4HEJA

Discovery of selective and potent inhibitors of gram-positive bacterial thymidylate kinase (tmk): compund 16
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
202
structure length
198
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Discovery of Selective and Potent Inhibitors of Gram-Positive Bacterial Thymidylate Kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 198
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hejA00
1CJKC 3A4LA 5L3QB 3MWLA 4HAWA 3ASZA 4V0MA 4YDSA 1G5RA 3R8CA 3BJIC 4O2LA 5G40A 2A9KA 1XFAA 1Z63A 1ESMA 4Q1EA 2O8EA 3DDCA 2HYIC 5LBIA 4QBGB 4GOJA 2O8DB 1X1SA 1ZW6A 3GJ6A 4QBHA 2JDID 1KSGA 2WWFA 1ZD9A 4S35A 1F2TA 2EYUA 2FGJA 1EGAA 4M9SA 4G0NA 4MUBA 1SXJE 3WRYC 2XITA 1YZNA 5C46F 1XXHA 3IEUA 4DCSA 3NHAA 1BO6A 1II8B 3BRWD 4WZAE 3BIFA 3K70B 4AG6A 1ZD8A 1MRNA 5BW8A 2QAJA 1XCGB 4KODA 4ZI3A 2PZEA 4YMUA 3LX5A 4G3XA 3B8HA 5HCNA 3BS4A 3N5CA 2NZ8A 1N2CE 1W0JD 1ZYUA 4CEHB 2R65A 2J0QA 1KSHA 2FV8A 2FDCA 1Q12A 1IM2A 4FWTA 1M7BA 2HCJB 2IUTA 4ITRC 5FTKA 3FMPB 4L16A 2RAPA 3DOFA 4LRWA 3GP8A 3LBHA 1E96A 3CRVA 2Z83A 1KOFA 4YMWA 4A8JC 2QSYA 1VG8A 2DWQA 3D3QA 5P21A 1KI9A 3B6EA 1R5OA 4H1VA 4KVAA 3W8NA 1QG4A 2ZJAA 4GP6A 3SJZA 4C3ZA 3AM1A 5KDLA 2IF2A 421PA 4NONA 4HB4A 2DB3A 4TWZA 2MSEB 4LBVA 3ZQJA 3LW7A 2J0SA 5CM8B 3QSYA 3SBEA 4M21A 1TQDA 2DR3A 4B75A 3LD9A 4RFVA 3S1AA 3JZMA 5TXGA 3L0SA 3H86A 1RFLA 5JFGA 1UAAA 1FQKA 2ZROA 1G64A 1FP7A 4AYTA 1FPMA 3GJ4A 2GESA 4IEEA 3OIUA 2ZE7A 2C95A 4EJSC 2BM1A 2GAOA 2O52A 2OFWA 1IXSB 1OFHA 5FBVB 3PR1A 4L9WA 3NBFA 1E9BA 2ATXA 4GOXA 4FWIB 3EG5A 4JL5A 2CMKA 4NYJR 3I5YA 3KB1A 521PA 1SXJC 1U0JA 3DVLA 3Q8XB 4ABYA 4XOIA 1RYFA 2OESA 2HF9A 4LHZA 4LOAA 4Q4HA 1RRCA 4FMDF 1XMJA 1EESA 2JLQA 2RGAA 4HYYA 2ZVPX 4B6EA 4TYWA 1COWD 3TUIC 2BJWA 1UEJA 4GP7A 2BBSA 3WBKA 5DE3A 5DISB 3WNDA 1E2NA 2QP3A 3HDTA 1SVOA 4KXFB 5L8VA 2WPDD 1OH5A 1A5TA 3EWSA 1IOZA 3EWAA 2J46A 2WWYA 1KI2A 1TPZA 5EJEA 3ZDQA 4RFSB 4KI0A 3C15C 1XD8A 3PUWA 2YWEA 4KLZA 1PZNA 1BYUA 3AVXA 3DKPA 2A5JA 1Z06A 4CVNA 5FI1B 2NO0A 4M1YA 3GMTA 2HCBA 1J70A 2FGKA 3VX4A 1FL9A 3AV0B 3FMOB 3TAHA 4KBFA 1G5PA 2AKYA 2J1LA 2ZJOA 1FNNA 2EFEB 3BOSA 5SZKB 1JPJA 1KZGB 4I1UA 3NC1C 1D2EA 1W49A 1QHGA 2FNAA 4NYMR 5EZ6B 5FPKA 1UKEA 2G88A 2RHDA 4IVPA 4KLNA 2VHTA 2ZJZA 3K0AB 4HATA 5A5GA 4URVR 5LB2A 2CVHA 2OEPA 4C7OB 1ZIOA 3MWKA 4II7A 1YR9A 2ERYA 4A6XA 1LF5A 3FPAA 3I4LA 1T3LA 3OHMA 3WXMA 1BKDR 4URWR 3AKCA 3IO5A 2R6AA 2V7QA 2J5XA 2DPXA 5K8UA 2CK3A 4NH0A 4JLPA 4URUR 1VCOA 1E3MA 4L15A 1U99A 4BPBA 4OI2A 3PFIA 2GNOA 2LKCA 1Q3HA 1YVDA 1K5DA 5BN3A 1U81A 1E1RA 1F60A 2CLSA 3JVUA 2QORA 1CRPA 4PC1A 4M9ZA 2FWRA 4PZLA 1GIAA 1IN6A 2Q0HA 5B58C 3NH9A 3W6OA 5DHFA 3VTKA 2AFHE 1KO7A 2ZE8A 2FH5B 4PPFA 2AKAB 2RGEA 1T5LA 1KMHA 4P0TA 1J8YF 2JA1A 2A5YB 3HYRA 2GCPA 3LQRA 3B1XA 1G9XA 2IK8A 3KQNA 2WWGA 4DCUA 3PJRA 3KB2A 4RSGA 2JAQA 3CH4B 3GFPA 4A0GA 4DLTA 4IOJA 2FU5C 1N5JA 3WYAA 5DGXA 4LJ6A 2OUKA 2WJJA 4ZKDA 1G8YA 3EAQA 2ZJYA 1MH1A 1W4RA 1CTQA 1XDBA 1YU9A 4QBFA 2GXAA 1E9SA 4PQFA 3X1YA 3L0PA 4ASUA 2Z4SA 1CR1A 1T4GA 2ZRHA 1VCMA 1D9XA 4MYCA 4MKHA 3SFZA 3ZH9B 2VP4A 1A82A 3G0HA 5BYKA 2AK3A 4QC2A 4IKEA 4DBLC 2BMFA 3ADDA 5KSYA 1VG0B 1RRPA 3MG9A 3SHFA 2IUSA 2QEQA 1TADA 2QT0A 1OIXA 2V9PA 4OHVA 1ZD1A 1KIMA 2OM2A 3CR7A 2H92A 3LLMA 4UXHA 1AN0A 4N3NA 2RGGA 1LTQA 3I8XA 1QBKC 4GRAA 5SZJA 2Q3MA 1JR6A 3K0EA 3NWJA 4V0LA 1NKTA 4KSBA 4B71A 5DYIA 4IDOA 1KJWA 1Z07A 1ZM3A 3DZDA 3FTQA 4FMDB 4IRUB 5JS8A 3IPYA 2W2TA 3C7KA 4DXAA 2P67A 5JWRA 5HE9A 1NN1A 4BZQA 4WZBE 1ESNA 2B92A 5KTYA 1F2TB 1G8PA 2GJ8A 3AGPA 4OQMA 3LWNA 5J4HA 3SJAA 1TU4A 2JATA 2QMUA 4GBMA 4D0GA 4BFXA 5GJCA 5KHOC 3UPUA 4PQYA 4DSTA 2FFHA 1WBBA 3QXHA 2EWVA 2IYRA 3QBTA 5B64A 4ARZB 1W0KA 4MRPA 4O25A 8OHMA 1P2SA 1XPUA 3R9WA 3EZ7A 3W9YA 3SQXA 1XBTA 2FSFA 4IVQA 1XCPA 3PENA 3G82C 4LJ5A 1Z29A 4EKDA 1EFRA 4HSEA 1ONBA 3H2YA 4HZUB 1Z47A 3W5JA 1W4CA 2CK3D 1ZNZA 2PZFA 1K6MA 1G6OA 2EFDB 5FR1A 4E07A 4XWAA 1IN8A 4NP6A 1I2MA 3RRYA 1Y3AA 4DVGA 3B82A 3SNHA 3O47A 3MWYW 2J7KA 1YE8A 2OFXA 1NVUQ 3CNNA 1N0UA 1W1WA 4MH0R 1F6BA 3L82B 4NHOA 4RD3A 1EK0A 4DDWA 4Q5IA 2IYVA 4P31A 1NN0A 4HDCA 3I72A 3IILA 1RRFA 4UNQA 3SC3A 5LD2C 1Z0IA 1UBGA 2REOA 2DFLA 4QGFA 1N25A 3C16C 1D9ZA 2BV3A 4IXMA 1VYVA 2ZUCA 1X8LA 3DO6A 4JT4A 5L3VA 3PEWA 4OQXA 4O3MA 1IN5A 3LO5A 1UKZA 621PA 2V3CC 1DARA 2D2EA 4JVSB 1Q1QA 2P65A 1QHHA 2Q9BA 1GKUB 4BFWA 1JEEA 5FTMA 4CEIB 1E2FA 3CO5A 1M6NA 2WICA 4NTZA 2CDNA 1S9DA 4ASUD 1FX0B 2HT6A 1YR8A 3A36A 1MV5A 3BE4A 1CIPA 3VNUA 3ECCA 4LHXA 2F43B 4WXRA 5G3YA 5EP3A 2AD1A 4NCHA 4BRUA 1HY3A 5E7MA 2VO1A 3CWZA 1T8TA 4EPTA 4C2TA 3NVAA 5ANRB 1U9IA 4QJ4A 4HLUC 3D7MA 3E70C 4NDZA 1G18A 2YWFA 3ONWA 2ORWA 2FN4A 2REXB 4A36A 2KB0A 4DLUA 1DEKA 2HUPA 1IONA 721PA 3OIYA 1ZCBA 2OXRA 3OESA 4IDPA 4DZZA 2YOHA 3SYNA 1DVRA 3OE7D 3GFTA 3T61A 1KI3A 4D81A 1AQUA 1Z6AA 3MD0A 2R9VA 4JLJA 4BLTA 4MRVA 4F92B 2E1RA 4B33A 2ZYTX 3BC1A 3RRMA 3L2OB 2G1JA 2GTPA 2QG6A 2YHSA 4LSGA 1F48A 3EZ9A 3GFOA 1Q57A 3ZYCA 4LHYA 1GRQA 5L3QA 2WIAA 2I3BA 1Z6TA 4N0EA 1ODFA 4LJ8A 2W0MA 4D4JA 1T3HA 1G291 2ZE6A 2HYDA 2CLCX 1GG2A 2FPMA 