3W8RA

Mutant structure of thermus thermophilus hb8 uridine-cytidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
207
structure length
207
Chain Sequence
b'KPFVIGIAGGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDLALYLEHAQALLRGLPVEMPVYDFRAHTRSPRRTPVRPAPVVILEGILVLYPKELRDLMDLKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIVPRGGQNPVALEMLAAKALARLARMGAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine kinase
publication title Indispensable residue for uridine binding in the uridine-cytidine kinase family
doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 69
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w8rA00
4X8LA 1ZMXA 1V43A 4LCBA 4LPKA 3B1ZA 1TADA 1D2EA 1Y3AA 2F1RA 5EE3A 2A5YB 2ZRMA 2FFQA 5SZKB 3A36A 4B3CA 4JJKA 3SZRA 4ITRC 2IWHA 4FMBB 1KK1A 3AM1A 3ASYA 3CW2A 3KQNA 5E95A 2JLRA 2QQEA 3QNUA 2O8DA 4TYNA 1BS1A 4RD3A 4MRNA 1VCMA 4RD6A 1FNNA 1OB5A 4MRSA 1E32A 3QIAA 4RZ3A 4IVQA 4LY6A 5C4GB 4RJLA 2R6CA 4GZMA 4EPVA 2FE4A 4ZV4A 5JWRA 1VCIA 4R9UC 1IN4A 2QPAA 2C77A 4GOJA 4XTCS 3RS7A 1A4RA 4YLGA 3VU9B 5C46F 4JLAA 2WSSA 1XTRA 4Q7LA 4AYXA 3K8YA 1Z0DA 2QGNA 2JLWA 1ZRHA 2ECKA 4PC7A 2GZDA 4PAMA 2XNDD 2JDIA 3AVUA 1HEIA 1CLUA 3A4MA 3MWYW 3K09A 2Y8EA 4A2PA 3U44B 3A4NA 1OIVA 3ZVMA 1FPMA 2P6NA 3AVPA 1MKYA 2IYWA 2V7QD 4A8JC 1E2PA 3I8XA 1U8AA 2HCBA 4MYUA 1YZNA 4JMPA 2W6JD 2EFGA 5KDDA 1R0ZA 2J45A 3LBHA 2OHFA 3UMRA 4CT5A 4XVRA 5FBRB 3TW4A 2RH5A 3T15A 1E2NA 3FKSA 2BC9A 4JLVA 2QSZA 3I73A 3FGNA 5KUTA 3RC3A 1H8EA 4ZIRA 1G3IA 3UG6A 3FMFA 5BN3A 4DDWA 3SDZA 3G82C 1JR3A 1M7HA 1AQUA 3QKUA 1T4GA 1G8FA 1P2VA 1RFLA 5HCNA 3I5YA 3KKPA 4R71A 3OEHD 1D6JA 2BDTA 4LYFA 4ZKEA 3W6NA 4PQFA 2PT5A 3KFVA 4FINA 4A82A 5EXTA 1L7VC 2BEKA 1E9DA 2QRZA 4F91B 3FB4A 1LW7A 2ZE8A 3VX3A 3U6BA 1G6HA 1KI3A 2J1LA 4BFVA 4BFTA 2BBSA 2GVZC 4PHGA 3EXAA 1OKKA 1GM5A 2C2HA 4PANA 2WMNB 5JI3E 1XEFA 3K70B 3UANA 1HH4A 4BFXA 1IY0A 2VRWA 2O0KA 4CRWB 1Z06A 1E9BA 1R4AA 1HY3A 2A5JA 3Q8XB 4HAWA 1S3GA 1CIPA 4QGHA 3ZQJA 4DLZA 1G8YA 4URVR 3ADKA 2QP4A 4B6FA 2QAGB 1MOZA 3X1WA 4M9SA 2OM2A 3M1IA 3B1YA 1GKUB 1Z47A 3QY0A 4A9AA 3ZZ0A 4ASUA 2HT1A 4PZYA 4R7ZA 3A1WA 3QBVA 3ZLJA 1ZINA 3T1VA 4DUGD 1KIMA 3RS4A 1KKLA 1G19A 3LVRE 5F9FA 3BFXA 2BHRA 4OBEA 2P6UA 4WAUA 3NIBA 3NH9A 3RNLA 3GFOA 3QI2A 4L8GA 4LBYA 4JLOA 3C5CA 2CK3A 5FOSA 4AG5A 1OW3B 1UDWA 5HZHA 1CULC 1G3MA 1NBMA 4KBGA 3IO5A 2JIZA 3LBNA 3HWSA 3AVVA 3BD9A 5TV2A 2QORA 1F5NA 1ZUHA 3CH4B 4UXJA 3T12A 2KSQA 1JI0A 1XJ0A 2GEVA 4UKDA 3EPLA 1UKEA 1PZNA 1P73A 2REOA 3U4QB 4I81A 1E96A 4MRRA 1CJTC 4PAOA 3B85A 3K0CC 2F9LA 1AIPA 1XD2B 2BVNA 3TBKA 4BZPA 3KUDA 3P20A 1BH2A 1SVOA 3Q3JB 3IIKA 3IGFA 4KITB 1KO5A 2C96A 5KYKA 2GJAA 4OQFA 2W2TA 4JZKA 5EE5B 4KSCA 3EZ2A 2Z6VA 4LYJA 4E03A 4DSUA 3KQUA 2R9VA 1SVLA 3AP2A 4UQOA 2C03A 2VHQA 3BERA 5EE0A 3SQWA 1XXHA 1CRPA 4OHWA 4LGMA 3QQ5A 3PEYA 2FMXA 4WVFA 1S9HA 1GKYA 2V6JA 1QBKC 2YNMA 3V00A 1K5DA 2IF2A 4A1FA 1JAHA 4A92A 4A0HA 3AUXA 2GJ8A 1VKJA 3CNOA 1ZW6A 2PCJA 3OIUA 5JWOA 4OHYA 5AK0A 1VYVA 4JKYA 3RC8A 1HQCA 4D82A 1QVAA 1YRAA 4L16A 3WHLA 1IOZA 4P0TA 1NI3A 3UXMA 1W46A 2V1XA 1UM8A 2G88A 2H18A 4I1OA 4EKDA 5AJXA 1SGWA 2GF0A 3HR8A 3RHFA 1R0WA 2XB2A 3CX8A 3KJHA 5FOUA 2ZSDA 2B7CA 4B47A 3GJ8A 1PLJA 4HB0A 3AKEA 2ZETA 3IO3A 4OQXA 5CK4A 3CBQA 2FFAA 1XBTA 1VHTA 1X6VA 2DFKB 2XTMA 4U5XA 3KXLA 4EDHA 1OF1A 4JBXA 5G3ZA 2ZYWX 1OLOA 3QXJA 3AP3A 1NN0A 3ETLA 3QVVA 3VQTA 1Q12A 1Z6AA 1QHXA 1IJEA 2I1VB 4EPYA 1G17A 4DB2A 2ZIAA 1X8KA 3DOFA 1KHTA 4ZDIA 4ILEA 2ZI9A 5HCIA 3U3JA 3V9PA 4B75A 3MWJA 3ZJYA 1JXMA 4B33A 3B6EA 3V4RA 1E2LA 3BBPA 3FTQA 1Z22A 4XWAA 2OG2A 1F48A 3EZ9A 2J7PD 1QRAA 5FUYA 3CPEA 2XNDA 4XD7D 4C30A 4B44A 3SN6A 3PQCA 4CF7A 1E0AA 1UKZA 4KHZA 4V0ME 1WBDA 4C2UA 5HE8A 4B2IA 5LB4A 5JLJA 5D3MB 1W0KD 2V7QA 2DWOA 3GEEA 1ESNA 1M7BA 3AVOA 3VKGA 1ZM3A 5FR1A 1RE0A 1G4AE 3SJZA 1HUQA 4A0FA 4PR0A 4DCVA 1NP6A 4Q1EA 2W6JA 4PX9A 2IHBA 1WCV1 4B3XA 5DYIA 2V54A 3T34A 4QNRA 1NG9A 1TEXA 2VP4A 3THYB 4A6PA 5L3RA 2GEUA 2HJGA 4HZIA 3NBFA 4YDHB 4PPGA 1ZNXA 3OFND 2FSIA 1G5PA 2G1KA 1KSGA 1UEJA 2BJWA 1R5OA 4QJ3A 4TMWA 3T1QA 2WJGA 3GJ5A 3M6AA 4FWIB 3CLVA 1KJZA 2ZE6A 2P3SA 1XCMA 3OEHA 5FOTA 4TLDA 5JSZA 2FJUA 2HF9A 2O8CB 1KZGB 3AUYA 2IYVA 2GCPA 2RGCA 1GDDA 3AV0B 4S2EA 1D2MA 2GCOB 4C0AC 5LBIA 1SXJB 4LJAA 4DIDA 3OIWA 1JQJC 1ELOA 4Q21A 8OHMA 2J3EA 4QBGB 4H1VA 1GWNA 3BIFA 3BORA 4Q47A 1ETUA 3NDBB 4RZUA 4M1OA 5DN6D 3A1VA 2FSGA 1RJ9A 3K70D 1N6HA 2F7SA 2DYKA 4DHEA 3KQLA 3I61A 2B8WA 5CITA 4JYBA 4URWR 2RGNC 4BFSA 2OCBA 4CIDA 4Q5IA 2RAPA 1ZUNB 5DGXA 2GZHA 1II0A 4B2LA 3CO5A 4FMDF 3QKRB 3LW7A 5DO9A 5FPYA 3B13B 1YR7A 1KI1A 4D0GA 2OXRA 1N5IA 4R98A 1XJQA 3WNBA 5LD2C 2WOJA 1E2FA 1MRSA 1WBBA 2A5GA 2NZJA 1P60A 3WY9A 3W3ZB 1JECA 3EAQA 1Q20A 4DUGA 4PSKA 5SZIA 3R7WB 1E2QA 4OK5A 5BQ5A 4Q1CA 1GRRA 2VHUA 5J47A 3CF2A 1Z2AA 1KO7A 2FZLA 1DG1G 2C95A 4LDJA 2OE2A 3FKQA 2EVWX 1P72A 4WOPA 3RRNA 4AIIA 1E2DA 1XZPA 4KJZA 1P2UA 5FUXA 2D7CA 3A1TA 3QEOA 4BFZA 4JBWA 1YE8A 2FGJA 4L9WA 3CPHA 2QPOA 3VR5A 5BW8A 2LKCA 1OH7A 5FPSA 1KKMA 2GESA 2VP0A 1P6XA 1RYHA 4W5HA 3T1OA 1Q21A 4DB4A 2JLXA 5AWFC 3SBEA 2O5VA 2ZI6A 2J5XA 1UAAA 