3W8RA

Mutant structure of thermus thermophilus hb8 uridine-cytidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
207
structure length
207
Chain Sequence
KPFVIGIAGGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDLALYLEHAQALLRGLPVEMPVYDFRAHTRSPRRTPVRPAPVVILEGILVLYPKELRDLMDLKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIVPRGGQNPVALEMLAAKALARLARMGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine kinase
publication title Indispensable residue for uridine binding in the uridine-cytidine kinase family
doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 69
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w8rA00
4B74A 1T3SA 1D9ZA 2PEZA 2R2AA 3C7KA 1EFRA 1A7JA 1US8A 4LCBA 2Q9BA 1RE0A 2Q3HA 1R8SA 2ZYTX 5L3VA 4XD7D 2EYUA 5FBRB 2YWEA 2FPMA 2IYUA 4RD2A 3M6AA 3S1AB 2QT0A 4A1FA 4D0LB 1N5KA 4DEXA 3HPQA 1E99A 3A4NA 3X1YA 2IXGA 3QXJA 3SQWA 2Q21A 4QM7A 1Z28A 2PEYA 2LKCA 4B3FX 4Q21A 4ZKDA 2YWGA 3SJZA 2GHIA 2Z4RA 3PEYA 3IIMA 4I1VA 3A1VA 2CK3D 4B35A 1CF4A 2ZAOA 4PSKA 5AJZA 4OHYA 3RWMB 3TRFA 4JLBA 4ZCIA 2OM2A 5J5CA 3RS7A 1W2GA 3OESA 1OV4A 1J90A 1ZCAA 4PC7A 4ZO4A 4DCSA 1EFHA 1Z07A 2QGNA 5JHGB 5GJBA 4M1SA 2IBMA 4BLQA 1O3YA 5FOTA 1FOEB 1MKYA 3QKRB 3OEHA 2JASA 4CT5A 3MCAA 1O87A 3K0AB 2KSQA 1COWD 1NP6A 2A5GA 4TLAA 3OAAD 4A0HA 4DDVA 4HAYA 2PT7A 3V00A 1M6NA 2OCBA 4PO1A 1GL7A 4MKHA 1ZVQA 4IRUB 5J4YA 3U6KA 4C2UA 1X8JA 4KJZA 3WHKA 3SN6A 3M4YA 3NWJA 4A8JA 4UJ3A 3BC1A 1C1YA 2BMFA 3SU8A 2KBEA 2NMVA 1CEEA 4MITA 1IN6A 4DUGA 4JJKA 1OXTA 3WP1B 3MFYA 4II7A 5FPHA 2BBOA 2FDCA 4UNPA 2CEAA 4W5HA 1WQ1R 2XGJA 5DYIA 1N25A 1IJEA 4K8OA 4FCTA 2NO9A 3AVTA 2RMKA 1PVOA 2CNWD 2QMUA 3FWYA 5CLLA 1UDXA 1LTQA 3C8UA 3IKJA 3OIUA 4W5WA 3O8RA 2GCOA 3RNLA 4Q1DA 3V9PA 2GAOA 3C14C 3CX8A 3SJCA 3TUJC 2CMKA 2ZE5A 5F2EA 2XOKD 2P6RA 2AX4A 4P4SA 2ZROA 4UQOA 3SBEA 3ASZA 1D2EA 1PUIA 1NIJA 4JZKA 2A5FA 2JLXA 2WKRA 4Q1FA 4KU4A 1DELA 4D4KA 5FPKA 4NYIQ 1KI1A 2QEQA 3NHBA 4C7OA 2ZSBA 4IDHA 2VHQA 3HYTA 2H8KA 2ORIA 4PAQA 4FIDA 2VTKA 5CDFA 3U2QA 4TZ0A 2V54A 2AWNA 1I2DA 1IJFA 3TR0A 5FI1B 1P75A 3M1IA 3A37A 3JVUA 1UBEA 5CDFE 5BQ5A 4LHYA 2W2VA 1JPNA 4H9GA 3QUSA 3CKLA 2XTMA 2GZDA 4JL5A 4TLEA 4TTRA 1LS1A 1WMSA 2OCAA 3P27A 4E5UA 4IDPA 1RRGA 1KI6B 1OLOA 2W6IA 3EIEA 4OK5A 5IK2A 2ZR9A 1R5OA 2ZRNA 4BLRA 3EAQA 3CPEA 4BLTA 1AS2A 5GVRA 4D4LA 3B9PA 3KB1A 3X1ZA 2XXAA 1MO5A 1F5NA 3DMDA 2Q9AA 1W5SA 4ZKEA 2BBSA 3TQFA 2GCNA 2JJ8A 3K0CC 2N46A 4PSVA 3RS3A 4NMMA 2BKEA 3PUZA 2X2FA 4I1UA 5G40A 1E2IA 1CIPA 1Q1ZA 2H16A 3UG7A 4GP7A 4PZZA 5FOXA 4Q7JB 4PZYA 1GP2A 3SYKA 4LOAA 2ZI7A 3TK1A 3B9QA 1UKYA 4NKRA 5JJIA 1DAEA 2J59A 5JEEA 5JS8A 2I1VB 2V55B 3B13B 4TMTA 2MSCB 3RDPA 2ZM5A 2ZRFA 3VR2A 1OH7A 4XSHA 4AKGA 1P9WA 4KVAA 4KLNA 3CNNA 1E2MA 3K1JA 4IOLA 3ND8A 1KGDA 4GZMA 2D3WA 3UWKA 2O0KA 1XEXA 4PR0A 2QAGB 5BN3A 1HT2E 4AG6A 4HB3A 2RGEA 2QMHA 5TY0A 2OFWA 2CVFA 1E79D 1S9HA 3LVRE 1G8YA 4LJYA 2AD5A 2QZ4A 2WWYA 1D2MA 1B23P 1TUEA 4EUNA 2AK2A 5IRCD 3K0FA 3AVXA 2DWOA 3QF7A 4RCZA 3DOFA 5KSZA 5AJXA 3E5HA 4KSCA 1EFCA 3B1VA 4EJSA 2LKDA 5HR5A 3NIBA 4RZXA 4XD7A 1KAGA 4OQXA 3ZDQA 1WF3A 2CL0X 4Z51A 2BVNA 3CBQA 4KFSA 5AJWA 1C9KA 2BMJA 2WBLC 3VU9A 2OLJA 4LUCA 2GCOB 3C15C 3FMFA 4FMCB 2OT3B 3LXRA 3BWDD 3EA5A 2R6AA 1VCNA 1ZNYA 2C78A 2F6RA 4YLGA 4A6XA 1FP6A 2DYKA 2LWIA 2Q0HA 2CK3A 3KJHA 3BFVA 1S3GA 4NYJQ 1K8RA 1Z6XA 1SHKA 2R8RA 2QTVB 1OIWA 2NZ8A 4Q03A 4Q18A 4BZPA 5JBQA 1E2GA 5FUWA 3ZH9B 4LY6A 2FZLA 1CKEA 2VP4A 5HPYB 4C7OB 4IEEA 1CJVC 3WP0A 4NL4H 1ELOA 2XZPA 1KI8A 3ZVRA 1VCOA 3PJRA 3OAAA 5FPTA 1OH8A 2OLKA 2QY9A 4IVRA 4LZZA 2IYLD 4MRSA 1KZ7B 1D8TA 5F9FA 1W48A 3P1JA 4YMVA 4D81A 3HPRA 4PAOA 3BH6A 1W0JD 1FQKA 5KDLA 4LJ9A 1G6HA 4JLAA 3C5CA 4C0QC 2BBTA 1VTKA 2HT1A 3B85A 4AY2A 2D7CA 2XXAB 1CR2A 1QZXA 5FOUA 2ERXA 4US2R 4X8OA 2WJHA 5JRZA 5DGXA 2CDNA 4HI0E 2HJVA 4F38A 4LJ5A 4PAMA 4DLRA 3BK7A 5JECA 5JRJA 3NC0C 1DEKA 3UWOA 4KFTA 5FBVB 4B2LA 4F92B 5FH9A 3W34A 2CNWA 1BH2A 4B75A 3THWA 3W9YA 3WRXC 1KO1A 2D4HA 4GSYA 2YWFA 1E69A 2F3TA 2OUKA 3FB4A 1DE0A 3CW2A 2VP9A 4FWIB 3KQNA 2BKUA 2FH5B 4RFSA 3D6TB 1AK2A 3A58B 4Q1AA 5TVKA 2IL1A 3TNFA 3K70B 1JQJC 1L7VC 4IDQA 3PCRB 2H5EA 2XOKA 3QF4A 4LSGA 4A0RA 4TMZA 1R7RA 2V8OA 5CK4A 3AVOA 4X8HA 2AR7A 4HUQB 2PZGA 1Z6AA 2GK7A 3BRWD 3FKQA 3QOFA 3IBYA 1OXUA 2CLDX 2EFGA 2RGDA 1XCPA 5L3RA 1XXHB 3CONA 5FBQB 1KI4A 1CULC 1YR7A 4IOJA 1G3QA 3KJGA 4FMDB 3TW4A 1RJ9A 5JS7A 1ZIPA 2HT6A 1KO7A 3TJZA 3X1XA 2IK8A 1J70A 2WM9B 1HE8B 4IVPA 4TSFD 3FOZA 1XTQA 1M7GA 1J8MF 1KI2A 3K53A 1AQUA 1W4RA 1KI3A 2R6CA 3K0FB 1NIPA 4CZ2A 3LDAA 3O8DA 3W3ZB 4PPGA 2P67A 3MUFA 3TUZC 4DRZA 2CJWA 1W47A 2HV8A 1CS4C 2EW1A 2NOAA 4EJSB 4DCUA 1F2UA 2FEOA 1EGAA 5EP2A 5EE3A 5L3QB 4GOKA 5DHAA 1LS6A 5CIWA 3U4QA 4KXFB 1UBFA 4B34A 2GJSA 4LV5B 3QPWA 1FMJA 2ASEA 4EFLA 2G1JA 1KMHA 1CTQA 2RGXA 4XTRA 1NNEA 1B0UA 2VSXA 2YOGA 4C4PA 1K5DA 3A4MA 3H1TA 4YXWA 1G18A 1IOZA 1NN3A 3EW9A 3D31A 1FMLA 2Y8EA 1AS3A 4UXHA 4DHEA 5DHFA 3OE7D 2P3SA 3WMGA 3LX8A 2DFTA 4WXRA 1JBKA 5GADl 3B1YA 2H92A 5K8IA 3U3KA 3FKSA 4KSBA 3ZVNA 5E7IA 2NPIA 2P5TB 4HAUA 2C96A 4JLOA 1Q57A 4U00A 2J0VA 5LBIA 2ZI6A 4E07A 5KDDA 4NZYA 