2FUKA

Crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
218
structure length
218
Chain Sequence
b'NPLFPTESAALTLDGPVGPLDVAVDLPEPDVAVQPVTAIVCHPLSTEGGSMHNKVVTMAARALRELGITVVRFNFRSVGTSAGSFDHGDGEQDDLRAVAEWVRAQRPTDTLWLAGFSFGAYVSLRAAAALEPQVLISIAPPAGRWDFSDVQPPAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMPDTSHFFHRKLIDLRGALQHGVRRWLPATP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XC6422 protein
molecule tags Hydrolase
source organism Xanthomonas campestris
publication title Structure of XC6422 from Xanthomonas campestris at 1.6 A resolution: a small serine alpha/beta-hydrolase
pubmed doi rcsb
total genus 63
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fukA00
3BJRA 4YASA 5A62A 4J0JA 4Q34A 3UMJA 5ALMA 4FDMA 2WFZA 1FSSA 5ESRA 4JH0A 1AC5A 3DL7A 2HU7A 1X70A 4H0CA 2WG2A 1EDBA 2VA9A 2GZRA 3F8SA 4FMPA 1FFAA 1HKHA 2BUAA 5AKHA 3R41A 2XQFA 3D2AA 4Y2VA 3LLCA 5HQ3B 5AM3A 1VA5A 5K5EA 1Q0ZA 2YASA 1P0PA 4DYHA 4AO6A 1LLFA 2G5TA 1C4XA 4DNFA 2C0PA 1ZI8A 5IVKA 1MPXA 5AM1A 4P93A 3G9TA 5K3DA 3R3UA 3VXKA 3G9UA 4H7IA 3CCCA 4HVTA 5EHNA 1XZHA 3OPMA 1CUYA 4C87A 4K6KA 3BF8A 3JW8A 3S2ZA 3SK0A 1DT5A 4ZGBA 4BVJA 2WIFA 1EB9A 3D59A 4F0JA 4P08A 5AIAA 4DSZA 5ALZA 2WUFA 3IB3A 5AI8A 1AGYA 1BU8A 1YAJA 3C6BA 5JANA 4BCDA 5HFNA 4J0DA 3DQZA 1EI9A 4X6XA 3I2IA 4FFWA 5K3EA 5BWCA 4HRYA 1JT2A 5IH7A 2WU3A 2HA3A 4BYMA 1XRNA 1XKLA 1THGA 5KWJA 4Y7DA 1TCAA 2QMQA 4FBLA 5A7GA 1QIFA 4CG1A 4G4IA 2X5XA 3SX4A 2JEYA 3ZI7A 4PF1A 2XQIA 4B80A 1F0PA 1VE6A 2DHDA 2ROQA 2BUCA 2J4CA 5JARA 2VT6A 1F8UA 2I78A 1XZKA 5CURA 3PF9A 1CUCA 4GLBA 1SCIA 1Q83A 2ECFA 5ALJA 4J0IA 1MN6A 1LGYA 3UUFA 3QITA 5CT5A 3TJMA 2XQGA 1LPAB 3ZLUA 1N8SA 2Z8ZA 4G4JA 3FVTA 3WA6A 3EBLA 1KU6A 1Y7IA 1VZ2A 1UOPA 1LZKA 1Y7HA 1VXOA 4UBMA 1CRLA 1EVEA 1XZGA 4E46A 1DWPA 2RGUA 4FLEA 4DMFA 1ZGBA 2RHWA 4Q3OA 1CLEA 4UHFA 4OB6A 3DOIA 3A6ZA 4U2CA 3WK4A 2FJPA 1CEXA 2XUAA 1VKHA 2JGJA 2GZSA 4XIIA 3N2ZB 3G0GA 2GBIA 2OCIA 3FYUB 4I4CA 4UHBA 2V98A 2HADA 2PSEA 2XLBA 4IH4A 1PJAA 3IULA 3HI4A 4WFJA 4S0XA 2PSFA 1EA5A 1ISPA 3STXA 1ZIXA 2WUEA 4H7DA 3DDUA 2BJHA 4NZZA 1HBJA 2RAUA 1TK3A 2RONA 4UFNA 4W1QA 4FOLA 5FPQA 5AK3A 3E0XA 3WWEA 3Q8WA 4QZVA 3A2LA 2OLEA 5JYCA 5K3AA 1CUZA 4NMWA 3KWJA 2XUHA 2OQVA 3I1IA 2C5GA 4W1SA 5ALUA 4TGLA 1IUNA 4Q82A 1E3QA 1E66A 5DYYA 2EEPA 1ZIYA 1SCKA 3CN7A 3K9BA 3HC7A 3B5EA 1X2EA 4ROTA 2QVBA 4G9GA 5F4ZA 3CXUA 2NW6A 4BAGA 5LZ5A 1CUHA 3QVMA 4ZV7A 3OURA 1BN7A 3D3NA 5HF8A 5DNWA 3D7RA 4H18A 4HXEB 1A8UA 3O0DA 1L7QA 3QPDA 1AMNA 5FUMA 1S8OA 4EY6A 5ALYA 1CPYA 4AX4A 2AJCA 1ETHA 2HM7A 3O9VA 1UT6A 2VJBA 1W76A 1ZD4A 2PPLA 1XZDA 4BE9A 5ALWA 4C01A 1CR6A 4GEGA 2OCGA 3U1TA 1QE3A 4BE4A 5AKLA 1RYYA 1QIIA 1YR2A 2PSHA 2PVSA 4LXGA 4AXBA 5HZGA 2C0QA 5ALIA 5T4HA 4UBOA 1A7UA 1XRRA 4LXHA 1VE7A 4IHAA 4ETWA 4KACA 3H0CA 2FX5A 1UWCA 3K6KA 1MX1A 1XRMA 4QDUA 2HHAA 1GQRA 4BC0A 4X85A 1QTRA 4LKOA 5FDFA 2ONCA 5BWBA 1JKMA 5ALFA 3WMRA 4QE3A 2WHPB 3VVMA 5IVHA 5ALXA 3ESCA 4BVKA 1ORWA 3W04A 4KAAA 2XUJA 2CKMA 3W9BA 4K5QA 4Y2UA 1MNQA 1R3DA 3V1NA 1CUWA 1TRHA 5CTAA 3I1YA 5HF6A 2E3JA 4MXDA 3VVLA 5JASA 5CT4A 2IIVA 1T4MA 2WIGA 3V1MA 1MAAA 2XT0A 4FNGA 3H2GA 2HA5A 3EQ7A 4BZZA 3C5VA 4DNOA 1CUEA 5JD5A 3WWPA 1XZFA 4HRXA 2C5FA 4XX1A 5AP9A 2VT7A 2WSLA 3M82A 5JATA 5JAHA 5DNVA 4GDMA 1XRQA 4W63A 2HL6A 4I19A 3MGAA 1UK6A 1W4LA 5HCUA 1IUOA 2XQJA 4XJVA 4Y2PA 4BDSA 2WIKA 2RI6A 3V1LA 4OB8A 2WUGA 1LPSA 5AIBA 2WUDA 1AZWA 3QPCA 1G42A 1QONA 1U65A 5LKAA 4ZV9A 1HLGA 4CCYA 2H7YA 1ZJ5A 2QM0A 2CEKA 4UBLA 1DX4A 1W6RA 4H35A 2HDWA 1R9NA 3I2FA 4C4XA 3FVRA 2XUPA 3GUUA 3IUQA 5AH0A 2CB9A 1R88A 3WL8A 1R4ZA 2OGZA 4A5SA 4UBNA 2R8BA 1ZOIA 4BBZA 4BB0A 4X94A 2FUKA 2VJAA 3NOXA 1RP1A 1IZ8A 1VXRA 1GT6A 1N5MA 3WZMA 3DNMA 3ESAA 2C4HA 3ZLTA 1QIHA 4H7KA 1GGVA 1XQWA 2DSNA 3IUMA 1E8MA 4GHWA 3I2HA 2JGFA 3STWA 5IKXA 1C7IA 3YASA 4AZ0A 3WWOA 3GROA 4G8DA 4NVRA 4LHEA 3FLEA 1K63A 1TCBA 1ACLA 3OTQA 3V9AA 2PU7A 1GKLA 1DTEA 3IVMA 5EIEA 5CRIA 4YX9A 3ZLVA 3S8YA 1Y37A 3CCBA 1B41A 5J3JA 3C5WP 4B9AA 2YH2A 1AQLA 5CW2A 4QLAA 5K3FB 2OXEA 3RARA 3O4HA 3I2JA 5SYNA 2BUBA 1XZBA 3KXPA 3F9CA 4BAUA 4BAZA 4YPVA 2QT9A 5KREA 1WPXA 4B82A 4BCCA 1UOOA 1WHSA 1FFEA 4Y9SA 3HYSA 1JFRA 1QZ3A 2Z3ZA 3MUNA 1CIJA 2GYVA 4FTWA 4Y2XA 1BRTA 5JAOA 2XMBA 2WM2A 3L1IA 5AOAA 3M81A 2C7BA 2CJPA 3KOOA 5DLPA 2J3QA 2WJ4A 4N8EA 5JZBA 1U8EA 5AI9A 3AINA 4OPMA 3G8YA 1MX5A 5E4TA 2XLCA 5K3BA 3NWOA 3FYUA 1DINA 4X90A 3JWEA 2B20A 4X97A 3RM3A 3WIBA 4U2BA 5AI6A 1DU4A 3M3DA 2QTBA 5AM2A 4FNMA 4OCZA 4DMKA 1MT3A 5AKGA 2QR5A 1LNSA 3EIOA 3BF7A 3KSRA 4Y2YA 5DTIA 4J7AA 2JGIA 4Y2RA 4M0EA 3O9MA 4Q3LA 4QLOA 1GPLA 1QIDA 2BAGA 3D5EA 5ALPA 1D07A 1YA4A 3DYVA 5DTJA 5CXUA 5EHZA 5AKYA 1QIKA 2ZYIA 4X95A 1QTIA 1N5RA 2AJBA 1XLVA 2ACEA 5AK6A 2PKYX 1BN6A 3BIXA 1P0MA 1N1MA 4Y2QA 1JU4A 2VF2A 4KE7A 1QO7A 2Y6VA 4Q05A 1JMYA 3AZPA 1IMJA 1G66A 2PUHA 2CZQA 2JGMA 5LZ8A 4J0GA 4K6GA 3BE8A 1U2EA 3ANTA 3QMWA 2V96A 5AOCA 3C8DA 1QJ4A 2XE4A 4FFVA 3A2NA 2WFMA 3O95A 4PO3X 3KWFA 4UPDA 1L7AA 4UHCA 1AUOA 4G9EA 4Y2TA 3QYJA 4K2AA 2XUQA 1WHTA 1YS1X 3VDXA 5LP1A 2JF0A 2XUFA 2QS9A 2LIPA 2HA0A 3HSSA 4KRYA 2WTNA 3DKRA 2HA7A 3H2JA 4L0CA 4U2DA 