3KZ1E 3SC3A 2AXNA 1SVIA 3GLFE 4HYYA 1AZTA 1AKYA 1IXSB 1CTQA 1HTWA 4LJ6A 2IS4A 5G40A 2RMKA 1WE2A 2K5UA 3OIYA 4F92B 1G3UA 1SHKA 4HLUC 4WZ6A 4LK2A 2IS6A 3RYTC 3SYLA 4IJMA 4H1UA 1FNMA 1MABA 3QXHA 4PC3A 2NPIA 2ODBA 2RGEA 2PMDA 2W2VA 3H86A 3IIJA 4KAXA 1GRNA 3DOEA 2KBEA 1EX6A 1IXZA 1TQ6A 2E9SA 1BIFA 2OCPA 1Q3TA 3TLXA 5KNCA 3GLGE 4I1VA 4Q00A 4QKQA 5J4VA 1NLFA 1U99A 3NXSA 3BFVA 2HCJB 2VA8A 2D2FA 3BS4A 4AKEA 1JAIA 3GLIA 5F98A 2QUZA 1NSTA 2AD1A 1G7TA 3KTAA 5JHGB 3PR1A 1JPJA 1E1QD 2GETA 3DL0A 4PQRA 4E5UA 1YJ5A 3GCGA 1XMIA 2FPLA 1XD8A 3R8CA 1VDZA 1P9WA 4UNPA 2JLQA 3K9LA 3C8UA 4C4PA 4KSBA 2QEQA 4FW9A 1KMHB 2ZI7A 2CXXA 4DXAA 4D26A 4LJ8A 3LX8A 3CRRA 2GBLA 1Z6YA 3EIEA 3FMOB 4D4JA 2HLDD 3IHWA 5FTKA 4NCNA 1NVUQ 4IXNA 4QG7A 3DEFA 2FNAA 2JATA 4GOKA 3VU9A 3ZYCA 3MRSA 4A8JB 3D3QA 5AJVB 2OXCA 2Z0MA 1T0JB 1TU3A 1EFTA 1Q57A 5EP3A 5L8VA 2J7PA 1Q1EA 1JR6A 3O8RA 3RANA 2ZRBA 1KDOA 4XD7A 3WHKA 1KO1A 4ESHA 5EQTA 2WWWA 3U7HB 4A15A 3U44A 2OAQ1 2ZU0C 4ZPXA 3KQHA 2Z5FA 4HAVA 3GLFB 2XXAB 3K0AB 1NVVR 1I4LD 2B92A 2J0SA 1VHLA 1W0KA 3W3AA 5FUVA 2AX4A 5F2EA 4DKXA 1EWQA 2VPPA 1IY2A 1OJLA 2C98A 3QKSA 5EP4A 4AYWA 2WTUA 3L0IB 4L5BA 1E2HA 3RS5A 4G0NA 4HDOB 1M74A 3WMFA 4KV9A 4DJTA 4C0LA 5UKDA 4POAA 2BM0A 4RSGA 3TSOA 1Z6TA 3EIHA 5KSPA 1EFUA 4NTZA 2O0JA 3OFNA 1F2UB 2FV8A 2ZQ5A 5JEEA 2QMUA 4FMDB 121PA 1XEWY 1PUJA 3QG1A 4B34A 1XJCA 3A6PC 1Z3IX 2IYTA 1FX0B 2QAJA 5HPYB 3VKHA 4LYHA 2WAXA 1Z0AA 3GLGB 2IEYA 5CLQA 3PUWA 4QHSA 4HB2A 4GT1A 1IJFA 1SXJD 3DO6A 4WXRA 4QJ5A 3TSWA 1QG2A 1YVDA 5IRCD 5GJWC 4D4KA 5EXPA 3QBTA 2N1BA 4DSOA 4Z51A 3DMDA 3DZDA 3HPRA 1CR2A 2QMOA 5DN6A 5FPHA 4C0JA 3M0EA 3H4MA 4Q03A 4LX0A 3EASA 1OYWA 5J4YA 4ZDKA 4CVNA 1UFQA 4Q1BA 5EJEA 2F43B 3BB4A 2XZPA 1DO2A 4MGZR 4R2IA 1UKVY 1N3BA 2AD5A 4EPTA 1QHGA 4KXFB 1XCGB 3TR0A 2BCGY 2GKSA 3B1XA 3SYNA 2H17A 1N5KA 2QAGA 3QVUA 1UPTA 4DDUA 3OIVA 1IN8A 1IN6A 2W0SA 2ZRCA 4LRWA 1KDRA 3LQQA 5ELXA 2ZJ2A 4C7OB 1RJ9B 3X2SA 2JJ1D 4YMVA 3IIMA 2G0TA 4ZI2A 1AJEA 4MKIA 3GLIE 1OXTA 5KO2A 2VQSA 4JLJA 2B21A 1XP8A 3EG5A 2IWRA 3AKCA 4TQAA 2WKPA 4KVAA 3DDCA 4UNRA 4JLDA 1E9FA 1ZIOA 1Q1ZA 2ZUBA 1AZSC 4AK9A 2D7DA 3PENA 3THXA 1OH8A 3AVYA 2GCNA 5AR1A 1T8UA 3H0KA 3WNCA 2VP6A 3MJRA 1OFHA 3PUXA 2A3RA 1PLLA 4JSYA 2PEYA 2XJ4A 2WJJA 3LH5A 4V02A 5EP2A 5IT5A 3U4QA 5CJPA 2FX3A 4M1TA 1U9IC 2QY9A 3TQCA 1XD2A 3ZQ6A 2SHKA 1G20E 3DM9B 2ZRAA 1TNDA 2XEXA 5BWMA 1OFIA 4ZKDA 2YOGA 2IUSA 3PG5A 5GJBA 1W47A 2EU8A 3WXMA 4B43A 4GI7A 1E99A 4Q66C 4Z8YA 2IXEA 2QM7A 4QXAA 3T35A 1OH6A 1Z2CA 3TVDA 3FDIA 4KFUA 1FZQA 3DVLA 4QBFA 5B30A 2VO1A 3SNHA 2CHGA 4TMZA 2QM8A 4MRPA 4O0MA 1R5NA 1D9XA 3NEYA 2G0NA 2ANBA 2F3TA 4HSEA 1XTKA 2WICA 3TK1A 3FHOA 4HUQB 3PUVA 4G5QA 4MKFA 1WF3A 4QHYA 1J7KA 2WWGA 3VTKA 1LNZA 3MG9A 2BEJA 2D06A 3JZMA 4NBSA 1E1QA 1M8PA 4BLPA 4DVGA 4ACAA 2XSZD 1ZNWA 5AJYA 3Q72A 4G5OA 2CL0X 3SJCA 2PZGA 4A4DA 5KDLA 3GLIB 3LWNA 1XTQA 2IF0A 2AKAB 4PO9A 4G01B 3ZD7A 2EFCB 4TL9A 4PC2A 2ZSFA 3EX7C 1U90A 3KTAB 1IAQA 2GRJA 2HYIC 4TYWA 2N42A 4QM6A 1CU1A 4C0SA 1CRQA 3I62A 2HLDA 1Z29A 2ODWA 4DWJA 5JS8A 1HE1C 1RW4A 3ND8A 4G3XA 4URXR 3PITA 3SYKA 4GOXA 1OT3A 2CDNA 4YXWD 1ZYUA 2RHDA 1UKYA 1HT1E 2ZITA 3P1JA 5EUMA 5FBWB 1E9SA 3SJBA 1VMAA 1GG2A 3F5FA 2ZRJA 1RYFA 4GFDA 4EPRA 4TZ6A 3ZDQA 3ND9A 4JVLA 3LO5A 2EQBA 4MA4A 2D4HA 2FU5C 1QDEA 1RPZA 3T5GA 1YZUA 1ZU5A 4GDFA 521PA 2P5TB 5H70A 1VIAA 2Q21A 3THWB 4V0KA 4TYYA 4BFYA 3PVSA 2YC2C 3K0FB 2BJVA 4N0DA 1A2BA 5D3MA 4MRVA 2PMKA 5EE9A 2O8BB 2IK8A 1RRGA 1R8QA 2GTPA 3CNNA 4MYCA 2CMKA 4FI3C 4MITA 3IBYA 3THYA 4IDPA 3B1WA 4DDTA 3HU1A 4R2HA 4UJ3A 1G1MA 1U2RA 1CS4C 2OT3B 3BB1A 3BGWA 4LYAA 3SHFA 2BMDA 1L8QA 4RKFA 3F8TA 1X86B 3B9QA 3MLEA 1SVSA 3TAUA 4A2WA 2NGRA 4GP7A 2O8CA 1QF9A 4A0GA 1NVWQ 1KJWA 2GCOA 3AKYA 2X8AA 2OUKA 5C2JB 1SXJA 1FL9A 1DOAA 2YWEA 4FCWA 3W6PA 2IYQA 2NO1A 3AVXA 2KWIA 1ZAKA 1D9ZA 2WM9B 3ZIAD 2XX3A 4N0EA 3IQXA 2MSEB 2IYSA 4FIDA 3PV0A 1TU4A 1SULA 2OSBA 2ZRDA 4DLRA 1U0JA 2J0UB 2O0HA 4CDGA 2BCJQ 2ZJ5A 4LHWA 3BFKA 2VHTA 3QKRA 3FVQA 2HJVA 1LFDB 3OE7D 1RKBA 3K1JA 2QTHA 2X2FA 3JZAA 2QU8A 1ZNZA 2JJ1A 4TN1A 2OAP1 2DR3A 1PVOA 2GJSA 1KK0A 1LF0A 1EX7A 4D0NA 1FQJA 2ATXA 4BGDA 2WKQA 3R7WA 4U7DA 3TMKA 3SFVA 4O2LA 4RFSA 1W4BA 4JBYA 2A7QA 2AWNA 4JL5A 1G291 4URUR 4AWXA 2ZR7A 2CCKA 2ZI5A 4BECA 1N0UA 1VYUA 2W83A 4V0MA 3REFA 4D4LA 2CHVA 3Q9LA 5E4FA 3GPLA 2YZ2A 2Z43A 2QE7D 4DDVA 5CB8A 5DYGA 1T3HA 4EFLA 4PO1A 1BYUA 4M53A 2F9MA 1CF4A 2OBLA 1ESMA 1GILA 3IPYA 4OHXA 4BWYA 3Q85A 1II8B 3THXB 2XNSA 3UWKA 3BC1A 1O3YA 2VEDA 4YONB 3W90A 2A9KA 4GNKA 1X1SA 4Z54A 4JSTA 4V0OA 3FHCB 5DE3A 3RWOA 4P31A 1PUIA 4LJ5A 3PUYA 3T06B 3RRZA 1QVRA 2FA9A 1OXXK 2QZ4A 2CL7X 4BPBA 3NEJA 4CEIB 3KUCA 4JLMA 4BASA 4RCZA 2IW3A 3IQWA 4MGIR 4C9BA 1N5JA 5D3QA 4FN5A 4PXAA 5SZHB 2BV3A 1NJFA 2GK6A 3CX6A 2ZJ8A 2KB0A 3TQFA 1DO0A 1WA5A 4DSNA 2F1JA 4QC2A 2GXQA 1ONBA 1VG9B 2JCSA 3TJZA 5CB6A 2QP3A 4F4JA 5KSOA 2FPKA 4AURA 3G0HA 4LHYA 5JJLA 1GNRA 4WBSA 1P3JA 2G6BA 4HB4A 4WA7A 3ZZTA 2QROA 3EA5A 2QG6A 5J4KA 4Q4AB 3IEUA 4U02A 2NPFA 5HZKA 5FTMA 721PA 5G53C 3ASZA 5M04A 3I92A 5FBLB 3FYHA 4M9ZA 1R7RA 3QF4B 1XNJA 4LWZA 4YMWA 4OI1A 3P4YA 1NG1A 2OFXA 