2D2VA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with maltose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords hypothetical protein slr0953
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
source organism Synechocystis sp.
total genus 94
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2d2vA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2d2vA02
2G1AA 3NALA 1F5SA 4C4RA 1L7PA 1LVHA 4NAVA 3ET4A 3WKBA 3UMBA 1VJRA 3ZTWA 2ODAA 3NANA 3AR2A 2BDEA 4YIKA 3SF0A 4L6CA 3HLTA 5AVRA 2HOQA 1ZRMA 4HAIA 3QU4A 1T9ZA 4MUMA 3ZX4A 2G80A 1Z4JA 3ZX5A 2IOFA 2YY6A 3OCVA 4I9GA 2GMWA 3SMVA 2FDRA 3QU2A 2R8EA 5AM1A 1L7NA 4AS2A 2JARA 3R4CA 2W11A 1YNSA 2HX1A 4KX5A 4MWOA 3U7HB 3KDPA 5ALWA 4XQ0A 3QU7A 1RMTA 4FYPA 4DCCA 5AW8A 3QLEA 1U2SA 3A3YA 3L1UA 3L5KA 2RAVA 3A1EA 3OCYA 2BY4A 4GIBA 3E8MA 2G06A 3WK6A 3L0BA 1QYIA 2MU1A 2P27A 5AI0A 5AVTA 3VAYA 5ALGA 3WKCA 2IOHA 5ALVA 3FPBA 3QUTA 5ALUA 4AS3A 1N9KA 2MSNA 4HGOA 2GO7A 3FGOA 5A3SA 3B8EA 2NO5A 3ZWDA 4BX3A 1LTQA 2YMPA 3DAOA 5ALFA 2NO4A 4FFDA 5AKGA 5AVSA 3WK9A 1WPGA 5AVVA 4CNQA 5FP0A 5ALLA 3KZXA 1AQ6A 4YCMA 2ZBDA 2FUCA 3WKDA 4Y2SA 4BNDB 3QU5A 3AR7A 2GHTA 3NRJA 4UM5A 1YJ5A 3WGUA 2WF7A 4HGRA 3W5DA 3ZW7A 5ALXA 4NWIA 5IT4A 5AKHA 1XP5A 3CZ4A 3L0CA 3ZWKA 5AK3A 4UATA 5ALQA 2P69A 2I33A 4OFZA 2WF9A 4ZEWA 2I34A 2YMMA 3L8HA 3QUCA 3PGLA 1JUDA 3SKYA 4F72A 2X4DA 1X42A 5AKKA 2R8YA 4UMFA 3OPXA 5ALDA 3F9RA 3U7FB 4HGPA 2B30A 3SLRA 5AW6A 5AKEA 5AVZA 1RKUA 3P96A 3W5CA 4Y2TA 3K1ZA 5AKLA 3FZQA 3OCZA 5AW9A 2RB5A 3SKXA 4Y2RA 2HEGA 1RDFA 3A1CA 5AICA 4BNDA 2RARA 5AW4A 5ALPA 5AIAA 4UAVA 3ZUPA 3U7GA 2ZBGA 3AR5A 3ZI4A 2OBBA 2GHQA 3AR9A 3U26A 4GXTA 4Y2YA 2ZBEA 4BX0A 2YJ5A 1Z4LA 3MC1A 4BKMA 2YJ4A 2B0CA 4E88A 4G63A 3NAMA 3OCXA 4H1WA 4Y3UA 2WF5A 4ZEVA 1WR8A 2DQSA 2QYHA 1RLOA 1O03A 3N28A 4UARA 4HGNA 3EF1A 5AW5A 5AM3A 1L8OA 1RKQA 1T5SA 2D2VA 3I28A 2ZBFA 3N5KA 1NF2A 1NRWA 2JAWA 3ZVLA 1U7OA 4QJBA 2HI0A 2R8XA 3ED5A 4UU1A 4CF5A 2HHLA 1ZD4A 3EWIA 1ZS9A 2WM8A 1CR6A 3QNMA 5AW3A 2YMQA 1TJ4A 2P11A 3A1DA 1XVIA 1QQ6A 2W4MA 3ZVNA 3NUQA 3W5AA 1L7OA 2IYEA 3UMCA 3E58A 4G9BA 1RRCA 5IS2A 3N07A 2B1QA 1WZCA 2YFYA 4OD0A 3I1YA 4C4SA 3IB6A 4EX7A 3W5BA 3MN1A 4KNVA 3M9LA 2FEAA 2RBKA 4XOUA 2AH5A 5AVWA 4DW8A 3CNHA 1Z5GA 2FPXA 3BA6A 3U13A 1YMQA 1RLTA 2Q5EA 4UW9A 5AI4A 3GYGA 3R9KA 3AR6A 2JAOA 2QLTA 3IJ5A 4BX2A 4EELA 1Q91A 1ZD3A 4OHFA 4IG4A 4KNWA 5AW1A 5AKYA 1QQ7A 5IT0A 3ZVMA 4KN8A 5ALHA 5AM4A 3NASA 3WK7A 2P9JA 4BYGA 2ZG6A 5ALTA 5AW7A 3WKEA 5A3QA 2R8ZA 1T5TA 5ALJA 4L6AA 3RFUA 3DDHA 1RMYA 2C4NA 3WK5A 2G08A 5JJBA 2BDUA 4HGQA 1TA0A 3L8GA 1ZRNA 4PNHA 5AI9A 4CF4A 3NIWA 5AVQA 4Y2JA 4QQFA 5AIBA 2B1RA 2ZOSA 3WK8A 3I6BA 3E84A 3WGVA 3ZU6A 2I55A 4DWOA 2FI1A 2Q4TA 1XPJA 1RKVA 3AR4A 2FUEA 3PGVA 1SWVA 3OCUA 2C8KA 1VFPA 4UMVA 1YV9A 4RESA 1TJ3A 5ALYA 3TLMA 5AK5A 1NNLA 1U7PA 3L8EA 4IFTA 4KX3A 4JB3A 2I7DA 3FM9A 4YCLA 5T41A 1Z4PX 2OM6A 2FPRA 4CF3A 3QXGA 1Z4OA 2PKEA 2VKQA 5ALOA 4YGYA 1ZD5A 3OCWA 3N8GA 2B82A 5AVYA 1FEZA 4YH1A 3M1YA 3B9BA 3UMGA 5E0OA 1SWWA 2C88A 1Q92A 4BBJA 1Z4IA 3KC2A 4EEKA 4NV0A 1RC8A 2YJ6A 4BEWA 1S2OA 4Y2XA 5AKIA 1VJ5A 2CN1A 4I9FA 4RETA 5AM5A 2AGVA 4L57A 4F71A 3S6JA 2O9JA 4EX6A 4J03A 2WF8A 1MH9A 5ALZA 4Y2VA 2CFRA 2C9MA 4EENA 4XPZA 3E81A 2PR7A 1U2TA 2HF7A 3PDWA 2G09A 4HYTA 4UM7A 3OTQA 3U19A 4UU0A 4UASA 3ESQA 2NYVA 1WVIA 4DFDA 3QX7A 1Y8AA 1Z88A 5AK4A 3ESRA 1IWOA 3SD7A 1CQZA 2WHEA 2W43A 2YJ3A 3ZTYA 5AM2A 5AW0A 1RLMA 5AHXA 4BEVA 1EK2A 4O8CA 3RF6A 1QH9A 1K1EA 1O08A 2EAUA 3D6JA 1YDFA 5ALRA 2YN4A 5AI8A 3B9RA 4EZEA 1N8NA 4YCNA 1S8OA 3AR3A 1J97A 2WF6A 2GFHA 1TE2A 4UMEA 4JDPA 3N1UA 5ALMA 1RQNA 5AKZA 1SU4A 2B8EA 5AI6A 1RQLA 4ZEXA 3WK4A 3FPSA 5AK6A 3QUBA 3MMZA 1QQ5A 1YS9A 2OA0A 3QYPA 1KYTA 2HF2A 5AKJA 3HYCA 5A3RA 5AESA 1J8DA 2G07A 3DV9A 4UMDA 1L8LA 1Z4KA 3ONNA 5ALSA 4B6JA 1Z5UA 2AMYA 2HDOA 2JGAA 4Y2UA 3R09A 3EF0A 2FPWA 4C4TA 2HO4A 3KOOA 2FPUA 2JAUA 3QUQA 2YBDA 4XE5A 5AI5A 3PCTA 1Z4QA 2Q4RA 1L7MA 2PQ0A 3KD3A 3I76A 3FVVA 3J7TA 4AP9A 1RPZA 1ZOLA 1Z4MA 1ZD2P 4Y2PA 3DNPA 5ALKA 4CE6A 1PW5A 2EATA 3KBBA 4UAUA 3UM9A 4NFLA 2EARA 4YIHA 2HCFA 3QGMA 4J2TA 3L1VA 2CFTA 2HSZA 3ET5A 5ALEA 3L8FA 3WKAA 5AVXA 3AR8A 3IRUA 3L7YA 2C8LA 4Y2QA 4NABA 2O2XA 1L6RA 1U02A 5ALIA 3QU9A 2IOFK 5AW2A 2I54A 2G0AA 2I6XA 4OCZA 1EK1A 1Z4NA 3EPRA 5AVUA 2IA5A 3SHQA 5AM0A 2B8JA 1ZJJA 2CFSA 3U7EB 2OYCA 1TJ5A 3L0YA 5ALNA 1RMQA 5AKXA 2FPSA 4KYTA 2ZXEA 2WFAA 2YMLA 2AUTA 4FE3A 3MPOA 3BWVA
chains in the Genus database with same CATH superfamily
