3QPDA

Structure of aspergillus oryzae cutinase expressed in pichia pastoris, crystallized in the presence of paraoxon
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
187
structure length
186
Chain Sequence
LTGGDELRDGPCKPITFIFARASTEPGLLGISTGPAVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIAEAQGLFEQAVSKCPDTQIVAGGYQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQERGQIANFPKDKVKVYCAVGDLVCLGTLIVAPPHFSYLSDTGDASDFLLSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords Cutinase 1
total genus 68
structure length 186
sequence length 187
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qpdA00
3N0TA 4X94A 3SWWA 5BWCA 4EY5A 3BF7A 2Y6VA 4X3CA 1GPNA 2WFLA 4G8BA 3DYVA 5AO9A 4LXGA 3VKFA 3LP5A 2VQ6A 3P2MA 3C6YA 2YASA 1TAHA 3QITA 1QIEA 1UKCA 5LZ2A 5HQ3B 5I8PA 3B5EA 1XZGA 4J0HA 1XZDA 1HPLA 1A8QA 2JEZA 3ESBA 3L1IA 1TQHA 2VT6A 4Y7DA 3IUJA 4Q05A 3M81A 3JWEA 4I4CA 1SCIA 1LGYA 5K5EA 3EQ7A 3QYJA 4Y2JA 4QDZA 4ROTA 1EVEA 2R11A 2O2GA 4E11A 2HIHA 1ZD2P 4Y2PA 3I1IA 1W4LA 1YSCA 4ARBA 2XUAA 2QUBA 3QMWA 4KYVA 1BN6A 1EDEA 3CN7A 5CURA 2AJDA 1UKBA 1G42A 4GI1A 4BAZA 4Y9SA 3TJMA 4DLNA 5A2GA 2RHTA 3ICVA 3ANTA 3VJLA 4G4GA 4E15A 2CMFA 3BJRA 3AINA 1EB8A 1XZKA 5K3DA 1WHTA 4DMHA 4FLMA 4OU4A 1AUOA 4A23A 3HI4A 5HF5A 1FFCA 4N8EA 3D4LA 1ZIXA 2RIPA 2WU4A 1I6WA 5ALIA 2C58A 3AFIA 3JYHA 1H2XA 5FPPA 1JJBA 3ESCA 3KDAA 1QO9A 2BUAA 4FLEA 1GKKA 1ODCA 1SCQA 1MX5A 4UHBA 5JALA 4C87A 1Q0RA 5HFAA 1BEEA 3E1GA 4UFNA 4C4YA 5D6OA 5FUMA 1EHYA 4BTLA 1EK1A 5I7UA 5ALWA 4E14A 5AKJA 1EB9A 3W9UA 3AJAA 4N8DA 3KD2A 4LXHA 2OCKA 4C89A 3I6ZA 5JZ9A 4HXFB 2XQJA 2WIKA 3O4HA 2WM2A 4IH1A 3WKCA 3YASA 5EIAA 6YASA 5ALNA 3STXA 3B3QA 3BXPA 2XI4A 1F0PA 2XQKA 2XMRA 3PFBA 3BIXA 3A2LA 5FLKA 3JW8A 1X70A 3WK5A 3ICWA 1DT3A 1GGVA 3DLTA 4G8DA 5AJHA 1XZLA 4N8SA 2XUOA 4X6YA 4CG2A 1CUSA 2ZJ7A 4AO6A 4U2CA 1T2NA 3FWHA 4AQDA 1XRMA 1PFQA 2QJWA 1P0IA 4JNCA 3T52A 5LIPA 2W22A 1VJ5A 5DLPA 1QOZA 2HU5A 4P08A 5AIBA 4OSEA 3F97A 2PKYX 5AP9A 5AOAA 5EIHA 3CCBA 2WUGA 1XROA 1CUEA 1XZCA 4OCZA 2C7BA 1DQZA 4B9AA 2J3QA 4ZREA 2XMGA 5FPQA 1DTEA 5HK9A 5KWIA 3EBLA 2GBFA 5HKAA 4AB1A 2FUKA 4E46A 3GELA 1GZ7A 3C5VA 1N8SA 4QDOA 2HRQA 1YAJA 2WIFA 5AM1A 5SYNA 2WFZA 1THTA 5EGNA 4X85A 4DM7A 4J0KA 1J07A 3FCXA 4BDSA 3I2HA 2WTNA 3NWOA 5LKAA 5D3KA 1TIBA 1BCRA 4P9NA 4NZZA 2OLEA 3RKSA 3WIBA 3STWA 1JU4A 4Z49A 3D3NA 2Z3WA 4P93A 4FNGA 2XMQA 3K2IA 5J3JA 5ALLA 2DHDA 5LLSA 4MWTA 1LPOA 2WHPA 1TCCA 1XQVA 1NU6A 4G9GA 1XFDA 2ORYA 2HA7A 3A6ZA 3UMJA 2ZYHA 1E8MA 3FVRA 3ZV7A 1QTIA 1Q83A 1XZAA 2OPHA 4Y2TA 5FKJA 5ALOA 3VJKA 4X7BA 1DU4A 2OQVA 1BEZA 5IH7A 4LYDA 1WB6A 4M0MA 2XQFA 3HACA 2QXTA 4H0CA 3DNMA 3STUA 4C88A 1MX9A 3E3AA 3BJMA 1O6GA 1XZBA 4H77A 4LKOA 1KEZA 3HABA 4KACA 2JGFA 2JGMA 5D7BA 2WILA 3FLBA 1ODSA 5AK3A 5AKYA 5CT9A 5SYMA 5E4YA 4HXEB 7YASA 3M83A 4YK7A 3UUFA 3PI6A 5ESRA 2QM0A 3FYUC 1QIGA 2QXUA 1L7AA 4XX1A 1N5RA 3EIOA 4ZI5A 3WYNA 4BAGA 4QDUA 4BB0A 3EF3A 2BFNA 1LPSA 3DYIA 4Q82A 2Z8XA 5CXUA 2BAGA 1SCKA 4B80A 3BDIA 3FYTA 4B85A 2ZVDA 2OCIA 1DINA 4GWLA 2QTBA 4KE7A 5FOQA 2VATA 1GKLA 5JD6A 2XDWA 4KAFA 4UHHA 2I78A 2VAVA 1H2YA 1MPXA 4K6HA 5JARA 2CKMA 4FBMA 4H35A 4OD0A 2DCMA 3GROA 3IBTA 2RGUA 2QT9A 2FJPA 2V98A 3SK0A 1IZ8A 4OYYA 4CCYA 1EA5A 4HZGA 3ESAA 1BN7A 3BIWA 5ALPA 1VOTA 1A8UA 3GA7A 5DNWA 1K6EA 3WLAA 3G7NA 1ZD4A 1IVYA 2K2QB 4AX4A 1X2EA 4UBMA 4IQ4A 2XE4A 2X8BA 4J0GA 1MX1A 5DJ5A 1ZI9A 1CUXA 4H7JA 5AM4A 1S8OA 2WJ3A 1G5FA 1ODTC 1P0PA 4Q34A 3R3XA 4U2BA 3W2TA 3WWCA 5C8VA 4U2DA 4K5QA 2WG0A 4PSUA 3QPAA 4UFPA 5C7YA 3PUHA 4AN0A 4QLOA 4W1SA 5JZBA 2EEPA 4U2GA 1XZEA 3IIIA 1VA5A 2D0DA 5FP0A 2PUHA 3ANSA 5A6VA 3RARA 2JGIA 3D2BA 4EY7A 3F96A 5IKXA 4IH9A 5ALFA 1LPAB 3IA2A 1CEXA 5AKXA 4Y2YA 3FYUB 3PE6A 1UFOA 4G9EA 4XVCA 3Q8WA 3U1TA 3R3VA 2CUTA 5AI4A 4U2FA 4X6XA 2AJCA 4EY6A 3WL7A 4CG3A 5BWBA 3A2MA 5CMLA 3H2KA 2ZYSA 5JATA 4QNNA 5I9IA 4IH4A 2O7RA 3PDCA 2ZJ6A 3QMMA 4DYHA 4MEAA 2AJ8A 3G0IA 2RI6A 2BUBA 4UHCA 2PUJA 3VDXA 3WZLA 3OC0A 4HAIA 4KR0A 5D3ZA 3X3HA 1PJAA 3QMVA 2PX6A 2G63A 2ZYIA 2WQZA 4PO3X 4B0OA 1O6FA 2H7XA 3H1AA 5HF9A 2JGJA 2BGRA 2O2HA 3AIKA 4UBNA 4B9EA 5HQ3A 1MTZA 4PF1A 3N2ZB 4UFOA 4EY8A 3WK9A 1GPKA 4FLFA 4BP9A 4HRXA 3I1YA 2XT0A 5LYYA 3KWJA 2WIDA 1CUHA 1B6GA 3PF8A 1XQWA 5EHQA 1GXSA 1Y37A 2HA2A 4L3WA 3S2ZA 2ZYRA 5AIAA 1E8NA 1GQRA 5AICA 4GXNA 3PICA 4BCBA 4G8CA 3ED1A 2XUKA 1R3DA 2C4HA 3O9MA 3AIOA 3G0CA 1VKHA 5FXMA 3QPCA 1U2EA 3DCNA 5AKZA 4P92A 5CT8A 5AK6A 1BROA 2GYUA 2GYWA 3WKBA 4WFIA 2CZQA 5EHNA 2PSJA 1HLGA 4AMZA 3SC2A 3FAKA 2QS9A 1ZD3A 4F60A 4WFJA 2VJBA 4CG1A 4RNCA 4CFSA 5AKLA 2XQIA 1CIJA 2ONCA 2C5FA 3FOBA 5ALJA 3SX4A 1UZAA 2QKYA 1G66A 2VA9A 1K4YA 4JUIA 3DL4A 1TKRA 4B7ZA 1HL7A 5E2IA 5CT5A 1CLEA 1KU6A 4QE3A 1QGED 3IULA 2Z3ZA 2W6CX 2VTVA 1DT5A 1XQYA 3G0BA 5AKKA 2GZSA 5AKHA 4MXDA 5IVKA 5ALMA 2JF0A 1XLUA 1QFMA 5JASA 5LKRA 3WA6A 5JZSA 1B41A 4UBLA 1R1DA 5H3HA 2QRUA 4NS4A 2HFKA 1IMJA 3STVA 2DSNA 3HSSA 4BYMA 3FVTA 4WFKA 3KXPA 3V1NA 2OG1A 2AXEA 4X97A 3IDAA 2Y1KA 1WPXA 1RYYA 1QIHA 2WUFA 4DMFA 2O7VA 3H0CA 1YA4A 5AI0A 3F98A 1H23A 2WFMA 4H18A 2XUGA 3NGMA 2OGZA 3WL5A 3R40A 1GQSA 5A62A 4PW0A 4ARAA 