4HEJA

Discovery of selective and potent inhibitors of gram-positive bacterial thymidylate kinase (tmk): compund 16
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
202
structure length
198
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Selective and Potent Inhibitors of Gram-Positive Bacterial Thymidylate Kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 80
structure length 198
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hejA00
3K8YA 3GMTA 1ZUNB 1DARA 1G7RA 5DSZA 2VP6A 5BN5A 4TTRA 1QHNA 1S3GA 3MJHA 3LRPA 1CR0A 2NOAA 2QZ4A 2ZRDA 3ADKA 3CB4A 1OKKA 1TNDA 1F48A 2O8EA 3SFVA 2QGNA 3ICQB 2GZHA 3Q7PA 1E2HA 4M8NE 1DAKA 2VF7A 4RY2A 3QSYA 4LI0A 4B2IA 1KK0A 1A7JA 3O8RA 1P2VA 4RD6A 1FL9A 2DBYA 2CL0X 3AVPA 4NYMR 3K1JA 1KO7A 2XOKD 4IOKA 4M22A 2CNWA 2H92A 3B9QA 4KCGA 4ZKDA 3HWSA 4CEHA 1YE8A 4G5SA 2FFBA 4DLVA 1NG1A 1AJEA 4KBGA 2CXXA 1P2TA 4P3YA 1WCV1 1W36C 1OF1A 1SULA 4NBSA 3X1DA 4UNPA 4BEBA 5KTYA 1A5TA 3NH6A 3ZIAA 4LJ4A 2FPMA 1QDEA 4C0LA 4A8JC 3CH4B 4G5OA 5H8WA 1RJ9A 4OBEA 1W7AA 1ZD1A 3ZVLA 3KZ1E 1M34E 1Z6AA 3CF6R 2D2FA 1N6PA 4L16A 2OCYC 1RE0A 3OIYA 4PSAA 1G9XA 3BB3A 5JI2E 4JLJA 1DAGA 4HLDA 1IN4A 4QL3A 2N42A 4K8OA 2IXGA 4TT3D 1US8A 5EZ5A 2O5VA 2BV3A 4JS0A 4MUBA 5JZVA 2WTUA 3T15A 2FE4A 3VR1A 2O0HA 1FTSA 3AUXA 3O8BA 4CEIA 1CLUA 1TUIA 5FI0B 3DDCA 5D3QA 2CCKA 1NVWQ 4DLYA 2F1JA 5E4FA 3DZDA 1JXOA 2WV9A 5AR1A 5JLJA 2FMXA 1G3UA 3LDAA 2Z4RA 5FPTA 3IQWA 3GLFA 1VDZA 4C0HA 4TMKA 4C0QC 4ZI3A 2QSYA 3AF3A 3IEVA 2WKPA 3AKCA 4ZI2A 1AZSC 2CNWD 3IIMA 4XSHA 1KSJA 2GXSA 4JBXA 5AUPB 2VYFA 4MGZR 1GL7A 4IXNA 2EYUA 3MJRA 4TLDA 1R0WA 2QAGA 2CK3A 1Q22A 4BRWA 5C18A 4Q19A 3EXAA 4M9QA 3X1YA 1P60A 4OI2A 2IHBA 1T8UA 5GJVC 2XNSA 1H8ED 3K09C 3QXXA 4CEJA 2ZSFA 2QT0A 4D80A 3A1SA 4BEJA 3MG9A 4PC3A 2ODWA 1GITA 4MKIA 4B34A 2BOVA 2AK2A 3HU3A 4PPFA 2J0QA 4ILEA 4XH9B 4ZV4A 4I1OA 2AR7A 3BWDD 1AKYA 1XJ0A 2BVNA 3P4XA 4JLBA 4ASUA 3CUEF 2HLDA 1MABB 3K9HA 3PUXA 4E5UA 2RMKA 1W4BA 2WPDA 4TN1A 4KJZA 2PX3A 2ANBA 1F2UB 1OXSC 3FMIA 1IM2A 2R62A 3U3MA 1W0KD 1UJ2A 2IL1A 2ZR7A 4RCYA 3FVQA 4PSVA 2IA5A 4IHQA 1X8LA 3OIUA 4PZYA 5KDDA 4TL7A 2ZRFA 4D4JA 4L5BA 1KDRA 1R8QA 2WPDD 3PENA 4DC9A 5AJVB 3LQRA 1W5TA 3R9WA 3IPXA 4BFZA 1E1QD 4PZLA 1IHUA 2ZEJA 1NVUQ 1S8FA 4E03A 4A92A 3WRYC 2JIZA 4B35A 4HDOB 1JNYA 4OHYA 1XEFA 5JHGB 3A37A 3I8SA 3QOFA 2OAQ1 4DLZA 3H0KA 1B0UA 2NO9A 2XJ9A 4XOIA 4W5WA 2V1UA 1EFCA 2ZI7A 4OHWA 3WYGA 4EDHA 4Q00A 4UJ5A 1JQJC 3K0FA 2WICA 1KKLA 3O47A 4MUAA 2MSEB 4LBWA 3M1IA 2VP9A 1JI0A 2H1LA 4D82A 2EFDB 1G8HA 1ZM7A 4HZUB 4NYMQ 4IEEA 2ATXA 2WJHA 2GJAA 4RKEA 2BMFA 1ZIPA 5TARA 2QG6A 1G5PA 2XNDA 4P0TA 2O8CA 5J47A 2A7QA 2P2LA 2XAUA 2PH1A 2ONJA 4ZDWA 1G7TA 5E3HA 1VTKA 2OLKA 2JLUA 1JR3D 3LXRA 4A0FA 4PO8A 5CB8A 4Q01A 1GIAA 1Q57A 2F9MA 1G6HA 1KDTA 4QJ3A 1OIWA 3MWLA 4URWR 1DS6A 5L3RA 2GXUA 2VF8A 4P33A 5G3YA 2MMGA 3FKSA 2EFGA 2IS4A 3W6PA 3ZVRA 5J4HA 2A5DA 1YVDA 1Q20A 1RRFA 2DFLA 1F2UA 1YQTA 4MYTA 5E7MA 2ZRNA 4C4PA 5BYJA 2QMEA 3NEJA 4C7OB 4ARZB 4H1UA 1KZ7B 2GCOB 1IN6A 3KKOA 4KBFA 4TMWA 3AUYA 4M53A 3QF4B 2QM7A 3Q5DA 3AVXA 5KUTA 3AP1A 1J99A 1G8FA 1II8A 4NCNA 1EWQA 1KI2A 1SKQA 1SKYE 2A5YB 4JT2A 3PFIA 2BMDA 2ZI9A 3OFNA 2ZYUX 1DADA 3EW9A 3H4MA 4N1AA 3Q7QA 2R8RA 2R2AA 4RVCA 1NN0A 4G01B 3NG1A 1ZUIA 4B48A 5JSZB 1GVNB 2YV5A 2WOOA 1X86B 3IHLA 1ZC3A 3VR6A 4HLCA 1RZ3A 3LQQA 3X1WA 4MKGA 2QTVB 1E94E 2FH5B 2KI5A 3GFPA 1M2OB 2JLZA 3VU9B 2ZR9A 1EXMA 1JR3A 3QJYA 5KNBA 1LF5A 2RGNA 2PZGA 6Q21A 4FI3C 1S9DA 3PR1A 1W0KA 1Z6YA 1R4AA 1T0HB 4QM6A 1WMSA 4PPNA 1P2UA 2XTNA 1N3BA 4CIDA 5HCIA 5DISB 3OF5A 4ZIRA 4AI6A 1PUJA 2JLQA 3B8HA 4DVGA 3TUJC 2CLDX 1ZM9A 2BC9A 5JCPA 1JB1A 4PAQA 4XJXA 1CR1A 3QF7A 5FL3A 2OFOA 3KKPA 3C14C 4PPGA 5GJBA 4PFSA 2RHMA 1N0UA 3EIQA 2NMVA 4WBSA 2HYDA 3IIJA 2WJVA 3CF2A 4YC7A 3EZ6A 5JECA 3K70D 3UK6A 1RJ9B 2W6ID 2IYSA 4WZAE 5JHHB 2OE2A 1IN7A 2GEUA 3LY5A 1Z0KA 2QMOA 4HEJA 1OFIA 5FOXA 2HLDD 2BEKA 4CEHB 1BO6A 4B33A 4O25A 3EIEA 3THWB 5AWFC 2FSHA 3QXHA 4JKYA 1PUIA 2ZSEA 3QXJA 4LHXA 4UNNA 2J0UA 2RGDA 1C4OA 1XXHA 2QI9C 2NIPA 3BD9A 1IN5A 3PUZA 4LYFA 1NSTA 4BECA 2GK7A 1ONBA 3RAPR 2DFNA 4S35A 4EQ6A 3TKLA 1RFLA 4KLNA 2CLCX 1D2EA 3RYTC 2PLFA 1GNRA 3I4LA 3CWZA 5LD2C 3K9LA 1R5NA 2DYKA 4PC7A 1KK3A 1EK0A 2QMUA 3FKSD 1ZAKA 4PR0A 1YRAA 1G19A 3L2OB 1KO4A 4XIGS 4FINA 2EW1A 3SJZA 5DI9A 1BOFA 4HYYA 3SHWA 2BCJQ 2QQ0A 1M1YE 1IJEA 1F5NA 4BLRA 1PJRA 3W3AA 4NONA 5A0FA 1FNNA 3KXLA 4TMVA 3A4MA 4NTZA 2XB2A 1KK2A 5HE9A 3WBKA 4R71A 1GUAA 4ESHA 3K09A 3CZQA 4GSYA 1XEXA 3K0AB 1FP6A 2H5EA 1SVMA 4RD1A 2Z43A 1WB9A 2GJSA 5DN6A 2IYYA 3SYLA 1N6RA 2D2EA 2VHTA 3U5ZB 3HP1A 3B6EA 1KAGA 1GTVA 2REBA 1YZTA 3GPLA 1N6KA 5FBQB 1FUUA 1KYIA 3DPUA 3FDIA 1XF9A 3UWKA 1ZU5A 2WM9B 5EXTA 4ESVA 3EX7C 1PVOA 4HAVA 1BMFD 5BXQC 4CVNA 1EESA 2W58A 4XWAA 1IJFA 2F7SA 3FHOA 3KJHA 1L2TA 4JLOA 3GEHA 4LBYA 3WNCA 5DN6D 3C7KA 4IOLA 2UVQA 1NL3A 3AKDA 3PEVA 2YHSA 4XTRA 4BFYA 1RYHA 3EG5A 4G5GA 3EPLA 3U4QB 1JJ7A 2NZ8A 4XWKA 5FPHA 4AURA 5DNYB 3THXA 2IWHA 1IXZA 5CJPA 1ZUHA 2J0SA 3ZZTA 5KYKA 4ZKEA 2EYQA 2ZJ2A 2ZUCA 3KQKA 4D26A 1OIXA 2FSFA 2XXAB 2GTPA 2C8VA 3ETLA 