3QPDA

Structure of aspergillus oryzae cutinase expressed in pichia pastoris, crystallized in the presence of paraoxon
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
187
structure length
186
Chain Sequence
LTGGDELRDGPCKPITFIFARASTEPGLLGISTGPAVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIAEAQGLFEQAVSKCPDTQIVAGGYQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQERGQIANFPKDKVKVYCAVGDLVCLGTLIVAPPHFSYLSDTGDASDFLLSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cutinase 1
publication title Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 68
structure length 186
sequence length 187
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qpdA00
4AO8A 2JGEA 1LPOA 2VJAA 4Q34A 1WB5A 1ZI6A 1JMKC 5AK4A 4F60A 4C6HA 2HFKA 1KU0A 2CB9A 1SCQA 1P0MA 2HU8A 2OXEA 4H7HA 2OAGA 4EZIA 5AHXA 3MVEA 1NU8A 3N2ZB 1JU4A 3C45A 4QDXA 4ZWNA 3I2GA 2XE4A 4Y2YA 3M81A 3O9VA 3G0GA 4ZGBA 3ZLVA 1LPBB 1YA4A 1GXSA 1EK2A 2D0DA 3O4JA 5T4BA 4GLBA 2XB6A 4X94A 1EX9A 3GZJA 1U2EA 3G0BA 4UHEA 5H3HA 2J4FA 5AI5A 4KRYA 3H2GA 5LKAA 1AX9A 5BV7A 4BC1A 3W9UA 1UOQA 3O4HA 1LLFA 4DLNA 3LCRA 4EUSA 3S8YA 5JATA 1MPXA 3I1YA 3H2HA 3ZPXA 3JYHA 3VJKA 3OTQA 2QUAA 2ECFA 5ALYA 1JJBA 4H7KA 1H2ZA 3OM8A 2X76A 3HABA 5EHXA 4E15A 3GUUA 3DYIA 2GYWA 1YA8A 5CT9A 2XQFA 2Y2VA 3GFFA 4FTWA 4MQMA 5AI9A 5ALRA 2QR5A 4QDZA 3WQHA 3D5EA 5BOVA 2BUAA 2ACKA 4J0HA 4GECA 1VE7A 4UBKA 1JI3A 3DKRA 4WFJA 2WLSA 4KR0A 4X97A 3AIKA 4ZXFA 5JZSA 2Y6UA 5C8XA 1R9MA 1CUSA 4BTLA 2XDWA 4QZVA 1UZAA 2AJCA 3WLAA 5A7GA 3R3XA 4X6XA 3SK0A 1X2EA 1B41A 5ALEA 1MNAA 1UT6A 2DQZA 1UK6A 5HZGA 1ZJ5A 2WHQA 4DNFA 1ZD2P 4I3FA 1DTEA 2XUIA 4E46A 4G9EA 1H2WA 1AZWA 3WL5A 4JEIA 4RNCA 1EINA 3O4GA 4A16A 3BL8A 4RGYA 1MAAA 4OUKX 5CT6A 1UK9A 1ISPA 4JYPA 2XUFA 2P8SA 3IBTA 3KOOA 4GW3A 1H2XA 2RGUA 1LBSA 1ETHA 2XMDA 4G8CA 4UBMA 1LZLA 3C5WP 3I6MA 3G9TA 3V9AA 4ZV7A 4DGQA 1W52X 1U4NA 1WB4A 1R50A 1QJ4A 3IIIA 4F21A 3DOIA 2XLCA 2WIKA 1D07A 4A23A 3N0TA 3W06A 4EY5A 2CKMA 4WY5A 3MGAA 4Y2JA 1XKTA 2WIFA 4QDUA 5LZ9A 3HRHA 2AJDA 1VE6A 1GZ7A 4Q3OA 3RM3A 3PICA 5CMLA 1GPLA 3WWCA 1XZFA 4U2FA 1ACLA 2RI6A 3D4LA 1ZD5A 4Y2VA 2H7XA 3MUNA 4ETWA 5JASA 5F4ZA 4Q05A 3PDCA 1XQVA 5AK6A 2C0PA 2JEYA 3E0XA 4QDOA 4W1PA 1UK7A 3BXPA 2DR0A 2XI4A 3DEAA 3HSSA 1ZD3A 3BWXA 3G9ZA 4HS9A 1EDBA 4INZA 2WKWA 4FMPA 5CT8A 4CG1A 2ZYIA 5I7UA 4H77A 2GBGA 2XQIA 3A6ZA 4LHEA 5J3JA 1ACJA 2FUKA 3TRDA 1AQLA 1BRTA 1CUFA 2HA6A 1QIJA 3F98A 3BF7A 3EBLA 2UZ0A 3AIMA 1USWA 4J3JA 2QVBA 2I3ZA 4JUIA 2O2HA 5AOCA 3EIOA 1YB6A 5EIHA 2V96A 3PUHA 4MEAA 2BKLA 4HRYA 3U0VA 4EY6A 1UFOA 3STVA 1XKLA 4Y2UA 3HJUA 4DNPA 3DOHA 1XZEA 4H7FA 1P0IA 4HRXA 1TCBA 3ESBA 4RE5A 1CEXA 2PSFA 3I2IA 4BBZA 4E11A 2ZYRA 1CUYA 4YPVA 1AC5A 1QIHA 4V2IA 4BAZA 3QYJA 1XQYA 5FPQA 4F5ZA 1R1DA 1AURA 3FBWA 3JW8A 4NMWA 5AJHA 5FPPA 1LPMA 2XMCA 4MYDA 4OB6A 3F97A 2Y6VA 2C58A 3D2AA 1UOPA 5HFNA 4P92A 4CG2A 1XZHA 1BN7A 3G0IA 4KRXA 3ESDA 4OD0A 1HLGA 4HXEB 2BGNA 1QFSA 4IHAA 4BC0A 5FDFA 4QLAA 2BGRA 2RHTA 3WK9A 4EY8A 1DQYA 4C01A 1R4ZA 1WB6A 5ALMA 1CR6A 3IURA 5A7FA 1G42A 3ILSA 2IX9A 3G8YA 1W75A 1JT2A 3FAKA 4PW0A 4L72A 3WWPA 2XMBA 1YS2X 3H04A 1PV1A 4J0JA 4UBOA 4DMHA 3BDIA 1VZ3A 1ZD4A 1L7QA 2PVSA 3BDVA 2LIPA 1QIFA 1Q84A 3BIXA 3WL7A 4DTCA 4QWWA 1FFCA 4MYSA 4S0XA 4X85A 3VVMA 2C7BA 4B85A 4QWMA 3AJAA 2BAGA 5ALUA 1EB9A 4KAFA 1BE0A 4P08A 4W1SA 1EK1A 4QE3A 4XIIA 1Y37A 2WUDA 1EVQA 4N8EA 3FVRA 1L7RA 2ZJ7A 4G5XA 1MX5A 3R41A 3QM1A 4UFNA 4IH1A 4RE6A 3DJYA 3FOBA 1QIMA 3ICWA 5K5EA 3V1NA 4OYLA 1ZIXA 4MWSA 3Q8WA 2O7VA 5AI6A 1Y7IA 4H18A 4EY4A 2B4KA 2B20A 3HI4A 1HL7A 5HF5A 6YASA 3WL8A 5LLSA 5JAHA 1JJIA 2OAEA 3WA6A 2WIJA 1VOTA 1DT5A 4BE9A 1EDDA 1LPNA 4OPMA 3FYUB 4QLOA 3DQZA 4BATA 1N5MA 1ZOIA 5LZ4A 1JMYA 2VT7A 5FXMA 3FSGA 1XZCA 4BZZA 1EHYA 2ONCA 1YB7A 3FLBA 3G7NA 1K6EA 3WKEA 4UPDA 3AZQA 1ODCA 3IB3A 1WPRA 2R11A 1RYYA 5K3CA 1F0NA 4P93A 4BZWA 4HXFB 2AJ8A 4X71A 4BCCA 1QTRA 4B9AA 1C7IA 1XQWA 2WJ6A 1LNSA 1GPKA 1DU4A 1QFMA 4LXGA 1XFDA 4H35A 3K9BA 3VJMA 1P0QA 4KE8A 4C88A 1GGVA 1E66A 2FX5A 2WG0A 4PF1A 2RONA 1HDEA 1VLQA 5ALZA 1N1MA 3K6KA 2C5FA 2QXUA 2WG2A 1AMNA 1L7AA 5FLKA 1H2YA 4C4ZA 2WIDA 4QEKA 1ORVA 4DSZA 1P0PA 4CFSA 2G5TA 4UBIA 5ALDA 4FBMA 1ZGBA 3LIIA 4N5IX 5ALQA 3EF3A 4H7DA 3A70A 1GKLA 1SFRA 2IITA 4HZGA 5ISMA 2CUTA 3WJ2A 5CTAA 3W2TA 3VJLA 1ZI8A 1THGA 1WHTA 1IVYA 3DLTA 1E89A 1SCIA 4UBJA 2Z3WA 4U2BA 1A7UA 5DWDA 1CUVA 1BN6A 2DHEA 1DWQA 2W6CX 4G8DA 1MJ5A 1XZJA 3QPCA 2ZVDA 4LIPD 4Y2QA 1QIDA 4BTVA 4AZ3A 1BU8A 1WHSA 1K4YA 2HA4A 4B83A 5AM2A 1LPSA 5ALKA 1YAHA 2YXPX 3KDAA 5ALHA 2I78A 3B5EA 2GBCA 4ROTA 3PF9A 4B9EA 4UHFA 3D59A 3R0VA 4ZV9A 2QS9A 3QBJA 2JF0A 2C4HA 3STTA 4Y2RA 3IUQA 3M82A 1EVEA 1BS9A 4BRSA 4CI9A 2WFZA 3K2IA 4FBLA 1MAHA 4M0MA 3ESAA 1OXMA 2BUBA 2E3JA 1Y7HA 4Y2SA 4DNQA 3QMVA 1T4MA 1QE3A 3I2KA 4AZ0A 4BYMA 3DYVA 4KACA 3O95A 1BCRA 4JYMA 3VXKA 5C8VA 5ALJA 2GYUA 4PO3X 3AIOA 1CUEA 2PSHA 4U2CA 1VKHA 2OCGA 1UKCA 2J4CA 2VSQA 4AQDA 5SYNA 4WFKA 2H7CA 4RPCA 3I28A 2ZJFA 2JGFA 2JGKA 2C0QA 2JGMA 1XZMA 2BCEA 4DMKA 5E2IA 2JEZA 4WFIA 1E3QA 4MQLA 2PU5A 1YCDA 2ORYA 4JNCA 1TKRA 3TEJA 5E4JA 1E8NA 2JGJA 5DLPA 2RIPA 4UHDA 3LIPA 