3QPDA

Structure of aspergillus oryzae cutinase expressed in pichia pastoris, crystallized in the presence of paraoxon
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
187
structure length
186
Chain Sequence
LTGGDELRDGPCKPITFIFARASTEPGLLGISTGPAVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIAEAQGLFEQAVSKCPDTQIVAGGYQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQERGQIANFPKDKVKVYCAVGDLVCLGTLIVAPPHFSYLSDTGDASDFLLSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cutinase 1
publication title Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
rcsb
source organism Aspergillus oryzae
total genus 68
structure length 186
sequence length 187
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qpdA00
3LLCA 2ES4A 1EHYA 4A16A 4ZWNA 3MUOA 4P92A 3QMVA 4MWTA 2BAGA 5AKKA 4QEKA 4WFJA 4G1FA 4B84A 1TRHA 3BIXA 2WUFA 4EB0A 1UT6A 1YB6A 5EHQA 1H22A 1GGVA 2DHDA 3WIOA 2WIGA 4FLFA 3ANSA 1BEZA 2OGZA 2GBCA 4FKBA 1B41A 2J3QA 3H2KA 2QT9A 1AGYA 2Z3ZA 3WLAA 2JGLA 5AK3A 3H04A 4P9NA 4UUQA 5AI8A 1YS2X 2ZJFA 5EHXA 4GLBA 5ALEA 1AC5A 3MGAA 1R9NA 5AKLA 2Y2UA 4G4JA 3WIBA 3FSGA 3G9XA 2XUJA 4QDOA 5A7FA 3F67A 1WPRA 5D3KA 3FYUC 2OGTA 2C4HA 4BAZA 2EEPA 2HM7A 4FNGA 4MEAA 1N1MA 5EFZA 5LLSA 4C4XA 1JMKC 1OILA 3O4IA 5IVHA 1J2EA 3AFIA 1FFEA 4P93A 5EIAA 4BP9A 2YASA 5ALZA 1GKLA 1XZCA 4G9EA 3H0CA 4IO0A 4OB8A 2XMCA 1MU0A 5CW2A 3C5WP 2VJDA 2WHQA 3EF3A 1WHTA 2OCGA 3I2KA 2WG2A 1CEXA 4OB6A 5E2IA 4KAAA 3KWJA 4IH9A 2JGMA 2QM0A 3QPAA 1F0PA 4K6KA 1J07A 3F96A 1WOMA 5HKAA 5T4FA 2H7YA 4QLOA 5JAOA 3H17A 5AK4A 2O2IA 4X90A 1CLEA 5CH5A 2XMDA 3D5EA 1P0MA 2XUPA 3Q8WA 2CEKA 1XLVA 3QPDA 2XQJA 2VJAA 4WDRA 4B80A 4LXGA 3IDAA 5AM2A 4N8DA 4LYDA 2ACEA 3WWDA 2XMQA 4LXHA 1UKCA 3WMRA 2WU3A 1CIJA 2G5PA 1Y7HA 1ZIXA 1ODSA 3STTA 4GBGA 2VAXA 4QDTA 2WFMA 2HRQA 4UHEA 4WY5A 5T4EA 1EA5A 2RIPA 2WILA 3OG9A 3I6MA 3DEAA 1FFAA 2HU7A 1UK9A 4ARAA 2CUTA 3WL6A 4J0CA 3TRDA 2QKYA 1QO9A 4WFIA 4X6YA 4HZGA 4ZV9A 2P8SA 4X95A 2QRUA 1Q0ZA 1QO7A 4HRXA 2XMSA 4FNMA 5K3AA 4C4YA 2HL6A 2QJRA 4PV7A 2BUCA 3UUFA 3TJMA 1K5PA 3ED1A 3FLBA 3QPCA 2EDAA 3L1JA 3ESAA 4Y2RA 3G0IA 3M82A 4U2CA 1QTIA 4Y2SA 1H2XA 4B7ZA 4DSZA 1XZLA 1W75A 2JF0A 4Y2YA 3IA2A 1EH5A 2OQIA 3R3ZA 3WK4A 4X3CA 2XMGA 3G0GA 1ZJ4A 3SWWA 2R8BA 3SX4A 1XFDA 1YR2A 2HIHA 4DLNA 1XQYA 2VA9A 4KEAA 4RPCA 1AUOA 5CT4A 5DTIA 2JBWA 2CBGA 1ZD4A 1HBJA 4X85A 1CQZA 2B61A 1E8MA 4M0MA 4UBKA 4Z49A 2VJCA 1QJ4A 2IX9A 3R3UA 4OD0A 5A6VA 1MN6A 3E3AA 3O95A 1ISPA 1L7RA 2YH2A 1LGYA 3PFCA 4IH4A 4TPKA 1XQWA 3D2CA 1E3QA 4H7EA 1JT2A 2HU5A 2WFZA 4QDUA 5JZSA 4GWLA 5AKZA 3WK9A 4W1RA 4YASA 2OCLA 1DTEA 2ONCA 3WL5A 4N8SA 3KD2A 2QMQA 5ALMA 4C89A 4JNCA 3STYA 3F9CA 2FJPA 2WTMA 3WKEA 5E4JA 2RHWA 4DMFA 5HF6A 2E3JA 2Y1KA 3LCRA 3O9MA 4AO6A 2Y2VA 4FMPA 3UUEA 4OSEA 5DLPA 3T52A 1Y7IA 2CKMA 4FLEA 3G8YA 4ZGBA 5HK8A 3QMWA 1QIGA 5LZ4A 4BATA 2W6CX 2GYVA 5CH3A 1QTRA 2XMBA 3H2IA 2HA5A 2C5GA 1DX4A 4KE6A 5HFAA 1E8DA 1TQHA 4AX4A 5HKBA 1W1IA 2Z8XA 4H0CA 3WZLA 5K3FA 2XUHA 4UHCA 4DNFA 2WIJA 4FBLA 3FVRA 3BF8A 4HXGA 1XLUA 3WJ2A 4UBOA 4AMYA 3ZI7A 3VJKA 1UK8A 5C8XA 1U2EA 2X76A 2XUQA 2HU8A 1IVYA 3AZPA 5ALFA 5J3JA 1EVQA 1CUZA 3AINA 5JZBA 5AM5A 3LIPA 4WJLA 2XUFA 4N5HX 4E46A 3C6XA 3M83A 3PF9A 5CRIA 4I3FA 2DSNA 5K3CA 4DSAA 1THTA 3A70A 3D0KA 4K5QA 4DNOA 2ZSHA 2Z3WA 5DNWA 4YX9A 5LZ2A 1UOQA 3BWXA 1YA8A 1LPSA 1R4ZA 4DYHA 3R41A 2D5LA 5DWDA 3I6ZA 3FCYA 1MJ5A 2VSQA 1ZJ5A 2DQZA 3C70A 3QYJA 5E4TA 4MQMA 3H2HA 3OTQA 1P0QA 1AKNA 2PU7A 3V9AA 3NUZA 1M33A 5IKXA 1ZGBA 2FX5A 1XZBA 5AIBA 4UFPA 4C4ZA 5FXMA 1EX9A 3HC7A 3IIIA 3I2IA 3O4GA 3K9BA 3BXPA 5JATA 1YA4A 4NZZA 1XRMA 3WL8A 1AMNA 2CMFA 4EY7A 1CUFA 3JYHA 1EB8A 2C5FA 1TCBA 5JADA 3NOXA 2PUHA 2DQYA 4BTLA 4C6HA 5ISMA 2QXTA 2JEYA 3QM1A 1ORWA 2XUDA 4ZI5A 3R3WA 4BAUA 2WUDA 3B12A 3D4LA 4MYDA 4LXIA 2D0DA 3E1GA 1EK2A 2OLEA 4PSUA 4X97A 1MX1A 3PE6A 5AKGA 2QS9A 4BCCA 2ZSIA 4E15A 1GXSA 1WHSA 3CXUA 1TKRA 4J7AA 2GBIA 2FJ0A 3C87A 3STXA 4MXDA 5BWBA 1J06A 2WUEA 3L1IA 1K6EA 2OPHA 5KWIA 4E14A 5ALTA 1CQWA 3K2IA 4DMCA 4BP8A 4CG1A 1QGED 4H18A 1VE7A 1R1DA 1E66A 3RKSA 3STWA 4XWGA 4D9JA 2DHEA 1UFOA 1ZI8A 3F98A 5AP9A 5AO9A 4ZRDA 4JH0A 1QOZA 1G42A 4H7IA 5AICA 2Y6VA 4BZZA 3L1HA 3DCNA 5EIHA 1HDEA 4G8BA 2ACKA 4KRYA 4MEBA 3G9TA 2C0QA 4J0IA 4QDXA 3FCXA 5K3EA 5ALRA 4CIAA 1ODCA 5CXXA 1CFJA 3FSGD 3VKFA 4BVJA 3LIIA 2WJ4A 2G4LA 2XUAA 1XZFA 1VKHA 1R88A 3GROA 4AN0A 5LZ8A 3G0DA 2V97A 4AZ0A 1WPXA 2WTNA 4GI1A 1VE6A 3GUUA 4XVCA 5HK9A 4B9EA 4EY8A 1EDBA 1DU4A 2BFNA 1E89A 2WU4A 4DMHA 2WJ3A 3C6YA 5FDFA 1BU8A 3RLIA 5K3BA 5BWCA 2JGEA 3ESCA 2JGFA 5LP1A 2VT7A 3H2GA 1XZAA 1CUHA 1FFDA 4BB0A 3EQ8A 4KE7A 4B0PA 3DOIA 4EUSA 1CR6A 1AURA 5I8PA 1LZKA 5JAUA 4F21A 2B4KA 5LZ5A 1MAHA 1CUAA 1DQYA 2HA7A 4G4IA 3VJMA 4QDZA 2PSHA 4FWBA 1S8OA 1ZI9A 5A7GA 3HACA 1A88A 1VLQA 1H2ZA 1HLGA 1XZEA 4RGYA 5I7UA 1LPNA 4BE4A 5ALPA 2XB6A 3ANTA 4JYPA 4BVLA 5LKRA 2XUIA 4BRSA 2ECFA 4OYYA 1QE3A 2O2GA 3AZQA 2RONA 4B82A 2Z5GA 3PFBA 5AI4A 4DNQA 1FSSA 1VA5A 3UMJA 4AN1A 4HRYA 3SK0A 2AJBA 1UK7A 1AZWA 5DYTA 2WQZA 1R3DA 5CT5A 2WSLA 1JU4A 3HI4A 2CB9A 4F5ZA 4ZV7A 3DKKA 1U65A 4Y2JA 1N5RA 2H9YA 4CCYA 4PW0A 2R11A 4UHFA 2VF2A 