2D2VA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with maltose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein slr0953
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
total genus 94
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2d2vA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2d2vA02
4UMDA 2HEGA 2YMPA 2GHQA 3KZXA 1TJ3A 1TJ4A 2JAOA 4YIHA 2O9JA 1Z4IA 3W5DA 3N1UA 5AESA 4KN8A 2C8KA 2FUEA 3ZW7A 2YMQA 3FGOA 4DW8A 2FPWA 3WK8A 1O08A 1L8OA 4C4RA 2CFSA 3L8GA 2ZBGA 4H1WA 5ALZA 3NIWA 5AI9A 5AVWA 2YJ3A 1MH9A 3QNMA 1XPJA 3ZWKA 4YGYA 2FEAA 1FEZA 1YS9A 2B8EA 3U7FB 2B82A 3OPXA 3QUTA 1Z4PX 3WKAA 4BEWA 2ZBDA 3QYPA 2Q4RA 3R9KA 1U7OA 5AW4A 3ZI4A 3DV9A 5AM3A 3QU2A 5AK5A 2IA5A 4JB3A 4BNDA 1Z4KA 1EK1A 1RC8A 3L5KA 3ESRA 3KD3A 4KX5A 1VJRA 4BEVA 4XOUA 4ZEWA 2HHLA 5JJBA 2G09A 3U7EB 4HGRA 3IJ5A 3QU5A 1X42A 2CFTA 1YV9A 3ZX5A 5ALGA 5ALDA 2WF6A 3E84A 4GXTA 2JARA 1L7PA 2IOFK 4RESA 1AQ6A 4HGQA 4KYTA 5AK6A 5AVRA 2FPXA 2AUTA 3DAOA 3UMGA 3I1YA 2HF7A 4L6AA 5AKGA 3HYCA 3PCTA 1TE2A 2NYVA 2YBDA 2ZG6A 2G08A 3RFUA 3SD7A 4CF5A 4YH1A 3HLTA 4DFDA 1KYTA 5ALKA 4EEKA 2O2XA 1XVIA 3J7TA 1ZJJA 3FPSA 4Y2VA 5AI5A 1ZD5A 5AI4A 3ET4A 1Q92A 3L8FA 5AW9A 3UMBA 3MN1A 3QXGA 3SMVA 2I34A 2AMYA 3I28A 3B8EA 2G1AA 2W4MA 4UAVA 2YJ4A 3NRJA 4J03A 2YN4A 4UMFA 2RB5A 2OBBA 3OCYA 5AKXA 1T9ZA 3OCXA 2YJ5A 5IS2A 5AI6A 4Y2JA 1ZRMA 2C4NA 4Y2SA 2WM8A 1S8OA 1Z4LA 5ALPA 3QU9A 4CE6A 4BX3A 1TJ5A 5ALTA 5ALXA 3N8GA 4JDPA 4HGNA 2JAWA 2WF9A 4RETA 3E58A 1VJ5A 3WK4A 4UARA 1RRCA 1L8LA 5AHXA 4EX6A 4NFLA 3W5CA 1U7PA 5ALUA 3ED5A 2CN1A 1RKQA 3ET5A 5AW3A 4ZEXA 5ALSA 2RBKA 2Q5EA 5AIAA 5AVXA 5AVZA 5A3RA 4CF3A 3AR5A 4BX0A 3EPRA 3U26A 2YFYA 2BDEA 5ALLA 4Y2YA 5E0OA 4IG4A 3BWVA 2G0AA 3ONNA 3A1DA 3L0YA 1YJ5A 3U7HB 5AKIA 3QU4A 3WKCA 3ZVNA 3FZQA 5AKZA 2EAUA 3AR3A 3I76A 1Z5UA 3PDWA 3FPBA 1Z4QA 2HO4A 1N9KA 3CZ4A 5ALRA 3E8MA 3RF6A 2FPUA 3GYGA 3QX7A 5AM0A 3QU7A 2NO4A 1QYIA 3WK7A 2PR7A 3QLEA 3NAMA 3MMZA 5ALWA 3QUCA 2G07A 3U19A 1CR6A 1YMQA 2R8XA 1L7OA 4UAUA 2WF5A 5AVTA 2C9MA 2RARA 3N07A 5AVSA 3OCZA 3OTQA 3R09A 5ALFA 1SWWA 4G63A 4UM7A 4XQ0A 3VAYA 2P11A 3DDHA 4EZEA 1SWVA 1WPGA 2GMWA 4Y2QA 4OCZA 5ALMA 3N5KA 1U2TA 2FDRA 5AM2A 4EENA 2EATA 1SU4A 2GO7A 2FPRA 5AW0A 1NNLA 4L57A 3KBBA 3A1EA 2YJ6A 5AK3A 2JAUA 1RQNA 2B1QA 2HF2A 5ALVA 3AR8A 1K1EA 3B9BA 4OD0A 4B6JA 4YCNA 2MSNA 2YY6A 4O8CA 2FI1A 5AW2A 4GIBA 4NABA 5AK4A 2C8LA 2DQSA 2FPSA 3BA6A 3L1UA 2C88A 5AVUA 1Z4OA 1Z4NA 4BKMA 2WHEA 3F9RA 2OM6A 5AW8A 2HDOA 3R4CA 5AI8A 3KDPA 3MPOA 4AP9A 3WK5A 2R8EA 5AW5A 5AKYA 2B0CA 4KNVA 5AW6A 3I6BA 2OYCA 4J2TA 4UATA 4UMVA 3K1ZA 3NASA 3L0BA 1RLTA 5AVVA 3SHQA 2ZOSA 3SLRA 1Z4JA 5ALQA 2R8ZA 3MC1A 3B9RA 2QLTA 4F71A 3IB6A 2HSZA 3OCVA 4I9GA 5ALYA 3A1CA 2WFAA 5AW1A 4EX7A 3L7YA 2GFHA 5AVYA 4YCMA 5AIBA 1Z4MA 2Q4TA 3QUBA 4UU1A 1T5SA 4I9FA 5ALJA 3KOOA 1WVIA 5ALNA 3AR9A 1CQZA 2PKEA 2ODAA 3UM9A 2AGVA 2MU1A 1O03A 2I55A 4HAIA 5ALIA 4E88A 4MUMA 3ZTYA 2CFRA 1WR8A 1ZD3A 1IWOA 4CNQA 1XP5A 3WK9A 4UMEA 4AS3A 3WKBA 1RMYA 3WGVA 1LTQA 4HYTA 4MWOA 3E81A 3ZUPA 2BDUA 1F5SA 2ZXEA 4AS2A 4OFZA 3ZVLA 3TLMA 4BNDB 3CNHA 1Z5GA 1RLMA 4BBJA 2RAVA 4DCCA 3ZTWA 4UW9A 3W5BA 4UM5A 3DNPA 3L0CA 3ESQA 5AI0A 2I33A 4C4TA 3ZWDA 3FM9A 3QUQA 4KNWA 2JGAA 5AM4A 3EF0A 1QQ6A 3WGUA 1ZOLA 5AVQA 1ZRNA 3PGVA 1U02A 3N28A 4YIKA 1Q91A 5AKKA 3FVVA 5AKHA 1N8NA 5AKEA 5A3QA 1YDFA 2I6XA 4Y2PA 3KC2A 5AW7A 2R8YA 4QJBA 1YNSA 4Y3UA 3WK6A 1RKVA 3A3YA 1Y8AA 1U2SA 4Y2TA 5AM5A 2IYEA 2NO5A 3L1VA 5ALHA 2B1RA 3EWIA 2AH5A 2IOHA 4NWIA 3WKEA 3AR7A 3QGMA 3W5AA 3OCWA 5FP0A 2HX1A 2IOFA 3AR2A 2HOQA 1RMQA 3SKXA 2WF8A 3NALA 2ZBEA 4UU0A 1QH9A 1VFPA 4NAVA 2X4DA 1QQ5A 2P9JA 3ZX4A 5T41A 4F72A 2WF7A 4BYGA 1TA0A 2VKQA 3L8EA 4FFDA 5AKLA 2QYHA 5AM1A 1RPZA 1RQLA 4FE3A 3PGLA 1Z88A 4ZEVA 2B30A 5AICA 4UASA 4OHFA 2I7DA 4HGPA 4CF4A 2ZBFA 1NRWA 1NF2A 2OA0A 1J8DA 1QQ7A 2HCFA 5A3SA 2YMMA 1RKUA 2BY4A 2D2VA 4NV0A 4Y2RA 2P69A 4PNHA 2I54A 1ZD2P 3NANA 2FUCA 1J97A 3U7GA 4YCLA 3S6JA 1RLOA 5IT4A 2B8JA 1S2OA 1WZCA 1L7MA 1LVHA 3WKDA 2G80A 4QQFA 4KX3A 4Y2XA 2HI0A 4C4SA 1ZD4A 2W43A 4Y2UA 3M1YA 1L7NA 3L8HA 3EF1A 4XE5A 3ZU6A 2PQ0A 3AR6A 3P96A 3U13A 1RMTA 2W11A 3SKYA 4G9BA 1EK2A 3ZVMA 4IFTA 3SF0A 4DWOA 1RDFA 4L6CA 2GHTA 5AKJA 1ZS9A 1PW5A 2EARA 5ALOA 1JUDA 1L6RA 4EELA 3IRUA 5ALEA 3AR4A 3M9LA 3OCUA 3D6JA 1T5TA 2G06A 4XPZA 2P27A 4FYPA 4HGOA 4BX2A 3NUQA 5IT0A 3UMCA 2YMLA
chains in the Genus database with same CATH superfamily