2IS6A 1VG9B 4FI3C 1W0KD 4RKEA 3RRNA 4B2IA 5FTNA 2YINC 3HYTA 1A7JA 2BM0A 3O8DA 4M8NE 5TVKA 2O8DA 3KDSE 4PC6A 1M2OB 2NTYC 5FUYA 1ZINA 5JZVA 4Q1DA 1EFRD 1KDTA 2HT1A 2F1IA 3BH7A 2QM7A 1RE0A 1KK2A 1HT2E 1II8A 2HXSA 2QTFA 3WNCA 1W36D 2I1VB 1E98A 2GVZC 2NPFA 2ZRCA 3TQFA 1P7CA 4US2R 3AKEA 3IPXA 1IN7A 2F3RA 3B13B 4FINA 2PCLA 5HR5A 4W9MC 1J8MF 3KKMA 3Q9LA 2DHRA 1JAHA 2WSSD 2R44A 4PAOA 3VR1A 1KO8A 4CEHA 2XXAA 1XPRA 4B43A 1UDWA 2YVUA 1PVOA 3FKSA 1G3RA 4OL0A 1EFUA 1NLZA 3RS0A 1J99A 2BBOA 1MKYA 5JWHA 4XD7A 2CCKA 1VYUA 1YZUA 4M2LA 5JLJA 5CYOA 5CLLA 2NO9A 3P32A 2ZU6A 1BYIA 2CJWA 5FBQB 3QXJA 3UKDA 3E1SA 3QNUA 3SYLA 1RC8A 3VR5A 2NZJA 5FR2A 1MT0A 5J4LA 5JJIA 3K53A 1SKQA 3C5CA 3U2QA 821PA 5FTLA 4XVQA 1P2TA 3ZZUA 2D62A 4OQLA 4TSFA 1E9FA 5EE1A 3RWMB 3BB3A 4UJ3A 1B23P 5AJVB 4C0JA 1WA5A 3R8FA 4FMBB 4LY6A 3FKQA 3OZXA 1XTKA 2OV2A 3CWQA 3DOEA 4B2LA 4U7DA 3UK6A 3N2IA 1CLUA 4FIDA 2AR7A 3MLEA 5LDDC 2ZI6A 2QAGC 3ADBA 1GWNA 2P6UA 3AP2A 1P62B 1E0JA 5IRCD 1OFIA 3BH6A 1TEVA 5E7IA 2J87A 4BEJA 1GITA 2WTUA 3W90A 1KO4A 1G3QA 3VHXA 1YQTA 2DFNA 2RGNC 1OV4A 4Y0VA 2ZS7A 1X86B 4KFRA 4IVRA 4F4JA 3IDQA 5EXXA 4BFVA 1PLJA 3VR3A 4M9XA 3P4XA 4TL7A 4BASA 5JCPA 2C8VA 1SVIA 4KYUA 4TYPA 5KDDA 3MJHA 4LUCA 1TMKA 2B7CA 5H68A 2JASA 1D2NA 3O8CA 2ZI4A 5FL7A 1OYWA 2F9MA 2ODBA 3SU8A 4B2PA 1YKSA 1RVDA 4EPWA 3K9GA 3GD7A 4G5SA 1LNZA 2ZRJA 1NP6A 2ANCA 2VHJA 2NQ2C 4DIDA 1XX6A 1KTVA 3QJYA 2IEZA 2VHUA 4BEBA 4NYIR 2P5TB 4Q1FA 3PG5A 3UG7A 2CE2X 4LBZA 2HLDA 3DKVA 5KOYA 1IXRC 3RYTC 4EPXA 1DAIA 1GFIA 4WOPA 1DAKA 4CF7A 1UM8A 4OJKA 2ZIAA 2JDIA 2YJTD 1UBFA 1HURA 1XTIA 2WJHA 4L8GA 3K70C 1XD2B 1AK2A 5BN4A 1N6LA 3EIEA 1MABB 2H57A 1XEXA 4AYWA 3LXXA 2R6GA 2WAXA 1Q1EA 1R2QA 3EZ2A 3M0EA 4ZIRA 1S96A 1U94A 3K0AA 4LK2A 2O8FB 3K0CC 1ELOA 4PHGA 1VTKA 4PPQA 3FFBA 1MRSA 3LVRE 3ZS8A 1ZJ6A 4C7OA 5D3QA 3QEJA 4W5WA 2WZQA 3T1OA 4DSOA 5EE9A 1KK0A 4Q4AA 1XZPA 5H70A 1CR2A 1GL6A 4OBEA 3VR6A 2Y8EA 4XD7D 5EXPA 4QRHA 5CIQA 4C2UA 1VYTA 4RJLA 4RD2A 1XTQA 3MAAC 5CLQA 1E99A 2WWXA 3CRRA 3I92A 4GMDA 4GT1A 2OLJA 2I4IA 2PX3A 3AQ4A 4R2HA 2O8CA 1NBMA 1VHTA 4UQOA 5KNBA 5H8WA 1FW6A 4KBGA 2OSBA 4P4UA 2LWIA 3KKPA 5CDFE 4HUQB 4C0AC 1OF1A 3QI2A 1L7VC 1QHXA 3SDZA 5KNDA 2PBRA 1W44A 4TSFD 3TE6A 1XZQA 3FOZA 2HDNB 2PLFA 2KI5A 3VHLB 3NBXX 5AJZA 1UKVY 3QENA 4DDVA 5HKKA 3THYB 2WVJA 1E2EA 1EFHA 3NTUA 1CU1A 1JR3E 4TMKA 4PHTA 3VMFA 3LA6A 1M34E 2X2EA 4LC0A 3QG1A 4MGYR 4EFLA 5C1BA 1GNPA 1R10A 2RMKA 5EE3A 1UFQA 2EFGA 3FMFA 2IX3A 2A5FA 2ONKA 1GDDA 2KWIA 1WXQA 1U0HC 1S1MA 1GNRA 2B21A 4GDFA 5DIFA 5FFMA 3GJ0A 2OCAA 2N46A 1VMAA 4ZV4A 2E9SA 2IWRA 3GJ3A 4D4MA 4RZXA 1Y63A 4JBYA 1KO5A 3LBNA 2PMKA 4WIAA 4BGDA 1TUEA 1FNMA 2YV5A 3GJ7A 4LHWA 4QGAA 5A0FA 5JJKA 3ZD6A 1U8AA 2OCYC 2GK7A 2WWHA 2MSCB 5FPYA 4JT2A 4U00A 4FD2A 4L5BA 4RZ3A 1EWRA 1G6HA 1LS6A 1M8PA 2EFHB 3AVVA 3SZRA 2V54A 2WPDA 1GRRA 4IOLA 5TY0A 3P20A 2Q9AA 4F7WA 2GA8A 4MKFA 1FOEB 1SKYE 4PO9A 1YZGA 4Q1AA 1IBRA 2H7VA 3QUSA 1UF9A 2DYKA 2IXFA 3X1ZA 4BZXA 3B1ZA 2D7CA 2P6RA 4A2PA 4DIEA 3CBQA 3EW9A 3GLGE 1GZSA 2B8WA 2HLDD 4YLGA 3ICEA 2J59A 2A3RA 3KKOA 4LHVA 1OIWA 2DCUA 3B1VA 3BWDD 1VECA 3QXXA 4IDNA 1ZRHA 5C4GB 4A82A 1G19A 2H1LA 3IQXA 1AS0A 4B48A 3V00A 3DL0A 4U02A 3P26A 1CR4A 2V6IA 3CKLA 4DB2A 1R7RA 2CHQA 1Z28A 2BEJA 1OXSC 2BHRA 4ARZA 2JEOA 2F1RA 5AUNB 3GLIE 5EQTA 2ZITA 3W5IA 3UMRA 3WRXC 3PUXA 4NL4H 4DLWA 3X2SA 2O8BB 4OHXA 2F9LA 5EE5B 3V9PA 2XXAB 2QGNA 1OH6A 4CZ2A 1DAEA 2ZAOA 2G1KA 2ASEA 1LV7A 1NVVQ 1OJLA 4V0ME 1Z2CA 4HZUA 2NMVA 4TQ9A 4A9AA 1P9WA 1X3SA 4Q9KA 4URZR 4LC1A 4PPNA 2FZLA 3LFUA 3RC3A 3TVDA 2C77A 4TL9A 2VF7A 4ZCLA 3I61A 3ASYA 1E9AA 1SVLA 1US8B 3QPVA 1Q1ZA 4PR0A 5GVSA 4JJKA 1II0A 2CJWB 2KBFA 3LVQE 1NBMD 1HQCA 1NL3A 2ZTSA 3U7GA 2XB4A 2IS4A 2BBTA 2AX4A 2H17A 2NG1A 4GFDA 1NJGA 2C78A 1FTNA 3OEHA 1HQYE 2AD5A 3SS8A 3KTAB 1XXHE 1UJ2A 3GLHB 4G01B 2ZQ5A 1N6OA 3QKRB 3F3YA 3GCGA 4EAQA 4HAZA 2R8RA 3P27A 2EWWA 2IYYA 3F0TA 1ZUIA 2W83A 2C5LA 4M1MA 2Q6TA 2UVQA 2ODEA 5HKKD 2ZRBA 3E5HA 5K8TA 1WP9A 3CUEF 2W0SA 2WMNB 2EFCB 1CEEA 2HXYA 4HLQB 1JEDA 3CZPA 5GJVC 2VL7A 3GEHA 1J90A 4YQFA 3TRFA 2O0KA 5DN6A 5E7JA 1N6PA 5KO2A 1E2MA 3ZJYA 4CEIA 2PT7A 2RGDA 2R6FA 1BOFA 4EPYA 2F55A 4XIGS 4YONB 3EPHA 2ZJBA 1FX0A 4KVGA 1DG1G 1QVAA 4QNRA 1GL9B 4JIMA 2F43A 4MDFA 2EQBA 4POAA 2CCJA 4TLAA 1ETUA 5CJPA 2FFBA 4JJZA 3SHWA 5IF9A 1YZTA 4CGZA 3CH5A 5KPDA 2QL6A 3A1SA 5FH9A 1WB9A 4OI0A 2ZYVX 2XZPA 2WKPA 1KY3A 2BMJA 3Q5EA 4NYJQ 1G7SA 1R5NA 3VAAA 4B3DA 2ZRNA 1E69A 1W2HA 2IHYA 3TR5A 1SXJD 3M4YA 3THWA 3IEVA 1ZM7A 4DEXA 4YDHB 5KSZA 2GXUA 1AKYA 1HT1E 2JLYA 2X19A 3AVOA 1KZ7B 3Q5DA 1G7TA 3WBJA 1OH8A 4EIWA 4G5RA 3WY9A 1TQ2A 3UMSA 2GILA 5CITA 4LPKA 3THXB 4D25A 4OYHA 4GSYA 4XWOA 5B57C 1XEXB 5TMPA 5CM9C 2JJ1D 4TN1A 2ZANA 4G1UC 2D74A 4TMZA 5JMTA 3J81k 2QUZA 2DBYA 4ZIRB 3WHLA 3NG1A 1SVWA 1JNYA 1NI3A 2FZ4A 4CW7A 5CJ2A 4TQAA 2FSHA 2WHXA 3I73A 1IY0A 4JLNA 4UKDA 3PVSA 2ZSDA 4X8HA 4Q4AB 2GJSA 5ELXA 1BMFA 1VIYA 2IYTA 3VX3A 2OBNA 2ZRFA 2FMXA 1XTRA 1G3UA 1JPNA 1NKSA 4LZZA 1DTSA 4AIIA 2IYXA 3OAAD 2WKRA 5EE0A 3PIRA 3MMPA 4A2WA 4P32A 3RS3A 3C41J 4F38A 1R8SA 2G9NA 2O8CB 