2FUKA

Crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
218
structure length
218
Chain Sequence
NPLFPTESAALTLDGPVGPLDVAVDLPEPDVAVQPVTAIVCHPLSTEGGSMHNKVVTMAARALRELGITVVRFNFRSVGTSAGSFDHGDGEQDDLRAVAEWVRAQRPTDTLWLAGFSFGAYVSLRAAAALEPQVLISIAPPAGRWDFSDVQPPAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMPDTSHFFHRKLIDLRGALQHGVRRWLPATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XC6422 protein
publication title Structure of XC6422 from Xanthomonas campestris at 1.6 A resolution: a small serine alpha/beta-hydrolase
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Hydrolase
total genus 63
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fukA00
2JGEA 3GZJA 5CXXA 4I19A 2VSQA 4KR0A 3D2CA 3QBJA 4PQEA 3N2ZB 2BKLA 3NGMA 3BJMA 4HXEB 3TRDA 3SK0A 5JAHA 2CKMA 5SYNA 4J0HA 3F67A 1XZAA 4WFIA 4BE4A 4QA9A 4UHCA 1N5MA 3LIPA 2K2QB 2V98A 2HA6A 1SOMA 2QKYA 5T4FA 4C87A 3WK9A 5FDFA 5FUMA 5AKHA 4EHBA 4Y2TA 3BL8A 5K5EA 2BUCA 4FMPA 3A2NA 3FAKA 5EIEA 3TEJA 5AM5A 2RHTA 2JGMA 3QYJA 3EQ9A 4J0CA 2VAVA 5IH7A 3PF8A 3DYVA 3IA2A 4C4YA 3HZOA 5ALKA 3HI4A 1MNAA 2JGKA 1NX9A 2OAGA 4AN1A 4BP9A 5AI8A 4BAUA 2Z8XA 3IBTA 1C7IA 3E3AA 1UKAA 5CT6A 3C45A 3F97A 3I6YA 2WIGA 5ALUA 1XZLA 2WUFA 4HRXA 4RNCA 3NOXA 2H1IA 3PUHA 1AC5A 3FNBA 3CN7A 2PUJA 4EBBA 2XMCA 2DFPA 1VZ3A 1YSCA 2HA4A 2ROQA 1KU0A 3OTQA 5LZ2A 2XUDA 5AI5A 5K3EA 3R3WA 3GROA 4Q3LA 4CCYB 4G9GA 4Q05A 1JJBA 2VQ6A 5JAOA 3BWXA 4IO0A 4UBNA 4LKOA 5HK9A 5DYYA 1XFDA 5AKEA 1XLUA 4WJLA 1XZMA 4B83A 1XQVA 2WIJA 4O08A 5HQ3B 1HLGA 5DTJA 2WM2A 4KYVA 4WDRA 2J3DA 4E46A 2BFNA 1J07A 2WUEA 3CXUA 4G4JA 3F9CA 4UHFA 4UBLA 2ZYRA 3HLKA 1ZD2P 4PW0A 2GBFA 3EF3A 3EQ7A 2GYUA 4MXDA 1L7QA 3E0XA 2RIPA 3HEAA 5JALA 2G5TA 1N8SA 3VJLA 1VKHA 3VJKA 1UFOA 4XVCA 5IVHA 1UOQA 4PSCA 3WIBA 5FPPA 1BN6A 2RGUA 1QIJA 4BZZA 4C6HA 2XQKA 3O95A 5JD4A 1LZLA 2W6CX 4M0EA 2HIHA 4UBMA 3WK7A 1NU8A 1SCKA 5ALJA 3OG9A 4Q1VA 5AOCA 4EY5A 4B0PA 2HA7A 3UMJA 4H35A 4C01A 5LZ9A 1UT6A 1QLWA 1CUFA 3FLBA 3PFCA 1T4MA 5A71A 4AXBA 1FFCA 1XQYA 4L72A 5JANA 5HQ3A 2GBCA 1MX5A 1MX9A 5AK4A 5ALDA 1QO9A 4LYDA 1MO2A 1WOMA 4E14A 2YYSA 1QIIA 4X3CA 1IZ8A 4GI1A 4OCZA 1LPPA 1QZ3A 2FUKA 3GFFA 2D5LA 2OCIA 3SC2A 3V1KA 1XLWA 1JKMA 4MYSA 4CIBA 3A2LA 3DNMA 1XKLA 1UXOA 3WIOA 1H2WA 3WWDA 4GLBA 2AJBA 7YASA 4EY7A 3MUOA 1JJIA 1BE0A 1YB6A 1C4XA 3WA6A 1SFRA 3ZI7A 1CFJA 3H2GA 3WL6A 2OQVA 4FKBA 4U2DA 3GUUA 1F6WA 5DJ5A 3Q0TA 5F4ZA 1LPNA 1H22A 1CQZA 3MUNA 4FTWA 4FWBA 1VE7A 4H0CA 3KOOA 2O2HA 4BBZA 2JGIA 4QLAA 4OB7A 2XMGA 3OPMA 5I7UA 3LLCA 2JF0A 3C6YA 4UHBA 4FBLA 1Q0RA 5BWBA 1QFSA 4DM7A 1IUOA 2B20A 2ACKA 4OB8A 1QONA 4FHZA 3O9MA 5BOVA 4B80A 4Y2QA 3G0GA 2PU5A 4BVKA 2XMSA 4QDZA 3K6KA 2UZ0A 1MJ5A 1USWA 4GECA 4ZI5A 2CJPA 3QVMA 2V9ZA 3ESDA 2PSHA 3DQZA 4MYDA 2VF2A 1DINA 1VA5A 5AKZA 2VA9A 5JAUA 2PSFA 1CUWA 1P0QA 4M0MA 1PV1A 4X94A 3H18A 4BAGA 3E1GA 1TIBA 4UUQA 4BC1A 5AOBA 4F21A 1N5RA 4L0CA 5ALPA 2XQJA 2JBWA 2HA2A 3JYHA 5EIAA 3JW8A 4OU5A 3OM8A 2ZJ6A 4IH9A 3A70A 1XZIA 3RK4A 5E4JA 4DTCA 4L3WA 4BCBA 1AGYA 1UKCA 3V9AA 3WK6A 5AKLA 2Y6UA 1TCBA 5AM2A 1ODCA 3U1TA 1HDEA 1J1IA 5HF5A 5LKRA 4DMFA 5FV4A 1ZICA 4EY8A 4Y2JA 3I1YA 1QE3A 4G5XA 5EHZA 5CRIA 2XUJA 4H7JA 3NUZA 4UHDA 5HFAA 4DNFA 3O4HA 1DWQA 3C43A 2V97A 4PV7A 1CUIA 1ZD3A 5K3DA 5C8VA 1DT5A 3A2MA 4AMZA 3C6XA 1QGED 2OCLA 1G42A 2GYVA 2OG1A 2AJDA 3C5VA 1H23A 4OUKX 1LBSA 4DLNA 2EEPA 3M3DA 2JGJA 4YPVA 5ALFA 2HU8A 4A16A 1Q84A 4B82A 3JWEA 3LP5A 2WG2A 3FSGA 5FXMA 4DSAA 3PE6A 4LXHA 3WZLA 3VDXA 4EZIA 4KE7A 5CT5A 5AM1A 2VT6A 2PSDA 4Y2RA 3BJRA 2VJAA 3Q8WA 3C6ZA 1AMNA 4U2FA 1E89A 2DHEA 5A62A 3G0IA 2IIVA 5AJHA 4ZWNA 3W05A 2WLSA 4HTAA 3ANSA 2I3ZA 3H19A 1JI3A 4A23A 1W75A 2PM8A 3D5EA 4H7EA 2QXUA 3F8SA 1GT6A 1QTIA 1U2EA 5ALQA 5BWCA 1W76A 2VTVA 3VKFA 5EHXA 3G9UA 3R0VA 4H7FA 2XMZA 2PUHA 4X6XA 1JMYA 3C6BA 3H04A 5KREA 2AXEA 2CMFA 4BC0A 2CB9A 3KSRA 3LCRA 4FLFA 1AZWA 4UBJA 4QE3A 4FFVA 1BEEA 3H2HA 5ALTA 1DQZA 2FJ0A 2YASA 2WHPB 1H2YA 1ORVA 5LZ4A 4OB6A 5EHQA 5EHNA 3WK8A 1IMJA 2O7RA 4F60A 4U2GA 4RPCA 3W9UA 3BDVA 5LIPA 2C4HA 3DKKA 1PFQA 2WILA 1BU8A 5CT8A 1Q0ZA 3G0BA 3R3YA 1QIDA 3DOIA 5LZ8A 3AIOA 5DNWA 1WB4A 4K5QA 1IUNA 1AKNA 1LPMA 3KD2A 2DR0A 5CH8A 3I6ZA 3IIIA 1VE6A 1ETHA 2QJRA 1MAHA 3B3QA 4DMKA 4LIPD 3EBLA 2WIDA 2ONCA 5JAPA 1MX1A 1THTA 3HYSA 4MEBA 1EX9A 3MVEA 3G02A 1E8NA 4WFKA 4X85A 1OXMA 2XMRA 2QUAA 4WCVA 5JATA 1X2BA 4HRYA 5A7HA 1HKHA 1ZOIA 4EA6A 2HFKA 1MPXA 5E4TA 1XRMA 3OC0A 5JASA 4P93A 1GQRA 4CG3A 2WHPA 2ZYSA 2W22A 1Y37A 3TGLA 2O2GA 3WKEA 3ZLVA 4N5HX 4K6KA 2OQIA 1GPNA 2GZRA 1Y7IA 5JZ9A 3PI6A 3W06A 4OU4A 2BGRA 4H7IA 2HA5A 3WJ2A 4QDTA 4B6GA 2JEYA 2XUKA 3O9VA 2DHCA 4JEIA 1XRQA 4ZV7A 1W1IA 3M83A 1IZ7A 1EB8A 1YR2A 3D59A 4K6HA 1XZEA 5CTAA 1DQYA 4DSZA 3FYUC 1LPSA 1R9MA 4GHWA 2C58A 3D7RA 2ACEA 2YH2A 1LNSA 1WCYA 2HRQA 4C4XA 4J0KA 1FJ2A 2I3DA 5AKIA 5DLPA 1WHTA 4BAZA 2QOEA 3I2GA 4N8DA 3M82A 4B0OA 4NZZA 2OLEA 4Q34A 1QIMA 3ANTA 3DCNA 2H7YA 1NU6A 3FYUB 4BVLA 4DMHA 5HK8A 1EHYA 1O6FA 4CG1A 5IKXA 3KWFA 4OSEA 4DNOA 3QZUA 4YX9A 2JIDA 3GELA 4XJVA 2O7VA 2D0DA 5D7BA 1XZDA 2XUPA 3LIIA 1YA8A 1W4LA 5AK5A 3ZWQA 2Y2VA 1GPKA 3E4DA 1RWQA 5ALRA 