2FUKA

Crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
218
structure length
218
Chain Sequence
NPLFPTESAALTLDGPVGPLDVAVDLPEPDVAVQPVTAIVCHPLSTEGGSMHNKVVTMAARALRELGITVVRFNFRSVGTSAGSFDHGDGEQDDLRAVAEWVRAQRPTDTLWLAGFSFGAYVSLRAAAALEPQVLISIAPPAGRWDFSDVQPPAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMPDTSHFFHRKLIDLRGALQHGVRRWLPATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of XC6422 from Xanthomonas campestris at 1.6 A resolution: a small serine alpha/beta-hydrolase
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Hydrolase
molecule keywords XC6422 protein
total genus 63
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fukA00
4E14A 2WLSA 1K6EA 4BAZA 2VJDA 3ZI7A 4LXGA 5A2GA 2WJ3A 1K8QA 4PF1A 2AJLI 3WIOA 1QGED 1TRHA 4E46A 3STVA 5HF6A 4BC0A 3IBTA 2VF2A 4FLMA 3OM8A 4G8DA 4H7HA 1C7IA 1BN7A 5FDFA 2O2GA 1SOMA 4L9AA 3F97A 3W2TA 2WIKA 2XE4A 1VA4A 4G5XA 3IUQA 3O9MA 3WJ1A 1QIFA 3D0KA 4B7ZA 1NU6A 2XUGA 1AMNA 5AM1A 1W1IA 4LIPD 2HA4A 3L1HA 1VXOA 4OYLA 5EFZA 2PKYX 3AINA 1IUNA 4FOLA 4N8DA 3EQ7A 5HF9A 4UBJA 3BIWA 3WYDA 1A88A 1EK1A 5SYNA 3WI7A 1QOZA 1VA5A 2QKYA 3LLCA 1BE0A 4Y2UA 3O9VA 3IIIA 4QA9A 4G1FA 1J2EA 4YK7A 3DNMA 3ZV7A 4GECA 1E8MA 2LIPA 5AKKA 4DGQA 1P0MA 4MJ3A 2PVSA 4RGYA 3WWPA 2ECFA 4A16A 3M3DA 3IULA 1AKNA 4ZV7A 2QT9A 1VE7A 4Y2RA 5ALEA 1MX1A 4MYDA 2I03A 4L3WA 4RE6A 2X76A 4K6HA 3I2FA 2P8SA 3K2IA 1CUAA 1EB9A 4EZIA 4EUSA 4M0FA 1YB6A 4CCYA 1XZCA 5ALGA 1KEZA 1Y7HA 5C8XA 2JGIA 1CPYA 4WCVA 2XUHA 3QM1A 3WJ2A 4E11A 4QWWA 4DMCA 4QEKA 3PF8A 3G9TA 2GBGA 2ZSHA 3I6MA 1Q0ZA 3U0VA 5HK8A 3WYNA 3V9AA 4MEAA 3I1YA 1XRNA 5I7UA 3BWXA 5FV4A 4CG2A 4QWMA 2QS9A 1MPXA 4X6YA 1TQHA 3WKAA 2DHEA 5ALNA 1TIBA 2VAVA 4UPDA 1CUWA 3O4JA 1JU3A 1ODTC 1BCRA 4H7EA 2VEOA 2J3QA 5LKRA 5AM4A 4IH1A 4BP9A 3L1IA 5AH0A 2PPLA 4WJLA 1SCKA 2QM0A 3SX4A 4D9JA 1MAHA 5CXXA 1TK3A 3OC0A 3D2AA 1XKLA 2XUDA 1R9MA 4JEIA 5AHXA 1IMJA 1L7QA 3IDAA 3AIMA 1RYYA 1DX4A 2AJBA 3I28A 3CN9A 3DDUA 4BVLA 1O6GA 1LPMA 3LIIA 4U2FA 4Y7DA 4BCDA 1Q0RA 2O7VA 3I6YA 2XLBA 1Y7IA 4P92A 1DT5A 3DYIA 4YPVA 1IUOA 1HBJA 1YASA 1NX9A 3EBLA 3D5EA 3NOXA 3O0DA 1RWQA 1LPAB 2HL6A 4FLEA 4KJXA 4KR0A 4FLFA 1GT6A 5AM2A 3WIBA 4NMWA 2JGEA 5DWDA 1HKHA 3DL7A 4OB8A 5AI5A 1XQWA 1L7RA 3IA2A 1AGYA 2CUTA 4BBZA 3DJYA 3FYUB 4J0GA 2ONCA 2CKMA 5AKLA 1QLWA 3RARA 3I2JA 5BV7A 2ZSIA 1THTA 5AI9A 1OXMA 1JFRA 5CBKA 2RHWA 4C4ZA 2AJCA 3FCYA 5CT4A 2H9YA 4H7FA 2OCLA 1E66A 2XLCA 2CZQA 2BKLA 3FLBA 1AX9A 3RM3A 2V97A 2QZPA 3O4GA 5FLKA 5K3EA 3TEJA 1UK6A 4Q3LA 2WG0A 1BS9A 5ESRA 2XMSA 4BAUA 1SFRA 1CQZA 4BRZA 5HF8A 4K6GA 2HU7A 3R3UA 3I2IA 1EDDA 1J07A 1UK7A 1ZI8A 5ALXA 2PUJA 4U2CA 2XUFA 2XQIA 2WUDA 2EDAA 3STYA 3OG9A 5CW2A 1C4XA 1YA8A 1RP1A 1P0IA 1VKHA 4FBMA 1ZJ4A 1XZJA 5I8PA 3LP5A 4J3JA 1BCSA 4AN1A 4TPKA 4W1QA 3PUIA 4DYHA 2VAXA 2XQKA 4BTVA 3AJAA 4W1RA 4X00A 3DYVA 2GBIA 3F9CA 2Z5GA 3ZPXA 4OPMA 4Q82A 4QLAA 3FBWA 1E5TA 2QUBA 3FNBA 2HHAA 4X94A 4A23A 5LZ2A 5AKEA 3AFIA 3QYJA 4BDSA 3FYUC 2WJ4A 4PSCA 5CH8A 4J03A 4GEGA 1W52X 1ACJA 3JWEA 4AQDA 1WHSA 3RLIA 1LPNA 2OGSA 2I3DA 2WG2A 4UBMA 3FLEA 1C7JA 4UBNA 1CUVA 1E89A 2WSLA 4UUQA 4ZV9A 4QLOA 1VXRA 1DQZA 3H2KA 5DLPA 2WFMA 4Q05A 3DD5A 5HZGA 1CUDA 5JZBA 4Q1VA 4EHBA 1CLEA 3C70A 3W9UA 4G4JA 1QIKA 4AZ3A 4NVRA 1IVYA 3M82A 5DTJA 5JD5A 3C43A 3WZLA 3V1LA 1HL7A 3HRHA 5FOQA 2GZRA 2VT6A 2XQGA 1LPPA 3KDAA 3FAKA 1WB5A 4BC1A 2ZYSA 4A5SA 2XQFA 2Z3WA 1KU6A 5ALTA 4RE5A 4Y2YA 4HZGA 3PFBA 5DYTA 1WCYA 5CTAA 4AXBA 4PSDA 4WDQA 5DNUA 1H23A 4DIUA 4UHEA 2WHRA 4H7KA 5A7GA 2OCIA 4O08A 1HPLA 3SC2A 3ZLVA 3MGAA 3FSGD 4X85A 4QDUA 4IQ4A 2Y2VA 2XUOA 2ES4A 2V9ZA 1F6WA 4JH0A 1ZD4A 1LNSA 1CRLA 2V98A 5AKXA 5CT6A 4AMZA 1XZGA 3W05A 1X70A 1NU8A 3HJUA 2DR0A 3QPAA 4MEBA 3OTQA 4J0KA 3QPDA 3A2NA 3DS8A 2HA7A 3ILSA 2VQ6A 5LYYA 5HQ3A 3KSRA 1EX9A 5A7HA 5JAUA 5CMLA 4PSUA 1U8EA 1GPNA 4Q3OA 1FJ2A 2GYWA 3BE8A 3WLAA 1LBTA 4DNFA 4AN0A 2HA0A 1F0PA 3F98A 1R9NA 4G4GA 2WM2A 3WK9A 3GUUA 3D2CA 2JBWA 1XZMA 3W04A 2ORYA 2VA9A 1P0QA 4V2IA 4QNNA 1F8UA 4XX1A 5AK5A 3WKBA 2QVBA 3TRDA 3PI6A 4AO8A 1MNQA 1LPOA 3FOBA 2VT7A 2Z3ZA 3G8YA 5JZ9A 1W76A 2I3ZA 5AM0A 5HKAA 5IVHA 3G7NA 3I2HA 2H1IA 4DSZA 5CH3A 3JYHA 2I78A 2OXEA 4FTWA 2WU3A 2C5FA 4F0JA 2Y6VA 4OUKX 5AP9A 1U2EA 1UK9A 3X3HA 3H19A 2BFNA 2H7CA 3AZPA 4WFJA 4B83A 4KRXA 1ZJ5A 4MWSA 1YA4A 4B81A 2BUCA 1XZFA 1ACLA 3G9UA 1HQDA 1LPBB 1PJAA 2DSNA 3VDXA 4BCBA 5ALMA 2VJBA 5K5EA 4BAGA 4NS4A 2H7XA 2HU8A 4KE7A 1BEEA 3VJLA 2WHPA 3SK0A 3BF7A 1ZGCA 4BE4A 4GDMA 3BF8A 4LXIA 3FCXA 2PSEA 4GXNA 5AI0A 1GKLA 3C8HA 5T4FA 1EINA 3ZLTA 3C5VA 1USWA 3MUNA 3I2KA 4U2EA 5CT9A 1ETHA 1AQLA 4Y2JA 4N5HX 5KWIA 1AUOA 1IZ8A 1X2EA 4QDXA 1MT3A 1ZIYA 3D7RA 1EK2A 4X95A 4HRYA 3NGMA 3D3NA 3DL4A 4EY4A 2AXEA 1H22A 2OQVA 5HF5A 4UFOA 2QXTA 3H18A 1DX6A 1CFJA 4BTLA 1U65A 4Y2VA 1KU0A 1XRPA 1VZ2A 2DCMA 2HRQA 3AUKA 3KWJA 5EGNA 2IX9A 2FJPA 3NUZA 4BRSA 2ZJ7A 4H7JA 1W6RA 2B9VA 5JAOA 2BUAA 5ALDA 3LS2A 2WUGA 3AIKA 3M83A 2WFZA 2QXUA 2XUQA 5EHXA 2OAGA 4P08A 2PSJA 3D59A 1GQSA 4QE3A 1QFSA 4ROTA 4J0JA 1ZI9A 4KE8A 4CIAA 4HVTA 1LPSA 1VZ3A 5E4TA 4KRYA 3U1TA 3V1KA 5E4YA 1EDBA 5ALRA 2J4CA 3VKFA 1XFDA 2XB6A 3HACA 4W1SA 