4X9XA 3JQPA 1DXQA 4JA2A 1MIOA 1P9OA 1SHTX 1GCGA 1ZKMA 1L7PA 3WGLA 1LVHA 4OGGA 5EOVA 4RVNA 1DOAA 3WZMA 1WUIS 2Z58A 4IRUB 5JG7A 5ED4A 3PJGA 4Q1AA 4BKOA 2Q5IA 4TWRA 2BDEA 1F9EA 3SF0A 3Q2IA 4YBRA 1W6RA 1J1IA 5FL7D 1V35A 1ZRMA 3NHUA 3QU4A 4BE9A 5EJ8A 2C0QA 5L9AA 3FTCA 2H2DA 3BH0A 4AIRA 4O1MA 3PHLA 2B5VA 2IE8A 3N59A 3D5QA 1NV9A 4TLDA 3C45A 3FNBA 2V59A 4G8JA 1JHOA 3MMXA 4HGZA 2ZRIA 3WNDA 3K9FC 3RAEC 2A4KA 2FDRA 3A6GA 4PGAA 1QO7A 2MHCA 2IU3A 5TF4A 3QI7A 4E5VA 4L85A 4BMOB 1W52X 2XGMA 2G77B 4L0DA 5KQGA 3HOWB 1CQIB 4RGVA 1L7AA 3KLPX 4OHKA 1USVA 3U7HB 3HVKA 5BOVA 5SV2A 1DAHA 4EDFA 1AN0A 2I66A 5KQSA 2Z1MA 4UPDA 2BI7A 1OLSB 3K70B 1E1QA 4DQXA 1HQYE 2AC4A 1W47A 2WVAA 2YXLA 3TKLA 1A9PA 2Y8EA 2BY4A 4F2HA 1RU3A 3PGXA 4GIBA 2XECA 3LTNC 1JSXA 3WK6A 3VR5D 3RNOA 1I0LA 5F3DA 3KSBC 5HIMA 1PQ4A 2GO1A 1OZ0A 1SHKA 4MW6A 4NLLA 5KSYA 4FFWA 4FTWA 1X1SA 5B7QA 1FOEB 1KJ8A 4GX2A 3DBVO 1XSEA 1IN7A 2XWPA 4LDQA 5CHYA 3O4HA 4Z4CA 2NVTB 1NY6A 4F9EA 4I08A 2PH1A 1F38A 3E27A 4NKRA 4G1EB 2ZVQX 2XUAA 1S2DA 3WGMA 4KQHA 1YB4A 4B81A 3GTGB 3ANNA 1XRQA 4C03A 2PSHA 3FCCA 1XVTA 4RSHA 1AB5A 2O3RA 2O7VA 4Z4HA 3QYAA 2R97A 2XBUA 3R8CA 2XVZA 1X80A 1RLJA 2HNKA 2PR2A 5AVVA 3F7OA 3OWOA 2Y0BA 3P9KA 1IBMB 2FUCA 3FKJA 3BXZA 3DDSA 3GQVA 3W3AD 1G0NA 1NY5A 2J0UA 2JEZA 2R6AA 2XSZD 3KUDA 4UDOA 4YP7A 5FUYA 1HQDA 1EXNA 1TA4A 1W9HA 2V7XA 1I3OA 1Y8RA 2P7IA 3MJRA 3AJRA 4OFXA 5AXCA 3S1SA 3KU4A 4NVRA 3EASA 3BJIC 4RS4A 5M2QA 2P7HA 2HJVA 4F21A 5IT4A 3GTPB 4ADSG 3HI4A 5BSHA 4JBIA 4M88A 2Y2UA 2PSDA 2LIPA 4O2AF 2X2PA 1E61A 2FSPA 3ILSA 4L5AA 2YINC 1WD7A 2GLTA 3GDFA 1H9CA 3DEFA 4DEYA 5IDQA 2ZU6A 4PYMA 1JDBB 3TL2A 4GWGA 1O5IA 1W5AA 2AZTA 3V1UA 2PUGA 4INOA 4JV5B 3G7UA 3JPYA 3FAKA 4D02A 3WWEA 3PC3A 2QN2A 1IG0A 1D2AA 1JHVA 2CNWA 3KSDO 1WEKA 1L8XA 3WB1A 3ZNNA 4XVCA 5LXTA 3FETA 3U0VA 4O2BF 2G1PA 4Q7JB 4RK7A 3NBXX 4LWOA 5I7RA 1T1IA 5FKJA 1BXKA 1L3CA 3BGSA 4HX5A 1E8NA 4BNHA 2NO1A 3UXYA 1SQ6A 5AKEA 3C5VA 4EAAA 4DV4B 4FJ0A 3Q3JB 1M5UA 1E1MA 1L8AA 5C5EA 1DTWA 1YNOA 2QRVB 3PC2A 4YREA 3CTMA 3HU3A 5EJ2A 4RH1A 3K0KA 3RUHA 5KNDH 3I9OA 4DR1B 3LUJA 2Q1UA 4AZTA 5FUVA 2ISSD 4DABA 3PP8A 1JR3E 2I99A 4MQBA 3BMOA 2NSLA 3IAAA 1MOSA 1ONSA 1UIRA 4S1WA 5JU6A 5G0WA 2XGSA 3RWMB 1DX6A 3RSOA 4E5PA 1O77A 2Y4OA 2OTCA 4M6WA 4DNXA 3GI1A 4IJQA 1LA2A 4L75A 4B3TB 2O8DB 1T4BA 5HGJA 4NU6A 4PYNA 2RAUA 4RJLA 3TAXA 4DSTA 3AFOA 2OV4A 3AILA 5F76A 2BFAA 3N8IA 3WL4A 5AT1A 5K6AC 1DDIA 5F9HA 1XDWA 4J4BA 3PLNA 3L6BA 5FUBA 3MCZA 5SICE 1Q0HA 3R3JA 1KBOA 1UBHS 3EEYA 2C7VA 2H2AA 2O48X 1EFVB 2O4CA 4PBTA 4OA8A 2DC1A 1I2AA 5DU2A 2R65A 2YJ4A 3I9FA 4R1NA 5B1HA 5LYJB 1GZ7A 3RVBA 3F8WA 3SHTA 4MKGA 2P2LA 2SKEA 1WJGA 1RTKA 1ZNZA 3BBPA 3G1WA 5BN4A 4QOJA 1XJ0A 4MWCA 3BD7A 5AW5A 3EH2A 5TIIA 1NBIA 3QPAA 2DHEA 3EUFA 3HSYA 2YX1A 1BW9A 3GQBB 4JCCA 4AXBA 3AP1A 2C3OA 3JASB 3B51X 4JGIA 3CPEA 4P7BA 4B75A 2EX1A 2HM7A 2C83A 1OIVA 1PJ2A 3KFVA 3P0RA 5HQ3B 1E63A 2KS6A 4CU5A 5JQGB 1ZJYA 2Z2IA 4A10A 3BERA 4Z7NB 1SK9A 2X6TA 4HMQA 3UMCA 5EIBD 4YTEA 1NMYA 3H2KA 5BV0A 5J4VA 4TMZA 4B6EA 3RU3A 3ND9A 1U8AA 2P91A 9LDTA 3A9UA 3FLAA 4RY0A 4O8ZA 4GLJA 1RHKA 4I50A 4A0HA 4F7DA 4D25A 3SOPA 2LUOA 1IQUA 1SJ9A 3NVAA 3K73O 2C31A 1DAGA 1GAWA 3AOEC 4EITA 2GXSA 3O75A 2GGSA 1GVHA 2CB0A 4UHCA 3CW2A 1N2SA 5TQ2B 1ORDA 5AI4A 2VRCA 1YACA 4P6VF 4XFKA 3R8FA 4NZPA 3IE2A 1P4GA 2O52A 1OBHA 4PYIA 4EELA 4NULA 3BCSA 3GGOA 2JPDA 1Q91A 3WNQA 1JFFB 2M9MA 3NB0A 4JI1B 1QHHB 2AI2A 4IDFA 3TR5A 3WZLA 1RQ2A 4C4YA 3ER9A 2H9IA 5KTMA 2W6CX 1W29A 1KMNA 1TM1E 3PIRA 4OSEA 3ZV3A 4EHBA 1B6RA 5EE0A 4M0LA 1LVUA 4MW0A 2QZ4A 2XYVA 1EG2A 3QPVA 1CJBA 4DCOA 2VBFA 2DPGA 3NQ41 4GVPA 2AMLA 1CB7A 1V41E 2VK2A 4L9RA 4BYGA 2P1RA 1WOYA 4CKCA 2JCBA 2AS0A 4FCTA 4EO9A 4QD3A 4RVHA 2ILVA 3WTCA 1TT5A 5CEFA 2JIDA 3ESBA 3LM8A 3K3PA 4EG8A 4RNCA 4H15A 4CG1A 1N2CE 2BJHA 2D1YA 2FP4B 4LJAA 1RZRA 3L8GA 5LA6F 1ZJ4A 1KWGA 1X8LA 2D5IA 2RH8A 3OTHA 2O2IA 3EVDA 5IVKA 2RBEA 3A27A 4D5GA 4B0PA 1M1NB 4MR8A 1YQUA 2JLBA 4AZ3B 4Q9HA 4RSGA 1XXHB 4JQCA 2FFRA 1SXJA 5H70A 4M8NE 2OD7A 3WIUA 2V58A 1ILEA 3JQQA 1J0BA 2Z6QA 3DL4A 3VKGA 1ZY2A 3SJZA 5EE3A 3GRYA 1GGHA 4IJWA 5AVJA 1G3MA 1H0HA 3RUFA 3K92A 3L7NA 3L8CA 1CR4A 1OU0A 2QU7A 1ATZA 1SM4A 3TQIA 1L5RA 4N3NA 1IN8A 1W581 4HV4A 4MYSA 5A03A 3SEZA 2ETXA 1NQAO 1Y6ZA 2X8JA 1S0UA 2DLDA 3QE2A 1EA5A 1XTUA 2H00A 4O5AA 4C0AC 1TU4A 1CB0A 1DFIA 4U00A 4B5KA 2J3JA 1QX4A 3DYVA 3KKLA 4QBIA 3CMCO 3JW8A 4KH1A 3LWNA 5A0VA 3NI2A 2OHOA 2QTWB 3QJYA 3A6EA 3H9EO 4NU8X 4P5EA 4PZDA 2Y66A 4E1BA 4I81A 1WTAA 4EQZA 4QYTA 1EQ2A 4AUEA 4EH1A 4FZJA 1QHXA 5FTNA 1JLLA 1NHWA 3D4NA 1G0OA 3L7JA 1ADFA 3P9NA 5LQNA 2GEVA 1P1CA 4IIGA 4F91B 5KX5A 5DZSA 5CIQA 4B2LA 4KAJA 4E09A 4C7MA 3GAAA 2PTGA 5ITZA 1PR2A 1RC1A 3GGGA 3VRHA 3D43A 3VAAA 3IHKA 5IZCC 1QYCA 5I7UA 2RGAA 4RVUA 2I9KA 3ZWAA 4CIDA 4EW1A 1O54A 3MBOA 2CGEA 3B9BA 1SWWA 3D1JA 3IV6A 1NBMD 1AX9A 5EINA 1YI8A 3P45A 5CBPA 1JT2A 1C0IA 2A1TR 1Q0QA 3EIQA 3T5GA 3CZRA 2ZSBA 4UFNA 4G89A 2GPJA 2I29A 1S2OA 1XD9A 1LB1B 2G67A 2JCGA 3AG6A 3F3YA 4L5BA 5EJFA 4HDMB 3V1LA 3ZHZA 4C21A 4I9FA 1FVHA 2DYKA 2G72A 4NOJA 3VYUB 1JGTA 4RW0A 4QATA 1Z34A 4D82A 1RYHA 5A4KA 5BPHA 1LQ2A 2O9JA 2RCYA 4BJ1A 2Z09A 3WFZA 1M6EX 2CLSA 2OHFA 2AT1A 1CJKC 3C3EA 3OM0A 3PRKE 5LQJA 3G5AA 4CEHB 4TPKA 3OKFA 1J0DA 1A72A 4R40A 3RS3A 4AC9A 4C7KA 5CG2A 4G65A 3VZPA 2EWVA 2J59A 3GHYA 4PIVA 3WGGA 4BLOA 1VB5A 2LCQA 3DR5A 5K3DA 3REOA 3V1YA 5C51B 3IQWA 3UT0A 3FVTA 4OOFA 1XHLA 3FGZA 5CLLA 1LSOA 4UFPA 1M6VA 4NCJA 2GCNA 2IS1A 3HJNA 4ETIA 2CJWB 4ZQFA 4UQLA 1T6ZA 4EUFA 3OLCX 1YRHA 3HJRA 3I32A 5B6IA 1G19A 1Z88A 2VSYA 4FFLA 2BM1A 5HE9A 1JKJA 3DAYA 3UXEA 4B1FA 4EYQA 1WUKS 3FXAA 3D4BA 3GFFA 4V0OA 4GQBA 4MUNA 5SY9A 5CFLA 