGWA 4A5SA 1KQ3A 421PA 3FPSA 4WLNA 2WTUA 3RBZA 4BQFA 5FB3A 7MDHA 2VNHA 1JJFA 1Y6FA 5J43A 4TV8A 5KIAA 3NH9A 1I2ZA 2I1VB 1V8DA 3CHYA 4YAUA 3KRTA 1IQPA 4NFHA 5JUWA 4F3TA 4E13A 3SQOA 2JAHA 2EKQA 2RARA 1LZLA 3HKDA 1NLZA 2X5JO 2BD0A 4CDGA 2W2LA 2BFEB 1VDMA 4XWAA 1AKEA 5MGBA 4J0KA 4RVUA 4FTWA 3RYHB 3U4HA 4YMVA 2YV3A 3L4KA 5KQPA 1ZU5A 3I9MA 5SY4A 3T7DA 1Q1BA 3F5FA 4NH4A 1N2OA 3A0RB 4J07A 4IKPA 3H4TA 5JASA 3DOHA 4PLGA 4C4OA 3IKJA 4JLBA 5FD8A 4BRUA 2I7CA 2O8NA 1K75A 3E18A 2D2FA 2XUAA 3C74A 4HO1X 2KS6A 4MIEA 1CF2O 4MK4A 2XHEA 5ERYA 2ECOA 2WWTA 3FMFA 4P4SB 2WFLA 3NBAA 1AF7A 1TIPA 2CUNA 5JE8A 1GNQA 1ZDMA 2R84A 1D6JA 3MTGA 4HF7A 1IEQA 2CWDA 3H3XA 4DCUA 2BFOA 1ABBA 1GEGA 3G02A 1RKBA 1OFHA 1V2HE 2NM0A 3UK7A 3E9DA 3NHBA 2TYSB 4XWYA 1Y4UA 3DAYA 3GXBA 1TCBA 3LLMA 3DVQX 4JXJA 1FDOA 3MYYA 1PO7A 2GPJA 2CJWA 3RC7A 3TLJA 1LNQA 1IJKA 2Q6TA 3WL8A 2E1RA 4EKDA 1MZPA 3KHSA 5FYQA 1DC5A 1T8SA 3CZMA 2OE2A 3DMNA 2V1UA 4UEOA 2G5TA 1IY2A 3DB1A 1WXQA 4TT3A 4O4HB 4U0KA 3UWMA 4NCHA 4Z7OB 1VL0A 2VS1A 2ZUWA 3P45A 1Q7RA 1R9JA 3CW8X 4K6HA 4IS3A 1OFUA 4UE2A 3DUFB 3QTLA 3TXXA 1MA0A 4JBIA 3U7IA 4F5YA 4M60A 3EPKA 1ESDA 2YY7A 4BZZA 1GUAA 4GOMD 1QE3A 2X5KO 2A1IA 5LUBA 2JFWA 3NB0A 1NATA 3ZDZB 2ZM6B 2VNIA 3ISTA 3D0QA 1ZVQA 2IUFA 2BFAA 1JYSA 4XVRA 4NABA 3UXMA 1FQKA 3BZBA 4OFXA 2I4MA 4IH9A 1KJQA 3HCOA 4MWSA 2EJTA 3CKMA 4CFYA 3NETA 2VJCA 3N70A 2NTVA 5JNTA 4GF5A 3Q3IA 1NN0A 4J2TA 4BWYA 3RAJA 5BRAA 5DGXA 1PR5A 1T0HB 2LR0A 4BBPA 4CDNA 5C46F 1NM5C 5JEEA 4H7JA 2HJRA 4HQ0A 4C4PA 4G97A 3FSJX 3PUJA 4N5LA 3ZJUA 1DZIA 1T26A 1NW9B 2QX7A 3D5TA 3PJEA 4NV0A 1X9HA 4YX9A 5A4FS 3R0ZA 4OIMA 2E4XA 2IHZA 2Q3FA 4GM4A 5HBRA 2C61A 1I4WA 2W0SA 3T4UA 2H1HA 3FPGA 2RJNA 4OJQA 1XEFA 4XWWA 2XCQA 3TXAA 1TZJA 3MFQA 4OHFA 4QDTA 3EDCA 1UP6A 1XWWA 1OI2A 5IHPA 1M2FA 1H1DA 2R9VA 1NASA 4KL8S 3L1IA 5JDCC 3TRHA 3K0CA 4G67A 4OXNA 4R9SA 1IAVA 4YJFB 3UFXA 3VDQA 2X2PA 3A26A 4NI5A 5D3KA 1ST2A 4J9UE 2PO7A 3WL7A 2ZSFA 3W9SA 2B35A 1R9NA 4G1VA 4L51A 3AFHA 4AUKA 3PTAA 1JPNA 4GYJA 2RH4A 2QN8A 2WWFA 4KQFA 3SYRA 1XNRB 3IT0A 1CY7A 1UZAA 3G0IA 2JJ2D 1Q16A 1YB1A 3ZDCA 1B6RA 2QUIA 1ZOOA 2X1LA 3GJSA 2AE1A 2C20A 3OZAA 4EX6A 1JIKA 1HETA 5F5XA 4MGYR 1CUBA 4UXJA 2MYNA 1QXSA 4S1OA 4JLSA 4TXLA 3NIBA 4V0LA 1FFWA 1SCUA 4V0SA 4Q1EA 5CA1B 3IBGA 2J7KA 2R8RA 1FFXA 1GPKA 1NZJA 4X84A 2ZYGA 3A6PC 1JE1A 2YJ4A 3EZ2A 4HH3C 1LQ2A 3EUFA 5AT1A 3SNHA 4ZVKA 5GP1A 4FOPA 4UTOA 5F2NA 3NEAA 1FPMA 1TF5A 2AT1A 2A1UA 3DF7A 1GUZA 2EW8A 2ISQA 1MEOA 1E64A 5JYDA 5JD6A 3TE6A 5HYVA 4L2IB 4NENB 4J3NA 3VR6D 5FBVB 5LCXA 4X65B 5FPHA 1BGWA 4Z49A 4EPYA 2ZANA 5TGDA 3L8ZA 4XPIB 5GZ3A 4L73A 2H1WA 3C6YA 1M1YB 3H5AA 1M75A 3N6XA 5FL7A 2PG3A 2AB0A 5HIIA 2PRYA 1NSYA 2WKQA 1U0GA 1QR2A 4BDSA 1I0IA 1HO3A 4PM4A 1G1MA 1OV6A 5F3DA 5ULLA 3TQOA 2X3UA 5KB3A 5MN5A 1VE3A 3E3LA 1L4YA 2IW1A 3PGVA 4EPXA 4BNWA 4WY8A 3C1OA 3ZWWA 3K8ZA 2Z5VA 5CM2Z 3DKPA 2COKA 4G07A 4EH1A 4LF6B 1ESZA 3D6MA 4XQ9A 1UC5B 3CR3C 2DHEA 4LTMA 4YFVA 3VR0A 2I7DA 2B25A 2P41A 3H2SA 5EJAA 5IVDA 3VHQA 4FHDA 3UMBA 4NV3A 3LCVB 4C04A 4DCMA 3ID6C 3ZIAD 3FNHA 1F8GA 1LRLA 1II0A 3HXPA 3C15C 4HZIA 4NMXB 4CE6A 2ODEA 3K9LA 2QTRA 3QMVA 5LA6B 3CH7A 4YRSA 4DVJA 2O2JA 