3OTWA

Structural and functional studies of helicobacter pylori wild-type and mutated proteins phosphopantetheine adenylyltransferase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMIQLATKSFKNVECVAFEGLLANLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPLISKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Structural and Functional Studies of Helicobacter pylori Wild-Type and Mutated Proteins Phosphopantetheine adenylyltransferase
rcsb
source organism Helicobacter pylori
total genus 57
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3otwA00
1Q19A 3IVGA 1JHDA 1GPMA 3LE8A 4ZT6A 1R6UA 4MVCA 3PNBA 4DDHA 3IVCA 2X1LA 3A05A 1O95D 3HV0A 4MULA 4MW4A 3SZ3A 4MUKA 1XNHA 1KKUA 3GMIA 2PIDA 2H29A 4YP6A 3IUBA 2E89A 4DNXA 1OWPA 1O97C 2GOYA 3K32A 3D6VA 4K0RA 2O8VA 3LOQA 3MMXA 3OTWA 4YP7A 1Q11A 2QTNA 2YY5A 2HGZA 1NUUA 3IMCA 2WQ7A 1IQ0A 1QNFA 5F23A 4MUEA 1IQUA 4ARCA 4XFJA 5KCMA 3H9CA 2R5WA 2E18A 2IELA 1NUTA 1O97D 2Z08A 1NUPA 1LI7A 2CT8A 4EG1A 1IQRA 3TQIA 1F7VA 1NYLA 3DV2A 2A88A 4K03A 1O0CA 1GAXA 1KQOA 4EG6A 1ZJWA 1JECA 3U1VA 3C8ZA 4G5FA 4ZCQA 5JBNA 1RQGA 1IVSA 4ND7A 4ZT3A 2G36A 1PFYA 2J4DA 1NUQA 1NSYA 1H3NA 3SYTA 5J58A 3H05A 1N77A 1D2RA 1MAUA 1LW7A 1EJ2A 1SURA 4MUNA 1I6MA 4Q16A 1F9AA 3HMQA 4NAUA 4R2LA 4JFAA 4MW0A 5H7XA 3BL5A 4KPUA 4CT0A 4S1OA 3F3MA 5FO1A 1K4MA 4ZT4A 2PZAA 4HJRA 1I2DA 1TQ8A 2E0IA 3TS1A 3H9BA 1WXGA 1J21A 1K92A 3A04A 4JXXA 3COWA 3SEZA 2HZ7A 1X8XA 4X0EA 4DDKA 2AG6A 1M83A 4MLPA 1MC1A 1WXEA 2YWCA 3UK2A 2YWBA 2QJTA 2RD2A 2CYCA 4G5YA 1GTRA 3CVWA 3CR8A 1VBNA 2HMAA 2DEUA 3MLAA 2J09A 3IOBA 4ZCPA 1N78A 3ND6A 4R0NA 2DERA 1KR2A 3CVXA 4G6ZA 2CSXA 3AFHA 5AHWA 4R2MA 1UFVA 1PFUA 1J70A 3Q4GA 1QRUA 1MB2A 3M5WA 4XSVA 1M8JA 1NI5A 5DASA 1T6ZA 1JEDA 1NP7A 3ZJVA 1JIJA 1OWOA 4OUDB 4J76A 1HYBA 2OQ2A 1IH8A 3FNRA 1S4MA 3IUEA 3X1JA 1M1ZA 3ELBA 3I05A 4RPIA 4ZT2A 4PBTA 3SP1A 4YBRA 5HUHA 3ZJUA 2WB2A 1QU2A 1U7DA 3N8HA 3X1MA 3RJZA 1BS2A 4CQNA 4PY2A 1TFUA 4JZYA 2VTBB 1NZJA 1JGTA 2A1TS 3NBKA 3QE4A 4QBTA 4U7JA 1KP2A 3UMVA 1TYCA 4DJAA 3FY4A 4J75A 4KPUB 2O5RA 1OD6A 3CLUD 1I6KA 3MUEA 3LCJA 2B7LA 2AKEA 3INNA 2RE8A 3K9WA 1MOPA 2CFOA 1WXFA 2IJGX 1NUSA 1XNGA 3AG6A 1WQ4A 4NDAA 4DLPA 4WSOA 4EG5A 3L92A 4EG4A 4ND6A 1OWNA 4E1AA 4NAHA 2PG3A 3CLRC 2D54A 3IMGA 1EUYA 1EFVA 4CDNA 4QRDA 2DXIA 1LI5A 4KR9A 1R6TA 1WOYA 4MW9A 5IJXA 1ZUNA 3A2KA 1H1TA 1U3CA 2V0CA 1A8HA 1ULHA 2VXOA 2PZBA 1N2BA 2TS1A 2A86A 3TQOA 4ZCSA 1MJHA 1I6LA 3HGMA 2PXHA 1YI8A 4P2BA 4DDMA 3MLBA 3FETA 3G6KA 2JANA 4KKVA 3ZIUA 2V0GA 4QREA 1J20A 3FI0A 4DE5A 2NZ2A 1F4LA 5K0TA 1GN8A 4CDMA 1Q15A 1K4KA 4JXZA 1X6VA 4OUDA 2DR2A 5LM3A 4I6GA 3HZRA 1VBKA 2EL7A 1N75A 3UY4A 1KH3A 3VU8A 3D6UA 2CV1A 2Z09A 2QUHA 1PFVA 1QJCA 3FDXA 3QTTA 2VTBA 4I6JA 1TYDE 1TEZA 3KT8A 4XFDA 1H3EA 1WZ2A 3UC5A 3L93A 2CV2A 5BNZA 3H99A 1N2HA 1Q77A 1YIDA 5TGTA 1PFWA 1N2EA 4EF6A 1O96A 1YULA 4PBSA 3SZGA 4ARIA 2CYAA 3VGJA 1M8KA 1FFYA 2GKSA 3Q10A 3FWKA 3E27A 2D13A 3CLTC 3ILVA 1M8GA 1K97A 4UZEA 3UOWA 1DNPA 3CVYA 1G59A 4HJXA 1P7PA 3HL4A 2A1UB 4MUJA 4MVWA 3ZGZA 1MAWA 1R6XA 1EFVB 4H3SA 1G8HA 2IP1A 3FOCA 1N3LA 1O94C 3SEQA 3RBAA 1T6YA 2NSYA 1EE1A 4U8HA 3CLTD 4NX2A 1T9GR 3VRHA 3P0JA 4KR7A 3P0HA 2OV4A 3NBAA 1T6XA 2A7XA 1EFPA 2XRZA 1XJQA 1QU3A 1YIAA 1WJGA 3CA8A 2GM3A 4I6EA 3ZJTA 4MUHA 2X0KA 4MVXA 1J1ZA 2DETA 1V8FA 2A4MA 5FO0A 1TYBE 3S3TA 1VBMA 5HUJA 3KFLA 1N1DA 3IDFA 4WNYA 3CVVA 3COYA 1PG0A 3PXUA 4F3RA 1U3DA 4RUKA 3H97A 1EUQA 2C5SA 3DLAA 1B6TA 1TYAE 3N2YA 1QRSA 1GLNA 4ZCRA 2ZUFA 4KR6A 1KORA 1JZQA 3AIIA 1J09A 4MWDA 4MUGA 3ZUGA 3RFFA 3AL0C 5KHAA 3RK0A 5IHXA 3IH5A 3G59A 1WKBA 3GLVA 1KH2A 1O96B 4HPWA 4FZJA 5TEVA 1JZSA 2JA2A 3COVA 4EG3A 1G8GA 2PFSA 3X1KA 2A1UA 4MWEA 4MW1A 3TZEA 1COZA 1MB9A 3P0IA 4F4HA 5KWVA 1WQ3A 1KAQA 4MWBA 1Y42X 3FH0A 1JMVA 2YXNA 3Q12A 3IVXA 2H2AA 3CLSC 4GU5A 3KT3A 2JAXA 3DO8A 5LLTA 1N2OA 1YUMA 2DLCX 1VL2A 2CV0A 3DPIA 1U0BB 1KAMA 4MW5A 3ND5A 1KP3A 1H3FA 3CLRD 3HFJA 1WXIA 1EXDA 4AQ7A 3GUZA 3P52A 3RHSA 3A4IA 4GRIA 1QRTA 2QUKA 1O0BA 2J07A 5J5AA 2A84A 1O5TA 4A91A 4ZCTA 2ZUEA 3CLSD 1EFPB 1OWLA 5K0SA 2QJFA 4MUIA 4NATA 1G8FA 3AKZA 2WQ6A 2BYTA 2WSIA 1GTSA 3ND7A 5J59A 3IODA 1WY5A 1ZH6A 3PRHA 1QQTA 3NV7A 1KQNA 4BWVA 5H16A 4NZPA 4MAFA 3ZXSA 2J5BA 2CUZA 4OJMX 3TNJA 3TZLA 1O6BA 4EG7A 2I1LA 2QTMA 2EJCA 4L2IA 4PBRA 5DB4A 5DEOA 1IRXA 1MBZA 1JILA 1M8PA 2QUIA 1M8FA 1FYDA 3IOEA 2PZ8A 2DPLA 2X3FA 1V47A 4EFKA 2X1MA 2BTEA 4MW7A 2CYBA 2DUMA 1IFXA 1WXHA 4MWCA 2E21A 1MRZA 4EGAA 2QTRA 2XRYA 3OP1A 5LFAA 3COZA 3KT0A 2QJOA 3KT6A 4YMIA 1JIIA 1N2JA 3RK1A 3FIUA 1J1UA 1XNJA 4MVYA 3G5AA 1N2IA 1U7XA 3ZXIA 1ZH0A 5TS2A 3N9IA 3ISJA 4ZT5A 1KQPA 5HG0A 2QUJA 1PG2A 5FNZA 3FHJA 3MXTA 1JEEA 1IHOA 3N05A 5EKDA 1QTQA 1JIKA 3JXEA 2Z3VA 3PNVA 4Q93A 3IOCA 1N2GA 3SDBA 1T9GS 4MQ6A 4ZT7A 1O94D 1GZUA 4EG8A 4MW6A 1KH1A 2AZXA 3FG9A 3PNYA 4MW2A 5TEWA 1OBCA 5DK4A 4JYZA 1NURA 4YP5A 4HK4A 2J08A 4UZFA 1F7UA 4MUFA 3AG5A 4AS1A 1ILEA 1O95C 4L2IB 1VLHA 1CT9A 1OBHA 1OWMA 4U63A 1YUNA 2ZP1A 3CLUC 2A1TR 2D5BA 3QTBA 3CVUA 4TS1A 3IMEA
chains in the Genus database with same CATH superfamily