3AIOA 4INZA 4MWTA 3BJMA 1DT3A 5BOVA 2JEZA 2CUTA 4U2EA 5A71A 5FV4A 4ZRDA 3C6YA 2OCKA 5AK4A 2VJDA 3DCNA 5CH5A 3KD2A 3D2BA 2HU5A 3DEAA 4N5IX 5ALDA 1Q0RA 4AN0A 4EY8A 3FOBA 3STYA 4QWMA 4CFSA 3GFFA 4B84A 1YASA 3G0CA 3PDCA 5EGNA 4BRSA 4BDTA 1OCEA 3PI6A 4JEIA 4IH9A 1BROA 1CUDA 3LIIA 1OXMA 4ITVA 3WL6A 1SCQA 1USWA 2ZVDA 1VOTA 3G7NA 3G9XA 1UZAA 3BIWA 5C8VA 2DQYA 3AIMA 5EHQA 4BZWA 5I9IA 3C87A 5A7HA 3HABA 2HFJA 3H2IA 3WJ1A 2WIJA 2HU8A 1MU0A 3EQ9A 5D3KA 4QA9A 3FYTA 3PFBA 1ZICA 5I8PA 3G9ZA 1XLWA 3IBTA 1GQSA 2WJ3A 3HRHA 2QUBA 3AFIA 3WKEA 4H7HA 5KWIA 4OYLA 2ZYSA 2GBCA 3OM8A 3DS8A 3R40A 3G0DA 1XZCA 2B9VA 1HQDA 4P92A 1ODSA 5CXXA 2WHQA 4GWLA 1JJBA 4MWSA 1WPRA 3ICVA 2O2IA 4DM7A 3QPAA 3O4JA 2PUJA 3DD5A 2XI4A 4GECA 1OILA 2Y6UA 2HRRA 2AJDA 2QOEA 4JYPA 4W1RA 3AZQA 5ALQA 2DQZA 4AQDA 4DNQA 4CG2A 2GBFA 2RHTA 4PSUA 2D5LA 3SC2A 1O6FA 5AKZA 3TEJA 3WL7A 1T2NA 3LS2A 1J06A 4Y2JA 2RIPA 5CBKA 1H2WA 3B12A 2XB6A 2XMRA 4EY4A 1EH5A 3FLAA 3H17A 4HXGA 3GZJA 1J1IA 5JD6A 3IDAA 3H2HA 1GZ7A 4EA6A 3I6YA 4L3WA 2QKYA 4B81A 4X7BA 3AIKA 5T4FA 4C6HA 1P0QA 4FWBA 4J0CA 1ACJA 5IVDA 1YCDA 3LIPA 5JAUA 5A2GA 4B83A 3RLIA 3FLBA 4X00A 2CMFA 3WYDA 5AM0A 3HEAA 2WU4A 1QO9A 1ZD3A 1UK7A 5D6OA 4AMZA 1XRPA 3VJKA 3VISA 4I3FA 1XQXA 2WG0A 4A16A 3WK7A 1EDDA 1CUUA 1CUFA 1H23A 5AM4A 2X8BA 3VKFA 4N8DA 2VEOA 3IA2A 3F98A 5HK9A 3W2TA 1DQYA 2O2GA 2PM8A 3M83A 2Y1KA 2WJ6A 3O4GA 2OAGA 1QIEA 4ZREA 4RGYA 5ALHA 1UFOA 4Q1VA 3E3AA 1ZI6A 4ZWNA 4WY5A 2ZYHA 1EXWA 2UZ0A 1MTZA 4XVCA 1LBTA 1CUXA 4UBKA 1YSCA 1ZJ4A 1H2YA 1TQHA 4K6HA 3IUJA 3NUZA 3F96A 3C45A 1Q84A 1IVYA 5E4YA 3R3ZA 3DLTA 4WDRA 2XUIA 2PU5A 4WJLA 2EDCA 2VATA 1XZLA 3WKDA 3U0VA 4GW3A 2H1IA 4OU4A 5CH8A 4DGQA 2DHCA 3N0TA 5JZSA 4J03A 3R3XA 4W9RA 3TRDA 4FLMA 5E4JA 3A2MA 2Z8XA 1SC9A 1BE0A 5ALEA 2OGTA 1MAHA 1NU6A 4GI1A 3V1KA 2WKWA 4Q3KA 4RNCA 4B0PA 3FWHA 2BCEA 4MEBA 3STUA 4X91A 4LYEA 1ORVA 1DQZA 2O7VA 2VQ6A 3ZPXA 1UXOA 5AKIA 5HQ3A 1MX9A 2X76A 2FJ0A 4AB1A 1AKNA 4KRXA 1R9MA 3UUEA 4L72A 5D3ZA 1FFBA 1JI3A 4OD0A 4PV7A 2ORYA 1K5PA 4UUQA 1ODTC 3BL8A 4CCYB 3AILA 4AMYA 4PNZA 4J0HA 3WKCA 5AJHA 1QLWA 3C43A 3T4UA 3IURA 4J3JA 3H18A 4MQLA 1K8QA 2XUGA 3O4IA 3WKAA 2B61A 5LZ4A 3G02A 5ALRA 3ED1A 4M0FA 4G4GA 5AICA 4B0OA 4BCBA 3IIIA 1BEZA 1BS9A 1XZIA 2QZPA 3F67A 2JGKA 1VA4A 1K4YA 3BDVA 3WKBA 2W22A 1CFJA 1WB5A 1PV1A 2O2HA 3X3HA 4ZXFA 3HZOA 3I2GA 4KEAA 2AJ8A 3T52A 1CV2A 2XUKA 4KAFA 5JADA 4X93A 2I03A 5YASA 3FSGD 3H1AA 1UKAA 1E5TA 5AI5A 1G4HA 3PFCA 4E14A 5AKXA 4J0KA 2XQKA 1QIJA 4FHZA 3FYUC 3DYIA 4N5HX 2XMSA 3FSGA 1CQZA 1E8DA 2HIHA 3I6ZA 4AZ3A 3TGLA 3BWXA 5HKAA 3WK6A 4C88A 2H7CA 1XQVA 4LIPD 3VJLA 2AJLI 4QDXA 4OYYA 5EIHA 1C7JA 5LZ2A 4QWWA 2VSQA 3JYHA 2V97A 3HLKA 4E11A 5LLSA 5LIPA 2ZJ6A 1LPPA 5AO9A 4CG3A 3OOSA 2HRQA 2GYWA 5C8XA 2DFPA 2HA4A 5ALKA 1BCSA 5FP0A 1XZMA 4BVLA 2IX9A 1P0IA 5JD4A 1JU3A 2Z5GA 2IITA 3FBWA 1DWQA 5C7YA 1GXSA 1UKBA 5A6VA 4G5XA 4KR0A 3ANSA 1CUIA 2DHEA 3EQ8A 4PQEA 3Q0TA 2C58A 1EDEA 4F21A 5HF5A 4JYMA 1O6GA 5ALGA 3A70A 4G8CA 4WFKA 3WYNA 4B85A 2PSJA 4HAIA 2H9YA 3WK8A 5DYTA 1G5FA 3R3YA 1ZD5A 2XMCA 3GBSA 5DNUA 2BKLA 3RKSA 1QFMA 4LXIA 1WB4A 4WFIA 1Z68A 4FBMA 4RPCA 1GPKA 1VJ5A 3H04A 3WA7A 1CUVA 5EFZA 2QJRA 2G63A 2XDWA 2XMDA 2WG1A 5AM5A 1EB8A 1A8SA 2V9ZA 2ACKA 3BDIA 1BCRA 4AO8A 3DL4A 3GA7A 2QXUA 3V48A 5HFAA 1WM1A 5JALA 1LPBB 1MJ5A 6YASA 3ESBA 4MEAA 1UOQA 2Y2UA 2I3ZA 3I6MA 3C6XA 1UK8A 1FFDA 4QEKA 2WHPA 3H19A 1BEEA 5AOBA 1IUPA 5JIBA 1NU8A 4V2IA 1EK1A 3F97A 1QFSA 3W06A 3STVA 3CN9A 5JAPA 4QDTA 3BXPA 1IZ7A 1YA8A 1RWQA 4Y2SA 3MVEA 1LPOA 2JBWA 4UBIA 1CVLA 2DCMA 1TKRA 4KAJA 3WI7A 1MNAA 5AKJA 1YAHA 2WIDA 4UBJA 3DJYA 2O7RA 3LCRA 4FLFA 4KJXA 2J3DA 3IUNA 2BGNA 4OU5A 1JJFA 4IH1A 3D2CA 5T4BA 1CUJA 4DNPA 4UHEA 2XUDA 4JNCA 1HL7A 3W9UA 5A7FA 4B6GA 1X2BA 4HZGA 4CI9A 1HPLA 3WWDA 3R3VA 5HK8A 1H22A 5IVIA 1M33A 4AN1A 4KE9A 1THTA 4ARAA 2YYSA 5JZ9A 4L9AA 4MYSA 4ARBA 3QMVA 1CUSA 1ZI9A 2PBLA 5C8ZA 1XZEA 2PSDA 5ALSA 2Y2VA 2ZSHA 5H3HA 5ALNA 4EZIA 1ZD2P 2OCLA 2B4KA 5FRDA 3PICA 4HS9A 1KEZA 2JGLA 1EK2A 2XMGA 3E4DA 2WQZA 3QH4A 2ZJ7A 5HKBA 1TIBA 4D9JA 1A88A 1I6WA 1H2ZA 3I2KA 5AK5A 5ALLA 2AXEA 2PL5A 3ESDA 1L7RA 1XLUA 4EHBA 4HTAA 1CUBA 1EX9A 3FCYA 2ZSIA 3WJ2A 1VLQA 1YS2X 4MQMA 1GPNA 1FJ2A 4JUIA 3I28A 4UFPA 3PF8A 4IO0A 4NS4A 4BTLA 1XFDA 4WDQA 2XMQA 4ZI5A 4C89A 1XROA 1W75A 2WHRA 3MUOA 4MJ3A 2PX6A 3DKKA 2GYUA 5HF9A 4P9NA 4BRZA 4X6YA 4U2FA 2QUAA 5CMLA 1W1IA 2W6CX 1CUGA 3R3WA 2JGEA 3E1GA 5BV7A 2HA2A 4XWGA 2QRUA 4E15A 5I7UA 1E8NA 5KBYA 4TPKA 1QOZA 3B3QA 2D0DA 1DWOA 3G0BA 4B9EA 5FLKA 2DR0A 2YXPX 4C4ZA 3H2KA 3QZUA 4F60A 1F0NA 3WK5A 4U2GA 5C81A 1VZ3A 3D0KA 5ALOA 4X92A 2WILA 1ZGCA 2WLSA 3H1BA 2VTVA 3ICWA 2G4LA 1H2XA 1SOMA 4W1PA 4QNNA 4DMHA 4DSAA 4WCVA 5LZ7A 1MO2A 2VAXA 2ZJFA 1YB7A 2H7XA 5DYWA 5K3CA 1EVQA 4AO7A 1U4NA 4UHHA 4LYDA 7YASA 4O08A 3C6ZA 3G0IA 4C4YA 4Z49A 5SYMA 5AHXA 1XQYA 1UKCA 4RE6A 1R1DA 1J2EA 1YB6A 4CIAA 1FFCA 4YK7A 4UFOA 1B6GA 5ALTA 1QIGA 1EHYA 4QDOA 3HXKA 3OC0A 4EB0A 3WIOA 1JMKC 1QIMA 3D4LA 3WWCA 2OQIA 2K2QB 3L1JA 1NX9A 4FKBA 5CT6A 3FNBA 4MYDA 2QXTA 2ZYRA 1XZJA 3WK9A 3SWWA 2WFLA 5AI0A 1PFQA 2J4FA 1TCCA 4EY5A 2GBGA 1W52X 5FKJA 2Z3WA 