3W8RA

Mutant structure of thermus thermophilus hb8 uridine-cytidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
207
structure length
207
Chain Sequence
KPFVIGIAGGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDLALYLEHAQALLRGLPVEMPVYDFRAHTRSPRRTPVRPAPVVILEGILVLYPKELRDLMDLKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIVPRGGQNPVALEMLAAKALARLARMGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine kinase
publication title Indispensable residue for uridine binding in the uridine-cytidine kinase family
doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 69
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w8rA00
1ZCBA 4I81A 4A15A 1KI8A 1YR7A 1P9WA 2XZLA 4WZAE 2DFTA 3NH6A 4POAA 4DLXA 4IDOA 2F1RA 1ZM4A 5CYOA 3B1YA 3SJAA 1NIJA 2W0SA 4EPWA 3TLXA 3AKEA 3NDPA 4FW9A 1P73A 1NJFA 4MUAA 3R7WB 5CK4A 1QHYA 3K0FA 5KDLA 5C46F 3HR7A 3QNUA 3IEVA 2F1IA 1LVGA 2JDID 4W5WA 1ZC4A 4RD0A 4BE7B 3WYAA 5JZVA 3L82B 3W5IA 3PENA 3EC1A 1KK1A 1NSTA 3VAAA 1D5CA 5AJYA 3CX8A 5CDFA 4O2RA 4LHXA 1KSJA 2GCPA 5P21A 4GPTA 1E2PA 2IWHA 4A6XA 1E3MA 1W36C 1KDPA 2ZJ2A 1CXZA 3UANA 2FWRA 4NYJR 1NIPA 1Q12A 3BB1A 3K8YA 4D0GA 3CRQA 2ZRBA 2XNDA 3KUDA 3FB4A 2P6NA 4AKHA 2G6BA 4NKRA 1HEIA 1P3JA 4I1SA 1E79D 2B8WA 4V0KA 3LO5A 4JLVA 4YXWD 2ZAMA 1JI0A 1GG2A 2RMKA 1X86B 2GCNA 1E0SA 3TIFA 4PX9A 3RAPR 3RRZA 1U9IA 2GKSA 4X8OA 1IJEA 2JATA 4PHTA 4PPGA 2AX4A 4LJ5A 2JA1A 3SYKA 3GFPA 1RJ9A 4KLZA 4PSVA 4CT5A 1Z08A 1E9AA 2REXB 3I62A 2EWVA 1FX0B 2G9NA 1JPJA 2NIPA 4AD8A 2FG5A 2QTFA 1DARA 4Z8XA 4B73A 1P61B 4BFTA 3KKNA 1XF9A 521PA 2V1XA 3CWZA 4N1AA 5DSZA 5EE3A 5JRZA 3DO6A 3VKWA 4I1UA 3AGPA 3QKSA 3B82A 3FMFA 3L8ZA 3Q7QA 2KBFA 1WE2A 3ICQB 2BBSA 4KBGA 5AR1A 1MRSA 1MO4A 1R5BA 2ZRIA 3AF3A 3DZDA 3QG1A 3BORA 1ZC3A 1E0KA 2HJVA 4PQRA 2QI9C 4YMWA 1AA9A 121PA 4UJ3A 2IXFA 3ZDQA 4ESVA 1OH8A 3AVPA 1BMFD 3E1SA 3WHLA 1OIXA 1TU3A 2HT1A 2Z83A 5EE0A 2XOKD 4TYPA 4CYMA 2RGEA 4UNNA 4KITB 2J0SA 4IEIA 1Q1ZA 1ZM2A 2QNRA 3U60B 1G4UR 2OE2A 4FWTA 3W6PA 2XTNA 3HPQA 4MRPA 1Z0AA 3QKUA 2WZQA 5EUMA 1NMZA 2EW1A 3B13B 2CK3A 1UBGA 2XAUA 3BAFA 3LLUA 2NGRA 2ZIAA 3GLGE 4EJSB 4D2IA 1ZVQA 4G1UC 3KJIA 2ZI5A 1XFAA 1NF3A 4A36A 3ZS8A 4M1SA 3FKQA 1XEWX 821PA 1S1MA 4DKXA 4Q21A 1ZM3A 3WNDA 1D6JA 2ZI7A 3C5CA 3IBYA 1MKYA 4CW7A 1G5RA 1N6HA 3C7KA 4P4SA 2N46A 4AK9A 3PFIA 2GEVA 2QGNA 5FTLA 1J8MF 2OZEA 5F2EA 4A2PA 2WWFA 4HLUC 2XXAB 4MA4A 5JECA 1FNMA 4IXMA 2ZANA 2C2HA 4GL2A 3TBKA 1N6RA 1DVRA 4RD6A 3WHKA 2AR7A 3DMNA 1S2MA 4WIAA 2REOA 2ZQ5A 2Z4SA 3WMEA 3UMFA 4ZI2A 2CVHA 4AI6A 2BMDA 1SHZA 3N2EA 1I2DA 2CLSA 3K9LA 3CPJB 5LD2B 2KSQA 3S1AB 3NHBA 5DI9A 4FI3C 3BJIC 3QEOA 1G8GA 2QY9A 4ASUD 1ZP6A 1CR4A 4E5UA 1CEEA 2XZPA 1KO4A 1VIAA 3K70B 3PITA 3GLGA 2RGAA 1YHNA 2OESA 1ZYUA 2VF7A 4W7SA 5HE9A 3RSOA 4Q9HA 1HYQA 3W90A 2QPTA 4KHZA 1DS6A 1NY6A 1Z5ZA 1XD2B 3CR8A 4H1UA 3IHLA 4BFVA 5CLLA 3FFBA 2ZEJA 1IAQA 1QHHB 2H16A 3PUZA 5KNBA 2GETA 5F9HA 1KI9A 4NCNA 3ZYCA 1VYVA 1ESNA 4I99A 1PUJA 3CO5A 2WVJA 4XVUA 1T0HB 2KBEA 1DADA 1F2TA 2OEPA 1AJEA 5DNYB 1E9CA 4MGIR 5BQ5A 3QBVA 2ZI3A 1CJVC 2ZYVX 3RYTC 5KHOC 1XJ0A 2AFIE 2ZRFA 1E2LA 1E2IA 4HEJA 3RS3A 1GL9B 1W0JD 2W58A 5DIFA 4JLPA 2O8FB 4WBSA 5B30A 1HT2E 1P72A 4RY2A 4DBLC 4EPTA 1CF4A 1T3LA 5EP3A 1PJRA 3DPUA 4TMZA 3MWKA 2ZREA 2E87A 4DRZA 1N6KA 2F3TA 2HCJB 1JEDA 4DLZA 2QN6A 4ITRC 4TZ0A 4JBYA 1KI6A 3DDCA 2VP6A 4D81A 4NYIQ 1Q3TA 3SHFA 4A4DA 1E2MA 3BXZA 4L9WA 4PPQA 4LJ6A 4NU0A 1UBFA 2YWHA 4V0NA 1GDDA 1VTKA 1AS2A 3RVBA 3FMIA 3VR3A 2ZR7A 3I5YA 4LJAA 2ZI6A 3R8CA 4HAXA 4XTRA 1Q0UA 2J45A 2DB3A 4JMPA 3CNLA 4HLCA 3T5GA 2VSXA 1W4AA 1DG3A 1U0LA 2QTVB 3QUSA 4JLBA 5FUXA 5B57C 3GLIB 2IUSA 2ZROA 4DB2A 1XZQA 4HDCA 4ZIRB 2BDTA 2LCFA 2OCBA 1ELOA 2WWGA 1PZNA 4ZKDA 2V6IA 3C4JA 3HU2A 2DY1A 3M4YA 2ORWA 2A78A 4MUBA 2CL0X 5FPKA 5C2JB 1KIMA 1XXHE 3FMPB 4US2R 3GJ7A 5DI3A 4JIMA 2EFEB 3M1IA 4CEIA 4GP7A 1G9XA 5GADl 2OUKA 4FD2A 1E98A 3AVWA 3P1JA 4QBIA 2ZPTX 1WBBA 2IW3A 4LV5B 1N5KA 1Z28A 1VDZA 4ZDJA 2BEKA 1KHTA 4CEHB 1VHLA 1GKYA 1F2UB 4LBYA 3AP3A 2ZSEA 1OYYA 4DIEA 3BBPA 3F3YA 2R9VA 2HJGA 4B47A 1W4BA 3TGPA 4B71A 2FPKA 4X8HA 1DELA 2KWIA 1ESMA 1UKVY 2WM9B 1RRCA 2WMNB 1DO0A 1TEXA 1CJMA 3A1SA 2VTKA 3T12A 3GJ6A 1IONA 1T0JB 1MT0A 4GDFA 4HDQB 4B2IA 1QVAA 2PEZA 2BM0A 4BLRA 1H8HD 5H1YA 3IPXA 2GBLC 4JLNA 4C0KA 3PUWA 2ZR0A 2CCJA 3MGCA 2BBOA 1Q20A 2C99A 5CB8A 1JECA 1DAIA 1OSNA 3LAWA 2GJKA 3Q72A 2VBCA 1XXHA 3P20A 3QF4B 4G5QA 1YR8A 4Q02A 2IUUA 1YR9A 3VTKA 2GJ9A 2XEXA 4WXPA 5EZ6B 1BH2A 2HEIA 2YOGA 1P60A 2OCYC 4UNQA 4EPRA 3CZQA 1ZUHA 1OIWA 2NO0A 2I1VB 1IOZA 3RRYA 3A4LA 2QP4A 3F8TA 4RD4A 4Q7LA 5B2ZA 3U3JA 1XU4A 4WA7A 4RVCA 1R0YA 2O8BB 1R0XA 2GCOA 4URYR 1KZGB 3SJCA 5BWMA 2IYRA 1DTSA 1JXMA 4HZIA 5CB6A 2D62A 4GRAA 2JLVA 4W5JA 5EE9A 2FPMA 3UMRA 5FOWA 4C0JA 1XMSA 3EA0A 5BN4A 2O8EB 3OIUA 4C0SA 4I1OA 4US0R 3U5ZB 5KTYA 4DEXA 2BIFA 2B92A 2CLCX 5FTMA 4TT3D 3A4NA 1LF0A 4UNPA 4URUR 1U8YA 1G291 1LV7A 2GJAA 5CYPA 1OPXA 2DFNA 2WIAA 1KKLA 2WSMA 3AEZA 1GWNA 3IBGA 2F6RA 3QPVA 4HAWA 4B2PA 4M1WA 2JASA 5B58C 2WWXA 4Q1BA 1NN0A 3UPUA 2UZ3A 5LB2A 2RH5A 3OE7A 3GLHE 4R71A 1TUIA 3QOFA 2OCPA 1IJFA 1J99A 