1EFRA 1KE2A 2O3QA 4CJXA 4FR5A 4F1KA 2W71A 4MCIA 2GAOA 1YQDA 5DRTA 1G5QA 3P9PA 5ALRA 5AK6A 1ESEA 4BX9A 3PNBA 1J42A 3NDIA 2NO7A 3ND8A 3LUDA 3TLBA 3UN1A 2XHEA 3HBLA 1BGWA 4QOGA 1D09A 4CM3A 3L7IA 3NTQA 3GMIA 2PIDA 3LV8A 3NETA 2ID8A 3MEQA 4RIFA 1WCIA 5FTNA 1RRCA 1NXTA 2BGNA 2EEPA 2R8YA 3SDZA 1U5CA 4G8JA 5M2QA 1KZ9A 1QFZA 1T6NA 1W85B 5F12A 1BX3A 1OFUA 1ZNXA 3USCS 3TNDA 3ICPA 1NUUA 1NOKA 3EIUA 4Q9AA 2J0QA 2CXPA 4QNNA 1ODSA 3MINB 4OM7A 3RJ9A 2RHMA 3ROPA 4KPEC 1ZNQO 1RPNA 1K75A 3FGNA 2X0EA 3GEBA 3LHIA 4GOOD 3I6YA 4NU6A 2HGSA 2ES4A 4AZ3A 3H8WA 2M9MA 2QD2A 2WU3A 3IE2A 3FUVA 4GNKA 4OL0A 1Y1QA 2PJDA 3EGXB 2G1UA 3EGDA 2ZIEA 1T4MA 4LDRA 1OSNA 3LBFA 1GT6A 3BQMB 2ZBFA 3O3NB 1LVUA 2W83A 3GGCA 3GL9A 1L3CA 3O91A 3R20A 4N65A 1G0NA 3H1TA 4EVIA 1ANKA 1RQGA 2FFJA 2C9CA 3R0JA 4IHAA 1NMXA 5C5DA 4W5RA 3AEKB 4M1OA 1Y5MA 2JFOA 1CLUA 3RDPA 3PITA 4D3SA 1CNEA 2IT1A 3K0HA 5FORA 3RSZA 2EGUA 3KYCA 4Y9RA 5C18A 1RZ3A 3K1YA 3WIBA 4B80A 5DNEA 2F64A 3EF1A 5FBRB 3K2BA 1UAAA 3KQQA 3LL7A 3EGEA 4HNTA 2OG2A 4H6XA 5FBWB 3FMOB 4Q16A 4XDZA 4NCHA 3OIDA 5ES4B 1WW3A 5KKCA 4WGGA 5BP7A 1NW6A 4D3XA 3QFRA 3KR9A 4R05A 3HCAA 4TL8A 4WKPA 1EK1A 3RQIA 4RHYA 4DCPA 1WZNA 5A5GA 1J2RA 3HBMA 4K9DA 1MO4A 1R16A 4BP9A 4H31A 2ZDGA 5HS4A 4OHXA 3T5CA 2E0IA 4PR0A 1XCJA 4ODIA 4RA6A 5ALIA 3C43A 4DMRA 5HF8A 4M38A 4DMGA 4RM3A 1B0AA 4FEAA 2K6GA 1WXGA 3M9WA 4MJ7A 3PUZA 5JWHA 1LKZA 1IUPA 2C1EA 3JZDA 3AF5A 3JTMA 1BVRA 3IILA 4KR0A 2HZ7A 3SEZA 5H70A 3WGHA 2FCRA 1TA9A 1I24A 1P2UA 3CO0S 2R25B 3K0FB 4UHFA 1L7PA 3VO1A 3ZLJA 5JJLA 1Z5VA 1M5TA 5HFNA 5SZKB 2HT1A 1RXSA 3GQBA 4MVJH 4Z53A 4Q02A 1ODLA 2YWBA 1T24A 3V8RA 4ACBA 2K87A 4V0ME 4MR9B 4B3DA 1QHIA 3EBLA 1SHTX 3A3YA 1DPGA 3H65A 3P2MA 2QHXA 4G5YA 2ZRNA 2DBRA 2OSBA 3UB3A 1V7ZA 1U9IC 1Z0UA 2ZJ5A 2W22A 3FRIA 1DQPA 3ZLBA 4CM8B 3HGQA 4DCUA 2ZB2A 2COUA 2E48A 1V8BA 1PV1A 3IUMA 1AUOA 3EZXA 1Z08A 4HNSA 1VKJA 3DBVO 3F96A 1DBIA 4D6XA 5KYXA 1N2CB 3KU1A 4PCAA 3HKDA 3I92A 3HO1A 2WHPA 2I6UA 3WMWA 1H8ED 1VHWA 3NH6A 4EB3A 4BE9A 4R2KA 1NWHA 5ECGC 4BECA 3UWDA 3HPRA 4CV3A 4UCQA 4RVCA 2GUGA 5DBHX 2GZSA 2WP8J 4G1UC 1CUIA 3PGVA 3K1AB 1PHPA 4OXIA 5FPYA 4YXWA 4ZHQB 1GPJA 1PQWA 2UYOA 3ZJVA 1T1EA 4PLTA 2BJHA 4K81B 3RVOA 2BVNA 4ZVRA 4E2WA 2FW8A 5D51S 4CXMA 3OTOB 4OGLA 1T0JB 5CDFA 1BMDA 4CU2A 1OQAA 2FMIA 2F9FA 1V6AA 3KR2A 2NQ2C 3DFZA 2WIBA 2HN9A 4E94A 3ZJUA 3N39C 5D7NA 1U7DA 1YWGO 2QF7A 2NU7A 1M2KA 2L19A 4UCWA 4UUNA 2IYVA 3DWFA 1SR8A 1JVBA 3H5NA 4G85A 3OT1A 2PWYA 2Z4RA 3QFSA 5EE5B 3MGBA 3TQQA 4P0QB 2D7CA 2FX3A 4Q3EA 5DBEX 5IYZF 3K2EA 3EMKA 2C5LA 4KQFA 1MQAA 1VSTA 3E03A 1WPXA 1YSCA 1DV1A 3AVQA 3LCJA 5IP5A 3TZHA 3EXG2 5F9HA 1SB8A 1ZIOA 1PJZA 5T4BA 1PT6A 3EIFA 3TLAA 1XQ6A 1NVVR 1SHLA 3ZHYA 3O2JA 1SD5A 3U4CA 5CT5A 1CZNA 2NUBA 2R66A 2P67A 2RI0A 1KI8A 3QXXA 1M74A 4KO3S 4N0PA 5A05A 4QIHA 5DE3A 4J94A 2J9RA 4NHEA 5BR8B 2WTAA 3VR5A 1D4OA 5A5DA 2FOXA 2GLXA 1FP4B 3USZA 3RYFA 2OLJA 3LPAA 2B7BA 1GGMA 1NU6A 3LUAA 4QWWA 4U02A 4UUAA 3TPZA 4JOSA 3I5AA 5KWJA 5F3DA 1ZUNA 1P0IA 4FWTA 4JSTA 2FPIB 1U3CA 3JASA 4IFBA 4OK6A 2C7BA 1XEFA 4U7WA 5CVJA 4O4LF 1P2VA 1J8QA 1GAWA 3DYVA 4HWGA 3OQPA 4WOJA 4WUVA 4ZCSA 4YCAA 1VLZA 1CQJB 2Y0PA 3ZCPA 4LCBA 5JC8A 4YRTA 1GU7A 2JANA 3FWYA 5EP2A 2OXEA 4MIYA 4QQKA 4QREA 2ZJFA 3UB2A 1AMUA 2I6TA 2C5BA 2KLHA 4MKGA 5BUCA 1A8SA 1PRYA 3LVBA 2NO4A 3ZKWB 1T10A 1ZCZA 3IPCA 4RFSA 3CWQA 3THSA 1EI9A 3C87A 3D2AA 3MXOA 5LXTA 4KR3A 2FTKE 2QT0A 2ZULA 4NCKA 3IQIX 4PIPA 1XZJA 4U4AA 3CEPB 3EGOA 1B8PA 1AKUA 3EIXA 2JI7A 3EW7A 2L82A 2WUDA 5EUCA 3M1YA 4QDXA 3S55A 2IKSA 1HTWA 3FDXA 2EKLA 4XX0A 1KFKB 3C3JA 1GPWB 3UNXA 3NP9A 3HYLA 3QE0A 2NV6A 3A3PA 4GI5A 4I50A 5LP6B 1FVOA 4OF4A 1F8UA 2FHPA 1ENPA 2ANCA 2E5LB 4KNYA 2WHYA 2SICE 4DDVA 1Z0ZA 1NP6A 1XXHB 2EKPA 4P7JA 1YIDA 2AKAB 3QX3A 121PA 2VPWA 2YN2A 3GAMA 2V1XA 4I7EA 4EARA 1OC2A 1GTVA 2QBYB 2XCOA 4CL3A 3TZCA 1U11A 5BV7A 2OHGA 3OF5A 1B14A 2BBOA 2CEAA 1PJLA 3NNSA 3K70B 1KI6B 3GJSA 1I01A 1D2EA 2P79A 3WI7A 4D81A 1FQKA 2JLCA 4JBIA 3GIWA 4BPRA 4I2NA 3CLTC 1NE7A 3VBEA 3KHSA 1MEJA 4OFWA 2FNAA 3OH8A 4P98A 4D6YA 3BEDA 3H2IA 2ZU6A 2V7GA 3ENKA 2OC9A 3DVAB 3LSYA 2Z1MA 1OJLA 2B98A 3HL4A 4C2UA 2H6EA 2WABA 4K6HA 1R88A 4OPMA 2Z3WA 1I9GA 1UPXA 1JH8A 1EX1A 2PL9A 3G5UA 1XEXB 1NBEA 5LQMA 1I51A 2Q0XA 2W0SA 1YJBA 5E9QA 3ML1A 4IDAA 1EE1A 1NM5A 2Y67A 4BE4A 1M67A 1K88A 2JH9A 4LGCA 5T6MA 4D9KA 3PE3A 4GSKA 2VDPB 4WCVA 5DI9A 3ENWA 1YD7A 3QTLA 4BLSA 3WL5A 3HKCB 1H0RA 3U4IA 1T6XA 2XRZA 5F5XA 5BWOA 3PX7A 3HB4X 4RDHA 3SFVA 5M29A 3C3BA 1RU3A 1AKTA 2FG6C 2VHZA 1LD3A 3DLPX 5JH7F 4RD2A 3ZX4A 1WJGA 5DXFA 1E5TA 1ADJA 1XSEA 1SD1A 2FEOA 5TT0A 1IU9A 3ABZA 1XVTA 3DM9B 3AL2A 4KI0A 5KYUB 1C30B 4ZOLF 4BFZA 4HLCA 1Y9JA 1PT9A 5THXA 5CB4F 5BPFA 4MQEA 3QWFA 1OFVA 2RBEA 3K9BA 1KJQA 3DD5A 4GP9A 4IOJA 4DBLE 4NONA 5BT8A 1ZM7A 2QMUA 3ENQA 4WNYA 2IBMA 3G49A 5AK5A 4PYIA 1WNTA 5LYYA 1XDDA 2NN3C 3GLIA 1JDZA 1G9TA 3FPAA 3VR6H 1JI3A 2W2PA 2AFIB 2Q6TA 3GNSA 2R87A 4ID3A 1PZGA 2WK1A 4UHKA 5BSEA 4IIGA 3DLBA 4AKHA 1TYAE 1RRPA 1FRNA 2BHSA 2V59A 1NVKA 4P3NA 4A2QA 1CUUA 2BF4A 2R4QA 4CLHA 3WRXC 5FPPA 3PD1A 3KQMA 2LXNA 2I87A 3L9WA 3TIVA 1ZPDA 2JLQA 1Q83A 5KJCA 2WD9A 