4HEJA

Discovery of selective and potent inhibitors of gram-positive bacterial thymidylate kinase (tmk): compund 16
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
202
structure length
198
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Discovery of Selective and Potent Inhibitors of Gram-Positive Bacterial Thymidylate Kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 80
structure length 198
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hejA00
2HYDA 2RCNA 1Q3TA 3SYNA 4ZCIA 1HV8A 1XJCA 3C41J 3GLGB 1A7JA 4DCSA 4DB4A 5KHOC 1QHXA 3CNLA 2F9LA 4TN1A 2GCNA 2FFHA 3ZS9A 1RE0A 1WA5A 5DN6A 3U3OA 2IYXA 1X8LA 2WTUA 1CLUA 1JNYA 4I4LA 2QE7A 4XTCS 2HCJB 2AL7A 1G5RA 3EIHA 4NH0A 4B48A 1AGPA 2B6HA 3AP3A 5G53C 4AYXA 4OI1A 5SZHB 3IGFA 1AS0A 1CJKC 3OE7A 5EXTA 4B73A 1KO1A 4FN5A 4AK9A 1XRJA 4R71A 2XXAA 4EJSC 1Z07A 2FOLA 1ZM3A 1II0A 2XB2A 1E9AA 3K9GA 1NIJA 1R8SA 2GILA 5F9FA 2EQBA 1B0UA 4XTRA 4N0DA 3A1TA 2QQEA 3GLHA 1E1QD 1XJQA 1D2MA 1EXMA 1I2MA 1SHZA 2NMVA 2J7PA 3GEEA 2RGNA 2QN6A 1GRRA 1CR1A 4KODA 1KO8A 1SVOA 4BPBA 5JECA 1IOZA 3HWSA 4NHOA 3WBJA 3X1ZA 1II9A 2HF9A 3OEHD 4U5XA 5ANRB 4LJ6A 1W48A 2WJYA 2W0MA 1SQ5A 2IYYA 1F2TA 3C7KA 3GFOA 2Q3HA 2CVHA 2PCLA 1TQ2A 2GEDA 5KNBA 3CX8A 4L16A 1D6JA 1Z0DA 2W6JD 4NU0A 4DLWA 2NO7A 1HUQA 3U4QB 2FV8A 2JLRA 3CUEF 2CL0X 4Z1MD 1NVWQ 4R7ZA 3NVAA 1NMXA 2QROA 3JZAA 2VPPA 2FGJA 3UPUA 1OW3B 3KL4A 3UG6A 5JJKA 3RNLA 2HUPA 3PEYA 2OCAA 3RABA 3U61B 5H68A 4BLOA 4OYHA 4YMVA 1N6OA 4QKQA 2FJUA 2REXB 1G4AE 4JLVA 2J3EA 1ZU5A 4BFXA 2V7QA 1N0UA 1OH7A 1TEXA 1NLYA 4PZYA 4QFMA 2CDNA 1AIPA 1UBEA 3JVUA 2F3RA 2OAP1 2BEKA 3THYB 4DSUA 2D2EA 2PZFA 1ZD1A 3T5DA 2WSSA 3REGA 1J90A 5DYIA 3FFBA 1NBMA 1AA9A 4PR0A 1W44A 4LX0A 1CP2A 1XNJA 4V0OA 4LJ5A 1TNDA 1EFRA 4Q4LA 1X3SA 1ZD9A 2FA9A 3SJBA 3GLFA 1S8FA 4G5RA 2XZOA 3BRWD 5EUQB 1E69A 2A78A 3A37A 3D8BA 5EXXA 1VG0B 4OJKA 1UBCA 