5YASA 4PV7A 1EI9A 3WKDA 1Q84A 1QIEA 1SCQA 4U2BA 1WHTA 1CUXA 4B6GA 4B85A 1CUYA 2YYSA 5FRDA 1DU4A 3DEAA 4EY8A 4FMPA 1EXWA 1JKMA 4OU5A 1QZ3A 1UOOA 3WQHA 1CUGA 2XQJA 3S8YA 4PNZA 1CUJA 3VVMA 2O7RA 5DNWA 3P2MA 1IUPA 5JYCA 2RONA 2XMGA 4KEAA 4H77A 4UHBA 1JU4A 4KAAA 7YASA 1UFOA 3E4DA 1R4ZA 5ALWA 5JADA 3DKKA 1WM1A 1R50A 3PFCA 3C45A 4B9EA 3WKEA 1R3DA 2JIDA 1BN6A 3O95A 3TGLA 1ZD2P 4Y2TA 1CQWA 3WWCA 2WIJA 2C58A 5J3JA 3T4UA 4G9EA 3G0IA 4BCCA 3R3WA 1YB7A 1B41A 4HTAA 1G66A 3O4IA 2HRRA 2HA3A 1LLFA 2HIHA 4ITVA 3D4LA 4IH9A 3DQZA 4K6KA 1QTRA 1UKCA 2WG1A 2IIVA 4ZWNA 4EY6A 3DLTA 3H1AA 4Q3KA 2FJ0A 2PU5A 3WL5A 3LIPA 5AM5A 2PM8A 1UKAA 3WK5A 3G9XA 1UOPA 2Y6UA 4KACA 3BJMA 4OB6A 3W9BA 3C8DA 1YAHA 4FWBA 3A2MA 2WIGA 1FFCA 4U2GA 4X92A 2X8BA 3M81A 5D6OA 1N8SA 3H2HA 1R1DA 1OILA 1S8OA 1YCDA 3S2ZA 3WMRA 3HXKA 3FSGA 4J0HA 5AIAA 2WU4A 3F96A 1EVEA 1QO7A 4DMHA 2X5XA 1UKBA 1BROA 4IO0A 5FPPA 2JGFA 5T4BA 4FBLA 4IHAA 5AKZA 4PQEA 2ZVDA 2XDWA 2WFLB 4W9RA 4X90A 1QFMA 2JF0A 3QMWA 3RK4A 3I1IA 2C0PA 4KAJA 2QR5A 4DNOA 2XUAA 4LKOA 1DQYA 2FUKA 4MQLA 2FX5A 2PSFA 4W1PA 1W75A 3D2BA 4H7IA 3G0CA 4G8CA 2OPHA 4UBLA 2NW6A 3H17A 1G42A 4GBGA 4B9AA 1QIMA 1GXSA 5AOBA 4DMKA 1A7UA 1K5PA 5ALUA 3I2GA 4Y2PA 2DHCA 1CUZA 3K6KA 5ALIA 5LP1A 1QIJA 5A7FA 2CEKA 3HABA 4EY5A 4QDOA 3ICWA 4U2DA 5ALKA 4AMYA 3G02A 1ZI6A 3PF9A 1UOQA 4BZZA 1DWQA 2Q0XA 3WWEA 4EA6A 2CJPA 1VOTA 3R3XA 4XWGA 4ZGBA 4Y2XA 5K3FB 5FKJA 3ESBA 4FFVA 4DMFA 2QOEA 4ZXFA 4I19A 1D07A 4F21A 4QZVA 4KE9A 3TJMA 4WDRA 2WUEA 3WA6A 5BWBA 3IB3A 3H2IA 4UFNA 5AI8A 3MUOA 4AO7A 2ACEA 3HSSA 3EF3A 4Y2QA 3N0TA 2B4KA 5HCUA 5LZ8A 1A8UA 3HEAA 1GGVA 4DLNA 2G5TA 1B6GA 4Q34A 4K5QA 5HFAA 5HKBA 4HXFB 3F8SA 3PE6A 2RAUA 5CXUA 4ETWA 1H2XA 4NZZA 5AK6A 2O2HA 2O2IA 1M33A 2C7BA 4J0IA 5JD4A 3G0BA 4CG1A 2B61A 2ACKA 1MX9A 1ZICA 2PSHA 5DYWA 2ROQA 4X6UA 1TCCA 3WK7A 4E15A 3R0VA 4HAIA 1XQYA 4C89A 3IUJA 3BIXA 4HS9A 4BB0A 1JMYA 3V1MA 1PFQA 3ESCA 3BJRA 3OPMA 2DQZA 5AK3A 4KYVA 1K63A 3QVMA 2XUIA 5JAHA 1A8SA 3PICA 1A8QA 2GYUA 3IVMA 3T52A 3OOSA 3KWFA 1XRMA 2IITA 1YAJA 5K3AA 3FVTA 2RI6A 5I9IA 4X91A 4M0EA 5IKXA 4L72A 2HFKA 1EA5A 4ARBA 1EH5A 1Y37A 2JGJA 3G0GA 2QJRA 2BJHA 2AJ8A 1ORVA 4Z49A 1SCIA 2C0QA 5IVKA 3NWOA 5A62A 2JGKA 2GYVA 2OCKA 4X71A 3CCBA 1BEZA 2HDWA 1N5RA 4JYPA 3O4HA 3YASA 5HQ3B 1E3QA 4TVKA 1BRTA 1MAAA 4C6HA 2R8BA 3B5EA 4ARAA 1K4YA 4YX9A 2DHDA 3PDCA 3HI4A 3FLAA 3WZMA 1GPLA 3CCCA 1F0NA 2YH2A 4BE9A 3GFFA 5C8ZA 1CUCA 1MO2A 2OG1A 3SWWA 2VATA 4I4CA 4X97A 3UUEA 5ALJA 2XMRA 1QTIA 3DOIA 3HC7A 3R3VA 1MNAA 1MX5A 1SC9A 4J7AA 1XRRA 2WFLA 3H1BA 4B82A 4TGLA 1XROA 1CUSA 4CCWA 4B0PA 4F60A 1G4HA 2JEYA 2PU7A 5LLSA 2GBFA 1DWOA 2HA5A 5T4HA 3QITA 4Y9SA 2VTVA 5ALZA 1XZDA 4HXEB 1Z68A 4MXDA 1WB6A 3C6BA 1YS2X 4C88A 3R41A 1IZ7A 1JJBA 2WIFA 3R40A 5ALFA 1TKRA 3E0XA 1J06A 4K2AA 3R3YA 3AILA 5D7BA 2WHQA 5KBYA 4M0MA 3C6ZA 4N5IX 1ZGBA 2R11A 5EHQA 3V48A 4OD0A 4UBOA 5LZ7A 1AURA 2G63A 3WL7A 5DNVA 3AZQA 1FSSA 2OAEA 5E2IA 3VISA 4F5ZA 3I6ZA 1QIGA 5CT5A 3H2GA 2XMQA 3BDVA 2WJ6A 3HYSA 5AI4A 2HADA 4WFKA 2E3JA 3C5WP 2PBLA 3WWDA 3VXKA 2C4HA 3C87A 3GA7A 3E1GA 4BVKA 2J4FA 3FYUA 1N1MA 4DM7A 4RPCA 5HFNA 1E8NA 4KE6A 5KWJA 5JATA 1LBSA 2OQIA 2XMZA 2XT0A 5K3CA 3FWHA 2H7YA 3JW8A 1O6FA 4AO6A 3VVLA 2OLEA 1YS1X 2RGUA 1MTZA 4QDTA 5SYMA 4JNCA 3DCNA 2D0DA 1FFAA 1G5FA 3GBSA 3IURA 1ZD3A 1THGA 4ZREA 4XJVA 5AIBA 2QUAA 1ZOIA 5ALOA 3STWA 2XMBA 1LZKA 4GWLA 2VJCA 1CV2A 2EDCA 1JT2A 3E3AA 2HM7A 5DJ5A 3ZLUA 1L7AA 4G4IA 5LZ9A 5AI6A 5AKGA 5H3HA 4G8BA 4B80A 3Q8WA 5AM3A 4UHDA 5CRIA 3QMMA 1XRQA 1ODCA 2ZYRA 1YSCA 2G5PA 1W4LA 5AJHA 2HA6A 4WFIA 5AKIA 2K2QB 2V96A 1XZLA 1XKTA 4C87A 5K3DA 3HZOA 2OGZA 1P0PA 5KREA 1DT3A 4MYSA 3AIOA 5ISMA 5ALVA 5JIBA 1T2NA 1EDEA 2XMDA 4LXHA 5CH5A 4UBKA 4BATA 2QMQA 5BWCA 1ZD5A 4CFSA 3WA7A 2Z8ZA 1I6WA 3ANSA 4CIBA 4H35A 2B20A 4FNMA 5C8VA 3QPCA 1DTEA 2ZJFA 3V1NA 3QZUA 1TAHA 3WWOA 1TCBA 4JYMA 2HFJA 3WK6A 5JASA 2XMCA 1U4NA 2CB9A 5FXMA 3ESAA 4FNGA 5E4JA 3DKRA 3KD2A 1XZAA 1QONA 1GKKA 1CUBA 4EBBA 2QTBA 4H7DA 4UHFA 1XQXA 3LCRA 4N8SA 1XQVA 1UZAA 3CXUA 1XZIA 5A71A 4Y2SA 3ZWQA 2CBGA 1N5MA 1XZEA 2GZSA 1XRLA 6YASA 2WUFA 1QIHA 3QBJA 2ZJ6A 1CVLA 4FKBA 1CR6A 4P93A 3WK8A 2Y2UA 5JAPA 3STTA 2RIPA 1LGYA 5CT8A 3H2JA 2XUKA 4FFWA 4PW0A 1ZIXA 1XZHA 5C81A 2GBCA 1ISPA 4RNCA 1EHYA 4OB7A 3EIOA 4UHHA 2ZYIA 5AKJA 1ORWA 1HLGA 3UMJA 4C01A 4FDMA 5DTIA 4UHCA 2BGRA 5D3ZA 4OYYA 1UXOA 3WK4A 4XIIA 1CUUA 1J1IA 1DWPA 2PX6A 4WY8A 1CUFA 4KAFA 4CG3A 4YASA 5JZSA 1UWCA 2OGTA 2RHTA 4GHWA 1JMKC 4BZWA 5IVDA 1PV1A 2UZ0A 1WPRA 3KXPA 5HK9A 3QMVA 3HLKA 3RKSA 2HU5A 1MN6A 2HA2A 3B12A 4L0CA 1WPXA 5AOCA 3BL8A 4LYEA 1AZWA 3F67A 3BXPA 4BP8A 4BVJA 2YASA 5A6VA 1TCAA 4DTCA 1QO9A 2WIDA 1AC5A 1BU8A 4J0CA 4OCZA 5IVIA 3A6ZA 4CI9A 1WB4A 5LIPA 1HDEA 1CIJA 4XVCA 1JI3A 3K9BA 5K3BA 2VSQA 5IH7A 2QRUA 5ALYA 3WKCA 1FFEA 3STXA 4BYMA 3C6XA 4MWTA 3L1JA 1CUIA 5D3KA 1GPKA 4UFPA 4X3CA 4J0DA 5AO9A 1ODSA 1H2YA 2BUBA 3B3QA 5LKAA 5EIEA 4EB0A 1WOMA 2BCEA 5JARA 1CUHA 2DQYA 1CUEA 3GROA 1QJ4A 1R88A 4INZA 4PO3X 5FPQA 3DOHA 4DNQA 1XLVA 3N2ZB 4HXGA 5LZ4A 2WKWA 2WHPB 4S0XA 3UUFA 5EHZA 5EIAA 5JALA 3WL8A 3FYTA 3QH4A 2PL5A 3IUMA 2JEZA 4B84A 