2Q4OA 5FJJA 2REQB 3UQYS 2J5BA 4XYGA 3CF6R 1OB5A 5JNRA 3AWDA 1BJTA 3UWMA 2IIQA 1SHJA 1GAJA 3R7SA 5BURA 2WJAA 4EI8A 2FWRA 3UAGA 5IXYA 4KFSA 3V4VB 1FIUA 3BVPA 3I83A 4IOLA 3S29A 3TNJA 4A26A 4HYYA 4I8XA 1N3IA 4OLJA 4DW8A 4R51A 1L8OA 4EUNA 3PT5A 4FP9A 4P58A 1Z36A 1U0BB 4GEKA 2JDID 3E9DA 2XXAA 1IHUA 2JEOA 4L22A 2UXCB 4YQYA 3FSEA 2VP6A 2CK3A 2M6LA 4W5HA 4GF5A 4EFNA 5AVWA 1MH9A 4M88A 3Q7EA 1X7WB 3UT5B 4DMCA 1MN6A 2ZTSA 1XJ5A 1DWPA 4JNCA 2HU7A 1F6WA 1R4MA 3KJIA 4BASA 3GBSA 2I03A 4JXKA 2RONA 1Z4PX 5JHHB 1CQWA 1NL3A 4HDKA 2OVBA 2Y71A 1OCEA 3P2MA 5DI9A 4D6XA 2FVXA 1GZVA 2PGIA 3N6VA 2MSCB 2B34A 3C3YA 3LIPA 1TCBA 1XB2A 2BELA 2BEJA 2IWHA 2PMEA 5JZBA 1UFVA 1MENA 3RG2A 5U4QA 2REQA 1Y1WB 4ISCA 3JQ9C 1RI2A 4DYDA 3PUXA 1YJQA 1P2TA 1ZI6A 4Z9XA 1TRKA 5JS2A 2BFDB 4MP3A 5FBHA 3FYHA 3U7EB 3ZE1B 3LSYA 5IH7A 1YJXA 5FHQA 1H85A 2VSYA 2I3ZA 1F4VA 3E84A 2OESA 2DBZA 4WL0A 5TRTA 5I7SA 1K6MA 3KJHA 1VL8A 2W6OA 4LAFA 4UEJA 1EZ4A 4C2MB 2P3LA 4G5GA 4MUEA 1P74A 4QECA 2WA2A 4DUPA 5KJ1A 2JA1A 2VHWA 3QWFA 2C2OA 4L5CA 1GU7A 5AVRA 2HWWA 2JCVA 2G04A 1IN7A 1E9CA 1MAWA 4QREA 3WP0A 4RMHA 4Z7JA 5TC4A 2Q2NA 1M1YE 3BFVA 2CJWB 3EW7A 4A3GB 1EX6A 1RIIA 1SOVA 2OC9A 1M8JA 3CNNA 5JR3A 2EX1A 2NVUA 3CJTA 3IE0A 3ECSA 4C76A 3ZGZA 1V41E 3DUWA 1SC3A 5JAZA 4FFNA 1DC7A 1E0SA 1VC2A 1HMPA 3SE0A 1AV6A 2OXTA 4MW6A 4LVOA 1M2KA 1D8TA 4X8LA 1SK9A 3FLBA 2ONYA 5DWQA 3WQRA 4ZCRA 3CJRA 1JTEA 1C5KA 1MXFA 1VE6A 1XP8A 2ETXA 1BDBA 5JZMA 1KRHA 3GDWA 1MVLA 1A95A 2D4HA 3BMNB 2BFOA 4ZYLA 2GM4A 2QN6A 4HG2A 2GWHA 2NO9A 1N5OX 3G9XA 3K9GA 1AUXA 4HX2A 1DKNA 2C00A 3H13A 4OQDA 2NOAA 5KREA 3DAFA 1ZN7A 2XKAA 2VWGA 2AMYA 3C0KA 5BSTA 1I7PA 3E9QA 3ND9A 3IVAA 4Y9DA 3U0BA 3AL3A 2HU5A 1T3LA 4QZVA 2YZ7A 2RB5A 3U7QB 3ANXA 5T6MA 2HMWA 1Q3KA 2C1XA 1W44A 3QPCA 5JQGA 4A8JC 1D1QA 4NENB 1J99A 3WG9A 1TYZA 5AKXA 2YV1A 2PSHA 2C99A 5GQSA 5GINE 3F7TA 1CB7A 2I99A 4JLOA 3HNPA 4L9WA 2W4QA 4JLMA 2XB6A 4QHYA 4YCAA 1ZCBA 2VEDA 4DREA 4WMLA 1YUNA 5DTMA 5IM4A 2VDPB 4BAGA 2J8ZA 2OV2A 3O3CA 3FHOA 3RFTA 3FTFA 4O8ZA 4BLSA 3FKQA 1ZK3A 4R0MA 1LV7A 4LMBA 1TJ5A 1RCFA 4DM3A 1JS1X 1KE1A 4ZTBA 1RQRA 2X2FA 4HGNA 4O5AA 4WXRA 2YWHA 5EWLA 3SC4A 2DUUA 2PYDA 3LT1A 1NE7A 4LZAA 5I9LA 2X8LA 4N41A 2J0UA 2W37A 2LCQA 4DNFA 3L40A 5KJFA 4DUZB 4NFLA 3ANNA 5LP6B 2DZDA 1OX5A 2J0QA 2XPCA 1T9AA 2XA2A 5E3IA 4WBNF 1ISSA 4NF2A 4OXRA 4ZXFA 2QK4A 3LYLA 1O87A 2E87A 3DE2X 3L1KA 2COEA 4KJXA 5FI3A 4DR3B 3KX2A 2OT3B 1WD5A 5AW3A 5IKPA 2VJMA 4I6GA 3MIZA 2HK9A 3B51X 3MQ2A 4GI2A 3NTUA 4GE0A 4IDOA 5J4YA 4NENA 2HBZA 2OHGA 1TCCA 1A76A 2ID4A 2ZYAA 4FWTA 3AQIA 3DCIA 4NY1A 4RIIA 1FVHA 4JXZA 1QRDA 4RACA 3C3WA 1TXGA 4HD8A 3OZIA 4IG4A 5ARCA 4N8EA 3VU0A 1J42A 4UJ5A 1I51A 1YJ5A 4EVSA 3FKSD 3AF3A 4DLPA 2Q0QA 5A4DA 4MS3B 4YLEA 3H19A 1QBKC 3IQHX 1RT9A 5AQ1A 1G7RA 5JWHA 4X92A 4OHKA 5K6TA 1XKTA 2V4ZA 1DRVA 4XVQA 4M0EA 4PQEA 1TO2E 2GJ8A 3CZ4A 3INYA 4MINA 1OROA 2HJVA 3TVTA 5BN1A 2CT8A 1SUWA 4JELA 4PCUA 4Q7LA 3ZY2A 3KFLA 5M3BA 2XCUA 2CSUA 3RTGA 4AAYA 3P32A 1I33A 3CRVA 3I6ZA 4RY9A 3LZ6A 3WGZA 5BRJA 3MMZA 1KI7A 1HXHA 4BB6A 4EG6A 3PWSA 1OAAA 3BDIA 2MIIA 5ALWA 3ICQB 1P8AA 2R44A 5C7YA 3E35A 3G8BA 4D99A 4TV9F 1X86B 5CAEA 2JLXA 2W6IA 4UAUA 3JQ9A 2QV7A 4CV0A 4OHPA 1ODJA 4FS3A 4N49A 2C4UA 3AI2A 4PPNA 3I4CA 3K7AB 2BBOA 5ITWA 2QGNA 1XYYA 2P11A 3NM4A 3GVIA 3VV3A 4ALMA 4CQLA 3DAHA 3NHBA 5CD1A 3O93A 1NFFA 1RJ9A 2C84A 1A9OA 2BZGA 2FQYA 2NYUA 5KTNA 3Q40A 1MGOA 1TDJA 4BU0A 1MF7A 4BFZA 5AXDA 4TTTS 5AW0A 1WOMA 1K7XB 1E79D 4M9QA 4XD2A 1JSZA 3EEYA 3UANA 4A8JB 4X0EA 1T9CA 1T2CA 2QX9A 2H5EA 5H81A 3NT5A 2BFFA 3IOYA 4K5QA 4DLVA 5AJXA 2QLNA 1OX4B 3OJWA 3UJNA 4KQ9A 1HE8B 3UC5A 3L84A 2J3EA 4II7A 4BCDA 3GB9A 1SG9A 3GUVA 3RB8A 4FQ5A 1LVUA 2VH2A 4DMGA 4ZT4A 4HDAA 3W5UA 3OQ1A 1Y5RA 4GIBA 3KWLA 1A7JA 3ONWA 1T36A 4JKOA 4YRDA 4ZAVA 4W8GA 3EZ7A 3GD7A 3U3JA 4DR5B 3OQNA 4US0R 4BNJA 3RADC 1Z4NA 4V39A 2YWJA 1ZVMA 3F9RA 2AXEA 4ZVNA 8ABPA 4A5OA 2PUEA 4B34A 4R1UA 3MTIA 5HS6A 5AUPB 1L8QA 1LJ8A 3WYEA 3A9RA 2PQ6A 3EWNA 5CEEA 1DWOA 4L8FA 1L5HB 1AY0A 4NX2A 1B00A 5K2OA 3QVXA 1NLFA 3HSKA 3JR3A 2Q5QA 1VFNA 1C7ZA 1MXHA 1P1BA 4KNVA 3SXJA 5J43A 4JNKA 2JJYA 1D1PA 1M1YA 4YXWD 1COZA 3UOWA 2NSLA 4A8JA 1LK5A 2QMEA 3MRXA 1Q7CA 3WHKA 3ZS8A 3BRCA 3DLCA 3LMKA 3HM2A 1THMA 3K1ZA 2EJBA 3OBIA 4TTIA 2FZGA 2QZ4A 3A3KA 3TLYA 3Q5GA 3HXOA 1B4DA 4RHFA 2NADA 4ZQEA 1IQ0A 1MB0A 3E3LA 4PGFA 3MUNA 1Y6GA 3TOSA 1KK1A 3RS7A 1TMKA 5C35A 4CM9D 1WXDA 1OVGA 2GHIA 5DX1A 1RSZA 3OCVA 1GL6A 4HY3A 1JV2B 2FQXA 4B32A 2X0IA 2VUHB 4Z4IA 4QPDA 1AUOA 3L4JA 1Z7BA 1ACMA 4ZVOA 3PNMA 3D8RA 4QPNA 4EKGA 4FYWA 4WXEA 3UFXB 1DO0A 3C1AA 2RAPA 4B80A 4ECAA 1T8RA 1W76A 4KXVA 2YJZA 3WWOA 1B3RA 3EXG2 4PHFA 5BSRA 3K70C 1L9KA 1PVOA 2WKQA 4EJ0A 1W30A 1XRRA 3K9QO 1LLFA 1U1IA 1KS9A 2BGIA 5H7XA 1LBHA 1LX7A 1OMOA 2ATIA 2GCNA 2KX7A 2O5RA 3OETA 2XYGA 2XNKA 5L51A 3KJZA 3C70A 1M2NA 1KEPA 5JS7A 3RYFB 1DIHA 4UDOA 3EISA 2XJ9A 4IMJB 4MITA 1ZD3A 3M34A 1ZCZA 1M67A 4MQEB 1KY3A 4AS3A 2VA9A 4FOTA 4BECA 4PFQA 2XGJA 3OTWA 4LFCB 3KB1A 3B82A 5DK4A 4TMTA 1ZI8A 4DA9A 3ZTTA 3FCYA 5G4KB 3LYAA 4DDKA 5K0ZA 4W9MC 4IICA 2NP7A 3D7NA 2ZXEA 4WX2B 3TR6A 1XZBA 3DQZA 1FQOA 3F5DA 4AJJA 5C51B 3OAAA 2HSJA 3C5CA 2Z6QA 2PVSA 2ACEA 2QSUA 3LPNA 2ZKLA 1IAVA 4A1OA 4M1TA 2P9TA 2GBCA 1M2EA 3DNPA 1HQKA 3HB9A 4P86A 2G1UA 2PPVA 3OUZA 3PPXA 2LGJA 3NTXA 4E11A 3SYRA 1VXOA 2FRXA 2Y1GA 3FPHA 3H4MA 4K9RA 4LF4B 3PFGA 2HRDA 3N39C 3T4EA 2V9PA 5BV2P 1YAJA 3DONA 2B36A 2PS0A 4KIJA 2Z43A 4G0OA 1SCKA 1USKA 4KXQA 1AZTA 5ERGB 3VR2D 3VO8A 3RYFA 4A10A 2VBGA 1UPBA 3WBFA 5AVQA 3DBRB 4RORA 3EGDA 2WPDA 4MQEA 1E1QD 3UK7A 2DX7A 2FQQA 1ECGA 1G41A 2C4HA 1E8NA 5E2IA 4U7FA 2YDYA 4B75A 4PLTA 2VG8A 7AT1A 3F97A 3NYRA 1V8OA 1U7WA 4TXNA 4Y3UA 5FL3A 4DT1B 2CMKA 4YXFA 