2D2VA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with maltose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
244
structure length
244
Chain Sequence
b'MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein slr0953
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
total genus 94
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2d2vA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2d2vA02
2FUCA 3B8EA 2ZBEA 3AR6A 5IT4A 2YMQA 5ALPA 3I76A 1RRCA 3U7HB 5ALUA 1Z4LA 2YMPA 4OFZA 5ALTA 5AW6A 2EAUA 3L5KA 5AVQA 2BDUA 1RLOA 1L7NA 2CFRA 1YV9A 2ZBFA 4UM5A 3ZU6A 5AVTA 3WK7A 3QX7A 2NO5A 5ALRA 4NAVA 4NFLA 4UW9A 2HCFA 4JDPA 3L1VA 4G9BA 2P11A 1NNLA 4XOUA 2YMLA 1YDFA 3PGVA 2B82A 5AM1A 3HLTA 5AVUA 3CZ4A 3QYPA 5AW9A 4KX3A 1U7OA 1J8DA 3FVVA 3QLEA 3L7YA 4NWIA 3W5AA 2EATA 3WKBA 5AW2A 1RMQA 4AP9A 4ZEXA 2YMMA 4G63A 2QYHA 5ALLA 3ZVNA 5AI9A 4NV0A 5T41A 1N8NA 4UASA 3AR3A 1WZCA 5AVYA 3QGMA 1VJRA 4YIKA 5ALHA 3I28A 5AIBA 3KBBA 3L0CA 2O9JA 2ZOSA 4UU0A 2G09A 3W5CA 2P69A 3SHQA 4BX0A 3FGOA 2YJ6A 3OCVA 5AKKA 2I34A 1Z88A 1YS9A 2GFHA 3L8FA 4YH1A 4HGOA 3OCYA 5AVWA 2ZBGA 2NO4A 3ZTYA 5AKLA 3VAYA 2FI1A 1TA0A 3L0YA 3KC2A 3WGVA 4F71A 5AW7A 3TLMA 1Y8AA 5AM0A 5AVZA 1L7MA 1L8OA 2CFSA 5AKGA 1PW5A 2FUEA 3L8HA 4UMEA 5AM2A 1RPZA 2I33A 2I6XA 3IJ5A 3NRJA 2C8KA 2JAWA 4XQ0A 1QQ6A 4F72A 1RLTA 3W5DA 3L8EA 3MPOA 4Y2RA 5FP0A 4GIBA 4NABA 3SD7A 2JGAA 3ZWKA 4IFTA 4ZEWA 1Z5UA 2AGVA 1ZD2P 5AI4A 4MWOA 2Q4TA 3PCTA 3IRUA 2B0CA 1X42A 2W11A 3E84A 1FEZA 4E88A 2BY4A 5AW3A 2HX1A 4AS2A 5AW8A 3OCWA 3KD3A 1S8OA 2RARA 5AKIA 4KNVA 3J7TA 1TJ5A 3QUCA 5AW4A 3QU7A 1LVHA 1ZJJA 2I7DA 1Z4OA 3OCUA 2RB5A 3WGUA 4EX6A 3L1UA 4J03A 2R8YA 4HGPA 1TJ3A 5ALXA 5ALFA 4QJBA 3ZX4A 4CE6A 2R8ZA 4AS3A 2EARA 3KZXA 1T9ZA 3ET4A 4KN8A 1Z4MA 1T5TA 2R8EA 2AMYA 2YJ4A 3ESQA 4HAIA 4BNDB 4HGRA 4O8CA 3N8GA 2WM8A 3QU4A 1ZOLA 5AK3A 2AUTA 3QU9A 5AHXA 2W43A 3RF6A 2PKEA 2D2VA 3QUQA 4FE3A 5IS2A 1Z4JA 4UARA 4DW8A 5AK5A 1N9KA 3U7FB 3U7GA 2JARA 3ZX5A 3ZW7A 1ZS9A 2OM6A 5ALOA 5ALGA 1SWWA 3QNMA 3WK8A 2FPXA 4UATA 1QYIA 2ZBDA 2C8LA 3CNHA 4CF4A 3WK9A 2C88A 2IOFA 1WVIA 2W4MA 1Q92A 3D6JA 1WR8A 3NAMA 5AI5A 4DWOA 4KNWA 2WF9A 3E58A 3N07A 3QXGA 3WKEA 2G06A 3OCZA 5ALIA 5AKJA 4DFDA 5AVXA 1L7PA 3KOOA 1RQNA 1CR6A 4OD0A 3ZTWA 3AR5A 3DDHA 3A1CA 3PGLA 3E8MA 4L6AA 2X4DA 5AI6A 2HF2A 4ZEVA 2O2XA 2JAOA 1T5SA 4YGYA 5AKEA 2HO4A 4RETA 4EENA 2CFTA 1U2SA 5IT0A 1U7PA 3U7EB 2R8XA 2OBBA 5AKHA 3E81A 3UMBA 2FPSA 1WPGA 4UU1A 4HGNA 2B30A 3B9BA 3U13A 2QLTA 1K1EA 3KDPA 3WK4A 3EPRA 1QQ5A 3RFUA 4Y2JA 2IOHA 3EF0A 3AR4A 3U19A 2DQSA 2FDRA 3WK5A 3ZUPA 3FM9A 2YFYA 2GHQA 5ALEA 3OCXA 3R09A 1SWVA 4XE5A 4UM7A 2IA5A 2WF6A 3SKXA 4UMVA 5ALYA 5ALDA 2B1QA 1YJ5A 2WF8A 3I6BA 5ALNA 5ALSA 4Y3UA 1Z5GA 5E0OA 1O03A 3MC1A 1L6RA 1RDFA 1TE2A 5AVRA 3AR8A 3IB6A 5ALMA 2GHTA 2C9MA 3QU5A 4Y2PA 2HEGA 2VKQA 2IYEA 1LTQA 3QUBA 5AK4A 4BKMA 4BBJA 3ESRA 5AESA 4XPZA 2OYCA 2JAUA 3DNPA 5AKXA 2FEAA 4Y2VA 1NRWA 1RKQA 3SKYA 4GXTA 4H1WA 3SF0A 3ONNA 3DAOA 1F5SA 1EK1A 3WKDA 5A3RA 1RQLA 2GO7A 1RMYA 2ODAA 2IOFK 4EELA 1Q91A 5JJBA 4MUMA 1Z4NA 1RMTA 4I9FA 3BA6A 2G0AA 3M9LA 3NALA 3FPBA 5AI8A 3PDWA 2WF5A 2I54A 1YNSA 2HI0A 3N1UA 4QQFA 5AM5A 3WK6A 1J97A 2I55A 4J2TA 3GYGA 4YCLA 2WF7A 1QH9A 2ZXEA 3L0BA 4PNHA 3B9RA 4HGQA 3ZVMA 3M1YA 5AVVA 3BWVA 2HDOA 3UMCA 1VJ5A 1JUDA 1ZRMA 4OHFA 2BDEA 1AQ6A 4L57A 2HF7A 3ET5A 4CNQA 3MN1A 2G80A 5AW5A 2P9JA 5AKZA 2HSZA 1Z4KA 1VFPA 3A3YA 3AR2A 5AVSA 4B6JA 2YBDA 5A3SA 4Y2XA 2G07A 2YN4A 1Z4IA 3K1ZA 4YCMA 4C4TA 3SLRA 3AR9A 3U26A 1ZRNA 4BX2A 4EX7A 4CF5A 5AW1A 1O08A 3MMZA 2G08A 4IG4A 5ALZA 4Y2SA 1ZD5A 4Y2QA 2GMWA 4Y2UA 2G1AA 4BEWA 1L8LA 2B8EA 1IWOA 4I9GA 1XP5A 4BYGA 3SMVA 2NYVA 3R4CA 4C4RA 2PR7A 1RLMA 1Z4QA 2B1RA 2YJ3A 3S6JA 1U2TA 1XVIA 3A1EA 3FZQA 4Y2YA 1YMQA 1RKVA 4BNDA 2P27A 1ZD3A 2FPWA 3HYCA 3A1DA 4KX5A 4EZEA 1MH9A 2WHEA 3EWIA 2ZG6A 1TJ4A 4UAVA 2B8JA 3DV9A 2HHLA 2RBKA 5AICA 4BEVA 1SU4A 5AW0A 4UMFA 2C4NA 5AK6A 3ZVLA 3ZI4A 3NUQA 3F9RA 1S2OA 1ZD4A 4Y2TA 5AKYA 3N28A 1XPJA 1QQ7A 5ALJA 2FPRA 4JB3A 3WKAA 2AH5A 3R9KA 2HOQA 4FFDA 4YCNA 4BX3A 3NIWA 1KYTA 4L6CA 1NF2A 2MSNA 4FYPA 3N5KA 5A3QA 4C4SA 3W5BA 2OA0A 2RAVA 3OTQA 2FPUA 3QUTA 3L8GA 4KYTA 5ALQA 1RC8A 2MU1A 3QU2A 5AIAA 3NASA 5ALVA 1Z4PX 3NANA 1CQZA 4OCZA 1EK2A 3P96A 3OPXA 4YIHA 1U02A 5AM4A 3EF1A 4RESA 3UM9A 3WKCA 4UAUA 3FPSA 2Q5EA 3I1YA 4DCCA 4CF3A 5ALWA 1RKUA 2PQ0A 2YY6A 4UMDA 5ALKA 1L7OA 2WFAA 5AI0A 2Q4RA 2CN1A 4HYTA 3ZWDA 3ED5A 4EEKA 3AR7A 2YJ5A 3UMGA 5AM3A
chains in the Genus database with same CATH superfamily
