3W8RA

Mutant structure of thermus thermophilus hb8 uridine-cytidine kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
207
structure length
207
Chain Sequence
KPFVIGIAGGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDLALYLEHAQALLRGLPVEMPVYDFRAHTRSPRRTPVRPAPVVILEGILVLYPKELRDLMDLKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIVPRGGQNPVALEMLAAKALARLARMGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indispensable residue for uridine binding in the uridine-cytidine kinase family
doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Uridine kinase
total genus 69
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w8rA00
1XD9A 1N5IA 2ERXA 3K9GA 1XD2B 1ZNXA 4Q1AA 4CEIA 1BYUA 4KYIB 1HQCA 4P4SA 5AJYA 2HT6A 4DCTA 2IC5A 2PT7A 1GL6A 2C04A 5KHOC 4EPWA 2J7PA 2XITA 2OXRA 3THYB 4CGZA 2FWRA 1DAHA 2P0EA 1OH7A 1E9BA 1JI0A 4LOAA 2YOHA 1SZPA 5DNYB 3H2YA 5SZJA 1LY1A 5CJPA 5CIWA 2IEYA 2YWHA 2XXAB 1XEWY 5C1BA 2XZPA 4NCIA 1P7CA 2BJWA 2EFGA 1SULA 3KKMA 3ZVLA 4YXWD 4D4JA 3SYLA 2KBFA 5C46F 3W34A 1KIMA 1XTKA 2A30A 3BB1A 3GLHE 1D2NA 1GM5A 4GDFA 3B1WA 4DLWA 1TU3A 1NLYA 2V6IA 3L8YA 4V0KA 4CW7A 4CVNA 1E2JA 1ESMA 4LJ7A 1XWIA 5EP4A 3KQUA 1DO0A 2BMJA 3P20A 2ANBA 2EWVA 3RAPR 2AXNA 3FHTA 1Z0FA 2QMOA 1UDWA 3ZZUA 4BWYA 3U6KA 3NH9A 5K8IA 1NBME 3THOA 3W6OA 2BJVA 2F3TA 4ACBA 4DLYA 2CCJA 4Y0AA 1G7RA 3CB4A 2ZVQX 2WOJA 2P5SA 3WP1B 4PPNA 4B47A 2GXQA 2WJJA 5FPYA 2OM2A 1U2RA 4NCJA 5IF9A 1CTQA 4M0LA 4NMMA 3CWZA 4CEHB 1K5DA 2BBTA 1L7VC 5JSZA 1QF9A 2OXCA 4BRUA 2C03A 2FPMA 4LDJA 2CMKA 5JMTA 4ITRC 4QM6A 2VTKA 5D3MA 4PQYA 2MSDB 5FR1A 1NNEA 2ZRDA 2DPXA 1EFRA 2GETA 3ND9A 3W6PA 1U81A 3QEOA 1J8MF 3PCRB 4LV8B 4DIEA 5KSYA 3C14C 3P1JA 1UFQA 1W4AA 1Z6XA 4L4UA 2AL7A 1XTJA 2VHCA 3OEHA 1NI3A 4HB4A 2D4HA 5HKKD 3ECCA 2YWGA 3AVQA 1E9FA 1I4TD 1D9ZA 4PPFA 5HE8A 1TADA 1W36D 2F9MA 3OE7A 4M1KA 4LPSA 1XNJA 3OFND 4V0ME 5F3WB 1HTWA 2OCPA 2BEJA 2GCOA 5FPTA 2P2LA 4XD7D 4Z1MD 1YKSA 2IUSA 4W5WA 2IUTA 3K9HA 4P4TA 1E2IA 1G19A 2ZXUA 2F55A 4TQUS 3PUWA 1L4YA 3U60B 2JASA 4HAUA 5JEDA 3DL0A 3T34A 3QKUA 1EFTA 4K46A 4QNMA 5LB2A 2DYKA 4WZBE 4Q18A 4IW3B 4DDTA 2EFHB 1KK0A 5CB8A 4TLEA 4NHOA 2D06A 4WZAE 1SVWA 2YZ2A 4X8OA 5EUMA 4XSHA 3QJYA 4F92B 3ZS9A 1D6JA 1G3MA 1QVRA 1Z2AA 2KBEA 3R9WA 2GK6A 2A5YB 5DI9A 2IF2A 2OHFA 3RWOA 1G7CA 4I1OA 5G40A 4YDHB 2QA5A 1T0JB 2OFWA 4JSYA 3G5UA 1ESNA 4W5JA 1E3MA 2PMDA 4Q9JA 2ZS9A 3J81k 4KBFA 3EG5A 5L3VA 1J90A 1UBCA 4OK3A 3TLXA 2ZRJA 3CF6R 2GEVA 1X86B 2BMFA 1FL9A 3NTUA 3K09C 1KMHA 5EP1A 1KNXA 2BDTA 2ZJ5A 1JEEA 1NN1A 2ECKA 2VHQA 3EC1A 3X1WA 1RPZA 1G4UR 2WJYA 2G3YA 1KI6B 2KB0A 2REOA 1NN3A 2Z83A 2KE5A 3CNNA 1CLUA 2A5GA 4QFMA 2CCKA 4Q48A 5J4LA 2GDJA 1NVUQ 4JLNA 2H92A 3Q8XB 3T1OA 4M1MA 2DFLA 1ZRHA 1CP2A 5B64A 2H17A 5AUNB 2AKYA 1P3JA 4CDGA 1MR3F 1PV4A 3BH0A 3H0KA 3RDPA 1SXJA 3BH6A 2FEMA 1G16A 1QHNA 4AKIA 2IYWA 4C0BA 2J46A 1KHTA 1M74A 1OXSC 5JBQA 1GRRA 3ZQ6A 1EFUA 5SZKB 2FZ4A 1FMJA 3DZ8A 1N6LA 3SFZA 5LBIA 2JA1A 3N2IA 1Z06A 721PA 5J4VA 2ZE5A 4RZUA 2WICA 5FUYA 2ZRPA 2ZM5A 1HURA 2V7QA 2YV5A 3QPWA 3ZZTA 3VQTA 3K0CC 4X8MA 1ZYUA 2BIFA 2IXGA 4EIWA 1W49A 1FNNA 2AXPA 4G5SA 4WW0A 4XH9B 2QPTA 5CK4A 4UXJA 4NYMR 2AWNA 4BUJA 4Q00A 5KUTA 3I1FA 1KI4A 2KSQA 4ON9A 2BBSA 5AJVB 2R6CA 2VSXA 2HV8A 2XOKD 3QXJA 4NCNA 2OCBA 1AA9A 1AJEA 2NO7A 1X3SA 3Q5DA 4MITA 3EX7C 1BKDR 3QKRB 3NHBA 4GRAA 3T1VA 4L16A 1YZTA 5J4KA 3PEWA 1VTKA 4X8LA 3LW8A 3KKPA 2GXAA 2EWWA 4TYPA 3K0SA 2ZUDA 4KVAA 5H68A 4Q9LA 2BBOA 2FN4A 4NKRA 1XXHE 2E1RA 2B8TA 1XU4A 4BPBA 3RRZA 5P21A 1ETUA 2QRNA 4KFUA 4WOPA 5JRJA 2DFNA 1CRQA 3VAAA 3B1YA 5FTKA 4DCUA 2IS6A 3WHLA 3GD7A 5CM8B 5DN6A 4C9BA 5IRCD 3AVUA 1E79A 5DHAA 2GILA 3EIQA 1MRSA 2C96A 4NE2A 4PC1A 1BYIA 4B6FA 2WVJA 3LBIA 2WMOB 4ABYA 1AS0A 4DEYA 1GTVA 2ZRCA 2EYUA 4ZCMA 1DAKA 1LF0A 1QDEA 3EC2A 4ASUA 1P5ZB 3KL4A 3ADCA 1R0ZA 4AIIA 4LI0A 3A8TA 3IEUA 1UM8A 2ZS8A 5KNDA 1AZTA 1WQ1R 3VX4A 3S1AA 3LXRA 1NVVR 2F43B 4Q21A 2ZRNA 1CR4A 2IYTA 1G5TA 3TMKA 1TEVA 1TF5A 2CCGA 3RS0A 1BO6A 2PJZA 4OHXA 1XPUA 3CR7A 1LVGA 2QQ0A 2R62A 4Q66C 4RD6A 4O3MA 1W2GA 1D8TA 2B21A 1UADA 1PVOA 4JT4A 3L0SA 4DSOA 2OBLA 3PR1A 3IBGA 4B2PA 1JR3E 3JVVA 3SI7A 3L0PA 4C7OB 2D3WA 3IHLA 1RFLA 4JVSB 4MA4A 3RWMB 4MKGA 4HZIA 2OUKA 5FI1B 5JI2E 4PX9A 4C0LA 3VKWA 1VG8A 4LJ6A 4A92A 4FN5A 4GZMA 1W5SA 4DSNA 3EZ6A 1DS6A 3SC3A 2QZ4A 4BASA 1W4RA 4C0JA 2IS4A 1JEDA 4MGZR 4A0RA 4A1FA 4DVGA 1YR9A 3MMPA 3ADDA 1Q22A 3WYGA 4HB3A 1VYTA 4HAWA 2F7SA 2P65A 2NO0A 2W6ID 2KI5A 3ADKA 4DBLC 4PO1A 3EWSA 4PQFA 1GWNA 4Q02A 4IOKA 1RC8A 1T6NA 1E9SA 4GBMA 4IDHA 1X8KA 1E99A 2I4IA 2ZI9A 4PHFA 4FMDB 4Q1BA 4Q4LA 3SN6A 4E09A 3BFVA 3A1TA 2IYZA 2G0TA 1AGRA 2PH1A 4DKXA 3RS5A 2HYIC 4URWR 4L15A 421PA 4ESVA 1P2UA 2O8BB 1H8EA 1XBTA 4R7ZA 4TMKA 4EPYA 1F3OA 5JI3E 4QBHA 1N0WA 3SDZA 3R20A 1DOAA 2DWQA 1KOFA 1OFIA 2WPDA 2ZROA 1I4LD 4G5QA 1RZ3A 2F1IA 2GVDC 3AKEA 2ZR7A 1EK0A 1UDXA 4TZ0A 4DLZA 1X1SA 3RS3A 2VHJA 4O25A 5CM9C 5BWMA 4TZ6A 2VHTA 2WJHA 2CHQA 4M53A 5J4YA 1AZSC 1CRPA 3GLIA 1TQ6A 3CR8A 4DWJA 2HUPA 1ZD8A 1ZM7A 2OV2A 1G1MA 3CM0A 4K81B 4F4IA 2FSGA 1XCPA 621PA 1GKUB 3QUSA 3VX3A 4BEJA 4EKDA 1FNMA 1MOZA 