2JHFA 1RYYA 4IEEA 5C1BA 2NQTA 4C88A 5HE8A 2XKKA 5LQJA 1JXMA 2EKQA 2ONCA 4LX0A 1Q1NA 3H4VA 5LBIA 3ZNQA 2IDKA 2TECE 4MP8A 3T0FA 3DS8A 4MB6A 1I5RA 5T4HA 1CVIA 5KTPA 3U5TA 5CFRA 1VG8A 1UPAA 1H6DA 3DWIA 3M6FA 5EPOA 1YRYE 2HLHA 4HUTA 1U2EA 4UAJA 4EDFA 4YUZA 2JA8B 5JJ5A 4HX5A 4F4HA 4E09A 3JRNA 2OECA 3LUCA 4DANA 1H4TA 2Q2WA 5CBPB 2PGJA 3CNQS 1P91A 4GM0A 4J29A 3QE9Y 3C8HA 3RSGA 3LCJA 3LY5A 5HDBB 1WOYA 4RSGA 3SKXA 1V71A 1VYHA 2H1SA 1CY8A 4QDKA 3HXQA 1DC8A 4F5DA 4ROTA 3MINA 1QH9A 1SELA 4OHXA 3S1QB 3M4OB 3HO8A 3HKDB 3IC5A 3K0AB 3C3BA 1YDWA 4IVRA 4KZKA 4CQMD 2AB0A 2FWMX 3QIVA 4DHEA 2WQ7A 1DC4A 2VKQA 1QO7A 5J4KA 2WU4A 2Z6AA 2AI2A 1NP7A 3ZYCA 2JGEA 1MJ5A 1NYTA 1W0JA 1WHTB 1YR8A 3DMTC 4FE3A 4HI0E 1QGOA 4OMDA 2WNIA 4AX4A 1YZYA 2Z8XA 4G5FA 4LJSA 4TTSA 4BB0A 3K9LA 1O5IA 2QUZA 3QVSA 4RF3A 4WESA 5JSHA 4MPRA 2Q50A 3I52A 4PICA 2CDRA 4PXYA 5KOHB 3Q9NA 4DTCA 2JNWA 1P0FA 2JGFA 4XJTA 5BNIA 3F6RA 2RK3A 1JLSA 4PVCA 4L0QA 4O63O 2UYYA 2IZ5A 3CW2A 1UXHA 3HMKA 5DMHA 3CZMA 2O8EB 1QV9A 3A2KA 1X9HA 1ZICA 5HG0A 3GLGE 4TUYB 2PKWA 3ABIA 4F2HA 3NHYA 4HB3A 2A2ZA 4AWAA 1H1DA 4I4LA 10MHA 1U5BA 3EUEA 1HE4A 3ETHA 2PX0A 3I92A 4MUXA 4PR3A 4EKNB 1FZTA 6PFKA 3ZS9A 2A0KA 1JA0A 1SXJB 2BFAA 4KX3A 3LL4A 4L02A 4AY3A 4TMYA 2C03A 1X1TA 4O02B 5LN1A 3SBEA 1KJZA 3L43A 1L7NA 3N8HA 4WN9A 5B6JA 3PIIA 3T34A 4BL5A 5B6PA 2RHDA 3G9TA 1FFGA 2I8LA 3OA0A 3PEYA 5GM2A 3TKLA 1VLLA 4IWXA 3I42A 4HVCA 1YVRA 1UK8A 2QN9A 2Y76A 3JALB 1GTG1 3C8MA 3F71A 1OA1A 3VNAA 4BKPA 5BYJA 1S5PA 1YS2X 4JBNA 1I2AA 4M76B 4DWOA 2FWAA 1CUFA 1TGVA 3FZYA 1T1EA 5TQ2A 2BFPA 3NP7A 5IK2A 4DLWA 3TBHA 2KB0A 2TMGA 1QCCA 4P3NA 4RLFA 1KMHA 1J2UA 4U7WA 5LMCA 5REQB 2W6JA 2DFKB 2GUGA 2YV3A 3MMXA 1A1VA 1Y1LA 4H7IA 2J6HA 4KLRA 3EXIB 4LZNA 3TQOA 1CNFA 3IV6A 2CXPA 1PL7A 2H1LA 2OCYC 3VHQA 5JW6A 5JVDA 4IUDS 4B40A 4TUYA 3LKBA 4JQYA 3CPSA 3PJDA 3EFEA 3A6LA 4EHAA 2O9JA 3OZSA 4O1MA 3H1AA 4G25A 1G2IA 1N4DA 3H3FA 4MI9A 1KL7A 1ZM4A 5AESA 3RK0A 2PBLA 3X2FA 5IPFA 4Q0MA 5FD8A 2RHTA 1MV5A 3P2YA 5D6NA 2WTAA 3FYUB 1ZCAA 2AFHB 3FZEA 3P1JA 2J85A 4YJHB 4C4RA 4HKTA 1U65A 2B4TO 2CV0A 2ZBGA 1F5NA 3OFVA 4RPKA 5DBGA 1WXXA 4LIPD 4F4CA 4CQNA 1L7EA 4H1WA 1ECBA 4JP1A 1OLSA 2D3WA 5TPWB 5ALZA 4YUAA 4M37A 3JALA 1OLOA 4CF6A 1SCDA 3PCXA 4EJSC 1RZ3A 1C3VA 4OIFA 4PLPA 4TLBA 2QB5A 5E95A 4B4WA 1CEQA 5KUTA 2HW8A 4L16A 4PQRA 2CVFA 1KMNA 1NW8A 4ON9A 3R6WA 3KUCA 5HKLA 2JCXA 4DDUA 3HA2A 1B0AA 3AJRA 2HLNA 2ZIZA 5CDTA 1L3IA 3DV9A 4RLQA 1V1RB 2FF7A 5REQA 4D8VA 4ZFNA 4PPYA 4QFDA 3UJ3X 1GARA 3LI2A 4F8EA 1IZYA 1K7CA 5EN4A 3H5AA 4DKJA 4O0MA 4IYRA 1V5WA 5I9MA 1UDAA 2OKCA 3PL1A 1K08A 2JA2A 2IC5A 3AHIA 1GWNA 4TX1A 5JSKA 3RSOA 1LLUA 3W9SA 4DLSA 1KI4A 4YQZA 3RQSA 3T52A 5EWJA 2OD2A 1DNPA 2AFHA 2G5PA 3DAGA 4HQ0A 4ILKA 1QHNA 4YJHA 4DPMA 2BGWA 2H4HA 3KJGA 2VFAA 4GXTA 4NARA 2QXYA 3LA6A 2FCRA 3GPLA 2D5AA 4M8KA 3S0JA 2YZ2A 2Z83A 4MDFA 3ER8A 3HEAA 1ZM7A 1EAYA 2IXFA 5TPWA 1LB1B 2HJ9A 3F4BA 2OC4A 1IOWA 2JFUA 1WM1A 3AC0A 4JVOA 3N8IA 4LZOA 3PYMA 4Q37A 4ZEOA 3WWYA 4FR2A 4J3FA 4W8OA 2JGIA 2Q8NA 2JI7A 3RRZA 2PH5A 4WNCA 1Z34A 2DQ4A 3PS9A 5DGXA 5E4TA 2G08A 2NG1A 2JFQA 3EVBA 4RNCA 3ZGOA 1E7SA 1RQXA 4HBGA 3LT2A 3PRJA 4YH1A 3FTCA 3DMTA 1V1RA 4MQ5A 1L1EA 3HCAA 3ILXA 1SU8A 4HH1A 5CBKA 2OFXA 1PEKE 4UJ3A 3ZW8A 4B4OA 2H7XA 3JTEA 4JXXA 3ZU5A 4ZC1A 5K8JB 3RAFC 2VF4X 3LG2A 1FFXA 1FRVA 4O2LA 1EAMA 2Z0MA 3OWXA 2SKCA 4IDDA 1PCXA 3I45A 3VZDA 1YR9A 2Z30A 3B5IA 4JAVC 4M9UA 2FSIA 5AI4A 3KR9A 2D5BA 2OQVA 2VL7A 3UJAA 1GLNA 2CXSA 1P1JA 1DB3A 1JQAA 2A92A 2QUKA 3LHFA 3DHYA 1EUDB 2YJ4A 2WSSD 5K0JA 1TUIA 4OVKA 3DO5A 4RKQA 4U2GA 4HNUA 6LDHA 1YAHA 2GERA 3TOXA 1KGSA 4J8PA 2DRIA 1QVZA 4UOZA 4KI0A 3KP1A 1D4AA 2PZMA 1CULC 1ZK2A 5HGXA 4HAZA 4X84A 4DJFC 1ST3A 5DM1A 3HYRA 3BJRA 3CF2A 3BK1A 1NRIA 4TRMA 5CR9A 3NMUF 2O57A 1XYVA 3ZE0B 4R7ZA 3AJ8A 4S3MA 1W96A 3C8ZA 5K3OA 3Q15C 4KV7A 4K8RB 2WM8A 1D6SA 1NVVQ 1N1MA 4XLZA 1HG1A 1O6ZA 4FLEA 4CE6A 2PT5A 1GFZA 1E5LA 2FKNA 2GK7A 1RHRA 2PY6A 3K0KA 2GN8A 3HOXB 1UPCA 4G5HA 3DOJA 1ZGBA 3ZLVA 4C7XA 1SCJA 3ACCA 1ZCJA 1BXGB 2ZWVA 1V8FA 3KQWA 1L5OA 3WNQA 2KM1A 2PRKA 3CTPA 3GL9A 1ZMOA 1P39A 1K8QA 2ZRMA 4FGZA 3ZNOA 3U6BA 4D4LA 1U1FA 5IAKA 1FFEA 1G8GA 3CUUA 4D81A 3SZMA 5KB3A 1U7PA 5LWHA 3ROFA 3GLGA 4O4HB 3PUJA 3EBOA 4DLNA 1O8CA 4A7PA 3R7LA 1EUDA 4IZ6A 2SICE 3LQ2A 2EWWA 4YUYA 4ER0A 2P41A 1W93A 2ZT7A 2HBQA 3BFJA 3QPWA 4RA6A 3EYAA 5P8WA 4LRTB 2V97A 1PR2A 3AUAA 4NOLA 5B58T 2DY0A 4X8OA 1L5YA 3PQEA 3I2IA 1QHEA 1E2MA 4W5WA 3GA0A 3ZKWB 1RM3A 1D6MA 2VVTA 1E9EA 2XGOA 2YCLA 3NV7A 4IX1A 3UICA 3V8RA 1UZUA 4M1ZA 4ZCMA 5EI5A 4ZVTA 3OJXA 9ABPA 5L4NA 3F5SA 5K8LA 3WMFA 1C81A 2IXAA 3ONNA 1R74A 1OE0A 4Q02A 1TKBA 2ZJ5A 1KYQA 4NC9A 1SBYA 3ETDA 3BFPA 1QLWA 1SGWA 4FFLA 3Q0EA 5DCWA 1Q17A 3V1NA 5I3ZA 1L5RA 2MYPA 5C1PA 4OLFA 4LI0A 3TYXA 3HJTA 4JT9A 4DIUA 1K9VF 4EJSA 1W49A 5IJAA 4KYIB 1KIAA 1DKRA 1ZK1A 3TLGA 1ZSNA 2Z3WA 3AOGA 2O19A 3QHQA 1XTIA 2N46A 3EXHC 2DTEA 3LCRA 4FW9A 3LUHA 4M0LA 5KNCH 3QUCA 1RP1A 4KQXA 3WLFA 4GM4A 4RQUA 1F60A 4M8SA 5K0GA 1RU3A 3NR2A 4PAGA 1W19A 3A9CA 3UMVA 1OXXK 1YSCA 4FOPA 5AJWA 1PJBA 2OBFA 