2EJVA 2WTXA 4LSGA 2QHXA 2I4MA 3BL8A 4OP1A 5I9BA 4RM2A 1U0GA 3QPWA 3EMDA 5K0NA 3VR5D 4KQHA 2WWIA 1PSDA 1HDZA 4JA2A 3ZGOA 4F4FA 4ZJYA 5CLIA 3V80A 1A71A 4JB0A 4Q7KA 2ZI6A 3HN7A 3L5KA 1NW9B 4DABA 3M81A 3PFNA 1RLOA 4MAMA 1O6FA 1L7NA 1OXSC 3RRMA 3ZHZA 3WHKA 5D1NA 1O5TA 4XPIB 1S5PA 5HFJA 5CEJA 4IVNA 3R5SA 3M3YB 1G60A 1AUPA 3B1FA 5FXMA 3VU9B 1N8KA 4EKIA 3H1TA 4QXPA 4C87A 3RRNA 2VDKB 3CMMA 3L1VA 2F00A 2P11A 4FYKA 4XOUA 1DC4A 4I3GA 4XDGA 1RWVA 3N2KA 2CUKA 5CJJA 4BOYA 5IMBA 2HL6A 1YI0A 3DDSA 1MPXA 2J3MA 1IY9A 1DHTA 3QF4A 3HVJA 2QI9F 4IWYA 5SYMA 2VTDA 1RHKA 3VQTA 4AJJA 5KBYA 3Q7PA 4NK4A 1QP7A 4QSHA 1U8TA 1TUIA 2HMYB 2I8AA 1JAHA 2I5PO 2P91A 4Q3DA 3VJMA 4D4GA 3ROXA 4DXHA 4G4IA 4OYRA 2Q1SA 1EB9A 3R3XA 4D3DA 2IEBA 4QC2A 2FK8A 3AGPA 3O93A 4QYIA 2CEAA 4NCHA 4ZU1X 3SF8B 5CDYA 2HBRA 3A8TA 3HJGA 4Q01A 3OLZA 2AOTA 1WF3A 4C5CA 5FTLA 4GYYA 1VHDA 3AR3A 1X1SA 1UBTS 3SU8A 1XR3A 3QUSA 3KYCA 3TTTA 2XUIA 3K73O 4PTZA 1GGMA 4QDJA 1SFRA 4WCFA 2G09A 5C44B 5FOWA 2CZGA 4JUAA 2P69A 2QLFA 2RK6A 3B2EA 3C70A 3ORRA 2G5CA 3FCUB 4XWKA 4U7FA 3VPHA 4FWBA 2BFDB 1A9SA 2OZLA 4TX1A 1QR2A 3DBRB 2B4QA 2QI9C 4YLGA 3UUGA 1JIKA 4GZ6A 5HK9A 5CG2A 3AJDA 5FAKA 2NO4A 4R8SA 3QVWA 2C9DA 3RVLA 4QOEA 3ISVA 1IIRA 1E77A 1DE0A 1S4QA 2FI1A 3H75A 4US1R 2A5JA 3U16A 2OBYA 1GCOA 1K63A 4UE2A 3I37X 3WC4A 2QEQA 3KCQA 1XU7A 1PJTA 1U2EA 2BGTA 3DT6A 3F9CA 3N7UA 4RQTA 3OT1B 3RWOA 4E5UA 2IUYA 1N78A 4DMLA 3GFVA 1NMEA 1RPNA 3DZKA 3GZNB 4J49A 4QTZA 3ITEA 1UBGA 4RZHA 3U3RA 1HRDA 1JFSA 1K89A 2JHGA 3DBHA 4ZQCB 2Z83A 1RAFA 1H2XA 1JDPA 4AJ2A 3WS7A 1E0JA 3C3JA 4Y2RA 1TVEA 1ONNA 2C3UA 4LRUA 1YK1A 4QVIA 1E64A 2C0CA 3AWIA 2UUAB 3ZIAA 4US0R 1PR1A 3ZZUA 3NBFA 4I8XA 4EW3A 1BGXT 2JVJA 3ENQA 5AI4A 5KREA 2QU7A 4EHIA 1SG9A 3A9CA 3F8WA 3LKVA 1FEZA 1I2BA 3WMGA 1B7GO 1X1BA 5DTJA 3S1RB 1UT8A 4UTNA 1YFKA 3RYHB 3L5OA 3PJFA 3C74A 1C14A 1S8OA 1Y4ZA 4OXRA 3W4JA 5FULA 4JASB 2FMHA 2V7EA 3PE3A 3TR6A 2XKAA 1WTAA 1K4YA 3GT4A 4KNVA 1UBLS 3K9GA 3G13A 4ALKA 1CUIA 5K1ZA 2QNRA 4YWJA 3PTZA 4G85A 2PBLA 2RB5A 2QVGA 4JUIA 2Q5JA 2QD1A 4JBIA 4WASA 3HCEA 2PGOA 2Z3ZA 1MJ5A 1N5DA 2CE7A 2HRBA 1LW7A 3GARA 3GTOB 2IYNA 4YREA 1YZNA 3URMA 1VRVA 3S1AA 3CW8X 5DBGA 2B4YA 3NUZA 4P4LA 4BB6A 2HQ1A 4GD3Q 2NV2B 4FLEA 3W6UA 1PKXA 4B2YA 5JPDA 2D7DA 4TTJA 1VSQA 1ONSA 2CLOB 2HWXA 4BLUA 1Q15A 2XUDA 1NWHA 3W2FA 4I1YA 4GUDA 3ESXA 2XB6A 4C6RA 5SY6A 4WKOA 3C6QA 1Y5RA 4I1PA 3TJZA 3V1MA 1ZIYA 4XTRA 3RF6A 3SM9A 4F2PA 3O5AA 1YNOA 4Z9AA 3H8JA 3OLCX 4FE3A 4L4UA 1RXUA 2PS1A 5F73A 3TO5A 1I30A 2G1PA 2DM6A 6AT1A 4PNZA 4Z9XA 1U2PA 4HEA1 4Z86A 2PSJA 2O8FB 3ZDRA 3HDTA 4KPEC 1TUEA 2JARA 5JD5A 3Q8KA 1YRBA 2B5WA 1Q3TA 4WZBB 4WOCA 2H9IA 2BEWB 1PNRA 2GAJA 1YWGO 3E0QA 3BIXA 2C00A 3OX1A 4ZXFA 1DPGA 4JBYA 4RHCA 3VSBA 3OQ6A 3IUMA 1TF2A 2F17A 2Z43A 5F77A 3RODA 3FCEA 3SMQA 3VO2A 4A8JC 5JI2E 1XJWA 2C88A 4P2BA 3HCAA 2AE2A 2FSGA 4PS0A 3SEZA 2UVQA 3CPHA 4JR1A 3ICPA 1PL8A 3NFRA 5BMOA 3GD7A 2XT0A 1BC5A 4IX1A 4XIJA 5FA8A 3MCTA 3DAPA 5JDCA 1HE8B 3A27A 1N3LA 1CP2A 5EJ2A 3K0CA 1RR6A 3KWLA 1UOEA 3U61B 2BHSA 3UTDA 1EJ2A 3ER9A 1E8MA 1MVOA 3HM2A 4JODA 2W8BB 3F0TA 1YMVA 4RFSA 3PFFA 3I32A 1GU7A 4R2XA 3E6AA 4OL0A 3T3GA 1M1UA 1TA4A 2HLDD 2RB4A 3VOBA 3R0QA 4UU7A 1OVMA 1QLWA 4F0JA 1TTHA 5H4HA 3RFCA 4HSGA 2AMJA 1PL7A 2BEJA 2FZGA 1N8SA 2NTJA 1ZN8A 3EZ6A 1G20E 5TMEA 4MIEA 1S9HA 1SKMA 1PN3A 5TF4A 5I7FA 2R11A 4DY4A 5DGCA 2XXAA 4A3EB 3RFFA 3ESCA 4KHZA 3PPYA 1BMDA 4L7VA 4ZHSA 3T7IA 3DQQA 3EN0A 4L8GA 5CNIA 3W6ZA 1BEUB 3ECSA 3SP1A 1G7SA 4M6WB 3TCNA 4PN3A 4AQDA 3JRNA 1VJDA 2VLIA 4X92A 1EX1A 3LL4A 2ANBA 3A9UA 5AKHA 4QJ4A 4E30A 2P5YA 3EXEA 5SZKB 4E1AA 3VPSA 1W85A 1JFFB 3QOFA 4L3WA 2IV7A 4AIRA 4R0MA 1ZUNA 2J3KA 4NF2A 4UVIA 4I66A 3I62A 1NI5A 1J20A 2QKYA 2YASA 1U1IA 1HMYA 1JR3D 2G1JA 2HA5A 1S2MA 1T1GA 3GLVA 3KOWA 3KDPA 4QFCA 3CJTA 4BN4A 5DGXA 4D7AA 2ZAYA 5BMVB 3QMPA 1UMDA 3SDBA 4MW4A 4HR7A 4KQMA 1YUNA 1QPBA 4IDPA 4AJHA 1BRTA 1QP8A 3FNBA 2AX3A 2FPIA 2WAAA 1IJBA 1BMFA 2HQOA 3WLFA 1AT1A 4I1UA 4JCCA 1IULA 1FLAA 2FDRA 1M2VB 1WV1A 2EWMA 2CHVA 4DCOA 1T9AA 1XQWA 1E59A 4MUYA 5I9SA 3KKMA 3MTDA 4DXAA 4EY8A 4MB2A 3TECE 5H02A 4C4PA 2AVDA 4YV1A 3IC5A 3IKMB 3S2GA 1JBQA 1JWBB 3U3KA 3PGMA 1L5OA 3Q40A 4FS3A 4EHJA 2A9RA 1GPDG 4HVLA 3EMBA 4JJIA 4B3TB 1DI0A 1VE9A 2GA9A 5CTJA 3PA6A 5F4BA 4F3CA 5ALSA 4Y3UA 1FDRA 1NVFA 1TZJA 4MVJH 4YJ3F 1DC7A 1Z63A 2ZSAA 4BKRA 1FLVA 4V0RA 3HBMA 1ULUA 4Q19A 4B6SA 3S2DB 2XWJI 3DEHA 3ZDQA 1QF9A 2GZAA 2GHTA 1AZLA 2HA2A 1BFUA 1VL5A 5THQA 3KSZO 4KQIA 4NZYA 5T4EA 1I33A 1RC1A 1AD2A 2ZRKA 1IDN1 2XDWA 3L6EA 3KELA 5BWBA 4WXRA 3HWRA 1E1CA 1PS0A 4JKYA 4W63A 1XRSB 2OHVA 3F3YA 3F8SA 3VR1A 2GRAA 3G89A 2OUKA 3OE7D 3I1JA 4GC5A 5HTKA 5D84A 4YRSA 3PIRA 2DUWA 2PBZA 3GL9A 2DLCX 1IBRA 1MFPA 3KALA 3FDZB 2NU8A 4JI8B 3OJWA 2QT1A 4MV5A 3RTGA 1LD3A 2DSTA 2VP3A 3R3VA 4RF5A 4B6PA 2ZB8A 1DQPA 4EO7A 1R37A 3GCXA 3KTAB 4C89A 5DLEA 1UMBA 2V97A 3WKDA 1FSGA 2EJCA 4UDXX 4M7OA 3HFSA 1J42A 2Y0DA 2VFAA 2EKBA 1U0SY 1F2VA 3PDWA 3I3SR 2HPVA 2IU6A 3BZUA 2QM7A 3EISA 5DNUA 2VK2A 2WTAA 3SR0A 3HA2A 1TKBA 1R0XA 1DMSA 5CJ2A 3PFWO 4HRXA 4KWIA 4OI4A 2IEAA 4YQEA 4Y6SA 3GA7A 4WOPA 3T7DA 4OX9B 3H1FA 4BEJA 1I6HB 1OZGA 3F3SA 4PEVA 5IYZB 3PYXA 4KH0A 3TMAA 1ORIA 1QB7A 3FMIA 3GNTA 4OBWA 4DQVA 1EG2A 4EF6A 2PJUA 3FAZA 4F7DA 3ZVMA 5BSHA 1P3JA 1DX6A 2H51A 1WZ2A 1EVJA 3R4VA 3U4CA 2GOYA 4C4YA 1H9AA 2AW5A 2PVCA 3LYHA 3NHAA 4RLSA 5JR3A 2HR1A 4AKGA 2P4SA 2QVLA 3EZGA 4PV7A 2O3JA 3G23A 4HAUA 6CHYA 3TZQA 1UEJA 1XLTA 1P31A 3W5IA 1OX4B 1DX4A 1Z8FA 3IQEA 2QYSA 3R3WA 1FYEA 4FGWA 1JILA 4E13A 1BW9A 1V1JA 4F8JA 2XMDA 4R9SA 5KKNB 2CVPA 3MJFA 1WCIB 4FHFA 3CZQA 3V2HA 1TEZA 4UUMA 3V46A 2PUGA 4A1OA 