1FQKA 4MV6A 2NSHA 2PEYA 1FMCA 1ODFA 1FMFA 4GU5A 3UJ9A 1BO6A 1SCQA 5JD3A 4CQJA 7ADHA 3K8ZA 1GUBA 1K1EA 4C3JB 3HMQA 4JEHA 4QTTB 5K8CA 1C1XA 1P7CA 2VQSA 4OJNA 5F1PA 2E37A 2XCSB 4Z0PA 3M3YB 4B40A 3VNUA 4MIOA 4A2QA 3MVEA 3S44A 4BB9A 4YCNA 4KU4A 1W9MA 3DTVA 3EMKA 3B1WA 3QHPA 1CP2A 5EKTA 3GRRA 4X64B 1BS2A 2OO7A 3KJXA 2VXOA 2VF8A 4GP7A 4EDHA 1RQLA 3UXHA 1T6XA 1TK3A 2Z5VA 1FTYA 1PT9A 3CH6A 3EQ9A 4FBGA 4MRMB 4TGLA 4ZO4A 1L5HA 3U4HA 1JHYA 3NTVA 2J9YB 1UBGA 2ACWA 4UDNA 1D2HA 2XQJA 4I5EA 2GEKA 2EDCA 1SURA 2FK8A 1UBLS 2R6R1 3NWBA 2WY2D 1FBNA 4PG5A 2TRSB 5A5GA 3BWEA 2D1SA 3QH4A 1O6ZA 1X7HA 1PT6A 4BX8A 1C4WA 4KPFC 3VPDA 1ID1A 1Z4KA 2NIPA 2QMUA 4M1EA 4OXXA 3IUNA 4PICA 4I6EA 2IHKA 1XNJA 4R8VA 3HLYA 2RFLA 4O0MA 1O0SA 3WWDA 4C20A 1JR2A 1TZMA 1GAQA 1BWQA 1L7VC 1WXGA 2WTAA 4C4TA 5E9QA 4TWIA 1O9BA 2AB0A 1MO5A 1EJBA 2F43B 2OAP1 1DG3A 3VNQA 1EXVA 1S9DA 5EKUA 3ELYA 2NADA 4AJ4A 1YWGO 4D4GA 2FZKA 1NVDA 3RTBA 3JVIA 3PTZA 3T9EA 4FOLA 1FDIA 4YMIA 4R16A 2WUEA 4AZVA 4QEKA 2QTZA 2KW5A 4IZHA 5DHRA 4JT9A 3HNPA 1FVOA 3SX4A 4GZ5A 2E4UA 2OL4A 3AM5A 3H99A 1GQSA 1P8AA 1QCYA 2IXGA 2ZAGA 4K81B 1CJVC 1TZCA 2EATA 3GMIA 3PNVA 2QPTA 2WHYA 3OU2A 3PRJA 2PXAA 4JGGA 1JU9A 4QXPA 4HY3A 4W9NC 4BJHB 1E2EA 3GCXA 5JWOA 4RF2A 1H66A 1V11A 2JA6B 2A92A 1CQJA 3ROXA 4DNPA 1T4CB 4EA7A 4HQ6A 1VPDA 4UNQA 2W2PA 4ZT5A 4BV3A 3ET5A 2WU4A 1DEOA 2LXNA 1X7YB 5BV8A 3L8FA 4G07A 2ZJ5A 4UZSA 3GVIA 3SS8A 1GZHB 3DEJA 3W06A 4KO2S 2BHLA 3PHHA 3QHQA 3BX1A 3EUAA 4EJ2A 4W1SA 1U02A 5ALIA 1U8YA 2ET6A 3RBZA 1A7UA 3T8YA 1XZFA 1FNNA 3R3XA 3VHXB 5JPDA 4G9EA 1F2TA 1NNUA 5B30A 1KU6A 3U3ZA 2MR5A 4HF7A 1QK4A 4KCGA 2RDMA 2RBGA 5H9VA 2Z5FA 1YI0A 3SZRA 3D6HA 3TL3A 1PK9A 5AVUA 2ZPUA 4M0CA 4BNGA 1ZJJA 4I1VA 4DLNA 5AH0A 2YNMC 3NR2A 4YRPA 3VVMA 3L0YA 3VNBA 4DSNA 4EUKA 1MJHA 4EUNA 2G4VA 3OQOA 3OT4A 1YZNA 3DZ8A 3ICQB 1XCPA 3L8ZA 4GECA 1WCV1 4GC9A 4JJ7A 2ZYRA 4P3NA 4FE3A 3CUEF 3NETA 4O2RA 4UNIA 3TF5A 3QMMA 3HPQA 3UT5A 4AT1A 4O33A 1GOTA 4KO3S 4MGKR 1GJRA 3VR0A 4B31A 3RABA 1K08A 3N8DA 2PRIA 2BUBA 2ZB3A 3UMRA 5FEMA 4OX9Y 2ODAA 2JK0A 4GLLA 5FWYB 2A58A 3FFWA 4JYAB 3LU1A 3L1HA 4PS0A 5K3BA 2WG2A 3HLTA 1XD2B 3A32A 3WLSA 1VKZA 4LGVA 3HOVB 1NQWA 1RI5A 3D02A 1IXSB 3SQDA 3OFVA 3A9WA 2GCOA 4I9GA 1KI3A 5JASA 3NHFA 2A9FA 3CBQA 4A8HA 2C2WA 2O1EA 4GG1A 4BX9A 4G01B 3GTOB 2V0CA 2R8EA 1JKXA 4A3EB 3B1XA 3W05A 3GEMA 1L7XA 4TYPA 3H4TA 1NFFA 3A6DA 4Z9FA 2G1UA 2VJNA 3VNVA 1QYXA 1U6JA 3IEIA 3V4LA 4YCDA 3DP7A 2G9QA 4UTZA 2QX8A 3PXCX 4FHFA 4BP9A 1GZUA 1Z16A 3QMWA 1NWCA 1YL5A 4YP6A 3E35A 1CUFA 1GVNB 2JKVA 2VPQA 3I8OA 4L50A 5D01A 5GONF 3SAJA 4PYJA 1XAGA 4RDIA 5IG2A 2YOFA 4ZMSA 4AG6A 3IQEA 4OQEA 4AJKA 3JWIA 1U8FO 1M2GA 3A3YA 4H31A 4G6ZA 4H7KA 3FI0A 1K8RA 1DJNA 4RPHA 3C48A 5JPIA 3WBJA 4XDYA 2R6CA 2KHZA 2XB9A 5JCZA 4BLUA 1NT2A 2E1PA 1HT0A 4I55F 4ZAXA 3BMNA 4EO4A 1LSUA 3VDNB 4L3WA 2EYQA 4MV3A 4ZCQA 3TOZA 2FEMA 2JLQA 5ULLA 3RVOA 1Y7LA 1D2CA 3WIOA 4GW3A 4HAXA 4MQUA 5DXAA 4DWWA 1W1IA 4L08A 1V5GA 4P53A 3G88A 4R2WA 4AX8A 1YU6A 4II3A 4WNAB 3TD9A 3F97A 1VLJA 2ZS9A 3TEMA 1DOHA 2C00A 2FW8A 2UZ0A 2VA9A 4AQDA 5A3SA 4CW7A 2NO5A 4TTJA 1M2EA 3UAXA 5K3FB 4CVNA 2FK7A 2YVLA 3LPMA 4P3YA 3W9UA 1H4TA 2W42A 2B1IA 4TS4A 3LWZA 1Z39A 4TMFA 3M7IA 5JSHA 5I3CA 4IF6A 3TI9A 1RKBA 1UOOA 4UUAA 1KBQA 3A6HA 4KMMA 5H9WA 2VHEA 1FFAA 1RWWA 1B43A 3Q6IA 3HE3A 4GX0A 3F3KA 3I2FA 4URZR 2W2KB 3KSMA 4P4GA 1JW9B 2GBLC 2R3SA 2GX6A 4P2BA 3S28A 5CG1A 1Z12A 5C7IO 4HUQB 4TLLB 4KPGA 4EG3A 1AVTA 4A0GA 2V6MA 3B70A 3ESCA 3QNUA 4G5GA 4KR0A 3FPAA 5EWMB 1QDUA 4MRRA 5F4ZA 3TB4A 2LIVA 3OEYA 4DA7A 1VHQA 4OP3A 4YRLA 5T67A 3E9CA 3RFVA 3RHZA 4CL8A 5MDHA 5LD2C 4NWIA 1R4MB 4EL5A 1QIIA 5CDFE 4M98A 3GLFB 1Q7TA 4OXQA 5CCDA 1FX0A 2VBCA 4F4IA 5TDHA 1JHRA 1KOJA 5JDCA 1LY1A 1PBTA 4N7RA 2I33A 3FCEA 2NZWA 1WB5A 3NM6B 3LDFA 2GBCA 3OQVA 4KVFA 4MQ6A 2VP4A 1XEWX 4YDQA 3JU3A 2QTBA 3IE0A 4QPPA 2R00A 4LYJA 5B64A 3RHFA 3HO1A 4E30A 1RBQA 1Q95A 2J85A 3TUJC 4AVYA 4BRWA 5C1BA 1ESNA 2IYFA 3A11A 1V7PC 3AF4A 3B9PA 2A8YA 1C3OB 4PFSA 3VJRA 4YK7A 3SLRA 3WQSB 3PQ7A 4YR7A 4K0KB 3DJYA 4UUMA 3C8UA 4EL0A 2WEKA 2XYGA 1WV0A 4A2PA 5AKLA 3NHRA 2Y68A 4M4SA 4OI1A 2FPPA 1LI7A 2FF5A 2RB5A 2ZUBA 1RM0A 1O8CA 2X0KA 1M1UA 1RDFA 2CD7A 1A9OA 5ES4B 3Q72A 2GXUA 1BMQA 1L4FA 2QTMA 2XMDA 3UCXA 3OU7A 3A1WA 3FD8A 2DWCA 3BE6A 4WXMA 5JS2A 2XE6A 3W4JA 2Q62A 1I32A 1IK4A 3UUWA 1JQJC 2OC9A 4UM8B 1R5BA 1RM4A 3TLCA 2GHQA 1P0PA 1XDZA 2XCUA 3PGKA 1VXOA 4NJMB 2XCTB 3GTJB 1KEKA 1B74A 4A6DA 4P7KA 4AXXA 5JRZA 3ICPA 4DREA 1D2MA 3MOSA 1RFLA 3CO5A 2VHWA 2RGYA 2JLRA 3DCJA 3GJXC 3RIXA 2WP8J 1P17A 5EQJB 1UPXA 3P32A 4HSGA 2VT3A 4TV9A 1PTJC 1K86A 2AFIE 2GEBA 2ECKA 2X9GA 3OZCA 3K0CC 3T7KA 3WYAA 2WF5A 4BCDA 3KZ1E 4HZUA 1E4EA 4WESA 6AT1A 1KI6A 4UARA 3B20A 4DGQA 3TPCA 3NVMB 1JU4A 4IKOA 1KSGA 1VYVA 3BORA 4HJRA 1GTL1 1LI5A 2NSDA 4CRWB 2Q5HA 1W8DA 2CYBA 2FEKA 3CH7A 1PIWA 3EWIA 1X15A 1XNGA 1LNQA 3Q5EA 3CNBA 4WOKA 3LY5A 5TARA 4KAXA 1U0BB 5KPJA 5AW3A 4RKFA 3FUWA 4FOSA 3O8OB 4ZVLA 3TVDA 2W4MA 2HLNA 1XMOB 4E21A 3M33A 1PP4A 1XALA 3D59A 3PDHA 3T7TA 4QASA 4FR5A 4HRVA 2O0MA 1EFDN 1TF2A 3I9NA 