2RKOA 3WMEA 4HZUB 1OIXA 3UANA 5FTLA 4EPRA 1G8FA 4WIAA 5G3YA 3BD9A 1OF1A 3OHMA 1U98A 1Z0IA 2IWHA 5TVKA 3B85A 2OAP1 4BE7B 3FOZA 1DE0A 1JECA 1FUUA 2QM7A 2VYFA 4HEJA 4IXNA 2FOLA 4OQXA 2PZGA 4PFSA 4RD4A 4YDSA 2ZE8A 1EFRD 5KDDA 3B7GA 1NKTA 4ZKDA 3T35A 4Q4AA 3BH7A 5L3SA 3RANA 1W4BA 2ZRIA 2LWIA 3H84A 1UBGA 4B3FX 2KJQA 5EP3A 2UKDA 3IGFA 4LYJA 5L8VA 2AWOA 3MLEA 3X1YA 1IY2A 1W4CA 1KAOA 3C5HA 4NYMQ 3ZQJA 1MABB 3KTAA 4V0LA 3CX6A 5HR5A 2EU8A 5EUQB 1F60A 4PC3A 4EJSA 1ZD9A 1OJLA 5FH9A 4PZZA 1KMQA 4A0GA 2J7KA 5KDLA 2QSYA 3EIHA 1N6PA 2AD5A 3AVWA 4I4LA 1CR2A 4QBGB 1ZW6A 4RZ2A 4TMVA 4V02A 1II8A 1KO5A 3WNCA 4TT3A 5A5GA 1MKYA 2ZI5A 2WWYA 2NZJA 4US1R 2QAGB 4QXAA 4HSEA 5B57C 1EXMA 4FMCB 2A5JA 2HCJB 2IEZA 5HCIA 3MCAA 1DBSA 3I4LA 1F2TA 4CEIB 3A1SA 1CJMA 1XTSA 2OZEA 3KUDA 1X1RA 1KI9A 3VR1A 5FI0B 2X19A 3NVAA 1A82A 3KX2A 2F43A 1G8HA 2VP2A 1M7BA 5KDOA 2KWIA 2FA9A 4DB4A 3AP3A 3CWQA 4DT1A 2BOVA 1GIAA 1Z0AA 5CK5A 1SQ5A 3IQXA 2JJ2D 1FP7A 3CH5A 3MWJA 4HLUA 4XTRA 3VMFA 1QG2A 3KDSE 1QRAA 4ZI2A 2GAAA 4KV9A 5C18A 4PAOA 3QSYA 1NLZA 1XTIA 1W5TA 2IYLD 2RGGA 2ZTSA 4HAVA 5J40A 1JNYA 1XXHA 1E2PA 2OFXA 2DHRA 1C4OA 1S8FA 4NL4H 1EGAA 2H5EA 2JDID 2FE4A 3VR3A 1U8YA 3PUZA 4M22A 3L82B 5DN6D 1VG0B 2CK3A 1DAIA 3GEEA 1P73A 4JIMA 3C16C 1TU4A 3GLFE 4ERNA 1NN5A 2ZYVX 5BYKA 2NOAA 3FTQA 5HTKA 5BN3A 1N5KA 3O8DA 4MGIR 4TYQA 2IX3A 4O2LA 3PENA 4KCGA 2GZAA 4IVPA 1G20E 2XJ4A 4E5UA 3Q72A 2GTPA 3W8RA 2W58A 4ASUD 3THXA 2QAGC 1IXSB 2ZRKA 3F0TA 1G7SA 4MRVA 2VH5R 4M21A 3I32A 1E9CA 1G41A 4L9WA 2C77A 4TLDA 4EFNA 2AX4A 4Q4HB 4ACAA 1TQDA 2PLRA 5DISB 4CT5A 1B23P 1P9WA 3DMNA 4XOIA 1TF2A 1GSIA 1VHLA 3W3ZB 2FFAA 1IHUA 2ZREA 2Y8EA 2EFDB 3KXIA 1JAIA 1AQUA 3UMFA 3HU1A 4PSAA 5J47A 4F7WA 4EAQA 2ZR0A 2XB4A 3S1AB 4I1UA 4UNNA 4MRSA 3PQCA 3DMDA 4XD7A 1TAGA 4Q47A 3AF3A 4LCBA 3GLGE 1KY3A 1XFAA 4LRWA 3AGPA 5LDDC 1QHSA 3IPXA 3L2OB 2HF9A 2OBNA 3F8TA 4LSGA 1FFHA 3ASYA 1YRBA 3R8FA 2VP5A 4KLZA 3LH5A 3QPUA 1JPNA 1ZM9A 1E96A 1E9EA 3QG1A 3TGPA 3B1VA 3UXMA 1DARA 1RYFA 3M6AA 3B6EA 2ZVPX 1S1MA 1HA3A 3X1DA 1E2DA 1ZM3A 4TWZA 2NPFA 1IXZA 3SYNA 2G83A 1SXJB 1ODFA 2TMKA 2B7BA 4NDZA 4A6PA 4B48A 2A78A 3I62A 4Z8YA 1R5NA 1ZU5A 1Z6GA 4HLDA 4PC6A 3KQLA 1T8UA 5SZHB 1DAEA 1KK2A 2BHRA 1TX4B 5KSZA 2NPIA 2AFIE 2XEXA 4M1YA 3U4QA 4A6XA 1ZNWA 4G5RA 2ZE7A 4V0OA 3U44A 2QEQA 2QORA 5H1YA 2DFKB 4FMDF 2A9KA 4Z54A 4XVQA 1CULC 2X8AA 2ZAOA 2ZE6A 4L5BA 1XCMA 1ZUIA 2ORVA 3LLMA 2VHUA 1KKLA 1HY3A 3DM9B 3IILA 1ZC4A 3PG5A 3Q9LA 3N5CA 3ZYCA 4JKIA 4LBWA 3EZFA 3PEUA 1E2FA 1ZUHA 1YZKA 1ANKA 4MDEA 1L2TA 2C2HA 4IOMA 3C7KA 2P5TB 2ZAMA 2RGXA 2A7QA 2YWEA 4B3DA 4CIDA 1IY0A 1XJ0A 1SXJD 4UNPA 2QAJA 5C4GB 4UNQA 2JLZA 2ZJBA 1SKYE 5SZIA 4JSTA 1XPOA 3TKLA 2FJUA 4DJTA 1KKMA 4WXRA 1H8HD 2P3SA 3P4XA 4LV6A 4NBSA 4GMXA 1D5CA 4BFVA 2JEOA 4HZUA 1KTVA 2OAQ1 1T3HA 2ODWA 4IHQA 2X2EA 3KKOA 2ZYUX 1KDOA 2J7PD 1HE8B 1FQJA 1EX7A 1KMHB 1OPXA 2ZJ8A 5CLLA 3RSLA 3REFA 4A4DA 2N46A 3SQWA 4M1SA 2G1JA 2RGNA 2A5FA 1OXUA 3PVSA 1E1RA 2D74A 4LUCA 3QOFA 3ZVMA 2JATA 4BRWA 1Q3TA 1N25A 1YHNA 1KI7A 4Q4AB 4LZZA 4YXWA 4BFTA 3SHFA 1XTQA 1WA5A 5AUQA 4RJLA 1FQKA 1KJZA 4C30A 2A2ZA 2OG2A 1EWQA 5KOYA 3FVQA 1LNZA 1R4AA 1YR8A 1UF9A 1W0JD 2N42A 3L8ZA 2NZ8A 3B1XA 4OJQA 3GJ4A 3PJRA 2D7CA 2ZSFA 1CF4A 2QP9X 3IIMA 3W90A 5JSZB 4ZCLA 1SVSA 4LYHA 4TQ9A 1XD8A 4OBEA 3TSZA 4BFUA 2HYDA 1N0UA 1P60A 4G5GA 4C0KA 3GJ5A 2VSOA 1NF3A 3ZVRA 4BFYA 1B0UA 3HR8A 4B35A 1OFHA 4OHVA 4B3BA 4IDNA 1Z8FA 3CRVA 2JDIA 3GP8A 3VR6A 4M4SA 3RLFA 5G53C 4F38A 2FSIA 4D4KA 1AKEA 3EW9A 5KSOA 3EWAA 1JQLB 3B2EA 4ARZB 4Q1FA 2AHOA 1DAGA 4V0NA 1JXMA 1BIFA 1G3UA 2ZUCA 3EXAA 4DDUA 2OEPA 1PLLA 2GK7A 1JR3D 1YR6A 1HUQA 2V3CC 3K0CA 2IS1A 1P2SA 3CH4B 2D2EA 4AK9A 1SXJE 1YU9A 4IEEA 1ZC3A 2SHKA 4URVR 1W0KD 2QP3A 3NH6A 3HYRA 4Q9HA 1HH4A 3AVPA 2ZJYA 4AY2A 5HZHA 2VF7A 5CDFA 3EZ2A 3ZDQA 1P72A 2O8FB 2BV3A 1N6IA 1TQ4A 4DCSA 3OFNA 3AVYA 5GJVC 2GKSA 2G88A 1KI3A 1EX6A 2FF7A 2GNOA 2NGRA 2GESA 2X1VA 5AR1A 2F1HA 3HP1A 1E1QA 4LBVA 4QJ4A 3AKCA 1M7HA 2WJIA 3RHFA 3FHOA 1TPZA 3ZIAA 5IT5A 2PLFA 3QPVA 2QG6A 1RRCA 1GL7A 4JLKA 2B92A 2RGDA 4KAXA 4LJYA 4Q7MB 1KYIA 5JCPA 1XB2A 1HYQA 1XEXB 4P33A 1RRPA 1XEFA 2AR7A 4KU4A 1QG4A 1W44A 4P0TA 3PFIA 2EYQA 3G82C 2WSSD 3LXXA 4LK2A 5J5CA 2DWPA 2B7CA 2HLDD 1A2KC 1ZINA 5FOVA 3K70B 1W47A 2CL0X 3E1SA 2LKDA 5LD2B 5CDFE 5AWFC 2QT0A 2PCJA 4IEIA 3MWYW 1OIVA 3V4FA 3JZMA 2V8OA 4KSBA 1NBMD 4R2HA 2PL3A 3HR7A 1KAGA 1WF3A 4RZ3A 1H8ED 3MRSA 1F2UB 2VIIA 1NMXA 1W2HA 1P4SA 3W8NA 3Q85A 5HPYB 3FFAA 1ZUNB 3PUXA 1E0AA 3CUEF 4PSVA 4HLQB 4KODA 1I2MA 4TLCA 4DB2A 2VL7A 1T5IA 1P62B 3B9PA 4CZ2A 1ZNZA 2J0UA 2IT1A 3FKQA 2ZRBA 1WB9A 3QENA 3NBZC 3P4YA 2J0QA 3THWB 1VDZA 3F3YA 4US2R 2GBLA 1OXXK 3I72A 3QY0A 4B3XA 3RC8A 1Q57A 5TV2A 4KFTA 4LYAA 1G4AE 1YR7A 4XWOA 4LBZA 4URZR 2I1VB 1QHYA 2QAGA 1R2QA 3NKVA 4RD0A 3R7WB 3K0AA 3KFXA 4M1TA 2FMXA 2V4ZA 1KSGA 3QXHA 2C95A 1WXQA 1NL3A 2QMHA 4TL6A 4Q7LA 3SZRA 1UKZA 2XSZA 4K8OA 3RNLA 1D9XA 2Z0MA 4NYJQ 1N2CE 4TSFD 2NG1A 4C7OA 5FUXA 2PJRA 4JYBA 4A8JB 2YYZA 1X6VA 3LRPA 1EFHA 1P2TA 2LKCA 4NPHA 4PR0A 2FGJA 2D2FA 2RGEA 4B71A 1KK3A 2CL7X 2GZHA 5BN4A 4BLSA 2JLQA 3EA5A 2WWWA 3B78A 