3FMFA 3AF4A 4D2IA 3GEEA 1VHLA 2GAOA 2NG1A 2QBYA 1TMKA 1YR6A 2VP0A 2VQSA 2OO7A 1KMQA 3VFDA 2ZXUA 4JJZA 2W6JD 4D0GA 1E2NA 2ZI6A 4CGZA 5FBLB 4AG5A 5HKKD 3AEZA 1T3SA 2X1VA 3ADBA 1ZCBA 5D3MA 5GADl 4B2PA 1GL9B 4JIMA 3THOA 4QBFA 1VG9B 5JJLA 3THYA 2Q3HA 4IOJA 1OH8A 5SZKB 5CK5A 1UM8A 2RGAA 4Q1AA 1QHIA 4Q02A 4KO8A 3KQLA 1IXSB 3HJNA 1W47A 4M4SA 2EFHB 4US2R 2WHXA 4QBHA 3W5IA 4B43A 5FOUA 4A15A 2V9PA 1U0JA 1KIMA 2C98A 1VKJA 2IS6A 3CPJB 2XXAA 4K46A 2V1XA 4CZ2A 5F3WB 2R6GA 4HATA 4HAUA 2GJ9A 1NP6A 5FTNA 4TZ0A 5FBWB 1KI6A 3UMFA 1J8MF 1R0XA 1ZM4A 2BKUA 1KNXA 3SE0A 1U8ZA 1W0JA 2ZRPA 4GP7A 3W6OA 2WMOB 1WF3A 2XSZD 3D7MA 1FMLA 4EAQA 1CF4A 3U6KA 1E2EA 1OIVA 1W36B 2J46A 2QRNA 1YKSA 1GSIA 1EX6A 3GLFE 1TX4B 4IVPA 1NRJB 4JLDA 1AK2A 1ELOA 3B1WA 5IRCD 5TV2A 2XSZA 1GRRA 1T3LA 3SNHA 2WKQA 2FFQA 1MH1A 2XTZA 3LD9A 4DLUA 3AGPA 1Z3IX 3R7WB 1G8YA 4HAWA 2WKRA 4X8OA 4PAMA 4TYYA 2ZANA 4QGGA 1UBCA 2JJ2D 5JS7A 4HZIA 1XTSA 2WJGA 2F1HA 2QM8A 4DSTA 2ZITA 1XTRA 4FMDB 1XD2B 1G291 1N6HA 2A5GA 1Z22A 1KO8A 1E9CA 1ZVQA 2A5FA 4JZKA 1ZNYA 3H84A 3LFUA 3DKPA 1TU4A 5LBIA 2ODEA 3GLIA 4BZXA 3FYHA 5CDFA 2D7CA 1JXMA 3BERA 3OESA 2H17A 5JJKA 1BKDR 3LVQE 3ND8A 1CIPA 4EKDA 3PV0A 4NH0A 3GFTA 3ZLJA 2WSSA 1HQYE 3D3QA 3AVWA 1HTWA 2IUSA 3ZVMA 2BMJA 1KOFA 3GEIA 3AF0A 4TTQA 4NP6A 4NYIQ 3BIFA 2UKDA 4WA7A 1XCPA 5H68A 1VYUA 4PQYA 3MLEA 1I4LD 4AKGA 4NCJA 2PBRA 1Z2AA 3WMFA 2F3RA 4TTPA 2QE7A 4BFWA 1W46A 2B7CA 2R6DA 1UKEA 1XXHB 3BE4A 3FTQA 4JVLA 1DG1G 3E1SA 2NGRA 4H1VA 4HLQB 2RHDA 4II7A 4TMZA 5FUYA 3RANA 4YXWD 221PA 2DY1A 3MUFA 4DDTA 1OFUX 3IO3A 3CBQA 4DJTA 2WIAA 3ZH9B 4PTLA 3K0CA 3QY0A 4AG6A 1OHHA 2H16A 3NXSA 1M6NA 4NKRA 3EC1A 4JVNA 2ZUDA 3GJ7A 1SHZA 4DIDA 4H9GA 4QG7A 3QPUA 2HUPA 2D3WA 2ZRGA 2VIIA 5EQTA 1U8AA 2OXRA 4QKQA 1HEIA 3U44A 2ODBA 4YMVA 2AX4A 1XPOA 3F3YA 1F2TB 1QHXA 1ZNZA 1NKTA 1N5KA 1Q1BA 2JEOA 4IEIA 4MKFA 3T12A 4Q1EA 3B1XA 3U7GA 2FNAA 4OJQA 4F4JA 5JWOA 4A9AA 3CX6A 5EE1A 5JEDA 3F8TA 4UXJA 1P61B 1S1MA 3WP0A 2JGNA 2ZQ5A 3AV0B 1KO1A 2VP4A 3B60A 1I2MA 1G8PA 2GA8A 3VTKA 4IJMA 4R7ZA 5HZHA 4EPWA 2DFKB 4EJSB 4DT1B 1T0JB 4TLEA 3LBNA 3CZPA 4TQAA 5LPNA 3OEEA 4DT1A 3L0PA 3NC1C 1N6OA 5G41A 2A78A 4ZIRB 2ZJYA 3SDZA 3ASYA 2PMKA 4NYJR 5D3MB 3RSOA 1D2MA 5KSOA 3F5FA 3BJIC 3RWOA 4C0AC 4ERNA 1OV4A 4ZCLA 1E2DA 1H8HD 4CEIB 3FOZA 2KJQA 1Z6TA 1XMIA 1DE0A 2PJRA 3CRW1 5E7JA 4OQFA 2ZRJA 1CXZA 1I4TD 1YZLA 3BFKA 4HAXA 2L0XA 4PHGA 3C5CA 3QKUA 3WHKA 1HYQA 1P3JA 1NKSA 4WXRA 2YOGA 3VX4A 3MWKA 4RJLA 3CPEA 1XCGB 1AA9A 4FMCB 1XZQA 4NMMA 3ZZUA 3I5XA 1X8KA 1T8TA 3U61B 5FR2A 3A1UA 3WMEA 1W2HA 5CDFE 1E2FA 1GILA 2R6AA 3QKSB 3W8RA 3EIHA 1E3MA 4LBZA 4A36A 2YWFA 1FQKA 3ADDA 3AVUA 3SBEA 3D6TB 2PT5A 2OBLA 3PJRA 2UZ3A 3GFOA 4F38A 3T61A 4HAYA 3VKHA 4KLZA 2ZR0A 3PEUA 4EIWA 2R6FA 2P67A 2B8TA 5LB4A 3TW4A 2NZJA 4MGYR 2BBWA 4JLKA 3THYB 4QGFA 1II9A 4UJ3A 1W49A 1HUQA 2AKYA 3WMGA 5FOSA 1WBDA 5CIWA 5AK0A 3ND9A 3LW8A 4MDEA 1F3OA 2ZJAA 1NMYA 2G0NA 1CJMA 1E32A 1L8QA 4Q1FA 1O3YA 2ZS7A 3K0EA 3P20A 3SQWA 2XNDD 2R9VA 1GDDA 2LKDA 1P72A 4CT5A 4Q66C 4B3GA 3A4LA 3HR7A 3UKDA 2QA5A 1W44A 1KGDA 1VG0B 4HDQB 5J4YA 2D62A 2C78A 2ZI5A 4QM7A 4BWYA 3GLIB 5HE8A 1U0LA 2ZVQX 4FWIB 4GOXA 4KYUA 1N0VC 4HB0A 1FFHA 3ZQ6A 3PEYA 1AN0A 4QNRA 2B6HA 5FOWA 3QBTA 4LK2A 4I81A 3U2QA 1LVGA 1TU3A 2P5SA 4M1TA 4LJAA 1AKEA 2CK3D 1D8TA 2VEDA 2VRWA 2WAYA 4ZPXA 1D9ZA 3VNUA 3C16C 1OLOA 4I1UA 2G9NA 1TQDA 3W5JA 3F0TA 4JBWA 1U98A 2GEDA 1IONA 3L8ZA 4XD7D 1NMXA 3IIKA 4OQLA 1MKYA 4BLQA 3CKLA 2ZRLA 1P5ZB 2MMCA 1WRBA 2CE7A 1BMFA 1XFAA 1YZGA 3DKVA 4QNMA 2FEOA 4QXAA 3T34A 4Z51A 3OFND 3R8FA 4PX9A 2V6JA 1TF7A 2V54A 4JLVA 2OBMA 1AS0A 2QEQA 3SJAA 3L0SA 1GKYA 4AKHA 5TB5A 3RS2A 1S3SA 4GP6A 1UAAA 1Q1QA 1E98A 3LX5A 2JA1A 1PLJA 1KSHA 3VQTA 2IYXA 1MOZA 4NYIR 3RRNA 2A5JA 3ZJYA 2OCBA 1N5LA 4TYWA 1PLKA 2IBMA 3UIEA 2V7QD 3CX8A 1E1QA 2YC4C 4YDSA 4IDNA 1G5RA 4M1YA 3Q8XB 4RKFA 3NHBA 1KJYA 1UADA 1LNZA 2ZREA 3TSZA 2W83A 1MRSA 2O52A 2QMHA 4FMDF 5B58C 3U7FB 4AKIA 4Q7MB 1CU1A 2LWIA 3C15C 3FGNA 1R10A 3TAHA 1W36D 1A4RA 2EVWX 4TQ9A 5FI1B 1P2SA 1T91A 2FF7A 2WOJA 4UNRA 1R2QA 3B1YA 3PCRB 3KTAA 3E70C 2O8DA 1AIPA 4G1UC 4DLRA 4LRWA 1H8HA 4OL0A 4KSBA 4AYTA 2V55B 1CRPA 4OI4A 3HPRA 2F9LA 3VKWA 5CITA 1BH2A 2BJVA 3BK7A 4GI7A 1J70A 4D4KA 3A36A 3IHWA 2JLWA 1OYYA 1SVOA 4O2LA 4Y0VA 2AK3A 2BEJA 3BFVA 5DLQC 3P32A 1F2TA 2QPAA 4LHZA 4C0SA 2C96A 2QQEA 2CLSA 1KI6B 2V4ZA 2ZRKA 1ESNA 4MRVA 2JDIA 4LHYA 1PLLA 3SEAA 3U4QA 3B78A 2ORIA 1S2MA 1G4UR 2B7BA 1PV4A 3A1VA 3HR8A 4HB2A 2WSMA 3AB3A 1RIFA 1FPMA 1MO6A 2ODNA 2QROA 1MR3F 3AVOA 4LPSA 3T1QA 2JDID 1HQCA 1XP8A 2F43A 3TSWA 1MT0A 3B7GA 3VU9A 1CRQA 1X1RA 5EXPA 2ZJBA 2OFXA 1NIJA 2YWEA 4ACBA 1A2BA 3WNDA 1A2KC 1ODFA 3QIAA 1VG1A 4R98A 5L3SB 3A6PC 1UKYA 3EWAA 2FGKA 2JLSA 1Z08A 2NO7A 3EZ2A 1XEXB 2JJ2A 5ANRB 4BFXA 4PANA 2OFWA 4HLUC 4Q7KA 4EJSA 2ZJ8A 4M9SA 1QHHA 1T6NA 1UF9A 1XMJA 1GKIA 4DZZA 5L3VA 4R2HA 4KV9A 1G7SA 4LV5B 1KJWA 3C8UA 1HH4A 3N70A 2YOFA 4IXMA 1G17A 2HT6A 1NLZA 1T9HA 1VG8A 4YONB 3AP3A 1IXRC 1KAOA 4E22A 3CRMA 1JEEA 1NY5A 3AKYA 2B92A 1Z8FA 2HXSA 1ANKA 1P73A 4PXAA 4V02A 5DIFA 4MH0R 1OW3B 4JKIA 4G3XA 