2BAGA 2JGMA 4C4XA 5ALPA 1QIIA 5F4ZA 4GW3A 5AKYA 5K3FA 4AB1A 4W63A 1VE6A 2W6CX 1H2ZA 2C5GA 5T4EA 2OCGA 1MU0A 3EQ8A 1GZ7A 4HRXA 3C6YA 5EI5A 1MJ5A 5BOVA 1Q83A 4H0CA 4P9NA 3GELA 1GQRA 1UT6A 4IH4A 3CN7A 3BDIA 5DYYA 3KOOA 2YXPX 3ESDA 2J3DA 3EQ9A 1FFDA 2XUJA 1OCEA 4ZRDA 1H2WA 3ED1A 4AZ0A 2JGLA 4LYDA 2G4LA 2PSDA 2Z8XA 4EY7A 2EEPA 4MQMA 5EIHA 2WTMA 4DSAA 2XI4A 3ANTA 4N8EA 1T4MA 4UBIA 1X2BA 1FFBA 4X6XA 4H18A 4I3FA 1XLUA 1VLQA 1JJIA 4BDTA 4WY5A 3VJKA 5JANA 1XZBA 4G9GA 1LZLA 5CURA 2QJWA 1DINA 4CCYB 2ZYHA 5AKHA 3G9ZA 2CMFA 4OSEA 3R3ZA 4AX4A 4JUIA 3OURA 5AK4A 2VJAA 2W22A 1XZKA 1YR2A 2WILA 5EHNA 3WL6A 2BGNA 2WQZA 3H04A 1EB8A 4GI1A 5JD6A 3W06A 4B0OA 1UK8A 4QDZA 3G0DA 3PUHA 1E8DA 3ICVA 4OU4A 3A2LA 1QE3A 2DFPA 3STUA 3AZOA 4ZI5A 3H0CA 3A70A 2WTNA 4GLBA 3GZJA 2D5LA 5AOAA 1EVQA 2AJDA 5FUMA 2PUHA 5FP0A 5ALQA 4FHZA 3MVEA 1JJFA 5ALLA 1QIDA 5C7YA 2XUPA 2Y1KA 4LHEA 4DNPA 4X93A 5AICA 5LZ5A 3VJMA 3IUNA 3Q0TA 5ALSA 1XLWA 1CEXA 1VJ5A 4C4YA 5ALHA 3FVRA 4X7BA
chains in the Genus database with same CATH superfamily
2GJ4A 2YY5A 4OUDA 4E14A 721PA 4WMLA 1UBJS 3IDSA 4IGIA 3G3EA 4MQFA 5TARA 2FZGA 3M6LA 4CN8A 1U7PA 2VJDA 1W44A 4EPRA 4LXGA 4CKZA 4X62B 1AKMA 3E53A 1F9EA 1P61B 1F7UA 3KZXA 3GCDA 3AJ9A 3LFTA 3H4VA 4PF1A 1AQJA 2PH1A 2P9TA 3ONEA 4LYJA 2JIZA 5F73A 4Z4FA 4CU2A 2AJLI 121PA 1L1EA 3BKWA 3Q7PA 3V7FA 1P8AA 1TRHA 5KU7A 4DR6B 4WRRA 2A5JA 3OF2A 3NTOA 4URWR 4Q02A 4F38A 2YXLA 2HBQA 5HBGA 4MW5A 1LDBA 4YMUA 2EF1A 1PJLA 3J81A 3S1LA 4A5OA 4CKBA 2B3DA 3P9XA 4OXXA 2IYLD 3F7OA 1A0OA 4MAAA 4R8MA 4DUZB 2O5VA 4FLMA 1K86A 3OM8A 3PNKA 4L07A 4DSOA 3U19A 1ILEA 4DPMA 1R12A 1C7IA 2FSVA 4G0YA 4WXYB 2A8YA 4OQXA 2O2GA 4F84A 4MS1A 1JB1A 4B7XA 1OLSB 1ZX1A 4F06A 5DM70 2CMDA 3BGWA 4N0EA 4AP9A 2XCRB 1T5IA 4EDFA 1X39A 3OZCA 4UJ3A 1TXGA 4M76B 3DVRX 1ZU5A 2WE8A 3Q5GA 2OD2A 3PNBA 3V2GA 5AHRA 2QJOA 4N82A 1BFUA 2A59A 5LXTF 2XUGA 1SBCA 4LXUA 1RLMA 1ULHA 3HB9A 3BXFA 5KTKA 2N42A 2FRXA 4Z4QA 2HSGA 3KTDA 3PGXA 3UMSA 4RZHA 1U7DA 1V1MA 4KX3A 1X77A 3A7DA 4DPLA 1KI3A 4OYLA 3ORSA 4RZ3A 3AINA 2UAGA 4TS1A 4IJWA 3E5MA 5F1KA 2ZQYA 5HILA 4BZPA 3Q4GA 2Y1DA 2ID8A 5BQFA 5BYJA 2LUOA 2PUAA 1KFCB 2CCKA 3EQ7A 3ZDEA 2J0SA 3NHPA 3MJRA 5HF9A 1X3LA 3BIWA 4PAQA 3WYDA 4FR0A 2APJA 1RZVA 3HZHA 1RFLA 1CFZA 2IPLA 1CY1A 3A1WA 1VA5A 4WK6A 3V8PA 1USIA 3WI7A 3LLCA 2H8GA 4DSTA 3D3JA 5D85A 4FOOA 3O9VA 4Y2UA 4PCVA 1TU0A 4HRVA 2QAGA 2IPNA 4TRJA 4ZU1X 1XC7A 1J2EA 5B1EA 1JBKA 1HFJA 3O92A 1QTQA 2CDAA 4JL8A 2ORED 3UBMA 4E1BA 2QM3A 3BSWA 3BEDA 3LQYA 2VR1A 1EX1A 4FT4A 3B3JA 1E8MA 1ZD1A 2LIPA 4ZOLF 3CX4A 1RDFA 4RESA 1HYEA 5AKKA 2MR5A 2Q45A 3NHMA 5TGZA 3CF6R 4P3XA 4E22A 3KLNA 3C6QA 1RACA 2PKQP 1T3HA 3EPLA 4MLDA 2PVSA 1S8NA 4C0WA 4LTDA 3PXDA 3RUHA 1DC6A 4HYYA 1EFPA 2GM4A 2MINA 4I1UA 3R76A 3M3DA 1X8XA 1R0YA 1PFUA 3M6FA 5LMCA 5J2UB 4ZKEA 4QGGA 2PV7A 5FQOA 5FWAA 2FUEA 1WZCA 4DB4A 5ALEA 1FVHA 1LSOA 1MX1A 1T0HB 4M7WA 1A9ZA 1KEWA 4P3PA 3CSDA 4R54A 4UAJA 2I03A 5BORA 3HKCA 4GKBA 3GRYA 3ZHSA 1EWQA 2CZCA 1RADA 3AHCA 4CEJB 3USCS 1TUGA 3FR8A 4HEJA 3L6OO 3E1KA 3PXCX 5EE3A 2DF8A 3P1JA 3Q85A 3T4PA 3H9UA 4IYJA 1DG9A 1G0OA 2P8SA 4TMKA 4TZTA 2WTXA 5K0TA 1E0AA 3H1EA 2A0UA 3GH3A 4B3GA 1S2IA 1NOJA 5F5XA 3LD9A 3TCNA 1G8HA 1JVBA 3DF7A 1Y1TA 3VHQA 5ALGA 4O6VA 2NNLD 5A5FA 1KEZA 3CWQA 1Y7HA 5C8XA 1KK2A 1RLIA 4CIYA 4CGZA 3DBHB 2BVNA 3A31A 4WCVA 2P4SA 2L42A 3I8XA 5GJWC 3T1HB 1NXXA 3MA0A 2BEKA 4ZOBA 2AZ4A 3OOHA 3GEEA 3LUCA 3GZNA 2C42A 1ZHFA 1PT5A 4XUEA 3AI3A 5B3KA 4I4NA 5GINE 1MT0A 3Q7TA 2QZJA 4RLFA 5IG2A 3ETDA 1GZVA 1WVMA 2YCBA 4E33A 1Z35A 3BL6A 3GEDA 3CPEA 4OHRA 5BN5B 3G9TA 1NNLA 2GBGA 3ZS9A 3CX7A 4J7UA 2WI8A 3L79A 3VOTA 1NBEA 4JASB 5HR5A 3BTOA 3SVLA 5IXYA 4ZZ3A 1DDGA 4HPWA 4V0MA 4PY2A 5HK8A 4OP2A 4B87A 1XDUA 2HJVA 3R7DA 1JF8A 1LQTA 1I2MA 3AL3A 3GRPA 2BDTA 5I7UA 4MLCA 3H9EO 4A8JC 3L8HA 1G20B 2ZIFA 3M33A 5BVHA 3Q8KA 3EPPA 3QY0A 1QYXA 4IGFA 1AZLA 5FV4A 1W36C 1P0FA 4CG2A 4QWMA 4D1YA 2QS9A 4NF2A 1OKKD 3FCCA 4QOHA 4Q9KA 2H85A 2QVZX 2EL9A 1PSZA 2FPLA 4Y2HA 3RBVA 1FOEB 1RYNA 2PGJA 4NU8X 2Q9BA 2QTFA 3G7UA 4HDRB 2QX7A 1SQ6A 3TFOA 1TIBA 1KC3A 4O0LA 2VRCD 4F5WA 1CUWA 4K7JA 4QQNA 2WB2A 2WMNB 3L3BA 4GRIA 2HGSA 2PUTA 3UN1A 4CUKA 3A3OA 4QTYA 3ROKA 1MRNA 4HO1X 4EA7A 3T6KA 2J3QA 5LKRA 3QX3A 2PL3A 1ULBA 3DJFA 1EFLA 1ZRSA 2KBEA 5AH0A 3K73O 5JQGF 1G8MA 3LKVA 4CI0B 3UHOA 4WK4B 1MQAA 1IEQA 1SCKA 2GXSA 3SX4A 5CX1B 1T43A 2G8NA 2Q4EA 3K4QA 3ROQA 1NVTA 1P8JA 1C9YA 5D5HA 4UW9A 2G08A 4MRVA 2BFBA 2CWWA 2XUDA 4GOLD 1R9MA 1T29A 3E8MA 2ZS8A 1U3GA 3DVAB 1XD2A 2CFIA 4LE0A 3EAFA 5JPDA 1QR2A 4YRDA 3ET5A 4X41A 2P4HX 1Y80A 4RX1A 1IMJA 3K53A 5AHXA 4A0FA 3HDGA 5IFLA 1KJ9A 2CNDA 4D9HA 4KSCA 3LPAA 3W5HA 5BY2A 5E1MA 2ZXUA 4GL2A 2X6QA 1GA6A 3N2GA 1EXNA 4RGVA 2G09A 3VKUA 3ZU2A 3UJBA 4P3NA 4S1WA 4G5HA 1NMQA 1D0VA 4FX5A 4LQCA 4GICA 2C88A 3KVNA 1K7FB 1GZDA 3EW9A 2ANBA 5FADA 1SELA 1B1CA 1GO2A 3GCGA 1DT5A 2Q2VA 3JATA 4U6NA 1E7MA 5AYVA 1HE3A 2PMEA 4O4LA 4MINA 3W1EA 1N1GA 2ODNA 3N07A 3NOXA 3W8EA 2MTBA 5BNFA 2ATCA 1UBCA 1F4LA 5BNZA 2FSHA 4S05A 2HL6A 1NJ8A 3K7EA 4KJXA 1J97A 4FW8A 1S2LA 2G9NA 4YJ2B 3WRXA 3LTEA 3L4KA 4PZCA 5DCWA 2GR9A 4KLRA 