1N7GA 3TRIA 2VRWA 3RU3A 5I7SA 4C03A 4HK4A 2GLXA 2VBCA 3DBVO 2HJ9A 3GV0A 4K9KA 4OQFA 1V3TA 4IO0A 3O2JA 5AJHA 3SKVA 1XD2B 2G7ZA 2WPNA 5CXQA 3CHYA 2H3HA 4R6WA 1GQRA 2FW6A 3S99A 2W00A 4L74A 1E9SA 4YGXB 3T7AA 3S2ZA 3N2NA 5A5GA 4WKPA 2QA5A 1FSFA 3I04M 4AWAA 4ZZ0A 2HCTA 4MS1A 4W6QA 1JIQA 2IYSA 3HB0A 1RPTA 4BEWA 2DQ4A 2BOVA 4K5QA 1DKPA 3OWHA 2I03A 4RENA 5FHRA 3U39A 1JQLB 2J5RA 2DGDA 1SZJG 3C5VA 3A31A 2CE2X 3NOQA 3OFND 5HR5A 1IPFA 2RBGA 2JFGA 4PGHA 4W9MC 4BY1B 3RRYA 1MABB 3EFEA 1OXUA 3G0OA 1YO6A 1N5MA 2OAQ1 2GK6A 3GFRA 1FYVA 3FYUB 2B69A 3A6JA 4HLQB 3GROA 1ISMA 4PZEA 1IJFA 2J48A 1SBCA 1TM1E 2YVAA 1E5VA 3L0ZA 3RH0A 3WAKA 4R84A 1OZAA 4B6RA 3A4NA 3CZMA 2FSSA 4QT0A 2G72A 3NOXA 4UPVA 1IZ9A 2PMEA 1C29B 2IYXA 3BYZA 1O5OA 3HR8A 5TT1A 4LNUB 3G5AA 1XROA 1NA5A 2J6HA 5BR7A 1F8FA 2RBKA 4BEVA 4YRIA 4ZVVA 2P2ZA 2HYDA 2WRZA 2C7RA 5IDXA 1J8MF 1Q6ZA 2B4KA 3T1QA 5K09A 1QV9A 2GM4A 1BDIA 1S2OA 1EXMA 4FGLA 3UHPA 4CR6A 4CGZA 1QQAA 4KIWA 3GRUA 3NDPA 2RGBA 3L6RA 1PR6A 3OTIA 1WHTB 1VIVA 1VGVA 3HJCA 4R71A 1QQ7A 1BQ4A 4DBVO 1PS9A 5HX7A 4M1WA 5DTEA 3NJ8A 1Z26A 2E9SA 1TZBA 1CDOA 3ZLTA 1CJCA 4YCNA 4PO9A 4KJXA 2C83A 5JWOA 4IUYA 2D2FA 2FSUA 3VNQA 4II3A 3KLPX 3EW7A 2C84A 4CM8A 3UHFA 2X1VA 4KAXA 5HM8A 2YUTA 1KAMA 3D8HA 2WSSA 1HOTA 2M1XA 2VF8A 1GGFA 2WNHA 2GBFA 1PGOA 2GTPA 1SM4A 2QSYA 1G8GA 3E1SA 4EATA 3SBEA 1TGVA 3BIFA 2UYQA 1Z4PX 1CUJA 3N39C 5DU2A 4BYMA 2AW3A 4MJXA 4MQ6A 5H9VA 5FI1B 4YIHA 1ESCA 1I94B 4EI8A 1FRZA 1S2NA 4LVCA 1L1FA 1OI3A 3H13A 3OC0A 3GLGA 1UAYA 2X76A 2OHFA 3A4YA 4FFNA 3UENA 5T8KA 3E7WA 1W46A 2EL7A 4PGGA 4UBKA 4XZ3A 1EU1A 5JQGB 1P4GA 1LNZA 1PZGA 2DHEA 2V7VA 1DEKA 1Z5OA 2Z0MA 4AF8A 4DZTA 2XYGA 3HU3A 1WVMA 3OTHA 3LXRA 1K4KA 4QFMA 3PQ8A 4TS3A 3RS7A 4RDHA 3UJDA 1V8PA 4HYTA 5JH7B 4IGEA 5G1PA 1IE3A 4RK7A 4PC2A 4J1SA 4QOFA 1FX1A 1I2MA 2Q3MA 3E15A 4QXRA 2OBLA 3UNXA 4AJNA 4E2XA 5AM3A 1VPTA 1T25A 3FCYA 1ZVVA 1J8VA 4I2VA 2AE1A 5LOVF 1LQ2A 1TFUA 2GM5A 4RH3A 3D4PA 3DC2A 5FBRB 2HM7A 3C3PA 1PBNA 2C96A 5ABPA 1XLWA 5LDHA 1Z47A 1DOAA 2WKPA 3NI2A 2CVZA 1TCUA 1A98A 5C4MA 5KTOA 3D4NA 2CFRA 2O5EA 1IN1A 2B63B 3DEYX 4L2IA 3JZAA 5AHRA 2PWPA 1GSHA 3PA8A 1ZNWA 2IDZA 4GPIB 4MW2A 1YBVA 4ZRMA 4H3HB 4XRRA 3UC9A 1D2HA 3JYPA 2ZRPA 1L5MA 2A9OA 3A26A 5KSYA 3JZIA 1YDFA 4I6JA 5AM1A 1P1FA 3JAKA 1W2WB 4XAQA 5C2JB 4UE3S 4UFOA 3WP1B 3JZFA 1RLUA 5AW9A 2NVUB 2BMVA 1SA0B 1ZGGA 3K71B 5B1HA 2ORIA 2OD7A 4FEGA 3WGZA 4OHWA 5EYPB 2Z4TA 2ZETA 1W88B 1NVXQ 1DDOA 3OT4A 2IYPA 4JN6B 1GCGA 4NK5A 4W82A 4AP9A 2I1VB 4D0SA 3TQOA 4A3KB 4PSVA 1V96A 4NE7A 3T5BA 4AYBB 1TECE 3OX2A 3P9CA 4LDNA 5K3DA 5LN1A 4G5FA 5BY2A 3U7QA 4HXYA 1KYQA 1OTXA 2A84A 3Q7EA 5EXTA 1UPAA 5AIBA 3L0CA 1XHFA 2HA6A 4FS8A 3WO1A 3P27A 1QONA 2IYZA 1FX0A 2JA2A 3HO8A 4K3VA 1XNJA 4P4GA 4PONA 3P2OA 5E1DA 1FDIA 4BX0A 1UKYA 3G5MA 2HAEA 2XOXA 2ZTMA 1CUGA 2Y1KA 2QRVA 4HJXA 1YQGA 1J8YF 4N54A 3DLBA 4V02A 1GCUA 2I6QA 4RGYA 1IG0A 2GFHA 3JWGA 4RMJA 4UHJA 4ZOEA 3ADBA 4GRDA 1SO8A 4G26A 2J6IA 1P6QA 4J4HA 4NBRA 4C0QC 4DNFA 1T3HA 4YEDA 3FJOA 1XQYA 4O2AA 4KACA 1MJGM 4XCQA 5AKLA 4IDCA 1AN9A 1B8NA 3UXYA 5EKDA 3TTSA 2FMIA 3AXTA 1TWHB 5JAPA 3Q41A 4L4SA 2WT8A 1Z0FA 2ISCA 4KLNA 1HYBA 4QDTA 3BZBA 1E7SA 1BU8A 3S7ZA 1VJTA 1O6CA 2AKAB 3DNMA 2R79A 4QHYA 5KX5B 2F3RA 4P3OA 3EEYA 4RADA 3NM6B 3ROPA 3LF1A 4G86A 4WFJA 1M10A 2RHTA 4P2GA 5TNXA 5A5EA 2BWJA 2PH5A 3ANTA 2FJUA 2JGMA 3BEOA 4ETWA 3QEOA 4ZHQA 4BQIA 5J43A 2IW3A 2L69A 3KLNA 5LJIA 3RK1A 1KYYA 2QD5A 2V3CC 3AM4A 3RUEA 2WU8A 5GOTA 3OSZA 1E2HA 1E3IA 2EIXA 3KT0A 4P4SB 1QH8A 3EGDB 1Z75A 3K9NA 4ID9A 1DJQA 2ZRAA 4IDQA 4ROSA 1GTMA 2BY4A 1KYVA 4KSBA 4YONB 3RROA 5BUSA 1CEEA 1N2GA 1D5CA 3NGMA 5C8ZA 4LDJA 2OXIA 2QUAA 1LC0A 2OY0A 3PYMA 1M5TA 2C95A 3CURA 4QU8A 2XE8A 1NAHA 1U8CB 3S44A 3ZS8A 1NLYA 1BS9A 1JA0A 1LWNA 2XHZA 1AKVA 2JD1A 2H7CA 4IZ6A 2BHLA 3ESBA 3REQB 3SICE 3UATA 3ZU4A 4HEJA 2EKLA 5JAMA 5DF1A 1JQAA 4DRYA 4J0IA 1T9HA 7AT1A 4G9GA 3WGUA 1GPJA 3LCJA 1GV1A 3IKVA 3L1UA 1JFRA 4RWEA 3PPVA 1K06A 4YC7A 1XZGA 3ND5A 1Q12A 3T35A 4M1MA 2P75A 2WFMA 1EJBA 3ANLA 3NC1C 3HPQA 4JC8A 2ZRGA 1U0EA 1EQ2A 3GGGA 3I42A 3K0CC 4LJ5A 3MXOA 4P32A 4TMVA 5EIBD 4D3SA 2W2PA 4XDYA 3DUWA 1NBHA 2HNAA 3JASB 2RI1A 1EVEA 1I36A 1Q5PA 2R8EA 4J1NA 5FUYA 2AYZA 3EZ9A 1EFAA 1H0HA 5UKDA 1TAUA 2J41A 3N8IA 1SCKA 5BVGA 2FJ0A 4O8CA 1GYQA 2WM8A 4FIZA 2Z6QA 5HOEA 4PHFA 4FHEA 4MB0A 3ZW9A 3NFYA 4MVJG 1M7HA 4R2LA 1YFZA 5LU8A 2XB8A 2D2VA 3QUQA 3THWA 1W4ZA 5KQRA 2J9GA 4BNZA 1ETUA 1NY6A 1WUTA 2DG2A 4XX0A 2I3ZA 3RARA 1PUJA 2V65A 1G59A 2PO5A 3O1LA 1EUDB 1Z56C 3D2BA 3GMSA 2PDAA 3IBSA 4UBMA 5A05A 3ZX5A 1JA1A 3KPYA 4CMBA 4XD2A 1ZS9A 4CEIA 4PSAA 2VEOA 4OK6A 2WSYB 4KG7A 4RK1A 1GN8A 2ADMA 4F2GA 2J5QA 2HEIA 1EUCB 1D2CA 4XUCA 1BMTA 1H5QA 3R75A 1RWNA 5JUWA 3GLFB 1C2YA 2W6JD 3P0FA 1ZGZA 3WWZA 2NSDA 1HL7A 4BPRA 2ONCA 3VR4A 2OKGA 3SBOA 9LDBA 1TVKB 3PHIA 1Q92A 1UWCA 4KQWA 4LJ6A 1CS4C 4DLKA 1QAOA 3QKSB 1PQUA 4P98A 5AI5A 3S17B 4CVNA 1Z35A 5JPIA 3LWDA 3TD2A 4M22A 2G06A 1Z34A 1N5LA 3O84A 1NNUA 1L7PA 2Z04A 5GJVC 1P33A 3Q8MA 2HTEA 3LUGA 2A30A 3C1TA 1CR6A 4XYBA 1H1DA 4PX9A 1OZFA 3TLYA 4IQFA 3R8CA 3D6UA 