1RKBA 3SYLA 1L2TA 1T5LA 4LBZA 3EWSA 1SKYB 2WBLC 1M7HA 2R6FA 2CNWD 3W8RA 2OILA 3I1FA 4ZCIA 4HUQB 2XSZA 4CIDA 1SQ5A 5EQTA 2EU8A 1JAHA 4IOJA 1JR3D 1X6VA 3AF4A 4DLYA 4ACAA 1M7GA 3ZIAA 3AUXA 3BH0A 2VP5A 1HA3A 4QJ4A 5SZKB 2HF8A 2V6JA 2YZ2A 4KYIB 4XSHA 1SVWA 1OHHD 2IXEA 2Q21A 2V7QA 3TQFA 3MSXA 5BN5A 1OE0A 1W5TA 3LRPA 3O8CA 3I8XA 3LNCA 3TK1A 2J5XA 4TLDA 3OHMA 5DE3A 2FE4A 3UATA 5C18A 4JKYA 4GZLA 3RRNA 3UK6A 2NPIA 4KU4A 4LK2A 5LBIA 4BLSA 3THXB 1E2EA 1W4RA 1M34E 3RS0A 2X1VA 5IF9A 4KFSA 1J2JA 3DEFA 2QQ0A 4GNKA 4HLUA 2YWGA 2QE7D 1AN0A 1GL6A 3ETLA 1BO6A 4TL6A 2O8DA 2C8VA 1OFUX 2O8CA 3OAAD 3C14C 2J0VA 1S96A 2CHQA 5KU1A 3CRRA 1U9IC 5L3SB 2MSEB 5L3QA 2G1JA 3GLHA 2C04A 2Q3MA 2IYWA 2QPOA 2SHKA 2QBYA 2Z5FA 1IN4A 4N0DA 1MABA 4IFEA 3F5FA 2EYUA 2Z6VA 1LS1A 4QNMA 4DSNA 2V54A 1U0JA 1L7VC 3W5JA 3BGWA 5IK2A 1DO2A 2AK2A 1N0VC 1RW4A 3QJYA 2EFGA 4HB0A 2JJ2A 1QVRA 3JVVA 2ZS8A 3ZGXA 2BCGY 1G17A 4IEEA 4BRUA 1SXJE 4OHZA 4LC0A 2IT1A 4KAXA 4NPHA 2G83A 4N3NA 2OFXA 1F6BA 1EFHA 5KDOA 5G41A 4LV6A 3K9HA 2BCJQ 1KKMA 2Q0HA 2VH5R 4P4TA 4BZXA 4XTCS 4X8LA 1NVVQ 2FZLA 4MKHA 1YU9A 1SHKA 4S2EA 2OFOA 3T1OA 3A37A 1BIFA 1OXXK 1N5JA 5D3MA 3PIRA 2Q6TA 3AVYA 4LYFA 4Q7JB 2JDIA 1P9NA 2I4IA 2D7DA 1DG1G 3ZD7A 3OEHD 2W2TA 1KO5A 3NXSA 1S9HA 1X8JA 1W47A 1XTQA 4DDWA 1MRNA 3KJHA 2XJ4A 4YMUA 1AGRA 1A5TA 2NO7A 3BFKA 2YWFA 1P9RA 1U8AA 4RJLA 3BIFA 3IILA 1ZD9A 4GZMA 4AYXA 1EX6A 4R2HA 4B74A 3SFZA 1W2HA 3SYNA 1DPFA 1F3OA 3EPHA 1VYUA 1IHUA 2UKDA 4Q03A 2QAGB 2WJJA 4Q66C 2J0QA 1VG8A 2XJ9A 3VR2A 1M6NA 4LJ9A 5FPHA 2GZHA 1SVLA 5EE1A 1E79A 621PA 4S35A 4YXWA 5JLJA 1VPLA 4V0ME 3E70C 4B3DA 1OFHA 1KDOA 1A2BA 4RKEA 2C9YA 3THOA 4Q48A 2Q9BA 3EXAA 3QF7A 4FMDF 2IS1A 3MJHA 2FSIA 5FPSA 3GD7A 1J7KA 3WP0A 4G5RA 2F43A 4Q4AA 4MKIA 2X2FA 5BW8A 4Z51A 5AUNB 3OZXA 1D8TA 4K46A 2PCLA 4D4KA 1NY5A 1US8A 5GJWC 3KXIA 4LWZA 1G8YA 2YHSA 2VHJA 4OI1A 1N6IA 3TUIC 4JZKA 1WDTA 4LDJA 3JZAA 2CEAA 2BC9A 3K0EA 1I4TD 2QRNA 1HUQA 4C30A 3GJXC 1L4YA 3I3SR 2ZRDA 3EARA 1BMFA 4PO8A 3T1QA 5SZHB 3KB1A 2XOKA 4Y0AA 3OIWA 5KPJA 1VG1A 2LKDA 1GOTA 3KQKA 1KK0A 2H17A 1KOFA 4QFMA 1YZKA 3QXJA 5FFMA 3A6PC 3SFVA 1JBKA 1R2QA 4RFVA 4R9UC 2ZJBA 2ZRHA 4C9BA 4B43A 1UPTA 3BB3A 3CWQA 3LBNA 2V1UA 3NHAA 2ZUDA 4V0MA 4MKFA 4ZIRA 3FYHA 3KKPA 2ONJA 1VHTA 1TF2A 4NYMQ 2WKPA 2P6UA 4MRRA 3B1ZA 4CEJA 2WV9A 1OXVA 1WF3A 4YLGA 1R0ZA 1N5IA 5JSZA 1JNYA 3CF0A 2B6HA 4NDZA 4E07A 3A8TA 2BKEA 3AM1A 1W4CA 4HB3A 5JHHB 4KODA 2IYLD 1KMHB 1U90A 3GLFE 2YNMA 4ON9A 3AB3A 1CS4C 3EASA 1Z3IX 3SS8A 3QXXA 2ECKA 4L5BA 5L3VA 3VKGA 4E03A 3VX4A 2VA8A 5JCZA 4IVRA 5FBVB 4FIDA 1CU1A 4GSYA 1PUIA 1Q22A 3TUZC 4DDUA 1NMYA 3QXHA 3R9XA 5FI1B 5A5GA 1CLUA 1MO6A 2FX3A 3NBZC 1UBCA 3BRWD 3MUFA 5AJZA 4D0NA 2B7CA 1JR6A 1Y3AA 4ASUA 3N5CA 2KJQA 3L8YA 2VPPA 2G88A 5LB4A 4WZ6A 4EFLA 4OI2A 3ZZTA 4Z54A 3LW7A 1K8RA 2XX3A 4WXRA 1M8PA 2J7PD 3WYGA 1NG1A 1KYIA 3KKMA 4FMCB 2ZJ5A 1VMAA 4LBVA 5FBWB 1X8LA 4B35A 4U7DA 2XB2A 2IF2A 3TSOA 3DZ8A 1PVOA 4BEBA 2VP4A 3AQ4A 5HKKD 4U02A 4LC1A 3R9IA 3QXCA 2D06A 1Z6TA 1NLYA 3BERA 1P2SA 4OQLA 5H68A 2F9MA 4ZKEA 3GLFA 2FSHA 2GILA 3QKTA 4MRSA 2QP3A 3DM5A 1KSGA 4AKEA 2D74A 3HPRA 2RGDA 2PZGA 1KJYA 4XWAA 3CX7A 2P6RA 4U00A 1CTQA 4OQNA 5DGXA 4KSCA 3VMFA 4DSOA 1W0JA 5BYJA 1G7RA 1JQLB 3K0FB 1Z63A 1XDBA 1E9EA 2CXXA 2O0KA 1D2MA 5CIWA 2ODNA 2OBLA 4G5OA 3RC8A 1XTRA 1GFIA 3IEUA 3R7WA 4IOKA 5FUYA 4LSGA 2GRJA 4A8JA 3GJ4A 3L0SA 4JSYA 1FFHA 1FTNA 3DM9B 1UFQA 5DYGA 4IFBA 3W3ZB 2BVNA 3IQXA 3GP8A 2ZUBA 4V0OA 3ADBA 3NC1C 1GNRA 4HDOB 4PAOA 2ZS9A 4PZYA 2CCKA 1SXJD 1U0HC 2OT3B 1SVKA 4KVGA 4LRWA 3WMGA 3KQNA 4O3MA 2VP0A 1XEXA 3IIMA 4QRHA 3WNBA 1XTKA 2GZDA 2KB0A 3C5HA 4JVNA 2PJZA 3VR4A 3RANA 1W46A 5JJLA 3GEEA 3G0HA 3EG5A 4QBGB 4H1VA 1T8UA 1G41A 2ZSDA 4US1R 4XJXA 1Z0KA 1U99A 2GK7A 4JSTA 4KI0A 3K0CA 4PR0A 2IYYA 1Q3HA 2FEMA 4PHFA 1G16A 5JCPA 3AP2A 1G8HA 1TTTA 1J8YF 1OXUA 4Q19A 5B64A 2JLSA 3ADKA 1T8TA 4HB4A 4QOSA 2DFLA 2HXYA 2IYSA 4M9QA 2AL7A 1FZQA 1SVMA 5CM9C 3EZ2A 3KTAA 2DCUA 3U2QA 3THWA 3V4RA 2H5EA 3OESA 3LA6A 4EKDA 4M8NE 3GCGA 1OKKA 1AIPA 3CZPA 1FX0A 4DCNA 2DFKB 3EAQA 2AK3A 3TR5A 3CH4B 3QKSB 5J4YA 2HLDD 3EPKA 1IXZA 1BKDR 1XMJA 3B1XA 3KQHA 2W2XA 3FTQA 3AF0A 2AN9A 3HJNA 3OFND 5SZJA 3AVQA 1GP2A 1KO1A 4OHXA 3KQLA 3PUXA 3RS5A 1KTVA 2IX3A 3QG5A 3RLFA 1XNJA 1RVDA 2IYTA 2P2LA 2VF8A 4QBHA 1G64A 3H4MA 4LBWA 4BLOA 3SEAA 4YQFA 1DAGA 1KDRA 3AH8A 5HZKA 4AIIA 4EQ6A 3OIVA 3CUEF 1KY3A 1CR1A 1Z07A 2NZ8A 1XD9A 4OI4A 3WRYC 4B33A 3DOEA 1D9XA 2PCJA 2DHRA 3NG1A 5HCNA 4TQ9A 4F4CA 4IHQA 1H8HA 1UEJA 1GRNA 4LJ8A 1ZRHA 4UXIA 2OXCA 2WJVA 4MH0R 4PQFA 2ZRPA 4DLTA 1JPNA 4B3BA 3MG9A 4XIGS 4IJMA 3UMSA 4OI0A 2HV8A 1SVIA 5AUQA 1EFUA 1GAJA 2ODBA 2ONKA 4OJQA 2VYFA 3PEWA 4P31A 4P4SB 2MSDB 1TU4A 5AUPB 2ZU0C 1M74A 4PC7A 1P75A 4QGFA 3LW8A 3U4QB 4YC7A 1SVOA 3KKOA 3K09A 3NC0C 4Q4HA 5EXSA 3DMDA 5J47A 1JR3E 4LHWA 3IHWA 5K8UA 1P2VA 1DAEA 4L4UA 3GJ5A 4TTRA 4ACBA 1HURA 2BJWA 3QVUA 1EFRA 2FNAA 4MYCA 3H1TA 3B9PA 4Q9JA 4G3XA 2EQBA 2R8RA 4HAVA 1W5SA 1IXSB 2CVFA 4JYBA 1F48A 2P0EA 4BEJA 1OH5A 2C98A 4RD3A 1IQPA 4TT3A 1XD8A 3B85A 2EFDB 4F92B 3GLGB 4ZPXA 4Z1MD 2CMKA 2FJUA 3PJRA 2QMOA 4IVPA 2RGNC 