4ENQA 1QLJA 2ZRJA 2FMUA 1RWVA 2G7ZA 3NVAA 3EZXA 4BKPA 4NMWA 4IJVA 3DKVA 9MHTA 3A1SA 1U5BB 1JEYB 3T3EA 5K8TA 3E23A 3HXOA 1JXOA 1X80B 2BELA 1EEXB 2NT4A 3BMQA 4MLPA 5DWDA 2IUYA 1RXEA 1E4OA 4JELA 2Y1WA 3U7HB 1FBNA 3U4GA 4AK9A 1TVKA 4LFBB 2V0CA 1XLTA 2OYSA 1G7SA 2YC4C 4M1YA 4PSAA 2H2WA 1L7RA 3GJ8A 2AXPA 3BRQA 3QKUA 3RDPA 1XMQB 4D80A 3VKHA 4MVJE 4NJEB 2B36A 3FYUB 2ONCA 4OGGA 3K0SA 3A4VA 1QLWA 3H4MA 1FYEA 3TLGA 1NWCA 1PX0A 4BGDA 3I2JA 3HP4A 4HQ0A 4UQOA 5L3VA 3FDFA 3L49A 3DM5A 2F64A 7ADHA 1MBZA 1UC9A 1THTA 2E4VA 3DXFA 4MV4A 3BBPA 3KXIA 1NNSA 4DQ0A 1CF9A 3MLBA 4KWHA 4ZT2A 4LMBA 4WUTA 4J2TA 1TM7E 2H4HA 2AJCA 3CUWA 3RFUA 1MVLA 3RVPA 2H3HA 1U3FA 2PKXA 5J4LA 2CYBA 2OCLA 1E66A 3HVHA 1WXEA 2CDNA 2CZQA 2HJWA 2YY7A 1AX9A 3A58B 1OI2A 2NM0A 3FLBA 4HJXA 4M49A 3RM3A 4EH1A 3TLAA 1PDOA 1TF7A 2E89A 3OLCX 4IG4A 5I47A 1K6XA 3ZNQA 2V3WA 5DXJA 4BUCA 4OHUA 1A98A 1XV5A 3VYUB 1ZS9A 2OB1A 4BIMA 3DDZX 2PR7A 4R7GA 4E5PA 4YAOA 3L8CA 1QRSA 1T0BA 1WL8A 1CDZA 3QE4A 1SCUA 2AOUA 1CQZA 1PJ4A 4K6GA 1GSOA 3ZWDA 5COBA 5LLDA 3VH3A 3BMOA 2FOLA 3ROGA 4L5YA 2C59A 2QA5A 4ZAYA 5T57A 3TNLA 5ALXA 3NI2A 1MG0A 1NVVR 4RD3A 4PGMA 2QQGA 2R3SA 3AFNA 3MBOA 3CQ9A 2WUDA 3OUZA 4EI9A 1B2RA 5I3CA 1BH2A 3MWYW 5D2CA 1ISGA 1ZINA 3AG6A 3L7OA 3C3KA 2DQSA 3P2IA 5IK2A 3WRYC 2RH5A 2W4IA 4YP6A 1C4XA 1UPFA 3CXRA 4HDSB 3SDSA 5CA1B 4H3KB 1ZVMA 4P4NA 4JXXA 3U6KA 1CEQA 1VKHA 5G4KB 4DYVA 2EX1A 1ZJ4A 1XZJA 2FJUA 5EPUA 3T1NA 3C24A 1V7QA 4NBLA 4UD2A 3SEZA 1YGYA 2H1HA 3C3CA 2TECE 4YLGA 4FFRA 1JE1A 3A9TA 4J6FA 1B8PA 4LKRA 4DQKA 5C8YF 4DKJA 4R2HA 4Q4HA 4DYHA 4NCAA 1CDEA 3PDWA 3ZDZB 3I6BA 3NT5A 1NVDA 3T3NA 4LQLA 4FQ7A 4NHOA 2ZRDA 4HQNA 5GOZA 2JAXA 4RDXA 3NCHA 2QTLA 5G2OA 2XXBA 1MB0A 1SZCA 4LY0A 3BVPA 1H2EA 3HCPA 2WPNA 4BPBA 5LMUB 2I6UA 4N6GA 1FFGA 1HDXA 4G0MA 4DV3B 3QBEA 1ML4A 3DZGA 1E5TA 5MN4A 4QQ8A 4I1PA 2RI0A 2DUUA 2QSJA 4OJNA 3ZKWB 5JFOA 1H6AA 2CJXA 5AKEA 1U0EA 3W5SA 2LCIA 5A6SA 5JH7F 1A9PA 1GR1A 1OX4B 2BF4A 3N0XA 3OJWA 4IHJF 3VYRB 1LFDB 4BDSA 3BG5A 2PQ0A 5EN4A 4CVNA 5LQAA 5DHTA 3DEFA 1TE2A 2AK2A 4XIYA 1AKVA 1NLYA 1S2NA 3HUDA 2XRYA 5BR8B 2J7KA 1SVIA 4M8KA 5F77A 1V3TA 2JKVA 3Q72A 4TMVA 3RT7A 4P35A 1ODLA 2VT3A 4E4TA 5LU8A 1B0PA 4GAEA 2F00A 4B2IA 5INTA 1VE9A 1P9RA 4GEGA 1BRMA 5TF4A 3BHJA 2I6QA 1K6IA 5EIOA 1YONA 1W0JD 4UMDA 2AJTA 5AVRA 3RODA 4FC6A 1XDDA 4UU0A 1JPUA 4EX6A 4ALNA 4X8HA 2I6TA 2HQ1A 3JWEA 3UJ9A 3SJ7A 4M0UA 2IY9A 1JN0A 4HNRA 1TRKA 4RANA 1LPNA 5JJLA 1PIWA 2OGSA 2ZRFA 1N4AA 2FP3A 4DTIA 1GN8A 1C7JA 1MJFA 3FLEA 3L02A 2A67A 2GF0A 1FX0A 4D5GA 1JHZA 3BIJA 4XRGA 4ZV9A 2G1PA 2P3SA 1O9BA 1QORA 4MROA 1OWOA 2GCPA 1TO2E 1DJQA 1QU2A 1VB3A 2WFMA 4EA8A 1O57A 5C3MA 3DD5A 3EFOB 3LXRA 4UCFA 3B13B 2K7ZA 3U4DA 4JYZA 3EXAA 1EZ4A 2P2ZA 2JAOA 3UMFA 3CZ5A 3DZJA 1CLEA 1KOGA 3DF9A 2R60A 3G0HA 2BFEA 4Q9LA 5KC8A 4X8LA 3AUUA 2OGWA 4BO8A 1QIKA 4FWTA 3QXCA 1QRRA 4AZ3A 4MQ6A 1PK9A 4V0OA 4YP5A 3T3OA 4O3MA 5DGDA 1AIPA 1RQ7A 1TYCA 2CVFA 3N6XA 1U94A 4FR5A 4RK7A 4DIDA 5IU6A 1YRAA 2X0RA 4BQPA 3HSKA 4UOEA 2MMCA 3UAGA 2FFQA 3FMOB 3NANA 3OM9A 1ISHA 4GRAA 3GFSA 5GJBA 5DHSA 4C2UA 2FZKA 4L4ZA 1E6KA 3F2IA 4HDKB 3ST7A 3BB4A 5FOQA 4C0AC 2GZRA 4JLSA 1Z6QA 3HBAA 4RZSA 3KO8A 2XQGA 4DC0A 1SC6A 3EX7C 3BH6A 3FAKA 2EZ8A 4FMCB 5ERYA 3GAZA 4ER0A 3NBAA 1BIFA 1AUXA 3QU7A 4YXFA 1I5OA 1EQAA 2EJWA 2WM8A 1BU5A 3B9PA 4X61A 2Y0DA 1KU6A 1ZM7A 4QTUB 4Y2YA 2CHEA 4L3VA 3T8YA 4RV5A 4NOMA 1XMOB 4OY3A 2P9QA 4QODA 4OLJA 2R5WA 4JQSA 4WZBE 1MRZA 1W19A 3QWFA 4OLBA 4B34A 5ITSA 4PSDA 5FV7A 1Z5NA 4AKEA 4DIUA 2W2KB 4UHEA 4RHEA 3DBHA 3P9RA 2I0FA 4KXXA 4OK5A 3EGEA 3Q6NA 1WAMA 5AJZA 4EF6A 2AN3A 1TKCA 2JIQA 5LC1A 5BSEA 3N1UA 3S2IA 4GBED 3PS9A 3ONDA 1NJGA 1W5FA 5FBWB 1EBFA 2RB5A 1LCIA 3OQVA 2GJKA 2JAPA 1KI2A 2X42A 3RAJA 4ARVA 1FU8A 2FA9A 2BFPA 4I5EA 4KHPB 3IH5A 4X85A 2ZTLA 1JNYA 4JJZA 3RG2A 3TZQA 5JBQA 4PFKA 4U9UA 4R1QA 4ZI7B 4EPYA 1RPAA 1RKXA 4JOSA 2GETA 5DRYA 2V9ZA 2OHOA 1DMSA 2NU6A 2BRUC 3MWEA 4LAFA 1ZY2A 5FB3A 1TT5B 1II9A 2HUPA 2VDQB 4O4HF 4UTOA 5F64A 3RVOA 4JI8B 3A8TA 1MJNA 3OY2A 4HGZA 2JJMA 1KZ6A 2ZIGA 3OICA 2A14A 2WAMA 4DR1B 4L74A 3JQDA 1XVUA 1CRLA 1KPHA 1M2EA 4TYPA 1PD0A 1SXJC 1IC6A 1KY5A 4IXTA 4OQFA 1F2UA 3LYAA 1G8FA 4CZ2A 2JDID 5AW3A 5CT6A 1XZ8A 2I1VB 3R7FA 1XZGA 3WOHA 1TM2A 3ZV4A 2WYHA 2FG6C 5DM60 3U4QA 1MC5A 3EH2A 1V1RA 2J5BA 3KKNA 4ZYXA 3QPAA 3EAGA 1IY0A 5AXAA 2QP3A 1ZH8A 3E2IA 4MEBA 2G76A 4EDHA 4RTMA 5K0FA 1K7EB 3BC1A 4LZLA 4XRRA 4J0KA 3EIWA 3WHLA 1OXUA 5EKUA 3OA2A 1M2GA 2AV6A 3A36A 3EOBI 3Q3HA 3GGGA 3EARA 2IOFA 2O0JA 4G1MB 4KPGA 1U1CA 2VQ6A 1YWGO 4MDHA 4RAOA 5C8YA 3I4FA 3NB0A 3KSRA 5HQ3A 1HKUA 3SQLA 1IWPB 5CMLA 1T1SA 2I22A 3CUKA 5LBUA 3U7IA 1U3TA 1YUNA 1YZTA 1U8EA 2NLOA 4FM9A 2D62A 7GPBA 5EJGA 4A26A 3PX2A 3OP1A 1QG6A 3K6SB 1FJ2A 4E70A 3WLAA 1OREA 1LBTA 3QP9A 1GYRA 5KTTA 3RUFA 5FLEX 3J80A 2ZRIA 3MXOA 2D13A 2GTHA 1KI6A 2IUSA 5THKA 1MORA 1QMGA 2JGDA 2Z9DA 2PEYA 4EABA 3SSOA 3GUUA 3PXGA 1R4AA 2DG2A 5CLFA 1NSTA 2QRKA 3HV2A 2BTEA 4JR1A 1SKUA 2JBWA 4NZ9A 5JI2E 3QHAA 2H4FA 3HKEB 3SEFA 5L3QA 1DC7A 4Q1EA 3UAXA 4M88A 1HYQA 1C8BA 4LBWA 5FWXA 3EPKA 1OFGA 3EDOA 3HU5A 4GKJB 5SY9A 1XTSA 1MXFA 3G17A 3NKVA 