3FSGD 1P0PA 4LYEA 2H7XA 3G0DA 3FLEA 4K2AA 1ZD4A 1F0NA 1DU4A 1CUUA 4F5ZA 3PDCA 1VOTA 5DYTA 5LYYA 1GXSA 2C5GA 1MTZA 3CCBA 3QMMA 5HKAA 4QWWA 4KE8A 3WZMA 3SWWA 2OGZA 3FOBA 3FCYA 3ICWA 4J3JA 1DX4A 2WG0A 2HA0A 4CCYA 3RKSA 1GPLA 5JADA 2XUQA 2Z8ZA 3FYUA 2XT0A 1QIEA 3STUA 3H2JA 3T52A 4X93A 3IULA 2XB6A 1FSSA 3QH4A 4ZV9A 2WUDA 4XX1A 5I8PA 3ESBA 1HQDA 3DD5A 4UBOA 1MAAA 2PBLA 4Y2SA 3FYTA 2VEOA 4UPDA 4DNQA 5AKYA 4UFOA 4N5IX 1WB5A 4GEGA 3STXA 1UWCA 1JFRA 3ILSA 1CEXA 1O6GA 5A7GA 1ACJA 1Z68A 3WQHA 3G7NA 5JZBA 4X00A 3O4JA 4OPMA 4AZ3A 5LP1A 4UBIA 1EVEA 3HXKA 3W2TA 2QJWA 5K3CA 3BE8A 3IB3A 4V2IA 4HXFB 4FNGA 4X97A 4B84A 1CUBA 2XLCA 2PKYX 1BN7A 4W1RA 3SX4A 1QOZA 5ALHA 3WWPA 2R8BA 2OGTA 3PUIA 4MQMA 2QXTA 4I3FA 1JMKC 1UOOA 2Z3ZA 5JYCA 3DJYA 2QRUA 1XRRA 3A6ZA 3FVTA 5J3JA 2XMBA 1F0PA 5AIAA 5FP0A 4DMCA 2XI4A 5JD6A 3QPAA 1TQHA 1A7UA 4S0XA 2XMQA 1TRHA 1XQWA 4QDOA 4BRSA 2J3QA 1TAHA 1X2EA 1ISPA 1GKKA 1LGYA 3R40A 5IVIA 3DS8A 1QIGA 2NW6A 3G0CA 4KAJA 2WUGA 4KAAA 4H7KA 4MWSA 3RARA 5LZ5A 4B81A 1T2NA 5CT4A 1CUZA 2WU3A 6YASA 1K63A 4TPKA 3WJ1A 1A88A 2BAGA 4GBGA 4KE6A 4L9AA 2BGNA 4BRZA 4MJ3A 3OOSA 4QLOA 5D3ZA 4NVRA 4JUIA 2VJDA 5C8XA 3BIXA 4Q82A 5AKJA 4LXGA 4HAIA 1W6RA 4BP8A 4W1PA 2I03A 3QMWA 1UOPA 4MEAA 1VZ2A 3H2KA 3ZPXA 4W1SA 5CT9A 5ALMA 1R4ZA 1ZI8A 1R9NA 1CUEA 1TCCA 1S8OA 4BTVA 1K8QA 4HVTA 1G66A 2JGLA 3IDAA 1EVQA 2HU7A 3WK4A 4X95A 1CUAA 1FFBA 4LXIA 5ALNA 1DX6A 2WFLB 4PO3X 5AHXA 4J0JA 3IURA 1G5FA 5D6OA 2PSEA 4CIAA 1C7JA 5FRDA 1H2ZA 3S2ZA 4BCCA 3EQ8A 5T4HA 4BZWA 1N1MA 2YXPX 1XROA 3R3UA 1QO7A 2HHAA 4Q3KA 1CUHA 3C5WP 1RYYA 2JEZA 1EDBA 3DL4A 4K6GA 4AO6A 4IH4A 1XLVA 2IITA 1ODTC 3I2JA 3AUKA 5FLKA 4C88A 1B6GA 5HKBA 4ZXFA 4Z49A 2X8BA 4X6YA 3GBSA 4B7ZA 4Y2XA 5HFNA 1LPOA 4YASA 4X91A 4CG2A 2ZVDA 2IX9A 4D9JA 3STYA 3C8DA 1A8QA 2B61A 2CBGA 3WYDA 1QTRA 1RP1A 2ZJ7A 5AM4A 5KWIA 4P08A 5CH3A 5I9IA 4J0IA 2HRRA 5E2IA 4B9AA 2WFLA 1BEZA 4ROTA 4DNPA 3CCCA 3FVRA 5CURA 2AJ8A 5EGNA 1BCRA 4CCWA 3VXKA 4LHEA 1H2XA 3WI7A 2VJBA 3R3XA 1UK9A 4WY5A 4OYLA 3VVMA 3I28A 4Y2YA 1E66A 1XQXA 4X92A 4AO7A 2B4KA 4E15A 2OCGA 1A8SA 2FJPA 3EIOA 1AX9A 4GW3A 2GYWA 4IHAA 4UFPA 2X76A 2ECFA 4BCDA 3IUQA 3H1BA 4QZVA 1MT3A 3B12A 4FDMA 2VT7A 4QEKA 3DYIA 3STVA 3V1LA 3ZLTA 1CUJA 5BV7A 2OGSA 1R1DA 5JD5A 3K9BA 3WL7A 1LZKA 4QDXA 4B85A 2PX6A 2WJ6A 2DCMA 1HBJA 4JYPA 3R3ZA 1X70A 1XZJA 4UHHA 4EUSA 4BB0A 3IVMA 5JZSA 4G8CA 3L1HA 1VXRA 4G4GA 3AIKA 4B9EA 2ZSHA 1CLEA 2J4FA 4MWTA 2Q0XA 3UUEA 1BS9A 5AI0A 4J0DA 4Y7DA 1JT2A 5ALYA 4G8DA 2WJ4A 2ES4A 1ORWA 4G1FA 3DDUA 1JU4A 4FOLA 2RAUA 1CUVA 1YAHA 2HU5A 3BXPA 1YB7A 3FBWA 5CXUA 4QNNA 4FBMA 4W63A 2GBIA 4U2CA 4RE6A 5ALZA 1ZIXA 4Y2VA 1FFAA 3WWEA 3VISA 1JJFA 5ALSA 4N8EA 3WL8A 4ZGBA 3ED1A 3D0KA 3AFIA 4GXNA 3X3HA 1EK2A 4X90A 2XLBA 4XWGA 1D07A 2ORYA 4Y9SA 1ZGCA 2PVSA 5AOAA 1ZD5A 3L1JA 1Y7HA 1AUOA 3ESAA 1DWOA 2BJHA 1J2EA 1XRPA 5FKJA 2XUIA 1WPXA 2RI6A 2GZSA 2OCKA 3V1MA 1XZGA 3BF8A 5AI4A 3O4IA 3QM1A 1E5TA 2DQZA 2JGFA 1U4NA 2DHDA 4TVKA 2OPHA 2XUOA 1YASA 4DGQA 1ZJ4A 2WQZA 1MU0A 4IH1A 1LPBB 1EI9A 3KXPA 1DT3A 1WHSA 1TCAA 3ESCA 3WMRA 1G4HA 4N8SA 1A8UA 2RHWA 1B41A 4BYMA 2XQIA 1L7AA 1ZIYA 1XZCA 1EINA 1CUDA 4I4CA 2WHQA 2QVBA 1QIKA 3W04A 5HF8A 4J03A 3DKRA 1P0IA 5HF6A 4GWLA 3D2AA 3IUNA 1K6EA 3T4UA 3OURA 1MN6A 3WKBA 2BCEA 5AKXA 4WDQA 4Y2PA 1VA4A 4PNZA 5LKAA 1WPRA 3D4LA 5KWJA 2HDWA 2EDCA 2XUGA 4HXGA 1P0MA 4M0FA 5CMLA 5FOQA 2G63A 3ICVA 3WYNA 4E11A 3WK5A 3NWOA 1CIJA 2CUTA 1BRTA 1QFMA 3KWJA 1EDDA 1CVLA 5DTIA 1TK3A 2AJLI 4X7BA 4H18A 4CI9A 4ZREA 4XIIA 1VJ5A 5ESRA 3QITA 1U8EA 4HS9A 1CUGA 3I2HA 3WWCA 1VLQA 1ZGBA 4UBKA 1KU6A 4FNMA 3O0DA 5IVDA 3TJMA 3IUMA 5CBKA 4PF1A 4J7AA 3WWOA 3YASA 5LZ7A 4F0JA 1GGVA 1KEZA 3B5EA 2I78A 1R3DA 3CN9A 3I1IA 2QT9A 3WLAA 3I2FA 2VAXA 4KEAA 3GA7A 1HPLA 3BDIA 2QS9A 4AX4A 5AI9A 1FFEA 3FWHA 4ETWA 5K3FB 2Z3WA 5AO9A 2QZPA 2AJCA 3DEAA 5AICA 3UUFA 3WKDA 3ZLUA 1YA4A 1THGA 4GDMA 5ALXA 1SCIA 1ODSA 1F8UA 4KAFA 2XE4A 1IUPA 3F96A 5C7YA 2QMQA 4G4IA 4HZGA 2PSJA 2CZQA 3STWA 2WG1A 3PFBA 2DQYA 2VJCA 3WKAA 5T4EA 1LBTA 1CUSA 3WL5A 2BUAA 1XKTA 5AM3A 5DNUA 2QM0A 1VXOA 5K3BA 1GKLA 3P2MA 3HABA 1LPAB 1EDEA 4AN0A 1UZAA 4UFNA 2PPLA 4J0GA 2WTNA 1K4YA 2WIFA 5K3AA 4JNCA 2J4CA 3R3VA 1XZHA 2HA3A 2VATA 3VVLA 2WSLA 4BDSA 2Y2UA 3R41A 1ZJ5A 3QPDA 4DIUA 2P8SA 5FPQA 5A7FA 4EY4A 5ALLA 2H9YA 3S8YA 2WKWA 3ZV7A 1AURA 5E4YA 5AI6A 4BDTA 4KRYA 3QPCA 1ZI6A 2FX5A 1ZI9A 1AQLA 4WFJA 5ALEA 5K3FA 1CUYA 3I2KA 3BF7A 4RE5A 3N0TA 4AQDA 2ZJFA 1XZBA 2O2IA 1CPYA 4MQLA 1CUXA 1DTEA 1EH5A 5ISMA 3RLIA 4G8BA 1I6WA 1JU3A 2XQGA 3PICA 1Q83A 3V48A 3C8HA 3D2BA 5C81A 5AH0A 3G9XA 2XMDA 1MNQA 5SYMA 1IVYA 4TGLA 5ALWA 2XQFA 2C5FA 3HJUA 2QUBA 1GZ7A 2Z5GA 3G9TA 3H0CA 4KACA 3AIMA 4H77A 1XRNA 2RONA 2WHRA 1EA5A 4UHEA 4EY6A 5CH5A 1SC9A 4ITVA 2XUHA 4RGYA 3DLTA 5HF9A 3IUJA 2HM7A 1K5PA 2ZYHA 2HFJA 5ALVA 2ZYIA 2C0QA 5ALIA 1CUCA 5KBYA 3F98A 3G8YA 3VJMA 1W52X 1CV2A 3WKCA 4AMYA 3HSSA 5EIHA 2XDWA 3AJAA 4NS4A 2BUBA 2WIKA 4C4ZA 1CR6A 2C0PA 3AZOA 2WFMA 5ALGA 2Y6VA 2X5XA 3M81A 4P9NA 2XUFA 1HL7A 1UK7A 3HC7A 4ZRDA 3U0VA 4OD0A 2OXEA 1E8MA 5EI5A 5A2GA 3FCXA 2WTMA 3K2IA 4QDUA 2PL5A 2CEKA 1EXWA 3C87A 4DYHA 3KDAA 