3G9ZA 3WVNA 5FUMA 5LMUB 4F2HA 2C59A 4KJZA 2JIBA 2R5NA 3PUIA 1A7UA 2OG2A 3Q9NA 2P2LA 5CLLA 4PRZA 1IBKB 1C2TA 2GN2A 4UNNA 4EHDA 4W5QA 2VSQA 3ICVA 1QYWA 3MMSA 1NPYA 3MPUA 3JZIA 4PBRA 4B32A 1SBYA 2R66A 5T4HA 3R7AA 3WLPA 2WTMA 5TDHA 4G5HA 1A4XA 3QX7A 1PL8A 1J20A 2PT5A 2DQ4A 2N42A 3QXCA 3IT2A 3WGQA 6REQA 4CMJA 2VTBB 4YK7A 1ZJ4A 3EY4A 5B1DA 1M73E 5JG7A 1G7CA 1W36D 1TK9A 4CLDA 2R1VB 3EIEA 1GN8A 3EULA 5GOZA 4RJTA 1N9GB 3QNUA 1EEHA 5L3SB 1QQAA 1E7MA 4YRMA 1XZQA 1QIDA 3CU5A 1WMBA 4FFLA 1IHYA 2V6BA 5DBIA 4AIIA 4URXR 4K9RA 3UTDA 1YZHA 1CY0A 1PEYA 3H1AA 3WZLA 4RQBA 1CQIA 3THYA 4IIYA 2WWVD 1YTUA 1NKTA 1QX3A 1RI1A 4KHZA 4WFQA 3S5JA 1YJ5A 3P52A 1J99A 2F9FA 2P4QA 3FCXA 3QLEA 2CKMA 4KJXA 4MI1A 2H85A 5G4KA 4U9UA 1NGSA 3IEPA 1IU9A 1MW9X 4KVGA 3ELYA 4OP1A 4QU5A 4XOIA 5LWHA 4G1BA 2NLOA 1QKJA 1GY8A 4K6KA 2OBYA 3THSA 4F6CA 5BSGA 1E98A 3EEFA 1SVKA 3DM5A 5LBTA 4D3DA 2OPBA 5K0LA 3Q4GA 3VKGA 2PAAA 4YJDA 1VCMA 1M72A 4RCVA 5JVDB 2ZWOA 5AVSA 4I1YA 2J7PD 2RBGA 1M2OA 2XE8A 1G9TA 2XMDA 4WNYA 5KNBA 3G7NA 5JNWA 3F6PA 4XD7A 2BSQA 1EUCB 4RKWA 3HLYA 2ZYTX 2ID8A 1AKVA 4WOPA 3FSRA 1Q1GA 2W98A 3JZFA 2JFVA 3E9QA 4YRJA 2A9QA 3R74A 4QBKA 4DLYA 5T4BA 5FNVF 3GQBA 3PK0A 1RQGA 1EVEA 4YAOA 1VSQA 5CT9A 4CUZA 4DIEA 5A5VA 3CEAA 3K73O 4UQPA 5EI5A 5C5CA 1WO8A 3KZCA 2JANA 3GPDG 2I78A 4C30A 3A31A 4JYCA 2ZWMA 1Z6AA 2F9MA 2GAOA 3D8UA 4F0JA 3LECA 4ENTA 5HJ5A 3U3DA 3M6FA 1RPTA 1FYXA 1LBIA 3IMFA 4J0HA 2NUTA 4CL8A 4JN6B 3GLFB 4WKNA 3BSWA 3KP1A 2NPOA 2QMHA 2B0CA 4QDZA 5LQDA 2J3HA 3N2EA 1HA3A 4IJKA 2JCXA 4GPAA 4DGSA 4WEQA 2PSSA 1MO2A 3MUOA 4WXHA 4EK9A 3VZSA 3ZY5A 3DTNA 2JFPA 3QU4A 2WNSA 3PQFA 4FNAA 4M83A 2RGNA 3JQ7B 1EFVB 4COKA 4WZAA 1PG5A 4Y8VA 1RXVA 1UWKA 2QJRA 1MJNA 2JFBA 2ZJFA 4MUEA 5BW4A 4RL6A 4F4CA 2PMFA 1LK7A 1YQWA 4IDOA 4MO9A 5FOQA 2J67A 1Y4AE 2X6RA 1T3ZA 2FPWA 4NX2A 3JVUA 4HNRA 4RTRA 5KYVA 1YR3A 4UQOA 5IFLA 2VBIA 5FP0A 3DZFA 3K3PA 1VKRA 3GP8A 1RAIA 4DB4A 2VT6A 4NOMA 4BZWA 1PR6A 3AI1A 1BYIA 1CUVA 4XEHA 1SHLA 2ALJA 2WTNA 1YUNA 3ITNA 5ALNA 5GIPE 3HKCB 2WG2A 4KWIA 1R6DA 2NXJA 4M8NE 2P2ZA 2FR8C 4MQ6A 2QG4A 4TV8B 4YT4A 2ZI3A 3INTA 2XLCA 2IHJA 3PP8A 3WGUA 1J9ZA 3ZDDA 2H5JA 2IUSA 1WBBA 5A0TA 1FXSA 1OKKA 1JKXA 3U1TA 1TGYA 2ZVQX 5DI9A 1YU6A 4AVYA 4GE3A 3M7IA 4G5RA 1C1XA 1NT2A 1R4NA 2DYKA 5JW6A 3F5QA 1R2QA 3N0VA 4IRUB 4ZRDA 4ZA2A 2FPLA 4JIGA 4UTNA 1M67A 2PJUA 3K2EA 1H0RA 5CNIA 1NW6A 3CBGA 2AN9A 5A6SB 1D1TA 2POQX 3C85A 1E9AA 3TGWA 1OZFA 2HJSA 3HVUA 5KDLA 4NBSA 1T4DA 5TF0A 5F77A 3TLXA 1EZ4A 3ORRA 3VPCA 4C7MA 3GFVA 2GTIA 2RDMA 1KJJA 2VTKA 3RR2A 1RE0A 4KGDA 5I5GA 5C5EA 2IU0A 5KMGA 4RVOA 4J8PA 3D7NA 3DEJA 4AJ4A 4YYZA 4IIJA 4NCIA 1EHIA 3OF2A 4LS3A 3ZU6A 2FSVA 3UUWA 2GESA 4BN0A 3O91A 5D3MB 1I4EB 4L4YA 4K26A 4OJMX 2BP7A 5TARA 4RPCA 2F4NA 2Q9AA 2HDOA 4FK8A 1RTKA 3OQJA 1EYZA 1Z8HA 4V0KA 4KX3A 2A78A 4HFMA 2VQ6A 4G09A 3AR5A 3RT7A 2AIRA 4G0UA 3PPYA 5K5EA 4L3VA 2WMDA 5KHOC 1UBJS 3OCVA 4QRDA 5C1IA 1PNVA 2Q5OA 4YI3A 2GN1A 2REBA 3NKFA 1A50B 4RSGA 4DM4A 2QPOA 1DWQA 1DGQA 3LWDA 4RE5A 5BSMA 3VAAA 3RO7A 4V0OA 2QPAA 3KAQA 1URPA 1U7TA 4KXMA 2JA1A 4DMFA 2VEDA 1NBWB 3QKSB 2EEZA 1KP2A 1VMKA 5KSWB 2Y27A 2WP8J 4RGVA 2PR7A 3LCUA 4KPUA 4AICA 