2D2VA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with maltose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein slr0953
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
total genus 94
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2d2vA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2d2vA02
5FP0A 3IRUA 4UMVA 5ALRA 1Q92A 1L7PA 2FPUA 5ALUA 1LVHA 4NWIA 4Y2XA 5A3SA 5ALNA 2AGVA 3DV9A 3AR8A 4UMDA 4BYGA 4EX6A 5AIBA 3NANA 5AI8A 1XP5A 4HYTA 5ALZA 4UMFA 3WK9A 2ZXEA 2EAUA 1TE2A 1RDFA 1J8DA 1YS9A 1SWVA 3QNMA 2ZBEA 4Y2UA 2ZBGA 5AM2A 4JB3A 1O08A 5AESA 4XE5A 3ZWKA 3ZVNA 4L6CA 4KX5A 1RQNA 4YIHA 4BX0A 1L8LA 3U19A 5AK3A 3WKDA 3B9RA 3WK6A 3VAYA 2B8EA 5AIAA 5AW1A 3L8FA 2YJ4A 5AI6A 3FM9A 4UATA 5AI4A 4CF3A 3SHQA 5AVYA 4OHFA 2HEGA 3KDPA 2AH5A 2HX1A 4Y2QA 5AM0A 4Y2RA 2FPWA 1PW5A 3OCVA 5ALYA 5IT0A 1L8OA 5AKXA 1T5TA 2AUTA 4MUMA 1L6RA 2JAWA 3QX7A 2HI0A 1YMQA 4KN8A 2JGAA 3N5KA 2YMLA 2BY4A 3QU2A 4BKMA 2ODAA 3L1UA 2OA0A 2MSNA 1Q91A 5AVUA 2DQSA 2EARA 3KC2A 4PNHA 3SKYA 1WVIA 3QUCA 1RKVA 3ZVLA 2CFRA 3KZXA 5AKJA 3U7EB 3ZWDA 2FUCA 1MH9A 2W43A 4GIBA 4C4TA 3PGLA 3QU4A 4Y2JA 2JAUA 4OD0A 3ET5A 3SF0A 2G08A 3WK7A 5AICA 4BNDA 3E84A 5AKIA 1L7OA 2HF7A 2FEAA 3B9BA 4UASA 1Z4QA 2WF9A 2Q4RA 2ZOSA 4YCLA 3AR3A 5AK4A 3I28A 5AKZA 2YBDA 3EF1A 1RQLA 2FPRA 4I9FA 5ALFA 4C4RA 1ZD3A 3FZQA 2WM8A 1NNLA 1JUDA 3SD7A 1X42A 3AR5A 5AVSA 2C8KA 3R09A 2FPSA 3QYPA 3L0BA 3OCXA 5AVTA 3AR4A 3DDHA 1ZD4A 2B1RA 2G06A 2B0CA 2I6XA 4EZEA 2MU1A 2R8EA 2WF6A 3QGMA 2CFTA 2P69A 3WK4A 3ZW7A 4FE3A 5AVXA 5AKGA 3L0YA 4YH1A 1N8NA 2I34A 5AM4A 2IOHA 1ZRNA 2OM6A 3QU9A 5ALJA 3I6BA 5AW5A 1KYTA 1VJRA 3DNPA 2G0AA 3DAOA 3OCUA 2WFAA 4FFDA 4HGRA 5AHXA 2G1AA 2BDEA 2W11A 2P27A 3W5CA 5ALPA 4J2TA 4AP9A 1RMTA 2YY6A 3KOOA 3A1DA 3ET4A 1Z4KA 1ZD2P 5ALMA 2FUEA 4DFDA 3PCTA 4B6JA 3A1EA 2ZBDA 4Y2VA 5AW0A 3L8GA 1Z4OA 3NIWA 2C4NA 4Y2SA 1RLMA 3L7YA 2ZBFA 4UW9A 3IJ5A 1Z4JA 3A3YA 5IS2A 2FPXA 4BNDB 4E88A 4EEKA 3PDWA 3WKAA 3ESRA 1WZCA 4KYTA 1O03A 3AR2A 5AK6A 5JJBA 4H1WA 3HLTA 5AVVA 2YJ5A 3N8GA 5AKKA 2WF7A 3ED5A 2G09A 4BEVA 3UMCA 2QYHA 5AKHA 1F5SA 1FEZA 1ZOLA 3MMZA 1Z4IA 3N1UA 3ZUPA 4L57A 4EELA 2D2VA 4EENA 4QJBA 2ZG6A 4KNVA 1ZD5A 1Z88A 4HAIA 2B8JA 2IOFA 2IOFK 2G80A 1Z5GA 4IFTA 3QUQA 3NALA 1T5SA 1QQ7A 5AVWA 5AKLA 2HF2A 2I54A 2YJ6A 1U2TA 4F71A 3W5BA 4ZEVA 3KD3A 1YNSA 3EPRA 3ESQA 3B8EA 2I7DA 2R8ZA 4L6AA 3SLRA 5AVZA 1YV9A 3WGUA 5ALEA 4I9GA 2YMMA 3BWVA 5AM3A 2B1QA 1WR8A 2PKEA 5A3QA 5AVQA 3CNHA 3OTQA 2IA5A 4BEWA 1RMQA 1Z4MA 3E81A 5AK5A 3UMGA 4AS3A 4UM5A 1L7MA 1U7OA 3WKEA 1XVIA 5AM5A 3W5DA 2C8LA 4UARA 5AW8A 1RKQA 2BDUA 3HYCA 4ZEXA 2JARA 2WF8A 1VJ5A 1Y8AA 1ZRMA 3OCWA 3CZ4A 2RBKA 1TJ4A 3TLMA 2I55A 1CR6A 2GMWA 1CQZA 4NV0A 2YN4A 3EF0A 4G9BA 3AR6A 3U13A 4NAVA 3SKXA 4UAUA 1S2OA 1EK1A 1SWWA 3R9KA 2HHLA 4HGOA 5ALHA 3FPSA 4BX3A 3E58A 3U7GA 2G07A 2P11A 5AI0A 4ZEWA 2C9MA 3AR9A 2QLTA 2GO7A 4Y3UA 3PGVA 1RPZA 5ALSA 3AR7A 4YCMA 4OFZA 2Q4TA 3NASA 1SU4A 2HOQA 3R4CA 2O2XA 3UM9A 3QUTA 1RLTA 1IWOA 1VFPA 4DCCA 4Y2PA 1AQ6A 4G63A 4MWOA 1EK2A 3SMVA 3QXGA 1QYIA 1TJ5A 5AW7A 3FPBA 4KNWA 2NO4A 2GHTA 1QQ6A 2JAOA 5AVRA 4C4SA 3QU5A 1QQ5A 2GHQA 3QLEA 2OYCA 3ZX5A 2R8YA 4EX7A 2WHEA 2PQ0A 3S6JA 1U2SA 1ZS9A 1WPGA 3E8MA 4UM7A 4HGQA 4RESA 4BBJA 5IT4A 4DWOA 2B82A 3OPXA 4UU0A 2YFYA 1YJ5A 3ZX4A 1TA0A 3KBBA 4CF4A 1J97A 3K1ZA 5ALWA 4FYPA 2OBBA 1U7PA 2HDOA 3W5AA 5AM1A 3WGVA 2EATA 1LTQA 5ALVA 2RB5A 3M9LA 3L1VA 5ALQA 3EWIA 5ALOA 1N9KA 4Y2YA 2AMYA 2B30A 3ONNA 5T41A 3ZI4A 3U7FB 1RC8A 2CN1A 4XPZA 4GXTA 5AW4A 3NAMA 4F72A 1QH9A 3J7TA 2NYVA 2FI1A 2X4DA 3F9RA 5ALLA 1L7NA 1U02A 4Y2TA 3U26A 3U7HB 4UU1A 2NO5A 5ALKA 1YDFA 2RAVA 2IYEA 5AW6A 3M1YA 1RLOA 2W4MA 3N07A 1NRWA 3WK5A 5ALIA 3MN1A 3BA6A 3L5KA 5AW9A 3ZVMA 2P9JA 3WKBA 4AS2A 4RETA 4CNQA 4XQ0A 4NFLA 4UMEA 4CE6A 4KX3A 3D6JA 3WKCA 3QU7A 1NF2A 2VKQA 2YJ3A 4UAVA 2HCFA 2GFHA 2YMQA 2HO4A 4QQFA 2C88A 3A1CA 2R8XA 3MC1A 3L8EA 3I76A 3ZU6A 3ZTYA 2I33A 3RF6A 1RMYA 4OCZA 3I1YA 5ALGA 4CF5A 1Z4NA 3QUBA 4O8CA 2O9JA 3WK8A 2RARA 3OCZA 5ALXA 1XPJA 3GYGA 4HGPA 4YGYA 2FDRA 1Z4PX 5ALDA 1RKUA 4IG4A 1Z5UA 3UMBA 2Q5EA 3FVVA 3OCYA 5AKYA 1T9ZA 3FGOA 4NABA 4JDPA 2WF5A 3RFUA 1TJ3A 5A3RA 5AW3A 3L8HA 5ALTA 3L0CA 3MPOA 2YMPA 5AW2A 3NRJA 4HGNA 5AI9A 4YIKA 5E0OA 4DW8A 3P96A 1K1EA 1ZJJA 5AI5A 4BX2A 4J03A 2HSZA 2PR7A 3NUQA 3IB6A 5AKEA 3ZTWA 1RRCA 4XOUA 1Z4LA 3N28A 4YCNA 2CFSA 1S8OA
chains in the Genus database with same CATH superfamily