2PT7A 2XSZA 2ZS9A 2N46A 1KSHA 2C78A 1MRNA 4FWTA 4XOIA 1IONA 2H5EA 2RHMA 1EFRD 1KMHA 4EUNA 3EC1A 2P2LA 1MR3F 1SXJE 4JL8A 3SR0A 4XVUA 1W36C 3CR8A 1NKTA 2EWWA 3CWZA 3CUEF 3SS8A 5H68A 4ABYA 1WXQA 1EESA 5HE9A 1ZD8A 2YHSA 4UNNA 1BMFD 2D2EA 1NF3A 2JLSA 4A8JA 3NTUA 1WP9A 2DHRA 4MGYR 4OK3A 2IYZA 3I8SA 1XF9A 4P33A 4P3YA 5CYOA 4YXWA 3GFPA 2QSYA 3AF3A 5FOXA 4FMCF 3CONA 4BRUA 3U3OA 4LBWA 2IA5A 3RVBA 4D4MA 4EAQA 4JJZA 1E0SA 2HT6A 1ZD9A 2ZRLA 4BLSA 3QKTA 4BZXA 2ZRKA 1A82A 5FH9A 3GLFA 2B8TA 1TQ2A 1Z28A 3CF0A 3CX7A 3K0AA 2J46A 4NPHA 4BLQA 3CRQA 1FW6A 2BBWA 1F2TB 2VP5A 2J41A 3LVQE 1L4UA 3Q5EA 2RGDA 1KSFX 2P65A 3TGPA 3ZH9B 3DKVA 2C5LA 5AUOB 2WWXA 1NLZA 1UF9A 4G5SA 4GRAA 3CPJB 3WYAA 4DEYA 4OK6A 2DB3A 4KO8A 4IHQA 3NH6A 1D8TA 2W58A 3C41J 2QI9C 1F2UA 4EPXA 5JI2E 3ZS8A 1GKIA 5JEDA 2X1VA 1N6IA 3BB3A 1U8ZA 2VLIA 2W6ID 4HATA 4K46A 4LC0A 1I2DA 1OV4A 3A58B 4PFSA 4BE7B 5K8IA 2FN4A 4YMTA 1FX0A 5JECA 2GJKA 1ZBDA 4EPWA 1CKEA 3GLGA 3GEHA 3UWOA 1P75A 4D6PA 2GAOA 2IC5A 1MO5A 2YOHA 1RZ3A 2RGGA 1FP6A 1VCNA 2V9PA 4LV8B 5DHAA 2HXSA 3Q7QA 1N2CE 1LS1A 3ZIAA 2WAYA 3NVAA 4Q4HB 3B7GA 1TPZA 2VHJA 1T3LA 3L0PA 1GVNB 2F43A 3NC0C 1KOFA 1FFHA 4XSHA 1WRBA 1LV7A 1NMXA 3MCAA 1BKDR 2H16A 2MMCA 2R62A 2ORWA 3F0TA 2J59A 2XB4A 1OPXA 2NQ2C 1OIWA 5TVKA 1X8LA 2QGZA 1WQ1R 1CBUA 2G77B 4C7OA 3OE7A 1TQ4A 1Z0KA 3WNDA 4A6XA 4F4IA 1JEDA 1E98A 4NYJQ 2ZTSA 1J2JA 1HT2E 3QF7A 4DC9A 1U98A 2AN9A 2GZAA 4TTRA 5IK2D 4GMXA 1OSNA 4NE2A 3U3MA 1EG7A 4DLUA 2PJZA 4QHTA 4BLRA 2PX0A 4MQBA 4YMUA 3GJ6A 2G83A 5EZ5A 1XMSA 1US8B 3B78A 3O8DA 1CJVC 1J99A 1R5BA 1H8HD 2H92A 4Q02A 2QE7A 2O8EB 3CZQA 4OQLA 4K81B 4RFSB 4PTLA 4CEHB 2LCFA 4LBZA 3R9XA 4EIWA 2R44A 1N0WA 2ZAMA 2V1UA 4IFEA 3KDSE 4ESVA 3AF2A 4DEXA 3C4JA 1AM4D 2FH5B 5FPTA 3DHWC 5IDVA 3QPUA 2XOKD 2J87A 3UG7A 4C0BA 1S9DA 4Q48A 4B3GA 2GXUA 3MAAC 4TSFD 2BM1A 2IX3A 2YWGA 4M9XA 2AKYA 1JJVA 1OHHD 3AF0A 4Q4JA 1G4UR 2ZS7A 1P61B 3L0SA 3OESA 4GP6A 4PC1A 4XSGA 3RSLA 3CH5A 2OFWA 2A2ZA 1DAKA 1N0VC 2R6GA 3WBJA 3U3RA 4TL8A 4M1KA 4F7WA 3X1XA 1IM2A 2ZRNA 1AQYA 4D0LB 1O87A 2WZQA 3L8ZA 2JGNA 1CJMA 4ACBA 4DCUA 2CCJA 1QHYA 3F3YA 4EQ6B 2H57A 3IKJA 4P4UA 5BN5A 5E7JA 1KTVA 1Z08A 2NO7A 2VHCA 4HUQA 4BFUA 4DIEA 5KSYA 4GL2A 3K53A 4FMCB 5FL7D 4EJSC 4OI0A 1FUUA 4RZ2A 4E07A 1HE8B 1IY1A 2JJ8A 2WJHA 2W00A 4LJYA 3R9IA 5TY0A 3UKDA 2FSHA 2V8OA 2PCLA 2VF8A 5DIFA 2ODEA 5FBVB 4NZYA 2QBYB 2ZU6A 4M1MA 3TIFA 4QGAA 3X1YA 3MWKA 2PBRA 1EFRA 3WP1B 2CL6X 4KYIB 5A0FA 3RSOA 4CW7A 4PHHA 1TF2A 1TAGA 4XWOA 1XEXB 2FWRA 4Q19A 5GVRA 5BXQC 1MT0A 4JKIA 421PA 1Q3HA 4Q9LA 1BMFA 2REXB 5KOYA 2ZUDA 2CLCX 4B3DA 621PA 2P0EA 1M2OB 3BRWD 2CLDX 3LBIA 1ZM4A 4HLCA 3VX4A 4PPFA 1DPFA 3HU3A 5JRJA 2RB4A 5JCPA 3X1DA 3KL4A 3THWA 4NP6A 2GXAA 1UBCA 2EFHB 2WWHA 3O8BA 4MKGA 1HV8A 1E9AA 3AGQA 3K0FA 4G1UC 5GVSA 2EYQA 4I1SA 5EUQB 1CEEA 2F6RA 2Z4RA 2ZE7A 2IS1A 4NYMQ 1X3SA 2O8BA 1NVXQ 4RD2A 3LRPA 1TUEA 4B71A 5KPDA 4V0NA 4KI0A 1DARA 2ZJZA 2BBTA 3MJHA 2CVFA 2GJ9A 1TL7C 1TMKA 1Q0UA 3GJ7A 2V55B 4IOLA 1XEWX 4BRWA 4C0HA 4M0LA 4I1UA 2FFHA 4QJ4A 2AR7A 4W7SA 1JALA 2C9OA 2DBYA 4M1SA 3AVWA 4OI4A 2W6IA 4NHOA 5L3QA 2X77A 3QEJA 2FEOA 2C04A 1Z0JA 3RRMA 2UZIR 4E22A 3BK7A 2RGNA 2VYFA 3VHXA 1IN7A 3GFTA 2I1QA 1BYIA 1XPUA 3K0SA 4P32A 5JJIA 2ZRPA 1PJRA 4IVRA 4B35A 4XVQA 3LAWA 2ZRHA 4JYCA 3NHAA 2ZM5A 2JLUA 5DHFA 2R65A 2ZRGA 3CIOA 1KO4A 2ATVA 2ZSEA 2MSDB 5JBQA 1RRPA 2IS2A 3GD7A 2DWPA 5E7MA 4HB3A 1S8FA 1VG0B 4P4TA 3U5ZB 5C4MA 2J0UA 2C9CA 3U3KA 2ZJAA 1E2JA 3A4LA 4HAXA 4GMDA 2Q3HA 3HU2A 5E3HA 4IDQA 5AJWA 2NMVA 3CRVA 2Q3MA 2WJYA 1G5RA 4ERNA 1HURA 3ADCA 1TF7A 4QFMA 3B8HA 4YDSA 5FTNA 1XPOA 1Z6XA 2KBFA 2YV5A 3KXIA 4ZCLA 2WBLC 2Q9AA 2VTKA 3LA6A 4LUCA 4PHFA 1E4VA 3RS0A 1W2GA 4Q7JB 2QT1A 1LVGA 1NMYA 2ZEJA 1T3SA 2WWYA 5L3SB 1GTVA 1SHZA 2WHXA 1WMSA 2Z4SA 2HDNB 3GEIA 1XD9A 4LV6A 4MDEA 5IK2A 1P9RA 1S3SA 3SQXA 3S1AB 5JHHB 4QBIA 2QPTA 3SBDA 2AWOA 4W5JA 4DLVA 2REBA 1J8MF 2QT0A 2IT1A 3CRW1 4I99A 1GNQA 4I4LA 1YZLA 2ZS8A 2H7VA 3HP1A 3V4FA 2AK3A 4BEJA 1H8HA 3LXXA 2ZXUA 4OJKA 3OAAD 3K09C 2J7KA 1BOFA 1ZIPA 2VSOA 1E4YA 2O8FB 3TAHA 3AEZA 3H84A 5DH9A 1CR1A 3BJIC 1II8A 2NO9A 4BFWA 4RVCA 1TEVA 1Q22A 1CJUC 2D74A 1UBFA 3CKLA 4J0QA 1CJKC 2XOKA 1E0JA 2F3RA 1E2EA 1KNQA 1KI2A 4Q7KA 4TSFA 2FPMA 4AKHA 4B73A 2YKGA 3N5CA 3DM5A 5KNBA 2H1LA 1XFAA 3PXGA 2F1IA 4IVPA 1OHHA 3WP0A 2JJ2D 2IBMA 2P6RA 4CEIA 1VG8A 4C3ZA 1HYQA 5JS7A 3I5XA 2VIIA 5EXXA 1TF5A 4JT4A 5BN4A 2Z83A 4M21A 3B5JA 1T5IA 2WOOA 2GDJA 1NNEA 1S2MA 1UADA 4Q4LA 5AJZA 5A4JA 2ZJYA 4UXHA 3UIEA 5C1BA 3W8RA 2HV8A 3KQKA 4P4SB 5B64A 4Q4JB 3FMIA 4M2LA 1P62B 1KI6B 1OFTA 4F93B 1ZCBA 3U7EB 2IYUA 4LHVA 1W36B 1SVMA 3BAFA 4QOSA 3ADBA 3QPWA 4NH0A 4B6EA 3C5HA 4Q4AA 5TXGA 4W5WA 5J5CA 2JASA 5G41A 3IDQA 1E0KA 1ZP6A 2ZRFA 3QJYA 4IOJA 2FEMA 2CEAA 2RKOA 4NKRA 5FL7A 3U6KA 1EK0A 3QF4A 3TVTA 4XTRA 4AD8A 3BXZA 5JWHA 1YR8A 3EARA 3IHLA 3LLUA 1I2MA 4IDNA 2EW1A 3PJRA 4PO8A 2E87A 4BLTA 1AGPA 2R6DA 1GSIA 3SI7A 2JLZA 4TMXA 1MO3A 2IYYA 1KMQA 4TLAA 4W9MC 2BMJA 5CYPA 4ZDJA 5AUQA 1RRFA 2QENA 1YKSA 3WBKA 1D2NA 1AK2A 5FTLA 4HLDA 1AS3A 3CB4A 1NY6A 3WYGA 3KJGA 5K8LA 3DMNA 2XTZA 3CWQA 4QGFA 4NCJA 1B0UA 1W4CA 