2V9ZA 4U2EA 1QLWA 2ROQA 1VXOA 2DFPA 3DS8A 1EDEA 4BDTA 4J7AA 1QIIA 3F9CA 1XRRA 5JIBA 4FOLA 3C43A 5AM3A 3P2MA 1CLEA 1RP1A 1JFRA 3WK8A 1WPXA 2HM7A 1ZJ4A 1DINA 2I03A 4B81A 2XUHA 1IMJA 4J0CA 4PNZA 1YS1X 3QITA 1T2NA 2PSJA 3EQ9A 5I9IA 5JAOA 2DCMA 3C8HA 1YSCA 4AN1A 4Y2TA 2VJBA 4B0OA 2D5LA 1E8MA 5IKXA 1TAHA 1TK3A 1XZLA 2G5PA 5EGNA 1TRHA 3ZLUA 1MNQA 4J0IA 1EB8A 1LZKA 4L0CA 3AFIA 1X70A 4B7ZA 3R3UA 1QGED 1W4LA 1HBJA 3D7RA 4BVLA 5A71A 3F8SA 3FVTA 1LPAB 3O0DA 4PV7A 1XROA 3H17A 5D3KA 3FYUC 3SWWA 5JALA 3QMMA 4K6HA 1BCSA 1C4XA 3G0CA 3PF8A 4FFWA 1OILA 2PL5A 3SX4A 4MJ3A 5ALOA 5AK5A 4FNMA 3UMJA 2WIGA 5JD4A 3OOSA 5C8ZA 4OU4A 2H9YA 1XLWA 2AJBA 4AMYA 3R3ZA 2HIHA 2X5XA 2OQIA 5AKYA 2AXEA 4B84A 4DIUA 5LZ7A 4W1RA 4QDTA 3I2FA 3WK5A 1ZICA 1ORWA 1E5TA 4Y2PA 1YASA 1CUWA 4L3WA 4IQ4A 1KU6A 2XUKA 1MU0A 4YK7A 5D7BA 3WKAA 2WFLB 4BVKA 1CUXA 3F96A 3IVMA 4BAUA 2JBWA 3DL4A 2HA2A 2PSDA 2VQ6A 4MEBA 4BRZA 4PSDA 1XZGA 1UWCA 5HK8A 1F6WA 4FLEA 2ZYHA 5HFAA 3WKBA 2GBIA 2WUFA 3A2LA 2BJHA 2HHAA 3C87A 2PUHA 5ALPA 2G4LA 1QO7A 4C4XA 1QTIA 1RWQA 2WTMA 3SC2A 1AGYA 2CMFA 5CT5A 2XUPA 2DSNA 2WILA 2WHPB 1CQWA 1PFQA 3QPDA 2YH2A 4X93A 2HA3A 4Z49A 4Q1VA 3PUIA 4X6YA 4AO7A 2BUCA 2XMQA 1WOMA 3E1GA 2J3DA 1IZ8A 5AICA 3HYSA 3C6YA 2XUOA 4K5QA 5AKKA 2XQGA 2J3QA 5SYMA 3C5VA 3WL6A 1QIEA 1SCKA 4OCZA 3STWA 1BEZA 3E3AA 2ZYSA 1QO9A 1G5FA 4NVRA 3FYUA 4BAGA 4XVCA 4HXGA 1B6GA 2RHWA 2GYVA 1IUOA 5CRIA 5FOQA 4X91A 1GT6A 3HZOA 2HFJA 3I6ZA 5HF9A 4GHWA 1FFEA 3UUFA 2XMGA 4FWBA 1A8SA 3EQ8A 2W22A 4W9RA 5FUMA 4KE9A 3WI7A 5AI0A 2EEPA 3WIBA 2QTBA 2PUJA 5JANA 4G4GA 4EY7A 4X3CA 4H7JA 2DHDA 5LIPA 1QONA 3VVLA 1GQRA 5ALFA 3WWDA 5KREA 1LPPA 3QMWA 3HXKA 1J2EA 2QT9A 4HTAA 2NW6A 5EHZA 4QA9A 4KAAA 3D2CA 4Q82A 1UXOA 4XX1A 1H23A 5EHNA 2WFMA 1HPLA 3FLAA 4FHZA 1CUCA 5AKZA 4ZI5A 1J07A 3CN9A 1GQSA 1XZIA 4FNGA 3BE8A 5DYTA 2WJ3A 3FNBA 2QMQA 5AOBA 5K3AA 3BF8A 1CUJA 2XMZA 3EQ7A 1MT3A 4AB1A 2Z8XA 2QJRA 4X00A 4I19A 2Z3ZA 4LYDA 3FWHA 3DL7A 5YASA 2CBGA 2PPLA 2VTVA 4HAIA 2WU4A 3C70A 1JU3A 4UUQA 4YASA 2VJDA 3V1LA 1I6WA 2V97A 3A2NA 1NX9A 4GEGA 4NS4A 1LBTA 2WTNA 1ODSA 2GZSA 4TVKA 5D6OA 3HEAA 1E8DA 3QZUA 1FFAA 5AKXA 3TGLA 1TCCA 1ZIYA 4PQEA 1FFBA 3NGMA 4M0FA 1EI9A 2XQKA 2CZQA 2WG1A 5AIBA 4B82A 2O2GA 3KD2A 4UHCA 1VA5A 4G1FA 4N5HX 5DJ5A 2C5GA 5HQ3B 3I6YA 4CCWA 3H19A 2HU7A 4DYHA 3AUKA 3PFCA 2HU5A 3ICVA 5LZ5A 4J0GA 3D3NA 3BJRA 2WUEA 4DMCA 5LYYA 2JGIA 3NOXA 3NUZA 1DWPA 5K3FB 5E4YA 3LS2A 3DDUA 4GDMA 3KSRA 4BCBA 5JARA 2ZJ6A 1QIKA 5EIAA 2PBLA 4GWLA 1W6RA 4FLFA 3OPMA 3KWFA 3H1AA 4ZRDA 4G9GA 2XUAA 2XUGA 5AI8A 3VDXA 5I8PA 4Q3LA 3FSGD 5AM5A 1N8SA 2XUQA 3QH4A 2WM2A 1CUIA 4FKBA 4GXNA 5AKJA 4KJXA 5EI5A 2X8BA 4DNOA 1UKBA 1UK8A 3TJMA 3G9UA 2VAVA 3GELA 5BWCA 4CCYB 5DNUA 5HK9A 3VKFA 2FJ0A 5IVKA 4Q3KA 3PFBA 1OCEA 4AX4A 1XRQA 1W76A 3DCNA 1G4HA 2PM8A 3M3DA 3DNMA 1JKMA 2CJPA 2HDWA 1QIGA 3AINA 5IH7A 3FCXA 1Q0RA 3ANTA 2HADA 5BWBA 3WK7A 1MX9A 2B61A 3WWOA 4K6KA 2JIDA 3IUNA 4X90A 4W63A 1THTA 3IUJA 5K3BA 5AH0A 4XWGA 5CURA 1JJFA 5DNWA 1F0PA 4K6GA 1R3DA 4GI1A 4UBLA 4MXDA 4KEAA 2I3DA 1EH5A 4IH4A 3WYNA 1CVLA 5ALSA 3G0DA 5EHQA 4BVJA 3UUEA 1YAJA 3ZWQA 5AM1A 1MN6A 4WCVA 3WIOA 4BP8A 4AO6A 3RK4A 4N8SA 5K3DA 2OGZA 3BJMA 1CUBA 1GPNA 2Z8ZA 3WYDA 3ESCA 1A88A 2Z5GA 1XZDA 1ZI9A 5DYWA 2G63A 1VA4A 2HA5A 3M83A 4J0DA 3D0KA 1FJ2A 1CUHA 1VJ5A 3H1BA 3WWEA 5IVIA 5ALGA 2ZSHA 3AILA 4C4YA 5HKBA 4FLMA 7YASA 1U65A 3V1KA 4AN0A 5AK3A 3D2BA 5JAUA 3O4IA 3STXA 1W1IA 5CBKA 4UBNA 3H18A 1HKHA 4ARAA 3WK6A 4OB7A 3V48A 3YASA 5IVHA 4P9NA 5KWIA 1XZBA 3ZLTA 2ES4A 5AP9A 2WFLA 4ZREA 2ACEA 4E14A 1R9NA 1CUUA 1EA5A 2WU3A 3WZMA 3STUA 1VZ2A 5JZ9A 4WDQA 1TCAA 1WCYA 5T4HA 3R40A 1CIJA 1QZ3A 3X3HA 2DQYA 1TIBA 3QVMA 4EHBA 1CPYA 1CRLA 2IIVA 3B3QA 5LP1A 1DQZA 1J1IA 2BFNA 4AMZA 5LZ8A 3R3WA 3WMRA 1M33A 4BP9A 2FJPA 2VAXA 4O08A 4EB0A 5AO9A 4G4IA 2WHPA 1ZGCA 1XZAA 1UOOA 1XLVA 4L9AA 5AOAA 1O6FA 4PSUA 4TGLA 3LLCA 2OCKA 3O9MA 2VATA 4C87A 5FV4A 5HKAA 1MTZA 2OCIA 1TQHA 4H7IA 3KWJA 3C6BA 4X92A 1DT3A 3H2JA 3WZLA 4Y2XA 1DX4A 5ALNA 3I2JA 4B80A 1XZKA 1XRLA 3A2MA 1PJAA 3FCYA 2VEOA 1O6GA 3WK4A 5AI4A 3OURA 4U2DA 2QM0A 2B9VA 4TPKA 1Q0ZA 3IA2A 1KEZA 2Q0XA 2XUJA 4H7EA 1G66A 1SC9A 4ITVA 5DNVA 5LKRA 4QNNA 2R8BA 5CW2A 1A8UA 3IDAA 3PE6A 3ZI7A 2QRUA 4B6GA 2ZSIA 3OG9A 1DWOA 5JAPA 1AUOA 4KE6A 2HA0A 4U2GA 1ODTC 2CEKA 2DHCA 5A6VA 5AKLA 4BDSA 5AKGA 1CUZA 1CUAA 5JD5A 3CN7A 4CIAA 3QPAA 3G9XA 1CV2A 5LZ2A 3I1IA 4I4CA 4WDRA 4J03A 2OQVA 2PSEA 2QKYA 3GROA 5CXUA 5FRDA 2EDCA 4H0CA 1X2BA 5FKJA 5HCUA 2QUBA 4OB8A 3AZPA 4GBGA 2QJWA 2HA7A 1U8EA 1WM1A 4EBBA 2QXTA 2EDAA 3PI6A 1YR2A 2OCLA 3ANSA 3FYTA 5AKIA 3U1TA 4UFPA 4X7BA 4YX9A 5IVDA 1K63A 4J0KA 2Y2UA 1CFJA 5ESRA 5HF6A 5CH5A 3H0CA 5ALTA 4NZZA 4K2AA 2HL6A 1UKAA 4PSCA 1FFDA 1IUNA 2GBFA 2Y1KA 4UHHA 3AZOA 1MO2A 2H1IA 3HC7A 2OLEA 3CCBA 4IO0A 3WKCA 2O7RA 4EA6A 4FDMA 1F8UA 4OSEA 2OGTA 2VA9A 5KWJA 5HF8A 4M0EA 3T4UA 4JH0A 4OYYA 3DD5A 1SOMA 4W1QA 3C6XA 4KE7A 5JYCA 3I2HA 3L1JA 3NWOA 1XLUA 3W05A 5AKEA 2WSLA 1NU6A 5AKHA 4F0JA 4X6UA 2V98A 5EIEA 1IZ7A 3G02A 2VJCA 3T52A 5HQ3A 1IUPA 2JGLA 4UHBA 4LXIA 3C6ZA 1XQXA 1VXRA 2RAUA 5ALXA 1J06A 3W04A 4X95A 3RARA 5C81A 