5E2IA 1F6WA 4DLNA 4GXNA 4DTCA 1E89A 3PUHA 4UHDA 3AZOA 4H77A 3QMMA 5DJ5A 4G1FA 2HA6A 3PE6A 2Q0XA 5LKRA 1CQWA 4EBBA 4DMCA 3KDAA 4X71A 4BATA 5EIAA 2OPHA 3QBJA 1AURA 1A8QA 4H7JA 4BC1A 1QGED 3R0VA 1WB6A 3P2MA 4CIBA 5ALVA 1LPNA 5FXMA 1LBSA 4CCWA 4X3CA 2EDAA 5T4EA 2QJWA 4KE6A 5LZ9A 5LYYA 4PSDA 4BP8A 3FCXA 1DX6A 4M0MA 5FPPA 4KE8A 2BFNA 4H7EA 1R50A 4OUKX 3HACA 3VJMA 5D7BA 4PW0A 4TVKA 3LP5A 5AKEA 2BGRA 1ODCA 3ZWQA 3HJUA 5CH3A 4BP9A 2XUOA 4EY7A 4RE5A 4WY8A 4A23A 1TAHA 1AX9A 2XMZA 4QDZA 2CBGA 3L1HA 3NGMA 3ILSA 3QM1A 3PUIA 3WZLA 5FOQA 1GKKA 1CUAA 4PSCA 2OAEA 4H7FA 1KU0A 3WQHA 1LZLA 4EUSA 5AI4A 1XRLA 1XZAA 2R11A 1J07A 3ZV7A 1EINA 4B7ZA 2P8SA 5DWDA 3OG9A 4HXFB 5EI5A 1WCYA 2G5PA 3STTA 4N8SA 5CT9A 4X6UA 2I3DA 1HDEA 2WTMA 4OB7A 3W05A 3EF3A 3WLAA 3C8HA 2VJCA 4IQ4A 2HFKA 4DIUA 1XKTA 2ES4A 5AKKA 3WL5A 1LPMA 1JJIA 2JIDA 1K6EA 3AJAA 3C70A 4OSEA 3FAKA 2VAVA 3RK4A 5K3FA 3GELA 5CT8A 1SFRA 4KYVA 5EHXA 2OGSA 4GBGA 1WOMA 3DOHA 3K2IA 4BTVA 2WFLB 2OG1A 3AUKA 4G8BA 5ISMA 4F5ZA 1UK9A
chains in the Genus database with same CATH superfamily
1JYFA 4LMBA 1M7BA 4MTLA 1FUIA 3H3JA 1E2QA 1HDZA 4ZZ3A 1PVDA 4J0JA 1KHHA 5C32A 2OZEA 4B3DA 4BLQA 5KYWA 3FPKA 3EJWA 5ALMA 4YLYA 4DKJA 5LQDA 1E4OA 4DA9A 2WFZA 4OXNA 4TKMA 5E1MA 3EGIA 2YOHA 4OQFA 5H9VA 2BKVA 4ZHQF 1G5RA 2ODAA 4IIJF 2P5SA 3E9EA 2GMWA 2VYVD 3FGZA 3KX2A 1WXIA 2WG2A 2VA9A 1GV0A 3PR1A 4HDSA 1OOEA 2XCUA 3IEIA 3KQYA 2DUNA 5AOVA 1SUDA 2YS6A 1L7XA 2XQFA 3PUKA 2RGNC 4Y2VA 4IYRA 4IJ5A 4NFHA 2JLZA 3ZHCA 4KCGA 1Y1LA 3ZNOA 1FRQA 3UWDA 1RE1A 3CH5A 3N2GA 4M1TA 4IXTA 1WBJB 2OHHA 3QW2A 4GR5A 1OBFO 1XCPA 4PC2A 1EHIA 1S2NA 1P0PA 3D4OA 4QUDA 3UUGA 4DM3A 4DYHA 1DP4A 5IX8A 4L95C 1EFVB 3SXUB 1E1RD 3H1EA 3WR5A 1QP7A 4EZBA 1NG9A 2H1VA 1PFGA 2C0PA 3NYWA 5FQNA 1TA9A 1MPXA 1JUDA 4YAJA 5AM1A 1KDYA 4CEIA 4P93A 5DKFA 3HXLA 5FOWA 1E32A 3RAJA 5K3DA 2LIVA 2UYYA 3HU5A 1QQTA 3FWPA 4KIFA 2H5IA 5EIBD 2YQ5A 1O94A 3F5MA 4YAFA 4HVTA 1BYUA 3S27A 1E6MA 2AEFA 1LTKA 3DMHA 4C87A 4BLVA 3MAGA 3ZU6A 2X0FA 4B3RB 4PO9A 1I2ZA 3WL3A 3WRWA 1SBZA 2PUBA 1MC8A 5BPFA 4D6YA 1KVUA 1ID8A 4ZGBA 4ZGGA 5KYTA 3D3WA 1YFJA 1AUVA 3A1TA 1JWAB 4QEZA 2W70A 2W6IA 1MQAA 1BX0A 2WIFA 4MRNA 3CXRA 3D59A 2XGSA 1WCIA 4F0JA 1GFSA 2K7ZA 4P08A 4AZVA 1JF8A 2QX8A 1RD4A 3X44A 1E1LA 4DSZA 4K9LA 4OQDA 4XXHA 4N0QA 5I3CA 4IOJA 2H0AA 3PPWA 5AI8A 1AGYA 1BU8A 2WIBA 1NR1A 3CNLA 3C6BA 5K51A 5JANA 1LD3A 3MT0A 4TZKA 1U80A 2VHZA 5HTKA 4EHHA 1NE7A 5LMNB 1PDVA 1OBCA 3KVNA 1KI3A 4C2BA 1Z0UA 1NLZA 3DQZA 3RVQA 1JPVA 1VSBA 1HYBA 4LE0A 2ERXA 4RVGA 1SHKA 4NICA 4FFWA 3F7TA 3VUEA 4PZZA 3JZAA 5GM2A 3HI6A 1M34B 1YC2A 3E61A 4OFBA 3ZN2A 5BWCA 5F3DA 3L8CA 2P4HX 3J81k 3NOOA 1JT2A 1OLOA 1WO8A 2ONZA 2XRFA 3C4VA 4RFSA 3EG5A 1DFGA 2A5GA 3HR8A 4YCLA 2O2SA 2YXBA 4DBVO 2QD2A 3AUSA 3CX7A 1N2CE 4BYMA 2FR8C 1GGFA 1XRNA 2F1JA 2Y9PB 3AHCA 5ERGB 4KBGA 1Q1EA 4CE6A 4PZLA 2WSMA 1XAHA 5DK4A 3ZY6A 4CEHB 5KWJA 1V9LA 3KJGA 2Y76A 1GQ2A 2R0QC 1RYMA 5K0FA 2QMQA 2X9LA 5A7GA 1JXAA 1QIFA 1E3IA 2AG6A 2DZDA 4LJSA 5J9FA 3LE8A 3ZY4A 4CG1A 4ZVPA 4F3TA 4ZVTA 1J00A 4JHXA 1FRNA 1H4QA 3L7LA 4ISBA 1E9SA 2BPOA 1QOPB 2FPMA 2QUHA 1JQDA 1DDOA 2FE4A 2KB0A 3MTGA 4WCFC 5A5EA 2SKDA 4C22A 3WYAA 4B79A 5A0TA 2F1KA 2JIOA 2XWQA 3FUWA 4B80A 3M1AA 2C94A 3DEJA 3C7DB 2MSKA 2P9CA 3OQ1A 3EZLA 3PI7A 2DHDA 4RF2A 1JV2B 3S2GA 3AJ8A 4BNDA 3KPVA 1NYTA 2B3TA 2J4CA 1DZIA 1C30B 4RQBA 2IEDA 2L0XA 3ORYA 1C9EA 2G8NA 3PJDA 5AK0A 5FL7A 4JLMA 2BFFA 4TYPA 2C9BA 4NJEB 4W5NA 1ODLA 3TL2A 4RHXA 2O57A 3ZZTA 2QL5A 4NCJA 2I4MA 3TLGA 2ZM6B 2I78A 4W5OA 4JHLA 2IHVA 3VOAA 4J91A 2OENG 3MMSA 2H29A 1O97D 3UMBA 3OZTA 5LXTA 1G59A 3RSHA 1A9ZA 1YD7A 2VAWA 1W88B 3U7RA 3RSCA 2PKQP 1SCIA 1Q83A 1YE3A 3PXCX 4JBNA 5ALJA 1AMUA 4LJ6A 1HGXA 3I9FA 3INTA 5KHOC 3OJEA 4PRLA 1MN6A 1LGYA 5EPOA 2OBNA 3HA3A 2W11A 3OKPA 4HADA 2ZP1A 3DZBA 4CQMD 3I62A 3WV5A 4HGQA 1ONOA 1ZY2A 1GNVA 1HE5A 1YV9A 3DVAA 5KQLA 1I2DA 3R5SA 1C3XA 4CDMA 5MF6A 2JFGA 2BEVA 1XVLA 3WDSA 3B6EA 1DOHA 5JSQA 2EKLA 3UHPA 1JAHA 3A9RA 4JELA 4YJFB 3P2KA 2IBMA 4JI1B 4G4JA 3GBVA 2R96A 1DARA 4WOJA 1KU6A 4L9SA 2BEWA 3Q7IA 5KJ1A 4N1AA 5DW3A 5JMPA 5ICGA 1AV7A 4RK0A 4M1YA 1E98A 2H92A 2ZULA 1FTSA 2AOUA 4HB4A 4WKBA 3CRMA 4RTLA 4GYWA 2YV5A 2B8TA 4M8LA 5JJKA 4MUGA 1F2DA 2GTHA 2V59A 3BH6A 4L27A 5G0UA 2PEYA 4DMFA 4FCTA 3NDRA 3EG9A 3EVFA 1A9QA 4JJFA 4MRMB 1PDOA 1V2GA 1QYDA 3ASVA 4C6TA 3CG0A 2EFHB 1UT5A 4TSKA 3SHWA 3EISA 2X9QA 1PNQA 4Z0TA 3A6ZA 1OH7A 4URVR 4QVIA 2GX6A 1RBZA 3DSRA 4RTPA 4X7PA 1EQAA 2XYVA 3SE0A 4EHAA 2QX7A 2HCTA 1WMAA 2R97A 1TQDA 1AKTA 3O47A 1IZZA 4Q9LA 4YJHB 3UXMA 4NBKA 4BUCA 4NJMB 2VJMB 1NJGA 4XUGB 5GZ3A 4XLTA 3ROPA 1X0XA 3E7DA 4IJUA 4YUXA 1SRQA 5ULLA 1FXWA 1KI6B 2B1QA 3VR5A 5FTLA 2XVMA 3QLUC 3GD5A 2OORC 4IWNA 1O1YA 3BT7A 4EJ6A 1TMOA 4UHBA 4U7DA 2ZB4A 4YJ2B 4FE4A 2HADA 4H7PA 5FUYA 3GLIA 1IOLA 3M6IA 4CM3A 2EU8A 3IULA 3HI4A 4LSZA 1UQRA 5EIBC 2EKBA 1V3VA 2HLDA 1UF9A 3O8NA 1FU7A 1EA5A 2OBFA 2X1VA 3I1FA 3TTWA 3OIWA 1PZEA 2HV8A 3BJEA 4I9FA 1LS1A 1NPYA 1YCGA 2GPAA 3FPLA 2AOWA 3HMKA 4WZAA 2GHTA 1ULTA 1M75A 4DJFC 4EL5A 1GTRA 3TOZA 2MSEB 5FWXB 3MWEB 4RHTA 3DFIA 1PJBA 2DHRA 3DC2A 3Q8WA 3GHHA 1M0WA 