2C5EA 3PD7A 1SKMA 1WZCA 1WAMA 4BZQA 1UKCA 2P9YA 2YNMD 4B17A 1SVNA 4HB2A 5JSUA 2ODWA 1GGMA 4IVQA 1MC5A 4WKCA 5BWLA 2Q46A 3K9WA 4D0SA 1BXGA 1DEXA 2JK1A 3DCYA 3OPVA 4W5JA 4L22A 4RIFA 5K0LA 1CKEA 1U8TA 5F2OA 4ZGBA 1U3UA 3ZCSA 4F2GA 4IH1A 3E5MA 2P2DA 2FFHA 3BYZA 2CYAA 4JLAA 2PU5A 3UANA 3VYWA 1QH1B 2RHCA 3TD6A 2WAMA 1KBZA 4Y1FA 4OHBA 4KQEA 2D5AA 2ZR8A 2IUYA 3IEVA 2WSYB 5DX8A 2Q3HA 3LLSA 3W7BA 4GBGA 4S3MA 1JDVA 2XRZA 2HA6A 5AOBA 5FFMA 2PLNA 2LPMA 3AEKB 3JWJA 3S5UA 5PNTA 4KTTE 2OHHA 4L0MA 4PLZA 2C77A 3CFYA 5BUQA 4G0WA 2BMFA 2P2SA 2QRJA 3G23A 2VC2B 3BRQA 3OU6A 4Z53A 4NXNB 5DN6A 5A3QA 1QAMA 3B7PA 2ZRMA 3HBMA 3L8DA 4DCJA 1RM3A 3PJRA 3AB7A 2VP0A 4HQRA 5EG5A 1MTOA 3F8SA 3PT5A 4X3PA 2PTHA 3REQB 3WC4A 1OJ7A 3L4BC 1M1YB 2IYQA 1BIFA 1R8YA 1WP4A 4A6EA 5KNDA 1TA0A 5K8IA 1SXHA 3A0UA 2JEOA 2WIBA 2B2NA 3IDZA 3LRXA 3Q10A 4WY2A 2LNDA 3ZU5A 1VGRA 2FR8C 1Z38A 3JWHA 4RIIA 4V02A 3WQRA 4X00A 4F84A 2B3TA 1R9MA 1GO2A 4LYEA 4FDLA 4M55A 3ZG6A 4MRAA 4IBOA 5SYMA 3RYCB 3M82A 1EGMB 4BQRA 1FTNA 2QV7A 4ZOLF 2C4MA 1BDBA 5KC8A 1RBZA 4KG7A 2V7GA 1I4TD 5K8TA 1EM8B 3H19A 3JYPA 2NZ2A 3E7XA 4LSWA 5FI0B 4S1VA 2BT4A 4LSGA 3TM5A 1XCLA 2LCIA 1ZOSA 4NESA 4W5HA 5B57C 2P67A 4UDXX 2AF3C 1KIMA 3GCGA 4KWTA 1RNLA 3OP1A 1H3FA 1VECA 3EVBA 1PO7A 1Y1RA 5REQB 3K2QA 2PVPA 3S99A 3WAJA 4XQCA 5GY7A 1T13A 1L5LA 4KYUA 5ADUS 1NFQA 2QGNA 1K97A 1KP2A 2RHLA 4Y9UA 1RE0A 1N6IA 2OFOA 2WJIA 2OFXA 4KIUA 4RA9A 4R1MA 4YUAA 2G40A 3QVKA 1AQUA 3PXBA 1EM6A 2EJWA 2V4UA 5GQSA 2QHXA 3DGFC 4LY3A 4DPLA 4M9XA 4UVEA 4CDMA 4FX5A 4YMTA 3F3MA 4LZAA 4WOCA 3C16C 3ZZNA 4HQKA 3IE1A 1HQCA 1A9XA 5FLEX 4FOPA 5HZKA 1ZNYA 3W79A 2VDPB 1ECBA 1KNQA 4FXPA 4D0LB 4BWYA 5ADVA 4PFQA 5A0TA 1FF9A 2G5PA 3D5TA 1DAOA 3BXPA 5CT6A 4JHXA 3OJOA 3ZXUB 1P29A 3GRUA 2H1RA 1G5IA 3EZGA 2GYUA 1TLLA 3BJRA 2ONZA 1DB3A 1Y9DA 1S8NA 2JEYA 1JHUA 2E5WA 5ICCA 5CW1A 5E3JA 2JA8B 1Z8HA 3KWLA 1W4LA 2FGJA 1OD6A 5ENZA 3X1MA 1T34A 3ONFA 1ODKA 1T0UA 4DDUA 3LA6A 2AOWA 3C5WP 4JT4A 3V32A 2HHAA 3H6HA 4P98A 2BUAA 4KO4S 3O03A 4KWEA 1SC4A 3VSDA 3RYIB 4RS3A 1QONA 3PZBA 4DC1A 4LFBB 3M2PA 4IEEA 1QU2A 4CKYA 5E4FA 1OAKA 1R37A 4L9AA 3ZU2A 1VSTA 4XD2A 121PA 1UMDB 4YONB 3TSWA 3QOFA 3O82A 5LDHA 1OYVA 3NFRA 2H2GA 3JVEA 1OZAA 3PFIA 1DLJA 4GMXA 1XVUA 3UGKA 1EE1A 4ZCTA 2IYXA 1NSTA 4GKJB 1U1FA 3LFHA 3RIEA 3X2SA 3T3HA 1MUUA 5TMDA 2G5CA 2YOHA 1JFVA 1XKLA 3LPCA 3M4OB 3G2OA 1HLGA 3CVYA 1NMEA 5FAKA 1NVEA 3IOCA 3IXLA 2F48A 1IM5A 1MORA 1ZN8A 3IPAA 2HMVA 4Q12A 4U6NA 1ORIA 3QOXA 5ARCA 5IEJA 3U19A 2L17A 2X1MA 3E7DA 3DZFA 4NEHB 3H9GA 2LRHA 3K30A 4G0MA 1JR3D 1Y6FA 3MXTA 3VR3A 4JU8A 4PC6A 1EFHA 3O95A 4H3HB 4KFUA 4J7CA 2WHEA 2QL5A 2WLTA 4GEGA 1OXMA 2JGRA 5F12A 5SZIA 2A1UB 1NJFA 4C05A 5KOYA 1UC8A 1JNXX 4WA8A 4HAYA 4JLSA 2OK7A 3FDZA 3VHQA 3VV3A 1SCJA 2Z3VA 2HQBA 1CPYA 2IPOA 3EOAI 1F1JA 2O0LA 4FQ7A 5GP1A 1RPTA 2IH5A 4K2HA 4BU1A 4ZYVA 3UOAB 3PTAA 1O3YA 3OVMA 5IPFA 1WS6A 2HZBA 4RD3A 2WVHA 4YJKA 4HBZA 3FMFA 5I4BA 5DCWA 1L4BA 3EY4A 2BGIA 4IGEA 1H2EA 1U0JA 4E15A 2UYHA 3MHTA 2WF6A 1S01A 2GAFA 3L9WA 1GPMA 3NH9A 4US2R 2HH9A 2J0EA 2ADOA 2PKWA 2EFDB 3RSLA 3K5IA 3RVRA 2PT5A 1UBCA 5BR1A 5DTMA 1ZH4A 3K8YA 3NCHA 5FL3A 3T9BA 1DSSG 1K7EB 2IFTA 1D4AA 3FKIB 1VM6A 3DL7A 3PEFA 1JEQA 2PBRA 1L7BA 2N9UA 3OSZA 1KYTA 2HF2A 1OROA 4UNRA 3ETEA 3RADC 4LOLA 1CUXA 2ZJYA 1HDIA 1V8OA 3RSHA 4ZZ3A 1P1JA 2HRBA 3IT2A 4QXMA 4IZ6A 1UINA 3ICVA 3GX1A 1F8YA 2FFQA 2COKA 3TJMA 3TMAA 1QUEA 3AUFA 1EK5A 3KL4A 3QRWA 1JLHA 3QLVC 4J91A 3TW8B 3TX2A 1GTSA 3GZTB 4X1YB 1H5QA 2VJBA 3DAGA 4US0R 2ZYVX 1U7HA 1W0KD 2AX4A 2YU9B 2JAUA 5GONB 4XE5A 4YJHA 2J1LA 3VPFA 1WZIA 3II6X 3R0IA 1Q14A 4X66B 4ZCRA 2FPKA 2P1ZA 1QV6A 2C42A 3TR0A 1JVBA 2QRLA 4BKRA 4DXHA 1RPZA 4QDTA 2XB2A 1NIPA 4Z9BA 4H7IA 1NMQA 2FPGA 4I55B 4YQFA 2AZMA 1OSNA 1WBJB 2GESA 4HRYA 4Y2PA 1NOJA 4IJUA 1Q0SA 3DNMA 1YT5A 3PNSA 3D4IA 1TOAA 1EB8A 2VTEA 4TYMA 2BHRA 1Y7HA 1WG8A 4Q9LA 4MS4A 1HZZA 5L3VA 2ON6A 3HBJA 3TQSA 1ULZA 3EISA 4AJIA 5C4GB 3E61A 2ATCA 4CI0B 4NZMA 2WIKA 3N2ZB 1IHOA 2NO6A 3EIOA 2VDNB 4NK5A 4R9NA 5E6SA 5HE8A 5HKKA 4XGRA 1BS9A 2DJ5A 3MWFA 2AZDA 5TGZA 3G6KA 2IOFK 4EUEA 3RZDB 1AGPA 4Z1MD 3KB8A 4OJYA 4DV0B 4DLRA 2JGDB 1F06A 1K2VN 1QFJA 1ONOA 4A36A 3D5EA 5A4IS 5LPNA 1QOQB 4I5GA 3GG9A 3KQSA 3K1TA 4I5DA 3AETA 3DE7X 4XYMA 4ZCLA 4CCAA 4G1FA 3UV6A 4LXYA 1U11A 3I53A 1FRQA 5TLSA 2GN8A 1L4UA 3DCNA 1W8IA 2OEPA 2WHRA 1E7QA 2QX6A 2Z4SA 2MSEB 1CETA 3ORQA 4G5QA 4LHXA 4QU9A 3RT9A 2Q4BA 4G8DA 2EBFX 3NNNA 3STTA 1EXMA 4GPIB 5D3MA 3BTSA 3HHPA 3K9QO 2AN4A 2ZDGA 5TC4A 5HCIA 2OXTA 3EGDA 3EFOA 2XCOA 4L95C 4XTCS 4DLVA 4HN2A 1VE3A 3MWEB 1SY7A 1O58A 2P5TB 1UMBA 5K1ZA 3ZJTA 3V8NA 4EATA 4CQNA 1RPJA 1YQGA 2XV1A 5JY1A 3ZKWB 1OV4A 2ZR0A 3FFXA 5EQTA 5CM8B 5DBOA 3EQ7A 1QLJA 2OZLA 1CF9A 4C78A 2ARKA 2EKDA 1KOGA 1SFOB 4MUMA 5KS2A 4G5RA 1U3VA 2VATA 1KR5A 1SXJE 1HG0A 4RKWA 3HDJA 2ES4A 2IOFA 2P5UA 5BW8A 1UH5A 2HZ7A 4LPSA 4BGVA 3GRAA 3UATA 3EXEA 4C07A 2FXVA 4MPDA 3R7WB 2IYTA 3GJZA 2IDZA 4C3UA 4X94A 3WJAA 4AICA 5COQA 1IHUA 4FKZA 3KR0A 4QM7A 2O54A 1H4QA 4ZV9A 4KLZA 4ZJPA 1W88A 3L46A 3LKZA 1TXGA 3ROEA 4LN1A 2GSWA 5I01A 