2XT0A 4DMFA 4WY8A 2XQJA 2XLBA 2AJLI 5JADA 3E4DA 2HRRA 1XRPA 5K3FA 2GZRA 4LYEA 1BEEA 3RLIA 5EFZA 5DTJA 1QOZA 3CCCA 4FFVA 3IULA 1CQZA 4BE4A 3R3YA 2PU7A 5T4FA 2PKYX 4KYVA 3CXUA 1FSSA 4N8DA 4HVTA 5T4EA 2O2IA 4MWTA 5E4TA 2VT6A 5AM0A 4KAJA 4C89A 3H2IA 1GKKA 4A5SA 2OG1A 3ZV7A 5A7HA 3GBSA 3H2KA 3WA7A 3ED1A 4IH9A 5CXXA 4AXBA 1N5RA 3WKDA 4ARBA 4B0PA 3W9BA 2PX6A 5CH3A 4BB0A 2K2QB 3JWEA 5DTIA 3LP5A 3MUOA 2HRQA 3R3VA 1AKNA 2VF2A 2YASA 5ALIA 3Q0TA 4CCYA 5AM4A 5C7YA 3GA7A 3L1HA 3F67A 3KXPA 4BCDA 5A62A 1CUGA 4LXHA 1A8QA 5ALLA 1C7JA 4Y7DA 5JZBA 3VISA 1CUDA 2QZPA 2WQZA 3WJ1A 4DM7A 1Z68A 5D3ZA 1Q83A 1HQDA 5ALWA 3RKSA 1MX1A 2XMSA 5K3EA 2WHRA 1K5PA 4CG3A 5DYYA 5JD6A 1S8OA 3HLKA 3DKKA 3OC0A 5FP0A 1EXWA 1DX6A 3FLEA 2H7YA 4CIBA 5CT4A 4OU5A 1LGYA 1H22A 2WJ4A 5AIAA 2XUDA 4G4JA 3L1IA 2OPHA 2YYSA 3BIWA 4DSAA 3B12A 4LKOA 5A2GA 3S2ZA 4G8BA 1K8QA 4WJLA 1BROA 4XJVA 3HACA 3C8DA 1XRMA 4D9JA 5ALVA 5KBYA 2QOEA 3STYA 4UFOA 4Y9SA 1R88A 2XMRA 5CH8A 1XRNA 2WUGA 2OGSA 3V1MA 3IUMA
chains in the Genus database with same CATH superfamily
4CM1A 5A1JA 3KE8A 1RRMA 2HQ1A 4EH1A 1VIVA 2IT1A 1NQTA 2EKDA 4G23A 2DEUA 1T4CB 1WB5A 3CSSA 3NM6B 3CA8A 5D1HA 1C9EA 4CLHA 2VBIA 2GAFA 2HFKA 4J7CA 5COQA 3ISTA 1SCQA 4X1OA 2PLRA 3U19A 2OXEA 2I8CA 1K08A 3EXIA 4AJLA 4H7HA 2E85A 3KYJB 4OBBA 4AVYA 4V3CA 4E2XA 3GDFA 4Y67A 4EZIA 1FUKA 1NU8A 3F8WA 1NI3A 2OFOA 3K9NA 4O6VA 3VHXA 2HLDD 1KKUA 2Q0QA 4ZWNA 1UAYA 2XYHA 4P3YA 1YB5A 221PA 4G4SP 2FEAA 5IWCA 4C3OB 1GYPA 3EIHA 4ZVRA 2JI8A 5IBQA 3WNZA 4MGYR 2O2EA 1YO6A 3B9BA 3DM5A 4PSAA 3QY9A 1QUFA 2M2IA 4M6WA 1X7YB 3D3KA 2YHIA 4UJ3A 4Z0PA 4BZQA 4ZGBA 1HLDA 2DWCA 2FMIA 5CITA 4N5NA 2CHUA 3K0FA 1UBMS 5AJWA 4EUFA 1BE6A 4X45A 5CVCA 2PNJA 3V4OA 1GXSA 2D0DA 1U7PA 2UYQA 3BGVA 3DDWA 1JIKA 2P4SA 2DR3A 1GL3A 3AVPA 4GLBA 1PLKA 3WP0A 5L6LB 1PRYA 3L4BC 3ONWA 4MMXB 1O96B 3PDJA 4M0PA 5AI5A 4CKCB 1ECPA 1P2FA 4K1LA 4TN5A 1XCPA 4ILKA 3TL2A 4KVZA 2JHFA 2A6PA 2QSUA 3A2KA 2MINB 3CNNA 4EFNA 1QS0A 4PIPA 3SC6A 2A0FA 1UOQA 4BO5A 3CNLA 2CLSA 1OT3A 4CV1A 1JJVA 3TZLA 4ZVPA 1DJPA 1JDBB 1QKKA 1TDJA 1ZXXA 4XVQA 4RF3A 1XYYA 3ZDBA 1AS2A 2F1JA 3DAPA 4OXIA 2Q3CA 1IBKB 1TW2A 3U6BA 1H4VB 1WTAA 3KOZA 3I01M 1MPXA 4BNXA 3I1YA 1I3MA 1RXSA 3GUZA 4G41A 2XGJA 5B1DA 4Q4HA 5HGXA 4WVLA 1U8FO 1X42A 4LDNA 2O8CB 3EXEA 4KHPB 3ANXA 1ULTA 2JZNA 2A0WA 2EZ8A 2YIVX 3EG9A 4MRVA 3PHHA 3ZXSA 2WVGA 5FO0A 3FOEC 1NW3A 3GDHA 4S1PA 4QQKA 1A3CA 2OZEA 3EY9A 3OTQA 3U1BA 3PFNA 3T1HB 1TPYA 3E1KA 2GCGA 5DNYB 3S5UA 4D42A 4DDUA 3HJFA 4H7KA 4BGVA 1NXWA 2AN5A 2GKGA 2X76A 5AHKA 1CK4A 2OV6A 5EHXA 1ZGGA 2I66A 5AXAA 5LXTF 1Y4AE 4Y1FA 2CJFA 3J7AC 1II8B 3EZ7A 1YA8A 2I3BA 1LI4A 2O2DA 2WTBA 2Y2VA 1WQ3A 2VJYA 2YZGA 4W5QA 4G1MB 1L4GA 3EFBA 3AR2A 1EZZA 3G2NA 1CJTC 4Q9DA 5ALRA 4H0FA 4QEZA 5KB3A 4AIRA 2QR5A 4L7VA 1I3KA 4ZZ0A 3VGJA 3EXHB 1Z29A 4IEEA 1VFPA 3AWDA 4O0LA 4JI1B 3RVPA 3WQHA 4CYMA 5JSZB 3AGQA 4DR7B 3HYRA 3TBFA 1EFRA 4TVSA 4YHBA 1D2MA 2HXSA 4J0HA 5JTUA 1GSHA 2VKQA 3E5MA 3TNDA 4PYMA 1KORA 1Y80A 1ZD9A 3GJXC 3Q3GE 1HL3A 1XNJA 2WJJA 3BM5A 1HORA 3N8NA 2XEXA 4V0MA 2GM3A 1PEYA 4IFIA 2F9MA 3EQ6A 1OFHA 4JBXA 3I1FA 1WDLA 2ZREA 4A6DA 5HIJA 1JL3A 2Y6UA 1MQAA 2X2PA 3VR4D 1R9MA 5GOZA 1B26A 2V0NA 4HVAA 5C8XA 2BSQA 4O63O 4BTLA 1NPDA 1X8KA 2EJTA 4L6CA 5CFOA 4MYCA 2DG2A 1EVKA 2AJCA 2JLCA 3ESRA 1OTHA 4JLVA 2IDZA 3BMCB 2IL1A 3Q9UA 5THQA 1BGWA 5FUBA 1Z7EA 2Y0PA 1ANKA 5A4MS 3LCJA 1GDTA 2QRHA 5ALEA 4H1WA 2O4UX 3MYRA 1GEGA 2NUAA 2R1TB 5CM2Z 4Q9IA 2AZXA 3FNHA 4QT0A 3FGOA 3E84A 1YC5A 4YXWD 1DAMA 1UK6A 3CS3A 3GMIA 2EOAA 4D8YA 1AU9A 5HZGA 2Z30A 2JAHA 4M21A 1NC1A 4N3GA 4DG5A 5A6SA 4KPEC 1ZD2P 1ZGHA 4AFNA 2ERYA 4JT8A 4RBNA 3RC2A 2PKCA 1E4EA 4MLZA 4ZCMA 2DWQA 2XUIA 2ZWOA 5E6RB 1SAYA 1V3UA 4IHJB 1O95C 1OGIA 1H2WA 4DKJA 1AZWA 4KMMA 5KPJA 1P77A 5E2BA 4B3HA 1NOJA 1C1XB 4LGYA 2HF8A 2HYIC 3QY0A 5KPDA 3BL8A 1E60A 4RGYA 3UB3A 3ZKWA 1CS0B 2WU8A 3IP5A 5EJ2A 4I55B 4A8PA 4RW0A 3TOCA 2G07A 1CYDA 4M9SA 1NBEA 4PLFA 4CDMA 1GGFA 5CT6A 3QLJA 1EX1A 5IAJA 3IDSA 5T7BA 2JCXA 3H86A 4QTXA 2VTBB 3MA0A 3LHDA 2JFVA 2J3JA 3NDIA 3IBTA 4MYTA 1XTUA 3FMVA 4FYWA 4WY2A 4F86A 1NUTA 2QX9A 2QVYX 2PDAA 1ETHA 3EA5A 4G5HA 2XMDA 4G8CA 4NU5A 2IYNA 3RJTA 4IWXA 4FFSA 4E13A 3MC1A 3N0XA 3UHJA 3IO5A 1F2UB 2C5BA 1LZLA 3L0YA 4YJKA 4AUNA 1KEEA 5C0OE 3I6MA 2Q7OE 6ABPA 1U2QA 3AW9A 3DTYA 3WNCA 3BC1A 5MN6A 2O0KA 1LI5A 1U4NA 1G5IA 1TYEB 1J25A 3IPAA 1FX1A 4NMXB 4CCAA 3EGVA 4C7XA 1TAUA 1FA9A 2FN3A 2JAOA 3QV2A 3NHUA 2RC6A 4JOCA 2KS6A 3K0BA 3KXIA 1QJ4A 4TYYA 3IIIA 4F21A 3ICQB 3O03A 5FO1A 5JRJA 4BEVA 3DOIA 1I4DD 4B40A 3ZVMA 4M9XA 4I5FA 2WIKA 3RTGA 2ZBEA 4TV8B 2JLQA 3ZV5A 4TLBA 4A23A 1OI2A 3GA0A 3N0TA 1ZIPA 4EY5A 3JVVA 1U8TA 4RVNA 4Z0TA 2CVHA 2UYOA 3PEUA 3K0SA 1N2XA 4BO2A 2MYTA 2IP4A 3O93A 4Q9JA 2C5HA 3DA8A 1JR3D 2DUUA 3L18A 3OU2A 1IATA 1G8AA 3HRHA 3KAJA 1Y7LA 4RELA 3OLXA 3Q72A 2FFAA 1ITZA 4U7WA 3IH5A 3T7DA 5KEIA 4QQNA 3QWFA 1LK5A 1GZ7A 2I9PA 3JQPA 3QTTA 4Q9LA 1KI7A 4ZVMA 5JPIA 3RM3A 3EJWA 1D0SA 1PJTA 3IQIX 4PCUA 5D51S 5H81A 4BNDA 1GPLA 3FE2A 4M54A 4KMRA 1I4WA 4ZAVA 3SHVA 1UAGA 4J0FA 4UXJA 1ACLA 3WWCA 4YRAA 1Q19A 4DDKA 1V6AA 3CW9A 4CQMD 2ERXA 2OK8A 