4AKGA 4ARZB 4NYJR 3HYRA 6Q21A 2IL1A 1OE0A 5FI0B 2WJVA 1NSFA 1QHNA 3N2EA 2ONJA 4OYHA 5LDDC 5JRZA 1VIYA 4JLBA 4D80A 1XWIA 1SVWA 1XTIA 3WRYC 4LJ9A 1G8HA 1YHNA 1ODFA 3BH7A 2DY1A 3IBGA 1F6BA 2IXGA 3AF1A 3D6TB 2ZYUX 4EFMA 3BWDD 1F2TA 3G5UA 2UZ3A 2ZREA 1GZSA 1KI4A 3VR4A 3ZZUA 5SZJA 2PH1A 5F9HA 4OKSA 3SOPA 1UDXA 2QL6A 1AA9A 4Q9HA 2A30A 4U00A 4DLWA 1EXMA 3KX2A 3C16C 3W5IA 5KNDA 1EGAA 1E79D 2YVUA 1SZPA 1KYIA 2ERXA 2L0XA 1VPLA 3KFXA 3SHWA 1W4AA 1OXUA 3OF5A 3KKMA 5B58C 3AVQA 1OXSC 2GVDC 3SJAA 4NL4H 4NYIQ 4X8OA 1G18A 1DAIA 2F1HA 4HLQB 1E9RA 2NO0A 3KB2A 3JVUA 3OZXA 5KDOA 2YOFA 4JT2A 1KDPA 2X19A 1ZC3A 4TLBA 1G3RA 2XXAA 2QTFA 5LPNA 1ZVQA 1Z5ZA 4WW0A 5G3YA 3CRMA 3OEED 2HF8A 4NMMA 1LF5A 1LTQA 2P67A 3FOZA 1OB2A 2X2EA 5KHOC 3U60B 3TSZA 4NU0A 5L3QB 4XJXA 2BMFA 5J4LA 5K8UA 2ZI4A 4Q4HA 1XMJA 4NDZA 1E2MA 1GUAA 1N5LA 1XRJA 1XZQA 2KI5A 3DPUA 5EXSA 3A1UA 3SFZA 3QOFA 4RCYA 4JLNA 4PPNA 1XX6A 3O8CA 1GL9B 1KGDA 4HAYA 1YRBA 1JEEA 2ZPTX 3IUYA 3VR3A 5LD2B 2PLRA 3EWAA 4LBVA 5TDHA 1DADA 3ICEA 1E9EA 2RGAA 3VNUA 1AN0A 3K9HA 2WPDD 2XGJA 1MO6A 1BO6A 3MMPA 5CIWA 4B32A 1J8YF 4V0LA 4C0QC 2PL3A 3T61A 3HR7A 1CXZA 5CM8B 1R8SA 1T0HB 3T5DA 4EFNA 1U9IA 5F3WB 1R6BX 4TTPA 4OHVA 4TLEA 3E1SA 5DI9A 1US8A 3E70C 3WMEA 3UMSA 5L3VA 1YU9A 4KU4A 5JMTA 4C0KA 1FMJA 2O8EA 1E2GA 2V3CC 2V6IA 3OAAA 4US0R 2OZEA 1DELA 3GJXC 4CEHA 1K8RA 4MGKR 2VBCA 2XAUA 2OEPA 2CJWB 4IRUB 4QGGA 1ZJ6A 4YMSA 1Q44A 3ICQB 2KE5A 1KI7A 4L15A 4PC6A 3LD9A 1Z6GA 2JA1A 1KY3A 3NC1C 1P7CA 4NCHA 4NCIA 4TT3D 3D7MA 4URYR 3UATA 2TMKA 4CEJB 4NYMR 1II9A 2JJ2A 4L4UA 1RC8A 1HQYE 1E94E 2Q6TA 4AC9A 3RS3A 1F3OA 1GAJA 1N6LA 1W0JD 5GJVC 2OLJA 4TMVA 2PX3A 4EJSB 2C8VA 5H8WA 3EIQA 5BYJA 4CGZA 4A0RA 2I4IA 1R0XA 3CR7A 3N2IA 2Q3FA 1FUKA 3B2EA 3KKNA 1JJ7A 4EQ6A 4KFTA 1OXVA 3ADDA 1XTJA 1UBEA 2FFBA 1W36D 4M22A 3I72A 4IEIA 3SEAA 2GA8A 4DLYA 1A2KC 1IN5A 1XB2A 5HR5A 1NVVQ 1K5GA 2GNOA 4IW3B 3LFUA 4OHZA 4D25A 3VNVA 5DI3B 3EPJA 3U61B 4DT1B 3KJEA 3B9PA 2VH5R 2PEZA 3QXCA 2O52A 1NL3A 1NN1A 1M1YE 2FZ4A 4Q9KA 1L2TA 1GFIA 1W44A 4X8HA 3SU8A 1R10A 2WJIA 1VECA 2B7BA 3X1ZA 2QBYA 3LLMA 2H8KA 1U0LA 1IQPA 1KNXA 1ZM9A 4QL3A 1N25A 4MUBA 5DNYB 3RDPA 5FOWA 3TW8B 1GIAA 3UPUA 1D5CA 2WWIA 3E2IA 3LDAA 1XEXA 2AK2A 2DPXA 2ZR0A 1KI8A 3GQBA 1RRCA 4XH9B 1DAFA 1GNPA 2CBZA 1KAGA 4URZR 1C4OA 3LY5A 2OBNA 1GL7A 3EPKA 1JNYA 5DSZA 4Y0AA 5E7IA 4HUTA 4LV5B 3ZVNA 3A37A 1N6PA 1W49A 3KKOA 4TMKA 3FHTA 4HI0E 4A2QA 1QHHB 5JCZA 1QHSA 1CP2A 4DLXA 1M6NA 1UBGA 1VTKA 1IHUA 221PA 3P27A 2CNWD 1YR6A 2P5SA 1N6RA 1WDTA 4Q1AA 1U81A 4ON9A 4L9SA 4OQMA 1JR3E 2QTVB 4II7A 3B60A 4LSGA 2LWIA 2GXSA 2OBMA 2D3WA 3PEVA 2EYUA 4XIGS 3ZVRA 5FPKA 1OFUX 1E79A 1Z0FA 2YYZA 1W7AA 1KZ7B 2G3YA 1AKEA 2NO6A 5GADl 1KAOA 1KSJA 5A5GA 1GITA 2FSFA 1RIFA 3QKSB 4JLKA 3IEVA 4PZZA 4HAZA 4Q18A 5GJCA 2NG1A 3EA0A 4Q9IA 1W1WA 4CZ2A 2OV2A 3LW8A 2DFTA 4Z1MD 2HXYA 2CCGA 2ZR9A 4TMTA 4UJ5A 1S4QA 2VP2A 4B48A 1I4TD 1A1VA 2QQ0A 4UNSA 1G9XA 1S1CA 1A5TA 3LXRA 3NDPA 2B6HA 3OEEA 5HTKA 1T91A 3FFBA 2AFHE 3R20A 1A7JA 1FTNA 2O8DB 1ZCAA 4LI0A 3AGPA 4Q1DA 4B3FX 1GOTA 5FTJA 1Z63A 4JVSB 1TX4B 3EPHA 2HUPA 2ONKA 4LZZA 5KU1A 4TQ9A 3FMPB 4MUAA 2QA5A 1G41A 3NHBA 4IKEA 2BKEA 4HDCA 5FFMA 1ZC4A 2AFIE 4TQUS 2XTNA 4N3NA 2ZYVX 1OYYA 3R8FA 5P21A 4O3MA 5CLLA 3GLHA 2IYXA 4A36A 2DWQA 3EW9A 1W5TA 3FWYA 5FOVA 3VHLB 4QM7A 4PAQA 3TH5A 2J0VA 1W2HA 3RWMB 3P32A 2R2AA 2UVQA 5L3SA 2GEDA 2WPDA 2GBLC 1G8GA 3K0EA 1P4SA 2HEIA 1DBSA 2XZOA 1TUIA 2AHOA 2EWVA 3WMGA 1U0HC 1W48A 2Q0HA 3U7FB 2LKDA 3S1AA 2C9YA 1I4DD 4KBFA 5JJKA 1NBME 3D8BA 4V03A 1TTTA 1FP7A 3QSYA 1XPRA 2WMOB 2J9RA 5EE1A 4JL6A 1R0YA 4PZLA 2NIPA 3O47A 1YZGA 3U2QA 5CDFA 3VAAA 1NN5A 1DAEA 4KLZA 5IF9A 3HDTA 3JVVA 1YZKA 1G3QA 3RAPR 4B3BA 2GAAA 1KK3A 4YC7A 3GMTA 4ZIRB 3IILA 1QHIA 4RFVA 2OILA 2O8FA 4GZLA 5H1YA 3REGA 3TRFA 3K0CA 2DCUA 1YZTA 4QNMA 1AS2A 1G16A 2WV9A 3AVTA 3AF4A 3I4LA 1ZNYA 1SVKA 1E1RD 4MYTA 1E6CA 2OFOA 3DKPA 4TT3A 5KTYA 1XXHE 2RGBA 4Q1FA 2V4ZA 1S1MA 3TNFA 4TWZA 2CHQA 5B57C 4DLSA 1GRQA 2ERYA 4PPQA 1K6MA 4PQYA 4GBMA 3MFYA 5HKKD 2ZJOA 4X8MA 3B1VA 1S96A 4ZO4A 5K8TA 1SKQA 5KPJA 4DSTA 3SE0A 5C18A 3PFIA 1LS6A 3MUFA 4ZDWA 1W0JA 4BQSA 4YQFA 4AI6A 2QMHA 2R8RA 4QBHA 2YWFA 2YWHA 3I1FA 4KODA 4M4SA 4P4SA 1T8TA 3UK6A 3LV8A 1Q1QA 1IBRA 2VP9A 1KI6A 3A8TA 4NYIR 3NBXX 4JVNA 3ZS9A 3PEUA 3D31A 3TE6A 1DS6A 3M4YA 3LQRA 2WIBA 3EZFA 3EWSA 3H2YA 4MH0R 2FG5A 2OCYC 2G1JA 3K70C 4C2TA 3CNLA 2QN6A 4G5GA 3ZVLA 3H1TA 2OLKA 2A5DA 5JFGA 1E3MA 1IXRC 1JBKA 3VR2A 1G8PA 1P5ZB 1DG3A 2A78A 4WIAA 2QAGC 3MGCA 1G7CA 3QUSA 2D62A 1G6OA 2ZSBA 4BUJA 2FDCA 3N70A 4O25A 2WVJA 4NCKA 4TYQA 1J70A 3W6OA 5TMPA 4HZUA 2G9NA 4DLTA 4H9GA 1JPNA 4S35A 4Q9JA 2IYRA 4JIMA 1DTSA 1XTSA 2ZSAA 3TUIC 3C14C 4Z8XA 2IXFA 1ANKA 1JQLB 1U8YA 3A1SA 1ZM2A 1DAGA 4IFBA 4ARZA 4PSVA 4OJQA 2NZ8A 1JB1A 4ZI3A 1E9CA 1ZU4A 4HDQB 2QP9X 2BMEA 3C15C 3GLHE 5IHPA 4NONA 3HYTA 2GF9A 3QENA 1LB1B 4Q7MB 5B2ZA 3THOA 2QMEA 2ZJBA 4FD2A 1DAMA 2ZI3A 2AL7A 3B82A 2W2XA 4IOMA 1QZXA 4US2R 1T6NA 4KCGA 1KJYA 1EFHA 4RKEA 1KDTA 4PSAA 1G21E 3VMFA 5J40A 1XXHB 2W0MA 3NWJA 1COWD 1NY5A 3QXXA 5AUPB 1J90A 3LX5A 2CNWA 2BWJA 1G7RA 2DFLA 2OO7A 2ASEA 