1SKUA 2O2GA 3NHBA 1JIIA 3DDHA 1EWYA 3A1NA 4TSFA 2QZZA 1QZZA 4ANFA 1HUQA 1MOPA 3MAJA 4QBHA 1CJKC 2TECE 1BYIA 1J22A 2XIQA 4KV7A 1D4FA 3LAWA 4PO1A 2X86A 4RD1A 3TCKA 4LWZA 4X64B 3J81A 5L53A 3B7GA 1OAAA 4EQ6B 3EDRA 4FZ3A 2XDQB 1LI4A 5A4JA 1PZEA 2C5AA 5KNCA 4LJ8A 1TD9A 3R23A 3ZQ4A 1POWA 4E12A 1J7KA 4CKEB 1GGVA 2FPSA 5IJ9A 3N2YA 2X58A 1KZ1A 2XKKA 3VR5A 3KEQA 3P9IA 4S0XA 3G2PA 4IOJA 1JBEA 5C53B 1W93A 2J5BA 1RRPA 2V7BA 1QE5A 4FYHA 4KXVA 4O0MA 1VCNA 4DCTA 3EXFA 2VK8A 3FWKA 4NJOA 5EXPA 1RI3A 3I01M 4DQUA 2Y3IA 4QUDA 4XCVA 2QRQA 3E7PA 1ID8A 1PWEA 4NJEB 2YFYA 5HCUA 5AD1A 1WQ4A 1OFTA 4QE3A 1F1BA 1KGSA 4Y30A 4EFDA 3AETA 4QFBA 1L5HB 3BWCA 1OJ7A 1CUSA 1O9BA 2VHTA 3I8XA 2H11A 2HZBA 4KXWA 4QKQA 3K70B 1NOKA 4JLJA 4RCYA 5ALYA 2PS0A 3HDYA 2WF8A 1UDWA 4GO1A 3NWPA 5FBWB 3IAUA 2FTKE 3OFJA 2JLZA 3N58A 1WKVA 3E22A 4K6FA 2OXCA 4Q1BA 2BE7A 4R41A 3B1YA 1X0XA 3IDQA 4N18A 4EKYA 3EG9B 1JTVA 1AB6A 2C9MA 3QU5A 2W83A 3WFJA 2ILTA 3AH8A 2XT6A 2R6ZA 1E6CA 3IE1A 3QSYA 1CF4A 2HTFA 1AK2A 1QCZA 2C03A 3KOXA 2WTUA 1PX0A 5L4NA 5K6RA 4HDMA 5AESA 1C41A 1XLTC 2R97A 4A8TA 4URZR 4AG6A 3WNZA 3V4SA 2JEOA 4ALLA 2OCBA 3MK31 1A9PA 4YRTA 2J9FA 4DYHA 2ZSJA 4L16A 3HK2A 4EPVA 1VYTA 5FV4A 4QTUB 3K5HA 4ND8B 5AHKA 4YAUA 1W36D 4DMKA 3LHDA 4RX1A 4CODB 2TS1A 1TGYA 1JH8A 1G2IA 4K9QA 3MINB 1OASA 3WNVA 2DOKA 4FHDA 3RYCB 1R0BA 3KQWA 4FLFA 2DTDA 2AEJA 1RMYA 3MERA 5BWLA 3U7JA 4WLEA 1SIBE 2QZJA 3I4CA 1PWYE 1UWVA 5H70A 1JNYA 3I30X 2MWMA 2NP7A 4YRRA 1GUBA 4O4HB 3VZPA 1EMDA 3WLIA 4BNIA 1BXGA 5EUMA 2YH2A 2NQ8A 3LX4A 4LXHA 4LZLA 4EG7A 2GYUA 1ESNA 1GO2A 3GYGA 4RNCA 2WF7A 1Z0ZA 4UBLA 4GC9A 3MYYA 4RV4A 5E1OA 1OLOA 2VXYA 1GHTA 2YUIA 5BQ5A 4A23A 1WUIS 3G2QA 1GFZA 4Z7NB 5IN4A 2TMYA 5I6DA 2Z4SA 1DO8A 1Q7RA 4FQ7A 1THMA 4OX9Y 3HABA 1Y4AE 5IVPA 3TM4A 4INZA 2WFLA 1ZH8A 1N32B 4WZBE 1UT5A 2FE4A 4C01A 2BDEA 3P97A 4EA6A 2BKEA 5FLXA 4W8OA 4PZPA 3I1FA 1T35A 4C4OA 5TXGA 2P9JA 1UQTA 4Z2AA 1N8TA 4HXGA 1FTSA 2DPMA 1ESMA 1K6XA 2IKQA 4DTIA 4MKRA 4LMPA 1V8BA 4PPFA 3PZRA 4TKVB 2HJGA 4A0RA 4OAQA 1L3IA 2UUOA 2AMLA 3MD0A 3U3DA 1DC5A 3EXIA 1A5AB 3QXJA 3QYAA 4D46A 1Q17A 2JNWA 2X42A 1JGTA 2OSVA 3FYSA 3KFVA 3KKZA 4OI2A 4OQXA 5AOVA 1PE0A 3ZJVA 2OL4A 3GGSA 1O89A 4IJMA 2G07A 2AA3A 1WQ3A 3DM5A 3ZE6A 1Z4IA 4WGGA 4EGCB 2PGIA 3N76A 4C7BA 4ZCRA 5KCMA 3P4UA 5EWJA 1JAZA 2XW6A 1G8AA 4CM5A 1IBMB 1JLMA 4UHEA 4PG5A 4KXXA 5HS4A 3GJ3A 5JV5A 1DPFA 1YL7A 3PEUA 3WNCA 5JS1A 1J7JA 4RLHA 2OQIA 1QGUB 3QKUA 3GJ8A 4N0EA 3VO8A 3TAHA 1O08A 1OSNA 1BO6A 4YJFB 4KFCA 1HG0A 2Q3CA 4PPNA 1KORA 1T36B 3M1AA 3ETDA 2YY5A 4LGYA 5FOUA 1XCJA 4JUCA 4G6ZA 4QUGA 4U2DA 1J2YA 2VJQA 2FWMX 3FXAA 4AUMA 4DUPA 4BLRA 4EMUA 4D4JA 1Q1ZA 3UAOA 3U4AA 2J0QA 2MTBA 3MWDA 3H0CA 3UK1A 1QIHA 3NBYC 4R9UC 2B5OA 4PBRA 3U5TA 4ZAVA 4DSZA 4LF6B 3C45A 4Q4HA 4S0ZA 3S6JA 2I71A 3MLBA 3EASA 1IMOA 4F9EA 2BJVA 4M49A 4NMLA 1UM9A 5FBHA 3HCCA 4BUCA 5IK2D 3PUZA 1N5KA 3A05A 3AKCA 3G5UA 1SELA 1ZOSA 3IXMA 1RI4A 3IDOA 1YMQA 1RKVA 3ABZA 3QFSA 4V39A 4YMIA 5KSZA 2IEDA 4EF4A 4LXQA 9ABPA 3ZQJA 4DDKA 4BL5A 3Q9SA 4DA8A 3ZW8A 3BAFA 5TPWB 4MUKA 1EPUA 1JJIA 5T8KC 5H68A 4IH9A 3RNOA 2EX4A 2NIPA 4DSOA 4QDXA 3UJ7A 2O7NA 1FTQA 3EBOA 1FXUA 2ID4A 1EBBA 1I0ZA 1ODJA 4GX5A 5KYYB 2OBNA 4UTRA 1FZQA 4MYTA 3OSUA 5B53A 3U56A 1E9RA 1B93A 3EAFA 3MTIA 1VL0A 2FW1A 1PVVA 4FD3A 5B1YA 5CDGA 2O3RA 4EFMA 1ZN9A 5BNFA 4PAMA 3AFNA 5ALJA 3VYWA 2WJYA 4RMHA 4RK6A 2GXUA 2HLDA 1MRZA 2XI4A 4QU5A 3MS7A 4CF7A 3O4HA 4KQGA 5ELMA 3VKGA 1YB7A 1X7DA 1YVUA 2ZB3A 2PNJA 1U1FA 2VIIA 3E3LA 4GOXA 1ZK0A 2C5SA 4R1UA 5GWXA 3AUUA 4GWLA 4RMGA 4XWTA 1XZDA 3QUTA 4UNQA 1Q6YA 3NBZC 3N0RA 4V0OA 2W6ID 5DEOA 2W70A 2LIVA 1WDKA 4W5TA 1ANKA 4EW1A 3VI3B 4B3RB 3QU2A 8ATCA 1B8VA 3WBBA 3N2IA 3TUZC 4A8HA 2CT8A 1S2IA 1SHZA 2CL5A 2DR0A 4YVFA 2WZDA 4BBAA 5JFGA 1H2EA 1OMOA 1QGAA 3GGCA 4QRIA 3DE7X 5AVJA 5BOSB 4A3FB 4R81A 1T4CB 1QCYA 1Y8QA 3RLFA 3FUXA 2CLDX 2DWUA 1XCBA 2XRMA 3N2ZB 1XNGA 4O2AF 3DBLA 1JR3A 3KTOA 3R7DA 4YJKA 4UVGA 1SBNE 2DB3A 2WI8A 3LX5A 2JI4A 3T7SA 2KSQA 3OP1A 4JQZA 3GG2A 5DNDA 2G5TA 3U17A 2Q4RA 2L82A 1ZG3A 3A37A 5C7YA 3ED5A 3H7AA 4P5EA 2XOEA 3CNOA 3IOCA 5CIQA 4G36A 1OA0A 3RSGA 3ZHQA 4N9WA 2QX8A 4MTLA 2AF4C 1E8NA 2VQ3A 5DKFA 4BQPA 1DCKA 2C2MA 4ZHQF 5JJCA 1PO7A 1TZCA 1NF9A 2M6KA 4FTWA 4LZWA 1KSGA 4CMCA 5K6AC 5ALTA 1UODA 3HBLA 5JECA 2HREA 2H3EA 1E0KA 3EQ9A 5I5EA 3H8WA 1YJ8A 1XIVA 1FSSA 4U2CA 5HSGA 1X86B 5CA0F 5GONA 3QWHA 3KT3A 1FL9A 1X9HA 4FMDF 5ELXA 5CM9C 4GLLA 4MQFB 4IGAA 3VH3A 1E7QA 2GUGA 3AERB 5J40A 2NQ2C 1J23A 1KXJA 5HFNA 1H6BA 4KQCA 4P5DA 1ZCFA 4RZSA 2Z1MA 4IVPA 4PWYA 1UXJA 3OE7A 4U2EA 1H6CA 4Z4IA 4GMXA 3AIMA 3H65A 4OYHA 1Y8RA 3ZDYB 1XN4A 2C9BA 5K3OA 1C7EA 1EGMB 4O2BB 5B4TA 2ID9A 4BP3A 3DV0A 1RIIA 1KHTA 2R4TA 3FROA 1YRYE 2AF3C 3PZBA 1K98A 1FXWA 1PZHA 2AEMA 3D59A 4J07A 4LHVA 4R40A 3USES 2ZSKA 4J3FA 2QK4A 4M8LA 4G63A 1NUQA 2B3TA 1XFAA 2F1KA 4NDNE 3AX6A 3A6KA 4XTCS 4JLDA 4TKUB 1P4JA 3RVDA 4FKZA 4DAEA 2VDLB 1KH1A 3H7IA 4RF2A 3HE3A 2IC5A 2YJGA 1NKVA 2QM3A 5GMOA 5I9MA 3FPHA 2G0NA 4FM9A 3LCUA 4JYPA 3X1DA 4NKRA 1CNMA 3GGDA 2AUNA 4KL8S 2KI5A 4KDCA 4XKJA 1RYFA 1MX3A 3W5SA 