3OCZA 4LHSA 1NUQA 5AVSA 1VG1A 5K51A 2FEOA 3IAEA 1XMSA 4H1VA 5A7HA 1FYDA 3NKVA 1D4FA 1WSBA 1HQYE 3BSSA 3KQTA 3KQSA 4YRSA 4LF5B 2EATA 4OM7A 3A28A 2QX8A 2IZ6A 3JAMA 1AS2A 2KSQA 2W9XA 5T3UA 3PXEA 1JAZA 3T7CA 1SBIA 3OZWA 3SC3A 4QYIB 1JT9A 3K31A 2H59A 4H7FA 3K71B 3E4CA 3WGMA 4BFUA 4CLRB 1R5BA 1TKCA 2QJFA 3UKDA 5CNIA 3FROA 3VHLB 1I32A 2I76A 2ZLBA 3CEPB 2P2LA 4MGYR 4LHWA 4EARA 4BNMA 5IAEA 5JI3E 4YCNA 4D26A 2J9ZB 4R2XA 4ZI7F 2XH8A 3GLQA 4PLYA 1F0PA 5JCJA 3HU2A 1EUCB 4JC5A 3BSWA 3PQ4A 3I4LA 4DMLA 4EB0A 3U4QA 5DTRA 2FP4B 3OZUA 1N5DA 1DBQA 4ZYZA 4DJAA 5HGJA 4EY5A 2GI4A 4IJ6A 1PWHA 3ZK7A 3U1TA 1ZVQA 4HZGA 3DEFA 2FPSA 3C1UA 3BA6A 3L1UA 2FR0A 2O3TA 4K1LA 4MRSA 3CSSA 4BVHA 5CA1B 4RULA 1LK7A 1Y9JA 1GHTA 1WDWB 4QJIA 3TQCA 1UWLA 3QXSA 2I78A 5H68A 4E51A 4MW4A 3DVAA 2HDOA 4AICA 3PQ8A 4GPIB 1KBQA 1PK7A 1X8LA 4FS8A 5A5EA 3LM8A 2FFBA 5MGNA 1RYNA 4HXYA 5CLIA 4AP9A 4QIWB 1RNLA 2RGDA 3OEED 5BQ5A 5MN5A 5D5HA 621PA 1ESEA 1TUGA 4EQ6A 1QKIA 3GV0A 2H4FA 4I55F 3OE1A 2OBLA 3FG9A 4CLRA 3EJ6A 4L08A 4TRNA 4ARIA 2Q4EA 4H3SA 2GBPA 3I09A 4UAGA 3FFWA 3TVDA 3LXRA 4JUBA 4LYFA 3DW1X 3HNRA 4CKBB 1VDZA 1L4YA 3B20A 1USUA 2NO0A 4RF5A 3SLRA 5LBTA 5BSMA 4CM5A 4DBZA 1MPXA 1IBMB 3WMGA 1EUCA 2WAQB 2NZVG 1DARA 2FP4A 1PP4A 4LJ9A 3BN3A 3CKMA 4OSEA 1LW7A 4B5KA 5ALYA 4DNQA 1J0BA 2C83A 1RWOA 2PH7A 4O4JF 4RFLA 1IAQA 4F46A 4EX7A 1DAPA 1T35A 1TKRA 4P3PA 5CA1A 2PH3A 3B1JA 3IV7A 2UAGA 4PY2A 5CJ2A 4B33A 2JFOA 5B1EA 3KQQA 1FTQA 2I8AA 1FMTA 1ZWLA 4E5MA 1KO4A 4E14A 4JI5B 4YO8A 2GCPA 4X3OA 3IUYA 3IELA 2Q3FA 3RWOA 3KPJA 2PKXA 4N7JA 3GFQA 3WRYC 4CYMA 2ZI5A 1CR2A 2QW0X 2BEKA 3ZIUA 1X87A 4V0QA 3SYLA 2BKEA 3SE7A 5FBWB 3KD2A 5DP1A 2EIXA 2JHCA 4O25A 3U17A 5A4KA 1JAIA 1YFZA 2G4VA 2CMFA 4FEAA 5B3JC 3E8XA 4TTAA 3RC7A 2MR5A 2Z2YA 2QN1A 4P31A 2YVQA 4QJ4A 4BNZA 3PQFA 3HOWB 1R8XA 4D97A 3ZG6A 3WLRA 2AMVA 2R84A 3G02A 2F67A 1AGRA 2A5LA 2HLDA 2Q4DA 2WPNA 2ZROA 1R9MA 3ASVA 1Y89A 1OI3A 4G07A 4OHBA 1HDZA 4I36A 1UBOS 2ANCA 4LDPA 5BVGA 2P6RA 1ENYA 3ZUPA 1F5SA 1PWXA 4OFZA 4WFJA 4UQPA 3GGSA 1V45E 1TU3A 2XGGA 2XW6A 3HGTA 3LS2A 3CNHA 4QGFA 4BNDB 4FT2A 1OBOA 1U6JA 1QAOA 5LLTA 1QZ3A 3NDIA 4FYJA 1MABB 4D9KA 1N6HA 3CYFA 2NZ8A 2EKBA 3P45A 1DIBA 4Q3DA 5G0WA 3WB1A 2NU6B 3LF2A 3A7DA 5JPCA 1QM5A 1UOQA 1XD2B 2PIDA 3EXHA 4TKZA 4MLDA 5BWLA 3FM9A 2HUPA 4EB8A 3CNBA 1W5BA 2XBMA 1SXGA 4DMRA 5HM6A 1SVKA 3KXDA 2AI3A 3FCXA 3ZWYA 2GF0A 3V1YA 4EYKA 2XMGA 4EPRA 3HRIA 1US8B 1V0JA 4X20B 3HKCA 2JCGA 4LDQA 4Q3LA 2TS1A 4GYKA 4M1EA 3KBOA 3VR4H 1Q91A 2Z08A 3W05A 1YQEA 1XZPA 4AUMA 4AO7A 1GPBA 4XR9A 1R6TA 1P33A 1QG0A 1E0AA 3R76A 3SF8B 3PRKE 1YACA 4BGUA 1XL1A 1GP2A 1Y8AA 4QFCA 4XH9B 4OAQA 1U2SA 1UBRS 3GEPA 1JILA 3KNZA 5B55A 4OY3A 2CEKA 3WQBA 3L1VA 1KYVA 1NLYA 1RRMA 4IIHA 2PMZB 2VRBA 3VPXA 3R0ZA 4KRXA 1E7WA 4BUCA 2V5VA 1TVKB 2R93B 4MS1B 2BBSA 4EQZA 3KTOA 1D9XA 4I1VA 4GR4A 1RVV1 1W46A 4RKEA 1U2PA 1E9DA 2WAMA 4NOKA 2ID9A 2KE5A 4MJXA 4CKXA 1DBIA 4O2AA 2QAIA 2VUSA 2BKAA 3F90A 4QUKA 1RRVA 4AG5A 4BO3A 3AY0A 4U0KA 3CO0S 3TW8B 5KSWB 1D07A 3SZOA 4C06A 5DNDA 3BDVA 1FL9A 4WSOA 3QTTA 4LXUA 1KZ9A 3INGA 4C2BA 4LE2A 3TM5A 4IQ0A 4Z4GA 1QMGA 2JRLA 1UC8A 1B8VA 3F78A 3LDAA 1JI3A 4YCCA 1M1UA 2PT9A 3HK2A 3RF7A 5FPYA 2XT9A 3UAOA 2I80A 4KWTA 1NKSA 3WY9A 1H9CA 4WN3A 1XAIA 3R8FA 1L5FA 2ZT6A 4AUNA 5ADWA 2FW9A 4YCJA 4LHVA 2QRVB 4PE5B 3SF8A 5KQSA 3L8YA 4ZHQA 3CBGA 1XX6A 2CC2A 1G8HA 1KJ9A 2ZIUB 1Z88A 3V7UA 3AIOA 3CRZA 1GN8A 3H04A 2V1UA 1FJGB 1FU8A 2I7DA 3JQ7B 4MS1A 4FGKA 3R2JA 5GJVC 1MRZA 1XLTC 1YC5A 4QDTA 2J3JA 1P31A 2TYSB 4U8GA 3E9CA 2BY4A 3GPBA 4JEHA 4OI0A 1HLPA 2JIZA 1GSIA 2XCOA 4QPPA 3RRBA 5JARA 3L7NA 1J8MF 5KEIA 1KJJA 4C0XA 3O0DA 3EGXB 3KAQA 2BP7B 1H6CA 1Y7HA 1PLKA 2M32A 3BRQA 4U63A 3TTUA 3QJGA 4YEDA 1E6WA 2FR8C 3JQBC 1P6XA 5CJJA 5IT4A 1QS0B 2WT4A 3AF0A 3RYHB 1WZCA 4PSVA 1E4EB 2Q3MA 4BAZA 4EKIA 4KTVE 5FNZA 2BTQB 7MDHA 1YDEA 4WACA 4UTPA 5CDYA 1AO3A 1UM9A 3VO1A 1UDRA 2XBLA 2V98A 4UDYX 3M1YA 2NXNA 4P7JA 3TQFA 4A8PA 1PFQA 3NZEA 2BFEB 4AK9A 5BN4B 4LYAA 1TW3A 3GA5A 1R0BA 3H18A 3KSRA 4E2ZA 1R66A 2VT2A 3GVXA 1GKYA 2ZE6A 4EI7A 1V3UA 2V7XA 2Y6UA 4FFSA 2NV0A 2MOKA 3ZVMA 1DTSA 1QHYA 2QD3A 2GWRA 1TZJA 2AE1A 4LSWA 2RIPA 3M33A 4F21A 2J46A 1YFJA 4X66B 2J48A 3WGLA 3AG5A 3MYRA 2NZYA 1XA4A 1JGTA 1J9EA 3DGEC 4J0GA 3M9LA 4P4UA 1YVPA 1W5AA 4ZQHA 2ZVPX 2P27A 4MQBA 1S3FA 3CURA 2JGDB 2HPVA 3IODA 3GJ6A 2O8NA 2VH5R 3PNSA 3I1IA 4BNNA 4O2BB 3HDYA 4A9AA 3EGXA 2YMPA 1U90A 5EKXA 4KVZA 3OO1A 2NSHA 4TMVA 1R0XA 1II8B 3FOFC 5LL6P 3FCCA 1Q2XA 1WG8A 3LXXA 5CFOA 3HY4A 3N1UA 4AO8A 3R5JA 1Q15A 1H93A 3O4FA 2QTCA 4MW9A 3I72A 3QWBA 3GZ4A 4W1SA 1YOVB 2G72A 4LXQA 4US2R 2P68A 3E9MA 5DGTA 1ENZA 1W0CA 9ATCA 2BMWA 2F8LA 1E9RA 2BFEA 2A3NA 5CH5A 4WLUA 3SQLA 3EPLA 2QBYA 3HS3A 3PKJA 4MS4A 3KUKA 2A94A 4P4NA 1PVDA 1RI4A 2M6KA 3W77A 5HVNA 3L8DA 2Y0EA 2VRNA 3QUSA 1GUYA 3MUFA 4QU0A 4WKBA 4DVGA 3SU8A 2B82A 3HR7A 1NMSA 1XCOA 2IXGA 3MWKA 3QYPA 1OXUA 2ZZNA 4KDEA 3KUXA 3H42B 1O0CA 3B38A 1RRGA 1TM7E 2YY7A 3O91A 4HAYA 3ZR4B 3A3OA 3GJ0A 1DC5A 2R2AA 4HK4A 4BNUA 3DO6A 1Z4KA 4JQZA 2CLMB 5K7SA 3U9LA 1FYEA 3BH7A 3FOAA 