4BFZA 4UNNA 3T1QA 4XVRA 3BB1A 2VP2A 4TWZA 1UKZA 5KPJA 4TQ9A 3ZS8A 5K8UA 1R10A 2QPAA 2RHMA 3DO6A 4CEJA 2OAP1 2D62A 3KFVA 4KITB 3BD9A 1T3HA 3EARA 2XTZA 3H0KA 4NYMQ 4DLTA 1FQJA 5K8LA 1OB5A 4F4JA 1N5JA 4HATA 3SNHA 1EWQA 3WHLA 1E79A 3TE6A 2JLUA 3THXA 2VEDA 2VP6A 1ZNXA 2YNMA 4D0GA 1P72A 3NBXX 3N5CA 3C41J 1G7CA 1Q21A 3TH5A 4BZQA 2W2TA 3BS4A 1OKKD 4BFUA 2OSBA 1ZP6A 1OF1A 4QGHA 1CJMA 2CHQA 5LDDC 3QQ5A 3WXMA 3PXGA 2C2HA 5BW8A 4DCNA 1G6OA 3ZGXA 3THWB 1X8LA 2NTYC 4TZ6A 1S1MA 1R8QA 2RGAA 4B47A 2EFEB 4YC7A 4G5SA 1ZCBA 2W2XA 1IY2A 1ZM9A 3O47A 1PLJA 1UFQA 2K5UA 4RFSB 1Q22A 1R0ZA 4XTCS 4BQSA 1ZNWA 4G5RA 4B3BA 2J41A 5GJWC 2QRZA 2A5DA 1CJUC 3I4LA 4CIDA 4HYYA 1KSFX 3QF4B 4DZZA 4MKIA 4Z8XA 4IOKA 2J0QA 4MKFA 1E0JA 2ECKA 2LCFA 2O8FA 1DAGA 2QSZA 4E03A 2I1QA 3W8NA 1Z6YA 2QM8A 4ZIRA 1VYVA 1SXJC 1HQCA 1RJ9B 2VP5A 1OT3A 1VG8A 1BS1A 4WZAE 4L5BA 1FNNA 5DO9A 4UJ5A 3OEED 3FTQA 1KO4A 1MT0A 3T06B 5BYJA 4ZDKA 5KNBA 1TU3A 2XNSA 1R4AA 2YC4C 4L9WA 1Z63A 3RRZA 3LFUA 3CO5A 5DI9A 2W0SA 3HU2A 2ZUBA 3ZYCA 2IF0A 1QHHA 2RB4A 4BFTA 4LC1A 4E09A 2B6HA 4CF7A 5IHPA 1AJEA 1W0JA 4IDNA 5SZIA 3KKMA 1LFDB 5DISB 2WJJA 1AZSC 5FFMA 2BEJA 2YHSA 1HH4A 5KOYA 1XPUA 3AVYA 2ZRPA 2PH1A 2BMEA 2D2FA 2OXRA 1ZD9A 1GWNA 3R7WA 1KMHB 5FBWB 1ZM2A 1XX6A 2OE2A 3EWAA 3I5YA 1Q1QA 3N70A 3GCGA 3RC3A 5H70A 4CEHA 2WSSD 1W4AA 2R6FA 1QHNA 3FHOA 2FEMA 4PZLA 2J1LA 4U02A 3TKLA 4NHOA 4DCTA 1NL3A 2Z43A 4JT4A 3S1AA 1YR9A 3ZD7A 3PG5A 2YYZA 4G5QA 3U60B 2XSZD 3G0HA 1TEXA 2AXNA 1AM4D 5BYKA 3CR8A 1X1RA 2FA9A 3QKUA 5C18A 4HAXA 2REOA 2HCJB 2IX3A 1E2QA 1S9DA 1OXXK 5H1YA 3MWJA 1E2JA 4LK2A 1LB1B 4Q47A 1VG9B 2G3YA 4B3CA 1P2SA 2XZLA 1DADA 1DO2A 3OFND 4ZI2A 3KUCA 3RAPR 4EPWA 4CEJB 2QPOA 2WWGA 1EX6A 4CGZA 1GRNA 4H1UA 821PA 2FE4A 1A4RA 1E2KA 3ETLA 2EWWA 1U8YA 4TQUS 5EE5B 2IUSA 2JATA 4TSFA 4RKEA 1HY3A 3L0OA 2PZEA 1T3LA 3K0AA 3ZZTA 4DLWA 1P2UA 3THXB 2CE7A 2XJ4A 4LI0A 3E2IA 4NCKA 4QHTA 4H1VA 3I92A 5LD2C 3SJBA 5EXTA 5E4FA 1QHIA 4KV9A 2GKSA 2FFHA 3SS8A 5KNCA 1UBCA 1GRQA 3NDBB 2W6ID 3P4XA 5IK2D 1FNMA 1T9HA 2W00A 1LVGA 5CK5A 4KBGA 1KK0A 3DKVA 2QPTA 3VAAA 5KDOA 3R8FA 2ZRMA 3AP1A 2YWHA 1DTSA 2F43A 1ZBDA 3B82A 3PV0A 3DMNA 3M0EA 3J81k 4DWJA 4HLUA 5TV2A 2ZS8A 2IW3A 4QGGA 3AM1A 1YHNA 2QE7A 1CRPA 1W0KD 1Z0DA 1SKYE 5H8WA 4GOJA 4MUBA 1HQYE 2IF2A 2ZE7A 2AFHE 4YMSA 2O8FB 4LJ7A 4D82A 4M1YA 3ONWA 5FUVA 5JWRA 4ZIRB 1Z6GA 3AVPA 1NLZA 3OE7A 4MDFA 1VIAA 2FSIA 3BORA 1E9BA 3I3SR 4UXIA 2JLRA 5KHOC 3V4RA 3SJAA 1N0VC 1XB2A 4A0GA 1CR1A 4QBGB 5G3YA 2J9RA 1DVRA 4JYCA 3K70D 5AUNB 2OBMA 4ZPXA 4A8JC 2P2LA 4QL3A 3H86A 1T91A 1CBUA 4LJ8A 2KBFA 5EP4A 2ATVA 1E2EA 4DSUA 1XTJA 3MD0A 2O8DA 2ZTSA 1P61B 2W0MA 3T1OA 2FGJA 4IHQA 2C95A 1QHHB 1G17A 1U9IC 2WOOA 4EFNA 1E3MA 2WV9A 3R8CA 5TARA 1OYWA 3CPJB 2BJVA 2FX3A 1HA3A 1LF0A 4QJ5A 3B1ZA 3PQCA 1OFTA 2HLDD 4LYAA 5KTYA 2IYQA 1LY1A 2O0HA 4FCWA 2NO1A 2WSMA 2QMEA 3BGWA 3C16C 4Q4JA 5LB2A 2JAQA 3R7WB 2BEKA 1IY0A 1YR6A 1OKKA 2UZ3A 3SFVA 4CEHB 1E0AA 3L8YA 4EQ6A 3Q7PA 1E1QA 2B92A 1KI6A 2H57A 4IKEA 2HXSA 3ECCA 3KZ1E 5SZJA 1XTSA 3LY5A 2A78A 3EC1A 3NVAA 1ZRHA 1E6CA 3LRPA 1HV8A 1KK2A 3DPUA 3W3AA 1FTNA 2NO6A 4IFEA 2GZHA 1ZMXA 3EASA 1FX0A 2Z5FA 4LX0A 1JAIA 1Z06A 3AVUA 1Z22A 2VSOA 1JEEA 4NCNA 1T5LA 1KTVA 2AKAB 3EZ9A 1J8YF 521PA 2OILA 3PR1A 4GMDA 5B30A 3BJIC 4V0NA 2WKPA 2ZQ5A 2HF9A 2PLRA 3NH9A 4JBWA 5JCZA 1T0HB 1WA5A 3UATA 3Q5DA 4NONA 3KKPA 5EP3A 4BECA 2A5YB 4QRHA 5J47A 2FU5C 3EZ7A 3MWLA 5FL3A 4B48A 1KDPA 4FD2A 3RYTC 1XPOA 2CLCX 1GSIA 5EXPA 2BC9A 1EK0A 1FL9A 5AK0A 3U7FB 1AGPA 1N6HA 5DI3B 3OEEA 5SZHB 3VKGA 4C0LA 4MGYR 1OYYA 2IYXA 4LGMA 1Z0JA 1E4YA 3CRQA 1DAIA 4P0TA 3VR6A 4EPXA 1MO6A 1R0WA 4WOPA 4O2RA 2F1RA 1SVWA 3RRNA 2ONKA 2QAGA 4D26A 4NTZA 1JEDA 4PPQA 5KPDA 721PA 2GJ9A 3OIYA 4LHWA 4HDOB 4KODA 4OI4A 1DO0A 5KU1A 4XWAA 2QAJA 2DFKB 2F43B 2PX0A 3BB3A 5IF9A 1SKYB 1Q20A 2GBLA 3LX5A 5SZKB 5FTKA 3VKHA 4V0MA 3AKDA 1KJYA 1NLYA 2WOJA 5G3ZA 2GVZC 4HLCA 5FBLB 4PHFA 3QXCA 1RFLA 3L8ZA 4RD6A 1NY5A 5AJYA 1FZQA 1NN5A 2WSSA 4DLZA 1G291 4L9SA 4B76A 1II0A 2ODWA 2VRWA 2ZAMA 1Y3AA 3THYB 5DE3A 4GPTA 1CJKC 4M21A 2PX3A 2ZRHA 4CYMA 1QHXA 2XSZA 4Q5IA 3U3MA 1GILA 4BLSA 1VG1A 4MYUA 1Z2CA 5FOVA 2BCGY 1H65A 1XMSA 3Q72A 3SI7A 4BLPA 2WIBA 3VR1A 5DH9A 2ZJAA 2NQ2C 4M2LA 2RGNC 5HE9A 3OFNA 2O8DB 1TQ2A 4R98A 3X2SA 2PLFA 2FOLA 3NKVA 4EPTA 2D7DA 3T15A 4PC3A 3ADDA 2XX3A 4EJSC 3W5IA 4OBEA 1ZM7A 2C9OA 4F91B 1WE2A 2WJYA 3ZD6A 3I61A 1JR3D 1ZM3A 4IJMA 4IFBA 1G9XA 2ZEJA 5FI0B 4G01B 4LBZA 2B8TA 1M7HA 3TSOA 1HURA 1OFIA 3LNCA 4Q4JB 2QTHA 1IBRA 3KKQA 5FUXA 1BOFA 4A2WA 1PV4A 5DSZA 4EQ6B 1KJZA 2HJGA 3AP2A 3PIRA 4HDCA 1QG2A 2WMNB 1Q1EA 4NCHA 1W36D 1YZTA 3CM0A 5L8VA 1IXZA 5C4GB 2GCPA 4C0SA 4JLJA 1E2DA 3AKYA 1PZNA 2IXEA 2QNRA 3SQXA 3IILA 1EFTA 2J7KA 1QDEA 4M1TA 1FX0B 3QEOA 4QKQA 4DIDA 4QBHA 2CLSA 5C2JB 1WB9A 1N0UA 4JSYA 4NCIA 1OHHD 3W6OA 1AS0A 4KBFA 2NPFA 4DBLC 2OCYC 1OSNA 2H17A 1W0KA 3K09A 1FP7A 3I73A 1R0YA 3LW8A 4IW3B 2G88A 1TMKA 1VPLA 3FMPB 5FUYA 4YXWD 2O8EA 3ASYA 4AURA 3FMIA 4QGAA 1XD2B 1E96A 1G3MA 1F6BA 2O0JA 2NO7A 1MOZA 3AVQA 5H68A 4DKXA 3AF0A 2QT1A 2ZVQX 4URVR 2QBYA 2IYVA 5IDVA 3FKSD 1IAQA 1W2HA 3PUWA 2EFDB 