4JBGA 5HFAA 4CN9A 5TMPA 1KETA 1NI4A 4FGUA 2I8CA 1Q83A 5ICGA 2H5LA 2X40A 3TNLA 1YH3A 2G4LA 3Q2OA 1SBCA 3ZHOA 2WAXA 3AF1A 4E2ZA 1DX9A 1FFDA 4W9NA 5CRIA 1D6MA 4AG6A 4PG7A 4LJ5A 3VR5D 1RQ2A 4YRBA 2DB3A 5I9IA 1NP7A 3MXOA 2W37A 2OXEA 2GZRA 4ZEOA 1E6MA 4LGYA 2R5WA 4P33A 5TS3A 2W2PA 4JL8A 5ETJA 1MENA 2NT4A 1ZCBA 4LC1A 3RVNA 3U37A 5ESDA 3ETCA 3ZZUA 1HT3A 2PUTA 2PZBA 3KL4A 1XTUA 4PXSA 5COAA 5DCUA 4BMXA 1UEJA 1ADFA 1B1AA 1ND6A 2G9RA 3I9V1 1FZTA 3UA3A 2MMCA 1KGDA 1WXIA 1G41A 2B37A 2V7XA 4RNDB 4RYDA 5LMNB 1TZBA 4NEQA 3B1YA 1PKXA 3B53X 1OLOA 1IZ0A 3VAYA 4FWIB 1E7WA 1EGAA 1YDWA 3KQYA 4OHOA 4P3PA 4XSVA 1XCOA 4JLKA 4D41A 2W4MA 5AHXA 4TXJA 3ETGA 5IAEA 3G49A 3D6TB 3LDGA 3T3DA 3K9GA 4WVFA 4AROA 2YOGA 1NJGA 4BFVA 5EJ8A 1XDBA 2BLNA 2G8NA 1EWRA 2PMDA 4J2OA 3LLVA 4Y2SA 3UJDA 4C7OB 1R0CA 5IT0A 3JVVA 4D9MA 3FPKA 2C03A 4AO7A 3V4RA 2D8AA 1KDPA 1BWPA 3Q3HA 2C1XA 2YV4A 3G0OA 3BFKA 4DSUA 4MYCA 1SBNE 4NAHA 1LD3A 2CEKA 5CYOA 4QBIA 1LQUA 2B92A 3RH0A 2Z2YA 5A7HA 4YLEA 1YRHA 1UAGA 1BH6A 1V7CA 1A9RA 4B2PA 1B3RA 1PSZA 3Q3JB 3KOZA 4RTLA 4YJ2A 1PJRA 1E1RA 2MYPA 2Y1XA 4HAOA 1YQDA 3A70A 4XX0A 5A3RA 3GLKA 1CRZA 2E2WA 2QUHA 2VL7A 3ZNPA 4E2YA 1NJ8A 3JQ7A 2EW2A 1S01A 3EGXA 2X1HA 5DGIA 4AG3A 1FDWA 1W93A 2H54A 2R65A 2HWKA 1IOZA 4IX1A 1JPUA 4MB6A 2AF4C 4UTPA 1TU4A 2GPBA 4RSMA 1U1EA 1TLLA 3HYLA 3N8NA 5GAJA 2XZLA 1GPBA 3ISVA 4J7AA 3SU8A 3S7ZA 3OC6A 4E15A 4YAIA 4Q3AA 4LECA 5E6RB 2WABA 4TTPA 4P5DA 1XNJA 2NO4A 3D4PA 2DPGA 3CG0A 3NPMA 3KU1A 3F5MA 2GNPA 1CUCA 2W6MA 3FYUC 2XOKD 1YA8A 3UB2A 1VHWA 4MV7A 4ZYVA 3H9UA 1QHSA 3QWBA 4M9XA 5IPFA 2EAUA 2IYOA 2VEOA 4EZBA 3E5NA 2W7TA 4FR0A 4C08A 5WRFA 5CDSA 1JDNA 2WIGA 1KI2A 3UENA 2CV2A 3DHYA 1V6CA 2CLCX 4MEAA 2R96A 1OWOA 1L8XA 4IDCA 1JRLA 2GF9A 3FTEA 1MHPA 5IG2A 1G5QA 2P77A 2ETXA 3HWX1 1NI5A 2CL6X 3GVPA 4RKEA 5HM6A 4M89A 3CUVA 2Y6VA 2FOIA 1R00A 5HR5A 4HWPA 4WKCA 1LBEA 1S3FA 1EXDA 4EENA 3UG7A 1UCFA 2WVGA 4JUDX 3OZRA 1Q92A 1RM5A 1SUAA 2BRUC 2GN9A 3I45A 4LGCA 3DR5A 4ENUA 2V6FA 1G291 1X7HA 3D7MA 1BXRA 3L7OA 4H18A 5JH7F 2L42A 1EGMB 4EO4A 4XX0B 4PANA 4DDWA 3W1EA 1C5KA 1KR2A 2ATIA 2PA0A 1AM4D 1NR7A 1BTOA 4LXHA 4QDOA 2FVYA 1TT5B 3G9TA 2WINI 3UATA 4AX8A 2AOWA 4C3ZA 4F1KA 1N36B 1OZHA 4X3PA 4EKEA 5DM70 3UMGA 2D00A 2DT8A 2HF2A 4YREA 4TYYA 4NE2A 4D9CA 1J06A 4RZ2A 1U0TA 3SKVA 1SQ0A 1DJQA 2I6TA 5ALHA 4BMOB 4H7EA 1NJ6A 1MIHA 2HU8A 2HBQA 3UV3A 4JBHA 2J3DA 5CT5A 3VVCA 4MDYA 4JY7A 3CF4G 3K92A 3AYZB 1PW7A 4RZUA 1UINA 1BE0A 2VRNA 2WJVA 5L3SA 2WF9A 5KYTA 4KAXA 3QFFA 2YFHA 2C7BA 4C0BA 1FU7A 1MDFA 3I64A 2AZMA 4P7BA 1IY9A 5AJVB 1WDWB 1BFKA 3M9WA 3PIRA 2WV9A 3MTEA 2B1IA 1GPLA 2PBLA 3JQGB 2J3EA 3BSYA 4HP8A 5KOIA 5JC8A 1JHPA 1NBMA 2QWXA 1ODIA 3FB1A 5U9CA 2CF5A 1TCUA 2BR4A 2R1TB 3H86A 4Q00A 2JCGA 2DH5A 3VJKA 4D02A 4F2WA 4IF4A 1NJ2A 3LC7O 4C06A 2BCGY 5KSPA 1FXWF 3WGYA 4RIHA 2HA3A 4OUDB 3IT3A 4ERNA 5LUAA 2DBZA 3E9ZA 4WXRA 3BQMB 1MG5A 1TA4A 2PWBA 4MS1B 4OFBA 3SMQA 3FGPA 3HCPA 1HNXB 2O2CA 4C3UA 1Q3KA 2ANCA 3BMCA 2AEMA 3RRYA 3T3EA 3V6LA 3BJMA 4S2UA 2WSSA 2LP4Y 2L19A 2INGX 1XZNA 4INJA 5COQA 5GONA 1Q15A 1QZ3A 2O3RA 3RWMB 4CYMA 4EI8A 2V7UA 4BO4A 4M49A 1ZH4A 4BNDB 5FOTA 3T7CA 2BI4A 2Z6VA 3O95A 4Q47A 