3AZQA 3PF9A 4U2BA 2XUAA 3I2IA 4QWMA 1TKRA 3QMVA 1M33A 4Y2UA 1ACLA 2PU7A 1EB9A 5LLSA 5T4BA 3FLAA 4W9RA 1CQWA 4X6UA 4A5SA 1DWPA 1YCDA 3HRHA 5AKGA 1FFDA 1XRLA 3I6MA 3HACA 4Q3OA 3WA7A 1QJ4A 1R88A 2DSNA 4FFWA 3RM3A 3DL7A 5AIBA 2HL6A 2OAEA 1LLFA 4AB1A 1SCQA 2GBGA 2WJ3A 5HZGA 2G4LA 4WY8A 5C8ZA 5IVKA 1E3QA 3G9ZA 4FLEA 1J06A 4C89A 1OILA 4IQ4A 1YS1X 4ARAA 1OCEA 4JYMA 4OYYA 3D3NA 1U65A 2G5PA 4AZ0A 1EK1A 1QIFA 5JARA 5H3HA 1BCSA 3H1AA 3O4GA 2V96A 5AK3A 5DWDA 4KRXA 2H7CA 1WM1A 3H2IA 5YASA 1GQSA 1XZKA 4NMWA 4P92A 3STTA 3C70A 4U2EA 4W1QA 3AINA 5JIBA 2ZSIA 4H7DA 5AM0A 5D3KA 4INZA 4KJXA 1QIHA 4BATA 5EFZA 4JH0A 1R50A 1YAJA 5DYWA 3L1IA 1BROA 1UK6A 1CRLA 4EB0A 1PJAA 4X71A 3W9BA 5HCUA 2WFZA 4ARBA 3MGAA 1UKBA 2Y1KA 4AO8A 3LS2A 4BVJA 3AZPA 4G9EA 4CFSA 4YK7A 2QTBA 1UK8A 5AKKA 4BE9A 3AILA 5AP9A 2R11A 3V1NA 2E3JA 2HADA 2EDAA 5CW2A 5DNVA 3H17A 2LIPA 5AK6A 1E8DA 1L7RA 1YS2X 2C7BA 4KE9A 2B9VA 5A6VA 3BIWA 2QR5A 3DOHA 4FLMA 1WB6A 2WU4A 4H7HA 4BTLA 5ALOA 4PSUA 4PSDA 1XZFA
chains in the Genus database with same CATH superfamily
5EWJA 2JGEA 3GZJA 1ZMOA 2QMHA 1YUMA 3IRVA 1XEXA 4I8DA 1M10A 4GRIA 4DDUA 2ZIEA 5HWSA 1A9RA 2VNAA 2WJJA 3D6HA 4G67A 4TOIA 4I19A 5CXXA 4DJFC 4EG3A 5JNLA 4MOWA 3CO5A 4Z1OA 4C4RA 1V5EA 3I5YA 1RTTA 2X3UA 2B0JA 4JMLA 4PQFA 5HIAA 4PFQA 2AOTB 3EVAA 2C84A 2B35A 3K09A 3H5WA 1Q6YA 2QGFA 3PHHA 4MARA 2KE5A 5IZ4A 3WB1A 1FUYB 1M83A 1CNFA 1ADBA 1WW2A 5LYYA 1FQOA 3TRDA 2YN0A 3QX9A 3SK0A 4R68A 1FE8A 3OPYI 4S2EA 3UJPA 621PA 2ETXA 3GRAA 2YXEA 3KPYA 2HXYA 5SYNA 2R1VB 2CNBA 1DKNA 1F5NA 1KFBB 4Q5IA 1UMDB 3BULA 1VBNA 5J2UA 3NM5A 1FFWA 1CRZA 4LJYA 2OK8A 4CDMA 4AAYA 3NYRA 4ZIRA 2AK2A 1YULA 4JI7B 1NRJB 2J3KA 5GIOE 3SR0A 3WJAA 3GEBA 2ZCJA 2V9CA 2ISSD 1JH9A 1YRQA 4E6EA 3B5JA 3LLSA 1ML3A 1AOXA 1I2ZA 2NO9A 3AT1A 3R6GA 2I7CA 2QKYA 4QQNA 3ENVA 4XCVA 5KYNA 1OB2A 4D8TA 1M1XB 5FDFA 5FUMA 2JI8A 2IXBA 3QUCA 5BWMA 3RNLA 2SNIE 1EU1A 1VKRA 2LZ0A 3BL8A 3QLVC 4UDOA 3MHTA 1JEYA 2ZAIA 2C2BA 1HNZB 1VI2A 3O94A 4IZIA 1ZRMA 1K4KA 4FMPA 4C6TB 1HFWA 4QTUB 2FZ4A 1VCMA 1WU7A 3H9EO 1CF4A 4MKFA 1ZH0A 1XJ0A 3GK3A 2DETA 3JAKB 4UZSA 5HJ7A 1GNVA 3R9WA 5BWOA 4P7GA 4V03A 4YJKA 4DTIA 3QYJA 1D5CA 1A77A 1XHLA 2A14A 1T0UA 3G9QA 3EQ9A 3HZZA 1Y6FA 2EV9A 3BVPA 4C0LA 3H99A 3IA2A 4AJLA 4C4YA 2YZ2A 2F1KA 1CZKA 2NVUB 4C3VA 4ENPA 5AVSA 1JF8A 1A4RA 2ERYA 3OCVA 4R54A 3A10A 2P0AA 3FUXA 3OQHA 1E92A 1RLUA 1XTBA 1G7TA 3Q8KA 4D26A 4EVRA 3Q0IA 1DIRA 4J0QA 3IKMB 3EY4A 1T35A 2PANA 2R1UA 4CQLB 1RHMA 3RVNA 4OXIA 1X9HA 3F97A 3GQVA 3I6YA 3R5SA 3NXSA 4HNVA 3UPTA 5ALUA 2R7KA 1T1GA 4PYLA 2NTJA 1AZTA 2I6TA 3R5XA 4IWYA 3VR2D 5F9HA 4H4DA 3FRHA 2EL9A 3OE1A 2QTVA 2MR6A 3FY4A 3NWPA 3AERB 4RFVA 4F5EA 3LWNA 1ZEJA 1N3IA 3CRVA 1MDBA 1AC5A 1USIA 3CN7A 5TQ0B 4LYYA 1ORDA 3BXXA 1IPHA 3GJYA 1W0CA 2XRZA 2HPHA 2R66A 4BNMA 2QBYA 1G8MA 2A57A 4NMXB 1AUXA 1K4MA 3AR6A 2X0FA 1GGMA 1GLNA 1H65A 1TZJA 5CVEA 5ICCA 3L5KA 1JIXA 2PCLA 4C0QC 3AM4A 2GGSA 4KLZA 2Y1WA 4URHA 1QH8A 1QH1B 4G2NA 1Z83A 1BS1A 2ONKA 5DTRA 1NT4A 4D9NA 5K3EA 2P9BA 1AXGA 3KT0A 1FDWA 3PEUA 2X8WA 4KXUA 5DTQA 3MD0A 2AR0A 2YHSA 4Q3LA 3NBKA 2E2WA 4X41A 1PJ8A 1JJBA 4W9NC 2VQ6A 3ED5A 5DWQA 2V65A 2WWRA 1QHYA 3L7KA 2FR8C 1LVGA 1C3VA 4R5HA 3Q88A 3VO8A 3ZW8A 4TVSA 3T1QA 5G3ZA 4K9QA 5HK9A 4GDFA 3SOZA 1KBQA 3C3PA 3IOMA 3B51X 4O6VA 3OZTA 3QENA 3JU3A 4OFBA 3DAFA 3H9JA 2XYHA 1GTVA 1XLUA 2REXB 2Y93A 4PR0A 4RL4A 2G72A 4KUHA 3U48A 2EAUA 4ERXA 2ZUSA 2H4JA 5DTMA 3PLNA 2BEVB 3DFUA 3FVVA 2EARA 4MX8A 2BVNA 2NUTB 2YWBA 3KQQA 4O08A 1HLGA 1R3UA 3QOFA 2WM2A 3A04A 4KYVA 4X66B 3IJPA 1KP3A 1XCJA 4FZJA 1L7XA 3OUZA 1W59A 4IHJA 4M7PA 1F1BA 1NFFA 2FEAA 4OA8A 4RJKA 2IWRA 3GRZA 4E46A 1JS1X 2X58A 1I7DA 4I46A 4JI8B 4AROA 1UWKA 3UANA 3CXUA 4MAAA 3PNLA 1KEPA 2H1CA 4CLEA 4B6OA 3HVKA 2RC5A 3CWQA 1KZ4A 1M75A 5C4GB 4G4JA 1Q3HA 4WN9A 4GO1A 2F1IA 4CKEB 3NPAA 1GRCA 3FI9A 1ZD2P 3TD9A 1SNYA 2FMIA 2DC1A 1ZGHA 4O63O 2RGDA 4PW0A 4AL4A 4CKWB 4PBTA 1H6DA 4MXDA 2WE7A 3KWMA 3CMMA 1SCDA 3E0XA 5E95A 5LC1A 2VHZA 1QFYA 4FW8A 2CLSA 4IDFA 3D7MA 1IEXA 3M6VA 3V8NA 5JALA 2Y0BA 1JQ3A 4FB4A 4EF5A 1NPDA 3O90A 1BA3A 4YCMA 2Z83A 4MA5A 1N8SA 3RS4A 3LFHA 4PHHA 3P9CA 1TM1E 4N5DA 3UJ8A 1VKHA 1MB9A 3I8XA 3NT5A 3CKKA 5EJMA 5FL7A 4B17A 4XVCA 4BS9A 3IEPA 2ZRDA 2FMTA 4ZAFA 5JCOC 4O4JB 2I76A 5DNYB 1FVHA 4P4GA 4RABA 3OC6A 1QYXA 4J2OA 4C6HA 4N3AA 2WZQA 5JH7A 1BQEA 3AOEC 2CJWB 2D5IA 2WOJA 1CQXA 1QF9A 3ZHQA 1WPQA 5JD4A 2NUAA 4IDNA 1QR2A 4WJZA 1CY4A 4PC3A 2O20A 1SKQA 1XMIA 1ZO8A 3PHIA 4FE4A 4GSLA 3RCBA 1R5OA 5AUOB 3BIOA 2HIHA 2W2KA 1GQQA 1I1OA 2Y8EA 2R5NA 2X0DA 1U8UA 4DJDC 2ZJBA 1SCKA 4IQ8A 1SUCA 3SEAA 3LCMA 5FBKA 3RIHA 4MR8A 2HA7A 1AQUA 1U8FO 4YREA 1UFKA 4HUQA 4KQ6A 3HYRA 5LZ9A 3OMXA 2IGTA 3LK6A 3WV4A 4BKPA 2ZWVA 1CUFA 1K6XA 2HX1A 3UK1A 2IY9A 4WERA 3K1TA 3OA0A 3SVTA 3GL9A 5A71A 1FFCA 4WMLA 4L72A 3DGEC 5JANA 2FPGA 3A7DA 5HQ3A 1P9NA 4AM8A 5B58C 5BRJA 5AK4A 1W4AA 4QAJA 2OYSA 3J81A 4ZRMA 3QE3A 1MO2A 1T9DA 1QUEA 1Z73A 4R8MA 2NUBA 2QIPA 1WOMA 1ZQ9A 1RYDA 3IPCA 1IJBA 3X1MA 5A5DA 1M9NA 3G2QA 3KALA 4DLBA 1KVUA 2XRMA 2N0SA 1X1RA 4D42A 3H2YA 3LVRE 4H6WA 3SPXA 3R5FA 4D8WA 4EQ6A 1HH4A 2QQ5A 3NBAA 2GCOA 