3O9VA 4HS9A 1BEEA 1GQRA 2I03A 3WK6A 1ODTC 3K6KA 5LIPA 1OCEA 2ZYHA 1BN6A 3OOSA 4L72A 2XQKA 5ALNA 4CCYB 3U0VA 5AKXA 3PUIA 2PSJA 1XRRA 2PUJA 2I3DA 4PQEA 5JZ9A 3P2MA 1FJ2A 3WK8A 3FLAA 4NMWA 1BCSA 1N8SA 4J3JA 2OXEA 3QVMA 3RK4A 3I2GA 4KJXA 5JIBA 4UHHA 5LYYA 1EINA 2HDWA 5K3DA 3PI6A 4U2BA 3G9ZA 2XT0A 3DS8A 2XQIA 1DT3A 1UOOA 3ZWQA 4X71A 2PSDA 2QUAA 3E4DA 2ZJ6A 1KU0A 1ORVA 1JI3A 4DMKA 5E4YA 1CUEA 4KAFA 3EBLA 5IVIA 1K4YA 5FPPA 2VAVA 2IITA 3O4JA 1MPXA 1DT5A 4BDSA 1BN7A 3I1YA 1SCIA 3U1TA 5ALUA 3WK5A 1VXRA 4KYVA 1D07A 3QITA 4J0GA 3C5VA 1IUOA 4MYSA 4K6GA 4BVKA 4UBJA 4Q3LA 2C7BA 5FV4A 3KSRA 1LNSA 1T2NA 3HABA 3BIWA 5AI6A 2PPLA 4XX1A 2VEOA 5AK5A 3N0TA 5C7YA 2X5XA 5AKHA 4H7FA 1MT3A 1CUDA 2W22A 3M81A 4I19A 1PFQA 1EVEA 4UBLA 1MO2A 3HSSA 3LS2A 4Q34A 2HA0A 3W9BA 5JD5A 1AQLA 1QZ3A 1VA4A 1C7JA 3DJYA 5FPQA 2C58A 4F0JA 3IUJA 5HQ3A 3VJLA 2ZVDA 1EB9A 3BJRA 5JAHA 3IUQA 5AM1A 4H77A 4Y2UA 1ZD3A 4DM7A 4QA9A 3ZV7A 5CT6A 2FUKA 3G9UA 5HZGA 1P0PA 2HA3A 1CV2A 1VOTA 1ACLA 2I78A 3AIMA 5T4HA 1RP1A 1SCKA 3WWCA 4JYMA 4Q05A 3I2FA 3KDAA 2GYWA 2AXEA 1GT6A 5EI5A 5JD6A 1TCCA 3C6ZA 1G4HA 2O2HA 1E5TA 1TAHA 4FDMA 4Q82A 4X93A 3AZOA 5D3ZA 1Q83A 3KXPA 1MNQA 3B5EA 1THGA 3C43A 4IHAA 5H3HA 1GKKA 1HQDA 1XZKA 3H1AA 1NU8A 3X3HA 3VVLA 5AOCA 1YS1X 2ZYSA 4PSDA 5K3FB 2WKWA 3RARA 3ZLTA 3IBTA 4FFWA 1EI9A 2WIKA 2BGNA 2PSFA 3M3DA 2XUKA 5AOAA 1ETHA 4ROTA 3C8DA 4FFVA 2H7XA 1CUIA 2XLBA 1QIFA 1SC9A 1GPKA 4W9RA 4A23A 4HVTA 1H2YA 5AH0A 3DLTA 2ZYRA 2WFLA 3WZMA 1GZ7A 2EDCA 4JEIA 4BRZA 1HKHA 5JANA 2Q0XA 5IVDA 1EDEA 4UHBA 2BKLA 2O7RA 1XZIA 3SC2A 3F97A 4KAJA 2OCKA 2WG0A 5DJ5A 1NX9A 4B81A 1Y37A 3E0XA 5CXUA 1WCYA 4U2DA 3STUA 3PICA 5FOQA 4OB7A 1PJAA 1QFMA 3AIKA 5D7BA 4MQLA 3V48A 2ORYA 2PVSA 5ALWA 4NVRA 2AJ8A 4YK7A 2G63A 5A7HA 4X6XA 3STVA 1LPPA 5AKEA 3FAKA 1USWA 4WCVA 5DYWA 4WDQA 2AJCA 3GBSA 1IZ7A 3IULA 2CZQA 4W1QA 2VT6A 5KREA 4ZXFA 2RI6A 1LZLA 1TIBA 4OPMA 4Q3OA 1YB7A 3WWOA 1LPMA 1A7UA 1ZD2P 5LKAA 3FLEA 3FVTA 3DL7A 3FWHA 1QONA 3JW8A 1Q0RA 1UZAA 6YASA 1CUUA 1J1IA 3VDXA 3HEAA 4CI9A 5AM0A 4EZIA 4AB1A 1Q84A 3BF7A 4CG2A 1IUNA 4AMZA 3IVMA 5FP0A 1MX5A 1YASA 2JIDA 5AK6A 2G5TA 4QWWA 1B6GA 3EIOA 4XIIA 2WHPA 5CT8A 5ALHA 4QZVA 5JAPA 2DR0A 4RE5A 2YXPX 1MTZA 2BCEA 4O08A 4Y2PA 4Y9SA 1EXWA 3S2ZA 1UK6A 2WLSA 2H1IA 2K2QB 5CTAA 4B83A 1YAHA 2XQGA 4FBMA 4AO8A 3I28A 3FYUA 4DIUA 1QIHA 1VZ2A 4ZREA 3T4UA 1XLWA 1L7AA 4QWMA 3WYNA 3FYUB 4H7DA 2PM8A 2JGIA 3DQZA 4OU4A 3G7NA 5JALA 3QMMA 5AHXA 1BCRA 1VJ5A 4UFNA 4KRXA 3GFFA 2RGUA 1N5MA 5JARA 4FOLA 1LLFA 5ALJA 4DNPA 3IURA 5AI5A 3C45A 3W04A 3VVMA 1CRLA 5A2GA 1RWQA 3V1LA 5JASA 4LHEA 4H7HA 1MX9A 1XZMA 3WL7A 1JMYA 2QTBA 3EQ7A 5FRDA 4EY5A 4KR0A 4BDTA 3WYDA 3NGMA 4L0CA 3D59A 1NU6A 3PF8A 5DTJA 4H7KA 4DGQA 1SCQA 4OCZA 3YASA 3BDIA 4BE9A 4IQ4A 2HFJA 4UBNA 3R40A 4MJ3A 1IZ8A 3DKRA 2LIPA 5DNUA 1O6FA 3O0DA 1CUXA 3WKDA 1DWPA 2RAUA 3B3QA 4WY8A 1ZGCA 4OU5A 1QLWA 4U2GA 4TGLA 5LZ7A 4BZWA 1QIJA 1K63A 3BE8A 3HZOA 5C8ZA 2QVBA 5HFNA 4LKOA 4PF1A 1BE0A 2GZSA 1EK1A 3DL4A 1UWCA 2XI4A 3N2ZB 3PDCA 4XJVA 1DX6A 2OCIA 1IUPA 4YPVA 2HADA 5KWJA 7YASA 1JFRA 1C7IA 1CVLA 4Q1VA 5SYNA 3W2TA 1G66A 2V9ZA 4ITVA 4KE9A 1HL7A 2PKYX 1XKTA 2OAEA 3ESDA 4BCBA 2ZJ7A 5JYCA 1FFCA 1I6WA 4GW3A 3WWEA 3C8HA 2PL5A 3OC0A 1YSCA 4GXNA 3D2AA 1A8UA 1QIIA 1BS9A 3GZJA 1BROA 1WM1A 4GDMA 5ALQA 4L9AA 4W1SA 3WA6A 2OGSA 2XUOA 1JU3A 3H2JA 3V1MA 3R3VA 4BC1A 1TCAA 3A2NA 3D2BA 1CUYA 5AJHA 4HAIA 3A2MA 2JGKA 3OM8A 3WK7A 1BRTA 3W06A 1X70A 1VZ3A 5F4ZA 1DINA 5HF8A 1CUBA 3FYTA 4E11A 2ZYIA 2QR5A 3DYIA 1ZI6A 4FTWA 5D6OA 3BDVA 3R3XA 1WB5A 1YCDA 3Q0TA 4N8EA 2JGJA 2HA6A 2WG1A 3FNBA 1QIEA 2Z8ZA 4X91A 5EHZA 2GBFA 4TVKA 5AI9A 5AKYA 4J03A 5ALOA 5JD4A 4X6UA 1LBSA 4QNNA 3S8YA 2OAGA 3HYSA 4EBBA 4Y2TA 4CIBA 5BV7A 4W63A 1L7QA 1XRLA 5ALXA 4G8CA 3CN7A 4C88A 1SOMA 4OYLA 3MUNA 1W52X 1OXMA 1CUWA 2PU5A 4G5XA 3ZLVA 2J3DA 4X00A 2B20A 1TK3A 4U2EA 1CUJA 4HXEB 1XZJA 4AXBA 3W05A 2WHRA 1AX9A 3ICWA 3WA7A 4K6HA 1KEZA 4MWSA 3WKAA 4INZA 4W1PA 3DNMA 3WKCA 1F8UA 2HA2A 2WIFA 1QIMA 2QJWA 4J0DA 5FKJA 1DQZA 4I4CA 5IVKA 1CUGA 1GQSA 3I2HA 4Y2QA 1SFRA 4ARBA 4FHZA 1GPNA 2UZ0A 2WM2A 3WJ1A 1RYYA 1DWQA 3FOBA 5A71A 4M0EA 4Y7DA 5LZ9A 2B9VA 4JUIA 2H7CA 3CN9A 1ZIYA 2AJDA 2NW6A 1XRNA 5ALSA 4EY6A 1VXOA 5AIAA 1QIDA 1IMJA 3BL8A 4L3WA 1ZD5A 2XUGA 4PSCA 1C4XA 4WFKA 5ALKA 1XZDA 5CT9A 3HLKA 4UBMA 2BUBA 1GPLA 4GECA 1UKAA 3GELA 3G0BA 3HJUA 3BJMA 2GYUA 3OURA 4LIPD 1W4LA 2VATA 2VQ6A 3H1BA 4N5IX 1ACJA 1W76A 1JJIA 5C81A 5AM4A 1MNAA 3A2LA 5T4BA 4B6GA 4B85A 5EIEA 3JWEA 3VXKA 3NWOA 3WQHA 2OQVA 3CCCA 3QZUA 1JJFA 5YASA 4BTVA 4DTCA 1P0IA 1H2WA 3OPMA 3HRHA 5BOVA 5HQ3B 4EA6A 1JJBA 3D3NA 4NS4A 1PV1A 3I6YA 1Z68A 3HXKA 2AJLI 3G02A 2QZPA 5FLKA 1H23A 5I9IA 5CBKA 1WB4A 4C01A 1YAJA 2PBLA 3TGLA 1U4NA 4J0JA 1FFBA 4J0KA 1XZHA 3ICVA 3WWPA 5CMLA 4PNZA 1CUVA 4B9AA 5ALLA 1ZOIA 4AZ3A 4HXFB 3FBWA 3VISA 3WKBA 4UFOA 4J0HA 3KWFA 3F8SA 2QUBA 4BAGA 2V98A 5ALGA 4BC0A 4U2FA 4BBZA 2X8BA 2VTVA 5KBYA 4EHBA 5FUMA 1UOPA 1LPBB 3O4HA 5AOBA 4QE3A 2DCMA 1W6RA 4F60A 4CG3A 4G9GA 1F6WA 1JKMA 1X2BA 1LPOA 4CFSA 4M0FA 2IIVA 4C87A 2VJBA 4BCDA 2PX6A 3MVEA 3IUNA 5DYYA 4EY4A 1LPAB 2XLCA 2WFLB 1E8NA 4P08A 