1VCIA 2AFHE 2EFEB 4D4MA 2OV2A 4IOMA 5L8VA 1E2GA 1VCMA 2C77A 4NU0A 2ZRAA 1XD8A 3EWSA 5C46F 1EFRD 2QP9X 4LYHA 1E9SA 2RGEA 1QG2A 3OIVA 1JQLB 3UPUA 4KAXA 1D2NA 2GNOA 3IPYA 3W8NA 5L3QB 2CE2X 2SHKA 2Z83A 1HA3A 4Q4AA 2W6IA 4F4CA 1R0YA 3ECCA 5TXGA 5JWRA 3PXGA 4GOKA 2ZYVX 3EARA 4JLNA 4RD4A 3VHXA 5FPKA 1JALA 4I1VA 1XTQA 4B3FX 2ZSBA 3OZXA 2J0UB 1FOEB 3CPHA 5P21A 1N6LA 3LVRE 3NHAA 1WA5A 1H65A 3DEFA 3H86A 4KVAA 5AUQA 4URVR 2J87A 2P6NA 1DG3A 2EFCB 3TLXA 3I92A 4G0NA 3ADCA 3FFAA 2WWWA 1NBMA 1KSGA 3W3ZB 5FBVB 3THWA 1KY2A 3AVVA 2ZAMA 1KDOA 1Z6XA 2H57A 3G82C 3K9GA 2PX0A 2OZEA 1UKVY 2EWVA 4WXPA 4X8MA 4FXPA 2OLJA 4QBIA 4HSEA 4DB4A 2X8AA 2AL7A 4M1KA 3MCAA 4P4SA 5FUXA 1ZM2A 3O8DA 3AVYA 2GCOA 4PHFA 3AF1A 2CBZA 4MGIR 4TLAA 5AJXA 3QEOA 3QXSA 3UANA 4IRUB 3RS0A 1ZP6A 2CVFA 1Z0AA 1I4DD 4U02A 4A6XA 4UNSA 1XBTA 2VH5R 4QHTA 4AIIA 5M04A 3L43A 1GNPA 2ZI4A 3KB1A 2ERXA 2WJYA 4DRZA 2O8DB 2QRZA 1FUKA 4OK3A 3J81k 3ZS8A 4JVSB 3I1FA 2IYLD 4EFMA 3P1JA 1JAIA 1K5GA 2RGNC 4P31A 3IBGA 2E9SA 2GETA 3VKGA 1RRPA 5JCZA 4B73A 1O87A 4KSCA 2FJUA 3GJ5A 5EP3A 2I1VB 2HF9A 1T4GA 2IF2A 3AP2A 2QAJA 2EQBA 2OILA 2W6JA 2GK6A 4KHZA 3TRFA 1OFTA 1EFUA 1UEJA 4B3BA 4U7DA 1YU9A 4ACAA 2IYRA 3KJEA 4V0MA 1P6XA 1Z28A 2C2HA 2WWFA 4M9XA 2QORA 2F3TA 1TEVA 3RRZA 2H18A 3KJGA 4TT3A 5EZ6B 3DM5A 3P26A 1XJCA 2CMKA 4HLUA 1P9WA 3PUWA 3AGQA 4UXHA 3UWOA 1TUEA 2ORWA 3P4YA 3H1TA 4JL6A 5EE9A 5IF9A 1ZRHA 1TAGA 4UXIA 4Q18A 4CRWB 3EPHA 4Q47A 3V4RA 4EPXA 2ZU6A 1TTTA 5SZHB 4GMXA 1K8RA 1BIFA 3JVVA 1E2QA 1XMVA 2IUUA 2B21A 4TYPA 3ZIAD 5DE3A 2AXNA 2VSFA 4V0LA 2J7PA 2DWQA 5G40A 4GL2A 1XU4A 3L0OA 4Q1CA 2GZDA 1E1RA 3TIFA 2GBLA 1IY2A 4MRSA 4OJKA 5BN3A 1OH6A 4AY2A 2BJWA 1DOAA 5AUOB 3KKNA 1K6MA 1P9NA 3HYTA 2PEYA 4ZDKA 2VHQA 1XEWX 3DO6A 1Z0JA 2JJ1A 2JATA 2IS1A 1LW7A 4PHTA 2OSBA 4RZUA 4DSUA 4C0BA 5FL7A 5FTLA 2ZJ5A 3BXZA 3QKRB 2HV8A 1OHHD 3DMNA 1VHTA 5KDOA 4JL5A 4TMXA 3GJ0A 4DHEA 1QVRA 1N25A 4DDVA 1SGWA 2P3SA 2B8WA 2XZLA 1E6CA 4BLSA 4TLBA 4Q1DA 1UDWA 1N6NA 4PC6A 4K81B 2GZAA 2TMKA 1U99A 4W9MC 2JJ8A 4A0GA 5EXSA 1UPTA 4DUGD 2XEXA 4QHYA 3OE7A 1G5TA 3WXMA 1NVVQ 2CHVA 2YWGA 2CL6X 3TH5A 4LCBA 1R8SA 4LJ7A 1V43A 3R9IA 1CP2A 1D5CA 3MSXA 3CRRA 2BBOA 2WJJA 2ANCA 1EFRA 2J7PD 1G20E 1LS6A 1M7GA 2O0KA 5TVKA 1JEDA 1KI1A 4DXAA 2XB4A 5KNCA 1CULC 3FE2A 1OXTA 1XD2A 4RD2A 2V7QA 1S96A 3BAFA 1FQJA 1TF5A 3TR0A 5G53C 2O8BB 5FTJA 3QQ5A 4LJYA 1XDBA 1G3QA 3FMOB 2OUKA 3U7HB 2O8BA 3LBIA 4PO9A 1U81A 4ZCMA 3TW8B 2JJ1D 2BWJA 4JJKA 4RZ3A 3SFZA 5JI3E 4OHVA 3NTUA 1HE8B 1XPRA 2V8OA 3VX3A 4YMUA 1CKEA 1KTVA 3QG5A 1NBMD 2NPFA 2ZVPX 4M2LA 4A82A 1XWIA 1E2MA 1TQ6A 2DPXA 4U00A 4YXWA 5A5GA 4BASA 2IXEA 1CJKC 3S1AB 1N0WA 3TGPA 2G3YA 3ZD6A 3EAQA 2GF0A 2VA8A 3R9XA 2D06A 4A4DA 3LLMA 1BYIA 1U0HC 2YVUA 4FIDA 2OCAA 4Q9IA 4ITRC 1EFTA 4BQSA 2QAGC 3OEHA 3B82A 2OAP1 5BWMA 1G64A 2Q3FA 2RGGA 1J2JA 3RS7A 1DPFA 4MYHA 2RB4A 4P4UA 3LH5A 4G5RA 3WNBA 5K8TA 3ZGXA 1W48A 4BLOA 1T5LA 4HI0E 1M74A 3ZZ0A 3QVVA 5DI3A 4LYAA 2C9OA 3R20A 4JBYA 1N5JA 4LUCA 2O0JA 2XOKA 3VNVA 1QG4A 3SQXA 3UMSA 1Z0DA 3KTAB 3QI2A 3A1TA 2IXFA 3QUSA 5JJIA 4DCSA 2F43B 1WE2A 4RFVA 3E2IA 3OAAD 1QHSA 2J5XA 2I3BA 3RS4A 2N46A 3N5CA 2VPPA 3QPWA 1II0A 2FFHA 3JZMA 4RZXA 1SVLA 2FU5C 2QPOA 2W0MA 5GVRA 2OT3B 1YRBA 3WYFA 4BFUA 4DLSA 4ZCIA 5K8IA 3KFVA 2XZOA 4W5JA 4LYJA 1RPZA 2MSDB 1PZNA 2ZETA 1MRNA 4QGAA 3RHFA 2QP3A 3U3OA 3ZDQA 3D8BA 3A4NA 1W4AA 5JRJA 3BOSA 3K70B 1UBGA 3CNLA 1OH7A 2JASA 1N2CE 3CH5A 1YZQA 2VP5A 3GLGB 4M1WA 2VL7A 2QN6A 4PPQA 3K0FB 1TQ2A 3GLHA 4KODA 3SYKA 5EXXA 3IEUA 1IN8A 2YYZA 4GFDA 2R44A 4NHOA 1KI3A 3T1OA 3FMPB 4MITA 1SXJA 4Q4HB 3SJCA 3Q85A 4KFRA 3GLGA 2ZS9A 2BM1A 5B2ZA 1COWD 4WW0A 3S1AA 1SVIA 3TUZC 3SS8A 1JBKA 2EU8A 3V4FA 1E0SA 1E2JA 5C4GB 1TADA 4OQMA 3BH0A 2ZU0C 5C4MA 3AKEA 1U90A 3LBHA 3NDBB 521PA 4IFEA 1FMJA 4YQFA 2C95A 2R65A 3IUYA 2IS2A 4DCVA 2C99A 1KSFX 3OAAA 2K5UA 4BZPA 3UATA 3T1TA 3RWMB 4EPTA 3NBXX 3GLIE 2ZUBA 4IW3B 4G5QA 4C2TA 2HJVA 3KX2A 3HYRA 4L4UA 4LJ9A 1KDPA 2VTKA 2WBLC 4GZLA 3I72A 2O8CB 3ZD7A 4EPRA 5EUQB 3IQXA 1CEEA 2WZQA 1Q3HA 3FFBA 4IVRA 2Q9AA 5CJ2A 4MYUA 1VYTA 2H7VA 2XX3A 4ASUD 2QT1A 3OEED 3KXIA 2DB3A 1OFHA 1P62B 4B47A 1LFDB 1AM4D 1EGAA 4C0KA 3NBYC 2ZRCA 1DO0A 2C9CA 4AK9A 1A1VA 3G0HA 2GJKA 1DAMA 1ETUA 2ATVA 2X2EA 4AD8A 3CW2A 1E9FA 3GJXC 2P6RA 2G6BA 2GAAA 5FOTA 1QVAA 2QAGB 5AUNB 2QNRA 1ZC4A 1IQPA 2HT1A 5DHFA 3U3RA 1N5IA 3QPVA 1MO3A 3I3SR 4B71A 1NN5A 3QNUA 3BH6A 3IO5A 5CLLA 3QKRA 1CJTC 4AC9A 4QFMA 1E79D 1KZGB 1ZM3A 1GFIA 2F1IA 3BGWA 1YR8A 3PIRA 4QC2A 4AYWA 2Q9BA 4QRHA 1F60A 2CCJA 3MAAC 4WOPA 3T06B 5IT5A 621PA 3RSLA 1XPUA 2ZJZA 4B6FA 5F9HA 1GWNA 1S9HA 2PL3A 2GCNA 3CX7A 4Q4AB 2GCPA 4P4TA 2ZTSA 3QVUA 3LXXA 4X8LA 4HB4A 3WBJA 2WWHA 5EE3A 4YMWA 1NG9A 3RABA 1E9DA 4BLPA 3ZS9A 5B64A 1US8B 5SZIA 4DEXA 5C1BA 1E0JA 1XCMA 4EFNA 2QPTA 1Z06A 2WJIA 3R7WA 2OBNA 1KNQA 8OHMA 4FCWA 2PZEA 4OYHA 4NPHA 1QHYA 4F7WA 2YKGA 2IWRA 1KHTA 1GOTA 4A1FA 1MABA 3EA5A 2JLRA 5IHPA 5EP2A 4MRRA 1X8JA 5AJYA 3A8TA 3KQNA 2WWIA 2V6IA 3SYNA 1JR6A 2FSGA 4XVQA 1NLYA 1RYFA 2PT7A 3TQFA 5J4LA 4M21A 1BYUA 2FA9A 4B3DA 4CEJB 1GP2A 3LO5A 3BB1A 1QHHB 