1Z62A 3DMRA 4Q7KA 3UCEA 2O2SA 1M6EX 3BWEA 3V1KA 4KQHA 1M7GA 1GUZA 1ULTA 1YE3A 2FSFA 4MYSA 4UDYX 5DRYA 4B45A 1WCV1 1E3EA 2FVXA 3A2LA 1YDEA 2QA5A 3D8TA 4JENA 4ZK2A 1UJBA 3F4BA 4Z9YA 3SSAA 1Y4AE 3IMGA 3WIOA 1KJIA 4F2HA 3BMCA 4PRZA 1XX6A 1Y82A 2V7QD 1YA6A 2A4KA 3ETNA 4ND1A 1H2WA 4I55F 4E5NA 2Q5EA 2PQ0A 4ND7A 2CF6A 3FCEA 1R0LA 1RAIA 2WNSA 1KH1A 4JD5A 5IM5A 4IOLA 4CMBA 3AR9A 4YRNA 5BQXA 7YASA 3AG5A 4K1LA 5JCJD 1ESEA 1B3RA 1XTIA 3OZGA 4G86A 1NQAO 4IXTA 1J9GA 2Q62A 2AX3A 2GYYA 3T7KA 5IAAA 1YB6A 1C4XA 1L9XA 4PONA 3CT4A 5DHRA 3RROA 4TL9A 1V5GA 1B6SA 3WA6A 4N7MA 3H2GA 3AMVA 4PC6A 4TV9B 5IC4A 1SPBS 2M6SA 5MN5A 2IHNA 1WXXA 4EJFA 4GQAA 2CL6X 2QUHA 3ITEA 3WP0A 9MHTA 3PQDA 1KS9A 1JT9A 4PBRA 3Q0TA 3SHVA 5DM60 4UXJA 4BQFA 1O95D 5AVYA 5BR4A 2VWGA 1CQZA 4UMDA 1Y5MA 2X0NA 4OX9Y 2OWDA 4H0CA 3KS9A 2EKBA 4BQIA 3KV3O 1CQJA 2CXPA 1EJ6A 3D9QX 3RG2A 1QC5B 2JNWA 1Q0TA 4M22A 2WKPA 2X1LA 1U3TA 3QPWA 1QG4A 3AR4A 3HA5A 3S68A 2AL7A 3BSYA 3EIUA 3EY9A 4XUDA 3UVEA 2XMGA 3OPMA 1GD1O 4P53A 4CI0B 4B6JA 3MWDA 3CJTA 3RIMA 3KVOA 2YL2A 5TQ2B 3MXTA 1L5WA 5LOVA 3GPLA 1LDYA 1DZIA 2ZRAA 1RYBA 4HH0A 3ZH2A 3T35A 4EFKA 5DEOA 2IH4A 4WZAB 2AXQA 3K9FC 4DUZB 3SC6A 2VZEA 1E2FA 1GGFA 3T0IA 1GU7A 1W85B 1P1RA 2R6HA 5GONF 4KVGA 1DNPA 1HZZC 1R66A 2R6GA 1F20A 3THSA 1FYXA 3NETA 3WAKA 4R0NA 2HQBA 5CCEA 2DY1A 1QHHA 5LA6A 5BR8B 1TO1E 4A2WA 2D74A 2YVLA 3QU9A 5JHHB 4B80A 2VF5X 3W8EA 4CXMA 2AC2A 3RSFA 2C4UA 5ENDA 5AW8A 3GJTA 3MM4A 1XN1A 1U98A 2XMSA 4QDZA 1HF3A 1VPDA 5LVAA 4NFYA 1MJ5A 4M99A 1FS4A 3I1FA 4IIXA 2CC2A 4LA4A 1GZ3A 1V39A 2ZATA 2CJPA 3PNQA 1W0KA 2GEVA 3REQA 3R5JA 2V9ZA 4ZJUA 1PFKA 2PSHA 3CEPB 4ASUD 1EIWA 3MCVA 4BU1A 1DINA 1O6ZA 4PPNA 3T1VA 2MDTA 2OBXA 3R0IA 5BP7A 5AKZA 2GVNA 1P81A 4GOJA 4B43A 2VA9A 4QBGB 4P3NA 2PSFA 2FLKA 2P6PA 4EGAA 1KEKA 3OH8A 4UOZA 4F6CA 4QTXA 3IQXA 4F6RA 2RG7A 3EJ6A 5H70A 1LC0A 2HD4A 2OENG 5KWEA 4GZ5A 3FKSD 4ALNA 3DZIA 2EW8A 2ZTHA 4FQ8A 2Q3MA 4P5PA 2BTEA 4TYYA 4M0MA 3I61A 1PV1A 5AVRA 2ZU6A 2G1PA 3DL0A 4NNPA 1VHDA 4DA8A 2VRNA 5AVZA 2QP4A 5A6SA 5FBZA 4BC1A 3E3LA 4YXFA 3W2FA 3CVWA 2WLTA 3VR4A 1G98A 1KMQA 1LX7A 3LDGA 2GTHA 3ZE6A 1CWUA 2IPXA 5ALPA 4EB6A 1UBOS 2JBWA 3R5TA 3TRJA 2VQFB 3PDIB 3AVQA 5DSZA 3IOYA 3RJTA 3JSXA 5AXBA 4RLSA 2D4HA 5H9WA 3ZDFA 2C2ZA 3A70A 1DG3A 1XZIA 4HNAA 4RHCA 3RK4A 3UGTA 2I54A 3F78A 1ISJA 4BCBA 1W1WA 2B7CA 4HAWA 4GL2A 1VIAA 3WX0A 1CXZA 4PR3A 4D57A 4BZXA 4HCJA 5CM9C 5AM2A 2FXVA 1UMCB 3OOEA 2UV8A 4TN5A 1ODCA 5K9ZA 3JAWB 1F14A 4DM3A 1Q7EA 4BZQA 1E94E 1VJ0A 2IDJA 2AKYA 4CCSA 5AW6A 3DBLA 3LBFA 3H5NA 5IN4A 3HJNA 4E21A 2CMDA 2LBPA 1AB5A 1U5BB 1E0JA 2HYIC 2FR1A 2ZQZA 5EIFA 1HO3A 2X0EA 2XH8A 1UJ4A 3OETA 2Y67A 1F2TB 4EY8A 4Y2JA 3V46A 4G5XA 3K05A 5COBA 4D4LA 5CB4B 5KQLA 4KRFA 3NEJA 3B9BA 3CUKA 1F2VA 1I36A 2J9GA 3LF1A 1S6YA 1QO0D 2APJA 1WXWA 1DKOA 1XKQA 1MC4A 2JFYA 1U99A 4U6SA 5AVJA 1XDDA 3N2KB 2HSZA 3GJQA 1K8ZB 2XUJA 3PENA 3WISA 2GNOA 3AV3A 2VLBA 4LMPA 4BFYA 1GYPA 4HQNA 1QQAA 4LOKA 1U9IC 5KTMA 3TPFA 2H2IA 2R00A 5HFAA 2ZXEA 2VG8A 4YBRA 1PWXA 1L4GA 5HJ2A 4OI2A 4MP3A 3K9LA 3FF1A 1VHQA 1O94A 5D01A 4UOEA 1YJ8A 3KR1A 5D85A 2V97A 4PV7A 1ZD3A 2AEMA 5K3DA 5C8VA 3S6JA 4PSUA 3GLFB 1E1RD 1GQ2A 3K1ZA 3BAZA 3MJSA 3GJ5A 5L4SA 1K7EB 3F71A 2ODWA 5F1KA 4L9RA 5LMCA 4YRPA 1Y8ZA 3DMTC 3MFQA 1RLMA 3IE1A 1H2EA 1Z4QA 2JHCA 3KM0A 3NAGA 1USKA 3ONWA 1M2GA 1CZLA 2VK2A 3C5VA 3HV0A 4JUAA 1H23A 2OZEA 4OQNA 4PAOA 1KO8A 4YNBA 5HCNA 1REQB 4ECAA 4ILEA 4DC1A 5B64A 4DR5B 2OAQ1 4DHWA 1K8XB 4XPZA 1OH7A 1OYWA 4TLMB 1TM4E 2JFZA 1L4FA 4OI1A 1G8AA 2B1GA 1H9CA 5TVGA 4P80A 4XM2A 4DJAA 1YBAA 2FOXA 2ZBPA 1HTTA 3JYNA 1DFGA 3MINA 2YW2A 1BH2A 2G25A 4MB6A 4FFBB 4BGDA 1Z22A 2BZ1A 3LMKA 4YJHB 1BFDA 1HNXB 4NDAA 2QTLA 5AQ1A 4I7EA 5DNAA 1W9HA 2CXNA 2WG2A 2IX3A 2JG3A 3D81A 3O2NA 1M2OB 1XAIA 2X22A 4L51A 4ZOAA 5JMPA 3P9XA 4FHGA 3VZSA 3O3CA 2XE7A 1KEEB 2B2CA 3DT8A 3H8VA 4KTTE 2X77A 4KXXA 3QHQA 4OJQA 5TPWA 4EZIA 3TFOA 1DJPA 4KE7A 3MTIA 4B3GA 2JZNA 3LY7A 1NDQA 5FPKA 3AETA 2VT6A 1S89A 2CYBA 2QL9A 3S70A 4B2IA 3U6KA 1Y8QA 3ZOKA 2PSDA 3CXRA 1ID8A 5EXPA 1SULA 4Y2RA 5HIMA 3BJRA 2Y66A 4Z54A 2GRUA 2JAQA 1GPDG 2EYQA 3C6ZA 5CDFA 2A9VA 1FLVA 1MB2A 1J2YA 1DEHA 1XFAA 2DHEA 4G0YA 5GJBA 4MUJA 3EUWA 3UAGA 1PZFA 2YRXA 4YGXB 4CGYA 2HT1A 1ULBA 1TADA 2DULA 4ZWNA 3IALA 3W05A 4WZBE 3SAJA 3UMVA 5BVGA 1N5OX 4ZYZA 4D6YA 2HPVA 2AH5A 1DTSA 2FW0A 3QHAA 4G89A 3MAJA 4LZWA 4AJPA 3HE3A 4BX8A 1W49A 1W75A 3D5EA 3E9DA 2G70A 1M1ZA 4H7EA 3L8GA 3SS9X 1LU9A 2P6MA 1ZW1A 2D5BA 3EDOA 1TM2A 3ZV5A 2XWJI 5DLYA 3O84A 1JHAA 3F8SA 1DUIA 3BRWD 1GNPA 2H9IA 3K4HA 1GT6A 4JQYA 4JLVA 4LNUA 4B4KA 4JLJA 3I6QA 5AVUA 1D04A 3NM4A 4IIDA 4NBNA 4X3OA 3TNDA 4L4YA 2ZT6A 4D9GA 2CL7X 3B70A 4BFCA 2H2WA 2IFTA 3KTAB 3PVSA 4QM6A 2PFGA 4EATA 3ADCA 2D1SA 2ZRNA 5COQA 1IE3A 4NJEA 5EYPB 1E1CA 3A1DA 1JXOA 4AJJA 3VOAA 1XQ6A 3VSAA 3G9UA 3T5GA 2KMLA 4U0JA 4S1TA 3MPOA 5JYEA 1Z4NA 4M9UA 5LFAA 2J07A 2JVJA 4N3GA 1J09A 4H7FA 3ZJYA 1P6QA 4HVAA 4MHOA 2ARKA 3KKKA 3NPMA 4UREA 3LT0A 2ZB7A 3VNUA 2W2NA 1WSWA 4BMZA 3C6BA 3CVOA 1Z3IX 3ELYA 2VNHA 1J1UA 2Q9AA 2ZRIA 4PS1A 2CMFA 2C92A 4EJMA 2JZOA 1WV1A 1JBQA 3F8WA 2CB9A 2O2JA 1DV2A 