2WUGA 3RM3A 1XQXA 1XKLA 1T4MA 3G0CA 4CCWA 4G4GA 3C6BA 4X7BA 3CCBA 4Y2XA 4AQDA 2V96A 4IH1A 3QH4A 2WJ6A 4RE6A 1WB6A 2GBGA 5IH7A 1UKBA 3DDUA 2XMZA 2DHCA 2HRRA 2WIDA 2HA4A 3W9UA 2BUAA 5CH8A 5SYMA 5HF9A 4Q3KA 2I3ZA 3AJAA 4BYMA 1UXOA 1ZICA 4KACA 3R3YA 1XRQA 1QFSA 4Y2VA 3LP5A 1XROA 3PUHA 3R0VA 3A6ZA 4RNCA 1CUSA 3ZPXA 2CJPA 2XMRA 3ZLUA 4OUKX 1DWOA 4G8DA 2OG1A 2GZRA 1XZGA 3ILSA 1O6GA 2DFPA 2C0PA 5AKJA 4LYEA 3AIOA 2QOEA 4H35A 2ROQA 5ALIA 1LBTA 2JEZA 3AUKA 5ALVA 5HF5A 5HCUA 5ALDA 2RHTA 3I1IA 4KE8A 2J4CA 1MAAA 5EHNA 2QXUA 4UBIA 5CURA 2BJHA 5AI0A 4K2AA 1KU6A 4V2IA 2BGRA 1EDDA 1QIKA 4QLAA 1HPLA 3V1KA 4PO3X 3I2JA 2WHPB 1U8EA 4UPDA 4H7JA 1F0NA 1A8QA 1R50A 1XQVA 3GA7A 1R9MA 2J4FA 1K8QA 4UHDA 5C8VA 2O7VA 3TEJA 2XE4A 2HHAA 1CUCA 3DYVA 4AO7A 4HTAA 5ALYA 3H18A 5AM3A 4X92A 1XRPA 3DD5A 4ETWA 3KOOA 3ESBA 3AILA 3IUMA 5EGNA 2PSEA 4GHWA 5A62A 1G5FA 2HFKA 4X94A 3EQ9A 2Y6UA 3DOHA 3H19A 5AKIA 4S0XA 1CPYA 4GEGA 1A8SA 4FLMA 5DNVA 3IB3A 3D7RA 5K5EA 3V1NA 4A5SA 1X2EA 3QBJA 5ESRA 4B0OA 3WI7A 2XDWA 2YYSA 2XQFA
chains in the Genus database with same CATH superfamily
2H85A 3GLGE 4QHTA 2ES4A 1EHYA 1TJPB 3B53X 3J81k 3ZWKA 2COUA 4RVHA 1XTRA 1PLLA 1K9SA 2ZIVB 5BORA 2O7QA 3QMVA 4AKIA 2BAGA 2FPIB 3IBGA 3HL4A 3KR9A 3NHLA 1NPDA 5AKKA 5HMLA 1KO8A 3C24A 1EJ2A 1J0AA 3DTYA 3FCOA 1WKCA 4IVQA 4WFJA 1DDGA 1ZRSA 4UVEA 5DHFA 1UANA 4AF8A 2R8EA 3THWB 1KP9A 2XTJA 3FMVA 1F1JA 4Q9LA 4AULA 3MWGA 3ET5A 3FFBA 4YJ2A 3P96A 1EWRA 1EIWA 2FPOA 5J5CA 3W90A 5HTKA 5CDFE 4QOGA 2LP4Y 1B42A 2P27A 3RAGA 2FWAA 1VDZA 2O2SA 4FLFA 1N36B 2DMRA 1CNFA 4QATA 3TLJA 2IYTA 1DIRA 2EZUA 3A6LA 1A4IA 1XGKA 2VXYA 2WZCA 4FKBA 1C9JA 3C48A 4YWJA 2G1KA 5HE8A 4YJ2B 2BONA 2I66A 4JCCA 4EYOA 1S4MA 2AL7A 5HGXA 3VR6D 1XCLA 3LBFA 1AGYA 2ZUTA 1Q3TA 3VISA 4GX2A 2GYYA 3WLAA 4BN4A 4TL7A 4O4IB 4P9NA 3CB2A 3K6RA 9LDBA 5EHXA 4GLBA 2HLHA 5TQ0A 1GGHA 3UAVA 1JALA 2HK8A 1SOWA 1XLTA 1DGQA 3FJ1A 1FL9A 4TZKA 5FUYA 1X7YB 4E08A 5CFNA 2V6JA 5AKLA 4F91B 3ESXA 5DWVA 3E70C 1G2IA 3W5HA 2ZJAA 3S0JA 4G4JA 4OHCA 5FO1A 4D3DA 2ADFA 5CFZA 1KJWA 3ETLA 5TQ0B 3CKYA 4OHUA 3BORA 4E7OA 4OQDA 3G9XA 1FB5A 2W2OA 4QDOA 5JJ5A 3F67A 4KWCA 4NAVA 5D3KA 2WE8A 4NZYA 3SZUA 3Q8MA 4OG2A 2O23A 4GIBA 5LUBA 2C4HA 3LQ1A 1Y81A 3AWIA 4M86A 4BAZA 1XC7A 1BJTA 3DT8A 1YL7A 1V9LA 3SJUA 1Z7GA 1HMPA 4AFNA 3MWEB 1ZA1A 2YCBA 3B1WA 1HEYA 1J56A 3OE7A 4I0WB 2JIZA 3C41J 3JSAA 3TSYA 3VPGA 2AC2A 1ONOA 1ND5A 3AEKA 3GFVA 3O4IA 3I05A 4IJ6A 3PTZA 5IVHA 3KV1A 1J2EA 2PRZA 1HWYA 1EFUA 4QQRA 3R7LA 3U7RA 1VRWA 1O03A 3HA7A 4B6FA 4IKOA 4AG3A 4EHDA 4A6PA 4U6SA 5EIXA 3ZCXA 4P80A 4DQ0A 4ZT4A 1PWXA 1OJ7A 2JCGA 4LN1A 3UUWA 3AHFA 1QZTA 5ALZA 4CEIB 3RU7A 2PV0A 2JLVA 4B5KA 2QGZA 3H0CA 4RVGA 1ICIA 2ZJ0A 4XJXA 3TIXB 4XJSA 5L4NA 3FUUA 3LT4A 3O7WA 4OB8A 3OCUA 4Y6OA 5CW2A 1SJ9A 1AJEA 2XJ4A 4H7PA 5HTOA 1T0IA 3OFND 5KUTA 2WHQA 2I6GA 2WABA 3TKYA 1DE0A 1XF1A 4RGQA 2ABWA 2DWOA 2ZGVA 3WE7A 3ENWA 3K1JA 1LQ2A 3NVDA 4MIYA 1NZFA 3ESRA 2QQEA 1CEXA 4HQRA 3RIEA 1FK8A 2WPNA 3R4VA 5CU7A 4OB6A 5E2IA 1FSZA 3EZ2A 4HAYA 1LV7A 4KAAA 5CVCA 4DF3A 2G09A 4PZZA 2MR6A 4GE3A 4NEGA 3BE5A 3PSHA 1WVGA 3U4AA 5BNIA 2AW3A 4EJMA 3KSBC 2IU3A 3B5IA 4JP3A 4X20A 4BMZA 1KI1A 1MVOA 2HN9A 3GEEA 2WJZB 3R0QA 5GONF 4DCJA 1J07A 1WAMA 1LBIA 2I4MA 2R8PA 3GLVA 3JY6A 3F96A 4R3NA 1QYIA 4RANA 4RCVA 3G49A 5DP2A 1QYWA 1GJRA 3UANA 4BPRA 1WEHA 3H9EO 4PO9A 1DPFA 2JFGA 2VZEA 1CBUA 3AR7A 3M49A 3NXSA 4MR7A 4ZT6A 3TNJA 3L04A 4IFEA 1RJEA 1PJ4A 1ECLA 3LHFA 1PTJA 2G88A 4G86A 1CLEA 4A0QA 1S4QA 1P1HA 5JCOC 1OWNA 2ZJZA 4KG7A 2ZETA 4A0SA 3SMQA 4YAFA 2XR1A 2XUPA 2CEKA 2FPRA 5ECDA 1GFIA 4MZDA 2PT6A 1P2TA 1PJBA 1DAFA 2RBEA 1GRVA 2WAAA 4WDRA 3FPEA 4QUIA 3T7SA 2BH2A 3BILA 4KR3A 2WTEA 4XRRA 5AM2A 4G1MB 3L7JA 3GRVA 5G2OA 3P4UA 2PZKA 3NG1A 3LQKA 2D5CA 2O2YA 3BCHA 3WP0A 3RJTA 4C0QC 4EX6A 3K5IA 1YOVB 3WMRA 5TJ9A 4C06A 2PAAA 1H5NA 1Z22A 2WU3A 3JQQA 1CIJA 3MGGA 4I4LA 4TRNA 1ZIXA 3FSEA 4OHYA 2PMBA 4HRVA 1DAPA 1RDFA 3WXBA 3UA4A 2R1ZA 1NWHA 1RLJA 2VIIA 3CRVA 4LJSA 2WFMA 4L6CA 4OP1A 3CMCO 4QDTA 6NULA 3F6YA 1GPJA 3WGIA 2IHBA 2P3SA 4KV7A 1Y0BA 3WP1B 3A4MA 4HV4A 2E4WA 2IXAA 2HBYA 5T4EA 1VE3A 3ROQA 2P5UA 3CQ9A 3IEMA 4UCQA 1HE4A 3A8TA 1SN7A 3I6MA 1LVGA 4B3BA 4GOOD 2XNDD 4YDQA 4E1AA 1XIVA 4BP3A 3ZCPA 1O2DA 4BFUA 1XA3A 5HHTA 3FDZB 1UK9A 3OX4A 2BEUB 1SKUA 3DHYA 3UPDA 2VUTA 2F3SA 1ORDA 1Y1QA 5C52B 3W2FA 5CBPA 2B3TA 1CIVA 2HZ7A 3C98A 2G3YA 3PK0A 1K7SN 3DL0A 2F9MA 2Q6LA 3IUYA 2QKYA 4LA4A 5MN6A 2ON6A 3N0XA 1B0AA 4RXMA 3B2EA 5CNMA 1XP5A 4XSVA 4HZGA 5ADVA 4LOAA 4CFZA 1RHRA 1WXDA 2QM7A 4PRKA 4X95A 4BNUA 3JQRA 4L8LA 1W30A 5JTTA 5TT1A 5FEMA 1CZNA 1Z17A 3ASVA 4L8VA 3CLSD 1PR4A 1C9KA 3IE2A 5EQJB 1P2GA 4KU4A 4PRZA 4WE3A 2FQXA 2BOVA 4FFSA 5KC8A 1OXVA 1RMYA 2ZSAA 2PX4A 4PV7A 1EZZA 1JYSA 3MJVA 3AHDA 1GRNA 1WNFA 5EXDA 3KVVA 1P60A 2B98A 4MULA 4OL9A 1T4DA 2XHZA 4YQFA 4KTTE 3R7BA 2P9HA 3L1JA 2Z2KA 4HI0E 3ESAA 3I01M 4KXMA 3RVNA 4YRBA 2GPNA 3DB1A 1UUFA 2X0JA 2NTJA 4NFHA 1QTIA 5DKFA 1LQUA 4Y2SA 1H2XA 1L8AA 5CVTA 1GSAA 2NYRA 2ZYGA 3ZUGA 1DAGA 1YBHA 2FZKA 4ASUA 2QN7A 3H87A 4CU2A 4IUDS 2DEUA 4A10A 4IF6A 5G0TA 3C3KA 4ROSA 2Z56A 1PFYA 3U40A 2OQIA 4QEDA 5AVTA 