5F2OA 3A1UA 3WDMA 3OHPA 1II8A 2RHHA 2X9NA 1SVOA 4R2JA 5JZVA 3MIIA 1B73A 2I2AA 3FUUA 4ZEWA 2PMBA 2O52A 1YA4A 1XCJA 2W6ID 3QU5A 1RZVA 4RCYA 3VGJA 3HHEA 4OLAA 2I2CA 2WF6A 3MCVA 5HOEA 4J4BA 2VDMB 2BPOA 3O8OB 1G4AE 4IUBS 4Y8VA 1NZFA 4XZ3A 1B14A 5A6VA 1BKYA 2XB4A 5E1OA 3BREA 3URMA 3ZLTA 2GBGA 4CR7A 2ZSHA 1KRXA 1DDGA 1XMJA 2XVXA 1PV4A 1U1CA 2FPXA 4B35A 3DAOA 4YAGA 1IZ9A 4JP5A 3P4UA 3VJRA 5AKGA 4BNVA 2C59A 3U3RA 3CEHA 1S0UA 3MVEA 4HEQA 2B1JA 3S8MA 5HJ5A 1HDOA 3DVRX 3EODA 4FX2A 4NBWA 2X8WA 3G0HA 1GGNA 3AB8A 3BB1A 4GICA 3LHKA 3EIQA 2C7QA 1MA0A 1NT4A 3WBJA 2RBGA 2XB8A 2VP3A 4WD3A 3D6HA 3OO0A 4LRYA 4XM1A 1R8YA 2VJYA 2YWDA 4Q7QA 1MRNA 1Z2NX 4TRJA 4DUYB 3J7TA 2OFWA 4FZVA 1NSYA 1KSGA 4DM4A 1J2RA 1NLZA 1XLTA 2NVWA 4QEDA 4ND4A 3OOSA 5AW9A 1J09A 3CKLA 2KPOA 4LE0A 4F0JA 2RSLA 2BEUB 3ED1A 3N8DA 4RS3A 3A11A 1YE3A 3N75A 3ESBA 4H7KA 2YN4A 3ECCA 4KLAA 2OHOA 1G9TA 2R25B 2QTFA 3A1VA 4MQLA 1IBKB 4EZBA 3ZEAA 1U8ZA 1WNTA 2VZEA 3K8ZA 2VAVA 3FZGA 3TSCA 4BWYA 1E5VA 2FR8A 3JQBA 3NPAA 1YIOA 3A6DA 4OI2A 3S17B 1E8MA 1Q1BA 3D8SA 4TT3D 3GLFB 3PGJA 4MUKA 3KQHA 4NJMB 3BJEA 4TYPA 1T4BA 1V43A 1KZGB 4IHJB 3Q72A 2IYNA 1J24A 5DO9A 3EZNA 3CCFA 1BA2A 2J67A 2JLAA 3N2LA 1FS4A 5IC6A 3TDKA 4LV5B 1TEXA 3LUKA 5JBNA 1BQEA 1M6WA 2V0NA 2P2ZA 3II6X 3NTQA 4BFVA 1GYQA 2XNDA 3Q98A 1J20A 4KN6A 5DEOA 1CETA 3RVBA 3RVPA 1UKAA 2GYUA 2J5RA 2IELA 3G23A 4HMQA 4J91A 4MKRA 5AHXA 4G84A 1FNDA 2IF0A 1HDXA 2PUJA 2ZSJA 2LCIA 2NQ2C 3OT4A 4FKMA 3GGCA 1YHZA 1M2FA 1P62B 3Q10A 5ANRB 5CM2Z 2OQRA 3RYCA 3O31A 2NP6A 4X63A 1DHTA 2G6BA 5GONA 3FN4A 3F47A 2AVNA 1CRQA 2H92A 3H4TA 4OB7A 4W5JA 5DPMA 2W2KB 4FJ0A 1IBRA 1ZUHA 2CHFA 2PGNA 2PQMA 3ICOA 1FSSA 1G60A 3AINA 2D1RA 3L8MA 4MIOA 3GA7A 2JLSA 4BX0A 1WCMB 3GMIA 4JA2A 1W9MA 4RD0A 5ALLA 1KOJA 3CIFA 4JD5A 2G71A 4NJMA 2QT0A 4NBNA 5BR1A 5MF6A 2LV8A 3L0YA 2XTZA 1QZXA 2VZ0A 4IL5A 2J3DA 4IHJA 4BXOB 2DSTA 3AR3A 3BBLA 3QVMA 5K3AA 4C4XA 5FTLA 1YZTA 2LIPA 3FWHA 3IVXA 1JIJA 2O8FB 1C14A 2EJWA 1Q14A 2X41A 1LZLA 3AEUB 5ALRA 1Z6XA 5JNUA 5JZSA 3V97A 1EEHA 3OAAD 4MUAA 4TPKA 4Y9TA 1E59A 3ICEA 3ENZA 5G1PA 5I8ZA 4AMGA 1TTQB 1NX9A 3H8JA 2QM0A 2OBYA 4Z9BA 4K6HA 4QG7A 1U8UA 2JFHA 1UKVY 1B16A 1DKUA 2P4UA 4LMPA 3RHTA 3LBIA 5IXJA 1OKKA 2WWHA 4ZT2A 5B1YA 1XROA 4K9QA 2JI4A 5AXBA 3WA6A 4CQJA 4FMBB 2ODQA 3NWPA 3UBTA 1UBHS 2XUAA 4MR8A 4GDFA 1T9DA 1XHFA 2VO1A 2JGKA 5IN5A 1ZK0A 4E15A 1WCIB 3BJMA 4RANA 3U6KA 1TEHA 3FWYA 4UVIA 5J4LA 2BM9A 3I64A 3N0RA 4BQNA 4FWBA 1O57A 2FLKA 4FNAA 1E2LA 1R5NA 3ESZA 3H2GA 1GN9A 2XKBA 4KMOA 2X8BA 4PPFA 4QBTA 2C58A 3KAKA 4LJ7A 1U0EA 4TQ9A 2PGAA 4BXOA 4YJFB 3E5NA 3NC0C 2QRKA 1L5WA 1H4VB 5ADUS 4H77A 3W4JA 1LPOA 2O8FA 2CXNA 3AF2A 3O2NA 1WV0A 5FA5A 1TAHA 2D2XA 1XPUA 4N1AA 3EQ8A 1XKLA 3F98A 1ONSA 4PZPA 1KMCA 1N5MA 3WWPA 2YY6A 1TYAE 4LZWA 3TR5A 4AYXA 2VTEA 3WFZA 2ICAA 4JL5A 1MZPA 5ILOA 1PD1A 4PBTA 4E1AA 3FY4A 5UKDA 3RSQA 1QSGA 1MTOA 2XYVA 4FN5A 3AUKA 3K8QA 3EZ9A 3RS2A 2R6GA 3G13A 5E7QA 2ZAGA 3OTHA 5EKTA 2P91A 3KOUA 4QRIA 2VF2A 5A71A 4WFQA 4F7WA 2J31A 3Q6IA 5IDWA 1L5NA 4TSKA 3KQMA 3O9ZA 4FQ8A 3M4YA 4X7BA 4GG1A 4EG1A 3SZRA 1TLLA 3AGPA 3MD9A 4YHBA 2QTZA 5K4HA 1OH7A 5EPEA 2OGSA 1JLLB 2B3TA 5E3JA 3IDSA 5LNK6 1YBAA 3VNQA 2OCIA 2QG4A 4MVJH 3TPZA 1NNEA 4ZN6A 4D44A 2VUMB 2CL0X 3OX1A 5J5CA 1IIRA 1SOMA 4OJKA 5B53A 1ZGHA 2W6ZA 3BGWA 4URYR 2GD2A 3M3DA 4ENUA 4EO7A 3ADDA 2ENUA 1W0JD 4Z3DA 1H6BA 5TQ0A 5CXUA 5KTRA 1HL3A 2MINB 2CFCA 4HUJA 1GSHA 1Z28A 2A5JA 2HWYA 4UXJA 1LRJA 1WMFA 1ZXXA 2V6FA 2ABWA 4G0VA 3EIFA 4HWTA 4OOEA 1J1ZA 2V7TA 3HG7A 3ITKA 4EVRA 2H8KA 2EJCA 3RH0A 2QUHA 4GMGA 1YXMA 4BZXA 1K92A 2C2MA 1EK0A 3B52X 3MF4A 4GKVA 1V6AA 5TR9A 4A92A 4JDUA 5C5IA 4A3IB 2AD1A 3KWJA 2KJQA 4IDHA 2IV2X 1Y6FA 1U9CA 2XTNA 2G1PA 5AHWA 3AR9A 5CFPA 3QWIA 4BY7B 4Z2YA 3MRSA 2WJZB 1H8EA 1F3OA 1JJIA 1JLLA 3BJIC 1FP2A 4MLPA 1IOVA 1I7DA 2ZPAA 3BMCB 4D42A 2CMGA 3G85A 2GZSA 3CLKA 2HA3A 2D5IA 3EVDA 3OJFA 3ZI7A 3ZTYA 2WY2D 3K70D 3DP9A 1IPFA 3KUDA 3KVNA 2HKIA 1V4VA 4QSHA 1X9IA 2P9CA 4I5IA 1ZJYA 4KN5A 4RZQA 4C4AA 1UXJA 4DIEA 5FDFA 2MINA 2P78A 1Y8QB 4ZO8A 2YJNA 4EL0A 3ZWXA 1IQUA 3LH5A 1JU4A 1U4OA 5DKFA 1OI7A 2QVBA 2FPIB 2I91A 4TS1A 2DH5A 1YA6A 2JJ8A 1IJEA 3CHYA 4ASUA 1NOIA 4NH0A 3V48A 1CS0B 3Q3VA 1RLMA 3T7EA 3V8NA 4CMGA 4N18A 2UUAB 2B6HA 4B82A 4D45A 1VMEA 2W6JD 5FPKA 2QSYA 1WKBA 3DLBA 1XDDA 3I8SA 3W3AA 1VIVA 1I36A 3DJYA 1EGHA 1K75A 3RVSA 2GZHA 2IX3A 3AQ4A 1WWKA 3ES9A 4QG3A 3PEWA 3OMXA 1VMKA 4YRJA 4DSUA 1LXCA 2G70A 5AD1A 1Q1GA 4WJKB 2ZCVA 3IHWA 1E64A 2ZE8A 3EULA 3FH0A 1SXJD 3I6YA 4HDNB 1MH1A 3U7IA 1FOEB 4LJLA 4Q21A 3D1JA 3O1IC 4YJDA 4F93B 4CM3A 2M6SA 5F7XA 4MVJG 1FUIA 3WGUA 5HRCA 2AFRA 1GG5A 1Q7EA 2NTVA 1QIHA 3I2HA 3K05A 1F8XA 4YJKA 2W4IA 2EYQA 3G9QA 4LTNA 2PT6A 2Z2JA 5IYZA 5E2BA 2BFBA 1DG9A 4XXHA 3GFTA 2Q7OE 2H2FA 4OYLA 4RJLA 4KUGA 4YJ3B 5EZYF 1GCIA 2NV2B 1X2EA 3E7FA 3L7AA 4XX1A 3UENA 4OIMA 1NQ5A 1ADCA 1YQ9A 4J0KA 5TPZA 4BYMA 4PHHA 5KKNB 1UMBA 1K2VN 1I6MA 1XJCA 2BZSA 2HIGA 2WZBA 2IHBA 2Z58A 3KT3A 1WZUA 1U28C 3NETA 1SRQA 4R9UC 2XDYA 4WXYB 5E9QA 2AOTA 1CS0A 1VL6A 2Z5VA 4LK3A 5CFQA 4OAPA 3PR2B 1BWQA 