4B5LA 3F3MA 4YJGB 4YLEA 4QTTB 1Z0DA 2VYFA 2N9UA 3RB8A 2Z08A 3AKDA 3UKJA 3ZHYA 3D8TA 2E2WA 1KMNA 2ZYSA 2BKVA 3OJCA 4A6PA 4AN4A 4EG3A 4JV5B 3O90A 2WSMA 5HQ3B 2EGGA 4TM8A 1NP3A 4FGKA 3ESDA 4HGOA 4M7RA 5EQTA 1XRLA 2CXUA 3RDPA 1GPWB 4H59A 2Q1WA 1EFRD 3NGXA 3ZTYA 2R7KA 3ORYA 4FFWA 4E4YA 1B42A 4F5EA 3CS3A 3FCCA 3KC2A 3LV8A 2F3TA 1K66A 4Y2GA 4BNLA 1C9NA 2QQGA 3O8OB 2CFSA 4MKIA 5AKGA 5HHTA 2AXNA 3FWHA 3G2NA 4MYDA 2QTCA 4WQMA 3IVRA 4KWTA 3C8ZA 2WKQA 3B7PA 2JCBA 3OZTA 4FWIB 1W30A 4TQGA 1Z8DA 4G1VA 4NIMA 4TVBA 4B0PA 4B8ZA 5AJUA 4MR9B 4GKAA 3C3KA 2BEVB 1P1HA 3CLRC 4ZAGA 3WHPA 2CB0A 4NDAA 4HWGA 4JL6A 3SD7A 1QX4A 5EHIA 4G0MA 3ZWKA 1KMCA 4HAYA 1Y98A 2F59A 1ML4A 4CL2A 4E6EA 1JQ5A 2OV4A 2VJLA 1M2GA 1FMCA 1DQNA 1QGYA 1XZBA 3E84A 4I3HA 3ICWA 3UBMA 1DKMA 3FX2A 4PRYA 1UZLA 3JVIA 4C7OA 3TLGA 1IPHA 2GPNA 4I5FA 4NG5A 2JFZA 1IK6A 1MEOA 3HVHA 3LF2A 3F6YA 4D44A 2RARA 5DM2A 2FQ1A 2PGLA 5KNLA 1MU0A 2ST1A 1IMJA 4KOEC 3OFNA 4Q00A 2EW8A 1NVDA 3H2IA 1VZ3A 3OCUA 5D01A 4EX6A 1E89A 1UBFA 2NUPA 5ALXA 1MQ9A 1YOVA 1QYDA 4B31A 5KU1A 3ZDCA 4DM7A 3MOGA 4UCXA 5KZMB 1N2JA 3ETEA 2WD7B 1X1RA 3EB9A 5GINE 2IFTA 4TUYB 4LRTB 3GJQA 4QGGA 5IARA 4UJ5A 4RL4A 3RRBA 3T54A 1JMKC 1P74A 1ZNZA 4MV6A 3RRFA 4A26A 1FVFA 2V98A 1OXMA 4I5DA 1F9EA 1CUZA 1HH4A 4ZYVA 5AXBA 4P3KA 5E3JA 1F8UA 4EWLA 3GRVA 5L7WA 2JCGA 2RCYA 3JYNA 2Z6UA 1N77A 1D03A 2H0QA 4RXTA 1OHHD 5AHXA 1YCFA 4FYIA 4YWHA 2RGDA 4GPTA 2PKEA 4UU8A 4ZU3A 3ZDXB 4Z49A 1SKQA 3VJRA 1J06A 1TTPB 1PIWA 1V5IA 2H16A 3M6LA 4DV3B 3CX6A 4CIAA 1KVRA 5FUBA 1B0PA 4EY4A 4CYMA 3FB4A 4LHEA 3U2QA 3V7NA 1YMUA 1XDDA 2NTNA 3KSUA 1E1RD 1H6AA 3LIPA 5F98A 2D2IA 3ZNNA 1SVWA 1JQDA 4NENB 1G42A 1A2QA 1C9DB 2AEFA 3FCOA 3M7IA 5EEGA 1Y1TA 4TTSA 1ZUD1 5EUBA 3TVTA 2LPMA 4CLOA 1Q14A 3TX6A 4CG0A 3LI2A 2X7HA 1V7PC 3V4PB 2V7WA 3IT0A 4N0MA 3RAJA 3DMPA 1UXOA 4Q66C 4ZJZA 1MBZA 2CBXA 4WVFA 3K2EA 4Q12A 5EJEA 3TSYA 1XRNA 2CXOA 2BVNA 3ZYCA 1BCRA 5DHAA 5ULLA 3VDNB 3KZKA 2VAVA 3UJ6A 4QYSA 5HEKA 2OCAA 1JS1X 1NONA 1KAEA 2PKRA 1O9GA 1O6GA 2VWPA 2Q4BA 4H7JA 3ONDA 3A6EA 5M5XB 5FL3A 4JI7B 1OXVA 3TD9A 4OGGA 3STWA 2IHTA 4LX0A 1E0AA 5CX1B 1Y5IA 1J6UA 5JAIA 4C2AA 2C99A 2VEDA 3DKVA 3PXUA 1WY5A 3A9WA 3E48A 3GFSA 4N6NA 3BXZA 4EB3A 5J1TB 4IDBA 3W04A 3FKJA 1JHAA 2C42A 1X87A 3KSMA 4WIAA 4Y9SA 5JVDF 3KEMA 1V8ZA 3FCSB 3T3OA 2ZYWX 3ZS9A 1U80A 2OCPA 2WWHA 4MV4A 1D2RA 2ZIGA 4UVDA 4E5YA 1FZTA 1OWLA 2P9EA 1OLSA 2FN7A 2DCMA 4FK8A 3BC1A 3HY3A 3FNEA 1EP1B 3O1JC 5AKEA 3HB4X 3ZHTA 2GF0A 3ZWPA 1P7VA 1XQ1A 2PVPA 3GH1A 3SS9X 3QLTA 2EZ9A 1MKYA 5LLSA 2PUWA 3E81A 3UMBA 4YUVA 1UJCA 1ZU5A 4PO8A 5F2OA 4QM7A 5F78A 3S70A 3RTEA 4UHBA 3Q3EA 4QQKA 4BB5A 3L0SA 2VDPB 1Z0UA 3S1NB 1ZUIA 2ZIAA 2XRFA 2ZI9A 1T0BA 1QMPA 2I2BA 1MNQA 1M6YA 1XEWY 2B30A 3D6MA 2XUJA 5KKCA 1VPWA 3QVUA 4LOLA 4R9VA 3ZV6A 4CKZA 1COWD 2DQKA 1DQYA 2LTAA 3C43A 3IE2A 3AYXB 5ARCA 1N5IA 3AVWA 1YR7A 1KY3A 2GPSA 4CQJA 3TOCA 4PZYA 5KAMA 2QVXX 1PD0A 4FOOA 2OPHA 3GA5A 4F6LA 5WRFA 1WWKA 5L6MB 2V4UA 2SCUB 2Y0PA 5A04A 1PLKA 3GRRA 4ISBA 3KJFA 5EIFA 2GHQA 4EIWA 4XJTA 1G7TA 1LCIA 1SWVA 3ANXA 1HBJA 5H82A 4CM7A 3JQ7A 4UM9B 5KVVA 3K9FC 3HRHA 1RYBA 2XF8A 4QUEA 3HVIA 3EHDA 1LJ8A 4WFKA 4FXPA 3SHWA 2Q8PA 1YJ5A 1DEOA 2EFDB 4P81A 4Z99A 5NLLA 3RIYA 4ZZ3A 3HWX1 1MV5A 4L5IA 2BCJQ 2AV6A 2IXAA 3BRQA 2AQIA 3KEGA 3NIDB 4PICA 1KO4A 3CFYA 3S81A 2DEUA 3L82B 1EFPA 4PYJA 4BO8A 3IB6A 3B2QA 3AJ8A 3U1VA 5DULA 1T5HX 2UZ1B 4RPKA 1Y6RA 4QXQA 2H4YA 4PFQA 4X6UA 3BTSA 4A4DA 5G0WA 4BZQA 2ES4A 5GADl 1HR0B 5AO9A 2VKQA 2X6TA 3G7SA 4Z8YA 1R7RA 3D64A 4QODA 1CF9A 2XUGA 3N6XA 3PC7A 3QUBA 5AK4A 3LPAA 4ICIA 1LLCA 3KPVA 5AMXA 3DNPA 3FTQA 4MV3A 2WILA 3KOZA 3WGOA 3NHKA 2BFNA 2BSQA 4M21A 3ZUGA 5EUCA 3ZU2A 1WBJB 3UCFA 2VQ6A 5HKKD 1H23A 3UICA 4CIWA 4PYRA 4OI0A 3K32A 5LJLA 1KBQA 1KTVA 1S7CA 2GO7A 4H3KB 2Q5QA 1NN1A 2ORVA 3MJRA 1CEQA 1PWXA 1IATA 3M83A 3NRBA 2EC5A 5KVSA 4RTNA 1NR7A 1EM8A 4D4HA 3QPCA 2EVWX 1S3IA 2ZZKA 3ORQA 3QA3E 1UR5A 4GMDA 1GG8A 4WNCA 5BWCA 2UUBB 1B73A 2QY9A 3FOCA 2GD6A 2RK3A 2ZREA 3KKEA 4JKIA 2AOUA 3KV1A 1V4VA 1NUUA 3X44A 3T3NA 4NJMA 4DV5B 4U9IS 3TXXA 2PA3A 5AM5A 3TBKA 1WEKA 5F2NA 3WADA 2JZOA 3V32A 4IVQA 3VYUB 5HWSA 2PRJA 4KO2S 3RTAA 4DR2B 3AVQA 3X2FA 3TLZA 1A8PA 1QGZA 5EIOA 1NVBA 1N1EA 1T4BA 5CA0A 1DBQA 4G97A 2XUZA 3P7MA 2OV6A 4NEQA 2O3UA 1KI6B 1ND6A 1TO1E 2FWBA 1RJDA 4N8EA 4K6OA 1N0WA 1RWPA 4W9NA 3WBJA 4CKBA 5IVKA 4HWOA 2FU5C 2PGXA 3BJRA 3BVPA 3EEOA 3SZRA 3GLFE 1IWPB 3AESA 2RFLA 1J1ZA 1JEJA 4G0ZA 3ZLUA 2CHGA 1S3SA 2PMZB 1XKTA 3R3SA 5AVSA 2WEKA 4HRAA 2DMRA 1XMSA 2W9XA 3S4YA 2RE8A 4FZ5A 1RXWA 5KC9A 5DXAA 3DP9A 1D2NA 2QW8A 2FJPA 4RSRA 2A3RA 1I6MA 1ESDA 1SOUA 2J0VA 2WZQA 4EARA 1GQFA 2OHOA 4Q3AA 4CDNA 1PR9A 2ZE5A 2OFFA 3PU6A 4DG8A 1VXRA 3HHEA 1O77A 2DBYA 4JC5A 1IY0A 2QXYA 4OF4A 3KLBA 5CPFA 1DLIA 4H16A 3L7NA 4EX7A 4D97A 5D85A 4BE4A 3W5UA 1Z16A 3AF3A 1GTG1 2PO7A 1AG9A 4KK3A 3UB3A 1XB2A 1TEVA 4YRMA 1EI9A 5F3RA 4Y2QA 1YS6A 1XDZA 2G1AA 4JNKA 2PGJA 4B3JA 2FR1A 2YC4C 4ZYWA 1CRPA 3TKYA 4JLPA 3FBWA 2BGGA 2ISQA 1C7QA 2RCNA 1CIVA 3O1IC 1YCGA 2ZJ3A 4TRNA 1H1LA 1OGIA 4NQZA 3H5AA 1JG3A 1J90A 2XADA 1BRMA 