1NL3A 3QVVA 2X77A 3SJBA 3I32A 5FI0B 1R8SA 2BEJA 3A1TA 4RFSA 3PUYA 1CKEA 1G5TA 3Q9LA 1NVUQ 2VHTA 2Z4RA 4PZZA 2QMUA 3C41J 2OLKA 1E6CA 2FEOA 2OO7A 1IXRC 1K5DA 5GJVC 2F1HA 4XWOA 2WTUA 4C0BA 4D4JA 5TDHA 3CNOA 4G0NA 1EXMA 1F2TB 2YOFA 4K81B 1QHHA 1TQDA 1SZPA 2ASEA 2JIZD 2W6JD 4F7WA 2B21A 4LHZA 2BMEA 3CB4A 4JT4A 5EE5B 5G3ZA 1G19A 3B6EA 3TMKA 2JCSA 1JR3A 4M1MA 4R2IA 1CJUC 4BZQA 3DKVA 4KLNA 3GLIE 4PC2A 5TV2A 1WMSA 1J70A 1LB1B 5DYIA 1OHHA 4HATA 1N3BA 1MH1A 3A58B 5E4FA 5FTJA 5DLQC 2PLFA 1XZPA 1Z0FA 1T3HA 1EFTA 4LJ4A 1H8EA 4MQBA 1OB5A 1K6MA 2REBA 5FR1A 2RGXA 3Q85A 3QSYA 4L16A 4NE2A 1AZTA 4F93B 1DBSA 2KI5A 4ZDWA 2BV3A 2J59A 2FFAA 3LVRE 2QE7A 4TYYA 4EDHA 2ZS7A 2WSSD 3OAAA 1R5OA 5JJKA 3TR0A 2R2AA 4Q9LA 3T15A 2JLUA 4OQMA 4LYAA 1QHGA 1R10A 2ZR9A 4PO1A 2C9OA 4TL7A 2O0JA 2Q3HA 4ZDKA 1S3GA 1HTWA 4B6FA 3O8RA 1ONBA 5TXGA 4WZBE 4A0HA 4PXAA 5TARA 2XNDD 3NBYC 3C15C 4JBXA 4OK3A 3WMFA 3X1ZA 2WWHA 2F55A 1W1WA 3PUVA 2WWYA 2DWQA 4DSUA 4TYQA 4Q7MB 3CRW1 2W00A 5HR5A 3VNUA 3K9NA 2L0XA 4GI7A 3UG7A 1ZD1A 4GBMA 2J0UA 2QL6A 3RS7A 2BHRA 3K1JA 1XB2A 2ZSAA 1GZSA 3EC2A 4D4MA 2W0MA 3EIHA 1E9BA 3GEHA 1YKSA 5JI3E 3R9WA 2ZITA 2RGCA 4HUTA 1M1YE 1NN3A 4M9SA 3KJEA 3BH6A 5FL7D 1ZINA 1KI4A 1TQ4A 4HLDA 3KQUA 1BYIA 5EP4A 1OJLA 2N1BA 1KDTA 3A36A 2YV5A 4RZ3A 4AYWA 2R62A 3U3KA 3VNVA 5DN6A 1A2KC 5DH9A 5E7JA 2VLIA 1XPUA 3EZ6A 1II8B 1GKIA 4F4IA 2IS4A 3KJGA 5DISB 3RNLA 1VIYA 2PL3A 2LWIA 2ZSBA 3OEHA 1E96A 3D6TB 3SU8A 4A0GA 4F4JA 1LS6A 2ZE8A 4Q01A 1F2UA 3FVQA 1P2TA 1UADA 1WA5A 4DWJA 4I4LA 1KO8A 5CIQA 2ZJAA 3TH5A 4DSTA 1Q1EA 1N6OA 2ORVA 2CLDX 3SE0A 2GXUA 3REGA 3HYRA 2RGBA 2WOOA 1YZNA 5FOTA 3ADDA 1W36B 3X1DA 1N2CE 4M0LA 4NTZA 1T9HA 1N25A 3N70A 4JLKA 1N0WA 2A9KA 3L0OA 4P4UA 3ZVRA 3TKLA 4EPXA 3BFXA 2GNOA 5TVKA 3P32A 1QG2A 4BLPA 3B1WA 1NKSA 3T06B 4EFNA 4AY2A 3QF4A 2QT1A 2Q3FA 1G7CA 1KI1A 2ATVA 1W44A 4JS0A 3ASZA 5D3QA 5UKDA 4EPYA 3NTUA 4F91B 1YR6A 1TX4B 4TSFD 3RWMB 4DC9A 1SKYE 2CL7X 4M1KA 2AD5A 2P5SA 2GCOB 2VSOA 3B78A 4V0LA 5TB5A 3R20A 1WXQA 1Z2CA 2PLRA 2W83A 2ZU6A 1HT1E 5J4KA 3O8BA 4JYCA 3OEED 4TLCA 3K0AB 3OIYA 3NBXX 3I4LA 2IF0A 1TAGA 4DVGA 1R4AA 5CJ2A 2CL6X 2RKOA 5BYKA 2CJWA 4JLOA 4RKFA 1Z83A 1G7TA 2IHBA 3REFA 1W2GA 1KZ7B 4WVFA 3T35A 3UIEA 2MSCB 2G1KA 1YRBA 3NDBB 3P4YA 2IC5A 2JLQA 3LQQA 3K70D 4NYIR 2GZAA 3SZRA 2IWRA 4KFUA 2YOHA 5L3RA 1IN6A 1GITA 3IKJA 4P3YA 5FOVA 1OB2A 4P0TA 3ZQ6A 3TAUA 2WAYA 4OJKA 3P26A 1G3QA 4HB2A 3V00A 1KK3A 1L8QA 4JL8A 3LY5A 1AS3A 1KJZA 5FH9A 4G01B 1NVXQ 1FUUA 1UM8A 4C0HA 4MRNA 2WAXA 3CR7A 5IT5A 5L8VA 4QM6A 2ZE7A 4NP6A 1FL9A 4OL0A 3O47A 3I61A 4A8JC 1NN1A 3EZFA 1YJ5A 3WP1B 3AUYA 4LOAA 1ZM9A 1OFTA 1G5PA 4MGZR 1Z0DA 3EA5A 2A7QA 2ZXUA 3CKLA 3R8FA 4UJ5A 2FFHA 2ORIA 4HLQB 5J4VA 4DIDA 2R6DA 1ZNWA 1GNPA 3T34A 4MGKR 4CVNA 3ZVLA 4A9AA 1OXSC 4IDQA 3CM0A 2WMOB 3K0CC 1E2FA 2CDNA 1XRJA 5ANRB 1FW6A 2OAP1 1Z6GA 1G3UA 3MWYW 3QI2A 5L3QB 3P27A 5G40A 6Q21A 2CHVA 3BD9A 2ZRLA 1XCMA 4Q4JA 4RZ2A 1LW7A 5C4GB 3W6NA 3D7MA 2QBYB 1R6BX 2B8TA 4YDHB 5JWHA 2ZRKA 3VHLB 4YMTA 1COWD 4TMXA 2ZRAA 4C3ZA 5JFGA 4TL9A 2GEUA 1W0KD 4KFRA 1GKUB 3UXMA 3K0SA 3MWLA 2J7PA 2D4HA 3B9QA 4G5SA 2W6ID 2Q9AA 1E9FA 4XVRA 5K8TA 1EFCA 2RGNA 2C77A 4FINA 4ESHA 1NI3A 4PQYA 2C9CA 4DEYA 4YMSA 5HKKA 1QDEA 1UDWA 1OLOA 4TTQA 2IYZA 2BM1A 3G82C 1YE8A 4CF7A 5ELXA 5HE8A 1IM2A 4LYHA 4PTLA 421PA 3LWNA 5SZIA 3TVDA 2WHXA 4KXFB 2FU5C 4LYJA 1E2JA 4DT1A 2IUTA 2LKCA 4U5XA 1E0JA 4TTPA 3KUCA 1XEWY 1N6NA 5KSZA 4A2WA 4HZUA 2FZ4A 2ZJ8A 1E2DA 4DLVA 1FQKA 2H57A 1S4QA 2HXSA 1ZIPA 4FCVA 2VRWA 5GJBA 5F9FA 3LBHA 2V55B 3TAHA 4AURA 5FOSA 3SI7A 2JJ1D 2OBNA 2X2EA 2FOLA 4ZDIA 3LXXA 4A92A 2ZYWX 2PBRA 1SKQA 4DCVA 1KAGA 4QNRA 3QE0A 2OXRA 4XVQA 3SBEA 1SXJA 4Q9KA 1E1QD 3HYTA 2J1LA 4P32A 1ZNZA 2B7BA 4C7OA 2IK8A 2PJRA 3U61B 3DHWC 3X1YA 4Q1AA 2EWWA 3IIJA 2IYXA 2A5GA 3ZZUA 3K09C 3C8UA 4RSGA 2QP9X 4QJ3A 3HR8A 1BOFA 5JJIA 2CHGA 1W36D 1EGAA 4BFSA 3DL0A 1ANKA 1GNQA 2VP9A 1KAOA 3SC3A 4C2UA 4M22A 1RC8A 3HWSA 4M2LA 2NTYC 2V9PA 1OT3A 1FTSA 2PX0A 5CK5A 5AWFC 4B3GA 1FPMA 2A5YB 1E2KA 2G0TA 1ZD8A 2C96A 2F1JA 3A1UA 1NBMD 3I8SA 3QKRA 4FN5A 4PC1A 2XGJA 2ZTSA 4YDSA 5LD2C 2IBMA 3SR0A 3U7FB 4NCJA 2EVWX 3ZVMA 4M1TA 3IQWA 3AVUA 3CIOA 3AVTA 2GESA 5HTKA 2JLWA 2H18A 4BQSA 4KSBA 1I4LD 1E0AA 1Z0IA 5GVSA 2NPFA 1Z29A 4JKIA 4ARZA 1G6HA 3I72A 2HLDA 1JXOA 2ZI9A 2ZRCA 4IW3B 3MRSA 4LHYA 1RZ3A 2OHFA 1RE0A 2ATXA 3HP1A 3U6KA 2BJVA 4NYJQ 4GFDA 1GUAA 2XNSA 4AG5A 3CRMA 2GK6A 1NKTA 3RSLA 2KE5A 2V3CC 4B3CA 2JGNA 4BLTA 2CE2X 2VHUA 4AC9A 5FL3A 1OH7A 2UZIR 3KL4A 4MDFA 3FDIA 1RRPA 3MWJA 3VR1A 1AKYA 5E3HA 4QGGA 1R0WA 1S0UA 3ZQJA 1AS0A 1LFDB 3TVTA 1Z0JA 2OFWA 4QKQA 2A5DA 4EUNA 1JJVA 4CEJB 2N42A 2QMHA 3H0KA 4AYTA 5F3WB 4NCHA 1GTVA 1Z2AA 1DAKA 1N0UA 4BUJA 1G7SA 2HYDA 1W48A 3JZMA 3SJZA 1IY1A 5EP1A 3U44B 1GRQA 1E9RA 4D4LA 4LJYA 3GJ8A 2ZE5A 1WB9A 5J4HA 3GMTA 1HE1C 4R7ZA 3VU9B 4DZZA 5FPYA 3HDTA 3IUYA 4PHGA 3PEUA 4UXJA 1CULC 1XP8A 3QEJA 2IHYA 3CNNA 4M1YA 3ZS9A 1II9A 4LZZA 1YZGA 1LY1A 2GDJA 3PV0A 3U3OA 3FFAA 2D3WA 1GILA 3MJRA 4RZUA 2WJGA 1AM4D 1CP2A 1EX7A 4ZO4A 4UNSA 4GOKA 5KO2A 2G3YA 1E4YA 1E4VA 1T91A 2A30A 2FA9A 3Q8XB 1MOZA 3THYB 1Q57A 