3TUJC 4LTNA 2JA2A 5FOWA 3CT4A 5ITWA 1A8PA 2V7BA 4UUPA 2Y0BA 4U2KA 4UDOA 4YRTA 2QYHA 4XWTA 4XDYA 2FZEA 2C2GA 2VI5A 2EFHB 1GAJA 3BOSA 1KPIA 3DYVA 3KSZO 3IUPA 1YRAA 4DR2B 1DPFA 1E2KA 3DO6A 3E4DA 2HWUA 5AM4A 3Q5GA 3CE9A 1MT0A 1WXHA 2GHRA 2HCTA 5EIHA 3PB3A 1KSFX 1WIWA 4OREX 3RRBA 4IAOA 3RTGA 2Q0QA 2CVPA 1ABFA 1Y6ZA 1A69A 5CTAA 4PCUA 5JSQA 1BDBA 1O8BA 5D3QA 4ITVA 4Z99A 1ZICA 2R86A 3KHUA 1EMDA 2XAAA 4AWBA 3IUEA 4HWSA 1CHNA 3CF2A 3HZZA 5KVSA 1Z0DA 3KFVA 4LMPA 2IIBA 1YL6A 2DECA 3RWBA 4PN7A 4XFJA 2HWYA 1DXYA 1KMHA 5KVQA 1X80B 4ETWA 4LCBA 4G0OA 3TL2A 4CLRB 4CFSA 1CZRA 1F20A 3LJKA 1WMSA 1ECCA 2O8DB 1QVVA 4D6PA 2QPLA 3GN2A 2IEAA 3JQFC 1DFHA 1M5UA 2JHAA 3D0KA 4J16A 2G7ZA 4KWEA 4Y2QA 2AMFA 3V7YA 5B4UA 3GJYA 1RYMA 3KYCA 3KQHA 4RY8A 1PL6A 1K2WA 1QGAA 3GNLA 3T5GA 4UBKA 1XLTC 1LGYA 3S2SA 4JLUA 4EM6A 1NW4A 4CU5A 4HN2A 3QHAA 3L1UA 1O0SA 5AVYA 3HB4X 2B7LA 1IIBA 4AJJA 1U8FO 3EAFA 3ZK9A 2HQ1A 5JAZA 3A9RA 4YRCA 1NYRA 5GJWC 1MQAA 3IDOA 2AEEA 5AJXA 3R5SA 4KI0A 1T0UA 2GOYA 9ATCA 2B8WA 3I5UA 4EG1A 3G88A 3EODA 5IKEA 2C2YA 2GWRA 5AP9A 4ZFNA 5ALYA 1RZVA 2OHOA 4EELA 1IMOA 1CUJA 2PZMA 1BEEA 5AKJA 2RJOA 1WHSB 1TVEA 1V5WA 4DDVA 3OLWA 1DC3A 5FH9A 5J1SB 1OLXB 1Y6QA 2I4RA 3SF8B 3RFVA 4WHMA 4P08A 1BEUB 4CCYB 5BSHA 3JWHA 5CLGA 4MQFB 4DTIA 1G8GA 3CB4A 4DMKA 4HZUB 1GGVA 1G8FA 2Y68A 3KQWA 1PLLA 3AY7A 2Q2WA 1OA0A 4O4LF 1O6BA 4IMIB 1H9AA 1NBOA 1DG1G 1P0QA 1PR9A 1XKLA 2ZTSA 4GVXA 4L4ZA 4BGIA 4ER3A 1UBEA 4TROA 2QSUA 4EI2A 2CCGA 1C30A 1E7RA 1WD7A 3HLTA 3IOBA 4WK0B 1E3QA 2PS3A 2WYWA 3VFDA 5CCBA 2PNFA 2BEVA 2FQQA 2NP6A 4JJ7A 1GZHB 1NQOA 5ARBA 3KKLA 2JCYA 5ANRB 3RQSA 4RKYA 2JDIA 4HLQB 3BWBA 1LZKA 3PGXA 4QG7A 4EABA 2D7JA 3A58B 3NDIA 3OP1A 4MVWA 4OHKA 1A7JA 5EJ4A 3CISA 2A92A 3CNBA 5FPPA 5B7GA 3S1SA 2BBSA 2BJWA 2OFFA 3BF8A 3KVVA 4Z3KA 5EZ6B 3G17A 1FJ2A 4E3WA 1GQOA 5B3AA 4DE5A 4RFVA 2OWEA 4I50B 4OB7A 4C2BA 2R7MA 4C6TA 3HGMA 4DV6B 1U8TA 1WDKA 4H7HA 3BTVA 2DHDA 1KPHA 1XQ1A 4QNNA 4Y67A 3OECA 3WGTA 2QJOA 3CTMA 3D81A 4IJVA 5D1HA 1TQ8A 1XDGA 3ACDA 3EXEB 3ZD6A 2O23A 2R1TA 4QYIB 1DAFA 4HOYA 5J2TF 2EFDB 4DWJA 2GO7A 4HH1A 3VU0A 2WQ6A 3JWPA 4AMGA 5C9ZA 1BD3A 3KZXA 4B3XA 1E6CA 1RT9A 2YJNA 4QXMA 1F1BA 3WAJA 4G1CA 1NVDA 2ZULA 2LD4A 3WGMA 5DHSA 1GOTA 5J2TA 4RNCA 1MG0A 3V8QA 5KNDH 2IYWA 4H35A 4J0GA 1C7ZA 4WXMA 1TAHA 2IEZA 3C8MA 5AM5A 4D3XA 5G4KB 1XVIA 4CM7A 3CEMA 2GJ8A 4ZJPA 4H4DA 2VDOB 4KXQA 4OYLA 3IP9A 3VJRA 2GK7A 3A6DA 4DGQA 521PA 1MAAA 3N1UA 5LJLA 1Z07A 1ZW6A 2B2CA 2OZLA 3RVPA 1V1MB 1W25A 3OJEA 3FJ1A 3PUKA 4AX4A 4NPCA 5EFZA 5HS6A 3AT1A 2ZIZA 3TMYA 3DOIA 3KEGA 3MJSA 4LXYA 3GFRA 1QP7A 1I24A 4AZVA 3K70C 4KBFA 4UHDA 3EQ9A 3SC3A 4YUAA 1VKHA 4MRPA 2DUUA 4HQFA 2CDBA 4FU0A 2FSSA 4IIDA 3WWYA 4TTQA 2JLYA 4KMOA 2VAPA 4HC4A 5C80A 3CUEF 2UYQA 3MJFA 1B14A 5A9RA 3LYHA 3OCXA 5TGTA 1DO0A 2WWIA 2EJUA 3OOYA 3LKZA 4JP8A 4ZVRA 4II2A 5I9BA 2YX1A 4PVDA 3DV0A 4JP1A 4EYKA 5A62A 2QI9C 4ER7A 5CNJA 4CWAA 3I73A 1ZESA 2MHCA 4EBBA 5DYTA 1ODTC 3KJZA 5LKAA 2AW5A 2XPCA 1T2UA 1KYZA 3E81A 3LHIA 1PR2A 3U44A 1U7UA 1Q7EA 5LA6A 2YIMA 3L1JA 4TPKA 4D46A 4KYVA 2RG1A 2C8KA 1KHHA 1GHTA 1PZHA 1UFRA 3CONA 3T3PB 1SXIA 4YO7A 4QFMA 4B4UA 2CGEA 2NN3C 2ZXEA 1EVIA 