2WFZA 4LS3A 3JALA 1B26A 4II7A 1NHWA 4CEJB 3MTAA 4HB4A 1XEXB 3MJEA 4KXYA 2BR3A 1C9YA 2CNBA 4ZI5A 4AWBA 1BIFA 3C5EA 1JWLA 1GYPA 3A1EA 5C1IA 3GCDA 1FQJA 1WOMA 3C4QA 2GD0A 1UP7A 3CF2A 3KX2A 1C1XB 2JJ2A 1PT9A 2HZ7A 3ABRB 4GMFA 4Z6KA 3LFUA 1WCWA 2AG0A 3A1DA 2QZSA 3PF8A 2WHEA 1QG2A 3IIMA 4A2CA 4E21A 3WICA 3GEIA 1HDYA 2P1ZA 2Q27A 4FDVA 2Q1XA 4XOIA 4G5RA 3KR2A 2M32A 4KQ1A 1HL3A 2RAFA 4JEMA 2R96A 5HIIA 3E53A 2GVNA 2W6JA 1X80A 3W2HA 2ZE6A 3D6FA 4TN1A 3QLUA 1M34A 4FYMA 2G9ZA 2JHPA 4MP3A 4CJXA 5JATA 5LMNB 1SUPA 3G68A 4LXTA 3RIGA 3R9XA 3NDIA 2VHXA 3TQCA 3O38A 1QB8A 4RD0A 4FDMA 1OI4A 1QRRA 1X1CA 2IP1A 2RC6A 3OEWA 2DWCA 4MIKA 3OZGA 4QREA 3UXHA 3H84A 2JFYA 1P9LA 3SSAA 1YCHA 4MO2A 4O4JF 2HKIA 1FXWF 2XCRB 4O0LA 1P2FA 4BV2A 1OH6A 1W4CA 4XFKA 2JGDA 4F3YA 1J39A 3N2GB 3P9NA 4UHKA 1GZDA 1VL6A 3E9EA 4RACA 1IU9A 2PS9A 1NF2A 2DFKB 4FYPA 5LQRA 2ZPAA 2UXDB 1HQYE 1VZ2A 3F5MA 1XZJA 2BFEB 2GJAA 1CULC 2X3UA 3BRWD 4UFNA 2HRRA 5E9AA 2Z2YA 3BH0A 3A2MA 2QTBA 1MGOA 2E49A 4YA6A 1N6LA 3PX7A 1QV7A 4WOJA 4WXEA 5FFNA 1Q44A 1XOIA 2PCJA 2WUVA 3BBLA 3ZHCA 1CQZA 1R4ZA 4G23A 4M7WA 2VSYA 1K2WA 4GKKB 3GD5A 2BGRA 1XKLA 3DHNA 5JZMA 3FUTA 5FWNA 2IPLA 5HYVA 3KEFA 3T3EA 3MJHA 3OKCA 2I6SA 4Q39A 1H0RA 1BNCA 4X93A 5KTPA 1NSYA 3D2LA 2X5KO 1KDZA 4OHYA 2X1HA 4X94A 2NV0A 5EQDA 1NULA 2VPZA 5JAUA 2NXCA 3ILSA 2H31A 1OT5A 3LT4A 1CXZA 4NNPA 2HRCA 1MUUA 4KTVE 4U7PB 1D9XA 1E1MA 3GAZA 2CUZA 4NS1A 4GOKA 4MWCA 2F8LA 1WZUA 4FFMA 5KTRA 3ROFA 1UK6A 3LO8A 1EX6A 1EZZA 1NUHA 2PAAA 3SZGA 5ICGA 3OUUA 3LQ1A 3U3OA 4NLLA 5DT9A 1L4HA 5FQOA 3A4VA 4PIMA 2E4AA 4LN1A 5E6RB 1JHMA 3TXAA 4FB4A 2F6RA 1I4LD 3MM4A 4QVGA 1R6TA 5A71A 3TZ6A 5IXSA 2OWDA 1QG4A 1MAAA 2WICA 5C3UA 1ES9A 3O9VA 3LTEA 3PL1A 3UG7A 3UOWA 3PHGA 4ARZA 3ZU6A 2FZLA 4TLDA 3WK7A 5AVTA 5L4LA 5HCIA 1V43A 3GCZA 3TVYA 3CLHA 2ZI3A 2VDRB 5LXTB 3U62A 1CY2A 1VLHA 1W9MA 1I01A 2JJ1D 4LGCA 4PE5B 4WT7A 3VZBA 2V74B 3V97A 3W7BA 3C6KA 3GDFA 4OP3A 1YR8A 4UOEA 2W2KA 3FETA 3IE0A 1BQ3A 3HPRA 4LYEA 1ZISA 1XKXA 2GEFA 3ESYA 3WYCA 4MROA 1Z6AA 1OXTA 2DJIA 2OVBA 3FVVA 3HNOA 2BFAA 3NV7A 4ML3A 4E2FA 2DX7A 3S2IA 4ZEXA 3LY8A 2BBSA 3Q2IA 3L6BA 3OZWA 2YCLA 5IAEA 1DX9A 4IHAA 2R5NA 1MO3A 1UZMA 3VZRA 1LLFA 3JAMA 2XOKA 5T41A 3DLTA 3BSFA 4A2WA 1R74A 1E5LA 1U3TA 1WZCA 2RDMA 1GIAA 2ZUDA 4BV8A 1BH6A 1EFCA 2NUTB 1KI4A 4IV8A 5E2BA 5BN5A 1XPUA 3E9QA 3VZSA 4LI3X 2COEA 1YVDA 3B3AA 4QOJA 4IMPA 1KBOA 4RY9A 3D5EA 1HKUA 1VL1A 1EX7A 2X2PA 3G2IA 4MS4B 4P3XA 3FGOA 4I8DA 4OJTA 1V35A 4ZAXA 2P6PA 4BTVA 1C81A 4L72A 3OZCA 5DX0A 2Q3FA 1DV2A 3EUFA 3F3KA 4L76A 4MV8A 4S2EA 2V1XA 4DA9A 3O94A 5C9ZA 3KO8A 2G8LA 5DHSA 2WINI 4P7KA 4YUZA 3CT6A 3AEUB 4F3KA 4MQ4A 3LRXA 2CNWD 3LFTA 3PUYA 4S04A 3V3TA 4DT1B 5HUJA 3G02A 5LKRA 2YTZA 2J45A 1TA0A 2C2HA 3MSCA 3F6RA 4AZWA 1BA3A 1FDUA 1U2ZA 4C4AA 3HY4A 3PG5A 4O4LA 1JR4A 5AM0A 3TD6A 2M6RA 5CT5A 3AHIA 3PWSA 4MVWA 4ZTBA 4JXJA 5AVZA 1PW5A 2FUEA 3H86A 1JBKA 4PQFA 4WERA 1RWXA 4RS3A 3Q3IA 3QEMA 5H3LA 1CSEE 1GKUB 1HT0A 4KODA 1GZUA 4CTMA 1I0IA 1YB6A 2J4DA 1HO3A 4UUAA 4ZZ2A 4BFYA 1GVNB 4H6WA 4C78A 3O6VA 1H2WA 2J3LA 4MR8B 2R87A 4PYMA 4XASA 4DJJA 3A10A 4YPOA 4DC1A 1P2SA 1CQXA 1A2KC 2JGLA 1CHDA 3ZI7A 1OA1A 1X74A 2RGYA 2AMVA 4NH4A 3VC7A 3W8NA 3QVGB 1V5WA 1VLJA 1YULA 1US8B 3HADA 5B2ZA 3EFHA 3F67A 4L8YA 2Z6AA 1QBGA 4Q9IA 4AS2A 2V0CA 4DBZA 2BAGA 2D1FA 2O6HA 1B23P 4F96A 3RS4A 1D1TA 4GHWA 3IBTA 3T1NA 2JBAB 2OCKA 2W2NA 1DAMA 5LBTA 4X20A 5DBIA 4MYUA 3SIRA 4ER5A 4Q4DA 1VXOA 4D26A 3C24A 4CCYB 1A4IA 3C3AA 3EAGA 4WJKB 5BN1A 1LJUA 3AG5A 5TGTA 1M1XB 2VBIA 3QJGA 3D4IA 4OHUA 5KWIA 2NU9B 5GQSA 3HYLA 2CSXA 3EMKA 1ZGCA 4H27A 2R7NA 4J7AA 3VSEA 3PQ4A 4HT3B 5LPNA 2PUBA 3KJZA 2A86A 3LPDA 2UU9B 4IJWA 5FIUA 1RHMA 2IYOA 3HFGA 3FZYA 4NULA 1U9ZA 2WTNA 3C3XA 4HFMA 3UMVA 4DVGA 3VTFA 1ZESA 4L0QA 5I7WA 2JGNA 4HAIA 2C7OA 2ORWA 1U7HA 4REOA 3CBQA 1QYXA 4RKEA 5FNVB 3SCZA 2IU0A 7REQB 2PTHA 1VRWA 4B6EA 3WA7A 3FIJA 1HOXA 1EESA 2RHWA 4I36A 4FP9A 5I4BA 4DA4A 3IELA 4QJ5A 5FYQA 3BAZA 4F6RB 3QE9Y 2OCXA 1GPKA 3EFOA 1VLQA 2EFHB 4WKCA 2R1TA 4OGWA 4NICA 2OV8A 3MUNA 1B6TA 2OENG 3HVKA 1MJHA 2JIDA 4MWDA 5J2UF 2XCOA 2F3UA 4XB1A 4RH1A 4RBNA 2L0XA 1IUNA 1L3CA 1J2EA 1UFVA 5EWLA 1G4HA 3DYBA 2IP4A 1UBRS 3F7OA 5IF3A 1L7XA 1X7ZB 1KEEA 1X94A 3FPEA 4WBNF 2AIRA 4HLUC 4P9NA 4BP8A 4F91B 1Y1SA 1GUZA 2Z2JA 1EP3B 1QYCA 2AZTA 5HKBA 3FY4A 5KOIA 1LXCA 3QPAA 1Z29A 5CB4F 2E2IB 1WS6A 4M0EA 5TMDA 4YYZA 3KJNA 1GL6A 4LJ7A 4C3VA 4JYBA 2Q2OA 3SXJA 3TAUA 1C4WA 2FCAA 1VMDA 3D6AA 4M0PA 3LCRA 3G0GA 1V6AA 3K1AA 3NKFA 3H17A 3IKJA 4R05A 3EGOA 5DRTA 2ZCVA 3VPXA 2YV2A 4S2UA 4LF4B 1RKXA 1C1DB 2W6IA 4RPIA 4ZCIA 1JG6A 2IIVA 3SC3A 3GPDG 3EPLA 4LF9B 4K03A 5FX2A 4NESA 1GSAA 3B1JA 2PM8A 4R8LA 2FH5B 2GVDC 3CG4A 3V33A 3RUHA 4C0XA 3BL5A 3OE1A 4LBWA 1U6JA 4L3OA 3DS8A 1CRWG 2CJYA 2FEMA 4B43A 2R66A 3GP8A 4CMJA 1M7GA 2HGSA 1S8FA 2QD4A 4ASUA 4ZYLA 3BEDA 1VPLA 1MR3F 2VPPA 3KSAC 3EIOA 2XR1A 2JAPA 5NULA 4TMTA 1R4MA 5LDDC 2A0XA 2FP4A 2DPLA 1QGED 3CEJA 3E5MA 2JAOA 4UTPA 2HO4A 2F1IA 2CFTA 3T5AA 2D5BA 2Z56A 1VI6A 2R1VA 1XRQA 4HNAA 3QV2A 2P67A 2R8XA 2ZB4A 1GL7A 3WLQA 1CR0A 3SX0A 4L28A 