5J5CA 3V9PA 4M4SA 2FSGA 4JVMA 3U7GA 1E2NA 2WPDD 5H8WA 3TJZA 4Z1MA 2ANCA 5CDFE 1HQCA 1G20E 2JAQA 1V43A 3ECCA 1OF1A 1TF5A 3TNFA 3V4FA 4BFXA 5JHGB 3LXRA 2XTZA 1TMKA 3CBQA 5IK2D 3CLVA 2VHCA 3QY0A 4X8MA 3EPLA 1E69A 2OG2A 4PO9A 1IBRA 1X1SA 2IEYA 2D2EA 1P62B 3FWYA 2F9LA 1TUEA 4OK6A 3CH5A 1G1MA 1YZUA 3EW9A 1JEEA 3L43A 3E2IA 8OHMA 4AKGA 1IY0A 2AWOA 1N5LA 2JIZA 2W6JA 2DPXA 1ZM7A 4MGYR 4NCKA 1G3RA 4B76A 4TN1A 2VIIA 2JLXA 2ZRNA 4QC2A 3MCAA 2Y8EA 3PEYA 1EESA 3GPLA 2WWIA 3SN6A 1DE0A 1XTJA 1GVNB 1JAIA 3AP1A 1II0A 1NP6A 3OF5A 4Q4LA 2QA5A 4QHYA 2GF0A 1G6OA 3ZZ0A 4RZXA 4PZLA 4JL5A 3LVQE 3AVXA 3IDQA 1PV4A 3Q7PA 4DB4A 1XCPA 3KXLA 5K8IA 4A8JB 3EX7C 721PA 2QQEA 2QROA 5A4JA 3D8BA 4TQAA 4BECA 4LGMA 2PT7A 4FMDB 4TLBA 1UKYA 3MAAC 2FPLA 3KX2A 1CJTC 5KPDA 4O2LA 2WSSA 4GOXA 1DAHA 4IRUB 5JS7A 4D26A 4QM7A 2ZVPX 1XEXB 2PZEA 4PC6A 3TUJC 3SQXA 2CE7A 2YJTD 3U3RA 3GFOA 5C1BA 1QHNA 2HYIC 5JRJA 1MR3F 3KFVA 4LJ7A 4EAQA 5AUOB 3KB2A 3VQTA 2H1LA 2JLYA 5H70A 3NBFA 1RJ9B 4TLEA 4LCBA 1BS1A 2FSFA 4Q1DA 4BFWA 2H8KA 1G8FA 1E9SA 2R6AA 3KKQA 3AKCA 2ZE6A 1NLZA 1OW3B 5EZ5A 3U3MA 5EXXA 4NYMR 1VCMA 1W49A 3KTAB 1NMXA 5AJXA 2OM2A 1NVWQ 2QGZA 2WJHA 3UG6A 5JWOA 3THWB 4B6EA 3L2OB 2YINC 2WWWA 1B0UA 1D2NA 5DHAA 1FQJA 4LI0A 5FL7A 3MD0A 4IVQA 3PCRB 2ZRGA 4Q00A 4OHVA 1SULA 4PPFA 1XPOA 1CBUA 2GVDC 1PLJA 4C4PA 3K9GA 2WKQA 1JJ7A 4WOPA 1OH6A 1EK0A 1ZU4A 3NH9A 5FR2A 5E7IA 1ZUNB 3TW4A 5C4MA 1WBDA 1GM5A 2GXSA 4EQ6B 1YZQA 1E1RD 1LNZA 5DO9A 4LV8B 2GA8A 2C03A 1CR0A 1ZNXA 2OBMA 4V02A 2JLRA 3H86A 3D3QA 3SBDA 1YZLA 1G3MA 2QM7A 3LDAA 2E1RA 1Q1QA 3D31A 2QZ4A 3I92A 4NHOA 2FDCA 2NO6A 4EJSA 5J4LA 1YRAA 1Z22A 3TQCA 1C4OA 2EYQA 1UDXA 1VYTA 4D6PA 3LV8A 2QAJA 4KJZA 2HUPA 2FFBA 4MRVA 4IDNA 3ND9A 1C9KA 1HV8A 3LH5A 4CDGA 4TYNA 2HCBA 3I73A 2GXAA 3AVVA 2P3SA 3AKDA 1DAFA 1IN8A 1CJKC 3EPJA 1U94A 5JMTA 1KI3A 5AK0A 5E95A 2GXQA 3CRVA 2XXAA 4TSFA 3FKSD 2PH1A 1XMVA 4Q4HB 5F98A 1QHIA 1I2MA 1KSFX 4ILEA 4HYYA 3U4QA 1OFIA 2J46A 2HT6A 4CGZA 3W8NA 3WYFA 3T5DA 3A1WA 3OEEA 1K5GA 4IOMA 5GJCA 4BFUA 3LQRA 4DLSA 5HPYB 3S1AA 5JEEA 4IXNA 1E2HA 1TQ6A 4A1FA 4OYHA 3L0IB 4DHEA 2WJYA 3RDPA 2G77B 5EXPA 5FBLB 2YWEA 1AQYA 2GJSA 2ERYA 2ZJZA 3FE2A 4TMWA 3EZ7A 3FHTA 2V4ZA 1ZJ6A 1VECA 1TL7C 2DR3A 4HI0E 1QF9A 4UXHA 1NJGA 1NNEA 1ZW6A 1JALA 3TE6A 4DUGD 3PG5A 4IOLA 3AF2A 1XWIA 1XD2A 4XD7D 1YVDA 4QGAA 5CLQA 4M1OA 4BFYA 1JB1A 2D2FA 4RFSB 3FMOB 3PR1A 3NIBA 5FPTA 1HY3A 2YYZA 1XMIA 3QPWA 2CNWA 1UBEA 3QIAA 3CF2A 1TADA 4QG7A 1TPZA 2A5JA 2H7VA 3IIKA 3NWJA 4M9XA 3KFXA 1WP9A 2BKUA 3BH7A 1KJWA 5JI2E 2JEOA 4A82A 1Z47A 4BZPA 1RFLA 1DAMA 2OCAA 5E7MA 1O3YA 1OV4A 1DOAA 5FUWA 1F5NA 4QHTA 3GFTA 3H2YA 1QRAA 1QBKC 2OAQ1 4LY6A 4OQFA 5CM8B 4KFTA 1IN5A 2Z43A 221PA 2O8FA 1RYFA 3JVUA 2IA5A 4M21A 1X1RA 5FBRB 1KI6B 3DOFA 1SXJC 4Q1EA 1KY2A 3ONWA 4OK5A 3WXMA 1XEFA 5KNDA 3RS2A 1E2GA 3SHWA 3K53A 4WW0A 3GQBA 1UEIA 4DLWA 5FOUA 1XX6A 4KV9A 2XITA 4JVLA 1EWQA 4PSKA 1M7BA 2QAGC 4DLUA 3GJ3A 4KVAA 1NN5A 3G5UA 4P33A 1VG9B 2X8AA 2R65A 4A0RA 1P7CA 2EFCB 5TY0A 4B3XA 3NEYA 2VO1A 2WICA 4D82A 4FMBB 4I1VA 3AGQA 4PPNA 3VX3A 3B1VA 1FP7A 4Q1CA 4Q5IA 2ZJYA 1COWA 3AKYA 3FGNA 4NH0A 4TQUS 3RWOA 1R8QA 5EUQB 1W0KA 1FP6A 3LX8A 5KSYA 3GLIA 1VG0B 3WY9A 2QM8A 1KO7A 3AF1A 1ZUIA 2W6IA 2XZOA 1NG9A 5DI3B 4QHSA 4Q9IA 3BS4A 4W5HA 3N2IA 5KDDA 4CEIB 2J0UB 2IS6A 1PLLA 3O8DA 4O0MA 4Z8YA 1IY2A 1Z6XA 1JQJC 4MYUA 3CONA 3I5XA 4B3FX 4DJTA 3ADCA 3B8HA 1R5NA 4M53A 5EP2A 2HF9A 1NBME 1OKKD 3VKHA 3SNHA 5GVRA 4L8GA 4ABYA 1KMQA 3M0EA 4G5GA 3UKDA 3ASYA 4CEHA 4D25A 2QG6A 1QG4A 3UWOA 2AXNA 2IEZA 2HDNB 1S1CA 4IDHA 4Q1FA 4B2LA 1IN7A 3ZVNA 2C78A 1D2EA 5BN3A 1II8A 1C1YA 1X3SA 3LX5A 1KI2A 2JJ1A 4JBWA 4B32A 1ZAKA 2RAPA 2CK3D 1RPZA 3X1WA 2QUZA 4JLMA 2GWHA 4BRWA 3UWKA 3GJ0A 1U81A 4EFMA 1E1QA 4PAQA 5G3YA 2CCGA 2FN4A 5AJVB 1XXHB 5J40A 1AK2A 1Q21A 4DCUA 2P5TB 1A82A 4JJZA 2GHIA 3Q5DA 1Z8FA 4BPBA 4QGHA 2GVZC 4JT2A 4NONA 5KNCA 4TMKA 4B48A 4QXAA 1FUKA 1UAAA 1LTQA 2GAOA 4DCSA 1A4RA 1NBMA 1P5ZB 1A7JA 3T61A 2BOVA 3EIEA 2R44A 4V03A 3RHFA 3TRFA 4PAMA 2O8BA 3DVLA 2DYKA 5KYKA 4JLDA 4L15A 1KK2A 4JL6A 2FMXA 2DWPA 1EG7A 5FTNA 5LPNA 3J81k 1ETUA 3GEIA 2BBTA 4RCZA 1XJCA 4RD1A 4JJKA 3W3AA 4E22A 5LDDC 1M2OB 1J90A 3EZ9A 2ZJOA 3U7EB 4B75A 2F3RA 2CJWB 2PMKA 4KBFA 4BWYA 2O8EA 1E32A 1XBTA 5HZHA 4KYUA 1EFRD 3WBKA 4C0QC 3B7GA 3K0AA 4NL4H 1AZSC 4XOIA 1WQ1R 4A0FA 1AGPA 1T5IA 5CITA 2FGJA 2YC4C 2BMJA 2F7SA 2FGKA 3WBJA 5KUTA 2V8OA 2QTHA 4XH9B 5HCIA 4DXAA 5BXQC 3T1VA 5EXTA 2A2ZA 4PSAA 3RABA 4DLRA 3RS4A 3F0TA 2YVUA 1KGDA 3QENA 1XCGB 1Y63A 4F38A 2AXPA 2QSZA 3VR5A 2ODEA 3ZD6A 4L9SA 3CX6A 3BE4A 4JVSB 4TLAA 2O0HA 2JLZA 2QEQA 5KOYA 3BOSA 2C5LA 4M9ZA 4OQXA 4AKIA 4HUQA 3RC3A 1NRJB 1YZTA 4GOJA 2AKYA 1TEVA 1P6XA 2JJ8A 2X19A 3HU1A 1GIAA 2J3EA 5FBQB 1SGWA 3CPEA 4TWZA 4Q18A 1ZU5A 2VQSA 2FFQA 1RRGA 3KZ1E 3PEVA 2IS2A 1KSHA 2DBYA 1G3IA 4ZV4A 3W6OA 1CIPA 3EWAA 1B23P 1U8ZA 3VFDA 2TMKA 5KSPA 2WKRA 1F60A 4NMMA 2GTPA 3PQCA 1VCOA 2ZM5A 2O8DB 4GP6A 1AKEA 2O8CB 2AKAB 1AQUA 3THXA 3FHOA 1H8ED 5FOXA 3PXGA 2DWOA 4BFZA 2ZYTX 1TQ2A 1XTIA 1E99A 2VL7A 4D0LB 2CBZA 1T4GA 3GLHB 4LPSA 4FCWA 1ZBDA 4XWKA 1UF9A 4EPVA 1L4UA 4NBSA 