1EX6A 3AB3A 3GLFB 5D3MB 4D82A 2OZEA 1KHTA 2QTVB 2N42A 4Q21A 3OEHD 1ZP6A 3VKHA 1VCNA 2NO7A 3U5ZB 4NCIA 3R9IA 4M53A 3RWOA 3MRSA 1W46A 4PX9A 2GBLA 2ZYWX 1ANKA 3A8TA 2IS1A 2C04A 1AGPA 1P72A 1XNJA 2HEIA 3NBYC 4A8JB 4QHSA 1QDEA 3REGA 1EXMA 4ZKEA 1Z8FA 2AL7A 2XOKA 5AUPB 2H8KA 4B6FA 1C4OA 3UWOA 5DN6D 1Z0JA 3TVTA 4TLEA 3C14C 3NC0C 1MR3F 4JS0A 3NIBA 5DLQC 2O0HA 1E2LA 4AWXA 5K8IA 5JI2E 1DELA 2VQSA 3P4YA 4Q7LA 4LYJA 1KKMA 2ZRGA 4UNRA 2H18A 1ZM9A 3RHFA 1HE1C 1KAGA 3CPHA 3F5FA 4YMVA 2IL1A 1B0UA 2ZYUX 3B60A 2CHGA 1HE8B 2KSQA 4EJSB 4B3FX 2NOAA 3A1WA 3W3AA 4Z8YA 1W5TA 1E9DA 2ZUDA 2KBEA 4US1R 4ZDIA 4AKGA 4KHZA 3AVPA 2Z4RA 4HI0E 3F8TA 3QF7A 2R6CA 4PQRA 2XZLA 1GRNA 3OE7A 2XAUA 4EFNA 1VHLA 2X8AA 4YXWA 1M7HA 4IOKA 1SXJB 1KI8A 4UNPA 4XSHA 1DO2A 3VNVA 1U8ZA 2ZR9A 2WAYA 2Q9CA 3CF0A 3ICQB 4KFTA 4ZI2A 3U7EB 3PV0A 1EX7A 2XNDA 5EZ5A 4KAXA 2OG2A 3QKUA 1I2DA 5HE8A 1AZSC 4AI6A 1QHYA 2ORVA 1I4TD 3PXGA 2GWHA 4IFEA 2IS2A 4U5XA 2ZSFA 4MGZR 3B1WA 1N3BA 4DB4A 2F1JA 3B78A 4QBIA 1AQYA 5FTJA 3RRZA 1V43A 4LJ7A 1YRBA 3U60B 4PHFA 1OFUX 2ZEJA 1GOTA 1BMFD 2ONJA 5HZHA 1N6KA 1ZUNB 4G5GA 2PH1A 1XD2A 1X8KA 3WYGA 1N5IA 1MABA 2YNMA 5AWFC 1W5SA 3TBKA 2RGBA 5A4JA 2QM8A 4TLDA 3FHOA 4ZCMA 2G0TA 2OCBA 1BS1A 1E79D 2TMKA 2VEDA 2O8FA 5M04A 1R0ZA 1OH7A 1Q22A 3T1TA 4EQ6A 4GPTA 3VKWA 2WSSA 4XWKA 4DT1B 1GKIA 3AF4A 2R6DA 1G8FA 4Q66C 1MO6A 2OHFA 3DMNA 3SJCA 5JI3E 1TTTA 2IHBA 2FJUA 2IC5A 1S1CA 1Q3TA 4TTPA 4DSUA 4QHTA 1Z0KA 1ZCAA 2ZUBA 3PEVA 4MITA 5E4FA 3TJZA 1BH2A 1M7GA 1MO3A 4C0HA 3UMFA 2XOKD 2QA5A 4QM6A 4DLZA 4HUQA 4JKYA 2V1XA 1XD9A 1W48A 3GJ8A 2P6NA 2QT1A 2IYQA 2BJVA 4QHYA 2ZPTX 5JCZA 1Z2AA 3VU9B 1A1VA 4MKGA 2QZ4A 4MDEA 3SQWA 1Z0FA 1IY2A 4TZ6A 2IYLD 2QP9X 1FTSA 1RJ9B 3THYA 4RZUA 3AVYA 2ZVQX 1Z08A 1FFHA 2IF0A 4TL8A 3OEEA 1H65A 3RNLA 1HTWA 4A0RA 4Q7MB 2R62A 3Q72A 4A6PA 1MOZA 5TV2A 2PLRA 4DCNA 3SJBA 1GILA 5JEDA 2JLUA 1OSNA 3EZ6A 2REBA 3RANA 1YJ5A 2VSOA 5F98A 5HZKA 1TF7A 4GNKA 4C30A 3D8BA 3UXMA 4PTLA 1DO0A 1KKLA 4H1UA 4NKRA 1P2UA 4TLCA 2FE4A 3AP1A 4DHEA 4YXWD 2VIIA 2QPTA 4OK5A 4RD1A 5BYJA 3THWB 2VP2A 1S4QA 3RDPA 3WHKA 3HU2A 4QJ3A 3EC1A 4RCYA 1F2UB 2UZ3A 5J4YA 3QKSA 3HPQA 1DBSA 1UADA 1LF0A 4IOMA 2XNDD 1XEWX 3MJRA 2XNSA 2L0XA 2C98A 3BGWA 3TW4A 3QBVA 3EIHA 4O0MA 3EPKA 3RSLA 2GEDA 1XB2A 3KUCA 4L9SA 1NIJA 2IA5A 3RAPR 3AVWA 3EA5A 3O8RA 1U98A 2V4ZA 1XWIA 3GEEA 5FUXA 1JAIA 1HYQA 4DRZA 4MA4A 2Z6VA 1G3IA 4ON9A 2GKSA 3VQTA 1XJQA 6Q21A 1J7KA 2AXNA 2FEMA 3KKNA 3CX8A 3QOFA 4UJ5A 2Q3HA 3TQCA 1OFTA 4N0DA 4DWJA 1Q44A 1W4BA 5K8LA 1W36C 4M1OA 2PJRA 1W2GA 4KCGA 3KQUA 3IGFA 5KYKA 1JI0A 1CBUA 2FF7A 1XP8A 1NN5A 5KUTA 1TL7C 3K0SA 2XGJA 3E2IA 3T5GA 2WMOB 1GNQA 3SYKA 2O8BA 4A4DA 2J0UB 3KXLA 5HPYB 2GXQA 1JBKA 1L4YA 5L3RA 1NG9A 3LQQA 1XJ0A 2IBMA 3NXSA 4B3BA 3L43A 3CRMA 5BWMA 2AFIE 2MSDB 4ZPXA 3WMFA 2VP9A 1E0KA 3IO3A 4JKIA 4CT4B 1KK1A 3IHLA 2LCFA 1US8A 1K5GA 4LJ9A 1N5LA 1WDTA 3MGCA 3H1TA 1XF9A 3ZZ0A 5JRJA 1P2VA 4CIDA 1GM5A 3RABA 1W7AA 3KJGA 1G4AE 1R0WA 2KE5A 4DCVA 3KTAA 3FFAA 3GLHA 3L8YA 3QKRA 3FE2A 4XVRA 5F2EA 4BLPA 2QNRA 4TMXA 3ZS9A 2OBMA 2PJZA 1QF9A 4KFSA 3AVUA 2B8TA 1R5BA 2QMOA 1NMYA 5JECA 1ZUHA 2CL7X 2GZDA 3ZVLA 1U9IC 3OEED 1VPLA 3KXIA 3NBZC 1E2JA 3ADCA 3U6KA 1E1QA 1AS3A 3GJXC 3BAFA 1NF3A 1OYYA 4JL8A 4FCWA 5JBQA 3FHTA 4BFUA 4JVNA 3CPEA 3SI7A 1HUQA 3R9XA 1C9KA 5DI3B 2JLSA 4H9GA 1G7RA 2QMEA 1Q0UA 2AXPA 1KY2A 2N1BA 5KDOA 1WBDA 1OXXK 1SVMA 2W6IA 4KO8A 2FEOA 2BDTA 3B9QA 3FHCB 3QPUA 1FQJA 3RS5A 2YC4C 1NVWQ 2F3TA 4MGKR 2HF8A 5GADl 3LW8A 2VRWA 3TW8B 3CRQA 1MO5A 4E03A 4B35A 4B44A 2ZJ8A 3R7WB 2VP5A 3BXZA 3LNCA 2V55B 5FOWA 1NSTA 1PUIA 1WF3A 2HV8A 2J41A 2BBWA 1R6BX 4LDJA 3GEIA 1T3SA 4PO1A 2BC9A 4Q48A 5AUOB 2WBLC 2RH5A 5IT5A 3FDIA 4FMCF 3UIEA 2ZS9A 4IDQA 2JIZD 1N6IA 3A4NA 4YC7A 1YR6A 5TARA 4DEYA 2QN6A 1QG2A 4JYBA 3ZQ6A 2IXEA 1KI4A 1RRGA 3A4MA 2H16A 4MYHA 2XX3A 2C9OA 4QFMA 1Z0AA 4D4LA 2JLZA 1KI6B 4I1VA 1F5NA 1OXVA 3IQWA 4WVFA 4OI1A 3LDAA 3QQ5A 2GAAA 5FPHA 5JWOA 4LV8B 3SEAA 3BFKA 5J4VA 3THXA 3LRPA 2JJ8A 4LYAA 3TIFA 1L4UA 1VG1A 3K9NA 4P33A 4NYIQ 1KNQA 4OK3A 4D26A 2SHKA 3QVVA 3ZVMA 4MYTA 2GHIA 4M4SA 3IHWA 3QKTA 1KJYA 4R98A 4EQ6B 3O8BA 1KNXA 2XZOA 3RVBA 4PSKA 2QENA 3CIOA 1UKYA 5AK0A 3I3SR 3LX8A 2F7SA 2ZETA 2A78A 3KJIA 3ZZTA 1PJRA 4IEIA 1OB2A 2EYQA 4CDGA 3B9PA 2NGRA 3A6PC 1H8HA 3U3OA 2G6BA 1T8UA 4Q9IA 3RS7A 2WWWA 1Z3IX 2FFAA 3UATA 2BKUA 1DAFA 1IJFA 4I4LA 2JGNA 2CEAA 2GK6A 3CZQA 5D3MA 3GLFA 1G4UR 4MRRA 1XMIA 3ETLA 4AYXA 1VKJA 1GVNB 3IIKA 1TX4B 5EP1A 3KJEA 2BCGY 1G5TA 1KDPA 3QVUA 2GCOB 3A58B 4LV6A 3R20A 1WCV1 3EASA 3DPUA 1Z22A 3W8RA 3ZD7A 3AF1A 2AWOA 4PC7A 3ZLJA 4M1KA 3TGPA 4TZ0A 2CVFA 1N0VC 3EX7C 3M1IA 5BN5A 4WAUA 2CHVA 2C2HA 2P0EA 4BLRA 1HA3A 1NN3A 2QRNA 4GZMA 4A8JA 2JCSA 5FOSA 4F4CA 1KDRA 4JBXA 1E1QD 1II9A 2A5DA 2XTZA 3TR0A 4TL6A 2GZAA 4W7SA 1A4RA 3LXRA 1C1YA 2MMGA 1G20E 1OIVA 1ZAKA 1TQ6A 2WJGA 4WW0A 3L8ZA 2OCPA 2IYUA 1GL7A 4TT3D 1NBME 2BIFA 2W6ID 5AUQA 1TAGA 1KJZA 4DUGA 4JVLA 4LGMA 4HDOB 4RCZA 3SE0A 4TYNA 4PZZA 2VBCA 1U90A 4AKEA 1ZNWA 2ODNA 4DDTA 3QKSB 5JRZA 2GJAA 4EJSA 1OLOA 1P4SA 4JLBA 1JALA 2BWJA 1ZIPA 1ZVQA 2ZRLA 3WMEA 