2Q1WA 3BIWA 1PZEA 2MMGA 3FKSA 2JAWA 4UTXA 3FMVA 2WYOA 4PCVA 3GEMA 3KWJA 3R6TA 2AQHA 4L8FA 4ND6A 3GCDA 3WKDA 2MSEB 2JI8A 1D6NA 2XLBA 3AL3A 3ASYA 3MGGA 3QA9A 4PLHA 3RWOA 3T52A 4KO1S 2JLVA 1RRPA 5ICEA 1Y5NA 4B6OA 1R0XA 3COWA 2NVBA 4KV7A 3FTNA 5GGXA 4WVLA 2Z9BA 5FWYB 4M2LA 5CB6A 3ROFA 2UU9B 2D5CA 4BQPA 1B0UA 2GZ3A 4LOKA 1HPLA 2FEMA 2B3DA 2NYAA 3B6ZA 3GJRA 2FX5A 1EDBA 4M88A 4WNCA 5C4MA 1Z7YA 1SEVA 4PGMA 2WE8A 2DY1A 3GRFA 3KR0A 1D2CA 4O3MA 4QFBA 1XZDA 3D1LA 2A9RA 3BE5A 4A0RA 5ILGA 1VZ2A 4BKRA 5BV1A 4XFDA 5H16A 4GPBA 4BMCA 2GDZA 1C7EA 3PCXA 4MQUA 1JA9A 3PIIA 3VYTB 1N4DA 1A5SB 1R7RA 2AG5A 4FZJA 1U8UA 3D31A 4UJ3A 2EWMA 2CLIB 2X2EA 4QGHA 3N59A 2H1LA 5F51A 3SDSA 5DNUA 1GKYA 3H04A 1M0SA 4E2XA 2AYYA 1Z2CA 3HDTA 1QYCA 3I37X 3IV9A 3RFCA 2AK3A 3JQBA 4RFSA 2JFXA 3LZ6A 3QVGB 2AKEA 4X91A 1TM5E 1OX4B 4C01A 4ENSA 2FDCA 2PUDA 5K3FB 1P0PA 2CV1A 4NARA 1PT8A 5IF9A 1U3UA 3ROQA 3TLGA 5F64A 1XTTA 1XAHA 3KWFA 1VG9B 3FPLA 1XTVA 2NQ2C 2O07A 1DEKA 3M6XA 4GLOA 4XIFA 4AS3A 4RS4A 1E63A 1CUGA 3ABZA 3DEAA 4PCAA 1WTCA 4PGHA 4K9SA 1UM9A 1ECLA 4P1ZA 5AW4A 2BGWA 1SOAA 1AD2A 1KDTA 3ORHA 3GAFA 3GLHA 4DR4B 2CBXA 4IJUA 3L9WA 1WY7A 3QUAA 2XVAA 1U7HA 3T5AA 3EW7A 1PP4A 1QHYA 2R2AA 2B99A 1I1HA 2MCFA 2BBTA 1XWFA 4R01A 3HB9A 4LSGA 1W4CA 1VXRA 1SPBS 1CQWA 4ED9A 4QASA 4ER6A 3M6VA 2C1EA 3DHVA 3O4JA 4HLDA 3DXZA 3EXIA 1NT4A 4YJKA 1L4BA 3WSWA 1XNGA 3BSFA 2X8LA 3JQPA 3REGA 3S2FA 2AYZA 3FYHA 4L08A 3W06A 3THRA 4UOEA 1A98A 4OOEA 3DFZA 3CFYA 2QD3A 2XYPA 4J3FA 2GEBA 2FMKA 1TA9A 1XEXB 3A4IA 3LP6A 3T9FA 2NPIA 4ENWA 5DIZA 1ZGBA 1RAHA 2IF2A 1VQ1A 4ZDKA 4ZT7A 3UH0A 3W5JA 4RPHA 4OI1A 5JDIC 2GEJA 2W4QA 4KXYA 4LYAA 3A06A 4OIFA 2EERA 1JJ7A 2K2WA 2P65A 3P8ZA 3U4MA 1IN7A 3QA3E 3EHDA 3WMGA 3LPDA 1ZKDA 5F9MA 3HKBA 1ZBDA 3JASB 2BZ1A 2JC3A 3NBXX 2GJSA 3BXXA 4KRYA 3O4VA 4E5YA 4CTKA 4I36A 1WQ1R 4ZARA 1OX6A 4QO8A 5CNKA 2C7RA 3NJRA 4XSHA 5T3UA 1SD2A 4ZV7A 1YUBA 3NNSA 3OICA 1TYAE 1HZZC 3B85A 1OE0A 3MJCA 3R5TA 3G9QA 4EG4A 3OMWA 3IL2A 1RXUA 4RD4A 3DUFA 3MLBA 5DNAA 1RLMA 3AHDA 3NUQA 4QDJA 3THYB 2PMKA 3GYGA 1T3TA 4IOKA 4RK7A 3ZD9A 4M1YA 4LF9B 2JGAA 5T41A 1X13A 1MMFB 3AO0B 2VZLA 3V2UA 4HH0A 4OKNA 3DBHB 3DH0A 1YZGA 1T0BA 1XJWA 4DF3A 5LU8A 2PGJA 3QEBZ 1SCAA 2QLFA 5J9FA 3CWQA 3OUZA 4DWVA 3A11A 2Z6UA 1N2BA 3B2EA 1U2DC 1DELA 3NAZA 1FW8A 1XPJA 1L4NA 4E33A 4QT4A 4HH4A 3RI3A 3A1WA 1HC7A 2O5VA 4HEHA 5C4GB 4RCZA 3WWPA 5F9FA 1Y6GA 1EFPB 3O94A 4Y6GB 3RS2A 1PWEA 2D0DA 1NY5A 3E1KA 1T9HA 1AHHA 4RMJA 3IJRA 2FA9A 3OSUA 2BMFA 3DS8A 1G5FA 2C2BA 4RPLA 4KREA 5FQNA 5IXJA 3G68A 3L40A 4FIZA 4JCOA 2C3UA 2HCRA 5AKHA 3VQTA 3A25A 4YPVA 1JQLB 1KARA 4JUIA 3OZTA 4NNJA 3KDAA 2ZIWB 1TW2A 5I7UA 5JXGA 2EJWA 3NYWA 5BORA 4CKCB 3KCNA 1FW6A 1TD1A 4KQ1A 4P36A 4YNBA 4AJLA 1NVEA 3PR3A 4XJTA 3LAWA 1FNNA 1GTZA 2CYBA 2RGGA 4BQRA 3Q8MA 4Z4EA 3AZQA 3WLTA 1DRVA 5CG2A 4B9EA 2ZQZA 1VIDA 3P2JA 2FUG6 4IDEA 2UYYA 4BFUA 1X8KA 3ETNA 1RHJA 1WHSA 3BC1A 3NDPA 4OPMA 4BNHA 5T7BA 3WV4A 1AS3A 3GVXA 2GRAA 5MDHA 4JC8A 3KKKA 5FWYA 2M6LA 4CLHA 4R8MA 4WZAB 2FDRA 1OB5A 2QN3A 1BS2A 5EWMB 2HQOA 2JGEA 1MBZA 3EVGA 4TTSA 5F3WB 2J45A 4V3BA 4N3GA 1TGVA 4UEQA 4ZRNA 1BX1A 2LKDA 1L4LA 3VPHA 3JQDA 4RHFA 4RA6A 