2HL6A 5F73A 5IAEA 2C96A 3F78A 3U7RA 1N34B 1S4QA 3WA6A 4BY1B 1ORWA 2E2HB 1U8FO 2YV5A 3B3QA 2BSXA 1OUMA 2FPUA 4XIFA 1OXUA 5L51A 1YK0A 1ZNQO 1QYXA 2DJ5A 3D4OA 3P4UA 2B21A 3AL3A 4RPHA 5D8DA 4R2MA 5ALNA 1GDDA 4EVRA 3B7PA 1VHWA 1EVZA 1R10A 4FX2A 3CV3A 2C94A 3G2PA 4HDNB 4EX6A 2G9VA 2PVSA 4PX3A 1MMFB 4O08A 1SURA 5B1HA 2XVYA 4AULA 1IWBB 2YVKA 5ALZA 4CKCB 1SUPA 1NXWA 4FFVA 1ADBA 1KAMA 5ELXA 2JHAA 3WTCA 3OJFA 3K1AB 4RKFA 4H6WA 4RTJA 1NG1A 2XB4A 4RHEA 4YRTA 4B3TB 3PP8A 1TZCA 4TV8A 5EMJA 2O7RA 3A27A 3RBXA 5HUHA 1M5UA 3VH4A 1JJAA 3FWZA 1EX9A 1L5YA 3BF7A 3ETLA 3QKWA 2J3LA 5JO9A 3GLRA 1NP3A 1UIMA 1X6VA 4MUHA 4D9CA 1QRSA 1VSVA 2Z3WA 4TSRA 4YJ3A 4DAEA 1L8LA 3GH1A 3EZYA 1TOAA 1ZIPA 3B9RA 3OIWA 4LECA 3TUJC 4LRUA 3EDCA 3SQDA 5BWLA 4G24A 4FCCA 1UBKS 4F21A 4MW7A 5C3UA 3UMJA 4YCAA 3GJ0A 2Z5VA 4BNHA 4Z3KA 4OUDB 1QGYA 3OHPA 5FUYA 5IVHA 2CV0A 4XGQA 2PCJA 2MHCA 1ABBA 2NO1A 4WZBB 4RD0A 1YS4A 3QTTA 3KVNA 4ENVA 4Y2HA 2Q1UA 3E0XA 3EPPA 1KY4A 2ZITA 1CR2A 2YWBA 5FBHA 3WFIA 3D59A 3QQPA 4GMHA 4DLKA 3BWCA 1XHLA 1M2NA 3EWSA 4E6PA 1Y37A 3B5EA 4MITA 2G25A 3C6MA 1DCFA 4QICA 1K8QA 3U0VA 1JWLA 2OMEA 1CVRA 2JANA 3H4TA 5IFLA 2J9YB 2I99A 2B4AA 1BXRA 2WC1A 1KSFX 1SQFA 3K8OE 4FE4A 4LI3X 5DXFA 3SZRA 2FPMA 1YHYA 4AF7A 2I78A 5HE9A 1L2TA 3PFFA 1L7BA 1G4HA 1HDXA 1S5PA 2A67A 2X3YA 4G25A 1PNOA 2J7KA 4WASA 1HY3A 1DWUA 2W2QA 3PC3A 4IVNA 3LCMA 1QTQA 5IXJA 3A4LA 4ZTZB 1Q44A 3EXFA 3KSAC 2OZVA 4BLPA 1NXQA 2C42A 2I1VB 1NW8A 4MS3A 4WBSA 3SE7A 1VI2A 1LA2A 3N8KA 2W43A 4DXAA 1XMPA 1H3EA 2BEVB 3VC2A 4OJQA 3T12A 3P32A 1GGFA 1P31A 1WUJS 2FQXA 2ZRDA 3HB1A 4MUXA 4US0R 3M3DA 1O5TA 3ZUGA 4BO9A 1IDOA 1NBMD 1S8AA 3H65A 3UH0A 4I4NA 2DFKB 3FOWA 2VXOA 2H7CA 1L7OA 5H80A 4QDKA 1BS2A 1YS7A 1YAJA 1T2VA 3H8SA 1VJDA 5TPWA 4JJ7A 2RK4A 2QNBA 1H3FA 1SG9A 3ZD7A 2A0KA 3HJAA 1JSLA 4KB5A 5LQCA 3MRVA 1YZHA 2B8TA 4KE6A 3RR2A 1YKGA 1JUDA 2VHUA 1NXOA 2ZYTX 3UCXA 5K0CA 2JAPA 5HF8A 2E3JA 3VR4A 4M46A 4URZR 2BI7A 2DBRA 4N12A 1GCGA 3C70A 2J08A 3H9UA 3OTHA 5E4JA 4JOCA 1THZA 1P1BA 2VQFB 4Q12A 1J25A 2VUMB 2R8BA 4GVXA 3IPAA 2ADFA 4HL6A 3RYIB 3O91A 1WD7A 4FBLA 4U63A 2AMFA 2MR6A 4EUSA 1ZITA 4KIGA 1P1CA 1QC5B 2WK1A 5EXPA 1Q1QA 2JA7B 2X8LA 1BGWA 2IYLD 2QZ4A 2IOHA 2JCVA 1CEXA 3I9KA 3D7RA 3T1YB 1NPTO 1QGUB 3HOXB 4B17A 1NURA 4PZDA 5AHXA 2PO5A 4PFJA 3BSWA 4QBGB 2BDEA 2PQ6A 2P27A 3W5CA 3RANA 3OZSA 4R1UA 2IT1A 1V7PC 2YY6A 2A0YA 1YB1A 3ET4A 1HYBA 1GUAA 2DPHA 3EVAA 3I4CA 2YZGA 2ZREA 3I92A 2BE7A 2FUEA 3KVYA 4F12A 3ZDCA 2YWHA 2FN8A 3SS8A 2FZLA 2QN6A 1EB9A 4N47A 3S17B 4DSUA 3ER9A 3BMOB 4QUEA 1R4ZA 1VJ0A 3V1TC 5IDQA 4B8YA 1FU4A 4EZIA 2OHGA 1P1IA 4FEYA 4MNTA 3H1TA 5BT8A 5KDDA 3OMXA 1ZSYA 2IZZA 4DJTA 1A7UA 2JLUA 2L2QA 2ZSEA 3IJ5A 2HUPA 4AKGA 4NEGA 2EIHA 1NVDA 4RPIA 2WP0A 4HADA 3NWOA 1X9HA 1XZLA 2VWHA 3IP8A 3WKAA 5JEDA 4C4ZA 3I32A 1U2DA 4WZ6A 1F7UA 4K86A 4D6PA 3ZK9A 3TLZA 4J16C 1FSSA 3JX9A 3KCNA 4NCKA 4EBBA 5KSYA 4MKHA 3PDUA 1U65A 2FX5A 2BFNA 2YXEA 3LOPA 5AKKA 3WWDA 4DMFA 4OHYA 2OO5A 3HVKA 3P19A 1DPGA 4B79A 3PK0A 4FW9A 3UMCA 1XHEA 5H9VA 3T7KA 1VYUA 3PU6A 1C2YA 5FTJA 1E1LA 2H4YA 1G7TA 3IP6A 2EJCA 4LHSA 2Q9AA 1F20A 4Y7DA 3QG5A 3OJXA 3MJRA 4XH9B 1TWGB 4KQHA 3EZ7A 2QPLA 3MZ0A 4TOIA 3IKLA 3DVQX 4MQEA 1XWIA 4B9AA 3WAGA 1DAPA 1Z34A 2EG5A 1X87A 4BFYA 3ORFA 3KQUA 3GFGA 4OSEA 1KBOA 5IAGA 1YD7A 4RD4A 1UMDB 3W8DA 5ES4B 3VH3A 2V0CA 1Y1QA 3B3GA 4Y0VA 3VHLB 3AMVA 1GLVA 5KTSA 4B32A 3WVNA 2XDQA 4D92A 3UATA 1Y5NA 3T1VA 4YT5A 4O8ZA 3B51X 4D0GA 5J2TF 1GN9A 5C5CA 2EJWA 1UK7A 2YNMC 2HQRA 5TQ0B 2QAGB 1XV5A 2AJDA 1SPBS 3BMCA 2O7QA 4MAMA 3ICCA 4RAQA 4QYXA 4LTMA 3WDLA 2AC7A 5A3QA 5L3QA 2YW9A 2NXNA 2I3GA 2QLNA 1XWWA 2ECQA 2ZP1A 4RSGA 5C7IO 4GE0A 5T3YA 2NX2A 1TQ8A 3BWXA 3R3HA 5D6OA 3K4PA 4I81A 4X24A 2OD7A 4EJSB 5I5EA 1CU1A 5DCUA 2C59A 3S2DB 3PUZA 3MCAA 3LHDA 4A3BB 2V7BA 4O3MA 4MYDA 4MQ4A 5FI5A 1YRWA 1DBQA 4IIVA 1HRDA 1MRZA 1UT5A 1YZYA 4OP2A 3AHGA 2Q6LA 1EHCA 1QAQA 1F2TA 2KPOA 2L42A 2O3RA 2W00A 3NU1A 1M34E 2IIPA 4V39A 2IF0A 1KO7A 4RGYA 3UJPA 5K4GA 1GWNA 1P1JA 3DT9A 4DANA 1E66A 2P40A 3N6XA 5F7JA 1EFRD 1EXWA 2YHUA 3NVDA 5CB8A 2DQ4A 1Z6QA 3PZRA 3OX3A 2Z5LA 2QMYA 1SVWA 2O4UX 3GFVA 4L76A 5EINA 3P52A 4WLNA 5SICE 5CA1A 2ODEA 2GK3A 1FNMA 4A8HA 1V8PA 4RKEA 4RTRA 2G1PA 2FETA 1L7DA 4MUKA 1EBFA 1DDIA 3DTVA 4CHGA 4V1CI 4LCBA 1UT8A 1SQ5A 5ISMA 1FDOA 4KQKA 4C0SA 5GONF 2XXAA 3PFWO 4D3YA 5FL7A 4KN5A 4EBFA 1I4OA 1YDMA 1Y3FE 2QL7A 1XF9A 3AFGA 2G9NA 4PNEA 5I7FA 1C1YA 1RXEA 4ZPXA 3U7GA 4REMA 4CMHA 1ND6A 1KO8A 2XNKA 5DPMA 1GTG1 2HV8A 2P11A 3WMFA 3MT7A 3NNDA 3DKRA 4LTDA 1MZPA 4DMHA 2QL9A 2WSSD 3QVMA 1FQWA 3AR9A 4ZRNA 4Y3UA 4EY7A 1MTOA 1Z5VA 2AZ4A 2VHTA 5B3JC 5JCOA 1IHOA 4FNAA 1N2ZA 2HSDA 4MB6A 2ZCVA 3I34X 3UAWA 3NASA 1SHTX 3OG9A 4NG4A 3UENA 4HWSA 3UKOA 4LF6B 5LBIA 1UZUA 1YDHA 2YWEA 2F1RA 1GPDG 2HA3A 2QZZA 5FA5A 3ZIUA 2J0UA 2EJUA 3A7DA 3UM9A 1ACLA 2IEDA 4TGLA 5B6IA 5JD4A 2Q5FA 1VFPA 2CDBA 1M2JA 1MZVA 4FEGA 5JC8A 1U3WA 5KNLA 1ZJYA 1AS2A 5D3MB 3WLTA 3Q85A 2E4ZA 1RAGA 4XLTA 3H05A 4C7BA 4NQRA 2HCBA 4EW2A 3AC0A 3PNMA 3FX2A 2B35A 3NHLA 3SHFA 4COOA 1REQA 4TXHA 4D9FA 3F4LA 3O82A 4BDTA 4QRHA 1T8RA 2BGNA 2C2HA 2HWYA 2L69A 4L8FA 1DFHA 2BUAA 1UKYA 2N47A 2H2DA 2Y8EA 3OOYA 1TCBA 3N70A 3HSKA 3S6JA 2JFFA 2JPDA 5EHNA 5KYYA 3OIGA 2XOKD 3NHAA 2YY5A 4FE7A 4M9XA 4UBIA 4ENQA 4YMSA 3CF4A 2H5IA 1WNFA 2X0EA 2BDTA 3Q11A 1XTJA 2DM6A 1VE6A 4ZOCA 1AQYA 2CKDA 1O9HA 4NBVA 4B85A 1KJ8A 4A5SA 4BO5A 4QG3A 3TOCA 1RIFA 1XK6A 4YBZA 4NOKA 4YJFA 3GLGB 2W42A 3E18A 2Y9MB 5T8KC 4B3BA 2C20A 2V6BA 4QOFA 2AJBA 1PZNA 1KR2A 2PAFA 1PD0A 2P5SA 3GZNA 4GT1A 3ILYA 2RJNA 3MTIA 4ZEMA 1KYYA 3BGVA 3RVOA 2E55A 3BVPA 1DBPA 3BAFA 3E0QA 1J97A 2SICE 1LX6A 1MGPA 4RGVA 5ALWA 3DWEX 1WE2A 3K0SA 1PJ2A 1NPYA 1B15A 1T6BY 3EGOA 4QAJA 