1G17A 1NN0A 1I6LA 1JUDA 2G1JA 4X9XA 2EIXA 2BGGA 1Z8NA 1POWA 3ECSA 3AJ9A 4QUGA 1T5HX 3A58B 2V3VA 1NDHA 1RZ3A 2GA9A 4NAUA 2SCUA 1NFFA 3ELBA 3OO0A 1PR9A 3X1MA 4GF5A 4L27A 3HGQA 4PZPA 1W1UA 4KWEA 4KB5A 4EI7A 1TMGE 4TLBA 3S3TA 2H3HA 2HIHA 3IQHX 1RWOA 4TTTS 2FCAA 3KE9A 5C8YF 1M3SA 1D09A 4FEAA 3CNLA 5JRJA 2ZTUA 2AUMA 2ZRKA 2YWGA 3VBCA 1Z2CA 4RPCA 2UYQA 3OZVA 3REQB 1XTZA 3MT7A 1T13A 4PLZA 4DT1B 4O63O 4G5SA 5JMPA 1Y3AA 2WHXA 2C8LA 2ZDGA 5IZ4A 5HZMA 4BFSA 4NY1A 1TGYA 4X85A 5JY1A 1Q0SA 1N2JA 4FFNA 3MINB 2FK7A 1OLXA 1SBNE 3MTIA 4I55A 1XEXA 5CIQA 1A9QA 2BE9A 4M0MA 3MJTA 4XOIA 1T15A 1EUDA 2BZ0A 3HXMA 2FKAA 3SYLA 4KV9A 3VUEA 4YUWA 4GOND 3F6PA 5HJ5A 1ORRA 3VU8A 3E3AA 4HB2A 3O95A 1YJ8A 1M8PA 1T9KA 2P6NA 2W2TA 3BZWA 1HDRA 2HX1A 3HU5A 4RK5A 1OLXB 5ER6A 2ZIAA 1EX1A 4MGHA 4JI5B 1NPTO 3ZR4B 4LG1A 5TPWA 3PFCA 3T3GA 1TW3A 1AQIA 4AS1A 3MPOA 3K1ZA 4O0MA 5BRNA 1AO3A 2HSGA 4FZRA 3C5CA 3I2YX 1XQ1A 1JA9A 1FVXA 3FF4A 1XR3A 1ZIPA 4BBAA 5FUWA 1JEQA 5IT5A 5H3LA 4DC0A 4N54A 3IOMA 5J2TB 1L4EA 1TC2A 1XDWA 2J5QA 4O3MA 4QDUA 1JXQA 4JBXA 4PHTA 3WNBA 3HZHA 3HFRA 5BW5A 5JCPA 3VKGA 4PYNA 3HDJA 4JJZA 1U81A 2OCLA 3P4YA 2FUG6 2CXXA 4LOHA 4MV0A 4IDNA 1JEQB 3LKZA 4MHSA 2BP7A 2JA2A 3C1TA 4TT8A 5KYTA 2YWEA 3A0RB 3OKCA 5ALMA 2VTEA 3RVPA 2ST1A 4JNCA 3TUZC 2J5BA 1GM5A 2GHRA 2Y3IA 1SC4A 4W5OA 3WKEA 4JI8B 1NAHA 4TYYA 1FBNA 2P35A 5E4JA 5SZIA 3DCJA 2ZWMA 3TQIA 1JF8A 2CN1A 1CJUC 4GUAA 2AE2A 4IJQA 3UT5B 3OLZA 3OQ1A 2BP7B 4OXRA 4L95C 3UHPA 1GZ5A 5BR8B 3FPLA 2ZG6A 4HUJA 4YMVA 3USZA 3LCRA 1RAIA 3QXHA 4YCDA 1Z7EA 3O9MA 1QBKC 3LYAA 2PPVA 2C5EA 2Q9UA 4MUFA 3TW6A 5ES4B 3SQMA 5ED4A 3AM1A 2KPOA 1JDBC 2CFRA 2CVQA 2EG5A 2K2WA 2XGMA 4UDNA 3DAOA 4D8WA 3W79A 5HVNA 1FMTA 3WQQA 5JI3E 5IAAA 4RTQA 4LI3X 3DV0B 1EZ4A 5DLPA 1K7CA 2CKMA 3UT0A 5I51A 2CE7A 1P2BA 4QFMA 4G5QA 1RPAA 1WSDA 1U8TA 1SAYA 2B25A 2F17A 2QR3A 3Q41A 2IODA 5KNDA 1F51E 3H5WA 4DWOA 3N8KA 2X40A 1PD0A 3KQSA 3KO8A 3PXUA 3QMWA 3R74A 3VI4B 4DLYA 3W5SA 5AW8A 2W6CX 2Y0CA 1F4VA 4B5LA 2CYAA 2XMBA 1BA2A 3HUFA 2A57A 3D0QA 5KNCD 2HA5A 4QASA 1TM1E 3OU7A 3AIIA 2NZYA 5E6SA 8ADHA 2BTQB 2OFOA 2WSYB 1NQAO 2OBNA 1LW7A 3KYDB 3REOA 3O03A 1IBKB 5TPZA 4F86A 2QSYA 3E3MA 1ENPA 4B33A 1MORA 4ONEA 4BHTA 5H8WA 4OQMA 4A92A 5K3FA 2QB5A 1N6NA 2PGOA 4UHCA 3JQBA 2VJLA 2MSCB 3Q9SA 4CM4A 1XVIA 3K09A 3ONNA 4KLRA 4FBLA 2W70A 3C8UA 5J2UB 3QEAZ 5F23A 3WGQA 4D56A 5IHXA 2XIQA 2ISCA 3AUSA 4MWDA 4LCJA 3VNSA 2C7RA 1Z6XA 4YP6A 3WJ2A 3DVQX 4UBOA 4RVNA 1J0XO 5AUQA 4HNAA 2MIIA 4PLVA 2IHYA 3DQPA 3ZI7A 1TEVA 4R9RA 3VJKA 4RDXA 3CISA 1KDYA 2QVCA 4ECEA 4EEXA 3UMYA 2DU8A 4QUBA 2Q5OA 2XA1A 5ARBA 2XUQA 2AFHA 4YJHB 3QVOA 2ZAYA 3KQQA 3FZQA 3RI3A 5BO5A 3LUCA 4HZUA 1GUYA 3QXSA 1I80A 2PYZA 2VYCA 4PZLA 1X7ZA 5IWAB 5ALFA 4S1NA 1CUZA 3AINA 3EVTA 3AR9A 4MVYA 3G88A 4X1YA 3T5CA 5AM5A 1Q0HA 2RHGB 2XUFA 4LXYA 2P4HX 4E46A 5CB8A 4RVUA 1EKXA 2PL3A 2DFLA 2V8BA 3PZRA 4IGFA 2ZM5A 1QFYA 4GKJB 4YONB 5IM4A 3C6XA 3QJYA 5EWJA 2ZBVA 2TMGA 4J3NA 5I4CA 1FJXA 3QVTA 1SZCA 4R8KA 5KHOC 1DBWA 1XCPA 1O5IA 3QOWA 4PCAA 2ZK7A 1M5UA 3PWSA 2F62A 3FDXA 3QU5A 3QWHA 1P1RA 2QL5A 4RD4A 1N5OX 4FZJA 4X1YB 3W5AA 2JIPA 2WWHA 1VC2A 3OY7A 2K5UA 1DOAA 3DR3A 4IIVA 2VP9A 2Q07A 3MK31 1XTKA 3AFOA 4JWKA 3OZCA 1T2UA 4TYMA 5K3CA 2YMQA 4RNDB 5KYKA 2IXFA 3TR5A 1YCGA 4O2LA 1GGMA 1WZ2A 1UIMA 3D6NB 2IHVA 4PZ9A 2ZP1A 2JIQA 4YWHA 5LQAA 4DNOA 3QENA 2YMLA 3QSGA 4GPTA 2Z3WA 2Q3LA 5I3CA 4GM0A 4JQCA 4X1IA 5DNWA 4YX9A 3DNFA 5E6UA 2ET6A 3GJTA 2YRXA 3S99A 4XGNA 4PS0A 3GG2A 4A8JB 4ZJUA 5IDWA 1N7IA 1O87A 3QHQA 3BWXA 1JIJA 3SLKA 2WFAA 1D8AA 1PEAA 3I5XA 4ER6A 1R4ZA 2HPAA 1FX0B 3I8SA 3VYWA 4HAOA 2AI2A 1BTOA 5C4MA 3I6ZA 3NW9A 5DBEX 1MJ5A 2C2BA 3C97A 2AV6A 3QKUA 1T4CA 4F1JA 4GVLA 2DQZA 3C3AA 3AF0A 3IODA 3H2YA 3N2GA 4NQZA 1F3LA 2CB0A 2HWWA 2WSBA 2PU7A 1KZ4A 2ARKA 3K4HA 4IGAA 4J2TA 2VHXA 2SKDA 4KC0A 3HCDA 2CNBA 2IYAA 1IQPA 3DMTA 5DI3A 5IKXA 2FX5A 5CNKA 1ZKMA 3BRWA 1TFRA 4G0ZA 5T6BA 1QVVA 2FP4A 1UPAA 1E7RA 3MTJA 3N2GB 3SR0A 5JYBA 3RQIA 3HC7A 2CNOA 4Q3NA 2FSUA 5E7QA 5IM4F 1C8LA 3O4GA 5D84A 1TUEA 4HGPA 4YR7A 2E1RA 4WCFA 4QBKA 5TF4A 1JIKA 5JATA 3E2PA 3BGOS 2CV1A 1ESEA 1LNZA 4M54A 2JAHA 3BEOA 3NU1A 5F5NA 2FP4B 2F3QA 5EE3A 3DBHB 1U8YA 5IJ9A 2UYCA 1K5DA 1ZEMA 1TCBA 4PSKA 4X8OA 3A2KA 5IJXA 1DFGA 1OZHA 2WMOB 3RPEA 1UBMS 4MRMB 4C78A 4C6HA 4MV8A 5ISMA 3CR3C 1ADBA 1TQ6A 1JV2B 2HI0A 2JEYA 2ZR7A 3QM1A 1I3NA 1TO1E 4BJHB 1ORWA 1JI0A 1NA5A 2XUDA 3GJQA 5LDGA 5IMSA 1H0SA 2CMHA 2G6TA 4BAUA 1T9DA 2R97A 4QIHA 2NU6A 5IJ9B 1W4AA 1QSGA 1Y3HA 1EG7A 1ZW1A 4RVDA 5FOUA 3UK2A 5DK4A 1WBBA 3D4LA 1TKBA 2HO5A 2O3TA 3AU9A 1CCWA 1WKVA 3TQFA 1ZMOA 1P72A 1RFLA 3VH4A 1H8HD 4EJ2A 4K6CA 4ZC1A 3UAGA 2JFQA 2QZJA 1H1TA 1X7XA 2H2HA 2MSEB 2OD9A 3PWKA 4BWFB 5DM70 4DDKA 1MX1A 3WRVA 4CKWA 2NU6B 4X60A 3W3AH 1TT5B 3T38A 3IBFA 3LPNA 3VR1A 4BQPA 2BF4A 3C5EA 4E15A 4ZVVA 3TIVA 4GQBA 4TKVA 3H8SA 4WKOA 2GLUA 4FILA 3GJ4A 3RB8A 4XD7D 2YNMA 3VOTA 4RWZA 3MNFA 5DX1A 4CMHA 1QF7A 1NJ8A 2GBIA 2FJ0A 4N76A 2ATXA 4IJ5A 1EX7A 2GN4A 3ONVA 3EG5A 2GUGA 2PZGA 4XUEA 4YMIA 3HKCA 4CKWB 1R0WA 2CXOA 4HOYA 1GLVA 3IUSA 3H6HA 4JJIA 2XGSA 4M9CA 3G2JA 2IYXA 3R23A 4Q7QA 4ZKDA 4X1KB 