1PUJA 4HLQB 1LV7A 2PBRA 2A3RA 3CNLA 3KTAA 4DXAA 3VR5A 1X3SA 5FR2A 1GDDA 5HCIA 1GITA 4HUQA 2J5XA 3MWKA 4FW9A 4TYPA 4EDHA 1XXHA 4DSOA 1GL9B 3UG6A 3UMRA 5B2ZA 4Q4HA 3HWSA 1XXHE 1ZU4A 2EFHB 3KDSE 4ASUD 3EPJA 1GNRA 4OHXA 3VKWA 3DZ8A 2HLDA 4V03A 1JALA 3CB4A 1E9SA 3T1TA 1QHSA 2J7PD 4ZDIA 2ODNA 2G9NA 3GLGA 1YKSA 2J45A 2CE2X 1TNDA 2O8CA 3PVSA 3NBZC 4LHXA 5EUQB 2AK3A 3QNUA 3NG1A 4HAVA 3P32A 2Q6TA 3QIAA 3GLGE 4ABYA 3FPAA 3AV0B 1VCIA 3H2YA 4TT3D 1IQPA 2R6GA 4TLBA 5L3QA 1HE1C 2FFBA 1X86B 1IXRC 621PA 5E7JA 5FTLA 4B32A 4BRUA 4WAUA 2ZI9A 4EPRA 4ZV4A 4X8LA 4ON9A 421PA 1DAKA 5EUMA 1KK1A 2Z83A 1L8QA 3LBHA 1F48A 2RGGA 1J99A 1EX7A 4B73A 3GFOA 2ZRJA 3H84A 4G3XA 1H8ED 3AH8A 1TAGA 3GJ8A 3U3OA 2VO1A 3MMPA 3JVVA 2DY1A 3TVTA 3KKOA 2RGCA 2YJTD 3AUXA 4YMWA 1LNZA 3AGPA 3C4JA 3RSOA 3UIEA 3T5DA 4D80A 1TQDA 4BFSA 3IO5A 2IEZA 3HJNA 1NVVQ 4US0R 5LB4A 4MDEA 4BLOA 3K0EA 1NN1A 1U8ZA 2A9KA 1E2NA 1E98A 1U0LA 1VKJA 2VBCA 2O5VA 1P9RA 2KB0A 4OJKA 3P4YA 4BGDA 2JLYA 2YC2C 4AI6A 2OEPA 3CWZA 4RD3A 2ZS7A 5BXQC 2E1RA 4TL9A 5TMPA 2I3BA 1XD8A 4OL0A 3B6EA 5LPNA 2I4IA 4MH0R 2YV5A 3QEJA 4LJ4A 4OI2A 4AKEA 1E9RA 2RGBA 2V4ZA 1YR8A 5KYKA 4BWYA 4MYCA 3I8SA 4PC1A 4NYIR 2V1UA 4C0BA 1G8HA 3CRMA 2C03A 3RS5A 5CJ2A 1CLUA 1XMIA 1FPMA 1JR6A 3B5JA 4BEBA 3IQXA 4LBWA 2A5JA 3KQHA 1T8TA 1TF7A 4JLVA 3T34A 2N42A 4D4MA 3RABA 3U61B 3GJ7A 1ZNZA 5HE8A 4UNSA 2O8EB 4ZDWA 5EZ5A 1AKYA 4F7WA 1Z3IX 1N6IA 2JA1A 4Q66C 3VNUA 3W6PA 3UKDA 4RD0A 1KZGB 1I4DD 2W6JD 2QBYB 2FV8A 4TMXA 2VL7A 4V0OA 4Q9KA 1RPZA 3RLFA 3K8YA 3ZZ0A 1G3UA 1KI9A 3A1UA 1Q1BA 3KTAB 4P32A 2IUTA 5FR1A 1E1RD 1HEIA 3PITA 1OPXA 4PFSA 1G4AE 1G21E 1WCV1 2BCJQ 1YZNA 2HUPA 2ZPTX 4HDQB 4I4LA 3QBTA 1NBMD 4N1AA 5BWMA 3WBJA 1KDRA 3UPUA 2XEXA 1FUKA 2VSFA 1PJRA 3U7HB 3EC2A 2KWIA 4TYQA 1QHGA 1S3SA 2J0UA 4Q4HB 4ACAA 4HAWA 4PC2A 2G6BA 3NEJA 3QSYA 1JR3A 1I2MA 1Q3HA 2MMCA 4DB4A 4G5GA 3GLGB 1N6NA 2Z4SA 2O8CB 1XZQA 3IDQA 2ZUCA 1M1YE 3EZFA 4JJZA 1NLFA 2IS1A 1JR3E 3AEZA 1ETUA 1KAOA 3U3RA 8OHMA 4OK3A 1KSGA 1BMFD 2OCPA 1D6JA 3KQKA 1P4SA 1S8FA 4C30A 2ZSAA 1IY1A 3MG9A 1T5IA 2GF9A 2BM1A 5FTNA 4BUJA 4FXPA 4GDFA 1ZUHA 5ANRB 4BRWA 4IXNA 3RVBA 3UXMA 1OHHA 3RS4A 4HB2A 2GRJA 2OBNA 2QE7D 1ZD8A 2JCSA 2X2EA 2ZS9A 3IBGA 5G53C 4M1MA 1R0XA 2RHDA 1II8B 4YDHB 2DHRA 1F60A 3LO5A 3KB2A 2F3RA 4XOIA 4JBXA 4QG7A 3DKPA 3IEUA 4OKSA 2Q3FA 5AUOB 4JT2A 1SVIA 1W7AA 1TPZA 1S0UA 1KHTA 4QHSA 1TADA 4TYWA 3Q8XB 3HR8A 4LRWA 1NG1A 3WY9A 2GK6A 5FTMA 2FPLA 2ZXUA 2MMGA 4NYJR 1XU4A 4WW0A 2XB4A 4BE7B 5BN4A 2A30A 4JKYA 2GXSA 4C3ZA 1CRQA 1YQTA 1P9NA 4R2IA 3CX7A 3IHWA 1D5CA 1F2TA 3U7EB 4ASUA 5J4HA 121PA 3TMKA 1MH1A 5DIFA 2J7PA 2JLQA 3NBFA 4RD4A 3ZIAA 2F7SA 4UNQA 4XVUA 3I72A 4Q9JA 5IT5A 4B43A 2OXCA 4ZCMA 1YZKA 2ODBA 2J87A 4YMUA 1MRNA 1TU4A 5DN6D 5F9HA 1E1QD 4TT3A 2CXXA 2HYDA 4A36A 2GJ8A 4F4CA 5L3SA 2PJRA 3EZ2A 3U6BA 4DDUA 4MYTA 3L0SA 5EE9A 1GNQA 2QN6A 3FE2A 2QQEA 3GEEA 1YRBA 2B21A 1DS6A 1G64A 2E9SA 1OIXA 2G77B 3NEYA 3QXHA 1J7KA 4YQFA 3KFXA 1HYQA 1TL7C 3EIQA 4WIAA 4IEIA 3CZPA 4JSTA 4M53A 2ZVPX 1KKMA 1H8EA 1UEIA 3EZ6A 4YDSA 3B78A 1EG7A 2VH5R 3VHXA 2WJVA 3GJ6A 1A2KC 1VYTA 3TQCA 5J40A 3GJ0A 3I8XA 4LWZA 4ESHA 2GVDC 3SYLA 4B6EA 2J0UB 4D6PA 4DVGA 3OIWA 1E2FA 2PJZA 2UZIR 3D3QA 1UPTA 4JLPA 2IT1A 4O25A 4TLCA 3WMFA 2JLZA 1WBBA 5K8TA 5CM9C 1GTVA 4RCYA 4OHWA 4XIGS 4M1OA 4HLDA 4KAXA 3RRYA 2PT5A 3KJEA 1WXQA 3LBIA 2DFLA 1NKSA 3QENA 4Z1MD 2QP3A 1ZUIA 4B44A 4HLUC 2FFQA 2R44A 4ARZA 1M7BA 1RYHA 3AF1A 5JFGA 2AKYA 2PCJA 3LQRA 4LJAA 1W36B 4RZUA 2OBLA 1IN8A 1U81A 4HB4A 4L4UA 2QMOA 1ZIOA 3A1SA 1KO5A 4MRVA 4W9MC 4BPBA 1XWIA 1YU9A 4IXMA 2C9YA 3IGFA 2YVUA 3BERA 4Q9HA 4DEYA 1TF5A 2GF0A 2D06A 3AF3A 5DNYB 4HZUB 1UBGA 3KXIA 1G41A 3CF6R 4K81B 2OV2A 1LW7A 2L0XA 3W5JA 2C5LA 2QQ0A 4EAQA 4QJ4A 2X19A 3DOEA 1OH6A 2H7VA 2UVQA 1CR4A 2W6JA 1GKYA 2G0NA 1GUAA 1KSJA 1SGWA 1Z08A 5E95A 3TBKA 1G3IA 1XNJA 1YZLA 1ZW6A 5JZVA 4GZLA 1GFIA 1AGRA 4PHTA 4MRNA 4US1R 2QORA 4LPSA 2NIPA 1MABB 5CITA 1P73A 3GLIA 4WA7A 1UADA 4DDTA 4M9QA 1MO4A 1E1RA 1RKBA 2C99A 3HYRA 2QUZA 3OF5A 1NBMA 5FTJA 2VHJA 4I99A 5GJCA 3PUXA 4AK9A 2FWRA 1GZSA 2MSDB 3KL4A 4HZIA 2JLWA 1W4BA 1XEWY 1T0JB 4ZCLA 3CH5A 1F2TB 3TW8B 5DI3A 2ZYWX 3CH4B 1N3BA 2VHUA 4FI3C 4JIMA 4DDWA 2B8WA 3D7MA 2FMXA 3QG1A 4JLMA 1BKDR 2DFNA 3LQQA 5B58C 2ZANA 5A5GA 3LXXA 1IM2A 2HF8A 4EFMA 2PMDA 3MWYW 1Q12A 2JJ2D 3K9LA 1XDBA 1J2JA 1MV5A 2GAAA 4ZI3A 1M74A 3GFPA 1JI0A 4NPHA 3CUEF 5HZKA 1BMFA 4A82A 1L4YA 3QXSA 3V4FA 4IOMA 5TXGA 1EFUA 4CEIA 5L3SB 4IVQA 3TR5A 3CRVA 3Q7QA 4NYMR 4Q1EA 4R9UC 2J0SA 2VF8A 4MRRA 1G7SA 4HAZA 3SR0A 1HTWA 4M1WA 3T1VA 2OESA 3GLHA 2GNOA 2ZR7A 5JCPA 5EP1A 2CCKA 4U7DA 2F1HA 1PLLA 1SVLA 2ZRKA 1DAHA 2IHYA 3O8CA 1UEJA 4LPKA 2QL6A 4LBYA 3THYA 2ATXA 1RZ3A 2WWXA 4WVFA 1RC8A 2QENA 3A6PC 5CLQA 4B3DA 2BDTA 1G19A 5EJEA 2VP0A 1IXSB 1Z47A 2FN4A 4FINA 1QG4A 2VQSA 1N6LA 2ZSEA 4RZ3A 2QAGC 2ZJBA 4C9BA 3ZQ6A 4B3GA 1N6PA 3O8BA 3BFKA 3B1WA 1MR3F 4CW7A 3K9HA 3K0SA 3ADCA 4KFUA 1W44A 4PPFA 1KY3A 1II9A 1XTIA 4ARZB 1JECA 2C77A 3UK6A 3I62A 2FJUA 4AYTA 4URYR 3EPKA 4M1KA 3VR4A 1ZYUA 3ZS9A 3KJIA 1T4GA 1M2OB 2EQBA 2QP9X 4OQLA 3GLFA 4LV6A 2QG6A 1Z83A 4M9ZA 2ZETA 