3GD5A 4YWHA 2XRYA 1DQNA 3HVJA 3NC1C 2NPFA 4JI7B 4EF5A 2M2IA 2QV0A 3PCRB 3P9CA 3ZWMA 2PEYA 3RO7A 3WX0A 1U98A 5LDHA 4JI2B 1ZEMA 4IDNA 5HMLA 4JJ7A 5L4SA 2ZB4A 4CCYB 4ARUA 3JYOA 3LGAA 4CEHA 3VVBA 4NATA 2VJNA 4JVMA 3L6DA 4MR7B 2CLCX 2BGUA 2PVCA 2VWQA 3AUJB 1UBMS 3LLUA 4X6UA 3SOPA 4DQUA 3UJ6A 5GVSA 4LWQA 4B3MB 2OPBA 2AOUB 2W6MA 3HZZA 3NTLA 1WRBA 3FWNA 2RHMA 4ID9A 3N9IA 1G17A 2UDPA 4KR2A 4B09A 2XMSA 1A27A 1KNXA 3LC7O 4FPXA 3TLAA 4GPZA 3WMWA 2C3OA 4QYXA 4C6TB 2FQWA 4KIFA 4LEIA 2ILTA 4B2LA 3RBAA 2X40A 4A2WA 4ENRA 3U49A 3SGLA 1R8QA 1P0IA 2QM8A 3CB2A 4JXJA 4QM6A 1O95D 5A5DA 1QFSA 2B30A 1ISPA 1CR1A 2IY8A 4H6WA 3VNRA 4CMIB 5DN6D 1LDMA 4L7QA 1BU8A 4Q9NA 4C01A 1ZNQO 3GJYA 4EKEA 5B2FA 4JOBA 4B6PA 5CFLA 5A6SB 3O4IA 3P71T 3EUWA 2ZUEA 1IB6A 4M83A 1J8DA 1TD1A 1WZ2A 4ATNA 2IODA 4CN9A 1RKUA 1O94D 3KJFA 4RIHA 3LCMA 1BC5A 1E3JA 1N7GA 2HPAA 3CXUA 3FGPA 4R4JA 4XFJA 3A6KA 1RQ7A 1RRKA 4FFMA 4IGIA 1E18A 5E8RA 1MZVA 1D2RA 3A9UA 3RS3A 4MR7A 1BCSB 1T1RA 2VYVA 2NTYC 1F20A 4CEIB 4IV8A 1RPNA 1E9FA 1XQ9A 3OM1A 3S40A 1Y3IA 1EDBA 1TADA 3BE6A 1TEZA 4H0FA 4N3CA 3COWA 4M3NA 3R41A 4QQNA 5I5GA 5HHTA 4JI0B 1MA3A 4WY8A 1IWBB 3VI4B 4OK3A 1EI9A 1BVUA 2F1OA 1Z16A 2WINI 3PIDA 4PYRA 1JEYA 3DFIA 3UOGA 4YT8A 2G25A 1WUYA 3HTXA 1V8PA 2O7SA 2V6MA 1FP4A 1QH0A 1EINA 3OQ6A 1RQPA 3SM3A 4GLLA 3GJSA 4D8XA 4GEGA 4G9BA 2FW1A 3RTCA 4AD8A 4CKZA 5JZOA 5J1SB 4HDOB 1SCUA 4WCDA 3DXZA 3G8CA 1I1QB 3PYXA 3Q0IA 3H83A 4EELA 3NIDB 2ANBA 4QHTA 3DP7A 5FWDA 1CKEA 1QGAA 1GUAA 3LTEA 3PI6A 4M1OA 1W4CA 1ZBDA 2O2CA 3QI7A 4GDMA 3U4CA 1TUBA 4A6XA 3A1SA 2JK0A 3HUUA 2VTDA 1RHUA 1UM8A 1BCSA 3GWGA 2VAXA 3MYYA 1CT9A 2CJYA 2H1VA 2SHKA 1THTA 4X95A 2WVJA 2Y4NA 3IJPA 4AVYA 4R0VA 4C2AA 2EP7A 4CLXA 1LF0A 3T7IA 1CUXA 2BMVA 3B70A 2W71A 3BXZA 1NI4A 5KDDA 1OT5A 1JQBA 2X5JO 3WGJA 1FJHA 3OZTA 2GYYA 4RL4A 3EF3A 5L4LA 2WTBA 1PGOA 1EWRA 1Z6AA 3DCJA 3JXEA 2JFXA 4I1OA 1KI1A 1OZHA 1BVHA 4LDZA 1YBFA 3SNHA 1J0XO 4M9CA 3ZXYA 1KI6B 1A8QA 3G79A 1EA7A 4P7GA 2EBHX 3RC9A 1SBNE 4H7EA 5KWJA 1IM2A 5KHLB 5KKCA 1CY4A 5AI9A 1WHSB 5L7YA 5DNCA 3Q2IA 4JOSA 2DT5A 2OHJA 4WXPA 1U8FO 3UJPA 1W25A 3WB9A 4B6QA 1WJGA 4MRNA 2ZUVA 4PRKA 4UREA 4BRWA 2ZJBA 2IVZA 1PWZA 1QXSA 3GOHA 5G0SA 4DJEC 4ALKA 2Y27A 2YIDA 1F2TA 2ZVDA 5GJCA 5KDLA 2FFAA 4RZHA 2GTHA 4XSGA 5K0NA 3KHKA 2GJAA 3OZ7A 5BMVB 5KS2A 3L8ZA 1ZHOA 4W9RA 4Q03A 4C6HA 4OHZA 4DB2A 2VF8A 3TSYA 3I2YX 4RK4A 4JB3A 1B8PA 1GNTA 1U28A 1YKGA 1D6NA 3ESRA 5IX8A 3C3AA 1WPRA 4UEQA 5DM2A 2CMDA 3GUZA 1Y6JA 2AOWA 2XY4A 5EIXA 3V8VA 5B30A 1Z06A 1CUWA 2EFGA 1ULUA 2F3UA 2BJWA 2H8GA 2J9FA 4L15A 2OZLB 4Q9LA 4MYUA 1XRJA 3NBMA 4LISA 4MMXB 1YV9A 2QZJA 5TVGA 4CM4B 3EPHA 5ALDA 5ISMA 4JLAA 4DR7B 3G2NA 3UQZA 1W88A 2IUFA 2IYWA 2YTZA 3K1JA 4F6CA 4IUYA 1ZIXA 3B6IA 3LPMA 1IJKA 1AQ6A 1KI6A 2IUSA 2W2XA 2XUFA 3HGQA 3QIAA 4TV8B 3O3OB 4EYSA 2KBFA 2HT6A 3L6CA 5HEKA 4C05A 1WHSA 1CCWA 4XGIA 1IXYA 4QDXA 4R9VA 2O0HA 5K8IA 2XQFA 1Z3IX 4UXHA 1C1XA 5BNWA 1A2KC 2WE8A 4NBKA 3S1SA 1MO4A 1KQPA 4DBVO 1D7AA 2VUIB 3RI3A 3KEMA 3WDSA 5FPTA 2ZXFA 3IUSA 4GC5A 4I1UA 1E2JA 3KOWA 1HL7A 4GX1A 3RFUA 3N59A 4S1VA 4TKUA 3AY6A 2O06A 3KRTA 1P0QA 1BE1A 2A58A 1SHLA 3PFFA 4ZQFA 2HR1A 4DFDA 5JCJD 3U9TA 2ADMA 3I9OA 4I4IA 4LHYA 4B47A 3TJMA 4BB5A 4ZAZA 4C3IB 1PHPA 1DIRA 1VI5A 3SY8A 4K9NA 3KJNA 2F1JA 3M5PA 1ONOA 3EVAA 3F1LA 1KVRA 2VK8A 1U3WA 3C3MA 2MT9A 4TL9A 3U44B 4FMDF 2E48A 1KDYA 2I2DA 1JR2A 1U2DC 2APJA 5D1HA 1RE1A 4O5OA 4EG0A 2ZQ5A 5TMBA 3UMBA 3ROQA 2IH2A 1GZ6A 3QSGA 1YR6A 1J23A 2QVZX 4G1FA 4LK2A 4UAVA 2PX5A 5DBOA 3FPFA 3MCTA 3VC2A 1A8IA 1FMFA 3M3YB 1DBSA 1FFAA 3ETJA 4K05A 3U48A 1Y1TA 4TV8A 3KOMA 3NBUA 3HJRA 3KLBA 4V02A 1YDHA 4LOHA 4XGKA 2L17A 2JW5A 1X94A 3STUA 3GUYA 2QMYA 2XUIA 4JYAB 5EJMA 3MPUA 3WGHA 1KAEA 2YYYA 2ZT5A 3G5MA 4L95C 5HK8A 2VSXA 1HDGO 3GRZA 3BZUA 4GECA 4LY3A 3N76A 1KDTA 1JLKA 1XF1A 2ZYRA 3GEGA 3LX6A 2J4CA 4B5LA 1H2BA 1TFRA 4IIJB 3BXOA 3M7IA 4PHTA 4QEKA 1PI3A 3VPAA 1ZN8A 3KB6A 4MSUA 3INTA 1IMOA 5ALXA 2C04A 2FLVA 3OKFA 2ZYDA 3LT5A 4E6EA 4Q4JB 2ZWIA 4LJ5A 4OMFG 3KU1A 3CNLA 1W94A 1WMBA 5SYNA 2HQRA 1ODLA 2VYQA 1NVUQ 3ZDCA 2CBGA 1CJVC 4PS1A 2CCKA 1CUZA 1YOBA 1PK8A 2RC5A 3H5OA 4YYZA 4Y1EA 5ED0A 4Z7QB 1WXEA 4RADA 3THOA 3KSBC 4TSFD 3ZVRA 1Y98A 2ET6A 2GEKA 3QEJA 1EFRA 3QNWA 3D8UA 4FR0A 4RJTA 5K6RA 2ORYA 4V0ME 1DJLA 4I1PA 2AC4A 2V1XA 3WTBA 3DB2A 3TRHA 3ZQJA 2OAQ1 2C0CA 3WMEA 1P1RA 3PX2A 3LOUA 4Y9SA 1J22A 4JGBA 4CF3A 4II2A 3KQNA 4HC4A 2CB9A 2F3SA 3I2JA 5F5LA 3U26A 2MSLA 1G64A 2CNNA 4IQGA 2Q3EA 2R7AA 3MUEA 4QOIA 4DJ5X 1VLVA 3AJDA 3FPLA 3R3VA 4LOIA 3H99A 5DBFA 1UOOA 3LX5A 4DLAA 1U7DA 2MMGA 2IHTA 1N5KA 4FHZA 2EQ5A 3C7DB 3TTWA 2WQ6A 3DPUA 4M89A 5FAXA 4NCJA 3VHRA 5KNBD 2PWYA 2R5WA 1F0YA 2J6BA 3VR6D 1R9TB 1ZD9A 1PR6A 3H1EA 3HABA 1Z47A 1QJCA 3SHVA 2C9BA 1L5MA 2D8MA 3JW8A 1G7CA 3BRWD 1UC5B 1FNSA 3KO8A 3NHWA 1OREA 4Q4JA 4RHEA 3BE5A 2GLUA 4V0NA 2FPUA 2QKYA 4RPJA 2PWZA 3M9WA 4UFOA 1XK6A 1OJLA 1YS4A 2ISQA 2PUTA 3H86A 1R6BX 3NH9A 2OB1A 4UNSA 2K2WA 4O4LA 3TLEA 4F86A 2B35A 4YV0A 8AT1A 5LJIA 2ZUTA 3KOYA 4WEQA 1K63A 3IAHA 3ETLA 1JG4A 2HTEA 3LECA 4NEQA 4YTEA 1HK7A 