4XWKA 4BECA 1RRPA 4EIWA 4V03A 1AN0A 2ODNA 1KYIA 1OLOA 3DKPA 4Q18A 3ASYA 2ZYTX 1NJGA 3CNOA 3V00A 5GJWC 1BOFA 4MKHA 4DKXA 4BGDA 2DY1A 1SKYB 1YZQA 4L9WA 4M1MA 2O8DA 5KSYA 2O5VA 2AKAB 1K5DA 4XSGA 2BKUA 4NCIA 1N6NA 3BK7A 3GFTA 3BC1A 4A82A 5AUNB 1X8KA 1FL9A 1OFIA 1KI7A 3IO5A 1EG7A 4GP6A 3CRW1 5F3WB 2J1LA 1JEDA 3KUDA 1XTRA 4HZIA 3SNHA 5FR2A 4DSOA 5JS7A 3B82A 4HZUA 2JA1A 2C5LA 4QNRA 1YU9A 3LW7A 2CNWA 2N1BA 3EW9A 4US1R 4RZUA 5C18A 1KMHA 3AGQA 4ZDJA 2FFBA 1M74A 3BJIC 2JJ2A 3IIKA 5KDLA 4EFLA 4CEIA 2Z0MA 2QGZA 1QHGA 4QGAA 1OF1A 1WBBA 2XXAB 1ZNWA 2RB4A 5IT5A 2X2FA 3C14C 2ANBA 3RSOA 1HE8B 2FE4A 1TF5A 3PEWA 1KSJA 4OQFA 3UWKA 4AG5A 4XD7D 3PUZA 2IUTA 3B9QA 3SI7A 4MUBA 4RJLA 5JEEA 2Z43A 2EYQA 1DE0A 3L0PA 2BV3A 4B35A 4C0JA 3QVUA 4CDGA 4ESHA 2FPKA 3LY5A 3DKVA 2AFIE 4HAYA 1MRNA 4HDCA 5FUVA 1M7HA 4GZMA 4C0HA 1F2TB 2QTFA 5SZIA 2XZLA 3WYAA 2GAOA 1DO0A 1XEFA 4G5QA 3KJHA 5FR1A 5HKKD 2XTMA 3LBNA 4WIAA 1U0LA 3GJ7A 1G3UA 1SGWA 3Q3JB 2ZYVX 3I92A 3I73A 4FCWA 3FWYA 3G82C 2YOFA 3B85A 3K1JA 3QQ5A 2BDTA 2H17A 3SHFA 2PMDA 5TARA 1Z29A 2UVQA 3DL0A 1CJUC 4E07A 5EXSA 3AVQA 2Q9BA 2AHOA 2ORVA 4OHWA 5B2ZA 1C4OA 4G1UC 1OIVA 4LJ4A 4Y0AA 2O8CA 4M22A 5FL7D 5IDVA 4F93B 1J7KA 4YC7A 3LNCA 3ICQB 4TYWA 1T0JB 1AQUA 3RS5A 2CCKA 4ZDWA 3L2OB 5L3RA 2C98A 5EUMA 2LWIA 4LC1A 4M53A 4DLTA 5HTKA 4NCKA 1RFLA 4F4CA 1WB9A 3I3SR 2I3BA 1OKKD 4B2LA 4XSHA 3QKSB 5GVSA 2XX3A 3K9NA 4B33A 1IM2A 2OV2A 2W83A 4P4UA 3ONWA 2WVJA 3TUZC 1FP6A 3BWDD 1HEIA 1DO2A 4GDFA 1ANKA 1DAMA 3LLMA 4O25A 4TL9A 4BFYA 2C9YA 1ZCAA 2AXNA 2J0SA 1NMYA 3OFNA 2W0SA 1XD9A 2ZUBA 4DLRA 2NO0A 1AZSC 1U9IA 1YRBA 5LD2C 1GIAA 2BM1A 1LS6A 1KTVA 1OXSC 3B9PA 2QL6A 2O8DB 4Q9LA 4IDQA 1FUUA 3U5ZB 4RKFA 2IXFA 1XX6A 2VIIA 2N42A 5AR1A 3UMSA 4BLPA 5HCIA 4YDSA 4N3NA 1JQJC 2YV5A 3B13B 3RWMB 2QUZA 2VHTA 2RHMA 1ZNXA 1E2HA 2VP5A 4XIGS 5M04A 1VYTA 3NC0C 1N6HA 1NL3A 2A5GA 4HDQB 4HZUB 1BYIA 