4ZO6A 4XWTA 3UT0A 4FDVA 1O3YA 3MXTA 2O3UA 2IH5A 1I80A 1IU9A 1NQWA 2CLCX 2NZXA 2VK8A 1X7GA 3JQCA 3B70A 3MLBA 4GBMA 4RVUA 4Z9XA 4MUGA 4DQVA 1TVCA 5JBNA 1Z9BA 5HM8A 5LZ4A 4D9NA 1A7JA 5K05A 1AKYA 2GEBA 1GKLA 3ZI4A 1B7GO 1RC8A 4I2VA 2HO5A 5DCWA 5BWCA 3ZZ0A 4GXTA 3W0LB 3E9NA 5KOHA 5JANA 2PUCA 4J94A 1HZZA 2QMZA 3OQ1A 2CLMB 3J7TA 4MGEA 2ZXUA 2I6UA 2PX4A 1HLGA 2IZ6A 3C14C 3F46A 4RZQA 2H4XA 1W87A 3SXPA 3V42A 3V3TA 1NG9A 4C6RA 4KI7A 3SG0A 2GPYA 3FCAA 3MGCA 4IGIA 7GPBA 1YJBA 1UL1X 2PUHA 4UCQA 1AGPA 4NJMA 2D13A 1HMPA 4FGSA 3IHTA 3QEBZ 1LTHR 2P35A 4B6FA 2OGZA 3JU3A 3P2OA 1QP8A 3O8NA 3AKZA 1I3MA 2A84A 3BA6A 2ADOA 5AW9A 5HJ7A 2VRWA 3KT3A 3OC6A 4EH1A 1OGIA 3GYBA 4X90A 1G16A 2B69A 4NY1A 4Q7LA 3CYFA 3VO1A 4CMKA 4YMVA 3I23A 1C0IA 4U2FA 4BU1A 5E7JA 4GYKA 4DSAA 4AWAA 4C2UA 1A5BB 2NTJA 3ENWA 3EODA 4P1ZA 5A1JA 4R31A 4HCJA 3ZHTA 3WLJA 4G1UC 3KOYA 2RIRA 1OOEA 4X8OA 3ONDA 4B48A 2HCFA 4RLFA 3M9WA 2YMQA 3KK0A 4HB0A 1J7JA 2YINC 3MMNA 3CU5A 4PG8A 2RI1A 2C78A 1IZ7A 3A1CA 1R9NA 2WSIA 3HQ4O 3MC1A 1RRFA 3M1IA 3ZWCA 4G65A 4XIJA 3GA7A 1QAOA 2BONA 4JVLA 4D8TA 4EHNA 3FRJA 3PHHA 2XJ9A 4OGGA 1G8AA 1OXXK 2HBRA 3LUKA 2R1TA 2XUZA 2DHCA 1L4UA 4HLUC 4KAAA 5EIXA 3VPXA 1PWEA 4UC0A 4INOA 2GBGA 2L0XA 1NAHA 3CUKA 2W6IA 3B2QA 1DHRA 3E22A 4II7A 1U1EA 3GRKA 4UUQA 4W8GA 4B74A 3OAAD 2XB6A 2N75A 5H8WA 5BRAA 1RWPA 4KGVA 4ZFNA 1JMYA 4G1EB 5BSUA 1HDRA 4Q48A 4UFOA 3G88A 4UUNA 4EZBA 3REQB 3W8RA 2NO9A 3SNHA 5IPFA 2UUCB 4XDYA 1IRIA 2AQIA 3SGLA 5KPDA 4KKVA 1WMSA 2R6AA 3H83A 2D2IA 1EWYA 1LBHA 1E5XA 2BMFA 4U9IS 4ER7A 3S8MA 2Z9DA 2YVAA 1K7XB 1MVNA 5BR1A 3AEUA 1IEXA 2IU4A 2A86A 1KVUA 4MCJA 3KZKA 1U2RA 3ES9A 4RD3A 3PXXA 3NRJA 5AI9A 2I76A 2WUFA 3PQEA 4KBYA 3QEMB 1TYEB 1CPYA 1MO4A 2KBFA 1F1JA 2RD2A 1FFYA 1K1EA 3AUFA 2D54A 1G9TA 4JL5A 5F1KA 4BX2A 4EQ6A 4EW3A 2AMLA 2HK9A 5BSEA 1IE3A 2OAP1 4N5MA 1PJSA 3COWA 3K9NA 1H23A 2K7ZA 5AKEA 4D9MA 1OH5A 2EX1A 4LVCA 4XD7A 4YUXA 1MGOA 4FXOA 1CKEA 1WUKS 2BKEA 4X3CA 1PL0A 2OZEA 3P5BA 3LNCA 4YHBA 1AB5A 1KEPA 5LMUB 4FFRA 1NSTA 1VZ2A 4INJA 1XAGA 4R41A 2EW2A 3CF0A 5DGDA 5EUBA 3ZJYA 4A3JB 1EFKA 2EF0A 4KXYA 2HMYB 3VU3A 5KU1A 4LFBB 4ZYZA 2NU9A 1F51E 4CN8A 2ZIXB 4G0PA 4BP1A 4LQDA 3KO8A 4L1KA 4OB6A 4B6SA 4KGZA 5EHXA 4LSGA 1P5HA 1KO5A 3A04A 4XUCA 5BSMA 3UK7A 4I8DA 3WTBA 5K09A 1Q0TA 4ZVOA 1FP2A 1JJBA 1X3LA 2JI6A 1H69A 2X2PA 4U7FA 4NYMR 3M5DA 4BP9A 5KMGA 1NVUQ 2G6BA 3G0OA 1T0PA 1ZUWA 2FSPA 3GCGA 4P4GA 4ALMA 4AJ9A 5GINE 4X54A 3S68A 4NZZA 3CH6A 4D96A 1HLDA 2AXEA 2VYCA 4P5DA 4U6SA 5M3BA 1UZNA 1Y6GA 2CHUA 2QPAA 1QO0D 1BQ4A 2CJYA 1FYXA 1HYEA 1N8SA 2F1KA 4Q0MA 4NBUA 3ZCSA 2X1LA 4UXHA 3FSGD 1CZUA 4EJ0A 5LOVA 4FKBA 4M9QA 4RJLA 4M1SA 3VR2D 4RD2A 4KGDA 4QOSA 3ZXUB 4I50F 2JIDA 3GLUA 2GUGA 3GRFA 3P26A 4UZFA 4N40A 2ISCA 3JASB 1EGMB 4DC9A 1P0IA 1UZMA 1YZFA 1PJAA 2REQA 2CSUA 2HEGA 4TS1A 3RUIA 4BFCA 3TSCA 4W9MC 3NEPX 3PDIB 4AAYA 4LJ7A 5D84A 1TWHB 1W88B 1BHQ1 1P2GA 1FS4A 3W4KA 5C53B 4LISA 5KTOA 3K6SB 4YMLA 2P6RA 3A6KA 4K8OA 2LW7A 5IT0A 4GBGA 3MGAA 1SPXA 3TD2A 4BMVA 4D80A 4CV2A 3TLYA 4MLDA 5G2OA 4OLAA 4LQCA 1EP2B 4AI6A 2JA6B 3H9EO 2ODAA 3OPVA 3P9QA 3TX6A 2H9AA 3ZHXA 2O0LA 5CU7A 4A2CA 1XAJA 5K4AA 2O8EA 1G18A 1DDOA 2CWDA 4MEBA 3OMWA 3QJGA 3OF5A 3SDSA 2N9UA 1KERA 1U0RA 1L0BA 2GZHA 4HB4A 4XPIB 1YRYE 1YQWA 3ZZTA 3C4QA 4KVGA 4HZIA 1Q7RA 4E07A 3EEQA 4JLPA 1M7BA 1CDEA 1X7ZA 2Y1LA 3D6VA 4Q03A 2YZNA 5F7OA 2BP7B 5HKOA 1Y33E 3ROQA 4EPWA 3AHFA 3KS9A 1L4MA 2PRKA 3KZXA 1C3OA 2XQGA 1PR9A 4QXPA 1U28A 2EFHB 2YH2A 1IUKA 1TJPB 1ZOPA 4NE9A 2AYXA 2WV7A 4OBEA 2PBFA 3LUDA 1VL1A 3FCCA 1YFKA 1H1LA 3NV9A 5CVCA 5DLQC 4CLRB 2CXQA 3VYRB 3QIAA 1ZN7A 1JDBB 2VEDA 4DIFA 1ETUA 5KX5A 3W04A 3KZNA 2BMJA 1XDBA 1B8UA 3I42A 4ASUA 1V4VA 2VT6A 4HFJA 5CNIA 3TBHA 1JBEA 2V7TA 1IMOA 1OPXA 2XWJI 4YC7A 4DLVA 3IPYA 4HX5A 1Q1BA 1CR4A 3MYRA 1KWKA 5A71A 2OP0A 1CZNA 4HUQB 1E1KA 5JH7F 4RBNA 4OHPA 1ADJA 2PU7A 3IAXA 4WBNF 1PYDA 4NNOA 1NBAA 3D4IA 4NBWA 5B55A 3AR5A 1C1DB 1QZ3A 5AVSA 3I2HA 2D5AA 1Q0QA 2O48X 3LO8A 3P9XA 1RYDA 3II6X 3QYPA 4RTNA 4I55F 4RPKA 1U6JA 2ODPA 1EINA 4MYSA 2H1RA 5LXTB 1PJTA 2VDVE 5K20A 1U4OA 5IJ9A 1P4RA 3GZJA 5B3LA 3GLFB 3H7AA 4PSDA 2DY0A 5LD2B 1Z56C 2E2JB 1KIAA 3AQ4A 3PHCA 1CY1A 1CY8A 3OECA 4NXMB 1QUEA 4GZ3A 4R2JA 3ZTTA 3DE2X 2VTDA 3KETA 3HNOA 4PLGA 1KEUA 3ECCA 4UHDA 4FQ8A 4V02A 4N48A 1MV8A 2X1VA 4P5EA 2ZTSA 3KR9A 1SBYA 3N0TA 3KX2A 4HAZA 2ATCA 2C5GA 2H85A 5BUCA 2DHDA 1C9YA 2PUJA 4GU5A 1XK7A 2HRCA 4LDNA 3V8QA 4DDTA 5K0ZA 1RJGA 2BT4A 4JJ4A 4NF2A 3R4VA 2E1PA 3AQIA 2J3MA 4Y30A 1ZMBA 2F1IA 3NHWA 1JAYA 1NLUA 4AY5A 4XWOA 4WK0B 3DCJA 3FMFA 3L93A 4B3XA 1J0BA 2ZRIA 3HS3A 2QT0A 5KYKA 4U8HA 2A5DA 4U2EA 1V4BA 3F8WA 2JC3A 3R75A 4DUPA 4HWPA 2HK6A 4N5IX 2LV8A 4MKIA 3BQMB 4N0QA 3SBXA 3T7RA 4NEQA 3OZVA 3WE7A 3DUFA 3QVJA 3DM9B 1SCUB 3FUXA 1G5PA 3TD9A 2ZBFA 3U31A 2JHPA 1JBQA 3BX1A 2TMGA 1IXZA 2XE7A 3HY6A 4WI1A 1HDOA 3LPDA 4JCOA 3JD2A 3G6WA 2WMDA 3OLQA 5A4DA 3NTUA 1K5DA 4RKWA 1XXHA 1TD9A 2OLJA 2PQ2A 2VJOA 5AK6A 1F9AA 4GPEA 1ZM7A 5JR3A 3H2BA 3PEFA 3BE6A 4QUKA 5AVVA 1NKSA 4UZSA 4Y1EA 3IIEA 3H17A 3BORA 4M0FA 5FBZA 3E7WA 3WZMA 