1EUDA 4L4SA 4Q7KA 4XDZA 5HBGA 2PRSA 3O1IC 4IIUA 4NAUA 1M6WA 4LBWA 5E7QA 3SR0A 2CV0A 3BT7A 5M5YB 3HI6A 2ZXUA 4I0WB 1HYGA 4OVKA 1ZGAA 5B55A 4RTRA 2ZWVA 1QNLA 4MS3A 4DCCA 5AW8A 3VSBA 4IIVA 5CYGA 3ER8A 1CZRA 1P19A 3CNQS 1PGQA 1PWXA 3PUWA 1XLTC 3UGTA 4DAOA 4EW6A 4FQ8A 5ECWA 5CCXA 1W44A 3A1EA 3OCYA 1FUKA 4MARA 4C0LA 1HO3A 2Y1FA 1HT3A 1TK2A 3IIIA 3V80A 5BYAA 5IN4A 3DBLA 2DY1A 2IHJA 2Z3ZA 2UUBB 3AVQA 2UVDA 1KOLA 3UMVA 5ALGA 1NP6A 1V8FA 2WU1A 2X13A 2M1ZA 3QQPA 3GVCA 2AKEA 5TF0A 2J9GA 3C3DA 5E7IA 5JZMA 2FZEA 1A5TA 4CM9D 2WM3A 4Q1FA 4EMUA 3UHFA 3VJKA 5A2QA 4HJXA 2FSHA 1JDNA 3LZDA 4L72A 2BR3A 1J2TA 3GFQA 5HF6A 2O3JA 2VCHA 1S4QA 1T10A 3NO4A 4OFBA 1WXWA 1CU1A 3TBFA 3WO0A 3KQUA 4DV1B 4NFHA 2DUMA 2OGWA 1IZ8A 3E7FA 3PJEA 2ZKIA 3VR4A 3PNLA 4EBFA 3T7RA 3TIFA 1UWKA 4B3CA 4CM3A 2Q5LA 3BMXA 5DYIA 1ZICA 5CT4A 1GIAA 4YO7A 1QU3A 3WTBA 2PZ8A 3H6KA 4X8OA 1K2WA 1LS6A 2I76A 2JI7A 3B6IA 3FPCA 3GC6A 4NTZA 1R27A 4TSKA 1UEIA 4X6LA 5DNEA 3UMFA 2HBRA 3VH4A 5BQFA 1YKGA 1CJTC 3Q88A 4R83A 5K8UA 2R7AA 2ZR7A 3CX3A 5E7MA 3AR7A 4TL9A 2QRQA 2O5CA 2APJA 2JVIA 3DQPA 3TSZA 3FG9A 2AJBA 2ZJOA 5KWJA 3D54D 4IXNA 4EBBA 1XF1A 3GJTA 3WY9A 1OH6A 1FFYA 5FQNA 4ZVUA 3VUFA 3ZW7A 3ZWVA 4OHVA 3LGXA 5A1JA 4D4JA 1RHUA 3L0CA 3PNOA 2X3FA 1DAMA 1G8HA 1XZMA 2YWRA 2C3YA 3CT6A 3IUPA 3NWJA 1UJMA 1BE0A 2QE6A 2W83A 3ESAA 4O4IF 3ZWKA 1B15A 4AP6A 5BW4A 1E32A 4FFVA 5T5QA 5GOTA 3N8KA 5TPZA 3AONB 3KFLA 2NVUB 4EVSA 3MMPA 4NONA 5YASA 4CMGA 2VR1A 2GVDC 2HSEA 3PGLA 4ZMBA 1CEEA 3IKMB 1CUYA 4DZZA 3A3OA 3DVAA 4H18A 2VXYA 3A9SA 1Q11A 1WDLA 2Q49A 1KYQA 3QG1A 1H1DA 4CCYB 4YMGA 2HCTA 4QAQA 4TN5A 2HV8A 1GG9A 5F2KA 1M76A 3JZDA 1SBTA 2C57A 3PZRA 3EMDA 1STOA 2HYDA 3OEEA 2W6QA 2XBLA 4MKZA 4WFIA 1WUHS 4WKGA 5AVZA 2OC4A 4TMYA 1P1KA 1JV2B 2X7XA 1D0IA 4QDOA 1NP7A 5CEEA 1P2GA 2NO0A 3N2KA 4LA4A 4QYMA 2HEGA 4Y2RA 3A1CA 1N0WA 3IOMA 5IVDA 4HZIA 1CZLA 2WV7A 3T54A 2R1VB 1SHUX 4KREA 1SCUB 2QJOA 3WIVA 5KU1A 2O7SA 1LI4A 2CJFA 1M34B 3H17A 1KMHB 4KQWA 1PT7A 4M1WA 4HFRA 1QZUA 4MV1A 2B9EA 2JCSA 4WV3A 5EI5A 3VKFA 4C76A 1NRJB 2PX6A 3H4MA 5DYYA 1NXOA 3IP9A 4EMBA 2H1WA 3I37X 3KE9A 1HOTA 1NC3A 3AR5A 5CX1A 4PFKA 5D5QA 4HL6A 1UXJA 1DT3A 1JMYA 1ARZA 3NXSA 5THQA 2OBBA 2NU9B 3RPEA 2ORED 1R9TB 4U1RA 2ETVA 2G9RA 4BX0A 1P62B 1YI1A 4HK4A 3H1GA 3CEHA 1Y5RA 1HL3A 3NEPX 3VPBA 1KYYA 1LJUA 2HQOA 3ZXXA 1PR4A 5KINB 1Z22A 2A9OA 1J0CA 3EVZA 4ZEVA 1RLOA 2NG1A 2RH9B 5DBHX 1TU3A 5JS1A 2QZ9A 4FGJA 3RYTC 3S3TA 5CXUA 5JAZA 4ZQBA 4E32A 2F64A 3CKYA 3PX2A 1O94C 4HB0A 1RYZA 3N5KA 2VWPA 3UJPA 2XYPA 2B4YA 2C95A 4OLJA 3KXDA 1BJTA 3QKIA 2R8XA 3PKZA 4QARA 4RHEA 1R88A 4ITVA 1ISGA 4CF5A 1HDEA 1EU1A 4NS4A 2KPOA 3PDIA 2OSVA 4MMXB 5FAXA 5CFRA 1NU8A 2JIMA 3N58A 4OHOA 3IP6A 1CZKA 1HYHA 3PU6A 4R51A 3PQFA 4L6IA 4RV5A 3ZVNA 3D4PA 4TOIA 2PZBA 2VF7A 1DQSA 3NFYA 5J2UB 3LHSA 1CIPA 2FYTA 4LV6A 1ZO8A 4Q37A 2E2WA 3F74A 1YBHA 3JQ9A 2YFYA 4YP0A 3I2IA 5BQ5A 3RAPR 2ESRA 2MWMA 4BS9A 1DQYA 1PNQA 1RADA 1S8FA 4RENA 3A4YA 2W4QA 3GLHA 4LRTB 3ZU4A 3BL8A 4E3ZA 4PV7A 1GCIA 1I5EA 1L3BA 2C82A 1YR7A 3E2IA 2X1VA 4JB0A 4MULA 2C5LA 3RW9A 8LDHA 4LF7B 3EPHA 1FZTA 1RLTA 5IJ9A 1T4DA 3PSAA 4TVKA 4M21A 4EM6A 2P30A 4W4TA 1IM2A 2D2IA 3PENA 2QLTA 4INPA 1Y81A 3ONDA 1KFCB 2VG8A 2CHFA 3R2JA 4Q7EA 3K6SA 1N78A 3IIKA 4B3BA 1VC2A 2ZJFA 1ZONA 2O3UA 3OT5A 2BJVA 3PT9A 5A2GA 3UV7A 2J30A 3CG4A 3G8YA 2FG7C 3DZKA 4G24A 3PFFA 4N9QA 1Q74A 1Q0RA 1RP7A 1Z8DA 3Q6NA 5ECDA 2QTTA 2DCUA 2HF9A 4RE6A 2WG0A 1J9ZA 3ZCXA 3OQIB 1NVWQ 2Z30A 3CF2A 3TNYA 3UHOA 5C8VA 5JLJA 4TWJA 5TVGA 2P3SA 5E7JA 5D85A 2FMFA 5F5LA 3W7VA 4D97A 4N01A 3WK5A 1IQPA 2G08A 4FFSA 4J75A 3QEJA 3VNAA 3JD3A 5C4XB 3Q7EA 3SIXA 3VXKA 4OLHA 1UZUA 4DV2B 3WP1B 2I9PA 5KHAA 1AA6A 4JWTA 2QK4A 1H8ED 1CZOA 4LYYA 3GTLB 1BHSA 1J39A 1GNRA 3CXRA 4NAHA 5D1HA 2R6GA 5LWHA 4R1SA 2QD2A 1TVCA 3BC1A 3KKNA 4YUWA 1E7WA 3BWCA 4L4ZA 3UAVA 3HGTA 3GH3A 2CV2A 1LNSA 1JQBA 4H1UA 4TRNA 1SIUA 1JLRA 5CHEA 4A8JB 4ENPA 4OQQA 3EN0A 5DBGA 4IJKA 3PQDA 3KKKA 1UZMA 1JA0A 1QGZA 2WKSA 2WVJA 3VI3B 3EFEA 1FBTA 1RAIA 4RLHA 5DW0A 1A9TA 2J4DA 5JUWA 3DJFA 3AU8A 5C32A 3EVGA 3SF8A 3FJOA 1C2TA 3TCNA 1G8MA 2Q3LA 4QHSA 3D3NA 5K8LA 5PGMA 2EFYA 1ZM7A 2NV0A 1SKAA 3TEJA 4FGSA 1WVMA 5EPOA 1U9ZA 1AHIA 1B42A 1KS2A 5BT8A 1XG5A 4NECA 1KZHA 2J9ZB 3W2EA 1CTQA 4R2KA 3A4VA 2XD9A 1BN7A 4KP7A 3ZQ6A 3LKDA 3R3YA 2VSQA 1TJ3A 1SCBA 4ZYUA 5LD2B 2Z9BA 3L6OO 1V9SA 3QJ5A 4KX3A 5CIWA 4UKDA 3PQ8A 5ES3A 3FMOB 2C9DA 3OUTA 1GNLA 2J32A 1X1CA 4H0NA 4HNAB 3WYEA 4DMMA 3CUTA 2EHDA 3HACA 4Y7CA 1QS0A 2UYCA 4CF3A 1WSBA 1IB0A 3VR5H 5B37A 1F8GA 1NT4A 2OXRA 4IVPA 4OG2A 1UJ4A 4N3BA 1MA0A 4IJ5A 3KTAA 1U80A 1ICEA 4IDCA 2ODNA 2B8NA 2OE2A 3I2GA 4GICA 1KVSA 4U8HA 1T36A 4ARZA 4C4AA 4X7MA 3H0KA 2G25A 5J4HA 5JY6A 2FMKA 2WTEA 4J9UE 4K2AA 3MCTA 1GL9B 4PLCA 1EFRA 3WMWA 3LO5A 4ZVKA 4PG6A 3SSAA 1P9LA 4DA4A 3PUIA 5DEIA 4IXDA 3CSDA 3D8SA 4EYKA 3T3NA 3I1IA 2PWPA 3K72B 3U39A 5JJ5A 3G2QA 1TM4E 3THYA 3AVVA 1W1WA 2HLHA 3LTEA 2JIQA 4BNLA 2XMQA 3UHPA 1KEPA 2GFQA 2VZ8A 4MLDA 4WN9A 4ZU3A 4EX6A 1M2NA 4HH1A 4D26A 1RT9A 2FCAA 4O4JA 5E1BA 1DVRA 1NX9A 4P08A 3FDIA 1OXSC 3H1BA 