1U0RA 2ZCJA 3I8SA 3N0VA 5M5BA 1G6HA 4QNNA 3FYSA 5CBPB 1G9TA 3V6LA 2FMTA 3P4XA 2G7MC 3WB2A 3PGKA 1N9KA 1MEOA 3WKBA 2AEFA 4YRGA 4MPRA 2LGJA 1X80A 2GHTA 4F2WA 2QVBA 1FDOA 3TRDA 3HJRA 1GKIA 3U9SA 3K0AB 1QHSA 1YZGA 2OV4A 2WMOB 3CMMA 4Z2AA 2XWJI 3TR5A 1M5RA 2AFHA 3FOBA 2VT7A 1X15A 4XWOA 4RY9A 1ISFA 1PR4A 1XDBA 3IELA 3SSAA 2CMHA 5DYNA 1BE6A 5JZ9A 5DOZA 5IM4A 1ZR2A 5SYAA 3FI9A 1DOZA 1HE5A 2QTCA 3Q7QA 4MR7A 1CQJA 3HVUA 2H1IA 2FWRA 4RFLA 4RIGA 4RIFA 5CH3A 3U44A 2VUTA 2IBSA 2QQ5A 2FFBA 1CU1A 3LOUA 1U31A 3FNIA 4QJ5A 2H4XA 4JUCA 3TLJA 5DTMA 5KKAA 3WL3A 4DA6A 2G9VA 1SQ0A 4NNPA 4XWWA 2G1AA 1A71A 2WU3A 4CEIB 4F0JA 4P3KA 3VPFA 1A72A 1JAIA 4ID9A 4HGOA 3WO1A 3OFSA 4NYJQ 3KPUA 1Z18A 4U7FA 4WN3A 3RRMA 4ZVSA 2KLHA 1RXYA 2JJ1D 3TVDA 2VOJA 5IKEA 4BO3A 4TWZA 4WT7A 2IFTA 4Q9IA 3X3HA 2UYHA 1GTRA 2BFNA 4FPXA 4WFJA 5IUKC 1Y4AE 1P7VA 5I9BA 4B81A 4C5BA 1YZQA 2QBYB 3O8CA 4I1YA 4YRLA 1Q0LA 1PJAA 1T3LA 3A3KA 1PLJA 1NQOA 3DDOA 3CYFA 3M0EA 1JZTA 1WXFA 1W4AA 2ZE8A 4D4KA 2HHCA 3OLVA 1V39A 4IOJA 3RE1A 4U8HA 4WPGA 4OHKA 1RI2A 4YMGA 3LM8A 4EG5A 4EF5A 5ALMA 1UH5A 2EX4A 2HYDA 4D42A 3KYDB 3BFJA 5K5EA 3C74A 5ITZB 4G85A 3TBKA 3DVLA 4BAGA 1EFVA 4EJSB 3SSMA 2JIBA 1V71A 4BTEA 3ECAA 4ZIRB 4KE7A 1KAGA 3KQTA 4B32A 4BNHA 2WHPA 2RHDA 1CJSA 3B6KA 4JSTA 1GAXA 4QPNA 4B3SB 3QKSB 4NARA 3A2KA 3EEOA 4BXOB 5IF3A 1S01A 3AJ8A 3EIEA 4BE4A 4DDUA 3BF8A 1H2RS 5DI9A 1I4OA 1A8PA 4JB3A 4LXIA 4KPYA 3BFPA 3LQ1A 4GXNA 5TX7A 2FG7C 5HJ7A 1GKLA 1W8IA 2OR3A 3BD7A 2H1VA 3C8HA 3S27A 4I2VA 4DJAA 2DPLA 3O26A 1EINA 4GI3A 2IOQA 3LGSA 4AUMA 4QPJC 3BILA 4ZALA 3U7QA 2W2LD 1Y1QA 3I2KA 4PHHA 2SECE 3HUUA 3IXMA 1YJXA 4GYKA 4U2EA 5CT9A 5EZQA 1M0TA 1NVAA 3V6MA 2VDNB 1EMDA 4N5HX 1CJMA 3Q8MA 5DYGA 3ERCA 4X54A 1T1RA 2FEAA 5TEWA 4BVHA 3CRRA 4L6AA 4WVFA 5H0IA 1Z7BA 4OFZA 3HUFA 4XKJA 5CB0A 3C97A 4AUKA 1N75A 1M74A 4MUKA 1R8JA 5H02A 2R6ZA 4FFNA 3NGMA 3MT7A 2O6LA 2IL1A 2TS1A 1B93A 3DL4A 3LZ6A 4V0LA 4BNWA 4EY4A 3BERA 5MHTA 3S81A 3EGDB 1U0LA 2QSUA 3O8NA 1DV1A 5T7BA 1YZYA 3PXUA 3Q2KA 4S3MA 3UV3A 5KOJB 3H18A 1XL0A 2JLRA 1DHRA 1KARA 2WWGA 1GU7A 2C5BA 2OL4A 3PX7A 2QPAA 3OCZA 3P4YA 2WNIA 2Y77A 1NKTA 3GF4A 4RW0A 2DLDA 4RELA 3DVSX 4BRWA 5CCXA 5EYPA 2FPGB 3ACDA 1CT9A 4BMVA 1EJ0A 1B4DA 1CDDA 3DQPA 1EWYA 5J59A 1JQAA 2D54A 4OKSA 2QY6A 3ZBUA 3BH7A 2H9IA 3GA5A 2C57A 1CRWG 5M3BA 3WAKA 3E9CA 3NIDB 1W6RA 3NM4A 1K92A 1N8NA 1VFNA 2OBBA 3QPBA 2YRXA 4I36A 1UM8A 5AVTA 2OXFA 3KOYA 4I5FA 4UE2A 4N47A 5JAOA 1X86B 2ZATA 3ACBA 3MPOA 4FHFA 1US8B 3QOWA 2V7UA 2OYRA 5IBCA 1KWGA 1L8QA 4OHXA 3OX1A 3U4CA 1WUYA 2Q62A 4GOMD 3LS2A 4PC2A 1T9AA 2EHDA 3KT3A 1E92A 1EVLA 4ZO4A 3UT5B 3RFXA 4JLDA 2QXUA 3FYCA 1YB5A 4O4JF 1OTYA 1UWVA 2OD7A 3TQSA 3KOUA 3KPWA 1EQUA 1OAOC 1KVUA 3VMFA 1ZMXA 2A84A 3F46A 3MINA 3QY9A 4TWBA 5JDCA 3IQIX 4PZPA 2YV4A 3T15A 3X43A 2OAGA 5HM8A 2IS6A 4MWDA 1ONBA 1HDIA 1M34E 2GMWA 3B70A 4MV8A 4QE3A 4ROTA 5EJFA 2FMFA 1W93A 1JAHA 1AXGA 3SCZA 4BFTA 4WOJA 2JFPA 5LA6A 4B3JA 4DV2B 1FX0B 1TZJA 4KE8A 2FOIA 1IG3A 4JLNA 4CIAA 2XITA 4QXAA 1L1RA 2O0HA 3RQIA 3Q7IA 1X1SA 1OFHA 4RF5A 4YHBA 4Z9BA 3ZD9A 4C3UA 2NO4A 2UYQA 1NLZA 4KH1A 3H9GA 3V1KA 4UOZA 1IQ0A 3PEEA 3K0KA 1W6UA 3U62A 4DARA 1GTSA 3DP7A 5CDUA 5JDIC 2RKWA 2BFMA 3ZZUA 1SB9A 1O94C 1BA3A 4U2BA 2D2FA 2VSFA 4UTXA 2ZANA 2DBZA 4PXYA 1M2OB 1CUXA 1P4HA 4DCCA 3LNCA 4XASA 1P74A 2REQA 3VUFA 2BPOA 1QF7A 2WTBA 4J7XA 4JBNA 4KXMA 4TMXA 2RBKA 3U4IA 1W5EA 4M37A 3JSXA 1ZLXA 1E7RA 1JSXA 2X19A 1SUAA 1E6UA 3RUEA 5M34A 2P4UA 1M2HA 1BQ4A 1JLLA 2WF9A 2ZRAA 4OAPA 1TL7C 1D1SA 4FMPA 2I6FA 1KJIA 1FUYB 2WA1A 3OEHA 3CJRA 1SVLA 2ZPUA 4QYXA 3MK31 4CFZA 1E2KA 1KEKA 2JVIA 1KJYA 1JKMA 4O0MA 2YCLA 1TECE 2P1ZA 3QV2A 5GMOA 3GA0A 3VR6H 3FZQA 5DH9A 1N2IA 1V1RB 1IIBA 1E9BA 1H8EA 1TF2A 1SCJA 3PVSA 4K9LA 4ND1A 5EVJA 2BTOA 3TPCA 4D4IA 5C7LO 3PEWA 2JH8A 1EK0A 3T12A 3ZWXA 1GARA 1A4UA 1V41E 4NNJA 4RXUA 1N1DA 3DOOA 4QECA 2QRVA 4P31A 1MC1A 3A3YA 3IBSA 4UHBA 5C1DA 3P0JA 2A35A 2GA9A 3IMKA 3C4JA 3PLRA 3IOEA 3NWJA 4C3VA 4GGMX 4FQ5A 3RHSA 2QVGA 3ROFA 2DTEA 5AJTA 2IGBA 2PLFA 1UUFA 1RRFA 2ZU0C 3PGA1 3ABZA 4G0PA 3DKKA 5DX8A 1BJKA 3VOSA 2QW8A 1LLUA 3ZIAD 5JSQA 4PG5A 4YY3B 4V24A 4R6XA 1AV6A 3RS4A 3WKEA 3BX1A 1VMIA 3C85A 3NTVA 3LYUA 5ECYA 3RUCA 4DV0B 2JZCA 1RRCA 2JIDA 4FOTA 1JHMA 2OC9A 2DY1A 4LQDA 4AULA 2XTMA 3HM2A 1ZD2P 5A9SA 9GPBA 3G8CA 1CQWA 4HAWA 3VPXA 3GPDG 4BEVA 1R8SA 3OPYA 3QEOA 2YVLA 4J4TA 3HXTA 3HUEA 4G9EA 4EB6A 2W2XA 4BCCA 2WF5A 1YK0A 4MR7B 3FM9A 4ZT5A 2W58A 1TK9A 1ADCA 1IQRA 4PYRA 1ECGA 4TMWA 2VCEA 1U1EA 1QKIA 1L3IA 4AECA 5JOQA 1A9OA 1K6JA 1O4WA 1WHTB 2CUZA 2PUGA 2B1QA 3M6VA 3IMGA 1P39A 5B7NA 1SU4A 2AG6A 3IE0A 4K6KA 4YJHB 5BWMA 5KTNA 2NWQA 1QTRA 2WNSA 3DCIA 5B6PA 4X1OA 3L5KA 5JAMA 3LHDA 4E6PA 1GZHB 2KLBA 4UDNA 1ZOLA 3VSEA 5BXQC 4FNOA 4Q3KA 1JG6A 2A9QA 5JWHA 4YR9A 3THYA 3HXQA 1JT9A 5T3YA 3ZQJA 2JKZA 2NXEA 3W34A 1SOAA 5DLQC 3R8XA 3CUYA 2GXAA 4CDRA 1WCIA 3P97A 2O19A 1Q1AA 4RVOA 1SUEA 1IWOA 4JVNA 1DB3A 4CTOA 3RYCA 2QUIA 2BEWA 3WMFA 5SZIA 1L8XA 1GYQA 3MINB 3WK5A 1C5KA 4KLZA 3O93A 4PSVA 1P2BA 4XW2A 1CG6A 4JY7A 3K30A 2H06A 4BNDB 4DLXA 4KQCA 2IEYA 4B3TB 1UMBB 3P9PA 4OB6A 1QCYA 5JISA 3HRIA 