1CS4C 4O0MA 2J9RA 2ZI6A 5EE5B 1F48A 3I8XA 4GL2A 1R6BX 2MMCA 4DCVA 2G6BA 1S1CA 2NTYC 4QRHA 2GJSA 3UKDA 2VP4A 4BFZA 4B3GA 4LJ5A 4B3CA 1EG7A 3GLFB 2CE7A 2F9LA 2GVZC 2BKUA 4ZDWA 4F93B 5FOSA 3HJNA 4A2PA 1TNDA 3ETLA 1VCNA 4US0R 4BGDA 1BS1A 3GJ7A 5DO9A 5G3ZA 4YONB 2V1UA 4G5OA 2IYSA 3RS7A 4QL3A 3BFXA 4YMSA 2ONKA 4TL7A 4D4MA 2F1RA 3U5ZB 4GOJA 4V0MA 4D26A 4JJZA 2PEZA 4NU0A 2IYRA 1IJFA 3TSOA 1KDRA 1NJFA 1ZJ6A 3NWJA 3LQRA 1FTNA 1E9AA 4RD1A 4JL6A 3FDIA 5CIQA 2MSCB 3LO5A 3SEAA 3TNFA 4CYMA 5C2JB 3DEFA 1U90A 4DC9A 3VKHA 1ZIPA 4TYWA 1E98A 3TUJC 3QF4B 4AKEA 2RGBA 5KPJA 1ZCAA 2BCJQ 4NCKA 3T61A 4PAQA 1JR3A 2REBA 4MKHA 1S0UA 2O8BA 1ZM2A 5GADl 5KU1A 1NBMA 3TVTA 2QMUA 4QBFA 4NYIR 2H18A 4KVGA 4DUGA 4B2IA 1K6MA 1R8SA 4PANA 2ZI4A 2W6JD 1JJVA 4EFLA 2IS2A 2YC4C 4QGHA 2OSBA 3VU9B 3AEZA 2J0SA 1Z08A 3KUCA 5EP2A 2F3RA 3VKGA 1X8JA 2JJ1D 2IHYA 4D81A 4DLRA 1OSNA 4BEBA 1KO8A 4JMPA 3UMRA 1TQ2A 4R9UC 1IJEA 3H4MA 2CJWB 1W36C 1GNRA 4JVMA 1T5LA 2HCBA 3ZIAD 3QEJA 4GNKA 3A36A 2GJKA 3W5JA 4IDOA 3P26A 3Q7PA 3ZLJA 1R0WA 2OLKA 1AK2A 4XSGA 1HT1E 1TUEA 3D3QA 3GJXC 2NO1A 4ZDIA 3KXLA 1SXJC 3UATA 1E4VA 1GZSA 1P6XA 2MSEB 1Q20A 2LCFA 1IN7A 3KB1A 4NH0A 2VLIA 4H1VA 1RE0A 4OI1A 3P32A 1M6NA 4PQRA 1ZNYA 3RC3A 3GPLA 3ZJYA 4A2QA 5F9FA 3BBPA 3MWKA 2QT1A 3MWLA 3LA6A 5EE3A 3V00A 5FBVB 4LHVA 1AGPA 2J0UB 1VMAA 4Y0VA 4BZXA 2ZYTX 1Z29A 4LY6A 3GLGA 3AVXA 1NMZA 5KNCA 3DM5A 4TN1A 3EZ9A 1JR6A 2O0HA 1FX0A 1ZIOA 3B60A 1QHXA 4PPQA 4PHTA 1KJYA 2FSFA 2YOFA 4TLBA 4GOKA 1XMVA 2WAYA 4LYFA 2ZSDA 4JLMA 2O8CA 4JLJA 3VNUA 5L3QB 3KQNA 3GFTA 2R65A 2C9CA 4MUAA 4WBSA 2XAUA 1XPRA 4DDVA 4N3NA 1MO3A 4Q1DA 4RFSB 3BE4A 4MGYR 1E6CA 1HT2E 5FBRB 2REXB 2PZFA 4JLBA 1TUIA 3K9NA 2YHSA 4RCYA 3A4MA 1CJKC 4P4SB 4MDFA 1JAHA 3B13B 1OHHA 3AQ4A 4POAA 3KFVA 1LB1B 1Z0DA 4WXPA 4ZO4A 4BLOA 2NQ2C 4RKEA 2ZUBA 3QXCA 4YC7A 4QG7A 1VIYA 5JHHB 3CZQA 1RW4A 3DPUA 2ORWA 4TT3D 3SU8A 5EJEA 4ZV4A 1SHKA 4E03A 3FYHA 3EPJA 2WM9B 1CJTC 2OLJA 2OILA 2H8KA 3THYA 2QENA 5FOWA 4TMXA 1NLFA 3MAAC 1ZMXA 4GP6A 2QI9C 5L3RA 3GJ0A 3UG6A 1MV5A 4YMTA 2GJ8A 3QF7A 4TMTA 5K8UA 2Q21A 4DLTA 5KNBA 1Z47A 2RH5A 4G3XA 4H9GA 3GLIE 1WBBA 5KO2A 2AK3A 1NIPA 4LC0A 1T3LA 4R2IA 1NVXQ 4D4LA 5DYIA 2CXXA 3RS4A 2H7VA 5FL7A 2QN6A 1GAJA 4HYYA 1U8ZA 2JJ1A 2PX0A 2ZU6A 1DAMA 5K8TA 1US8B 1IONA 1KDPA 1LW7A 3RRNA 4BFXA 1Y3AA 3PEVA 4YLGA 2F1JA 3IIJA 3CF0A 2C99A 4TTPA 2VP6A 2JAQA 1JPJA 3LWNA 4FIDA 2R2AA 4WVFA 2FZLA 4GFDA 5TDHA 3AP2A 4MQBA 2WTUA 1DG3A 2QTHA 2DCUA 4JLDA 4PPGA 1SGWA 1S96A 3OIVA 4YQFA 5D3MB 4TTQA 2ZRHA 3U7EB 2CNWD 1QZXA 3U3OA 2NIPA 4FI3C 1YZQA 5B30A 4IFBA 1E1RD 2BM0A 3MG9A 2BMDA 3SJAA 2X2FA 3QXSA 3E70C 3A1UA 4KSCA 1GRNA 3KKNA 5DI3A 3OE7D 1AM4D 4UXIA 1N6NA 4XTCS 1Z0JA 2IHBA 2WWFA 3EZ7A 4F4CA 1LF5A 2QE7A 1UKVY 3NHAA 1ONBA 4BQSA 4CT4B 3CO5A 1WCV1 4CEJA 2F6RA 3NXSA 4DEXA 1ZU4A 2C98A 3QI2A 3CNOA 2FH5B 1VECA 4X8HA 1XXHB 1E0KA 3TW4A 4ZKEA 3I5YA 3HDTA 2HXSA 1Q44A 4HUQB 2JJ2A 3WNDA 3X1XA 3A58B 3KZ1E 4OHYA 5E95A 1G8YA 3AVVA 3TRFA 5FUWA 2DB3A 4QKQA 2BEKA 3H1TA 5GVSA 3MUFA 1NIJA 2VPPA 3D8BA 1N6HA 2O8EA 2EVWX 1UKEA 5E7JA 5TY0A 1QHHA 3VHXA 3QKTA 2XZLA 3EASA 1XCGB 1Z6AA 2FU5C 1Z83A 3MD0A 3OAAD 5IK2A 2ZRGA 1F2TB 3T5GA 2GZDA 1E2MA 2IXFA 3FGNA 2WWXA 3NBFA 1G17A 1ZM4A 3AKYA 3BXZA 2GBLC 5FTNA 2ZSEA 4D80A 1FP6A 3WMFA 4JJKA 4XWKA 1DO2A 2UZIR 4AI6A 4LPKA 2FNAA 1WDTA 3OZXA 2XZOA 1KZGB 2YWFA 1XX6A 4JBWA 4OQMA 2X77A 4R98A 6Q21A 5LB4A 4F91B 1Y63A 1T3SA 4N0EA 3R9XA 1U0HC 3LQQA 5FR2A 1BMFA 1IN8A 1XD2A 2ANCA 4XIGS 3WHKA 1TMKA 1G5RA 1HE1C 1FOEB 3A4LA 3FFBA 4RZXA 3VU9A 2CK3D 4C0AC 4Q03A 2DWOA 2CHVA 3RRYA 2FFHA 5FL7D 3GQBA 1GRQA 1GKIA 1KI6A 1NG1A 3GJ6A 4FCTA 3SOPA 2C5LA 4P31A 3IO3A 3DOFA 4A2WA 1O87A 3ZZ0A 4LJ9A 4NTZA 3BC1A 4M9XA 1U99A 5FOXA 4QJ3A 3AF4A 1KO1A 2OESA 2QU8A 4B73A 3BIFA 4QHTA 3ND8A 4RSGA 4W9MC 2PMKA 1ZCBA 4LV5B 4DUGD 2CDNA 3IQWA 2G77B 4JL8A 3OF5A 1OYWA 3SE0A 4BECA 4IDQA 5BW8A 4LHZA 4BFSA 4LC1A 2P6NA 4UJ5A 3KXKA 1Z22A 5J4HA 4HB2A 5BYJA 4OK6A 2B6HA 4KBGA 1KI8A 1VCMA 1KSHA 3TW8B 3KJHA 3VFDA 2OCAA 1W0JA 1GNQA 1U94A 3AB3A 2GCOB 3K0EA 3K0FB 1IN5A 3BK7A 4HUQA 1YZUA 4Q1EA 4HAZA 4PZLA 3WP0A 1CEEA 3CRQA 4D6PA 3V9PA 1NY5A 1QHIA 4HATA 1GKYA 2QE7D 4NYIQ 3I5XA 4AD8A 2ZS7A 2CLSA 2WSMA 2VSFA 3QXXA 1U9IC 2P67A 3M1IA 1DELA 4FD2A 1PJRA 3NG1A 3TQCA 1FZQA 3Q7QA 3NBXX 3C8UA 3D7MA 4AYTA 3PV0A 4FCVA 3BORA 1J70A 3R9IA 4DLXA 1G8PA 4OJKA 2EW1A 5GJCA 5ELXA 4D25A 1IN6A 3C15C 4XVRA 2J5XA 1NVWQ 2H1LA 4N1AA 2IF0A 5DSZA 3I8SA 3OEED 1XEXA 821PA 5FBLB 5FOUA 1VYVA 1SHZA 1GDDA 2DY1A 2HDNB 2J1LA 3MFYA 1F2UA 1UKYA 2HF8A 4GSYA 3C5CA 4IVQA 3CPEA 4I81A 2ORIA 2V7QD 1NY6A 2JIZA 4Q01A 4FWTA 4KO8A 4HAYA 4CEJB 2RGNC 2ASEA 2IUUA 2ZI7A 3SBEA 5IK2D 1OT3A 5EZ6B 4FMBB 4EPXA 2O8DA 1NSFA 2C8VA 2RAPA 3M0EA 3QKRA 3A6PC 4ZPXA 1H8HA 2FGKA 3QF4A 3AKDA 3HPRA 4OHZA 1IXRC 4LGMA 1A2BA 3O47A 2G1KA 2QY9A 1XF9A 3DKVA 4Q4JA 2CVFA 3WBKA 4RKFA 2HT1A 2FFBA 3IBYA 3A1VA 4UNSA 4DHEA 1A4RA 4AC9A 3O8RA 2YOGA 1UBFA 2ODEA 2WBLC 4M1WA 2BKEA 4Z8XA 5TMPA 2O8CB 3CPHA 3B1ZA 3OIUA 1BOFA 1KDTA 1OYYA 1AS3A 5D3QA 3NDBB 5JWOA 1AIPA 4NP6A 2OO7A 3C4JA 4EPVA 3D6TB 3U7FB 3BAFA 4CRWB 1S3GA 5HE9A 4UKDA 1S2MA 