1G21A 2Q45A 3G7UA 1Y9AA 2LKDA 3QF4A 1J99A 2EXXA 2JA2A 3CRNA 4JUAA 4RMHA 4YMLA 2H85A 1UZLA 2ORYA 4M86A 5I9IA 4CTNA 3BDAA 4LBZA 1RKUA 1V5EA 2WVAA 3P2YA 5A4DA 2XNCA 1XP5A 2DCUA 2Z6VA 1P4RA 3E18A 1PZFA 2ZJ7A 3Q0IA 1RQNA 3L6DA 2JIOA 4GOKA 4ZYYA 2JFWA 4PRYA 3IVXA 4ARSA 5CT6A 1JDVA 3P9YA 4GNRA 4UVIA 5HFJA 3S2UA 3DO8A 3HG7A 2YQ4A 1RYFA 4N5NA 4DQUA 2DLCX 1P3JA 1VL2A 3JWGA 1QX4A 1I0LA 4LOJA 4MARA 1NV9A 1VTKA 1JHUA 1C7RA 3A1SA 1DBSA 1QH8B 2X8JA 3M5CA 3FCYA 4R3NA 2X0DA 4AQ7A 1RIFA 3GUZA 3M6FA 3M9XA 1QQ7A 1SULA 3FZYA 3K5PA 4MO2A 1OV4A 1Y3HA 1APBA 2GILA 3P9ZA 6REQA 3FHTA 1RJFA 1VCHA 1YQWA 1WQ1R 2A0FA 5U9CA 4AZ0A 1O9GA 1Y4AE 3R24A 1KRXA 1JHPA 3W4JA 3CLSD 3V8BA 1AN0A 3ZOKA 1T3ZA 1GUZA 4RJ2A 2FSSA 4EHBA 2XUKA 3HADA 4OQDA 1N25A 2ATVA 2H1FA 2R6GA 3A14A 1HFWA 3FSJX 3QPUA 5JSFA 2XCTB 4L6CA 2O1WA 3FPGA 2NXJA 3D7RA 3RS7A 1PJ8A 2ZYDA 3CV3A 5K8JB 1CUAA 2CCGA 4C0AC 2XMDA 1U1IA 4JWKA 3ORSA 1VLLA 1LQUA 1T0BA 1OCEA 1U5AA 2WSMA 3KUUA 2JJQA 1SBTA 1CC1S 5AXDA 3E0XA 3G0IA 1M8FA 3GLGB 4QU5A 1JYSA 3UKOA 4DRZA 1F51E 4RESA 1H2RS 2YYAA 3LWBA 1KJYA 3HO8A 1MB3A 1DRWA 2FETA 3DB1A 3MCZA 1JSRA 1QIDA 4H6VA 4IPTA 4MTCA 2BTEA 3VOTA 5DTIA 2J46A 3URMA 3ZZMA 5FWDA 2ENWA 3QEJA 4LE1A 4PNZA 1CJUC 4YH1A 2ZSJA 3ETEA 1NQUA 4LQDA 1W4ZA 2NAFA 5AKZA 4AP6A 1DCTA 1SOUA 1ADCA 5CA1B 4J4TA 4REQB 4XUCA 5JCZA 3NIGB 1JMYA 5EIBD 2B83A 2Q7XA 1BVUA 2WYIA 4Q1VA 4FGUA 4D9EA 3SJUA 1K6IA 1C41A 4WINA 4ZYTA 3ES9A 4I99A 4ZN6A 2O8BB 3PC4A 3HHPA 2YX1A 1NG9A 1FSSA 3LQ4A 3ESAA 4DV6B 1U0TA 4PYKA 1XALA 4XB1A 5DXAA 1JR2A 3T12A 4EUFA 2QUJA 3W5SA 4MITA 3RRBA 2D7JA 2OUIA 1QO0D 3OQIA 4GEGA 3IQFA 4LI0A 2Q5OA 1WZEA 4NFSA 5LZ2A 1KI2A 3RSOA 4AUMA 4WKBA 2YASA 4OV6B 5CLIA 4XM0A 3IO3A 5TNXA 3CB4A 1DXQA 5HRCA 3RASA 1O87A 1XCMA 4DZRA 5EZ6B 2K2WA 4CCWA 3KJZA 3BD8A 1H2BA 3PQ3A 5IABA 1E2MA 4A0QA 1FDTA 2VYND 3HB5X 3KEGA 1CF2O 4GLFA 1E3MA 2HFJA 3QRWA 1HE5A 3MJRA 2GPYA 5DYGA 3M81A 2CW5A 4JVOA 5ITSA 4GKBA 1ONSA 1Z4PX 3VR4D 2Z8YM 1MC5A 3BSFA 3ED5A 1YRWA 1V3VA 4HH3C 1VJ5A 3R74A 4CUJA 3W77A 2HMUA 1U0LA 4YHBA 2P91A 2J08A 1QIMA 4W8HA 2C20A 2FVYA 4OD0A 3FW1A 5GJVC 5B55A 2HDWA 5F1YA 3EXEA 3O82A 3OVMA 2W6CX 4DAOA 4GRAA 1KKLA 3S44A 3DOFA 5KKNB 5KTTA 2GA9A 3MFYA 4EJSC 1H94A 2FF5A 3AEXA 3IMEA 4PSKA 2AFRA 3DT8A 3R4CA 1JHDA 2RK4A 1HBJA 4R0VA 1SVKA 3W05A 1OILA 5CBKA 1EFRD 4M53A 3L7MA 4PZ0A 4DDHA 1M2OB 1B8UA 1JJIA 2GASA 3ZVNA 4JLKA 2SKEA 2ZYSA 1TB4A 4HTFB 1YOVA 2VTDA 3KLBA 4YVFA 3VX3A 2H92A 3ER6A 1KKUA 2Q29A 4YMUA 3VBCA 1U63A 2ZSEA 4W63A 1LF5A 4E1BA 2EBUA 1NFFA 4N03A 1L4HA 1E4OA 1O2DA 4MQ4A 4BTLA 4PO9A 4MKHA 5GGYA 4RYDA 4Y2JA 1EUDA 3PWZA 4K40A 5E0OA 2WG2A 4G56A 4WK6A 3SIRA 4B7XA 2ODEA 2E82A 5FAKA 2FN7A 3MMXA 3PDIB 1RJDA 3KL2A 4Q9DA 1SNYA 3MA0A 5F5NA 1AB6A 3JRNA 4PICA 5I7FA 4RLQA 3RHZA 4AMZA 2VWGA 4R54A 5KSPA 5IS2A 2GPJA 2H08A 1A04A 4FE7A 3A1CA 4BLQA 1NNEA 4BATA 1R5NA 4EITA 2H17A 2ZZMA 2PYZA 4NBSA 2VA8A 1F8YA 1YB7A 1Z2DA 3N3AC 3ENNA 3O8OB 3JVIA 4OIFA 1QC5B 2XAAA 4PZYA 3ZCQA 2PPVA 3DTVA 5FPTA 3IC5A 5KNBA 1LI7A 1ZRSA 4OJYA 3TTXA 2UUOA 3VKVA 1MC4A 3U5ZB 4GQIA 5DX1A 3JZAA 1PEKE 1NYLA 1M1NB 2A88A 2JS7A 4UM9B 2FEAA 1Z4KA 2FW1A 3BN3A 3L79A 2N9UA 3ASVA 4LJAA 2BUCA 4IBOA 4WNIA 1TUEA 3WDLA 5JMTA 2BH2A 4ZOQI 4CMJA 1ZMXA 5E6SB 3P45A 3H17A 2IYSA 3QHQA 4DVGA 4EHKA 1WD5A 1WCV1 2WM2A 3CNHA 1ZCAA 2H1RA 3I39X 4HYQA 4ZT3A 4KLRA 4BKOA 3QI2A 2YHIB 2AV6A 2HPZA 1T1JA 2QLNA 1GRQA 3FF1A 1AZWA 2FPGB 3K3PA 4MVJG 5C3UA 3UXEA 1SG9A 1LWOA 4BB5A 1DIOB 2YRXA 5DHUA 5B1IA 5HJ7A 1XT6A 4CRWB 1A4UA 4XDGA 4PQGA 4L4ZA 2O7NA 3EGVA 3W4IA 4RO0A 4ALLA 4D0LB 2Y68A 3TLZA 3D8TA 3RIEA 3V6LA 2VJLA 3E9QA 2O1XA 1QZTA 4UDYX 2ADFA 1B3RA 1ZGAA 4KP7A 3OM9A 2AZTA 3B6JA 3BL5A 1SBNE 3D3NA 1AKNA 1IHXA 2JFBA 3JZFA 2OXRA 3RS4A 3T34A 1B16A 1TEHA 3F7MA 1T5LA 6YASA 2WAAA 1OXTA 5C1OA 4Y6GB 3J81k 3AZPA 1OAOA 3DULA 4M46A 1YZHA 1I2DA 1RDFA 2B5VA 3KS9A 5TC4A 4LWZA 2WTUA 1CZHA 4YRQA 1EVYA 2DJIA 4I3FA 3TS1A 4YYEA 4YUWA 2DR3A 4FEYA 3IESA 2LDBA 3KK0A 4F97A 3KFVA 2MSCB 2XMQA 3AUKA 4GI3A 4IHQA 4XPIA 3VPDA 1Y80A 1FDOA 1BH6A 4PPYA 5C53B 3RUIA 3MTJA 1JJAA 3K9HA 3KKEA 1G8SA 1LNZA 3I3SR 3UHFA 2ZI7A 1G6OA 2OBYA 3E7PA 4UBIA 3QFCA 1QYXA 1KKMA 4XGRA 1IWPB 3W9UA 1XX6A 4MUAA 4E2FA 1VE9A 3I01A 3WQQA 3QX7A 4UASA 1T5IA 1CB7A 5IVDA 4N6NA 1K9VF 4B3GA 1WB4A 2IUFA 1RBZA 4RA9A 5HILA 2XOKA 1I1NA 1QV6A 3LHDA 4LRTB 5AHXA 3VNAA 1KP9A 4CMHA 5HBRA 1NC1A 4HWSA 1K8ZB 4IIUA 3TRIA 1BCSB 3BORA 4KSCA 1X7YA 1R6AA 4K9LA 3VTZA 4RACA 3AI2A 1L8AA 4XYMA 2OCBA 1VE5A 4GKVA 4B3BA 4D9FA 5I5EA 4PZUA 1PV4A 1Y4ZA 4ND4A 4MZXA 1I3NA 2M1XA 3NALA 3F71A 1KOFA 3C4JA 3D8NA 3FVRA 3KSAC 2C88A 2VQSA 1C1DB 3CR3C 4ITRC 2F1HA 3O4RA 1JEDA 1SVSA 1JHZA 4YXWD 4WEOA 5EZYA 3HCWA 1VJ0A 2GAAA 2LWIA 2Q0HA 5KI6A 3GVPA 2R8ZA 3WYEA 5LDDC 1H9BA 3HRIA 1TM4E 2Q3FA 2XTNA 4FDMA 5DHFA 4TUYF 4F04A 3OLWA 4HDKB 5HUHA 4EA7A 2X4LA 1O03A 1U7OA 4CM5A 2VJMA 5DLYA 5KDDA 1JKIA 1ZGZA 1XLVA 1M7BA 3DC2A 4HXYA 4WDQA 4WBSA 4YS6A 3IP6A 2HIAA 1ZC3A 3H8JA 4ME6A 4MRAA 3NBKA 2AQHA 4PPGA 3VDMA 4ENUA 5A04A 1JALA 1S8AA 2I6XA 2KMLA 3D59A 1AK2A 3NVMB 2HJWA 4YJ2F 1TYCA 4ZMRA 3FY4A 2VXCA 1XRPA 4RY9A 2JIBA 2BUBA 3GEIA 1OGJA 