4ZYTA 3WV5A 3LQFA 5IUNC 4OQDA 3WNVA 4KB5A 1WCXA 4XPZA 4CIVA 3SDSA 2OCYC 4B79A 2FDCA 5A0FA 1RKXA 1AK9A 1R0XA 4JLKA 1EDBA 1H6AA 1PLJA 4Y6QA 5HIJA 5E6RB 1HRDA 2YV4A 1E0SA 1KC3A 3KQNA 4YMVA 2IL1A 3D3JA 3C8HA 3FRJA 4BO6A 3HKCB 1QO0A 2XZOA 4XWWA 2QX9A 4GD3Q 4I4TF 1AKMA 3JWGA 2VTKA 2VYQA 3EPPA 5ARBA 3IDAA 1L5QA 1NVVQ 2V6IA 1RRMA 1YFLA 1SU6A 2M98A 3CNNA 2AMVA 3CISA 1GLVA 1ULSA 2D0OB 2HMWA 2I1LA 3OM1A 2AOTA 2D5BA 3ZUGA 5FBZA 2XT9A 3G2HA 3OX1A 2CJYA 4K46A 3ZE6A 3W4KA 3OEWA 4BNKA 2C2HA 2Z56A 2VPWA 1O08A 3GRFA 3LVRE 5EMKA 5LLDA 2GKGA 3GEDA 4LMRA 3K6JA 3WGNA 1XZGA 4DSOA 2Q4DA 3LDHA 5KTNA 3RSSA 4GOJA 4DDMA 5HZMA 2WD9A 1P2UA 5CH3A 4MYUA 5G4LA 2FMTA 3O1JC 5E9AA 2WU0A 3LW8A 4B34A 2XUOA 4ZO7A 3ROGA 5EJGA 4O4LF 2OSBA 5EHNA 1LLDA 1SA0B 1U99A 2FVYA 2PM8A 3EZNA 3HCOA 5G4KB 1EVQA 3CH5A 4KR2A 3WLLA 3ITEA 3HU2A 2JLSA 3RKUA 3MLBA 1ESDA 3I0NA 4LF9B 3MCVA 3FUUA 1E3SA 2QUIA 3O4IA 4GPEA 5AJXA 5FBRB 4AZWA 4BLSA 2ZIXB 2FMXA 4G0OA 4HQFA 2L19A 3U3DA 2IELA 1VPLA 3EGCA 2DPLA 1DBPA 1L1RA 4FINA 4BQOA 1OKKD 1BNCA 2OMKA 3OFND 4ND3A 1WXDA 5TT1A 5JSZB 1SRRA 5FPHA 2C07A 2BIFA 2G28A 3M6UA 4MJLA 4UMDA 4FWTA 4YACA 2GN4A 1QRAA 4BBRB 4YP5A 4JNKA 1E2BA 4TKVB 1OHHA 2D54A 1AKEA 4DCGA 2V3WA 3UFXB 4ZJZA 4U0JA 1P1FA 2BKUA 4FYXA 3NORA 4NBRA 4Q7LA 4TV8B 5AUQA 2REQA 3DMGA 3PYMA 2FLVA 3R3WA 5FUWA 2NSJA 4ETNA 1Z0SA 2JFGA 2QENA 4OQXA 3FHOA 4N3GA 4XZ3A 4EG6A 5KWIA 2A4MA 1HFKA 5A06A 2XVXA 1B0UA 1NMSA 2ZI4A 4GPBA 5I8ZA 3GRCA 4PG8A 1JG7A 4ZO6A 5DPMA 5I7FA 1FP6A 5ALKA 3HBFA 4HH4A 4BEBA 1HQKA 4C08A 4M0DA 4KVGA 4K3UA 3KAQA 4BMXA 1TMYA 4U02A 4F5WA 2NUTA 3ZWQA 3R7SA 1I4WA 1AQJA 1Z0DA 3E22B 1OAAA 2AJTA 3EUWA 3FE2A 3AF0A 3RVPA 5ALEA 2BM9A 2LV8A 3C8DA 1EGVB 4H27A 2INGX 2ZRHA 3AK4A 2PUVA 3DUWA 4F93B 3HUTA 3R0VA 2GZDA 2VP5A 3IRUA 3VDMA 3PEYA 4Q00A 1U0GA 3H5LA 4LJRA 2Q1XA 2WA2A 4PYOA 521PA 3VC1A 3GGSA 3QF4A 5FOSA 4DCMA 2QUAA 1DDOA 3LECA 2PXXA 1MW8X 1GU7A 1A27A 1CLEA 1EK1A 3INNA 3UG6A 1H2YA 5NULA 2OGZA 3SZUA 5LKAA 2PWBA 1QOZA 2CE2X 5BSVA 4PSCA 1ZI9A 4TVBA 3BK2A 1QXSA 2VXCA 2XQGA 5D5PA 3V46A 1IHDA 1EP3B 1BE8A 1QV9A 1EBBA 1HFJA 2MSDB 1TJ5A 4DC9A 2VHZA 4TUYA 4QDKA 3BHIA 1NXSA 5I6DA 2QD3A 2VYVA 1G5FA 1H9BA 2Y0PA 1RYFA 1Z2PX 3KZNA 3MPOA 2Q4OA 3BFVA 4LK2A 5L7YA 2GNPA 4CFZA 2NAPA 3EXG2 2X4LA 5FOTA 1RXSA 3K5HA 3VTKA 1PKEA 1P60A 2P78A 4WOPA 4LWPA 4R1PA 4LBVA 4OB8A 3COWA 2VK1A 1NC1A 1LGYA 2EC5A 3QVVA 3SJ7A 1Y34E 4J76A 5DNAA 1GTZA 4FGUA 2O2DA 1NW4A 3R74A 3RKSA 4BLRA 1KY4A 4D4MA 5L8VA 4RV4A 4Y6RA 2WFZA 1USUA 2BZSA 5FO0A 5U4QA 2DR0A 4DM3A 3H3XA 1T9ZA 1QMGA 3DG9A 1V6AA 4OU4A 5AD1A 2JJ1A 4M22A 4KKVA 4AKHA 3QIVA 4D74A 3PL1A 1NLUA 4A26A 5JMWA 4ZJUA 3D3WA 4FLMA 5K3EA 1JQKA 4B80A 3O2QB 4DIOA 5DBIA 1QYDA 2X2OA 2CLFB 2BC9A 2ZLBA 3D8HA 3NBQA 5JARA 2N42A 4TVOA 4C2MB 3RFTA 4DYHA 3ZHBA 4RJKA 3VA7A 1T5IA 2WHPB 2VJDA 2HU5A 5B4UA 1AZWA 1RWKA 3T7SA 2HX1A 4ARCA 2VDRB 5GJVC 4RLQA 2OUIA 2ISQA 4WQMA 2AI3A 4DTCA 1HI9A 3E4DA 4LNUA 3TEFA 3VGPA 3W2HA 4E6EA 4F11A 3MPUA 5JCJA 4EJ0A 3ST7A 4ER0A 5KCZA 3FNRA 4CQLA 1FLVA 1FVXA 4TN1A 2PMZB 2YUIA 4F6RB 1Z63A 1XKQA 2P90A 1SFRA 4A3IB 1WPQA 3EVAA 5JSYA 1X1DA 2XKJE 4R6XA 4YJGB 2CJPA 4UUQA 4QBTA 4ES6A 5AVTA 4AS1A 4CLHA 3OIVA 4JYCA 1WPRA 3QF7A 2GI4A 4BUZA 3W5UA 1KQOA 1ZOOA 1OBCA 1NLMA 1E89A 1K8XB 1WXFA 4CM7A 3W3ZB 5BWNA 3O83A 5K6RA 3H4IA 4JUIA 3HUUA 1A8SA 1N0IA 1JJ7A 1O5TA 3B38A 3O8BA 4NU0A 3TX6A 4D44A 4F9FA 3AI7A 2LE0A 2R6JA 1CR2A 1OLUB 1YJAA 2XF2A 3VPSA 4CMAA 4YJFB 5JAUA 1APBA 3GLGB 1LBIA 1PJBA 5ALFA 1VP3A 4FFDA 4JB2A 1CV2A 3IAS6 3D1VA 4X1IA 1Z2AA 3GB9A 3KIPA 1SKYB 2EFGA 1YZTA 1TEHA 2PUHA 3RK1A 3OT1B 4S2UA 2E4ZA 1X1TA 1PNOA 2FW0A 2NUAA 4N41A 4UTOA 3K0SA 1CHDA 2WBLC 1E0JA 3MA0A 2HL6A 5GM1A 4WGGA 2HRDA 4Y2SA 4D9JA 1W5TA 1NTRA 3MZ0A 5GVSA 5J2TB 6LDHA 2CNWD 2Q07A 3AF3A 4N0QA 4HNGA 3NM4A 2FUKA 3QVGB 3OICA 5DNWA 4ZXFA 1ZXBA 3NRJA 4KTVE 2XUZA 3RT1A 3ON5A 1R8JA 3H0GB 3B3AA 3W5DA 3DPUA 4R1TA 4IXWA 3AHFA 3H2SA 3V1KA 5JS6A 3SQNA 1PUJA 4B6QA 1E9BA 3KYDA 4CMHA 4CI9A 2WYWA 2EV9A 2CMKA 4ZYZA 4Q4DA 2ZP1A 3IQFA 1S3IA 2YICA 4MVJI 1N3BA 7REQA 2CHVA 2JI6A 2CXPA 2ZJ4A 1F8UA 1O57A 4F3YA 2HU8A 1QIEA 1GZ5A 4PSAA 1GR0A 1UJ5A 4KLNA 1E2JA 2H29A 1C4OA 5AKKA 1JIVA 1Y5LA 3GPBA 1W4BA 1ZVQA 2V03A 3ASVA 1UEXC 1SUFA 3ANYB 3HJCA 4IMPA 3WYBA 2OCDA 4G4SO 2C9OA 2X0IA 1WW8A 4D79A 1ZM4A 2GVNA 3OJ0A 4MGZR 4ROSA 4I5IA 1DKNA 3T7DA 4DEVA 2YIJA 2RK6A 4EG7A 1F0YA 3D64A 2O5EA 3QVUA 4URVR 3KZKA 3JRWA 2H4ZA 4MYCA 3A14A 4H4EA 1MPTA 1OUMA 3M6XA 2RARA 2WKQA 3AI2A 5EYPB 4DIUA 3B7GA 2QAJA 4E70A 4F06A 5ITWA 1SVOA 4OKNA 4NENA 3CZ9A 4YB8A 1KI4A 3PLAE 1F14A 1PNTA 2QSJA 1SUCA 1R6TA 1JZQA 3RR2A 2QOEA 2IIVA 1XQVA 4LY0A 1CWUA 2PUWA 2N3ZA 2GXQA 4OXRA 3WWCA 4Q3KA 4D0RA 1OIXA 5EXEA 1YH3A 3BGVA 3UK1A 4HTFA 4P4SA 5HRUA 3DAFA 5CRIA 3ZLTA 3GN2A 3LT1A 3CS3A 1LXCA 2NW6A 3QKRA 3TMKA 4FFRA 2PIAA 1UMKA 3MC1A 3X1JA 4NPAA 3H2IA 2O8BA 4D8WA 1IL0A 3IJRA 4LXQA 4QTZA 1Z7WA 5DFAA 4LE0A 1N4DA 2F9LA 1MQ9A 1XRLA 2OV8A 3I9MA 3JZMA 4FX2A 4B3IA 1SBIA 1SUEA 2AYXA 1HE2A 4MITA 3LQRA 3WNBA 4A8PA 3F4BA 3F6CA 3NTUA 1OZGA 4L2IA 3V3TA 1QNFA 2BF7A 2ZM6B 5LXTF 4Q3CA 3GK3A 