2VF7A 1T5LA 3QG5A 4TYPA 2WIAA 1NKSA 4KFRA 2BKUA 2I3BA 2ZAOA 3NBYC 4Q01A 1QG4A 4LPSA 1PLKA 5CDFE 1KI9A 4KLNA 4TLCA 3TKLA 2EFDB 4LJ7A 1W4RA 5BYKA 4ZCMA 2R6FA 3FE2A 1ZD1A 2ANCA 1N6OA 3IPXA 3K9NA 2F55A 2IYLD 4US1R 2VSXA 3AQ4A 3AP1A 4CYMA 5ANRB 2UKDA 4Y0VA 4RD0A 4Z1MA 4OI2A 4RD4A 2XZLA 2QRNA 1Z8FA 3AB3A 2CE2X 1NRJB 4GSYA 2IUUA 1SQ5A 2PZEA 4M8NE 1DVRA 821PA 5FUWA 3QPVA 3L82B 3BOSA 2VSFA 2EFEB 3QXSA 1FTSA 3KXKA 1NLYA 1OH5A 3K9GA 4B76A 1SKYE 1NIPA 4LC1A 3MD0A 4XWKA 4TL7A 1X1RA 4JVMA 4KYUA 2XJ9A 2FF7A 3EC2A 3MWLA 4GPTA 3W5JA 2C99A 1KK2A 2WSSD 1RVDA 5DLQC 1FQKA 5EZ6B 4FXPA 4WXPA 3I32A 3NKVA 3CZPA 5CJ2A 5TARA 1Z07A 2ZE5A 2ORIA 5DISB 4OL0A 3ZD6A 2JDID 5EP1A 1NIJA 4KFSA 2YC4C 4TZ0A 3AKDA 1Z83A 5FI1B 3L43A 1R2QA 2CVHA 3I3SR 2OCAA 1DE0A 3GLHB 4LHZA 3FPAA 3BH0A 5CM9C 1C9KA 3E5HA 2YJTD 4KVGA 4ZCIA 5LB2A 1GL6A 2BIFA 1CR4A 2ODNA 4N1AA 3VFDA 3RS2A 3Q5DA 1CR0A 3EZ7A 2ZVPX 3FKSD 3VKWA 3EZ6A 5FL3A 4RZXA 1AS0A 1H8ED 4MDFA 1MO4A 1ZUIA 2Q9BA 3L2OB 4LHXA 4DZZA 2J0QA 3TR5A 4M1YA 4UXIA 5FBQB 1JR3D 4PHTA 3RLFA 1UEIA 2CJWA 2ZUCA 2FOLA 4D81A 1UJ2A 3ZGXA 2BBOA 2IEZA 2Q9CA 3ECCA 5JSZB 1VCOA 5CIQA 1F60A 2A5FA 4B74A 1E1RA 4FCTA 4IDHA 4M1WA 1T9HA 3PIRA 1DEKA 3HJNA 3RABA 4IOKA 4HLUA 1V5WA 1NJGA 2NOAA 1NN3A 4CEJA 1G64A 4JLPA 5KSZA 3NBZC 1OKKD 1YZQA 3DZ8A 3OHMA 3HPQA 5HKKA 1X8JA 2NTYC 3KKQA 4M9QA 2IUTA 2QNRA 2RGXA 4EJSA 2JLVA 3TUJC 4DCSA 2JAQA 3AH8A 3MSXA 3GJ4A 1U94A 4TL6A 3UMFA 2RCNA 3CF6R 4HEJA 4E09A 3PCRB 4CT4B 1KY2A 4AYTA 3GJ0A 1SXJC 3ONWA 1Z0IA 3GP8A 3R9WA 1SKYB 3TUZC 1YR9A 2R6AA 2DFNA 1C1YA 3BE4A 4RY2A 2VL7A 3GJ3A 3WRXC 4G5RA 4ASUD 2MMGA 2E1RA 4RD1A 3L0OA 2PJRA 3LNCA 5J4HA 4WZBE 1MV5A 5DI3A 2ZYTX 1VYTA 1XDBA 3BH6A 4DT1A 1Q1BA 4JS0A 4QRHA 1FOEB 1JXOA 1DAHA 1Y63A 3L8YA 2HYDA 1B23P 4BZQA 2GWHA 2CLSA 4MKHA 1L4YA 3C7KA 2CK3D 1VG1A 2FGKA 4DCTA 4HAUA 4DRZA 1E2IA 1OIXA 2ZANA 1P2TA 1M34E 2KJQA 1NBMD 1P2SA 4OQNA 2JIZD 3FFAA 4B2PA 3W34A 3P4XA 2JEOA 3NG1A 4F38A 1AGRA 4DCNA 5CK5A 3CM0A 3P26A 1HA3A 1N6NA 1S0UA 2YINC 3VR1A 2OESA 2WWFA 4FCVA 1EFCA 1XU4A 3W8NA 4HZUB 4IXMA 4DBLC 4AKIA 1E69A 1P9NA 4WZAE 1ZM7A 3T1TA 2XITA 5JZVA 1G5TA 2WKRA 3KB1A 2ZVQX 2IHYA 1WB9A 3J81k 1TQDA 1H65A 1LY1A 1KO8A 2PLFA 4MYHA 4AG6A 2GK7A 2GHIA 2JLYA 5TB5A 2ZROA 3KJIA 4BEBA 1QHHA 1E2KA 1G7SA 3VR6A 4IEEA 2BOVA 1YQTA 4BLOA 2ORVA 1MABB 1MH1A 1COWA 4AY2A 1M7GA 2AXPA 1XMVA 1FMLA 4TTQA 3WYFA 1W5SA 3RRYA 1NMZA 2CE7A 3PUZA 2WSMA 4K8OA 4UNQA 5AUNB 2ZRIA 3PEWA 1EWRA 1GP2A 4IDOA 5FR2A 3W9YA 4F4CA 2GILA 3Q7PA 3QE0A 4O2RA 2MSCB 4LJ4A 4D2IA 1PV4A 1XCPA 1N6KA 4LOAA 2PZFA 3U7GA
chains in the Genus database with same CATH superfamily
1KJIA 1JRLA 4LCBA 1YSCA 4LPKA 3GOQA 3GDOA 1TM2A 2ILVA 4ZMSA 2OOKA 1W76A 5SZKB 1GDHA 1JWAB 3A36A 2VZ9A 3RBVA 1X8XA 3NPAA 1JR4A 2H8GA 2PL1A 4FMBB 2Z8YM 3WMXA 5BUZA 1O77A 3G2KA 3ND7A 4K0RA 3FTPA 4PVCA 5AKJA 2JLRA 1JXAA 4S1OA 4EX6A 5CDHA 3FWPA 4ZAWA 3BJRA 1N2JA 2R1TB 1T8PA 4P7BA 3GB9A 4XB6B 3MNFA 4MRNA 4BVKA 4ZU1X 4DQDA 4YRSA 2O3SA 3NHFA 5JPCA 1E32A 3QIAA 4C04A 4DHWA 4LY6A 5C4GB 4EPVA 4HNQA 1L8AA 3CRZA 4IYRA 4Z3DA 4C5BA 1ORDA 4RPGA 3SC6A 1JSRA 2YQ5A 3D6MA 4AUMA 4EG6A 4R9UC 2JAOA 1NJSA 2XUDA 1QFMA 4XTCS 2CF5A 4QOIA 3C2QA 1PQ4A 1GEEA 4YLGA 3VU9B 3F78A 1U8CB 3FLEA 2O5RA 1JTVA 4KXVA 1GNLA 5D3KA 5FNVF 2E4VA 2XMRA 2ZPAA 4AYXA 2DBQA 1I7LA 1M5TA 4QGSA 1QZZA 1FFCA 1SUPA 4DJAA 3W2GA 3VR0A 1RWVA 3OX3A 3L7BA 1N4DA 1VL6A 3GUHA 4WTOA 3CIFA 3N6XA 1RP1A 1YDEA 1BFKA 3G0IA 1Q1GA 2OQ2A 3A4MA 2OPBA 2PYZA 2Y8EA 3ZV6A 3ZVMA 5JQGF 3ER6A 3AJDA 2W98A 2P6NA 3PJEA 5CB4A 3C39A 4LOHA 2HLNA 2IYWA 3F97A 3GARA 3CJQA 1UZMA 3P9NA 1E2PA 1HQDA 1VXOA 5DEOA 4RV9A 2WT9A 3HS3A 4I9HA 5BR8B 3R76A 1JHYA 3EGWA 1YZNA 3IHTA 4Z9XA 3UMVA 2W6JD 2EFGA 4Y9SA 3PUKA 3VAYA 1MJ5A 1X2EA 1CF2O 1RHRA 1PEAA 2UYQA 5IN5A 5PNTA 1E3WA 3RIMA 4CT5A 4E4TA 4XVRA 5FBRB 3BXPA 4GKBA 3T15A 3I30X 3TW4A 1HX7A 2BC9A 4CM1A 4RKQA 4IXTA 4BYMA 5KUTA 3RC3A 3PXCX 4C2AA 3SDBA 1DIAA 3DF7A 1G3IA 3J7AC 2L17A 3HKEB 3UG6A 3P9XA 1QV9A 1UPXA 2WKSA 1HETA 4GWGA 4DIOA 3QKUA 4ENSA 1P2VA 1CE8A 3EN0A 3HJUA 3GHYA 1JSCA 3KKPA 4R71A 5JYEA 1RXIA 1NATA 2OA0A 4LYFA 2Z8ZA 3LI2A 4Z0NA 3W6NA 4PQFA 3AEXA 2AR9A 4Y0NA 5EXTA 4CKWB 4JJ6A 1E9DA 2QRZA 2WB2A 3DF9A 4KR7A 3N76A 4N3BA 5BR4A 1T5BA 4L8WB 3H1AA 2J1LA 2NTNA 1RCUA 3NO4A 4BFVA 3MF4A 1J42A 4BFTA 2BBSA 2CVPA 1YKGA 1FSPA 2Y68A 1N33B 1Q74A 1RWPA 3X43A 3EXAA 3PXEA 2Z58A 5F1PA 2C2HA 4PANA 1TUBA 5JI3E 1TD1A 3BGIA 2B94A 1VCHA 1KF0A 1R12A 4PAWA 4CRWB 4D42A 4HT3B 5AVXA 4QNNA 1RQLA 5KJFA 1KYQA 1E3JA 1RU3A 3Q8XB 5IUNC 4FVTA 3NHUA 4R2LA 2WU4A 4URVR 3ADKA 4B6FA 1MOZA 4ZRMA 4BKPA 4X20B 2AQ8A 2VRNA 3SLRA 3TLGB 5KZMB 3MINA 2E37A 2H4YA 2O2HA 2OM2A 4UW9A 2XADA 1FB5A 1OAOA 1NJ8A 4JODA 4KGZA 4EG7A 1CPYA 4UQPA 3GH1A 3BXOA 1THMA 1DT5A 1R9GA 3K1AB 1Q19A 3ANTA 4DUGD 2OXTA 1KKLA 1QG6A 3LVRE 3RS4A 4M49A 2BHRA 2MSKA 2N1MA 4LXIA 4WAUA 4JH0A 2AC7A 3EGXA 3FAKA 1SIOA 4CTKA 5KQSA 3AM4A 2BFNA 1UXOA 3OKCA 1CZLA 2BFAA 5JBIA 4LI3X 2JH9A 3FVWA 2CK3A 1DCMA 2R6HA 4KQ9A 1PQWA 3KHTA 3UC9A 5HZHA 1L9KA 1RWNA 4UUOA 5YASA 3U7RA 5A7FA 4UREA 1L1FA 1LRLA 1CULC 5D5PA 1UH5A 2HLPA 1JEJA 5HF8A 1GEGA 3IO5A 2IBTA 