3GJ6A 3BS4A 4YDHB 3BFXA 3JVUA 3U6BA 5JRZA 4TL6A 2FZ4A 2J9RA 3AH8A 5HR5A 1TEXA 1COWA 3UMRA 1KK1A 3CR8A 1CJUC 4XSGA 1W0JD 2FDCA 4JSTA 4Q03A 1QF9A 3GP8A 1Q0UA 4F4IA 3EPKA 2YZ2A 3ICEA 5J4VA 2VHCA 4HUQA 4IVQA 4QJ4A 1ZW6A 4X8HA 1LTQA 1VPLA 3W6NA 4WZBE 1IY1A 1FW6A 2QBYB 1E1RD 3M0EA 3DVLA 1MV5A 1JJVA 1IAQA 2FPLA 1I2DA 2I4IA 2KB0A 3KQUA 5CYOA 2MSCB 1W2GA 1Q1ZA 3LW7A 4TSFD 4JYBA 2WIBA 3GLHE 5JMTA 4I99A 3T35A 4FCVA 5KOYA 2I1QA 5F98A 3AVQA 4JLAA 4DDUA 1E9BA 2QE7D 2PLRA 2ZROA 3K0AA 3K0SA 3HU1A 2DFTA 2ZM5A 2VBCA 3T5GA 4IDHA 2REXB 3TK1A 1QZXA 4TLCA 1ZMXA 4Q7JB 4A8JA 3JZAA 1Y63A 4N0DA 3SHFA 1Z0IA 4L9SA 1G1MA 3B9PA 4PQFA 3TSOA 1ZBDA 3VAAA 1AS3A 2J59A 1NVVR 3QEJA 4RFSA 2WVJA 2AXPA 3Q72A 5AJZA 2RCNA 3AM1A 2F55A 4F91B 1X1SA 1SKYB 4BFTA 4PSKA 1HURA 5IK2D 4WIAA 1Z5ZA 3NBFA 2W2XA 3NVAA 4XWOA 5EJEA 1J8YF 2G88A 4Q1BA 5B30A 3X2SA 3G5UA 4RZ2A 4Q9HA 2ZE8A 4I1SA 5DH9A 2JLXA 3TVTA 3X1XA 1GG2A 1LS1A 2AN9A 2REOA 4QBGB 2LKCA 1SHKA 1VECA 1KO5A 3HPQA 1DAEA 2G1JA 3ZVNA 1R0ZA 2G1KA 1OB2A 1ZINA 3KL4A 4D4LA 2PCLA 4QJ5A 1N6IA 4EFLA 3CM0A 1OT3A 3L82B 1E2IA 3PUYA 4W7SA 5DI3B 4KITB 3CO5A 2ZRIA 3SBDA 3GLGE 4LJ6A 1AZTA 1J90A 4JYCA 4HZUA 4O3MA 1L7VC 4O2RA 1E9EA 1QHGA 2ZSDA 3KFXA 1Q3TA 4D81A 1UDXA 2A2ZA 2FFAA 2ZJOA 2IK8A 3A1WA 2QGZA 1DAIA 4Y0AA 5HPYB 2F1RA 4AYXA 1G6OA 3KQHA 1YHNA 2QY9A 4EQ6B 4E09A 1T5IA 1D9XA 4MGKR 1AQYA 2IYQA 4R2IA 4CF7A 3M6AA 1CTQA 3RLFA 3LAWA 2CL7X 5KU1A 4Q4JB 1E96A 3PUVA 4JLPA 4OQNA 2O8FB 2BIFA 2V3CC 1WQ1R 2Y8EA 4MQBA 4PQRA 4EPYA 5CK4A 1HV8A 4NCIA 5JEEA 2QU8A 4OK6A 5EP1A 5JS8A 1E4YA 4BRUA 1ZYUA 1DVRA 4JL8A 4B32A 4Q21A 4L9WA 5E7IA 2CHQA 5LDDC 2NO6A 4BUJA 5IDVA 4IDQA 2BBTA 1R7RA 3RS3A 1FX0A 2OM2A 5KO2A 2A3RA 4QHSA 2GESA 2J41A 4A0HA 4EPVA 4O0MA 1T3HA 4LHVA 4KXFB 1B23P 2OEPA 3IGFA 4TYQA 2ASEA 2P6UA 4RD3A 1LB1B 4M9ZA 1CJVC 3KDSE 5J5CA 3E5HA 4Z1MD 5JSZA 4Q7LA 1G7CA 2PCJA 1XZPA 1G16A 5BN4A 1OH5A 3I73A 4DSOA 1OYWA 3AQ4A 2JAQA 3BORA 4FW9A 3PEWA 5TMPA 1SVSA 2WMNB 1V5WA 4PHHA 1OXXK 3GLHB 1XJQA 4HDCA 1Z29A 5TDHA 5HTKA 3MMPA 3OE7D 4PC1A 1TPZA 1S0UA 5DHAA 3FHTA 4KFUA 5JBQA 1MO4A 4IDPA 4BLTA 2JIZD 2CJWB 3C5HA 1G21E 1ZD9A 3ZQJA 2BBSA 2VSOA 3T1VA 2NTYC 4V0KA 3FPAA 3EASA 2HYIC 1SVKA 2BCGY 3LX8A 1UEIA 3EA0A 4ZDIA 2C5LA 3TNFA 4OI1A 3B13B 1ZD8A 4MA4A 2FG5A 5FL7D 1OJLA 1P9RA 3TJZA 4WZ6A 1VCNA 2FPKA 4GZMA 2ZYWX 4LY6A 4Q9LA 5G3ZA 4DSNA 2ECKA 1XB2A 3VMFA 5K8UA 5KSZA 1RVDA 2ZRMA 4TSFA 1M8PA 4D6PA 2VHJA 2P5TB 1EG7A 4KU4A 1RKBA 2CCGA 2FWRA 3TE6A 4DCUA 2KBEA 1QRAA 1HE1C 3LA6A 2WSSD 3GJ4A 5F2EA 3NEYA 3WY9A 5KPJA 2YNMA 1RRGA 2ONKA 3W34A 2BDTA 3Q9LA 2G0TA 5CB6A 4Z8YA 5K8LA 2JLVA 1ZIOA 3W9YA 4IKEA 3N2EA 4C2UA 1Z07A 4FD2A 1QBKC 4Q9JA 3BRWD 1G18A 5TY0A 4C3ZA 2FZLA 1GAJA 3D31A 4HAZA 4KI0A 121PA 3ASZA 5FPYA 3I32A 3RC3A 3FWYA 4L8GA 2YC2C 2RGBA 1R5OA 3AF2A 1YZUA 2WWYA 1GM5A 4C30A 4FWTA 2YOHA 3OIWA 2Q21A 3NDPA 2D7DA 1ZU4A 3B5JA 3QENA 3QF4A 3MWYW 1SXJC 2GF9A 3CWQA 2C03A 3K70C 4RCZA 1IOZA 4DLXA 2QSZA 2ZE5A 2E1RA 1SZPA 1ZNXA 2BKEA 1KI9A 5H70A 3QE0A 4A2QA 5BW8A 3SI7A 4XVUA 4URXR 2IT1A 4ZO4A 5KDLA 1Q21A 1GL6A 5KPDA 3SZRA 1RC8A 3B2EA 2Z4SA 4PO1A 1K5DA 3V9PA 4BFVA 2PMDA 2O8EB 3UG7A 2IF0A 4F93B 4POAA 1E79A 1L4YA 4D0NA 4LOAA 1IBRA 5HKKA 2Z0MA 1P75A 2HF8A 4DWJA 2HCJB 5AJWA 1NVXQ 1Z6GA 3CR7A 4CT4B 2VHUA 2ERYA 3REGA 2ZS8A 1RW4A 1XRJA 4N3NA 4ON9A 1KMHB 3DHWC 1XTIA 1YZNA 1DBSA 1D6JA 2C9YA 1RRCA 1E4VA 1NBME 1NI3A 4HUTA 3RRMA 4PAOA 1WDTA 4LV6A 3THXB 4Q4LA 3UG6A 3PQCA 2YINC 4B3XA 2IYWA 1UKZA 4R9UC 1W1WA 3WP1B 4TL8A 2ZRHA 3KUDA 2J0VA 3K0CC 1NNEA 1OB5A 1TF2A 1VMAA 2HXYA 4URUR 5CLQA 3TR5A 4F92B 4ZDJA 4HB3A 4GNKA 1JPNA 2AWOA 4NCKA 3VHLB 2IYTA 3QXCA 4B2LA 3MD0A 1E0KA 5L3SA 1LY1A 5FOVA 3O8CA 1HY3A 4A2PA 1KI8A 3K53A 1C9KA 3OEHD 4TZ6A 3OHMA 3VR2A 2GDJA 3SR0A 4OI0A 2IW3A 3TMKA 4CDGA 4NDZA 2JCSA 1UBEA 4WAUA 5GJCA 3NWJA 4OK5A 1XEWY 3QKTA 1NN1A 1WP9A 3B1VA 3B85A 3DMDA 4LSGA 1KKMA 4FMBB 3CRQA 3WRXC 3HDTA 4AKEA 2KSQA 3MWJA 1M7BA 2FN4A 5GVSA 3QKSA 4PZZA 1NSFA 2Q9CA 1Z47A 2J1LA 2OHFA 2ZE6A 4Z1MA 1U8YA 4B74A 3NBZC 3CLVA 2RGCA 4LC1A 5CIQA 4LJ8A 1OXUA 2AFIE 1IY0A 4UNQA 1XMSA 2XGJA 4WVFA 4GMDA 2Q3MA 2WWGA 2VP2A 5JWHA 4DCTA 4B3CA 3BB4A 4BE7B 1SXJB 2P65A 4U5XA 3W90A 4P4SB 1OKKD 3LLUA 2GWHA 4GPTA 4DBLC 3RC8A 1TQ4A 4Z8XA 2RAPA 3VR5A 4Z54A 2D4HA 3P27A 2HDNB 4S2EA 3TUIC 4DLTA 4Q48A 3GCGA 3KKMA 2XJ4A 3M4YA 4A6PA 721PA 5FTMA 1SVWA 2P0EA 2GXQA 4HUQB 4LC0A 4KYIB 3LV8A 1G8GA 2DWPA 3VR4A 2O8FA 3L0IB 4ABYA 1Q1EA 1XXHE 2CJWA 4P32A 3GLFB 4V0OA 5BYKA 1CR4A 1E2KA 1YJ5A 3FB4A 2LCFA 3L8YA 2J3EA 1W5SA 2A30A 1TL7C 3HU2A 3IDQA 3TQCA 2QENA 1XD9A 4LHWA 1EFHA 3DL0A 4RFSB 2HCBA 4DCNA 1NF3A 2AHOA 2GHIA 3RRYA 1NJGA 1R6BX 1JAHA 2NQ2C 2WWXA 3NIBA 4NZYA 3RS5A 2DCUA 1JR3E 2G77B 4LWZA 2IX3A 3RDPA 1H8EA 4MRNA 3B1ZA 1CR2A 4OHZA 2QTHA 5F9FA 1M7HA 4V0NA 2FSIA 2Q0HA 3MRSA 2AD1A 5CM8B 1VCOA 3GJ8A 1HT1E 2GBLC 4B6EA 4C9BA 3VR3A 3SC3A 5HZKA 3U60B 4JSYA 3PITA 1OSNA 1ZNWA 1HT2E 1ZCAA 4DUGA 4BZQA 3U44B 1OPXA 1EWRA 2X2FA 4PC2A 1JPJA 1F6BA 3RNLA 1BS1A 1FTNA 1GRQA 2AWNA 2QUZA 4JLMA 4M0LA 5FUVA 3H2YA 2IYVA 4UKDA 2BMEA 5FR1A 1S4QA 5DGXA 4NE2A 1AGPA 2F6RA 2J45A 2W2VA 