2H1SA 3WRYA 1EG2A 3AF4A 2NO0A 5FO0A 4FDLA 3NAQA 4GGMX 4IDQA 5TS3A 2WFZA 2NTNA 3SC2A 2CKMA 2ZWIA 2OL4A 5KTRA 1JG3A 5CNMA 1YCHA 4W6QA 3I8XA 1FFHA 4DBVO 3S27A 1SD2A 1U9IA 2JJ1D 1NGSA 1LQTA 2PZGA 3OKPA 4IM7A 1NX9A 4DC1A 1ZD5A 3C5VA 2JAQA 2RGXA 4HAIA 4UOEA 1RWNA 2PT5A 1UDRA 1FDSA 4MROA 4QNRA 1CUYA 5JWRA 5BVHB 1I6KA 3PXCX 4KHPB 1CJBA 1YU9A 5H16A 3DBHA 2HYIC 3VR5H 1L5RA 2FN7A 5CEJA 1LPOA 1PL6A 1RQ2A 4FEEA 2JGKA 5IU6A 1T43A 2C3UA 1JHOA 3EUFA 2BFPA 4FZ3A 3ESQA 4GI2A 4EG6A 4IW3B 4AP6A 4IIDA 1UJ6A 4EJFA 4XGKA 4C0JA 2PK3A 4QYIA 2R8ZA 4UTXA 1KZGB 3PGA1 3WWYA 3JQPA 2P5TB 1NI5A 3QW4B 2WWGA 2TS1A 3HWSA 2Q3FA 4R8LA 1JA9A 1W25A 1NVEA 4HAOA 1ZLYA 3PZBA 3UV3A 2RGUA 3EXG2 7ABPA 4U8GA 3DZIA 3QHPA 4P4UA 4TWAA 2VNIA 5DGHA 2HYDA 1NVTA 3E81A 3WYAA 5HZGA 3H1FA 3H97A 3MUFA 3QJ5A 3HK2A 3B20A 1LLCA 3ZGZA 1PNQA 2YV1A 1B26A 4ARBA 3DV0A 1BWSA 4BJHB 1GEGA 1NVAA 3DC7A 2RGNA 3IULA 3WGNA 1ZGBA 2C8LA 3ETHA 3IUMA 3O2JA 2WT8A 3DE5X 1WP4A 1X39A 2C4TA 4K6KA 4UM9D 4C2AA 5ELLA 1NF8A 3K9FC 3IX7A 1CLEA 5KYUA 1JR3A 1XQXA 4PQFA 2PKWA 3HL0A 3QOFA 3ZWQA 2VHJA 1VKZA 3CWQA 3RRXA 4B2PA 3BOSA 4C4AA 1RU3A 3LDUA 3NC1C 3SYMA 3EAGA 1KJIA 1J8VA 3OFND 4Q02A 2I55A 4IGAA 5FOQA 2W2KB 3NGLA 5BNZA 3GTKB 2OXEA 3COPA 4DMLA 1KYQA 1DL5A 4LDRA 5LDDC 1H42A 3VO2A 1NKTA 3IXLA 3EF0A 3LSTA 1WW3A 2EZUA 2NADA 4QYSA 2J5RA 2JH3A 3VR5D 1JQ3A 1I9GA 2WJZB 3TRDA 4C6HA 3WIBA 3P2EA 2AOTA 2GF0A 3CMMA 1T0HB 2XOEA 5EJ6A 3HYTA 4IZHA 4EGQA 2EC5A 2NUBA 4OFWA 1VMIA 2C82A 5TGDA 3RVQA 2P77A 1SD1A 4XKJA 1XWFA 4A8PA 2AYZA 3WIVA 5M2QA 1KPGA 3WG9A 3E1SA 2VK2A 4PO9A 2AXPA 4ZTBA 2QRUA 1RSZA 4DABA 1VE3A 3UHAA 3MQ4A 1DC4A 1WPQA 4GPZA 5L8VA 4EUNA 4TLLB 2VHXA 4EA9A 4IUCS 3UJNA 3QOYA 1ZVMA 3S2ZA 1UBGA 5ESRA 5CB4B 2QMEA 1XC7A 5ALSA 1U7DA 1R74A 1CRQA 1DLJA 5CA0A 5D7NA 2XX3A 4PPQA 4KSCA 4C4OA 1QQTA 5IH3A 3VSDA 1E69A 3FB1A 4CT4B 4J2HA 3BJMA 2OV2A 3V8MA 3GTOB 2Q4DA 1XDDA 3W5UA 4AJJA 4BBZA 1GXSA 3HN2A 3MTEA 2IU0A 3DKVA 4Q9LA 4ZQEA 5BSKA 3ANMA 1NR5A 4V1CB 3PRYA 3SK0A 1QZXA 4L08A 1MRNA 5EJ5A 5HM6A 3HCRA 2HF8A 4A3SA 4NPHA 3X1KA 3BFXA 1TO1E 4M22A 3HEMA 1GZ7A 1RRPA 1MAWA 1JH9A 2WSLA 2Z83A 4IDEA 1FVHA 2BGUA 2X86A 3AK4A 4Y9UA 1FYDA 2YW2A 3ZX5A 2ODBA 4OGKA 2IC5A 1DAFA 2FJPA 4Z4QA 3S16B 1L3CA 1NZDA 1UPXA 1QFYA 3NHUA 2Q3DA 4FYJA 4JJ8A 3JQBA 2W8BB 3KJFA 4HDSA 4DR6B 1FYEA 2VEOA 3V2IA 5EY5B 1UC5B 4UM7A 2PXHA 4Q3DA 4RJJA 3PGXA 1H2HA 4UFPA 1BKSB 5DTRA 4YHHB 1BCRB 2J9GA 1KJYA 3PE4A 3OSZA 4M86A 4E2WA 2J3HA 3GEPA 4O2BA 3QPDA 4KZKA 4M49A 3IKTA 3ON5A 4MHSA 3AFMA 3ZQKA 4POOA 8LDHA 3VKWA 1N7JA 4D44A 1M54A 5AXCA 5GWXA 3SEZA 1WB9A 3RIHA 4CF4A 4K9PA 3F0TA 2BJHA 3K1ZA 1E6CA 1WXEA 4FYPA 1UJBA 3T4PA 4AJOA 1ZL2A 3A0UA 4UVDA 4CFZA 1RBMA 4LWQA 3WO1A 1CE8B 3PXGA 2PYIA 1VECA 3EXEB 5CHYA 1JE0A 1RHMA 3ZD9A 1U5AA 2N1MA 1ABEA 2RG1A 3A9RA 5ALOA 2E21A 1HA3A 4W5RA 5LNK6 3NRCA 4IMIB 2WJYA 5T41A 3EJ6A 2DFNA 2RGCA 3G2KA 1Z3IX 3KKOA 2ECOA 4G5FA 5KHLB 2XUIA 3ZS8A 3NAMA 3R0QA 1IL0A 4CEHB 3OQVA 4B33A 3DVAA 4NMWA 4L8WB 4X6LA 1JHRA 6LDHA 1OROA 4RQTA 4LOKA 3ZXYA 2VFAA 2IITA 3R5HA 3BIWA 2BVNA 3TLCA 4RLQA 2ODQA 3DE1X 4RF2A 4IQFA 3W5VA 4NMLA 2F4VB 4G4IA 3AI7A 3GBSA 3O74A 4KK4A 4R71A 2V58A 3C7TA 1JVSA 1U0EA 1NRWA 4OK6A 5DOVA 2I2DA 3K35A 2GTPA 3KTOA 1O6ZA 1DEXA 2Q5IA 3CUYA 3IBCA 3L5KA 2A7QA 3C3CA 1U7TA 3OM1A 4HSGA 1Q0RA 3VNBA 3VJLA 4BAGA 4UUAA 1MB4A 1NRJB 4GF5A 4F5EA 3O3OB 5BMVF 2G6TA 3PTZA 5LU8A 2QRKA 3OZTA 3LYUA 4NCBA 1QH1B 2XAAA 1W49A 5JS1A 1KJ9A 1P1RA 1FL9A 1XNGA 1EWKA 2NAPA 1S89A 2Y1KA 4CMAA 2LTAA 3F7OA 4K3UA 4P8RA 1ZD1A 1S2NA 2F67A 2KLHA 1U1IA 5HJ2A 3O21A 2VP9A 4JDUA 3OJCA 4OXRA 4PHCA 1UXGA 4Q34A 2OPHA 1C7IA 3P27A 2OG2A 3D7NA 3L07A 1BMTA 3OVMA 3CEMA 2D5LA 2JJ8A 4NH4A 5FHQA 5IRCD 4MA5A 2XIQA 3SVZA 5AFSA 1YQDA 2E6KA 4G23A 4I2NA 4MGYR 3P7MA 1O0BA 1AIPA 4MYRA 3TO5A 3WBKA 2YXPX 1PEAA 1RMYA 1RHRA 1SXIA 2YJTD 3AM3A 4TZKA 1JQEA 4GPD1 2HLDD 1V8ZA 2WMYA 1BDHA 3ZN2A 2BF7A 1RWMA 1ZM9A 4OATA 3GCDA 4WK4B 4OOFA 1O8CA 4OQZA 5F4ZA 1A9PA 4R8RA 4ERNA 3KTAB 3OCZA 5E9AA 3ZWOA 5L40A 4CEIA 4QUDA 3NHZA 1WY7A 1HXHA 2OK7A 5DBEX 2GCNA 3T34A 2FMIA 4RQBA 4TLDA 1E99A 3TGPA 2WKSA 4Q66C 4KIUA 5CFOA 2I1QA 1FW8A 4CMIA 1NUSA 5K0LA 5FBKA 3VPFA 2QLJA 4EGFA 3ZDAA 2IVZA 2WTEA 1VSQA 5A3RA 3O3MB 1NXPA 5ALTA 3ZQUA 3NYRA 2EP8A 3EXHA 4P81A 3AVUA 4ZI7F 3M7IA 5CVTA 1F0YA 1OLSA 2AEFA 4L7VA 4B0PA 4WERA 4BUZA 5HQTA 2P9TA 1C9NA 1PJLA 4KBFA 1JEYB 1K3FA 3E9YA 1KP3A 1FDIA 5CVDA 4ZWNA 1KU0A 1RTTA 3C87A 4OSOA 4J03A 5HKBA 2BTQA 2F3PA 2NSYA 1IBSA 1X74A 2QXTA 2WD8A 3UXHA 4F38A 3R8CA 2HTEA 1CFZA 5CLLA 4LYGA 1RWQA 4OX9B 1E2GA 2PLAA 3K8ZA 3VSEA 2DT8A 4YJHB 1KAEA 2DX7A 1PV1A 2EX4A 1U8UA 2HNKA 3LVFO 4QU9A 1RIIA 1WHSB 5IG2A 1M0SA 2G82A 4C14A 4J1SA 4UMVA 2OFPA 4LZJA 3NXSA 3NV7A 4KFTA 1NJFA 2KBEA 4D6XA 4CMEA 1TKBA 3JWJA 3TI7A 2FFBA 2ORIA 2QAGC 4PNPA 3WDSA 1BVUA 3EIQA 4R51A 5HQJA 4OLBA 1XMIA 4PRYA 1DKRA 3QPUA 2OESA 5AIBA 2ZJOA 1CS0B 4GO1A 1MBZA 3CCBA 4RSHA 5GV8A 2ON6A 4MQUA 4HYTA 3WGZA 4E5VA 1RZRA 4DUGD 4EJSC 1H85A 3HRIA 2R47A 2MIIA 1DQSA 4C0XA 5DBHX 4R3NA 5IBPA 2Q4OA 2WSYB 4GQIA 2V74B 2LWIA 2F17A 4B4VA 2BFBA 1MB2A 2ZI9A 