1QCYA 2Q1UA 3CLUD 3PQ7A 3L02A 4KLNA 4BAUA 621PA 3EQ7A 3SBDA 1UK6A 4IUDS 5C8YB 4UULA 2OFWA 3MJSA 1E3WA 2CMFA 5GZ3A 1K6EA 1T34A 2XTJA 1VLMA 1L5RA 3N8DA 4PHGA 1XNGA 1CDEA 1I14A 2I6QA 5IAKA 1X92A 1K8QA 1UBHS 1V41E 1ZKMA 4ZEOA 1CHDA 5A71A 4Z3KA 4WSOA 4JQZA 4KAAA 3IR5A 4NAHA 2QLTA 3IBCA 8LDHA 3K8ZA 5CX1B 1GA6A 2YJTD 2G0AA 4PZDA 1JAYA 3X3HA 1RQ7A 3ZGNA 3W7VA 3M89A 5DIFA 4MB6A 3VR5D 2VPQA 2CJPA 2AX3A 4LZZA 2C4TA 4G0YA 3WXBA 1RI5A 4UEOA 3IQXA 1WUTA 3NDPA 2QW8A 1CB0A 4DDUA 3C70A 3DTNA 4N7RA 3AX6A 2BJVA 3PTAA 4I5DA 1U9JA 2ZJ4A 4LZWA 5DYNA 4KMSA 2P2NA 4KWEA 5J23A 3E5NA 3ILXA 4C21A 4DLWA 3K6SA 3GUYA 4LPSA 1WDLA 1VRWA 3FOEC 4JLSA 5K0FA 1U8UA 1BC5A 2I1VB 4PFQA 1K4KA 4ZVLA 3H1EA 1GQRA 3Q98A 4KACA 1AA6A 1JDBC 1LQ2A 1QORA 3EASA 2XH8A 4JT9A 3SXUA 3T1HB 2DR2A 5CM2Z 4C06A 4NI5A 3H9JA 2OGTA 2VJNA 3AETA 3SQDA 1JSCA 4YFYA 1FSFA 3AZOA 2QN3A 1V37A 2BFOA 3A1WA 2Z09A 2X0NA 1RQXA 2FU5C 2WMDA 1EG7A 1BGVA 4GS5A 4ZAZA 1QJCA 4P7KA 3QTTA 2PUGA 2YWGA 2OORA 5K4GA 1FVXA 4TMWA 1QZ3A 1IZ7A 1N5KA 2NP7A 1IE3A 1UWVA 1BXKA 5HZGA 2HQBA 4GZLA 5JARA 4NCBA 2WTXA 4Y2XA 1YOBA 2ZPTX 4IGKA 1D5WA 2J5XA 1KETA 1VIYA 3I2IA 3KP1A 3E15A 1MEEA 1N2HA 3R3UA 4HZUB 5DW0A 2H5EA 2YWEA 3DMHA 4P83A 4CM4B 1WDKA 5KSWB 4UTOA 4CMEA 4MVJA 5A4AA 3OIWA 1T13A 4TTIA 1PL0A 2GNAA 4EMBA 2OFPA 2Q41A 3G9TA 1KIMA 2J0UA 3W06A 4H0CA 1LFAA 5AVUA 1AE1A 1GY8A 1JQBA 4N5IX 4PAWA 1ND5A 2ONZA 1L5HA 4BLPA 1RC8A 3HM9A 3HU2A 1PBNA 3I2FA 3ORHA 3KCNA 4OQZA 3D2CA 3ZN2A 3ZWWA 5FI0B 1KPGA 1DKLA 1K97A 1LBIA 5G4KA 1YJXA 2JIZA 4KZKA 1DU4A 3P2IA 1L4EA 1N0HA 4OFZA 5BXQC 3NCTA 1S4QA 4R8KA 5C7IO 3DEKA 2R751 1SVIA 1E3IA 3FOCA 4FGJA 1N3LA 4RNCA 3RBAA 1CFJA 2PL1A 4UTVA 1UPCA 1NULA 2R5NA 4Y0NA 1JHQA 4E15A 4BDSA 2NLOA 1ZUD1 2PEZA 3CLTD 3GCWA 3TUIC 3VDQA 4BKMA 1O8CA 1WVGA 1L3IA 4OO3A 1RTTA 3H4IA 1JKJA 1Z74A 1V25A 2QZ9A 2EJBA 4F86A 3H2YA 1M2FA 2WD8A 1NBWB 1T9DA 4AS3A 5I9LA 1RWQA 2HJVA 1IXSB 1QH0A 3A37A 3F97A 4Q6WA 2P65A 1WA5A 1QV7A 3P9XA 1RLTA 2HI0A 4PG4A 3RS5A 4KPYA 2B2XA 3SIPA 1GFWA 4RC9A 4EIWA 1P44A 2GM3A 3CA8A 4RVUA 1OLUA 3NAGA 2FJPA 2GO7A 1LLUA 3JRWA 4MVXA 4AXBA 3VO9A 2WFMA 4BO3A 1XTTA 2J45A 1IATA 2NYVA 4HZGA 4QOEA 4CHTA 5JEEA 1W52X 3JQAA 3T7TA 3E7FA 3CBGA 1N1EA 4AB1A 4G07A 5ADVA 3NMUF 1Y8RA 2H9AA 4R01A 3CVVA 3R2JA 2HRDA 4MAAA 4NPHA 3STTA 3NPMA 2H2IA 3E23A 4RUKA 1RD4A 4EMSA 1OX4B 4EYQA 4GL2A 3IIIA 4WD3A 3S2ZA 1AXRA 2FQQA 1TGVA 2EG9A 4QQRA 5BMVB 3FPKA 4HNUA 2QAGA 3KYBA 3ZUGA 3H1AA 2O6HA 1CZOA 2C9BA 1AKQA 1USWA 3B3AA 3F67A 3L7CA 5H80A 1DAKA 1O96B 2P35A 3RVRA 5GADl 2POQX 3A26A 3FOWA 2CDCA 3RARA 3WBBA 1NASA 4W99A 4JVSB 5EJEA 2HWXA 4DQ0A 2Z1NA 4JL8A 2VNJA 4QL3A 1ZNWA 4ZVMA 5ERXA 3F2VA 4YONB 1MB9A 1NT4A 1NV8A 3AKCA 3DV0A 3PVCA 2VH1A 3MT9A 3AHIA 4Q7KA 3V2GA 3H75A 4BGDA 4D25A 1Z56C 4KQ9A 1O6FA 2G1JA 5DBOA 4XRGA 1M66A 3AFOA 2WI8A 2W4IA 2C96A 3FLAA 3NYWA 2JPDA 3Q3JB 4IX1A 1JMVA 4NTZA 4PC6A 1Y6FA 1LDMA 4KXLA 2BWJA 1K7YA 3KJEA 1AQUA 1NBIA 4J3FA 1EK5A 3RANA 3Q41A 4TSFA 5HMLA 1CZRA 3HGTA 3OPVA 4B0OA 4OAOA 4LDPA 5CW2A 5JNUA 1AK1A 1ATZA 4A92A 4RGYA 1YVEI 3QVWA 1Z13A 1RRKA 5LQDA 4H3HB 1FMFA 1OFTA 1FE8A 3PYLA 3JAKB 2DG2A 4BFVA 3C0KA 1EFPB 1II8B 1JXOA 3ZWDA 1VC2A 2UDPA 3N59A 5DHRA 2QJFA 5K0SA 2BYTA 2BN4A 4AP9A 4NYMR 3CO5A 1NSFA 1MN6A 2L17A 3AKDA 3ONDA 2PO5A 3GJ0A 2WWTA 2D4HA 2CUZA 4KWTA 3D4BA 3H5LA 4IIDA 4XD7A 4MPTA 1YZKA 2OK7A 3U4MA 2L18A 1CWUA 3DYIA 3QY9A 4EVSA 5KHLB 4Q4JB 1G2PA 3OAAA 4XWOA 4OBXA 3HY6A 4NYIQ 4XWKA 1K1EA 4UTPA 1FYDA 1M0TA 2XUHA 4ZYLA 4U6NA 1K8RA 3NH9A 4Z7OB 5HQTA 1FBTA 1RYHA 1K0UA 3HCEA 4NENA 1CS4C 2BUAA 1RP7A 3HLYA 1OASA 1J07A 2Y0DA 1D4FA 4FPXA 2PUDA 2MT9A 2PGLA 1NLUA 4LF4B 3KEFA 2C3MA 2VS1A 2Z3ZA 4RJJA 3U44A 3Q8KA 3OO1A 2VDNB 4W7HA 5IBRA 1A98A 1XXLA 5B3AA 4M49A 3MPOA 5ENZA 2NW6A 2VZ0A 3ODGA 2J3JA 5FULA 3ISVA 4KHZA 5AHRA 2I4NA 1E2UA 4IO1A 2VSXA 5IUKC 5B37A 3CEMA 3OA2A 2IIVA 4HQOA 4CKEA 5TS2A 1GXSB 3W7BA 3QPAA 3RC8A 2H2FA 5HG0A 3TLCA 2DY1A 2F1IA 4DYDA 4KRYA 3TD6A 4GT1A 2XRFA 2TMYA 4JU8A 5DT9A 5MHTA 1X38A 2ZS7A 4KFRA 5CYOA 4ZARA 1MQ9A 1Z0IA 3IBYA 4DLUA 2JVJA 1ZO8A 1X80A 4RQBA 4AJOA 4YJ3F 1N2GA 4IOKA 2IHKA 3EF3A 3H9EO 4TMTA 1KEKA 3M6VA 2OBNA 4ENVA 4EYOA 1GFSA 1DG9A 1PIWA 2CFRA 4GFDA 1QYIA 4MUYA 4OB7A 3CSUA 4ZGGA 2IEAA 1HUQA 2JJ1A 4U7HA 1JJVA 3SD7A 2IYNA 3C74A 4IF6A 2XLCA 4QTZA 1YXMA 2QXUA 4KWIA 4FEGA 3IEXA 2ZWOA 1BOFA 3KRTA 2IEBA 5FNVA 1KH1A 1W29A 2QTGA 3UMJA 4TTJA 5JMPA 4GQBA 4RIEA 4MW2A 5AMXA 3MTDA 1NURA 4LECA 2X0FA 3SZLA 2PN1A 2YW9A 2AWNA 4HK4A 1T6BY 4Z4HA 3UA3A 4DA9A 3BXPA 1SIOA 3JARB 1E7RA 4MUFA 4NE9A 3FOZA 5AXAA 2ATEA 1Y3AA 1DB3A 4C04A 2QJWA 3MYYA 5C0OE 4MQLA 4XDHA 4M0CA 5CURA 3QTBA 2VEOA 3V4VB 1FX0B 1HLDA 4O4JB 2D6FA 4W1QA 5IULC 4U7PB 1AO3A 3LE8A 2L0XA 1ZK4A 5LU8A 1WR8A 1FMTA 1JB1A 2AC7A 2FWNA 1W87A 4QUAA 4HVAA 4MULA 3HV0A 5DGCA 4F5ZA 5EVJA 1PTJC 4IJ5A 3T52A 4BIIA 2JHAA 3EFOB 1RIIA 4Q3LA 1DC5A 1OB5A 3RS8A 4FCWA 1DAHA 1QRDA 5JBQA 3DE6X 2CVOA 3IP9A 1KO8A 4LXHA 3NTVA 4M22A 4YO7A 3E8SA 1OI3A 1PVVA 1SCKA 1VDZA 2QE7A 2ZCUA 1M34E 4WT7A 4QYIA 4G24A 3O0DA 1O97C 5B6JA 3D6VA 1PTJA 3LDFA 4PAOA 1DEKA 4QU8A 4AKTA 2O8VA 4F3NA 4KRFA 2X22A 3RYHA 