2VH5R 4ZDJA 1GSIA 2OFOA 4HB0A 4JLAA 1SXJA 3IKJA 3BFXA 2CCGA 1OKKA 3LBIA 4KU4A 4CEJB 1XMVA 5FBLB 4B76A 4HDQB 1QHSA 3Q85A 3VR2A 3BORA 1E2IA 1XTSA 3LLUA 2D3WA 3NDPA 3MCAA 4YMSA 1L8QA 3EPLA 1OHHD 1T6NA 3DMDA 3G5UA 4E22A 2ECKA 1RKBA 4RD0A 1IN4A 2IYSA 2JJ1A 2ZU0C 3U3KA 1N6NA 4FMCB 4DLVA 4DDUA 3TH5A 2ZRIA 4ZDKA 5DNYB 4PSAA 4QGHA 4Q9JA 4R7ZA 5JSZB 4RZ2A 3VFDA 1TUIA 2CL0X 1NY6A 3AVTA 4HAVA 4OQNA 1CR0A 4Q18A 3AF0A 3QF4A 1NVVR 2ZI3A 2JLRA 1VDZA 4XSGA 1IJEA 1H8HD 1YZLA 2GRJA 2ZI7A 5F3WB 2FFQA 2RKOA 5J5CA 1XRJA 2IW3A 2D4HA 1E4YA 3OAAA 5EUQB 5CB6A 2OE2A 3DZ8A 2R2AA 1IAQA 4Z8XA 1PLKA 2QP4A 3U3JA 1TEXA 4A15A 3NH6A 4IFBA 5C18A 1Z6XA 3HU1A 5B2ZA 4XTRA 3HPRA 4TQUS 2J7PA 4DT1A 4BWYA 1D6JA 5GJWC 1GTVA 1JR3D 2AK2A 3IUYA 3K09A 3K9HA 1E2KA 4WXPA 2JJ2A 4B3CA 1S2MA 2P3SA 2JLWA 1S3GA 2GZHA 2VLIA 3HJNA 2FPLA 2XTNA 3MWJA 4KJZA 4LX0A 3HP1A 2NIPA 2PEZA 2W6JD 4C0QC 2VA8A 3HR7A 4TMVA 4TYYA 4P4SA 5FBRB 4ZO4A 3AF3A 3WMGA 3WYFA 3VKGA 3QEOA 2KJQA 5JEEA 2NO1A 4IJMA 3VU9A 3TMKA 4F91B 3AKYA 2ZAMA 4D2IA 3HR8A 3QG5A 1KDOA 1LW7A 4Q01A 4ESHA 4X8LA 3U7FB 3A1VA 1RJ9A 1G7CA 3H84A 1TF2A 3M6AA 3BD9A 1WQ1R 2QU8A 4DUGD 4M1SA 1DADA 1F3OA 1U2RA 2A30A 1OE0A 2FX3A 2PZGA 2ZRAA 3CRW1 3TLXA 3KKQA 2OT3B 5FL3A 2VHCA 1S0UA 1I4DD 1I4LD 4GZLA 3EXAA 4M22A 3KL4A 2ZXUA 4RVCA 5E3HA 3FMIA 1ZU5A 1G1MA 1S9HA 1E9CA 2OAP1 2YOFA 1RIFA 1LFDB 5DSZA 4DJTA 1R4AA 4JZKA 2P5SA 1SZPA 4NCNA 2D2FA 2XTMA 4B74A 3UANA 4CYMA 1N6HA 5DI9A 5CIWA 5HTKA 1OKKD 2QROA 4PAMA 4HAXA 1E4VA 1E32A 1NLYA 1F2UA 3W6PA 2IXGA 1WMSA 1NIPA 2ZJ5A 1S3SA 1OT3A 4K8OA 1R8QA 1ZBDA 1SVSA 3IBGA 4LI0A 5TB5A 3I5XA 3BBPA 1TF5A 4LCBA 3CNOA 5FOUA 2Z43A 3Q7PA 1SHKA 2YC2C 3U4QB 1W47A 4E09A 5HCIA 4CT5A 3P1JA 4Q1CA 2FSGA 2V8OA 2IYZA 2EW1A 2YYZA 3U44B 3MSXA 3N2EA 1ZM4A 2PMDA 2QMHA 2ZJ2A 4ZCIA 5EP2A 4Q7KA 3OFNA 4XJXA 4TTQA 4JVMA 3TUJC 2PX0A 4UXIA 4AC9A 3T35A 4IHQA 4UNSA 5L3SB 2EU8A 1Z0DA 4BECA 1J2JA 1MO4A 1CRQA 5H1YA 4DCTA 4GOKA 1GUAA 3RLFA 3W34A 1BIFA 4JBWA 4Q19A 5IHPA 4FW9A 3ZIAA 1AA9A 4HB2A 4NYMQ 2H5EA 1E79A 4ACBA 3PUZA 1NY5A 5CYPA 3K09C 2ZR0A 4PC2A 4UNNA 2J0UA 3CLVA 1CJUC 3WNBA 2J7PD 3RS2A 2X77A 1IQPA 5FI0B 4MRNA 1YR7A 2WJYA 1WRBA 4W5JA 1P5ZB 4W5HA 3K9LA 2JJ2D 4OHZA 2XB2A 3D6TB 2CL6X 5JHGB 1K8RA 3QXCA 4BLSA 1XMSA 1T0HB 2BOVA 3I8SA 2C96A 4Q00A 4PPGA 4P3YA 1G3MA 1KMQA 3GQBA 5E95A 1PV4A 4AK9A 3AEZA 4TMWA 5FOVA 2ZRKA 1VCIA 1DAMA 1ZU4A 4GL2A 4IW3B 3AKDA 1G8HA 3LH5A 5J47A 1T0JB 2CXXA 2WM9B 4OJQA 1X6VA 1Z5ZA 3KFXA 4BFSA 1ZNXA 3OF5A 2DWPA 4MKIA 1V5WA 1ZM2A 4JMPA 1JJ7A 5B30A 1QRAA 2ZE5A 4AURA 2G0NA 1XEWY 2WIBA 4HEJA 1SKYB 2A2ZA 4MQBA 2RHMA 4Q1BA 1T9HA 5KSPA 3CF2A 3QY0A 4QG7A 1YZQA 1NJFA 4B34A 2HJGA 1SHZA 4NE2A 2DY1A 3GLGB 1KSFX 1P73A 4C0KA 5KSOA 5DI3A 4ACAA 3OIWA 1AIPA 1L2TA 4FCTA 4A0FA 2GEUA 2WJVA 3T12A 2A5GA 2X2FA 3CF6R 1RZ3A 4BFYA 3KX2A 2QBYB 2X1VA 3WP1B 3V4RA 4XH9B 5SZIA 1KO1A 4PANA 2OILA 2ZSAA 3B1YA 1UEIA 3R7WA 1LB1B 3B5JA 4BQSA 3FB4A 3IBYA 1X8JA 1P75A 1QVRA 5FBWB 1NSFA 3GLIB 3I32A 2NPIA 3C8UA 3V4FA 3T1QA 2FG5A 4HLUA 1XU4A 4OHYA 3RSOA 1LY1A 1S8FA 5JHHB 3W6NA 4HAUA 4Y0AA 4Z1MA 4HUTA 2WOOA 4Q4JA 3TSOA 4JLVA 3A1UA 1QHNA 1FP6A 5F9FA 1R0YA 3B85A 1OXTA 3CX6A 4M1WA 4TLBA 3TNFA 4DKXA 4ESVA 2O8EB 1X1RA 1JQLB 4R2IA 1E0AA 2QPAA 4ERNA 2W58A 3OFND 4JSTA 1KI6A 3LAWA 4OK6A 5CK5A 1D8TA 2ZRPA 2B7BA 1E94E 1TNDA 3QF4B 5EXTA 1NMXA 4P4TA 3T06B 2F6RA 3N70A 2BMDA 2F1HA 4J0QA 3ND9A 4AKIA 3SR0A 1XXHB 2CNWA 2VHQA 4LBYA 2GF9A 2PT5A 4DLYA 2G77B 1P3JA 3ZIAD 1NVXQ 1E9RA 3CNLA 4I99A 1W4AA 2YZ2A 5FOXA 1A2BA 4B73A 2WOJA 3IIMA 1D5CA 2BCJQ 3I62A 2J9RA 3T1VA 3AF2A 3TAUA 3GJ5A 5DYGA 4QKQA 1RPZA 2ORIA 4BE7B 4MRSA 4V02A 2GBLC 2V7QD 2YWHA 3EARA 4D0NA 4V03A 2IEYA 1KI1A 4URYR 3PQCA 4EUNA 4O2RA 5GJBA 2Q3FA 1AKEA 1CJTC 4DLSA 1E1RD 1E9EA 3U6BA 2VTKA 4IXNA 5LPNA 4ILEA 5F9HA 3KZ1E 3THOA 1RW4A 2AWNA 4JSYA 2AN9A 2XSZA 4P4SB 2HJVA 2YOGA 3FGNA 4GMXA 2CLDX 5EXSA 3ADKA 1KI7A 2RGCA 2DWOA 3KJHA 4PC3A 2E87A 5FOTA 4QM7A 4LYFA 2GCOA 3U3MA 2WJIA 1DAGA 3K0FA 1G16A 4JLDA 2RB4A 4Z51A 4BUJA 4OKSA 1H8EA 4D80A 4I1SA 3S1AB 4F4IA 2FOLA 1SVKA 3QIAA 1ZMXA 1HV8A 2DFKB 3Q3JB 4L4UA 4WA7A 3KXKA 2AHOA 3PITA 2GVDC 1G21E 2ERXA 3KFVA 5AR1A 4AG5A 4C0LA 5DHAA 4NU0A 4I1OA 1KYIA 4KV9A 1QHIA 3CR8A 4HZIA 4US0R 4I81A 4NZYA 1XPOA 2CBZA 3OIVA 3KQKA 4HB3A 2D7DA 4R9UC 3PEUA 2O0JA 3NDBB 4HAYA 4Q9HA 4F93B 1GP2A 2W2VA 3PUYA 2GF0A 1NLFA 2ZSEA 5FPSA 1R0XA 1CF4A 1FZQA 4Q4HB 1XTJA 1Z6YA 4HLDA 1G41A 4PO8A 2P2LA 5KU1A 2GEVA 4YMTA 3A1TA 3AUXA 1NG1A 2FA9A 2Q21A 2QPOA 3NHBA 4FCVA 5AJWA 5JS7A 5TDHA 2LKDA 2QAGA 3DHWC 1PLLA 1KSJA 3B2EA 1CJMA 1O3YA 3B7GA 4C0SA 5KNCA 2JLVA 4RD4A 4DLXA 3BB4A 2JIZA 2QRZA 4Z1MD 3HU3A 3ZVRA 5C2JB 2YWGA 1NMZA 2RGNA 4CEJA 4C0BA 2XEXA 1KAOA 1P61B 4QXAA 4MYUA 3QE0A 4PSVA 4V0NA 3ZVNA 1SULA 1UBCA 1CKEA 4LJAA 4LYHA 4PAQA 5GVRA 3QXSA 2C99A 4GI7A 4M9QA 4Q47A 3C4JA 1P60A 4TMTA 1CS4C 4KITB 3TUZC 3CONA 2GCNA 1E2DA 2WKQA 2CNWD 4WZ6A 2VPPA 3SBDA 4A0HA 1GKYA 3D31A 4B3XA 4RY2A 3TSZA 5JSZA 2QGZA 3SN6A 3LV8A 2IWHA 1CJVC 3EPJA 1GAJA 3W3ZB 2Z0MA 4M0LA 3AP3A 5G41A 1PUJA 2OAQ1 4LJYA 1AM4D 1T91A 1FUKA 1EWQA 2V6JA 4EPRA 4FN5A 4E5UA 4NCKA 