1XAGA 5FO1A 1E77A 1V35A 4HRXA 3U60B 3QBEA 2J1LA 3PDHA 4M9XA 2ZJ3A 5D51S 3VXKA 1HUQA 3RIEA 1R3DA 2P35A 1W5TA 3LBAA 5GADl 1TB4A 1LS1A 4KK4A 1UFOA 2X9GA 3ESXA 2WZCA 1DMRA 4NIMA 1Y1KE 5AJUA 2CLKB 3SNKA 2VP4A 3IIIA 4C3OB 1ENOA 3M81A 1OXTA 1UBNA 3TFOA 1T3GA 3FDJA 4NZOA 4TLLB 3DWEX 4YLGA 1VDMA 5TX7A 3B1XA 5KYVA 4CFZA 4CU2A 2REOA 3OQVA 3OP4A 1U0OC 3UJ8A 2VXBA 1YQUA 2MSDB 1JHMA 4JJ4A 3FTEA 1EVKA 5B64A 2GO7A 2YWEA 4K9LA 1XVAA 1VCHA 4LZLA 2PX2A 3T3DA 4CM8A 4YRMA 3GLIE 1IRIA 3GC6A 1NW4A 2JAUA 3HWSA 4R40A 3DKPA 4OHMA 5C4JB 5M3FB 1POWA 1YB2A 5A9RA 3MWDB 1ISJA 1K98A 2GRUA 2VLBA 4O8CA 4KDCA 3DUFB 2PUCA 2JVJA 2ZUBA 2PL1A 1CHDA 1DCKA 1U9YA 2NU7A 2GKOA 2PO7A 1Z0KA 1D0VA 2UYHA 1YB7A 1S2IA 2QIOA 2GR9A 2ZB3A 3REFA 1V4NA 3WIEA 1N2CB 1Z74A 4CL3A 4CIBA 1OAKA 2Z04A 2P1DA 4D3DA 5CDFE 2ZWAA 1EYZA 1WUKS 3STVA 2M1ZA 1FJ2A 3H5WA 4NAHA 3HJFA 5C4XB 2B7CA 4TTRA 4DV4B 2FSVC 4JQOA 3R0XA 1CJKC 3UV7A 4DCVA 1EK5A 3R4CA 3U3DA 1U2DA 3H5TA 3MPOA 4P35A 1W75A 3KETA 3JQGA 4KE6A 3FHTA 3NHMA 3ANYB 3F4KA 4YR7A 1W29A 2DKOA 2EQBA 1U3UA 4G81A 1W8IA 3L77A 1PNQA 3H87A 1GGFA 3FDZB 2H31A 2IJGX 1G66A 1AA6A 1C4WA 3DGFC 2CKMA 2RFLA 4ESVA 4RVSA 2ZIEA 4PR0A 1MC8A 4JCCA 4N6NA 3R3JA 3MWDA 4UUBA 4WOPA 2P3SA 3WXBA 4F2PA 4KVGA 1XXHE 2GARA 2QQ0A 4MVJF 2PA3A 3USZA 2NUPA 2IYZA 3OURA 4NCNA 2YS6A 4M0KA 4PW0A 1T6NA 3IB6A 4M0UA 2ZWOA 4Z8YA 2HWUA 4DA7A 3SVTA 4JLBA 3I5XA 2JLWA 2VZ9A 5JJLA 1C41A 5LXTB 4A3EB 3MGCA 3IMEA 3OY7A 1X7YB 2QEQA 2JIZD 3EXAA 2GFHA 3I8XA 3L7YA 3WO0A 5ITZB 2FN3A 2GK6A 2QMHA 1WD7A 1WO8A 2RBEA 4MI3A 3WGIA 2ZANA 3N58A 1TMOA 1G5TA 3DT9A 1AUVA 4KLCA 5BRAA 2R1TA 4FEEA 4XKJA 1H2XA 5J5AA 1YZUA 2PKEA 1RM0A 2XQIA 1RYFA 3SQXA 1IEVA 3VTFA 221PA 3LLVA 3R0QA 2UUOA 2FX2A 4UPVA 3I8OA 2AR9A 1Y5IA 2CFRA 3MGGA 4UHCA 5FOVA 2PHZA 4ZCSA 1QZTA 1FUKA 3FDZA 4JWTA 4BNTA 3VBCA 2NNLD 2VSFA 5H4GA 5T4BA 3IAXA 2BT4A 2BZ0A 4GBMA 2E2HB 1U7HA 1KDRA 3A2NA 3GGJA 1OLUB 1QUEA 4JV5B 2W6PA 2WMOB 2WHQA 4G1CA 4GYYA 2WYWA 4F3YA 4R7GA 1DFHA 1EDOA 2G5GX 2HDNB 2PMFA 1I01A 1XA0A 1KK0A 1AKYA 3NGXA 1UXIA 2FUG6 2ETVA 3IJEB 3PXUA 4ZTZB 1BGVA 2G0TA 4U9UA 4Q34A 4YBRA 1J70A 3VH3A 3TIIA 5JTUA 5ITZA 3K6SB 3BOSA 1KPIA 4UW9A 1CJBA 2ECQA 5I9SA 1FFWA 1OQAA 2EERA 3AM5A 3OLZA 2WILA 4QU9A 4RV4A 4EJ6A 2ZJ0A 2BMJA 4KXWA 2XD4A 4ZV4A 3QKSB 1Z12A 4W9NC 3MLBA 4RSRA 1E5TA 1FDUA 1T9BA 3ZV4A 1I4EB 1P1KA 5J4HA 5LP1A 1LPPA 5AI0A 1XMOB 1RBMA 4V0MA 1TWHB 3WGGA 1U0FA 2LW7A 2WHYA 4OQLA 3FVWA 3GCWA 4N5IX 2NAPA 4JLPA 3IEKA 3IPCA 5ER9A 4C9BA 3NHZA 3CX3A 2PUGA 4OQNA 2ES4A 3KLOA 5L45A 4QOHA 4GOND 2FZCA 2HQOA 3I2KA 2I7XA 1DXHA 3PGVA 4NFSA 1PLJA 1EUZA 4L8VA 4L75A 5LA6F 3FMPB 2ZITA 4WECA 3GVPA 1XTZA 4E94A 1B74A 1N3BA 2RHBA 1OLUA 4HEA1 2CWDA 4JT2A 1I1HA 2VTKA 5DT2A 2W0MA 4BFCA 1U8XX 5A03A 3A8TA 5D86A 3WZMA 1QWOA 2H52A 1RLIA 2QUAA 4ND7A 1FVOA 3O4HA 2AKYA 2E55A 3RR2A 3ASZA 2NO5A 3C8UA 3AHJA 4QM7A 4FMCB 1O7JA 4NBTA 3WYCA 1X38A 3PPIA 5FLEX 4AROA 3MMSA 3W1VA 1JHRA 4C14A 1B1CA 1E5XA 2DHRA 3AHHA 3O1HB 1S8FA 3HUTA 5DSXA 1VHDA 2I2XB 4FGSA 4G0NA 1RFLA 3H75A 3ZWOA 3AI7A 2CYAA 3EBLA 3DZJA 3UGQA 1DX6A 1WQ1R 2X9QA 4ETNA 3EG5A 2ZI7A 3AI1A 1QQTA 3BMXA 5GV8A 1ZEJA 3AR7A 3VFDA 5A1JA 3J81A 4OGLA 3TWOA 4BNWA 2V4UA 1N0VC 2P65A 2LBPA 2WBLC 3C14C 4LYDA 3EDOA 2AZTA 2I65A 3ZZ1A 2P9YA 1FP1D 1UPUA 1VGQA 1SOAA 3K94A 4AMVA 5I3CA 721PA 4L72A 2XOXA 2ZBEA 3UIEA 2O20A 3JD2A 1MJNA 3KQUA 2Z4RA 1GNSA 1JMVA 1KO1A 1XOIA 3PGKA 2FSVA 4PLWA 5LYJA 2NGRA 5K6AC 4RD4A 4QYTA 1VECA 2QLBA 4I46A 2EV9A 5KX5A 1NURA 2QPOA 1F38A 5E6RA 4OOFA 3RC1A 5BN3B 3OTGA 2DWPA 3GLIA 3U2QA 1YL6A 4QARA 2VHJA 3V2HA 4LSGA 1F1BA 1COWD 3I6IA 3QI2A 2IEAA 3LBHA 4MEAA 4GVLA 4P4TA 2HCRA 3AIMA 1H1TA 4C0BA 1XU7A 1NSFA 1R8JA 3ILVA 4KO2S 5K3DA 3I23A 1E3LA 2F17A 1BQ3A 1N5JA 1QQ7A 1XGKA 4HNQA 3A05A 4I4TF 5A3SA 1NPYA 4YYEA 3RZOB 2FMKA 2VJPA 3I05A 3IIMA 2R6JA 3HCNA 3JZDA 5DCUA 4YRZA 5CDFA 1MU0A 2HRZA 2DPGA 2PS3A 5A1TA 1U3DA 1E7YA 1Z2EA 2EU8A 2W2MA 3OOJA 4GSLA 3A2LA 1I3NA 1TJYA 2I8CA 2PMKA 3SK0A 1KI8A 4HWSA 1ZXLA 3T41A 1NNSA 1G20E 4KMMA 4DV5B 1XMPA 4CMBA 3K8OE 3VH4A 5BW6B 1L7DA 3MT9A 4C03A 3I9KA 1G3RA 1SBQA 1FQKA 3VU9A 1O89A 5IASA 1OYYA 2F4VB 3KHSA 2AS0A 4MUJA 1KBZA 1A5AB 6GPBA 4QAJA 3BFXA 3IP8A 2Q3CA 4Q6BA 4R2WA 3S2UA 4K03A 1TVEA 4O1HA 4YJGB 3IO3A 5CCDA 3U3ZA 3WAKA 3IDFA 1SOWA 3PC7A 3CRQA 4DLKA 1UBGA 5JZ9A 1YMVA 1LTKA 4WDQA 3TTVA 1ZGJA 1W2WB 4LJAA 3H2YA 4Y1FA 1PQPA 5EMNA 2ODPA 3MZ0A 1MIOA 4C7JA 3O94A 2EARA 2AW5A 4KQIA 3SHWA 2DXIA 1FU4A 2UVQA 4L9SA 2XNDD 2XRZA 1ISRA 1R9GA 1CX9B 1W59A 1Y6QA 3EY4A 3F7NA 3PNPA 3PQ7A 4DKXA 1T6YA 4L8YA 5SZHB 3CVVA 1SO8A 1C9JA 4C20A 5CDSA 1ZR4A 3PSAA 1OIXA 2AOVA 1QRUA 4KR7A 1D09A 4IHQA 3FNHA 1VG0B 3H9BA 4M7WA 1JBQA 4HVAA 4WINA 2E85A 9GPBA 1HR0B 3O75A 3JQ8B 2C9YA 2JLYA 3LF1A 3PGMA 3JAKA 4WT7A 2DHQA 3ZXIA 4JN6B 1NC1A 1ZQ9A 3HJHA 4LNHA 4W9NA 3HO1A 2WM2A 2HK8A 4M86A 2DB3A 2AZXA 1MX1A 3TZQA 2CFSA 4G5XA 2I66A 2Q7DA 1LA2A 2HB6A 3CFYA 2ZS9A 3UMRA 4FB5A 5J40A 4QU8A 3DF9A 3TXYA 1CLEA 4YRNA 3E3MA 3NIWA 5KU7A 4R1QA 4P3KA 5LQSA 2ZRGA 2X7XA 4HRAA 3FFXA 4Y67A 1R10A 4JB0A 1STOA 2QSZA 4YRLA 3HU3A 3FHLA 2CLIB 