2ZJOA 3GFFA 1Y4SA 1CNFA 2VP0A 5ENDA 5A5EA 3ECCA 3GZNB 4GPD1 2XGSA 1OZFA 4H17A 2CB0A 4W9RA 3INRA 4HMQA 2OA0A 3L8CA 2AF3C 4CKBA 1N5LA 2PX3A 2UUPA 4FJ1A 3TUJC 2PH1A 4G65A 4Q3AA 3IEUA 4EPXA 1ZJJA 1QP4A 4C88A 1UMKA 3GJ8A 4QPCA 4LGYA 1C9MA 2AH5A 4V1CB 3Q8LA 3I4FA 3HU5A 4ZHQF 1MVNA 3UAWA 3F5MA 4D98A 2CT8A 2QM8A 1W5SA 2EKQA 1O0CA 2JGFA 3DTVD 2H63A 5KNBD 4M9RA 2OXIA 2YYSA 4RJIA 3DOOA 1A9ZA 4X63A 1M2VA 4XWTA 2NZUG 5TX7A 4W6ZA 2G6TA 4G5FA 2QDKA 2J9GA 4U2DA 1A96A 4HUJA 4ROSA 3ZBPA 2RC6A 3OC0A 5JQGA 1BMQA 4M0LA 1O4VA 2QNRA 4BASA 4IQGA 2J4DA 1S2DA 5B5SA 4PG8A 5DU2A 2YZ2A 4HYEA 1SPBS 3ZV5A 3SYTA 3JAWA 2I4OA 3LKVA 4DDWA 3DJYA 2Z5VA 4OYHA 1L8XA 2C0PA 3UTCA 4ZYZA 2IQIA 2J85A 2LRHA 4IVQA 3PQ4A 4RVFA 5JNWA 3THWB 2FZ4A 3AUTA 2DLNA 1QP7A 3D0KA 5DLEA 3G2KA 5JDIC 4YQYA 2UXBB 1JSXA 1VHTA 2CDNA 4GM4A 4P3XA 1Z4JA 3OY7A 4YQZA 1BFKA 1RMQA 5ALUA 4NE7A 4AJKA 3GUHA 1Z06A 1P1JA 2AXEA 2YINC 4PTZA 4ZANA 4BVLA 2HHHB 1HX7A 3O83A 3EEFA 2IUUA 5AKYA 3LT4A 2IU4A 4P86A 4MP8A 2IGTA 3UXHA 3BFXA 1LDGA 1W1IA 4I19A 2MMGA 2IKQA 4UOQA 4Z4QA 3AVWA 3DF7A 1QIEA 3HVUA 3LBAA 2CVFA 4IZOA 4DG5A 3HUDA 4OJTA 4P5DA 1B23P 4J7XA 1G0OA 3ER8A 2JHPA 2E5WA 1WCIB 4MP6A 1RMTA 4WFQA 2DC1A 3OHSX 3NTXA 2J9YB 2G08A 1YS9A 3EQ6A 3TW8A 3H2KA 1F3OA 3BJIC 2HV8A 3KWJA 4K86A 3D7MA 3DQPA 4L1KA 3G0BA 5A02A 1U3GA 2CYCA 1LPMA 5DSXA 4Z0TA 3RIYA 4CM6A 1HL3A 1T2NA 2V7UA 3ANSA 4K9KA 4CG2A 4EY6A 2VHEA 5AVRA 3ABRB 4ETNA 4YX9A 1IMOA 3LFHA 3LQ1A 4C4PA 4Y9SA 4H59A 1UAYA 2VF7A 1Z16A 1PUXA 2XOKD 4UD6A 3PFWO 2AN3A 1S6YA 4MR8A 4Q03A 4RL4A 4W8OA 3I52A 4AZ3B 2UZ0A 3D3KA 5F77A 3BREA 3EFBA 2CXOA 3M1IA 5LMZA 1LPAB 3HXMA 2C4VA 1NMYA 4NYJQ 3RIXA 1NKTA 1WPGA 3ZV6A 5LQJA 3IKJA 4NVRA 4ROTA 1ZNZA 4TVBA 3R3HA 5CVVA 2H1OA 3ST7A 3AF3A 1O6GA 2P69A 4P22A 2FDRA 4BTEA 4KPGA 1DX9A 2ZDHA 5LP6F 2YTZA 1BEEA 9GPBA 4D2IA 2A5FA 5IHPA 3EZ9A 1QRAA 2E3JA 2OQ2A 1P0FA 2VRNA 3FNRA 3AT1A 3KYCB 3FUXA 5DK6A 2BR4A 3FPEA 3UYKA 2DULA 2OBXA 3DVSX 3L46A 5ALTA 5C5CA 2WB2A 4ND5A 4EKEA 4XWAA 1E9CA 1GZHB 2FMXA 3HJUA 4B4KA 2F3TA 5CBPA 1N3YA 2IIBA 3HSSA 5IVPA 5FTLA 4CQNA 2RHGB 2EEZA 4MMZB 4P6VF 4DEXA 3UOGA 3ZDFA 4AMUA 3BGSA 3KD3A 1ZM2A 1V48A 4WHMA 1GQFA 3GG9A 1L1QA 1UOQA 1YK1A 4A4DA 4KI7A 3KFXA 1A97A 2P2GA 4QGAA 1G7CA 2VATA 2WPNA 4K05A 4EHIA 3P19A 2VBIA 2ZAOA 2CLKB 3P97A 1K7XB 1VLJA 4J0FA 1E2QA 4FXPA 3ZOZA 4ZDJA 1BQ3A 3QI7A 2VP4A 3QKRA 2YJ3A 4ALJA 1NUSA 4E22A 4EWLA 2XYVA 4RETA 3ITKA 3LT5A 5AFSA 4YMHA 2HJGA 2E4YA 3HN7A 3W6NA 2YXBA 3TR0A 3L92A 4JHXA 3CRRA 3WRWA 1SZCA 2X0RA 4G4IA 5J3JA 1CZUA 1H5UA 1PNTA 5P21A 1A3CA 2PG3A 3CLRC 3SHOA 2ZE8A 3GRRA 2P2YA 4BV3A 1UZMA 1LS6A 2A4KA 1Z82A 2Y92A 3I53A 2FN4A 1EVIA 3LK6A 4LQ4A 5BWCA 3A2KA 4XEUA 2O20A 1CUJA 5KIAA 1U02A 2A86A 1AKWA 4BJ3A 4F0JA 3AINA 2PSFA 3G2MA 2PXHA 2DAPA 3VKUA 3NUQA 3Q3EA 5DZSA 1ULAA 3B51X 3SEFA 3PR2B 1WCYA 5KYXB 5KQLA 3KM0A 3HMKA 1X3LA 3IDAA 4N3BA 2R7LA 1V96A 1GN8A 1FTSA 2QLLA 2WFLA 3HKDB 3OCJA 4BXOA 2WHPB 4CDMA 2AS0A 2H65A 2OVBA 2YMMA 2KX7A 2ZBQA 5B53A 1T0PA 3VH4A 1WZUA 2NO0A 4GMKA 2G4CA 2FZEA 3E4CA 3OY2A 1ZGJA 2EL7A 1N36B 2VJBA 1QXSA 4E14A 1I36A 1ORTA 2EIHA 5TLSA 5AD1A 1TDJA 4RVHA 4D74A 1V9SA 4IMIB 2ZAGA 3D6UA 1WE2A 3GMDA 2A5DA 4Q19A 2CV1A 2BKLA 2PTHA 3QOWA 4YO8A 3A6HA 1R4NA 1HE4A 2P2SA 1RMYA 5C31A 2RG1A 4NIMA 4DSTA 2VTBA 2C07A 2X4GA 4ON9A 1POXA 1Q0QA 2FN3A 2YOFA 3CQ9A 4MVJI 4E0BA 1GCUA 3AIMA 4XFDA 1XNRB 3TAUA 3P4YA 4W6QA 4RKRA 2EFYA 3FYHA 2QPAA 3ZNOA 2Q7OE 4BFXA 2CV2A 4O8ZA 3UHPA 2PWZA 3DGEC 3OA0A 5ICMA 2BHTA 4F85A 4WNAA 5FL7A 3OT1B 3R5TA 2XA1A 3QH4A 3ZXXA 1E2HA 1KWGA 2JFUA 4IIJA 2XDWA 3FDFA 2P5YA 4NPAA 1JHXA 4GBGA 4E5DA 1YL7A 3IAS1 3WGVA 3EIOA 2C4HA 4Z1OA 4MVJD 1G19A 2YFQA 2IRWA 2Q8NA 1Z7EA 4DLAA 4GLLA 2BTOA 2MHCA 3O8QA 4X5OA 2WTEA 3DDZX 4IJ6A 2EFDB 1NVUQ 3LM8A 2WR8A 3N87A 2XMPA 4NOLA 4WECA 2VJQA 4AUKA 1PW5A 3RPEA 4Q37A 2OCAA 1J97A 2OV1A 3HCPA 3I04M 4RM2A 4MUXA 1HG1A 4HAWA 3TR6A 3ZEAA 3GMSA 4YJ3B 4WFIA 5C2JB 4J1TA 5IKXA 2B7CA 1IZYA 2GH1A 3HP1A 5H82A 4IRUB 3RYFB 3ZE1B 4HAZA 5JD4A 1JWAB 2JIZD 4EM6A 1NX9A 2IZ1A 2QRLA 3E5MA 1SVMA 1ZUNB 2LPMA 1Y1PA 1ZJ4A 3MSCA 4IILA 5B1DA 5EJ6A 2YOHA 2Q2WA 4J0DA 2P9ZA 2HXSA 3C6KA 4LXYA 2G5CA 4Z0PA 4OHYA 1KK1A 1U90A 5HDBB 4HB2A 1W5AA 2CVHA 1FNSA 1S8NA 2OV4A 1WRBA 2LE0A 2VWHA 3PPIA 3RSSA 3V32A 2QTWB 3BXHA 3HKBA 5K0EA 4A15A 3FR8A 1NR1A 3R7LA 3HXOA 2ZUCA 3G89A 3HJGA 2F1OA 3HXLA 3KPJA 4G9EA 3REQB 2C7VA 2EARA 2WAOA 1VZ2A 4M1QA 4RFSB 4A0RA 5LXTB 1T3LA 1LJUA 5FB3A 4C7OA 1QDLB 2M6KA 4QYXA 1V8ZA 4Q4AA 4ZXFA 2DBZA 4BCDA 1ULTA 1U8EA 3I6IA 3PDWA 1EGMB 4R7ZA 4XWWA 2YVLA 1P8JA 1Y3FE 1RAGA 2X5NA 4RF4A 3AVYA 1ZHOA 1ZHHA 4DNPA 1S2MA 4BBZA 1QKJA 2MSWA 3F4KA 2N46A 3NHRA 2ST1A 1BFUA 1SFRA 4Q0MA 4WESA 3RC3A 3KFLA 3R77A 5G0UA 1FW6A 1Z6TA 3JQAD 3NIDB 5J43A 1IEQA 4CCAA 3I61A 1QGAA 3ORYA 3PXUA 1YDFA 2R8BA 3CRVA 2EW1A 4RF3A 3BJMA 1DEAA 2XCRB 4KAJA 5JAOA 4B7AA 2P6OA 4QXRA 2FMHA 2YS6A 2ID4A 3C3YA 4NNPA 5BYKA 3FMPB 5CA1F 3IAHA 2XMGA 4FYYA 3U4HA 4ZK6A 3ZHUA 4KR6A 1DJMA 7REQA 2Z57A 4YRPA 3M5DA 1GCGA 4LS3A 3JZIA 5TARA 3RFFA 1GNVA 4YRIA 3BFVA 1ECCA 3LFUA 4E5YA 3Q3IA 4Y6PA 4R83A 1IULA 2XX3A 2YH2A 3TR5A 1B1CA 4C89A 3FGZA 