1H8HA 1S2MA 5HZHA 1NVWQ 2REXB 5KO2A 2CCJA 4KVGA 4M8NE 1KK3A 4AKIA 2DPXA 2EYQA 5F3WB 1G4UR 3BBPA 1P3JA 5DN6A 4RFVA 4GRAA 5CJPA 3N2IA 3DEFA 5F98A 4P4UA 4FCVA 3ICQB 4KO8A 5HCNA 2D74A 3ICEA 3R9WA 2ZJ5A 1V43A 4URUR 4M4SA 1N2CE 4MA4A 4ERNA 3FVQA 1WRBA 5J4LA 2Z0MA 4DSTA 4S2EA 1XMVA 3EX7C 2YOHA 2B7BA 3FGNA 3VMFA 5CYPA 2PZFA 2ZRGA 5KSPA 4GMXA 3LW7A 2P6NA 3RC8A 4TYYA 2HYIC 5CB6A 3GLIB 3AKCA 2GWHA 4E22A 2F9LA 2ZYVX 3FFBA 1RRCA 1NSFA 3TVDA 1IONA 1YJ5A 2YZ2A 1XD2A 2Z6VA 3AVWA 1DAMA 2Q9CA 4TTQA 5JMTA 4Z54A 3EPLA 1GM5A 3SHFA 4QBIA 3RANA 3KUDA 5ELXA 1NJFA 1ZC4A 1E0SA 4DSNA 4MKGA 4FMCF 1GOTA 1WDTA 1ZINA 3FDIA 2IXFA 5G41A 1C4OA 2ZU6A 3NTUA 3SDZA 1QHYA 3L43A 1U8AA 3QJYA 4NBSA 4DLSA 3DDCA 2C8VA 3I32A 4Z1MA 3SHWA 3GMTA 2BBWA 4OQMA 1JXMA 1SVMA 4Q9IA 4EKDA 1IHUA 2FNAA 2X8AA 3HU3A 3PEUA 4CEIB 1AN0A 3K09C 2V6IA 4B3XA 3SZRA 2FSFA 4UXJA 4V02A 2XZOA 3AQ4A 1KO8A 4WZ6A 3BH0A 4JVSB 4A15A 4OHVA 1E9DA 2GA8A 1S4QA 2C9CA 3A4LA 3LA6A 1M34E 3GLHB 2P6UA 2WHXA 3GJXC 3SEAA 2WIAA 3AB3A 4F4IA 1SXJB 3RS0A 3K70C 2BMDA 4C2TA 2NZJA 5EXSA 2IWHA 1X8KA 3NHAA 1G3RA 4V0ME 3WYGA 1XF9A 3SC3A 2IA5A 3ZVMA 3ADKA 1CR0A 4PC6A 4Q7LA 4MQBA 4QXAA 4QOSA 2V7QD 1CXZA 5FPSA 5P21A 3RS2A 5AUPB 5JHHB 1KMQA 1CJTC 1RVDA 3A1WA 4LYHA 4B33A 1E2PA 2WJIA 1KY2A 1SVSA 2BJWA 4N0DA 1Q44A 4CVNA 2WVJA 2ZIAA 5JSZB 4GL2A 3IQWA 3GQBA 1U9IA 1U98A 4YONB 2WZQA 2WAXA 4Q1BA 1OJLA 4GOXA 1TEVA 5GVSA 5J4KA 1P60A 2WWFA 4POAA 4NE2A 1DG1G 2ERYA 1A82A 1U0JA 3BIFA 2NO0A 2DWPA 3RRMA 2F1JA 3IIJA 4Q4AA 2J46A 1QVRA 1FUUA 1IN4A 2FGKA 2SHKA 4C0AC 4JS0A 2JEOA 4Q02A 5M04A 1GKIA 2YOFA 4G1UC 2WPDD 2YKGA 3PUVA 3GLFB 1E0KA 3QKSB 2G83A 1E9EA 2IUUA 1BIFA 1QVAA 3IUYA 3U44A 1KI7A 1G5TA 1YRAA 1SKQA 2JJ2A 5KSYA 5B57C 2VIIA 1P7CA 1XD9A 4BFXA 1E9AA 4LBVA 2WWWA 1XJ0A 3TAHA 2IS6A 4MYHA 1Z0IA 4Q7KA 4JLKA 2WMOB 2ZJ8A 1BO6A 4FMDF 5TDHA 2JDID 2JGNA 2GETA 2QROA 2ZREA 3REGA 3OZXA 4UKDA 4DT1A 1E2LA 2R6DA 5FPYA 1G8FA 3RWOA 1SVKA 3U3JA 2REBA 1SQ5A 3CNOA 1JJ7A 4ITRC 1OE0A 4C0HA 3NXSA 3ZJYA 1W4CA 1D9XA 1US8B 3F5FA 2GEUA 3BAFA 2GEVA 2AWOA 2ONJA 4MGZR 1E9FA 1KOFA 4AG5A 4NH0A 4WBSA 2QA5A 4PQFA 2F55A 5KUTA 1E4VA 4TMVA 4QGFA 1G16A 3SFZA 2AN9A 2RKOA 3TLXA 5LD2B 4RY2A 3SBDA 3D8BA 1BYUA 2BM0A 4OI0A 1DARA 3F8TA 1XCMA 4URZR 3WMEA 4LYJA 1GKUB 2OO7A 4LYFA 4OQFA 4WXPA 2FG5A 3JZMA 4LC0A 2VPPA 5TB5A 3TAUA 2AFIE 1VYUA 3WYFA 3QE0A 3QY0A 1F3OA 3T61A 1Z29A 2KE5A 4I1OA 4Q19A 4B71A 5C4MA 1V5WA 2QI9C 2RAPA 4JL6A 4NDZA 4P33A 1KDTA 2ZRAA 2AL7A 4R2HA 1Z0KA 4GBMA 4TN1A 2QSYA 1QF9A 2WWHA 4PX9A 3EWSA 3L82B 2F9MA 4JVNA 4HB0A 1P2TA 4Q48A 2C98A 2O52A 3DL0A 1E9CA 1OH5A 1ZM4A 1SZPA 1NVUQ 3SOPA 2N1BA 2CHGA 2DWQA 3ZIAD 1XPRA 3KKNA 4BFVA 3A1TA 1GL6A 1RRFA 2V3CC 3WRYC 1G7TA 1G7RA 2OG2A 3CR7A 2FZ4A 3WNCA 4MGKR 5JEDA 2XITA 4URXR 2BOVA 5EE1A 1NG9A 1XJCA 3EA0A 2AHOA 2GZAA 2MSEB 2XNDA 2ZR0A 5E7MA 4A8JB 4O2LA 4D4JA 1TX4B 1NJGA 1Z0AA 2QTFA 4AC9A 1W46A 4IDOA 4PPNA 2RGNA 2O8BA 4JL8A 4W7SA 3PENA 1JPJA 3HP1A 5CYOA 1N6RA 5CM8B 4A2PA 1G20E 4R7ZA 3JZAA 2CBZA 3GEIA 4NP6A 5EQTA 3VX4A 2VLIA 3E1SA 4JMPA 5AWFC 4XWOA 3NBYC 1VECA 5FOWA 1M8PA 4D0NA 3IEVA 5JWOA 1YZQA 4KFRA 1II8A 1MO3A 1ONBA 3EG5A 2AXPA 4Q4AB 2J3EA 3Q9LA 3K9GA 5HTKA 1OB2A 2ZRIA 2GXQA 2ZSDA 3VR3A 3LD9A 3QXXA 3BOSA 3GJ3A 2GXUA 3QI2A 4QM6A 2BHRA 1KKLA 2VA8A 1XRJA 3DM9B 1FFHA 1E32A 3PUYA 1W36C 3F3YA 3MGCA 3A36A 4QNMA 1GG2A 1N6OA 3LBNA 2FF7A 1DPFA 5KSOA 4P4SB 3U44B 4A4DA 1E2HA 3KXKA 1W49A 2C04A 3B2EA 3DZDA 4DC9A 4M9XA 5JWHA 3LVQE 4ACBA 3L0PA 2D2EA 4CT4B 3AGQA 1N6KA 1XFAA 4QNRA 4I1SA 1YVDA 2OFOA 1QBKC 2PCLA 5A4JA 3I1FA 3LH5A 1TTTA 3K0CA 3AF4A 3VFDA 4P4TA 3THOA 4S35A 3ZVLA 4EIWA 2FSHA 1G5RA 4PTLA 4Q1CA 4DT1B 3FFAA 4P31A 1COWA 4HSEA 4PQYA 3DM5A 2ZRBA 3L2OB 1R6BX 3IPYA 1YZGA 1X1SA 2IHBA 4O0MA 4AIIA 2QM7A 4V0LA 1XP8A 1LF5A 5C1BA 4AYWA 4DB2A 3FYHA 2ZJZA 4LJ6A 4RKFA 5KNDA 2V7QA 4KYIB 4MGIR 2ZRLA 1MRSA 2IS4A 4QHYA 4Z8YA 4DJTA 4DCVA 2R62A 4LDJA 1T8UA 4HUTA 3CRRA 1Z8FA 4ILEA 4GFDA 4O3MA 4OK6A 2RH5A 2P0EA 2VYFA 3VTKA 2P65A 1DG3A 4OJQA 2A7QA 2WTUA 2GDJA 2JJ1D 2V6JA 1U99A 2R65A 4W5JA 2JIZD 4KHZA 2DBYA 5JI3E 3HR7A 4RVCA 3CZQA 1DOAA 221PA 1K5GA 3QG5A 1GRRA 1U90A 4A92A 1VDZA 3IHLA 2ZJYA 1VG0B 4XWKA 1JAHA 1CP2A 3QVUA 3ND9A 2IYWA 1I4TD 2F1IA 3CLVA 4XSGA 3IPXA 2WPDA 1HUQA 3W6NA 3WBKA 4F93B 2P5SA 3Q85A 1KJWA 3WYAA 3A8TA 2ORVA 3E70C 3VHLB 2IYYA 1ANKA 4KYUA 4PO9A 2X77A 2W58A 2IYSA 1VMAA 2VHCA 5GJVC 4DLVA 3AUYA 3GP8A 2PL3A 1HT1E 4JBYA 3X1WA 4PHHA 3SYNA 4QBFA 1EWRA 4TMKA 1XEXB 4FWTA 4KI0A 3GFTA 1R5BA 2WKQA 2NGRA 1FTSA 1WP9A 4GT1A 2JDIA 3CWQA 5HKKD 5AJVB 3ZQJA 4LV8B 4TL7A 1S1CA 1Q3TA 4PXAA 4LHVA 4URWR 5AR1A 3N2EA 4HZUA 4BFYA 2V1XA 2XB2A 4D25A 2O8BB 2HEIA 4KLZA 3B7GA 3GJ5A 1XTRA 1N0WA 4QJ3A 4BFWA 4YMTA 1SXJD 1G5PA 3Q3JB 4DIEA 4RZ2A 1YZUA 1W1WA 2G0TA 3LLUA 3QKTA 1ZD1A 3CRW1 2ZE8A 5E3HA 1GIAA 1BYIA 1Q0UA 2ZITA 4B6FA 2FFAA 2ZYUX 2VHTA 3VU9B 4A9AA 3VNVA 4Q01A 2IYRA 3MJHA 2KJQA 4DLYA 1K6MA 4ZDJA 3TSZA 3U7GA 3MLEA 1MABA 1L2TA 1OW3B 2WAYA 1G1MA 2JLSA 1U94A 4DLXA 3REFA 3R9IA 4TL8A 2OFXA 4N0EA 4Y0VA 4U5XA 4JKIA 2IC5A 1Z5ZA 1NSTA 2A2ZA 4JVMA 2IYTA 3CF2A 4NU0A 4AKHA 2ZRDA 3BH7A 3W90A 1TQ6A 1JXOA 2Q3MA 