3LPNA 4KO8A 3WIDA 4CUZA 5KYWB 4YMLA 3EGEA 3GLQA 3AI3A 1WPQA 1RS0A 3RBVA 1LDGA 3BFVA 5FTNA 3INRA 4OAPA 3MQFA 1NUSA 3R5FA 4I5EA 4RANA 3VNBA 2Q5HA 3FSGD 3IALA 2QTHA 4ZVLA 5KSPA 4XVUA 4CL3A 2XNHA 3B9BA 4BDTA 4JIGA 2FW7A 3OU7A 3F6SA 2QLTA 3H1GA 4UM8B 4F6CA 3EPRA 4JXXA 1CBUA 2YWEA 3OTGA 4M86A 3EIHA 1NDUA 1CD5A 3RFUA 4RYLA 1N2CB 3COWA 3WLNA 5TQ0A 4RIEA 1P0PA 3BXOA 4K28A 4YK7A 4BVBA 4X8LA 3W4IA 2H1FA 5F51A 5HDBB 4XSVA 3IEUA 5ED0A 1ONOA 1TUBB 4PNPA 1KO1A 3H2SA 4QSMA 4IRUB 4F2WA 1M2WA 2H1SA 2ODQA 2VPTA 2JCSA 3PNKA 4Y67A 2P65A 1THZA 3L4EA 3W6OA 2OWEA 4F04A 2FWNA 3ONVA 3S1SA 1VL2A 5F1YA 4LMAA 3UAZA 3RU9A 2X9GA 1E9EA 4ENTA 2C4KA 1KIAA 4AZ0A 3HEMA 3I9OA 3IUEA 4JT4A 2QU8A 4JL8A 5COBA 2C4HA 1F1JA 2YL2A 4LBZA 4EDHA 4N6OA 4EPWA 4P7GA 4DDVA 3ID6C 3F4LA 4CT0A 4HLCA 2IYTA 4WKGA 5JYEA 5L45A 1X7WA 1WRBA 3VZDA 4IYJA 4GOLD 5CEEA 4IDGA 1ADYA 1NVVR 2IHBA 2P4QA 1O9HA 3G6KA 4OP2A 4C7XA 1E6LA 1D3AA 2JI8A 4L0CA 1U11A 4W9NC 5EN4A 1G41A 3JSAA 3NB0A 2OK8A 5KUTA 5FWAA 4AJPA 3VNVA 3L0IB 3K1YA 1MAUA 2JAUA 1LF5A 1KH3A 1J0EA 2FEAA 3D0KA 4K6KA 2Z4RA 4H7PA 1T2DA 3IOYA 1NRWA 1G3MA 4FEAA 5DEIA 1D7OA 2HMWA 1ZITA 4H1WA 5JSQA 1YACA 2QGZA 2SICE 4E5PA 4F4HA 6ADHA 1C9JA 5AUPB 5A3RA 2XE6A 4G25A 4RCZA 3LD9A 4D6YA 3IMKA 4G09A 1P0MA 2Z9DA 1U2GA 3NM5A 1EFRA 3P9KA 1ZHOA 2WUEA 3BCUA 4Y6OA 5IAKA 1OIVA 1CJUC 4EHHA 1V48A 1XTQA 4K9RA 4N0PA 4BLSA 5IRCD 2E3JA 3KQUA 2D0OB 1NXVA 2FETA 4P1ZA 1DUSA 4U0KA 2LW7A 4FE4A 3CX3A 5EIBC 1EE9A 3IHWA 2Y1LA 3R6DA 1A96A 2I55A 2I62A 3DPIA 5CFNA 4RTMA 3F73A 1PL0A 4BTEA 1OB2A 4P7BA 3REFA 1FDVA 2X1LA 3EQ8A 1OTYA 4MGHA 4DCSA 3L7DA 2QYTA 1NI4B 2KPOA 1YK0A 3B6EA 1CR2A 1HEYA 1LWOA 4TV9A 1T9DA 1RVV1 3QFTA 1Q2XA 4RHFA 1BQEA 1QKJA 5LP6B 3PDIA 1GU0A 1HURA 4M60A 5KB3A 4MRMB 3UVEA 1T8SA 3DE6X 2ET6A 1TAGA 1Q3KA 4JJGA 4KE7A 4A0HA 4CNQA 1Q21A 1QHYA 4F5YA 1O54A 4I81A 1ISSA 1O87A 4G41A 1GD1O 4J0GA 3U48A 3IA7A 5BW8A 3LRPA 3JYOA 3M0EA 3O75A 3QVOA 5C4GB 3WLMA 1ZCJA 2IK8A 2FG5A 2VT6A 1Y3IA 2X19A 1CG6A 3AR2A 4YRDA 5EZYB 3CWCA 4R8VA 5TEWA 1AIPA 4XH9B 4E5VA 1VMKA 2BR4A 2YBDA 1ECBA 2ZJZA 5K3BA 4B6JA 4BCCA 2BYTA 4IHJA 4OK3A 2K4MA 2D8MA 2AS0A 4BGEA 1D0SA 2AN5A 2XXBA 3RQSA 3SE0A 5CVJA 3NP7A 5JZBA 1GP2A 4NR0A 3QLUC 4TXMA 4YCMA 3F5SA 4LYYA 4RVDA 4Q9LA 4N39A 1TQ4A 1X1DA 2QUHA 4X63A 4DRXB 1GTRA 5LZ5A 5AXAA 1M1ZA 1EWQA 1I7DA 1ZNYA 2DE0X 3GLIB 4GVXA 4BQOA 5IKXA 4LV8B 5IW8A 1TX4B 3UW3A 4CTJA 2VT7A 4DQLA 4HBZA 3MWGA 2CHEA 5FBVB 1IBLB 4AUEA 4X1IA 1TM7E 2LZ0A 3PB3A 1XZHA 3T3IA 3EBPA 3STYA 3QTBA 3PXXA 2B61A 3MUEA 1N6KA 5T6BA 3ZWYA 1E2UA 1GZ6A 5JROA 4Y7NB 1Z12A 1XZNA 1AHIA 1OHHA 2M1ZA 5LQMA 2P9CA 4P6VF 5A7FA 3HKEA 4PZZA 1U7TA 1YHYA 1MORA 2I2DA 4RXUA 2C20A 4MUGA 4XSGA 4CLRA 2Z57A 1MA0A 3AVYA 2APJA 2J0UB 3CGWA 4IQGA 4TRJA 3MMSA 4ZCSA 1OYWA 2ZYRA 2XJ9A 3CUKA 4MNTA 3T8YA 5IC4A 3J7AC 5T7BA 1MNAA 1UBHS 3T5DA 4ND7A 2NVOA 1RZUA 2EKZA 4INAA 4KPUA 2AC4A 3FOWA 1ZBDA 4IIGA 5F76A 4E2ZA 3O8QB 1NYQA 4KX5A 4AY5A 3U4QA 1VLLA 1QNLA 5K20A 2G9NA 4BAZA 2V8OA 1BS2A 4MP6A 4NZMA 3LPMA 3DWEX 3PXCX 1G3RA 2JGRA 2N42A 4AB1A 2XTNA 2C0PA 4TL7A 3OI7A 2M6LA 4AMVA 5AICA 3QM1A 3TIFA 4ZYTA 5E9WA 2GN1A 2I4TA 1JQJC 3D5QA 3QI2A 3LYUA 4HWRA 4MR7A 3O8DA 2NVBA 3IHTA 3NONA 3OQIA 1P2BA 3P5SA 2NZXA 4M9RA 4ZJPA 3E61A 2XBLA 2ZAMA 3OJLA 2H57A 4IM7A 5TQJA 2OT3B 3DGFC 4HO1X 2QR3A 2O2SA 2HY7A 2ZYUX 3AB7A 3SYKA 3SQDA 4YAKA 5J4KA 5KTMA 4Y1RB 3VU9A 1Q3HA 5EQJB 4EY5A 4H3SA 4II2A 1ENZA 5TR9A 2EKDA 5SY4A 5SZJA 4QVKA 1RW4A 4HFRA 4NY1A 4QU9A 3DYIA 2QORA 2J4CA 2N1BA 2OQVA 3F6EX 2G82A 4ZC1A 3D3QA 3N5KA 3M34A 1P9RA 4URXR 1E32A 1WLYA 4G56A 4BMYA 1QKIA 1CJTC 1Y7LA 5K4GA 1XD9A 4IHQA 3P19A 2WJ3A 1PQPA 3L8GA 1G8HA 3LQQA 4AL4A 4UOZA 1M2FA 1RCUA 3NM4A 4DDTA 1DQZA 3RTDA 1HSZA 3SF8A 3NASA 1T8WA 1QV6A 1VE7A 4GSLA 3UJ9A 4PLVA 3W79A 2SKCA 4RDXA 2XEDA 5BRJA 3T95A 4H15A 3TQRA 3EF1A 5BWOA 1KY4A 2HWWA 2BJHA 3IS3A 3AUXA 4KPFC 4AP5A 5C80A 4LTNA 4J0DA 4K2HA 4DUGD 3JARA 3U4DA 3ZHUA 3H9QA 3L6DA 3ORSA 3STTA 5D8DA 2QQEA 5ALWA 2DWOA 3SZUA 3O2SB 4BVAA 1TU4A 1QSGA 1CS0B 4P08A 5FTKA 5IG2A 1MAVA 2BFDA 1R15A 4RVCA 1WKCA 3DBRA 1ECCA 1IIBA 1HT2E 1K8YB 1N2XA 1PJBA 4KXQA 1T1JA 4QAQA 5DGDA 5EMHA 2PV0A 3DL4A 3ZE2B 4KXFB 2DECA 2IF2A 3VFDA 2EQBA 4PQGA 3ROTA 1SCIA 5HGJA 4IZHA 1UDRA 4PRLA 3IKTA 1GSOA 5IABA 3TZBA 5JNRA 5CA1B 4FN5A 1UDCA 2O7SA 1RVDA 1SY7A 2O8VA 3OQBA 1MQSA 1ZFNA 3K1TA 4JB2A 1N2BA 7ABPA 3H18A 2NTYC 1VCOA 4GR9A 1Y6JA 1YR1A 2OESA 3K9CA 3OO0A 2BZ0A 4ARSA 1XWIA 2FK7A 2OFXA 4C29A 3F47A 4BE7B 1E3TA 1HZZA 1T3SA 4RO0A 3GJ0A 3V8EA 1TEXA 1HLDA 5IDVA 4E32A 1RHJA 4V1CB 5DM60 1P9WA 3AFGA 1T5IA 2BZSA 2E4XA 2PZMA 3CU5A 2FWIA 5ESRA 2EW2A 2GT1A 3L1KA 4WZAA 4DHWA 4QLBA 5I9NA 4A3DB 1FP6A 5EI5A 1PI3A 3H05A 3R9IA 5A2GA 3VR4H 3QYPA 5CYPA 4BLQA 3CKKA 3C3MA 4HMOA 1CZLA 1SVOA 5M2QA 1PX2A 1L8XA 1XEAA 3GFGA 1GQOA 3RYHA 3FW1A 1UUFA 1B00A 5IJ0A 2GN0A 5FBKA 3ADCA 1NTOA 1RAAA 1U0BB 2YMMA 4Q3LA 4K9NA 3T0FA 1E6EA 3TLCA 4C6HA 3Q3JB 2GASA 2P9YA 2MYPA 3C7TA 3CEPB 2BFWA 1AKRA 4KQ6A 3EW9A 3HZOA 1HE1C 3X1XA 5HE9A 2H1VA 1L6IA 3KQMA 1C4KA 1MH1A 5DWDA 5SICE 1P77A 1ZM3A 3AL0C 4IMIB 3QQ5A 3K0KA 3KBBA 1YQXA 