3MCWA 1OYYA 5DX1A 2X4LA 4Y2VA 3IODA 3NI2A 3ZCRA 5L9AA 3L79A 2VHYA 2AXPA 4UCFA 2O3QA 2Q3DA 3AVYA 3UFBA 16PKA 3IOEA 2D7JA 1PT7A 4CMCA 1RQ2A 3AKCA 1XAIA 1LNQA 3GZNB 4RD3A 2XIQA 3GLRA 2EJBA 4B3GA 1O6ZA 4CM9D 5AW2A 1ST2A 5HCIA 1YL7A 4ZZIA 2HUNA 3GFSA 1WQ1R 5GM1A 3UPUA 1XQVA 3VOBA 4Q93A 3FMOB 4EGFA 4FXOA 3JTEA 5NULA 2ZUTA 4G25A 2DQSA 2Q62A 2YVQA 2FZ4A 2L17A 4QDOA 4FDLA 5BO5A 3T5GA 5K09A 1Z6ZA 4W1PA 1V47A 3UN1A 3E70C 1NR7A 2HIMA 4L4UA 4P3PA 2M1ZA 2AFVA 3GI1A 3MIZA 3NC1C 2ZE7A 1HFKA 3HS3A 3RCBA 2PAFA 1B0ZA 3HHPA 3DEAA 3I2YX 1ZD3A 5T8KA 1PBNA 2PX8A 1QXSA 5L6MB 5HXAA 1Q16A 3OFND 2PZKA 1SB9A 4J3FA 4RJKA 3EGCA 3PTZA 1DADA 1I3OA 5EFOA 3HUEA 3P1JA 1JDPA 1XVUA 5BVHA 2HGSA 2EC5A 1RJGA 2P1DA 3ABOB 3DH0A 1UBTS 2WKWA 3PWKA 3ZY2A 2VP6A 1IH8A 5JH7B 2NXJA 1PR3A 2WT9A 4EI2A 1QQAA 3OZVA 4O8CA 3VH4A 3K9CA 3UK2A 2HMAA 2L18A 2XQIA 3EZNA 1X7XA 3AG6A 5EC8A 5PGMA 4NPHA 3SHTA 3EVFA 4ZOLA 2OWDA 2FUKA 4KU4A 1AV7A 2IKQA 3TZ6A 3CSDA 1ZSVA 1CUFA 2O59A 4YMTA 2YYAA 4O4LB 3CSUA 3ZS8A 3JZFA 1M6YA 1T3TA 3ZVRA 1YFZA 5CD9A 4FHEA 4JOSA 4HX9A 2UZ0A 3AIMA 3BQNB 1M0SA 3GWZA 1USWA 2X8AA 4J3JA 2QVBA 5F77A 5BR1A 2K7FA 1RFGE 1SBYA 4QYIB 5KTNA 2FETA 2HXYA 4WZAA 4W5JA 4GUDA 1K5HA 3I83A 3MELA 4FI3C 3E3OA 2ILVA 5LB4A 2QUIA 3RVSA 2JKYA 3S2FA 4L8FA 4HMOA 4F1WA 2FMFA 3DHYA 4IZHA 4E5KA 4BLPA 1TM4E 3PL1A 3PUHA 1RW4A 3CLTC 4H6VA 3SLGA 8ATCA 4A9AA 3N74A 3USCS 3H6GA 2ZI5A 4XLZA 2IUUA 3U0VA 2XKBA 3NBKA 4F5DA 4EY6A 1QF9A 1NVDA 1X80B 3W5DA 2C9BA 2BRUC 4MVJM 5KWSA 2IOHA 4L4ZA 4D57A 1YUBA 2PO5A 2CNBA 3ILHA 1W94A 1DCTA 2VUTA 4F9GA 1PVDA 1A50B 3RTAA 2MSNA 1P7PA 1EGVB 1TYAE 4RLFA 4QGGA 4HRXA 4OIFA 4TLEA 4JB2A 5IK2A 5TC4A 2PN1A 4KN6A 4AS1A 4A0FA 4LJLA 3ESBA 3AH8A 4GM1A 3WLKX 1ZU5A 3PUKA 4QPCA 3I9OA 3LX4A 2XT9A 3NTVA 4E11A 3SHOA 3TOZA 1CUYA 2CF5A 1AMUA 1QIHA 3HH8A 1IJEA 4V2IA 4EPYA 1LJ8A 5KNCD 2DPMA 3DE7X 2Q5IA 4YONB 2OO5C 1AURA 2UYYA 3HR4A 3OCZA 1TF5A 3IV7A 4NMWA 3OCXA 3B3FA 4WW0A 2KLBA 2B5VA 2ET6A 2GXUA 4J4HA 1JEQB 5FPPA 4G56A 2J0UA 5LC1A 3GRFA 4LMRA 2GF2A 4OXRA 2ZB4A 1IOWA 4NBLA 1W73A 3T15A 2XMCA 3TVYA 2HH9A 1V8DA 4C2BA 1ZO8A 2Y6VA 3S2EA 1NLZA 2RBKA 2G8LA 4V39A 3EVEA 5DMHA 3ZVNA 1XZHA 3NU1A 3L92A 3O1IC 5DXJA 2Y68A 1A5TA 2NU7B 2ZRHA 2IXAA 3SMVA 3MILA 3S44A 2IS4A 5C32A 1JIUA 2BGNA 5HM6A 4EW6A 1COWD 4BLWA 1IPHA 4FGZA 4IHAA 4J2TA 4C6SA 4DADA 2G83A 5IAEA 4BC0A 5FDFA 1FJXA 1I7PA 4J8PA 4R16A 1EWYA 2A33A 4J7UA 3L7IA 2Z43A 4PAWA 2BGRA 2RHTA 3GNQA 5TMBA 5FWYA 1G5TA 1CRWG 1EK6A 1V2HE 1P1FA 2XXBA 4R9SA 5COAA 5GGYA 4MQEA 1US8A 4KVFA 3IMFA 5JXIA 2VO1A 2IUFA 4QD3A 3UOWA 3ZHTA 3AI3A 4DOMA 1N32B 1PNRA 1W87A 1HLFA 3BE5A 2ST1A 5ALMA 3ZYCA 2B7LA 2FZGA 1CR6A 2RKWA 2VNHA 3DLPX 3IURA 4PWZA 4LNHA 2GAAA 4ZOBA 1X1BA 5GY7A 3ILSA 2C3YA 2IX9A 4O02B 2NTEA 1JT2A 1Y48E 3LRTA 4P34A 1DG9A 4E6EA 5BV0A 3TDNA 3Q7QA 4L72A 1FYFA 1ZRHA 2HF2A 4QDJA 3WWPA 2HIGA 3WLMA 1HDZA 1FNNA 1CR1A 3RBXA 2YVAA 3SJCA 4HVCA 3NEYA 5FYQA 1RM0A 3HP7A 5A9SB 1W48A 3A06A 5F21A 4J0JA 1FYWA 2X15A 3NVMB 1ZD1A 3KRTA 2GEJA 3BDIA 2IPAB 1JEOA 5IYZA 3V2HA 3LVQE 3VZQA 2HLNA 2FR8A 5SICE 5CHYA 3FHLA 1NN1A 2K87A 3TZEA 3INGA 2DC1A 5KVAA 4S2UA 5A9RA 3MWGA 3A10A 3H1EA 1T4DA 5JQGB 4QGBA 5KKCA 2VYVD 5JHHB 2CCGA 3HSYA 2VF4X 1Q0TA 3KAQA 5HIAA 4TS9A 2Y67A 3BK2A 1VRCA 3BKXA 2ZRMA 3H97A 3UHPA 1ZUIA 2XA9A 4CR8A 4GX0A 1I0LA 1QYCA 2O8NA 4Z8XA 2RH4A 2Y93A 1X86B 4ARVA 1GRNA 5K8UA 1GAEO 4N18A 2GD1O 1KK3A 4B85A 3U16A 3R9IA 3UAXA 4PFQA 4QWMA 4DLXA 4ENSA 4NCBA 1I6KA 1DPGA 2ODTX 3LF2A 4JVOA 2GEDA 3EE6A 3FMPB 2P9YA 4URZR 3PEWA 4MS3A 1QF7A 1ZJYA 3O8DA 4OHBA 4KAFA 3DOCA 3TQIA 3ZZ1A 4YYEA 2UVQA 2G70A 4PZPA 1TTQB 4XIIA 4QFDA 1Y37A 1HYHA 2WUDA 2IYOA 4CEJB 1CZLA 1QGUA 4N8EA 1TIKA 3UHFA 3ZCUA 4R3UC 5DM0A 4EKEA 1PL7A 4MAAA 4KZPA 3PKIA 4ZN6A 3W3AD 1MX5A 2J6IA 1A9YA 3JPWA 3GJ4A 2HWYA 3CPSA 4JYCA 4Q02A 3X1DA 2QRVA 2AHRA 4YB8A 4A10A 1CT9A 4HDCA 3P97A 5E1OA 2FW6A 3CJRA 1JEDA 2WA1A 4KQFA 1UJ2A 3P7MA 1L8QA 3DJYA 4OX9Y 2J6HA 1TXGA 2JARA 3GLHE 1S3GA 2R7AA 2FFJA 3FWPA 1N1GA 3ICWA 2I6XA 5HTOA 4NBSA 4R1OA 4MJ7A 5GONF 2CDRA 4JAVC 4R8RA 4EITA 2OFWA 1Z2CA 1K27A 4HDAA 1H2EA 4WACA 2O3RA 2O7VA 4R2JA 1X7DA 3QVTA 5AI6A 5EKUA 2EX1A 1KSHA 5DP2A 4HNGA 3W8NA 2NSYA 3N6XA 4QO7A 5E0KB 4F97A 2GJSA 4XCVA 3RGGA 1U8XX 6YASA 4ZT5A 3IE1A 3GZ4A 3WL8A 3B6EA 2W2VA 4BQPA 2L0XA 1RJFA 3AV3A 2Q6VA 5CX1B 5LLSA 3ROEA 3WA6A 4UM9B 5JAHA 2WIJA 1VOTA 1TGYA 3GJ6A 5H4GA 4LTDA 2QG4A 1N2CE 1MO6A 2FEMA 3B51X 5JCJA 1P1RA 4IFTA 1CW2B 1DS6A 1V1MB 2ODBA 3D8UA 4ALKA 3H0KA 2BH2A 5TPZD 2NP7A 4S05A 1KZYC 3TIFA 2B2NA 1NN0A 4QLOA 3DQZA 3U3XA 1QHGA 5LPNA 4EHNA 5K03A 2QF7A 1VHJA 2P6NA 3ZI0A 4F1KA 1SU6A 5BQ5A 4BVBA 3GGOA 4F2GA 2PX3A 2WTEA 3DV2A 2FMUA 1I4EB 3KR9A 2WSBA 1YNOA 3IEIA 3QX7A 1F8FA 4HEJA 3CZ4A 1DV2A 4L02A 4KOAA 4MW5A 4M86A 2I2DA 3FPCA 5HOQA 2EBHX 1U2RA 4E08A 3IJ5A 1XTPA 5E95A 1WNTA 2ONCA 3UOGA 1OLOA 5K0EA 1Z2EA 1DFHA 4DCTA 2XQVA 3BL6A 3DUFB 5C2JB 3R24A 1C7ZA 4X5OA 2PD4A 1EGMB 1E9VA 1G9TA 4LF9B 1K6EA 4KRGA 2H31A 4MIKA 5ADVA 2IDKA 3E9NA 1L7VC 3BFXA 1RFLA 4FYXA 1XT6A 4L28A 5JFGA 5HJ5A 1N2IA 4YBZA 1J0BA 4NE9A 2G1KA 1T9GR 4QTUB 4WK2B 3B3JA 3M1YA 4TZ0A 2VAWA 1ZY2A 3NP7A 3EZFA 