1MABB 2H92A 3BC1A 2IXGA 1Z6AA 2ZAOA 4J0QA 3NKVA 5L3SA 4Q4JB 3VR6A 2Z0MA 2IYVA 1E2QA 1NSFA 2BMFA 1CRQA 2FF7A 2XB4A 2P67A 4HAUA 2WPDA 4UKDA 4RCYA 4H9GA 2YKGA 4OHYA 1D9ZA 4DDVA 3L0PA 3DKPA 2VHQA 1QHXA 3U7HB 1KNQA 2PZFA 5IRCD 3IO3A 5DHFA 3BFVA 3SQWA 4AWXA 2WOJA 5IHPA 3B2EA 4PFSA 4JLJA 2E9SA 3X1XA 3BWDD 1OXTA 4CRWB 4HAYA 2GAAA 3BB4A 3WRXC 2ZRJA 4A6PA 5K8LA 1S9DA 2MMCA 4LHVA 3T1TA 2QRZA 1Z6YA 4E09A 4BGDA 3QXSA 1TNDA 4MDEA 5JEDA 2PX3A 2ZYUX 2A5FA 4IKEA 4BLQA 1V5WA 1YQTA 1ODFA 4LPKA 5TMPA 2QSYA 2BWJA 2QORA 2GF9A 5D3MB 4DT1B 1MV5A 4Y0VA 4TYWA 4MKGA 1PLKA 3AVOA 1VKJA 4N0EA 3B60A 3QPUA 5KSOA 1W7AA 3CW2A 4HZUB 1ZMXA 2FH5B 1GSIA 2QPAA 3IGFA 4TMVA 5FTKA 3W9YA 5EJEA 1SVSA 5DN6D 3CF6R 2PT5A 4GMXA 1ZIOA 1S3SA 4FMCF 4EJSC 4OBEA 3C16C 3P4XA 1N6LA 2QMEA 4FCTA 2NQ2C 1ZCAA 1T6NA 4OHWA 3W34A 4K8OA 2NMVA 2NOAA 1WRBA 2ZVQX 3TSZA 2PMDA 1SXJB 3A4MA 4PHHA 4A2QA 1RIFA 2I3BA 4PC3A 3FPAA 2R6GA 2P65A 4C7OB 2NZJA 5AJWA 2RB4A 4ZCMA 1FNNA 4HSEA 1DEKA 1I4DD 1MO5A 3MMPA 2QAGA 2OSBA 4YMVA 2NO1A 3WNCA 2VSFA 2RHMA 3IO5A 3LLMA 4B34A 1CR2A 1H65A 1KNXA 2PEYA 2AHOA 2RCNA 4DCTA 3NVAA 1G21E 4URZR 1GL7A 1TF7A 4AG6A 5CJPA 1U98A 3QKRB 2F43B 1FMJA 1G8PA 3Q3JB 1Z06A 1EWRA 3QQ5A 3HU3A 4Q4AB 4C0AC 3M6AA 3MFYA 4Q47A 4QBFA 3X2SA 2K5UA 1X8KA 4TMTA 2QENA 4UQOA 1US8B 4EIWA 5G53C 2UVQA 4KCGA 3A1VA 3K70C 3B5JA 1P2UA 2C95A 4MITA 1XJQA 1P4SA 3SDZA 4XSGA 4FWIB 2NO9A 3OFNA 4ARZB 4LX0A 2ODWA 2QT0A 1HQYE 1HH4A 2VEDA 1UKEA 2J87A 3EIQA 2GJ8A 3ND8A 1LF5A 2W2VA 1ZNYA 4TL8A 5JS8A 1KI7A 3ZJYA 1GRRA 2G0NA 1XTSA 2ZETA 3LD9A 2EFHB 2ZSFA 4JLAA 5JWRA 4GMDA 4LUCA 4URVR 2ZI4A 1XPRA 3LFUA 1RRFA 1T3SA 3KDSE 4B44A 1NLFA 2ANBA 3VHXA 2J9RA 1OIVA 3BK7A 3AV0B 1E94E 1HE8B 3OE7D 3TSWA 3E5HA 4ZI3A 2NG1A 3TW8B 1E1RA 3ZH9B 4WAUA 1U2RA 2AWNA 2MMGA 2D7CA 1VCIA 4NCIA 1A1VA 1G4AE 2WIBA 2QU8A 2XTMA 1QZXA 4C0LA 3CPHA 4OKSA 1O87A 2A3RA 4PANA 4RD2A 5JSZB 3H84A 4W9MC 2XSZD 2YC2C 4Q7KA 5IDVA 2BBWA 2IYQA 1FMLA 4FXPA 2ZUCA 2R6CA 3ZIAD 4CT4B 1OYWA 4KO8A 4O25A 2WJIA 3SOPA 1MO3A 2I1QA 2VP2A 2GEDA 2RHDA 2V7QD 5M04A 2GBLA 3LBIA 1KMHA 1UJ2A 1NVVR 2ERXA 2ZRMA 1G18A 1FOEB 4UNRA 3U44A 3PVSA 3FKSA 3FHCB 4YONB 1E9DA 3RRMA 4D80A 4TZ6A 1BYUA 4URWR 4II7A 3VU9A 1N6PA 2IL1A 3FOZA 4GT1A 1WCV1 5FUVA 2AFHE 3IPYA 1Q1BA 1S8FA 1R7RA 2O52A 1Q44A 4DDTA 3U6BA 3ICEA 4CZ2A 4QJ5A 3KXKA 4MYTA 2AD1A 3THYA 2RGGA 4R98A 4MYHA 4BASA 2J7KA 5JBQA 4HAZA 4NZYA 3NEJA 1QHSA 1RYHA 2FV8A 4QL3A 4DUGA 1UKZA 4IDPA 3ZLJA 2Q9CA 3QBTA 4XD7A 2JJ2D 2OLJA 4ZCLA 4C2TA 4ERNA 2IYUA 3MLEA 3GLFB 2OV2A 1VCNA 5A0FA 2O5VA 1CRPA 2J41A 4URXR 3Q5EA
chains in the Genus database with same CATH superfamily
5HQTA 3EGXB 3WKBA 4I81A 4A15A 1KI8A 1P9WA 3AY6A 4WZAE 4AWBA 1YCHA 4RX1A 4B09A 4ANFA 3BA1A 3W9BA 2F1RA 4AVYA 3TJMA 1LX7A 3A6ZA 3KC2A 4TTIA 3RNOA 3HACA 4TRRA 1N2XA 4MWEA 1I7QB 1JAYA 1LLCA 5EHGA 1RM3A 2H3HA 2P3LA 4HQNA 1DUSA 1ZN8A 3R7WB 4IYRA 3M3HA 5CK4A 4EHHA 1T4MA 1DEOA 3K0FA 5KDLA 3UEOA 3HR7A 1DPGA 1LVGA 4KR9A 1ZC4A 5JZVA 3IR5A 3PENA 3ZE7A 1PEYA 4JBIA 4KTTE 2AOUB 3A9TA 1D5CA 3LY7A 5AJYA 5C8ZA 5CDFA 5B5SA 2NNWB 4KPUA 1I32A 2H63A 3K2EA 4BXOA 3F7MA 3UMYA 1E2PA 4R68A 4A6XA 1CS0A 4WVLA 4ZMSA 5CW2A 2AGVA 3D6NB 1PUXA 3FYUC 4C22A 3L6UA 5JCJA 2ZJ2A 5CUQA 3UANA 4BMYA 3ABQB 5JH7F 4ZU1X 4F6RB 2Q5EA 4C4RA 3ZWKA 4NYJR 4CKWA 1JJAA 4WFIA 5I9MA 3X1JA 1JHPA 1PEKE 2NV2B 3CRQA 3L8MA 4EGQA 5IAGA 4ZCTA 3FB4A 2ZULA 5D1HA 4I1PA 4AKHA 4YAWA 3QFSA 1HEIA 3RCBA 3E7XA 4MPRA 4ISCA 4I1SA 2B8WA 4V0KA 3PUIA 2C1XA 3V55A 5D6NA 3RASA 4FFBA 1IBLB 2QX8A 4YXWD 1GG2A 2PVCA 1G6Q1 1X86B 2DWCA 1MLDA 3RAPR 1OXBB 4DJDC 4JGIA 1IL0A 4M7WA 3TVYA 2EKDA 3FGZA 1V7PC 4RKQA 2FPXA 1SK9A 2W6PA 4R8LA 3HKEA 2JATA 2AX4A 4LJ5A 4LY0A 1GXSA 1RJ9A 1YMUA 2I4TA 4KLZA 4DYHA 4DLAA 1E9AA 2REXB 3HDVA 3PQ7A 1WCXA 2BCEA 2Q4RA 2V9CA 4BMSA 2H4XA 4Z0TA 4CMEC 4KQEA 2NIPA 2FOXA 1WF6A 2QTFA 4DMHA 1DARA 1CX9B 1Q50A 1VPVA 2GFHA 3H8SA 2BISA 4Y2UA 1PZHA 3DO5A 5AW7A 1QO0A 4PQGA 5AVYA 3CWZA 4N1AA 5ICMA 3JAKA 5JRZA 1YR1A 3DO6A 3DDSA 3VKWA 3UMMA 4KG7A 1L7BA 2AYZA 4UVEA 1XQXA 1USWA 2PRJA 3A32A 2XYRA 3B82A 3DBHA 3L8ZA 3E35A 3OZBA 1V7ZA 4KXXA 1WE2A 3WGIA 1F8GA 1ZR4A 3ICQB 3Q15C 4Q12A 2C00A 1MRSA 1R5BA 2ZRIA 1VL2A 1WZEA 3O4HA 3QG1A 2HJVA 1SCDA 1YD7A 3DFZA 3MRTA 2CXOA 1L8OA 2QVLA 4H08A 2IXTA 3FJ1A 1OH8A 3WHLA 4MZXA 2HT1A 3DOJA 1TU3A 4YRPA 2G36A 1M2KA 2MJLA 1I80A 4FZVA 5E4YA 2J0SA 1DCKA 3TRJA 1QH1B 4NF2A 1R8JA 1ZM2A 2QNRA 4JI4B 3DAHA 2I2FA 3BD7A 1NV9A 3B70A 3MTGA 3RYIB 3CLTD 4IV8A 1NMZA 3RVLA 4G8JA 2EW1A 1K6JA 2JH3A 1VE3A 2ZKLA 3H0EA 4OAOA 1TW2A 3R5XA 4BLWA 3LLUA 3HU5A 2NGRA 3D7KA 3UBTA 4O4IA 4GYKA 1I2BA 5AP9A 4GMGA 2WJAA 4ZAWA 4G1UC 3DLIA 3KJIA 4YRFA 5GGXA 3R7LA 2ZI5A 3TB6A 3ILYA 1M75A 4NI5A 5ESDA 1Z4NA 2C2YA 3W1VA 4PGGA 4A36A 3ZS8A 4DAEA 3OQJA 5FV7A 5DBHX 5WRFA 2PX2A 4Q21A 4DCJA 3AR5A 2XUIA 3C5CA 1XO1A 3KR9A 5I4BA 1G5RA 4FUQA 5BVGA 1ZCZA 1FYEA 4P0QB 4L8YA 4RYDA 3CR3C 5AVVA 1F8XA 4NFYA 2YNMD 5F2EA 3TSAA 4A2PA 4DL9A 5HFAA 4PZEA 1AUPA 5CXQA 1WSAA 1FNMA 3OF2A 1CE8A 5H82A 5F35A 1XDSA 3UB3A 2XYQA 1GUFA 1JLHA 3C5VA 3WHKA 2GTHA 4OFXA 1GV1A 1TO2E 2REOA 3GB9A 4AI6A 4K0KB 3E7FA 3N2EA 1CVIA 1O77A 1GPDG 