3QNMA 4IJ6A 2XMQA 3LT1A 1Q15A 4CRWB 2CHVA 2R79A 3LHSA 3RYFB 4ZYWA 1KZ9A 1R0LA 3MTAA 5AESA 2H48A 1XA3A 2ZIWB 3A6HA 3ZWKA 5LP6A 1ZIXA 3TAHA 3V9AA 1E3QA 4I5FA 1GTL1 3U17A 1V11B 2ERYA 2Y93A 2QXYA 1OYVA 3WLKX 2OZLA 5DP1A 4LRYA 3JZMA 1PFKA 4AYTA 3EPLA 1HDZA 1FTQA 3KEFA 3FZGA 2RBGA 1ZMTA 3ASUA 3EDMA 4OHFA 1X8KA 3SHQA 1U6KA 4AWXA 3I2YX 1WMFA 4KWCA 1T26A 1U9ZA 3UK2A 1XO1A 4EUFA 5CLFA 4NE2A 4AJEA 1CERA 3QIVA 4YS6A 2ZSKA 3AUUA 3NH6A 3AIMA 3LPNA 1MT0A 1U3TA 4H9GA 5CK5A 4AG6A 2HXYA 4LRSB 2NPFA 5I4IA 1X7XB 3T8YA 5C8DA 1XRJA 1JXQA 1ZA2A 3AHEA 2JAWA 2CJPA 3U44A 1E2HA 3O1LA 2OENG 1XDGA 1BHJA 4IEFB 3RDPA 4BQSA 5HOEA 4J7AA 2AKAB 3V34A 1RXSA 2BIFA 3GJ8A 1UQRA 1WKCA 2CLKB 1W4ZA 3KDAA 1SVSA 1NQAO 4QOGA 5AR1A 2JBAA 3LTNC 3K0EA 5HIMA 5L4SA 3F1LA 2LCQA 4PSCA 2VNHA 3F6RA 1A5SB 1N9GA 3V8NA 3B7WA 4WK6A 2QY9A 4O4JF 4JXKA 2YJGA 3U9LA 1F6BA 1X1DA 4EKEA 2QN3A 4JSRA 4MI6A 4P6VF 1JKXA 4GOOD 4K2AA 1UK6A 1GIAA 1Z15A 2WTAA 3L02A 4N0DA 2F8LA 2R8RA 3CEAA 2UZIR 1J00A 3IEXA 3NCHA 3NGMA 4BO2A 4DCUA 1EUQA 3T0IA 1XNRB 1U7XA 4XJXA 1TM2A 1B73A 4I1YA 3JWGA 2FPPB 3NYWA 4R83A 3VTKA 2BKLA 2ZETA 3LKBA 5EXTA 4E51A 3GLHE 2GYWA 1P7CA 2G4CA 2I4IA 3PDJA 4I9HA 1OYOA 3UAZA 1QCCA 2ASEA 2I7XA 3AJEA 4MV8A 3B1VA 1NVFA 4GEKA 3R3XA 1F8UA 1X7HA 3EFHA 3B9BA 4KFCA 2I62A 4OQLA 4U7PB 2P2ZA 3X2FA 1W581 2JDID 2R3SA 1O94D 1U3GA 4H0CA 4N1AA 4F91B 4IXNA 2YRXA 4WE3A 3ICVA 1NVWQ 5AHRA 2YUIA 3H18A 3GL9A 5ALFA 3RF7A 3ZKWA 1Q95A 3EZXA 3OZEA 3MCTA 2ZJBA 5CYPA 2C29D 5C1DA 1W1WA 3C3AA 3IBFA 4H3KB 1TK9A 1RKBA 2GT1A 4PC3A 1BGXT 4ZAGA 1ZVJA 1FSZA 1QNFA 1QFJA 1SXJB 3BWYA 3GN1A 3KKZA 4R2WA 1ODIA 1OLXA 2ZULA 1JJFA 1UKZA 3AETA 2VZEA 2JKZA 3PPIA 4OLJA 1WDTA 2NT4A 4PHHA 1NWHA 1T1RA 5HCUA 4B76A 2OCAA 3HUUA 2W6CX 3M6LA 3DDHA 4XQEA 4S0XA 1E9EA 1FNSA 1DUIA 3SJAA 4DM7A 2B0CA 1T3HA 3LUBA 3QEJA 2CV2A 4C3ZA 4CLHA 5EIWA 3B9QA 3C97A 2Q3MA 4ZV4A 1P5ZB 4J0FA 2Z6VA 1KI8A 2IPMA 1K66A 5IJ0A 2I34A 3RQSA 3AF0A 1QP0A 2WA2A 4J0HA 4LYJA 2HLHA 1ENOA 3JV7A 1QH0A 5C31A 4YPVA 5BR4A 2Z8ZA 1DMRA 4LW8A 4LYYA 5AT1A 4WKGA 3JYNA 2LKCA 1RLIA 3KSRA 2F6RA 4S24A 4IOKA 4DDWA 5KU7A 2EVWX 1CSEE 3A1DA 3NAZA 1BDIA 1PR0A 3GNQA 4ZGBA 1BH2A 2VTEA 3M3HA 1WU8A 4WXRA 2OCKA 3DLCA 1HE2A 1QF9A 5H70A 3RB8A 3WI7A 1KZYC 1ZWKA 3AOEA 2VK1A 5JVDA 2WG2A 2XF2A 2R86A 4P54A 5KYVA 3X1MA 4V0MA 3ZD8A 1D7AA 1UJNA 3N3BC 4FFOA 5FTMA 1HPLA 1OFTA 2IEYA 2PEYA 4LXUA 4EHIA 3TNYA 5EKUA 3AUXA 4G37A 2BCGY 5K8LA 3DLBA 1TAUA 4HI0E 1X13A 1E5QA 3PDWA 5DX8A 3HLKA 1ZINA 3HV0A 4MKXA 3WGJA 1Y1VB 6REQA 2B3DA 2IYZA 3NDRA 1X1QA 4IDPA 1B6GA 2IU3A 4RL4A 1GCIA 1NI4B 2RKWA 3STHA 3UUEA 4AZ0A 5JJBA 3ORQA 3VJRA 1YO6A 2YJ5A 4PZLA 4L51A 4YP9A 5TLSA 3CSSA 1ZNYA 4B4DA 5CYOA 2B99A 2E37A 1ILWA 6Q21A 5IZCC 2PH1A 2PSEA 5LA6A 2VZLA 2NUAA 4FIDA 4Z8YA 1QXSA 1TQDA 1W47A 2IYXA 2QAJA 1Q1GA 3BH7A 3KHSA 3ZDFA 4AURA 2A59A 3MMZA 4G2TA 1H4QA 3OFKA 2P2YA 1H9CA 5E8RA 5K2MA 3QJYA 4QVIA 2QI9F 5C8YA 3CGGA 4LOAA 5HSGA 3L5OA 1NUTA 4DV0B 4Y6GB 3TZLA 3UJ6A 5JNSA 3KCQA 4GWLA 4JLSA 4X1IB 4FGJA 2IOFA 2XYPA 1FNDA 1WD5A 3HP7A 2X8WA 2VUSA 2PD3A 1SUEA 1I9CA 1T5SA 5K45A 4HPJB 2I4RA 3PRKE 1UAGA 3QVTA 1IN5A 1QTNA 4YGXB 3ZEIA 4Z4EA 4YRNA 3MJHA 1ES9A 3S2FA 2D74A 5KI6A 2BKUA 3RROA 1YIDA 2Y92A 3EK2A 1W6RA 3OOHA 4NPCA 2AHRA 3OPYA 1M1YB 3U4IA 1EFLA 3RRYA 2NVWA 1U1GA 3SE0A 3SLRA 4OH1A 1U7ZA 2B61A 5AM3A 3ZJUA 2YMMA 3BWVA 3DPIA 3UUWA 2HCTA 1Y6JA 1JZQA 2CK3A 3Q7EA 1ZI8A 1JLLB 2QTVB 2Z8YM 3WV4A 3VKFA 2YJZA 4F4FA 1Y3IA 1P9LA 5HF6A 1WSAA 5C34B 1PUJA 3OEEA 3PKJA 4JZKA 2OQ2A 4LZAA 1T8WA 4MIKA 1TJYA 1L7MA 4V0LA 4JJKA 3MWEB 2ZSUA 1FSPA 3GI1A 1U7OA 3RS5A 1MA0A 4EGSA 1VL0A 3KKPA 5B7NA 1CZHA 4OXQA 4NZPA 1SA0B 5JC1A 4A36A 1V41E 2ZRQA 1ORTA 4GD3Q 3M1LA 3ZGXA 5ADUS 5D5PA 1E5VA 3A9UA 3HU3A 4N49A 4G5SA 3V55A 4F8JA 2ZBRA 4R0MA 5JXGA 2IPOA 1AS3A 1TU0A 4HNVA 5IP5A 3LUPA 3VJKA 4KXLA 3JARA 1ZGHA 4AF6A 2ZRLA 1OWOA 2X0KA 3N53A 1SK8A 4MK4A 5EHZA 3DEHA 4OHMA 3IQWA 2R6ZA 4QJ4A 1VRCA 2QMUA 5DWVA 1JDTA 4H6PA 2IFTA 2IUTA 3WQHA 1L8XA 2XQJA 1BVYF 1YRQA 4OXXA 5EMHA 5HF5A 1JJ7A 1AE1A 3BTOA 3U60B 4BATA 1DIHA 1LK5A 2I1WA 2PZEA 3RUAA 5BOSA 1SQ6A 3ZYZA 3OF3A 1S2LA 2VF8A 2WJHA 2G72A 2QX6A 3KQTA 3VKVA 4OLHA 3F96A 4GOXA 1J4AA 3L04A 3JVIA 1NBIA 1YQGA 5AI0A 3PC7A 1USKA 3D2LA 1FXWA 3PNPA 1GLGA 3JQ8A 4TTQA 1KDOA 1GVNB 2YVQA 4YP7A 1C4OA 3RJTA 2GO7A 2XZLA 1XTVA 2MINA 3F98A 5A6SB 1QHXA 3Q7SA 4TLEA 1AGNA 1E1MA 3AR7A 4Y18A 5BQXA 3IUBA 1OLUB 1CEYA 1JR4A 1WF3A 2UVQA 3W1WA 4C22A 1A4IA 4FDTA 5HKKD 3CVYA 2IUYA 3U39A 4YMTA 1KGSA 1G3MA 4MS4A 3H5TA 4MICA 2EERA 1M75A 5D5QA 3NRBA 3KQMA 4DR5B 5JYEA 4Y2PA 1GAQA 1CUIA 4CXMA 3ITNA 1DG3A 4HPXB 1SVNA 2GK7A 4NBLA 1QDEA 4DQUA 2VDNB 4NNJA 1JEDA 1KL7A 4B7XA 4RVDA 2RMKA 4EHLA 5JATA 4C7OA 2PX5A 2WM2A 1UBLS 4D46A 3SZGA 3WL3A 3CPHA 1JG2A 4FSHA 3AM1A 3E7FA 4GM1A 3ODPA 2AWNA 2Q2OA 3OQJA 3GQBB 3QPWA 2ZATA 2VTBB 1Y81A 2DLCX 1TYZA 2OB2A 3ADKA 3EWNA 3WR5A 1C9JA 3ZWYA 3AI2A 1G2OA 4BEBA 1ZS9A 3N39C 4JB8A 1PQUA 2FW1A 4RS4A 1G4UR 2LKDA 1V43A 1KK2A 1II8B 2OCXA 3DE3X 4NCIA 4PQGA 4YRSA 4NXNB 3DAGA 2DTEA 4HNAB 3CLUC 2I3BA 4B2IA 5C3EB 1A4RA 2HC9A 1Y6RA 1OI4A 