2P9EA 2CLOB 2H9YA 2OLKA 4C7XA 3K0HA 1KORA 4GYWA 4WOCA 4FLFA 3ZCUA 2CVHA 4GBGA 1I4OA 3G7SA 3ITDA 1UBMS 4Q93A 3DEFA 3FOAA 3SJZA 3I6YA 3LXMA 2I67A 3D6NB 3SAJA 3O8QA 5FYDA 3X3HA 5JV5A 1IK4A 1QG0A 1R1DA 1PFQA 5HJ7A 5EMNA 2NU9B 2GVNA 2VYQA 2IITA 3PWZA 5DE3A 2WIJA 2QRKA 4E7OA 1XZHA 1ZD2P 2E4YA 3ZY3A 3I6QA 4RGBA 1ITZA 3V7WA 3EVZA 1JHDA 4C4TA 3OCCA 3OM0A 2CXPA 3AM4A 1JQDA 4LMBA 1DKPA 4LY6A 5B37A 5CVDA 3WJ7A 2WD7B 3BHNA 3Q41A 1MJGM 3HVIA 2BTQB 3EA0A 1XHFA 1KSGA 3AVUA 4WY2A 1F2TB 1OIXA 3OY7A 4DLBA 3H6GA 2CLLB 1RU3A 5BYKA 1QRTA 2XUFA 1KDVA 1R8JA 4JODA 1ISJA 2DE0X 4FSHA 4NQRA 4NH0A 3BXEA 1YT5A 4PTYA 4X24A 3HB7A 2I3DA 4K28A 5K0CA 3CJRA 3PJRA 3K72B 4ZQCB 4KUHA 1P1IA 5CBPA 5CD9A 2W42A 4DR1B 2VJMB 3T4EA 4DCOA 1HX7A 4O4IA 3AMVA 3RUAA 3T0GA 4IIEA 1XZLA 3LYAA 2GO1A 5LWQA 5EINA 5EJFA 5EIEA 4QJIA 3QVOA 2OGSA 3KLPX 3G2NA 3ZTYA 5I8PA 2FZCA 1CNEA 3KKOA 4G0YA 2NVOA 4FZVA 5TV2A 3UFBA 4BFLA 3D3EA 2WAMA 2WEKA 2CVQA 2YZ7A 3EAGA 4HGYA 2CXUA 3TECE 2B2NA 3DE6X 4OJKA 3BM5A 1JR4A 5K03A 1V11A 3U2QA 3VR5A 4EEXA 1UJBA 3H4MA 4FYIA 1CUDA 1YCFA 3ORYA 3C4JA 1Q0QA 1Z2OX 2QSYA 4JEMA 4NVRA 4DSNA 4W6ZA 3EF3A 1RRMA 1S7CA 5K4AA 1G8PA 2VTEA 3IUBA 4FGKA 4KLZA 4S1PA 1RCTE 2H4JA 3FCAA 3NONA 3Q3CA 4IGKA 3ZUGA 1AB6A 1DHRA 5KNBD 1JKJA 1NMYA 4AXXA 5A5EA 4CM6A 5B1EA 2MIIA 1XJ0A 4P81A 1ZRHA 4ZAZA 2VK2A 4X1KA 5SYMA 5KKCA 4I66A 2Q3LA 3DZCA 3L7BA 4HXFB 1KO5A 1VG0B 3P9XA 1SJ9A 3QXXA 5A4KA 2QL6A 3K8OE 3EWNA 2Y1GA 1LBQA 1TU0A 2WYIA 2QX4A 1FS5A 4AM8A 4I7EA 2H9AA 2XMRA 3AHGA 3WLOA 3L8MA 5M2QA 1KVQA 3WB0A 3ZKAA 4RQAA 4Q24A 2GBLC 4C0XA 2B5WA 4B3RB 3NBUA 1PWHA 5CK4A 3EZ7A 3R4VA 2WW8A 2K2QB 2P7IA 2M6KA 4JBWA 1GPAA 4BKMA 1DMRA 1X7DA 4LJLA 2HR1A 2D5LA 4NLLA 5AVUA 3QUCA 3NVDA 2H2WA 2PH7A 2SHKA 2XXBA 3FB4A 4BLOA 5C8YB 4ZGWA 4Z3OA 2G0TA 4KE8A 2WZCA 2SECE 3CSDA 3HKEA 4RK1A 1ZWLA 3LBYA 4YJHB 5AI0A 2YW2A 1DUIA 1L6IA 4GC5A 1EM8B 5A4IS 4GD3Q 4KDEA 1PJ4A 4OHMA 1VE6A 1PVOA 4JOQA 2H4HA 3OA0A 2FZKA 1Q3TA 5IU6A 3DPSA 2FPKA 1G5IA 2OQ2A 2ZRDA 1W5SA 1QOZA 1NW7A 4MP6A 4Y2VA 2NSYA 5K4GA 4F7WA 4Q1VA 4BUCA 2Y99A 4QUAA 1Z88A 2F43A 2OG1A 4FFPA 3H2JA 3VKFA 4U2GA 3IURA 1ZSNA 2V7VA 2IHNA 2VDLB 4BFSA 5A9SA 2CCKA 1UMBA 1IUOA 1IN5A 4DMHA 2K87A 1T4MA 2DSTA 3GEEA 3Q98A 2AW3A 2PKQO 3L0DA 3MW8A 5DSZA 4GMKA 1D1PA 1KNQA 4RSHA 4TKUB 4G4GA 1NVFA 5AIAA 3SJUA 4BJ1A 3OPYB 4RORA 5BQ5A 2ZR9A 4AN4A 1DJPA 4XQCA 3D0OA 3GLSA 4JJKA 2CJFA 1CZOA 4J3JA 3KXDA 2Y4NA 4MHTA 2YS7A 3EZGA 2NSDA 3WK4A 4N5HX 4RWZA 1LPSA 2LZ0A 2D0IA 2VUIB 3FOCA 2P8JA 4PFSA 5B6PA 1WPGA 2IZ0A 3A14A 3DCYA 3TINA 2H4WA 5ILOA 3VZBA 4LCEA 3R3UA 1VYVA 2ZYRA 4CTMA 2R7KA 3IJEB 1TT7A 3HVRA 4DUZB 3ESXA 4DCJA 1UQTA 5I7RA 3TQHA 2CVZA 2FHPA 4BLQA 1ZCFA 2OBMA 1OH5A 2XKJE 2C04A 2FRDA 2WA2A 3STVA 3NWPA 3UQZA 2PSEA 4KE7A 4ZOAA 5SICE 3X1WA 4A6DA 2BZ0A 1MHTA 4RVNA 4D0RA 1D0IA 2Z5LA 3WJ2A 4G5YA 2QUZA 3ACBA 1S5PA 3GDWA 5B1HA 1NX9A 1ZJZA 2XT6A 2IY8A 1MO3A 3H0CA 2GEFA 1I6WA 4XH9B 1TI7A 2VK4A 3E53A 2ZLBA 3LRPA 2ZGVA 4OQXA 3VJLA 3E8SA 3ZR4B 4ZO8A 3RKSA 4CF3A 1FYEA 2RG7A 1OFUX 3LUKA 1M6HA 4ON9A 1FTNA 1YO6A 3MS4A 2CXSA 3P9KA 1KKLA 3PFKA 3BKWA 1BKYA 4AZ3A 4ARBA 5LOVB 3BCSA 2G7MC 3G0GA 3ZG6A 1WMAA 4JJ6A 5FR1A 5KYKA 3CTPA 