2AG5A 1L4MA 1VPEA 4RF5A 4B5KA 4YRGA 3PJGA 1Y5NA 4IDCA 5L3QA 4GRDA 2XBLA 3DAPA 1NW3A 5IEBA 3P0IA 4HL6A 5G41A 5CPBA 4YAIA 1QLHA 4M37A 4EB0A 4MWBA 1OPXA 4JBYA 1SOWA 3ZQUA 3VPCA 5BSFA 2J3LA 2QQ5A 4B3HA 2Y76A 3W2EA 1L5GB 1CEQA 4NEQA 4OX9Y 1MZVA 2P9TA 4MKFA 4XCQA 1M5RA 1HRDA 3NATA 5AOBA 4MV7A 1RQLA 1NRIA 2C5HA 2DTDA 2IYAA 3FAZA 3H0EA 1JQ5A 2IYLD 2VCYA 3HFJA 4MINA 2HSDA 4TSFD 4UC0A 2HA0A 4JJIA 5IJ0A 4YAOA 1FP7A 4R69A 2A84A 5C8XA 1C9KA 5ALVA 3HXTA 4D79A 4KJZA 3P9KA 5C7OO 4XKJA 3MCVA 1G291 1YCFA 2PX8A 5TQJA 2Q28A 3A7DA 4FHDA 4GO1A 1T4CA 4WZAE 4A0HA 2WM9B 3K0KA 3LCVB 3TYXA 5C1DA 2IEGA 3IODA 3A6PC 4JKYA 1ZH6A 3A9UA 4F2PA 5DTEA 4J2OA 4KIFA 1ZVJA 2KBEA 4RMNA 3UT5A 2VT2A 3VU0A 3C2QA 2WILA 5JI3E 3QVJA 3CUKA 2EJCA 4PF1A 3PT5A 1QG4A 1PN3A 1XU7A 4FQ8A 4MQEB 3RC7A 1IOVA 4BNMA 1TIKA 4MRSA 3V2UA 1JEOA 2FWPA 4XD7D 1SOAA 3MLEA 1JVSA 4JQYA 4CM9A 1CK4A 1J8MF 3IOEA 4C0SA 2A9RA 4B8ZA 1Z5ZA 2Y6UA 3B38A 4IV8A 2DPLA 2J3HA 3OAAD 2GTHA 3KYIB 3J7TA 3LQRA 4U9HS 3JQEA 4X61A 5SICE 1KZ7B 3BXOA 4X6XA 5T6BA 1D07A 2Q6LA 3I72A 4D02A 8ATCA 3ZD6A 1M34B 3VC1A 1ZOOA 5ALPA 2H5IA 2PQ0A 3R3WA 4JYCA 3ZJ4A 5BR1A 1CR6A 1HEUA 1JAIA 1CR2A 1EP1B 2AG0A 3DHNA 4KXWA 1GPH1 3LA6A 3BX1A 2YZNA 5D87A 3HSKA 2E1RA 1NNI1 2PRYA 4DCNA 1G21B 4QZVA 2XIJA 3ONFA 1BE8A 4B3IA 2H1IA 1QG0A 3KT0A 5BYAA 4DQLA 4EUHA 4DWVA 1JFLA 2ZDQA 3WLEA 4Y0VA 4GLBA 2YJ6A 3P9NA 4DLVA 4LSMA 4HGPA 2Q8PA 4Z99A 4RTJA 4R16A 1I3MA 1MCZA 1RHMA 1RNLA 3FCSB 4ZT5A 1TYZA 2ZRPA 2HA5A 1D6SA 1ZSNA 3IR7A 3DL2A 3ZW9A 5LSAA 2POCA 4L51A 4BY9E 2A9QA 3FVQA 3RI3A 4BZPA 1W1UA 1JIKA 2CFTA 2W2KA 4OQEA 2Q9AA 4FHGA 4Y1EA 5HMMA 5HIJA 1YJ8A 1GKLA 5AW8A 1G3QA 2X8JB 3G5TA 1KE1A 3PX3A 3WK4A 4AG6A 1Z38A 2QB5A 2PD3A 1NOJA 4XUEA 5EMNA 4A6XA 6REQB 5IT0A 3PDHA 5HIMA 4ZYXA 3UGQA 4EW2A 4AZ0B 3OUTA 1FFCA 3OURA 2IY8A 2FLKA 4KXNA 5LC1A 5IVHA 3NHZA 5L4LA 4EKNB 2AGVA 2JJ1D 4BZQA 1ZN8A 4ILEA 4DWWA 2MINA 2YV3A 3P32A 5DNWA 2X0JA 2AMYA 2RHHA 2ZVDA 4OHBA 3VR6D 221PA 2D1QA 3W8EA 5IJ9B 1RXUA 2JFXA 4XGIA 5JAUA 3C48A 4HXEB 4UCXA 2R6JA 1I7PA 2G1AA 2JGDB 1L4FA 2XUAA 5DXJA 3RE1A 3UUWA 1NXXA 1F7UA 3ERCA 2GK7A 3T3NA 2XZTA 2DT8A 2Q6OA 4R9NA 2JLVA 4P80A 1TKCA 3V6MA 2G72A 3KOMA 4Q34A 4CMBA 3MRVA 2ZB7A 4Q1CA 2YN0A 1WDWB 2HIMA 4RZ3A 4DLKA 2R7KA 3B3JA 5ALKA 5KOHA 3NI2A 1JSLA 2BFEB 2ZSIA 4ZEMA 5HNKA 1UPTA 4YJFA 2O8EA 5JJIA 1N6PA 2JIQA 1Z4QA 4JAVC 1H4QA 1F6BA 2BL4A 2C2XA 1TYEB 1CKEA 4ZT6A 1GPLA 1LX7A 2ZR9A 3H5WA 3INGA 1E58A 2PRKA 4ZO8A 4B40A 1ZL2A 3PD7A 4LXIA 3UMMA 3FYDA 4I14A 1VGRA 3O4HA 2PBFA 3H5AA 5JY6A 4LKRA 2PO7A 4B85A 4C5BA 3BD6A 5JS8A 1KEWA 2WJPA 2AI3A 2QE7D 3A6GA 1E4VA 4LNAA 4Z2YA 2XYHA 4KXYA 3LOQA 5FA6A 1HG0A 3EY9A 4ARBA 1DC7A 1GG5A 1J23A 1I4OA 2HRCA 2VYVA 5EJ2A 1PWXA 5TDHA 4J0CA 3BTSA 4I9HA 5FPQA 3I64A 5HR5A 2BJWA 3OMWA 4YCBA 5D1NA 1Y63A 3OQIB 2Q3EA 4TT3A 4YT8A 5JFTA 2BZ0A 1FRQA 1K0FA 1YBMA 4NZ9A 1O97D 3SYKA 2XNKA 3RU3A 1G8KA 4EG1A 4TQUS 1JKXA 3ECSA 3ET4A 2OBFA 4TKZA 2AG8A 2I1WA 1Z28A 3DNMA 4X90A 2C7QA 1H65A 3JYOA 2PKCA 1T5BA 2D8MA 4R1TA 3RRXA 1JHVA 1UT5A 4ZCQA 5LNK6 5JBNA 1C0KA 1Q21A 4KKXB 1W59A 2R6CA 2ZANA 1H5NA 2ZYUX 3FTQA 3GFSA 4XQGA 2W11A 1HLFA 2AN9A 1NFQA 2EJWA 2PLNA 2Y2VA 2ZRLA 1P7YA 3S2YA 4EATA 5I4KA 3EZ2A 1VSQA 1QF9A 1VM6A 4YRKA 4Z5XA 2WU1A 4XWGA 1FVHA 3T5GA 4F2WA 4RIGA 3U48A 1A5AB 3AVUA 3GBSA 4GDMA 1EYZA 1G5FA 4XLZA 1R37A 1IN5A 1E6EA 3OCXA 1T2VA 5C8YF 3HP4A 2Q5EA 3C24A 4I4NA 4NMXB 3VHXA 1XMPA 3CXUA 3FKQA 2ZUBA 2PT7A 4TMVA 3WNQA 5LZ9A 4XB2A 4ZT4A 2O19A 2IYUA 3X1ZA 4QXAA 1E2JA 1MA3A 4KDCA 3LHKA 1J2JA 2TSYB 4BO2A 1Z63A 2H4ZA 4EEXA 3N7TA 4M55A 3E1GA 1W76A 4AROA 1EGHA 1X3SA 4L15A 1OH8A 3VTFA 2NYRA 1AA9A 2ZYIA 2EBHX 1W19A 3GEPA 4ZJZA 1M83A 3ON5A 1CJBA 1KEPA 1N6KA 1TCCA 3PPXA 5CDHA 4DT1A 5AHOA 1NPDA 3BRCA 3DMYA 4H16A 3IPLA 5IPFA 1PX2A 1XK6A 1C50A 2XVAA 3GPLA 1THGA 2ZJBA 1VCOA 1Z3IX 2AJDA 2P9QA 1WP4A 1R27A 2DH5A 3OJWA 5T67A 4JODA 4GPAA 4BLOA 1R1DA 4QOIA 4DSUA 1OPRA 1FXUA 5HK8A 1SG6A 2QX9A 1E69A 2JCSA 1X1BA 1RI1A 1Z75A 3H9GA 4WFJA 4X6YA 4XDYA 1XP8A 1V16A 3GEDA 3HRKA 3GEEA 4L9RA 4MB2A 4LJKA 4LFCB 2OHFA 2QZZA 3JQ7A 4L9AA 3ZXUB 4C08A 1PK7A 3FOFC 5SY9A 3VYTB 3CVXA 1M6HA 1TC1A 2HBRA 3O03A 4FNMA 1WY7A 4W8GA 1UFVA 5HBGA 1UBMS 4F7WA 1RWPA 1WMFA 1R8YA 2GEVA 2QN6A 4QVGA 1NQOA 3KQHA 3IULA 4F56A 5JHHB 5F1KA 4IIVA 5KYWB 3WWOA 2C77A 3VPAA 4H7HA 3FTEA 2J6HA 2XKBA 1P9RA 3KJQA 3KSZO 1NHGA 3Q7PA 3GLIB 4L50A 3WIOA 3O2QB 1FXWA 3NBFA 3HY4A 5AICA 3KR0A 3OG9A 4M88A 2WYWA 4MB0A 1S4MA 5ALXA 3T7RA 1X8KA 2PX2A 3AEQA 3L3BA 5BSWA 2OLEA 3CMMA 4ETWA 3EEOA 2MCFA 2LTAA 1F4PA 2WJYA 2OKCA 3KXLA 2PMDA 4DAEA 1GRRA 4RIHA 1C1XA 3IOMA 1MJFA 3DE0X 1MO6A 2VCEA 1Y9ZA 2B9EA 4P34A 4RDIA 3BCUA 4L8GA 5DTQA 3SKYA 4BFYA 4RXTA 3KLMX 4YT5A 5BSVA 1MB4A 3HI6A 1FDWA 2MWMA 4KCGA 4NBWA 3IE1A 1TUBB 1GNSA 2H1HA 5J5CA 3WHKA 2PSJA 1NFRA 2OZPA 2B4KA 4OI0A 4V0RA 2PUJA 1J0BA 2BBWA 3PKIA 5HS6A 1T3TA 3OEWA 5H3CA 1PQYA 1THTA 4EELA 1MOPA 1XQ1A 4I4TB 4P08A 2BEWA 2CMHA 2YIDA 3EH2A 4JP1A 2VF5X 2ZTUA 2DTEA 1WSWA 1UMCA 3BIXA 4IVPA 4NDAA 3N74A 4DR4B 2GDZA 4DLPA 1JMKC 2X9GA 5A9SA 2FSPA 5BSGA 5TMEA 4KOAA 4M60A 1AQ6A 1T8PA 4HLUC 1QYVA 2Q3HA 3A36A 