1E2PA 2J3EA 4NCJA 2C9YA 4MGIR 4BLQA 1T5IA 4PZYA 4QGGA 1M74A 1UBEA 3Q7QA 1JXMA 1JXOA 4LPSA 1AGRA 1OXUA 2XSZD 1E2HA 1WE2A 4LV5B 4X8MA 1DOAA 3K0CA 3MUFA 2ZM5A 5SZHB 4Q02A 4NPHA 4S2EA 1ZNYA 3BK7A 4KYIB 5UKDA 1KMHB 2ZRMA 1G17A 1O87A 1H8ED 2JLXA 2W2XA 3FYHA 5LD2B 5EUMA 4A1FA 3RC8A 1FMLA 3AH8A 4K81B 3TK1A 2GETA 2QQ0A 3NEYA 3JZAA 1DE0A 2OO7A 2QE7A 4FXPA 5CK4A 3X1XA 2G3YA 4DLRA 1DG3A 4D0LB 3DEFA 1N0WA 4QL3A 3SFVA 4C4PA 4C9BA 1EFTA 1OPXA 2IUUA 4EPVA 2B6HA 2OLKA 2VSFA 1TQ4A 4TT3A 5FUVA 3U61B 3RS4A 4AD8A 5G53C 4MUAA 2BMEA 1AJEA 2BKEA 5FPTA 2XJ4A 1ZC3A 4LBWA 3GLHE 4UXJA 3T5DA 4EFMA 3KQHA 3EC2A 3ZGXA 1XJCA 121PA 2ZSBA 3KUDA 5G3ZA 3FVQA 5IK2A 5CB8A 3L0IB 3H0KA 3DM9B 4Q4JB 2QSZA 2J0VA 5KPJA 1D2MA 4CRWB 4JLOA 3CW2A 4BRWA 5JJLA 1N6RA 4R71A 5DO9A 1JJVA 1SGWA 3CB4A 1KK3A 3JVVA 3GPLA 2PCJA 2W00A 2XJ9A 4X8OA 4A2QA 2WWIA 1P9RA 3EIQA 2C9CA 4D6PA 2DFTA 1OHHA 4V0OA 1KGDA 2BEKA 3TKLA 2WV9A 2VYFA 2ATVA 3KQLA 1NNEA 2FSIA 3NEJA 3U4QA 2GJKA 3EA0A 4RFSA 4B3GA 1U8YA 1UDXA 2O5VA 3NKVA 1XCMA 5FUWA 3VR4A 1RYHA 3U44A 1U0LA 2FPKA 3CM0A 1E2GA 1JB1A 4RD6A 2YKGA 1YRAA 2ZI9A 1YZKA 4BFZA 2ODWA 2QY9A 3AUYA 5L3SA 1CP2A 2QI9C 4ZDWA 2D06A 4Z54A 1AZTA 3A37A 2ANBA 2VP0A 3CPJB 2ZR7A 1TU3A 2VF8A 5CDFA 3UG6A 3PCRB 4M1TA 3K1JA 3BH0A 2GXSA 221PA 3DM5A 1W36B 1AS2A 4RKFA 1LS1A 4B47A 3K70D 1NRJB 2NO6A 3C5HA 2GDJA 4OI4A 4Q03A 5BQ5A 1FUUA 4QOSA 4G5OA 5DH9A 1W0JA 3REFA 4KFUA 2G83A 1A2KC 1JR3A 3WP0A 2OXCA 4Q4LA 4BLOA 1DPFA 3T15A 3QPWA 1Q1BA 4JLMA 1CULC 4LJ4A 3FKSD 2RCNA 4NMMA 4OHWA 3K0FB 4IDHA 4K46A 1P9NA 1YHNA 3H4MA 4JYCA 2ZRDA 4NBSA 3I1FA 1IXZA 1Z83A 2Z5FA 2WSMA 4V0KA 3X1WA 1SQ5A 4JL6A 2VP6A 4G5QA 1HH4A 1JECA 1FMJA 4AKHA 3T34A 3BFVA 5AJXA 2W6JA 1Q20A 2ZREA 2V1UA 3BERA 5LB4A 3PUVA 2QE7D 2MMCA 5IDVA 3LY5A 4QJ5A 1Q21A 1QHHB 3FWYA 2PEYA 3PEYA 1LVGA 3AGQA 3AVQA 4AY2A 4XTCS 1E2QA 3CX7A 2BVNA 4PXAA 4Q9LA 1DS6A 3ND8A 1CXZA 1HEIA 2QQEA 4JLKA 2CE7A 3GLFE 3U7HB 1N5KA 5EP4A 1Z6GA 1E0SA 1JQJC 1IHUA 4N1AA 4XVUA 1OB5A 2ZI5A 4LWZA 1DAHA 1UPTA 2EVWX 2K5UA 3EZFA 1ZC4A 4Q7JB 1P6XA 1E6CA 3HWSA 3GLGA 2QAGB 4OQFA 4KSCA 1VIAA 4EDHA 4DSNA 1QZXA 5BXQC 4B32A 2PL3A 5IK2D 2ZS8A 5C4MA 2IYWA 3BB1A 4A92A 2QTHA 2UZIR 1M1YE 4PHHA 2J45A 1G8GA 2UKDA 3K8YA 4HLCA 2QBYA 4URXR 2A7QA 2IT1A 2OBLA 4BZPA 4DC9A 1EFCA 2RGXA 3U3RA 3TSWA 5AJYA 3X1DA 4TTRA 4BFTA 5J4KA 2C03A 3IIJA 3UWKA 1COWA 1XEFA 3L0OA 4PFSA 4D4KA 2GJ9A 2I1QA 1EG7A 3MFYA 4TYQA 3SOPA 3GLIA 4WBSA 4QNMA 1IY1A 1OW3B 5FL7D 5J40A 2VSXA
chains in the Genus database with same CATH superfamily
3UA3A 3A4LA 4M83A 3IA2A 2ACEA 2FMUA 1Q6YA 3L8CA 3MWLA 1O5TA 5U4QA 3BMQA 4S1PA 1G5RA 4YV7A 2DVMA 2E5FA 4MRMA 3SNKA 5A7GA 3UCFA 4O2LA 1Z63A 1XFAA 3EGDA 3L92A 1F4VA 4EJ0A 4QM7A 4JASB 4PSCA 2VJNA 1C2YA 1DP4A 1WM1A 4L7QA 1KSGA 2WWFA 4R54A 1ZD9A 5CT4A 1P29A 5K6RA 1XVUA 1ZA2A 1EGAA 4PFQA 2LV8A 2IDKA 3WRYC 2WTXA 1UR5A 3NHRA 5DFAA 2XITA 2Z5VA 2Q5EA 4HXEB 1II8B 3AFOA 1BJKA 1Y5MA 4WZAE 5K6AC 2QRQA 3H83A 4HL6A 1H23A 1MRNA 4FDUA 4HNQA 1XL1A 4J7CA 4OF4A 2D6FA 3Q6NA 2QXTA 5LA6B 3M6FA 1PFGA 5I7RA 3B8HA 3CKYA 2FQXA 3D0RA 3HSYA 3R5XA 4XVHA 2JHPA 3NOVA 4PNHA 4AJ1A 3MZ0A 1DWOA 4DFDA 2BTEA 5HGJA 4P80A 4JJ7A 3WMWA 1KSHA 4O4JB 2Z2YA 5AW2A 2J5QA 3DV9A 4KIGA 2IUTA 1JNXX 3OY2A 4M1EA 5DLYA 4B83A 5FTKA 5KTSA 5CIYA 2G80A 3GP8A 3D2BA 5DWQA 2B25A 2Z83A 1KOFA 4YMWA 5KMGB 5KVCA 1ECJA 1V8OA 1QGAA 1RRVA 1UPFA 2DWQA 3OIFA 1SBTA 2OG1A 3B6EA 4OD0A 2DECA 4QYIB 4K9SA 3V9AA 4B45A 4KL8S 2HLHA 4KVAA 5E8JA 3W8NA 1L5VA 2ZJAA 2D8MA 4C3ZA 1UKBA 2RSLA 1Z34A 3DO8A 2FPGB 5FPPA 4JQOA 1KORA 1AD2A 4QXRA 2P3LA 421PA 4YP6A 3PLRA 4TWZA 1BC5A 3C6MA 3ZQJA 1QTRA 3W3AH 2E0IA 1E6KA 5CM8B 5LXTF 5CX1A 1JHRA 1SOWA 1WG8A 2CF6A 1GPBA 4I55F 3S1AA 5TXGA 1QS0A 2WK1A 1TEZA 3KV3O 2ZROA 1P6UA 4NBWA 1C9MA 1NVMB 3WK4A 5EJ4A 1EE2A 3GJ4A 2YWXA 3LQKA 1FFAA 1YZ3A 1Z3CA 2WT8A 3OIUA 4GQBA 4LVCA 1RXIA 1ZWKA 4C88A 2HRRA 2G4LA 3BEDA 3KD3A 3M3PA 1YVPA 1TAHA 4PV7A 4K26A 2OFWA 2E48A 3N0XA 4U2EA 2DWCA 1RAGA 3X2EA 4PYQA 5IFKA 2WUGA 5BN1A 2ATXA 4GOXA 4N5IX 2PA3A 5LQMA 5KKCA 3BE6A 1MW8X 3GEGA 2F59A 1RMYA 2X1HA 1MAUA 3I5YA 1SXJC 3EDRA 4ABYA 3OSZA 4KBYA 3AFNA 3QKWA 4XOIA 2JC3A 3ME5A 1DL5A 1ZN7A 2JVJA 1J07A 3N2KB 2Y27A 1DJQA 3L06A 1PG0A 1W85B 4HBGA 4LOAA 8ABPA 3PHCA 3T0FA 1EESA 4IUCS 2M32A 4I2VA 1WY5A 1IUPA 2IHTA 1K1EA 2JCBA 2OZKA 3FGPA 2CMHA 4KAJA 4L0CA 2W93A 4B6EA 2BJWA 2ERCA 4ZYLA 3TSYA 3VAYA 1E61A 2J31A 3IURA 2GERA 1DC5A 1J56A 2QP3A 3SHVA 2SBTA 4HNHA 3IULA 1SBCA 2XVXA 2MCFA 4CCYB 2EOAA 2WPDD 3X1JA 3EWSA 1T35A 1IOZA 5JC8A 3S7ZA 4P93A 2GAFA 4M0EA 1KI2A 5EHIA 1TPZA 3HXLA 1MQ9A 1BWRA 1ZGHA 4RFSB 4NQRA 4KI0A 1JT9A 3IAM1 4V0QA 2Q3DA 2YWEA 3NTRA 5JAZA 1LJUA 2XUDA 4GOMD 1BYUA 1XZDA 4OX9Y 1QGUB 2A5JA 2QJOA 4J75A 5E1MA 4CVNA 4TMFA 4FB5A 5KAMA 2NO0A 4TM8A 3HRIA 5EMLA 5BSVA 5JNLA 4RELA 3MCZA 2A1UB 1Z8DA 2P8JA 3AV0B 4RHTA 4HT3B 4EHNA 1GPH1 3TAHA 1BW9B 1VJDA 3F4LA 2AKYA 2J1LA 4KBFA 3OO0A 4NU8X 1JPJA 2IGBA 4NV1A 4OB6A 1MXFA 1KZGB 5BWOA 2XDQA 4I1UA 1AH2A 4YIKA 1WS6A 4MMXB 1W49A 3GJTA 5FPKA 2RHDA 3F7NA 1XMPA 3L05A 2DTXA 3PQ5A 4NNJA 1PBTA 3DTVD 3K0AB 4C6HA 2BHLA 2EBFX 4ALJA 