1GNPA 1P62B 4RJLA 4K46A 1G8PA 1NVVR 1S96A 2NG1A 2TMKA 1UKEA 1VHLA 1H8HD 2ZI4A 3PEWA 4Q4LA 1R2QA 2E87A 4M0LA 3TGPA 5DLQC 3QPVA 5D3MA 4NCJA 2R9VA 3SE0A 3ZZUA 4M22A 2CCGA 4OI1A 3K9NA 1XZPA 4EPVA 1P2VA 1RW4A 1UAAA 3OIVA 1VIYA 2V9PA 3RSLA 1EXMA 2FSGA 3P20A 3W8RA 2GEDA 4XVQA 4OHZA 3ADBA 5FL7D 1AKEA 3EIHA 3TIFA 1XCGB 2VF7A 2GJAA 3C5HA 2PMKA 2OHFA 2ODEA 1X6VA 1IN7A 1EFRD 3R20A 4Y0AA 1ESMA 2CL6X 1W5TA 3BFXA 3R9XA 1KNXA 4BZXA 3WNDA 1TQ4A 3T12A 1A2BA 1KSHA 4B2IA 1NVXQ 4MUAA 1GVNB 1ZC3A 4CRWB 4HEJA 4TQAA 2H18A 3FHCB 4L8GA 1AZTA 1XBTA 5CIQA 3CPHA 2IS2A 1WBDA 3T35A 4A6PA 2DCUA 1KNQA 4PHGA 1OIVA 1ZU5A 1CU1A 3NDPA 3DHWC 4TLDA 1ESNA 4C0JA 2ORWA 4X8MA 2AD1A 2DR3A 4JLDA 4TTPA 3MAAC 1A5TA 2B7CA 3ZLJA 1AIPA 4I81A 2IYZA 3AVVA 2IWRA 1NRJB 2HCBA 4Q00A 1ZUNB 2CL7X 3UMFA 3L0IB 1PLKA 4G0NA 1RYFA 2G1KA 3AF2A 3OEHD 2EU8A 3KXLA 2ZSFA 1VHTA 2ZE6A 1OFUX 1UF9A 1Y63A 4AWXA 2ANBA 2WWIA 4ESVA 4PQRA 1NF3A 1UKVY 3OHMA 1EESA 3PEVA 4TYNA 4FMBB 1G8GA 2CJWB 4P3YA 2HDNB 1Z0FA 1NMYA 1F2UB 4XJXA 5EZ6B 5DYGA 3B8HA 2BIFA 1UM8A 2BWJA 1DAFA 2ZI5A 3CIOA 3RHFA 1XMJA 3TUIC 2GTPA 3B60A 3CX6A 4DUGD 3U4QB 2KI5A 4PANA 1KIMA 4JVLA 1NN0A 1QRAA 3UANA 2CHVA 4GNKA 3EPHA 2EFCB 1JJVA 2QU8A 2FPKA 2W83A 5C46F 2ZJ2A 4FN5A 2ZJOA 2JJ1A 2XJ9A 3LLMA 1JQLB 2JIZA 3GPLA 3IIKA 2X1VA 3GLIE 4GI7A 2ZUDA 1KDOA 1XEFA 3P26A 1AA9A 4BASA 1RRPA 3WNBA 1NBME 3F0TA 4R71A 1GAJA 4RD1A 2QGZA 4J0QA 1JB1A 5B64A 1D2NA 4TMWA 3DVLA 5EE0A 3Q5EA 2XAUA 1TUIA 2RCNA 1TF2A 3KQUA 5D3MB 4CDGA 4L16A 4BEJA 5JJKA 2ZRCA 3QBVA 1P5ZB 2QRNA 2EVWX 3GD7A 2OAQ1 3X1DA 4PSAA 1E94E 4KCGA 2BV3A 3MJRA 3QKRA 4DLUA 1I4LD 5CB8A 1R5NA 3HDTA 5HKKA 2WJGA 4M9SA 1NKTA 3B1XA 1ZAKA 1A1VA 4JYBA 1SULA 3VX3A 1AQYA 5A0FA 4Q7MB 1DBSA 1N5LA 1VCMA 3AKEA 1SXJA 4QFMA 1NI3A 5UKDA 3TSWA 2YINC 2XTNA 3BXZA 4QC2A 5JI2E 2ZI3A 3G82C 3GLHE 3T5GA 1Z2AA 1XJQA 2OZEA 4D2IA 1SXJE 4B2PA 1IN5A 1T6NA 1JNYA 1ODFA 4N3NA 5BN5A 2IEYA 2GILA 1Z6TA 4EPYA 4GP6A 4LHZA 5FOSA 3UMSA 2H1LA 3LWNA 5JLJA 3PFIA 5JSZA 2ZU0C 1NY6A 1NMXA 3G5UA 3CF0A 1L4UA 4Q9LA 3BE4A 3QPUA 5EXXA 5D3QA 3QVVA 4JLNA 1YE8A 1ZJ6A 1U0HC 3NH6A 4V0KA 4AD8A 1XTKA 1OXVA 2GBLC 1UJ2A 1SHZA 1KYIA 3LV8A 3BB4A 4OYHA 1XEWX 1RIFA 4UNRA 1OXSC 1OFHA 4PO8A 5J4VA 5JJLA 3HU1A 4TL6A 3H4MA 4OQNA 4XH9B 1U2RA 1P6XA 3QKSA 3FMOB 3VQTA 2WICA 4A0FA 3GEHA 3NC1C 3KQLA 2HXYA 3GLFE 4G5OA 4AYXA 3EXAA 4C0KA 3I5XA 4L15A 1FW6A 2JLVA 3LAWA 2CVHA 2GJKA 2XNDD 2ANCA 1UDWA 5AUQA 4WZBE 3U5ZB 3MSXA 6Q21A 3KX2A 4MRPA 2GESA 3AP3A 2QP4A 2EWVA 2DB3A 2GXAA 1N5IA 1NMZA 3GJ4A 3IO3A 5FL7A 1SVOA 3MRSA 4RSGA 2UKDA 3FHTA 4A2QA
chains in the Genus database with same CATH superfamily
3TTWA 3EB9A 1JSLA 1T3SA 4U2FA 3IMGA 1D9ZA 2JFGA 5AKYA 1KA9H 4XASA 2IKQA 1OT5A 5AO9A 1US8A 3QMVA 2Q3HA 5IM4A 4B0OA 2HSJA 2PRYA 3DAOA 2ZYTX 3HL4A 5L3VA 1SCKA 5FBRB 4WKCA 3BRCA 3IVMA 3JQ7A 4RJJA 4UTXA 1U31A 4A27A 4AROA 1M1UA 1KQGA 1PQ4A 4CI0B 4UU0A 4BRZA 1UFOA 3IEIA 4B7XA 1WQ4A 5A7GA 1HSOA 2FTKE 3N6RA 2G9UA 1F9EA 2P4EA 2AVDA 4MR8B 7MHTA 2I67A 3SS7X 2HBRA 3LYHA 3LYLA 4GMHA 4K9QA 2YWGA 5KYYA 3S5UA 3V7NA 3IIMA 5JXWA 4INAA 4H7EA 1EQUA 1POWA 5L95A 4JLBA 4UM8B 4ZCIA 4L8YA 2RHGB 3RS7A 1W2GA 1OV4A 2PY6A 2N0SA 4LJKA 2Z5LA 4ZO4A 5DX1A 3PNSA 2JFBA 5EQDA 2FWIA 4DJFC 2JIPA 2QGNA 3FVVA 1VBMA 5GJBA 3DLHA 4M0PA 4MRMB 4UUOA 4AG3A 4FYHA 1MKYA 3BZBA 3QKRB 1O95A 1SJ9A 3OEHA 5CNIA 4NOMA 3BA1A 3OZGA 1Q15A 1MVOA 3I0MA 3ICWA 5A4MS 1C30A 2A5GA 1I0LA 1NP6A 2J3KA 2KSQA 2WG1A 4E5KA 3WJ7A 3LUHA 5EN4A 5A71A 2PLWA 3CCBA 1K1EA 3LP8A 4TTVA 5IH7A 4AO7A 2OCBA 4PO1A 1ZVQA 5TR9A 3KVYA 4FGWA 3NP9A 1ONOA 2X6QA 3FBWA 4KJZA 1CUXA 1DHRA 2A9PA 4O2BB 4TSKA 3ZD9A 3M5CA 4BMXA 5JAOA 1OX5A 1PL8A 1IZZA 3NWJA 3BC1A 1C1YA 1BCSA 3E9EA 3E81A 1UZUA 4GVXA 4XPZA 2GN0A 2IZ7A 2F3QA 4MITA 5BN5B 1C0LA 3BXFA 1IN6A 4JJKA 3E5NA 3Q1KA 4WD3A 5DXJA 2VKTA 1X38A 2JPDA 5FPHA 1IK6A 5LBUA 4LJSA 2IPOA 3RVNA 2GT1A 5EIEA 4Q3EA 2PVPA 2CEAA 2VDMB 3W7AA 5DYIA 1XVIA 4F2HA 2RHLA 1JLKA 4CKXA 1TJ3A 3H42B 4M6WA 2VYVD 4G4GA 5DU2A 4F72A 4PN3A 4DF3A 1R9JA 2QUBA 2PKRA 3FSRA 3LY9A 3AVTA 3N28A 1HLDA 1TT7A 2WIFA 2CNWD 1K88A 2I8AA 2PMFA 2QMUA 2WSBA 3E9DA 1JTFA 1ZK1A 2WY2D 2I4RA 1RIIA 2YWBA 3E0XA 3AIKA 2W2KA 1LTQA 3OIUA 3HC7A 1NRWA 4KWIA 4LA4A 4MCIA 4MKZA 4W5WA 1WD7A 4D9IA 2UUBB 1FQOA 2CXSA 4XEUA 3CX8A 1W5AA 1XOIA 2WQ6A 2EP8A 2ZE5A 1T1IA 1W59A 2XOKD 3REOA 2AX4A 2VDWB 5LXTB 3PKJA 1ID8A 3ASZA 1RQGA 1D2EA 2EOAA 4JZKA 1S3IA 4KX3A 1PEYA 2A5FA 4IVNA 5T3YA 3WJ2A 2BI4A 1Z37A 5FWXA 3QVKA 4F7DA 4KU4A 3DHNA 3AR4A 2V4MA 5JPDA 5EXDA 4CPDA 2DKNA 1UPCA 1SEPA 3NHBA 2UV8A 3EGCA 3NETA 4L5CA 3UGTA 4C20A 5BOSB 1A4IA 4UTPA 4IDHA 3FVRA 2CLLB 2H8KA 3MN1A 1X7XB 4PAQA 3BKXA 4FIDA 4ZQGA 3BGVA 4GIBA 3B3JA 1I2DA 3EMKA 2OGWA 1G98A 2I2WA 1T8PA 3A37A 2RH9B 1N7JA 3HYNA 4MLCA 4QPPA 2CVOA 3FBGA 4DIFA 3OWOA 4LQDA 4JBGA 1EDDA 4BO8A 3QUSA 3CKLA 4B3MB 2XCUA 2GZDA 4KDEA 4TTRA 3VPAA 4LE0A 3PWZA 3ITNA 4NBNA 4DYDA 4IDPA 1TCVA 3U16A 3O74A 1OLOA 1J5XA 4NIMA 4YCBA 1A8SA 3WK7A 3G2HA 1KE2A 2VH1A 4BNDB 2V45A 4S24A 5KSWB 3EAQA 4BLTA 3M5WA 3QU4A 1AS2A 3SLKA 2F1KA 1NUQA 2J32A 3X1ZA 4D4LA 4BNTA 5EIOA 5JYEA 2XXAA 4RF5A 5G1OA 1MO5A 1F5NA 2M9MA 4ZK6A 