5HBRA 1G4HA 5K6AA 4Y1FA 2FPRA 3EQ9A 3P2OA 3WZMA 2MWMA 3SS7X 4CV1A 5TV2A 2QORA 3GV0A 4UXJA 1NW4A 2HQOA 1VI6A 2O2SA 2KSQA 2GEVA 1XJ0A 1C9EA 1YUMA 1POXA 2GPNA 2PGDA 4CG0A 3EPLA 1PZNA 2H4ZA 4I81A 4N7MA 4BNXA 2FRVA 1HDXA 3G1UA 4PAOA 4U4AA 2BVNA 1XD2B 3A6GA 2IXDA 2XW6A 3W3AH 3RGWS 3KUDA 2UVPA 3P20A 1BH2A 2FX5A 3OQHA 1UDCA 2M32A 4KITB 1ECLA 5FHQA 1U9CA 1GHTA 2C96A 2GJAA 4JCCA 4BGVA 5FYQA 1V3UA 4JZKA 1S8NA 3VDMA 2FOXA 3WFIA 4E03A 3LL7A 5KYGA 1LDBA 5I9IA 4N49A 3VTFA 5L7TA 3I9JA 3WX0A 1EE2A 3SQWA 2VHQA 4XXHA 1N4AA 4YAOA 4OHWA 3W9BA 4CMBA 3R5TA 3KOWA 1UC4B 4XVHA 4YWHA 1Z0ZA 1MX1A 3K72B 1QBKC 2YNMA 5AI5A 5H80A 2YXBA 4XQGA 4Q3NA 2PE5A 1RT9A 1SU6A 5TT0A 3JQQA 1ZW6A 3LUJA 2PCJA 1HLFA 2BFDA 1A96A 2GN6A 2HF7A 4B4DA 2BGIA 1NMEA 2FSSA 4Y9TA 3T8YA 3O8LA 4UHJA 4D82A 3P2KA 3V3TA 3DCIA 1C7IA 1JVBA 2GWRA 1IOZA 4M9CA 1NI3A 3A6FA 2NQ8A 3OP1A 2FQ1A 1V25A 2V1XA 3H11B 4G2NA 4I1OA 2AKEA 5A3SA 3ZE8A 4ESEA 3PTLA 4KEAA 4EG8A 2RK6A 2BISA 2FP4A 4DFDA 1NXWA 3KJHA 5FOUA 1YJCA 4HXEB 1G5QA 4M0MA 3TZ6A 3GJ8A 4PGAA 3DMPA 4IJKA 4OQXA 1FDIA 1H85A 4Z9FA 5TPWA 3A3KA 2B6NA 4EDHA 4ZJYA 3CU5A 5IKMA 2V7TA 5CD1A 4DV1B 1CDOA 2PVCA 3OMWA 2Q1SA 3ZTWA 1W8DA 3VPCA 4F84A 2XIJA 2HTFA 2XWJI 3AP3A 3G2HA 1QXSA 3MMNA 3N8KA 5JYDA 3VQTA 1Z6AA 4WT7A 3TRJA 1IJEA 4EPYA 1UBJS 5F5LA 1BQ4A 5FWXA 1YA6A 3SHTA 2VN8A 3UK7A 5DBOA 3KYDA 4ILEA 3U3JA 5DTMA 3MWJA 2VNHA 5CTJA 1JXMA 1RZRA 1H2FA 4H27A 1H93A 3COSA 1NW9B 4BO8A 2FB9A 4YRZA 1Z22A 4C21A 1YIOA 1L5WA 1RQGA 3ANXA 4NJEB 1F48A 3T0GA 4YLEA 1BJRE 1VL8A 1QRAA 3VO8A 3M6WA 3CPEA 4BNHA 2XNDA 4XD7D 3D7LA 1T2UA 4JY7A 4B44A 3LSTA 1R37A 3V8QA 1GU7A 4DUYB 1J1ZA 1DO8A 1XK6A 1ICIA 1WBDA 3HDVA 3L1VA 4LJSA 5JLJA 1WMDA 2NSJA 3EY4A 4U6NA 1BKYA 2GM9A 1RSZA 4Q05A 5D3MB 1ADYA 1M7BA 1FSZA 1TTPB 5A4AA 2DJ5A 1RE0A 1YIDA 2H63A 3FCXA 3SJZA 4R3UC 4BN0A 4PR0A 4DCVA 3BILA 1H4TA 2VNAA 3BXGA 3JYPA 2VT3A 2P3LA 3D43A 3FSJX 3S29A 1MP0A 2XNHA 2P27A 2V54A 4BN5A 2PXXA 3ABQB 5LA6A 3WK6A 3THYB 2Z5LA 2HJGA 4HZIA 3RU7A 1TVKA 2P5UA 4HDKA 1W35A 3EXHC 4J07A 4DWWA 5KOIA 2XE7A 1B8VA 4UVEA 4WQMA 4HBZA 3GLKA 2VAPA 3MTAA 4EH1A 3ETNA 4I55F 3TZEA 4FWIB 1K8QA 4CFYA 4D96A 2QRJA 2RD2A 5FOTA 4BNJA 3QWHA 3IJPA 4TLDA 5IFKA 5JSZA 5JATA 3I9LA 1NYLA 3WWZA 1LI5A 1C9DB 1VFNA 5D6OA 2GCPA 2HSJA 1GDDA 2RGCA 1X1TA 1D2MA 4QJIA 4S2EA 4C0AC 4CM9D 3CHYA 2OV3A 1MB4A 2VWQA 1UWLA 1JQJC 5AHRA 8OHMA 1FXUA 1STOA 1SA0A 5CDSA 4ZANA 4H1VA 3H2IA 3L04A 1XMOB 4XLLA 3OSZA 4HN2A 2YUTA 2AOWA 3AWIA 4RZUA 4ZMBA 3BZUA 4J90A 5ITWA 2PFKA 1BA2A 2FSGA 4FB5A 3SIRA 2F7SA 1C8LA 5KSWB 4PGMA 3UNXA 1W25A 2DYKA 1B8OA 2R6JA 4DHEA 3KQLA 2BLLA 2BYTA 2BFMA 3TM4A 2P4SA 5CITA 3QU7A 4JC5A 2IQ5A 3NALA 4BFSA 2OCBA 4DYHA 4Q5IA 1JYFA 1ZUNB 2W4QA 1N7HA 5JH7B 1JDVA 3CO5A 4FMDF 3QKRB 3E5RA 1AQ6A 3LW7A 2WM2A 1YO6A 4KJXA 5DO9A 5KYYB 4RMNA 5AKKA 1N5IA 3B5EA 4R98A 3WNBA 2FCRA 2O14A 4L76A 1RWOA 3IE1A 4P93A 3CPSA 2H4WA 2NZJA 1P60A 4HXFB 1HSZA 5G2OA 1JECA 3NT4A 5DRTA 3AZOA 1C14A 4QIHA 4D0RA 5EOVA 1DWPA 4J1TC 4U6QA 1Q0TA 3D6HA 4R83A 5TRTA 1WL8A 3UJ7A 2AFVA 4G0VA 1USUA 3KTDA 4BU0A 3A6LA 4U7HA 4Y6OA 2B30A 5FX2A 4LDJA 3Q8WA 3FKQA 1OT5A 4WOPA 4CQJA 2MR5A 4UTVA 5HQ3B 1XZPA 1XF1A 3FYCA 4G0PA 1IFXA 5K2MA 1X80A 2X8JB 3A1TA 1O8BA 1AHPA 1NRWA 1EIWA 4ZAGA 4R9VA 4D9HA 1YE8A 3HUTA 4CMIA 1QP7A 4UDXX 4BP8A 2ON6A 4RL6A 1RCTE 1OH7A 3IBCA 1HE3A 1CQJB 3K9WA 1Q95A 4HQRA 5LOVB 5KYWB 1MJHA 2CKDA 3EXEB 3JWHA 2JLXA 4XFDA 4FPXA 1Q1NA 4KQKA 2G7ZA 1HZZC 5AWFC 1JKMA 2EHJA 1FU7A 2O5VA 3HA5A 4WZZA 3W1VA 5B55A 3O1LA 2PH5A 2FXVA 1LJUA 1EXNA 1P9LA 1U0EA 3SC3A 1QCYA 1SVIA 1GPH1 1EK5A 2AXNA 2G9VA 2VPTA 4GOND 2JZNA 2LR0A 1JI3A 1NVTA 1AZTA 1IXSB 1CTQA 4MPPA 3UJ6A 2IS4A 3FD8A 4R81A 1G42A 2HIHA 3CN9A 2G8LA 2WINI 1A7UA 2PRKA 2X2PA 4MUFA 1ATZA 3I52A 3OIYA 2C3OA 3E05A 4BNIA 1QAOA 2XLCA 3WNVA 3WR5A 4ATNA 1O58A 2Q5CA 3CC8A 3IUEA 3AJ9A 4ZHQA 2DKFA 3JQPA 4UVIA 3UXEA 3FPBA 4KQIA 2NPIA 4PCLA 4D7AA 3GEMA 4KAXA 4Z53A 3DOEA 3PTAA 5B3LA 2DGDA 3B6MA 3D3EA 1EX6A 4JHXA 5JD3A 5INTA 1IXZA 3ELYA 3AEUB 2X4DA 2X86A 2YFQA 1Q3TA 1U65A 3GLGE 2GGSA 3PI6A 3IPRA 4Q00A 4BJ5A 4F5YA 1NLFA 4FLFA 2HCJB 2VA8A 3BS4A 3UWDA 4AKEA 3II6X 2BM8A 3Q7EA 4IO0A 5F98A 4W4TA 1NSTA 1IZ9A 2J8ZA 1RQ2A 1JGTA 3HLKA 3I0MA 3W2EA 3LXMA 2ACWA 1T1EA 4EG4A 5HUQA 3PR1A 3ESDA 2C88A 3PQ4A 1SC3A 2GETA 3AEQA 4ZVKA 2R8OA 1TGYA 2TMDA 2GI4A 3ONNA 4GYKA 4KI7A 3L8HA 3ML1A 4U7PB 4YO8A 5J2TF 2ZCVA 3LWBA 5JNWA 2NUAA 4RO0A 3NKFA 1AXEA 3R7FA 1P9WA 3M5CA 2X1LA 2JLQA 4FKMA 3C8UA 2GBPA 4C4PA 4NWIA 3I2FA 4QT0A 4FW9A 1KMHB 4OGFA 2CXXA 1VPEA 4GAEA 3ZHCA 1FLVA 3QH4A 1RYDA 5F21A 4QSHA 1Z6YA 3D4LA 2I67A 2VHYA 1P4JA 1XZDA 4CKCB 2I6FA 5AQEA 1MAWA 2LP4Y 5FTKA 3U0VA 1HL7A 4MA5A 4LY9A 2QRPA 4GXQA 4NABA 1WV0A 4YRLA 4GOKA 4GXNA 4INOA 2OD2A 4A8JB 2PQ0A 3D3QA 4I5DA 4P3OA 5CP8A 3BJMA 1YB4A 4ZYVA 4I3GA 1M1ZA 1T0JB 1TU3A 5EP3A 1V11A 1ZS9A 1ZN2A 1SHJA 4DNPA 3O8RA 1I10A 3WWYA 3E8SA 1U28C 4JC0A 1KDOA 1KO1A 4I9NA 2PUWA 4FGKA 3EMVA 3KQHA 1A5SB 1B74A 2X14A 2PGJA 3PEFA 3OT1A 3E9EA 3VC1A 2XXAB 3LKBA 5LZ5A 1NVVR 4HNAB 1KZ9A 2B92A 3STXA 1TM3E 1IWOA 3MPUA 4KL8S 3M2TA 3SVLA 2AUNA 3W3AA 4UCQA 1XXLA 4DKXA 1NBEA 2VPPA 2CSUA 