5KUTA 4QFDA 3NJ4A 3RYCB 2OSVA 4NY1A 4N8EA 1EFVA 4W5JA 1EUYA 2PKWA 2Y6VA 2QDXA 2COKA 3LY8A 3R40A 4BN4A 1LI5A 3W8RA 1GL7A 4J0IA 4C9BA 2MYTA 3Q8MA 2AQIA 3UMYA 4K9MA 3BMNA 4LUCA 1I6LA 3BGOS 4MJXA 3HO6A 3K96A 1TK2A 4YIHA 2QNIA 1YI8A 1WP9A 2CDRA 3VC2A 1PT8A 4L5CA 4FDLA 1GPAA 3TUZC 4H4CA 3FI0A 2DQSA 2ZROA 3U4DA 4AYWA 2GCNA 5ECWA 4ZOCA 2O2YA 3K15A 2CZCA 4JJKA 5JVDF 1FUUA 1A88A 4Y67A 3ESQA 3K6KA 5WRFA 5JSQA 3T15A 3UIEA 1XDBA 5TJHA 3LH5A 1IBLB 3BJEA 2PGDA 3ESBA 4WCDA 3W2GA 5FWYB 5IJWA 3C45A 3P2KA 4QT4A 1XZGA 2HCFA 2E85A 3U13A 3IPYA 2G0NA 5K05A 3KC2A 4OP1A 5C32A 1P3Y1 5LP1A 1JG7A 5MFZA 4BE7B 5EZYB 3S7TA 2Q07A 2BFPA 5AM4A 3FB4A 2XNSA 2RAVA 3QU4A 1E9AA 2DFDA 2IPXA 2OAQ1 1I32A 2JNWA 5BMVF 2ZU0C 4CEJA 3WIVA 3LCUA 3T3MB 5B1SA 4CEJB 2OENG 2NNLD 3CZRA 3WYDA 3ZHXA 3ZX5A 3TMAA 2V7PA 2HM7A 3CEJA 2Q4OA 5I8ZA 1Q77A 3B9RA 4TVOA 3VZDA 4BGEA 1PP4A 2BFCA 2D62A 4FD3A 4TLBA 2A3NA 3BILA 3TRJA 1JRLA 1TMGE 3ZZNA 1XC7A 2EFGA 2PFGA 5FL7D 1KDTA 3L84A 3WBKA 4LDNA 1JKMA 4R68A 4RAQA 2RHLA 3OPNA 5C5IA 2HV9A 2O2ZA 4PBSA 5E0KB 1KRHA 6Q21A 5ITWA 4PW0A 5A1JA 4B45A 3UH1A 4KXUA 1FLDA 1Z5WA 2BI4A 3OE7D 1W5TA 3BWEA 3HR4A 4COKA 4ZVNA 1HDEA 2CSXA 1ZFNA 1EFAA 3UOWA 4AKSA 1G7TA 1K5PA 4ENRA 3DEAA 4MV4A 3CVYA 2A1UB 3NORA 2IS6A 1N5DA 5K3BA 3BYZA 1TO1E 4IW3B 3SC6A 3NXKA 1BKSB 1W44A 1PR6A 5BUQA 1NVDA 4RD6A 3I6ZA 2YDXA 3GPIA 4QE3A 1FU8A 4Y6SA 4QASA 3NOQA 4MX8A 1UFKA 4KR7A 4DA6A 3FN4A 3NYIA 1NJ1A 5JRJA 3Q3GE 3Q88A 1EEXB 1GQQA 3NBMA 3K6SB 1E2FA 3X1XA 4CETA 1ODKA 2Q6IA 4Q21A 2F8SA 3AH8A 1XKTA 2C4NA 5BOSA 4XSHA 5EE1A 5K8IA 1YZNA 4CCSA 2GQ0A 2P7HA 4R51A 4K6GA 3PXBA 3I4CA 4J2HA 4G0QA 1ZDMA 4KYIB 3N8KA 5CX4A 4JI5B 3RCBA 5CT8A 4LF9B 1IXRC 2C0QA 3L5OA 1DCMA 3AETB 1J5PA 4NQZA 4JYPA 2M1ZA 4M99A 2P5UA 1PWYE 1UBTS 2FW0A 2SKDA 1A7JA 3HLTA 3TL6A 4AMYA 2ZIGA 1WL8A 1PNRA 2PQ2A 4OFXA 1QK3A 4ESEA 2I76A 3ELWA 1JDBB 2QGNA 4INAA 2ODPA 3RYTC 4RVSA 1GV0A 1T5SA 5ECDA 3VSBA 1H0HA 2GBLA 4K28A 2BISA 4F3RA 2Q4RA 4F4UA 1NF3A 1TT5A 4JJZA 2O8FA 1YBAA 3T54A 3AF6A 2RHJA 1GRNA 2W6QA 1N6HA 1VL0A 3AW9A 4KG7A 4NFYA 3VVLA 1QRSA 4A73A 3ZIDA 5LOVA 1Q95A 2FZKA 3AV0B 5AJWA 4EZEA 4HEJA 4PS1A 2I7XA 1Z29A 2H1VA 3A9WA 3KAQA 4LYGA 3E3NA 2L69A 1KH2A 4ISBA 1NRXA 1BKYA 2RH8A 4QG7A 5E9AA 5DDIP 2FR8A 1HFEL 1GTMA 4H0FA 4OLJA 2J0UB 3UFBA 2F3SA 1FIUA 4UM5A 2P4HX 1XZAA 3HTXA 1NNLA 3BMXA 2X8BA 1L5HB 2WD7A 1COZA 5AVQA 2O2GA 2YMQA 3GGPA 4K2AA 4TV8A 1LV8A 5DJ5A 1A0OA 1IVNA 1XKLA 1WHTA 4FI3F 4MMXB 1QFXA 3DO5A 4I4LA 4Q18A 3GLFE 1BE6A 1KDZA 5G4KB 1W48A 2VPIA 3OUUA 1QMGA 4AQYB 2XUPA 5DI3A 3EXFA 2E37A 5LLTA 1YUMA 2V5VA 4J16C 1TEZA 2QN9A 1AQYA 3E9NA 3U60B 4XUGB 4BJHB 1GWNA 3DZJA 4ZRDA 3V42A 3MB8A 4R9RA 2R8EA 3DOCA 5IKEA 4QOSA 3T3HA 2HJHA 2X9QA 3TSCA 1KAEA 2VT3A 4E5KA 1JKJB 1VYVA 4L6AA 1PT5A 3ZVRA 3T0FA 2YHSA 2H06A 2G5GX 3LQ2A 5DTMA 1X1RA 3RIGA 3GFBA 2PXAA 1ECJA 2WIJA 3H84A 1Y48E 2IP4A 2ZATA 2PKYX 3I01M 3TQTA 1TRHA 4LDAA 1KYQA 5DM0A 4AMBA 4HEA1 3EC1A 4X8OA 3GK3A 5ALLA 4X66B 3HWSA 2IY9A 4EGFA 2P41A 3TIXB 4O2BB 1E7WA 3LBIA 2J3KA 1OLUB 4YXFA 1U8FO 3SQNA 1T4BA 3WISA 2I1LA 4L2IA 5TMBA 5AW1A 1YRYE 4AKIA 1T5DX 4GZ6A 3ACDA 3ENZA 4O4JF 2LW7A 1F3LA 5H59A 4ZI2A 2P9FA 2AYYA 3JQAB 1M8PA 3U5TA 1A77A 1P8AA 3NAQA 1SCJA 4I4CA 4S05A 3UO8B 1KO7A 1Y8RB 4PYMA 4D26A 4WCFA 4L8WB 3H7IA 1II0A 1MT0A 2XUIA 3HACA 3R5KA 4CM9D 3AF4A 2GARA 3FCOA 1WV1A 5AVOA 2I9KA 3D7LA 4JS0A 1ONOA 1JG2A 3B13B 1G4HA 1L1RA 1A50B 1XVAA 2AJ8A 2FMKA 4PX5A 1NSTA 1MO5A 2QAGB 2V7QA 4X1KA 1ISJA 4XOIA 4R2HA 1A9OA 4EFLA 3AUYA 2J0VA 2JIPA 4NLLA 3V8MA 3HYNA 5JXJA 3JR3A 1IM2A 2ZWPA 1X86B 4TWBA 2D0IA 3N70A 1XZPA 4RTPA 1IVYA 1BYIA 1KA9H 3DBHA 5JD5A 3NU1A 3RK1A 5KTMA 3LXUX 3FIUA 2J3MA 3LHSA 4RPHA 4UOEA 2SHKA 5BWMA 1P9NA 5EJ9A 5I4CA 4HAIA 4KO8A 3DV0B 2O1EA 1K5GA 1QVVA 1BH2A 5ALSA 4COOA 5JO0A 2PS9A 1A9XA 2JKVA 3V3TA 3ZDQA 3BMCA 2CNDA 5EUQB 4QYWA 1U0EA 5EUMA 1JG3A 1RBYA 3LX8A 3KQTA 1DZIA 1R0YA 1D3AA 1NNUA 2IH5A 3UAVA 3VVBA 3GZJA 4US2R 1R50A 1UXGA 4NDZA 5EG5A 1IOZA 5D8DA 2GJ8A 3T1NA 1VSUA 1FQJA 4DLXA 2WJJA 3QJYA 1PZMA 3F6PA 3DDCA 1IXYA 2Y0BA 3AM1A 3BOSA 4FCVA 3H7AA 1FS6A 1KYIA 4NV0A 1Q1QA 1ZM9A 3P2EA 5F52A 2WY2D 1I3OA 3K2IA 4MTLA 3CRMA 2JHGA 4LHEA 4K0KB 3KXKA 3S2SA 2D2IA 1JQDA 1OZAA 2H57A 1NR7A 2XF2A 2B36A 4KH0A 2QTVA 3L82B 5HQ3A 3EJ6A 4W7IA 3PA6A 3QMVA 1LU9A 1EK2A 1OAKA 1RVV1 2EX0A 3LVRE 4TKUB 1P1CA 1XEAA 4CVNA 4FYJA 4EKIA 1J0XO 1T2EA 7MDHA 3FZQA 4KGVA 4RS4A 3HVRA 1Z07A 2WICA 2XMZA 3D8RA 3LPCA 4KX5A 4F6CA 1PD1A 3O3CA 1CT9A 4Z4GA 1OWMA 4Q1FA 4K6MA 4AM8A 5A9TA 1PLKA 1ZBDA 2AHOA 3RT9A 2CB9A 4FQ7A 3TQCA 2ESRA 3AUFA 4OP2A 4PLWA 2R4UA 1YFLA 3ZLUA 1M2GA 3HB7A 1X9GA 5FHQA 5CT9A 3ZVLA 3FYUC 5LJIA 4NBTA 2AA3A 2G8NA 2K5UA 2NT3A 3M4NA 4G0UA 1DIGA 2B25A 1JDPA 2GUWA 3MERA 3RFXA 1G3UA 1TTQB 5DBGA 3QK7A 1RM4A 4GC5A 3HYSA 4MUMA 4MVJP 3VUFA 3N58A 1UEIA 4BC1A 2GJ9A 3V4PB 3LPDA 2MOKA 1I5OA 3LO5A 4B4UA 2KM1A 5BSHA 5AM3A 2VNIA 2HK6A 1DEHA 2C9DA 4G0NA 5A2QA 1CUFA 4P2GA 2FKAA 3AY3A 1RT9A 1XHEA 2ZE5A 4CKEB 1W94A 4TYWA 3NIBA 3OX2A 4FYWA 1KZ1A 1I4EB 1HMPA 4PFKA 1ZI8A 3OM8A 4MVJM 2X0IA 3UFXB 1CVRA 3KKMA 4YMGA 1R4MA 2WV7A 4LRUA 1MOQA 1QNFA 4FR2A 