1VZ2A 2IITA 4Y2UA 4FKBA 4Y2XA 5CRIA 4H7DA 1JT2A 2H1IA 4CIAA 1IUPA 3A2NA 5ALEA 1EINA 4F0JA 1ZGBA 3C8DA 4BC1A 5EIEA 3VVMA 1CVLA 4W1QA 4X95A 4KE6A 2RAUA 4DNOA 1CQWA 1E5TA 5A71A 4EY4A 3BWXA 4YPVA 5IVIA 5T4EA 1P0QA 3GFFA 1EDBA 5YASA 1IZ7A 2PSDA 2EDCA 2EDAA 1IUNA 1A7UA 4ZWNA 1JJIA 2WUEA 4BVJA 4EBBA 3OG9A 4UHDA 2DHEA 3C70A 3W05A 4Q3LA 4KEAA 2DQYA 3D2AA 2JEYA 4AO7A 1LZKA 1XLVA 5A7FA 1JU3A 4Q3OA 3VISA 2HU7A 3WA7A 1YAHA 4QLAA 5AKEA 4OUKX 1SFRA 4DNFA 5T4HA 1N1MA 2HA3A 2JGKA 4LXIA 4N5IX 2Y6UA 3WJ2A 2ZSIA 3HXKA 2QJRA 4J0CA 4QEKA 3B12A 4X92A 1XZMA 1AQLA 4ZXFA 4FBLA 3BL8A 5LZ8A 3MGAA 5JD4A 2PL5A 4X71A 5KBYA 3V1MA 2GBGA 5CH3A 3G9TA 3MUOA 2VAXA 2C0PA 3H19A 4BRZA 1A88A 1W75A 1BS9A 1DWPA 1CUBA 4HRYA 2OGTA 2B20A 1AMNA 1YS2X 4X6UA 2HA0A 3LLCA 2BUCA 2QR5A 3V1LA 2PBLA 1UK6A 2H7CA 1MN6A 3I2FA 4QDXA 5DNVA 4AO8A 4O08A 4M0EA 4UBKA 1QIDA 1YASA 4CIBA 2WJ6A 4OU5A 1W6RA 5ALDA 1CUCA 5CH8A 5E4TA 4OB7A 1XZJA 5JIBA 4GBGA 4DSAA 5JANA 1QFSA 1LPNA 1X2BA 3H2HA 1QLWA 3IURA 5T4BA 5DWDA 2BKLA 3O0DA 2J3DA 4BTVA 3HEAA 2YYSA 1XZIA 3I28A 4JEIA 5JADA 4RPCA 1OXMA 4WDRA 4UPDA 5AM2A 3DQZA 1UOPA 3ILSA 3G0DA 1AZWA 4B81A 4UUQA 4BATA 3IB3A 4K6KA 3FSGD 4PQEA 2LIPA 3HRHA 5CT6A 3C6BA 1W52X 3U0VA 1F0NA 3H04A 1QIIA 4ZV9A 1BE0A 4N5HX 4WJLA 2JBWA 1E8DA 1H22A 3IUQA 4PNZA 3H2IA 4BVKA 1OILA 1QZ3A 4D9JA 4DNPA 5C8XA 2JGLA 2H9YA 4U2EA 1UXOA 5LZ7A 3LIIA 4MYSA 4L0CA 5ALKA 3RK4A 4QDTA 1L7QA 1EH5A 3CN9A 3C5WP 5HZGA 1E3QA 1QJ4A 3E0XA 3WKAA 3DL7A 2D5LA 3H2GA 3G02A 3WKDA 4OB6A 4WY5A 4H7KA 1VE6A 3AUKA 2OGSA 2Y2UA 3WJ1A 1FSSA 1ZOIA 3R41A 2C0QA 1EX9A 3I2KA 3FNBA 4FWBA 1H2WA 4TGLA 4RGYA 1CUFA 4KAAA 1F6WA 3C8HA 4KJXA 5CXXA 5DTIA 2ACEA 3ZLVA 2XMDA 1VLQA 1FFEA 1E89A 1R4ZA 1YB7A 5HF8A 3OURA 3G9XA 1CUVA 5K3BA 3WYDA 4KAJA 5F4ZA 4BAUA 4J0IA 1MJ5A 4PSCA 4FMPA 3OOSA 4AZ0A 5KREA 1C7IA 5IVDA 4AZ3A 1WCYA 3E4DA 3STTA 1Q0ZA 1RWQA 2XQGA 3F9CA 3L1HA 4ZGBA 3WI7A 3T4UA 4G5XA 5EHZA 5FRDA 2J4FA 4JYPA 1DX4A 4J3JA 3C45A 3IUNA 2XMZA 3WKEA 5HFNA 3WQHA 4BZWA 4TVKA 2WJ4A 4W1PA 4HVTA 3AZPA 3IVMA 1QTRA 3WK4A 1G4HA 5C81A 1YB6A 1WOMA 3O4GA 3FLEA 5DTJA 4FTWA 1VE7A 4J0JA 1HKHA 1L7RA 4DMKA 3WIOA 1AX9A 4A5SA 1EVQA 5AOBA 3WK8A 4I3FA 4C01A 2HHAA 1OCEA 2OQIA 2WG1A 1ZD5A 3BF8A 5DYTA 3G8YA 2WU3A 4DGQA 4J0DA 3WK7A 1K8QA 3ESDA 2VEOA 1FJ2A 4HTAA 5ALYA 3PF9A 4Q1VA 4W1RA 4EZIA 4DSZA 5JYCA 2FJ0A 5ALXA 4YX9A 1ETHA 1SOMA 2B61A 4J7AA 2HA6A 2HRRA 4WCVA 2E3JA 1LPBB 3V9AA 3R3YA 5EFZA 1VZ3A 5JAUA 1ORVA 2FX5A 4ZRDA 4BC0A 3A70A 1UK8A 3W9BA 2DR0A 3V1KA 4JH0A 1HQDA 3LCRA 1R50A 5CBKA 4X90A 5DYWA 2I3DA 4G4JA 2JGEA 2VJCA 2XB6A 5AOCA 4M0FA 1W76A 2PSHA 3G0GA 2AJLI 4H7IA 3BDVA 2PU7A 1F8UA 1WB4A 1LBTA 3QPDA 2HA5A 4L9AA 5ALRA 3GUUA 1XRNA 1DWQA 4KRYA 2GZRA 3K6KA 1CR6A 4Y2QA 2P8SA 5AM0A 1ZGCA 1UT6A 1R88A 5CTAA 5AM5A 4QZVA 4LIPD 3WWDA 2VSQA 3H17A 1EDDA 5LZ5A 3IUMA 2JIDA 2AJBA 1WHSA 1LNSA 4MQMA 4ZV7A 1GPLA 3K9BA 1VA4A 3H18A 5AI8A 2PVSA 3OPMA 1LPPA 4KE8A 4OYLA 3PUIA 4KE9A 3H2JA 3I2GA 3O95A 5AM3A 5CH5A 5A7GA 3I6MA 5ALGA 2BGNA 1MAAA 4A16A 1ISPA 1D07A 2V97A 4MQLA 3DDUA 1VXOA 5ALQA 1MAHA 2WHPB 4LHEA 4F5ZA 1FFAA 1Y7HA 4FHZA 2HL6A 1BCSA 4GEGA 3M82A 4L72A 2PM8A 4INZA 4HXGA 1IUOA 2R8BA 4C4ZA 5DYYA 1EK2A 4K2AA 4EUSA 4IHAA 1CQZA 5EHXA 2CB9A 3RLIA 5AKIA 1TCBA 3FSGA 4UBOA 4IO0A 5HF6A 2ES4A 4GLBA 1NU8A 2OAGA 4FFVA 1TCAA 4LYEA 1FFDA 1BRTA 2VJDA 1T4MA 2XUDA 3KWFA 2WUDA 2WG2A 1ZI8A 2C5GA 1MT3A 4QWWA 2HDWA 3ZLUA 3TRDA 5K3CA 1CUWA 1PV1A 3OTQA 1CUAA 2ZJFA 3W06A 3FCYA 4MJ3A 4FNMA 3G9UA 1XZHA 4XWGA 1JJFA 4J03A 4BRSA 3LIPA 2ZSHA 3EQ8A 2XMBA 3AIMA 4X93A 4UBIA 4DNQA 3GBSA 1JFRA 5ALTA 1JI3A 2PSEA 4B0PA 2Q0XA 2XLBA 2WFLB 5T4FA 2QVBA 4Y2SA 5AKGA 2CBGA 2V9ZA 2WHRA 4QA9A 1VXRA 4C4XA 5KWJA 1U8EA 4CCWA 4BE9A 3WWOA 3DD5A 4GECA 4H7FA 5ALSA 1EXWA 3GZJA 3ZI7A 4DIUA 3AZOA 3HC7A 4QWMA 2WLSA 4NMWA 2GYVA 3HYSA 5EI5A 1Q84A 1CUUA 3D7RA 4FDMA 5AK5A 3FLAA 3HJUA 2WKWA 3QM1A 4C6HA 3DKRA 3MUNA 3D0KA 2B4KA 3R0VA 2GBIA 1YR2A 1ORWA 4I19A 4EHBA 3DOIA 3UUEA 5CT4A 3L1JA 2YXPX 3DS8A 4OB8A 4Y2VA 4CI9A 1U4NA 3FBWA 1MNAA 2NW6A 1QIJA 1FFBA 3WL8A 2Z5GA 1CUIA 3Q0TA 2IX9A 1P0MA 3H1BA 1DX6A 3C6ZA 5FV4A 1C4XA 2BCEA 4GW3A 3QVMA 5AHXA 4UHEA 3CCCA 1ZJ5A 1XZFA 1E66A 3W04A 3QH4A 3NOXA 2WSLA 1BU8A 2ROQA 2CJPA 2XUJA 4B83A 1GT6A 3WZMA 4Y2RA 4UHFA 2XUIA 5AH0A 1USWA 1CUGA 2HU8A 1UK7A 3WWPA 2UZ0A 5BOVA 3KOOA 1QIKA 1CUZA 2PU5A 3TEJA 1QIMA 5IVHA 1RP1A 5A7HA 2DFPA 5HCUA 3M3DA 3DOHA 1J1IA 1WM1A 1JKMA 5HK8A 4DMCA 3D5EA 2O2IA 2ECFA 1CFJA 1XKLA 5HKBA 3HLKA 3VVLA 1JMKC 3AZQA 4AXBA 4EB0A 1N5MA 4BZZA 5FDFA 1QIFA 2I3ZA 4WDQA 4BP8A 2G4LA 5AK4A 1K5PA 3QBJA 1R9MA 3KSRA 1YA8A 4BBZA 5ISMA 3CXUA 2H7YA 1J2EA 2ACKA 4GDMA 5K3FB 3O4JA 1CRLA 4F21A 1SC9A 1WB5A 3LS2A 1QE3A 4KRXA 3TGLA 2PPLA 3FYUA 4ITVA 1J06A 1AGYA 3R3UA 4NVRA 5LZ4A 3C87A 2Z8ZA 3F8SA 4MYDA 3STYA 5C8ZA 2X5XA 3HZOA 2G5TA 1LZLA 3O4IA 1ACJA 3WL6A 1EI9A 5ALVA 1TK3A 3I2IA 2XUPA 5K3FA 4FOLA 5LP1A 2BJHA 1MU0A 5K3AA 1Z68A 4W63A 5CW2A 4BCCA 4BVLA 4TPKA 3D2CA 1HBJA 4B82A 5AI6A 1AKNA 2XUFA 4ETWA 2WTMA 2XUQA 2XUHA 2XMSA 2CEKA 2V96A 1WPRA 3I6YA 5LZ9A 1CUJA 5JD5A 1CV2A 1CUDA 1YCDA 4MWSA 2QOEA 1W1IA 1YS1X 4G4IA 4YASA 3PFCA 1QONA 