4TSFA 4AY4A 3KKQA 2A33A 2X2FA 3OLQA 3M34A 1L5ZA 1FSGA 1I14A 4PCUA 1CUHA 3DMYA 4DZTA 1XPRA 3I39X 4EKIA 5IYZB 4GI3A 1TJ4A 3G5TA 5DWDA 3O4GA 3EDMA 1ZOPA 1M2KA 4AQ7A 3DMHA 4TMXA 3WB9A 2I4IA 3FWNA 4KIJA 4D4IA 3T5DA 5EIEA 4URWR 3DF9A 2ZSJA 4ZVOA 4N0PA 4CL3A 4OLFA 2DG2A 5JATA 3I6IA 5KTPA 5JNTA 2P6NA 2I3GA 1O97C 3C3BA 5JAOA 2HQSA 3K9BA 1WMDA 2AH5A 1UT5A 1Z28A 5ESDA 1DGQA 1S3GA 3BA6A 4D4KA 1N32B 4Z86A 3JZAA 1W7AA 4IHJF 2W6JA 4M1ZA 3CKMA 3VDXA 4ALLA 3WMEA 3ELDA 4LI0A 3X1DA 5M3FB 1DAFA 2AYYA 3EZYA 3KPJA 4X3CA 1P61B 2ID4A 1XZNA 2P9GA 4EHKA 1UDXA 3WJ2A 1DARA 3KTOA 1RZRD 3L1KA 1CRPA 2WK1A 2J46A 4F0JA 2NXWA 3JARA 4KMSA 5AJTA 4AF6A 4GXQA 1CY2A 4FE7A 3BRWA 5AM4A 4XLZA 2HU2A 1YMVA 1SXJD 1HDCA 4DE5A 1IRIA 1QGUB 2ZRFA 1WHSB 2BOVA 2M1XA 1KIAA 3EGXA 2G71A 3HY3A 4MLPA 4Y1RB 5D87A 5E0KB 3VQTA 3WLHA 4FGWA 5ALJA 2P75A 1ODIA 4LNHA 2WUDA 1ZHOA 3SJAA 3HWRA 4KQ9A 4TS3A 2I67A 3WLIA 2VAXA 1QR2A 2RHWA 2XDWA 1G21A 2HN9A 4OMCA 3TRFA 3WGIA 3B2EA 3DYIA 5BP7A 3F1LA 2ONYA 5DHPA 2D74A 1A2QA 3ME5A 4GWKA 4C3HB 1DOZA 4ZC1A 1FFXA 5TEVA 4I50F 1PEDA 1QCCA 2OORA 2EJUA 4E46A 4EP1A 3ISVA 4CLEA 2I7CA 4XW2A 4IIHA 5FWDA 1PKXA 2NN3C 2Q2VA 4JELA 3BL6A 5B4VA 3GBPA 1DCMA 1WHTA 5BV1A 2G5GX 3W5HA 1RKVA 4L4YA 1OPRA 1T3GA 3PGVA 1AM4D 3G2LA 5EEHA 1DJOA 3HC7A 1V16B 3BCHA 1FFEA 2EZUA 3OTWA 4O4LB 2MYNA 1JB1A 3OCUA 4X71A 4O29A 5LP6C 4L4XA 5HKAA 1XVAA 3DLAA 4CR7A 4AFNA 3ZEIA 2ST1A 1S89A 1IOLA 3ZH9B 2WB4A 4ER6A 1QYWA 4C22A 1D5WA 4RK0A 1E7YA 4BLVA 3LXXA 2HXGA 4IFTA 4OUDB 5HDQA 2L42A 3OLYA 1GXSA 1UJ6A 4Q82A 4U3JB 2PPLA 4M60A 3UH0A 1Z6AA 4HPJB 4PR0A 5U9CA 2JA7B 4B46A 3H2GA 1IHYA 2NAFA 2ZAOA 5HK9A 1NRXA 1N1MA 2P2YA 1LC0A 4XX0A 1UFRA 5BMVB 3N8GA 3M4JA 4XPIA 3MLAA 4FFBB 5IJ0A 3G82C 1YFKA 1WO8A 1QHYA 1IMOA 3GZNB 3GUYA 2BFBA 2Q9CA 3UVEA 4AO6A 4F96A 1A82A 1YB5A 1W93A 3JRNA 2E4WA 4FIZA 3ZW9A 3SK0A 5EPEA 3QVOA 4BEWA 3OQ6A 5HRCA 3S4YA 1K6EA 2XXBA 4B48A 1YHYA 4QUKA 3EA0A 4UHFA 5HG0A 3H11B 4IWYA 1CIVA 4PVCA 1F4LA 1J2EA 5HIAA 1CQPA 3MM4A 3NVKI 3HB4X 5JZVA 1O95D 3ITKA 4JJKA 5EJ5A 1GNTA 1YE8A 5CA0A 4E6PA 1SOVA 3S29A 3HG7A 2XNDA 3FRIA 3UAOA 1AF7A 1VKJA 3I58A 1HR0B 1AJEA 4PHCA 4B9AA 3D8NA 5KQPA 3CF0A 4BVBA 1GTRA 1X92A 3WL3A 5AHKA 4CM4B 1VSVA 2BE7A 2B9VA 1Q44A 1UWLA 2X4IA 2B92A 1ZGCA 2D3TA 2YN0A 3E81A 2BR5A 3JQDA 3LUKA 3OZGA 3PQEA 4J0KA 3TNDA 2BFOA 5IF3A 2XPCA 1P44A 4MVCA 1IPHA 3V4VB 3ZWOA 3AV0B 1P0FA 3IQGX 5BPFA 5EJ7A 5BW5A 4HYTA 1KQ3A 1R0YA 3NBMA 4MQLA 4EG5A 2QPAA 4UU0A 3FYUA 2WAXA 1LKZA 1AS3A 4HX9A 1M74A 1QQBA 3IALA 4Z4IA 4FDTA 1XX6A 2WP0A 3M3PA 3SSNA 3ICCA 3DTVD 3RQIA 3MJHA 4I9HA 3DEZA 3KQOA 5FJIA 2ZM5A 3O93A 1GILA 5JHHB 2AFIB 1QRTA 2TMKA 1SXIA 2VNIA 1DIBA 1G41A 1ZAKA 3GNQA 2R00C 4XWKA 5AHXA 2VF5X 3G2KA 4EVIA 1SOMA 1X1RA 1XP8A 2D4AA 2RG1A 2PQ2A 1CJUC 1QH9A 2PKCA 5KPDA 2NOAA 3ETLA 2WVGA 3BREA 4R9UC 1V5IA 2NU7B 1R64A 4PE5B 2R7KA 1T2DA 2V7VA 1DX4A 2CBGA 2EHJA 3AY6A 3LYAA 3TTVA 3C6QA 4LF6B 4QGBA 3EEIA 4Z7QB 4QBKA 2XWSA 4V1CI 4MGEA 5JOQA 3O7WA 1O5OA 3PRHA 5LP1A 3F4KA 3DWIA 4RZXA 5KWSA 4CLRA 4BNXA 3OA2A 2YBEA 2Z3WA 1GUAA 3GDOA 1HEUA 2WZCA 3G2NA 3P2KA 4AROA 2H5EA 4B85A 1BN6A 1CF2O 4HNHA 5ER6A 5JNWA 2D8AA 5BW6B 5E1MA 1VPTA 3JALA 2Q5OA 1EUCA 4JQOA 3HCAA 3PVSA 2ZB8A 4O2BA 4DLPA 5CDUA 3RUDA 3FW1A 4R71A 1U9IC 1Z7EA 1C1YA 1MO6A 2JFFA 4IOJA 1DHRA 1P77A 2F1RA 4CKEA 1XCJA 3ZHYA 5HX7A 1KFJB 5DGCA 1L8LA 2OCKA 2GBIA 3IKJA 3I9V1 3Q87B 4HXGA 1NNI1 1XU7A 2AMYA 2C2XA 3CT4A 4YI5A 2V74B 2OHGA 1E1RA 4KXNA 3Q1KA 4AL4A 1RI2A 5IZ4A 2DE0X 1GRQA 4D41A 3KOOA 2X6QA 3SLKA 2QG6A 1ZWLA 4JGBA 5CU7A 3NEJA 1WMAA 5FFNA 1HDZA 3R9XA 2X58A 2GERA 1R3UA 5JYCA 5DW3A 4IICA 2PVCA 1X86B 4CFYA 1L7QA 3VO9A 5BQXA 1OLOA 4BNFA 1H93A 2P9CA 2AQKA 3P9PA 4YRJA 1KZ4A 3FCOA 3ODGA 3DUFB 4URHA 1OFIA 3HFGA 4H0CA 4BZWA 2EFEB 4WCFA 1MIOB 3DNPA 4LJYA 3RKRA 3NNDA 2IZOA 1ZL0A 4D3SA 5CCBA 2GM5A 2OCAA 2XTAA 3O4VA 2QDXA 3QUAA 4GLOA 4KBGA 1KFKB 4E7OA 4B35A 5KWEA 2L18A 5EUCA 3BQNB 4B0OA 1KQPA 1QJCA 2C4WA 2J33A 4AI6A 2C9YA 3WKAA 4BP1A 1ESEA 3HM2A 3DLIA 1FCJA 2DGDA 2J3HA 3OPYI 4O2LA 4BLTA 4ISBA 5JT1A 1J9GA 3DQZA 3ZHSA 1YMUA 2AG0A 3LPLA 2X0DA 4HYYA 4RTJA 2RGNA 2SKCA 2GAOA 4HVCA 5HKBA 2GK4A 2CL0X 1UADA 4HDRA 4PGFA 1QGAA 1D0VA 1I3LA 2FLWA 2CYCA 3TO5A 1AQNA 4TYNA 5LMNB 1PL8A 1PYOA 3KHTA 3WG9A 2X9LA 2O1SA 5EP2A 2Q0QA 3ZY4A 4PHFA 1C81A 4RMGA 3B1YA 3O9VA 3S70A 4ZYWA 2ZSAA 2Z2JA 1C9EA 3C3YA 4Y6PA 1D2GA 3IOYA 4IUBS 3GFTA 3NEAA 1LNZA 3QEAZ 1QP0A 4NZNA 5DSZA 5BORA 5I47A 1NSFA 3HJHA 1AHNA 3ETGA 5IAKA 1NJ8A 2C2YA 3TXYA 4Q3DA 3TQFA 1AUQA 1COWA 1ZHHA 3BWDD 2ZJ2A 3H2JA 1ZXLA 2NU6B 4NAVA 1MFPA 3NIBA 4U5XA 3DM5A 3IPYA 3ZS9A 4DN6A 5J1SB 1XCOA 4ZQGA 1EINA 3JVUA 3SYKA 4MMYB 4GNKA 2XGJA 1MJNA 3AG5A 4LF4B 2NYAA 1BMFA 5DHFA 4IDEA 4H6PA 5LOVF 4JVSB 2BMJA 4HLQB 4NH4A 4FILA 1XMVA 3RVKA 2GEUA 1R0SA 3QBJA 5CH5A 4XJXA 4A82A 4AJJA 5FNVA 2AV6A 1AT1A 3ETHA 4LW8A 4ZZ0A 4F7WA 3R20A 3EPLA 5KYYA 3AM1A 4QXRA 1TRKA 4ZALA 4UEWA 1P8JA 3ZNPA 5DMXA 4L3OA 4CLDA 4DM7A 4F56A 1TT7A 3RF7A 5F7ZA 5KTKA 1RYNA 2FR0A 2HMYB 2PZEA 5LQRA 1W76A 1X80B 2DQZA 3H5IA 3MILA 1IY9A 3C3PA 4GYJA 2FZ4A 5C3MA 1K68A 3OIYA 3VU8A 3HB9A 