1NBIA 1B2RA 4KOAA 5J23A 5CNKA 1ZIOA 5BVGA 1YR9A 4M6WB 3FPAA 4RWEA 4J16C 1PR5A 1ONNA 1FYXA 3R40A 3S81A 3OHMA 1ZZGA 2YFHA 2OK8A 3FF1A 2PH7A 5L4SA 4E31A 2CK3A 2E4VA 1U7DA 1QQAA 1KFKB 4HWTA 2J3LA 4URUR 3WLTA 3USZA 3W9UA 3PFIA 1KARA 2GNOA 2UAGA 2XIQA 2ZP1A 3IVXA 2VTBB 1U81A 3AHGA 3MOSA 1CF9A 1PP4A 4M9ZA 2FWRA 2DKFA 5LVAA 1JLLB 1GN9A 4PLVA 1JQEA 1X39A 3G9XA 4PZLA 5ARDA 1Q0TA 3CMMA 3W6OA 1XT6A 4MEAA 1GTRA 2EWMA 4U1RA 4HYTA 3FNIA 3QOXA 4R4JA 2ECQA 4PPFA 2AKAB 1T5LA 3QFTA 3U0VA 2A5YB 2B98A 2ZB4A 5K4AA 3DBLB 3KQNA 1G9XA 2IK8A 3CQ9A 1L3IA 1QQ7A 4Y6QA 3ZBTA 3UB4A 4DCUA 1XRPA 4X45A 3VJRA 2JGEA 2C4KA 4M54A 5I51A 3OQMA 1QR2A 2RHLA 4A0GA 3L6BA 1V96A 1N5JA 3CT4A 4OJMX 3BMNB 5DGXA 3UAOA 4LJ6A 2OUKA 2WJJA 4JA2A 4QICA 5B1DA 4DCOA 4GGPA 4BKQA 3IDSA 3L4JA 3MQ2A 1W4RA 3GB9A 2C88A 3C6QA 4MV9A 4DIOA 5BV1A 3CV3A 3GT4A 3K5IA 1B41A 2JF0A 2JI9A 4ASUA 3EPPA 4QIHA 3PZRA 1VKHA 4R40A 4RLSA 1VCMA 3G2OA 3Q9SA 3D5EA 4XLTA 1T2VA 2CYCA 1HT3A 2ZBUA 4J2OA 4M60A 2XQIA 4OXNA 2HQOA 3E22B 4P54A 1A82A 5D2CA 2D5BA 3JQ9C 3G0HA 5BV8A 4J43A 3CY6A 4Z7NB 3IL2A 4AF7A 3ADDA 1QF6A 2FFRA 1PE0A 2B83A 5JROA 3KFLA 1GRVA 2IHJA 4ZQEA 4LY9A 5LQSA 3LDUA 2F8LA 2Q7DA 1JKJB 3ANSA 2CDRA 5LBTA 5TPWB 1GA1A 3NM4A 3BMQB 3I30X 2G9ZA 3TYXA 4U2DA 2Q5QA 2OOSA 2PFGA 3EGDB 4IQGA 2EX4A 4V0LA 3N8IA 2QRGA 3EZXA 5BRAA 4NLLA 3IIEA 1AUQA 2OFFA 3FTQA 4FMDB 3SHTA 3IPYA 4DXAA 2I9PA 2ZSKA 3MTDA 3KXPA 2R8XA 4B6QA 4MV4A 1F17A 2IPAB 3HKBA 4CI9A 5KTYA 3AGPA 4OQMA 3IQFA 1YBMA 5KTTA 3Q8LA 3SJAA 1YC2A 2NO4A 2QPLA 4QWMA 5AJTA 2Z3ZA 4GBMA 5D6NA 4J3NA 2Q0XA 4TXJA 2O4CA 2WFZA 3IKLA 4DSTA 3S3TA 2H2WA 4MRPA 1L7NA 3RU7A 2VKTA 3TO5A 3BK1A 4X92A 4A0QA 1XPUA 3R9WA 4D57A 2GX6A 2M6RA 3TG8A 1NZDA 2HMAA 4K3UA 5AHOA 3PGJA 3GJSA 3SQXA 3IVCA 3PENA 3BILA 4EKDA 1DRKA 4U9HS 4ZVVA 4HSEA 1ONBA 2WNSA 3H2YA 3KOYA 4HZUB 1Z47A 1REQB 2GNAA 3TIXB 4AW9A 1JQKA 5FP0A 4JC0A 3EVGA 1PEDA 3KT8A 1O6ZA 2EFDB 2R5NA 3TMYA 1GQYA 3GZ4A 3QP9A 1RQPA 4PYLA 4XWAA 3ZCTA 1AZLA 3N1UA 2KW5A 1Y3AA 1AO3A 2GO7A 4GWKA 4DVGA 3CEMA 3O47A 2P1ZA 3MWYW 1UC4B 2J7KA 2B4TO 4JJIA 5FD8A 3CNNA 3SP1A 1N0UA 4QJBA 4KPEC 2DJIA 4DMFA 1K3UB 4MH0R 1F6BA 4Z4GA 1TO1E 3I2GA 3K1ZA 1BA2A 4RD3A 2J08A 2ATIA 3TZEA 4A7PA 4HGYA 4C07A 1UL1X 5KC8A 5TVGA 5L9AA 3G2KA 4BB6A 2IHUA 2YV3A 4ZT5A 4DV3B 1RRFA 3H5LA 5CX1B 4YN3A 2ONZA 4Y2RA 3ZKWA 4ZO6A 4FE4A 1N25A 2BV3A 4YRKA 2ZUCA 4RPKA 1LRKA 1OWOA 2PXXA 4JT4A 3CS3A 2X0RA 1WV1A 5HOEA 1NT4A 4RTJA 3P0FA 5AHRA 621PA 3MRXA 4ZHQF 4EM6A 3GRVA 4P4GA 1P8AA 4KTTE 6REQA 3RYHB 1RWBA 2I1WA 2EAUA 1B15A 3AJ9A 3TPFA 3ZWYA 5JSFA 3TKYA 1ZLXA 3F46A 3MBIA 1JEEA 4OHOA 1E2FA 2GEFA 1M6NA 3MTEA 2WICA 2ADMA 3CX4A 3KETA 3MPUA 1THGA 3EH1A 3R7AA 3B5IA 1C3EA 2HT6A 1YR8A 1Z0UA 3P9PA 1CIPA 1NW8A 4HNUA 2AOVA 2F43B 5GWXA 4G81A 3ZE9A 3U62A 3EULA 8ADHA 1HQKA 3CUTA 3CWZA 5HXAA 1WF6A 4UHJA 3ZIDA 5JMWA 1CZNA 1W30A 2QRLA 1XU9A 3LG2A 4J9UE 1ORTA 5CCBA 1YGYA 4DARA 1JGTA 2JGJA 1DXHA 3ELWA 3IP9A 4NBRA 4QQKA 2IVFA 1G66A 2D5CA 2FN4A 2IE0A 2ORWA 3ETJA 4A36A 4PZCA 2CXNA 4QATA 4HTAA 1IONA 3ZDCA 2PFKA 3H1FA 2CDAA 2CL5A 2OXRA 4GICA 4BY9E 4NF2A 1JFTA 3AHCA 2N1MA 2ZTUA 3D3WB 4FHEA 2OHOA 4B0OA 4RZSA 4E2FA 2H1RA 1JWLA 4UPVA 1FFCA 4RENA 3T61A 5C8DA 4JLJA 2VSNA 3RU3A 5JSKA 1ABFA 1ISMA 1PJCA 4B33A 2ZYTX 1PFKA 4ZRDA 1Z7BA 4ND4A 1ZICA 2G1JA 2GTPA 2QG6A 2NVBA 2X8JB 2YHSA 4R3UC 3WWOA 3EUFA 1DZIA 1RWWA 1PD1A 1U2TA 3F2VA 3I04M 4FJ2A 4LHYA 4RYDA 3T3EA 3EGOA 3RJ5A 4MPDA 1AC5A 4X66B 4N0EA 5BWBA 2F67A 2PY6A 4X91A 3LUBA 5IZCA 3PS9A 4BIIA 3OY7A 3CLRC 5CDGA 1SEVA 2E4XA 3UK7A 1R6UA 4K9QA 5IUNC 1KYWA 1SC3A 1L8OA 2XYGA 5DEIA 3T9DA 4B5LA 4RKEA 3RRNA 3AX6A 3KEOA 5F12A 4ZOAA 2BM0A 4OFBA 1GDHA 3OWOA 5BVGB 3GQVA 4Q1DA 1EFRD 2FMIA 3GP3A 1R8YA 2GQ0A 1TUGA 2A57A 4F5WA 3QE9Y 2QM7A 1KFCB 5IEJA 1JJAA 1USVA 1IB6A 3WNCA 1KYXA 4IG9A 1M0WA 1EE9A 2I1VB 4Y30A 5EPEA 1W36D 2ES4A 5TE9A 4E70A 4LXHA 3ICCA 1FRFS 3IUEA 3MCWA 3TQFA 5CA0F 2HHHB 4ITUA 1BMTA 1HL7A 4FINA 2Z56A 1D1QA 2O8NA 5F78A 4TKMA 2VWPA 3ZE7A 1MAAA 1JAHA 2WSSD 2Z2KA 1KO8A 3N7UA 1YS1X 4K6KA 3KXDA 2I54A 2YVUA 1U04A 1A5ZA 3GVCA 4QPJC 3SIWA 4H08A 4E15A 1NLZA 3OE5A 2PE5A 3RS0A 1B8PA 1BVHA 2BBOA 3KV1A 4XD7A 5CB4F 2CCKA 4M2LA 2I8CA 2FR8A 1X1CA 4D97A 2PSSA 3FMVA 2JFXA 4UARA 2QUBA 4C20A 2P9YA 1HYHA 3I8OA 1UDCA 2LIPA 3V1YA 4B5KA 3GRZA 2ZU6A 1BYIA 2Z95A 3BYZA 2EGUA 4L4YA 2CJWA 2YL2A 1A9ZA 4WFQA 5ALUA 1RPTA 3QXJA 3UKDA 2C8JA 2NZJA 5B3KA 1CFZA 2M9MA 3ITNA 3OCVA 2QRHA 4GM4A 3C5CA 2QN8A 3KR1A 3BL8A 821PA 5J4LA 1YA6A 4XVQA 4RJJA 3OPYA 5A4FS 3ZZUA 1O94A 1P3DA 4QFDA 2R2GA 1YJ8A 1KMIY 3RWMB 3BB3A 5AOCA 5I7HA 2UU9B 4PZEA 4JR2A 3PVCA 4MVJF 3P9RA 1L3CA 2NZYA 4C0JA 4DR6B 3TM4A 3NHJA 4IIDA 5M5BA 4FEGA 3L0ZA 2HQRA 4J0EA 3VTFA 5L6MB 1I33A 3NAQA 5E9JA 5B2EA 2XMBA 5IKMA 2AR7A 3MLEA 4KXUA 2ZI6A 1U7OA 3ILYA 1GWNA 3BCRA 2XUIA 5C52B 5JALA 1DOHA 1V7ZA 5JH7A 1E0JA 4UEKA 4UBMA 3A9TA 1CEYA 1PR3A 1YCHA 3RC9A 1FYDA 2QLLA 3KQMA 3ROQA 1Q83A 1FPQA 2J8ZA 3IOEA 5AIBA 3W90A 4ENVA 3U39A 1NRWA 1KO4A 3DOCA 2PWYA 3N8GA 4KX5A 2DFNA 4JITA 1Q95A 4JY7A 1X86B 2R1ZA 2H2DA 4IVRA 4KFRA 4AJ2A 4F4JA 1NKVA 3IDQA 3LLSA 3MJVA 4GI2A 3ZW7A 