3C43A 3DKKA 3R3WA 4RE5A 3EQ9A 5E4JA 3OM8A 3WWEA 4B84A 4H7EA 3ZWQA 3VXKA 3ZLTA 1UOQA 1R9NA 1XKTA 3O9VA 2OCLA 3R3ZA 5ALZA 3AILA 4CCYB 5JAPA 1ZIYA 2YH2A 4OPMA 5ALHA 2Y2VA 4B6GA 1QO7A 4V2IA 1DWOA 2OXEA 2DQZA 4X00A 1JMYA 2HADA 4DTCA 4PV7A 1LLFA 4PSDA 2QUAA 4AN1A 4HS9A 3DEAA 4BE4A 4BCDA 5JAOA 3MVEA 1MNQA 3ZPXA 4S0XA 1C7JA 2QMQA 5K3EA 2HA4A 3F67A 4RE6A 3QZUA 1CUYA 2G5PA 2X76A 3C6XA 1U65A 2XMCA 4W9RA 1UK9A 1XRQA 1DQYA 2QZPA 2VF2A 1ZICA 2VT7A 5ALUA 2IIVA 4BDTA 2WHQA 4FFWA 2WIGA 1M33A 1UOOA 2J4CA 4X91A 3D59A 1MO2A 1LBSA 5DNUA 3V48A 3G9ZA 2WIJA 3I2JA 2XLCA 1K63A 2VJAA 4WY8A 1Y7IA 1TRHA 1NX9A 2RONA 3WMRA 4EA6A 2HFJA 4AMYA 4JYMA 4K6GA 2I03A 3S8YA 2GBCA 4H7HA 1THGA 2RHWA 2PSFA 4Q3KA 2OCGA 5AI5A 4GHWA 1XRRA 4XIIA 2OAEA 1UKAA 1UWCA 5JAHA 1CPYA 1AC5A 1XQXA 3RM3A 1HDEA 1ACLA 5AI9A 1XLWA 1XRLA 4MEBA 1ZJ4A 3NUZA 5BV7A 1H2ZA 2DHCA 1AURA 3DJYA 3BE8A 1ZI6A 1KU0A 2B9VA 4XJVA 3WK6A 2HM7A 4G1FA 4UBJA 1LPMA 1A8SA 3VJMA 1XRPA
chains in the Genus database with same CATH superfamily
1O94A 3BERA 4Y2GA 4CIXA 3L6OO 2BLNA 1N6RA 4X94A 4PONA 3RROA 4CNQA 1PO7A 5DN9A 1DC4A 3SWWA 2FN8A 1A5TA 1U3CA 3F3MA 3NC4A 4FSHA 3ZQKA 3E1SA 3F3KA 4EY5A 1ZCJA 1IN1A 1PYOA 1CDEA 1NULA 1Q12A 2BR5A 1CBUA 2I2BA 1F7UA 4PLFA 3BF7A 3EOZA 1Y82A 3K9HA 4XE5A 2CFIA 1GPNA 1PNQA 3L6CA 5TT0A 2CKDA 2WFLA 2OBNA 3NQ41 3DYVA 3PYLA 3TZ6A 4C0AC 4LXGA 2BL4A 1TPZA 3JQGA 3EQZA 3ZD9A 2XGOA 1FFGA 3CG4A 3CRQA 2NUAB 4GRIA 2PGXA 3EEQA 4R9VA 2NPFA 1W4BA 3VYRB 4YUXA 2YASA 3MYRA 1TAHA 3QITA 1QIEA 1UKCA 2HSJA 3ZBTA 4CU5A 2IS2A 2A59A 5JEEA 5AHOA 3VAYA 1GV0A 3ESBA 4O3FA 4EL0A 4F38A 1JQDA 4R71A 5JAIA 4UJ5A 4M8NE 4MCHA 3V00A 3WV4A 1QHHA 1XJCA 1ADGA 3J7TA 1FFSA 1PS8A 2XGJA 3ZKWA 2QL9A 1AS3A 4R1LA 3TWOA 4HY3A 1XZNA 1DHRA 3AUTA 4GO1A 4LY0A 2Z8YM 4OUDA 2PAFA 2C84A 3OIWA 3ZNQA 5MGBA 1PYGA 4NBNA 3FYHA 3JAMA 4EJ2A 3DVLA 2YJ5A 3EQ7A 4RV9A 1W2HA 5B3JA 4N41A 4HYQA 5AW7A 3LC7O 3TQCA 4OO3A 4QDZA 1UBMS 4E2FA 2K6GA 3VKWA 3ORRA 3QW4B 4QTTB 1T0HB 2YZNA 4V03A 4K3VA 2DH5A 4XDYA 5GVRA 1GVNB 1ZD2P 2R60A 2VSOA 4XR4A 3WYBA 2UUPA 3BMCA 1AKUA 3CRZA 3LFUA 2V5AA 3UK1A 1O2DA 1BXGA 2YC2C 3IIMA 3Q0IA 3TRFA 4ARBA 5IN5A 4MWDA 4L4SA 2AX4A 1QFJA 2V5VA 3MJFA 1D7AA 2Z2JA 3HU1A 1NYLA 4HFMA 4X3OA 4MW1A 3T7RA 1AXRA 1O96A 3OFND 4BNDA 3LX5A 3QMWA 4P0QB 2H00A 2YFYA 3I72A 3W6PA 3MTJA 2BEJA 2YQZA 2HSWA 2O59A 3E9CA 4RTSA 2OZVA 2OT3B 3AJRA 5DBOA 4HGNA 3ROTA 1NBMA 1EDEA 4R0MA 1N2CE 2N1MA 3EQ6A 3ZYZA 2GJ9A 1UKBA 1KYWA 1QUEA 3GARA 3DOFA 3KSBC 3L7OA 2G0TA 4B87A 3U7FB 3ZW8A 2I8AA 1QDEA 2HGSA 2BGUA 1JFTA 4CQMD 3TL3A 3VOTA 3T3MB 1E98A 3TJMA 3WP0A 4URFA 1U80A 2NV0A 4PYQA 3FOWA 5J1TB 4D99A 3A1NA 3OLXA 2YJ4A 1DO0A 2YINC 3EEYA 5DI3B 1S9DA 1OVMA 2I8CA 4XZ3A 1CHDA 2C8JA 4X1YB 4EP1A 5FI3A 2RGRA 5A2GA 2P2LA 1SKYE 2Y1CA 3M1YA 2G70A 4RWZA 4YN3A 2XXBA 5MGNA 2WAAA 2QORA 4HWOA 1MP0A 3ICVA 3T9CA 4GF5A 1YF3A 1IRXA 2DHQA 1XTSA 1GG8A 2CMFA 1MB2A 2JIBA 5F9MA 3AINA 1QZUA 2BFEA 2IU3A 4OHXA 3L05A 1Z12A 1WHTA 3WJAA 3TZLA 4OU4A 1I51A 1AUOA 4GOJA 1GTVA 4A23A 2C7OA 2GZ2A 3GZNA 2GEFA 2DY1A 2ZIUB 4MQEA 4Q9JA 4JOSA 4DLRA 1A4UA 2JB9A 3D4LA 3IIEA 4PN7A 8ATCA 2MHCA 5IAOA 1BIFA 1OC2A 3HXQA 1PQ4A 2FF7A 4LDZA 2QIPA 5EIWA 3HCPA 2IDJA 2ZRPA 3ZX4A 3T9BA 4EEXA 3KUDA 1V3UA 3AFIA 2OV3A 3JYHA 4KX3A 4TXMA 4HF7A 3SEQA 1Y4AE 5FPPA 3K9CA 3UK2A 2FWNA 3IAM6 1PTKA 3D0RA 3DHNA 3SU8A 3ESCA 3KDAA 3VU1A 1SZDA 10MHA 1QO9A 2BUAA 2R7MA 2X9QA 3CT4A 2QD2A 2XUZA 3F7NA 3IMGA 3O47A 3JQ9A 2XB4A 3ILVA 5HQTA 1FBTA 3AEQB 4Z3OA 1QLHA 1FQJA 1RPAA 1Z8FA 3D7LA 3OOWA 4OXXA 3VTZA 4DPMA 3OZCA 4Q19A 1POWA 4UAJA 4QLBA 4ECAA 4P4TA 2WSSA 1ZVJA 3PQ4A 3ZDQA 4YJDA 1MORA 1MFPA 1IJKA 4M7OA 4F56A 2EP8A 3OQ6A 1EHYA 3LX4A 1WZIA 5ALWA 5K0GA 3FA2A 5FPTA 1G3RA 2OYSA 2IHYA 3K8QA 3PHBE 4Q39A 2JD0A 1RHQA 4JGIA 4RH0A 1E2JA 1FJHA 5EIBD 1KOLA 3DZIA 4IKPA 3S3TA 2HLPA 2GZ3A 2ZZMA 4IRXA 1C1YA 4P7GA 5IKOA 4BGVA 4EGCB 1MUUA 3FLMA 4LXHA 4CJXA 1NWHA 4QUAA 2GR9A 2D00A 3EPRA 2GEUA 1RE1A 4GYYA 4QGGA 5K0LA 1FS4A 5IH3A 3NAGA 2OD9A 4W7IA 3RUHA 1G3UA 3SDZA 2DC1A 4EMUA 1F8FA 2NPOA 4MQEB 3SLKA 4BKRA 4KQFA 2XXAB 2FCRA 2H31A 4LDQA 2WIKA 3R76A 3WKCA 1N6LA 1QF9A 3PUWA 3C3BA 1Y48E 6YASA 1RWWA 4OBEA 3STXA 3B3QA 1M1XB 4U3JA 5EWLA 4CR8A 3DAHA 2ZSUA 4ZHQA 3AI7A 3I30X 4CDRA 2JI9A 2BI4A 4GYJA 3NC0C 4P22A 2ENUA 3S0JA 4ETNA 2DWCA 2Q5CA 3OF5A 5EMLA 4M46A 2GBLC 3IILA 5FLKA 2Q3DA 3THOA 2Q6LA 1X70A 3RTGA 4YRFA 1EUZA 3PVCA 1G4AE 4Q66C 4Q7MB 4F5EA 1SCAA 3U4AA 3LF1A 2DKFA 3VNRA 2J30A 4TVSA 4JVNA 5B6PA 4JJKA 3UO8B 1G2OA 1XZLA 2J46A 2PWYA 2XUOA 1OX5A 1E6UA 2DETA 2H2GA 1RNLA 2FPSA 4ZHQB 2Y05A 2VJYA 3M49A 3BXHA 1CUSA 4NPHA 3R75A 4U2CA 1M1NA 1T2NA 1TTQB 2H2HA 3CHYA 3FFXA 3QVOA 4OYRA 2J87A 3DW3X 4ZQCB 1PFQA 3JVIA 4LOKA 5C2JB 1IEVA 3HCFA 1N5OX 4Z3DA 3HMKA 4JOQA 2W22A 2VXBA 1Q20A 5H80A 4N0EA 1N1GA 1YGPA 1XXHB 3GT3A 3MCUA 4NH0A 2WSMA 5ECGC 221PA 3ANMA 4RU1A 2F3QA 3GUCA 1NMZA 4R5HA 4X7RA 1ST3A 2HU5A 3NIDB 4P08A 2K2WA 2VDLB 4RGQA 4RKQA 8GPBA 1AXEA 1EVKA 4DCNA 3CZPA 4DSNA 2G67A 2Q2NA 3B1VA 2NU9B 4AS2A 4WW0A 2Z83A 1T4DA 3NAMA 2XDYA 3ZV4A 2GHQA 3MJDA 4KRFA 1ZHFA 4IGIA 1MG0A 4RL4A 3AETA 2F9MA 1TVKA 3OE7A 4ZCIA 5AP9A 3SXUB 