5FNVA 2BIFA 1KEZA 3L7YA 5E9QA 1OFIA 2I4TA 1MJGA 3EZXA 2BKEA 1OLUA 3TD6A 4QQNA 1OXSC 1WOYA 4JITA 4ZODA 3RVDA 3IQIX 4Y9TA 1HTTA 2ZBDA 1TT5A 2QD4A 4W82A 4LK3A 2CHGA 1JLHA 3NXSA 5DW0A 4DMRA 4GBJA 4B09A 1Z28A 4RDIA 1PAUA 1W73A 4XUGB 1V5GA 3AKCA 5GJCA 5DM1A 4TWJA 1GN9A 3ZGVA 1T5IA 2GJKA 1SUDA 3PQEA 3M1YA 2QDKA 1I3CA 1SOMA 3R0QA 1PK9A 4UNSA 2PKEA 4BVKA 1PQWA 4MICA 3DVAA 3ENVA 3C2QA 2Q5EA 4LQLA 4AL4A 5AOBA 3ONWA 1QONA 3PFGA 3CBQA 4FKBA 4J1QA 2VTBA 3KZOA 1AKRA 4RZXA 4XZ3A 4ND1A 3NWBA 1UBUS 4TVBA 3U26A 2I6GA 5BWBA 4LRWA 3V1KA 1XRQA 1EHYA 2FW9A 3KQLA 2EKZA 1JKMA 1W5FA 3AQIA 3QF4A 4Y1GA 2YVAA 5E6SA 5CDHA 4DNPA 5JXHA 3R44A 3U3ZA 2V54A 2H57A 4EWLA 2ZAOA 2Q3JA 1P9OA 4QU0A 1M6VB 2F3PA 2I34A 2ZB3A 4MCJA 2YWHA 3B3AA 5K3FA 4EHKA 1NVXQ 1A88A 1Q21A 3QPWA 5BSUA 2PU5A 3FVVA 4WXPA 3O8QB 4X8LA 1RZRA 2YVKA 1NVUQ 2ZIFA 2H17A 1ZRMA 4OB8A 3H65A 5TF4A 1ID8A 3F4BA 1AMOA 3QVMA 1RP7A 4IEIA 3P2EA 2ZBEA 3REOA 1EFTA 1ONPA 4IM7A 5L3RA 3Q8LA 5DHFA 3DEZA 3FJYA 2WFLB 4IZ6A 4MV3A 1HQYE 1WPQA 3RE1A 1K4YA 4BVEA 3A6KA 2AX3A 3KJXA 4WDRA 4Z1MD 3T5PA 4JJ8A 2IH4A 1MW8X 4P0QB 3DOCA 2SNIE 2G5PA 4IH1A 1XZFA 2XQGA 2QTMA 3Q1LA 5JSZA 4JJ4A 4LRTB 4MAMA 3ZCVA 2RHOA 3B36A 3AVWA 3DYIA 1XLTA 1X39A 2W2KB 4ALNA 1XMXA 4LWZA 1AA9A 4KIWA 4L85A 1TZCA 1N6KA 5KTOA 3ZEIA 1NJ1A 5IASA 3GT3A 1ZAKA 3M1LA 4KAFA 3C6ZA 3I5MA 4WBNB 1C7FA 3PICA 2GRUA 1BS9A 2JKVA 3QTTA 3VVLA 3QVVA 2OEPA 2KYRA 5IANA 5H4HA 3HKDB 4OA5A 1JHYA 5G2OA 4X64B 4ZT4A 1WB6A 3QRWA 2FPIA 3NIWA 4TLBA 2BMVA 2HX1A 5I6DA 4B3CA 5LYYA 3T9BA 1Q0UA 3FA2A 4RVDA 1VSTA 2EFYA 4DKXA 2JFUA 3EG5A 2ZYVX 3HS3A 4CXMA 1WDLA 1WPXA 1THGA 3IVMA 3NORA 1XXHA 4MDFA 3QHPA 1SKYE 1CW2B 4ZVOA 5CEEA 3LUAA 4OHWA 4TYQA 2M2IA 4A2QA 4BMYA 5KCMA 4I08A 2QN1A 4RTOA 2YWRA 2BMWA 3KT3A 1T0IA 1YZVA 1IQRA 1DKLA 3GJ7A 3QEJA 1OU4A 1JLLA 2N9UA 1YRBA 2HKIA 1AV7A 3A6JA 1PGQA 2WSLA 3EH2A 2VDPB 3B13B 4I5EA 1GR1A 4LE0A 4XXHA 4LW8A 3L43A 4D4MA 2C9OA 4TGLA 1EIWA 5KUTA 3F8WA 5KNDA 1VJCA 4FCVA 4IEFB 4RTPA 4I1RA 1AUXA 3WL3A 5DNYB 1ZIDA 1JHQA 5IRCD 3DBHA 2XW6A 4LOAA 4RH1A 2V5UA 5ESWA 3GXOA 1Y5RA 1Z0KA 3L1VA 4FFMA 3K15A 4YIKA 2XRFA 3WGVA 4R1MA 4TZKA 4EMUA 1B15A 4LDRA 3WTCA 3DHWC 3NIFB 3Q0EA 4URHA 4CGYA 2DERA 2GBGA 3P9YA 1BVHA 4DJFC 4G2NA 2WK1A 2HHAA 4E70A 4ZP1A 1O97C 4D9HA 3EUEA 1YIOA 2XB8A 2G07A 3I30X 4Z7QB 3VPAA 3U4QA 2GM5A 1HRDA 3QLUA 5DRYA 4QDXA 4GWGA 4J0QA 2O06A 3D2CA 1FZQA 3NGXA 2CE2X 4U7GA 4BKUA 5EHQA 4KEAA 5IW8A 2X0NA 3VVMA 8AT1A 3N0WA 2VSFA 5FTWA 2BEWB 1E4OA 1BYUA 3AR7A 4XB2A 5AQEA 1MD9A 5EUQB 3FH0A 1TCVA 1BSVA 2Q4OA 2JFOA 3QQ5A 2JW5A 2WD9A 4V38A 1Q0LA 1A7KA 4B48A 3OQMA 4DFDA 1QLJA 1L3BA 2OK7A 3SZ3A 3KDSE 3HA7A 1EFHA 2HBRA 4WPGA 5GONB 3FROA 3SZRA 1LBSA 2YXPX 1E18A 4N3BA 4QODA 5K3EA 1PDWA 3RSHA 4FCCA 4PHGA 5C81A 4GMGA 2Y93A 5ICMA 3D6AA 4UCQA 1I2DA 1J09A 1U0NA 2XNDA 5EPOA 4TLEA 2XA9A 4FWTA 4MS1A 3O26A 1YB6A 1S2MA 1SCKA 1II8A 3E2MA 5CURA 1YZ3A 2GWHA 2RH5A 4ZCSA 4E4RA 2IXTA 3M81A 3HADA 2NVUB 1O0BA 5I7AA 3BILA 3RIYA 1VRVA 2COEA 2KX7A 4W99A 1ZO8A 3SIRA 3AKZA 2O19A 3V8BA 3EUAA 1X1RA 1P61B 3MUNA 3TQQA 1IXZA 3DCNA 3K35A 3L7KA 4IH4A 4KQ2A 3Q9LA 2R8EA 1KI4A 2PSJA 1J00A 2GF0A 1HOTA 1A9TA 1CZKA 5AR1A 2PS1A 3OETA 1GCAA 