1XJCA 5FFMA 3I3SR 1Q0UA 1Q12A 4TQAA 3Q5EA 4Q4HA 3R8CA 5LD2C 3PEYA 5UKDA 2J3EA 3GMTA 3WMGA 2AFHE 2PZEA 2OFOA 2O52A 3K9LA 5A4JA 1E79D 4IXMA 2ZYWX 1KZ7B 2W6IA 1YQTA 2V54A 2WJVA 3O8CA 3IEVA 3EPLA 4IOJA 3LV8A 2IK8A 4AURA 4PC2A 1IY1A 2VP9A 4YMUA 1U8AA 2IYQA 2ZETA 4QHYA 4HDQB 2BMEA 2GEDA 1XMSA 2QTVB 4QGFA 2QGZA 2CL6X 2GCPA 1E1QD 4PTLA 3AVOA 1N6OA 4AKGA 3HU2A 1G21E 3T1TA 1WE2A 2ZJOA 4I99A 2H57A 4HI0E 2FG5A 5JS7A 2JLYA 2J41A 2O0JA 4BZQA 2J45A 3ONWA 1UEIA 4RVCA 1G3IA 2RMKA 5FPSA 1MABA 1T91A 2UVQA 5IHPA 1E2KA 1OKKA 3LBHA 3OAAA 4KLNA 5EXTA 1DADA 2AKAB 3WBJA 1E0JA 1R0XA 3IKJA 3K70D 3WY9A 3GCGA 3NC1C 2R9VA 3LVRE 3VTKA 1GVNB 2CE2X 4A8JC 1QHGA 3QKSA 5CB6A 1W46A 3JZAA 4DLVA 2WIAA 1E2LA 1WP9A 5L3QA 3IO5A 4P3YA 2E9SA 1P9RA 2FV8A 4U7DA 4Q9KA 3GJ3A 1G18A 3GEHA 5DIFA 5F2EA 2K5UA 4FWIB 3AGQA 5CITA 5F98A 5EXPA 4B32A 5FTMA 1IOZA 4G1UC 4A36A 1GILA 2GAOA 1KK1A 3U3JA 4EFMA 3UK6A 5E4FA 1RRGA 3LLUA 4DSTA 1E4YA 3DKPA 1T9HA 1MO4A 1Q21A 3GLHA 2JCSA 4I1SA 1XTRA 4TTRA 4TYNA 4WA7A 3A1WA 3SQXA 1E9DA 1A7JA 1DAFA 3DOEA 2NMVA 4Q7JB 5AJZA 2QGNA 3TAHA 1UBEA 2VEDA 1OE0A 1M8PA 4E07A 3SR0A 1E2GA 2EFEB 3U3KA 2GF0A 1N6RA 1FMLA 1SVKA 4RY2A 3WYAA 5F9HA 2C9OA 2O8DB 2CNWA 1EESA 4JKYA 1RIFA 2G9NA 1Z2CA 2GXSA 2V6JA 4TL8A 3IUYA 1G6OA 1T8TA 2XSZD 3D31A 3T1QA 4UJ3A 5LPNA 521PA 4OQLA 2ATXA 2QBYA 1ELOA 2HEIA 1R5BA 3AM1A 1US8A 2WKPA 4GMDA 4YMWA 1QHHB 2QPAA 3CRW1 3CIOA 3VNVA 3U3RA 1II9A 5FPHA 3KTAB 3QBVA 2BVNA 4OQFA 2C9YA 2FEOA 2IYUA 5L3SB 2MMGA 1S4QA 1T4GA 2Z5FA 5BQ5A 4PO9A 4B74A 1FW6A 1OB5A 2A5DA 3UPUA 3IDQA 1XJQA 4GOXA 4A0HA 4DCNA 1MT0A 2ZSAA 5FUVA 5GJBA 2QQEA 2QSZA 2CVHA 3LBNA 4QHSA 4E22A 4FINA 3U4QB 5AJXA 2XNDD 3CBQA 4D2IA 5JECA 1J2JA 4URYR 3WXMA 1W36B 4IJMA 2GRJA 5BN5A 2ZRLA 3A4NA 5DI3B 4UQOA 3AF2A 1SVIA 3SYKA 1G8GA 1N3BA 2I3BA 3WRXC 3U6BA 1OLOA 3TSWA 2PCLA 3F5FA 4XVUA 4CEHA 2J0VA 2RB4A 3FE2A 4RD2A 3MSXA 1N5LA 2ODNA 3TUZC 3KQHA 1JQJC 1PUJA 1YZNA 4RFSA 4DXAA 2WMNB 5KYKA 1TL7C 1R10A 4OYHA 4ZI3A 3HYTA 1E9RA 3MJRA 5CJ2A 2NO9A 3TIFA 2W00A 1C9KA 3OIWA 2BBWA 4KFSA 3OESA 4LJ8A 2DR3A 2PBRA 2W2TA 4DT1B 4ARZA 3EPKA 2BM1A 2R6AA 4MYCA 3BJIC 1OFUX 2QRZA 4KI0A 2GJAA 4NZYA 3R7WA 2ZSBA 1R7RA 3K0AB 4DLUA 1U9IA 1OH6A 3KKQA 4D0GA 1A5TA 4M2LA 2AK2A 2EFCB 2WOOA 4AYXA 2UZ3A 3L0OA 2ONJA 2WWHA 2AN9A 3FPAA 4AKHA 1N6KA 1DG1G 2ZI3A 2J87A 3ZVNA 1OW3B 2V1XA 2V9PA 1M7GA 3NBYC 1CJUC 4EJSB 2NO6A 4AG5A 1GL9B 1NVVQ 2N1BA 3BFKA 3PIRA 4PSKA 1ZBDA 5AJWA 1VYUA 1FUKA 3W6NA 4PAMA 3U3MA 3OEHD 2ZJAA 3K8YA 1KO7A 1MH1A 4JYCA 3W9YA 3ZH9B 2GEUA 5KPDA 1G5PA 3AH8A 2BCGY 3BOSA 1G64A 2P6UA 4IFEA 4PZYA 3QQ5A 2QM8A 2Q9CA 4MGKR 3CW2A 4HUTA 3NIBA 4LHYA 1Q1EA 2W2XA 4DSUA 5HZKA 4WAUA 3FMIA 2ZRAA 3EARA 3FMOB 1AKYA 3CZPA 1CJVC 3U7GA 2QPOA 1AS2A 2DBYA 2W83A 3VR4A 1S3SA 3OIYA 4QBIA 2JGNA 5HCNA 3K09A 3WYFA 3QVVA 5AUPB 2DFTA 4IVRA 3KJGA 5AK0A 4U5XA 3QNUA 3ZD7A 2J59A 2HJGA 3SFVA 3TUIC 2ERYA 1NG9A 3TQFA 2O5VA 3FMPB 1A1VA 1LFDB 3UWOA 5CYOA 2PEYA 4KITB 2ZRFA 1DPFA 2XNDA 2CBZA 4HLCA 3OEEA 2YC2C 2IXEA 4URUR 3REGA 4M9ZA 3RVBA 4U02A 1RKBA 3AF0A 4JVLA 3V4RA 3FKSD 2GHIA 5C4MA 5E7IA 4TMZA 1W48A 4HDOB 4PHGA 4QM7A 3LDAA 1IN4A 2RGAA 4EPTA 4B76A 4RFVA 2W6JA 1RVDA 3AUYA 4JLAA 1IBRA 3VR5A 4A9AA 1F5NA 4RCZA 1E2HA 2Z43A 4Q5IA 4MKFA 3U7HB 1V43A 2O0KA 2W0SA 1NN0A 4C0SA 4OHWA 3L0IB 4BLQA 3KQKA 1VCOA 3ICQB 1XZPA 2RHDA 3SHWA 2ZITA 4MYUA 2OCYC 4WZ6A 4DIDA 2JLRA 3QBTA 4MRNA 2XB2A 4IOLA 2WHXA 1UEJA 1E94E 2G0NA 3SS8A 4GI7A 1SKYB 1Z6TA 3EIEA 4EDHA 2YJTD 5CYPA 1L4UA 2Q9BA 3QVUA 5EE1A 5JWRA 1JALA 1NMYA 4AYWA 1E32A 4HDCA 1PLJA 2VO1A 4NCHA 4DLSA 5KSPA 2XTNA 1G291 3TVDA 2B8WA 2ZJ2A 5JS8A 2HXYA 1T0HB 3GEIA 1K5GA 4FMCF 2C78A 4EQ6A 4KHZA 2R8RA 5ANRB 2Q3HA 2HJVA 4W5HA 5DYGA 1COWD 1I4DD 1OIWA 1ZP6A 4LHWA 4D0NA 2D7DA 2JLVA 4JL5A 3AV0B 4QJ5A 5FTJA 1P75A 2ZR9A 2IL1A 3BB3A 3FMFA 1HEIA 1OV4A 2GJ9A 4JBXA 4OL0A 3I61A 1RYHA 3AF1A 2CLDX 1EFCA 4J0QA 1X8LA 2PT5A 1Q1QA 2CJWA 2ZQ5A 4AWXA 3ZD6A 3IIKA 3X1ZA 4B43A 5JZVA 4JLVA 2R6FA 4B75A 2XJ9A 2ZPTX 3CF2A 1GOTA 3TR0A 1I2DA 1NP6A 4KJZA 2O8EB 2QL6A 3IPYA 4C2UA 3NC0C 221PA 1YRAA 3DHWC 2P6RA 3X2SA 4ESHA 2WWIA 2JJ8A 4DDWA 3ADBA 1OKKD 1YJ5A 4UXHA 3NDPA 1BMFD 1R0YA 1W1WA 3I92A 4B44A 4B6EA 3SNHA 1Z63A 1NKSA 5E3HA 3TK1A 2QTFA 5B58C 1YZGA 2W0MA 4BFWA 5JJLA 1LS6A 3SJZA 4LBYA 3WRYC 3PUYA 1SVMA 4Q1CA 1XMJA 5EZ5A 4KXFB 5DH9A 4C3ZA 4EUNA 1JBKA 2GF9A 2IYYA 3CKLA 1Z28A 2FPLA 1H65A 2BWJA 4LWZA 1AN0A 3EAQA 1WRBA 5FBQB 2YNMA 5JJIA 1VHTA 1FPMA 1CBUA 1VCIA 2A3RA 4U00A 5CLQA 1NRJB 1U0JA 4JT2A 4Q9IA 5EXXA 3CONA 4MRPA 4KYUA 1J99A 2ATVA 4URXR 1OB2A 5H70A 1YVDA 2GA8A 3B82A 4TSFA 4BZPA 2QP4A 1IQPA 4TL9A 1D2MA 1M2OB 1DEKA 3FB4A 4JS0A 3GLFA 2CLCX 1V5WA 2O8FA 1ZAKA 4QC2A 1MO5A 5FPKA 4H1UA 2RHMA 5FBWB 4FCWA 3PITA 3MGCA 3BGWA 1VG1A 5AUOB 3SJBA 1LV7A 2RGCA 1CKEA 2ZIAA 3QKSB 4XJXA 3KB2A 3TE6A 1L8QA 2H16A 4LX0A 3BWDD 5EXSA 1U0LA 3UG7A 1E2NA 3O8BA 2VQSA 3QIAA 1YZLA 4MH0R 1BH2A 4V03A 2CHGA 2XTZA 2YVUA 1RJ9A 2IYVA 3HWSA 5B2ZA 3W5IA 1Q3HA 3GFPA 1KI1A 2ODBA 5JJKA 4S35A 5JFGA 4FXPA 1IAQA 2FX3A 3UMSA 1COWA 5EE0A 4ZDKA 3K1JA 4GT1A 1Q1ZA 2XTMA 3TR5A 3RABA 3LVQE 4M1OA 2WV9A 1GP2A 2I1QA 1HV8A 4TLAA 5A0FA 