4QZVA 1X9HA 5CD1A 4F1WA 1Y8RB 4ZTZB 1P31A 2CY0A 3VVCA 3C8MA 5JYCA 5KQMA 4PEVA 3OWXA 1INLA 1ZW1A 3HFGA 5KZMB 1UMCB 3NJRA 3R24A 2VCHA 3AL3A 4U6SA 2V6JA 3OAAD 1YULA 1W48A 5EEGA 4ZCSA 1DC6A 4OG2A 1NVBA 2HK7A 4W1SA 3PWKA 1ULZA 1J70A 4HWKA 3IHKA 4ADSG 1Y8ZA 4G81A 1QGOA 5B2FA 1IUNA 1CJCA 2I67A 4PNHA 3P9YA 2XBLA 4D2IA 4DG5A 2VF4X 3E1KA 4Q1DA 1JR3A 3NNDA 5CNJA 2EEPA 1ZA1A 1SCKA 4WZZA 3RV4A 1KI7A 3CN7A 4DZTA 2NZJA 3KNZA 3HC7A 1WS6A 2XNHA 2I6FA 4JOBA 3W8RA 3D3JA 5ES3A 2IWHA 3QSYA 1VIAA 1E64A 3B2NA 1N6NA 4ZCMA 1SO8A 4G9GA 5F4ZA 3CXUA 3DPIA 4FZ3A 3SJAA 3MM4A 1Y6ZA 5LZ5A 1FDRA 2O8FB 2J46A 2KS6A 2Q41A 3BCRA 4C20A 4C6TB 1S5PA 5HDBB 3QVXA 3QPBA 4KLZA 2PX4A 3RRYA 2XNDD 2OOSA 5C3UA 1C9DB 5F78A 3HYCA 3TBFA 2FQYA 4D4JA 4LZJA 4RK5A 4MVJD 5EGSA 5K0BA 3JYOA 1BXGB 1N9GB 3PZBA 1DJQA 4M83A 4B09A 4UUPA 4ZEXA 5KUTA 3O4RA 3DDWA 1Q0UA 2QZ9A 1A8UA 2R6CA 3ORFA 3PLRA 4LE1A 3EGDB 3O0DA 4IV8A 4S04A 1FIUA 1PJZA 4JOSA 3U7QA 3QPDA 1AMNA 2ZXEA 5DGCA 2X4IA 3CBQA 2HYIC 2VRCD 2YV4A 4CUZA 3ZCUA 2O1WA 4F2HA 2C7PA 1V6CA 2Q4DA 1EKXA 1L4UA 2BWJA 1FSGA 2IE8A 1DVRA 2JFFA 3O9ZA 4M55A 4AX4A 3DEKA 1MHPA 4YCCA 3D0OA 3EWAA 2HM7A 1BC5A 3AI1A 3QVLA 5HM6A 1W76A 4PLGA 3O8QA 3PGJA 2PPLA 4L16A 1NMZA 3A9VA 1AKVA 2W2QA 3FCOA 2R751 3LVFO 3O2QB 4KVGA 4X1YA 4YDHB 3VZRA 5SZJA 1ZCJA 4ARBA 4CKWA 3QENA 3GLFB 3KZXA 2CYCA 3EPHA 2ZIFA 2G4CA 3U1TA 1B14A 1IFXA 1GZ4A 3T7DA 3T9CA 4CPDA 7MHTA 3BFVA 1QIIA 3QBEA 2BFDA 1LQ2A 4IGFA 5E0KB 4XD7A 1YKGA 4TTIA 3Q40A 3GZTB 2GD0A 2IQIA 2PVSA 4LXGA 4RPIA 5DBGA 1NMQA 3ZE6A 3F46A 2ZWAA 1GSIA 2A0XA 5T4HA 5J59A 2OXRA 2G7MC 1ENPA 1HH4A 4JXKA 3VZBA 3S44A 4FHFA 4G0UA 4RD0A 4HNVA 3SJUA 1Q95A 4NENA 1VE7A 4GQAA 3SHFA 3H8JA 4NPAA 3SS9X 4IHAA 1KQNA 2YRXA 2JFWA 4R1LA 3M8KA 4UU8A 3JQ7B 1CZNA 1NOKA 3K6KA 5EY5B 3RSZA 1J8DA 2B4TO 2CVZA 3A28A 1QB8A 1NYLA 1I33A 3T12A 3TRJA 3T3NA 5IJAA 1A9TA 3LU1A 2WRZA 1C0IA 1LJLA 4YAOA 3ZKWB 4BQIA 5LMUB 1E1CB 4BC0A 4E32A 3AG6A 2VNKA 4JI5B 4OI4A 4OUDA 4DBLC 2QG9A 2P0EA 2P40A 4BBPA 5EJMA 3SS8A 2QAGC 2G1PA 4XR9A 1WXDA 3F47A 1M8PA 4GZ6A 5C1PA 2NZXA 2ONCA 4KQXA 2BIFA 2FWBA 4EDFA 4W9NC 2QLFA 2PUAA 1GGJA 2VYNA 3TVDA 3WMRA 1G21B 4QE3A 1PFKA 3OICA 3BBPA 3B7PA 3KJHA 3QNWA 1MB9A 3WVNA 4PYMA 2PGOA 1AM4D 4F6CA 4JB8A 1P1RA 1ORWA 4YHHB 4OH1A 1JX6A 1B7GO 2QD4A 1YMUA 3F74A 3NBAA 1T2CA 3N2EA 4R8LA 1TAGA 2I4TA 2J33A 4H08A 4GRAA 4KAAA 5EXEA 3HSKA 4GE0A 3RUPA 3TZKA 1P2SA 2O3UA 3ORHA 1J23A 5IBPA 3C97A 4FE3A 4C43A 2DWOA 4LHVA 4K5QA 4Q03A 4M22A 2J5BA 4MEJA 2P9QA 2FQXA 1R0KA 2YHAA 1CUWA 3C6MA 1X1AA 1QYRA 1T9HA 2GN2A 1EGVB 1W5AA 2GRJA 3IAM1 3OQBA 3PNVA 2GCIA 3K1YA 4MXDA 4EGJA 1EIZA 1ZG3A 1A5AB 4BZXA 3SF8B 3ROGA 4EVIA 1X7GA 2B1GA 4BMSA 2C3MA 3I05A 4CKXA 5CT4A 1YVRA 1ANKA 1PS0A 5H3LA 1GSHA 1Y7LA 2WIGA 3V1MA 3D6AA 5FTWA 4YCBA 4FNGA 3ROFA 1RQLA 2EQ5A 4LYJA 3OY2A 4RIIA 4M9UA 4NBTA 1S2IA 4BZZA 3C5VA 4RKEA 1CUEA 3QXJA 5JD5A 1FDTA 4YCJA 4B3HA 3JZDA 4O4IF 4OXXA 4UZEA 3HNOA 1SU7A 2C5FA 4XX1A 3I6BA 1O5OA 2VJYA 4YJDA 4ZJYA 2I8LA 1IZ9A 1WP4A 3M82A 3VH4A 4EO4A 2DC1A 4DJJA 4DCTA 3OFND 3KAJA 1E20A 4X24A 4FD2A 1R4NB 2GI4A 1A77A 3O91A 2OE2A 2ZIXA 4YJFA 2IHBA 2VJPA 1VRVA 4MCAA 4MQ6A 1Y42X 3EZXA 3AQ4A 3KELA 4UVEA 2BD0A 2ZJBA 3TW8B 3QUQA 3HK2A 2WFAA 1QH9A 1ZNYA 2CWDA 4WXRA 4CLRA 3K6SB 3AQIA 3M49A 4JWTA 4C78A 5EP2A 5KWEA 4NTZA 4BQPA 1YBFA 3NW9A 2QTCA 4IHJF 4DILA 3UKJA 5J58A 1UC9A 1IUOA 1CY0A 2I6XA 2IYPA 4LHSA 4Y6RA 3W77A 4C0AC 2QX6A 2OXCA 1YJ5A 1T0BA 2RI6A 1U8CB 4HFNA 4REMA 1EUDA 4YLEA 3V1LA 4CMBA 4F9EA 3UHFA 2PMBA 3F4LA 1AZWA 2Z95A 3QI7A 3RS3A 3CWZA 4D3SA 1SXQA 2A35A 3EQZA 3C15C 2DETA 2PFGA 3JYQA 1PCXA 1BOOA 4OP2A 2VTBB 1QONA 1U65A 4N9QA 4L6AA 2CBZA 2RFLA 3BDAA 1FOEB 1LWOA 4P3XA 2R7MA 1MCZA 3KKNA 4II3A 5LB2A 4Q1AA 1ZJ5A 2EJVA 5SYAA 5K8JB 2AN4A 2Z5FA 1RIFA 4Z9FA 4LNAA 4RTSA 2J8ZA 1W9HA 2O6LA 2QE7D 4LUCA 1OYOA 2HCFA 2ZRMA 2XRZA 4CMGA 2I71A 2HDWA 2DHQA 3AXSA 1GGEA 3EVEA 2C84A 2JJ2A 4ZEOA 4NENB 3NBKA 3M4NA 5L6LB 2V3VA 2I1VB 3G5AA 2CK3D 2B0CA 2XUPA 3LLMA 4BO2A 3VNVA 3L0DA 3JSXA 3CF2A 4HQLA 4I66A 2PL1A 4EZEA 5BVHB 1XXHE 4HL6A 3IUQA 1EBUA 1O96B 2PV7A 2RK4A 2X2FA 3B53X 5DM60 4BMDA 2ZRPA 3P52A 5JSHA 3U9TA 3ZYCA 2ODWA 3IKTA 4XX0B 1YBHA 4D0LB 4YT4A 1T8PA 4GOND 4RACA 1OIWA 1CY8A 1YR3A 4JT2A 4IDHA 4A5SA 1R37A 2XWBF 5FX2A 3VHXB 4BB0A 1GUAA 3A9UA 3NOXA 4G2NA 1KTIA 5HRAA 3SSOA 2B37A 3P2OA 4TZ0A 3CVXA 5JAZA 5LPNA 1GT6A 5AVWA 1M1UA 3DE1X 1MFPA 3CZQA 3OLVA 1UODA 1W59A 2AMJA 2ZJZA 4MKGA 4FVTA 4YT8A 3NTXA 3RBZA 3ZLTA 3L49A 5AXDA 4AZWA 3ASZA 1JH9A 2BRUC 4CHTA 4R1QA 2Q2VA 4GMKA 821PA 4BEJA 1H8EA 2WTXA 4TSRA 2WF8A 3OVMA 2DLDA 1E0DA 4I36A 1KE1A 3MTIA 4MB0A 5JSFA 3DO6A 3BMCB 1PX0A 1J9EA 3JQCA 5J4YA 5IXYA 1OXKB 2GEJA 1JZTA 1NN1A 3E5MA 1VLVA 3BK1A 3I2HA 4JQYA 3JY6A 4N3GA 4V02A 4A8PA 5MFPA 2CT8A 2JGFA 4LF9B 1C7IA 2QQGA 3AOEC 4MB2A 4QHYA 3P5SA 4XQCA 4U02A 2OYRA 4ERXA 3SZ3A 5BSFA 1H2HA 4ZGWA 4YRCA 4LI0A 3HJGA 2JHAA 4G8DA 5KNCH 1L4KA 3VGJA 4I99A 2IPAB 1QX3A 3FLEA 3I9OA 3CRNA 4PSKA 2B36A 4ZXPA 3VZSA 4K9OA 2B83A 4HDKA 4B44A 3KPJA 4DLVA 1U0BB 1J8YF 4A27A 1RYEA 2W2XA 3G2KA 4ZT7A 1GG2A 1PJLA 4PX3A 4JJKA 2JG3A 2OKCA 3MHTA 2A88A 2NNWB 2Q5LA 2X86A 3WWZA 