2QP4A 4PAQA 3X2SA 3KQKA 2P0EA 1L8QA 3TSOA 2G1JA 4IOMA 4C0KA 4XWOA 3DM5A 1HH4A 4LUCA 1KMHB 4LGMA 2D7CA 2PZGA 1AKEA 1G16A 4K46A 5FPTA 4QG7A 1ZYUA 3A4NA 4CEIB 2BWJA 5D3QA 5HCNA 3IIJA 3QXSA 2DFKB 3T1QA 4ZKDA 4YXWA 1E94E 1DELA 1JR3E 2X19A 1MR3F 2ZVQX 1G291 1D2NA 5DYGA 2HLDD 4CRWB 4PHHA 3W6NA 1U8YA 3W3AA 3LH5A 3F5FA 3RC3A 3MD0A 3SJZA 2MSDB 2J0VA 4QOSA 3TUIC 5FBVB 3VR2A 4PPQA 2JATA 2OZEA 1Q1EA 2CK3A 2D06A 1RPZA 3RRYA 2FG5A 5AJVB 3K70B 5GJBA 2XJ4A 4FIDA 2ASEA 3V4FA 1SXJD 2R6DA 3OEEA 4FD2A 3IBYA 4P33A 1XU4A 2O8EA 4CT4B 3TH5A 3MAAC 3HYTA 1IY2A 4LHXA 4B3XA 3ZVMA 3RC8A 3P20A 1Z0AA 2ZQ5A 1N5IA 2HDNB 1G3IA 2OILA 5CJ2A 1P72A 3BORA 1ZUIA 3ZVRA 1OXVA 3D6TB 1E2DA 1T4GA 1W5TA 1P62B 1G9XA 3HPRA 3CX7A 4Q5IA 1U90A 4TTPA 3HU2A 2ZI7A 2O8CB 3TAHA 4BFWA 1EWRA 1GKIA 1GG2A 4C2TA 3K0CA 4LPKA 4DBLC 3VR6A 5EZ6B 4KI0A 1QHYA 3EZ9A 4RFSA 4C2UA 3D3QA 3TJZA 1KK2A 4NYMQ 3B8HA 3X1XA 4LK2A 1ZM2A 1XBTA 1W0JD 1G41A 4WA7A 1T3HA 1W2GA 1SXJC 2P2LA 1MO3A 3AF0A 3NBXX 2Q3MA 3ZD7A 5JFGA 1XMJA 1OE0A 5DIFA 3KB2A 4TLAA 4MGKR 2F43A 3F3YA 2V6IA 4BEBA 4OQMA 3H86A 2J87A 1ZD8A 3RDPA 221PA 4LV6A 4MRPA 4NYMR 4C0BA 1CKEA 3C5HA 3THOA 1R0WA 2QY9A 4GOJA 3LQQA 3BE4A 5CB6A 1Z47A 4DIDA 2XJ9A 2Z6VA 1RZ3A 4UNPA 3H4MA 5AUPB 3L0OA 3M1IA 4ACAA 4B6FA 1R6BX 3NBFA 3PV0A 3PXGA 2BHRA 2PEYA 4HLUC 1U2RA 3MG9A 1T9HA 3WNBA 5AWFC 1E79A 3T06B 4G5GA 1Z22A 1OIWA 1YZTA 1AK2A 4ACBA 1WF3A 2GZAA 1UDWA 2V9PA 4D0LB 3THWA 2PLRA 4IKEA 3I4LA 3DPUA 2QP3A 3FHTA 1T8UA 1K6MA 4KU4A 1XXHB 3FTQA 4HB3A 2ONJA 3QE0A 5KU1A 1D2EA 5KOYA 2FU5C 4CZ2A 4GPTA 1H8ED 4JKIA 4WXRA 3CZPA 1W4BA 1NSFA 5DI3B 5DISB 2HXYA 4XJXA 1ZMXA 4I99A 4M1OA 2GJSA 4UXJA 2R44A 1T0HB 1QZXA 3EWSA 2D4HA 2F1IA 2ZPTX 4L8GA 4TQUS 1JAHA 4WAUA 4KHZA 5AJZA 2ZRJA 1KK0A 2BJVA 2HXSA 3BIFA 1TF2A 5DE3A 3W6OA 2C8VA 5CDFA 1OH8A 3IBGA 2IS1A 1NIPA 1GZSA 3OIWA 3U2QA 1S2MA 3W9YA 2ZR9A 2A2ZA 1JJ7A 1SVIA 5CITA 1Q44A 4MRNA 