1K7EB 4PZCA 5THQA 4Q7JB 3Q0TA 2Q4RA 1H3EA 1A5BB 3BK2A 4XGNA 2C9ZA 5JBQA 3GTQB 2H7CA 1S02A 2BM8A 3M83A 5IARA 2J3HA 1P19A 2XT0A 5GZ6A 1TX4B 1Y9EA 5LWQA 2PZKA 5EL0A 4F7DA 5I48A 5HF5A 3ZDBA 4BY9E 1CIPA 1RW4A 5DLQC 1VJRA 4DB4A 1QGUA 2BJVA 2R5NA 5BWOA 4WZBB 1O9GA 1OKKD 4UTNA 2HNKA 1PV1A 4FDMA 5JTTA 3NVKI 2DECA 3RSFA 3BE8A 1EIWA 1D2HA 2GZ2A 2Z9BA 4D9BA 4LQCA 2GEVA 2IKSA 3DOEA 1JLHA 3FFTA 3OLQA 1MX9A 2NO1A 4UHEA 4GGPA 4JVSB 1ADGA 1DPFA 3W1EA 3WWZA 2Y1OA 1L7PA 1LDBA 3CRNA 2ZR7A 4YNBA 3TBKA 4IIFA 1KU6A 4S05A 2O3JA 2F3QA 2XZPA 2O1SA 5DLPA 4XYMA 3ZWCA 4CDRA 5B6IA 3PUVA 1LRKA 2O23A 3LCCA 4IDGA 4NULA 4BGIA 5B4VA 5K6AA 1QRTA 3CRRA 4QULA 4YALA 1IRXA 1MAVA 1VI6A 4CV2A 1PLLA 3CE9A 1KA9H 1VSTA 1YK1A 1F7VA 1RJEA 1QO0A 1ZG3A 1NXVA 1T3ZA 3PFCA 4UNQA 3V6MA 3ZE9A 1LDGA 5E0KB 1QGYA 1U9JA 5K20A 4P8RA 3U4DA 1GILA 1JNYA 2JF0A 1NXWA 5BT8A 3P2OA 2EYUA 3DHVA 1M2OA 1L5QA 1IONA 1PZXA 1N6PA 2O3RA 3LJKA 4HDCA 4HTAA 4DEXA 5HZGA 3Q5DA 2YHIB 1ZX1A 2EDAA 3B2QA 4L5IA 1DAOA 3F49S 1S9HA 1KF0A 4WEOA 3UUWA 5E9WA 4U6SA 3MN1A 1X1BA 2AJCA 3SX2A 3TSAA 1E96A 3KV1A 1GAWA 3HADA 4KIWA 1PL6A 5TS2A 5HS4A 1X0XA 2G6TA 2V96A 4HFMA 4CDMA 4CCAA 2R6HA 2WVHA 3Q3IA 4MW1A 4LRXA 3ZBQA 3P97A 3RRNA 1YS1X 2R6FA 1YVEI 2QJTA 3EXEB 1ZGAA 5D3MB 4D8YA 3B7WA 2B9VA 2X2OA 3TXXA 1L7VC 4DG5A 2OBNA 1VHLA 2ZI4A 3CC8A 4AYTA 1F6DA 5E7JA 4D4JA 3AF4A 3ROTA 821PA 5HBGA 1GKLA 2PPLA 1IPHA 1YD7A 3BXPA 1M83A 1ISMA 3JYLA 4JU9A 4GPEA 2IDZA 5AP9A 1OILA 4L6IA 3NAGA 1A88A 1BDJA 1TM3E 1VHTA 1NM5C 1UMCB 3PRHA 4LWPA 2PBZA 4RFSB 3STTA 4CW7A 5LLDA 1XNJA 2AFIE 2JH9A 4TYMA 2IS4A 4BMSA 4E6PA 3M1IA 4FR5A 2QVLA 1FMCA 3ZD9A 2B8WA 5NLLA 1I6KA 2IP4A 4S1WA 3UT0A 5LOVB 3L3BA 3PA8A 4HV4A 1C2YA 3KKOA 4A6EA 1NQAO 3OFJA 3W5CA 2CV2A 3Q88A 4G5RA 5CB0A 1UJ4A 5A62A 4W5RA 3EVCA 4Q05A 4WDRA 4FNGA 1PTJC 3ED5A 3QNUA 4XVRA 2OWEA 1U1GA 3TE6A 4F9FA 3W3ZB 1CZLA 1VIAA 3WV4A 3IUQA 4RIGA 1HORA 1UOEA 4HS4A 1H3NA 3R3UA 3S5UA 1BMDA 1W1UA 3TL6A 4A93B 3AUTA 4GQAA 1QAMA 2PLFA 5AHKA 1ML3A 2J3MA 1E66A 1FP7A 2G83A 3DE5X 1Q0PA 3R9XB 2WABA 4Z6KA 1RPJA 2YZKA 1LBIA 4TL6A 3SBDA 4B71A 1K3UB 2Q6IA 3GR6A 2C2YA 4ACBA 4XD7D 4ZOAA 3MFQA 3GGDA 3ZVNA 2KLHA 2OWDA 1WABA 1TU4A 1Z08A 3D4PA 3EMBA 4S0ZA 1RZRA 3LUAA 1TAUA 4RFSA 3FPBA 4G2NA 2JANA 4G85A 5I45A 5CCBA 5HQ3B 3DFUA 3UMJA 2DHCA 4WBXC 5IVPA 3ANLA 3IQWA 4BFXA 1OXMA 3E8MA 1VKOA 2CJFA 2I1WA 1P5RA 4HLNA 5KTSA 1SCBA 2M9MA 1ZP6A 3AIIA 5IKOA 2PZ8A 4Z1MA 5I47A 5LP6F 1YZNA 1BN6A 2NT4A 2OHVA 3OQHA 4J1NA 4MR9A 5IVIA 3PXGA 5HOQA 4W4TA 3R8XA 2GCOA 1U8AA 4R2LA 3ROPA 4D0RA 5KBYA 1VKZA 2QN2A 4F3CA 5KJ6A 1TU0A 3EZ2A 3NG1A 1GGJA 2WYIA 4KGDA 3ZEIA 1WLSA 2HU2A 3KYIB 3U19A 2R8XA 2QN3A 2GB4A 1I4WA 2W83A 4ZQGA 4C4PA 3U3OA 4M1KA 1CJTC 1W85B 1ZNWA 1I10A 3GDHA 2IEZA 3OTQA 4HMPA 1IHOA 2I1QA 4NU6A 2RG7A 1G3UA 1SG6A 4N9WA 4CGZA 4OA8A 4UM7A 1KDZA 1QJ4A 2OB2A 3CVOA 1J49A 1JL3A 2BGMA 3O2JA 1E63A 5ALMA 2X14A 1NULA 1A0OA 5FQOA 2X5KO 2XDQB 3L4SO 4JZKA 3TFQA 2Z8YM 4DRXB 3PU6A 5L3SA 3PJEA 4FGUA 4ZICA 4EHKA 5G0VA 3ETGA 2OQ2A 4GL2A 5TPZD 3SCZA 2QG6A 5HQ3A 2Q5CA 1VB5A 3C4QA 1NNI1 1E2QA 1UEJA 3D0RA 3TECE 1RQNA 2G0NA 1M66A 3CLHA 2B2XA 3B5EA 3RTDA 4AN1A 4O4IB 5HWSA 4FYKA 1K1EA 4GMKA 4DGSA 3KSUA 3OQOA 5BVHB 1UZAA 1K8ZB 1R9JA 1RQGA 1Z5ZA 2DWUA 1TUEA 2EW8A 4F5WA 3CU5A 4XFDA 2C98A 4DSTA 5INTA 2I6UA 4BVJA 3IHTA 3R3YA 3LW8A 1JR3E 2VPIA 2PSSA 2NV6A 2XHEA 1ZC4A 3BKXA 4TZTA 3FF1A 1HSOA 4AY2A 4DV1B 1DWQA 2CBZA 1M6NA 2MSKA 1E6CA 1W4ZA 2QR3A 1T15A 2C07A 3QPBA 1W85A 5CD9A 3KXPA 3EHDA 5AHOA 1E1MA 5AXAA 2WFLB 1UFRA 3W8NA 1R5JA 3TNFA 2J0SA 1WXWA 2V6JA 5E4FA 3NOVA 3KE8A 5JY1A 4UTXA 1B6TA 3CONA 3E18A 2GN4A 4C3VA 1PJLA 2XDQA 5FNVB 2V3CC 2ZQYA 3MGBA 5BXQC 3NDBB 1S7CA 4DRXA 2V7WA 3JWJA 1TQ2A 4QBIA 3U1VA 4D82A 4B3SB 3D3WB 1OBFO 3GEMA 3M1LA 3NWBA 2X22A 2QOEA 2QP4A 5NULA 1T4CB 1NVMB 3L6OO 4CMKA 1BNCA 3HKEB 3L92A 1XCMA 3TRDA 4MWDA 3VKFA 3L0BA 3PA6A 4AKHA 2L2QA 2Q1UA 3NFRA 3ZDXB 4OQPA 1QH1B 4IDPA 2E1RA 2EX0A 2R8ZA 4YAWA 4L9RA 2VAPA 5FFFA 4BN4A 3HY6A 5C80A 2BUCA 3EAFA 3TK1A 3ILHA 1P80A 1QRRA 3RKUA 1NM5A 2F00A 3SZGA 5C3EB 2PL9A 3IBGA 3DDSA 2D7JA 4NMWA 5IW8A 4EJFA 3IO5A 4N5NA 1GFSA 4YCDA 4BE7B 1KKLA 4EY8A 2A0YA 2PSFA 1U63A 4ZOLA 2ZT8A 3N2KB 2VYVD 1UJ6A 1HE2A 2GN1A 2WFLA 3DG9A 2ECKA 1V1MA 1ZUNA 2R4UA 5FORA 3BQMB 3IKLA 3UM9A 5I6DA 4HNGA 3G2OA 3DAYA 2RGNA 5FLXA 1PTJA 1T2UA 3GPDG 1TEVA 4OFXA 3YASA 5ALIA 5CT4A 1NXOA 1VPWA 1XWWA 2F3PA 2J59A 2MJLA 2OEPA 5IDYA 4DWVA 4EPYA 4F4DA 3HVUA 4CI9A 3LPAA 2PLNA 1GYPA 1HC7A 4D0LB 3ISVA 3B8HA 2VRWA 5F51A 4DNXA 1AKNA 2ZS7A 4C3HB 1R6XA 3QVGA 2ZB8A 2OK8A 3AFOA 3D9QX 3CUVA 3FHJA 4U00A 1IE3A 2H3EA 4ARZA 4DJDC 3L7IA 3ZBTA 5JSZB 4GR9A 5KC9A 4L1KA 2EW1A 2FWIA 3THSA 2H4YA 1LVGA 3TGPA 2AFIA 3WGKA 4GNRA 2NM0A 5B7PA 1RXVA 3EX7C 2LPMA 1YRAA 4KB5A 3UV3A 4QTTB 4EAQA 3WLSA 5KQMA 1P7VA 1U1DA 4ZU1X 1FRFS 1NNUA 3HA5A 1ZL2A 4JJ6A 4LOAA 3FD8A 4LVCA 2AXQA 4NS4A 1E3EA 2V4MA 1T9HA 1VSVA 3PZBA 1GGKA 1Z7YA 2OOSA 3DFFA 3DLAA 2OMKA 3H3JA 1PR4A 2X8AA 4YO7A 3VVMA 4KYUA 2OORA 3Q2KA 4OG2A 5CIWA 1HFKA 2OZEA 4WOBA 1OI4A 3JWGA 1BCRB 1GZHB 2PRJA 4PO3X 2V45A 4LOKA 1G0OA <