3GLRA 4FLFA 5HTKA 1UWVA 1AZWA 5CNIA 1M73E 3DE4X 3QNUA 2XXJA 1RBYA 5ILOA 2NT4A 5KVVA 3O73A 3LUGA 1I1NA 2I4MA 3ZZUA 1SVMA 3H2HA 3I42A 4NK5A 3NTOA 5ALTA 4Y1EA 1RLTA 2ID4A 1I8TA 1KH3A 2C96A 4MQEA 1DQZA 1AQNA 2FJ0A 3AF4A 2AMYA 2O8EA 2HBRA 4D4MA 1QV7A 1XB2A 2GN8A 1AKQA 2P35A 2V6IA 4FGLA 1Z0FA 4H3SA 5EHQA 3ZUPA 1GCOA 1RMQA 4YCCA 2O7RA 3UT6A 3V80A 4QYSA 1J0XO 1F3LA 1QMGA 3NGXA 3OT1B 4B31A 1PFQA 1ZVMA 4G1CA 3JQBA 5K0NA 4EI8A 4ZT6A 1KOJA 5FO1A 3SEQA 4ZJYA 2GFQA 3BWBA 1RRMA 1VLJA 2EJVA 3D43A 2EFDB 4TXNA 5IH3A 1PP4A 1EGVB 1T5BA 3DTVD 3UGKA 3KC2A 4HVCA 2RB4A 2UZ4A 3LUPA 5L4NA 4JC4A 1I2MA 3N8KA 4HB3A 1DAFA 3AIOA 5LU9A 4ZT7A 2VJKA 3OZCA 5D5PA 2BFBB 4Y30A 4C7OB 1IY9A 1L4BA 2W4IA 3UGJA 2LW7A 4KWHA 1AKNA 2ZGVA 1WDWB 3U31A 5FI5A 3BFXA 3OCYA 5G4LA 1POXA 3DUFB 1J2JA 3FFTA 4G0VA 2A94A 4MI3A 3B1VA 3BD8A 3MBOA 1DELA 3KBBA 5D2CA 3KQMA 1BX1A 3I6ZA 4QU9A 3IIIA 3HBLA 5LR6A 4FFOA 5IJZA 4MKXA 2B69A 3QE0A 1AHNA 1RRGA 3GWGA 3N74A 5G4KB 1A1VA 2JVKA 4Z4QA 4FR0A 3UUWA 1N2IA 3KKEA 1P1JA 1RADA 3O26A 3G1UA 5E3IA 4DMKA 2I1QA 1RR6A 1UDRA 3RT1A 1JNXX 3W5AA 4WNAA 4INPA 1ABEA 4Q4HA 3T7IA 4F5DA 4FGJA 2P5SA 2W6ZA 3COVA 4ARZA 1P4RA 1QOQB 3IQGX 1MX1A 3IO5A 1THTA 5C34B 2Y05A 3T3EA 5AVQA 3QTBA 1UPCA 1U0EA 1MT0A 4FUQA 3F5QA 4R1MA 3UHOA 2NPIA 3KQYA 4F97A 2PTHA 1J70A 3G02A 4HVLA 1E8NA 4CDRA 4WFKA 1OXMA 4PSVA 5JXWA 1JU9A 1KVTA 3UA3A 3S2SA 2AMJA 5JATA 3VPXA 5HRUA 4YMTA 2IPOA 3SX2A 5EUCA 3QLJA 4Q7EA 1HKHA 1UAGA 1ZOIA 2H63A 1A8HA 3ILYA 1SCBA 3O8OB 3HKEA 2J45A 3DBRB 2HFKA 3Q6MA 5DLQC 5KUTA 1QV9A 1XRMA 2KI5A 1P2DA 5JASA 1ZL0A 2ZJ5A 4XASA 4ETIA 1T9AA 3OZUA 3L6UA 3KOUA 4L5IA 4CG3A 1C41A 5BW8A 1PCXA 1VKJA 1R6VA 2IXEA 2V7TA 3QXHA 5G53C 3SIXA 2HHJA 4KIJA 3UKJA 3KSUA 3TGLA 4S3MA 4J07A 3G6KA 4KQJA 2BFAA 3FNHA 3KL2A 1BWQA 1WIWA 1O58A 1M1YE 3HHPA 4KXLA 4N47A 3OQBA 1T4GA 13PKA 3W5SA 3VDQA 4DZZA 2DUJA 4CM4A 1ZU5A 2AFIB 1YT5A 2GZRA 5T7BA 2VHXA 4FZRA 4G5SA 5BSVA 2XJ4A 3CC8A 1JHOA 4CMIA 3SXJA 2PRKA 3HN2A 4G5HA 4GXRA 4MMXB 4J75A 3WO1A 3C4QA 1KYIA 1T6XA 3D6MA 4FC6A 1RBZA 1ZL2A 2HJGA 4H7IA 2D0IA 2HO4A 4II2A 4NC9A 4FS8A 2XHEA 3RTCA 2HJVA 1WPGA 2EFEB 1SWWA 2JFXA 3P4XA 3G2NA 2I71A 1R0ZA 3NHUA 4EHDA 2ZRLA 3QIVA 4QOFA 1LLQA 1XP5A 2DECA 1XRQA 1C30A 1ZHFA 2C61A 1NW8A 3HWWA 4OAQA 4ZV7A 4C9BA 5KNBH 2AS0A 1GNRA 3R20A 4EP1A 3CEMA 3MTDA 5BURA 1W5SA 5IJ0B 4FD3A 5CTAA 1FTGA 3D4BA 4DSZA 1JBEA 4LDRA 2G3YA 4NOMA 3ZHOA 1RXSA 5JOQA 3W34A 1Q22A 5FBLB 2FWAA 1LPSA 1R9MA 3WTBA 4GHWA 3MLAA 2K7ZA 1CY8A 1OIXA 4HQFA 1WUHS 1S2LA 2J85A 4I8XA 4N54A 2RFLA 3CUYA 3K9QO 4Z7JA 2B0CA 3EH1A 2VT2A 1UPUA 3IVCA 1NWCA 4J0KA 4QYWA 4DNFA 1ECGA 2EL7A 3FPHA 5FOVA 3KYJB 3FUVA 5K3SA 1IHPA 2DWOA 3SHOA 4B8ZA 1KZ7B 1RYEA 1ZYUA 1PF7E 2P2GA 2R96A 3B9PA 3IIMA 4EG6A 1BD3A 4RVUA 2AUNA 3THOA 3NWEA 1NRXA 1ZEMA 2VUTA 3DMFA 2ZJ0A 5F2KA 4FIDA 3TLEA 5DX0A 1EP3B 3GR6A 1U6IA 4G1UC 1FZQA 3ANTA 5CYGA 2EZ4A 2AFVA 3LE8A 2WY2D 1ZCBA 2C4NA 4HMOA 1VPTA 1Z2CA 3ER6A 1KE2A 2I7XA 1US8B 3QZUA 3OJ0A 2WF5A 4YY3B 4YX9A 4GT1A 1A95A 4N9WA 1F60A 5A4JA 4DV2B 4DIMA 1AK2A 2VAPA 1G6Q1 3HL4A 3L7CA 2NZXA 2D0DA 1S0UA 3LOPA 2VHJA 1UPBA 3DMGA 3ORFA 5LOVF 2FMKA 1ZRSA 2X8JB 2VDLB 2YV3A 3GRCA 3MWKA 1WDMA 2BMAA 2J6BA 3I8OA 3PQ5A 3LIIA 2ALJA 4ZDKA 5ED0A 1YA8A 3Q5DA 4DCVA 1EE1A 4E4RA 3EPJA 1W4LA 1Y5NA 4MDEA 2F3QA 2O07A 2CJYA 1XQ9A 3ZWQA 2FW7A 4IIGA 2W48A 2O0JA 2Q99A 2Y2VA 3E15A 4RM3A 5I5GA 1CS0B 1P61B 2X4LA 4J6EA 3TIVA 5A4MS 2J33A 3RWMB 3PRYA 2IU0A 3B1KA 1Z5VA 2P3LA 3S2UA 3FSGD 1CB7A 2XB9A 1QKIA 4NEHB 2BM8A 2JEOA 5I7EA 2PWPA 4LXUA 4I81A 2F3PA 3H16A 4K2AA 1NF2A 2RGRA 1PQ4A 3EBPA 1E6KA 3PFIA 2IP4A 5FWYB 4G0OA 2ZT7A 3H84A 3WNCA 2ISQA 3GJSA 1U0NA 2ZSKA 4ILKA 1HR0B 2A30A 3C5CA 2IQ5A 1V16B 3IJEB 4Y6RA 1UM9B 1ZUNB 4ZO9A 4Y6QA 4ENSA 4HGPA 1YVRA 1U2DA 4GUDA 5F1OA 2JBHA 4HFNA 1X0XA 3HUEA 4Q24A 2WD7B 4MPDA 3EVFA 4IHKA 3NWBA 4GYJA 4XXHA 3QKTA 4TLEA 4F5ZA 1EAMA 3CUWA 2H2GA 4BJ1A 1VKOA 1P2BA 2VYND 5DYTA 3TM5A 3TW8B 3IPAA 4YAJA 1NI5A 4Z8YA 1MTZA 3K6JA 1T2AA 4J29A 5HKAA 3F5SA 1GCUA 3HFJA 1RJFA 2KM1A 3IAEA 2HMUA 4YONB 4YRZA 1E4EA 3DBVO 3BWCA 3QKUA 5LBIA 3QVLA 2P67A 2TRSB 1NYQA 2VJMB 1JEQA 2C5SA 4AY4A 3ZHBA 4UULA 4A7PA 2OO5A 2WG0A 3RT7A 4CCYA 2Q4TA 1JLLB 5ESWA 1U80A 2HYDA 3VHXA 3LTNC 5EUMA 1V8BA 2QLNA 4QBFA 3ZX4A 4YRGA 5JR3A 1GN8A 2YHUA 2MYPA 4R69A 4HGOA 1FDRA 4RXUA 1JHUA 3HGMA 4RCVA 2ODAA 2PZJA 1QIEA 2AEJA 4IDDA 1D7OA 2HCJB 3STUA 1C3LA 3W6PA 5E6SB 1QCZA 3TD6A 3HFRA 1CW2B 1JIQA 2WC1A 2WUDA 4PLGA 4YRKA 4H2DA 1GGJA 2CLDX 1XQ1A 3ESBA 4PQRA 5HA5A 3UNXA 1HQDA 3RVDA 3V6MA 3GDOA 1RYZA 2QZJA 2Z1MA 2W58A 3EWNA 3OZFA 4G65A 4M9ZA 3BWYA 4NJOA 4ZFNA 1WVMA 5THQA 2A0UA 3FYTA 3VO2A 2CUZA 1T8UA 2QTWB 3DZGA 4BVBA 3VC3A 4DNQA 3BXEA 3ZE0B 4NCNA 3GLHA 4GMKA 5HFJA 4UFOA 3W77A 1N6LA 1N9ZA 4WUVA 3DE5X 3L9WA 1CEXA 1M6WA 5M3BA 4E4YA 3JZAA 4O2BF 5A4FS 5FAXA 1SPXA 5GWXA 3NBUA 3B3JA 3BGOS 4RJTA 4B3TB 3IXQA 2YZNA 3JXEA 5A7GA 1VLVA 2Q5JA 3VU0A 4B74A 1A4XA 2CXQA 5M29A 4J4HA 3LRTA 5TS2A 1RQNA 2FYTA 4X00A 3NX4A 4GNKA 4RVSA 3WLSA 5I4IA 1IONA 1IOWA 1NVEA 4TXJA 1G16A 3LPLA 1K7YA 2JH8A 3G79A 3PNSA 5LP1A 4KN8A 3I76A 4UBIA 2M1XA 2CUKA 3F1LA 3ZWMA 1HFKA 3HXKA 3I23A 4HWSA 