3JYLA 5K9ZA 3FOCA 4XH9B 4LMAA 4MKHA 3WGQA 3A2MA 3CPSA 4JZKA 2CVOA 4QYWA 5FTWA 1HNNA 2IHKA 4LHYA 5IT9A 3IP1A 1B73A 2CLEB 1L7VC 1QBKC 3U3XA 4CTJA 4Y6GB 2AG1A 1Z2EA 4TWIA 5FLXA 2P79A 1ODIA 4GXTA 3ZH9B 2FSGA 3BWVA 2FX3A 4UZSA 4IZ6A 2G82A 1W34A 2P9HA 1ZL2A 1L5KA 1S8OA 1RM5A 1TMOA 1I0IA 1YCDA 3A4LA 5F78A 4Q9NA 3O0TA 5K09A 1KYTA 3HXKA 3HKCB 4HX9A 4LVNA 4R2XA 4G8JA 2VXOA 1P60A 3TBHA 4D9KA 1NPYA 2ILVA 3SZMA 3CVJA 1Z08A 1G18A 2WU4A 4MQ4A 1WHSB 3W5UA 2GNPA 2VHVA 2ZT8A 3F96A 1WCWA 4YDQA 3GW8A 1QO7A 1C30B 3AW9A 4DMHA 1GQQA 1BROA 4YYEA 3BE6A 1B8UA 4KLNA 1Q16A 4UQPA 5FPPA 3SF8B 3UUWA 3VU9A 1Y8RA 2CNNA 1NI5A 1SH7A 2P9CA 2Z43A 4IDDA 5AW7A 3B20A 3U4MA 1QFYA 1GAQA 3EE6A 4LSZA 3F0TA 2AMYA 2KSQA 3NQ41 1O95D 4FS8A 3KTAB 4Z4IA 2PQ6A 2ZSBA 3GC6A 4FN5A 4U0KA 4Z86A 1Q7GA 1JE0A 1VHJA 1HNXB 5JCZA 1AKRA 2QD5A 3AYXB 4RC9A 1KAQA 1PJCA 3S0JA 3I9MA 2XCSB 4S24A 1KRXA 4JLPA 4PPQA 4YUYA 1EWRA 1I32A 1QFMA 3NG1A 5CX1A 3SYRA 3C7KA 3QMWA 4NNOA 3VU1A 5JXJA 1WO8A 4AUNA 2HHJA 2CV2A 4H17A 2VRNA 4DNOA 3MAJA 2CNLA 2XUAA 3PHLA 1WKBA 3S2YA 3OEYA 2D8MA 1HMYA 2E6UX 3GT0A 3ID6C 3UJAA 4KQ2A 3VC3A 1N77A 4RDHA 3QVGA 1ZXBA 2AI2A 3ML1A 4LS3A 1PWYE 1T9KA 3OT5A 3W6OA 1NBWB 4WADA 3D2BA 1IXSB 4P2BA 3WGTA 4ZIRA 3CE9A 2A86A 3EIUA 4GKAA 4YV1A 2FK8A 2AFIE 4EEZA 5C4MA 3KQUA 1IZZA 4GBGA 3WLEA 3ZE1B 4BNYA 1T3GA 1QF6A 2R6CA 3GEIA 4BFXA 1QIMA 3DZFA 5CD9A 1M8PA 5IMSA 1C0EA 3RREA 3IVCA 4N18A 1N2CE 4DADA 1U1DA 3JYPA 2R68A 2X6RA 1PEYA 3PC6A 4ZMRA 2HAEA 1TMKA 3AB8A 1D2NA 4GBJA 3BM5A 1Y81A 1XPOA 3BGIA 2I6XA 4Y2PA 5ADVA 3K0BA 3ZDCA 3RRZA 5I7OA 3VNQA 2A92A 1DBQA 2AOTB 1ABFA 1U0SY 3GLUA 3HCAA 5ALIA 3UT5A 3SYNA 1FTQA 2ZB2A 2ZEJA 3E7WA 2CEKA 3QLVA 1WTAA 2C2XA 3HFSA 4EY5A 3FUWA 1PBTA 4RV4A 1PL0A 1NR1A 4NCNA 3DAYA 1E2QA 1FFWA 1IB6A 4FFPA 3UAYA 4YJKA 4FZ5A 2FE1A 1J56A 3PF9A 1S9DA 3K09A 4BZZA 3FMVA 3MWJA 3GZNB 1DQPA 1R0KA 3CLTD 2VLIA 1MRSA 4FDUA 3UFXA 1QJCA 1VOTA 2QMUA 3K1AB 1W25A 1KI9A 1R00A 4OKIA 5AVKA 3RYTC 5FNVF 3SX2A 4ZGBA 1ZUNA 3TD2A 1JHPA 4KAXA 5LQMA 2GN8A 1NE7A 3A6KA 3BXEA 1TYBE 3HL0A 3I9KA 4FFVA 4J1TA 4KK4A 1KQNA 4Z3KA 2WTUA 4D9EA 4OXQA 3VR4D 4W7SA 1U0TA 4GMGA 2ZB7A 4I19A 4C2BA 3LDGA 3NNNA 1T3TA 4PYQA 1DAEA 2TMYA 1SVOA 3D3WB 4JA2A 1H0SA 3WGMA 3ZWVA 4F21A 2FW8A 3HMQA 3T4EA 1X7ZA 3TJMA 3WLNA 1UJMA 1U4SA 1ZUIA 4M9XA 3H5IA 4WDRA 3SBXA 5BMOA 2OM2A 4G0NA 4OGWA 4UMFA 1QHEA 4BL5A 1K89A 1QFXA 4WX2B 5AI8A 1ZAYA 4ZMBA 2PIDA 2YWJA 3KP1A 1YR1A 4AO7A 4ZI3A 1V2HE 1CXZA 2AKEA 2ISCA 4B76A 4JWKA 3HJFA 1U28A 2IYOA 4UMEA 3HSSA 1JQ5A 3ZI0A 4P0QB 4OA8A 4I66A 2D5CA 4M6WB 4FFLA 4O4HB 3DFZA 3B7GA 5D86A 4A23A 4RS3A 3IXQA 4MSUA 1R0WA 5J43A 1B0UA 2B4KA 2YS7A 1GEEA 1NUAA 5FFFA 2GASA 1Q14A 2YDXA 3UZUA 1NMZA 3QLTA 1Z26A 1QHNA 1A8UA 2FPKA 3KJZA 1GGVA 2BJVA 2I7VA 3PUZA 2G5TA 1FP4B 3JVUA 4EGQA 4UPEA 1FXWA 1U81A 3KYCB 1R6UA 4IOLA 2OCDA 4Q34A 5FWYB 4K5QA 4HLUC 3W78A 3QYFA 5HKBA 3EWNA 4O1MA 5CVDA 3ZNPA 3ZV5A 1U9IC 5HQJA 5B4VA 3ULKA 1ILWA 1H2XA 5EOVA 3UWOA 1DRKA 3BHIA 4I6EA 2YWXA 1WY5A 4ZCMA 3LQ4A 3PNLA 2DYKA 2O2HA 4FFDA 1AN9A 1QZUA 1V4VA 4Z9XA 4MW4A 2B61A 1LY1A 3PUKA 1DEOA 1ZICA 2WM3A 4KX5A 1XYVA 1XEWY 3AVQA 1LV7A 1KBOA 4ZVNA 1ESDA 4OFWA 3B6MA 1JR6A 3K05A 2F17A 2HMTA 5CFRA 1UAYA 4J1NA 4S1VA 4DA7A 2H4WA 4D9IA 2Q9AA 3WFIA 3L46A 4W7IA 4E15A 3FYHA 3NVDA 4DGSA 6CHYA 2X0KA 2XWSA 2IYNA 3U1VA 4JUBA 4K03A 1IZ9A 4C89A 2WWIA 2VO1A 3W2EA 1DFGA 1VKRA 2WJGA 3M6WA 4CT5A 3KQOA 4BB0A 3E9EA 1JMYA 1EFTA 4DMGA 3ZOKA 1H0KA 1BG6A 2VK8A 5D00A 4REOA 3IE2A 2OCXA 1UZNA 5F35A 2WF7A 3A37A 3TEMA 2PRYA 4MPDA 2XYQA 1GAWA 1U3DA 4KYVA 4JL5A 2XUIA 1SXHA 1OWPA 1U6IA 1XGKA 3H8SA 4LZNA 4XPZA 4HQRA 3MIIA 4J0QA 4D3XA 3RF6A 1O95C 4Q4AB 2O05A 5CP8A 3IDQA 5TXGA 4UAUA 1SIWA 2Z4TA 4MVJD 4EVSA 1WULS 3T52A 3ZEIA 1OLXB 4UC0A 2OKCA 2REQB 2ZS7A 5I7WA 5IZ4A 3KWFA 3QLUC 4HWTA 2PWYA 4RTSA 1SG9A 3UCXA 3QEMA 4UATA 2IITA 3DAPA 2D1QA 3HR4A 4NECA 3T99A 4EG8A 5CFZA 4ZO7A 4ZT7A 5K3AA 2GPSA 2M1ZA 1CHNA 4BKQA 3MIZA 3TTTA 1SUPA 3CE6A 4G37A 1H0HA 2AN9A 3INNA 2EJVA 1D4OA 3E9ZA 2CWDA 5EJ2A 1DEHA 4Q4JB 5IKXA 1QP8A 2R6HA 1Z2OX 4CDMA 5FIUA 3NHWA 4F97A 3RKUA 3NONA 1JG4A 4H1TA 4IMPA 2ZI3A 2IQIA 4E2ZA 1E2FA 1XHLA 2AJ8A 2BJHA 4FOSA 4WA7A 3V00A 4JS0A 3WR5A 4KFCA 1E1QA 4BNKA 4DDMA 5KKCA 1JDPA 2C0QA 2PKWA 4JVLA 3IO5A 4M89A 4S2UA 3RSFA 1RM3A 4I2NA 4JMLA 4U6QA 4R2JA 4UUMA 1O6CA 2C9CA 1ZCAA 5KYUB 3ADDA 1U9CA 1HLFA 2X41A 1URPA 4GR9A 2OV6A 3GQBA 3GRVA 3CCBA 2WK1A 5DISB 2QE6A 4MI6A 3PGMA 4N7JA 2NP7A 1QS0A 4IKEA 4J1QA 2C3YA 4YRQA 2O07A 5LN1A 2HDWA 4JYPA 2C4VA 4MRSA 4PWYA 2OVFA 3O4HA 3SS7X 3VNBA 1XVVA 3YASA 3LCVB 4LE1A 4ZOLB 4D9MA 5A06A 4XA8A 2W2LA 1GRRA 2VEDA 4M87A 4JKIA 5EXPA 5FUWA 1V95A 1DRVA 3WNBA 2EJBA 2UYYA 3K09C 2HNBA 2DT5A 2NSLA 5B7QA 1HDRA 1EX7A 2WD7A 3FJ1A 5AW8A 2IRWA 2GJAA 4UNPA 3GFQA 1Y3IA 1SG0A 3Q1LA 2AOTA 4M2LA 1Y7PA 4XLTA 2R8BA 3NHFA 4U3JA 1FDIA 1CZUA 4NESA 3VTAA 5KWSA 4Q21A 3B5EA 4LJKA 3LBIA 1C3JA 3L6CA 5D3MA 4IS3A 1E9SA 3DDSA 5K6TA 4LC0A 4QELA 2ZULA 3PDCA 4I8XA 3VI3B 4KNVA 4CL2A 3RAFC 1VG0B 4H2DA 3WZMA 4ZGWA 1IONA 1SK9A 4WL0A 4HNGA 4JB8A 5IDWA 5FA6A 4WW0A 1FPQA 1HURA 4JB0A 3QKRB 2Q0HA 2A58A 3CURA 2OWDA 1DTWB 1QHIA 