1TNDA 2FG5A 1DXOA 2NYUA 5LIRA 2ZR0A 4HV4A 2WAMA 1N2HA 2P6UA 4TYPA 1PR9A 3ROMA 3RT1A 1AQNA 2QK4A 4NICA 2BSXA 3SS8A 1NG1A 1JLLB 1YQ9A 3WGVA 1P75A 3OEED 1T4BA 3MGKA 1IXYA 4B9AA 1DC5A 5KX5F 1GPYA 2J3QA 4EHFA 1TW3A 5FPQA 1YUNA 3GXOA 3V32A 1SNYA 1IXKA 3K72B 4OYHA 2C8KA 3EBLA 2GBFA 4L7VA 1TM4E 2GHIA 2E1RA 2YWCA 1JB1A 3M6AA 2ZCJA 3W5CA 5LD2B 5BMOA 2WYIA 2BGIA 4GC9A 4TL7A 2VPIA 2VXYA 1JHMA 4YP1A 4Z9XA 4UM5A 4QDOA 5FAXA 3VTKA 1YAJA 3HDGA 3H5TA 1XXHA 3RIXA 1QO0A 3R9XA 5AJYA 3HJBA 1X1RA 2BIFA 3TL6A 2W8ZA 4LNUA 1THTA 2D1RA 3PGXA 3R5KA 4Q21A 3DMGA 4J0KA 4QUEA 1KQNA 6PFKA 1J07A 4ZQGA 1SOUA 2CK3A 3FCXA 2Q7XA 3NOOA 2WTNA 3DE3X 3GGCA 1P1HA 4KQXA 4EYQA 1P44A 5HPYB 3JX9A 4MB0A 5K6TA 1TIBA 1V5WA 1I7QB 1Z38A 3VDQA 1D8TA 3ICOA 1HI9A 2V1XA 3HFJA 1PX0A 2MYUA 4FMBB 4NZZA 4CGZA 3RKSA 2D7CA 1IIRA 3TW8A 2O8EB 4Z49A 1B1AA 5CM8B 1J5XA 3UT5A 4NESA 2IYUA 3Q8KA 3HYTA 3Q3IA 4JZYA 3SR3A 2PLWA 1RHKA 4CKYA 2QRVB 5K99A 1Z4NA 1I8TA 1D2EA 5K45A 4BFYA 5AW2A 4WNAA 3COVA 4D41A 1VL5A 3FR8A 2I66A 5JMTA 2J0SA 4WAUA 5LLSA 4MWTA 3PJRA 4ZEMA 3FM9A 4XSGA 3RUCA 5ES4B 5JNSA 1HDOA 2ZRAA 1XQVA 4LZAA 2NUPB 4G37A 4OA5A 1SB8A 4DLKA 4LQCA 2FZWA 4RZUA 4KFRA 2YZ2A 1USGA 1EVJA 4LUCA 4YAJA 2DBYA 4G9GA 3IE1A 3L9XA 2ZS7A 4EI9A 821PA 2HA7A 3GFBA 4HUQB 2HMVA 5JTUA 1O7JA 2OZLB 3ZJUA 4UVGA 2GVDC 2QTAA 4JN6B 2WYUA 3JD1A 3B3GA 3GUZA 5D6NA 3ZV7A 3E9YA 2DUMA 3GLFE 4LGCA 4S1OA 4HZIA 2X8WA 3F5QA 1S3GA 3T9FA 1Z7BA 2BR3A 4XW2A 3BRWA 1A9XB 3EJ6A 1BEZA 1KI3A 5U4QA 4C78A 5IH7A 4UMVA 2AUTA 1DBSA 1DC7A 1KPGA 1ZBDA 2FSGA 3JQAA 4NV0A 2GN2A 2L2QA 3NWBA 1AKWA 1WW3A 2R8ZA 2W6OA 1QG2A 2GK3A 1CP3A 2R8RA 3K0KA 1LQUA 1VYVA 3K1AA 2PN1A 3T7AA 4G67A 1YIDA 3BJMA 3RFCA 1SRRA 3PA6A 4IXNA 2GNPA 4WZBA 2HZ7A 1H1DA 1K92A 1XZBA 4U39A 4LKOA 1JVSA 3PQ8A 4CIDA 4DIOA 4RA6B 1IBLB 1U0OC 1KAHA 4K6FA 3EA5A 4QRDA 1FUUA 4R1MA 5E8JA 3BL6A 2JGMA 1E7QA 2PZEA 2WILA 3FLBA 3GW8A 1WNFA 4R2WA 3FB1A 4IM7A 1ANKA 5AW5A 1GSAA 2OMEA 5AKYA 5A04A 1DBWA 4KYUA 5J2UF 1BMDA 1WZUA 2QGNA 1P60A 4ZO6A 3O8DA 1KJNA 2X2FA 3BXOA 4G5SA 5A3VA 4JU8A 1G19A 2Z9DA 5E4YA 4EEZA 5DIZA 2F4VB 3DE4X 4RA9A 3AX6A 3NONA 4ZCRA 4ZC1A 1K9SA 1YZHA 2JFPA 1ZIDA 3I53A 1YZUA 3UUFA 4LZZA 4H4CA 3BJIC 4EHJA 2FETA 2QM0A 4F8JA 3FYUC 3EG9A 3ZOKA 5KJCA 3HXOA 3MTBA 4KU4A 3KHUA 3K71B 4UTXA 1ZUNA 1U0RA 4F4CA 1NZJA 2GARA 2X3UA 5C5DA 1YXMA 4D3XA 1JDZA 3EDOA 3EIWA 4JI2B 1C7QA 4G0UA 1N5RA 3GLRA 1NYTA 1XTVA 4RANA 5CP8A 1RMYA 1QFXA 1VGVA 2YWBA 2BJVA 2H2AA 3DC2A 3DNFA 4QDUA 5JCXA 1SKMA 1N6HA 1E6LA 1CP2A 2A1TR 4MVWA 4OQFA 4TXJA 5DXFA 4LWQA 4KN8A 5CXUA 2BAGA 4G5YA 4Z2AA 1SGWA 1SCKA 1RWVA 2VJKA 3LLVA 4KLAA 3Q41A 3JXEA 1Y1PA 4RVNA 1B8PA 1XQ1A 4NOKA 1NQTA 1X15A 4S3MA 4ENUA 1XTBA 3EIHA 1DAPA 4W7HA 3TLXA 3P0EA 4U7JA 1U0JA 3D3KA 4WZBB 4MS1A 4F85A 3CLTD 3FGPA 4TLEA 2D5BA 3N0VA 3OJFA 5J2TF 5DBIA 1E59A 3OZTA 5IYZB 4DZTA 2F67A 4LJ8A 4PG5A 3EZNA 3G3EA 3WSWA 2ABWA 2IZ1A 4KIFA 5FOQA 1Y98A 2VATA 2VK2A 1GKLA 1SUWA 3TG8A 5HJ7A 5B4TA 1CJCA 3VTAA 1C0KA 1CZLA 1PGPA 1S02A 3LA8A 4UHHA 4UU7A 4XX0B 1MPXA 3DHVA 4XGIA 1XRJA 2O2XA 5EJEA 4EB6A 4P81A 2Y99A 2CKMA 5AD1A 3SG0A 4DILA 4ONEA 4M2LA 1P7ZA 5IANA 4H35A 4MVJI 3BXZA 3OFVA 4Q6BA 3SC2B 1F6DA 1KI4A 2DCMA 1ABEA 4XEHA 3BD7A 1V4VA 3EIXA 1XN4A 3CB4A 3T4XA 1HT3A 2YIVX 3AI3A 4IOJA 2I76A 3TRHA 1Q7BA 1CERA 2D3TA 2RHCA 2WPNA 2X1HA 5A4AA 4PC7A 2YN0A 2V98A 3SK0A 4QPJC 4YP6A 4YRQA 2Y67A 2NP7A 3PITA 3WGTA 3IUEA 1VFNA 1AG9A 3CVJA 4CCYA 1YWGO 4RIHA 1AGXA 2PGJA 2Z1MA 4F3NA 1RPTA 2OAQ1 4GBJA 3THWA 2YVUA 3N2YA 4BEWA 3HDVA 4DV4B 3PNVA 2AZTA 3BIWA 3GLHA 4XB2A 3ZHRA 2ZR7A 4XWOA 1OWNA 4PRLA 3D7MA 1EJ0A 1FPQA 1Z62A 2W6ZA 2DPHA 3QSGA 3UTCA 3V8MA 5B2FA 3TDNA 1KY3A 4IQFA 4EELA 4ZMRA 1W36D 4I14A 1NF2A 1BEUB 3HL0A 1U31A 4D6YA 1S2NA 2QPLA 2R8YA 2Q07A 2R1TA 1X1BA 1THMA 1QK5A 3FR7A 3DGEC 2MSNA 2ZUWA 2IEDA 3NHAA 1MJGM 2HPAA 3LXRA 3MQFA 4YT8A 4AX4A 1U2SA 3TQSA 2HNAA 4GYKA 1LH0A 1Z6AA 5CM9C 4UQLA 3MJVA 3VR3D 3Q8XB 4GSKA 2IE8A 3PEYA 4ZO9A 4E70A 5CD9A 3WY9A 4BO4A 3BGIA 3K32A 2ST1A 1CUXA 3U26A 1N2XA 3RS3A 2IHUA 2V7TA 5BSHA 1IZZA 1S8OA 3FB4A 4NP6A 2OCPA 4S1TA 3ZHCA 3RLFA 3U4QA 4YMUA 1IY9A 3LH5A 1CEQA 1ML4A 1ODTC 1P0PA 1SCUB 3FG9A 4UUAA 4G5FA 4IHJB 1IVSA 1G64A 1DUVG 4FNOA 4N6NA 4YJKA 3I1FA 1L6RA 3UXMA 3WWCA 2H2IA 1G55A 2FEKA 4U2DA 2WG0A 4Q3BA 2EG9A 5TVKA 3OCVA 5DGXA 4UFPA 5JQGA 1MGPA 2Y77A 2NQ8A 2Y9PB 4CV1A 1K86A 1ZNXA 4MWCA 3E9RA 5KMGA 3ADPA 3GLTA 3REQB 1X80B 2AZDA 1RZ3A 2NSDA 3U44A 1UJBA 1YI8A 2Y92A 1UBRS 1VA5A 1PJRA 2P4EA 4JX8A 3RI3A 2XCOA 3RU2A 4EA8A 1ORTA 5FADA 4QKQA 1QG4A 5LMCA 1U2GA 1D04A 1DTWB 1GUBA 2LP4Y 3VUEA 3VTFA 3ANSA 1VLZA 2W5UA 3LY7A 4IGKA 4CM1A 3WRXA 3LGXA 4RMIA 1LB1B 2JJ8A 5A6VA 2JGIA 2X7HA 1MRSA 5KCZA 2Z8YA 3D2BA 2W6IA 4NBWA 5C7LO 2LTAA 1C30B 1DX9A 5ALFA 3S5JA 4RY0A 4AZSA 3BN3A 3FRHA 3AHJA 1G5RA 9ATCA 1XAIA 2C3PA 2IXFA 2QA5A 1O9GA 5A6SB 3OFSA 1CF2O 4JEUA 2YN4A 3CLRC 4G9EA 4XVCA 1XL1A 2AG6A 3MN1A 4KC0A 2ZYTX 4RVHA 3UANA 2CLOB 2GT1A 5AI4A 2CV2A 1WXXA 5FUWA 4FW9A 3JQ8A 1Z63A 1C30A 3WL7A 1UXGA 5HJ5A 4G5OA 4PCUA 3IMKA 5BWBA 1SBCA 3BT7A 1E2QA 1T35A 1XEXA 5L4SA 3KOMA 1VCHA 2GAAA 3IBFA 1HT0A 3QV1A 5KWEA 2XNDA 2ZJ3A 2ZYSA 