3SDBA 2RONA 3T0IA 2QRQA 3ZY5A 4KRYA 4HDNA 4IIYA 1CHDA 3HLTA 2UV8A 1OWPA 5DI9A 1PK8A 4BU1A 3BJIC 3KPYA 2P5YA 2QY9A 5M29A 2ZP1A 4CM9D 4E5UA 4HPXB 5D85A 3DQQA 4DA7A 2XZPA 1FFXA 1UQUA 2XXJA 1KFCB 2J9GA 1FJHA 3K8ZA 3R44A 3PITA 5EZYF 1GFZA 3CF4G 3MIZA 1YHNA 4HRXA 5C52B 4W7SA 4YT8A 5JYBA 1Z5ZA 3Q0EA 1XD2B 3Q3EA 1C9JA 3NWPA 3DUFA 4TSKA 4H1UA 4BFVA 1L4NA 5CLLA 3GZJA 3AUFA 1A9XA 2OGUA 4YPVA 4J1SA 4JH0A 2NVUA 1QHHB 3GPDG 3OCJA 6REQA 1Q16A 4HWGA 2GETA 4KW7A 4NCNA 5FT9A 2NP7A 1LX6A 1ZY2A 2OSVA 3JQ6A 4GF5A 1M2EA 1HL7A 1NMEA 2KBEA 1JFFB 1F2TA 1WP4A 2FI1A 1SC4A 5JSKA 1LKZA 1YT5A 3UBMA 3QBVA 1WQ3A 1YU6A 1DHRA 2IDMA 2ZYVX 1SUIA 1VJ5A 1PNVA 1XJ0A 1GYRA 3F5QA 5K0CA 5J2TB 4JLPA 1WXIA 2NSHA 2YDXA 2FPRA 2EBUA 3KYDA 3NT4A 4DBLC 2CMGA 4CUZA 1SCAA 3ZWQA 2P68A 3DPUA 4NULA 4TMZA 5ITVA 3WIUA 5C51B 1OB2A 4DRZA 3PFHA 5K05A 4E2XA 1A9PA 1R12A 2Z2XA 2JLAA 4GKAA 1U7UA 2JCXA 1KI6A 4TZTA 3DDCA 3BICA 3M33A 4D81A 4MUYA 1TW3A 1U8CB 3BXZA 2XBMA 4L9WA 2IDKA 4QX6A 1GDTA 4DS3A 5A6SA 3I39X 3A25A 3SHTA 4UHEA 3TOSA 3U1TA 3GJQA 4JYMA 2PXXA 2J31A 5C5EA 1T2AA 3C6QA 4IX9A 4JOSA 4WKOA 2VCYA 5KTNA 1DBVO 2ZYDA 2GNAA 2ZI6A 2J45A 2A4KA 2WYUA 1GFSA 1Z45A 1VJTA 2LXNA 3B3QA 4Z4FA 1GHTA 3P9PA 3NHSA 2Q1SA 4U5QA 3T5GA 5EIBD 2X5KO 3LDGA 5B57C 3GLIB 2ZROA 3M6FA 1XZQA 3S99A 1D2CA 4QFCA 1O08A 2BDTA 2BF4A 4OXRA 2HPVA 3HFGA 1ELOA 1I30A 1T4BA 2YIMA 1TKAA 2I7DA 3HU2A 2ZBVA 3UC5A 4WXYB 4ZKDA 3L7NA 3DPIA 2W8BB 3WJ7A 3RSZA 3O1LA 3OE4A 3RPEA 3OPYA 4J4TA 1SOAA 2FUEA 1IRIA 1B00A 1LI5A 3FNFA 3JASB 3NUZA 4IFIA 3IT3A 3UGQA 4L85A 2EFEB 2H4ZA 2Y71A 3M1IA 4PRLA 4CM4A 3KR2A 4BHTA 4LW8A 4AULA 4FQ7A 3C45A 5KOHA 3TD9A 3EZYA 1FSSA 3SQNA 1HDZA 5G1OA 3P1JA 1TYAE 2NUAA 1BXGB 2WILA 4L4XA 3PC8C 4QBIA 1SIWA 4BVAA 2FSUA 2X7XA 3MAGA 2XAAA 3GXOA 3MERA 1KHTA 4CEHB 3I9MA 1JL3A 1RJEA 4AKTA 1RRVA 4I55B 5T4EA 2K7ZA 3VYTB 3F3YA 1NUSA 1N9KA 2HJGA 2A92A 1W4BA 5BN3B 4JC8A 1CWUA 2FPKA 2FW8A 2XLBA 1A27A 1DELA 3PP8A 3WA6A 2C5FA 1ESMA 2D0OB 3G49A 3PL5A 1QIIA 1RRCA 1TEXA 4PM4A 5KQMA 3TL6A 2XUFA 4DJ5X 2OAEA 3T12A 1V8BA 1PU2A 1GTJ1 1I1HA 3GJ6A 3SYTA 3W9UA 4EGJA 4GDFA 3M6MD 2H52A 2FMKA 2PEZA 3HJGA 4B2IA 1H8HD 3GLQA 2UUBB 2JD0A 1NFQA 2GBLC 2CSUA 3IAXA 4XLLA 1WXGA 4LQCA 3N86A 4BUCA 4MP8A 3G85A 3MXOA 2PS0A 1JECA 3OU7A 1A96A 1DAIA 4ARCA 1P7PA 3IV7A 1A98A 1QIEA 5IVKA 4D9NA 4I19A 1HLFA 4G5QA 2IUUA 3GU3A 3T1HB 2RIRA 2O0LA 3VDRA 1U1CA 2GJ9A 3VTKA 4ISBA 4RENA 1TMYA 2XEXA 1LPPA 4LNAA 1O1YA 1P7YA 2QM3A 4A5SA 3DMTA 2HEIA 3HXQA 3CWCA 2OCYC 1GN9A 2AG1A 4P3KA 2SICE 4LMPA 5AM4A 1OIWA 3TLMA 5I8ZA 1F14A 3F8TA 2QP4A 3DKKA 4RD4A 4UEQA 5B2ZA 4F11A 2MSKA 4KJXA 4ZT5A 4E7PA 1R0YA 5DGHA 4Z0PA 3BIJA 5SYAA 3S2YA 1PEAA 2QVZX 4KYTA 1KEEA 3MQ2A 4PGHA 1XAJA 1ISGA 9LDTA 4RZHA 5LP6C 4GRAA 2AUNA 2FPWA 2XMCA 1G9SA 1A9XB 2O9JA 3WZ2A 1OT5A 3EA0A 2OXFA 3WTCA 3WQHA 5D5HA 2Y1FA 3V8PA 5BSEA 2O8EB 2QTZA 4ZEOA 1P1JA 4U7FA 4C0SA 5AW0A 4DPLA 1EHCA 1E63A 2VCHA 2BIFA 4NCBA 1JIJA 1LLDA 2OLEA 3OEWA 1NAHA 4URUR 2GJAA 1G291 2L42A 4RESA 1H6BA 4DILA 2BN4A 1CUZA 2DFNA 2WIAA 1KKLA 3D0OA 3HWX1 1GWNA 2YY7A 3L41A 5C34B 3QPVA 4ND3A 4AP9A 3BE8A 2O2DA 5B36A 2JASA 4GEGA 3GUCA 1EQ2A 3WGGA 5B58C 4NENA 2CJXA 2BTEA 2P2YA 2VPXA 2DQ4A 3F9CA 3U4IA 1EP3B 1JPVA 2NTJA 1NC3A 4R71A 4B9AA 3WXBA 4YAIA 5AW3A 1IJFA 2V7VA 1J99A 1WHTB 2QX6A 1YGYA 3EODA 4W63A 4MWSA 5CDHA 1KZHA 4E6PA 1K7FB 2CZCA 1SKYB 3VNRA 4YRIA 4Q3LA 2R0QC 3A14A 1DJQA 2B4RO 2REQA 5AW6A 1ZVKA 4MCHA 4LOJA 2OILA 3DVAA 1XDDA 2XSZA 4WK0B 4CIDA 1SQ5A 1KA9H 4OUKX 4FHGA 3WRYA 4OLFA 4PXYA 1JR3D 3AF4A 1WDKA 2C1EA 3IT1A 5CP8A 3WI7A 5KJ6A 2FSSA 3BSFA 3IBFA 4JUFA 2FLVA 5I7EA 1PR5A 2JRCA 4R9SA 4KYIB 5A05A 1GKLA 1R4NB 1SXQA 4HR7A 4NG5A 2I6GA 2V7QA 3IYLW 1T6YA 3MSXA 2XGOA 1VI5A 2OP1A 1W5TA 1AZWA 2CUZA 3FZEA 4PRKA 4YRRA 3WYEA 4AMUA 4CM3A 3ISVA 1ULUA 2J5XA 3UATA 3OHMA 4JYZA 5MHTA 4BJ1A 1FP2A 4CGYA 2GCEA 1KYVA 2I33A 2H8GA 3EXHA 1FNBA 4ADSG 2XPCA 3NIFB 1EAYA 3WL7A 1W4RA 4MWOA 1M34E 3LGXA 4Y98A 5IF9A 4LDAA 2QV7A 1QZ3A 3ETJA 3JQ8B 2YVAA 3P97A 4GNKA 2QE7D 1GL6A 3ETLA 4TKUB 1M2HA 2C8VA 3LT1A 3RIMA 4DR4B 5DRYA 4RV9A 4IGFA 1CW2B 1SKUA 2IIBA 3VYSB 1S96A 4JX9A 3CRRA 5HX7A 2FK7A 3OJ0A 2H11A 2CVPA 2XDQB 1LLFA 4M0UA 1U9IC 1ZI6A 1ZK4A 2XMGA 2CB9A 2H48A 3FUVA 2C04A 2MHCA 2IYWA 1AUQA 2SHKA 2QBYA 2XB6A 2B6NA 2IY7A 5SYMA 4DV6B 4N9WA 5J43A 2Z6VA 4G63A 4QNMA 1JVSA 3TZKA 5AM1A 4AJKA 4B87A 2V54A 4UDXX 1T9ZA 3KR0A 4O4JF 4AMYA 3WKCA 5IK2A 4OHCA 1DO2A 1Q2XA 3QLVA 2RKBA 4XQGA 4YT5A 4C05A 3VJKA 1EUCA 5KEIA 2HMWA 2EFGA 3GLUA 4HB0A 4D4GA 1VGRA 2PZJA 5TQVA 2WUFA 2ZS8A 1IQ0A 4N48A 2XQVA 5FPPA 1G17A 3GUHA 4N47A 1XRQA 3TPZA 1SXJE 2BFDB 4QEKA 1B6GA 1PI3A 1N1GA 3HYNA 3MS7A 4KAXA 1CY2A 4LC0A 2ZUWA 4B40A 2GZRA 4X44A 5D51S 5KDOA 4OMCA 2Q6VA 4P34A 5G41A 3EWNA 4AWAA 4PYJA 5AO9A 2AJCA 4XFDA 1FF9A 3RVDA 5C5DA 2MTBA 3TZQA 4EB3A 1VBKA 4AMVA 4ZJYA 1VE5A 4MJLA 4XTCS 3U3ZA 4JU8A 5LNK6 3Q8MA 2FEXA 5CA1A 3OCVA 2FZLA 2H2WA 4N40A 1G4HA 2YBDA 1UKCA 2G72A 2P9FA 3ETCA 2BGUA 1OXXK 3AFIA 4DUZB 1DV2A 1WULS 1VLJA 3PQ5A 4II3A 3FOCA 4Q7JB 1IWBB 2I4IA 2D7DA 3IMEA 1WHSB 5C3UA 3ZD7A 4W4TA 1FZTA 4MJXA 4L27A 4MP6A 3FLAA 4EYEA 4F86A 2C4VA 2YMLA 