3PQCA 1HGXA 4L8GA 4BIMA 3N2EA 5LKRA 5AQ1A 2WU4A 2KE5A 2VDWA 3I3OA 1NLZA 2O3QA 4FNMA 1SVKA 4HZUB 1JDBC 3FWKA 5B64A 3IAS1 2EDCA 2G63A 3UMFA 5B57C 1BDJA 1N2BA 4Z7OB 2CXUA 2OSBA 5ES3A 3KPYA 3MGGA 4MJ3A 1IBLB 1XTTA 3OZGA 4LSZA 3CCFA 4MULA 5JWHA 2EATA 4O0LA 2H52A 3NWJA 5EUMA 1NXSA 3NWPA 3AP3A 4B2YA 1OH6A 1RWOA 3RYFA 3UQYS 1VLZA 2I3DA 1Q57A 3IQDB 2R7LA 1QB8A 2NV0A 3HR8A 3ZY5A 3RU3A 3E4DA 5D3QA 2X42A 4QZVA 1D7OA 4KIWA 4U2DA 2N42A 1E0AA 4J3FA 2XRMA 4GSYA 4ITRC 4MRVA 4QATA 2ZAYA 4YCJA 3T3IA 4H27A 1W96A 4GLLA 4F72A 2QPOA 5ANRB 3W77A 4PQYA 2I2FA 3EOAI 3I5UA 3KPWA 3HVRA 4BS9A 2NVTB 4OYLA 3WLOA 1WETA 2H92A 2VJAA 5BW5A 1QHFA 4R1NA 2O0JA 3DKPA 4EB0A 2JGJA 2IHNA 4EMSA 2CDNA 2VR1A 2VRCD 2QRZA 4YRQA 3EGXB 1L7AA 4TL8A 4RTSA 2Q4BA 1H1TA 2XWQA 5FFMA 2QN7A 2J6HA 2P6PA 3SXJA 3F3MA 5HDQA 4CL0A 1KHTA 2VH2A 3MN1A 1JSRA 5IK2A 4LMAA 4DCGA 3ZVMA 1BMQA 5CGQB 3M5WA 3Q87B 3DZJA 4PVDA 4PN7A 5JY6A 4DWVA 4QEKA 5DRYA 4CNQA 2J9FA 4J4TA 4Q4JA 4YO7A 4UUOA 1PTJA 3TDKA 2B0JA 3WKCA 3U1TA 1SVMA 4KR3A 3SX0A 2KWIA 2PXAA 2VKQA 1P3Y1 5CRIA 2HAEA 1PL8A 2QRPA 4A3DB 1E3DA 3WNBA 4YXFA 1Y8QA 4GYYA 2W2TA 3FYCA 4RKRA 4BFLA 5BW6B 2WNSA 1PE0A 3CNEA 2Q62A 3LY9A 2BKAA 4QHSA 4YJ2F 2Z56A 1JGTA 3RVRA 4DF3A 2ZQ5A 3HA5A 1C1XA 1I7PA 2Z08A 5LZ7A 1TUIA 3QMMA 1PU2A 4IH4A 2VPXA 2GKOA 4J91A 1PT9A 1OGJA 2QTHA 2ZYUX 3PUHA 4EHAA 1PJRA 5FH9A 2Q9BA 1FNCA 1Q1ZA 1UIRA 3M6FA 4F6LA 3VZRA 4MQBA 3IYLW 4DNFA 3PLAE 1G8GA 2QN2A 2RH4A 4ZOLF 2CE2X 5KUTA 4WKOA 1YE8A 3NIBA 5BRJA 4FR0A 3S29A 3TLXA 3GYGA 3AYZB 4MEAA 1Z5UA 3ELYA 3AGPA 4RWEA 1YRHA 3JAKB 1DIOB 2WHRA 2CNBA 4KZPA 2EQ5A 2K5UA 5AXDA 3V7YA 3BQNB 5DXAA 4B35A 4BMYA 3N0VA 2WF5A 5DBGA 1RYEA 1TQHA 4TYMA 1RACA 4RX1A 3VBEA 3NG1A 3D0OA 2BUCA 4RSMA 2PSSA 5BO5A 5TF4A 3STWA 2VXYA 1H1DA 1A8SA 4ZOQI 4MYTA 3Q5GA 2FUG6 2CMHA 4UM9B 3FVWA 3MPOA 2Q5OA 3K1TA 1N5OX 5E9QA 4K0KB 3AVOA 3AI3A 4YIKA 5EZYB 2O05A 1FDVA 3QM1A 2OHJA 2A4MA 1ODTC 5K8TA 3HU2A 5ETJA 2IK8A 3GTLB 2WQZA 3NUQA 4KTTE 4D9KA 3C85A 4OM7A 5K3FA 1QHHB 1M2VB 2XUJA 4P3XA 3GJZA 4FHEA 4JQOA 5CX1B 3ZNNA 121PA 4CT5A 5LZ9A 4RANA 1O77A 3GCZA 4WNAB 7AT1A 1LSJA 3T1OA 1R0KA 1UINA 4CNBA 4TZ6A 4O2AF 2NM0A 4TV8F 1CT9A 1Q6YA 4OXIA 2NXEA 4QOHA 1RXIA 2FR1A 5EZ5A 2XMSA 3NWEA 1NW5A 3WYNA 3T3OA 2CHFA 3FTDA 4RPGA 5TQVA 1JQKA 1Y34E 4B3FX 4E5YA 2ZE5A 4JI1B 1ZC4A 4UMFA 2JJ2D 3K2EA 3T1HB 2RG7A 1ECCA 2EAUA 1UPAA 2CXSA 1TE2A 2HQ1A 3HA3A 3MBOA 4JLDA 4KNYA 4HK4A 5FUBA 3R7LA 1UP6A 4X84A 3T06B 2BI8A 3UWOA 2DPXA 2QTGA 4TTAA 2OVBA 3K0AB 3LKDA 4NYJQ 4Q7MB 1K6MA 1SBHA 2BGTA 2SKDA 3HBNA 4G8JA 5BVGB 2XNCA 1OX4A 3RS4A 3MYYA 3P2KA 5HIAA 5C5EA 3HYSA 3M6WA 1LFAA 4TMFA 5EZYF 1BYIA 3E9EA 3PQDA 1W0KA 3L43A 3CJTA 3R3VA 1DWPA 4C4XA 4UNNA 5ED0A 1PHRA 1BZYA 3FHOA 1I3CA 3EBLA 4FOTA 1Y42X 2O1SA 3RK1A 4MVJE 2R11A 1UODA 5DHRA 3UJ3X 5KC8A 1FF9A 3EQ9A 3DXYA 1CIPA 1QS0A 1RZVA 1NJ1A 1Z29A 2AR9A 2O2ZA 2YS6A 3H11B 4GVLA 1LPNA 4H1HA 4QYMA 1TMKA 4AG3A 2DPLA 5LQAA 1UXJA 1EFPA 3DV2A 2FMTA 4XSGA 4UCFA 2BHNA 1IN8A 3USES 4BY7B 1V7CA 2BCJQ 1PAUA 4YRRA 3QYAA 1L6RA 3VUEA 4DLNA 1X1RA 4KC0A 4QVGA 4ZXFA 4AUEA 1OBHA 5ITWA 2Q5HA 3N5KA 4KPEC 3D7MA 5THQA 2V8OA 4RKQA 1XZPA 3OHSX 1I6MA 4TXMA 4CJXA 1RPAA 3SF8A 1W75A 4TQGA 2V55B 2V7VA 1AJEA 1KEWA 1P29A 3KKQA 4KDRA 3KC2A 2GHIA 1HL3A 2FB9A 2VZ8A 4PSKA 3WXMA 4ESEA 4PNHA 5DYWA 1OW3B 5IYZB 1H0RA 4DMGA 1NE2A 5A5GA 5FOWA 1H8ED 3AUAA 3HKDB 2Y0CA 4EUEA 4FLFA 1R6BX 2ZR9A 2WHPA 1JG1A 3HNPA 4CLOA 5KSZA 1NAIA 2JIRA 2WYOA 1XFDA 1X14A 1Z0KA 2ZE6A 3OSUA 4TL6A 3V4RA 4MJLA 3RSHA 4D8YA 3PGLA 3RTEA 4ZOAA 1KI2A 5HTOA 2ZUEA 3JAWB 1YJQA 2WB4A 2ID4A 4GBED 4EI2A 2O5CA 5T4BA 2JGEA 4Q05A 4A2WA 5HA5A 1MX9A 1QYWA 4RVSA 4BNDA 3MD9A 2EV9A 4L4YA 3E84A 4RKYA 3FVTA 3ADPA 3MTQA 4ZQGA 3JTMA 3S7ZA 2TMYA 4UASA 2ONKA 3ABOB 4RMHA 5G3ZA 4ARZA 1KYVA 5AK4A 3HCWA 1XTUA 3Q15C 5DVZA 3WQQA 2ORYA 1TW3A 5IULC 3N74A 4JJGA 4YJGB 1DB3A 4FFSA 4TYNA 4AG5A 3U9SA 3TBFA 4KO8A 4BMPB 4QE3A 2VA8A 1YQQA 4LHWA 4CTKA 1YL6A 5C18A 1FPMA 4LWPA 1Y6FA 2HDNB 3K9LA 2ZCJA 1DEHA 1ZL0A 3VH1A 3P9YA 1A5ZA 4BTLA 2HU8A 5K01A 4KRFA 4L0CA 1Z62A 4EYEA 5I4BA 2NW6A 2VNAA 1E2IA 4TKUB 3V4LA 1OFVA 1J5XA 1LPMA 2B5WA 3U4GA 3M4OB 1G5TA 4QT0A 5F51A 2C7PA 2HMAA 5KVAA 2XT9A 4EG4A 1AY0A 1QB7A 4E7PA 2CDAA 2WD7B 2BOVA 3G2LA 2C2WA 2X0RA 4IDOA 1TM4E 2RKBA 4ML3A 1SHZA 1QRUA 1TECE 1TYAE 1Z7BA 3HSSA 3OZAA 3TTSA 4D8UA 2QYOA 4IZOA 5CD1A 2HHAA 4YMUA 4TUYA 2ID9A 2CBGA 1UPBA 4X0EA 3FWHA 3C6XA 1GL7A 4GPTA 5AM4A 2DH6A 3HJGA 3IUEA 4X94A 4OMCA 2IHZA 3TQSA 4KXFB 1ZN9A 3I6BA 4PSUA 4E5MA 1YR2A 3DBLB 4LF4B 1E1QD 3RT9A 2QBYA 1IJEA 3NTXA 4X9XA 4MAAA 4A93B 1I32A 3I8SA 3T7CA 3V1YA 4LG1A 3SQXA 3TQOA 5CLIA 1IDN1 3OEYA 3LLSA 4WJKB 2XTNA 2E89A 2EKZA 4LJ8A 4QIHA 4UHEA 2Y4OA 5BV7A 3AFNA 3B1YA 1NNUA 3G8DA 1RRGA 1OFUA 3EIFA 2G5PA 3NOQA 4G67A 2AG8A 4MVWA 4K88A 1Q22A 2Q0QA 1DKOA 3D1LA 3GJYA 4OA8A 2C04A 1R3DA 3R7SA 3BRQA 5EKSA 3BHNA 2R0QC 1MAHA 2ZB3A 4JJEA 5B7QA 3O8OA 3P2YA 4ZCLA 1JNXX 2PBZA 4IIEA 3U2QA 5KKCA 1EG7A 1YONA 2GBLC 4FMCF 5ARCA 3B38A 3GEHA 4UULA 4EG8A 4M8IA 4ENUA 3HLYA 4RH1A 4IBOA 4WKNA 2O0KA 4R81A 3T5DA 1LSSA 1FRNA 3CM0A 1TIBA 