1VLHA 2FZCA 3ZKAA 2CL5A 3SN6A 2CV0A 3UJNA 3G8CA 2CXSA 3PNPA 4D8YA 3LC2O 1CQPA 1DTEA 1JQJC 3IVMA 3P32A 4DUGD 2ZK7A 3FH0A 4O5OA 5CRIA 1Y3AA 1XKQA 2WB4A 3ZD8A 5IANA 3U4QB 3S8YA 2P9ZA 4WCFB 5IULC 1H1DA 2BTQA 2ZB7A 1QG2A 5TQVA 1NMSA 2QJFA 1CRZA 2IZZA 5BRNA 2ZUWA 2QLMA 1YFZA 3P1JA 2YH2A 1DO2A 3JATA 3BXOA 4A0RA 4R1OA 3N6VA 2VO1A 4BKMA 1C41A 2H5JA 3G2LA 1YDMA 5FYQA 1W581 1JIIA 2NO4A 3AT1A 2R62A 5DTMA 1QF6A 5IJWA 2PZJA 3QBVA 2QRJA 5A05A 3TIFA 1BFUA 4JP8A 3QVOA 1P6QA 2NVWA 1Z9BA 4QBTA 3CMCO 1WCV1 3OHPA 2IYXA 3L7AA 3LSTA 4YPVA 4MQEA 4EB3A 4MKFA 3UATA 2IP4A 3EXG1 3TCXB 4EPWA 1WPXA 4TXMA 2CJFA 1QE0A 2GEVA 5KVSA 2YIDA 3DXZA 4UARA 1NP3A 5CM8B 1F12A 2QL9A 5EMHA 1NWCA 1FFEA 3H5AA 3HYSA 3IVGA 5AW3A 1FLVA 4F46A 4JVLA 1G19A 1LC0A 3LUAA 1IEVA 1JFRA 1Z74A 4D79A 5KDDA 2ETXA 1EP9A 3S1AA 3FPFA 3MUNA 4B74A 4J4HA 2GYVA 4JBYA 4RD3A 4DCOA 2XA9A 3ML1A 4GUAA 4BBAA 4F12A 5BXYA 3ED5A 4IVNA 3WRYA 2D3TA 1CJTC 4RJ2A 2R6HA 2XMBA 2M1XA 2WM2A 3RYTC 5AOAA 3UJPA 2HTFA 1RBQA 2IYQA 3FSRA 1IN4A 2CJPA 3KOOA 1PD1A 5IZCA 3NASA 1T3HA 3MUFA 4MKIA 4C14A 4YPOA 2O07A 2J3QA 2J9YB 4KREA 2GCOA 1XWWA 3OQMA 2UVQA 5C18A 1W73A 3MJFA 4QUHA 5JNTA 2QSJA 3EQ2A 1D0VA 3P4UA 1C3OA 1EJBA 3JD0A 4LJRA 4HAYA 2HIGA 1WDMA 2FZKA 3U1VA 4IBOA 1QUFA 3WQBA 1OJLA 2IUEA 3ME5A 2QTHA 5T64A 4NAVA 4YJGA 4FN5A 5BVGB 3LY9A 4JX9A 4MO9A 2BEVB 2JH8A 5E4TA 4BZQA 3VFDA 2XLCA 1FYDA 3JZMA 3HJNA 1P44A 3FYUA 3L7KA 1YFKA 1L5VA 2HF8A 3AP2A 3L18A 4XM1A 4QSHA 4XOUA 4HKTA 3VV2A 5L51A 1UP4A 3ER8A 1N3YA 4P22A 4IUYA 1OFUA 4HDOB 4C4PA 2VP9A 3GEHA 5EZYF 2GFQA 3FMVA 1R6DA 4RVSA 4U0KA 1ARZA 1TTPB 2ZT6A 2ZWIA 4EYKA 5HUHA 2W93A 3A6KA 4IMRA 3UJDA 4HGRA 2N1BA 3S6JA 3M3DA 2ZI7A 4O29A 1PK7A 4HDNB 1BXRB 2NX2A 3AVQA 3H9BA 1RLMA 1ZFNA 4PFQA 4FNMA 2JHFA 3NAZA 3OJLA 5FTKA 1GNPA 2B7CA 1MG5A 1NGSA 1LSUA 2MR5A 3C85A 1KRHA 3TJRA 3TW0A 4DNXA 4DMKA 1IL0A 1BU5A 4NJEA 5IKOA 3T1YB 1HYGA 1YS9A 3OPNA 4DSNA 3KBBA 3GQVA 4ESOA 4XYLA 1LNSA 1MOSA 1NVWQ 4H1VA 1WZCA 3I9MA 4LOKA 3DB2A 1ZD8A 3BF7A 4KXQA 4RSGA 4WKCA 3RSFA 4Y2YA 1S2LA 4OHBA 7REQB 3EOZA 2VSFA 1W4AA 3O9MA 1V4BA 2FB9A 3ONWA 1XQ1A 2NXEA 1F2UA 1XMXA 5F33A 1RFGE 1C9MA 1EDZA 5K7SA 3WGHA 1RWKA 1LY1A 3DAGA 1NVGA 1BAPA 1PZHA 1LLUA 3U4MA 1X13A 2ZIVB 5JU6A 3V46A 3D5EA 1Q17A 2YC4C 4NSNA 4O1HA 4P5EA 3ZHBA 3DAYA 2FW9A 3ZWCA 3HO1A 2YCBA 4KQHA 3FVWA 3O90A 1L8OA 1PZXA 2IV3A 4RTMA 3H0KA 2XWSA 2QAJA 4EHJA 2G0TA 4MUYA 5FBQB 5TEWA 2BGGA 3PJGA 4BJ5A 2MHCA 3Q1KA 5AKYA 1D03A 4CLDA 1Z4OA 3TSWA 1O08A 5D84A 1UAYA 3QOFA 5A4DA 1LS6A 3IV7A 1DIAA 1U31A 1M34A 1QTIA 1N5RA 4B47A 1NF9A 1WOYA 1GIAA 4K9QA 5A5FA 1N2CA 5CB6A 2PA0A 3BIXA 1TECE 4WJZA 4AD8A 5IDWA 1PWXA 3RTBA 5BQ5A 5IJ0A 4LEIA 4MI3A 2EVWX 1KXJA 2QTLA 2VH2A 4TXHA 4YRLA 2VF2A 3EH1A 5KJFA 2Y6VA 1NXVA 3G2HA 4AI6A 4O25A 2EGHA 4EB6A 2G07A 3VI4B 3TB4A 1V11B 5C37A 1IRXA 3AZPA 1VB5A 4NZ9A 3RS4A 4GNKA 4MUHA 4G0ZA 5AVQA 1CJMA 1G66A 4XGRA 1IXYA 2CZQA 1F06A 3I04M 1UC4B 4CN9A 2YRWA 1BTOA 1T4DA 1CS0A 2QT1A 3BE8A 3RTGA 2EW1A 5D01A 1KQFA 1CR4A 1MABB 2NUBA 1WBBA 3LQ1A 4FS3A 3EB9A 3R0JA 4Q39A 5I9LA 3H87A 4R3NA 4HCJA 3RWMB 5JDIA 1XKXA 5F77A 3KBOA 3U09A 1QYXA 1BA3A 2O2JA 2YRFA 4D9GA 1YHZA 2NU8A 3H7IA 4FPXA 1G21A 4RK7A 1PK9A 4FFVA 4D9EA 2O0JA 1B93A 3A2NA 1OQAA 4P6VF 5I7VA 1ZU5A 2WFMA 1TYDE 4KP7A 4RD4A 1ZBQA 3GJYA 3CW8X 3GDHA 3WGKA 5C1BA 1KEVA 1KO8A 3KR1A 4F5WA 3N8DA 1SHJA 4LZWA 1L7AA 1C4WA 4FD3A 2WF7A 1YONA 4OUDB 4UHCA 1YRBA 1GPJA 1YR9A 4G9EA 3GNLA 4RORA 2JI6A 2LRHA 3DO5A 3QYJA 3V8NA 1RM4A 5HMLA 4CGYA 5JQWA 2HT1A 1P6XA 3AVTA 1EBFA 1GCGA 1TADA 1T6ZA 4IQGA 3M4YA 5FBHA 1LDGA 4XWTA 3RPEA 3ONEA 5LP1A 2OWDA 4Q9DA 1YWGO 4AS2A 2HBRA 3HPRA 3V3KA 3BWVA 2WVJA 1F51E 3TI9A 4R0MA 4R81A 2R1ZA 3E7WA 1ESDA 1NQVA 3OH8A 4JLUA 4KRYA 2J9FB 2WTNA 4RD1A 1U5BB 1P61B 5D5PA 3PCXA 3ETDA 5AW1A 4CF6A 4QFDA 3BTSA 3O7MA 4ZT6A 4HH0A 2JLCA 1K75A 5DXFA 4BNIA 4Q7EA 2OXTA 3IGFA 4DW8A 3GN2A 5BW6B 2IYVA 2H54A 3RF7A 1NW8A 4INZA 2CVOA 3FG9A 3R5KA 3EWNA 1JSCA 4TTQA 5GZ1A 1HDIA 5BOVA 1FS6A 1XF9A 2GJ8A 2X0RA 3TH5A 5FV4A 1WPQA 3LBFA 1PGJA 2OCKA 4H4CA 2VJDA 4ZRDA 3RSLA 1V39A 5KYXA 3LDUA 3TEFA 4LDNA 2X5NA 3DHYA 4UAVA 3R7WB 3WDMA 1JALA 4AJOA 5ALDA 5J2TB 1NI3A 1OR8A 1E7WA 1JNYA 1D1PA 2NQTA 5G0VA 1MH9A 3BA6A 4E03A 1JPUA 4CFSA 5FEUA 1R5NA 4K05A 3PDCA 1F3OA 2HH9A 3OIGA 5EGNA 1WMFA 4BRSA 2QMYA 4Z4GA 1OCEA 1NBHA 2WSIA 2B2XA 2EF1A 4J9UE 3OZVA 5HHTA 1T9KA 1WUKS 3I6QA 1CUDA 3SP1A 3VKWA 2UXBB 3AUAA 3L8HA 2QYSA 3L1VA 1OXMA 1T5DX 2BC9A 2A5LA 2Y0EA 3UXEA 1KYVA 3N8HA 3OFKA 3NDJA 4ITVA 4LY6A 3QJYA 2YHBA 3U7QB 3WL6A 1CHDA 3FI0A 3HDJA 3PDIB 3K53A 1YU6A 2JIZD 2J9RA 1P17A 1VOTA 2C59A 2DMRA 4LC0A 2W2MA 4UCXA 3BH0A 5AQ1A 3CLSC 4F1JA 4JYAB 2Y1EA 2FP4A 1Y80A 2DQYA 3HHPA 3MRXA 3MJCA 3V1TC 2DT8A 4BZWA 4RTQA 5A7HA 1DKMA 1M1YA 3GZNB 3BWDD 3QI2A 4UNIA 1V5WA 5G3YA 3UN1A 3L02A 4UNRA 1J0BA 1S7GA 1WUHS 2B98A 3E22B 5C4GB 4P7JA 3JQAB 3B20A 3P9ZA 1C3VA 3L93A 4OQXA 2FZ5A 3DMPA 5BV1A 1STOA 3VR4A 4BV3A 1TYCA 4QA9A 3AUXA 3B82A 3FYTA 4AKIA 3SBDA 4NK5A 5ED4A 3L9WA 3NO4A 4KV9A 4Y0VA 3G9ZA 5CLHA 2I65A 2Z8YM 3G85A 2PQMA 5I8PA 3RKRA 1IN6A 3AY3A 5E8RA 5JEEA 1P2VA 3KQOA 4UEKA 3RTCA 4KIJA 4L02A 2IYOA 3HRHA 1TUIA 