4HH1A 4YBZA 1R4NB 3GFFA 5ARCA 1L4EA 2VK4A 3PENA 1MO2A 1M1YE 1TEXA 2QGFA 5FTJA 3S68A 1CEYA 2OG1A 2PTGA 3GJ5A 4HDMA 3LF1A 2VATA 2QGZA 3BREA 3ETJA 1NMXA 4YRKA 2X4DA 3M3PA 2AE2A 2Q6KA 4D99A 1THMA 4A03A 1J8QA 4CR8A 3ZU4A 4X97A 1XN1A 3W5JA 4BLRA 2RFLA 5AXDA 4HFJA 1MB3A 5B53A 1QTIA 1GITA 1DCMA 4L51A 3ZIDA 5EMKA 1A9XB 3R3VA 4Q39A 3H8JA 1BW9B 2X9QA 1DVRA 2Z8YM 3R8FA 3QFSA 3N70A 1WZNA 1SURA 3N2EA 3H1BA 1TC2A 1UBOS 1BQEA 2J0VA 4TGLA 4B3HA 3HDVA 4R69A 2F3TA 5SZHB 2FR0A 1LWNA 2QI9F 3DV2A 4UVDA 1MMFB 1RE0A 5HJ5A 2N1MA 1NVKA 1T5HX 4G1EB 3OKPA 1RLTA 3QVUA 3HMKA 3U44B 1X1TA 2P6RA 1I10A 4FYPA 4NZYA 3JQ9C 5LLSA 4JX9A 5J2TB 5F7XA 4C1BA 3ILVA 2QTAA 2GBFA 2I7DA 3TO5A 3QITA 4JJ8A 1DXHA 4MVJA 4MQEB 4LV6A 2XWBF 4KN6A 5JZMA 1TCVA 1UXHA 5JG7A 2FEKA 1E1CA 2WDZA 3E1SA 1Y8QB 3PJDA 4IDBA 4HXEB 1QFZA 1YS2X 4C88A 1M0SA 4EAQA 4YMIA 1IZ7A 3VUEA 5LP6B 1L5MA 1QFJA 4DT1A 3T3GA 2G9QA 5EE1A 3HKBA 3OFKA 5JS6A 3PFHA 1C7FA 3C6MA 3PUXA 4N0DA 3WGUA 1N0WA 2AG0A 4J0FA 3V7WA 2AR0A 3BFXA 4B79A 4PLWA 1NATA 2MT9A 4FNAA 3SIRA 2Z2XA 1Z8FA 2HIMA 4LJSA 3GVPA 2GSWA 5D7BA 1T2EA 2YWFA 3IC5A 5IVPA 5IAJA 4PN7A 4INJA 4BMOB 3LJKA 1U1GA 4MS4B 4N5IX 1RI5A 2CFTA 4IX9A 1SA0B 4NQRA 3TECE 4CMEC 2HNAA 4C2AA 1VDZA 3G85A 2X2EA 3V48A 1LRLA 2H08A 4LPSA 1RRVA 3AC0A 1CNEA 1O94D 5KYKA 1KZYC 2G63A 2WJYA 2C3PA 3NAGA 3Q87B 4IWYA 4NZOA 4QBKA 3E9NA 2DC1A 2G5GX 1WMEA 3O3NB 5EFOA 3WL7A 3MJ4A 2XE6A 2JASA 3GJ4A 4ZCLA 3TTWA 1SIBE 1TTQB 1FSSA 4RLHA 4MUEA 4QBTA 1Z7GA 4QYTA 2OAEA 4PYNA 5HXAA 1HYHA 5E2IA 5IP5A 3X0DA 3OKCA 1JDUA 1UANA 5LPNA 1RU3A 1QIGA 1CC1S 1RNLA 5CT5A 5KYXB 2ZUVA 3LX8A 4GZ6A 1Y9DA 2YYZA 1Y3HA 4IVPA 2QNIA 4PYKA 4RADA 3WYGA 4AG6A 2FPOA 2LKDA 1KXZA 3PD0A 4M8SA 4RVSA 4DT1B 3EGOA 3MCTA 1H85A 4R2MA 2CZGA 1CR0A 2HADA 5AI4A 4BLTA 2X9NA 1FS5A 2X13A 3C5WP 2IS1A 1UFVA 5JAIA 1H4SA 2PBLA 2C96A 1GNPA 5EL0A 3VXKA 4Y6OA 4TRMA 3HN7A 1EVKA 1RS0A 2K4MA 2QW1A 5EAIA 1GTZA 3E1GA 4W5RA 1X94A 1M72A 2W2PA 3FMPB 2R65A 3G5MA 5KHOC 3DCJA 1YRBA 1N1MA 2J7PA 4ZQCB 2XX3A 5G1PA 2H9AA 4RD2A 1Z6GA 1N3BA 2PIAA 2ZJAA 2VP3A 4RPCA 5K8JB 1QYWA 4LDZA 4ZCTA 1NVXQ 1R0CA 1PG0A 2AW5A 3OAAA 5JATA 2Q46A 1TZMA 2IP1A 2UYOA 4MVWA 1LBSA 4D3FA 6REQB 4FDVA 3W5CA 1L7EA 1LLQA 3ASYA 4K0KB 3WIDA 1B7GO 1KNQA 2YXDA 3ROMA 2XMZA 1EXVA 1HE4A 3UT6A 3VSAA 4BQFA 1WE2A 3CW8X 3RS7A 5HDQA 5K3CA 1CR4A 2W6PA 1WQ3A 3HFJA 4GOND 3X2FA 5BOSA 1T34A 1XZQA 4IL5A 2SBTA 1LVUA 2PRJA 2PZAA 1L5OA 4YA6A 2HDNB 1YDMA 5AW1A 1YS1X 1P33A 4R9NA 1MTZA 2YIMA 1BVYF 1KEPA 2RJOA 2TMKA 3NYIA 1N2JA 3G2LA 3T9DA 3TE7A 2HUNA 4AKHA 1T6NA 4MUJA 1I2DA 4A0GA 2CVHA 1FFAA 2NU7A 3KD3A 3JD2A 5L40A 4V0ME 1NJFA 1THGA 4IIJB 1TIKA 4XJVA 3W4IA 2CL0X 1CF2O 1G5RA 3N05A 4RH0A 2R62A 3W9YA 5AIBA 5TT0A 2XMBA 3STWA 1FJXA 5AW2A 1FRVA 1WXGA 1FS4A 4GC9A 1OY1A 2REBA 4GWLA 5G3ZA 2ZUFA 4UU7A 2R7KA 5JLAA 5JCJA 2F55A 3VR2D 2Z5VA 3AR3A 1GFWA 2WZQA 3ER6A 4JBGA 3COJA 1PUIA 4PPNA 4G4IA 3OU6A 5AKGA 3R74A 3VFDA 3BYZA 3Q8WA 5HS4A 5F9FA 3QOYA 5NLLA 1I36A 2EWVA 2HQBA 2YBEA 1Y3BE 2WAXA 2ZRMA 3DWEX 4NL4H 3IXLA 3SYLA 5KNDH 3PQFA 4Q1DA 1NHGA 2E4UA 2ZYRA 4NMLA 5HRCA 4S04A 2OXCA 1YSCA 3QX7A 2HCRA 3GRKA 4MK4A 1JEAA 4Q7LA 2IIPA 4GP9A 1XDGA 4XCXA 2CXTA 4PHGA 4Y6LA 2WAAA 5EJ9A 1UFKA 2DSTA 1AM4D 1FFSA 2GJSA 1SQFA 2GZHA 2K2QB 5LQDA 1WR8A 3NWEA 1U11A 3DEJA 2G77B 2QLLA 4EL0A 5AUPB 1WKVA 3W1WA 3JALA 1QH8A 2XNDA 3I9OA 4AKTA 1K3FA 4WJKB 4AJ1A 2DAPA 2AEEA 2R8EA 2VC2B 4MYSA 3RHFA 1KKMA 3CG0A 3UQZA 3TM5A 3OCWA 4LRXA 5B37A 3LC2O 4UTNA 1AN0A 1KORA 2AL7A 2BFFA 4TTPA 5CBPA 5JIBA 2VDPB 1DIGA 1EDEA 1JG3A 2XMDA 5E8JA 3HRKA 3FDZA 5FULA 1H1LA 1SC4A 1QQTA 3U7FB 4IRXA 2O3SA 4UBKA 1CY2A 2O8FA 4BVAA 4QNRA 1QQ6A 1ZYUA 3P9KA 3E27A 3AR2A 4U7TB 1Z25A 1OV6A 1X3SA 3U40A 2NX2A 1ZD5A 2EC5A 2D06A 2PGXA 2L19A 4CFSA 4TVSA 1UAAA 3ABOB 4AJEA 1RZRA 4MHOA 3QYAA 1WDTA 5CVEA 2J30A 3IV9A 4CRWB 1E9EA 1HZZC 4R81A 1PVOA 4XB6B 4P81A 4LZJA 4RTOA 4ID3A 4REQB 2BFDB 5GV7A 3MRXA 4PEVA 4XPIA 3LC7O 1E6WA 4BFLA 1UP6A 3DAOA 5C8VA 3GEPA 4K6CA 3IJPA 3LUPA 3QPCA 4IDCA 1US8A 2I3AA 5GGXA 3U7QB 2QRMA 3ZHZA 5CPFA 2SKDA 4BKOA 5CK5A 3X1KA 1V6AA 4W5HA 2KS6A 3C98A 3CBQA 4MDEA 1LLCA 5BW6B 1KEUA 2NO6A 5EQDA 1HE8B 3HO1A 1U4NA 5FXMA 5BPFA 2WFAA 4NYIQ 4FNGA 1TTPB 1LDMA 2AHOA 2YR0A 4LGYA 2LRHA 2QX6A 1BMFD 2CY0A 3FUUA 4UU1A 5DEOA 5FBHA 1HSZA 1MX3A 3UK0A 3WY9A 4FOPA 1XD8A 3E3NA 1BMQA 2Y05A 3IP8A 4KXFB 5JVDF 3TNFA 3H7IA 3ZE2B 4HEA6 1MJGM 3H99A 4JV5B 2QTBA 2FZCA 2NQTA 4ARSA 2E5FA 4LDPA 1GILA 4R1LA 4RK5A 1NVFA 4ZKDA 3UMYA 1QRUA 4JIMA 1UZAA 4Y2SA 1M8GA 2B25A 1VLVA 1Z5VA 2NZWA 3G8DA 3KEGA 4L6CA 4NCHA 1ICIA 3MLEA 4UREA 4X44A 4ZYTA 4Z9FA 5J47A 1N5MA 3LBHA 3E3MA 2F1IA 3KCQA 3PYMA 5BSHA 3AVPA 1W5AA 3D7MA 3EG9A 5I7FA 2OY0A 2YX1A 4JWTA 6YASA 3O91A 5DZSA 2FLKA 1QH0A 4B6QA 5JT1A 3QBJA 3R2JA 1RQPA 1J2JA 2B3TA 3SKYA 5L3SA 3K71B 4FKBA 1NW6A 3KJEA 2XMPA 3L4BA 2VRCA 2N46A 2C2WA 1N2ZA 3E2PA 1VKZA 3MTAA 3EIFA 3QPUA 3CF4A 1ZW1A 4MYHA 3PWKA 1WZUA 1A50B 2QMZA 2DX7A 1I94B 5FUBA 1R9GA 5JEEA 5K99A 2G0TA 2PQMA 4HADA 3PJRA 4WXPA 4OAOA 1O87A 3KUDA 1C50A 2VOEA 5D87A 1XZHA 3GCWA 1YNSA 2BGMA 3N2KA 1E6EA 2NO0A 3VKWA 2B7BA 1MIOA 2ZYDA 1GDDA 3QELB 4N4AA 2D1SA 2YYAA 