1DAHA 4M1MA 4US1R 1G3RA 3GD7A 5E95A 4URZR 5CM9C 2ZE7A 4KFSA 1E2LA 2KWIA 3X1ZA 3MGCA 1A82A 2IYZA 4L15A 2KE5A 1OXVA 4LJ5A 4Q9KA 1U2RA 4LBVA 3BH7A 2VLIA 2XTMA 4CW7A 3BC1A 5KHOC 1NMZA 5FH9A 4RD0A 4JVMA 5GJWC 3U3JA 4B44A 2EWWA 2QP4A 4GDFA 5FFMA 4QOSA 2ZSAA 4E07A 3CRVA 4KVGA 2A9KA 4DLWA 4TYNA 5DYIA 1KI7A 1KI4A 3TVDA 4B75A 4OKSA 2G83A 2Z6VA 2IEZA 1Q44A 3CNOA 2XITA 3SU8A 821PA 3NC0C 5H1YA 3TAUA 4TQUS 5JFGA 5KNDA 2GJ8A 2X19A 1G3IA 3WYAA 1DEKA 3WHLA 2ZPTX 5DO9A 3CNNA 3EZFA 4XTCS 2GKSA 4TWZA 5SZJA 2IC5A 1FX0B 2C04A 5C2JB 2CHGA 2GRJA 3FHCB 1DAFA 3IBYA 1UBFA 3MFYA 2RKOA 3QBVA 5LD2B 4MYCA 2FEMA 1E9RA 1Z0FA 1NJFA 1CBUA 4JMPA 2ZAOA 3I5YA 3EC2A 4NCHA 4XVRA 1AS2A 1XTJA 1SXJD 3DM9B 3SOPA 1WXQA 5FBRB 1WBBA 1NIPA 4MKHA 2W00A 1VYVA 3I8XA 4BGDA 4C0JA 4LGMA 2CVHA 5FPSA 4M1SA 1XTKA 3REFA 4BFSA 1KJZA 2KBFA 3KJIA 3EZ9A 2H8KA 4QGHA 2JLYA 4Q5IA 1NY6A 5ELXA 5EE5B 5EUMA 3U7EB 4B76A 2GXAA 4LV8B 4GOJA 2FOLA 1YZKA 1II8B 4LPKA 1SQ5A 4A8JB 2YWHA 4IDOA 3CIOA 5KSYA 4DIEA 1X6VA 5KSPA 2RGXA 1DELA 4IFBA 4GBMA 3EZ7A 3Q5EA 4D25A 4XD7A 1JECA 1VIYA 1FZQA 2FX3A 1MO5A 2E87A 2NPIA 3CONA 4TMTA 4OHXA 2UZIR 4W5HA 3NKVA 1Z2CA 1Z83A 1G3MA 3QG1A 4GRAA 1GNQA 1W4RA 3AVTA 2AD5A 3IILA 3BBPA 5HCNA 1AQUA 4J0QA 4N0EA 1YR7A 5A4JA 1DO2A 4YMTA 3ONWA 4FN5A 3KXKA 4YLGA 1P7CA 1ESMA 2J7KA 1L4UA 3A58B 2OCPA 1FP7A 2GEVA 4YMSA 421PA 2D74A 4FMCF 2PZFA 2Q6TA 4RSGA 2ZI3A 3T5DA 4OQXA 1Z63A 4NYJQ 3U3KA 2GVZC 2X77A 5FTKA 2DWOA 3LNCA 4EJSC 1X3SA 2GVDC 2OXCA 2CDNA 3N2IA 1E2PA 3DZ8A 4MRPA 2RH5A 1J7KA 1FNMA 2ORVA 5UKDA 1S1CA 2GILA 1LF0A 2QTFA 3V00A 2W0SA 1U9IC 1XNJA 3KUCA 4URYR 3SN6A 5IK2A 3K9NA 1GKUB 4DKXA 1LV7A 4V0ME 2OG2A 4A2WA 1E69A 3FKQA 4LX0A 2QL6A 2Z5FA 4LZZA 4M1OA 3I61A 5EE0A 3PG5A 2IEYA 4AWXA 4D0LB 3KKQA 3C4JA 1E99A 1NLFA 5LB2A 1G41A 2IYUA 2HJGA 4DB2A 1E0AA 5B57C 4JT4A 4EUNA 3CF0A 3UXMA 2IUTA 5CYPA 2BM0A 4ARZA 4TL9A 1P4SA 1SXJE 2FGJA 2DR3A 3ZYCA 2PEZA 3EPJA 2NO1A 1E9AA 2ZYTX 1KY3A 2PJZA 1C1YA 2R6CA 3Q3JB 3SJBA 5DYGA 1AGRA 1DTSA 3TBKA 4DDWA 4I4LA 2YJTD 3I62A 1GRNA 3DOEA 2DHRA 1EX7A 4A0RA 2FV8A 5J40A 4Q4JA 2W2TA 2ZIAA 5EP4A 2VSXA 4KFTA 2N1BA 4CYMA 4LDJA 1YR9A 2ZRBA 3KB2A 3R8CA 2VO1A 1XX6A 1VIAA 4UQOA 4US0R 1Q12A 2IHYA 4V03A 4Q4HA 1U9IA 4DEYA 5L3QA 4FCTA 3GQBA 1U94A 1G4AE 2HEIA 3DOFA 5J4KA 3RVBA 1ZJ6A 2AKAB 3PVSA 2NO0A 3C41J 3NH9A 2XZPA 1CS4C 1GZSA 3GJ3A 4NL4H 5BQ5A 1NN3A 2OESA 5FUWA 3LWNA 3IKJA 4BPBA 4MDFA 2WAXA 4C7OA 2BHRA 1KMHA 4GT1A 1Y3AA 1UFQA 1OE0A 1R5BA 1W4CA 2CEAA
chains in the Genus database with same CATH superfamily
2JAHA 3K8YA 3KEOA 2Q07A 1ZUNB 1SFRA 4I36A 4P81A 3KOUA 1HBJA 1G7RA 1EVEA 1Z62A 1XQ6A 3OBIA 3SXUB 1VDMA 2C5HA 4ZVVA 5CP8A 5DGIA 3SY8A 3JD1A 3EIWA 1CR0A 3BWCA 3GVPA 4ALNA 1KRHA 1NM5A 2QZ4A 5ARDA 3N53A 1C30B 4KQMA 1F48A 3AEUA 3M4JA 3ICQB 1CDDA 1RQ7A 2GZHA 3O26A 1ECCA 2X1LA 3TWOA 2BFFA 1DAKA 4P34A 3OPQA 5ILGA 1C1XB 1KK0A 4JUFA 5IKMA 4RD6A 1FL9A 2DBYA 2G40A 3QLTA 4NYMR 1YC2A 2BONA 4XYBA 5AKYA 2H92A 4CTKA 3ZV5A 1VB3A 4KCGA 3QKIA 1V9LA 5CA0A 1C3XA 3VUFA 3JYPA 4DLVA 1AJEA 3GFRA 3PT5A 5EIBD 3UJ6A 1VM6A 4RS3A 1Z6PA 4RJKA 1WCV1 4J3JA 3R5HA 1OF1A 2OQRA 5KYGA 1EU1A 1JV2B 3X1DA 5KTYA 1JSLA 5BW6B 3I45A 1UT6A 1XEAA 2I3DA 3NRJA 3ZJ5A 2I2CA 4YH1A 1A7UA 1DOHA 3EYAA 4GOLD 4PAWA 4I7EA 2Q5FA 3G7UA 1DXQA 1G5FA 1GTJ1 2JGJA 4Y9UA 3OOWA 4ANFA 5ITVA 3BB3A 3FWPA 1SD5A 4IS3A 4PZPA 3U37A 4JLJA 2J30A 3ZHOA 1QSGA 3OCWA 1ZVJA 1X2EA 3ODGA 2HHJA 4PG7A 5COQA 3WIVA 2PKQP 2Q2WA 2IXGA 3EFOB 4INAA 1LLCA 2C58A 4GKBA 5HGJA 4WKNA 1QONA 4IHJB 2BV3A 4JS0A 4MUBA 4B6JA 5JZVA 2PQ2A 2ACVA 3UUGA 3I6BA 4UTRA 1NW3A 2O0HA 2FUG6 4ZC8A 3ROPA 5JYEA 4J2OA 5NULA 2Q7OE 2V4MA 1TUIA 3GVCA 4YUZA 1W73A 2OVFA 2X9NA 2V7TA 3DQPA 2BHLA 5AM3A 1JR6A 3KELA 4TKVA 3IP9A 3L1UA 4CGYA 4EBFA 2CKMA 2WV9A 2ZB7A 4ZP1A 5JLJA 4EZEA 4U39A 2Z4RA 4ZVRA 3WYNA 3ZY5A 3ASUA 4B17A 1U7TA 3H2SA 5I48A 3WIEA 4MR8B 2UDPA 4C0HA 2UAGA 3A9RA 4ZI3A 3BRCA 3ZG6A 2ZTUA 3IERA 1B6TA 2JC3A 1W6RA 3KE9A 3IIMA 4GWGA 4MPJA 1TE2A 1AQJA 2BZ1A 4MGZR 4IXNA 5EJGA 2G4LA 3LDGA 2Z98A 3MJRA 4MROA 2ARKA 3VDNB 2QAGA 1EJBA 3WGLA 4LN1A 2DKOA 5JASA 4OLAA 3EXAA 3S29A 1ORWA 2CJYA 5GONB 3JQ7B 2XNSA 2DCMA 4BU1A 2DERA 2VK1A 1PQPA 1C9MA 2BHSA 2AT1A 1UMBB 3R23A 3TRDA 1GTZA 1V4BA 2JARA 4I3HA 3PQ3A 2ODWA 1AHPA 1LDNA 3HU3A 2AK2A 3OU2A 5MHTA 4ZV4A 4NENA 4I9NA 1AKYA 3MXOA 4OLJA 1P6QA 3G2NA 3IPAA 2ALJA 5DEIA 3VPSA 3GCXA 3HXLA 3VJRA 5DYYA 3SVZA 4ZHSA 2WPDA 3B3AA 2VATA 3E7WA 4H7JA 2HPVA 3EXHC 4PYIA 1OXSC 1WIWA 3ZE1B 5TQ0B 5BQXA 4Z4GA 2MINB 1IM2A 2H3EA 1W0KD 4PBTA 1TM4E 1UJ2A 2IL1A 1H4VB 5EKTA 3SC2A 4RCYA 4ZCSA 3TBHA 3MCTA 3WLSA 4BWVA 1QIIA 2CVOA 5IJ0A 1B2LA 2XECA 4PN3A 4TRNA 3BULA 3MRXA 4MV1A 2QMYA 4LZNA 4ZJYA 4D4JA 5HFNA 1KDRA 3NWPA 2NADA 1W5TA 1LX6A 1O9GA 3OQIB 3GAAA 1NF2A 1E1QD 1YXMA 3EJ6A 1XZHA 2GNAA 2ZEJA 4IIFA 4R1OA 2JF0A 1ODTC 1BN7A 3HWWA 3DE4X 1NVUQ 1S8FA 4IZOA 2R1TB 3SYTA 3WRYC 4R4JA 5JDIA 4ENVA 1TA4A 1WQ3A 1W9HA 1WBJB 3E23A 3QY9A 4BQQA 2E4XA 4F46A 2KPOA 4BO3A 3PXBA 4YPVA 1QUEA 2F59A 3LMKA 2WD7A 4IIHA 4DLZA 1RE1A 1YDGA 1EI9A 4EDHA 2XWSA 1UOQA 1UOOA 4UJ5A 5CYFA 3AFOA 1L4LA 1E3JA 2IZ5A 3C3KA 3C98A 