1NUUA 1W46A 2JJ2D 1I5EA 2VIIA 3AETA 2C2BA 3QVOA 4R9NA 2GPNA 3PKZA 1F0NA 2WU1A 4EB6B 3K0EA 2YBEA 4XA8A 3PR2B 3VZCA 4O4IA 1KL7A 4N6GA 2J5KA 1D2RA 5BUZA 5A0VA 3ILXA 4HN4B 1GPKA 1DU4A 1QFMA 1V0JA 3MTAA 4P5EA 1NVXQ 5GVSA 4P6VF 3ZIDA 3VJMA 3BH7A 4YT2A 1BU5A 2X6RA 3PIIA 4KE8A 3DT8A 3K20A 1MO3A 2WG0A 3DAOA 1XL1A 4EJ6A 3MAAC 3K73O 1P75A 1HDEA 2RONA 1WUJS 2C7PA 5BN4B 2Z56A 3DO5A 3FCUB 5DB4A 1NSTA 4GWKA 2C5FA 2UVPB 2QXUA 1KWGA 2CT8A 4JN6B 1L7AA 5FLKA 3C5CA 3WLOA 2X13A 2DYKA 2XCQA 3O3OB 5D5PA 4C4ZA 4I4TF 1TQ2A 4Q4JA 1GLVA 1GSIA 3EGXA 4M8LA 4PIVA 1O2DA 4AYTA 1R6BX 4ZI7B 1B6RA 4HN9A 3JQBA 3V3TA 4GX2A 2AUTA 1N5KA 1UBJS 3CW8X 3WAJA 3O2SB 2VP4A 1B8UA 4PLCA 4HAXA 4UBIA 4QVKA 1YDGA 3BCHA 4G5YA 2XOXA 4E1BA 4Z51A 1YULA 1UP7A 4FBMA 1ZGBA 4BV8A 3LIIA 3C8UA 4L95C 2OO7A 3R8FA 1MZPA 5CAEB 4MKZA 4RESA 2OCBA 1FP7A 2H65A 5TJ9A 3I4FA 4B71A 2YKGA 1UXKA 5TR9A 2HZBA 4NBUA 4P86A 1Q1NA 1HTTA 2HSZA 3HRKA 3R2JA 3L40A 1VJTA 4IL5A 1K98A 2DF8A 2JHAA 2JNWA 5HFJA 4D5EA 4R8LA 5B36A 4Y9UA 3WJ2A 3HXOA 2JCGA 3I32A 5D3MA 1ZSYA 1RAHA 2X7XA 4JJ4A 3FA2A 3L8GA 4EATA 1UQUA 3VH2A 4A0QA 3JD1A 5LUBA 5DM60 2VVTA 1CDZA 4I0WB 3RBVA 2UZIR 3EZ6A 3FD8A 1I94B 1P45A 1AA9A 2JK0A 3BORA 2XTNA 2V9CA 4UBJA 1ZVVA 2BBWA 4I9HA 5DMXA 3S2GA 1CUVA 1H0RA 2A35A 2ZUVA 1OPXA 1UBFA 1ZH6A 3L4EA 2I80A 3LY7A 1APBA 1J1UA 1BN6A 5E4FA 1E3DA 3C8ZA 4Y9DA 2GDJA 2R65A 3MIIA 3TM5A 1Q57A 1PD1A 1BZYA 1Q17A 1UJBA 2FW0A 2JAUA 2JBAB 3I64A 3JARA 4KTVE 4R01A 2YCLA 4EF4A 2FPXA 4DDWA 2A9QA 3PVSA 5KS2A 1T36B 4RS4A 5BQXA 2IODA 1UWVA 4WADA 4RZ3A 4AZ3A 3AMVA 4EM6A 1RPTA 2ZXUA 1DHRA 1NVBA 2V7EA 4U4AA 3J81A 2CVFA 1WHSA 5KOJA 1RXIA 4MARA 4LK3A 5E7IA 3QF4B 1QQ6A 1EE9A 4MVJG 2VSXA 3EGDB 1LPSA 3RYTC 5ALKA 4B83A 5KSYA 2QDKA 1YAHA 1FMCA 2PZLA 4NFYA 2I78A 4QU8A 1X7ZB 4RPKA 3N2KB 3WGQA 5DM70 5BWNA 3B5EA 4QO8A 4J43A 2JKZA 3UUWA 2V03A 4ROTA 3PF9A 4NENA 1GVNB 5DO9A 3X0DA 3QVSA 4MWDA 4TKLA 4AW9A 1Y3DE 3EAFA 1RCTE 1BDMA 4GP6A 3CCFA 4RAQA 3NTXA 4UHFA 3VPSA 4GYYA 1SVIA 4DJJA 4GKJB 3O1JC 3QG1A 2GTIA 1ZC4A 3CUUA 4LC9A 4LSGA 3W77A 4KR7A 3T0IA 1K8XB 1U5CA 1GD1O 1QH9A 3NNSA 1DL5A 1ORDA 1KVSA 2N47A 1AN0A 2QS9A 3A0UA 4R7ZA 2ODAA 4RVOA 5C53B 2HB6A 2JF0A 2ZCUA 1YJCA 5EQJB 4BN5A 2VQSA 1KP3A 2FFHA 4JYBA 1R4NA 1HURA 3AY7A 2QTCA 2YWXA 2AMVA 2XKKA 1E99A 5JS6A 5CB4A 2VFAA 1DNPA 1A9RA 4Q19A 1OGJA 3TH5A 3TX2A 1H3FA 1E63A 1AUVA 1SA0B 1BS9A 4FKMA 1NNI1 1SCUA 3M3HA 2RIRA 1E5DA 1RJEA 2GUWA 3D43A 2FUEA 5DM2A 5BSVA 2HQSA 3JZAA 2WAXA 1RMQA 1ZGAA 2AH5A 3DBOB 2A5FA 3IP3A 4F4JA 4GE0A 3AJDA 5JNSA 1ZUNA 3P9QA 2VT3A 3PD7A 2HNKA 4TRRA 2E3JA 4P0QB 2OD9A 1OU4A 1BH2A 4ICIA 4FFBB 2ID8A 4DNQA 1BKDR 1ICIA 1T4MA 3I2KA 4D8TA 5J2UB 5IRCD 3AL0C 1O8CA 1PT8A 5AOVA 3LYAA 3VU3A 4BYMA 4OQFA 4EJSC 4KB5A 4B5LA 3ETDA 1K7FB 3L5OA 3RAGA 5L53A 1CRZA 3PT5A 4QLBA 1S2MA 5E1DA 2V1UA 1BCRA 1VLVA 1IQUA 3KQSA 4DWVA 4MUAA 4JLDA 4FW9A 1FXUA 3UT5A 3GFRA 4AZWA 5JR3A 4CM3A 5ALJA 3LA8A 2J67A 2BTEA 2FDCA 1G7CA 3BWCA 4HZUB 1CUEA 1P3JA 1IQ0A 1ZXLA 3E5HA 3QELA 1NVUQ 1Y8QA 2F67A 1VKHA 1P1KA 4U2CA 4CKZA 3I0MA 1G8JA 1EP2B 2I8LA 1K2WA 1UKCA 3G17A 1WSAA 2JB9A 2GZ2A 4AQDA 5ER6A 2YFHA 3PQ2A 4K9RA 2ONJA 1MUUA 3E9ZA 2XDQB 1J0XO 4QPPA 4WFKA 3KKLA 4NYMQ 4RA9B 3SDSA 2VHVA 4F7WA 5G41A 1B42A 4RPCA 5IJ0A 1UDBA 3ZDAA 3SEAA 2EZ4A 1ECFA 1I0IA 1I32A 2F3QA 1FMLA 2ZJFA 2GD2A 4FNOA 1FDWA 5BSHA 1D4ZA 2C0QA 3SIPA 1N6HA 1MJNA 5DSTA 2RD2A 1K88A 2JGMA 3HTXA 4DMKA 1WPQA 3SEZA 4IIJB 1M1ZA 5E2AA 3U3KA 4BO3A 2IYWA 4IIBA 2OUKA 2FMKA 3UUGA 4P8RA 4MQLA 5A03A 2QUKA 5EL0A 4JLWA 1UMKA 4ONEA 5BVGB 1TKRA 4GPTA 5HPYB 2JLUA 4WBNF 1E8NA 2JGJA 3DFUA 3UA4A 4KDRA 5HMMA 3I42A 3LQRA 5ED4A 3O7WA 2O8EB 3U0BA 4OQXA 4AK9A 1Q44A 4H3VA 4U2EA 4DZZA 3LUDA 4W9NA 2DFPA 1MOPA 1I9CA 3CJTA 3RFTA 5K0BA 2H6EA 3OSZA 3SLKA 1ZDMA 2G09A 5IJAA 3ZR4B 1UBHS 1X8XA 2X5JO 3AX6A 5ECGC 3DDSA 2Q4RA 1ULZA 3RAPR 5I48A 1KJ9A 2FE4A 4G26A 1A98A 1WUIS 3AUXA 4FOLA 4AM8A 1UINA 1B0UA 4MLDA 4P7KA 3V46A 5K0CA 2OFXA 3MWYW 4JASB 5EWMA 5B7NA 2IYRA 1WZIA 4IIVA 4BE7B 2AOUB 3CVXA 2DKFA 1JFRA 1WPXA 5A04A 2HM7A 4JT4A 3RBAA 3DBHA 3RK1A 1ZU4A 1J90A 2E5LB 3PPVA 3EULA 1DAHA 1DINA 2I03A 3QE0A 5JZOA 2IS1A 2C4TA 2FFBA 1HYBA 2XUHA 5DEOA 3UKDA 3ZTTA 4B81A 3UICA 1BHSA 4J0CA 5C5IA 4P4UA 2YV1A 1U1DA 3DONA 3WTBA 2FEXA 4C6TA 4B4OA 4YJGB 2NU8B 1W4AA 1T2NA 1D9XA 2FU5C 1WDTA 2PKQO 2PX5A 3T7KA 3L8CA 3ABIA 3ROFA 4DMLA 5A4AA 5LMUB 4DCOA 1GIAA 5AW1A 1PR9A 1T2VA 1FW6A 4MIYA 4BVEA 1DMSA 4N3AA 3D7LA 3UH0A 1CIVA 3BIFA 4ATNA 3P52A 1KS9A 3N2EA 1YSCA 4PYKA 4EYKA 1ILWA 2VJBA 4PG7A 2FXVA 1C7RA 1FYVA 1SCDA 3A1SA 3T5BA 3TRKA 4A03A 1IXYA 2G1PA 1GRVA 3OT5A 3QQ5A 2VDKB 3DG9A 1T1JA 1TK3A 2D06A 2J30A 2WM3A 1IEVA 1U1CA 1ZN8A 1SZPA 3N86A 1JFFB 1XZLA 4FQ7A 5IJXA 1TRHA 3JASA 1WJGA 3ZLUA 4I7EA 3NV9A 5EIWA 1LZKA 1SC6A 2O2XA 2PGJA 3G68A 1HNXB 1O8BA 1X70A 3COWA 1SUDA 3NZEA 2BFEA 5H7XA 3FHCB 3WV4A 4D9NA 1B3BA 4CQNA 1F5SA 1QGED 2BCGY 4RH0A 5T67A 1M7HA 1HBJA 3JSXA 4R83A 2QGZA 2QTGA 4D8UA 4Z3KA 3FKJA 3UAWA 2OOSA 2ZP1A 5EMMA 2YVUA 4ARZB 1DC5A 1IONA 2C2YA 1AMOA 2XOKA 3PXAA 4CKBA 1F4VA 1A1SA 1EJ2A 3FVTA 5DGHA 4IDAA 4YRMA 3HDHA 3ZEIA 3OP4A 1YUNA 3O4FA 3PGJA 2IV2X 3O0DA 1KOGA 