2QTVA 2XYPA 2RAFA 1Y3CE 5JATA 3V7UA 4QNNA 4QUIA 4EVQA 3DWFA 1U5BB 3LUHA 4M1WA 3UAXA 5BWNA 4DCVA 1A9TA 1KDVA 1H8ED 1JMVA 1T0JB 3DZDA 3PC4A 3QNUA 3H11A 4L3VA 2V4UA 3PEUA 4NZNA 4OXQA 3IP1A 4O4JA 3MXTA 4BNGA 1OTXA 3AHIA 3WZLA 4MQUA 1TKCA 4QTZA 1NDHA 1E9RA 4I5FA 5TPZD 2BFOA 3BA6A 1I9CA 1JN0A 4HAIA 4UUOA 3SF8A 4ARZB 2I3AA 4HQLA 4MS3A 4E2XA 4RBNA 4KR0A 3GJZA 4PHGA 3ZE2B 2J9YB 3A4NA 4C08A 4LOJA 3QKSB 1Z6QA 2BBSA 1YK1A 2TMGA 4UDXX 5D3ZA 5BORA 2AE1A 2GXAA 1Q44A 3JQPA 4N1AA 4PO3X 3A28A 4N9WA 3ZUPA 2BMJA 2CYBA 2H7XA 3OZWA 4AU1A 4BKUA 5IAAA 4BO0A 5KWSA 4Q9LA 4W5QA 4GOXA 1Z28A 5HF9A 2FWIA 9GPBA 2NADA 2O2HA 1PQWA 3AIKA 4O4HB 2FPWA 1W5TA 1EGVB 3D0QA 4QPZA 3RD5A 2WWTA 1MTZA 4PF1A 1K5HA 2R6DA 5FTJA 5HA5A 3EPLA 1H8HA 3SI7A 1T9BA 4EY8A 3O26A 3QKSA 5G41A 5TPZA 1U02A 2GF0A 1U90A 4HRXA 2XF2A 2QPTA 2XT0A 2C8LA 3A31A 3FPEA 3I04A 4EI2A 3PDJA 3REOA 2GKGA 1OH7A 2UZ1A 4J29A 1O89A 4ZCMA 1IN6A 3CUEF 1RAEA 2HOQA 5C37A 1GFIA 1VJTA 2PVCA 4E21A 2FFJA 1UT8A 4XPZA 1ID8A 3S2ZA 1WJGA 3GRCA 2LCIA 1YZLA 1XN1A 4HSGA 4Q4HA 4DMMA 2I91A 2GRJA 1TA9A 1E8NA 1GFSA 5I48A 4IHJA 1ZY2A 3INYA 2XVMA 4G8CA 5CCBA 2VH2A 3BZWA 3ED1A 5DMXA 1EFPA 3SLRA 3FHTA 1YR3A 1CJSA 3GT0A 2XUKA 1MW9X 4INOA 3NTVA 3D1VA 3T7EA 1NUUA 4PCVA 3A4LA 4D9CA 3GQBB 2CB0A 4QVGA 3T5AA 3E81A 5K0TA 1NQOA 5H3LA 3FOCA 3ZZNA 1HKUA 5LN1A 1I2CA 3QIVA 1EWYA 5EHIA 5FQNA 2KW5A 2FN7A 4EDHA 4JKIA 3P45A 1M6HA 3DCNA 4P92A 2NU7A 4UDYX 1SCNE 1BROA 4ND4A 1G5PA 3T3HA 3FKJA 4LYAA 3CJQA 2GVZC 3GEMA 2HWWA 3UJDA 2CK3D 1VHJA 3VI4B 4R7GA 2FRXA 2ZR9A 4BV3A 1ZNYA 1P8JA 1XDBA 3K8YA 1EWKA 1PUIA 2Q4RA 1RD4A 3NWPA 2CFRA 1YJQA 1ZD3A 2VDNB 3IEVA 1F14A 2YFQA 3NHYA 2CNBA 3CH7A 3I0ZA 2DQSA 3KP1A 3OUUA 4RNCA 3CVOA 5FOVA 7MHTA 3OX2A 2XKAA 3JALB 3FCSB 4IP0A 4F2WA 2OG2A 1E5LA 3MA0A 3ZGVA 5JXJA 3UXEA 4MQFB 1Y3DE 3I32A 3SKXA 1SIBE 1KAMA 1CIJA 1YO6A 3DULA 4KPGA 4DE5A 3FOBA 5ER9A 1T0IA 3IAEA 3AB7A 2XDQB 2ZK7A 1ZJZA 4Y7CA 1UZAA 3IAM1 4ZJYA 1MW8X 1BMQA 4FFLA 1U1FA 2O4UX 2ZAGA 1B4DA 2HMYB 5H4HA 4DHEA 3PHGA 3ZWWA 5HUJA 2JZNA 1K4YA 1E5DA 1LW7A 2H4FA 3GOQA 3KR0A 3KXIA 4HKTA 1DNPA 4MULA 4V0NA 3TR5A 1FP7A 3LWDA 5BNTA 3AOEC 1HL7A 2WRZA 4CDNA 1NASA 5K6AA 4D4MA 3JQDA 3B6JA 2N47A 4JMLA 3I42A 3OM1A 2ZRLA 4NFYA 1KU6A 3B78A 4ILEA 4QE3A 1DAOA 1JR2A 3ZQUA 1Z75A 4BASA 1J56A 1QGED 2HCBA 4TKMA 4JWKA 3M4NA 3PEVA 1XTUA 3ZR4B 1KS2A 1XQYA 4NG4A 4RK6A 1ODLA 4Y1EA 5BNZA 5BUZA 3OU7A 1T5IA 2PDAA 4RY8A 2INGX 4MXDA 2XJ4A 2P2YA 1AQIA 2QSYA 4QOIA 4R2JA 2JF0A 5COAA 4FYJA 4IHKA 5ALMA 2FTKE 3BOSA 5FYQA 3TDMA 2YMLA 4IEIA 4NSNA 1QFMA 1FX0A 2NYAA 5HTKA 4KJZA 3ABOB 3IP5A 4CF7A 2GS9A 4U1RA 1P3DA 2FPUA 2BCGY 2X4IA 3MSXA 5FBHA 1EX6A 4MA0A 2QM7A 5FUYA 5JZSA 2X0RA 1L4EA 1N8TA 1YVPA 3GU3A 1Z0FA 4I4NA 5A5DA 3LTNC 2Q6TA 1WDKA 1KGSA 3CA8A 2W6NA 5H3HA 3ETCA 1V7CA 3R6DA 4B43A 4DLSA 2CFTA 4MRSA 5LQMA 3ENZA 5I8ZA 3UHAA 2HFKA 4Z4EA 3O1HB 4GWGA 1DDGA 1AO0A 1JLMA 2FK7A 4ZJZA 2YUIA 3W5BA 1DEXA 3RYTC 4R9RA 3SC4A 4JAVC 1ZESA 2P6NA 3OKAA 3UENA 1AK2A 1JALA 1PN3A 3I73A 2CHEA 3M5PA 3TM5A 1IXZA 1E58A 2EATA 3OQJA 4HNAA 4FP9A 5DM4A 4ZVUA 2G09A 3BMNB 2BN4A 2OG1A 4ZYWA 1E1RA 4QPDA 5IDXA 1OU0A 1TD9A 4UUMA 4AIRA 1OA1A 4NJEA 1OIVA 1YQXA 5AJVB 5HNKA 2ZRBA 1WF3A 5DX8A 1YL7A 1LC3A 5HIKA 5CJJA 5J4KA 1RYYA 4OIMA 4G5GA 1IHOA 5MFPA 5DH9A 1HDYA 3ESRA 5GJCA 2WUFA 4DMFA 2VOJA 4P4SA 3H0CA 3KTDA 1IUKA 3TCNA 4CMCA 2A5YB 2R7NA 3C3JA 2ZCVA 3F98A 4NBSA 2YY5A 3HJRA 4H18A 4RHEA 2XUGA 5FUQA 2PEYA 2ONYA 1XTKA 3GVHA 3NGMA 4G65A 1P80A 2OGZA 3MJCA 3OBIA 4BB6A 3Q7QA 4QSHA 3GEPA 5JCJD 1U8CB 4B4VA 1X42A 1ODJA 4CMIA 2V6MA 5DGIA 1M75A 4QHYA 4ENQA 1QDUA 1TCVA 1NFQA 1P2TA 1B8OA 1Z5GA 1ZVQA 1VZ2A 2W2OA 1Q2UA 3WGKA 2H17A 4ZOQI 1KK0A 3IHWA 1TIKA 2VZ9A 1EG7A 2ZYAA 1ZX1A 3FDZB 4FKBA 5BVHA 3CS3A 4EJSC 5C80A 1I01A 4DWWA 4LKRA 1ONSA 3E03A 1O5IA 3D2LA 4Z51A 5EZ5A 4CIAA 3H65A 3LCVB 2ZBRA 4OGKA 4F4JA 3MMNA 1IUPA 3IHKA 4NAHA 3BMOA 1EINA 4H3KB 1QS0B 1ZGBA 2PH3A 5KCMA 5LWQA 4HGRA 3TW4A 2QZJA 4BC1A 3VVMA 3LX6A 1Y3AA 2Y93A 4NENB 4X95A 4C0JA 1OZGA 3GPBA 5JY6A 4AN4A 3JQAD 2RAUA 3FWYA 3O8QA 4JKOA 5DTMA 3WSVA 4D42A 2KHZA 5HM6A 3DTTA 2WF8A 3C3MA 2PYDA 1Z4IA 3ZU6A 3EX7C 4PBSA 2CHFA 2YQ5A 5KTPA 4JI8B 4IDQA 1U7TA 2HCJB 3SP1A 1L8AA 1YH3A 3VX4A 2O0HA 2G71A 4BFXA 4EG6A 5JSUA 3QNMA 1GXSB 4NH4A 4BQEA 4MV4A 5TV2A 3CZRA 5BOSA 1YRBA 4NATA 4ZQIA 3CE9A 1EDBA 4I6EA 5YASA 3T1TA 2PSDA 2EDCA 5MN5A 3CZQA 2JHCA 1MV8A 1VI2A 2BD0A 2ORIA 3G7SA 1DAEA 3V7WA 3P0HA 5K03A 1J97A 3VR1A 1C1HA 1V3TA 1JJIA 1XZPA 1OC4A 4LYGA 4MKXA 3Q8MA 1WXGA 1M10A 4OK3A 3W9YA 4D3YA 2OAP1 1Z6GA 3KDPA 3VZDA 5K9ZA 4CMHA 2XPCA 4C7OB 2ZB4A 1SY7A 3V2HA 1J7JA 4KODA 2RGBA 1O95D 1RJGA 4U6NA 2UYHA 4EBBA 4PBRA 4KKVA 1O0SA 1VSBA 2QT0A 3OT1B 3CLUC 2LR0A 4GMKA 5FTNA 4CIWA 1G4UR 3W05A 2HJSA 4HAYA 2GN9A 2NTEA 3MT7A 2OO5A 1E63A 3UC5A 1Y9EA 4AS3A 3PA8A 4JJFA 1Q0SA 3LAWA 1ZW6A 4EPWA 2QD4A 1EVYA 1FXSA 3AESA 4W5WA 2M6RA 3ZWYA 5DNAA 2SNIE 5IFLA 3UT6A 3W2GA 2PWPA 1XNHA 2KQUA 1W87A 2UUOA 3WXMA 2ZT6A 1JU3A 1BJKA 3DEKA 3WB0A 3WGJA 1MRZA 1UJ6A 4Q3OA 1G5HA 1PFUA 1A69A 2PMBA 2PV7A 2EVWX 2VHQA 3L92A 4JT2A 3VISA 2RC6A 1B1CA 1D2HA 1XYGA 3LPLA 1YAHA 1B0UA 1N6IA 3JR7A 