4Y2SA 4G09A 2Q1UA 1E6WA 1J56A 1ZR4A 2Q9AA 3UB2A 4B8WA 3C3BA 5CLIA 2BBSA 4IV0A 2GCNA 5FF9A 3UV3A 2XHEA 3ZDYB 4BBZA 4B6SA 4O1IA 1ZL2A 1PNVA 5L53A 4JGIA 5AIBA 1N1MA 1VLMA 4FILA 2AOUA 1E2IA 1LBEA 3MLBA 3QW2A 5ADVA 1IZ9A 5LZ9A 3DL7A 1G5IA 2ZYIA 3MJ4A 1PAUA 4KDCA 4CMJA 2OFPA 2J5KA 2QXTA 4Q7JB 4WOCA 3LUBA 2BRUC 4POOA 2GTHA 3V8BA 1OZAA 4LRYA 4UBOA 3TK1A 4BB5A 4FYJA 3VAAA 3VZDA 1QORA 4NKRA 5CFZA 1H9AA 3ZOKA 1DAEA 4Z4EA 4RA6B 5JEEA 2P4HX 2I1VB 2V55B 3B13B 4UMFA 1FDTA 1X1AA 3RYFB 4N03A 3P45A 1WZCA 2ZRFA 1FYEA 4N3CA 4IICA 2GNAA 4M98A 5JCJD 4R1LA 3ZY2A 4OKNA 3OHPA 3WLRA 4FGKA 5KX5B 4R1MA 1EGHA 3W5CA 2HSWA 1E2MA 1KQ3A 3K1JA 2EKBA 4S12A 4ZVOA 3ND8A 1JQAA 1KGDA 5IBRA 5A6SA 5FV4A 5JALA 5KCMA 2WWVD 4MO2A 3UWKA 3AHGA 3O94A 4PR0A 5BN3A 4ZFNA 4D41A 1R37A 4J2HA 2QMHA 1QP0A 1SUWA 4J49A 4M7RA 3R40A 1JKMA 1EGQA 2HAEA 3T9AA 1A50B 1E1NA 3W5BA 4KN8A 3JX9A 1SD5A 1CUHA 2WWYA 3EY9A 1B23P 4CMKA 1MIHA 4O5AA 3UUGA 2GLTA 4O63O 1DGQA 1L3IA 2AJ8A 5T4HA 3AVXA 3R3HA 5KSZA 4Q3LA 4UUNA 4YALA 5AJXA 4D3XA 3MAJA 3KR9A 5ERGB 4X1IA 1F0NA 1R27A 2G63A 5EUCA 5DLPA 1J06A 5FLKA 3B1VA 3WICA 2R00A 3KKKA 2LKDA 4Y1EA 3LK7A 5A4DA 3OKFA 5FFNA 5HR5A 3ZDQA 5HGJA 1O08A 4JA2A 4RC9A 4ZWNA 1JN0A 4GW3A 2PZLA 1ZO8A 4GECA 2J3MA 5DBIA 5ESDA 1O0SA 3R76A 3ZGVA 5BWNA 2PUEA 2LUOA 3WADA 4JV5B 5KQPA 1ENZA 4Y2JA 2OLJA 2GEBA 2QQ5A 3LXRA 1HE2A 5D5PA 1VCNA 4YLGA 2JGJA 1YS6A 4CCSA 4WXMA 2ZBPA 4C14A 1IQ0A 3QU2A 3IAFA 1S3GA 1KBZA 3PQ2A 4I9NA 4BQQA 2DHEA 4H4CA 1OC2A 3RVSA 3DE0X 1DV1A 3W5DA 2IYAA 4Q03A 5M5BA 4Q18A 4MNTA 3JD1A 1YA6A 3PQEA 3EXIB 5FUWA 5EIBC 4A03A 4RMHA 2XVZA 1THGA 2FZEA 3LQYA 5HPYB 5DBHX 4R8SA 4FQ8A 1M2WA 2Z9DA 3QV2A 1LLDA 2FWAA 4WNAB 4O4HA 2OHGA 4TUYA 2HPZA 4PU0A 4CQMD 2AZ4A 1TYCA 1I8TA 3L79A 3NIFB 1P9LA 2XZPA 4XWTA 3ZVRA 3UM9A 1VCOA 1LU9A 3OAAA 5EXEA 1J9ZA 4UBLA 3V80A 2G1AA 4B84A 3N5KA 3QEBZ 1X39A 3A10A 1WLSA 5FI3A 1GPLA 4LF6B 1SXGA 5AVKA 1KZ7B 3TZEA 1M2EA 4YHHB 4RNDB 3OOYA 1VP3A 5G0VA 3P1JA 4YMVA 3HPRA 4CN9A 3UT5B 4PAOA 4YYEA 5K4HA 2C61A 3FWKA 1V9SA 3IDAA 3KTOA 2ZTUA 1G6HA 4HK4A 3UWPA 4L2IB 4C0QC 1NI4A 1XRPA 4PLHA 1QIEA 3AI3A 4R0NA 4L8FA 2D7CA 1RYEA 2J07A 1QZXA 3QPDA 1N2OA 2Z98A 5JISA 4X8OA 2WJHA 3RKRA 3TL2A 4X94A 1EVQA 1Y8QB 1VFPA 2CDNA 2H1HA 3UJ9A 3KVVA 4E2YA 3JCZA 2P1ZA 4HNQA 1Z2DA 2C5HA 3TG2A 2WUGA 3PFFA 4LJ5A 3GRVA 4V2IA 1HQDA 2M6SA 4UVIA 5JRJA 3RRJA 1TT5A 3K2BA 3ZTYA 3UWOA 5AW1A 4YJFB 1OGJA 1RI1A 2XGOA 4LZPA 1KO1A 4GSYA 4A1OA 1Y8RB 2YWFA 3EIUA 4E3ZA 5ETJA 1MORA 2X1HA 3Q9NA 4LDQA 1QGAA 5D01A 3BEOA 2R4TA 4KO4S 3GAMA 4YN3A 1BS9A 4KZKA 2FH5B 4NZ9A 4RFSA 3N05A 4Q1AA 4HAOA 3TNFA 3LPAA 1UH5A 1JQJC 1YOVA 1PFUA 5TIIA 1ZSVA 3DC2A 4A0RA 5ADWA 4LSGA 4WI1A 2VTBB 4OHRA 1K97A 1ZEJA 2V8OA 4OTZA 1WMFA 3I04M 2AR7A 4UUBA 2ODTX 1G2QA 1WW8A 3EXHC 3BRWD 4X1YA 3T9FA 5LYJA 2VDPB 5JDIC 2CLDX 1NNSA 5L3RA 5C53B 1XXHB 3CONA 4Z4IA 1V26A 1WMBA 5FBQB 1CULC 4IOJA 2WU4A 2XE4A 2XUOA 2C31A 1Q5PA 4M55A 4UD2A 1JDSA 3OPNA 5JS7A 1ZIPA 3C6BA 2HT6A 1KO7A 3Q9SA 3FYTA 2IK8A 1KR5A 1YDWA 1J70A 3UAXA 1Y34E 4FNGA 4TSFD 1XTQA 2ZUFA 1KI2A 2AE2A 4C07A 3CA8A 1W4RA 3ZCRA 1C2YA 4DSAA 2D2VA 1KI3A 2JIQA 5G0SA 3LE8A 2R6CA 3CZCA 4CZ2A 1X13A 3LO8A 3W3ZB 1ZOOA 2P67A 3BHNA 3G9UA 3PDIB 5ED0A 2CJWA 2HV8A 1N9GB 1CS4C 3CWCA 3DLCA 3FZEA 4JEHA 3RNOA 5B3KA 1MC8A 3DBRB 3GG2A 4QE3A 3RSHA 5CFLA 1Y98A 3OZBA 4O1MA 4R0VA 3FH0A 5EP2A 5GIOE 2B7LA 2Q5HA 5I47A 1RYDA 3RYHB 4GRIA 1G8MA 2IYEA 1LGYA 1IPFA 3FJOA 5BP7A 2VAMA 2IEIA 5K3CA 5IWCA 4L22A 5KYUB 1AZWA 4B34A 1UWCA 2COUA 2CYCA 1E0DA 2WD8A 5M3BA 1SIUA 4EFLA 2RGXA 3D0RA 1B0UA 2YOGA 3RFCA 4C4PA 3T0FA 1CUYA 3H1TA 3MCTA 4P3XA 3I42A 3IPAA 5BMVF 1EM8A 2OGUA 1ZBQA 4IQGA 2XRFA 3SX2A 3D31A 1FMLA 2QRMA 1SM4A 4UXHA 4P7GA 4LXUA 1WXHA 4R4JA 2I2BA 3LX8A 3WMGA 3CXRA 1JBKA 4H7IA 5DM1A 3UGQA 5GADl 2H92A 1DJNA 4JFRA 2LZ0A 3FKSA 4A8PA 3A1DA 3CKMA 4OO3A 2P5TB 1D7OA 5E7IA 2P3OA 4HAUA 4BEVA 1Q0SA 4NY1A 4QO7A 2JFUA 2QRJA 4KP7A 2HW8A 2FR8C 1HSZA 5MFPA 3GN2A 5LNK1 4G4JA 4MB6A 4L0CA 2ILVA 4I1PA 1NU6A 3BB1A 2IY9A 5F7JA 1DT3A 3OIFA 3HCOA 1UKZA 3OOWA 5KPJA 4TQ9A 3A14A 3GLUA 3JQCA 1UQUA 1XUOA 1OOEA 2WJ4A 3AHEA 3W7VA 4K9LA 3A3NA 3B53X 4CEJA 2RONA 4U6NA 2SKEA 1OLXB 1OZGA 1A5BB 3BD9A 3GP5A 4I55B 4UCWA 3SYMA 1Q2UA 3CEHA 2Q6OA 4ZZ2A 3W06A 2WYWA 1ZJ4A 4NYMQ 2LR0A 2R86A 3VO9A 4YCLA 3EN0A 5EHIA 3VPSA 1N5JA 4J03A 4MHSA 2PKCA 1D2GA 3ANLA 3O0DA 4WN9A 2FPRA 1OFVA 2P1DA 1W1UA 3I9V6 4HGQA 1V7QA 4XYMA 4XFDA 2C29D 2BGIA 2H48A 2VEDA 2PIDA 2VP6A 1ZNXA 2YNMA 4D0GA 1L5ZA 4A0SA 1ILWA 2BFMA 5FDFA 2XDQB 1T36A 1GG8A 2N47A 3C41J 5P8WA 4ZVPA 2Z8YA 2XA2A 4X7PA 1PGJA 1BN7A 1B2RA 4BFUA 5K20A 3DMHA 1ZP6A 5A04A 1EVKA 5FV7A 2FB9A 3GPIA 3K1AA 3OOJA 2OVBA 3WXMA 5MFZA 4TYMA 4YJ2A 3ZGXA 3THWB 5HKOA 3FNIA 4MUFA 5EINA 4TZ6A 1R4MA 5KTTA 1KJQA 4D9EA 4YC7A 3U3DA 3GFBA 1ZM9A 3O47A 1ZXLA 1EFVB 1LZKA 1U3CA 5DVZA 1R0ZA 4BCCA 3NATA 4BQSA 2PWPA 5IFKA 3GT3A 4BMCA 2J41A 3TWOA 1C29B 4G5XA 3R3ZA 2A5DA 3ER6A 4ZREA 4G5FA 1KSFX 4OAPA 5FQNA 4YAKA 3TEJA 2O8FA 2QSZA 5FULA 4AO8A 2INGX 5F5LA 1KJ8A 1P0IA 2QR5A 2QM8A 4ZIRA 2A92A 4OHKA 2P78A 1MG0A 5CDTA 1SXJC 2FMKA 3ZCUA 1MB9A 4X41A 2IH2A 1RJ9B 5IT0A 1Z6PA 4M7PA 