3G0DA 4NI5A 3K0FA 4UUAA 1B76A 2FN7A 4MQ6A 3JYQA 3P5SA 4FGKA 2ZIFA 4NZ9A 4TTIA 3ZE6A 3M1IA 5KOHA 2H1LA 3ORSA 2EFDB 4D82A 4Z1OA 1K1EA 3CJTA 3CZMA 1EVKA 2VAPA 4PLWA 1ABFA 2WJHA 2GJAA 2DR0A 3C74A 4RKEA 1ZIPA 5TARA 2QG6A 1G5PA 4YIKA 3SLRA 2O8CA 2ET6A 5J47A 2HEGA 1NRIA 2A7QA 1OZAA 2IH5A 4A10A 2CEKA 2EIHA 2P2LA 3Q3VA 2VJYA 2PH1A 2QNIA 3V4VB 1A9ZA 3D0KA 4DHWA 1G7TA 1GYRA 1OT5A 2WU3A 2PUTA 4QQ8A 4HDSB 1MVLA 5C5EA 1SURA 1RKVA 4X1KB 3DDZX 3UB4A 1U9CA 1UJ4A 2VDNB 2AW5A 2XMDA 4URWR 3MTEA 2OBBA 2GXUA 4YRCA 3JY6A 4Y98A 3SF8A 3ND6A 2MMGA 3L0YA 3X2EA 2IS4A 2WHEA 2XCIA 4EYQA 4DDHA 1JKFA 3NT2A 4AJNA 4DQUA 1OVGA 1Q20A 2OM6A 2X0JA 3KEQA 2UVDA 4WFQA 1O54A 4TSKA 1LFAA 3DH0A 4G2TA 3LPCA 3AHFA 3DLTA 4GLJA 3TEFA 1KZ7B 3F3MA 2GCOB 2ZYGA 4R8MA 4YP5A 4EG0A 3MC1A 3HN7A 1JEYA 3Q5DA 4OAQA 1FTGA 1CZNA 4U8GA 2L18A 3FYUA 5KUTA 2OHGA 3FSRA 3U80A 2ZLBA 3NT4A 5LM3A 1EWQA 2GO1A 4JT2A 2PKCA 4D9NA 1H1LB 4EUFA 2E48A 4CR6A 1I2BA 1KEPA 1YVUA 3KZMA 5FNZA 5KYNA 1YCDA 3TCXB 3WWEA 4DLKA 5MF6A 2VRCA 1GLGA 5LMNB 2ZYUX 1DADA 3H4MA 3Q7QA 3WYCA 2B8NA 5JS7A 2R2AA 4L3WA 4RVCA 2Y6UA 1ORVA 3DMYA 1UMCB 2PBFA 4G01B 3RRJA 1ZUIA 1RPTA 4BNJA 1GVNB 1KH3A 4GBGA 2YL2A 4KQGA 3VR6A 1RZ3A 5EZQA 1B73A 3I4FA 4ZT2A 3H7AA 2QRVB 4MKGA 4FHZA 3Q88A 2H5IA 3F6RA 4IX9A 2DUMA 2QTVB 2RHTA 1ZVMA 1F5SA 3ORYA 3V8EA 5FUMA 4H4EA 1WS6A 4MUGA 1FFBA 1GXSB 1V39A 3KQWA 4X20B 4ZODA 3S2UA 1JR3A 2YIJA 3OIFA 2GT1A 4M54A 3L1HA 1OJ7A 1XHEA 1Z7BA 3ROMA 4J90A 3I37X 1VYHA 1DQPA 1R12A 3AETB 1QPGA 1P2UA 2XTNA 2V7WA 2DBZA 1PK7A 1SQFA 2GEFA 1VPEA 3SICE 3UV6A 2WA1A 2WKWA 3K1ZA 3DEHA 2JLQA 3B8HA 4DVGA 3R3JA 5B6JA 1G2PA 1DC3A 3U1BA 5A9SA 4JXJA 1LEHA 1NR1A 4KX5A 4X95A 4LYDA 2HJHA 1JB1A 3KYDB 1CR1A 4XJXA 3EK2A 3MMXA 5KJ1A 1T24A 4FZ5A 2VI5A 5MN5A 1L5YA 1TJPB 4ID9A 2NMVA 1OZGA 2WJVA 2QS9A 4IZIA 5A06A 3TQRA 4B1FA 4E4YA 1JAYA 3EGEA 3AINA 1XUOA 4BNDB 5L95A 2W6ID 4Y2QA 5F7XA 2G70A 2RHLA 5BW4A 5JHHB 2GEUA 4WLOA 4OXNA 2N3ZA 3T3GA 1SELA 1QGOA 3LPAA 1BO6A 2VDVE 4O25A 4B33A 5KWEA 3C7DB 1FP4B 1TEHA 1TDJA 2I9PA 2JHGA 3LUGA 1XCOA 4HMPA 1Y9JA 4TTSA 1TJ3A 1LI7A 1MG0A 1EWYA 1XZCA 2B1RA 3V2HA 2ZIUB 2QD1A 2YBEA 4PWZA 4JP5A 4HV4A 4RTNA 4BEVA 3O9ZA 5KINB 1O8BA 3HKEA 1NJ6A 3E9QA 4XRGA 1Z2NX 1OA0A 3GAZA 2NIPA 3I9KA 2WM3A 4U7FA 1H9CA 1JVSA 3PUZA 1NSTA 1FVXA 5CIYA 1KC3A 1ONBA 3RAPR 3VH4A 3DW3X 2CNOA 1X3LA 3NTOA 3ETEA 1SOMA 3RYTC 2ZAIA 5AKJA 3VM6A 1GNRA 2PVCA 2MJLA 2YVQA 5DTEA 4CL3A 4DQVA 5LD2C 1KMCA 2IYFA 4PC7A 5JPIA 2QMUA 3C5VA 1LLQA 1YBVA 2X0NA 2GI4A 3AR4A 3E9MA 3HM2A 4J0DA 3STYA 1NOJA 1KO4A 1H66A 3L2OB 3ENVA 1XZLA 1BFUA 1SO8A 2A14A 4X7BA 3W8FA 4C3OB 3ANNA 5JQGB 2HHHB 5KYVA 3PDJA 3RFUA 3OLCX 1RTTA 1K89A 4UU1A 1P5HA 3FA2A 3GAFA 3EDYA 3WLOA 5AESA 5DBIA 4C7MA 2EFJA 2EJCA 3W3AA 5A0FA 1KZHA 2H59A 4AX8A 1VL6A 3A70A 4X97A 3OC6A 3KXLA 3OQNA 5I5GA 1WW3A 1KK2A 1ID8A 1KJIA 4R9RA 5T8KA 3COZA 3CZQA 5KYXA 2ZUTA 1Z5VA 3L8HA 1BU8A 2JANA 3DDWA 1MN6A 4IIGA 3B7WA 1E4OA 3OG9A 1FP6A 1ADFA 3A6LA 4I3GA 2IV3A 3PP8A 4BU0A 3F98A 3OQOA 1N6RA 2OCIA 2WD9A 1BW9B 2VHTA 4GVPA 8ADHA 1C7JA 4I14A 2REBA 1AMUA 4M0KA 3USZA 1QRTA 1QH0A 2J85A 1P3DA 5FBQB 3R0VA 1XF9A 2PBLA 3C6ZA 3UWKA 3CG0A 4A73A 1PBNA 2PSFA 1OBCA 2WC1A 1EESA 4CVNA 3UKOA 3RBAA 5AT1A 1PR6A 4REQB 4O4IB 1GGVA 3WNCA 5DN6D 2O0LA 1YQ9A 3TCNA 2CVZA 2O54A 4IOLA 1PJ4A 3TIGA 1R0BA 4ARBA 1FFAA 3D4LA 3QHQA 1JDZA 1AE1A 1N3IA 1NUAA 3G0CA 3H5TA 3ZHCA 2Y9PB 2NZ8A 4NMHA 4H0CA 1M1NB 2CUZA 4JNKA 2BP7A 3UFBA 4C4SA 4F4UA 2D8MA 3LT1A 3M5PA 1R4NA 5KYKA 2ZUCA 5LDHA 2JHAA 1XDZA 3QX9A 2PKRA 4P3PA 4GO1A 4P38A 5A7FA 3OQJA 1T4MA 3L02A 3W0LB 2YIDA 2IRWA 3ETLA 4S1TA 3GEEA 4DQKA 2ACKA 2Q3EA 2BSXA 2PRSA 2WZCA 4BMSA 1U7WA 2ZKLA 3O75A 3GN2A 3E4DA 4XFJA 1TQHA 1CUSA 1EE1A 3OECA 4JJZA 4WXHA 4CF3A 1DHTA 1IUKA 5T8KC 4CGZA 1L7BA 4NS1A 5JE8A 4BVLA 3PJEA 1E3QA 2JBAB 5GADl 5EMHA 3DUFA 5KHAA 2O2ZA 2BI7A 1E66A 4QBFA 3N58A 3QU5A 5D3KA 2Q3HA 4GS5A 4IOJA 4R9NA 3RFVA 4CM6A 1JIKA 2D2IA 4HD8A 1OH8A 5HG0A 3KD3A 1QHIA 4Q02A 2HFKA 1J39A 3U81A 1O6BA 3SZUA 2HOQA 4F3TA 2R8EA 3GA7A 1YFLA 1C0EA 1IXSB 4LISA 3VHRA 3HJNA 3VPAA 2H7YA 1RJFA 3IBFA 3TN7A 4US2R 3H0CA 2QNBA 2WHXA 4QBHA 3TD9A 4B43A 3LBAA 5DM70 2PZMA 3BE5A 3Q3IA 1VI6A 5FOUA 5KVAA 4QOIA 2HA3A 1RZUA 3I1YA 4EKYA 2C98A 1VKJA 2BGTA 2J8ZA 2XXAA 4K46A 2V1XA 2EGUA 3FW1A 1IZZA 2R6GA 4RY9A 2ATCA 4DCPA 2HTEA 1E7YA 1U3WA 3CG4A 2YW9A 4FKZA 1KI6A 4PYOA 2GSWA 3AY6A 3AG6A 3V1LA 4OMDA 1ZM4A 2Q3JA 2YQZA 3BGOS 5FYQA 5F3RA 3SE0A 3V80A 4JH0A 3W6OA 2V0GA 1C81A 1WF3A 1QF7A 4W5RA 2X4DA 1FMLA 2XVAA 4L08A 1E2EA 3U6KA 2J46A 4Q3EA 5CVDA 1MRZA 3VSCA 3LTNC 4WJLA 4FS3A 4KKVA 1EM6A 2RG7A 4NBTA 1KEEA 3PUJA 3SQOA 3T7SA 1JHYA 5GONA 1TX4B 1FRFS 4L9AA 2MDTA 4YJ3A 1CUHA 3MYRA 2AJLI 4CN8A 1GPKA 3UMYA 4MQFB 5KTSA 3E8SA 5A6SA 3MJVA 4QO8A 2FFQA 2XTZA 4DLUA 1Z3IX 2QRQA 5E7QA 2JD0A 5CURA 1IXKA 2HRRA 2PH5A 4CF6A 1TGVA 4PAMA 5GV8A 5HIJA 2EXXA 4TYYA 3GNQA 4QVIA 4AW9A 4KXNA 1P4JA 3FNGA 2W8BB 3ORRA 1PJZA 4IAOA 4HZIA 5IJAA 4U6NA 4DR7B 1GKKA 3PD1A 3WGQA 5CXQA 1FLDA 2BW0A 3M6MD 4G0XA 4HKTA 2P9BA 3KR0A 1CUJA 3S2GA 4HP8A 1XQXA 1ZNYA 1VOTA 4PLTA 1GCUA 3LFUA 4DR4B 3NBKA 1TU4A 