1U7UA 4DTIA 2WUEA 2AI3A 2LRHA 4W6ZA 4C0LA 4E5YA 2XRMA 2QRKA 2EARA 4NE7A 3EZGA 5FOVA 5E7IA 3HKCB 3LQRA 1W0KD 1EXNA 3DEHA 5ESWA 1BX1A 1CQWA 3R8CA 5B7PA 5EXXA 4LJ8A 3ZBPA 5JQWA 3VPAA 4JT9A 1A8HA 2H1LA 3JR7A 2W6ID 2RGDA 4PG8A 4G0XA 1QGED 2ZB4A 1CS0A 2C98A 4H18A 4LJ9A 1FP6A 3JZAA 1WW8A 2WOOA 3DOUA 4K3VA 4EATA 3KQPA 2Q5HA 4PZYA 3V4OA 2NXEA 3NTXA 1Z06A 4K7JA 1TT7A 4HWOA 4PFJA 4JV5B 3GXBA 2KS6A 4LF6B 3CJTA 3PNLA 3STWA 1V26A 3OCXA 4U0KA 3ROMA 1V37A 2DHEA 2X5KO 1UFOA 3F98A 4CL2A 3K9FC 2QGFA 2UYOA 2WB4A 5CFPA 1FQOA 4DV5B 1U4SA 1WW2A 4TWRA 3IQWA 2HK6A 2FXVA 1E3WB 2NNLD 4BVAA 4UPVA 4HH3C 4ZRDA 3BJEA 4V3BA 4YI3A 3OD1A 1NBAA 1NXVA 4A03A 5C32A 1DKLA 4M87A 1QOZA 3MJFA 2GXQA 3NNDA 4H7IA 3OWHA 1QO0D 2F3UA 3K16A 3B3JA 3WHLA 2FU5C 4BNNA 4OHVA 1TVKB 4FYVA 2NV0A 1L4UA 3EVZA 4ZGWA 3RSCA 4G97A 3T0GA 2VQDA 1XCOA 3DCNA 3IEKA 2WAXA 1B1AA 5EZSA 1A4RA 3K20A 1E6KA 1AG9A 3KPJA 2HQSA 4CMEC 3T99A 2XSZD 4QARA 1N33B 2ACKA 2PLNA 3RT9A 3CWCA 1J8MF 1NI4B 3RFFA 2QW8A 2C0QA 4HDKB 4FDVA 4K0KB 3LKDA 4DDMA 2OZKA 3JQ8A 2DWQA 3KSUA 3G79A 3IP6A 3ZE0B 2DBZA 2BIFA 3SYRA 4UE3S 1TL7C 5AICA 5ALRA 4QQ8A 1XMPA 1ODCA 1DJNA 3K0CC 4GM4A 5CXXA 1WETA 1WULS 1R6DA 2QT1A 2HU2A 3EF0A 3PUYA 3RSFA 5A5VA 2NVBA 1PR5A 2AE1A 2KWIA 3ENKA 3EXIA 4TXJA 1JG2A 1ODLA 1WZIA 1O95A 2PJUA 3LIIA 3QUQA 4NMLA 4P4GA 4U7WA 3VU9A 4R0NA 2WJ4A 1F17A 1E6CA 1WZUA 2X0KA 2ZE6A 1XZFA 2I7TA 2JHCA 3HNRA 2MSKA 3UV7A 2C96A 3AF4A 1WCXA 2PGLA 5HKKD 1SK8A 1I4EB 4M55A 5EWLB 1FUUA 1LLCA 4DWWA 1R88A 4RVCA 4AN0A 3EXIB 1VYVA 3L4EA 4FEGA 3U09A 3M1YA 2YDXA 5IU6A 3DP7A 4J7CA 2WDPA 1YZ3A 5A5EA 1MIHA 5F9FA 3HDGA 2R1TA 3VU9B 2FE4A 2VP5A 3HNOA 4KNWA 1NY5A 1TB4A 2ZULA 2V9PA 3EPRA 3GA0A 3PIRA 5T7BA 5FNVA 2N1BA 3H05A 2FSVA 4QU5A 4C9BA 3D3KA 3TLBA 3TX6A 1SUSA 1DBSA 1VHJA 2WU4A 4EY8A 4IQ0A 4D57A 2YN4A 4ME6A 2Q7DA 3ZEAA 2PNJA 2ATEA 2I1VB 3C6YA 4LTDA 2R1TB 1ZH8A 3JAKB 5FDFA 4QGSA 1T6XA 2WD9A 3PNVA 5CVUA 3BJZA 5BQFA 3WLQA 1U1DA 2JGEA 3IPCA 5FNVB 3CVWA 3I04A 4M0LA 3I30X 4E88A 1UBEA 3EQ2A 3AQIA 1E9SA 2ODBA 5DBHX 1T0UA 4UPEA 3GQBA 1RCFA 3N2LA 5M34A 1FSPA 2YVQA 1I3MA 1DDIA 1E2GA 2JB9A 1FFDA 1OASA 3QKIA 4LX8A 4BB0A 5JBIA 4BLRA 5DN6D 4B0PA 3GEDA 4GXQA 2D2EA 4QOHA 5JECA 2J0QA 2QAGA 1GQYA 2NZ8A 1ZGZA 3PX2A 4P53A 5FHQA 1QCCA 1Z2AA 1FJGB 1I33A 1RHUA 3FZGA 3LT5A 2D54A 5I8PA 1PJ2A 3UC9A 4B3TB 3DBLA 1A5AB 3IKTA 2XNCA 2OZPA 5CJ2A 4Z9YA 2IYWA 4B7UA 3TFOA 1UAGA 1R4MB 4F04A 1GNQA 4ALNA 4B3CA 5B1DA 1CWUA 3WL7A 2GNAA 3NALA 4B35A 1O4VA 3ZH9B 5FQNA 1ZN7A 2PSHA 5HS6A 3VNQA 3T35A 1X19A 1ZI9A 1X42A 2C7VA 4O6VA 5A7GA 5KOYA 2D2IA 1FX1A 3DBLB 4Q47A 4RY8A 2G83A 2PIDA 1AKRA 2QEQA 5KU1A 4URYR 3SQWA 3R5JA 1HLGA 2I7VA 1DADA 1H93A 3BVPA 1XK7A 3NXKA 5EJ4A 1W9HA 5I7UA 1IN8A 2J67A 1FNDA 3LKVA 4WEQA 4Z99A 3W5UA 4GLLA 4HQFA 2GVDC 4CR6A 2I2CA 1WHTB 3M6WA 3ANTA 5A5GA 1USKA 3THXA 4C4AA 1Q12A 1VIMA 1M5TA 2XUIA 5BSUA 4XYMA 3SGLA 2RBGA 5A5FA 1S3GA 1DC7A 1ZK0A 1OWPA 3VC3A 2V8OA 3PQ6A 1KFCB 1P4RA 4PHHA 1PJRA 2RSLA 5IF9A 3MYRA 4M1EA 4B82A 2VYQA 4WNAB 4OY3A 5AI4A 1IAVA 3BTUA 4IDPA 4ZQIA 3N39C 3O90A 1W87A 3DEZA 2QRJA 3TTWA 4LNUB 1DEAA 1V1MB 3A25A 1VA5A 1X77A 1G9SA 2AMLA 4MUHA 5JDCA 2K6GA 1USGA 5FBLB 1P29A 3OY2A 3PQ3A 4JOCA 3UJPA 3UMJA 2QTAA 1W19A 1XMIA 1GR1A 2B1JA 3DCIA 3L1KA 1Q19A 4HWGA 4J2OA 4R01A 1Y9AA 3DZDA 2AJBA 4GDFA 4UTRA 1JW9B 4AUEA 3HJGA 1AHNA 2BGKA 2VWPA 5L7YA 2Q2OA 1VB3A 5CT5A 5EQDA 4ABYA 5JZOA 1N34B 3C5HA 3OJEA 1PZNA 1V5IA 2ENUA 3PHHA 4YGYA 4KQMA 1TJ5A 2H4XA 3TFWA 3HI4A 3SEFA 3A1SA 4IMPA 4KSCA 4U6NA 1HORA 3ASUA 2ID8A 4JLSA 4K86A 4ZV7A 4EUHA 1M2OA 2ORIA 5TR9A 3JQPA 1G2PA 3FAZA 4LECA 4HFMA 4JYCA 3T7KA 2ZRDA 3KUUA 2ZANA 4LXUA 3VVBA 4HZIA 3EXG1 4PQRA 4R2LA 4EJFA 2ZIGA 5HW0A 1X74A 1FW8A 2ZIXA 3VR3A 3H3XA 2I03A 4YRGA 1XNRB 3K6KA 5BN5B 3IIKA 3PXCX 1CB0A 2B37A 1CXZA 1M2OB 2ZYHA 3DNPA 3MBOA 4HWTA 2OCDA 5FUBA 2O54A 3RFUA 4EHKA 3DDZX 3LXXA 4F3YA 3GR6A 1KJZA 1EE9A 9GPBA 1VJTA 3VMMA 1NSYA 2BLLA 3QXGA 3EGXA 1E2KA 1NJ2A 1SK9A 2ID7A 1XU4A 4LBZA 4QJ5A 4UAGA 1QOPB 1XTVA 2PGJA 1U1GA 2QUKA 4WASA 2I3DA 3ROKA 2YN2A 1F5NA 2QNIA 3K1TA 3WLNA 4ZZ0A 2IZ6A 2A8YA 6REQA 1GOTA 2VPZA 2C88A 3G5UA 3KT6A 4G1EB 3WK8A 5LDHA 1N8SA 2AF3C 2DH6A 2O20A 3NIGB 5IMBA 5B3KA 3QVMA 3EWSA 5BSMA 5EJ7A 1KMCA 4ABTA 1RJWA 4YQEA 4B40A 1CY0A 5K3DA 4M8KA 4K9OA 2H2DA 1NQWA 2JI4A 2XQIA 4FCWA 3RVDA 3TNDA 4YAUA 1DT3A 1UOOA 1MAWA 2JI8A 2WSMA 3FPFA 5KJCA 3T1YB 4F93B 1NI5A 4CLRB 3S55A 3QG1A 1C14A 1IH8A 1MT0A 3IMGA 1R66A 4KXNA 4C7KA 1SU8A 4DJTA 2XEXA 4PRLA 2ZE5A 1DAOA 2CVFA 3AONB 2Z8YA 4IFIA 2G4CA 1D7OA 2KE5A 2QUAA 3DM9B 3GMSA 4IL5A 4A2PA 3ZU5A 3K0AA 5GGYA 1ITZA 1GNRA 3MN1A 3GZ4A 3PEFA 5LCXA 4ZOQI 5BW6B 2VWGA 1FA9A 4N7MA 1BDJA 4CLHA 1Q1QA 1JQAA 3CE9A 5SYAA 5GTDA 5JV5A 2EX4A 4Z7JA 4HQKA 1XDGA 1RTKA 2AOWA 5LUAA 2ECQA 2JFUA 4FX2A 4LDJA 4NDNE 3TH5A 5IVIA 2W6MA 1H6DA 1MOSA 2E0IA 2QRVA 3I6BA 2AW5A 3U4IA 2OHJA 1DAEA 2F48A 4LYGA 4RYDA 4YP0A 2X5JO 2C95A 3BXZA 4NG5A 4F4CA 2HMSA 2IU0A 4EX7A 1MPXA 4MV6A 2AZXA 1ENYA 2FYTA 3QVWA 2R00A 5EP4A 2BL4A 2YC2C 5AJYA 4JVMA 4OXXA 4TVBA 5CPBA 5ALUA 5JZMA 2QGNA 2V5UA 1VXRA 1XMJA 3LD9A 4L8FA 4CUJA 3P20A 3WRXA 5BUZA 3NMUF 2R5NA 1JVNA 3GXOA 3C4JA 