4XGQA 2PANA 2XMPA 1UZLA 1PUJA 3INNA 2HH9A 3MM4A 3TTTA 3REQA 1RYHA 1R3DA 3VNVA 1J24A 3NC0C 2FPIB 4OAPA 1CVRA 5HKBA 4DMCA 1PJCA 4OU5A 4RQUA 4WNAA 1ORDA 1Z4MA 4ZHSA 3NHZA 3WJ1A 1QTQA 2GJAA 3HNOA 3S2YA 1KK2A 5DI3A 1H2YA 3HCDA 4X6XA 4EY6A 3D6VA 1FL9A 1RJGA 2EC5A 2G1KA 2QRNA 4HLCA 5UKDA 5BN3A 2O5CA 4KV9A 4BOYA 4CKEA 2AN5A 4EHFA 3CW2A 5ADUS 2B4YA 1ZFNA 3BULA 4C2AA 2JIDA 3WAKA 1H66A 2AD1A 2Y0EA 4TLDA 1L1FA 4FQ8A 2WJWA 2WTBA 2VHZA 1GZVA 3DD1A 1U1FA 2XCTB 3CVWA 1PDVA 4Q3DA 5JCPA 1H05A 3EARA 4KK3A 2N1MA 4XPIA 1D9ZA 5IC5A 4PYOA 4FXPA 3IIEA 1KC3A 3EZYA 3LU1A 4LYEA 2I6FA 4XTRA 4BP1A 5B4TA 3F49S 4HDKB 5B53A 3HBMA 2QN9A 2W2MA 4WBXC 1U9YA 2F3TA 4S1TA 2O59A 1IBSA 2QAGB 4AS2A 1TYDE 1ZGZA 2C2HA 4UATA 1Z35A 3BGIA 3GHYA 5DU2A 2N3ZA 3S7TA 1J1IA 4FZ3A 2E87A 1MPTA 4YI5A 3IYLW 1E1QA 4YCLA 4NEHB 3AHFA 1SA0B 3LMKA 4RGYA 3LNCA 5JHGB 2IDJA 1N0VC 3SX0A 2NADA 2ZITA 2I3BA 1L5NA 4B33A 5BSEA 1R4NB 3KQPA 3AU9A 4QOFA 3T7KA 1IWBB 1P1BA 1A04A 3IT1A 1JB1A 4JHXA 2QZ4A 4TQAA 4BAZA 1DXQA 4BE9A 3RLFA 1MX5A 1NXSA 3NO4A 4P8RA 4TLCA 1J2JA 1KHTA 4ZOLF 1HDCA 3IGFA 3KAJA 3TJMA 3T15A 1USIA 2Y3IA 1BKSB 2FZLA 5JD3A 3I61A 3M2TA 3H42B 1UK7A 2HWXA 2JJ8A 4G1MB 1XZKA 3HKCA 5MFPA 2FP4B 2DBYA 4ZI3A 4TKUA 1YJCA 4I2VA 4F71A 5JFOA 4M1WA 4PHCA 1GSAA 1G20E 4ARCA 3ZE2B 2VCYA 3AR6A 1LX7A 1FP2A 3DB2A 3GC6A 5AOAA 1HE2A 3P0FA 5EJ2A 4AZWA 4EHHA 3NCTA 4AT1A 4YUVA 2C42A 5D1NA 4K1LA 3RKRA 1H85A 2QRVA 3CW9A 2K5UA 3OT1B 3DFMA 2PEZA 3QBJA 1OBVA 2MU1A 3HYTA 4GAEA 4GQAA 4BZPA 4ABTA 3PUHA 1BMTA 1ARZA 4CEHA 1TJYA 3F71A 4LVUA 4TMVA 3TD2A 3DBIA 3VISA 1BKDR 3LXUX 4GZLA 4IMPA 2GERA 4ZT6A 4AO8A 4HB2A 2DTEA 3C7DB 5DHUA 3ADOA 1XROA 2PZLA 3BXFA 1RI2A 3A4YA 2VH5R 1DE0A 1X3SA 2X8BA 4ODIA 3WJAA 4KO8A 1EM8A 2CYAA 3IUYA 1UKAA 4G4JA 1P6XA 3P2KA 3BMNA 4H4CA 2E6KA 5TMDA 4IQGA 5G1PA 4I55B 1YV9A 1P1JA 2P9JA 5SZHB 3FZYA 3HJCA 3VPFA 3HJHA 3HYRA 2OAP1 3D6HA 2DLNA 3G5AA 4PLVA 1XA0A 1A8IA 1CBUA 4TOIA 4EMTA 4BV2A 1FSPA 1I0LA 3AHIA 2GLXA 3G2OA 1ADJA 1GDDA 1MKYA 3TFOA 1XIVA 2H29A 2OFOA 2PH5A 3MBOA 3TW8A 2VQFB 1YBVA 1JXAA 1UKEA 1WRBA 3EK2A 2ZG6A 2QN6A 1MLDA 1KJ8A 2MSWA 1NZFA 2FJUA 2ZYUX 3D0RA 3LBAA 3QU2A 3ZGLA 2YXDA 4B7UA 1T5LA 1JHXA 3EF0A 4Q9NA 4G41A 1GZDA 2FU5C 1SU4A 2BTQA 5K0JA 3U7HB 3KJGA 4TKMA 3ZY4A 3WDLA 3Q8KA 1ZRNA 1GM5A 5SYNA 4OQDA 4C76A 3V46A 2IP2A 2BVNA 4ARIA 3UHOA 1VL5A 4CL3A 3MELA 5K8UA 3ZCRA 1VI5A 1S2GA 3GBPA 4PHFA 3MTIA 1CIVA 1DAEA 4LZZA 3N6VA 3OHMA 1E5DA 2FLKA 2Y0PA 1XHEA 2RHJA 2QVZX 3CCCA 3KZVA 2KHZA 5LR6A 3PKZA 4LBWA 2V7PA 1MC5A 2IVFA 3LGXA 2H2FA 3PQ4A 1PT5A 1C14A 1UC9A 4MEJA 4N7MA 1AQYA 3WOHA 3GLTA 4HTFB 3ZU2A 5REQB 3EISA 3X44A 1KQPA 2YHBA 4DEXA 2IYUA 4FSXA 1JDVA 3HNRA 1HYBA 2UVDA 2I03A 4DQLA 1RAAA 4E5DA 2XF2A 2J6BA 3F6YA 2D2XA 2BOVA 3DL2A 2UYOA 4FC6A 4JQZA 4TKVB 5K8TA 1LXCA 2QVXX 4HX2A 3BFPA 5AVWA 1Z2EA 3KLNA 1FX1A 2GVDC 4G01B 3DAFA 3LUGA 4YJ2F 4TYMA 2EZ8A 3CNQS 2FMHA 5FPQA 4X8OA 3BREA 4RVGA 4W5NA 1F4LA 3TNFA 1E4YA 2V1XA 3VC3A 3BXZA 5IABA 1ZUHA 1M1YA 3F90A 4OLFA 1LFAA 2UVQA 2GLTA 3HCBA 3X1ZA 1OZ0A 1MAVA 3KB2A 4XJVA 4NZPA 5HP4A 3NHKA 2CFRA 5H81A 2IF0A 1P1CA 3G8YA 3UQYS 4O59O 1UBCA 4EPTA 1VCHA 2E1PA 1D2MA 2C9ZA 2RHLA 1RYBA 1Y7TA 1FQWA