3LLUA 1N33B 4DJJA 2G9QA 3VO9A 3P8ZA 4DEVA 1SBQA 1KBQA 2ZAMA 4CMJA 1GRNA 4JITA 3ZLTA 5IUKC 1TCAA 2JJQA 1QGOA 3HPQA 3WL7A 3UCFA 2CUZA 1G3UA 1BHSA 1R4MA 1QLWA 2WZBA 2M6LA 3UXYA 5BNWA 2C7OA 1EVEA 4MARA 4G3XA 2ODWA 4BE7B 1RWWA 1SXPA 3AL0C 1W2HA 4US1R 4RZIA 2I8LA 5JI2E 2ZS7A 5DE3A 2BFFA 3D4PA 1AN9A 2OAGA 2VZ9A 3QXSA 5EC8A 4H1UA 4P5PA 4QJBA 1PFUA 3NDIA 4L15A 2IU6A 2HIAA 1PDOA 1CLUA 2GZAA 1P9WA 3DEAA 3NHBA 1PR2A 3RHZA 1CD5A 3A4TA 1P7YA 2AXQA 3NJRA 4Q37A 1E8NA 5E3IA 5AVWA 1VC2A 2CB0A 4TKZA 2FFQA 4F3RA 4MUJA 4C04A 4WPGA 4BRWA 1GZDA 2V8BA 3R8FA 3CX8A 2Q1SA 3R7WA 4X6YA 5SZJA 5M7EA 4AW9A 5TE9A 2VUHB 3N2YA 1G21B 5DULA 1N77A 4YN3A 1WEHA 2QMHA 4FMBB 4PIMA 4S0ZA 4EPTA 4Y2GA 4BNFA 3ZH9B 3LYLA 1TT5A 1W30A 1FVFA 1X7DA 4UBLA 1WR8A 2X76A 1Z35A 2H2GA 3VPDA 2JZOA 5KYNA 3FPCA 4BP8A 3IAEA 4BFWA 3R1IA 4GKJB 5F76A 1T2NA 3FF1A 2L19A 3GJTA 4CMGA 5AO9A 2VYFA 3NKVA 4UM5A 5JHHB 2QK4A 2OORA 3FOAA 1QHEA 1ZEJA 1UBRS 1GL3A 1KZ4A 2GPWA 3LGSA 4H15A 1W35A 4KO3S 4YWJA 2DWQA 3BFKA 2HB6A 2V6MA 1G291 5CG2A 2WU3A 5BOVA 4B83A 2VPQA 4EMUA 4HNHA 5MGBA 2R84A 3VFDA 3JALB 1EZ4A 5T6MA 2QROA 5DHPA 1ETHA 1WW8A 1Y5RA 2VDQB 1DBVO 1ZUNA 2HBYA 2PVPA 1UZAA 3GRZA 3QELA 3W2EA 1VCOA 3WMGA 3B6JA 2V5UA 2CMDA 4ZN6A 2NPOA 3A4VA 2H57A 3BFPA 2RH8A 4UD2A 2ZJ6A 1NX6A 1SXQA 2H1IA 1XEWY 2W2NA 2CJXA 1FS6A 3L6RA 3QRWA 2FCAA 5DKFA 5BURA 2GXSA 5G4KB 3X1YA 3KYJB 1IEQA 3BXPA 4IV8A 3KWFA 3CEJA 4M88A 2IE8A 5ALHA 3TQTA 3U49A 4OJMX 2IYNA 4NHEA 5CNJA 1OBVA 1SR8A 3T1NA 1P4AA 4BZXA 3FTEA 1CUWA 3HE3A 3SJBA 3MFYA 2WHYA 1OB5A 2P3LA 2JFQA 3QHQA 1NASA 3DMRA 3OH8A 3O8BA 4MLCA 4JLWA 5CXQA 3V6LA 1JAHA 1O96B 1ORRA 2XYHA 3PFNA 3WYFA 4CN9A 2V0GA 1DKMA 3DBRA 3EUAA 4HX9A 3D7SA 5DGXA 3H9QA 1UCFA 3DSRA 1MOQA 4NC9A 2H1HA 2OLEA 4FQ5A 2Z2IA 2ZSFA 3G23A 2I3AA 4NOJA 2DLDA 2ZSHA 3R6GA 4TQUS 5DCYA 3NOOA 2B5OA 1XQ6A 1XU7A 3CRW1 2O2DA 2YICA 4MWZA 3HO8A 5LBUA 3HKBA 4DMRA 4AUMA 3EA5A 2RI6A 2ANCA 1DKPA 3IP9A 3OPQA 3R5SA 3RHFA 3SQMA 3AP2A 2G67A 4TM7A 2J4FA 2Q4EA 3O4FA 3PUXA 2BEJA 3P71T 2X1HA 2WWHA 1Z5PA 2QOEA 4U0JA 3V46A 4FB5A 4L9AA 3JYPA 1GR1A 3JR7A 4PZAA 3LW8A 1UXOA 5F52A 1NOKA 1ZOSA 4HFMA 1ARZA 3BKWA 3O93A 5LKAA 2DERA 1OLOA 2ZFUA 4LMPA 4MYUA 4XWWA 5JD5A 2VP6A 1SCDA 1J42A 3AEYA 4JX9A 4P31A 3RSZA 3ZXIA 1XMVA 1A8IA 2GRUA 3FROA 2PR2A 3OIUA 4OA5A 1N5DA 1LY1A 2FQQA 1UDWA 4JQCA 3RRBA 4Q9HA 4Q1VA 3TMKA 4B3HA 5ILOA 3C6YA 3GROA 2X22A 2NVUA 2QQ5A 4WCFA 4DG8A 3ND6A 2ZRHA 2VF4X 4MLPA 4EKGA 3EY9A 1JKJB 3O7WA 4XJTA 3ZX4A 4NFYA 5K2OA 2PRZA 1PJBA 1W29A 4WEQA 3GLIE 2C77A 2NG1A 4L9RA 4PPGA 1BDBA 1LPBB 1L5OA 2IP2A 1V16B 2QTMA 5C8VA 3UXMA 4QTUB 2R1UA 3RGGA 4BNXA 3C3KA 3IRVA 5C1BA 3I45A 1CQIB 4HP8A 1V3VA 3IT0A 5DIZA 3SC4A 3L1VA 2PJRA 1VGRA 1PWZA 4IJVA 1N9KA 2HJWA 3LLMA 1YHZA 2DQZA 2FMXA 4Y2YA 5J1TB 2GPAA 2O8DB 3RSOA 5CLGA 4K1LA 3VPAA 1D1QA 1GCUA 3F6PA 5AJXA 4OL0A 2FWPA 3BCHA 3OOJA 1SXJC 4WINA 3UTDA 4C76A 1SB9A 1L4NA 2XF8A 2ZSJA 1TPYA 3AG6A 1JI0A 3HXLA 3SKVA 5KINB 5KNCH 4CM4B 4D8WA 3D4BA 2R6HA 5HK8A 5G0TA 4IIGA 1T1JA 4W8HA 3KVRA 1L7NA 1XNQB 5IT9A 4PBTA 3TTUA 2E82A 4DIDA 5BR8B 2DWUA 2ERXA 1N7GA 1YKFA 4ZTUB 4WDQA 3EG9B 3UJAA 1TC1A 3E7DA 1LJLA 3VR1A 1JRLA 4B4KA 1E32A 2FOLA 3WK5A 5T57A 3JS5A 3GLKA 3OP1A 4AJNA 5F1OA 4DIBA 1TVKB 5H9WA 1IEWA 3HY4A 3D8TA 3TRFA 3Q8LA 4NV1A 1L4LA 4OHBA 2H4WA 3L0DA 4UMEA 1FE8A 2HJSA 5M04A 5LLDA 1NMZA 3AB8A 4ZC8A 1PX2A 2CVOA 3PIRA 3LXUX 3IERA 4IXTA 2COEA 4ESOA 4GS5A 3IKMB 1NF2A 1LI7A 2QLFA 3T4EA 4Y7NB 4JOSA 2YJ3A 3W6NA 4QXMA 5D87A 1A1SA 3SLGA 3B6MA 1RE0A 1KPHA 3PNYA 3KLNA 1RP1A 1H5QA 5FI0B 1NYLA 5E2BA 4HDNA 2HWXA 4ZRDA 3ZDBA 4DQ0A 2HXGA 2NSHA 4J7CA 4QXOA 3GEIA 1ZU4A 2BGIA 2PUWA 3LQRA 2BUBA 3E6AA 4BNWA 1M6WA 1U90A 4F04A 4F96A 4R8KA 1WKVA 3SYLA 1SXGA 4LRXA 3EFBA 5C8ZA 4G81A 3NVMB 2HRZA 3OX1A 2VT7A 1C9DB 2RHMA 5KNCD 2WTXA 1AO0A 3UFXA 4B3CA 3MJDA 4MR7A 4Q4AB 1GTJ1 4UJ3A 4GR4A 1TT7A 3P0JA 1E77A 2XEXA 3LX4A 2XKAA 4PX2A 2IODA 5MFZA 4DKXA 1CHNA 4MHOA 4V0RA 3QLUC 3TMAA 1QDUA 4KU4A 2P1ZA 3NHKA 4A27A 1P1HA 3SQNA 4R1SA 4IHJB 2QB5A 4AP5A 3GEDA 3QX3A 2HDHA 3FHLA 3W7BA 4D56A 1I10A 4EHHA 4GI7A 3KYCB 1OWNA 4IJUA 3SYNA 3T7IA 3VDQA 2QIOA 3PFGA 3R0ZA 3MRXA 2ZB4A 1Z3CA 2QJFA 2BV3A 2YMPA 4HVTA 1BD4A 4D6YA 4CQNA 1WJGA 3EMBA 4RE6A 3ETNA 3N6VA 4U5QA 1BO6A 2BD0A 3CLSC 3FTQA 4EFNA 3IE1A 4RE5A 1Y8ZA 3MA0A 1QBKC 2AX4A 3R77A 1P62B 5BNFA 1SC9A 3A4IA 4UNPA 3B52X 4S2EA 4BKUA 3ZV3A 2FX3A 3OE5A 1U0SY 4K6CA 1UKBA 2H9IA 2PR7A 3INTA 3VZSA 5IX8A 1EFAA 3DNMA 3H5IA 3ENNA 4G97A 3I04M 1K4KA 2ORED 4NS1A 1KI6B 1XQVA 3W2HA 1Z4LA 4WZBE 5IWCA 2O0MA 3D02A 2JJMA 4IUDS 2E85A 3F4BA 1I30A 1T0IA 5A7FA 4ND8B 2VZ0A 1X7YB 1G6HA 1ISGA 2IYOA 1E1YA 3FKSA 1N1DA 3MIIA 1GRRA 2VF5X 4RA9A 2BMEA 5ALRA 4EG1A 1OXMA 1JYSA 1FS5A 2GLUA 1GPH1 2XCQA 1UOEA 1WG8A 4II2A 4XQCA 4CG2A 4ZU1X 2CYBA 5EEGA 1OA1A 3PFIA 2QVBA 5JFGA 1MX5A 1Q74A 1TYCA 2I6GA 3DV9A 4NESA 1XR3A 5REQB 1AVTA 1NVVQ 3HCCA 4Q9DA 4MZDA 1TCCA 3N7UA 1UMBA 3ZI7A 2JBWA 1JILA 1N3BA 5E9JA 3WNVA 1N2CA 2QLBA 3HCFA 2VHZA 4HQLA 3H1EA 3UG7A 1H2ZA 3IQFA 3WMWA 2BEVA 3KQLA 1FSFA 3I4MB 4P36A 4Z0NA 2I4LA 3CZ5A 3J7AC 1Z5OA 2P0EA 3KEOA 