3Q7SA 3D8HA 3Q8KA 2PUGA 5JFTA 2POQX 3ND9A 1E2FA 3CNQS 1IY1A 3JXEA 3MMZA 4BJ6A 5EJ8A 1VB5A 3OT1B 1HYBA 2FMFA 1KAMA 1UQUA 2JFPA 2OENG 4UEJA 1BO6A 1O9HA 1SUDA 2PZAA 2ZDQA 1P17A 4MYSA 5BNFA 5EJAA 4FX5A 4XQ9A 4Q01A 2YW2A 3SEQA 4K6GA 4DIMA 3QEMA 4DA0A 4E30A 3JYQA 3BXGA 4D9MA 4MJ7A 4I5DA 3KQOA 1D4ZA 2BGJA 3H9CA 4LZZA 5KVQA 4DDVA 3HVHA 3IAUA 1LBQA 1U0FA 4HATA 5FV4A 1KJ8A 2JJQA 1T2NA 1WOYA 2LDBA 5K8IA 4BVFA 1GLGA 2AG6A 3F6EX 3K2BA 4UC0A 3HU2A 2QRLA 4EA7A 3RYFA 4O2RA 4RVFA 2JC3A 2C4MA 5K7SA 3BIWA 2NUBA 4IMIB 2XE7A 1GUBA 2JVIA 3CM0A 1PS9A 5FO0A 5LQNA 4TS4A 3V32A 3N0TA 4G0UA 1RQXA 3IV9A 3OPYA 3SY8A 1E6WA 4DCMA 5KYNA 4KPEC 1PQWA 2B7BA 3WLFA 4H7FA 1T6YA 4DEVA 1CUDA 4H4CA 1I6KA 4Q6BA 5DCYA 1REQB 4MPDA 4PHFA 1YT5A 1G5HA 3L8HA 4QBFA 4XSHA 2ZCJA 2KYRA 4BFXA 1EVEA 3VJRA 1JTEA 3R6TA 4FONA 1PT6A 3OQPA 5ITWA 3INGA 5IYZF 4BLVA 4D81A 4F38A 2DHQA 2ZUSA 2HA0A 2H00A 1N3BA 1PG5A 2GHIA 2IIPA 3TLGB 5I7OA 5REQA 5FLEX 4DQDA 3IO3A 1SXGA 1QZ3A 1PFVA 2C1EA 5C51B 1JT9A 5LJLA 3AERA 3DHEA 4GL2A 3F6CA 3QXXA 4P86A 4Y1EA 4ETIA 1Q7TA 2QTVB 4CM1A 4KUGA 3H8JA 1QFXA 3OETA 4R5HA 3ZY4A 1RLMA 5B2EA 3X2FA 5C1OA 3DF7A 2QTRA 1NE2A 1Y8RB 3JD3A 4C14A 5B57C 4OQXA 1YQDA 2PLFA 3S1AA 2QLMA 1J1ZA 2DOKA 4L7QA 5JAHA 5AM1A 3ETHA 2R7AA 4EENA 1RYZA 2HDNB 1OBVA 2JRCA 3B7WA 3OHPA 3HB7A 4TKMA 4TWJA 5HKLA 1OH6A 2UUOA 3DZ8A 3SKYA 5CT6A 3G9UA 2GS9A 1COWA 5LJIA 1YS4A 1P0PA 3QFCA 2HA3A 2D5BA 2RI0A 3N58A 1CV2A 4LFCB 1EA7A 4WINA 1O94D 2O8FB 1JJAA 3PHJA 2FSHA 3CNNA 4UM7A 2WU8A 3DOCA 3DQQA 2OZVA 3N76A 4A2WA 2YZGA 3A04A 1JA1A 1SHJA 2XEDA 3OTIA 4XM0A 2JCSA 3JZMA 4FYPA 3ZZMA 5AW3A 3SHQA 1OFUA 3KXKA 5HGJA 3UJHA 2A0FA 5D00A 4Q05A 3I2FA 1KSJA 3AY3A 3L40A 1LI5A 4KN8A 3N6XA 3SR4A 2WPDD 4DCPA 4QECA 4EFKA 5FWYA 2EP5A 2WB2A 1E1QD 1QHIA 2Y27A 2ZT6A 2QE6A 2XRFA 1EUCB 4D9BA 2C3PA 4D82A 5G0WA 2NLOA 3QQ5A 5TS2A 1IUKA 3PGJA 1M34A 1Y9JA 3QFFA 1WMBA 4LW8A 3ZY2A 3O91A 5JQGA 3ZI4A 3RVSA 3ENNA 3PZBA 1ZH4A 4GMKA 4XDHA 3M4JA 2WUWE 4X93A 1S2IA 2ORED 5IH3A 3LUPA 2R79A 4AUMA 1DQPA 3JQDA 1NNI1 2WJIA 3LNTA 3MCZA 2NMVA 5GGXA 3L8DA 1YUMA 5A9SA 4W5RA 2PS9A 4QOSA 3PPWA 3K1YA 3P1JA 1VMIA 2DX7A 1M34B 2EJUA 4ZDIA 1ZP6A 1TVCA 2A9RA 3GLTA 4PPYA 2QMUA 5A3VA 3IPAA 3SOZA 4N4AA 1WDKA 4IHAA 3DC2A 4P5DA 4HC4A 1XZKA 5DMXA 1NU8A 3ZWXA 3EW9A 1DFIA 4LZLA 5A6SA 2ZUCA 4OM8A 1Z5GA 1CZUA 2NQ8A 4QVGA 4GYWA 4PSDA 3DDSA 5B3AA 3IEUA 1U28C 3TW8A 1FU8A 3D7LA 1VLVA 1EI9A 4D44A 1LDBA 1U2DC 2PSFA 3HJNA 4JC5A 2VS1A 1L5MA 5CX4A 3AW9A 3JD2A 1RXEA 2I7DA 4EHLA 1RI3A 3B52X 1AMUA 5IRCD 2XUKA 1RM5A 4R41A 1F5SA 5CUQA 5A6SB 1YVPA 1J9GA 2DLCX 1AK9A 1B6RA 1DLIA 4OQLA 3C8DA 3TW8B 4LZAA 1FLDA 1GU7A 1QIFA 2XOXA 5FA5A 1NSTA 2W7TA 1GPKA 1E1DA 3PHBE 4A23A 4LGVA 4EPTA 2MJLA 2PFKA 5GM2A 4OH7A 1Q20A 2PCJA 3M4XA 2AYYA 1W0CA 4IWNA 1OOEA 5JJCA 4MKRA 4PHGA 4B32A 2JHFA 4RK7A 1VKNA 2BSXA 4KWTA 1WD7A 2Q0XA 3NVKI 4UU8A 3ZEIA 2AMJA 5IAKA 3C7AA 1S3IA 4J2HA 4WVLA 5FBZA 4PPGA 2O3SA 2BFOA 3HCEA 3J7TA 3PWTA 1XZIA 1HSZA 2QN6A 4IVRA 3RT7A 3WSWA 1G4AE 4HJRA 1HK7A 3T3DA 4KAJA 4DJDC 1C0EA 3GP5A 3RSSA 4EKDA 2FF7A 5TC4A 3WBKA 1N8TA 1OYWA 1YC5A 2WP0A 2VRCA 1M7GA 3ELYA 3QFSA 4K9NA 5C3UA 3V2IA 1BMTA 4IXWA 5CXUA 4CF7A 1Z0UA 3S8MA 1QGOA 1Y3IA 4U2DA 4HGYA 2IUUA 3LAWA 3KQTA 2IXGA 4QBIA 1EVYA 2ODWA 4GI3A 1L4NA 2WHEA 5ALGA 3I04M 5B53A 3T8YA 3ZCUA 3GEGA 2DETA 1B74A 4IZ6A 2JAOA 3EPJA 2EC5A 4MQLA 5EZ5A 3V48A 1C7RA 4TXLA 3FDJA 5L53A 2PLRA 2Q9CA 4NVRA 5DE3A 1MC4A 2RG1A 2VOJA 2FUNB 5CX1A 1JYFA 3L93A 5A7HA 4XIGS 4X6XA 1PD1A 2AEEA 3A9CA 2O8CA 5DW0A 1PFWA 1HL3A 4GSLA 4MUKA 5AKEA 4J4HA 2VQ3A 2BFCA 3FAKA 4G25A 1EFLA 4XPIB 1VL6A 1R6UA 3AQ4A 1UPCA 2C8JA 4Y0VA 3ZH2A 2QJFA 4HO1X 1TNDA 4DA8A 4JFRA 4N0DA 1KS2A 4U7HA 3T7CA 4W1QA 5TGDA 3CURA 1WPGA 4RL6A 1LRJA 4RH0A 4BX2A 3U7HB 1XF9A 3DMDA 1LB1B 3HUTA 4EMUA 3V7FA 2BFCB 3IQFA 1RNLA 4ZXFA 2X0RA 1FYXA 2J9ZB 4ZOBA 3GHHA 3Q10A 1SUFA 3PQ5A 1Z37A 4Q3OA 1VGRA 4YJGB 2QJTA 3L8CA 1PAUA 3NM5A 3GGJA 5BSRA 4J1NA 4E21A 4CMIB 4DLRA 1ZD2P 2BPOA 4LJRA 1BVHA 5G40A 5LKAA 3J7AC 2VSFA 1VM6A 3NBAA 3FPKA 4YO7A 2CYBA 3CJRA 4ZHQA 3E27A 1M7HA 1MV8A 2OD7A 5JNSA 1NYLA 1QHNA 6YASA 4EEKA 2HY7A 1ZW6A 4ZVQA 2H5EA 4LRWA 1CUUA 1JIQA 2ANCA 4ISBA 2WF6A 4RA6B 3VDXA 2EJWA 4J1SA 4J94A 4JR2A 4EGQA 1ULSA 3FXAA 2R6GA 4WLVA 5AM0A 5BMVA 2I4TA 4QHSA 2Q4TA 1Q84A 2Q46A 4JL5A 1I3CA 2OQRA 1MQAA 3PNKA 4KLNA 1VLHA 4CG2A 3NIWA 3IVCA 3SXPA 2NX2A 5KB3A 1IY9A 4ZP1A 2QVXX 3L2OB 1JILA 4G0QA 3D4PA 4TV8A 2MR5A 4BZPA 4XWWA 1B6GA 1S3FA 3EIOA 2HV8A 3X0DA 2YVKA 4R2IA 1L7DA 3GJ0A 4MB6A 1U5BB 1TZ2A 1BVRA 1SXJD 1J33A 5JAPA 1EE1A 3TE6A 1AQNA 2NTYC 2YXPX 2B83A 1MTZA 3A9VA 1TM5E 4U7JA 3VNBA 4O08A 1J21A 4Y2PA 3HA5A 5BNZA 1G3RA 3PKZA 1LDYA 4MRPA 4Y9SA 1F8GA 2YWDA 3KTFA 4F9GA 3OEHD 4C6RA 2R6CA 3IR5A 1E5LA 1EVIA 1GXSB 2P4UA 1UK6A 4Y6QA 4B4UA 4Q9JA 3H9UA 1RPZA 1NDUA 4BN5A 4M37A 3E9EA 4UNSA 4HEA6 4RPHA 3UB3A 5DNCA 1GZ4A 1MQ8B 2FLWA 3KL4A 4ZTBA 1JPJA 5CTAA 3RSOA 1QS0A 4IV8A 4PRYA 3W6UA 3FTCA 1GU0A 1YAHA 1X9HA 4AO8A 3ED5A 2JVJA 2FW7A 5KEIA 3TBHA 4HADA 4P0PB 5AD1A 2RBKA 1TZKA 4YJ3F 4K9LA 1M1ZA 4MPJA 1QIHA 4C04A 3LUBA 4RX1A 5ILOA 1XLWA 1EXMA 1L7AA 3LK6A 3DMNA 1C0LA 2NADA 1K5GA 4Q3AA 