4DZZA 1C1YA 4EQ6B 2L0XA 1W7AA 3T06B 3GLIB 3CPJB 3FHCB 3G0HA 2ZRMA 4B33A 4Q7KA 1Z6YA 3GLHB 3LX8A 4PHHA 2D62A 5HKKA 3L43A 1KY2A 2Z4SA 1JXOA 4L9SA 2WZQA 1J8YF 8OHMA 1GITA 4OQNA 5G41A 3P27A 2WWGA 3FKSA 1F6BA 1OXTA 4QOSA 5FL3A 3M4YA 1GNPA 1CU1A 2AD1A 1XRJA 2YINC 1Z5ZA 2QNRA 4M9QA 1GFIA 2XXAA 1AQYA 2Z4RA 4O2RA 3ZS8A 4DRZA 2WPDD 3K70C 4M9SA 3ASZA 4IRUB 4IKEA 4PO8A 4QNRA 5EQTA 4BLPA 4C0HA 3B9QA 1R8QA 3B8HA 4JLOA 5K8LA 5KTYA 3C41J 4L8GA 4OKSA 1M1YE 1KJWA 1QVAA 3GJ8A 2R6DA 1KGDA 4S2EA 2WSSA 2HLDA 2WAXA 2XOKA 3JVUA 5TARA 2OT3B 2Z6VA 4OK5A 1VKJA 3VR2A 1Z07A 3RRMA 3THWA 4C0QC 4B34A 4JVNA 4GZLA 3U61B 1N0VC 1P2VA 3RS2A 5E7MA 2GXUA 2XX3A 1II0A 1LTQA 1II8B 4NYJR 4OI2A 3QE0A 3H86A 2VRWA 3KJEA 3LX5A 3EPHA 2FFQA 1PUIA 5EE9A 1OXVA 3UWKA 3DZDA 3DO6A 1TEXA 1E0SA 4AG6A 3THXB 2IYXA 3QG5A 1XZQA 1VIAA 2WKQA 4LJAA 4Z1MA 2EQBA 1RJ9B 4KFRA 4I1VA 4YMVA 5JLJA 1TTTA 4MUBA 2IA5A 3PUVA 4JLPA 3RYTC 1W0KA 1O3YA 3CX8A 1KNQA 4HLUC 3AP1A 1R5OA 2ZEJA 4MYTA 2RCNA 1UJ2A 4IDPA 5DE3A 1S9HA 1XEWX 1KSFX 2IW3A 4GPTA 1CR1A 4LHXA 1ZVQA 3N2EA 1YE8A 1MRNA 2Q3FA 2VF8A 5BXQC 1WBDA 3SJCA 2WIBA 3I73A 3AVTA 2WJGA 4TYYA 1XDBA 1LS1A 1K8RA 3MJHA 1FTSA 1GG2A 1NSTA 1OHHD 3GLGB 4MRRA 2QUZA 1SKQA 1SVOA 2VA8A 3LY5A 4TMWA 4ZCIA 5M04A 4PXAA 4Q4JB 1Z3IX 4M8NE 5JEEA 5JRZA 1JJ7A 2ZJZA 5GVRA 3HPQA 5IDVA 1SVLA 2E87A 3TH5A 3TAUA 3W3AA 4PC7A 3EA0A 1E2QA 3LNCA 1G7TA 2JLSA 4C2TA 1D2EA 1CIPA 4JBYA 1DTSA 2WKRA 3T12A 4EJSC 4HB0A 1MO6A 3RSOA 2VP0A 3K53A 3T15A 1OH8A 4QGGA 3T5DA 3TJZA 1G3RA 2OBMA 5GJWC 4RD3A 3IHWA 4G0NA 4F4JA 1KI2A 1HQYE 2CEAA 1OFTA 3NEJA 4ZIRA 1CXZA 2JLXA 4R71A 4P32A 4ZIRB 3WNBA 1XP8A 4BLRA 121PA 4Z51A 5JHGB 2YKGA 5DLQC 4FW9A 1Q1BA 4MKIA 2IWRA 3TBKA 4ILEA 3E2IA 4UNRA 1EWRA 3KJIA 4CF7A 4NONA 1OH5A 2FDCA 5JWHA 2PX3A 2JLUA 3HU3A 2ZU0C 3DDCA 1KSJA 5TXGA 3DVLA 4D0LB 3B5JA 3UIEA 2GCNA 2FSHA 2W2VA 5TB5A 3CX7A 1M34E 3BB4A 1PZNA 3ICEA 1S9DA 4LJ4A 5H8WA 3LFUA 1KO4A 2QBYB 4C4PA 4D82A 1WMSA 3BS4A 4B2LA 2Q0HA 4OI4A 1P9NA 3CRRA 1VG9B 4MYHA 2ZANA 1ZD1A 2BC9A 2XGJA 3K0FA 3U2QA 3ZGXA 1G3QA 1E2EA 4A0FA 4HAXA 3N70A 3CRMA 2VBCA 1Z0KA 2QMEA 3FWYA 1G9XA 1QBKC 2FPKA 3LD9A 4OI0A 3CNLA 1N5JA 2Q6TA 3BERA 3CLVA 4G01B 3VHLB 4A15A 1PLKA 3AUXA 2QROA 4P4UA 5JCZA 1CR0A 1TF7A 4JZKA 4ZDJA 1IM2A 4QGAA 3LW7A 5DGXA 3A37A 2R44A 2IBMA 4Q19A 1J7KA 2GWHA 3SBDA 4II7A 3LAWA 1P61B 3NEYA 2JLWA 4A8JA 1E69A 1JB1A 1RRFA 2JIZD 5DHFA 4A82A 5FOTA 1VPLA 4N0DA 3PXGA 2Q9AA 1DVRA 3BRWD 1FX0B 4GP7A 1UPTA 3U44B 3GFOA 2R6GA 2OE2A 4W7SA 4XWAA 3E5HA 1GUAA 2V55B 2Q3MA 1XMIA 4BLTA 1UAAA 3Q3JB 1NJGA 1G6HA 2XNSA
chains in the Genus database with same CATH superfamily
5K8VA 4BVLA 4Q34A 1XZIA 5K20A 1I51A 4WJZA 1XD9A 2ERXA 4Q1AA 2JFHA 1BYUA 1WVMA 2R8OA 2G8LA 1BS9A 1BNCA 3V2UA 5AJYA 4UTZA 4DCTA 3U9SA 1WMEA 2PT7A 4ND8A 4Q4CA 2PWBA 1RLIA 4UAGA 5EIAA 2FWRA 4E46A 1XN4A 4O4LA 1T1GA 4R1MA 3AR6A 3DVQX 4YRBA 1S02A 4LOAA 1NBEA 3EVCA 3ZWCA 2M9MA 5LU8A 4GC5A 4EG8A 3IDOA 5TE9A 2XVYA 3UHJA 2NV0A 5SZJA 3M6IA 1LY1A 4BTVA 4NOKA 3GJQA 5IEJA 1V11B 2HKIA 4QGSA 2FPUA 2YWHA 2XXAB 1XEWY 3OX4A 4NCIA 4D8VA 4B3SB 3KKMA 3ZVLA 1TK2A 3LQ2A 2WZCA 2QRLA 5C46F 5EXDA 3CCFA 3TTVA 2XGMA 3HA2A 4OBWA 1QR2A 4PNEA 2EXXA 2WM2A 2I6QA 3ENQA 5GOZA 3BRQA 1UBRS 4DM3A 5JATA 3KPJA 1GM5A 9MHTA 1CUIA 1YB6A 5C3MA 4DLWA 3K5PA 5JE8A 5KQSA 1RZUA 1QOPB 4CVNA 1Z68A 4G41A 1JEQB 3EC7A 1X2BA 4LJ7A 3RVDA 4DV5B 4IGFA 5EP4A 3TFQA 4HWKA 4EG7A 5L9AA 4KPEC 1VJ5A 1EXDA 1EVLA 3FDXA 2ZUTA 5JRJA 2EWVA 5B3KA 1NU8A 2CB0A 3B3AA 3RAPR 3ANLA 5K8IA 1I5RA 3T9BA 3AERB 3BCHA 4Y2SA 2F3TA 5F5NA 2A4MA 1T3TA 5CLJA 3PFCA 3OPQA 2HAEA 3CB4A 2P5SA 3P71T 1PR4A 4PPNA 2HSJA 5DHQA 2BCEA 4YY3B 3FHJA 4HS9A 4NCJA 5TMBA 3R3WA 4ZVMA 3LDUA 1D2HA 2WYIA 1H2ZA 1ISPA 3H17A 1CY6A 3HV0A 3LQ1A 3UMBA 2AQHA 2B6NA 2P2NA 2D3TA 2FPMA 3CH7A 2CMKA 3B3JA 4YRFA 4GD3Q 5EY5B 3UC9A 3ETHA 4ITRC 2AOXA 5TPWA 4DL9A 4EI9A 1CUSA 4CKZA 1JBQA 4W5TA 4NU6A 4RKQA 4EHDA 4N3AA 1C0PA 4PQYA 3LPNA 5AKEA 5THXA 3VNQA 3M1LA 3A4YA 5H80A 4KPGA 1EFRA 4Q6WA 2PL1A 1MX3A 5E9JA 2PUVA 1WJGA 2K7FA 4LV8B 3ZWDA 1XNRB 2UZ1B 1W4AA 3O4IA 2LCQA 3SAJA 1M2OA 4L4UA 3K73O 3JQ7A 4QU5A 2PIAA 5F51A 4NCXA 5AW8A 1XTJA 1XQYA 2V5AA 4B0PA 1G8AA 1U3TA 2JIRA 1C8LA 4HB4A 4BU1A 5I8PA 5IM4A 4LJRA 3DD5A 4E5NA 3I9LA 1D9ZA 5IX8A 5HE8A 3P2YA 2JIOA 3V8RA 3AFNA 2C59A 3KYDB 3KZNA 4ZRNA 2DLNA 3QSGA 4N49A 4BNIA 2YY5A 4DSAA 5C8XA 4OYRA 2OCPA 2BEJA 1PRYA 2GCOA 2WB4A 3HN2A 2IUSA 3FH0A 2JFWA 1MVLA 2GFHA 3W06A 2OQ2A 3T9EA 4XVHA 3WLAA 5IMSA 2AEEA 2ZXUA 2LV8A 4TXHA 4C78A 4E1AA 1JG1A 5JEDA 4LS3A 4I66A 4AY3A 4QNMA 2XGGA 1Z18A 1FLDA 2IDMA 3SY8A 3KZOA 5ILGA 4WZBE 1FEZA 1R4NA 3GRAA 4JI6B 1G2OA 3REOA 3QFFA 1KK0A 4PGAA 5IUJC 3ZDFA 5CB8A 4JR1A 2OV4A 1K06A 2X5JO 4TLEA 1SVWA 3U1TA 2PWPA 3RHSA 4H35A 1A9YA 1VHJA 2QS9A 4F92B 2IVFA 1JAZA 2KBEA 3PGJA 4FM9A 2OHFA 3RWOA 4OMCA 4Z6KA 1SCJA 2PWAA 2OFWA 4MVJD 2VRCD 4ND3A 5ALNA 3VPGA 4GPIB 4TWRA 3T4EA 1KA9H 1U4OA 4WJLA 3DBHB 2V03A 2VDQB 4HTFB 4CUJA 5HOQA 4Z0PA 1J90A 1LNSA 1EINA 1XWWA 1XQXA 4ZVVA 3CF6R 4QELA 1X86B 2XECA 3E7XA 3GT0A 3H4VA 4XR9A 2FG6C 2X9GA 4MV3A 3V46A 5I7EA 5C53B 2I4OA 3K09C 2NTVA 1YHYA 4J0EA 1NN1A 5DT9A 