4OREX 1U7WA 1E0DA 4AK9A 3V55A 3BE8A 1IN4A 2X5OA 2DBZA 1P3DA 1R4MB 2H59A 2WI8A 2XTMA 4V2IA 3TKLA 1NC3A 1OC4A 4FNGA 3FTQA 1XXLA 4HDRB 2GAJA 2PX0A 2Q2VA 1F48A 2AV6A 2XLCA 4KODA 1U2TA 2W2QA 1JHQA 3TOCA 3WWPA 1UBUS 2ZQYA 2R8BA 2OGTA 5DP2A 4V1CB 1FNBA 2I2XB 1B76A 4JOSA 2HWYA 3NBQA 5IK2D 1JMKC 3N6XA 4OUDA 1UOOA 4YR7A 3S2IA 1ZUHA 3NVMB 2GN1A 2XIJA 1GAWA 1ORIA 4WXYB 3FTNA 2ZR8A 1P75A 4CM9A 4TRJA 1TIPA 3DJYA 4ISCA 1E2JA 3CNEA 4KQ2A 4ON9A 1PWEA 3PUYA 2QRUA 4UKDA 1TF2A 1XRRA 1PS8A 3ND6A 4KOAA 3UB3A 3VR3D 4E70A 3KQOA 3QHPA 3U5ZB 5JQGB 1U9ZA 2NU7B 3N59A 3SF8B 1R7RA 3TXYA 1TYEB 3ZK8A 2NSYA 3Q7SA 4E2FA 4P4LA 2WB2A 1SUIA 4YAGA 4DMCA 2XI4A 2QG9A 1YNOA 1PFWA 3FMFA 3QPAA 4RIGA 2F2TA 5JD6A 3WO0A 1IXRC 1SCJA 2XXAB 3KTDA 3U40A 1DBPA 2BGIA 4C7KA 3COYA 4JSRA 4UNPA 4RKQA 2VT3A 1Z8HA 1TRHA 1XAJA 1BVRA 2BFFB 3KJQA 3L4SO 4RW0A 5DN6A 1R0CA 3I4CA 5I7SA 4F9EA 2B30A 1TKAA 2HBZA 2J3QA 2O3JA 3L1KA 4QDOA 3EXG2 3T7JA 4BRSA 5HJ5A 1RRCA 1DADA 4KO3S 2O8FA 1VRVA 4N5MA 4TTAA 1DAKA 5IM4F 3R40A 4DLXA 5I7OA 3U3JA 2FZLA 2CDBA 4FCCA 4R7GA 2EJUA 5C7LO 3F4LA 3G0CA 2Q21A 3NW9A 2CK3A 4IMPA 1OR8A 4YRBA 8OHMA 4KAJA 1P73A 5FR2A 1FMJA 3CLSD 3PLRA 3CONA 2C7RA 1UH5A 2FOIA 5F2EA 2FI1A 4IJVA 4MS1A 5F77A 5FFFA 3RBAA 1T2NA 4ZARA 3IAHA 3NRCA 4B81A 1NF8A 3OQOA 4BGVA 4UNRA 3OHMA 3ZWXA 4CMEC 3ETJA 3JV7A 4ZI7F 4JVOA 5KTTA 1LS1A 3SJCA 1EESA 4I50A 1JSZA 2X23A 4D80A 4LDAA 1AGNA 4OBWA 2NGRA 4H08A 1WKBA 1AKMA 2GHTA 3KG2A 2BGNA 1DBRA 2CWWA 2ZJ2A 4F92B 4MJ3A 4REQB 4KO1S 4JI5B 1T5DX 1V0JA 4H15A 5LQMA 2GDJA 2JIQA 6ADHA 4L0DA 2YMMA 1P1IA 3PRHA 4WIAA 1E6MA 2GZ2A 4R16A 1QVWA 5C8XA 3C8MA 5HVNA 1RFGE 2PD6A 4Q82A 2I0FA 2VVTA 4FC7A 1K3FA 2ZBQA 4ME6A 4QJ5A 3WP1B 3WLTA 4RPLA 2KBFA 2QV7A 4V3BA 1GTZA 4LHWA 3SN6A 3NG1A 3ZH9B 1B14A 1TEXA 1MCZA 1P4SA 4B40A 4R1TA 3RJ9A 4L75A 5U4XA 2BIFA 4FMBB 5KC8A 1ZZGA 4MVJD 3OTOB 5LP6F 2QGNA 5TDHA 5GZ3A 1T0PA 2NTEA 3I83A 4DSTA 3RBVA 1AT1A 1VZ2A 3SY8A 5AW2A 1HE3A 4DQXA 1C8BA 1V11A 1TUBA 1JDSA 2PR7A 2QPTA 4B75A 4EPRA 1XK6A 1VHLA 4L4UA 1Y6QA 1ICIA 4JLAA 4KFRA 4C7MA 1R4ZA 1UC4B 3BERA 4OHYA 1CUEA 1IN7A 4WKPA 1EWRA 4L5AA 4NYJR 5D51S 5B3JC 4BTVA 1O97C 1JZSA 4NBSA 3FKJA 4QDJA 4DIOA 2MSNA 4MB2A 1XSEA 1N3YA 3I72A 4DLVA 1MMFB 4LXXA 4D25A 1VIYA 2XNDD 1F3OA 2YUTA 1M1UA 3PJGA 1EWYA 3MRSA 2O8DA 2EX0A 2HU7A 3DWIA 2REBA 1GLGA 4K9MA 4TTPA 5CYOA 5A3VA 1F4LA 5KU1A 3UV3A 2PV0A 5F33A 5GOZA 2IZ6A 4KI0A 3KZOA 4AU1A 1DAEA 1GLVA 1PWYE 3NUGA 4M1ZA 4MGKR 1M0WA 2GETA 4X20A 1W5BA 2K2WA 5FWAA 5DU2A 4PO3X 3U81A 1XD9A 3F6EX 3QVGB 4H1VA 1W9MA 3A6FA 5E6RA 3VR5H 1PR5A 1UKEA 2GNPA 3AGQA 2A5JA 2Q8NA 3LCVB 1G8KA 4PXSA 3ORHA 4NU6A 5CXSA 2IIBA 2OZKA 3GLIA 5KVAA 4N3CA 3EXFB 1BCRB 1UXGA 5EKXA 3U4CA 5EZ6B 1Q1ZA 3AHIA 5EWLB 3LNCA 1GSAA 2P11A 5IMSA 1B2LA 4S35A 1U2PA 2CLLB 4KQIA 1E99A 1T4DA 3IA7A 1WMDA 4IYJA 1Y3AA 2R7AA 1RXWA 1H05A 3EMKA 2W2OA 3DW3X 3E22B 1HEUA 1KMMA 5A4KA 1N3BA 1UAYA 3F7OA 4BECA 2MINB 3D4IA 3P45A 5EJFA 5G1PA 5I8ZA 4B3IA 5K8TA 5G0TA 4B3BA 2VBIA 3M2PA 2HHAA 3I5UA 4Q3KA 1CUHA 1U8YA 1Y98A 3DLAA 1RYYA 1VE9A 1T36B 3ANXA 3DT9A 4Q1AA 3ICQB 1EDBA 2YVUA 4DV5B 4ZQEA 5FPYA 4MVJE 4QAQA 4WOBA 3ZYCA 4ND6A 3Q7IA 3RH0A 4BLVA 1QCCA 4MRAA 5ENZA 2AYYA 2X2PA 4YMHA 3EVDA 4JL5A 1PT9A 1TCUA 1C9JA 3R7SA 1FYVA 2VQ3A 3I2JA 2F3TA 4LJLA 1A9XB 4AT1A 1A2BA 1KSGA 3DTYA 3PEFA 4BIMA 1B6GA 1V5WA 1E5VA 4A0GA 4KXWA 5HKBA 4JITA 3WBKA 1GPMA 3E3OA 3E27A 4MQFA 3GBSA 1V45E 1EAYA 3K0AA 4Y2XA 1H4TA 5HFNA 3PHCA 4HATA 4Q4AB 5KYUB 2PJRA 3DAPA 4YASA 5FBHA 5KOHA 1NNEA 4WNIA 1M8PA 3MK31 2ZVDA 1NAIA 5DXFA 1YO6A 5AXDA 3AOGA 2IX9A 1XU4A 3ABSB 1S02A 3OP1A 2WJVA 4Q0MA 1GR0A 5EMLA 3ZY6A 1F5SA 2V0NA 3L0PA 4HZUB 4XB6B 3C8DA 3P0JA 1SKBA 1SBTA 4GICA 3NAZA 4NTZA 4W5OA 4EI2A 3QEMA 1XCMA 4BXOA 2V54A 3IUBA 1CP3A 1BGXT 1Z7YA 4W6QA 4PZLA 1MO6A 2ATVA 1YRBA 2I2CA 3OIWA 5KC9A 2L18A 2JJYA 4IPTA 2A1UB 4GR4A 4W8GA 3ITNA 3D1JA 4F2PA 4XUCA 4W99A 2DH6A 1KI6B 4Y3UA 2AF3C 4XDYA 1NJGA 2A84A 1JDNA 3CUVA 4MLDA 4WOKA 2H17A 1PNOA 4OAOA 5CURA 1UKZA 1G8PA 4ZOEA 3NTXA 4LYFA 5EGNA 4QOGA 1JJ7A 4QG3A 5K8JB 3DZCA 2GJKA 1BXKA 1X7ZA 1UQTA 1P2VA 1DRKA 3K1YA 1BG6A 2PRYA 4HI0E 2CY0A 2NYAA 3NONA 1E63A 2WINI 3NR2A 3ZQJA 1H2XA 4FYMA 2YJZA 4OXRA 3V2HA 2C9MA 3HP1A 3R3XA 4MA0A 5CTJA 3WLRA 5FEUA 4XOIA 1COWD 3G82C 1RW4A 3WNZA 1RAEA 3I28A 1CR0A 5H02A 5K1ZA 4B2LA 4B79A 2X9GA 1N0UA 4YIHA 3COJA 3WGNA 1XWFA 3I53A 1RHKA 3OE7A 2OC9A 2V5VA 5HW0A 1ES9A 4KQ9A 3I62A 4RMIA 2PAAA 3KJGA 3OFVA 4ZVSA 4B5KA 1ZXBA 2MU1A 2XB8A 4Z3OA 1BXGB 3BB4A 3PGXA 1SXJD 4RK4A 1KI7A 2COUA 1NM5A 2CL5A 4TWIA 3RVOA 7REQA 2DT8A 3EIOA 4OP1A 3HYCA 4UVEA 4NCHA 2FG5A 3UYKA 4EPTA 1LC3A 4IZHA 4B6EA 2H2HA 2MSCB 4UFPA 1K1EA 5KNDH 3S8EA 2X76A 3LCCA 2YQZA 1V6SA 1GDHA 2HWWA 3EFEA 3IUQA 1FDUA 3IP8A 3LQYA 3EDQA 4GP9A 4ZOLA 3JASA 5E8JA 3GLGA 3OCCA 4BEVA 1JIUA 5IHPA 4UXIA 1WETA 4WK4B 3AEZA 3KYDA 1XE3A 5DI9A 2OV2A 1D6NA 1L5MA 1S2GA 1KVRA 3JQ8A 1WULS 3DZ8A 4U7JA 3V1LA 2P0EA 3JVUA 1RSZA 3KKNA 3AUSA 3ZLTA 1PR6A 2Z1DA 5IN5A 4M98A 5I47A 2O3RA 2O1XA 4XPIA 3GDFA 1V9CA 3PD7A 1KE1A 2Z4SA 2SCUB 1QTNA 4ZVKA 2PUAA 1GTSA 3P9IA 3LDHA 3TQRA 3FOCA 5BV7A 2GAOA 4ENUA 3N5CA 1NQOA 5JPCA 3A3OA 4N03A 