1OT3A 1VG8A 3W6ZA 4DDKA 4L5BA 3IB6A 2PFSA 1FNNA 3ZX4A 5IYZB 3FTQA 4PGAA 1LWOA 3T06B 3WLMA 2GGSA 3VSCA 3F71A 1LJLA 4ZDKA 2CNLA 4HQKA 3GNLA 4LW8A 5KNBA 4CG0A 2QRVB 4W7HA 2YC4C 4L9WA 3ZHXA 2C2XA 4BN4A 1P4JA 1WKCA 5DI9A 2Q07A 3QITA 2GN1A 3QEMA 5BV8A 2RB4A 2WUDA 4E09A 2UYGA 2C8JA 2QTGA 1W0JA 4IDNA 1RMTA 3BMOA 3DFFA 5ICEA 4OOFA 1R12A 1SG6A 4JKOA 5DMHA 3UK0A 2NO5A 3AOEC 1YZVA 1WSWA 2O7NA 3E3MA 4OB8A 2DULA 1V8FA 3KAKA 3JAMA 3D4BA 3NOOA 1VP9A 2P27A 2ZRPA 5T64A 1QCYA 2PH1A 2WTEA 3ZN2A 2BMEA 4YPFA 2X23A 1V4BA 1ZD9A 2Q5OA 1SBHA 1KMHB 1UZLA 1ZM2A 4JWKA 5HIKA 5LR6A 1Q1QA 1VBFA 2A33A 3CS3A 3DDWA 3NOQA 1PV1A 3DWGA 1SBYA 4IILA 5H70A 1L0BA 5A03A 4CEHA 3ZU2A 2RARA 3TM4A 1W4AA 3MS4A 2DPYA 3FHOA 3W6UA 1V48A 4U02A 2AZTA 3CURA 4DMHA 3T7EA 4PBSA 1ISFA 3GRPA 5BQFA 4G5QA 3B6IA 1P29A 4DV3B 1G38A 1XCJA 4Q9NA 4IDGA 4OLJA 1TEXA 5D6OA 5I7WA 3ORFA 3HDYA 1XNRB 1BFDA 3GLSA 1AM4D 1TGVA 3SIWA 4IDCA 2ZJ4A 1J21A 1KZ1A 2REOA 2HCJB 2PZMA 1LPNA 4WCFA 3WDKA 1XLVA 1RRVA 1T6YA 3MWJA 4ZCPA 2C9ZA 2J6CA 2XY4A 4Q47A 4BQRA 4RHFA 3SDSA 5JTTA 1P2SA 2XZLA 2VPQA 3OFND 3OPYA 4TVBA 2NSHA 4OGLA 1CDZA 3GA5A 4I4TF 4BO0A 1K7CA 3WHIA 1GRNA 4H1UA 5CM2Z 3OQOA 4MW9A 4TGLA 3V8RA 1A4RA 3VRHA 2AF3C 4Y2VA 2QTRA 3VZQA 2YZNA 4QLBA 4MQ6A 2HO5A 6YASA 4L72A 1HY3A 2G4LA 4RIGA 5CT6A 4EX6A 2R7KA 4D0SA 1FRFS 4DSNA 1R0RE 3EVEA 1BCRA 4QHTA 4H1VA 4RK5A 5FP0A 1J2TA 1WJGA 5BSMA 1REQB 2DLCX 4HXYA 4JXJA 1GKLA 4RH3A 1TLFA 4AB1A 3CUTA 2G82A 2GKSA 2FFHA 4O2BA 1ECBA 1M3SA 3H1FA 2PD6A 2W2QA 3K05A 4FBGA 3E0QA 1ISJA 2HB6A 3AX6A 1FNMA 3J81A 2W00A 3K6RA 1T25A 3JD0A 4D4HA 1R3UA 3CT6A 3R3YA 1P19A 3IP7A 3AP1A 1NHWA 2YWHA 4BLVA 4UM9D 1ZBDA 3T4XA 1KBOA 1ST2A 4E6EA 3GDFA 1NW9B 4HLUA 5FUQA 3E5MA 2IW3A 4WOBA 2PV7A 3NWOA 5EZYB 5J5AA 3SKVA 2IOYA 1SKYE 2PD3A 5D84A 5K3BA 2L19A 5CCEA 1BVUA 4MGEA 2H5LA 4AY5A 4IHJA 1F4LA 3IP5A 1U7ZA 1D2RA 4D82A 4KR6A 3EEFA 4K9SA 3OE7A 2BHLA 4ND3A 4MDFA 1YQ9A 2AZMA 3WYCA 1E9BA 1HLFA 2B4RO 3I3SR 4UXIA 3ZWBA 5HQTA 1CR1A 2Q8QA 5IAOA 5ISMA 4Z7OB 5G3YA 2J9RA 4FUQA 1GQYA 5MHTA 5AUNB 4ND8B 4NJMB 1B4DA 2GBFA 3NX4A 2P2LA 2I2DA 2VDWA 3MOGA 1OYVA 1XQWA 2VFAA 3H86A 5BORA 1H42A 4LJ8A 3E22A 1K3FA 2X0NA 1ABBA 1T9BA 1JHVA 2OV3A 4CG3A 3HFJA 3MD0A 4WUTA 2X3FA 4CTOA 4GAEA 3V9AA 1E5DA 1HDZA 2AMVA 1KRXA 5F21A 4CE6A 1QHHB 2D54A 3NM6B 1IXYA 1U2DA 1Y1TA 3S6JA 3GQVA 5K0EA 2IHVA 3I2YX 3VDNB 2ZBGA 4NAHA 3BIWA 1HA3A 1XXLA 3BPSA 4CJXA 1T2UA 4ZO6A 5CEEA 1ZQ9A 5C5EA 3PFHA 3QFTA 4GMFA 5KTYA 4XX0B 3VTFA 2CFOA 3EOZA 5EIAA 3UWMA 1G6Q1 3KOZA 1JFLA 4FCWA 4EKGA 3UZUA 1TO6A 4EGFA 2WSMA 2QMEA 1O54A 4J1TA 3R7WB 1MFPA 2JAQA 5AW6A 1R88A 2BEKA 2MOKA 4Y6OA 1OKKA 3SFVA 1TUBA 3PSAA 1MC4A 4G1CA 1UKCA 2J09A 4WTOA 4PLTA 5BMOA 1W6RA 5GGXA 4BNDA 2DBRA 5CGQB 1PG0A 5FPPA 2A78A 3H75A 3EC1A 4MI6A 3PDCA 1KZYC 3MSCA 1KK2A 1PGQA 2GF2A 4BTVA 4IFEA 2NO6A 4N8EA 2FLWA 2P11A 1QV7A 3SC2A 5IJZA 3NIGB 4NCAA 5E6SA 3BHMA 2ORYA 5E8RA 2VSOA 1JEEA 4IZOA 1T5LA 1KTVA 1X19A 4YJKA 1X7ZB 4GMDA 5T41A 3KLNA 3VNSA 4V0NA 2EBWA 5KDOA 4KX5A 2CV2A 1HFKA 4I50F 2VBFA 1WA5A 1C9EA 1O94D 1RCFA 3UATA 3Q5DA 1NW6A 4GF5A 3KKPA 4NONA 1X15A 3VJLA 4PQEA 2A5YB 3JQFC 2AMYA 8ATCA 3G68A 1L5YA 2IIBA 5FBKA 1BC5A 1PVVA 4GLJA 3U7IA 1LDNA 1KIAA 2QYTA 1COZA 4ZOCA 4ZCSA 3W9SA 1PN3A 3CN7A 1GSIA 4IGEA 1MVNA 1UCFA 1PDOA 3LFHA 2BC9A 1FL9A 2H85A 4QEDA 2E4WA 3HXPA 4H6WA 3SBXA 2FP4B 1Y1QA 2PRIA 4XM2A 3M6IA 4W1RA 2DLNA 1XRLA 4UAGA 1ZH2A 2QVZX 4BMVA 4MIKA 5KX5A 3GUZA 1QMGA 1JSZA 1JE0A 3DUFB 4JEUA 4RV4A 2EGGA 4CIYA 1MO6A 4LTDA 3WHPA 4O3FA 3JQBA 3TB4A 2WU0A 3QVGB 4JITA 2ABWA 2F1RA 1ADFA 2POQX 4B87A 1AKNA 5IAKA 3WYEA 4OEHA 3PX7A 3EBPA 4C5AA 1V3UA 4NATA 1YFKA 1NJSA 3Q8LA 4HDOB 4XWAA 5BT9A 2J9GA 2BZ1A 2QAJA 3CVOA 3BB3A 2PS0A 4Z7QB 5ADUS 3LX5A 1CY0A 1HG0A 1D4AA 1JU4A 5FTKA 2GPJA 5DNAA 3SYTA 2C82A 1XV5A 3AKDA 3R09A 1KJYA 2IIPA 2WOJA 2PX8A 2Y1KA 3IVCA 1VIDA 4F96A 5K0JA 3UPTA 1QB7A 3A06A 2X22A 3TQHA 1FZQA 5JS2A 3FUTA 2EJCA 3F5SA 3H1PA 4BUCA 1G291 1JHQA 2Q5IA 2W7TA 3TSAA 4NBWA 1PE0A 1TGYA 5IG2A 2WB2A 1IHPA 1QS0A 1Y3AA 1QM5A 2IY8A 1FDSA 2PX5A 2YBEA 3KR0A 3O1LA 3OSZA 4GPTA 2C7GA 4YWHA 3S29A 4EUEA 1A4UA 2PX3A 2ZRHA 1YV9A 3AILA 1QHXA 3MYYA 1BDBA 1VG1A 2I1LA 2PT6A 4GPIB 2P6OA 4NS1A 4MYUA 3AEXA 1RJDA 4QPNA 3U13A 5CDSA 4AJ4A 1QO0D 2AG0A 1XMSA 2FR1A 3AQIA 3Q72A 5F76A 5AW5A 3HB5X 4UFOA 1EP3B 4RYLA 1HX7A 1ZW1A 5C7YA 5DH9A 1RAHA 3SE7A 1TFRA 2G09A 3Q7IA 3R3VA 1Q2XA 5EWJB 2YUIA 2O8DB 1JEOA 3F6CA 1V39A 1T5DX 4IF4A 3GNTA 1XHLA 4JGGA 3E9YA 2PLFA 1ABEA 3N2ZB 2D7DA 2JI8A 1DDGA 3PKZA 3Q8MA 1LPBB 2XX3A 1XKTA 2IEAA 5EMJA 4ZQFA 4J4TA 4EJSC 3S68A 1VMIA 1WE2A 2WJYA 1PK8A 2FG7C 2DQYA 3QK7A 4L02A 4PR3A 4QEZA 3FYUB 1ZM3A 5GTDA 3BDIA 2ZSKA 4R9RA 4G01B 3WKCA 2B8TA 3GPCA 3OZ7A 2E49A 2I22A 3B6ZA 4Q4JB 3TD9A 4LOHA 2PGDA 3KKQA 2IU3A 4BO3A 2PYDA 3DMYA 2HJGA 4HDCA 1CUEA 3B52X 2WMNB 3WTCA 1W36D 4MQ4A 2AMFA 5AQEA 1JEJA 5EWMB 4JLJA 5EQFA 1EKXA 1UWKA 2NUTA 5BSVA 2PD4A 2CDAA 1JA1A 3QTLA 3IILA 1DCFA 4E5YA 1QDEA 4QUBA 1FX0B 1IZ0A 3QEOA 4DIDA 5C2JB 2XA1A 3EPRA 4RHTA 4ESOA 2OMEA 3S70A 2OCYC 1GUFA 1YTLA 2FN7A 2CMFA 4HPXB 1FP7A 1T9DA 2CB0A 1UT6A 1VPLA 5FUYA 4BMSA 2O8EA 3A70A 3H5WA 