2YHUA 4LDAA 4LWPA 2HFJA 3IAUA 2NYVA 2C61A 2DUJA 2A0UA 2G3YA 2WHQA 2O7SA 4ND4A 2BEUB 4S24A 3KJNA 1Z9BA 4LDNA 3NGXA 2KE5A 2UYQA 2UZ0A 1M9NA 1T1IA 3AONB 1Y7TA 3GGPA 4Q48A 2GDJA 1TM7E 1JMYA 4LXIA 1E4OA 1SNYA 3A6HA 4BV8A 4EBFA 1NWHA 2GPJA 3IR7A 4R8LA 3BZUA 1ZRHA 1CP2A 3Q7RA 2OGSA 4BKOA 5B64A 4ZCQA 2H17A 2AKYA 2B78A 2XNCA 4F5EA 2IXAA 2YN0A 4PW0A 5EEHA 3G5TA 1G16A 3CLRD 4MI3A 4AKIA 3EVFA 1KHTA 4WXYB 1I5EA 1OXSC 4ZZ1A 2HJRA 4WNAB 1EFUA 4V38A 3OCUA 5K3FB 5SZKB 3SLKA 2L19A 5C1IA 1N6LA 4KNVA 2QGFA 2J9XB 3EIFA 2JCXA 1CE8A 5LBIA 2XUHA 2PUTA 4MPPA 5J4VA 5C7LO 2OG1A 2HX1A 4DR3B 5L7YA 3FYUC 1K0FA 1UWVA 5FUYA 5H7XA 1E1NA 2YV5A 5IAAA 4RTQA 4OQ4A 3K0CC 2W2NA 2W2LD 2Z3ZA 1XRMA 1ZYUA 1W4ZA 1F8XA 2BIFA 2DP4E 1Y5LA 3B89A 4I50B 3R7SA 4EIWA 1W49A 4D9KA 1FNNA 2XQVA 4XH9B 1ZNQO 3W2TA 4FFOA 4UTXA 4RLQA 1JIQA 3AY6A 4BUJA 4N48A 1IMOA 4ON9A 3QXJA 4E5KA 4JKOA 1RKXA 2PKEA 3AR4A 3EXEB 2OCBA 4XIJA 1AA9A 4EY5A 4BQIA 5C52B 3CCBA 1NPDA 2Q8PA 3ILXA 1EX1A 2ZSIA 1JTFA 4ZEMA 5I7HA 1X3SA 4NENA 4MITA 3AEKB 3QKRB 3NHBA 2EV9A 5EOVA 1QZ3A 2FFJA 4E2WA 5FBZA 1WF6A 2GN6A 3NBKA 1KDYA 3FCOA 3EYAA 3LW8A 4B3RB 1A71A 4QYIB 2FK8A 5K3CA 2EWWA 2D13A 4DJAA 1YJCA 4D4IA 5H68A 2A5LA 3ND7A 2FN4A 2Y27A 4H27A 1XXHE 3C2QA 3O4FA 5CA1B 3X44A 4JI5B 1DX4A 3TTXA 2Z08A 3KWFA 2AG8A 4M38A 3MERA 4PR3A 4BPBA 4G8JA 3K4PA 1V8FA 2QRNA 4WCFC 4KFUA 4XYLA 5A9SB 1SXGA 4I8IA 3VAAA 3G5LA 1IDOA 2JJQA 2WAMA 3ANTA 1J0EA 3I6BA 3I83A 4IF4A 2IS6A 1CUUA 1M73E 4HPJB 5IRCD 4C3OB 4WOJA 1NJ5A 3DXZA 1NUTA 1GSOA 5T4BA 3STVA 3FI9A 5ICMA 2IQ5A 1KERA 4OLJA 1VP9A 1ABBA 2WMOB 2YJZA 1BH6A 1D2RA 3K32A 4RTLA 1LK5A 2DHQA 2EL7A 2EYUA 3TECE 1QDEA 3F6SA 2OKCA 1P5ZB 1XTBA 1IL0A 4OP3A 6GPBA 4AIIA 4MCJA 4D3ZA 5KNDA 1THTA 2FPRA 1WQ1R 2HK6A 3LUDA 3GK3A 3BMNA 2F43B 2KS6A 1WZNA 3ROKA 3SGLA 4L8YA 4F5YA 2P2YA 1DEOA 1SOWA 1T5OA 2AE1A 3UYLA 1CR4A 1GNTA 3TMKA 1TEVA 1D1QA 3ESCA 2P77A 4U2BA 1BO6A 1TIKA 2PJZA 2PXHA 4AQYB 1XPUA 1N77A 4EYKA 1SHTX 3A2KA 4Q66C 2YIJA 1NW9B 2BN4A 4MWCA 3DMTA 3RARA 4JT4A 3L0SA 4QYTA 4BNYA 3M6XA 2H1WA 2R4TA 1Z2PX 2CHEA 1BXKA 4FZ3A 1RQ7A 4BZZA 5A05A 2JD0A 2YRXA 3H05A 4HZIA 4MKGA 1WG8A 4F4FA 1MQAA 3VKWA 3C5WP 3RADC 3HBFA 1KDVA 4X1KB 5C80A 4GZMA 4Y2VA 5K3DA 4O4IF 1W5SA 4H17A 4HFNA 2O0MA 3RU2A 3DF9A 1KC3A 4BASA 1AV6A 1JEDA 4MGZR 1V39A 4A0RA 4CLDA 3FSRA 4DVGA 3EQ7A 4EX6A 1MQ8B 2CZGA 3OPMA 2PUWA 2CV0A 2XCOA 1GZDA 2PHZA 3INRA 1T2EA 3HXTA 4JB0A 4DNPA 4NI5A 2O3QA 3P97A 4G24A 3ANNA 3OQBA 4PQFA 4Q02A 1L9XA 2EBHX 3PQ2A 1NVTA 4YT4A 1X8KA 1V9SA 3P0JA 4Q1BA 4U6NA 1P9OA 3K96A 4FNMA 5IJ9A 2BZ1A 1WKCA 1USGA 2GCEA 4C1NA 5J1SB 2G0TA 3F3KA 3N6VA 3D43A 1WXDA 3C4VA 4KRYA 4DKXA 1P7VA 1DRKA 3RS5A 1D4OA 1SOUA 4DUPA 2WT4A 1CQJB 2B82A 2O8BB 3C1OA 4R7ZA 1EE1A 4TMKA 4GPAA 3LIPA 4RZHA 5CFMA 3SDZA 2XAAA 3MEQA 2XIJA 1QTNA 2HO5A 1T35A 2VCYA 3R20A 4RM2A 4PZ0A 3A0RB 4BMVA 2ZROA 4QXMA 2I80A 1U7DA 3LK7A 1I4LD 1M34B 3NOVA 4OBXA 2OMKA 4UVHA 1JDVA 4DLZA 4LRXA 2FZ5A 1TM4E 2VHJA 4O25A 3RS3A 5CDHA 4TZ6A 1JQ5A 2QUAA 4HXYA 5D5QA 2ZSHA 3HDJA 4Q6BA 2GPWA 3L1KA 4DWJA 2HUPA 1I01A 3RH0A 1THMA 2O57A 1NYQA 5FLKA 4HUJA 4FSDA 4F4IA 2GAFA 4ZMBA 1EUZA 1SWVA 1B2LA 3VX3A 3JTMA 1FNMA 1XDSA 1P17A 2RKOA 3HUDA 4QJIA 3UK0A 1ID1A 1OIXA 4GQBA 2CEKA 1CT9A 4WIAA 1DU4A 5BQ3A 2RHLA 5FTLA 4XPIA 1JAYA 3Q9SA 1L3CA 1JVNA 1JSCA 1KJNA 1KP2A 2IXBA 3N74A 2IWHA 1PT7A 2YY7A 1N2CA 1O89A 3VO8A 3FTFA 4BE7B 2BE7A 1DE0A 1JECA 4IXNA 5T4HA 3C5EA 2GERA 4DA7A 4AY6A 1TGVA 2PZGA 2R1VB 3ASVA 4B17A 4ED9A 4RTMA 3W8DA 3ED1A 1GZ6A 4Q4AA 3BH7A 1NUSA 4OUKX 1TZ2A 3RANA 3OSUA 2PMCA 1W4LA 2ZYAA 3E9NA 4HNRA 4BN4A 2E6KA 1XRPA 4B3FX 4DMMA 5EP3A 2UKDA 2QQFA 4IWNA 3WKAA 2AWOA 2EWMA 1WV0A 4BGVA 2I4MA 3H1EA 4NYMQ 3ULKA 2AOVA 3I2JA 4EA7A 4EKNB 5EUQB 3N2ZB 1DBRA 3IALA 1OJLA 3STYA 2D1RA 2XE6A 3SC4A 1AX9A 2W2LA 3ZW7A 4CF3A 2I6TA 2B8NA 4RMHA 2AD5A 4NE7A 2QOEA 5I4CA 4ZGBA 2VXYA 5AHOA 3HXPA 4RL6A 4WA8A 1MKYA 1ODIA 3L6CA 2B8EA 2J31A 1FVHA 4LF7B 5BW4A 4ZQIA 1CE8B 2PY6A 3VDMA 3WRXA 2X76A 2IEZA 5HCIA 1U6JA 4MWBA 2BFFA 3KSDO 4FYYA 5BSVA 2AJ8A 3O95A 2MHCA 3U4GA 5GV8A 1CJMA 4F7DA 1ILWA 4QOHA 3CNHA 5LU9A 3IP6A 4OLAA 1IRIA 1RP1A 4U2EA 1C0EA 1IEVA 4B6OA 2M6KA 3I6YA 2F43A 3GDFA 3KX2A 4MQLA 4PZEA 1M7BA 2J3KA 4RF4A 4X90A 2MSLA 5E9AA 1M5RA 4DB4A 1JBEA 4DV2B 4M55A 1BZYA 2P11A 2EG9A 2H4HA 3EG9B 1BFKA 2I5PO 2JJ2D 1FP7A 1PK7A 3FLBA 4XTRA 4B5KA 4F3NA 4ZI2A 4NCBA 1QRAA 2FMKA 4OLBA 2RIPA 1GARA 2IYLD 2RGGA 5I8WA 4WKPA 2VUUA 4Z7OB 4WNYA 1E2PA 1EZ1A 3QWBA 2FRDA 3I28A 1C4OA 1DX9A 1Y8AA 2CKDA 3RT7A 5U1PA 1M2HA 1FNBA 1KHHA 1WP4A 2NYAA 2UVPA 3LDFA 1I3LA 1FJHA 1U8EA 3L82B 4ARAA 2GK4A 4GKAA 4Q3AA 3WQBA 1RYEA 4I36A 1DAIA 2XE8A 3I6QA 5DMHA 2H4XA 1P73A 3LT4A 3N2LA 4C7MA 3C16C 4HADA 4LMBA 2BD0A 1L8OA 2RHGB 3IQGX 3SYMA 5HTKA 3NUZA 4PGGA 4PNPA 3PENA 4KCGA 2WFZA 4IQ0A 2WIJA 3LYUA 4BC1A 3OI7A 4E5UA 4HNAB 3S2UA 3O2NA 3D7LA 2QAGC 2Y1FA 2BHLA 2ZRKA 1Y6RA 4MUKA 4AU1A 3GRCA 4ZHSA 5KYXA 2O5CA 3FBTA 1NXXA 4M21A 5KJFA 1N7JA 2MJLA 2JAPA 2VSYA 5LMZA 2WM8A 5JW6A 4CUZA 1RI4A 1W35A 3BREA 1JA9A 1O6ZA 3PQ5A 4N0PA 4TLDA 4RACA 4BX2A 4EFNA 3JZDA 3CLRC 2Q5EA 1TQDA 2K4MA 3BYZA 4WXHA 5DISB 1YRHA 1B23P 3EWIA 