2NVUA 4OM8A 3FB1A 4J6EA 2ZRHA 3TG8A 3E3NA 4JUDX 1OF1A 3ZIAD 5CM9C 2IIPA 3CF6R 4H1UA 2I54A 4X6LA 4ZQIA 4TVOA 4OHUA 5AJVB 5TS3A 2EKPA 2D1QA 1MF7A 3RG2A 1GZ5A 1GV1A 4QTXA 3L8DA 4QTUB 4FMDB 4P3OA 1RPJA 2Q45A 3GFPA 1G8FA 1U81A 3GI1A 3PIIA 3LUPA 2GUWA 4LNUA 4MUNA 2P9JA 5JS8A 3M9WA 4XB6B 2ORVA 3OM8A 1WP9A 3R40A 1LQUA 4QYTA 5KMGB 3NWPA 4TTTS 1TU3A 1JFSA 2IHUA 1RJFA 3UF0A 3G0DA 5DCYA 2B9VA 2OHFA 4P92A 3AG5A 1ODSA 3IEUA 4Z9AA 1P0FA 5CXXA 5K0NA 2WHQA 3V97A 4ENSA 2W6QA 3FFTA 3G8DA 1IHDA 3EN0A 3LHSA 3NYIA 1O89A 4R71A 4MWSA 1FC0A 4D41A 1GWNA 4CTOA 1NFQA 4WRRA 5K2OA 4QHSA 4LV8B 1CULC 4YT5A 3I58A 3RFUA 4UZSA 1NUTA 2EHDA 5HOEA 1J5EB 4NV3A 4P54A 2XTJA 1Z63A 1OILA 2Y6UA 3LQYA 5LQUA 4Y6QA 2X3UA 1O77A 2OV3A 3A3PA 3KOZA 2QOEA 3A6FA 4JYPA 3VYTB 4ZJPA 1E1YA 2WU1A 3NFRA 1AO0A 4W1RA 3AZQA 3L8FA 1K7SN 4Q4JA 3QKIA 2IH4A 4IKOA 2GBFA 4IRXA 1YRLA 3USZA 4ZOLF 2VNIA 1MTOA 3GLTA 1LSOA 2OA0A 1WU7A 4CQNA 2G9UA 4HDRB 4YC7A 1AKEA 3FOWA 2FUNB 2E6KA 1SUBA 4KXNA 1Z7BA 1N7HA 3CNOA 1EFAA 2BSXA 4IV5A 3EA0A 4LFBB 1YDEA 4MLZA 5ITSA 3LS2A 2YYZA 2GN6A 1YJBA 2Y1DA 4JP1A 1NATA 3A4NA 4Z86A 3TTSA 2FTKE 2VQ3A 1G9SA 1JTFA 1ZGJA 2PJRA 3ZZMA 3L8GA 4WJKB 5DASA 1UKEA 4XGQA 1AK9A 4BZPA 3T0IA 1HRKA 1T9CA 4HXGA 4TTPA 4WOCA 5SY9A 3TKLA 2DF8A 1BXZA 2PZLA 4B3GA 2GGSA 1H0SA 1W87A 3GXBA 1YNSA 5JROA 2C98A 3IAAA 3GPLA 1N2CB 1TJ5A 3HN6A 5I51A 1B6TA 1GCUA 3PRHA 3IDAA 3H2HA 3BIFA 3A4IA 4BQNA 1JHMA 3LM8A 3PHIA 3DZGA 4EA6A 1NBAA 2HDHA 1KMHA 2HMAA 2QTGA 2QKYA 2GAIA 1KVTA 4IMJB 5DI9A 1RXIA 4TKUA 3W90A 4B81A 4HSEA 3K05A 2AG0A 1FQJA 2WTAA 1EPUA 4C6HA 1P0QA 2OO7A 1C0KA 3CRRA 1GUFA 1M3SA 4IRMA 1X7WB 1QCCA 4JC5A 5IVDA 3V4SA 4NBUA 1BDBA 2GZ2A 2I87A 2YYAA 3IKJA 4PWYA 5HQTA 2A94A 2QV7A 4HB3A 4HF7A 2GZ1A 4B83A 2PMKA 4HH4A 4AMGA 3RADC 4BPBA 5T6BA 3GLSA 3CLKA 5GY7A 4ECEA 5TR9A 4H3HB 4M6WB 4X00A 3G2MA 2CSUA 1F2UB 3HEAA 1MIOA 1LCIA 1FYXA 1HUQA 2A59A 2JLBA 3UVEA 5BN1A 1IY0A 2VHYA 4X8OA 1T8YA 1ZD3A 4KNYA 3ZHXA 2F9FA 3THYB 4PX9A 1VE3A 2OR3A 1N2HA 1UEJA 3SBEA 3PUXA 1QRDA 5H4HA 4YRBA 3TTUA 2W2KB 4I3FA 1XQXA 2P8JA 5TJ9A 4AJ9A 3U26A 2ZG6A 3CEJA 5EC8A 4A16A 3K5WA 4KGZA 2XAUA 5CUQA 3DA8A 1OZFA 3GGGA 4HY3A 4US2R 1UKZA 1UPCA 2F62A 1O9HA 4JLPA 3UAYA 3VKFA 4UEOA 2VEOA 2CDRA 3ZE7A 3NWEA 2G08A 5I4BA 1NVFA 1RHRA 2C5HA 5LNK6 2DYKA 5I5EA 4DCJA 1W0KD 1HDGO 1E6LA 1Q16A 3GRZA 3M83A 1E92A 2QIOA 3QFRA 4CMIA 1VBFA 1LC3A 1KOFA 2WJ6A 3O4GA 2OAGA 4LZLA 2GRAA 5B12A 1A7KA 3P0HA 3CEPB 4ZREA 1FXWF 2GVZC 3QFCA 1ENYA 1ISHA 3CF0A 4G1CA 5ALHA 3UANA 5LDHA 1WW8A 1UFOA 3D81A 3QE9Y 3MQFA 3PNSA 3H11B 2PWZA 2I1LA 1ZI6A 3UEOA 1NOIA 1SKYE 1PD0A 2AI3A 1ZITA 2QYTA 4MKXA 5ELXA 2XJ9A 2WNSA 1EJ6A 4OXIA 4FOOA 4PRKA 2XKKA 4TKUB 1GNSA 1VKRA 4WGFA 4YXWD 1N6LA 2IHZA 5JXWA 1AKMA 1EFDN 2XA2A 1F8GA 3E9YA 1MDBA 3IPYA 3TPCA 4V0QA 2JH3A 1G98A 1QK3A 2OORA 1X8XA 2XNSA 5EWMA 3IV6A 3ZJYA 1H2YA 1U4SA 1MX3A 2IGBA 2WPDD 3IUJA 3LYUA 3M5CA 3PFFA 4OIFA 2FW8A 2NTEA 4V03A 5DM2A 2ZUFA 4YV1A 1KNXA 3H9QA 3R6TA 1FUEA 1M2KA 3ABQB 2DP4E 3HU1A 5ERXA 1HSOA 2J0VA 2G76A 1VCMA 3N8IA 3ZCSA 3U5ZB 4RDHA 4RIHA 4KZPA 5ICSA 5K0GA 2FGJA 1Q84A 2AE1A 5DF1A 5DM4A 5E4YA 3ZWYA 4Y6OA 2OOKA 3GLIB 5DXAA 2Q5IA 2XCOA 2Y0BA 3BMOB 2QR2A 3I9NA 4GM1A 3NBZC 1E69A 3PDIA 4CQMA 2J7PA 1G41A 2VATA 4MCIA 4C0XA 4EEZA 2OVBA 4I5DA 4HDRA 1BCSB 2NO6A 2Q5FA 4UJ5A 1PEYA 2C8LA 2P4EA 3TSYA 3ZD9A 4OU4A 1L5FA 4AY5A 2GN0A 3AV0B 4FFMA 4EYGA 5CA1B 5MFZA 2ODBA 4Q4CA 1RQ7A 4G25A 2HQ1A 4J03A 2B5OA 2BFAA 2Q0SA 2ZQZA 4V0KA 2ORIA 4BFVA 2I7VA 4CFYA 5ITZB 4ESVA 5LL6P 2EJUA 3TRDA 4AQYB 1Z6PA 4W99A 3EARA 3V4OA 1BE0A 2XYGA 4L4YA 5IAKA 1KKUA 3PTZA 4BNGA 4J0QA 4DPKA 2B2NA 1MAHA 2BM9A 4GI1A 4PAQA 3RVOA 3V1KA 1C3LA 5AVOA 4N7JA 2WKWA 4LPKA 5JS2A 1Q0QA 2PKRA 4K9MA 4CM9A 5L3SA 1ZL0A 3UK6A 5KC8A 4JB3A 3OA2A 2BDUA 5EMJA 5B58T 4QARA 1T9ZA 5JQGA 4B0PA 5E8JA 2YXNA 3SSMA 4QBHA 4XB1A 2R6FA 2LVBA 2ZBVA 4J90A 3GJRA 2HDNB 3JARB 5CYGA 4ENUA 1H2RS 2GPTA 4ND6A 5JR3A 3P0JA 2VQ6A 4KR7A 2V7BA 5LBUA 5LP6C 1HY3A 4REOA 3AR5A 3JTMA 4QQNA 3VDMA 4BMPB 1MX9A 2HMYB 4C4RA 2FJ0A 2HUNA 3C3JA 1H1LB 3MS7A 4R6XA 4G1UC 1R9MA 4HMQA 3UUEA 4L72A 3VC2A 3CUVA 4LS3A 4WCDA 3RCBA 4EPRA 2BI4A 5D3ZA 4JVSB 2VDRB 5MN5A 4AQDA 2H6EA 1K3UB 4OD0A 1SCDA 4NS1A 1OA0A 4HWOA 1PL8A 3EPPA 4U9HS 4B32A 2TMYA 2C8KA 3T7EA 2I1QA 3W78A 3VMMA 4H0FA 2WP0A 3BL8A 4NK4A 3O94A 4CCYB 2C99A 4JIGA 5ANRB 3H4IA 3QJGA 1MMFB 4J0HA 3WBFA 1XAGA 5CA1A 5D5HA 3TQIA 2AQKA 3SC3A 3WKCA 3OLXA 3SZMA 3C43A 1RABA 2YBDA 2QX9A 3T4UA 2JGDB 2WYVA 3TJZA 3IURA 2XIJA 5EUMA 2FPGA 2I34A 2W6ZA 5HS6A 5B30A 1ADGA 1I2AA 2HSDA 1T36B 2XUGA 3O4IA 3TLGB 1KWKA 2HO5A 5ED0A 2P2LA 1DOZA 2VNSA 3QPWA 1GJRA 3G02A 3PPIA 2VXBA 5A3SA 4CM5A 3H75A 4N65A 5ALRA 5EJGA 3G8BA 2OHXA 2HJWA 1TJ4A 1Q7CA 1XDWA 1SNYA 3NPAA 3U80A 4KNWA 2BMEA 5K4HA 3EIEA 1NULA 4DCPA 1O0CA 4B0OA 3S3TA 5E9QA 3NCTA 4A6PA 1G20E 1ABFA 2V3CC 5CVJA 4LA4A 5HUQA 1V45E 3I5YA 1VA4A 4RY2A 1R6TA 1CEQA 3BDVA 1RW4A 2ZJ1A 3DDCA 1KY3A 3WNVA 3VOSA 3ZU4A 3LTEA 3X3HA 2YVAA 3AH8A 3B78A 3C8ZA 1X87A 1PK8A 5DN9A 4C3ZA 2ENUA 4WN3A 4KEAA 2AJ8A 1N2EA 3IC5A 4JSTA 2HCRA 1CV2A 1M8KA 1U0NA 5CGQB 5JADA 3OJWA 3H1AA 2AHRA 4C7VA 1PL6A 5BVHA 3PEWA 