1ISPA 3DW3X 1PWEA 1YH3A 3QWHA 2V0GA 4UXJA 3EIOA 4QG3A 1F14A 4UHHA 2JEOA 2VHEA 3KZKA 4LYHA 4XDYA 2C7RA 3AQ4A 2IC5A 2CLCX 3HG7A 1OC2A 1ORWA 1AF4A 3QK7A 4KIWA 4NU5A 4DAEA 1OIVA 2JI4A 4PPYA 2ONYA 2IY7A 3A4YA 1H8HD 2C9BA 4FD3A 4OYYA 2QHXA 4R2WA 3TZ6A 4GM1A 2JIPA 3A05A 3DEHA 1PHPA 1LA2A 1SMKA 3NETA 4WY8A 1ZHHA 4CG3A 3AVUA 1OIXA 3GT7A 3D8TA 5KVCA 2NSYA 5L53A 3UICA 3AKDA 1Q44A 3ROXA 2XB8A 2RHTA 3RVNA 3ILYA 4ER6A 3GJZA 1YUBA 2VBFA 4GHWA 1KDVA 2HXSA 3B36A 4DMLA 5I51A 3ENNA 3I9JA 1GTL1 1IOVA 2FOXA 4YI5A 3VO1A 4RTRA 1JQKA 1UQRA 3PL1A 5TS2A 1VBMA 4HTFB 4QYIB 3OIDA 4LYFA 1OZGA 1WPRA 1BS1A 2MJLA 3BH0A 3KXPA 3LVBA 3GT3A 4C06A 4D81A 4UCQA 3ET4A 2FRDA 1CNMA 1XKXA 4F3KA 5HM6A 2DPYA 4EGFA 3W6ZA 1Z34A 4LYAA 4L0CA 4P22A 4TLDA 1QRTA 1MW8X 1BXRA 5ECGC 3WGHA 1KETA 2AXNA 2AKYA 3BZUA 3M5DA 3MMNA 1IPFA 1ZH6A 4QM7A 2EP7A 3GGDA 1Q0SA 1ZJWA 3AHIA 2XGGA 3TTYA 4JA0A 4DPKA 3NR2A 3VZBA 3HR7A 4YPFA 1Y34E 1POXA 3I12A 1TC1A 3AOEA 1KMQA 4J0CA 3B89A 1PN3A 2D0OB 3MOIA 1LK5A 3K4PA 2OD9A 3THYB 1BMTA 2XOXA 3IVXA 3LAWA 1RYDA 2LCFA 2JD1A 2ZBVA 2ZZKA 4RPLA 3IALA 3A6ZA 3DZBA 1EGHA 4NBNA 3ZWAA 3ZTYA 4CI9A 4E2FA 3BAZA 2NTJA 3GVHA 3LRPA 1JG1A 3NWPA 4GWGA 3LO5A 5TS3A 4XVCA 2JFGA 4HY3A 1JI3A 5AQEA 4XB1A 4DQUA 5K3BA 2NPIA 2VSQA 3TNDA 3O3OB 4XTCS 4BNUA 4P8RA 1KOLA 3L6RA 2ZQ5A 4FYVA 1KDOA 4M1ZA 5BWLA 1DJPA 3KVVA 3C6XA 1K88A 4NCXA 3IKJA 2QSZA 3ZNNA 4J8PA 2PANA 4ZO6A 5D3KA 4A91A 1PJ3A 4F4IA 2RSLA 4LDQA 3C5CA 1HLPA 1YNOA 2BFCA 2VBIA 1PFYA 1E5DA 1FLDA 1PUJA 2BZSA 2YQ5A 1T8WA 3OZWA 5IC5A 3ZEAA 3AF6A 1D1PA 1I6KA 3NHBA 5J4HA 1NASA 1MJGA 1ODSA 1RWWA 1UINA 1XKQA 1TYDE 3KSUA 2JCGA 3IVAA 3MMSA 3OE7D 2ZJ0A 1XJCA 3TYXA 4WKPA 3WNCA 1MZVA 2Y0PA 4I5IA 3NHKA 4DDKA 2QVXX 2W6JA 3AJDA 2RGGA 1XQ1A 3ESZA 1EP3B 4QOSA 2JW5A 3CRMA 4KP7A 4OH7A 3GROA 2HNKA 4JXKA 2F6RA 2VHWA 3CB4A 3OZBA 5FR2A 1KAMA 4J75A 2XTNA 3OWXA 1JIKA 1VJDA 4D6YA 1KO4A 4C7JA 3UCFA 3R9IA 4QQFA 4PFJA 3HJCA 2POCA 2WKWA 3CX3A 5LZ4A 2WHPB 4S0XA 2H54A 3FFWA 3UUFA 4A0QA 1EFRD 3DONA 3QW2A 4IDPA 4EJ6A 3GLVA 2DULA 1GDTA 5EIAA 4NZPA 3H4IA 3ZH2A 4EATA 4YFVA 3DR3A 5HOQA 3G5TA 3JD3A 4PANA 2MSNA 1XXLA 3TRHA 3SC6A 4LWPA 2A0YA 2GFQA 4P7KA 2JFWA 3CZ9A 1Y33E 3A3NA 2LDBA 1LF0A 2JEZA 5GQSA 4QUHA 4DJJA 5A5VA 3A9WA 3QVOA 1U9IA 2F1RA 4B84A 4BVFA 2JL1A 2UUPA 3UJNA 2GEBA 1NHWA 2BBTA 2JGMA 3AR8A 3JQRA 3O83A 3BS4A 4HGPA 4HQLA 1QIIA 4Z8XA 3R8CA 2XJ4A 3AUJB 3VBEA 2JIZD 5AKYA 1VHQA 2Z6QA 1S2MA 3E61A 4FILA 4ZQGA 1JZQA 5K51A 3R6GA 3AM1A 3RSZA 3VR2A 1BYIA 1KQOA 2OB2A 1KNXA 2QMEA 3EDMA 2GM5A 1AZTA 4E2XA 2W43A 1Z36A 3T9AA 1UPUA 1UZMA 4M8IA 5ILQA 3PWZA 1H2ZA 1UM9B 4J29A 5JJ5A 3GP5A 4QKQA 2R84A 1VKJA 1I6MA 1V8BA 5T4EA 2GLTA 2JAUA 3A9VA 3GI1A 3EQ8A 1Y4ZA 1DAHA 3F6CA 4L85A 4UM7A 2X3UA 1N9GA 3ICOA 3HCCA 4HP8A 1IBSA 4ZJYA 4HRXA 3SGLA 1JB9A 3GAAA 1MJ5A 5MN5A 3GUYA 1Q83A 3D8NA 4FBGA 4H0CA 4RH3A 4DLUA 1TUEA 5JNTA 2Y1GA 1Y98A 2OCBA 2KJQA 1OHHD 4CMIA 1WBBA 3VVCA 4IMRA 4HAUA 3CN7A 4H31A 1NJ6A 1JNXX 1BXKA 2GFHA 3PE4A 5CLIA 3FSEA 1OPRA 3C7AA 3NM5A 2YMPA 4KDFA 4P6VF 3RIGA 5LU9A 1ZVVA 5DN6A 4AJHA 3EQ9A 2F90A 4MIKA 3BBLA 3FOZA 2J41A 2PL9A 1KJ8A 5DGXA 3ANNA 4HAYA 4ABTA 2O8FB 3TW8B 2C9OA 4WCFC 2C2MA 1HRKA 1XDWA 3WWYA 4C6RA 2AHRA 3SZOA 3FPGA 3A9CA 3DP9A 1WV1A 2R47A 5B1YA 4PPFA 2DB3A 2G83A 3FJOA 1VI6A 3GNLA 1U7XA 2G25A 3NYQA 1JH8A 2Z8XA 3RT9A 3N87A 5I7EA 2G9UA 621PA 3GXOA 5EIHA 1UMCA 2WTMA 3NXKA 4HAXA 4KIGA 3I01A 1Y6ZA 5KJFA 3NTXA 1U5BA 3MAGA 3OTWA 4E5NA 1JEYA 1T4MA 1X2BA 4KPUB 4UBIA 3REFA 4X6XA 4YJHA 4DLLA 5L6LB 2Q3JA 2HSWA 1O58A 3L0IB 4FINA 2JBHA 4I3FA 4OXYA 4OMDA 1R6DA 4TQ9A 3FX2A 4YUXA 1IU9A 4RVHA 4IUBS 4OHZA 2ZE5A 1XMPA 4AF7A 1KDTA 2POQX 1CBUA 1XEXA 3HWRA 4BDTA 4MCIA 3BGDA 1V5FA 1D0SA 4H4EA 4WY5A 5KSPA 5JO0A 2ZB3A 3EZFA 2B5WA 3PIIA 3TQOA 4DLTA 2JZNA 2WQ6A 1RWBA 5A6SB 2EJCA 2QZZA 2QJWA 4CCYB 3B2QA 1VL5A 2Q4DA 3L8EA 5CPBA 4ECAA 5EWJA 3EZ7A 2QRQA 4TS4A 2IH4A 2J0UB 1C3LA 1OVGA 2IHYA 3R0XA 3UAVA 4GNRA 1BMFA 4J94A 1YQGA 3R7WB 1MVNA 4WESB 2J6HA 1LW7A 3QG1A 3R3ZA 1NOIA 3HBNA 4LCEA 2DBVO 3B52X 4GNKA 4NU6A 5K3OA 2O5CA 4MKFA 1Q3HA 3LHKA 4XVQA 2W22A 4X0EA 1XZKA 2C84A 1Q1EA 2BM1A 5JBNA 4A1OA 1UEIA 1YR2A 2HWYA 3TDKA 5EHNA 2HJHA 4RF2A 4C3ZA 2ZRQA 3OLWA 1U1FA 3F6YA 4MJLA 1YE5A 2VZEA 4DL9A 2I65A 4PYOA 1Z2NX 2CNWD 2Q0QA 4MTLA 3QV1A 2WQZA 3L1UA 4Q7MB 4F1WA 1YMQA 1RQNA 1UPTA 3JTMA 2DZDA 4KWTA 1NRIA 4O4IF 4KXQA 3IJRA 1JHVA 4QDZA 4ZA2A 3U3KA 3W06A 3KKPA 3RRFA 3BPSA 1S2GA 4JODA 1CTQA 3VR5A 1O5IA 4BB9A 1E8DA 4RUKA 5JC8A 4HQFA 3HB1A 1CE8B 4E5YA 4LBZA 3D4PA 3LBFA 3ZHRA 4CDNA 3PQCA 1RABA 4MIEA 4C2TA 1VL1A 4CQJA 4XJSA 3EY9A 3U9TA 5E3IA 4EG6A 1BDBA 4JI5B 1J09A 1L5YA 1RHUA 4G36A 4QM6A 2BTQA 3F5SA 1CZLA 1N78A 5BNIA 1PO7A 1RYMA 1T6YA 2D3WA 3SEAA 2F9MA 1EVQA 1YBAA 1WXQA 2LNDA 5DP2A 2YINC 3NORA 4RGBA 1IM8A 2Q49A 3MVEA 2I4MA 3DL2A 3OT1B 3S70A 5ALLA 4CTMA 3OPQA 2ZSAA 2P5UA 3PIRA 4LHEA 4IKPA 1M6WA 5IDYA 1GDHA 3VJMA 2DPHA 1CW2B 2C94A 1GUAA 1DAOA 2H29A 1B6RA 1T6XA 2CGEA 1WXIA 2JFOA 2JFZA 2LZ0A 3QU4A 5GAJA 4UAGA 1C2YA 1O7JA 1YZKA 2H65A 1ZM3A 1EE2A 2ZBQA 3H65A 5ALSA 4BQEA 2R9VA 3OD1A 3MTIA 1TZ2A 4JNKA 2H52A 3OX4A 4ZAGA 5IYZB 4KFTA 1QE0A 3MMPA 2R751