3WNQA 4B6EA 1P4JA 3OCXA 5FWNA 1ABBA 2W71A 3VPXA 5PGMA 1Q57A 2X1VA 2AFIA 3HUEA 4ZKEA 3HHEA 4W8GA 3C4VA 2R9VA 3DL2A 3VMFA 5T4HA 3HKDB 5EJ5A 5KSOA 2AD5A 1WUHS 1EAYA 1JUDA 4YYEA 3C6KA 4GGOA 2Y6UA 5JZVA 2B94A 2ID4A 1ECPA 2ZSIA 4L02A 4MVJH 3FOEC 2WPDA 4OI1A 4PGMA 4HQNA 1WB9A 1G2IA 4WIAA 1GZ5A 2F3PA 4ND1A 3GPLA 1W1UA 4K9SA 3OOJA 4P36A 1UC8A 3L7AA 4PGAA 2GO7A 4OATA 1NQXA 4C7KA 4LJLA 1MCZA 2RBGA 3FGOA 3U80A 3A6JA 1NMXA 3FRIA 3PUYA 3UAVA 2FR8C 3MGAA 3NIBA 2H1CA 2QLFA 2PL5A 3WBFA 3LVRE 1IPHA 4ZC8A 2P9EA 4NOJA 1V0JA 1WLYA 2F8SA 1ULZA 3ZVNA 1W0KD 1KZ7B 2HBRA 5ECWA 6GPBA 5I7FA 2R1UA 3V1MA 5KBYA 1MPTA 2BEWA 4TS3A 4EL5A 3TG2A 1B0AA 1O4VA 2P79A 4B09A 5EKSA 1X7XB 2TSYB 1NNUA 3GDWA 1NJ5A 2WPDD 1A88A 1W75A 3MWLA 1TXGA 1BS9A 4GP6A 1FCJA 3WBBA 2B5WA 2OXFA 4M36A 1CUBA 3U49A 1D6JA 1T91A 3NHMA 1IH8A 1MXFA 2I9KA 1NKVA 2OGTA 3IYLW 3MJ4A 1J09A 1Q1AA 4CM8A 3U4HA 4F4HA 2AF3C 5BUQA 4BXOB 1LDYA 2QLMA 3KYIB 3ID6C 1DQPA 4LS3A 3HVKA 4KQ9A 1TZJA 5I5GA 2BUCA 2FR0A 3RFXA 1V11B 1NNEA 4X45A 4P2GA 4K86A 4BX9A 5H0IA 4I55B 1GLGA 1EXDA 1SJ9A 1W0KA 3NHRA 4HGOA 3MW8A 4JEHA 4XLZA 2G0AA 5JMPA 4DCCA 3JZDA 3FUUA 1X92A 4KTVE 1DHTA 4LWPA 4RACA 4B3SB 1Z0IA 1G9TA 2H4HA 1O5OA 1V8OA 3FPCA 3A6PC 4U7TB 4DV2B 1AS2A 4YFYA 4HLNA 3P94A 4Q02A 1F2TB 1DG1G 1KKMA 1PJSA 4BNNA 1XDZA 1R5NA 4OU5A 3H4MA 4G1UC 3ZHUA 4CM4A 1R37A 1M2NA 2J3JA 4HGYA 2GZHA 4QUHA 1E2FA 4URYR 5JO0A 1BQEA 1IVNA 1R27A 4IIXA 3S70A 4Q3CA 1ULBA 3HPQA 3ZKWB 2UYOA 3S2IA 4LSGA 4JI7B 1ZN7A 3D4PA 1D03A 1KJ9A 4DA6A 3RC3A 4ZVKA 2HQBA 1L1FA 4DMRA 1NSTA 3A3YA 2KPOA 4QG3A 5JANA 1ISGA 3FBGA 4D96A 2O7SA 4B8YA 1KMNA 2CXPA 2J7PA 1AT1A 2REBA 3C1AA 1BE6A 2P9TA 5KYXA 1NF8A 1SXJE 1L5WA 5KTRA 2JATA 3LYAA 5LP6F 1DCKA 4C2UA 2O0MA 2B8TA 1P7VA 3QEJA 4FFSA 3SHOA 4QASA 1OXMA 3WTCA 3HVRA 3NDBB 3T7IA 4XWYA 1DFGA 3BD9A 4YC7A 4A2CA 5JEDA 1XWIA 2ZIGA 3NDJA 3MBKA 3A27A 1U8XX 4UTPA 3HB7A 2D0IA 3QJ5A 1HORA 4JJZA 4Z53A 2AUMA 2NWQA 4D9EA 1VECA 1TPYA 4DA4A 3GD7A 3U4IA 2WJVA 2CZCA 5T3UA 5ANRB 4I1IA 4PHTA 2G1UA 1FLAA 2A1UB 2JA2A 2NSJA 3I9FA 2OFOA 5IAEA 2LIPA 1SU8A 1HDZA 2F4NA 1G0NA 2ISQA 4ZGWA 5JHGB 1TAQA 4KW7A 1F0NA 2I67A 4MDYA 1Z2OX 3U0VA 5B4UA 3NX4A 3N07A 1P9OA 1VLJA 3BA1A 3B9BA 3FW1A 3QKWA 1XV5A 3HCAA 4TTAA 4ZV9A 3RSCA 4N5HX 3UWKA 4D46A 4MRAA 3QWFA 4DBZA 5HKKA 3U19A 4ZZ0A 4N0PA 5HRUA 4JXXA 2JBWA 2OZPA 2F64A 3H2IA 1PHRA 5C18A 3LJKA 2JI4A 4KPEC 2AC4A 3B6ZA 3X1DA 2ZBVA 2GWRA 4YRBA 1SU4A 2JGLA 2VCHA 3WHIA 5DWQA 2BFEB 4PGHA 4KR9A 1CK4A 2BMWA 2PKQO 1NDQA 4ADSG 4ZTUB 3BKXA 4ZOBA 5KUTA 3LIIA 4MYSA 4L0CA 4E2YA 3AR3A 3RAGA 1G38A 4PC3A 4EMTA 3T99A 2HIAA 4Q3EA 1XYVA 3HE3A 4JBGA 3CN9A 1BDHA 3VKUA 4D57A 2PL9A 1KYIA 4IHQA 3TZKA 1O97C 2PT5A 4XM2A 1H2BA 3ELBA 1YB2A 4O2AB 1N2CA 1XU4A 2JGDA 2HF9A 4UEOA 2II6A 3DL7A 5IUNC 1DPGA 1U3DA 4XCVA 1F0YA 4RGVA 4KQKA 1MQ9A 1X1EA 1E77A 521PA 1TECE 2WUWE 4URWR 3SC3A 4C06A 3H2GA 1IB6A 2AQKA 3OD1A 1LNZA 2IWRA 1FLVA 4OB6A 4RKEA 3ZGXA 3WGIA 3AEQA 2UV8A 3WLHA 1V2GA 2NXNA 2J6CA 5F5NA 2VP9A 3K53A 1J6UA 3KQQA 2DECA 3C7KA 1Z4MA 3QE4A 3K73O 2Y2UA 3UIEA 3A9TA 5KNLA 3CTMA 2CY0A 2C0QA 1VG1A 1ETUA 4LE0A 5KDLA 4DJDC 2VYND 3PNQA 1A1VA 1CR0A 2Q8NA 1GIAA 1NRJB 4TGLA 4RJTA 2GUGA 4L7QA 4RVUA 1H1TA 1CUFA 3E0QA 5LP6C 4A6PA 4F2GA 2QG6A 4KB5A 1CSEE 4KAAA 3U4MA 1E9VA 4IG4A 3FSRA 4GLJA 4E5UA 4MYUA 4OMDA 4U7FA 3ZLVA 1E5QA 2AS0A 5T57A 4XCQA 3M6UA 1SVOA 4FDTA 1BDIA 2Z6AA 2Q4OA 1VLQA 4YCDA 4YP0A 5E3IA 1GTSA 1E89A 3A4IA 2CYCA 1FA9A 4MO2A 1N9ZA 5FBZA 5JROA 3CVYA 1ZLYA 1V6SA 3H86A 1A9OA 5EKUA 2GNAA 1Q7RA 3MSCA 1N7HA 1PJQA 4BO2A 3ANYB 3ISTA 5KTSA 4NCXA 3ZW9A 4E30A 1GUZA 3ZBPA 1SZCA 1MXHA 3G9XA 2IU0A 4AJ2A 1DEAA 2OKGA 3CF2A 5B5SA 1NIPA 3L7DA 2P0EA 3MXOA 4B45A 1YTLA 4KAJA 2HSEA 4Z1MA 5IDVA 4BAUA 3CR8A 2NTNA 1FU8A 3RWOA 1E4VA 3RSFA 1XCGB 1XD8A 2R96A 3TB4A 5IBPA 1HFWA 3H5WA 1A7AA 4MV6A 2VSXA 3M9XA 4D79A 8OHMA 1N8NA 1FF9A 3L0YA 4A8JC 1FTNA 2BHTA 1ZWLA 5L7YA 1Y5NA 4AZ3A 4C1NA 5JH7F 3VDRA 4BLOA 2J5QA 1MKYA 1PHPA 4ERNA 1GR1A 1RWQA 3LT0A 3NIFB 3TF5A 2BT4A 1JW9B 5JWHA 4UTOA 2Q3MA 1KTIA 4LCBA 2GEKA 1ZMRA 3OZFA 4UHKA 2ZRGA 2AXNA 5HILA 4MLDA 1N6NA 2LGJA 3P9PA 3U7IA 2F17A 3WI7A 1GFZA 4EW2A 3H11B 4BNDB 4IJWA 5KVVA 1AB5A 1EQUA 4KX5A 4ZAZA 2X6QA 1DEOA 1JPJA 2F1HA 5EHZA 3L7IA 5JFTA 4K8OA 2OUIA 1CE8A 1WKBA 5FF9A 3T12A 3UQZA 4OXYA 3ZV5A 1HTBA 4ZOEA 4JYPA 5LU8A 4J3JA 3ES9A 4UCXA 1NNLA 3IUNA 3RTCA 3WQHA 1PT6A 2FMKA 4LX8A 4CW7A 5HGXA 4DYVA 4TVKA 4W1PA 4N3CA 1SZPA 1B42A 2ASEA 2GILA 1GSHA 4X63A 1M3SA 4BJ3A 1GAQA 1GWNA 1TJPB 2PXXA 3IOYA 2DFTA 2GSDA 2A0WA 3G13A 2VRBA 3VUFA 5JCJA 5LLDA 4RNDB 3TEFA 1Y8QA 3AR2A 5HKOA 2FHSA 1F9AA 2I3BA 3MT9A 3O4GA 1YC2A 2JFFA 2XRYA 4J7CA 2ARKA 3FLEA 4P0PB 3DZ8A 1CX9B 3R0IA 1VE7A 3UJPA 2BMAA 1FYFA 3LC1O 4J0JA 1IQPA 1MO5A 1VL8A 3OTGA 2VJLA 3ZE1B 1MQAA 2VNAA 3AQ4A 4HWPA 3RQIA 4C0SA 1EUDA 4DQXA 4NF2A 4PZDA 5K6RA 4JGGA 2BHLA 3WIOA 3TAHA 2BKVA 1Y1SA 2ZB8A 4HH0A 4Q9KA 3ILYA 3P2OA 3U7RA 3WJ7A 1BO6A 1VP9A 2O1SA 1RZUA 2J5KA 4DA0A 4XA8A 3KAQA 3ZHXA 3WK8A 4MLCA 4ZCPA 4I3FA 2PZFA 4QHTA 4C76A 1NC3A 2WWVD 4A5OA 1OCEA 2WM3A 2QRZA 3P5SA 1HQCA 5HKLA 3A1WA 1O96B 1NW7A 2PKXA 2XVAA 1XELA 3C5CA 2P78A 5HE8A 