5DM60 4DDWA 2BH2A 3ODPA 5CH5A 2CBGA 4MAFA 1V3TA 2NO7A 1U8AA 1P8JA 4ZAGA 4RJLA 4EVSA 3IILA 3NI2A 4GZMA 2Q2VA 4AYXA 1GTSA 5TQJA 1U0BB 1XQVA 1TLTA 4MIYA 1WKBA 1DPFA 2Q5OA 4BX2A 1H5UA 5EJ4A 2ZCJA 1PZEA 1RXSA 4C20A 1P7ZA 2CLLB 1KQPA 1MG0A 2QAGB 1LSOA 3AUUA 2VDUE 5BR8B 2CFRA 2XJ9A 1JYFA 2FK8A 2JK0A 1M6NA 1ZUD1 2X5NA 1LI4A 4TVSA 3ZX5A 1O9HA 3RGGA 4ETMA 1GZHB 3NHJA 2UUCB 4NFHA 1NJ1A 4KI7A 4I8XA 2J30A 2XT9A 3VDMA 3W4JA 1XHLA 2NXWA 3FZYA 2Y67A 4AT1A 3EXIA 3DHNA 4IUBS 4BGUA 5CPFA 3E70C 1BMDA 4MUEA 1I36A 4EY4A 3OMWA 4D9BA 1N36B 4KHPB 5TRTA 2DKOA 3GVIA 4M0PA 4DDKA 3RTAA 2C9YA 3HUEA 3OJFA 3PJFA 1O03A 1NQWA 2ZIEA 3KELA 5DRTA 3GLSA 3R9KA 3UUWA 3QF7A 1C0IA 5EESA 3MJHA 2FSIA 5FPSA 1J7KA 3H9EO 4CIBA 2JNWA 2IOQA 3A1CA 4FHCA 2PH5A 4JD5A 4N9QA 4N7RA 5DBOA 3H9JA 2ZM6B 2H4FA 3DBVO 3EH2A 2X2FA 1KU0A 3LA8A 4Z51A 4J16A 2PUJA 1M6EX 2PCLA 1NY5A 5GJWC 3INRA 3WRWA 3OETA 2YHSA 2VHJA 5F4ZA 1AGNA 2DR0A 3LP8A 4WXEA 1I5OA 3FUTA 4AW9A 1A9OA 1GPKA 3JZAA 3M4XA 3OX3A 3ZHUA 4ZGGA 1I4TD 1LPBB 4C30A 5EJ6A 1L4YA 4G89A 5JRDS 1YUBA 3U16A 3EARA 2W43A 3PC8A 3KB1A 3I37X 2QWXA 5LVAA 2D5IA 3F7OA 3GG2A 3OIWA 4M0CA 4YV0A 3QSGA 3LHSA 5AT1A 2H17A 1KOFA 2BFFA 3TX6A 1XTBA 3W0LB 2PR2A 4EI8A 2PLWA 5CIYA 4RFVA 4R9UC 2GPTA 4XRGA 1YVPA 4WCVA 3OZTA 4HS9A 2F59A 1KKUA 3W7VA 2WT9A 4E4RA 2Y2UA 4GVXA 4HFRA 3NHAA 4J7AA 4MUKA 4UDOA 5FNVB 4ZIRA 1TCCA 2V1UA 2ZRQA 3FYHA 1PQ4A 4P3PA 5PNTA 4RADA 4WESA 5IX8A 4H7PA 2WKPA 4NYMQ 4PLFA 4MRRA 2HWYA 5AJTA 4IAOA 3RTDA 5BWCA 3S29A 2QLBA 3DVRX 2C2ZA 2VNKA 3A6JA 1E3DA 3A6EA 1OXVA 3IQFA 3ZK8A 4ZVMA 1R0ZA 3BTOA 2WVAA 5JXJA 2RHJA 4NDZA 1DDGA 4BO1A 4E07A 4XZ3A 4O59O 4YV2A 1H1TA 3CLRD 1W4CA 3BKWA 1T0PA 5DHRA 1Z74A 4KODA 3P9QA 2H85A 2ZYGA 5AK3A 7MDHA 3UGJA 2HAEA 3EASA 3EZNA 5ALTA 2BFMA 3QXXA 1RYEA 4L5BA 5L3VA 2QTAA 2GH1A 3VX4A 4E03A 1TD9A 3BTSA 4XUCA 1H9BA 3E2MA 4I14A 4X7BA 4HNTA 1ODIA 4BP8A 4CCYB 4GM0A 1PUIA 1Q22A 2J5KA 5FI5A 1OX4B 3R8XA 1RLJA 1TJYA 3EB9A 1YF3A 1AQNA 1A7AA 3R9XA 2CJYA 1EP1B 4GHWA 5FI1B 1UJ5A 2FX3A 4QOFA 1B8OA 2PO7A 3NBZC 3F3MA 3AI7A 2PGDA 3L7OA 3BRWD 3RF7A 5AJZA 3ZK7A 3NDJA 4ASUA 4ZYZA 3N5CA 4GI3A 3Q5GA 1PHRA 3L8YA 1YJAA 3QX3A 3E3MA 3ZU5A 2VPPA 2G88A 5LB4A 2YHUA 4AJOA 4EFLA 4JHXA 4R2MA 1IZ7A 3LW7A 1JHMA 3W4IA 3TOXA 3DZGA 3ORHA 2B4QA 1X42A 2GPNA 1IEQA 3H3JA 4HCJA 3TCNA 2J7PD 1Z39A 3WYGA 4GYYA 1NG1A 1KYIA 2NTVA 3GFSA 2WA2A 1VMAA 1XJWA 3H4TA 4FEAA 1L7PA 4PLPA 2VTBB 1KQGA 1C9YA 1DWUA 5FEMA 3ONDA 4XI9A 4U02A 3LUFA 4E7OA 4LC1A 1FSFA 2D06A 3FPGA 3IULA 1C0EA 1NLYA 2J3QA 1P2SA 2QJFA 1CUJA 2F9MA 1EP9A 3EGOA 2GN0A 4OQLA 2OYRA 3GLFA 2ES4A 1N5OX 1WETA 2P1DA 1PW7A 2D74A 3C74A 4P93A 3FTDA 4XWAA 2P6RA 4U00A 1CTQA 1D4AA 1EGVB 4OQNA 3EGDB 3AT1A 1XHEA 4TWJA 3V7YA 3VO9A 4D3ZA 4DSOA 3T6KA 4F4FA 4IMIB 1G7RA 1L5MA 5KYWA 3K0FB 3KWJA 4TTAA 4Z99A 5IAAA 1Z63A 2GHTA 2HPZA 1IXYA 1XA3A 3GC6A 4KDRA 1XDBA 3GT3A 2ZBUA 4XYMA 1E9EA 1D2MA 2HNKA 1EUDA 1JKMA 2OBLA 4XASA 5CIWA 1ACMA 1Z26A 1AURA 3GRPA 2J8ZA 3IEUA 3VH1A 5DTEA 3EMVA 4RF5A 4CLEA 3TRIA 4BXOB 4JSYA 5I48A 1ZD4A 3U49A 1B26A 1CS0B 2HQOA 5FP0A 3GW8A 2BVNA 4NS4A 4N8DA 3L7YA 4YUAA 5JNWA 4QUKA 3V4LA 5I7OA 4O8CA 4HDOB 4QDXA 3AR2A 2VDOB 4PAOA 5F1KA 2ZS9A 2CCKA 1SXJD 1W0CA 2OT3B 1SVKA 4KVGA 4MXDA 4OQDA 1A7UA 4PYLA 2VP0A 4O3MA 4RA6A 1QGUA 1I3OA 3IIMA 1D0VA 4CKWB 3NBQA 5HCUA 1KORA 1VKRA 3FI0A 4NOJA 3AEXA 4JVNA 4OXXA 3A9SA 4EG6A 3MTAA 5ALMA 1TCAA 1Y6QA 3RWBA 3EG5A 1G41A 1PK7A 5H9WA 1PJQA 4GKJB 1Z0KA 1YS6A 4FFBB 1O94A 5JNTA 1RKQA 3EFOB 2Q50A 3H9UA 5LQDA 3RUHA 5LZ8A 5IHXA 2A1UA 4QDOA 5IBPA 4XDZA 4JC5A 1FS5A 2FQQA 2J4FA 3FD8A 3GRUA 1G8HA 3GRYA 3KWLA 3L06A 4DCMA 4EB6A 1OTHA 3K71B 1OXUA 2C42A 3HKEB 5B64A 2JLSA 2CEKA 2VZLA 4HB4A 4FPXA 1GXSB 1N2IA 2DFLA 2HXYA 2NO5A 2NAPA 3HBMA 4L75A 2JH8A 3LOPA 5CM9C 4BNYA 1KBQA 3KTAA 4QLOA 3OPXA 5AQ1A 2M32A 3THWA 5CPBA 2B1GA 3OESA 3LA6A 4WXMA 2QMQA 3GCGA 1OKKA 1ZCJA 3T5BA 3JAKB 2O48X 3O1HB 3W6ZA 1FX0A 4DCNA 3GNLA 2AK3A 3G2NA 3B3AA 3CH4B 4HNRA 2WINI 2HLDD 4IJ5A 5ALRA 1IXZA 2VLBA 3B1XA 4ZODA 2A9QA 2W2XA 4BZWA 1Q7RA 3S2EA 4CV1A 4FJ2A 2Y1CA 3DTVA 2AN9A 3PDHA 3HJNA 1KYXA 1VXOA 2QD3A 4XPIA 2I54A 1HDOA 4OHXA 1GCUA 1S6YA 4BKQA 2OP0A 3KQLA 5K3OA 2IX3A 3QG5A 1P3Y1 1RVDA 4RQUA 2P2LA 2R8OA 4EO9A 2K7FA 3OM1A 1BVHA 1C7ZA 3BIWA 3MCWA 1YJCA 4ND4A 1E64A 1DAGA 3S1LA 3K1ZA 1Q19A 2CF5A 3A06A 3GZTB 2IHTA 4AIIA 1EVEA 3BHMA 5HZKA 2HOQA 2X6TA 3T4UA 4D9CA 1Z07A 4NG4A 4LZWA 1XU7A 2Y1EA 3DEYX 1GL3A 2CD9A 3NG1A 3PSHA 5AM5A 3WJAA 2BW0A 4RM3A 1OXMA 2FSPA 4LKRA 4Z7NB 1EIWA 2JFFA 1BJTA 1UEJA 1GRNA 4LJ8A 1TIPA 4O4IB 5E6RA 2QVYX 2WJVA 3GH3A 5CLIA 3UO8B 3OC6A 2I29A 1RLIA 2NYVA 4MH0R 1AHPA 2ZRPA 3OSZA 2COEA 1Z5UA 4WTOA 5HF8A 1KPGA 2VF4X 4RNDB 2QMYA 3AL3A 3UMSA 2W70A 3U17A 2AMVA 4X97A 1EFUA 2WR8A 5BUSA 3S1SA 5BVGB 5FDFA 4OJQA 5L4LA 1Z56C 4N3BA 3PEWA 4P31A 3MWGA 4IXWA 5T3YA 2DBQA 2R87A 1UXHA 4NARA 3Q7SA 4A8TA 1P75A 3U4QB 1Y9JA 4ESEA 3KKOA 2WUDA 2Y4OA 1DEXA 3TQHA 4B0OA 4U39A 5EXSA 3DMDA 4P8RA 4CLOA 5I8WA 3ZD8A 1RZVA 2X14A 1U7TA 2BJWA 1DC4A 1KP3A 2OTCA 2OCXA 4ZN6A 4HDNB 1W73A 5CDSA 2OKCA 1T2NA 2X41A 3OOHA 2ZXEA 3F4LA 4ENSA 4URFA 3NPMA 2AIRA 3JPWA 4GYWA 1PT7A 2CVFA 