2XWPA 2CVOA 3N0WA 4S1WA 4YMHA 1HFWA 3HDQA 2YQZA 4NYJR 5GGXA 5BUSA 3UWMA 3DMTC 3RVLA 4PLWA 4IZ6A 3PFFA 1KRXA 2B8JA 4U0KA 4CM4A 4DC1A 2NPFA 4WXPA 3SZOA 2WEKA 2APJA 3EZ2A 3BHIA 4PGMA 1SMKA 4HN2A 5G0VA 3TLAA 5EJMA 4D96A 4ZJPA 4DJAA 2VPPA 4YMWA 1GDHA 2FN8A 3BD6A 2PUVA 3QMMA 3PD1A 4YQZA 1PJSA 1TZKA 2AEFA 1X1RA 5U4QA 1YZGA 1MB9A 3NKFA 4M0UA 5TQ0B 3RASA 3RYFB 5FA5A 1OILA 2KMLA 2PL5A 4KIGA 1QF6A 3AM4A 4G0OA 3JQCA 1C8VB 4MJ3A 1G1MA 3LOQA 3PITA 3WVNA 5HWSA 4JXJA 2ZRNA 3OOSA 1T9HA 3GZTB 1SXJE 3R3ZA 3LK6A 2HIHA 4I1IA 1XG5A 3LF1A 4HUQB 2AXEA 5C18A 1FU8A 4FFOA 3KBOA 3AHFA 1ENYA 1TJ5A 3GFBA 4ZAZA 6REQB 4B84A 3ZLBA 3DVLA 1VB3A 1A77A 4FFPA 1EVJA 3ZWWA 2WU0A 1W5EA 4RTMA 1FMTA 2C8VA 3OEED 1EDZA 2JD2A 3Q85A 8ABPA 1PE0A 3IQXA 1GPMA 3IAFA 4N4AA 1EWTA 3V55A 2BL4A 1JIIA 4RM2A 4XPIB 5KC8A 2IXBA 1YZUA 2XECA 4L3WA 2O9JA 4RA6A 3MMSA 3V32A 4IQ4A 2XUKA 1UEIA 1UCFA 3GY0A 4ZO4A 1I30A 2JGRA 3WKAA 1EBUA 2WFLB 2GN0A 2YZKA 1CUXA 3FPAA 1EUCA 3F96A 3MJSA 4F3RA 2UZAA 2A86A 3IVMA 4BAUA 1F9EA 4UU8A 1JWLA 4GI2A 1MO5A 1SD2A 2JBWA 3QX8A 2QAGB 1M34A 3FB4A 5EVJA 5J5CA 1N6LA 3NM4A 1J9GA 2ZI4A 3RGWS 2VJNA 3AHHA 2GNOA 2BFMA 1N5IA 4JLSA 2CEAA 3EPHA 2E4WA 3FDIA 4M0KA 5BV2P 5HUHA 2OESA 3D02A 5EYPA 3SN6A 1JHAA 3I73A 2V58A 2ZYHA 1DC3A 2FPUA 2RK3A 3CXRA 4PXYA 2EGUA 2VPQA 3KELA 1EFPB 3Q1LA 5HFAA 3UIEA 3WKBA 3K70C 5HKKA 1V1JA 3KG2A 3PHJA 1GZ3A 1WKBA 4OK6A 3PLRA 4LFAB 1R00A 4ZA2A 3BHNA 2BBSA 2DH5A 4GOOD 1H3NA 2RHJA 4UDOA 4ZU1X 2XR1A 2OVBA 3NTQA 5LYJB 1QO7A 3EDOA 3HO6A 2PWBA 3DFMA 4KGZA 4QHSA 4D9KA 4PC2A 4UMDA 1XZNA 4UNIA 4OQ4A 3OOYA 1S1CA 2ONYA 1XNHA 1PK7A 3NYWA 4HH0A 4WLNA 1OXUA 4HRAA 1AGYA 2F3RA 3FJYA 4DM3A 4K87A 4CIYA 2YJ4A 3VYTB 4Q48A 1UBRS 3IJPA 4KXQA 4G65A 2CJXA 4M1OA 5DNEA 3WJ7A 4BFCA 1O1YA 2WHPB 3JS5A 1GFSA 3FNQA 2M1XA 4LVNA 5FI0B 3I6BA 1JSXA 4IRUB 4IHJF 2YH2A 3W5CA 3M4ZA 2RGWA 3JQGB 1BQEA 2DBYA 4FYIA 4JUFA 3L3BA 3SNHA 1V8ZA 4Q3AA 2D0IA 5L40A 4LRSB 2EP5A 5TEWA 3GLIA 1YOVB 1ZM2A 1RBZA 1GGEA 3FPKA 3ONEA 4PQRA 5LBIA 3ZH9B 4AO7A 4O4HB 3HADA 4D9EA 4I55F 3BCSA 1QAOA 4MS4A 4TXNA 5EWLA 3C6YA 3ERCA 2RGDA 3QLUC 1ULHA 3LL4A 3FDZB 4O1IA 2BISA 4N5MA 1RKVA 1AQYA 1FUIA 4W4TA 3WB9A 4V02A 4HQ0A 1G0NA 3PG5A 1M76A 4BFYA 1Y6GA 4JYAB 1OFTA 1OX5A 2G0AA 1I7SB 1AQIA 3C5VA 1A1VA 4XD2A 3QK7A 1SVMA 5A4FS 4FILA 3LYLA 3MS4A 4PEVA 3NIGB 1XAGA 4GP7A 5F9MA 2PT6A 4NXNB 3M6WA 1NN3A 5CDGA 5CFPA 3LDFA 3U80A 1RZVA 3ENQA 3HCRA 1WXFA 2DY1A 2GAOA 1O95D 3OZDA 2FQ1A 4B7UA 1GQFA 7AT1A 1IFXA 4OGWA 4EFDA 1JLLA 4RU1A 1DIRA 4IINA 1XZ8A 1IRIA 3DEIA 4A0RA 4BO0A 1HM5A 4G37A 4HXGA 4X54A 2FLWA 4ZJYA 1PFYA 3VPCA 2WVAA 3PP8A 1PWHA 4QFBA 3S8EA 3K32A 2J5XA 4ZT4A 2F1RA 2J33A 3O3MB 3BTOA 1EVYA 5FNVA 3WDSA 4DYDA 5L3SA 3OF2A 1JVBA 3L0SA 1ZJWA 2WRZA 4E5PA 5HIIA 1SRRA 2ZIUB 5ECWA 1HT0A 4CKYA 2GM4A 3D1JA 5AXBA 3CQ9A 3FCEA 4RO0A 3LX8A 2GA8A 4AG6A 2A14A 3A8TA 3GEHA 3SMQA 3PLNA 2HFJA 2XRFA 5DBGA 5HF9A 2PWYA 4MW6A 2YJTD 4KVGA 1GL6A 1U3TA 4RSMA 4G2NA 4DBLE 1A8SA 3EQ8A 1KMIY 2QTFA 3PQ5A 2W22A 4HWOA 5JO9A 1TADA 4HMQA 5FUMA 4F4IA 1CR0A 4GI7A 2V3CC 4E03A 4S04A 5CXSA 1V1RB 1QLJA 1H2HA 1SG0A 3QVKA 3SOZA 2UUBB 3GP5A 1DTSA 4GKVA 1UXGA 5LOVB 3WIBA 1NVEA 2QTBA 1WAMA 4IY1A 2JJYA 4K0RA 3PTAA 1IXRC 4JJAA 1IHOA 3PCRB 4EY7A 2CXRA 3HU1A 2H3EA 3K5HA 1WXWA 4I5IA 4B2YA 3Q5EA 3NYRA 1TM3E 2VYQA 4UE2A 1WF6A 3AVWA 2BSXA 3TMKA 2Q5QA 2E48A 5JROA 2MSEB 1G8MA 3FW1A 3RRYA 5LIPA 2JA2A 2C2OA 2WV7A 4AKSA 3GLFE 2AG6A 1GQRA 3AI2A 4CGYA 3EGIA 4KQ6A 4X65B 2WJVA 4PCVA 1AUPA 5PNTA 4YFYA 2QYSA 2YDYA 3QKRA 1Y6RA 5CVEA 1YXMA 5KREA 2LWIA 3DKIA 1KVUA 3QMWA 1ZCBA 4DV6B 1L4NA 3HXKA 2OE2A 4HZIA 3ZE1B 3CWZA 1BVHA 1JU9A 3ZY5A 1WCIB 1R74A 2IBSA 2G9RA 3C6KA 4OSPA 5AVSA 3UT0A 1V9LA 2QT9A 2WINI 4YUWA 5J4VA 1I6LA 3PJRA 1O89A 2VYNA 5EHZA 4U7JA 5H02A 1N3BA 3OX1A 4Q82A 1KI1A 2KI5A 3V80A 1NVTA 5EHNA 3S6JA 4CKEA 1WUYA 2FQWA 1KY3A 2CWWA 1HPLA 2Q8PA 3OEWA 2QD3A 5DZSA 1BMTA 2WM9B 1DEXA 3I4CA 4FHZA 1BGXT 4MWOA 2QTVA 3NR2A 1CUCA 3GAMA 5AKZA 1G8SA 3QEOA 4PYIA 2ZT6A 3K8QA 1JZQA 2Z8YA 4MW9A 3LHIA 4OBXA 4GL4A 1NM5C 2ZB8A 1XZIA 2QL6A 4FNGA 4HH4A 3G5AA 2AD1A 1N0HA 2VDLB 2AN4A 2WJ3A 3ENZA 3UMSA 4AS3A 4DB4A 1P1BA 3FNBA 2QMQA 1GPJA 1KSJA 2BGJA 2W4QA 3B7PA 3E8XA 3W5AA 2WZCA 3DMGA 1JQJC 3DZIA 1FNMA 3BL5A 1HDXA 1DG3A 4DRXB 5JH7F 2OA0A 2ODEA 1U7UA 2BZ0A 4ZJUA 1T13A 1PG2A 2XYRA 2Z8XA 4JA2A 1N6IA 2JLBA 3V2GA 3MBIA 1UDRA 3UAOA 1BIFA 2IZ1A 1KE1A 1YBVA 3QNWA 3S70A 1C14A 1PZEA 3SICE 1CS4C 4I99A 1JSLA 1Z2NX 2SKDA 4HAIA 2XNDD 4O4LF 2VP5A 2WU4A 4V0NA 4XTRA 1PJ2A 3K6JA 1JU3A 2X8JA 4WKCA 1OLXA 1TTHA 3OAAA 2VJDA 3HPQA 4HEA1 2HWWA 1H94A 2D74A 4TS4A 4OV6B 1JR2A 3TNJA 2IE0A 3AU8A 1Q6YA 3GH3A 2RG7A 4N01A 4FYPA 1SHUX 2NZVG 4YRRA 4HUJA 3LDUA 3QKSA 4K05A 5FA8A 1A9XA 1P74A 3GL9A 4M8KA 1HQCA 2Y1OA 2GK4A 1GG2A 2YWEA 2PT7A 1R6AA 1I1HA 3QE4A 4JODA 2ZR8A 3MOIA 4KYUA 3RVKA 4F91B 2PUAA 4DQ0A 3RAEC 1V95A 3IOMA 2BHNA 1GTSA 2I22A 4K9DA 3F5DA 1TVEA 4UQLA 2PGOA 1VLZA 1EWQA 1U8ZA 2VHQA 1KBQA 2CHFA 3K9WA 4HTFA 1GKIA 2OV4A 2P65A 3IDQA 4PQEA 5KTKA 2YZMA 3L9XA 2PFKA 4AF8A 2XQKA 1T6BY 1ULSA 2WG1A 3O3CA 2Z2ZA 1OXVA 1XCMA 3KTOA 3UMYA 2DOKA 3THWA 2EJUA 3FJOA 1E5XA 2GK3A 1PK9A 1PFKA 