1IHXA 3CRRA 1QS0B 3MTQA 4G5OA 3EVNA 3TRJA 2Q4RA 4YCJA 3WYNA 2AQHA 3DMPA 1R0LA 2D2VA 1KEEA 3DO6A 1A9SA 3EXHC 2NUAB 4EUKA 1LW6E 1WG8A 3KZOA 1LC0A 3DQZA 1P62B 1L1QA 4ARZA 1Q92A 2JIRA 3CVOA 2W2KB 4KDRA 4EPYA 1JBQA 5FWXA 2AN1A 2V4MA 3GUZA 2GAFA 1KZ1A 3MAJA 2D2XA 4JBHA 1Q0QA 4HWRA 3ZE8A 3KAQA 1FYEA 1L8XA 2J3IA 1DAHA 4TV8F 5CB4F 3LDHA 4HDNA 2CZCA 3LC0A 4ARZB 2RGUA 3HVJA 3I9LA 4MPTA 4LDNA 2IEDA 1N1EA 1XD8A 3OJLA 1GHTA 1NC3A 1XKQA 1KFBB 1LLFA 2FW8A 1XHLA 3S1LA 1YKGA 2QPOA 5T3UA 3L7NA 1S2DA 4IX1A 3W04A 2Z8YM 1DV2A 3BL5A 3DH0A 3TIGA 1RWMA 2DFTA 4Q3CA 4HX2A 2WTBA 4BIIA 1PYOA 3GLFB 1JMYA 3IAXA 1WUIS 3HSYA 1ZUWA 4AJJA 1OTYA 2R1VB 4UUPA 2JLWA 1VSVA 5EMKA 2VYVA 4N7JA 4N3CA 5FRDA 1VCMA 5FIUA 3D8TA 2FW6A 1VSQA 2QTZA 2YJ5A 2QBYB 4OLAA 4JU9A 4BDTA 1G55A 2G72A 2GPSA 1QHSA 3E58A 5AESA 1WY7A 2YX1A 1JQDA 3NGMA 4J1TC 4NFSA 4O2BA 1G0OA 4LSGA 3WLOA 3KAKA 1FP4B 3NC1C 3ER8A 1W5EA 5DTJA 5JT1A 4DGQA 2OXTA 1SCQA 5AVYA 2BBSA 3BDIA 3KVOA 4HL6A 4BE9A 3GGGA 2OXFA 3OTGA 1NBMA 3C4VA 3SQLA 4US2R 4HT3B 1ZU5A 4QPCA 2YHSA 3MWLA 3CBQA 4F4UA 2QNBA 1AZLA 1SZJG 1X80A 1SG6A 3NBQA 4XB2A 3D5QA 2HKIA 1TK9A 3QNMA 4KXWA 2WV7A 4O2BB 4GMGA 5H68A 2JLAA 3V2UA 2YWBA 3O0DA 5LP6F 1YQUA 3U4GA 4B7CA 1DWPA 1EGAA 2PO7A 4G2NA 2FETA 5ER9A 1QCYA 3B3FA 1FDRA 4L0DA 2OMEA 2HJRA 4CW7A 2IF0A 4R16A 1XA4A 1ZLYA 4K9QA 1UEJA 1Z5WA 1ZGCA 3BAFA 3K2EA 4WY8A 1Q7GA 2NQTA 4KUHA 3UPUA 2BI7A 2XVAA 4FE3A 3NAMA 5LC1A 1QLWA 1EJBA 4P6VF 2JLYA 4O4JA 4OAPA 5T57A 4TGLA 3EOAI 3JR3A 3LHDA 5JEEA 1OE0A 2L18A 3DTVD 3I9JA 4URUR 5TEVA 4LDQA 4BBPA 3KB6A 1P7CA 4DIKA 3ZDCA 5KSPA 3K70B 1JQEA 3PA8A 4PF1A 2LD4A 1I0IA 3PPYA 4B4DA 1EK1A 3P2EA 3V3KA 2ZU0C 5JS7A 2BMEA 3DL4A 1HM5A 2XI4A 2QMEA 3BB4A 4RMIA 4TQGA 3W6NA 1HDXA 1UMBA 4PG4A 1DKPA 5LWHA 3R7FA 4MV5A 4O4JB 4CMAA 1QP7A 2Z4SA 1DX6A 4EVRA 1IUPA 5GONB 4OJTA 4GKAA 1R0ZA 2E4VA 3GLIB 2B7CA 2XZOA 1GN9A 3D4BA 2E37A 3LUAA 4PQYA 3AI2A 1HY3A 2ZWVA 3EMKA 1A9OA 4UQLA 4ZICA 1ZJJA 7YASA 1YQWA 2B5OA 2YOFA 1JFRA 1YRWA 1NQ5A 4R8MA 1U8AA 2RKBA 4X63A 5I9TA 1CDOA 1G66A 1CIPA 2V9ZA 2O2CA 1UC9A 3VSAA 3ABRB 5KYVA 3FHJA 3ZZ0A 4XGIA 1N2ZA 4Q7LA 1R8JA 1VE1A 1VL0A 1RSZA 4I5FA 2QYTA 5SZHB 5KOHA 4FQ7A 2OAEA 3LDUA 3D3WB 3DE3X 1VJ1A 2J9GA 4JH0A 4ZO8A 5JYCA 4QSMA 1TLFA 3FHLA 1V8BA 1SOVA 5JS6A 2PNFA 5KYYA 4A4DA 1C30B 1YIOA 3WWEA 4WBNA 2D0PB 3QMPA 1FVHA 1X8LA 5C1PA 4MYRA 1YZYA 3X1XA 2PK3A 1HEUA 4P3KA 4F3NA 4WJKB 1Z18A 1C81A 1QRUA 4LV6A 3RKRA 1CJBA 4ZU6X 3KV3O 1IBMB 4RY2A 3OEEA 4UW9A 4FKZA 4F3CA 3D2AA 4N0MA 1CFZA 3HCRA 5I47A 5BWNA 2YRFA 4JIMA 4ZVKA 3ZLJA 4CKCB 4F2DA 3K3PA 3L7BA 5L3ZA 5GINE 1P2FA 2C3YA 5ITZB 4I4NA 4LHYA 3ZWCA 1NT4A 1E7YA 1G64A 3GZJA 4P3YA 3ZWPA 4L9AA 4KXQA 2YIVX 3MQ4A 4INJA 4KDFA 2G0AA 4BE7B 2QLTA 1CQIB 4Q4JA 3PC3A 1JU3A 2UZ3A 3FNRA 3UJ7A 2CNKA 4YRDA 1CQJB 4DIFA 2E48A 1U7HA 1E7MA 3R3VA 2CBZA 4XLZA 4ZD6A 3SIPA 1CUYA 4MPRA 5EKUA 3UWSA 1OKKD 2HYIC 4MUYA 4HAIA 4X8HA 1KE2A 2Z5VA 1Q1GA 3R75A 1XT6A 5EMLA 5TARA 2KM1A 3OM8A 4CCAA 5HOEA 1I13A 1BRTA 2BFEA 3EXAA 3R9KA 4DV4B 2BEJA 3W06A 1X8JA 4GYKA 1YZFA 1E1RD 4RIIA 4HAWA 4PLGA 4CWAA 3CRMA 3EZNA 4EQ6A 4ZV4A 2BDTA 2WJJA 4MROA 3WFZA 1DINA 3W1VA 3IIMA 3JVVA 4CIDA 2EYQA 1CEYA 3KUKA 4YR9A 5A9RA 1YJCA 3G85A 2I9KA 3ZY6A 3UOAB 2BFEB 3IO5A 2BDUA 3MCVA 4KXYA 1C9MA 4NBVA 4KBGA 5EN4A 2Q5FA 4JXJA 1BSVA 1A9XA 1BXGB 2B8JA 4I08A 1E77A 2BHNA 3FFXA 2AVNA 3PHGA 2FWNA 3DYIA 1BOOA 3DXZA 4A36A 3L7KA 4OI4A 4WV3A 4MAMA 5CLGA 4YYEA 1YZVA 4EYQA 4O2AF 4BB9A 4FI3F 2Q2QA 1XCMA 2CJYA 4P7KA 1HXHA 2C5BA 1QIEA 2Z8ZA 1GKYA 3AJEA 5EHZA 5FL3A 2GBFA 4KVZA 3DM5A 1KEVA 1I36A 1P18A 4ZOLF 5D2CA 4XASA 3VMFA 2R60A 2QV0A 1HYHA 4R98A 3HGTA 4DLBA 5A1JA 1SKAA 5EWMA 3S8YA 2OAGA 4MI6A 6CHYA 3GOHA 5J40A 3WAKA 1S3SA 3K32A 4DLPA 2D06A 2DULA 3FUWA 3L07A 3NVMB 4G5YA 3NM4A 3W78A 1Y48E 2HJGA 5KNDH 3EEIA 4G1VA 4XVQA 4DG5A 1DRVA 2G40A 4BV3A 1DPGA 1W85A 3C3CA 4IGKA 4HB0A 1LF5A 1N2BA 5L3VA 4Q1FA 1VYHA 2FWMX 4J29A 1K92A 5C1BA 5EWMB 2PZLA 1SOMA 3K8YA 2C4UA 3KLMX 3U26A 5C8YB 2FNAA 1W52X 1OXMA 4BNHA 4XVRA 5TMBA 3A1UA 1SXIA 2FFBA 2WKPA 3S2UA 1E6LA 1UDBA 1UBHS 2B20A 1AHIA 1RQLA 3R0XA 4FSXA 4U2EA 1F2UB 1W85B 3C2QA 1ZRMA 4HXEB 5A05A 1BCSB 1O4WA 1XZJA 1CU1A 2J30A 3ZDYB 1Z63A 1IN5A 4GX5A 2GHTA 2AXNA 5KDLA 3RYTC 3W05A 5LMCA 5BURA 2O8BA 1L0BA 4W7IA 3TTUA 5HIKA 1PNQA 3CU5A 3FHCB 3JARA 1LLUA 4BB6A 5ECWA 4BLSA 1D2EA 3U7JA 3HN7A 1S1CA 1KEZA 4K6HA 4TX1A 2YW9A 4MV1A 3QKSA 3X43A 2APJA 4W1PA 3PNOA 1MRSA 1E2IA 1NVBA 4B8ZA 4P7JA 3D2LA 3RANA 2G1PA 4DJFC 4EHJA 1QIMA 2BM9A 1AS0A 1HYGA 4WUTA 3ROTA 4BJ1A 4EG6A 1ZRHA 2L82A 3PGLA 2O8BB 2Z6QA 1WUTA 3JARB 2QTMA 4I4CA 1MC1A 1CJSA 3EXEB 3FYDA 3U5TA 2I4LA 2C2GA 1NRJB 4FC7A 4HQOA 4HWPA 3EXFB 3QKSB 1VKZA 1I2MA 4BY9E 1ZUNB 1NXOA 2FW9A 1SFRA 3K0KA 2ZJOA 3MA0A 4ARBA 1PJLA 4EOGA 121PA 3BWEA 2IL1A 3ZC3A 4RM3A 5DNDA 1TCUA 2PGDA 1VHTA 2ECOA 2WM2A 4XJTA 3W8FA 3F46A 3DLIA 4MS3B 1JB1A 2R4QA 1GDDA 1KEUA 3IT2A 4I8DA 3RROA 4F06A 3ADDA 3V4VB 4D99A 1V7ZA 4GPAA 4M0EA 1ODIA 1NMYA 2RC5A 3ETNA 4Y7DA 5LZ9A 4EHAA 2B2XA 3MSCA 1ZIYA 2JJ1D 3OHSX 1EG2A 3TMYA 2VHQA 2WWVD 4GPD1 2G1AA 2NW6A 3LDFA 2GJAA 1MW9X 3D6VA 5ESRA 1RJ9A 4Y0NA 3DL2A 1ZK1A 5I48A 1XRNA 2OO5C 