5EJGA 1YS9A 5J5CA 1KFEB 3QXCA 1PEYA 2BFCA 1GEEA 4MS1B 4QU5A 4U2CA 4QTTB 2P3SA 3L7AA 4JUDX 2ONYA 4NYIR 4RTMA 8MHTA 1BX0A 3O4GA 3IBGA 5I9TA 4HPWA 1TQ2A 4A3KB 2WTNA 3FLEA 2ZJAA 1XGKA 3PQ5A 4A26A 5HPYB 3UJ9A 1TRHA 2O6LA 1AKEA 2D1RA 3KFXA 1NN1A 3QNWA 1T9DA 3FW1A 4PC2A 2M1ZA 5BN4A 3IFSA 3BMNB 2I6QA 3LMKA 2XGOA 3R7NA 3PR2B 2VKTA 4UCWA 4ZAYA 3ZJTA 4YASA 3D9QX 1UBEA 5B53A 4MQ5A 1ZH6A 3PB3A 2YV2A 1T0UA 4PGAA 3OA2A 4YYZA 1E79A 1GZVA 1SN7A 1VI5A 4N7MA 3SN6A 1XUOA 2JCBA 4G5RA 2EFGA 3UCEA 3QUAA 3TZKA 3N3AC 4RFSA 2GN6A 2FOIA 2NO7A 2V6IA 2HH9A 1GSHA 3IEUA 4K9DA 4V3BA 5DYGA 2HPZA 3TK1A 1E0SA 1V3TA 4YI3A 1XRSB 2YMLA 3H3JA 3TUZC 4Q19A 2X2OA 1QC5A 3ZGNA 2AOXA 4IMJB 4M6WB 3U0BA 3OQHA 2VDKB 1GJRA 4JQZA 3L7KA 4QOEA 1IAQA 5BPFA 4AX4A 2JCSA 1TL7C 4K6HA 4LN1A 5JZVA 2JB9A 2FRVA 1NWCA 4EHBA 5CK4A 2GAIA 2ZU6A 3HJHA 3SKYA 4RNDB 1WMDA 5KX5F 1BIFA 4WWHA 4ZALA 3KXLA 3ZZUA 1Y1WB 2FSVC 4K9QA 3GFPA 2RGRA 2WT9A 1VLJA 5DYNA 4X62B 4JUAA 4D0LB 1GZ4A 2DF8A 3VKHA 4HWKA 4MPTA 1MH9A 1WCYA 1DKLA 4C4PA 3OTGA 4C4TA 1M9NA 1XKLA 2O2HA 2PTGA 4KE8A 4E12A 2J0SA 3ZHZA 4YLEA 2PV0A 4ZVQA 2DBYA 2UYYA 1HTTA 1KFJB 3C8ZA 3QKRB 3QVGA 4KTVE 3SR4A 5F3DA 3WK7A 4AKIA 1CUEA 2PCLA 5G0SA 3VR4H 1T4CB 2F3UA 2WWWA 4AL4A 4IOJA 3UWMA 5J2TA 1NFRA 1GZHB 1DFIA 1DXOA 2UZAA 4JROA 2JFPA 1U04A 4KW7A 1R6AA 1QIEA 2C5HA 2TECE 2D4AA 2Q4RA 5F64A 4XR4A 5FBVB 2KX7A 3E5HA 4JBHA 1QUFA 2YBDA 2Q7OE 5HRAA 4X3PA 2QE6A 4ARSA 3UT5B 1U9CA 2QQGA 2BF4A 5E7MA 2W2VA 3BAZA 4QPNA 4GOND 3RREA 4C4RA 1GPJA 4G0QA 1Z6YA 4BLSA 4EB8A 4CW7A 1T0JB 2R44A 3MINA 4RY9A 5SZIA 2ID7A 2VSQA 1QCZA 4M0PA 5JYCA 1C7ZA 1E7YA 4HY3A 3DP9A 1NN0A 2O2EA 4ZYTA 5JAPA 3QXXA 3LT2A 3AIIA 4JU9A 1I7SB 3LKZA 3X1DA 2QE7A 4DWJA 3PX7A 3ABSB 3KPUA 2E4XA 2LIPA 3E3LA 4OQMA 1D1PA 1GKKA 1ONSA 4PXAA 5KWJA 4R2IA 4S1NA 1L4FA 2YFHA 1Z18A 1RAAA 1V1MA 3VGJA 4URFA 4F7WA 2H8KA 3QGMA 2IS4A 3PA6A 3TW8A 2FSSA 1K6JA 1G6KA 1KJJA 1QHNA 1R7RA 3SBOA 5AVXA 5JAHA 3BXEA 5BUZA 1XCPA 1OZHA 1I6WA 3G7SA 1KMQA 2UZ0A 2DPYA 3KD2A 3D1JA 5DNEA 3KQKA 5KTMA 3QVVA 5GONA 3DJYA 1KQOA 3PHGA 3R8XA 2HNAA 3DO6A 4YRGA 2QMQA 5C32A 4EHKA 4DZZA 1EAMA 1GNRA 3WWPA 4O4LF 1F4VA 1MAUA 4ZI2A 4ZVVA 4Q01A 5TQ0A 4N5NA 1Z4KA 2HIHA 3FZNA 3BDAA 3C7DB 1J90A 2VN8A 1GCOA 4MW0A 5P21A 1S0UA 5JPDA 1KI7A 2PQMA 5AW0A 2D3WA 1CEEA 4NBTA 3L8GA 1N78A 1W36D 3RIMA 1XE3A 1Z0IA 2A1TS 1E3EA 4AJLA 4CDGA 1V5GA 1E4EB 4TTTS 2RHBA 5AUNB 1U0GA 4G9EA 4BVGA 2XT6A 3RUEA 1VMAA 2DXIA 1LXCA 3WGYA 4HNQA 1Z2DA 1GPUA 1QIHA 3B53X 4Y67A 2PMZB 2Y1FA 4KI0A 4CKBB 1T4DA 2L17A 4QGHA 4BNLA 5JCZA 2F4NA 3PWTA 4OU5A 3EZ2A 3LIPA 5AJVB 3M6XA 2DHRA 2ZQZA 5F3RA 2ZIFA 3AR2A 4OQ4A 4QBHA 4GMXA 1B00A 4NDNE 3WB0A 5LYJB 1JFSA 4IP0A 2ZUFA 4MAFA 4FONA 1RZUA 3L7MA 1Q17A 4QRIA 1MHPA 4UXIA 5HCIA 2PGDA 2QQ0A 1RHKA 2CXHA 4NK5A 1KH1A 1C3LA 1QX3A 4R1TA 4XEHA 3TFWA 1FUIA 3G2HA 1NATA 2BEUA 2BHSA 3AESB 1DC6A 1DBSA 1O5IA 1B3BA 1G8PA 3ZDRA 4TZ0A 4LGYA 3OUUA 1K9VF 3QFHA 4QECA 1CK4A 2PT6A 4I1PA 5CTAA 2J0VA 2QF7A 1I50B 2GVDC 3V2HA 1KDVA 3TXAA 2XBMA 1JYFA 1N0IA 1WY5A 2CXRA 2XQFA 3PWSA 5FR1A 2H4ZA 1Z5GA 3AJ8A 2OM2A 4JZYA 1ZH8A 4FM9A 2VJCA 2Z6UA 2ZUSA 1EVIA 3KFLA 3X44A 1ISHA 5JAQA 1XF1A 4A8JB 3E1KA 5TV2A 5I7SA 1NMEA 3KE8A 2C2XA 1RHQA 1YDWA 2RJOA 4J0QA 4E46A 5JSQA 5KVVA 1NF3A 2ZKLA 2GJ9A 1WDWB 4LSMA 4JXZA 3GW8A 3S1SA 3BXOA 2Q0HA 5FNVF 8GPBA 3T5BA 1JZSA 1B93A 5AVZA 1CJUC 3G5UA 4FDUA 1JPNA 5DSTA 4IQ0A 3LECA 4XA8A 3FZYA 1XLTC 3TSWA 3LWBA 5D3MA 2PLNA 5EE5B 5AVQA 1IBKB 3IEVA 1JDZA 1I24A 2BFAA 4KPUB 3N87A 4MIOA 3IV7A 3ROMA 5C4IA 3OWOA 3BHMA 3DHWC 1RT9A 3R6TA 3SJUA 3T7JA 5CAEA 1RBQA 3PF8A 3G0IA 2FSFA 1MC4A 1VDZA 2X6TA 3EASA 3R5FA 5TNXA 2OXTA 3S3TA 3FOEC 4XTCS 3TSAA 3KG2A 2EFDB 4CM9A 2XRFA 5AW8A 4HJXA 4ITVA 5CLHA 3THWB 4H16A 3ESYA 3L7CA 2BDUA 2JKVA 4HQRA 4BV2A 4D7AA 1TA4A 1Z12A 5A4JA 2I0FA 2R00A 3LDHA 3OCWA 3AIOA 3FOZA 4I7EA 2VHEA 4DLAA 2J0QA 3NHPA 1DTWB 3LFUA 1L9XA 4KXMA 3SBDA 4XEUA 3L6DA 2GESA 3DZFA 3I9LA 4QDZA 2VDLB 3RVDA 4RHTA 3EEOA 3EPKA 1D09A 1PQPA 2X0JA 1QK5A 2BEKA 3AR6A 1SKUA 4DQDA 4KWHA 3RC9A 5CA0F 3DLTA 4FD3A 4BPRA 3GZTB 1M1NB 1G6Q1 3EVNA 5GAJA 2GOYA 2QX7A 3HOYB 1EK1A 2R2AA 4FINA 3AO0B 1FLNA 2ETVA 1X1CA 2Q1WA 3FZEA 3IDZA 1XL1A 3OEHA 2H0AA 1HQDA 3FA2A 4E0BA 5BR7A 1UADA 2WE7A 1J06A 1G5IA 1FFBA 2X23A 4WNYA 4YJDA 3UB2A 1FUUA 3RJMA 4AK9A 2IS2A 3T5TA 3I39X 2H1OA 4YCSA 3OJEA 3BCRA 2Q3LA 2Z2YA 3FDXA 3VR6D 4EKNB 3CRNA 2BTEA 1MC1A 3IUNA 3P45A 1F9EA 3T35A 2IZ1A 1HKUA 4OFZA 1ID1A 4LTNA 3VYWA 2FV8A 4JC8A 3HRHA 4RQUA 3GA5A 1MB9A 3W2FA 1E5DA 1EUCB 1V6CA 2CXTA 2OOSA 1QMPA 3GT7A 1OXVA 3GFTA 1IWOA 4C87A 4DCCA 2DKOA 3TJZA 3ABZA 4DDVA 2HHCA 2XMZA 1QFXA 3BK7A 3RTCA 3TGWA 5BWNA 4ZVSA 4XIGS 2IZ5A 1DO0A 1F8XA 3FNRA 2IHTA 4O2BF 4PAWA 4J1TA 3FPBA 2Z2KA 2I4OA 2RCNA 1VKOA 4Q4HA 5IKMA 5EIBD 2GAOA 4CT0A 2XD4A 3B1ZA 421PA 4DIEA 1KSJA 2P6UA 3ICWA 3KV3O 3QU5A 4Q1FA 1U0TA 3G0BA 3Q88A 4ZVMA 4BY9E 4LFAB 2F7SA 3OLWA 1TWAB 4MINA 3DKIA 2DBVO 1YTUA 5JZ9A 2PQ0A 5I51A 3RYCB 2AG6A 3QKUA 4YAFA 5G0VA 1X1TA 2J8ZA 3SIWA 3UNXA 4MPDA 1EB8A 1MDBA 1H6BA 3MWDA 4EATA 1PJ4A 3KWJA 4FCWA 1XALA 1J99A 4C0KA 4KQ9A 2O2CA <