2WD7A 2Z30A 2C98A 5EP4A 4AYWA 1XJ5A 2CJPA 4HX9A 3QWBA 5F1KA 3IPCA 5M04A 3ACBA 3E5NA 2VYNA 3Q11A 5TEVA 4Z4EA 1CY1A 1SOVA 4HDOB 3T1NA 4II3A 4C0LA 1GGHA 2YFYA 2HPZA 1PI3A 4RSGA 2FQQA 1UJ5A 1KFKB 1Z6TA 1PSWA 3CW8X 3EIHA 1EFUA 1Q5PA 3U7IA 3ZGOA 4D8XA 2O0JA 4ZYYA 1HSOA 3EW7A 5C7IO 1JHVA 1D5WA 2VTDA 3TIGA 121PA 3OTHA 4OGWA 3UHOA 2R3SA 5BPHA 2NT4A 3O8OB 4RA9A 2YJ6A 4R2JA 2QD3A 4FGZA 4BMZA 3RC2A 3BL6A 3LMKA 3BRSA 1IBSA 4EARA 3GLGB 4C6HA 4K05A 3PUWA 3UMGA 2KLHA 1U5BB 2AJLI 1C80A 4HB2A 4QHSA 1REQB 3GGJA 4RVNA 3JQFA 3VKUA 4QJ5A 5LNK1 3QX7A 3A27A 1EDDA 4MULA 2DHCA 5JARA 3P0RA 2AT1A 3QBTA 5EXPA 1BGXT 3OZDA 4Z51A 2AI3A 3DZDA 1CR2A 2O1XA 2Q5IA 2QMOA 4G65A 3ZK9A 1ZJ5A 3QA3E 4LX0A 4RV5A 4CVNA 5HBGA 3WYDA 1HFEL 5E1OA 2Q2VA 2XZPA 2YJ5A 5IW8A 3RT9A 3ABSB 3WICA 2W22A 4P0PB 1N3BA 4EPTA 1QHGA 2EOAA 2H2WA 2YDXA 4ZQBA 5A5VA 3KEFA 4EB0A 1Y8RB 2L42A 1UMCA 5TF0A 1RLIA 1DIRA 2H17A 1D0IA 1X3LA 1UPTA 4FYYA 5E9WA 4DDUA 2AZDA 4UVDA 4YALA 1HPLA 3T4PA 1IN8A 1LA2A 2RJOA 3F46A 3FLMA 1KDRA 4MNTA 4LVOA 4BE4A 5M2QA 3F49S 3X2SA 2JJ1D 4YMVA 2O2EA 3IIMA 3Q87B 5A4FS 3ETJA 1RMYA 2XMDA 4GPIB 1DINA 1A9XB 2PO5A 3QMVA 1AJEA 1RRKA 3GLIE 3RK0A 5KO2A 1P80A 2PSHA 2HK8A 1XNGA 3UAOA 2I78A 1R88A 3ESCA 3PNBA 3WBBA 3M6UA 3GT3A 4KVAA 2I22A 2NXCA 1E9FA 4JLDA 1Q1ZA 4UNRA 2ZUBA 2B5OA 4KPYA 4AK9A 3CZMA 3CZ4A 3NWEA 1NBIA 1Q6YA 3EHDA 2VCHA 3LUDA 4NJMA 2KM1A 1M83A 3RTAA 5JFOA 1TYAE 2VZ8A 2HCRA 2WHRA 3D3KA 4J9VA 4W8GA 2XODA 5AR1A 4C29A 4C4TA 3WK7A 3M4NA 2X0RA 1IEXA 3MJRA 4ZZ0A 1OFHA 2ZIFA 3OKFA 5JJ5A 3F5QA 2YIJA 1PLLA 4HWSA 4DM4A 6REQB 4KXMA 4LRXA 1W85A 1T3TA 3FAZA 4HK4A 5TPZD 3FKJA 2FG6C 5DCWA 4JP2A 2OYCA 2V0GA 5EIFA 1B76A 5EVCA 5HA5A 3FSGD 1N5OX 1ECFA 4PBSA 5H3LA 2RGRA 2QRLA 3O3NB 1G20E 5COBA 5H5JA 4K9DA 3IS3A 5BWMA 3U4MA 1OFIA 1JFFA 2XDYA 4YIKA 1O94A 5EL0A 5JDCC 4UOQA 2M6RA 2WHPB 3DKRA 5DXFA 5IP5A 2XCUA 3Q2OA 4IINA 1E99A 4JU8A 3P97A 4O4LB 4Q66C 1FXWF 1LSSA 3Q1KA 3HU5A 4Z8YA 2Q2OA 3GIDA 1WETA 4DA6A 1F8XA 3KXDA 5EFZA 3GRKA 2CLOB 1FZQA 3DGFC 4URFA 4QBFA 3WLMA 1N34B 4TMZA 4H1TA 3UMJA 4C87A 1L3IA 4PICA 3LS2A 4CMEC 4U3JA 3TG8A 1G8SA 2JGMA 3WGYA 3NEYA 3N8GA 4TKVB 4KLRA 3IPLA 4RNDB 5IEBA 1FNBA 5E2AA 4MPDA 5BN5B 3TK1A 2HK7A 4HH0A 5FNVA 3OQOA 4G5QA 5BNFA 4MKFA 1QLWA 1WF3A 3D7SA 4Z4QA 3HBFA 1M2HA 1G59A 1Y1KE 1EM6A 1DJLA 1E6UA 1XMXA 2I3AA 5AM1A 2D06A 2O1SA 3LGSA 1EH5A 3WIUA 1W6RA 3CINA 3NS7A 3SQDA 3A1FA 2M6LA 2AI2A 3KE8A 4LXGA 3BWCA 1Q17A 4TVKA 1TKAA 1MXHA 3Q72A 3S0JA 5ELMA 3ZEIA 5JQGA 3GLIB 2C00A 4JXZA 3NIFB 1IIRA 1LBEA 5A71A 4F4HA 2WVHA 4G01B 4DKJA 2EFCB 3MJ4A 1YVPA 2Y1GA 1ZI9A 2RHWA 4HFNA 4L95C 1U8UA 4RC9A 5EZYB 4C1BA 2HYIC 1L7EA 2N42A 1ZOSA 1CRQA 1Z29A 4R4JA 4DWJA 2C94A 2GJ4A 3DULA 4X97A 4AECA 4UFPA 4AZ3A 2ZTMA 5JS8A 2YS6A 4I4TF 4YP5A 1QLHA 5B7NA 4URXR 3C3KA 4GOXA 1YF3A 3Q6NA 2J9YB 3FZNA 1UKYA 2DUUA 1Z4JA 3P1JA 3EC7A 3HNRA 4EZIA 2WD9A 4E5MA 4R9NA 4HEHA 5J5AA 2MT9A 3ET4A 3LA8A 2EDCA 2QJFA 3ND9A 4UTXA 1TIPA 4AJ2A 4COKA 4FFOA 1ULSA 3WLRA 1K8ZB 3RSZA 4X00A 1CQIA 2ACEA 4B4WA 1LK5A 2P4HX 5EJIA 1QYCA 1G20B 5CYGA 3JVIA 3VYRB 4BFYA 4EJMA 1P1RA 1PO7A 1RWMA 1T9DA 1BJTA 3A3OA 3RTBA 5EE9A 4FTWA 4RNCA 3OU7A 2GTPA 1SUFA 2FSUA 3CNNA 2O07A 1SB8A 1N2OA 2RH8A 3QOXA 1K0FA 4IDPA 4P1ZA 2C7BA 1J4AA 4ECEA 2V8BA 1NBWB 2O8VA 1AGXA 4FEEA 1AK9A 1BEZA 1ZA2A 1UJMA 3ZIDA 4UJ3A 2P9CA 1G1MA 4JEUA 4Y2PA 1AGNA 2FZWA 2C5HA 4CV2A 1F2VA 2G36A 4GI2A 4C20A 4ND5A 4F6LA 1ISSA 5LWQA 2R8PA 1PGQA 1BVUA 1NP3A 5JAIA 2Z8YA 3MLEA 3HCOA 2QU7A 2C42A 4DADA 4A2WA 2BHSA 2O8CA 2LZ0A 2ZB4A 1QF9A 3RVMA 3S55A 2WVGA 1KJWA 1XCBA 4MLPA 2X8AA 5C2JB 1USKA 1SXJA 3NTXA 5KTMA 1P1CA 3MUNA 4BQPA 3AVXA 5AVQA 2C9DA 3IVCA 2QTRA 4WADA 4ZI7F 3ZIAD 5HKOA 4RLFA 1WCXA 3PXDA 2ZYSA 3UJAA 1HQKA 4EY8A 1XDWA 2VQFB 4FIDA 1P0IA 3LUKA 1TU4A 2OSBA 4NBKA 5KYVA 2UU9B 3FR8A 3OECA 5KKAA 4AP9A 5IMBA 2BCJQ 5NULA 5BSKA 1SC1A 1B14A 3BFKA 1SCAA 2WQ7A 5EJFA 4TKLA 2H52A 2QYSA 3ICCA 1M72A 5DLDA 3ZHTA 1THTA 1TCAA 1WB5A 2DU8A 2PGNA 2MINA 3RYHA 2JZOA 1K7SN 3F3SA 5KNCH 2PFGA 3OZFA 4GL4A 3K1JA 1YE5A 1ZNZA 1HRKA 4OX9Y 3KT0A 4TTTS 1OA1A 3RU3A 3AFMA 2GLXA 4W8OA 3K15A 1BVRA 1MG0A 1QAMA 4OUDB 3T9BA 2I4OA 3D0RA 4DA8A 2YYYA 4ARUA 1QWOA 2A9FA 2DERA 4WA8A 3T95A 3SFVA 1JG2A 1PZXA 3DPSA 3K5PA 4ND3A 2Y1CA 2I34A 2Y1XA 2ZIEA 4S0ZA 2PMBA 3H9QA 4AVYA 1G291 2GO7A 4UHBA 4AWXA 2CCKA 4P3NA 4KWEA 4J2HA 3KR2A 4PLGA 5HMMA 4BAZA 4BECA 1W19A 5GZ3A 3WLJA 2W11A 3Q9LA 4D4LA 1PNOA 3AFIA 4CM5A 4DBVO 2AVDA 2Z43A 3ITEA 4LC9A 3EWIA 3H9GA 2B0CA 4G36A 1WU8A 1K27A 3DOJA 1AXRA 3HXQA 1C3EA 3SOZA 1T3HA 2TECE 1VJRA 1L5FA 3LQ4A 4Y2RA 5E6UA 3MTQA 4PO1A 4M53A 2YX1A 4D9JA 2WVAA 2HL6A 3H99A 1II8B 3Q85A 1JN0A 4PO3X 4X6YA 4HRAA 1Y6FA 4BATA 4RABA 1XLUA 1LPAB 3KBOA 3UWKA 1ZH4A 3CCBA 1EE1A 5IX8A 2A9KA 2CXUA 4GNKA 1A8QA 2VWHA 4QFDA 4V0OA 4F06A 4PG5A 3RTCA 1RLUA 1RZUA 4UUAA 4DWVA 5CNKA 3NVKI 1OXXK 1Z7YA 2Q27A 2R84A 4BKOA 4XQCA 5EJ6A 2YW9A 4FSDA 4V39A 1J9ZA 4JLMA 4HH3C 5CLFA 3IQWA 2R7AA 1YDHA 1N5JA 1E6MA 3AI1A 4HGZA 1PEKE 1Y8AA 5AO9A 5BN4B 5BQPA 1LSOA 1T9GR 4PYIA 4PXAA 1QDUA 4X44A 3TMAA 5B37A 3RBAA 3Q8KA 2GK6A 1O0SA 1LCIA 4BMSA 3TQFA 2JBAA 3LQ1A 3OQIB 4QC2A 5CB6A 