3FYDA 5FHRA 4JI1B 1K68A 4BZXA 4JNCA 3HXOA 3ZKWB 3GLIA 4L57A 3PK0A 1KJQA 2GZ3A 5ALHA 4D8XA 1U11A 5JD5A 5JJKA 3L1IA 2X7JA 2P62A 1H6CA 2D8AA 2FSVA 3ND8A 1CIPA 5H3LA 5CDTA 3LLSA 2C92A 4OAOA 1GNSA 1MVOA 2EWMA 2WSSA 1HL3A 1HQYE 1QK3A 2EZ4A 2ZIWB 2IUSA 2HU8A 1J9EA 2ECPA 3NM6B 3GEIA 2HA5A 3NP9A 3AF0A 1HRKA 1JHUA 3ETNA 4NP6A 2NM0A 1IVNA 3BIFA 1XCPA 5H68A 4B4DA 3TLZA 4G41A 3ZI4A 4B5LA 4K6GA 4LDQA 1I4LD 1Q7TA 4NCJA 1X9IA 1VI5A 3JQFA 4W99A 3TOZA 3ZK7A 4CLRB 4DLNA 5KWIA 4I9UA 3U09A 4TKMA 1RADA 3IESA 4BAZA 4TTPA 2PHZA 1ZEJA 5JQWA 2GKGA 2CMFA 4J75A 4WN9B 1UC8A 3PC8C 1PNTA 5C0OE 2NU9B 3R75A 4RLFA 3EYWA 3S2EA 4TMZA 5FKJA 3RANA 4YGYA 3SC4A 3THSA 2J0EA 3U3XA 2RHJA 3WS7A 4MSUA 1P31A 5FI3A 4B6SA 4DQDA 4PCUA 1QP7A 1ND5A 3RU3A 1EX9A 1M2FA 3GBSA 4PG4A 2YZMA 3IB3A 1QVZA 3L8DA 4WJKB 2WUGA 2H16A 1X2BA 5ETJA 3EC1A 1E8MA 2EKLA 4UM7A 4FJ0A 4QG7A 1TKBA 2QLJA 4F56A 1DGQA 4KAFA 2VIIA 4QU9A 4ZTZB 3ZDDA 5HDBB 2FPPB 3B8EA 3G0OA 3I9JA 4ONEA 1U8AA 4YCNA 2OXRA 1ZUNA 2ODBA 5GOZA 3BQMB 5IT9A 2AX4A 1PI3A 1RI5A 2E4ZA 1F2TB 1QHXA 1MGPA 4MKFA 3HI6A 2HJSA 3B1XA 3WWYA 4OJQA 1DXHA 1QRUA 4I4TA 1TAQA 4F4JA 3VH1A 4G5FA 2FMKA 4EITA 4A9AA 3CX6A 2JK1A 3EC7A 1PE0A 3DVQX 4TUYA 5CPFA 3NI2A 4UXJA 1SIOA 3WJAA 4ER5A 1QIGA 1RYDA 3WL4A 4J94A 2ZQ5A 2VP4A 1N9GB 2GA8A 4EI2A 2WMYA 4IJMA 5BV8A 1ZGZA 1CUVA 4KO4S 1WTCA 5FLYA 3ZGOA 5TPZA 5TPWA 4R9VA 3AKZA 4EI9A 3FPKA 5AW4A 5BXYA 1AB5A 3R4CA 5K01A 3OUUA 2O05A 4YJDA 3L0PA 4GUDA 4BVJA 5LUAA 2BFEB 2PRIA 4NOKA 4XR4A 4ZIRB 4ZI7B 2BI8A 1H6DA 5KSOA 4PGAA 1TVCA 2EG5A 1D2MA 1L5GB 1T1EA 1PX0A 2QTGA 3BJIC 3IT2A 3WRYA 2WLSA 4ERNA 1P74A 1E2DA 1H8HD 3LX6A 1TT7A 5D86A 5JXJA 3FOZA 1Q7RA 1YQUA 1XMIA 3A1FA 5DVZA 3OTOB 1LC0A 2O1XA 4J0EA 4N8EA 4OL9A 1GGMA 1JXQA 5A9RA 4HAXA 1I1OA 1V3QE 3QHAA 1M73E 4ITVA 5LQSA 5LZ4A 4F1JA 3WHKA 2JLVA 3V97A 4UEQA 1JKJA 3FBGA 1I51A 4WXRA 4YJFB 2QRUA 4HFMA 2FJPA 1AA9A 1PW5A 1XZQA 4FMCB 1U1IA 4NMMA 1X8KA 4YV1A 4MP6A 4YO8A 3U61B 2QX4A 1SOUA 2ZJ1A 1QQ5A 5AW2A 4GWKA 4KMRA 3A1UA 1D09A 3TQQA 2GSDA 3WMEA 5A2QA 3I0ZA 3KPWA 3L7JA 3OZUA 1GILA 3QKSB 2VXOA 2HB6A 5CDFE 5AKGA 3V5NA 1OPRA 1QKJA 4IR7A 1K4KA 4MKXA 4OO3A 1R1DA 1SPBS 4I2VA 3ADDA 5LWHA 3W2TA 3UWDA 2PYZA 1FLVA 1GJRA 1YHZA 2I6SA 4JJGA 5JADA 2C7QA 1ZJWA 2GPYA 4KMOA 3VKUA 1GG8A 3SKXA 4X91A 1FSGA 4QDXA 1SZCA 5JNSA 4B40A 1Y3FE 3TRKA 4BN0A 4ND8B 3DR3A 5CA0B 4EIWA 1Z88A 3STXA 1H1TA 4QEZA 5LB4A 2NZJA 2QN3A 3Q15C 3U7QA 1VGQA 1J0CA 1XOIA 5HMMA 1F8GA 1QC5B 2P4UA 5K3BA 1JF8A 1VE7A 3FUUA 1WBDA 3ND7A 1AHIA 3AXTA 1ITZA 3AG5A 3VU1A 4D96A 1Y80A 1Y1TA 1NYRA 2OO3A 1F3OA 1F8FA 2ZJAA 4XGQA 1T9GS 3QVTA 4EHFA 2L19A 3PF9A 4RPKA 4CIXA 2X7XA 4CNQA 3M34A 1H1LA 1QRRA 1ZCFA 4FHCA 3HDGA 3TNYA 2LKDA 1P72A 2O7NA 3F8SA 5FWXA 4Q66C 3PWSA 2I8LA 4TUYB 3UKDA 1Q1NA 5BSHA 1NFRA 4BN5A 2DLNA 2Z3ZA 2Q3LA 4ZMRA 4X65B 3RUCA 4B4UA 1MOSA 1ORIA 4QM7A 2GEJA 2RKBA 3PXEA 4FWIB 5E0KB 2LV8A 3KLPX 3R0QA 5I45A 3OPYA 1N0VC 5EIOA 3FUCA 4AWAA 3LWBA 3RS8A 2GHRA 4HWRA 5GZ1A 5IVKA 3EVAA 3H2GA 5KOHB 3PEYA 1QOPB 4S1VA 3U2QA 4I81A 1ZWKA 1SCAA 1TU3A 3AF5A 4YRTA 2YTZA 4WKOA 2YRXA 4M1TA 2GN6A 3G13A 1AKEA 1HYBA 4YCJA 3VR3D 3AERB 4F2DA 5EQJB 3OO0A 3ZE0B 1YUBA 3C16C 2GPAA 1KMMA 3DWEX 4QEDA 3BGSA 1KVRA 1XVIA 3SX0A 2W2NA 4CL8A 5FA8A 3OCYA 1U98A 2GGSA 4JBWA 4P82A 4F3NA 1NDUA 1V96A 4IFTA 1X1AA 3IIKA 2Q5JA 4OQLA 4XD7D 3WE7A 3KSZO 5M7EA 3DV0A 1EXWA 2CJFA 1KYYA 3U0VA 2MMCA 1TCAA 3Q8WA 4RVSA 3ROTA 4EH1A 3L0CA 5IDWA 1XFAA 1OA1A 1YZGA 2XQVA 1W8DA 3DKVA 3QNWA 4QNMA 4ENPA 3FBWA 3R8FA 4NATA 3VKVA 4C7BA 1JEQA 2QVZX 1T0BA 1GD1O 4X1YA 3SJAA 3BAZA 1NNUA 1NDQA 2YJ3A 3L0SA 4QICA 4AF7A 4R81A 2D5AA 2ZGVA 4O1MA 1USWA 2IZ7A 5ALLA 5L6LB 1U2GA 3G3EA 2AN3A 3E3NA 3TJMA 3VQTA 4R0NA 1ZOLA 4NOJA 1VIVA 4NYIR 3H42B 4IH1A 3RRNA 2GYYA 2A5JA 1DLIA 1CERA 1EEHA 1W29A 2ES4A 2OCBA 2PXHA 4G5YA 2QL9A 1S2OA 2IBMA 2OTCA 5JS2A 2V7QD 2XQIA 3UIEA 1EUZA 4WNIA 2J5QA 4FE3A 3HXPA 3VYSB 3VZPA 4UHCA 4NF2A 5F7JA 4JT9A 2JFPA 4V0QA 1YB6A 2G71A 5FLEX 4NPAA 1I01A 4EX7A 4WBNB 3L49A 1SKUA 3UCFA 2NU7B 1IM8A 1KEVA 2IXBA 4LNUB 5E1MA 2ZREA 1TYBE 1H2BA 1J24A 2KLBA 3ROZA 3JD4A 3TSZA 2O52A 2PX6A 2KM1A 2VHEA 1O6ZA 3T9AA 3HJCA 4YGXB 2G82A 4L4SA 1R10A 5K2MA 3ZDFA 3I04A 2EVWX 4TQ9A 3L1KA 1T91A 4LY3A 2JIDA 3A1DA 1P18A 3NWOA 1WY5A 2OCKA 5HW0A 4IKPA 2XMSA 1SCKA 1SXHA 1SH7A 4FMPA 6ABPA 1A1SA 3I53A 3RM3A 2C7OA 1H8HA 1SB8A 4WNYA 4KSBA 5LZ9A 1LPAB 1PK9A 1SY7A 2AG1A 3NHKA 1UFVA 4YJKA 5AVRA 1QIDA 2FR8A 3PGLA 4M0MA 3V8MA 4D5GA 4G1EB 3F1KA 3KT0A 5FO0A 3PWKA 3LQKA 4OHKA 4IMPA 1PKEA 4ZI5A 4KPYA 2OXTA 3VKWA 5CITA 4Z4EA 5FPPA 1A2QA 2KHZA 5KIAA 1KFEB 2XXJA 3TR6A 4PSCA 5LU9A 3LY9A 1LPNA 3WAKA 2AK3A 2BEJA 5CAEA 1QHEA 2PZ8A 3LCCA 2MTBA 4IGFA 5DLQC 1NUPA 3P32A 5EJ5A 3FROA 5LZ5A 2C96A 1ZQ9A 1BX3A 3F6CA 4GNRA 1UKAA 1KI6B 2X14A 5CM2Z 5KMGB 3LPDA 4RHXA 2WJPA 4YQZA 1YGYA 2ORIA 2HU2A 2XOEA 1RXEA 1S2MA 1G4UR 1ULUA 5CB0A 5JLAA 3C6QA 3QW2A 3HR8A 3AR3A 2O7RA 4HB2A 5DHRA 1VLHA 2CNLA 5I6DA 5IF3A 2ODNA 3OJEA 4ZVNA 3MCVA 1MR3F 1VL1A 1JDSA 3T1QA 1Y8CA 1HQCA 1O94D 1J5XA 3B7GA 5DT2A 3JZDA 1CRQA 4RV4A 4M76B 1KMNA 2A57A 5I7UA 1E2BA 2PE5A 1R8YA 4UU7A 1SOVA 