5A2QA 2QENA 4RYDA 4EHJA 3AQIA 2QD1A 1FSPA 4MKZA 1SA0B 1EP1B 4HN2A 1PJTA 1VFPA 2EKQA 5FF9A 2W6OA 4B8WA 2QLLA 1IM5A 1J25A 1UMBB 3OI7A 3RYIB 5KJFA 3M1AA 1J0CA 1P9WA 2X1VA 4AKHA 1G2IA 4R1QA 4GKKB 3IDSA 3QI7A 3OJOA 4GX2A 1NBMD 4CMHA 1LQ2A 5SZJA 2Q6VA 3RC2A 3BT7A 1XAGA 2YW9A 4Z51A 4DJEC 3CH4B 5A5VA 5BN4B 4HNGA 5GVSA 3AIIA 1OPRA 3EFHA 1UEJA 1ORHA 4G4GA 1YS6A 3LT2A 5C1PA 2I4TA 4NBUA 4RTMA 2WOOA 4WOCA 2C2KA 2C9OA 2J4FA 3L0BA 1EZ4A 3Q2KA 4G2TA 3DZHA 4LC1A 1AGPA 5AJUA 1OYYA 2XA2A 1BS9A 1GTL1 3I34X 4P84A 5AI0A 3TM4A 4OIMA 3UUEA 3NIGB 4KGVA 2PUBA 2E6KA 5ALYA 3RDPA 1J9EA 1GZVA 2VRWA 2W98A 3KE8A 4IUCS 4O0LA 2ES4A 1SXJE 1ORWA 3D3WA 1ECFA 1N1DA 4EYGA 3D1LA 3HJGA 3HRKA 3DFKA 1MW8X 4B3HA 3QBVA 1D1QA 3GAMA 3JQFC 2HU5A 2PGAA 3L1UA 3QU2A 4KYUA 1AKYA 1YB7A 5FBRB 4DV7B 2OXRA 1II8A 1ECCA 3AEYA 2ZKIA 3P2YA 1TKBA 3B6ZA 1FP6A 3ZKWB 4WKCA 4HAVA 1FQJA 1UINA 2GBIA 3I30X 1JQBA 5LXTF 5EP4A 2ZSBA 3D3QA 4TL7A 4D46A 2I3AA 3CNNA 5ALZA 1S01A 1WLSA 1XDSA 1ZIXA 3TQOA 3B7PA 1F0KA 3B1XA 4EB8A 5FQOA 4Y2VA 1W87A 2CDNA 2ZBEA 2QTTA 3A1NA 1RM3A 1X86B 2XQVA 1WTCA 5G02A 3VYWA 4JQOA 3OEEA 1JKIA 1JJFA 2GD1O 3LX6A 4RPKA 1SR8A 2TYSB 3FCAA 3OJFA 2E87A 4MUBA 4N8EA 5SICE 3RAPR 3E61A 4ZGBA 3O1JC 1CJBA 5CG2A 4NNJA 4A8JC 5KYYB 1B93A 3N2GB 3ED1A 4ER5A 1OKKA 2YV5A 3F2IA 3LLMA 3H11A 4GMFA 4NMLA 3ZWKA 2FCAA 4GXNA 3JCZA 1I32A 1DAIA 2BFDA 1ILEA 4EYSA 4JCOA 4K9SA 4MO9A 2ZJ3A 4P82A 4AKGA 3HDYA 2V8BA 1Y7PA 2DGDA 2QGZA 2QN3A 4XWGA 2AOUA 3CV3A 2R48A 4YRQA 4CEJA 1JKJB 1ZIPA 1NBME 2EHJA 4UDXX 1WCIB 2IHZA 4NE9A 1VG8A 1ZD1A 2HC9A 4CQMA 2I6UA 4U6QA 1Z88A 1MO3A 2OGWA 4LXTA 1AUOA 3ESAA 1OT5A 4WK2B 5EIXA 1OI7A 2BJHA 4M49A 4RKRA 1J2EA 1PT5A 4ZP1A 2QMUA 2XUIA 3IAM1 5E9AA 3QKSA 4A8JB 2WKSA 3M6AA 5KPJA 2C3MA 1EBUA 1VL5A 3IKVA 4CL8A 1DO8A 1UBTS 4IXDA 4RTJA 5HPYB 1F7UA 2DT5A 1V1RB 2PX5A 3E03A 5FB3A 2RGAA 2RI6A 3BSWA 3JRNA 3L02A 2OCKA 4XIYA 4Q48A 5BNTA 1E7WA 5FHQA 1QHSA 1XZGA 3E70C 4BUCA 3HMKA 5AI4A 4LRUA 3GEMA 4BPRA 1RKUA 1A8PA 4UAGA 1OWPA 1VMIA 2XKJE 5ETJA 1KNQA 2O9JA 3PXAA 4IGIA 4CT0A 2PUVA 1NW3A 4NPAA 1DI0A 1V4VA 2GVZC 4HLDA 2DHDA 2ODQA 4XYLA 1C4KA 1FYEA 4Y2GA 1U6JA 2REQA 4TVKA 2C8KA 3KVVA 2B5OA 1KXZA 4NCJA 3TRFA 5J43A 3HVRA 1PVOA 1NW4A 3O75A 1N2GA 1C9NA 2NN3C 4IH1A 1X1TA 1SVIA 3KEOA 1FA9A 2WYHA 4HNSA 4YQFA 2IOFK 2VTBA 4MKRA 3KXPA 4GGPA 1DT3A 3U3ZA 1VP3A 2OV8A 1HA3A 1TCAA 1AU9A 4XD2A 5AHKA 3D3EA 1L5LA 4AFNA 2HBYA 1VC2A 2YDXA 3MA0A 4HPWA 4MWGA 5EXXA 4E07A 4DBZA 2NO0A 2GDZA 1L5GB 3WWYA 3GJ3A 3T15A 3WGJA 1GPJA 2OFOA 1HRKA 2IODA 2RHWA 4DCOA 3ZHZA 3KYCB 3TLBA 1Z07A 5ADWA 1GUFA 4P8RA 1VQ1A 1M0SA 1DP4A 4WSOA 5CEEA 1QS0A 4YUYA 3NHBA 2X7HA 3KUDA 4KYIB 3F9RA 5L4LA 1PNRA 3ETGA 5HE9A 1EINA 5LBTA 3PXEA 1ZNWA 4I4CA 4KOEC 1HE4A 2GSWA 1QIKA 3EXG1 4RACA 1MG5A 5ECYA 3FDFA 2R97A 4ZOBA 3VYUB 4J03A 3DKRA 3MOIA 1OI2A 4OK3A 1YUNA 1MGOA 1QVAA 4IIYA 4YACA 4CR8A 3FVWA 1C0KA 5FFMA 4ZHSA 1G60A 3ISVA 1E3MA 1E2IA 4AMUA 1W1UA 4M1QA 3V4SA 3HO1A 2VTEA 1E3SA 2BV3A 4Y18A 1O8CA 3CG4A 2QPAA 3FAZA 1SEVA 5BUSA 5K20A 1U7ZA 4CEIA 3F1KA 1L0BA 2C2OA 2N3ZA 3E9YA 5CW1A 4E5DA 2WZDA 1G21E 2J09A 1RJGA 4XW2A 3OURA 3WICA 1T6BY 1UANA 5A3SA 4JQCA 5J2TA 1FP2A 5LQAA 4WDQA 4DEVA 2BDTA 4Q9JA 1H69A 3V9PA 5C18A 4RHTA 1G4UR 5T57A 3UJ9A 1KAGA 1UBSB 2VPXA 3DVAA 5CMLA 1DXOA 2AOVA 4FX2A 4BX9A 5CA0F 4EBFA 3ICVA 2WICA 1HYGA 4AWBA 1B4DA 4U3JA 1EUDA 5ELXA 1FP1D 3UEOA 2PUEA 1YC5A 2X13A 5KYXB 1R64A 2P2SA 3GLSA 4G84A 3ZI0A 2NACA 2WD9A 4EFDA 3Q72A 2WNHA 4LG1A 2ZI6A 1E7YA 2D7DA 2PGOA 2NU6B 2O8NA 3GFSA 1PLJA 1TK3A 2AJLI 1HEYA 2ZZKA 3DF7A 2M1ZA 4H18A 4CI9A 3M49A 3P0HA 4MPRA 2QRPA 2B2XA 2JCVA 3E2IA 2JHFA 4MVXA 1PNVA 4R2HA 4KKVA 1DIBA 1EE9A 4HQ6A 4DLYA 5JCZA 3WC4A 4MMYB 3OBBA 3IR7A 1CUGA 4HS9A 3FOEC 3OF2A 3MMZA 1VLQA 5LQRA 1JXMA 1C81A 3E2MA 2VHQA 1GTJ1 2XBMA 1ZGBA 2XOKA 4GZLA 5HUHA 3TIFA 1SUAA 4D9BA 2ZS9A 3PTLA 4UAUA 3TJMA 4C7XA 3IUMA 1J5PA 5CBKA 3EZ7A 4S1WA 3PHGA 4D4KA 2FXIA 3ENWA 4MYCA 1IQ0A 4KQMA 4QULA 4TTVA 1YACA 1VL6A 1NJ8A 1E79A 1EEHA 1GZ4A 2O2DA 2QAGC 3HY6A 4DDVA 2I22A 1Z18A 4GVXA 1K7XB 2RCYA 3TL3A 5DM4A 3N53A 4FONA 1OAOA 5TT1A 4D4JA 4YT8A 1KEZA 1U9JA 3VHQA 2FE1A 2XCRB 3D1VA 4FNOA 3KT3A 1XHEA 1SQ6A 4ITRC 5KAPA 3AP1A 4TTRA 2NNLD 4Q1DA 4LQ4A 5KYGA 1VB5A 3FSEA 5DISB 4NMMA 1JHVA 2PS0A 4QFMA 1AO0A 2XCLA 3TTUA 1LLUA 4GPZA 4OHWA 2QS9A 3GMTA 5B57C 4CEIB 1X8XA 4AX4A 4F1KA 1MJGA 2E49A 5CCXA 1G1AA 3X1WA 4ZU6X 1NOJA 5AI9A 5F7OA 5L3SA 3CVUA 1KJQA 1FFEA 2HSGA 1VMDA 2Q5QA 4V3CA 1R0RE 2IOQA 5FI1B 4ETWA 3FNRA 3I8SA 3KR2A 1K7FB 1C7EA 1PZMA 1ST2A 3KTFA 4JIMA 3JWPA 2Z3WA 4UD6A 4LTNA 1GNLA 2QAGB 1ZJZA 3G2HA 4XGRA 4Z8XA 1T9HA 3M6WA 4ERNA 3BGSA 3Q7RA 5KOJA 4C29A 4MS3B 4DQ0A 1XMXA 1H8HA 4WBSA 5L8VA 1FUEA 3WE7A 2ZM5A 1WMFA 1THGA 4GDMA 1AK9A 3DT6A 3AF5A 4LV5B 5LN1A 1SCIA 4Z86A 4M36A 3QFTA 4LGMA 3RGGA 4B3CA 3ES9A 3W8FA 5JSUA 2QMQA 4GUAA 1SBNE 1BH6A 4PG6A 2PSJA 4N0DA 1G9TA 3NQ41 3STWA 2ZRHA 5CGQB 4P6VF 1IU9A 1PFUA 1WDTA 2JDIA 2WG1A 3P0IA 3CUEF 4XB2A 3RF7A 5IASA 3JTEA 4GKAA 5BN5B 2F8SA 1PL6A 2MYTA 2VKQA 4F9GA 1ZJ6A 1LBTA 3M5DA 4Z3DA 3WNVA 4AYXA 3KQHA 1UPTA 3NUQA 1KAEA 1TZCA 3O1LA 2FY8A 1XKTA 1QTQA 3ERCA 5C1IA 2JFWA 4DMRA 