4YWJA 3WHPA 3SVLA 2RK4A 3WRYA 2CHQA 4IDGA 1CYEA 3SE0A 1S2OA 1UEXC 3BF8A 3F5FA 3Q7RA 5DYTA 3R77A 3WYAA 4BNYA 2AOXA 4PSVA 1CLUA 5D51S 5F23A 4CL8A 4B5LA 1COWD 4DGQA 4ZOLB 3D7NA 1AK1A 1M83A 3EXAA 1G60A 2PZMA 2V55B 4RPLA 2FKAA 1ZJYA 3ACDA 1KHTA 4MA5A 4TWBA 1K5GA 4EG7A 5BMVB 4N82A 1LD3A 3LZ6A 3G79A 2VC2B 4FE4A 5DW0A 4C4TA 1E2EA 3AHDA 1XAJA 4BQQA 4KDCA 3NKVA 2QJOA 2P9CA 5HDBB 2HXGA 2PCJA 4I9GA 4JOCA 4MUEA 1XQ9A 4QUBA 4FN4A 4XDZA 3LC2O 3CPEA 3RS4A 1WSAA 2V7PA 5FTMA 1SULA 4FD3A 5FPKA 2H1FA 4TSKA 4UM7A 1SWVA 2ZI6A 2FZ5A 1T3ZA 1BA2A 1J99A 1I2AA 2DPGA 1P5HA 1RJWA 4MS4B 1NMYA 2B61A 3KZXA 4TV8A 2HRRA 2O2DA 2D5IA 2EQAA 4DXDA 3H5RA 3S7ZA 1JZSA 4AROA 1YR6A 2JW5A 4FZ5A 1EGMB 3R6TA 2CE7A 3GEIA 2MSKA 3OX3A 2E3JA 2R00A 5EFZA 4FS8A 2VLIA 1KI8A 4ZRDA 4YUWA 3QE0A 4BC0A 1NSYA 2E18A 3ZU3A 1XXLA 3GGSA 3A70A 2PUFA 2GEJA 4JXKA 1NVBA 4TLLB 2PGDA 1GT91 1IZ9A 1QNFA 2XOEA 4BBPA 3OJXA 4ZAWA 1X7DA 1TZ2A 2C1ZA 2RGEA 3RVQA 1O95C 3Q2KA 1Y34E 3R0QA 1K98A 4BYGA 4LYYA 4DIMA 5A02A 1CRWG 1PFGA 3KNZA 2WD9A 1BW9A 4DR6B 3JVVA 4OJMX 3AF1A 3K09C 3ZTTA 3QF7A 4HMPA 3V8BA 1R50A 1QQBA 5JQGB 3PIRA 5KNCH 3GNQA 1LDBA 5KAPA 5TQVA 3AFOA 2B4YA 3TIIA 2WQ6A 2CEAA 4R51A 3VR5D 4MYRA 1XVAA 3DT8A 4X65B 5ED0A 1G16A 3LUGA 5A4IS 2GERA 4G4JA 4JKYA 2HPVA 1TQDA 2GVNA 4AVYA 1W25A 4ZJUA 2UYCA 1XTTA 1R8QA 2AF4C 2Z3VA 3EXFA 3L0BA 4R7TA 4TV9F 1W76A 4EHLA 3KSAC 2JAXA 1CVIA 3GGDA 3A14A 4GPTA 1B0ZA 1OBVA 3L7MA 4RQTA 3BDVA 3I09A 1ZRMA 1WB4A 1LBTA 2HA5A 1O4WA 3ONDA 4L9AA 4XUCA 5BW8A 4RHTA 3MHTA 1GU7A 4LOLA 4XOUA 3RU3A 3FTDA 4WOJA 4EUHA 3GUUA 4KHZA 3TO5A 4DR2B 2AWOA 1XRNA 3NT5A 4FYIA 4RUKA 5H7XA 2W6JA 3ZDEA 2R3SA 3LECA 3KDSE 4KRYA 2V7QD 4LRSB 1CYDA 4LJ5A 4WNIA 3WNZA 1LSJA 1N2ZA 2JPDA 4Y2QA 3OPYI 4WQMA 2FDCA 4G09A 4JP1A 3CSUA 4CFYA 3IL2A 2YS6A 4QC2A 2H63A 3WQBA 3QE2A 5LA6B 3BWYA 4PSAA 4AULA 3LU1A 3SKVA 2JI7A 5IT4A 1BU5A 2PQMA 1HA3A 2J59A 5CYFA 2DLCX 4RY9A 4HVAA 5BR8B 4M9XA 4ASUD 5CTAA 1Z6PA 5LD2C 2RHDA 3H9GA 2B21A 3H9JA 3GNTA 5CX1B 3U3OA 3B1YA 3NBKA 4P5DA 1P4RA 3C1TA 2EHDA 1N32B 3K05A 1J25A 1O95A 3LNCA 3RG8A 3UHJA 4CLRA 2HK7A 3T1QA 3NTXA 4TZTA 3WGZA 3IUMA 5CLIA 4AM8A 4TS4A 5KNBD 1RXIA 1QHHB 3OP1A 2AFHE 3BILA 2FFAA 3KSMA 2NO5A 3EGXA 1XK7A 5FO0A 3BMOB 4L8FA 3OQMA 1ZK4A 2IELA 3IAS6 4BGIA 3K9BA 4EABA 1IY0A 1N2OA 1QE0A 1YCHA 2QN3A 3PC8A 1VA4A 2Z2XA 2QYOA 4R01A 2CXQA 1ZXBA 2VDQB 3IQFA 5CAEB 3AMVA 2HCRA 3X0DA 5AI8A 1LU9A 2PVSA 1XP5A 2R751 1Y8RB 3OPMA 2QL6A 3ESQA 1LPPA 2JLBA 1ZK2A 1JA1A 2ZTHA 1JQEA 5KQMA 2O7NA 4MR9A 1NR7A 1XNJA 4HWTA 4OYLA 1D4OA 1I2DA 4O4JB 4I9NA 1WW8A 2I1VB 1WY5A 3L77A 3I2GA 5T5QA 4ZICA 2BTQA 1UC4B 1XJ0A 4RMNA 2P7IA 2NAPA 3DBHB 4ZVQA 3OCWA 1SN7A 2ZP1A 2YIDA 5ALGA 3IELA 4M0CA 3WNDA 3PD1A 3SEAA 1MAAA 2QEQA 5JXIA 2G7MC 3NHJA 4HGZA 4QU8A 5HIMA 3UEOA 4F3CA 4H1UA 3DC7A 1G2PA 2V97A 3IKMB 4ZVPA 3W6NA 5IYZA 1U1EA 1VLVA 1YR1A 1FIUA 3D6TB 3NWJA 4ZO7A 4H17A 1L5QA 4MQFA 4V0SA 4DVGA 3CZAA 1VXOA 1YBAA 1HQKA 3R7NA 4KQCA 5HYVA 1IK4A 2L18A 4PLPA 2H2WA 1Y7HA 1JVBA 3W4IA 1V37A 4IY1A 1H3NA 1OX6A 4GEGA 1FLDA 4J91A 3SXUA 2GF2A 5L4NA 1UIMA 4INZA 2GAJA 4HXGA 4B35A 3U56A 5M3BA 3IUBA 16PKA 2P69A 3KL4A 1GUFA 1V7PC 3M8KA 3D5TA 1R8YA 4D80A 5B2EA 4IHAA 1UFRA 4LJRA 2B3DA 3NM4A 3WIEA 3MJTA 2WVAA 4HDNA 2OQ2A 3QBTA 5CAEA 1XEAA 1RKQA 1T10A 4DADA 3BBLA 4L5BA 4NBRA 3FDZA 5LNK6 3SKYA 4YCMA 1YB1A 4ZVRA 2VTDA 4UEKA 1XLTC 2ES4A 2AVNA 1NU8A 2EFHB 2OAGA 4GLBA 4HYTA 4PWZA 3TQTA 1H3FA 1Z06A 2OXRA 2ZJBA 4A8HA 3E3LA 4RJKA 5HTOA 1SA0B 3IR5A 4LN1A 2NO9A 3GH1A 1NT2A 4JLKA 3RTDA 1K7FB 3GGPA 1WWKA 2B2XA 1R6AA 2DFKB 1EQAA 1O0BA 2QDKA 3EGCA 1FJXA 3P9RA 1Q0QA 2B83A 3EFHA 1JB9A 5IASA 1SC4A 4FR5A 5AXAA 3WYFA 2VCYA 1LBQA 4J16C 3TTSA 3ZLUA 4EOGA 3GJXC 1YS9A 2ODQA 2NU7B 4JWTA 4YACA 4IX9A 5FR2A 2IWHA 3WP1B 1ZMXA 4M1ZA 3ZCPA 3NWEA 1BYIA 3ENWA 4RTMA 2JLZA 3KQVA 3QKUA 4HJXA 2ZJFA 3QNWA 2OY0A 2QP3A 4PZYA 4FNMA 2WLTA 3AR6A 4WKPA 1XZQA 1JJFA 3WZ2A 3E5RA 4E7OA 1OR8A 1ZGGA 1JIKA 1B0PA 1K1EA 4BMOB 2XMBA 3AVQA 1T1JA 4QL3A 2WKSA 3JQQA 1X7ZB 4BNMA 4DCGA 1WE2A 4MW0A 3O83A 1Q17A 1DI0A 1R15A 3K0EA 4C5BA 4UBIA 2REOA 2Y1EA 3DAYA 3FKQA 1KK3A 4DNQA 3GBSA 3OCCA 3O82A 1T0PA 3RC2A 1V8DA 5JRDS 5KU1A 2PUCA 3SJZA 1QTQA 1VIMA 3VNQA 3A05A 1C29B 4PYMA 2WJZB 5ALTA 5LMZA 4FDUA 1ADBA 4O8ZA 5C5CA 3N3AC 3C3CA 2PSEA 2XDQA 3MUEA 3W90A 2HF7A 3ONNA 1SD5A 3C5HA 1GZVA 2QMHA 4MYTA 4D3FA 2C1XA 4Y2SA 5AKGA 5KJEA 1XMVA 2BELA 3O92A 3REQA 3UOGA 4CT0A 4LF6B 1JG4A 1PTJC 1W2WB 2YN2A 3UA3A 2A5JA 5EZYA 1N6PA 5EYPA 2B4TO 1M6NA 2BBOA 4PFJA 3TCXB 3Q0EA 2R6ZA 2Y0PA 3CE6A 4I6GA 2PBZA 1U8EA 1OXUA 4AMUA 4PC1A 5AVVA 5JJCA 3FCCA 2C2KA 3H05A 5ABPA 2D4AA 4HGQA 1IHUA 2OZEA 2UVPB 2IL1A 2SKEA 3C39A 4EKNB 1QRTA 1ICEA 3GAAA 4H7FA 4Q5IA 5ALSA 4MOWA 3W7AA 1N78A 3A4TA 3UM9A 2RG1A 3ZI7A 4KXNA 2ODNA 2XOKD 4LTMA 3WGHA 3CW2A 3HC7A 5KS2A 1UBSB 5KO2A 4BLRA 4YJHA 5FJJA 1UBKS 5IWCA 1UPAA 2LNDA 5EI5A 1Q84A 3M34A 2IBTA 2DHRA 1CJTC 1OX4A 3DKIA 4AG3A 1J42A 3LQ4A 4OBWA 3VYSB 3LBNA 2KE5A 2R48A 4FU0A 4P98A 3U3RA 1T8YA 1SIOA 2R8EA 3GUYA 2QVLA 2HMWA 2BM8A 4WNYA 5DEOA 3SS9X 1EFRD 3OA2A 4XD7D 1XHEA 4GICA 3RVLA 5J58A 1GAJA 4M8KA 1PEKE 4O5AA 3QM1A 2VCEA 1WV0A 