1ESDA 1BEUB 1E7WA 1UMKA 3H1EA 1CVLA 3W1WA 3P9XA 4BASA 4EHKA 3JSXA 3L1KA 1X74A 4U7TB 5AI0A 3T41A 1H2HA 4CQLA 2O5RA 3Q3IA 4TYPA 4MV0A 1X7WB 1PQUA 1IATA 2JFUA 4ZT2A 1T0UA 2V59A 2Y0PA 2JASA 3DR3A 3KAJA 3M81A 4C3UA 1Q14A 2C9ZA 5FL7A 3HKBB 2F9MA 2ODBA 3I6BA 1PQ4A 1YKSA 4KDCA 3OD1A 5HX7A 3TSCA 4OMCA 2ZRJA 1NP6A 2NUBA 4J0GA 1I7PA 2DY0A 3DWIA 4WA8A 1RWVA 2PRSA 1V1MB 1E6WA 4J2TA 1PL7A 1QCCA 3OJEA 2IEZA 1QB7A 3EQ7A 3OM9A 1NFRA 1VGQA 4BEBA 3EQZA 3T99A 3ZHZA 5BNWA 4C6SA 2HA3A 3UG7A 2BYTA 2HLDA 3QWBA 1N2BA 3EK2A 3O9ZA 4RO0A 1MAVA 4XB1A 1NE7A 3ZXYA 2BLLA 4NICA 4CU2A 1QFXA 2B61A 5TQ2A 2JHGA 1AGNA 1TIPA 4BNLA 4I5IA 2WLTA 3DLBA 3JQFC 1EHYA 3RUIA 3OQOA 1WEKA 4L8GA 4F96A 4X7BA 4UATA 3C2QA 2YVLA 3AFMA 3KWLA 1AK2A 4B40A 1XJ5A 2JG3A 2BT4A 1MABB 1XEXA 3HY3A 2R6GA 3HMKA 3KEQA 1SUFA 4AKSA 2B7LA 1R2QA 1QO0A 3EZ2A 3QA9A 1K92A 3MTJA 1BNCA 4M1ZA 2H1VA 2P9QA 1ELOA 4BJ5A 3AEYA 1ZD3A 3F3SA 3LVRE 2B4KA 2RI1A 3WRXC 2OMKA 4L85A 4F8EA 3C98A 2WZQA 2I2BA 3DG9A 1KK0A 4ZOBA 4Q4AA 2PSEA 1TJ4A 5H70A 4OBEA 1ATZA 3K1AA 4DS3A 3OLYA 3FBGA 5BUQA 3S2IA 3SSMA 2QTZA 1PT6A 2Y8EA 2A9RA 3SX2A 3ZKWB 4FQ8A 1V7QA 3L0DA 4IF4A 4CG2A 1ISFA 5CIQA 4C2UA 4N9WA 4HGQA 3WFJA 3WQBA 1XTQA 1BHJA 3F96A 3HJAA 4GMDA 5BV0A 3VYUB 4QOHA 1VSTA 2O8CA 1VHTA 5M3BA 1Y4UA 1TCCA 1C50A 4AJOA 3ZW9A 5KIAA 2QTVA 2OSBA 3VR5D 3F5MA 1JU9A 2LWIA 5CDFE 4QX6A 4HUQB 2C2MA 2CKMA 3T3OA 3DHEA 2FI1A 3LPDA 2Q8QA 3INRA 3QI2A 1L7VC 3RE1A 4CUJA 3EIWA 1W44A 4TSFD 2BFAA 4N8SA 1HORA 2PLFA 2KI5A 3DP7A 4E1VA 4BOYA 2WVJA 3KZNA 2J3JA 2PDAA 3KQYA 4JJGA 2Q4TA 3V1NA 1NC3A 1CU1A 1JR3E 1MIOA 2W71A 3I0NA 4XJSA 5KJ1A 2DBQA 5D1HA 2X2EA 1CUAA 4H35A 1ZH2A 4E21A 1XVTA 5JAMA 4GPAA 5AXAA 2PBLA 2QD5A 3PHIA 1RMTA 3LVFO 4W9NC 2WD7B 2XLCA 4DG8A 3EQ9A 5AI4A 3IV9A 2A5FA 2KWIA 1WXQA 1U0HC 2Y1LA 1Z4JA 2RD2A 2A9JA 3OSUA 1BE6A 1GNRA 4BO4A 1P4GA 1V7CA 2VDMB 2P4QA 3BXFA 3FKJA 4EO4A 1KRXA 4PRZA 5JXIA 3P8ZA 1FU4A 5KVVA 1Y63A 4BZZA 4EB3A 5CLFA 2I6XA 5DBEX 5K2OA 2E2WA 1FNMA 3QYJA 4I9FA 3TIGA 5K7SA 1NU8A 2NTJA 4XFJA 2AE1A 1AX9A 2I4MA 1P1HA 1OPRA 5C1DA 5ALNA 3BM5A 5JDIC 1DRJA 2LGJA 4U00A 4WT7A 4DGQA 3H9UA 1EWRA 3IPCA 1LS6A 2HSDA 4YJDA 1QIKA 3BRQA 5C81A 3HI6A 2Q9AA 2RH4A 2GA8A 5HIIA 4CLDA 4YRNA 1YZGA 1QGOA 3GA7A 3NWPA 1EINA 2PJDA 4ND8A 1IBRA 4OUDA 2QV0A 5EMHA 5TPZD 3ZXSA 4P3XA 5JYCA 5HDBB 4ZQFA 3B1ZA 4RCVA 3GLGE 3C6XA 3CBQA 1EIZA 3NUQA 4QEKA 3PUIA 4XQ9A 1QPZA 3ICEA 1I6MA 2A3RA 2I2DA 2R86A 1U9ZA 4G56A 4IYRA 4L8LA 4LHVA 4N3BA 4MPPA 2WU1A 3KYCA 1WUYA 5ITSA 4JP1A 5EIBD 1AO0A 3CF4A 3RVJA 1CR4A 2FW7A 2V6IA 3G9UA 4NULA 4FVTA 4H18A 4DB2A 1R7RA 2DC1A 2BEJA 3W7VA 4ARZA 4TVSA 4MINA 1EK1A 1Y6JA 2B8JA 4A23A 3WO1A 3W5IA 2FZ5A 1W76A 3PUXA 1PQPA 1U0TA 2CLLB 2FWPA 4KR9A 2FW8A 4OHXA 4TWRA 4FYIA 4BNKA 2H1FA 2QGNA 3L7BA 3OLZA 4AZVA 2FR1A 2WRZA 2PK3A 2ASEA 1NVVQ 2C3PA 1Z2CA 3DAHA 3VR6D 2QQ5A 4TQ9A 4V2UA 4A9AA 5C8VA 5A62A 2WUEA 3IDFA 3IT1A 4XQGA 2YHBA 4RAQA 3I53A 2E4YA 3LFUA 4K9DA 2JKYA 3GMIA 3TVDA 4TL9A 1SVLA 2FHPA 4LXUA 4HRXA 2A67A 3FPBA 1MXHA 1V0JA 2CJWB 2KBFA 4L78A 2Y68A 5D00A 1RXEA 3UK2A 4AWAA 1JSXA 1UKCA 2ZTSA 1WUJS 4OM8A 1NQXA 1NULA 4PYOA 2AX4A 2H17A 2PX4A 2V8BA 1NJGA 3JQBC 3OEHA 4ILKA 2AD5A 5AVUA 4DMKA 2IITA 3HUFA 3G2PA 2Y4NA 3GLHB 2ZQ5A 3B3JA 3KZKA 3PIDA 4G0VA 1Q7EA 1LWOA 4MWTA 1MO2A 1ULSA 3P27A 4C87A 2WB2A 4NVRA 1SKBA 1PW5A 4PR3A 4KOEC 3D54D 3LBYA 4AY5A 2E37A 4ETWA 1QANA 3BWMA 4FN4A 3A6EA 1CS0A 3ZNQA 3NFYA 4NCBA 1G5HA 1E3QA 2IQIA 3CUEF 2B94A 3JAWB 5EMNA 5DW3A 2NYVA 1QOZA 2GN4A 4YQFA 1IQ0A 3AR5A 5JH7B 1Q91A 3C3KA 2O0KA 4BMZA 1K7SN 3ZJYA 5DYWA 3BZBA 3G59A 4CEIA 2QX8A 2PT7A 2EW8A 1UIRA 2JFQA 1BOFA 2X23A 3NS7A 1QBGA 4QPPA 1RLIA 4S24A 3UJ8A 3V48A 3V1LA 3WB0A 4BQFA 1J09A 3D6AA 3F6SA 2YN0A 3NU1A 4KAAA 4KVGA 4DCCA 1YACA 1QVAA 4PONA 3IOBA 5I45A 1CB7A 1GL9B 1C3LA 4UASA 3WNZA 4LY3A 3L4KA 1TW3A 4MDFA 4HGZA 2EQBA 4BNYA 1VJRA 4POAA 2HSGA 4ZMRA 3HKEB 3BTVA 4PZAA 2N3ZA 3DO5A 1ZCZA 5ILQA 1YZTA 4CKBA 2IZ5A 5IF9A 2AN5A 4MVCA 1IPHA 1DEOA 4MRAA 3WLIA 3PFKA 2HW8A 2AG6A 2CW5A 1WB9A 2XMDA 1Y5NA 5BSRA 1B3BA 2Q49A 2BMJA 3E9MA 4OHBA 1EXDA 4NYJQ 1G7SA 1V3QE 4EGAA 4FSHA 3HCPA 5IFLA 2ZRNA 3JD4A 4MW6A 2ID8A 4PRKA 3OLXA 3UK1A 5B12A 1UJ4A 1W2HA 4MZXA 2VXYA 2W2LD 3IEVA 3WZ2A 2H54A 4FYJA 4Z99A 3ZI4A 3ENQA 5CA1F 1EK2A 4HDSA 3KDAA 4IIEA 3GFQA 3ZHBA 1WWKA 1HT1E 1Q0ZA 4YJ3F 3QE3A 1TKCA 3IAXA 1G7TA 3Q5DA 4CNQA 5HGXA 3WY9A 3IXMA 1E18A 2H2GA 4FCCA 1A27A 3Q6MA 3VKUA 1B8OA 4HN2A 3WOHA 4DUPA 2V6MA 2HRCA 5GONA 1SQSA 2IOHA 2BD0A 3HVJA 3TRDA 1H3FA 1QGZA 2A0YA 4XWOA 1XEXB 2VUIB 3AUJB 3VO1A 5T4BA 2D74A 4TMZA 3VZBA 4YPOA 3SVLA 1VQ1A 2DBYA 4LE1A 3G9ZA 3WHLA 4GPZA 4M86A 3NG1A 3G7SA 2VTEA 1C3JA 3MERA 4TQAA 4X84A 1NOIA 1RJWA 3GLRA 2P77A 4X8HA 4Q4AB 2GJSA 2IYTA 2C5SA 2DBVO 3K1AB 4E5YA 3TL3A 2PXAA 3IP8A 4G1FA 3DT6A 5BRNA 2IEDA 2I4TA 2SICE 3LCCA 4K6HA 3W8DA 3R6DA 1OILA 1NKSA 2OCXA 1J39A 4LZZA 3GIWA 3LLCA 4TRMA 5KCMA 4XUEA 1MUUA 4AIIA 4QQRA 4U2GA 4YV0A 1C4KA 1ZD4A 2ZYHA 3MMPA 4F38A 2O8CB 1EX6A 3H11B 5D3MB 1N9GB 4D82A 2OK7A 3FWKA 1ZPDA 2QTVB 3LHDA 5T6BA 3FPCA 1KR2A 3AZQA 2N42A 4B9EA 1O03A 2HU5A 4D42A 2HK6A 1GZUA 1EWVA 4L51A 