2A0FA 3L0CA 3GGSA 5M34A 5CEEA 4YVFA 2MIIA 3AJEA 4JASB 4IQ0A 4AP5A 1FFXB 2QQFA 3IEXA 4YP0A 4FONA 4DSAA 5JJBA 1T9GR 4I6JA 3KVNA 3AJRA 3E0XA 3H6HA 1J5PA 2HQSA 4AMGA 3TNYA 1I4WA 1VDMA 1N7JA 3L1KA 4C6RA 3DUFB 3D1VA 3G79A 1H85A 1K2VN 2BEJA 1AGXA 1K4YA 1CKEA 1R6DA 1TVEA 3Q9LA 3JQBC 1NVUQ 2NVUB 1UPBA 3VSBA 4PZZA 4BB9A 2QMUA 3EHEA 3WGJA 2OLKA 5A5VA 2DJIA 1E6CA 3DWGA 5ED4A 1BQ4A 2EGHA 2OO7A 2PWAA 1NJ6A 2F1HA 4C0BA 4D4JA 3CNOA 1VLVA 1F2TB 3PPIA 4K81B 5A71A 3DEHA 3KPJA 1ECLA 4F7WA 2HSJA 2BMEA 3CB4A 1THGA 4GKVA 3B6EA 4F4UA 5AW4A 4UVHA 4R2IA 1CJUC 1QAOA 4QYTA 3ELBA 2G82A 1T1GA 1WMSA 4ONEA 1PNRA 1ZIXA 3O8NA 4HATA 1L4LA 1EA5A 3A0RB 1XZPA 1Z0FA 4CQMA 1KZ9A 1UT6A 2WU4A 3R3XA 1T1SA 1O9BA 1H8EA 1NVMB 3HDJA 3UTCA 2W48A 1Q7BA 2PKYX 2FKNA 5P8WA 1UBMS 3ZW7A 1I94B 1VKHA 3T3HA 4NE2A 1T6ZA 1WLYA 4CKYA 2PU7A 4BZZA 2B2NA 2FFAA 5A6SB 1PF7E 2Y1OA 4TYYA 4KRFA 3QHPA 2Y68A 2JZCA 3QJGA 3CVXA 3QY9A 2WSSD 5F76A 1R5OA 4CIYA 4N76A 1XMPA 1UANA 1FRVA 2TS1A 1BDHA 2O7SA 3Q6NA 3NW9A 2H06A 3WK7A 4LYAA 4UHHA 2P40A 1DKRA 1XZGA 3OZUA 4KRGA 1JA1A 4MQMA 4DY6A 2ZBPA 4ZOBA 3RYHA 3N0WA 1S3GA 2P7HA 3HB7A 1ONBA 5DW3A 4EMSA 3RRXA 4GD3Q 5BMOA 4LRXA 1J09A 5TARA 4UULA 3NBYC 1IG0A 2PL9A 2QLLA 4DR3B 2AFIA 3L7DA 3LPCA 2CHEA 1EGMB 3X1ZA 1JHOA 1W35A 4LF9B 2WWHA 3EBLA 4KE8A 5JQGB 2WWYA 1UBRS 1OFUA 2JIOA 3ROKA 3OBBA 4Q7MB 5CFNA 3CRW1 5B6IA 1RI4A 1VZ3A 3HN2A 3TG2A 3VNUA 2P9JA 4KL8S 5AYVA 5KSWB 1YFLA 2JS7A 3K6SB 2QL6A 1SXGA 3ESAA 2BHRA 5ADVA 1NATA 3EC2A 5JI3E 3AERB 2V7BA 1YKSA 2XLCA 3H5VA 1ZJ4A 5FLKA 4CM4B 5ITZB 5ENZA 1WMEA 3KJEA 2AN5A 3BH6A 1ABEA 1ZINA 1TQ4A 5JSQA 3URMA 3IQEA 5AVKA 2W2MA 5JSYA 3A36A 4RZ3A 4AYWA 2R62A 1QO0D 3U3KA 1WZNA 3VNVA 4IGEA 5BRJA 1J7JA 5KQGA 3LVBA 3HVJA 3EEFA 3IAUA 4UMDA 4HGNA 5DH9A 4ZV7A 3OTIA 2XYPA 4LRSB 2FQWA 3EZ6A 4MOWA 3LIIA 3L40A 5E6SB 2IS4A 3NVDA 3WLNA 1GD1O 1KAHA 3K35A 4UPVA 2Q2QA 2VAVA 1KJNA 2IP1A 3C48A 3E8SA 2C5BA 3DPSA 2M6LA 2WM8A 1LS6A 3CIFA 2RH9B 1CUYA 3Q12A 4Q01A 1QIJA 1WA5A 5BMVA 1KO8A 5JS1A 2DG2A 5CIQA 2ZJAA 4N8EA 1OZGA 4DKJA 1FFEA 1KEVA 5D84A 4BVJA 1WDMA 1N6OA 1U3FA 4NBNA 4A10A 2CLDX 1DBIA 2A59A 4X3OA 4EHBA 1XGKA 1BU8A 3UJBA 3ADDA 2H1WA 1KH3A 2E2WA 2QJWA 3Q1LA 4ZC1A 1JS1X 1C14A 3LF2A 1UXGA 2GPJA 4BVHA 3DP9A 1N25A 3L0OA 1GQSA 1X9GA 3NOOA 2I3DA 4ZCRA 5CG1A 1NSYA 3Q4GA 2DQYA 3AW8A 1EVJA 5E1OA 3R5TA 2ID4A 3TKLA 1ITZA 2JI4A 2VRBA 3BFXA 5EERA 5DBFA 3FNRA 1H3EA 1M1YA 2G71A 3AJ9A 2J07A 3T06B 3OQOA 2JIQA 1JEJA 2OO3A 3OJCA 4E31A 4AY2A 1KI1A 1ZRNA 5AVXA 3DONA 3ASZA 4HV4A 2NAFA 1O96A 4HH1A 1YR6A 1MRZA 1DAPA 3RWMB 4BGIA 1E6EA 1UT8A 4E08A 2HF2A 5IEBA 4M1KA 4DHWA 3K1AB 4DQKA 2QR3A 8MHTA 1XNHA 5B37A 1KEEB 4XUGB 5TB5A 3KD3A 1ECPA 2Z08A 4TXMA 3THSA 4X62B 4TV8F 1HT1E 3O0DA 3PXXA 4UFNA 5CNMA 4YK7A 1A8HA 2VT7A 4IHJF 5ESXA 3OIYA 4FQ8A 1PS9A 3I4LA 1PJTA 1PJLA 2WJ6A 3IEKA 4TRMA 1M2OA 3QW2A 2EX4A 5CJ2A 5BYKA 2Y1WA 4UTXA 3BM5A 3D02A 1ZWLA 1C1DA 3UIEA 2G1KA 3PTLA 1RAFA 4LDNA 3NDBB 1D2GA 4ARUA 1U7DA 4IRMA 4K9LA 4NYIR 1R9GA 3ZV3A 4J1TA 2AVDA 1WLSA 3GRFA 3VGPA 2I87A 3MZ0A 2ZAGA 3PRHA 4J0JA 1IN6A 1NP7A 3CCFA 2IYFA 2GYUA 4NENB 5JVDF 4YQEA 1M2WA 2FF5A 2X40A 3CH6A 3IC5A 2NXJA 5KOJB 1DKQA 2RE8A 2GK3A 4RS3A 2GBPA 3F6PA 1R18A 3V00A 1F38A 1KK3A 1L8QA 2VK2A 4F72A 1AS3A 1KJZA 2WMDA 3E4DA 5LQRA 1B8PA 4G01B 2PT6A 3QVKA 4O2BB 1UM8A 2PY6A 4C0HA 2C58A 5JMPA 1L4FA 3CR7A 2REQB 2YWBA 5DVZA 5IT5A 2C7OA 1EX9A 1FDOA 3DVAB 3CISA 4HH0A 3T0GA 4RSRA 2KQUA 3DE7X 4A23A 1E6WA 2J48A 4OL0A 1RIIA 3PWZA 3RM3A 1UMBB 1TO1E 4N0PA 3RUFA 4IZHA 1HE2A 1NN1A 3G2KA 3CEMA 3IEMA 2FW9A 3CF4A 1M2GA 2RDMA 3DFIA 2HK7A 3KOMA 4KXLA 4LOAA 4PHCA 4QA9A 3GROA 5THXA 7ABPA 5JDIC 3PWKA 2W6OA 4MGZR 3AX6A 3DHVA 3O75A 4MS1A 3BA6A 3PQ6A 4DWVA 3W5CA 5GZ1A 2O6LA 1X13A 5LYJF 2FMFA 5F4BA 3SLKA 1XZJA 2FFHA 5K3DA 2C2XA 3V4VB 2ORIA 5J4VA 2Q2NA 4P84A 2I9PA 3KL2A 1RYYA 3PQ4A 5F12A 9LDBA 5JZ9A 3T7KA 1C4WA 1OZFA 4PIPA 1T29A 1NW9B 3T34A 2BONA 1HNWB 2H5IA 4K6HA 5SICE 1JHAA 3ZVLA 3JRWA 2DSNA 4ECEA 1OXSC 1QRTA 3LUJA 3CM0A 4IDQA 4DQUA 3UAXA 5F5XA 3ZC3A 4NU8X 1V9SA 2C88A 3AG6A 1CZHA 1XRJA 4ZAXA 1FW6A 1FDRA 1K8QA 1Z6GA 2WEKA 4RVHA 3KQSA 3OHSX 1UP4A 2XT6A 3P27A 5G40A 1Q77A 1XCMA 2FXVA 2QBYB 2FPPA 5A7FA 3BXXA 1G6KA 1R6BX 2O5RA 2VYQA 4FT4A 5EJAA 2E4AA 3BXEA 4IIBA 1HFEL 4RH3A 1EE2A 2ZRKA 4ZYTA 4R1UA 2ZOSA 3IUPA 4TMXA 4MDHA 4K86A 5CVCA 5DP2A 3OKAA 1Q7CA 2E4WA 5JFGA 1QVWA 1UM9A 3QVGA 1U0OC 3CZCA 4C3OB 4CCAA 4DBLE 2W6ID 5KTPA 1LLQA 4KTVE 1MD9A 4LYGA 5K8TA 3L49A 4DRXB 2BP7B 3ZDAA 1G8JA 1X9HA 4ESHA 2PRYA 4PQYA 4ZQHA 4BNHA 4DEYA 1EFKA 1TJ5A 1ULTA 2FPSA 2VSQA 2Y93A 4GIBA 4GX5A 3TCXB 2CXSA 2BM1A 3O74A 5JYCA 2H9AA 4I5FA 3ND6A 1H3FA 1YE8A 5B1YA 3ISTA 4CF7A 1H0RA 1R27A 1YZHA 2VK4A 3DYIA 3PGLA 2D5CA 3ROTA 2FUNB 3KQVA 1ENOA 2OHIA 3SICE 3KWMA 3TVDA 2FWMX 4KXFB 5CA1B 5ALYA 2IUTA 2LKCA 4P98A 2E21A 1U63A 3GWGA 4TTPA 4B85A 4HZUA 2ZJ8A 1IZZA 2V65A 3BE5A 3L7MA 1E2DA 2OOKA 1ZONA 1FQKA 1EGQA 4QSHA 1M6VA 1S4QA 2AXQA 1I10A 2JBAB 4GECA 1QGED 4LXTA 1DKOA 5DHSA 2YYSA 3A1FA 3CZAA 5K03A 4AURA 2VAPA 1JZTA 2DPYA 3ZE9A 4L28A 4RTOA 1ZIYA 1ZN9A 4V0RA 2QRMA 3ZDXB 4MEBA 2V0GA 4FOSA 1UH5A 1QUFA 4RKRA 2X86A 5ALSA