1GGHA 1HDXA 1L5WA 1DUIA 2RHWA 2X2OA 1U3FA 1J0CA 1EUCB 2OCIA 2VYVD 3EOZA 4BVKA 3ZGOA 1HDOA 3X1WA 1X80B 1WZIA 4FDTA 3H83A 2GRJA 1NUPA 4RPKA 2F67A 3BFKA 3G0GA 3QOFA 4KBFA 4TT3D 4NXNB 2EG5A 2UYYA 3FCXA 3L06A 3FSGA 1UWKA 4RK0A 1N1MA 4XRRA 1NUHA 4ZTZB 1LXCA 1XJCA 1ZOIA 2YCBA 2OFOA 3QELA 5AJTA 2R68A 3UQZA 3U1VA 4B35A 1KSJA 3W78A 4RMJA 2TMKA 4CQMA 4ZGWA 2B8TA 4A23A 1ZX1A 4GECA 1IVSA 4MDFA 4QM6A 2ATXA 2B3TA 4CKXA 5FNVB 4F1WA 1USKA 4ZV7A 4BLTA 3KDSE 2CCJA 2OMEA 3I23A 2JK0A 1TT7A 1E92A 2B8WA 1H5QA 1XTBA 3OOHA 4MR9A 4OJQA 5EZQA 4HGQA 3L7AA 2P9BA 4NG4A 4TYQA 1J56A 4FZRA 4Z54A 3RM3A 4RZUA 2BONA 1YJ5A 3M33A 3NR2A 2ZE6A 3FTDA 4NP6A 2G1KA 2PT9A 3KOWA 3R44A 4KC0A 4G86A 4RE5A 5IWCA 2XSZA 2MSLA 4TZKA 3D5EA 3SBEA 4QUHA 4NAUA 1UT6A 3EZ6A 4R2LA 4YAUA 3R3YA 4B48A 2GEJA 3U0BA 1GD1O 4HNVA 4I9FA 3FJYA 1P5RA 3PT9A 4DQKA 1V4VA 3G02A 5CXSA 5HKKA 1W25A 4PZZA 1KYVA 4ND8A 2JKZA 3NBYC 4O5AA 4YTEA 1KDYA 4A9AA 1U4SA 1TAHA 4ER5A 3NNNA 3GA7A 3OO0A 4JOBA 1W96A 2FZGA 4TV9A 5A62A 4L5BA 1K9SA 2DPYA 2FQXA 2X9NA 3DFIA 3OZFA 4GZMA 3AI3A 3CMCO 4C6SA 5KVCA 1ORHA 1J5XA 3PFNA 2QX4A 3UMGA 2AJCA 3CZ5A 4AMGA 4QDTA 5HOEA 2E87A 4U2BA 1MFZA 5HKOA 1PJSA 2IWHA 2G04A 3DF9A 1UDAA 3Q0TA 5B58C 4HOYA 2OV2A 2WA2A 5KPDA 3DMFA 3LVQE 3RYHB 3AFNA 3B70A 2WTBA 2W48A 4BNUA 3BD9A 3GARA 3KDPA 1PLLA 3DL0A 4IDGA 3D4NA 5FPSA 2B1GA 4KHPB 3CR7A 4QOJA 5T8KA 3TTWA 3ZZ1A 4MOWA 4UREA 2H48A 4N5HX 4N3NA 2GCEA 3ND6A 5L3SA 3ICOA 2DERA 4E2XA 3EX7C 4MJ3A 5DT2A 2ABWA 1MXHA 3AFHA 1A4RA 1E61A 1KDPA 1M1YE 2YRFA 2PGNA 2HYIC 1WSAA 2W6IA 3DZGA 2REXB 4EBBA 1S01A 2PT5A 2CDAA 2RI1A 1T36A 3LP8A 4OLFA 1PJBA 2AEEA 3SYLA 1ZGHA 4AWXA 4ZYVA 2MYUA 2H07A 2O2DA 3PEYA 2UU9B 2W58A 3LPLA 2JH3A 2OOSA 3UH0A 1RW4A 3BRSA 3ZZ0A 4DLRA 1E5QA 2P75A 5JQGB 2AW5A 1C8LA 4YBZA 3HJRA 4DM4A 5IM4A 3ROQA 2NQTA 4LYHA 4TZTA 4K3UA 3LXRA 4DMFA 3R0ZA 4AU1A 1LZKA 2H16A 3E4DA 1YJAA 1YRQA 3OSZA 2NNWB 4NMHA 1JG6A 2WHRA 1H6BA 1U0OC 2XDQA 3G1UA 4FIZA 4FMDB 4WZ6A 4Y18A 3SM3A 1CUXA 1DEXA 1G63A 2H7XA 3GJ5A 5C51B 1P6UA 1SKQA 1TFUA 2F3PA 2ZTMA 4H0NA 4YUXA 1DKQA 1JGTA 1MJ5A 5JU6A 1YR2A 1HFKA 3CWZA 4O0LA 3FNQA 3L9XA 2PDAA 3H2HA 4WK2B 3TVTA 4J75A 3KSMA 5FA8A 5IMSA 4HGNA 1I8TA 2O5RA 1FPMA 4UQLA 1IZ0A 1JEJA 1M7HA 2ZIZA 4FFRA 2B7LA 5KBYA 4DUYB 1JEAA 3INNA 4I1UA 4RHCA 3RBZA 5EPOA 3BIOA 5BO5A 4ER7A 3C8UA 2OR3A 1K68A 3HNRA 5ED4A 2IYQA 3PI7A 3WB0A 3LDAA 1C0EA 2A35A 3LQKA 3W8DA 4CNBA 3AVOA 4JGGA 2XPCA 1MR3F 4ARUA 1YKGA 2PX5A 4G8BA 2O2SA 1C3VA 1W88A 2D59A 4AWBA 4OQXA 4JB2A 1UK7A 3UMFA 3V1LA 3KHUA 5D6NA 4H1VA 4UU8A 4LHXA 1TZMA 1K7CA 1HH4A 3FTCA 3LA8A 2R7AA 4JEMA 4ZVUA 4CDNA 2AR0A 1XZFA 2DXIA 3VSCA 3FCEA 4CDGA 2Q1WA 3O9VA 3IUYA 3JWJA 4GM1A 4FYVA 1L7QA 2G80A 1RLMA 2PBRA 2XCIA 1DAPA 1X39A 1FNCA 2H52A 4P2BA 3Q11A 4RF2A 2DUNA 3MJHA 5LXTF 2Q9UA 1J20A 3LNTA 3QMMA 3A3OA 2IUYA 3H3FA 3L1KA 3WGQA 1F4LA 3UTDA 4F11A 1D1SA 3ZNNA 1UQRA 2JEOA 4JXZA 1EFDN 1X6VA 3GH3A 1HURA 3GVCA 2AUMA 2I3GA 3Q1LA 2WG1A 3EA4A 2HSEA 2X15A 5L3ZA 1YU6A 2DPGA 4KODA 2BFNA 2MTBA 3E1SA 1DJQA 2E5FA 4FB4A 2VTKA 5IT5A 5FRDA 3T4PA 5D1HA 2E4XA 3HN6A 3WR5A 2PX0A 3MJVA 3TDMA 3DDWA 1PR5A 1OREA 4DKXA 2IPNA 3GT3A 3KQWA 2QUHA 1QK5A 3SWWA 2BMWA 1G66A 1GRCA 1OE0A 5E3JA 4ZVKA 5A2GA 4Q4DA 4YP0A 1BS9A 3BE8A 4BP1A 4U9UA 2FWJA 1WTCA 4DR7B 3V4FA 5DM1A 4QICA 3H86A 1WZ2A 4W5WA 2R4TA 4J07A 1HT2E 1DAEA 4NCJA 2BFDB 2HA3A 3UJNA 3V55A 3JRXA 4C03A 1IUNA 4HN2A 4JT8A 4EG0A 1GEEA 1FC0A 1GL3A 1MPTA 1FEZA 2IHTA 3IP1A 3PGLA 4REOA 3BAZA 3ZQ6A 3ZR4B 1ZWLA 4XH9B 4C29A 1L7VC 1Y5IA 3JY6A 1CRLA 4HKTA 1LLFA 5EMJA 3BMQA 2VDRB 2YC4C 3BK1A 3GDHA 3JQBC 4GXNA 2PA0A 4RY8A 4EHLA 4W7SA 4HN9A 3M6WA 4NJOA 5I4BA 1ONNA 2AD5A 3FBWA 4GUDA 3QKRB 3U9LA 5LKRA 3E7WA 2GKSA 3Q10A 7GPBA 2DX7A 1QGUA 4NNJA 3UCFA 2Q1YA 1KMQA 1SU7A 3WYBA 5IC5A 2W42A 1XCOA 2WFZA 3JQBA 4UZEA 1OFIA 3FNFA 5EHIA 5F78A 4JI4B 1KEEA 2ZYAA 4FUQA 1SUBA 5TSDA 4RZ2A 4HAOA 4MVWA 4NBNA 4RE6A 4EO7A 2AYZA 1KK0A 2R65A 3S2GA 5GONB 5AYVA 4B43A 3NAMA 4UTRA 2VJKA 4LY0A 1NW5A 3DAFA 5A5VA 1PCXA 1Z0FA 3DDOA 4KQIA 4YREA 3GXOA 2NSYA 1VLVA 4O4HA 1O54A 4L85A 4U8HA 5KYKA 1G17A 4TL9A 4B76A 1UBGA 4D0SA 3EYAA 4MV6A 1GAEO 2ZB8A 4FBGA 1ULBA 2V5AA 5FEMA 4BX3A 3G7SA 4H4DA 3R6WA 2GHIA 4Y1RA 1RKQA 4Z1MA 2X77A 4AUEA 5ALQA 3V1UA 3RHFA 1E1YA 2WFLB 1DIAA 1IHPA 4BXOB 4JLMA 3JW8A 1QU3A 1DX6A 3CPEA 3HWX1 2IBSA 1XRMA 1TEVA 4WTOA 2VDMB 4HXGA 1PGJA 4U6SA 2IUSA 4V02A 3KJHA 5H81A 3LY9A 5JS1A 1XVVA 4EJ6A 1YA6A 1E4EA 3OZUA 2R2AA 4NEGA 1HQCA 5JAZA 4AF7A 2Q2OA 1JYEA 4QBGB 3EIEA 4Q9HA 5EE0A 1UOPA 2VHYA 2B20A 1P1KA 2Y1DA 5M34A 2HIGA 4NH0A 1VA5A 3KZ1E 5IBQA 3UMBA 1JUDA 3F98A 4LJSA 4US1R 5IARA 2IL1A 1R4NB 4OXYA 2IK8A 4JL5A 2FSGA 4UAJA 1CNMA 2RGWA 3C5WP 1S1CA 3BHIA 4L72A 4Y6OA 4XVCA 3OQOA 1NGSA 1CZKA 1QV9A 5CTJA 5IKMA 4F9TA 4HHEA 4QO7A 3DZCA 3ANNA 4N9QA 1CD5A 4XQEA 2NP6A 3I76A 1UC5B 3LAWA 2O7QA 1NBMA 1OXMA 2BGRA 2NYAA 4IIJB 5FLYA 1OC4A 2GRAA 2CK3A 4EF4A 4G97A 2A9OA 2OCXA 2PZJA 4JZKA 1T0HB 1YQGA 4TKLA 2EFCB 2GNPA 1OIVA 1RZUA 2OHXA 4DMLA 1CQIB 2P2LA 5A1TA 3G2PA 1BCRA 2VXBA 3TX6A 4MW1A 3TVYA 4DB4A 3KQVA 7MHTA 1XHFA 2PUHA 4N0MA 4S1PA 4TLMB 3NUZA 1CRWG 4UE3S 2A94A 1UP7A