3T0FA 1EBBA 4JVLA 4ZXPA 3UENA 5G1OA 4EJ0A 1U3UA 4L4SA 5FR2A 3AY0A 3H86A 2JPDA 4YEDA 1JQ5A 4OX9Y 1FS6A 1UZMA 2PKCA 4XDYA 1T8PA 1KDPA 4TQ9A 3HBFA 3DW1X 3TEFA 1J8QA 5HR5A 3NTRA 3IOBA 1I51A 3BL8A 3EG9B 4XYEA 4PY2A 1F48A 1LDNA 3FGNA 3I9V6 3KEGA 3RD5A 2H1OA 1XMOB 3EZYA 3D8BA 2V54A 3DHNA 1X1BA 3U81A 4H6PA 1Y80A 1XZ8A 5ALKA 4RK4A 5LA6F 1FDWA 3ZYCA 3EIUA 2W43A 1F3OA 1E5XA 1D0VA 2BI4A 2IYVA 3OZXA 2Q4BA 3HB1A 3IEXA 3QBTA 2IE0A 3AOEC 2XNHA 2EU8A 1SB8A 3HLKA 2BUBA 1DUIA 1GPLA 4UBMA 2YN0A 3TW4A 3OZSA 1GG2A 1VE5A 3PKIA 3T3EA 3OUTA 2PR7A 1IWBB 3R44A 4KN5A 4QFCA 4CETA 2SNIE 3WMGA 1QC5B 5JH7F 3CO0S 3DLPX 3BJMA 2Q7XA 3PUVA 1FXWF 2B35A 1R0RE 2WICA 2Q50A 3KOWA 1E3MA 3OURA 4W9NA 4WK6A 3DZIA 1KDTA 3OPYI 1JLRA 1UWLA 1KMIY 4WXMA 4PO8A 1K98A 1BRMA 5KVCA 2AX4A 1FC0A 2C78A 3PUKA 3WLRA 4EVSA 2CMKA 2L69A 1GARA 2P5TB 3FPGA 5AM4A 4RZXA 2O2DA 2FZ4A 3M5PA 1LDEA 1BXZA 1W49A 1BMFD 3KKKA 4TXNA 3AUTA 5T4BA 3NB0A 4GQAA 3ZVMA 4B6GA 2CDNA 3FKQA 3ONFA 1D4FA 3JWEA 4MW2A 3ENQA 4AYXA 1TXGA 2FFRA 3IPXA 4BNZA 1QVRA 3DTNA 4GZ6A 2CFIA 3WQHA 2OQVA 3CCCA 2A5FA 1P7ZA 5D3MA 4XFKA 5JCZA 4US1R 5JNWA 3OU2A 3OUZA 2OCBA 4BNDA 1KA9H 5HQ3B 4FZVA 4EA6A 5C34B 1QB7A 3ODGA 4M88A 1OB5A 4O1MA 1WABA 1HNWB 1NMQA 2QX7A 4JYAB 1WVIA 5JWOA 2HSZA 1ZVKA 4F3KA 1K3FA 3BGWA 3HY3A 4PVCA 2GLXA 4RV5A 4NS4A 3C3YA 1QOQB 3IH5A 4RLFA 3ZDEA 4UUNA 4EVIA 3ZGZA 4BNYA 4BNDB 4LNHA 5DOVA 3W2EA 3T3NA 4OQPA 1A97A 5B7QA 3JQAB 3R5SA 4G0PA 5EKSA 4ZVLA 3VHLB 1F2DA 5DPMA 1R5OA 3L46A 4LF5B 1C0KA 3FI9A 4K87A 3I9MA 1MLDA 4W5TA 1ETUA 2RHHA 4NEHB 2WKRA 4QPPA 3ZE2B 1VSBA 3EFBA 2Y1WA 3WL4A 3B2NA 1ZBDA 4CUKA 5EFOA 1U4NA 3L4SO 4J0JA 1SBTA 5B7NA 3OQBA 1TJ4A 1N7JA 4TS3A 4O29A 3QUAA 5AYVA 2B36A 1YRQA 3SXUA 2YV5A 1E0DA 3L7AA 1HI9A 2VZ0A 3MS4A 4KR6A 3AR8A 3QXJA 3USES 1M34E 3W6ZA 4K6MA 3O84A 3P9RA 1PV2A 2WYHA 3TF5A 3WLTA 1QH9A 1X8XA 3ZE7A 5ALLA 1ZOIA 3LX4A 1JAZA 5KNBA 3KM0A 4NARA 2HMVA 1Q95A 1BE6A 2IVFA 4YJFA 2BFFB 4BCBA 1XWWA 5T67A 3W9YA 4YCMA 3DUFA 3BCRA 4TTVA 2OBXA 4CTJA 1G8MA 3KJHA 1WIWA 2MTBA 3ZIDA 2JHGA 2WV9A 1JHUA 1UPFA 3KCQA 4JA0A 1YQXA 3DDNA 4EW2A 2F1RA 2YZ7A 4C0WA 4C05A 4PZCA 4KI7A 3MJSA 1SQ5A 3GX1A 1FDVA 3COSA 2YHAA 2M1XA 4JELA 4RO0A 1DSSG 2QUZA 3UTDA 3DUFB 3RSHA 4EFLA 5KBYA 4EHBA 3M3PA 3Q40A 4WH0A 3ANMA 1IWOA 1EVLA 1VL5A 3TNFA 5IAGA 1LPBB 1O6ZA 2XYPA 3O4HA 3ZVLA 2AYXA 4KVAA 4QE3A 3OTOB 1GQOA 4F1WA 1TPYA 4DCGA 4M8NE 2AQ8A 4KPUA 4B4WA 4CG3A 1ZHFA 3FNQA 4OQ4A 3K31A 2AT1A 3G7UA 4P36A 3DOJA 3ZOKA 4FIZA 4W99A 4YPFA 2H4ZA 2HPHA 2RH5A 1RAFA 5C80A 1DHRA 3ILVA 3IHWA 4C87A 2Q99A 3KQUA 1UIRA 2QX8A 4L51A 1T9CA 5DYYA 1ZIOA 2ZZKA 3A9WA 1AKVA 4OFWA 4EY4A 3GI1A 1RZRA 5B4VA 1XHEA 3MRVA 2AOTA 4P82A 1U0TA 2WFLB 1E8NA 2PH5A 1X13A 3AM5A 3P94A 1MF7A 2DBYA 4KIFA 4YRAA 1NW5A 4M9ZA 3RM3A 2P2SA 3WX0A 3BXEA 4FOPA 1Z0DA 4IXMA 1DRWA 4NNJA 3G0CA 5KMGB 3O8RA 2FXIA 4A8TA 1OWMA 3QWIA 2ZJ4A 4DV6B 4NYIR 2ZTLA 3H65A 3N87A 4BGEA 2A92A 4XQEA 1CJMA 4JZKA 4HVCA 4C7OB 4S2UA 3NS7A 3ZX5A 4JX8A 4RHEA 3R3JA 2WC1A 4RE6A 1JSCA 3I52A 5EZYA 1C7FA 4Y3UA 1NYTA 1NXWA 1WB6A 2CXPA 3GJ3A 3QGMA 4K1LA 4PG6A 5F78A 5KKNB 2PRSA 4NPAA 1Y1KE 1D6JA 5FI0B 1U8CB 2QTHA 2VF7A 4WZZA 4GMHA 3STUA 4LJYA 5C37A 5GJVC 4WLUA 1K8ZB 4MUBA 5BWOA 3X44A 2E5WA 4D0RA 2HA4A 2HHCA 3GLHA 1UL1X 1NIPA 2BUAA 2LDXA 1DKOA 4WKNA 5SYMA 2I3ZA 5LWQA 4LV8B 4XE5A 4XEHA 1E9CA 5F3RA 4UKDA 4KGDA 4BYMA 2W2PA 1YBVA 4MUIA 1KXJA 3W7BA 4AY3A 4BX3A 4B6JA 3KQHA 1RI4A 4L76A 3PUHA 3HH8A 3H5VA 3L18A 1VSUA 3A6ZA 2XB2A 2CT8A 4TYNA 4R1QA 1OGIA 1JHYA 2H5JA 3JYOA 2GH1A 1H05A 1VFPA 5FFFA 9ABPA 3AGQA 3HL0A 1KY3A 1S8AA 1KNQA 3F8TA 1HNNA 1M8FA 4V1CB 2DUJA 4ZEVA 2CJPA 1WPQA 2WMDA 4JHLA 1Y4UA 2XMRA 4N0PA 5HIIA 2FSSA 2OILA 2JAUA 3QEOA 3Q9UA 5K0ZA 2MINB 3Q5EA 4MWCA 4YXWD 2JD0A 1VIVA 2DFPA 2TRSB 5F1PA 1U63A 3TQRA 3LSTA 2OC9A 3R6LA 4LYEA 3EFOA 2AYZA 3ICEA 1R37A 2ZJ3A 4H35A 1DG9A 2ROQA 3HV2A 2XF8A 1JLSA 1G18A 1NT2A 3PRJA 1J6UA 5ALVA 4IF4A 3Q5DA 4EKIA 5HCUA 5DT2A 1QQAA 1SIBE 4AKGA 1TTPB 3HCPA 2RHTA 1O94C 3FBGA 1P81A 3V6LA 1KVRA 3PNSA 5D3QA 2PT9A 3ZHZA 5E1BA 4QGFA 3EFOB 1GV1A 1I01A 1TQDA 3UWOA 3QELB 5ESDA 2VWQA 2PUCA 1OJLA 1ZYUA 2VRBA 2VHUA 2P9QA 3PNQA 3PKJA 3CFYA 4JQOA 2Q1WA 3GJSA 4RJKA 4RZ2A 2BJHA 3ZIAA 4I6JA 2V7WA 4ATNA 2EBFX 1MO6A 3W9SA 2Y66A 1EWTA 1DCKA 1JR3E 1NJ6A 3P2OA 1GGKA 3ND5A 3NHYA 5I01A 3GD5A 3JAMA 1UJMA 2V03A 4I9GA 1EDDA 3PFWO 3TSAA 3K8ZA 3LHIA 4Z7QB 4G41A 2PE5A 1HPLA 1Z07A 2R6DA 1E9RA 4JJ8A 3JYLA 4P3NA 2FW0A 4KQEA 4FHDA 3UBMA 3E23A 4PO3X 1MBZA 1VHWA 4L8WB 2AX3A 3I6QA 2HW8A 2F7SA 2I33A 4F12A 1T2VA 4KFTA 3ZDZB 3KSDO 3ZCRA 1V1RA 4GRIA 4LZWA 1F0NA 2ZTVA 4AJIA 5TIIA 2IBMA 4MUMA 2PO5A 4GSKA 4JFAA 3ZWWA 4EHIA 3C3MA 1R9MA 1FPQA 3K35A 3J81A 1J00A 3UXEA 4M7OA 4Y6SA 3DWEX 2VNKA 1BGXT 4LOJA 3JQ9C 2H92A 3M2PA 3TM5A 4I4TA 2O7VA 4BNMA 1GG5A 2SICE 4BEVA 1CE8A 5D8DA 4QXQA 4OKNA 1UT8A 3V3TA 4XVUA 1GG9A 1CUCA 4TM7A 3UGKA 1IXYA 4AO7A 5C4GB 1RT9A 2GZ3A 3H18A 2A88A 1V45E 3WLJA 3CF4G 4ZDKA 3TB4A 4R1OA 1JLLB 1H85A 2WWXA 4FDUA 1KJ9A 3UKOA 2XGOA 4BYGA 1C7ZA 4ETWA 2VH5R 2G82A 2RGEA 1K3TA 2XOKA 1W48A 3ZQUA 4YMTA 1ZJWA 3A27A 4HQ6A 3W5JA 1JBKA 1CY2A 3BE6A 4G0MA 3GBVA 4ETNA 2J5KA 2XA9A 4WOJA