1CQJA 4NMWA 1P9WA 3OPNA 3DDWA 3L06A 2ID4A 4XIFA 1TF2A 4M88A 1VHLA 1IHUA 2J4DA 2Y8EA 2EFDB 3KXIA 5EMHA 3V80A 3R75A 3UHPA 5F5LA 3A70A 3HU1A 5H3CA 4F7WA 4X1OA 2P5UA 2QL7A 4EAQA 2GEKA 1LPOA 2AF3C 3ZV4A 4Q16A 1U6KA 4MRSA 5SYAA 1ODSA 1O97D 1I7LA 1J20A 1LPAB 4IDAA 3EDMA 2RK3A 3NIGB 4Y2PA 4LCBA 4Z49A 3EVDA 5K45A 1KY3A 1NVMB 1PR9A 2YV3A 4TS4A 3RS9A 1J0XO 1IVSA 1CNEA 4RKYA 5ALYA 1G20A 3I9FA 3PSAA 4KOAA 4KWCA 5IAGA 1G5IA 2DUWA 1WHTB 1YRBA 2AUMA 3AG5A 5AW2A 3LH5A 4BNJA 2DECA 4KQ2A 2QLFA 1DOZA 1V5FA 2JEYA 3V33A 4WOKA 1WPQA 4EY7A 1YKFA 4PRYA 4ZYWA 2NZWA 1NRIA 4GSKA 4N7MA 3TGPA 3K5HA 1DARA 4RETA 1WAMA 4Z9BA 3ZHTA 1RYFA 1REQA 3KEGA 4TSRA 3T7DA 3CRZA 4ZGGA 3LLVA 1QGYA 2ZT7A 2FW6A 2JFUA 4RTPA 4G0VA 3K1AB 3SYNA 3AUSA 5DPMA 1O54A 3O3NB 5H5JA 1G2IA 2RJNA 1L1FA 1ODFA 4B7XA 4DNFA 1JNXX 4J2TA 1Y9AA 3D6UA 2WYVA 2E4XA 3I62A 4Z8YA 5B1HA 1TRKA 3Q10A 3VSCA 3VYUB 1T8UA 4BKPA 3TRHA 3DR5A 4IILA 4OH1A 2J5RA 1DAEA 1KK2A 5SZHB 1VXRA 2BHRA 2PQ6A 5HFJA 3VV3A 4AZ0B 5KC9A 1EUDB 1K4YA 3AR2A 2NPIA 5KSZA 2NAFA 1V8OA 2AFIE 2GN0A 2PRSA 2XEXA 3NHJA 4GLBA 3AK4A 2VDPB 5F3DA 1ZNWA 5JR3A 4G5RA 2IOYA 3U44A 5KREA 3K1TA 3IXLA 3NOXA 2ZIEA 1M8GA 4MVJM 1CULC 2DWUA 4IDDA 3M5DA 4L5BA 1XCMA 3WO0A 4BMPB 3LLMA 4YJHA 3SG0A 2YZGA 2VHUA 5TIIA 3VA7A 4MZDA 3PF9A 3BQMB 3PUJA 1ILEA 1T36A 1GGFA 1Z26A 3Q9LA 2ZBDA 2C1EA 3N5CA 4TQGA 3ZYCA 2GGSA 3KYBA 3EZFA 4HX9A 2RHOA 2PBFA 5JO9A 1EFPB 1NSYA 1RR6A 3N2KB 4MDEA 1L2TA 4IOMA 1NQUA 5LLSA 1QTRA 3DFIA 1TZKA 4IIEA 1XAGA 1Y4AE 2H06A 4DRXB 1U3DA 3D8HA 1IY0A 2FWNA 1XKLA 4EO9A 3C7CB 5CBKA 3LFTA 1WW8A 4XEUA 1V5EA 3NONA 1CEXA 1S8OA 4R9VA 4AS2A 1XPOA 4P2GA 5I7WA 1AO0A 3SMQA 4I0WB 2FJUA 3M2PA 1NXWA 1KKMA 3UFXB 1H8HD 4CQLB 3HYCA 3M8KA 4X00A 4NBSA 2I22A 2JEOA 3P7MA 1Y9DA 4L4XA 5EVCA 3UFXA 1K7EB 2OAQ1 1T3HA 3NHRA 1H0HA 3TLKA 1C9EA 3KKOA 5H3LA 1QK5A 3FFWA 2ZYUX 4FBLA 1KDOA 2QZ9A 2ZJ8A 1EX7A 1KMHB 4ND1A 5CLLA 4C7VA 4PE5B 3W6UA 3REFA 5CDTA 4A4DA 3SX4A 1LI7A 1T8SA 2QXYA 3COYA 4DCJA 3SQWA 5KYWA 3PVSA 4QPZA 1OXUA 2C58A 3ZE1B 1B8PA 1RWVA 1DV1A 2CFCA 3F1LA 2E89A 1R6AA 2JATA 4XQCA 2R5WA 2FWBA 4Y2HA 1Z5VA 2AVNA 2IIQA 1C3LA 2N75A 2RH4A 3AJAA 4TKMA 1ZR2A 4KV7A 3UMVA 1PSDA 1LH0A 2GLXA 4LZZA 4ND6A 1N5MA 1P0FA 3BMCB 3SHFA 3ELBA 1IZ8A 2Y2UA 4BO1A 2JVJA 1PWYE 5AVYA 5HP4A 1XTQA 1WA5A 1XDUA 1VLLA 3L6DA 3CTPA 2YWJA 1FQKA 3NWPA 2XMSA 4IGKA 4PZDA 5T5QA 4EJ2A 3R6TA 1LBTA 3GJTA 1GQYA 2A2ZA 5EJAA 3WRWA 1EWQA 1ZS9A 1YULA 1JFVA 1UF9A 2N42A 4FYPA 1CZHA 1UFOA 4OLHA 4QQNA 4AUMA 4CG1A 3I05A 3GP5A 2W6CX 3DBVO 3L8ZA 2MSNA 3NT2A 3WAJA 3R3UA 1CF4A 4WSOA 2ERCA 1BEZA 4IIBA 4EZEA 2ONZA 2BDEA 2X9QA 4Z0TA 3JQRA 2JHFA 5H0IA 3O4RA 3GJ5A 4PEVA 3RAFC 1WEHA 4RV5A 1J1ZA 3M6VA 4EDFA 3RIXA 3T3OA 4GPZA 1F0KA 1TGYA 4M8KA 4ESOA 5KBYA 1X7ZB 3CRVA 4BV2A 1OAOA 5ALGA 4GOOD 1YS1X 2DUMA 2PRZA 3EHEA 4BLWA 3LUFA 1YD7A 5IKPA 1AKEA 3EW9A 1P5FA 1UUFA 2ECFA 4ENPA 4C4RA 5CHEA 4LMAA 3B2EA 3L8DA 4ARZB 4RC9A 1SMKA 2AHOA 3E7WA 4KPUA 3HVIA 3IVCA 1PLLA 1JR3D 1SU6A 5EJIA 1HUQA 2V3CC 1E1DA 4LY0A 3OOEA 4AK9A 2D2EA 1A8QA 4IZHA 1Q1GA 3PX2A 4MVJA 3BTUA 3JSAA 5ED0A 5JDIA 1J42A 5SICE 5K0TA 2LIVA 1W0KD 3HJTA 5ALXA 3L0DA 6REQB 2H48A 3H2BA 1FFSA 2WQZA 5JSFA 2ZJYA 3R6GA 3SZ3A 3EHDA 4KDRA 4HT3B 3OIDA 2HI0A 3F67A 4JC5A 1K6JA 3EZ2A 4JNKA 4U3JB 3USZA 5E1MA 3ZDQA 5JAIA 5LDGA 3GRFA 3U0VA 4RPCA 1X19A 2ZIZA 3SC6A 4M60A 3AVYA 4DW8A 2ZWIA 4EW3A 4YBZA 4C4XA 3LUCA 1JDBB 3G8YA 5B6PA 1KI3A 1EX6A 1X8XA 2FF7A 2NGRA 3D59A 3L0BA 4IQ8A 2GESA 3LYAA 4KIJA 4C6SA 1H6AA 3IR6A 1V35A 5E4YA 4TVKA 4QJ4A 2V9ZA 4LQCA 1M7HA 3WFIA 4YYEA 2VNJA 9ATCA 2UYCA 5JPDA 3QPVA 4RK1A 1RRCA 1J1IA 1GL7A 1T13A 4LJYA 4R0VA 5EKSA 5JCPA 4W5RA 3AI1A 1XZKA 1RRPA 2XYGA 1UAYA 4CKYA 2CJPA 2JFYA 5D85A 5GONA 4M0EA 2JBWA 4P0TA 2EGHA 3PFIA 5HYVA 1ZIXA 2WSSD 4FSHA 4LK2A 1B76A 2DWPA 1YMQA 5J5CA 1P4JA 4LE0A 1AD2A 4D92A 3KUKA 3WOVA 3W7AA 3K70B 4REOA 1W47A 4CCSA 1F0PA 1WD5A 2AUNA 2JZOA 2CL0X 2FVYA 2LKDA 1U7OA 4LZPA 5JZBA 3MXOA 4H6XA 4J43A 5CDFE 5LYJB 3KSAC 1AXGA 5DHRA 1PR6A 1OIVA 2EJWA 1N1GA 3BXHA 3L7BA 1WLYA 4TMWA 4KSBA 2WQ7A 4CMEA 1NBMD 2Q27A 4RTOA 3HR7A 4BCBA 3AM5A 1U80A 2PXAA 4RZ3A 2XR1A 1MB3A 3ZXUB 4EVIA 1Y4ZA 4PYJA 2VIIA 5CU7A 1Y6ZA 1P4SA 3IAM6 2QTWB 3KTOA 1MNQA 2PUJA 1KZ9A 3I5MA 3W8NA 1L4EA 1E0AA 1A9ZA 5G2OA 3CUEF 5DIZA 4JYZA 3OCYA 5INTA 2PFKA 2VL7A 3ZNOA 2ZJ7A 1B3RA 3SK0A 3A1NA 4HQOA 2POQX 1WB9A 1E7WA 3HABA 2FSSA 4WL0A 1DBQA 1EK2A 1UK8A 4R7GA 4RE6A 4US2R 1MFPA 3ITDA 3RC8A 3DDHA 5KNBD 4KFTA 1OBOA 1G4AE 4URZR 1V16B 2MYUA 1VDMA 2B4TO 3MINA 3MTEA 4E14A 1R2QA 2FEKA 3ILHA 4IO0A 4DNXA 3OECA 1KH2A 3GUUA 3HU5A 3V7NA 3QXHA 4D3FA 4DDMA 3R6WA 1SH7A 3Q2KA 1NQAO 4JYAB 1J2TA 3SZRA 4J3FA 3ZGZA 4UHJA 2PRIA 4C7OA 1QO0A 4HJXA 3B36A 4DREA 2YYZA 3NDRA 1UBOS 4V0RA 4CR7A 1P2TA 4P8RA 1QRSA 5F3RA 3SBXA 4UZSA 1NC1A 5JSKA 3KJFA 1KK3A 4IJ5A 1QLWA 2CLFB 5IARA 1PGNA 3ZI0A 1H94A 2G08A 1M83A 1E1CA 2JLQA 4OHUA 4BLSA 4OQDA 4PWYA 3F6BX 4R2LA 3B78A 5F1PA 4E5SA 1KYZA 2J9RA 2ZI6A 3MHPA 1CUZA 3I8XA 1SOMA 3DAFA 3EF1A 5EESA 3TI7A 3TPZA 1T6ZA 3DVRX 3UV6A 2VUIB 4BRZA 1S1CA 3GJYA 4MNTA 2NTYC 1OX4B 2GJSA 1D8AA 1JVBA 8ATCA 1OCEA 1PSZA 1GU7A 5CFOA 2CWDA 4LJ5A 4B3CA 