1O77A 1VCNA 1FFXB 3RWOA 4ZYXA 4GG1A 3DE7X 1E1DA 3ITEA 3MXOA 2CLMB 4TVKA 2C2XA 5C7YA 2C04A 2GPSA 1AGPA 3QSGA 4GD3Q 2HEIA 4CL3A 5LZ2A 5DHQA 4FFDA 2FP4A 7YASA 5BSGA 1MIOB 3IJPA 1Q16A 3HLKA 4QHSA 1WZIA 5IJ9A 1FIUA 1Z8FA 2AL7A 3FNFA 3GROA 2H8KA 1IEVA 3GBVA 1C4OA 1WABA 3RYCA 3UWOA 3IC5A 1Z5PA 3UTCA 1TT7A 1D6NA 2FWBA 3HB0A 5DN6D 1RLUA 1LJ8A 1V4VA 3OZBA 2NSHA 4GYYA 4HWSA 1QUEA 3BE5A 3TQQA 3O92A 4L75A 3HUUA 1Z8NA 3NC0C 4LG1A 4DSAA 4ZMBA 5HM6A 4J3FA 5DLQC 1JPUA 2M6KA 2XRYA 2ALJA 2XH8A 4EG1A 2J4FA 1RLMA 1THTA 1GR0A 3CVOA 4DRXB 2FOIA 3G9QA 1MJGA 2B35A 1HE1C 3RHFA 2ZIZA 3F5DA 2ZYUX 3U19A 2GN1A 5CHYA 4O08A 2OXIA 4QFCA 1T1EA 4BQPA 2P0YA 4FK8A 4ARVA 4CKCA 3PUJA 4URHA 1Z5VA 1WX1A 4ZDIA 5TGTA 3G89A 3WLNA 4BX8A 3VYTB 3GN1A 2HHAA 4XQCA 3TTTA 5FEUA 1LBTA 3PRHA 2O5CA 1GRNA 1VHLA 3K35A 4R05A 3O0TA 4ZOLB 3HWWA 4IOKA 3ZY3A 1V25A 4YJGB 3HBNA 3ONNA 4GMGA 3TLMA 3F6RA 1T2DA 2P9GA 2OUIA 1U8ZA 3PX3A 4TT8A 2ZR9A 3C97A 2Q9CA 4KR2A 3CF0A 4ZI2A 1IY8A 1HG0A 3U7EB 3WSVA 2XNDA 5JS6A 2F1OA 1MIHA 3BMXA 1FNDA 1LX6A 3FFXA 4Q05A 4HCJA 1I2DA 4F60A 1AZSC 3ZDAA 5FXMA 1YRHA 1QHYA 1EXWA 3JZFA 5FNVA 1A9XA 2VDVE 3WYNA 4AI6A 2ZIUB 3ANMA 3TX6A 1OZ0A 2F3UA 2GWHA 2FZVA 4IFEA 5DHTA 1VMDA 4M7OA 3VDXA 3ICPA 3B1WA 5EMMA 4DB4A 1CP3A 2H4XA 3B78A 1WSAA 3MILA 1AQYA 1EAYA 4F5YA 5FTJA 3W79A 3EXEB 3SMQA 4KRFA 3FLEA 2YXNA 3AC0A 1N7GA 2B0CA 3LTEA 4PHFA 4TTJA 4WCDA 5ALKA 1CZUA 2EEPA 1UM9B 3SPXA 3IH5A 1BMFD 1PW7A 1ZIDA 3FSGD 4AZSA 4BV8A 4W5TA 4NZNA 3P4UA 5YASA 1LK7A 2CMGA 5T3YA 4I19A 2VHEA 1JEAA 2BELA 3EWIA 1X8KA 3MMNA 5DT9A 1CCWA 1AKNA 3SR3A 5JZSA 2HHCA 5A4JA 1JG7A 3O7WA 3FHOA 5CBPA 1N1DA 1ZOPA 3H2KA 5TJ9A 4ZCMA 3NHZA 2DH6A 2G0TA 2OCBA 5MN4A 1E79D 3AWDA 1M1UA 1E77A 5M04A 3CJQA 4EQ6A 5DDIP 1L5RA 4GPTA 5TMEA 3VYRB 3SSOA 4QXQA 2AN4A 4DT1B 2J07A 5KVAA 1EUQA 1MG5A 2VPQA 4MLPA 2R6DA 1G8FA 1PZFA 4ZQHA 3S8MA 3DMNA 2ZULA 4HLNA 4XPIA 1Q3TA 3GLTA 3IB6A 1EQUA 2ZUBA 2Q5JA 2B2NA 3NO4A 4WLNA 4TWBA 1O54A 5I8PA 3AF5A 3OJFA 2CXQA 1CS0B 3LY9A 3W4KA 1WR8A 5KINB 1L5YA 1A1SA 1CETA 5A3SA 1GUZA 5H9VA 2B1QA 1T1GA 3GH1A 3MRTA 2REQA 4WNAB 4AJLA 4YQEA 1ZR2A 4F12A 2XCQA 4AECA 2QA5A 4QM6A 5BVHA 2H6EA 3RQSA 4B84A 1B7GO 1RQ7A 3HLYA 1XD9A 1N2XA 1Z36A 3LT0A 3C24A 4Y9RA 2BJVA 3HEBA 4QHYA 3OPNA 1KFBB 4IIUA 4F5EA 1HRKA 1XTTA 1PYGA 1WO8A 3VU9B 4QZVA 3HDJA 4NR0A 1PGPA 1V1JA 5IH7A 4V1CB 1OASA 1FTSA 3HYCA 3FM9A 3B7WA 3D64A 2CNDA 5FORA 4BV9A 3THYA 3AVYA 3WGHA 2WF7A 1Z08A 4GR5A 1Q19A 3NP7A 4XYMA 5EJIA 1AA6A 2IH4A 3CO0S 2PUEA 2C2BA 4Q7MB 3L7YA 3VYWA 1M3SA 13PKA 1MOZA 4IDCA 2PLRA 4I3HA 3W8EA 4D9CA 1HR0B 5JCJA 4CKBB 5CT5A 1ZSVA 7MDHA 1OSNA 2EIXA 2REBA 3NJ4A 1P0MA 4KQ6A 4OJTA 3GYGA 3JR3A 3SQDA 3TB4A 4BBAA 2CLOB 4M7RA 4EJ6A 3FYUC 5J2TB 5HQJA 2NU9B 1UDBA 2FVYA 3D8BA 2GEKA 3OFKA 3F6CA 3WGTA 4LFBB 3C3XA 2ZYSA 1BD3A 1OLSB 1R74A 2J9ZB 3FLAA 1EJBA 1KP2A 2Y0BA 1UQRA 3I2JA 4G8CA 4IJUA 4MVJM 4PGFA 4CIXA 4RA9A 1P2UA 3KHKA 4TLCA 1TM4E 5ALLA 3RIMA 4CE6A 1R0KA 3L4SO 2DUMA 4YXWD 2YYAA 4TRRA 2ZBRA 4OK5A 4EZIA 2VP2A 2UUBB 4IXDA 2FRVA 3EC1A 4HDSB 4XASA 3LX4A 3O74A 1T8RA 2RHOA 4ICIA 3R3HA 4H4DA 4WCFA 1R88A 2PKEA 3HPQA 4EJ2A 1KEPA 2J5KA 3D02A 2HSZA 1DMRA 1TECE 3MJRA 4R0NA 2WB4A 1SQGA 3TW4A 4PICA 1ULZA 5AW6A 2R8OA 4EHBA 5LNK6 5MGBA 4F8YA 3ZOZA 4UTRA 2Q6KA 4XIFA 5GONB 3CR3C 1J23A 4H0CA 4L9SA 5AVJA 1ES9A 3CVJA 3LRTA 2DFDA 3I3OA 3EA5A 4JFAA 3V2HA 4IM7A 5FLYA 1BXGB 5FUXA 1SD5A 3LPLA 4DRZA 4FS3A 1YB7A 3GD5A 4PG4A 2P62A 1H5QA 2BFEB 4TUYA 3LK6A 2GKSA 1Y8RB 2IKSA 4ZYUA 1CF2O 4LDAA 1M2NA 2C9BA 1YJAA 4I5GA 1O8BA 4EGQA 5C46F 4W7HA 4C04A 1J7KA 4LA4A 2AXNA 3P9CA 4MUFA 1U7XA 5ALVA 3CX8A 5KOHA 3QOFA 1JAXA 4XB6B 4N0DA 4HDMA 2R8ZA 2AC2A 1RKQA 1X7YA 4M1OA 5ALJA 4P0QB 4YJ2A 1SWWA 1UBJS 1YE3A 2IDJA 3D2AA 4KCGA 4Y6LA 1R6AA 1YMQA 2AFHB 2FUG1 3ONFA 4MPTA 2FZWA 4O4HA 4S1OA 2VAWA 1NV8A 3BFJA 1C1DA 4ZEVA 1I3MA 4L8YA 1FMFA 5JD5A 1YIAA 1XNHA 3VJKA 2ZTLA 4ZU1X 1R37A 2WM3A 1YHZA 5KUTA 3RBXA 5KNBH 1ZVVA 2HR1A 1D2AA 1RYYA 3WKEA 1DCKA 2GEBA 4OP1A 4B82A 1GNVA 3CLKA 4A4DA 2FZKA 2ZUTA 3O03A 3RVDA 2GXQA 2WE7A 3VDRA 5L3RA 3ZY5A 3LNTA 3DMYA 4V39A 1SG0A 1XA3A 3L43A 4E5DA 5BWMA 1Y1LA 3GCXA 2MSDB 4AJJA 4FGWA 4Y7CA 4JP3A 1E1CA 1F8GA 1PYOA 4JP8A 4C3OB 2LCFA 4WERA 4O5AA 1K5GA 4Z9XA 3C3WA 5LZ9A 4JI2B 3DEAA 1PZHA 2MHCA 1WDTA 3BMOA 3GZNA 3IESA 2PRYA 1I4OA 4R8SA 1XLWA 3RYIA 3WGQA 2NV6A 2VJMA 4F3KA 3W8FA 1ZCJA 5EIEA 16PKA 4L08A 1R0WA 4Y2UA 2KE5A 5ITZB 3RYCB 4I0WB 3MAGA 1LH0A 2CDCA 2I34A 2VDQB 3QKRA 4LW8A 3ESBA 3Q5GA 2C3YA 1A2OA 1VRCA 4TMXA 4E13A 2VZLA 4C4YA 2GF2A 4YP0A 4G9BA 1P6QA 4AO8A 4AZ3A 4KFSA 2QZZA 5F76A 3AVUA 2B8TA 2C1ZA 1Y0BA 2WU4A 2WSLA 3U40A 1SK9A 1NNI1 2E89A 3GPCA 1U9IC 5E4TA 3OEED 3Q41A 3KXIA 3NBZC 4ZICA 1E2JA 3RJTA 3ADCA 2VK8A 4MDHA 4R1QA 1U2PA 4HC4A 1AS3A 3C6BA 2AG8A 3ZE6A 4QECA 5JBQA 2FMKA 4FCWA 5HOQA 1ZJWA 1Z88A 2QIPA 3JW8A 4CKCB 3SI7A 3MBOA 1SIOA 2OAEA 1HBJA 5EPOA 2AXPA 1CZRA 5FJJA 1O95A 2CD7A 2W6IA 4J90A 2BDTA 3RS5A 2A1IA 2Q2OA 1FQJA 1O97C 3U09A 1NVWQ 4MVJD 3WK8A 4ZN6A 4KMSA 2O1SA 2P41A 4KO3S 5GADl 1DRWA 1NOJA 3LW8A 3VH4A 4CQMA 3VR3D 2VRWA 4Z7OB 3PKIA 3CRQA 1MNQA 1MO5A 2CUTA 3BDAA