3OPQA 4QUKA 3S0JA 2JI4A 1QM5A 3JVDA 2NYVA 1OLXB 2Z2YA 2Y9PB 4ZVNA 4CKBA 2A5FA 5ITZA 4ZHQF 1Z4LA 1SK9A 2Q0SA 1K7CA 4S12A 2PWYA 4TKMA 1Y1RA 3OIYA 1XTQA 5E7MA 4J0GA 4A0RA 1XPOA 1W2GA 3KB8A 5ER6A 2RGBA 1E2QA 1OVMA 1S7GA 4YDQA 5A03A 2FSUA 2NU8A 1WUIS 4A8TA 3GGCA 3QVSA 2PZ8A 4CV2A 3CHYA 4QYIA 4BUZA 3C7KA 4NK4A 4UTNA 2VATA 1S2DA 3QELA 4U7HA 1ONPA 1C7RA 1HK7A 5EKDA 4C3ZA 2EJTA 2Y2UA 4JXKA 3R41A 1PE0A 2Q1SA 3O9ZA 3ZZMA 1Z9BA 5JDIC 3VC7A 4MTLA 3ZU6A 3MWEA 3NI2A 1TU0A 4DIUA 2P8SA 4GR9A 5DM70 5A7FA 4QUIA 4WESA 1X7WB 1Y9EA 3STHA 3BGIA 5BR7A 5JUWA 5ALLA 1WXEA 2D7JA 1M6VA 4MYUA 5MN6A 3S8YA 3ZS9A 2I4NA 3LC2O 3WADA 2NZ2A 1ZSVA 3KOXA 3LM8A 3MS2A 5E4YA 3AJRA 3M1IA 1PZHA 1ZUD1 4PIVA 4X9XA 1FY2A 4FDTA 2Q5CA 1KPGA 4OHFA 4BBPA 4S1NA 5F76A 3S7ZA 1RQRA 1ZI6A 2FSHA 2IW3A 4EK9A 4EWLA 1EDZA 4O29A 2DWUA 5ALEA 1CUYA 4PYRA 3LYHA 4UUOA 5K3FA 1WSAA 3ZZ1A 2X41A 1JXAA 4A27A 4ZYVA 4E4TA 3GPDG 4RE5A 2PGIA 4WGFA 3A4TA 4CKCB 2CD9A 4OAPA 4DFDA 5AVOA 3L06A 1NE2A 3P2JA 1W29A 3HEMA 4MW9A 4YJ2B 5TJHA 2GKOA 3AOEA 4JHXA 1R0YA 1IY8A 4XWKA 2X2OA 1GG9A 4CLOA 1ZSNA 4MQLA 2E9SA 2X1HA 1NZJA 4DMMA 1I0IA 5EJ6A 1Q7CA 2V5UA 4HAXA 3KXIA 3ELWA 5A0FA 2Q6LA 3PJDA 4U02A 5HM8A 1SKYE 1Y5LA 3OVMA 5ISMA 1MA3A 2ZAOA 3D7LA 4DANA 1KOGA 4WPGA 1LFDB 2Y1XA 4FEYA 1P72A 4G8BA 1HNWB 3NVDA 1JU3A 2XQGA 3AL0C 3EA0A 3PICA 4BNZA 4X1YB 4HO1X 1OREA 3C5EA 1Q83A 5U1PA 5BV2P 2P5TB 2VHVA 4IINA 4HLQB 3QBEA 3C8HA 3D2BA 3IJRA 3T5CA 5AH0A 2PYZA 4RD0A 3KJNA 1E1QD 5FTLA 3NHSA 4MWCA 2R5WA 3R7WA 5HYVA 4X7RA 2EGUA 2JFQA 3G9XA 3IAFA 4MUNA 2FKNA 4D8UA 1M5TA 1TM5E 5HX7A 1Z45A 1DO2A 1XBTA 1DG1G 2CUNA 2YJ5A 4I55B 4Y9UA 5KNCD 4PQGA 5SYMA 1G2QA 2VPWA 4O1HA 2IV3A 2C2HA 4FIZA 1K6MA 3C4JA 3TDKA 5J4VA 4TGLA 3QYPA 4YJ3B 5ALWA 5KYWB 1MV8A 4TUYB 3TTWA 5IHXA 3BTVA 1FXSA 4KITB 4PZZA 1H2RS 1I3OA 2I8LA 4IIFA 3G9TA 4ZOLF 3DOOA 3UM9A 4TXHA 2ZYUX 3HYTA 4L0MA 1GNTA 2J87A 5AW3A 2HI0A 4YI5A 4ER7A 2IELA 1EA5A 1DAGA 5CH5A 1SC9A 1VL0A 3AUTA 3IMCA 3UMRA 1SQFA 4O33A 3TCKA 1X92A 1X38A 2PNFA 5FADA 3RFXA 4C0JA 2WU1A 4AQYB 1QKKA 4YQYA 3T5MA 1YB5A 3IUJA 1AQYA 5KNLA 5EZQA 2CE2X 1C1YA 1JR2A 1RJ9B 2F43A 2C0QA 3VMFA 3O8LA 5EJEA 1S7CA 1K75A 3VJMA 4LMRA 3UG6A 1IYZA 1CJVC 1YNSA 3QVOA 2A9OA 3JVIA 3ROGA 3HSSA 2R87A 1JE0A 2XDWA 1LTHR 1MAVA 2AFHE 2GKSA 3N70A 2WIKA 2WJPA 4FFPA 3G2JA 4WKOA 2FEMA 4ZTBA 4A8HA 4AP9A 4OQPA 2BFEA 4E32A 3EXIB 3GH3A 2FX3A 2DYKA 2QUZA 2YTZA 5EC8A 3B3GA 3EARA 5EJAA 5KJEA 2B1IA 4TWBA 2XUFA 3OTIA 3ZGLA 3SQWA 4YPFA 1T15A 2V55B 1VSBA 4MWEA 5FBQB 3U4AA 3VR2A 5F5NA 3DC7A 2OXEA 4HNQA 1CVIA 1EJ0A 1SUEA 3VKVA 3WLHA 3OU6A 2FEOA 2GRAA 5FFNA 3FCXA 3L6CA 4QDUA 4YYEA 3QFRA 5E0KB 4ARIA 1QQ5A 1U2SA 2JFGA 2Z2KA 1GL7A 2Q2OA 3C87A 3FFAA 4L16A 4M0CA 3B2QA 3RRNA 4DYHA 4RTKA 3II6X 1CJCA 1HXHA 2MJLA 1VJTA 1MJGM 1JQKA 1U9YA 2RGCA 4QIHA 4QWMA 1ODJA 1Y4ZA 2GPYA 3LT4A 3T1NA 3U4HA 3KZXA 4H6PA 5FYQA 4D0SA 1S2OA 3OQIB 1XNGA 5AW1A 1RHQA 4AMBA 5IAKA 3KLNA 3HA3A 3KBOA 1TLTA 4MW1A 3DCIA 3DO8A 4OHXA 5K2OA 1VE1A 4JUDX 4HEJA 1DBVO 3SI7A 3G7SA 4URFA 1WQ3A 4DCPA 1YCDA 2P4HX 4RA6B 1EZ1A 5BV8A 4M87A 2GMWA 3B78A 5AKGA 2G4VA 1E3IA 5E9WA 2VDNB 4LZZA 4MUKA 3I4FA 1TK9A 1JILA 4RQBA 2C5HA 3HACA 1FYWA 2C00A 1WZIA 1NVAA 1VIDA 2DJIA 2F1JA 2GF9A 1EFCA 2ICAA 3AI2A 3AI7A 1H1TA 4G0ZA 4UJ3A 2HSDA 1GRVA 1QJ4A 2G9UA 4L5JA 3DONA 4ZEVA 1S8NA 3SU8A 1KQFA 1NJFA 1J8YF 3BMQB 3T5DA 1RXVA 3JTMA 1QGUB 3RM3A 4I1PA 4OKNA 3OZBA 2P4QA 1HYEA 3L4KA 4KPUB 2WV9A 2BL4A 1NRWA 1EUCB 1WVIA 4AZTA 6Q21A 1MRZA 3WR5A 2ZAGA 3CZQA 2H8GA 1JG1A 2FR0A 1E61A 3X1DA 2DPLA 4AB1A 3HCEA 3O2SB 4I36A 4KBFA 4UM5A 5L7YA 3SYNA 5HZGA 1RWOA 2G4LA 4OQMA 1DJMA 4JLDA 4V0NA 4DR6B 4LDPA 1E3QA 3HLTA 2AX4A 2FRDC 1TYZA 3MYYA 4WCDA 4C89A 3WGLA 1YS1X 1NV8A 2P3OA 1FTWA 2UVPA 4OYYA 2AHRA 2O19A 4N6GA 3C3JA 3ZY3A 3R8FA 4IDHA 1VCNA 1IN6A 3VDMA 1JFSA 1A0OA 5JMOA 3JQEA 1ZVVA 2C7GA 3L8ZA 3U1VA 3WFJA 2IU4A 2Y99A 5L3QA 1RYNA 1Z6XA 2JGDA 2JW5A 3ROTA 3Q3JB 2QVYX 4RH0A 3VRHA 4FYYA 3K31A 3UATA 1LLCA 5KB3A 4IJWA 1NBHA 5KVQA 3D4PA 4OQZA 1E9RA 4AG6A 5KDLA 4B46A 5CD1A 4G5FA 2H7CA 5TT0A 1V3UA 1WM1A 3NKVA 1NUHA 2NZWA 3K09C 2VAWA 3PDHA 4IX9A 4RKWA 4RV5A 2B5WA 5GVRA 1N6NA 5HUJA 1Z4MA 1JTEA 2CD7A 3W1VA 4BFWA 2F9FA 4HT3B 5IAOA 3EGOA 4QC2A 1KEVA 1Z0DA 2HU2A 2WTUA 3VFDA 5B4UA 1JSXA 1LY1A 2DVMA 3CBGA 3F3YA 3HKDB 1L3CA 3PNVA 4IFTA 1FRVA 4JUFA 1CQIB 4KHPB 2A5LA 2WD8A 5EWJB 2O59A 2O3QA 1XEXB 3A9VA 4I5EA 2NXCA 4AN4A 1KKMA 4H7DA 1HG0A 3CLHA 1CJKC 1NBOA 1M2EA 4C0XA 3WMEA 2A7XA 5D3KA 1QNLA 4V24A 4BLOA 3AGPA 4LF6B 1S2MA 3V8EA 1SHZA 3I73A 1QIHA 4BQPA 4BFLA 1OOEA 1G63A 2PLRA 5FTNA 3DZJA 5KCMA 1CE8B 5GGXA 2IXAA 4OP2A 3SEFA 4OKSA 1BSVA 4OJYA 4E03A 3GY0A 5IAGA 1JYSA 1V4BA 4KXMA 1YAJA 1YR8A 3HU5A 2XOEA 2YIJA 1GUYA 2HLDD 3R6LA 3DVQX 2QN8A 5EXDA 4F1WA 1QDUA 4RF3A 4CKYA 3BTOA 5ENVA 4WE3A 1BROA 3W3AH 3VDNB 1VB3A 3SS7X 4W5QA 1MX3A 4EG4A 3PE3A 4X71A 1B8VA 4UM9D 5J2UB 1L5OA 2PO7A 4JSYA 2P65A 3CLTD 3TPZA 1UDCA 5ELMA 5EXTA 5DGXA 1D6SA 5K0CA 1LVHA 3LY5A 1N6HA 5JJ5A 3SS8A 3MGAA 1YJQA 4R3WA 3UO8B 4K1XA 1KMHA 1MVLA 4AO8A 2GN9A 1R0WA 1IY0A 1NSTA 4IJKA 4YK7A 4D4IA 3IAM6 3IAS1 6ABPA 1T4CA 1UBLS 1E7RA 1XALA 4P2GA 2ZZNA 3CNHA