2O2GA 3NHAA 5AIBA 3JD0A 2JLZA 4YCLA 1KMHA 4H31A 4UHCA 5TQJA 1AUXA 2OXRA 2V6BA 4M0DA 1NVVQ 3K1YA 4YGYA 3H9UA 2UZ1B 1ZK3A 3ZK8A 2GJ8A 5CEEA 2P35A 3BWDD 2FPIB 3QWBA 5EJ5A 4DHEA 3KXDA 5BYAA 4YJDA 2QL9A 4CCWA 5HQ3B 1Z56C 3H19A 3VBCA 2BR5A 3OJFA 3HVKA 3U61B 3CLTD 3VR6D 3B3GA 2ZCVA 5K8LA 1U1GA 4YRTA 2HLDA 1LV7A 3FGZA 3FOCA 5IN5A 2H4FA 1KIFA 2PR7A 2PRIA 3V1UA 4HO1X 5H4HA 3DOUA 2Z57A 3WDLA 1ZPDA 5IDQA 4P53A 3BWYA 4J2OA 2J1LA 1QYIA 5SY6A 3LY5A 3PWZA 4RKQA 3BJRA 4IXWA 3K6SA 4DMCA 1VCIA 3OECA 2JGIA 2BFFA 5LYYA 3ZVKA 1GQQA 1IRXA 5DTRA 3AF5A 1NBMD 5IULC 4QQ8A 5H0IA 5D1NA 3ICOA 4RMJA 3B9RA 3VX4A 5LFAA 2MMCA 4O59O 3NHJA 2Q2NA 1DWPA 5CUQA 2OYRA 4QPZA 4G5RA 3HR7A 4NPAA 1I2DA 4PHGA 5JEEA 3CWCA 2FI1A 2BYTA 3IAAA 2YVLA 3HP4A 4F2PA 1HLPA 5JARA 5FJJA 4L9RA 4L6IA 2B21A 4BNVA 4IWNA 4NECA 3KYBA 4R7TA 2DTXA 4OJQA 1OFUX 4JQCA 5JMTA 1QV6A 2GARA 4QFMA 4DG9A 1EIZA 4RY8A 5DRYA 3O1LA 1T8WA 2OQ2A 1EX7A 4G0UA 5CNMA 3C14C 4RZ2A 4BFSA 4ZTBA 1J8MF 2P11A 2Y77A 4IUBS 3ZE0B 1VYUA 1PJZA 2BEUB 1ZM3A 2E21A 1TF2A 2ZRQA 1UZUA 4L85A 3IV6A 4EG8A 1JZTA 3A28A 1GYQA 1YUMA 4WLFA 2AOVA 5CLJA 2NTNA 2LPMA 2XUAA 4RDHA 2XUGA 2NVUB 2OLKA 3KPJA 3RFCA 2Z2IA 4H08A 5AI8A 3VDXA 2HJSA 2BFAA 2D2EA 2VUIB 3K8ZA 1WMFA 1WSWA 3SYMA 3TX6A 5EPEA 3W6OA 4ZYUA 2XUQA 3QH4A 2FH5B 1II0A 4LOHA 1W2WB 4LRXA 5ERXA 2DTEA 3EWIA 3IE0A 3BB1A 4PC7A 1TKBA 4F92B 1KFJB 1YHYA 5DOVA 2Z6VA 4CUKA 2P9CA 1F14A 3G5TA 1QRRA 2OQRA 3QSGA 4GXNA 2FXIA 2WK1A 2HJRA 1DBIA 1C1DB 3EIXA 4AICA 2D3WA 2B4YA 2QE7D 3C3BA 3LKZA 3KTFA 2G28A 5L7WA 2ODNA 1DDIA 4QYMA 4UEWA 5FOSA 3TJMA 4A1OA 5FTLA 4GI5A 1DXQA 2J9XB 1H5NA 2ZUSA 4QEDA 4UQPA 5D84A 5H59A 5DNUA 4FSHA 1MORA 5JQGF 4MA5A 3PENA 3QEJA 1VIDA 3SZLA 4KHZA 1G5QA 3N7AA 1C1XA 1ICEA 1YTLA 2AUNA 2FJ0A 3RSZA 3ROZA 3PX3A 5L4LA 3TE7A 4HWRA 4Q3KA 1J7KA 3ZQUA 3FHJA 3JD3A 2AR7A 2HMVA 2QN3A 2PM8A 4WH0A 1RJ9A 2JI9A 3P32A 4DXHA 4RF4A 3DNMA 4U7PB 4MGEA 4EA9A 2PUTA 1FSPA 3KQYA 3AF2A 5DLEA 3EN0A 1M67A 2FEKA 2CNWA 2A4MA 3VR4A 2B2CA 4F5EA 1C3LA 4F6LA 1DDGA 5JRZA 4TMWA 4ZYYA 2FZCA 2ODWA 1HSOA 4FOPA 4HADA 2AK3A 1I7QB 1TZBA 1GOTA 1OKKD 1Q0RA 3IIKA 4YCNA 1QHHA 2HADA 3ZHSA 2LIVA 2OBBA 2OENG 2QB5A 4NATA 1J2JA 2GD6A 3QHQA 2UYHA 3GRRA 4L5CA 1OWMA 2WVHA 3ZDFA 4MRSA 4K6KA 4FYVA 4YXWA 3IUNA 4FCTA 3Q8MA 1GNQA 2PY6A 4RPJA 2EQBA 2EGGA 3SXJA 3I52A 2NZWA 5EERA 4AUEA 4W5RA 4CV0A 4IMIB 4XM0A 3A6DA 2X1MA 3L06A 1IVSA 1T0PA 3NTUA 4MAMA 5TEVA 1SOVA 2AEEA 1W7AA 1PTKA 2PS1A 3O9ZA 2GNPA 1G6Q1 4TV8A 1F0PA 2AGVA 3OU7A 1XQ6A 4HQOA 4RHEA 3RO7A 5E7MA 3WDKA 4WSOA 1WETA 3ZJ4A 3DBLB 3L7JA 3ROPA 2O8BB 1PZNA 1A4UA 2O0JA 5FAXA 3TRFA 1V2GA 2J5RA 4KTTE 3FR7A 4ZZ3A 2CLDX 2I3DA 2IPLA 5FUQA 4JWTA 4IH4A 1XWFA 4GQBA 1HI9A 1YE3A 3EA4A 5CLIA 5AMXA 2QP4A 4Z2YA 1J2RA 1JYSA 1NWCA 5ALSA 3WSWA 1XL0A 3ETNA 4X0EA 2HQBA 4PBSA 2BKEA 3L1UA 5KYWA 2YHUA 1L7XA 5CNJA 5FBQB 3D3WB 1YAJA 1SHTX 4CXMA 1WULS 3IP6A 5EPUA 2ZETA 5H8WA 4OL9A 2YS7A 4DEYA 1MN6A 3VPHA 1A2KC 1FRFS 1JQEA 2VQEB 1H1DA 2W00A 3IPLA 2RI1A 2IY7A 2EQ5A 2W2MA 3PNSA 4CLRB 1VCOA 4UUOA 4ZYXA 4EARA 3RUAA 2PGDA 5K3DA 2OGZA 2O5EA 4TKVB 3OZEA 4D56A 2I34A 2CFOA 1PGPA 1NMSA 2SNIE 2GZHA 1BO6A 1E9DA 4DDTA 1CRPA 3HU3A 2D8AA 1MJHA 3OPVA 4UM7A 5I47A 1VMEA 1ISHA 1E3WA 4K6CA 2XAUA 1E64A 2C2XA 2ZI3A 3H5RA 3T7AA 1A88A 2XVYA 4U3JA 4KQIA 5TB5A 2AKEA 2O8FB 2XVAA 1UP4A 1QLHA 3HJCA 1XZQA 2HA5A 3M83A 3OC6A 1OVMA 2PUWA 4ZDKA 4AY3A 2GYYA 4E2WA 3VSDA 4U7DA 1IIRA 1CUHA 1SZDA 2C00A 3WWEA 4DQLA 1NX6A 2QQEA 4EUHA 5JJBA 3LKBA 1HE4A 5IVIA 7REQB 2YXDA 3A04A 1XUOA 2EFJA 3OJCA 4IBOA 4KQ2A 3HBLA 3WB2A 4C4YA 1JR3A 3K4QA 3FXAA 2A84A 1IB0A 3V1KA 1ORIA 4LCBA 3ZE8A 3VVBA 2F6RA 3HUDA 2PYZA 3D2BA 1TLTA 3X2FA 3ZNPA 3PGVA 3AONB 4Q4CA 2PUFA 3DTTA 4PAOA 3O4IA 3EFOA 1SIOA 4DJFC 1E0DA 4X1KB 4CQLA 2DR2A 2IHBA 2JBHA 1UBUS 3ZE2B 2GGSA 1UBCA 2GLUA 2WHEA 3EFEA 2YWHA 1HKHA 4KFRA 1XEAA 4ARAA 4EVQA 2VDWB 3JATB 1TO6A 2QU7A 2NX2A 2VBGA 3Q6NA 3N3BC 3V48A 2VRCD 1FTGA 1Z5ZA 2XGOA 2A78A 3V34A 4B47A 4WHMA 4JP1A 4WTOA 3IC5A 3T8YA 4AKEA 1XZBA 1QBKC 3HSKA 1RI2A 2QQ5A 4LDPA 2CKDA 1K4KA 4MI9A 5KSPA 4ZOCA 4CNQA 3X1WA 4ZCRA 4NZPA 2IYQA 3URMA 2IF0A 4C0WA 1N9GB 1M2JA 5IAGA 5E8JA 1R8QA 5AP9A 3OY2A 3AHGA 2HLPA 4E33A 2QT1A 4ZREA 2ZAIA 4XD7D 2ACEA 4OHCA 1U28A 4MROA 4WK0B 2IHYA 5F73A 5KYYB 2D0OB 4UDXX 4WXHA 4JB0A 1JHDA 5FFNA 3UXYA 4BN0A 4EIWA 1DBWA 2P27A 1VL8A 1YNSA 2CYAA 3HWWA 4P22A 3R9KA 3T3GA 3WP1B 4CEHA 4ZVKA 1VGQA 3ZGVA 4R71A 2CMGA 2EW8A 2MWMA 3BGDA 3MK31 4R8KA 3A1CA 3QBVA 4MVJD 3WGVA 4H3SA 3WFIA 4CF5A 3V4LA 9LDTA 5JZ9A 4H6WA 5F78A 2HRZA 4LWQA 4X66B 1KZ7B 3C24A 5E1MA 1P7CA 3I58A 1T6YA 3KR1A 5BW8A 1JH8A 3E8SA 1Q0PA 1ULBA 3OE4A 1VP9A 2E2WA 5AHWA 2PWAA 3TWOA 4LF7B 3OTWA 2F8TA 3DV0A 2P91A 1U9YA 2B1JA 3ETEA 4IHQA 3ITDA 1DIHA 1QE5A 3SVLA 2PR2A 1Y3CE 2P0YA 1Z0FA 4EHBA 1EUZA 3EDRA 4RQTA 3ZX5A 4UUAA 1J1IA 1SBZA 4UM8B 2RBEA 4UVHA 2NWQA 2QN2A 4US1R 5B5SA 4LJ5A 1NYLA 1H1LA 4RJ2A 5G1OA 3WIUA 3EH1A 2P3SA 2AOTA 2RAPA 1NFQA 1THMA 1VP3A 3OZXA 3REOA 1E6UA 1EGAA 3D4OA 4N5LA 4JQZA 4JOQA 4PFJA 1C1HA 4UXHA 1G8PA 1ML3A 3N3AC 4I08A 4XJTA 3ELDA 1ZGCA 2RGAA 2CZCA 1XDZA 4QAJA 1PWZA 4YP7A 1AGXA 1G7SA 1UADA 3O6VA 1X94A 1T5OA 