2JCSA 3PFKA 2Z6QA 1GYRA 1H2HA 4B8YA 1U2TA 4LHYA 1NVKA 4EY6A 1GNRA 3R3ZA 5C5EA 4DZRA 4ZYZA 2G6BA 4XYGA 3ABOB 4HB4A 5CJJA 1NJ2A 3EOBI 4JNKA 5DCUA 3T7RA 1SO8A 2B82A 1EVZA 3KYIB 3TNDA 3WVNA 5IM4F 5G53C 5K0SA 3ZDYB 2ST1A 4GP9A 5BVGB 1ILEA 4PGHA 3H6GA 1P0MA 1YK1A 3UUGA 3PDIA 4D9BA 1AO0A 3WGGA 5EAIA 1NG1A 3NIGB 2AOXA 1FY2A 2WRZA 3QPBA 1VE9A 2N46A 2A6PA 4ZZ2A 5KAPA 1QANA 2OCGA 4XOIA 4E15A 2RHMA 5CFRA 4QOHA 4EUNA 2YYAA 4JL8A 3EZGA 5T4BA 1I6LA 3TAXA 1KZ6A 2PNFA 1NU6A 4RM2A 3JD4A 1E5VA 2YJ3A 4LISA 3SS8A 4ABYA 5CT6A 2OLEA 4FNOA 3BJZA 1JFRA 1ZD8A 3M1LA 1XI2A 2YHSA 3PNSA 1VE3A 5ADUS 3T9CA 1S2DA 1CFZA 1WOYA 2B20A 2RK4A 2WV7A 3TBHA 2JLSA 4BHTA 1Q7TA 4NSNA 4NV3A 2JI9A 4OK3A 4YBRA 2IYZA 3I8SA 1XF9A 4P33A 5ILGA 3L8GA 4RESA 1R27A 3GFPA 4UHEA 3SZUA 2XNJA 3B6KA 2VJDA 4W82A 1LJ8A 4I55A 3TLBA 3CONA 3S8EA 4EFDA 2QR5A 4LF7B 2JRLA 4MA0A 3RJMA 2VTVA 2JKVA 8AT1A 5A6SB 3E7FA 4ZO6A 4BLSA 1BDBA 4L0DA 2NO5A 3VV3A 3ZLBA 1OXMA 2ZIXB 1URPA 1RBMA 3DFFA 4QVKA 4QYMA 4YACA 5DBGA 1SBCA 1A82A 1L5LA 3GLFA 5CNMA 3RREA 1O97D 3K0AA 4CT0A 3JU3A 4NPHA 2W6QA 5IYZB 2CY0A 3RUIA 5IJ9B 5HQTA 2J41A 3W5UA 3LVQE 1U8EA 2M9MA 2RGDA 3Q5EA 5KIAA 3TGPA 4J1QA 2X0JA 4BGIA 1Y3CE 3AY0A 2FPUA 2IHVA 2C5LA 4XAQA 3ICWA 1VSTA 2E21A 1Y5IA 4ENWA 1T4MA 1XALA 1B1CA 1YRYE 3ITDA 3OCZA 4MXDA 1NLZA 1N57A 3DOHA 4MTLA 5I9BA 4E2WA 4OK6A 2DB3A 4AMYA 4YT4A 4KO8A 1KEEB 1HNZB 4R05A 2O6HA 3KZVA 2W42A 1KXZA 4PS1A 2QI9C 3R0JA 5JI2E 4Z3KA 1GKIA 1RVV1 2Z9DA 4FFMA 4RHTA 1N6IA 4UUNA 1OZHA 4XIYA 4JXXA 4AZTA 4PFSA 5FORA 1THZA 5G1OA 4BE7B 4DJFC 4EHNA 3VNBA 3RYFA 1FX0A 4E5PA 2GJKA 5G4LA 1ZBDA 4B3SB 1CKEA 1E92A 3V6LA 5IPFA 1E0DA 4EGJA 1OZ0A 4IIYA 4YRNA 6NULA 2H07A 2R68A 4GYWA 4OHOA 4COOA 3BMOB 3H04A 2QIOA 2RGGA 1FP6A 4KE8A 1NJ5A 5DTQA 4YV0A 2P1DA 1FTWA 3C5VA 2H1HA 5DHAA 5E4YA 4AJNA 3Q7QA 5IULC 2AZ4A 1N2CE 4FC6A 4H1WA 1LS1A 3IH5A 3NVAA 2LNDA 1SR8A 4Q4HB 3B7GA 2H7XA 4EF5A 3AY3A 3NC0C 3K9CA 3FF1A 2FEXA 1EVEA 4URHA 3IKTA 4QTTB 1NMXA 2Z3ZA 3OE5A 1KZHA 2ORWA 2Q5EA 3B1JA 3EGOA 1NW3A 2XB4A 5JXWA 3P9PA 4HDNA 1OPXA 4J1NA 4C4RA 3DDNA 2NQ2C 5A02A 1OIWA 3I04M 2ZJFA 2SKCA 4AWBA 3QFHA 2G77B 1GKKA 3OE7A 1TQ4A 3LCMA 1E98A 3R09A 1YGYA 2Y66A 5HRUA 4JUBA 5HIMA 4B4KA 1HT2E 1JLMA 4N7JA 4KXNA 4DC9A 5IK2D 5L9AA 3B51X 4DDKA 2NXEA 4GMXA 4LAFA 5TT1A 1KARA 4FGSA 4NE2A 5IXYA 4L3OA 3EXFB 1ENZA 1I94B 4GGOA 1LBTA 5ESDA 1IHOA 4I14A 4YMUA 3GJ6A 2O06A 5DGCA 1LDEA 3GJTA 4M9UA 2P9HA 3LNTA 5EZ5A 1XMSA 1WB4A 3U1VA 3B78A 3N59A 4F2HA 1J99A 3DA8A 1R5BA 1FK8A 1D2CA 2G4VA 1IVSA 3NFYA 5BXYA 4GOMD 3CZQA 3VM6A 3O73A 1XHLA 1WUKS 2E4WA 3CH6A 3GNLA 4LTNA 4N0MA 1PL6A 2PRSA 4K81B 5SICE 4EI9A 1NZFA 3MIZA 4CEHB 4KREA 3R9XA 3H19A 3LC2O 3V1KA 1JHDA 2NZYA 1YV9A 3VH4A 2O2ZA 2ZAMA 4KO3S 4IFEA 4G1CA 1ECJA 2RK3A 3O0DA 4D8TA 1T9GS 1AM4D 5FPTA 3A4IA 4WFJA 2J87A 4FZ3A 4JJIA 3LG2A 3L4EA 1HZJA 3DMHA 4Q24A 3MAAC 4G0ZA 4TSFD 5BV7A 1RD4A 2AW3A 1UC5B 1QCZA 3KIPA 3OCWA 5JAZA 1TLFA 5TIIA 3RW9A 4JJ4A 3KSRA 4DC0A 2DULA 4BNDB 3C85A 3ZN2A 1G4UR 4HEA6 4W6ZA 4PC1A 5J2TA 3ACCA 1L1RA 3N8DA 2XTAA 3C8ZA 2QRMA 3CH5A 3O8QA 4J4TA 2R2GA 1EINA 3TRDA 3WBJA 3PRJA 4TL8A 4J0IA 3X1XA 3COYA 2FZCA 2GD6A 1N2CB 2OORA 3L8ZA 2JGNA 1KPIA 4IZOA 1FX1A 1MB9A 1PD1A 3K9FC 1CJMA 2HKIA 2XR1A 1CQZA 2JGIA 1E1CA 1E1LA 1XOIA 1FDVA 2IEGA 1F4VA 2OVFA 2WT4A 2YZMA 3F3YA 1H4VB 2NU7A 3DWIA 2Y0DA 3F71A 4P4UA 1NTOA 2VHCA 4BFUA 4HUQA 1NQUA 3GD5A 4DL9A 5EESA 1I30A 3RD5A 1FEZA 5B1EA 4MWSA 2GMWA 4DG8A 2C2XA 4E6PA 4EJSC 4AM8A 4K9PA 3GUUA 2IHZA 5G0WA 4CIWA 5LUAA 3WB1A 4LJYA 2VDWA 5TY0A 2JAUA 3QLVC 1ZSYA 4ZP1A 5REQA 2ID8A 3DFMA 3ULKA 4G09A 5FBVB 2QBYB 2ZU6A 1M9NA 1QIHA 3WKEA 2WMYA 1RS0A 1UODA 1L5NA 3WP1B 1IPEA 3ZGLA 3WGMA 4PHHA 1TF2A 4K28A 5A0TA 4XWOA 3HUEA 2FWRA 5EEHA 4LF4B 4P5EA 5GVRA 2FPPB 1NE7A 3KS9A 1MT0A 1Z5GA 2JLAA 4HWTA 4XD2A 3R3WA 4JKIA 5ILQA 1N3YA 3EPPA 2YRWA 4J7XA 1DKLA 2ZUDA 4I1IA 4IH9A 2EW8A 2P0EA 3DNFA 1FFGA 5BOVA 2CLDX 1QX3A 4KQXA 4HLCA 3VX4A 4IJVA 2VSYA 4WY2A 1DPFA 4RHUA 5KMGA 2Y4OA 1DV2A 3FN4A 4WHMA 1N75A 5JAQA 2XB6A 1CVIA 3FPCA 3NV9A 4RIEA 3ZDBA 4HP8A 4CM8A 3EXHA 3OC6A 5B1IA 1JDBC 2GXAA 1UBCA 2WWHA 1HV8A 3K0FA 5GVSA 2H1SA 1JF8A 3RYIB 4UBJA 1SG0A 4U2GA 2KLBA 3VNQA 3PP8A 2Z4RA 1C9NA 2J0EA 4DLPA 1NVXQ 5GM2A 2FMHA 1QRRA 4NV1A 1QIIA 2NM0A 2ID7A 3IODA 1ETHA 4AQ7A 4TSKA 1TUEA 4KI0A 4OTZA 2Z98A 3V4OA 1TL7C 1Q0UA 4J6EA 3T94A 3DFZA 1XEWX 4FFBA 2NWQA 1MIOB 1Z8DA 3N2KA 1FBNA 3KZMA 1JHQA 4JB3A 4BP1A 2C9OA 4HNUA 1KMNA 2OK7A 3BF7A 4M1SA 1GGMA 3U19A 4C4XA 4OI4A 1BE0A 1NVFA 3LGAA 2W6IA 3ET5A 2IGBA 1Z2DA 1EAMA 3I9KA 1E5XA 3NBUA 4MVJM 2Y05A 1JIJA 2UZIR 1WXFA 2XMBA 4C7JA 4E22A 3BK7A 4MWTA 1A9YA 2NZUG 2UZ1A 4LXYA 1WF6A 1BYIA 2QI9F 2ZYDA 1GZ3A 3KVRA 2WFZA 1HDZA 2ZUUA 3N74A 4JFRA 1SUBA 3BM5A 3FB1A 1HE5A 3K0BA 4IVRA 4P2BA 1TFUA 1WG8A 1Y3DE 2WJPA 2V9ZA 4JYCA 5DHFA 2HWWA 4B1FA 4D8VA 2ZRGA 3CIOA 3RFFA 2ZSEA 4IZIA 5LJIA 1RRPA 2HQ1A 4LHSA 3GD7A 2DWPA 3KU4A 4P4TA 3HUUA 5CFLA 3U5ZB 1DOHA 2DPLA 2J0UA 2Q1UA 4DLNA 2A1IA 3ODGA 4L1KA 5HFNA 2I54A 1XKQA 5C53B 4O4HA 5K3BA 2XKBA 4QG3A 4KO2S 1EFKA 2NMVA 4IDQA 5AJWA 4J0GA 3WYNA 1G5RA 1TYEB 4ERNA 1MHTA 3EEFA 3P0IA 4YDSA 3R23A 5ELLA