1KZ6A 4IIBA 1Z4LA 2F67A 5DEIA 1NATA 3U81A 1XD2B 4C04A 4DQUA 1C80A 3GRUA 3LL4A 1F6BA 1MIOA 2VDKB 1FZTA 2C5SA 1PJLA 2JEYA 2QVLA 3AVQA 1SG9A 4FDTA 4FQ7A 2P2SA 3WXBA 3ER9A 5A0TA 1MU0A 1TCAA 4UULA 2IYVA 1MC1A 2RIRA 3FKSD 4IM7A 3TFWA 4UTZA 3AZPA 3BMNA 1DIOB 4QSHA 2YDXA 4HNAB 2BFAA 3EWNA 3OZVA 1PUJA 4JB0A 4HLQB 1LV7A 1N2ZA 2BSXA 2JVIA 2VTBA 1V71A 1ZK2A 3OY7A 1WMDA 4G65A 3VR5A 5IJ9A 3HN6A 4Y2QA 2PUJA 3LLCA 5CU7A 1GQFA 1UBNA 2JAHA 3TR6A 4PNZA 2J5XA 3MWKA 5CVDA 2VYND 1QQ7A 1IHYA 2F9FA 1H23A 2HHAA 1J4AA 2ZWMA 1XXHA 3HHEA 3OE5A 3OLQA 5KMGA 2DH5A 1AGYA 4O4IB 2X8JA 3UMRA 1DCKA 5KYWB 2B2CA 2JZCA 4PGMA 2C4HA 3AIIA 2EFHB 1ZU4A 2GR9A 2ZBEA 3SZOA 4OHXA 3VKWA 3ETDA 2WQZA 1N3LA 2HLDA 3DZ8A 5BSTA 1KEVA 1QHSA 4ZHQF 3I1IA 1E7RA 2FRVA 1QPZA 1YKSA 1Y6QA 3GHHA 2C3MA 1GV1A 3QNUA 4KN6A 2VA9A 4E6PA 5JZSA 1SCIA 3AR5A 3P32A 2QJWA 5F3RA 3FPAA 4FE3A 3EVFA 4WESA 1Z5NA 1JDBB 1U7PA 1Y0BA 2C2GA 4TLBA 5M29A 2O7QA 5KEIA 2FFBA 3KEFA 5I8PA 1IXRC 3S99A 1O7JA 1CE8B 3FLBA 3MMNA 1T9AA 4RVSA 4YK7A 1D6SA 4WAUA 5E7JA 1HC7A 2Q4RA 2ZSIA 4X8LA 2QXYA 4L85A 4ON9A 4ZN6A 1ORWA 1UBJS 3HACA 5EUMA 5KQRA 4TKUA 1KK1A 3BFPA 1J23A 2P35A 4RVUA 4H4EA 1TVCA 2QM3A 2RGGA 1QH1B 5A4FS 1Y6FA 5T8KC 3U4MA 4J94A 1O4WA 1QTNA 2REQB 1XK6A 1USKA 4A10A 4CL3A 5JD4A 2ALJA 1L5OA 2ZRJA 3RVKA 1BAPA 1T5OA 2G67A 5JO0A 2Q8PA 2CJFA 2F8MA 4B6JA 1NV9A 1U5BA 5TQVA 5KU7A 1ECFA 2HQ1A 3MMPA 2JGLA 2QDKA 1UOEA 4UPVA 5AW2A 3C1AA 1WCWA 3KKOA 4DQ0A 1GSAA 1UPXA 4OQ4A 5FCDA 2YJTD 4FR5A 5BUQA 1HR0B 3MOSA 1R6AA 3UYLA 1Q7EA 2GMWA 2HK9A 4PBRA 1KEZA 2GZSA 3C4JA 3RSOA 4D80A 1Z5PA 1IMJA 2OB1A 1G59A 3OT1A 2IEZA 3HJNA 4EQZA 2DR2A 1NVVQ 1OYOA 4GSKA 5LB4A 4BLOA 4GP6A 1Q0HA 4DBLE 4TMTA 1SK8A 3FCUB 2O5VA 1VPDA 3LCRA 3UCFA 1ZN8A 5JARA 2OEPA 4CNBA 3CWZA 1L8AA 2XUGA 1E9VA 1RXCA 2C2YA 2E1RA 1NQVA 3NEPX 2WT8A 4OL0A 5D87A 1FF9A 4DNPA 4D44A 1WUYA 2CMGA 1XEAA 4IH1A 4JJAA 1Y7TA 1GYRA 3ZHRA 1HM5A 3HKBB 2QW0X 1WY5A 2H59A 2IDJA 4NYIR 2BTQA 4L74A 3RS5A 2Y9MB 16PKA 2QZZA 5LCXA 2J5RA 1XMIA 2FFJA 1FPMA 4UM9B 3L6DA 1WVIA 3K0HA 5EVJA 3VZCA 6NULA 3IQXA 3KQSA 5THQA 3K92A 2A5JA 4C7XA 4J16A 4TV8B 3T34A 2BPOA 4KLAA 3HKEB 4YQEA 2VG8A 4D4MA 4KLRA 1LI5A 4ZICA 2Q3DA 3CZ5A 4K9NA 5J2TA 3C5VA 5AK5A 1PJAA 4WINA 3UBTA 2YV2A 3HCRA 3ZU6A 1U1FA 1N6IA 2I65A 4Q66C 1W19A 4OP1A 5DHQA 5I9SA 3HUUA 1WU8A 2G08A 3E9MA 2C1XA 3UKDA 4R54A 3EEOA 1KZGB 1CNEA 1UBSB 2G0AA 4U8GA 2O3TA 1NQUA 4WX2B 3TTTA 2HOQA 3L4BA 4K9PA 5JZMA 2QBYB 4EUKA 4AZWA 1RZVA 5ECYA 2DUUA 4Q9KA 3SD7A 4EVIA 1RPZA 1UANA 3RLFA 2WF8A 3R3UA 1F4VA 1G3UA 1KWGA 3KTAB 4KTVE 3ZHQA 1AHIA 2ATEA 1S2GA 1OPXA 2Y1EA 3D1JA 1WCV1 2ERCA 1SUSA 2HUPA 2X4LA 1XELA 4R2WA 3H65A 2P75A 4EW2A 1DC4A 1V2HE 3N0RA 4YRDA 4RA9A 3EC2A 3MJTA 5EVCA 1QHGA 1S3SA 4C4RA 5B7QA 3HZOA 1Q17A 4Q4HB 1NBWB 4JR2A 5BYBA 4M60A 4PC2A 4HCJA 2G6BA 4I6JA 4P1ZA 4HV4A 1Q3HA 3MFQA 4QTUB 5FRDA 2NXCA 1RQ7A 3GLGB 2QRVA 3ILXA 1JJAA 3DTVB 2O8CB 3IDQA 1M1YE 4BJ1A 3SHVA 5EESA 1PNTA 1JR3E 1QF7A 1FLDA 3DD5A 3DF7A 1ETUA 2YJGA 1KAOA 2J9ZB 5JAHA 1HQKA 1NW4A 4E5SA 8OHMA 1RBMA 4GUAA 4KYTA 4OK3A 1C9YA 3KQKA 3KQHA 3CEAA 1JFFA 1S8FA 4C30A 1DIGA 2ZSAA 1T4CA 1U8EA 3N7UA 4HRAA 5DBFA 3U48A 4K6KA 4GOMD 5AJUA 3MG9A 1JVBA 1T5IA 4L8WB 5KWJA 2HREA 2RE8A 4QU8A 1ZUHA 1G20B 2B4AA 2XYVA 3FNRA 4GX2A 1OHHA 2W2MA 2GRJA 1V35A 1U1CA 3B6JA 2IV3A 3E4DA 3R0ZA 3TAXA 3N6XA 3QE9Y 2R8OA 3KLBA 4CUKA 3JSXA 4WACA 5JNRA 2X2EA 3DGFC 2ZS9A 5G53C 1S3FA 4M1MA 4YRBA 2RHDA 4ZA2A 1NC3A 5FPQA 2H2IA 1T1RA 4GC9A 1L5HB 3VNBA 3LO5A 2F3RA 3EE6A 4JBXA 4YI3A 5LWHA 5H4HA 5IUJC 3PC8C 4Z6KA 4ZI5A 4N9QA 3CVJA 1YI8A 5AUOB 2VOJA 4LXHA 3LHIA 1TPZA 1UJ5A 4HF7A 1XLWA 4YCAA 1TRKA 1YQEA 4TYWA 4C5CA 4DZRA 1RYNA 2P8SA 5TQJA 3WY9A 2GK6A 3JR3A 1JHUA 4KYVA 2DF8A 1AD2A 5AKZA 2C3PA 5C3MA 4NYJR 4EB8A 4MVJP 4RE6A 5BN4A 5KJ1A 1XYGA 2MTBA 3GNQA 3ICPA 2GXSA 3NYQA 2JAXA 3IRVA 3L77A 1CRQA 1YQTA 2X4IA 4Q34A 2QF7A 4R2IA 4RL6A 4WUVA 3G2PA 1D5CA 1F2TA 1RLMA 1V1MB 3OWXA 3DAYA 4NE7A 3WGGA 4HQOA 1FP2A 2DY0A 2HU2A 2YN4A 1YBMA 4M89A 1QK3A 1S7GA 4MV1A 4OGFA 4Q93A 4UPDA 3WGUA 2F7SA 2WVHA 5KJCA 3V55A 4RK7A 4P4NA 2B37A 2ZWOA 3I72A 3IKTA 5IT5A 1REQA 4KDFA 1V4VA 2VJBA 3H2KA 2IPMA 3EYWA 4YMUA 2ODBA 2VWPA 4QX6A 4XYEA 3AR7A 4ZI7B 4MMZB 4Z0TA 2YXNA 5HHTA 1MRNA 1ZH4A 2M6RA 3RJ5A 5F9HA 2DH6A 2UYYA 1FRVA 1P3Y1 2VJPA 2VRCD 2HYDA 3LNTA 10MHA 4WN3A 1H93A 3G8BA 1ZZEA 5GM1A 3VDMA 5L3SA 1Y42X 4IDDA 1OXBB 2FSVA 1DV2A 5AVSA 5H7XA 4C88A 4DDUA 4MYTA 4GOOD 1SKAA 1VJ1A 4YMGA 3DBLB 5EE9A 1GNQA 1Q11A 3PYXA 1APBA 1BU8A 5IJXA 1X1DA 2XMSA 1VMKA 2G77B 3QSGA 1H3FA 4UW9A 3KLOA 1W1IA 3QXHA 1J7KA 4YQFA 3KOWA 1CY8A 1ETHA 3LX4A 3KFXA 2ZYHA 1PD1A 5ALUA 1TL7C 3G3EA 3IOYA 4WIAA 1RZRA 4I3GA 2B34A 3E2MA 4JSTA 1SUAA 1YHYA 1PFWA 2ZVPX 4NNPA 5AHKA 4Y6QA 1KKMA 3GVCA 4PLYA 1AG9A 1ZESA 1KMIY 3R41A 4YDSA 3B78A 1EG7A 4TT8A 3VHXA 1FVFA 5A9RA 1VYTA 2YV4A 1AMUA 1V25A 3GJ0A 3FOCA 3KOMA 3RE1A 2GVDC 3FFTA 4KQ1A 4MUEA 1VGRA 3H11B 3CIFA 4QLOA 2J0UB 1ULHA 4QUGA 1F8XA 1WABA 3HDHA 4CFSA 1U9ZA 5BWCA 3T8YA 4KK3A 4ND8A 3T54A 3LK6A 2Z5VA 4UU7A 3WMFA 2B4QA 2Q5LA 1PT8A 5CM9C 1YKGA 5GWXA 2X0FA 4HLDA 2Q9UA 2Q46A 1I6WA 3Q98A 4KAXA 2DFLA 3WWDA 2J0EA