4DC1A 5FWYA 2F9LA 1FUEA 4LYGA 1J6UA 5CB4F 4O33A 1LBQA 3ETLA 2XY4A 4AS3A 3GQBB 2RJOA 2XPCA 4RGVA 1BS1A 1WUHS 4RHFA 2IYSA 3RS7A 1EM6A 4S0ZA 3IAAA 3QIVA 4Q15A 3JWGA 4D26A 4GOJA 2PUGA 4PG6A 4C89A 5T4EA 4JJZA 2PEZA 4GKVA 4PLWA 3TSOA 1O4WA 3WE7A 4JL6A 3FDIA 1XVAA 1Z25A 4QWWA 4DV4B 1TW3A 3DEFA 2O7RA 5EN4A 2GWRA 1U90A 2XRFA 5DBEX 2FF5A 3U1BA 1CV2A 5K0FA 3DHVA 5BSFA 1QGDA 4U7JA 3QF4B 1M8KA 4K9DA 4MPJA 2RGBA 5KPJA 1UMBB 2BCJQ 4NCKA 4ND7A 1ZG3A 2Q5IA 3UPDA 1E3SA 1JR3A 3CTMA 2VDJA 3PA8A 2XF2A 1N2ZA 1T5TA 2REBA 3N0XA 1LDEA 1EDZA 3MK31 2O8BA 2HH9A 4CM5A 3ER8A 4NZPA 3JYOA 5CRIA 2QDXA 7ABPA 3H1PA 5GADl 3EFEA 2Z98A 4MDHA 1CZRA 4KVGA 1U0NA 4B2IA 4PANA 1R8SA 4NDAA 4NG4A 2OPBA 3E35A 3QLVA 4GE3A 4UE2A 5I7AA 1HNWB 1EAMA 1GCIA 2D0OB 2FCRA 4KQFA 3FWHA 5AVRA 4G09A 2IS2A 3EEYA 3R3VA 1MA0A 2OSBA 1LJ8A 3VU9B 1RM5A 4RJJA 3DLHA 1Z08A 3O1LA 1PR2A 4D9JA 2BI7A 3E8MA 4X6UA 3HJGA 3R2JA 1GPDG 1X8JA 1Q0HA 1YZHA 3AFOA 3MGGA 2IHYA 2WD9A 3BHMA 3HCDA 1BGWA 1KEUA 3BGOS 1IIBA 3CJQA 3G85A 4G4JA 1G59A 1H2AS 1IJEA 2C2MA 3CVOA 4C1BA 1W36C 1GNRA 2V96A 3HRIA 3KZKA 1WU7A 5AI6A 2HCBA 5FPPA 2Z6UA 3H1FA 3FNGA 5E1OA 1EX9A 2GJKA 3DWGA 2PUEA 4KKXB 1NF8A 5FBKA 2QG4A 4XSGA 2MSKA 1QM5A 2XTJA 3D3QA 3GJXC 2CV1A 1ULSA 2W48A 4E94A 3ZH2A 2OXTA 1W96A 3N8NA 4YWHA 3PDUA 2MSEB 1QQBA 1UKAA 3K9FC 2HWWA 1X13A 1IN7A 3BTOA 2PUHA 3KB1A 2VLIA 4ODIA 4H1VA 3JD3A 1ECCA 1M6NA 3DZKA 1ZNYA 1CNFA 1KJJA 1JEQA 3EXIB 3VHXB 1NYTA 2I67A 4C4SA 3MWKA 4D3YA 2YXEA 2HRQA 3NNDA 3MWLA 3LA6A 3NTLA 3FKJA 3K8ZA 4BZXA 1QCZA 3ON5A 2L42A 3K5WA 1Z29A 3HACA 3D0OA 1P1BA 1DBVO 1GQRA 4X1YB 4CMEC 5CDUA 3GLGA 4IJKA 4BNDB 2J30A 5C31A 2P91A 3Q3IA 3EZ9A 3M81A 4RCVA 2Z95A 4N8SA 4CIXA 1GYPA 4LWQA 4DUYB 1FNSA 2DHDA 3CVJA 4NATA 2Q29A 1QHXA 4FN4A 4PPQA 3VYVA 5FWNA 1A8IA 5FA6A 3JD4A 5LOVF 3BM5A 4GOKA 1XMVA 4LYFA 5KTTA 1A9XB 1OBCA 5L3QB 1XVIA 4ZO8A 4MUAA 1RYZA 3G1WA 1J8FA 2I66A 3HBNA 3HV2A 2P68A 4N3NA 2I9KA 5DX0A 3KZVA 1DRJA 2QRJA 3KWLA 4RFSB 5EMKA 4NRDA 3BE4A 2M6LA 1GTSA 2WDZA 1FDOA 3KZXA 3N7UA 2QSJA 3LPCA 4F1WA 4LXXA 4ZALA 3IP8A 4GM4A 1KEEB 1DHTA 1OHHA 3VH1A 3U56A 1LB1B 3NM4A 5EG5A 1MC1A 1SIUA 3KE8A 4AP9A 3AV3A 4F85A 2NQ2C 1XVLA 3LUHA 3OJFA 3QXCA 3EIUA 1VIYA 4GIBA 5ERGB 1RADA 3DOOA 3DPUA 4FFMA 5JRDS 1SWWA 3MWDA 1M2JA 2FG7C 4J0FA 4DBLE 3FYHA 1A9OA 2JJYA 3IAM1 2OLJA 3H2HA 3QU4A 4M1ZA 3L8CA 1H4VB 3CVYA 2W7TA 1OLSA 3MAAC 4PGHA 2QI9C 1N0IA 1OBHA 3GJ0A 1MV5A 3LKBA 3RJ9A 4C14A 4YMTA 4EG4A 4JLWA 5KNBA 2PR7A 1Z47A 1TZMA 5E1DA 3K35A 1SPXA 1U3UA 4L8LA 1WBBA 4ETMA 2AK3A 1NIPA 4HDNB 4ITVA 4KAAA 4LC0A 1RMQA 4R2IA 4DTCA 1SZJG 4ENSA 2VPTA 2CXXA 3RS4A 3B52X 3UUGA 3TS1A 5LP1A 1J97A 2BELA 2AZDA 4ITUA 4HYYA 1QMGA 2CZQA 4MEBA 2UUPA 2WJ4A 2WINI 4RQTA 4ZP1A 2OC4A 1KDPA 3TX6A 3MAGA 3RRNA 4BX8A 1ARZA 4MQUA 4WDQA 4ZT3A 5IBRA 3W2GA 1QTQA 3PEVA 4E4TA 2H2DA 3EQ6A 3JX9A 4J0DA 3MCUA 2FKNA 3B3FA 2IOFA 2R2AA 4C0XA 3SKYA 1PJAA 1QOQB 3NX4A 5TDHA 5IUNC 1CY7A 1MCZA 2FWAA 3AP2A 1E7SA 2WTUA 2GHRA 1CB7A 2OCKA 2OY0A 2XW6A 3KYCB 2QTHA 5BNIA 3N3AC 1B8OA 4Z4QA 1QO9A 2PPVA 1U2PA 2H2IA 4OMFG 5EWMB 4YQFA 4TTQA 3VPAA 3WX0A 2JFXA 4J7XA 3U7EB 2O3UA 2X58A 1QZXA 1SU8A 3VYRB 2I6GA 3QA3E 1YZQA 2FJPA 4FKMA 3EVNA 4IFBA 1ESEA 1N2JA 1Z2NX 1JGTA 2JPDA 4PSDA 3V4LA 1WDLA 3G2KA 3TLGA 1E5VA 2WMYA 3FVRA 4G0QA 4KQXA 4AN1A 1WSAA 1N6NA 2KM1A 1BDHA 4HRYA 1UC4B 2WWFA 4DIKA 4MJLA 2QE7A 1UKVY 1VBFA 3NHAA 4S1TA 4BQSA 2XLBA 1ST2A 4QVKA 4MW7A 3A9SA 2JFPA 2F6RA 3NXSA 4F9FA 4LE1A 4HDMA 2H7XA 4ZQGA 4CEJA 1SUIA 4UCWA 2AEMA 3CNOA 5HZMA 4X8HA 1WCWA 4QUKA 2LBPA 3R7NA 3RVRA 3WVNA 1VPEA 5LC1A 4EHKA 2WUFA 4ETNA 2WW8A 1EAYA 2HXSA 4HUQB 2DERA 3RUAA 2QRPA 1WCIB 5AKYA 3R3JA 3MPUA 1YA4A 4QE3A 3KOWA 5BWNA 3AVVA 3NBAA 1DUVG 1XU9A 3DC2A 4NF2A 4S12A 4BUCA 2VF4X 5DBIA 4B6QA 5JNVA 3WBFA 2BEKA 4XCXA 1BFDA 2OYSA 3HLYA 2OB2A 1N6HA 1PJSA 3FG9A 4TTIA 3KQTA 1N2SA 1F5SA 1YS4A 1IJKA 5HDQA 3RSFA 3RYIA 3IUSA 1EEXB 1Z6AA 3MT7A 4X63A 3MD0A 1L7XA 3IAFA 6ADHA 1R3UA 2C4NA 1IQ0A 2OCLA 4YV0A 5IVKA 4OIFA 5FTNA 3GO4A 4BMNA 1W9MA 2GX6A 2JIPA 1I4WA 3JYNA 1FP6A 1W76A 2P7HA 2WHRA 3NDIA 2VJMB 3H5RA 4L0MA 4KXWA 5IEBA 3VOAA 4LPKA 1Z7BA 2J07A 4NOLA 4DR2B 1G66A 3DOJA 2YWFA 4JBWA 1XX6A 2SNIE 2XZOA 2X77A 4REQB 4MYDA 5LB4A 3IKTA 3OFVA 3U4DA 2RD2A 4F91B 4J1SA 3DE1X 3O8OA 1D7AA 2NNLD 1U9CA 1DAPA 1U0HC 1R1DA 3DE5X 3NTXA 5DGHA 2Q8NA 1C1XB 1IN8A 2YWCA 3C48A 4WY2A 3QNWA 5CDYA 2CNLA 1EIWA 3OWXA 2C1XA 4WESB 2PG3A 5JO0A 3EZXA 2FEWB 2PGLA 4P9NA 2R6JA 1CDZA 1MXHA 1Q0PA 4C0AC 3ZHUA 5H9WA 4UBMA 2CHVA 4YP5A 5FL7D 4RDXA 1B14A 1I24A 1MEJA 1W8IA 1UXJA 3SOPA 4DARA 2H3EA 1YV9A 2ZJ1A 3IO3A 3LSYA 1TMGE 4L3VA 3ZZ0A 3TTUA 1KR5A 4MHOA 1U99A 5G1PA 4HP8A 4AWBA 5ITVA 2OESA 2QU8A 2QX4A 3V1TC 5A4KA 3GFBA 3LQKA 5HKAA 4Y2RA 3JD0A 4N47A 1ZCBA 3FDFA 5EKXA 2B1IA 2NO5A 4W1PA 2QMQA 4IQGA 1ADYA 2JGLA 2PKRA 2HD4A 3OF5A 2HPZA 3BT7A 4IDQA 5EGNA 3T52A 1Q50A 2VDVE 3HKBA 2BGUA 3QFCA 4P7FA 4P53A 3T3GA 2P6NA 1MOSA 4UJ5A 4LYEA 1Z22A 1HE2A 2JFNA 3QHAA 5L7TA 2B6HA 5IZCC 2WUWE 3IAXA 4A8TA 5FLXA 1VSVA 1SZDA 4JXZA 3R44A 2C7PA 4YACA 1GNQA 3OX2A 1VBNA 3JQBA 4NPAA 4RK6A 1NF2A 2QWXA 2B7LA 2WUEA 3OM9A 4NNJA 1TYAE 1ZIYA 4H77A 1PGJ