5LYJA 5C0OE 3GAZA 3PNYA 5I7SA 2J0UB 3WWZA 4D9MA 1J33A 3JR3A 2AWOA 1OA1A 2WJPA 1U2SA 3WHLA 4X7PA 3LQKA 4D4HA 4Z7OB 5ICEA 1KVTA 2DXIA 1Y8RB 2H11A 2JIBA 4ANFA 2YIDA 1F12A 2QQ0A 1GAJA 4HRAA 3LW7A 1ZI6A 2HDNB 2Y6VA 13PKA 2GUWA 4M2LA 5F21A 3SPXA 4MEAA 1RRFA 1CEYA 3IIMA 2QLLA 2A6PA 1QYIA 3SBXA 1GKLA 1ZD1A 2CLIB 3B6MA 4MAMA 4PLHA 3W34A 2CHEA 3GJ7A 1Z5VA 2DX7A 4CUZA 4I3FA 1MEJA 1G6KA 5IN5A 2FQYA 2C78A 3SZLA 2K6GA 1KMMA 1N9KA 1N1DA 2NTJA 4XQEA 5BN5A 4HGOA 2Q1SA 3FFTA 4KUHA 1YVRA 2GJAA 5F9MA 3AUYA 2HGZA 5FR2A 3W7AA 4GDMA 5FBLB 1SG0A 1PEKE 5DJ5A 5LXTB 5BVHA 4LFCB 2QTFA 2QUZA 3CE9A 4TKUB 2H1CA 2ZI6A 1G7SA 3QG5A 2NO4A 4IPTA 5AKGA 3NHWA 2QUKA 2HEIA 1E5TA 4DXAA 3OJCA 2VQFB 4NMXB 4QUJA 3F0TA 4FGZA 3H8VA 5EQDA 2FH5B 1H6DA 4W7IA 5EXTA 4AYBB 2F9MA 1PJAA 2XWBF 3OY7A 3EYAA 1GDTA 4ARSA 4AM8A 3BMOB 1KO5A 5TPWA 4JITA 1X1QA 3ETDA 4MJ3A 3H04A 1EGHA 4EI8A 1DELA 2CY0A 4M6WB 1HGXA 2EZ4A 4MW9A 5JAHA 4UDYX 1GPLA 2I2WA 3DTYA 1M8KA 5DVZA 3TRJA 2H1LA 4YMUA 4OGKA 3IUEA 2PD6A 3MJDA 1ZSVA 2B69A 1SIBE 2BD0A 3IAHA 2CKDA 4WUVA 1VE6A 4ZEOA 1N5KA 3CGWA 3PQ2A 2GF9A 4OOEA 5LDDC 5IWCA 5HZGA 5JZ9A 3QUCA 4P0QB 2ZWIA 1MC1A 3E9RA 3FPHA 7YASA 2WSBA 5JCOA 1UFVA 2JFOA 3DHEA 1CUAA 5JSKA 1Y80A 1IEQA 1B8NA 2P9QA 5A6VA 2H63A 2EW2A 2VUIB 2J6IA 2PE5A 4JLWA 5LBTA 2Y27A 4IAOA 5FOUA 4ZAGA 4IFBA 2O7NA 1E5DA 2VNHA 3QY0A 4KWIA 4YVFA 4MKIA 4XM2A 5JFTA 4E03A 5DYNA 4C88A 5INTA 2AE2A 2GZHA 5G53C 1MJ5A 1IZ7A 4Y30A 3DHVA 3PI7A 4NH0A 4QXAA 1NI3A 4XJVA 2PYIA 3QMPA 2P8SA 3DHYA 1OT3A 2B4AA 1D1PA 2GBFA 2HK6A 3LKBA 5GGYA 5ILGA 5C1OA 3PDUA 1JL3A 1I80A 1PG5A 3ITDA 5CB4B 4UU7A 4I50B 1XLVA 1YDHA 3ENVA 5H68A 2XZLA 2XE8A 3U26A 3PEWA 1P7WA 1VI6A 3CRZA 4E4RA 5LZ9A 3EDCA 2RHDA 5A4FS 3FMVA 3K35A 3NV9A 3ABIA 3EAGA 4MW7A 4XFDA 1Z4LA 4X6YA 1YHZA 3PIDA 4I46A 3UPTA 4RKRA 5DIFA 4LUCA 5BOSA 2PXCA 1N33B 2B0CA 3AIIA 4PC3A 3ZGLA 4BAGA 5DBEX 5FOXA 3E9QA 5C46F 3HCEA 4Y3UA 4DAEA 4DUZB 1B4DA 2VA8A 3R77A 5CFNA 3A2NA 2ANBA 4YRQA 2ODPA 2O2SA 2PX2A 2VHJA 5JEEA 6NULA 1DWQA 2D2VA 4N5DA 1ZRHA 5SY6A 3ZZ1A 2RJOA 4E5MA 2VWGA 2WD8A 4TROA 4OP1A 2V1XA 3NATA 1J8MF 2IUEA 1E0DA 3HOUB 1FFWA 2IU6A 4OHPA 2ZDQA 4PSVA 5EKDA 5JH7A 1Z47A 5EMJA 5BSEA 3ICWA 2EL7A 3A4IA 1Y1LA 1Z2OX 2K2QB 3ED1A 4JD5A 4CKCB 2VAWA 3UUFA 3HKBA 4PFJA 2Z8YM 1J7JA 3I09A 1V1MA 3PBKA 4N4AA 1JPUA 2H5JA 1TT5B 3C7DB 1BGVA 2XYQA 3G2PA 4NK4A 4YJ2A 4H7DA 3E48A 4KQFA 3C87A 2I2BA 3MWGA 3IAFA 1P39A 1XEFA 5FIUA 4K5QA 4ZTBA 5G0TA 4EFNA 2P5YA 2XWQA 3QFRA 4F38A 3WGYA 5JDIA 4NYJQ 5DNYB 4YEDA 2W6ID 3I83A 4H35A 1TYAE 3SYRA 3LT4A 1TUEA 3S1QB 1DEKA 1DKOA 1VYUA 1RHMA 2QP3A 2BEJA 5TR9A 1DBIA 1X38A 2C04A 1HZZC 1VHLA 1SCNE 2FEAA 2RBKA 4LV5B 4MR8B 4OK6A 2PJZA 4X1OA 2BKEA 2V1UA 1ST2A 3C6KA 3HFSA 4JP5A 2A7XA 1SXJB 4M0UA 1E3DA 3O2SB 3G0DA 3PUKA 2ONJA 4QECA 3NP7A 4DLSA 1WEHA 4DLYA 5LMCA 2YY5A 3X1WA 3S2SA 1FUYB 1FMLA 2QRKA 3PXDA 4NE2A 4G0XA 3HV2A 4TV9F 5HDBB 4MINA 4JQYA 1FUIA 3GRVA 5NLLA 5KNDD 1MX9A 1RYDA 4KGDA 4LOHA 4O1IA 4BO7A 4C0HA 5EJ4A 5EE5B 3MCAA 3CRVA 2RGXA 3OQPA 2C7BA 3JXEA 1KQGA 3LX5A 3S16B 4OYHA 2PT9A 5G40A 4GE0A 1CNMA 4CM5A 1Z0UA 2X8JB 3RFXA 2EF1A 4DJ5X 4QRIA 4BFXA 2IGTA 4M9CA 5ALTA 3SC3A 2DT5A 1T29A 2R8ZA 4NNOA 1T5TA 1VBKA 3MELA 1N5JA 3C74A 5C5DA 3NT4A 5HZHA 4N5MA 1GRNA 4LF8B 1M9NA 1Z7BA 3A06A 4PX3A 1JNYA 5GMOA 3AUUA 2C9ZA 2E18A 1RXCA 2OK8A 4K6OA 4FBMA 2RK4A 1JI0A 4XJSA 5IC6A 3V7FA 1KKLA 5AI9A 2CNKA 3PUJA 2M6RA 3CE6A 4UZEA 5I4CA 5KX5B 1CXZA 3TW4A 3OKPA 3EC1A 4LRXA 5KVCA 1DRKA 1YJQA 2G0TA 2VS1A 3A7EA 5ITZB 2PUTA 2HNAA 1N57A 2JJ8A 1DFGA 2JA2A 2VN8A 3FI9A 3QKSA 2VDQB 4BQPA 4WZ6A 5CBPB 1CHNA 1G6Q1 1G20A 1GKUB 2WIDA 3UJDA 3WGVA 1CC1S 1EX6A 3GUHA 3NCTA 3HKEA 3K1AA 3C8MA 2RHHA 2JGIA 5J47A 3S27A 4K7JA 1TEXA 4JYZA 4DB4A 3OC0A 1XAJA 5FNZA 4MGHA 2XA2A 5HJ2A 2A84A 1T9KA 3NW9A 3WHKA 1TJYA 4DQUA 1HETA 3G1UA 1VFPA 2QLJA 4BMCA 3OF2A 2OY0A 5JWHA 1WQ1R 2VHVA 4RESA 1QR6A 3BQ9A 1GCUA 4J3NA 3UPUA 2IUSA 3AUTA 3TLXA 1UM9B 4PO3X 2B7CA 1IM8A 2V0NA 4YAGA 2H8GA 4EJMA 1EHIA 2RGUA 3VR1A 1M6VB 2ATXA 2C97A 2UVPB 2J9FA 4AK9A 2VWHA 4QLOA 2VSOA 2J3KA 2QP4A 3M83A 3RRBA 4DCPA 2PUEA 2OBNA 4YAJA 3RARA 1YB2A 3ZY2A 1E98A 3HCCA 4JBYA 1Z25A 5B6PA 1JKJB 4M1TA 2QTNA 4YH1A 1O6GA 1IC6A 5JLAA 2LD4A 4ENWA 3AM4A 3AO0B 5EQFA 2IJGX 4BTVA 1X2EA 2C4KA 3KC2A 1XELA 2GWHA 4YJDA 3VOTA 4QOEA 3WYFA 4CG3A 3MWDA 1QFXA 4XIIA 5EMHA 5COAA 3GY0A 1RWXA 4DZRA 2E0IA 2KB0A 3TTYA 1Y0BA 2JFVA 2O1WA 1U2GA 2ZRAA 3MFYA 4Q1DA 2HPAA 3HL4A 2BFFA 2ZZNA 1VLLA 1TM7E 1MIHA 1R66A 3VR3D 1VMEA 2BFPA 4FFMA 4OQMA 5ALZA 3ZE1B 4CMIA 4EB0A 2VPIA 2XADA 4KODA 3ULKA 3HO8A 3KQMA 3KT6A 4DPKA 3RVNA 4EEXA 2VJKA 3PHBE 2ZETA 1RJ9A 2QZZA 3I0ZA 3AIOA 4F2DA 1KEWA 1S96A 4PTZA 2IF2A 1U2TA 2ZUSA 4I8XA 1FYFA 2JD2A 4FXOA 4BAZA 4UHDA 4G9GA 2W2QA 4GE3A 4YJ3A 2CMDA 3V4PB 3NNSA 3RIHA 3ADBA 2Q9AA 1MB9A 1TEZA 1ISFA 1Y4DE 4D9HA 1ML4A 1DNPA 2QRPA 4E33A 1FSZA 1WVIA 4AY6A 1IG3A 3HS3A 3IT3A 4N8SA 1W4RA 3TQTA 2HY7A 3DULA 4KPUA 3WRVA 2FEPA 3NHJA 3I04M 5E2IA 5AK4A 4DUGA 5LQCA 1JILA 3CM0A 2X8LA 3AJEA 2RGBA 4BZZA 5KTOA 1KY3A 1G55A 1NULA 2E49A 2VZLA 2BJWA 2NVBA 3EUEA 3JD2A 3M0EA 3MTGA 3PFKA