4MUKA 4E14A 1VYHA 3FZQA 3G5UA 2VJLA 2L82A 2Y0PA 4V3CA 3LRPA 3KXIA 2RHMA 1V8BA 3H11A 3JD4A 5CFLA 1QIJA 4FHZA 3DYIA 1ONBA 1HE4A 1SH7A 1Q92A 5F5XA 1K4MA 2BN4A 1NT2A 1WUJS 3DL2A 1ZHHA 4CLHA 1GTZA 1BQEA 2HIHA 5JV5A 5CJPA 3I6ZA 1N3BA 3HXMA 1J8VA 3CLVA 2F17A 3SY8A 3UMSA 4CKEB 5LFAA 2UXCB 3ELBA 2GARA 4BNWA 4QM6A 5IC6A 1L8LA 4F8YA 1KQOA 1H85A 2RC6A 3H8VA 3OZEA 4NY1A 2VDWB 3PQ3A 1YDFA 4YCAA 3VR0A 2FN3A 2IEGA 3RW9A 2RGWA 3TE7A 5KNBD 3USES 4OYYA 5IRCD 2FPRA 4CT4B 4BP3A 5EIHA 1C7JA 3AR8A 1BGXT 2QD3A 3BHNA 4Q7QA 1B8UA 4MPJA 1PT5A 3GFGA 2V97A 1P72A 3OQ6A 4YIHA 1H0KA 4HQFA 2H3HA 2GN1A 1UZLA 5GWXA 3U39A 3QG5A 5CJJA 3T5GA 4DE5A 2CD7A 1G18A 2XA1A 1AKQA 2P9YA 1ZN7A 4QJIA 4HDNA 4FU0A 3GU3A 1N77A 5CVCA 4UE6A 3N3AC 3VNBA 4CG3A 3NVDA 1K9VF 4IJVA 5L3SB 4EIWA 4YCDA 2XH8A 1WETA 2PWPA 5F5LA 4MJXA 4TRNA 4L4RA 3VH3A 5FH9A 1GQOA 2OHIA 4I6JA 2DFPA 4BGIA 4DV7B 4I9HA 2OLKA 2HA4A 4OREX 3OCWA 5DHPA 2JLQA 4DLWA 4C7JA 3OLQA 3KSUA 4CXMA 4DBLE 1XZMA 2J6CA 3HVIA 5A4AA 1B0AA 1ZM4A 1J5XA 2W58A 1O95C 3B48A 3BSYA 3MTEA 1WQ3A 4GYKA 4XPIA 1OAAA 4OXQA 3ES9A 3U17A 2I2BA 2TSYB 2HDOA 3QF7A 2BF4A 4BNXA 1CRPA 4KH1A 4S1NA 5JD4A 1AGXA 4DC9A 1JU3A 1ND5A 3EDMA 2G1JA 3L7JA 3PGVA 1SGWA 3F3SA 1NTOA 2KPOA 1RR6A 4Z4EA 3B7WA 2FEMA 4ZU3A 3U0BA 1B8OA 1H69A 3G88A 4AK9A 3F9IA 4R1TA 1JHUA 1Q1QA 1YNOA 3AUYA 1JQLB 1OROA 2AJTA 3FAZA 1VG9B 3W4IA 4CHGA 5HKKD 3LUGA 3NVMB 3K0FB 2VYND 4LV6A 2N42A 3LX6A 4ALJA 1NLMA 3K9HA 3LX5A 3UMRA 2BJVA 3M34A 4IIGA 3SVLA 3C1OA 1UKBA 5A6VA 3RQSA 4G5XA 3IDFA 2KSQA 2BKXA 1U7DA 1UBOS 1LB1B 3ANSA 4DRYA 3OZIA 2W2VA 3I76A 5KYWB 3ZDBA 4JU8A 2O8EA 2DHEA 3I39X 3RIXA 3PRKE 5AW2A 4HAVA 3BFXA 5PGMA 1NUQA 1NQWA 3CUTA 1FPMA 5FD8A 1OVMA 1JA1A 1TL7C 4NDNE 3MD0A 2I3AA 5CK4A 1DLJA 3RV3A 1PVVA 2VDPB 3FIUA 1OXXK 5C1OA 1QOQB 3GRCA 1IY9A 4PQEA 3IT2A 5H9WA 3DNPA 1W8IA 1PV4A 2O2CA 3IAS1 1K6JA 4NBNA 2C4VA 3ONNA 4ZQBA 4CM4A 4JYMA 4F2GA 2VQEB 4DHWA 2JHGA 3VKVA 4Q1FA 1TMYA 5K6AA 3LTNC 3A70A 3GARA 3V8MA 621PA 2RKWA 3IBCA 3LBIA 1NBOA 4J0FA 3QEOA 1RRCA 4E5VA 4OHRA 2E0IA 4GBED 4B85A 4KDRA 4CMAA 1J42A 4K9RA 2VHXA 2GHRA 3DFFA 3NATA 3L6BA 3OEYA 4OQNA 4LNUB 1EVLA 4V0ME 2H9YA 3TR5A 4RBNA 1IBRA 3WK8A 4BASA 4EMUA 4BQRA 4XD7D 2F00A 5EIWA 3S2YA 3R3YA 4F3RA 3Q85A 2IUYA 1GEEA 1JSRA 2W6MA 1T4CB 4M7RA 4M1OA 1WHTB 1DBIA 1FNMA 3L84A 1WE2A 1FVFA 3IVRA 4L50A 2GEBA 1RYDA 3IXLA 3KL4A 1SIUA 3I5MA 4KLRA 2P1RA 2ZANA 3FXAA 4KBYA 2Z6AA 1I6KA 4TLMB 4TL8A 3VPGA 3PJEA 4L0QA 1TFRA 1PR6A 2WSSA 3AEYA 2AG1A 1B8NA 2WG1A 3FJ1A 4GICA 5AM5A 3MGGA 1BMFA 2O0MA 1A8SA 3HCAA 3JYNA 1PSDA 3DGFC 3UOAB 1J25A 4M0LA 1KTVA 5JTUA 4G5YA 5KJEA 1Y6JA 3UC5A 1KEWA 2B5VA 4AJHA 4LNHA 3BDIA 2JATA 1E96A 2NG1A 4AO8A 4BQQA 2VOEA 4FEYA 2PJUA 3KP1A 5JPCA 3NTQA 3SMQA 3RAPR 2OYSA 2PLFA 1U98A 2MMCA 5BPHA 1U0HC 2HN9A 2OD7A 4JLDA 1LPBB 4B87A 3IAEA 4NZPA 3N8KA 6YASA 2GXSA 1N8TA 5JZMA 2I91A 1UL1X 4MEAA 4KQJA 1DOAA 1JZQA 3IIEA 2PIDA 3C6XA 4FW8A 4MULA 3QRWA 4OHWA 2F8TA 1VMIA 3K0CA 4V0MA 2J5RA 1ISSA 4F6RB 1YDGA 3H19A 1NT4A 3K32A 8ADHA 3ONDA 5CFMA 1AOXA 5DNDA 2B35A 3D3EA 4BN4A 4NXNB 1EK1A 4DM4A 2FZWA 1IIRA 2R7AA 4R2IA 4U63A 1KIFA 1QFSA 1YFLA 3OCVA 1M34E 1XEXB 1DZ3A 2H06A 3C3CA 4QDTA 3LXXA 5DH9A 1FFXB 2HCJB 1QP0A 5DTRA 1RTKA 4UNQA 4XE5A 1OGIA 4DLLA 3SYTA 1VLZA 2VL7A 1XZQA 3ORQA 3A9TA 3OZXA 4OM7A 4ZU1X 3S99A 3EPRA 2CE2X 2YJ4A 1Q7TA 3DBIA 2FSGA 4UATA 1KY4A 3E35A 4TLCA 2BGTA 4UBIA 1ZBDA 5HBGA 5A04A 1JEQA 3DMNA 2RSLA 5FORA 1CVLA 1X86B 1ZIDA 2DCMA 2Z56A 3U3RA 1QCDA 1U7TA 3ANYB 4Y9TA 4B8YA 1WW3A 1PW7A 4D82A 5AKJA 4ZO7A 2G9QA 1B6SA 1BGVA 4G41A 5BWNA 3L4JA 2WIDA 4BV2A 2FPKA 4UBJA 1KH1A 1KH3A 3D6MA 4JX8A 2JAXA 1T5TA 3DJYA 1T8WA 3TZCA 1GDTA 4MIKA 3V4ZA 1IY2A 3JAKA 4O4LB 4PPYA 4FLFA 3AHDA 4PM4A 5G40A 5U9CA 4N5DA 3K5HA 2J3DA 4E4RA 3U60B 2D7DA 3TFQA 1M2WA 4OU5A 3DW1X 2H2HA 1ZX1A 1PL7A 2J32A 2QLBA 2QRHA 1Y9AA 3AEKB 3DC7A 3KLMX 3OUTA 3D2CA 4NU5A 3DXYA 3UWSA 3ETCA 4AJNA 5T4BA 3MMPA 4AKSA 4UAGA 3A6DA 4UHEA 1SUEA 5FUQA 3DBHA 4PZUA 4EG7A 1C7ZA 2EARA 2PGIA 3EDOA 4GZ5A 1DRJA 2WWHA 3OT1B 4LFAB 1X2BA 4G1EB 4EPYA 3LG2A 5HXAA 1GZDA 1HPLA 1LSJA 3Q1LA 3N0XA 3UK1A 3HXQA 2BBOA 1JZSA 4LGMA 3R3VA 1DEXA 2C97A 5H3CA 4E21A 1AB6A 2CVHA 3MW8A 2GB4A 1XVVA 3BQMB 4LBVA 4QTTB 1KMIY 4EX6A 1M33A 4Z8YA 4GKBA 4CMCA 1U1IA 4ARAA 2Q4TA 4N6GA 1UZNA 2QRZA 4PLFA 1E9BA 2YYSA 4IQFA 4TYMA 3HJRA 5EQTA 5JQGB 2BEKA 4MYTA 5KNDD 1J0DA 1UBTS 3KT6A 1CUSA 3G2PA 3ITDA 1L5LA 4WN9B 2NV0A 2QRPA 1GGNA 3MC1A 3O03A 1W4BA 3U4CA 1J20A 4F96A 1WX1A 1YK1A 1XE3A 1ZOOA 3E82A 1SKQA 3ETHA 3BZWA 5ALSA 3RGGA 3TBKA 1FX0B 2QV0A 4DV4B 2Y2VA 2XBUA 2ZSHA 1NVVR 2QWXA 4QTZA 4DLBA 3K09C 3V2IA 2V9PA 1E7SA 2XCQA 2CNWD 3I42A 3PVSA 4H6VA 4UC0A 4GX5A 4WBNB 5MGBA 4EZIA 1ZD2P 4X45A 4YJ3F 3HP7A 5FL3A 5C0OE 1IEQA 3MINA 1JVBA 4HS9A 4XUEA 2QA5A 5FRDA 2LCQA 3GJ7A 3IIMA 4R69A 1SMKA 1Y63A 13PKA 2FQQA 3IT1A 2VSNA 3KZVA 2MTBA 2XMGA 3E4DA 2C4KA 4MDYA 2WQZA 3HCPA 3LYHA 2QUIA 3DBLB 2L42A 1JIXA 3GP5A 3OCJA 4K87A 2H31A 4Q24A 3SFTA 3UPUA 2IXTA 1WZEA 4M9RA 4MR7A 4QBFA 3UAZA 1OWPA 4D9JA 4YV7A 4IUCS 1A88A 3EFHA 2FPWA 2AK2A 3NKFA 5C3MA 1N2OA 2GSDA 2PK3A 3FMPB 4PFKA 4Q3EA 1NSFA 1RCUA 2ATIA 1PQWA 2FVXA 