5HCNA 4FUTA 2VG8A 1A7KA 2PMBA 4BO3A 2X23A 4IUBS 4QGAA 4QPNA 2IYRA 4UU0A 4DIDA 2C4UA 1PQ4A 2O3SA 4R2KA 1SUSA 5EHXA 2WHRA 2IU3A 2COUA 3BSWA 2JRLA 4XVQA 2V6FA 3B1KA 4F7WA 2XTZA 1R6XA 2V1UA 2A5YB 3LKZA 2HMVA 1G5FA 4YLYA 1GWNA 5KNCH 5BYJA 4Q9KA 3DE2X 4ZICA 3CVUA 3QKWA 3V00A 2DT8A 3I2GA 4RQBA 4AJEA 4AKEA 1JIVA 1JHVA 1KK2A 1OUMA 2DSNA 3H6GA 3L77A 4BBSB 3JU3A 3VR5H 3M9WA 1R3UA 1H4VB 2YV4A 3D2AA 4B9EA 1VKNA 3CUYA 1J9EA 3DXYA 5HJ2A 3FZNA 1L1EA 2JFPA 2HMTA 3H1PA 3L8HA 3CVJA 3QP9A 4P4TA 3E5NA 2REQB 4UC0A 4UMEA 5FTJA 5AM2A 2X0FA 1JHQA 4NU8X 3AF4A 2XYQA 1LPSA 1ZK1A 3EVBA 4WBXC 5AOAA 4DCJA 3M6WA 5CW2A 5AUOB 1AV6A 1ZLXA 2GBIA 2OD9A 5KQSA 3AQIA 3VOAA 5FOVA 5DB4A 4P0PB 3IBCA 4U1RA 1DS6A 1IJKA 5FP0A 4RSMA 2FR8A 4RCVA 1Y7TA 4R83A 5LIRA 1TM5E 3JD3A 2XUAA 2G70A 3ADDA 2NTVA 3LXMA 4X3OA 1L7RA 4YCAA 3VR2D 4LJLA 1M1NA 1NQWA 3PCTA 1OX5A 1AKUA 1XTKA 3N75A 1VMIA 2Q99A 3BULA 3HXPA 5DIZA 1G18A 3JXEA 1AM4D 1ZR2A 3IQHX 2FPGB 4B35A 4OY3A 5JCJD 3L6CA 4G0YA 1ORWA 1PJ2A 2ZIXB 1N92A 3PXAA 4YRBA 3SVLA 2ERXA 2V8BA 5AKIA 1RQ7A 5KU7A 2O20A 1P0IA 1O96A 3H6KA 3J7TA 3TL6A 1NBME 2OO3A 2Q9AA 2G8NA 4XARA 4X60A 3R7SA 3IUJA 2ZR8A 1GAQA 4MYSA 1E9BA 4YYEA 4HV4A 3RF7A 2QN3A 4XA8A 4H60A 5C8VA 3PEWA 5C4XB 3ACBA 1YD7A 5I9TA 5ICFA 4J9VA 3O95A 3K20A 3ON5A 1Z8NA 4UBJA 2X3YA 3I2IA 1DEAA 2QROA 3SLKA 2XB9A 3DB1A 5I4CA 1ZH6A 1DBSA 2BMAA 3CEHA 2Z9CA 4RA6B 1EXNA 3AYZB 4UQLA 1XQ9A 2RHDA 4N4AA 4RZ2A 4H7FA 3WB0A 2K7FA 1HEUA 4EAAA 3GTKB 3ZBTA 5JZOA 2ZANA 2I7XA 4FDUA 4MV9A 3Q8XB 1RU3A 5KO2A 1JJ7A 4DLUA 3L8MA 2BMDA 2WVHA 3DD5A 3ICEA 1W5AA 4A16A 1SCUA 4K8RB 2YW2A 3L0OA 5EMJA 1J25A 3KB8A 5DSTA 5BSWA 5IX8A 1B3RA 2A1TR 3PGKA 1I1HA 2XGOA 4QPZA 4W5WA 4GEKA 3TJMA 4PLFA 3TTYA 4E5MA 3L1JA 2CJXA 4PW0A 4HCJA 4CLXA 1LSJA 3TDNA 3O26A 3FFXA 1XRPA 2AHOA 4DMRA 3R5TA 4RWZA 3OBBA 4NHOA 5HK8A 1ESZA 2Q41A 1SXJA 4UOQA 4KRGA 2P9BA 1CUWA 3KBOA 3C0KA 1ZM7A 3X1WA 3NJRA 3ZW7A 3MS2A 1NU8A 2NSYA 4N65A 3OTOB 1CNFA 3TQTA 4M4SA 2WQ7A 2PANA 2D4HA 1PRYA 2X0DA 4E5NA 4B3SB 3T3MB 3IGFA 3BXXA 2FPXA 3NXSA 2C2YA 2FAXA 4M99A 3WQBA 1W47A 1NVAA 1PJCA 1QHHA 1RABA 2Q07A 3E1GA 3EDCA 2XNSA 2NN3C 3ER6A 4BNXA 4CV1A 1O95D 4LJAA 2FE1A 4GUAA 2JFQA 2AUMA 3HLYA 2G5GX 1SQ6A 1TQ2A 4GRAA 3SIPA 1H9CA 1V8DA 5THXA 1RXYA 2C4TA 1CCWA 2FOIA 3DMYA 3KJEA 4DPLA 3FGNA 3WMWA 2GKGA 2R6JA 4CIDA 1EVQA 1BE8A 3D6JA 1AKYA 1XZIA 5HIMA 3BRWA 1GRNA 4GW3A 5FJIA 1SBIA 1U81A 1UK9A 2AK2A 3NAMA 4EPYA 4EG8A 4MPJA 3UJAA 5B1IA 5ETJA 2XAAA 3A3KA 3IRVA 4QA9A 1FJHA 3A1TA 4Z4QA 3KVOA 4N48A 3ZH2A 3PDUA 3STVA 2FFAA 5HKAA 1XAGA 3RLIA 2D1SA 3FUVA 2EV9A 1LB1B 3JVDA 4HDSB 3AM1A 3BE8A 3MJVA 4HEQA 4M37A 3DW3X 3DWFA 4DLAA 5IUJC 1VJ0A 4KE8A 5AI6A 1GILA 4Q21A 4ZO6A 4MCJA 4GI2A 4CUKA 4OYYA 4RZIA 3FDZA 2NMVA 3RZDB 1AXRA 2A4MA 3KYIB 4ZEVA 3CF4A 1W87A 5B64A 1T5SA 3G8CA 4BEBA 2J3HA 2H1OA 2HMSA 1JKMA 1R0RE 1SVNA 4J0HA 5AOBA 4CLEA 4ZVQA 3R7FA 1BHO1 2MINB 1RIFA 3UJHA 2QT9A 1R5JA 3RV4A 1DAEA 3H4VA 3HUFA 3PUWA 1QHGA 1PJ8A 1YHNA 1B1AA 1ACLA 2PLFA 4YECA 5I3ZA 4GE0A 1P29A 4YPFA 1J21A 1F6WA 5EJAA 1N57A 2P9HA 4A27A 5EXXA 5B3KA 3PJDA 2ECFA 1QIJA 1N25A 4OYLA 2J0EA 3W3AD 1M5UA 1FU7A 4HYYA 5JALA 3DZ8A 5BT9A 2IOHA 3QEAZ 1Y1VB 2NP6A 2JLQA 3R7NA 1QWOA 1U2GC 1WE2A 4MRRA 1R0LA 2C77A 2IDMA 1NMZA 3PWKA 5IUNC 3KJGA 1FFXB 3GZTB 2JJ1A 3DL7A 4YMTA 3RNLA 1ZMXA 3OCXA 1QHSA 5D7NA 2R93B 2O5CA 1KDYA 5K3EA 3SSOA 2HC9A 1GTL1 4IHJF 1MIOB 4NMWA 1PQWA 2DFNA 3PFIA 2EP7A 2I4OA 2OHGA 2ZRMA 4UZSA 4JYCA 5F7JA 1RAEA 1KOJA 1CY7A 2XQKA 3GG9A 5ALNA 5JXJA 5MN4A 1OX4A 3GK3A 3R6WA 2ZSBA 2H1CA 4MCAA 4DQDA 4KFSA 4LKOA 3UOGA 1P3DA 1VPVA 3CH4B 4G0XA 2Y66A 4R3WA 1E1KA 1JL3A 1A8UA 1VHTA 2SNIE 3FI9A 3VHRA 4B09A 4DIOA 1PJRA 3Q6IA 3MWYW 5KWVA 1CY6A 1U3CA 2XSZD 1WM1A 1YA8A 2VYCA 1J70A 2P7HA 1NU6A 1N33B 1XD2A 2JLSA 5J58A 4AJ1A 2DWQA 1GQYA 3ESRA 4IWXA 5D5PA 5EPEA 4HJRA 1T5DX 2R1ZA 1ODTC 1MRNA 2ZJ0A 4MK4A 5CDTA 2V45A 3T7RA 1CQWA 3TFWA 4BTLA 3FZEA 1PZFA 3I6YA 2AG5A 4CU2A 4ZOLF 1G0NA 3GTQB 5GOZA 2QRPA 1IBSA 1R66A 4H6PA 3FE2A 1LLUA 3HU5A 1ULZA 4KUHA 4MUMA 4I9FA 2CNWA 5C81A 2VTKA 1SHUX 5FA5A 4DC0A 2LDBA 1FUEA 1PSWA 2Z5VA 2QP4A 1QHXA 3E3MA 1JSZA 1MABA 2C9YA 2XPCA 4FB5A 2X15A 5E7JA 3UWSA 4BZXA 5BV8A 3WJ7A 1P6UA 2H4WA 3CX4A 3FYUA 4GWGA 2ETVA 3NDRA 4IL5A 4MZXA 4U8HA 2UUPA 2QLJA 5B6JA 2Z09A 4OHRA 3SQXA 1IOWA 1ZIPA 2X0RA 3G9TA 4BVLA 4D82A 2O0JA 4DV6B 4OXYA 1PFGA 1QH9A 5K8CA 3C8DA 2CLFB 3KYDB 1V7CA 4Q1FA 3UO8B 1V2HE 2F90A 3ILHA 3NWEA 1CV2A 3OM0A 1ABFA 4G1MB 4MVJE 5TDHA 4KR7A 5FR1A 2QTLA 4E0BA 1U3VA 5A3JA 2PX2A 1IG3A 2CKDA 5KOHB 4EP1A 3BMOB 3KTDA 3JD2A 3Q0IA 1G3QA 1M2JA 4RZ3A 3K96A 3PC2A 4TWRA 5B57C 1ND5A 1YZYA 2P5SA 1HFKA 5ARDA 1J99A 2Z98A 2XMGA 4BKQA 1K6EA 4M8SA 3RGWS 2IIBA 3FGPA 3D4OA 4TQAA 3FR7A 3CY6A 5JJ5A 1WDMA 1Y82A 2WM9B 4WL0A 1E7WA 3PC8A 4PQRA 4XYGA 4MZDA 4H4DA 3N3AC 2WNSA 2X77A 4TTRA 2H2FA 5DVZA 2W37A 3IBFA 1G0OA 1WHTA 5DHPA 2VUIB 4HDCA 3ZV7A 3TXYA 5M34A 3IHLA 3GNLA 5KNBD 1FXSA 2K5UA 1EX9A 5JSHA 3C7AA 2EX1A 4JGGA 1TQHA 1T13A 5K0LA 4LVOA 4NBWA 4R5HA 2QUZA 5FCDA 4WNAA 1T8TA 1LF0A 3A9VA 2GI4A 2DY1A 3WYEA 5DWVA 1WXDA 5JZVA 3DOIA 4BNJA 2XIJA 4XXHA</