2AUMA 3D0RA 3MTDA 1DXHA 4P3KA 2LGJA 1J20A 2DETA 2EF1A 2Y1GA 2Z6UA 5D87A 2JC3A 3PEEA 4M1YA 4MWCA 1WS6A 1JHOA 2GHTA 4RK5A 3T95A 4D92A 4BMVA 4MDEA 1O6FA 2ZT7A 3BERA 3CLKA 5JZVA 4IIHA 1JEQA 4C4PA 2HX1A 2GPYA 2Q3LA 1D7AA 3KEFA 1DO8A 2COEA 2IW3A 3DB1A 4LPSA 2OCKA 1X1SA 5DISB 2V7GA 3WLPA 2D1QA 4NH0A 2H8KA 4BLQA 1M5RA 1V96A 3ZV6A 2G82A 1CC1S 2PGXA 3ZYZA 1W36D 1QWSA 5DCLA 4G01B 5FV4A 2YMMA 2XTAA 2C2GA 1T2UA 2E37A 3KWJA 4NWIA 1L5ZA 5HS6A 1IEXA 1NL3A 3GFPA 4AJKA 2ZFUA 5CXQA 4QVIA 3V4RA 3IT3A 2PXHA 3C3XA 3G8DA 2F8MA 4X92A 1DT3A 1YR8A 2OC9A 2Z2XA 2CHGA 2CSUA 1P1HA 2H4ZA 3WICA 5FBRB 2CLOB 3C2QA 1V3TA 1CDEA 2WPNA 3AF3A 2WAOA 2BPOA 3EOAI 3EVAA 5E6SA 3K4HA 1I80A 4J29A 4PM4A 4JU9A 4BO9A 1HE5A 3AEKB 4LRWA 4RDIA 3BIOA 4ER5A 1K7EB 1CY6A 4E6PA 3LY8A 5DHPA 4MUIA 5JSFA 4JJ7A 1V3VA 1PJAA 1Y7TA 3FCYA 4JKOA 3T1TA 3ZDEA 4NU6A 3RUIA 2AQ8A 4MZDA 4C07A 3AHDA 4V24A 3N2NA 4BNGA 3CR8A 3HNOA 4W99A 2XVXA 3D4NA 3N2YA 3QFSA 3UXMA 1MIHA 4BJ5A 2GWHA 3UK1A 3BD8A 1ISIA 4TPKA 1Q0ZA 2VT2A 2VZ0A 5KNCA 2I71A 1NQVA 1X7GA 2OV3A 2VAMA 3CONA 4KDFA 1W0CA 5JLAA 2QY9A 2V8OA 4ZU6X 4CQMB 2OM6A 4BGIA 4EBFA 4EZEA 3V4SA 5IF3A 1JTEA 2XUJA 1H3EA 2C20A 1A2BA 1G66A 3L8ZA 2INGX 1R10A 3AF1A 4X7MA 4DC0A 4MRRA 2O1SA 3WGUA 5EKDA 2C77A 2O4CA 4MR7B 2QENA 3WMXA 4POAA 2V1XA 3G23A 4FDAA 4OHUA 3PE6A 4U5XA 5J2UF 5A9SA 3ZQKA 1S8AA 4AC9A 4B6GA 2CFIA 1XTBA 1TM2A 4HT3B 2REQA 2B6HA 3IVGA 1JX6A 2B8EA 3HKCB 3KCQA 4YROA 4OHZA 1EIWA 2NYUA 1AA6A 2I8AA 4JP3A 1JNXX 4P35A 3OUTA 2FEWB 1COWA 3VKGA 5HW0A 3B78A 1ZHFA 3LQQA 1XDGA 3OHSX 3MHTA 1YI1A 2IA5A 3CINA 2J32A 2BMFA 3L8HA 3VR1A 4KGVA 3BEOA 1CUZA 4NK5A 2A9KA 5JD5A 3CN7A 3H05A 2KX7A 1O0BA 1HZJA 1R4MB 5CM9C 4CIAA 5LZ2A 4EUNA 4XYEA 3LHKA 3WGKA 4CM8A 3CVWA 2HV8A 3H13A 2IYXA 3HY3A 1QO0A 3QEMA 4P4SB 2A57A 2E4ZA 2ENWA 2PS3A 3FMGA 3K8OE 4JOBA 4D6XA 2EDCA 5BW5A 2VNAA 5A3RA 1NNSA 4IVQA 3Q8KA 1TPZA 2CLEB 2CD7A 1IN6A 1S2IA 2Y4NA 2ZIXB 1P9RA 3FPHA 1E2GA 1X1EA 4FZRA 4LK2A 2WNIA 4RETA 3EUFA 3IUSA 4WV3A 5HCUA 4BWVA 4EJ2A 4OB8A 3L1VA 3AZPA 4E70A 1G20E 1Q95A 3WWYA 2QJWA 2HK9A 3L7KA 1NMZA 2HA7A 3PQDA 1KI3A 4IIJF 1Z8HA 1DQRA 2QLLA 3JV7A 4QBHA 2I29A 1CQJB 1E3LA 3B89A 3EVNA 1WM1A 4R8VA 4NSNA 4E30A 4MR9B 4F3TA 5AVOA 5CVVA 1JBEA 3GEGA 2NV0A 3QV1A 4NCNA 1FE8A 5JDCA 2QXTA 3ZK9A 1D1SA 2QRMA 4YI3A 3OEHD 3WE7A 1NONA 1YR2A 1U2TA 4FMBB 4RCVA 4WUTA 3ANSA 3DVSX 3DO6A 3PEVA 1XC7A 3B13B 3U1TA 3IHTA 3ACCA 3G2MA 3OTIA 5DRTA 4UFPA 1SQGA 4X7BA 4D6YA 1PVOA 1X1QA 1ECCA 4YX9A 3REQB 3OE1A 1Z8NA 2Y2UA 4ZT7A 1CFJA 4IZOA 1DEKA 3U3DA 3UMGA 1QC5A 3LUGA 1ZWKA 3ZDYB 8OHMA 4D6PA 1OW3B 3R0JA 1QGOA 5CH5A 5CA0A 4W7IA 1Y5NA 2WWTA 4QNRA 1DJLA 3H4IA 3HA3A 4NZZA 1P39A 2A1UB 3N8DA 1XXHB 721PA 2P6RA 2NQTA 1GUDA 2FSHA 1W5FA 4O2AA 2RSLA 3NOQA 1BXZA 4JC4A 1IUNA 2GBFA 1YVRA 2ZANA 3Q7RA 4DL9A 4JDPA 4ZKDA 4DV3B 2LCIA 4PBRA 3R7AA 3RC8A 3HC7A 4HDMA 4UDNA 4IO0A 2O2ZA 3LGXA 3MG9A 4ZARA 1N9ZA 3IBCA 2I1VB 1GUYA 2N3ZA 1M1YB 2GAIA 3I04M 1H69A 4CUZA 4YP0A 1IEQA 4NAHA 4MI6A 1R15A 3T7CA 3LT1A 4F4FA 3CF4A 2W2XA 3FJ1A 4FDMA 1DRWA 1F8UA 1K7CA 2DLDA 3NHMA 3M2PA 1MQ8B 4Y1EA 5FPKA 5EE9A 1MIOA 1MV5A 5HQJA 2VA9A 5J2TB 1JR6A 2IYTA 2VF5X 1JHRA 3BJIC 4OIMA 2XEDA 1M2VA 4MQ5A 5I9LA 5HF8A 2NU6B 1PWXA 3CE9A 4OYYA 3W3AA 5JJKA 3DD5A 4R1UA 3LC0A 1JB1A 1YL5A 4URUR 5DBOA 3ZWCA 5JLJA 1WP4A 2VDNB 3ABZA 3KR2A 1XOIA 3A9RA 1RPZA 1LNZA 1VMKA 1O9HA 1ADJA 1QZTA 2Y9PB 3NWOA 4RLQA 3KZCA 5KOHB 1MHPA 3T35A 1XLUA 1X7WA 3CB2A 4L75A 4YRIA 5BNZA 3CPJB 4RMGA 1D7OA 2MOKA 3GDGA 4Z8YA 2JA1A 2WSLA 4BMYA 1NU6A 1E94E 4DLZA 3EVDA 4GLOA 4ZAFA 4D46A 5I9BA 3MRXA 4RMIA 3UJ3X 3RODA 1C9MA 1ZEJA 4C1BA 4M1EA 5FPSA 1XD9A 2BMVA 3O26A 4LZOA 1QPBA 2HJGA 3QLTA 1RWOA 3NKLA 5ENDA 2J9YB 1L0BA 2H11A 5IG2A 3DDNA 4GNRA 2CV0A 2WKSA 1KXZA 1KYYA 2C59A 2C8LA 1TT5A 1H6CA 3Q0EA 4ENUA 3R3HA 4JIGA 1V7QA 1FUYB 2Y1LA 4DS3A 4TL7A 5ALXA 3HY4A 5IAKA 1MB0A 1WXEA 3AFGA 3BB4A 3L6BA 3KZXA 2BHRA 4XGKA 2IVZA 3LUFA 1IOZA 4KKVA 2I4IA 4X95A 4KKXB 3RARA 5DHRA 3L8YA 5GV8A 1ZN7A 1G8HA 3CHYA 3LWBA 5TPZA 4AKTA 1WW2A 4ZYLA 2VPYA 1YE5A 3JAWB 4LTNA 1T2AA 1QHNA 2CLCX 3PRHA 3P96A 4TWBA 4BBJA 2C2KA 3CZAA 4XIFA 1RR6A 2DVMA 2EZ9A 4HGYA 2D5CA 1PW7A 3CNBA 1MJGA 4PO1A 3K72B 4KIJA 3TI7A 2IU3A 3ELBA 3SC3A 1N1DA 4LYEA 2DHQA 3RB8A 4LWPA 4KUGA 2I6UA 5FBHA 4BV2A 4NEGA 2EBWA 3MPOA 4YH1A 3TW8A 1YZHA 3RS5A 3KYCB 1A71A 1BX0A 2TYSB 4D4HA 1LBHA 1Z7BA 1QOZA 1U7TA 4L4YA 1DJNA 4PINA 4C0HA 4ZI7A 2R85A 1CQZA 1NZDA 1ZM7A 4IJVA 4IP0A 4LVCA 5DHUA 3R3YA 3JQBC 1ESNA 4P80A 5T4FA 1HY3A 5FWXB 3TN7A 2QLTA 2Z6AA 1Q5PA 4XDHA 1BVRA 4UTXA 5F3DA 4QGHA 4DUZB 4OMCA 3GJ0A 2JJ2A 3EPJA 2TS1A 4Q9KA 3WSTA 3AK4A 2ID9A 3VTZA 5LB2A 2Q27A 5AM0A 1QCDA 2EAUA 1C4OA 3SBDA 3WMWA 4C43A 4AAYA 4UTPA 2FSPA 3ORHA 1QCCA 2P62A 3Q3IA 1O4WA 1RRFA 1SZJG 4RJIA 1GKKA 2CNLA 1ZK1A 1YI8A 3MTQA 4WA8A 2OG1A 4YMGA 5BUCA 3OZIA 1VL5A 1UXIA 2IYPA 5F1KA 4P3OA 3ZVLA 3AFHA 4NULA 2FUG1 4JEHA 1WUKS 4IH9A 4HEHA 5HS4A 1OH6A 5FWNA 5K99A 1A82A 1N5RA 4LQLA 2PBFA 1OI3A 3HL0A 1LH0A 2HWUA 3HKDB 3KIPA 3P0EA 4NCXA 3KOXA 3OJLA 1KPGA 2IZZA 2WBLC 2YN0A 4J49A 4J1TC 4EI7A 5LP6A 2J7KA 4LFBB 4WVFA 3ND8A 5EMJA 4BECA 1ODFA 1R9GA 1JDVA 4MV5A 1CVIA