4KDRA 4ACBA 5AW1A 2I54A 1AK1A 3WNDA 1PNQA 1U5BA 2WLTA 1VG1A 2B83A 3FSEA 4B79A 4NBUA 3KFLA 3A6PC 2I6QA 3LQYA 1UKYA 1NYLA 1PFQA 3EWAA 3LXMA 2R6ZA 2FGKA 2BFFB 1Z08A 2JLSA 2NO7A 2PUJA 4JBGA 3VZQA 1KR2A 1TFRA 3W2GA 5JJCA 1WXIA 2W22A 2Q4RA 4BFXA 4PANA 2OFWA 4M9SA 1XMJA 3GGCA 4H77A 3TCKA 4DZZA 4OHBA 1OY1A 3DL2A 4WEOA 1TK2A 2DHEA 4IXMA 3MGGA 1M2WA 5B53A 4EWLA 4HQOA 2V9ZA 4HWSA 4N8SA 2Z2IA 1J21A 1VG8A 3AP3A 1KAOA 3SSNA 4QUBA 3GQBB 4NWIA 2I91A 3CRMA 1JEEA 1NY5A 2XEDA 3AKYA 2RHCA 3M1YA 3VR5H 4TZTA 1OWLA 4V02A 1ODSA 1P73A 2QD2A 2Q6KA 3PRYA 3PXAA 3AJEA 4HDAA 4JKIA 3KQOA 2ON6A 2QVCA 2R47A 3BN3A 4W5TA 4MZDA 2DUJA 3WDKA 1V6SA 2IE0A 4OMUA 3B3GA 3KXPA 4Y9SA 2OV2A 1E2GA 2BGIA 1VCMA 2HDHA 2C77A 5IMSA 3HJHA 3KZXA 2HBQA 2XAAA 1XD8A 2YQ5A 3AYXB 1EFRD 3CHYA 3EWSA 1HKUA 4WWHA 2RGEA 5T6MA 4CE6A 5C46F 4Q4DA 1JQLB 1HYHA 3GT3A 4KAXA 3P0EA 1FFDA 1XDDA 4R7GA 1X7WA 2Z83A 4Y2HA 3HBJA 4AROA 5ABPA 3RTEA 1RXIA 4BFLA 1M2JA 5TXGA 1FRQA 3RVKA 4E2YA 5JWRA 1C8KA 3UT0A 2AC4A 1ZHFA 2LZ0A 3VHXA 3L8EA 3M4XA 1HLDA 1ZW1A 2AN4A 4FFWA 2ZSBA 3OZXA 2HHLA 4I1RA 5P21A 1F8YA 1NVAA 2VFAA 3P2KA 5KTMA 2J87A 4G0NA 3V1MA 1LPMA 2AIRA 3I23A 2CF5A 3LHDA 3THWA 4EB3A 1KEUA 4RH1A 3HVUA 1T6YA 4WADA 3QVWA 2C8KA 3RGGA 2K87A 3LKZA 3WADA 1TUGA 1USGA 4FYJA 3FR7A 4PLGA 4QGBA 5F77A 1KEEB 2FCAA 4FXPA 2QJRA 5K0TA 1LNSA 4J43A 3F6BX 1PDOA 4P4SA 1P0PA 4YYEA 1Q0RA 3CSUA 2RIRA 2LBPA 2NV2B 4JUDX 3AF1A 3FZEA 2CBZA 4LKRA 4TLAA 3UANA 3QXSA 4XYGA 2GM3A 3UHFA 1ZP6A 2C4WA 3MT8A 3KQSA 4JLWA 4U02A 2VTBB 3WR5A 3JCZA 4AIIA 3H2ZA 2V6GA 3GUHA 5LA6F 2YYAA 4CNBA 1A9RA 3OZEA 3PUKA 4NEGA 1NQAO 1H6AA 2O8DB 3C3YA 4EGFA 4JVSB 3I1FA 2IYLD 2OSVA 4I4IA 3P1JA 4KR0A 3VPCA 1XAJA 3GRAA 4HRYA 1SXGA 3VKGA 1RWKA 3QUAA 4O0LA 4QATA 4JBNA 5GV7A 4B73A 5FQNA 1Z5OA 2HIAA 6YASA 2FJUA 3GJ5A 1YIDA 4FSHA 2AMFA 3R3WA 1FUIA 2IF2A 3AP2A 2NN3C 3IAS6 4MPTA 3VZBA 2EQBA 2OILA 4ZOLA 1QH1B 1DIRA 3TRFA 1LJUA 1C2TA 4FX2A 3PX3A 1WSDA 1MXHA 3N2KB 1MO2A 1YU9A 4JP8A 2IYRA 3LC2O 3CINA 4M6WA 3QBDA 1UMCA 2C2HA 1UR5A 4XGIA 2NSYA 4NXMB 2G5GX 1JPUA 1TEVA 4LFBB 2N75A 1N2ZA 4K05A 2H18A 13PKA 1G66A 2D6FA 3C45A 2Q1TA 2X5OA 5JW6A 2R7NA 1T36B 4XYEA 4F6RB 1ZZGA 1RYNA 2G8NA 2QUHA 2BTQA 2J3LA 4DCJA 5IF9A 1ZA1A 2OZLB 3RAEC 5SY9A 3EPHA 4UXIA 4KL8S 4RQTA 2BKXA 4Q47A 3V4RA 4F6RA 3I9V6 5ICEA 4M83A 2RJNA 2WD7B 3IB6A 4L75A 4LRTB 1NI5A 4IQ4A 3EDOA 3A3YA 3DFIA 3FAZA 1MGOA 3OQ6A 4HX9A 4M8KA 4DUYB 4CIYA 2B21A 4B4WA 1TZMA 3MPOA 3O94A 2UYOA 5SY6A 4L76A 1BCRB 1E1DA 2J7PA 3FLBA 1B6SA 3GCZA 4R8RA 5H02A 2QXUA 1V8BA 3S1SA 1C9YA 2B34A 1ESEA 4MR8A 3NHSA 3W5VA 1MX9A 1UC9A 4UU0A 3FNHA 3EPPA 4V3CA 3U7IA 4A0QA 1IBLB 1X74A 1IY8A 1IY2A 2BF4A 2E7ZA 3QX8A 4MRSA 4DARA 1CY1A 3GUUA 4LXYA 1XR3A 1DOAA 1X9GA 2FW6A 2G04A 2VQ6A 4PLCA 3HTXA 4A27A 3IUQA 1P9NA 1Y4SA 2XB8A 3HYTA 4O5OA 1UZNA 4ZDKA 5LLTA 4JQCA 3U5TA 3DO6A 2UUAB 3CBGA 4P8RA 1PZEA 3QVGA 2O3UA 4UVIA 4M9UA 4JD5A 5AW6A 1LW7A 4PHTA 3JPYA 4RZUA 1M6VB 5FTLA 3QMVA 3BXZA 4BHTA 4J8PA 4AECA 1FUEA 1OHHD 2AS0A 4I50F 4N6GA 1MW8X 3BDAA 1LK5A 1L7PA 1YZ3A 5FV7A 4DHEA 1QVRA 2F00A 2V6BA 3IEXA 3JQQA 3OHPA 4KEAA 5ERYA 2XBUA 4DDVA 3ER9A 4HX2A 2I4RA 3A6EA 1F3LA 5AIBA 5KC9A 3HHPA 4TLBA 3RS9A 3I6IA 4ARSA 2H1OA 4PC6A 1NQOA 2LUOA 2NUBA 2GZAA 3DZKA 3E05A 4LXIA 4RTLA 5FWXB 2DMRA 3GVXA 5EXSA 1E5TA 1A9PA 3EHDA 3WFZA 2XEXA 1PV2A 4QHYA 1KYXA 4RKWA 1G5TA 3WXMA 4JDPA 4DZRA 3PICA 5EPUA 2CHVA 4DAOA 2YWGA 3FYUB 5KTPA 3GWGA 1FDVA 1Y9AA 4LJ7A 3F5SA 1TIPA 2OLEA 4MXDA 4H3HB 3O0DA 4ZHQA 4ZK6A 2XE8A 2BGJA 3IQDB 5J1SB 2BBOA 2WJJA 1K0UA 3E1KA 4YRAA 4DANA 3GGGA 3LA8A 4C1NA 1HDYA 2YIVX 2XB4A 3FE2A 3M83A 2MOKA 3DOIA 4QYSA 5GIOE 4LDPA 4EJ6A 5C1OA 2OHVA 4RD2A 1S96A 5EFOA 3R2JA 3FZGA 3TR0A 2XMCA 4G23A 1RJEA 4HSGA 3IBCA 2Z9BA 4HRXA 3FMOB 1BVYF 2HO4A 2Q49A 3TDNA 1KJJA 1GCGA 3EF0A 4MICA 4CKWB 1L7RA 3GFGA 3LBIA 1U81A 1CUYA 4PO9A 4D9HA 3E9NA 2C5BA 2JJ1D 3P2JA 2ZTLA 4JJKA 4JC0A 3SFZA 3Q41A 2B35A 1V1RB 3A2LA 3JSXA 5D1NA 2XUGA 1HE8B 1L7QA 1UAYA 3NTUA 1XPRA 1PT9A 4M36A 4QDJA 1T3GA 4YMUA 1KTVA 1SA0A 2NPFA 3BCUA 1EFPB 4U00A 1IHOA 1Q15A 4UTVA 1CPYA 1CJKC 2I99A 1N0WA 5AOAA 3R9XA 3ZD6A 1CB0A 2GF0A 4BX0A 4G9EA 3ILYA 2PGIA 2AE2A 4GXQA 4FU0A 3DFKA 2EP8A 3GLKA 2M6RA 3OJ0A 1R74A 4FIDA 1UBUS 4MI3A 3RF7A 5BQFA 4Q9IA 4ITRC 1EFTA 3R1IA 2LIVA 4TVOA 4BIIA 1YDFA 2XE7A 2OHJA 2RGGA 3TL3A 1RKUA 4OKIA 4P4NA 2HR1A 1M1YA 2JK0A 5JH7A 2VNHA 5DBGA 3WTCA 1SXQA 2B20A 2ZIXA 4G5RA 3RVOA 3ZOKA 2ZAYA 5DNAA 3ZGXA 2DECA 2W2KA 4KTVE 4D9IA 3U4MA 4F1KA 4HDNA 1AF7A 3SCZA 3TNDA 1YI0A 3R20A 3F47A 1T34A 4JBYA 4LUCA 3FTCA 1RRCA 1P6UA 2XOKA 3PHCA 4H1TA 2K7FA 5C32A 3FGOA 3QUSA 4YP6A 1Y8RB 2XF2A 2GASA 3A1TA 5JJIA 3P9RA 3QGMA 4JB0A 1WE2A 2IZZA 1UK6A 4OGGA 5BUZA 2WIJA 1QHSA 3LOPA 2J5XA 3N8NA 4E21A 5JNVA 1H2AS 3LUJA 4R1PA 1PHRA 2VPPA 4ZQCB 3QPWA 4RMGA 4ZTBA 5GVRA 2QPOA 2W0MA 4ZQHA 3UJPA 4J16C 5F76A 2PN1A 3PPWA 4CJXA 1XQYA 2VYVD 1RPZA 2MSDB 5FNVF 4N0PA 3RUFA 3KHUA 1ZO8A 4L7QA 1LDMA 3ZC3A 2GBIA 2YNMD 2Q5CA 4MWDA 3ZDQA 3D8BA 1W4AA 2GM9A 3BOSA 3E8XA 1UBGA 3PTLA 2AJDA 4FOLA 4BS9A 3CH5A 1YZQA 4QU0A 2NTEA 2VP5A 2VNSA 1M2HA 2Z2ZA 1GZHB 2CYBA 5JMPA 2BEWB