4C6HA 3AV3A 4W5OA 2QZSA 4D0GA 4O2BA 4EG3A 5AXCA 2PGNA 1X1TA 1HEUA 1LTQA 2GEVA 2XBMA 1I7DA 4KLCA 2B4KA 3R0VA 4HS4A 4P3PA 3UOAB 2QZ9A 2MTBA 3FOFC 4C0LA 1RQGA 4I19A 2BWJA 4IIFA 1U2RA 5CT4A 2PUGA 2WWFA 3KR2A 2G40A 2W2PA 3C3DA 4Y6QA 3HP1A 4Y2VA 1X3LA 4LJYA 5DTEA 3VHXA 3MTEA 3FBWA 2NW6A 3BDAA 3E9NA 1QIJA 4EA7A 4AY6A 2AW5A 4NRDA 1ZM3A 1Z0DA 4TRRA 3Q0TA 3QYAA 3MIZA 1NF3A 4CKWA 1TJ3A 2PL3A 4JDUA 4LXUA 3ISJA 1ID1A 4MUYA 4R1TA 4WY2A 1PX2A 1Q7EA 1TYCA 5CXSA 3E7FA 2N0SA 4MUIA 2ZYVX 3WGNA 4CEHA 2VHJA 2BCEA 2ANCA 1KRWA 4IGEA 3QVGB 3DF7A 1RC0A 2FDRA 4GW3A 4ISCA 4JLDA 5HE9A 1XMSA 2HSZA 2CMHA 3ZK7A 2P30A 5GY7A 1DJOA 3EFOB 3EH1A 5AHXA 5K4GA 4PO1A 4QGAA 4XLTA 5EHGA 1WBJB 3CONA 4UHEA 1C2YA 1R0CA 4FZ3A 5CYPA 1QGDA 4LMAA 2OFFA 3TLZA 5CBPA 1W93A 1WCIA 1XZFA 4FGZA 4MS1B 2EGHA 4MTLA 4HG2A 3W04A 3VZSA 1J9EA 2PL1A 3U7EB 1POXA 3NOXA 2JAQA 2EQ5A 1WXEA 1AKTA 2LDBA 4LJ7A 2QX4A 1BU8A 4DY6A 4HSEA 5KJ1A 1MQ8B 2CJPA 2XUJA 1XVLA 3ZYCA 4ZIRA 4HRVA 4B1FA 1G63A 4WJKB 1BFUA 3DO8A 4QM6A 3OQVA 1L5NA 1ZC3A 3BQMB 3N8NA 1CUGA 2R44A 2HU8A 2WJYA 1LQTA 2JANA 1P7PA 1L1QA 1JGTA 2UZ0A 1IE3A 2ZSEA 4RVGA 3QYPA 1F3OA 4YMVA 3KOOA 1RPZA 1IG3A 1ECBA 4I55F 3KT3A 1QIMA 3EGEA 4P3KA 5ENVA 5I7RA 5CVVA 5A7HA 5A0TA 2CJFA 1NQAO 3G5AA 3V5NA 4B34A 3UGTA 1H2FA 3C41J 3OZRA 1RADA 5F21A 2ZBGA 2QTHA 3P26A 1WM1A 2PH1A 3R9KA 2NU8B 3UC9A 1HRKA 4DMCA 1YZGA 1E1DA 2V6BA 3QVKA 4WT7A 1QOQB 2ILVA 2B0CA 1NVEA 3GLHE 2A3NA 3PDUA 4AX8A 4ZKDA 1BJRE 3UHPA 1PVVA 3GFSA 4A0SA 5HKBA 1JJ7A 3W3AD 5A9TA 1JMKC 2PX5A 4FB4A 1U1GA 4IPTA 4DM4A 5A4FS 1ZS9A 3AZQA 5F5LA 4AXBA 4EB0A 3DDZX 1FK8A 1SU7A 3O3CA 4KNWA 4URUR 4CL3A 3O8RA 1N0WA 4ND8A 3K9WA 1JEOA 1NI5A 1RTTA 2I0FA 2YZMA 3P0RA 1GUDA 1TO1E 3M1IA 3M5CA 1QVAA 4TWAA 2NUBA 4LRUA 4RWEA 4TSFA 2E1PA 2Q4DA 3K5WA 1OGJA 4N0QA 2I3ZA 2IY9A 1CZNA 4AYXA 4D0LB 2AMFA 4BP8A 3DV9A 3LLSA 2WMNB 3PPVA 1TUEA 4GKKB 5AK4A 5EUQB 1UQTA 1NXWA 1CQJB 3QBJA 4LYFA 4R16A 3WWYA 3GZ4A 1YA8A 4XYBA 5F7OA 2A0XA 4ZI7F 5BWOA 5DT9A 1PL8A 4YRCA 3O1LA 3SDBA 3VPAA 1PR0A 3B38A 3PNKA 3W4KA 4B47A 3FTEA 2BKXA 4CUKA 1L7BA 2ACKA 3THXB 1QYDA 1JDSA 5K3FB 1M54A 1Z6ZA 2GF9A 3HN2A 1S8AA 3Q9SA 3WLRA 4MS4A 3OMLA 1W59A 1QPGA 5LDDC 4F5WA 1RXSA 2LCFA 1CB7A 1WB5A 4KXMA 4BN0A 4ENSA 3QA3E 4KRXA 3EOBI 4KXQA 2OHVA 1JFVA 1ESMA 1UJ2A 4OP3A 2JIMA 4Y98A 3TQOA 2PPLA 1E6CA 4LRQA 1GG5A 3LSYA 4L85A 3KKOA 2CXOA 2ZATA 1D8AA 4XGNA 3NV9A 4JSYA 3PXBA 3JS5A 5GONB 1EM8A 2IJGX 4IJQA 4CF4A 5LZ4A 4MPPA 4Z9AA 1ZOPA 2GETA 3STYA 3KJIA 2JLSA 3N2EA 4DBLC 2X5XA 1PL7A 1CIPA 1P2VA 1PEAA 3OE1A 3F3SA 4MINA 4ESHA 1E64A 1EI9A 1FZTA 3BFPA 1TLLA 4FYXA 4UEJA 2X5OA 3OAAD 4RZSA 4P5EA 2A7XA 4ZDIA 3GR6A 3HVHA 3HA5A 3SFVA 2BJHA 3WLFA 5K3AA 2ZIVB 3IV7A 4A1OA 2XMPA 3M4JA 5CYOA 5JSQA 1FMJA 3KEFA 2ZT7A 4EK9A 1COWA 1QSGA 4LYHA 1E2KA 3D2CA 1HBJA 2XYQA 4N5NA 4OUDB 3UGKA 4GZ5A 2C2ZA 1YFJA 1BDMA 4PXSA 1KY2A 2DMRA 5GM2A 1TFUA 2P1ZA 3AFMA 2WTMA 3PL5A 1V45E 2VNSA 5I7AA 5K2MA 2ATEA 3RRJA 4ETWA 3R3JA 4ZEOA 4CF5A 5EESA 4HWSA 1NRXA 3AF4A 5JQGF 1VCOA 2F3RA 5CA1F 3EVFA 1CUDA 1PNRA 2LKDA 3B60A 4Q4DA 1ZD8A 1L4MA 4MWSA 4UZEA 2IIQA 1YS1X 5BV0A 2EZ4A 4G4IA 5JW6A 1W0JA 2HI0A 1ESCA 2E55A 3MJRA 3PUVA 1RIIA 3CX4A 4Q1EA 1FNSA 2FVYA 4WZAB 2ZWMA 1JJAA 4J94A 4BN4A 4AJKA 1Z35A 3C16C 5E4JA 1BJTA 1VG9B 4DN6A 3GT4A 2B7CA 2C88A 5F73A 3Q12A 4A0QA 1NJFA 2PGIA 4TLAA 1CS4C 1V41E 2V0GA 1L4BA 1SOVA 1U7XA 4L8WB 5IXJA 3HU3A 4QEZA 2HBQA 3DWGA 1BDJA 4UNQA 1ZFNA 1GCAA 2GBPA 2VG8A 4I9UA 2GPWA 3GLGB 4OBXA 4KXFB 3RU7A 3R3ZA 4RV4A 1LK7A 4OI4A 1XYYA 2YVKA 1D1TA 2EZUA 2WU0A 2DP4E 2P1DA 3AILA 2WMOB 1TJNA 3JQRA 4PNHA 4R5MA 4X1YA 3KVVA 2QZ4A 3P2KA 5AK0A 3A36A 5ADVA 2YH2A 3HN6A 4ZVVA 4DRXA 1N36B 4BWYA 5ALHA 3RV4A 3TECE 1H5QA 2B6HA 2YW9A 4KHPB 4B6GA 3PNBA 4RFLA 1C0LA 2C4WA 1QO7A 1H3EA 1I7PA 2GZMA 1DWOA 2WT8A 2XRFA 1V5IA 2OXEA 3FX2A 2O8BB 1PZXA 2IYZA 4QELA 4HN9A 5DX1A 3RVDA 3EK2A 2VSYA 1OAOA 4IUYA 4J3NA 3T35A 1LLFA 2HDNB 1D1QA 2VDWA 4BKMA 4LSZA 3VPBA 4YV0A 4AN1A 1A27A 2ANBA 3CSDA 5KZMB 3KEOA 3KTAA 1LW6E 4WL0A 1NVUQ 3TK1A 4E4RA 3SOPA 1EIZA 3EC2A 2OL4A 3FVWA 3I9MA 4MKIA 4QNRA 2J07A 4BCDA 2E5LB 3KAJA 1IQUA 2DBVO 2Q3HA 1PD1A 4JFAA 3ZPXA 5T6MA 1RHRA 4S0XA 2IYAA 3R5HA 4FFBB 1ORIA 2HA4A 3ZK9A 1WXIA 1UM9A 1WZNA 3VOBA 3DONA 4KIWA 4B40A 4WTOA 1T0BA 2ID7A 1O94D 1QZZA 4HFRA 4RM3A 3ZLBA 2R1TB 5AVRA 2X76A 2I7TA 4F9TA 2PYIA 3EULA 2IEAA 3O31A 2HF2A 1HDGO 1U65A 2RARA 2XMCA 3AF6A 4XJSA 1XRQA 4QOFA 3GN2A 3H0KA 3UMMA 1KJIA 2X0NA 2VF2A 4K9NA 3BZUA 2UYYA 3MINA 2HHHB 3N39C 5ALUA 3UJAA 3GQBA 4A15A 3IIJA 5G3YA 4C22A 3OKFA 4FMCB 2WIGA 4M89A 2IE0A 2Q9CA 5DWVA 5FPYA 1PFVA 1X1SA 3I9V1 5CLFA 4KZKA 3AF2A 5CFOA 3OTOB 1OBHA 3T7DA 1H0KA 1A4XA 2BZ1A 5IF9A 2J5BA 4IOKA 5JNVA 1OH6A 1WF6A 1PT5A 4IDDA 4I8DA 3F6SA 1FYVA 2QM3A 4N39A 3EVGA 1ZDMA 2WIJA 4BZXA 4EHDA 1EJ2A 2WTAA 1JA9A 4ZPJA 4RY2A 1K63A 2QG9A 3QTBA 2X19A 3JARA 3KKMA 2QRMA 4WY8A 3RVOA 2Q27A 1NX9A 1LDNA 2RONA 3W8FA 4CTJA 3D3QA 4P3YA 3WMRA 3A32A 4O4IB 4JYMA 2H54A 4KUHA 1QX3A 4Z2YA 3D8SA 4ZOAA 4UPEA 3VNAA 1Y3BE 3B6KA 3M6FA 2Q46A 2GBCA 5FI1B 1ADFA 3K0AB 4H7HA 3T3PB 1ATIA 3RHZA 3S8YA 1THGA 3GPDG 4ICIA 1GLVA 2RHWA 4FILA 4NPAA 2ZWPA