4U4AA 4GKVA 1V8OA 5AK5A 3TXYA 2AXEA 2PL5A 3ESDA 2G82A 1WY5A 3LNCA 3PGA1 4RH1A 3AUFA 4HTAA 1PEKE 4I5FA 1EX9A 2GM5A 3FCYA 3FYCA 2ZSIA 2NU9B 3SGLA 1QHSA 4LBZA 4OFWA 4DJDC 2XTMA 1R0ZA 4H15A 1M2VA 5EZYA 5B58C 1CZLA 2R47A 1XA0A 3MAJA 2W90A 4XWWA 4JUIA 3D6FA 1R15A 3FSJX 3PWTA 4L15A 4ND7A 4UFPA 1KFBB 1LJ8A 1VMDA 2CYAA 4NS4A 4FSHA 3G7UA 4M86A 1TXGA 2VTKA 4NBWA 4LF6B 3OCYA 1WDKA 5BYAA 3A1UA 4KQKA 2C7RA 4N03A 1NONA 2LUOA 1WY7A 3HP4A 4P31A 1N0VC 5B6IA 1E2PA 3MUOA 2QZZA 3CJTA 1BHQ1 1HQKA 2V6GA 4RH0A 4PVDA 4Q3CA 5C4MA 2A7QA 3CNNA 3VPBA 1JW9B 4P9NA 1NZFA 1KYZA 1XEAA 1JP7A 4JQSA 2FA9A 1B74A 1FCJA 4TWIA 1ONSA 4E5KA 4BWGA 2V6BA 5FA6A 3R3WA 2FPPA 2ZBQA 4GOXA 1FDWA 5JFTA 2JGEA 1LRJA 3KETA 4XUCA 4ZOAA 5BV7A 2RBGA 3QYFA 4XWGA 4IDNA 3TE6A 2AYXA 4E15A 4HD8A 5DMXA 5C7IO 1N2GA 2ASEA 3G13A 3FD8A 4PXYA 4UDXX 5JQGF 1P4HA 1F3LA 3AONB 5G41A 3E23A 4IKPA 1I9GA 2ZAIA 4DQKA 1S6YA 3OTHA 4MW1A 3IMEA 4QPNA 3TZEA 1T0PA 2PQ6A 3ENQA 1ZH8A 1MB2A 1T5SA 2C9ZA 4C2AA 3ZDFA 1N4AA 3E5NA 1YI1A 3H2KA 1Y8QA 1FBTA 4CEHA 1A4XA 3KKOA 2V5UA 5TXGA 3N5CA 3TD6A 2VNHA 3V6LA 2Z3VA 1AZLA 1F0NA 4D56A 4ZI3A 4RCYA 5JVDA 1B23P 4AF6A 1SC3A 4U2GA 3M4ZA 1KQPA 3L1KA 4UW9A 4UDOA 4M8IA 1JIVA 1V9CA 3H65A 4B3FX 3WLMA 2BW0A 5FTJA 1FS5A 2OBXA 3H1BA 3I0NA 1TZ2A 1Z7GA 4Z4QA 4GIBA 1ESMA 3DBLA 3PGLA 4NAHA 3RC7A 3L2OB 2VTVA 3T5AA 2COEA 3HDQA 4DUZB 1L7MA 4RULA 3VPSA 1SOMA 3H13A 1ZNWA 5L3RA 2GDZA 3VU1A 5CXSA 3OQHA 1MO2A 4XOIA 2VUUA 5FBLB 3WSTA 4YRDA 5DEOA 2ZIZA 3IPRA 4DT1A 1A8IA 2AMFA 2E5LB 1M54A 3RS0A 5IDVA 1ZKDA 5DYWA 3PGKA 2JDIA 1TLLA 3LXMA 4A4DA 4ZK2A 5K3CA 4I9UA 5B1DA 1W0CA 1ZISA 2HLDD 3D6HA 4O08A 2FGKA 4C4YA 3RK1A 5KYNA 2J3LA 3BS4A 1X9IA 1XQYA 1ZJZA 4W8OA 1EFKA 4MMZB 5DB4A 3PFNA 2QLNA 4G24A 2X0NA 3D3WB 3HR7A 2M2IA 1YZTA 2AR0A 5TGDA 5BXQC 1J2EA 3TG2A 2F3PA 5FPSA 2IELA 1S3GA 4MI6A 1AA6A 4GD3Q 1Q20A 2VPTA 4NCNA 2NGRA 3MPOA 1HTTA 2KMLA 5LB4A 1C50A 4MQFB 1IZ0A 1KOJA 2E21A 3E03A 1EHYA 1T15A 5LDGA 1E79A 3LUJA 4NOJA 5JUWA 4U5XA 1RRGA 2WYHA 4EB0A 5DRYA 4W5RA 1L5MA 2BP7A 2FUG6 3N2GB 2GM3A 1ZRSA 2KBEA 1M74A 1TM7E 2AI1A 5EMMA 3D4LA 3RWOA 3VUFA 3AJEA 1W5EA 4RIFA 3HRKA 1BKSB 2JJ1D 3DT9A 3NEYA 3HDVA 3PG5A 1U0GA 3DBHB 4FGLA 1K0FA 1ZMBA 2OQIA 4JA0A 4WCFA 1OYVA 1QVZA 3Q41A 4BNMA 5BSEA 4NNOA 2ADMA 1TGVA 1VPTA 4UM9D 4D46A 2EFCB 2GESA 3C7KA 3RSGA 3WZ2A 1Y8RA 1JHPA 1NX9A 2OXFA 4BGEA 2C5LA 3MGBA 1NRJB 1DUVG 4MVJA 1P19A 1V41E 2ZYRA 3LMKA 5EJ4A 1UBRS 2BHRA 3HBAA 2QQFA 3Q88A 2E6UX 1O6ZA 3GWZA 3BTUA 3K9LA 2PUWA 1C8LA 1ZK1A 1Y1PA 4MAFA 1L6IA 5FPKA 1O3YA 4ML3A 2ZJ3A 3RHFA 1PFQA 1X3LA 1NY5A 1FP4B 1VE1A 2O0HA 2J4FA 1KPIA 1TCCA 4TQGA 4G0QA 1DBVO 1X7YA 3AVOA 5IABA 2UVPA 3ITNA 3MF4A 4EM6A 3FROA 5DLYA 3ZDZB 1E2IA 1F6WA 1CLUA 3A9SA 3I72A 4D6XA 4I1IA 5TGZA 4BNTA 4DTCA 3WWYA 3GFVA 3PUHA 3SQLA 1ZOPA 3IUBA 4FR2A 1SQSA 3AZOA 4HGYA 1JEJA 3DWEX 4E30A 2WZBA 4RZIA 4AUEA 1H65A 1IQPA 2OVFA 5CNMA 1LBHA 2YV1A 4PSVA 2RHLA 2O05A 2XXAA 3DE7X 4OHMA 1CQWA 3GX1A 3MOIA 5CA0F 5KEIA 1QR6A 5TQ2B 5F7OA 1W85A 4X71A 5HYVA 5IKMA 4OQEA 1FQKA 1VBNA 5LP6F 3Q8LA 3SE7A 3HADA 5CEJA 1E2FA 1QGED 3R0VA 2HLHA 5LQCA 4CIBA 2GLXA 1QC5B 2ARKA 1CRQA 1S9DA 1BSVA 3NEPX 4AMUA 4TTSA 5ALVA 1WSDA 2YY5A 4DQDA 1LBSA 2CL7X 1A3CA 4O33A 2EDAA 3RVKA 3I4LA 3WJAA 4CCWA 4DCGA 2GPJA 2UYGA 4KE6A 2O59A 1A50B 5LYYA 2E89A 5IBRA 1P9NA 4YH1A 4N4AA 3V2UA 4BN0A 1E2HA 1YIAA 4MW6A 5FPPA 3NBQA 2I80A 2ZT7A 1KZHA 1ENOA 1Z12A 2R8RA 4KE8A 2IUSA 2CF6A 3M9LA 5BSWA 4LHYA 1XEXA 1Y1SA 1YF3A 1AQ6A 4V0NA 2WMNB 2W2LA 4RZ3A 1N7GA 3NFYA 1NY6A 4KZKA 1JL3A 4EMBA 5D7BA 1OFUX 5DIZA 1XDGA 4BEBA 1SIBE 1RLOA 3PPVA 3Q3IA 3M6WA 3OD5A 1NUPA 3MWKA 4YRFA 2CJXA 1U6JA 5K09A 2IYTA 2ASVA 2FAXA 5CDUA 3UAXA 1XTIA 2EBWA 4TWAA 3VR5D 4MS3B 5AKEA 4E88A 2BGRA 4LTMA 1Y89A 2FVYA 2Q21A 2QHXA 2Z2IA 4IPTA 5LJLA 2FWPA 5TQ0A 2OQRA 4ZRNA 5JJLA 2Z4SA 3UJ9A 4E5DA 1OLXA 3FHOA 1U0FA 1F2VA 1QG0A 2I6GA 4GWGA 2V7QA 2NTNA 1N5IA 1O2DA 1XJCA 4FJ0A 1MXHA 2OB2A 3L01A 4PX5A 1G5PA 2COKA 4S1WA 2TS1A 4DJ5X 4D9NA 4ED9A 3AKZA 4ZIRB 2G28A 4N3BA 1AX9A 1R00A 1DUIA 1YUBA 2XMZA 4P35A 5ILQA 4LFCB 1Z2AA 2PKCA 2AR9A 2CBGA 4HWRA 4QDZA 3ZH2A 1DIBA 4RX1A 1FMFA 4MARA 4RTNA 4OQZA 3QM1A 4QKQA 1BDIA 1P1JA 2Q1XA 3W0LB 3TOVA 1SOVA 2FPIA 4U7WA 5ECYA 2IBSA 2ZUBA 1R8SA 3EEQA 3TLCA 1N6RA 3MJSA 4R54A 1CUAA 1JFTA 4JI7B 3HUEA 4KODA 3CRQA 3HUFA 4H7FA 4HEHA 1RKBA 4YJ2A 3Q9NA 2VK4A 1Y9ZA 3FR7A 3T7JA 4EUSA 5J2UF 2PRIA 3V8PA 4OSOA 1JDBC 3OU2A 1SU8A 2JIQA 1KO7A 2RHBA 1K3FA 3C0KA 3CH4B 1J07A 3OU7A 4B2PA 5A1JA 2A1TR 2DPGA 2XOXA 2X5KO 2Y0CA 4IQ8A 1A9OA 4Z0NA 5JNLA 4R83A 4CL3A 2AE2A 3B1KA 3PDHA 1YQ9A 3HO6A 2XCTB 3ICEA 1B26A 1OX4A 3F6YA 4XB2A 1D7AA 1SELA 5F2EA 1WSBA 1E7QA 3PT5A 2ZYTX 2R86A 3F7OA 5FWYB 2QQ5A 1WCYA 4CIWA 2B69A 3O84A 1LH0A 2G5PA 2VXOA 4GO1A 3R8CA 2QGFA 3NEAA 2V4UA 1BS1A 3CEHA 4M89A 2AWNA 3UUWA 2BBWA 2DY0A 3HNRA 2FDRA 5DTQA 3SZUA 4N8SA 3G82C 3OBBA 3TRFA 1EXVA 3Q7EA 3TZBA 2OM2A 1XCBA 2JRCA 3HKBA 4XGIA 1HDEA 1KGDA 3NCHA 5COBA 3UFXA 4OB7A 4WOKA 3W05A 1B16A 2JLYA 4AZTA 4E22A 1OWLA 1A4IA 4DWWA 3LVRE 4GEKA 3V2HA 5G4LA 1CFZA 2P9FA 4NV1A 2JIZA 2AQ8A 4C2UA 1E94E 2EOAA 4DIUA 4H17A 1XKTA 2ES4A 4UREA 4JV5B 1UBJS 5AKKA 4YJ2