1W2HA 2GZHA 2O8EB 3KJEA 1HQCA 2R62A 1YRAA 1PUJA 2WBLC 5H70A 3WHKA 4C0SA 2QPTA 3LX5A 1QVRA 3B60A 4GI7A 2DFTA 4GSYA 1GM5A 5FI1B 4I81A 4TLDA 3Q7PA 4MGIR 4NPHA 3QPUA 2IC5A 4TL7A 1NLZA 3F0TA 1US8A 2QNRA 5F9HA 1XZPA 2ZRPA 1UM8A 2IL1A 3SJAA 2VSFA 3CPJB 4RFSB 4W5JA 4DDVA 4JVSB 4LV5B 4NP6A 2GCOA 4JYBA 4KO8A 4MRRA 4A15A 5SZKB 521PA 5JMTA 3HYRA 2ERXA 4TMXA 1A82A 2BMDA 1S9DA 1G3MA 4URXR 4OHVA 5JZVA 1VHTA 3SFVA 3U7HB 2F3TA 3FDIA 4B2PA 1WCV1 4UXIA 1YHNA 1ZU4A 2IYZA 2QGNA 3H84A 3U3MA 5JWHA 2XNDA 4UXHA 3CBQA 2LKDA 4DCTA 3CO5A 2EYUA 3KQHA 4GNKA 3GJ3A 4TLBA 4NCHA 1OJLA 1PVOA 2F43B 2ATXA 5JCZA 1SVKA 1COWA 1P6XA 2R8RA 1JXMA 2HJVA 4Q66C 3FMIA 1G4UR 3AB3A 1OPXA 3K0EA 1AZTA 3SE0A 5IK2A 2E9SA 4JBYA 1W1WA 2XNSA 2GKSA 4EKDA 4WZ6A 5TY0A 4BZXA 1LTQA 4PSAA 2RGCA 4MH0R 3PVSA 2FFAA 3TVTA 4BLRA 2QMEA 2BBOA 1DARA 1E0JA 2QMOA 2VP6A 2CE7A 3AQ4A 3MRSA 3UMFA 4AIIA 4B3BA 2WPDA 1P60A 1ZC4A 2FN4A 2LCFA 4RD6A 2ZU6A 1M2OB 4A2PA 5CM8B 4Q7JB 2P6RA 4RCYA 3VKGA 2EFEB 3AKDA 4IW3B 1GDDA 5JI3E 2CEAA 2XSZD 3ZIAD 1Z06A 3S1AA 1E9SA 4FINA 1A2KC 1ESMA 3W5JA 2ZE7A 2JDIA 1C9KA 2WV9A 2CHQA 1VCIA 2KSQA 5UKDA 1CU1A 2GBLC 3FKSD 1EFHA 1E1RA 1Z08A 2O0KA 3RS7A 2Z83A 3U6BA 4CEHB 1M34E 4IJMA 1Z6YA 2Q3FA 2R6CA 2IWHA 5IF9A 1G8HA 3BFKA 4WW0A 3LD9A 4DLSA 3T34A 4P32A 1IHUA 2H1LA 1NVVQ 1KI8A 4DDWA 4S2EA 3IIMA 2H5EA 4R9UC 2KBEA 2XOKA 4F92B 3PIRA 4MYCA 4Z8YA 3VX3A 2P6NA 2GK7A 2ZSDA 2D62A 3ICEA 2J45A 2W6ID 2YWEA 2JJ1D 2Q9AA 2GF0A 1NLFA 4Q03A 3AP2A 1IN8A 3MWJA 4P0TA 4B71A 5L3VA 4G0NA 2B21A 1LNZA 1OIXA 3QF4A 1E9EA 1ZVQA 2WWFA 3CH5A 1XEXB 1NVVR 1CXZA 3AVYA 2CBZA 2F1HA 1Z6AA 2JLQA 1KZ7B 1M6NA 5E4FA 4CF7A 3AUYA 3I1FA 1Z2CA 2YWFA 2DHRA 4IXMA 3ASZA 1TQ6A 1US8B 3QF7A 4IVPA 1TUIA 2JLSA 4UJ3A 1UEIA 4AKIA 2R2AA 4BFSA 1J2JA 2CXXA 4PPFA 3K0SA 1P75A 2WJJA 1KSGA 2UZ3A 3U3RA 1G6OA 2RGDA 1E6CA 4IVRA 2IA5A 4EPVA 3Q9LA 4LY6A 4QNMA 2GCOB 2V55B 2BOVA 3RYTC 3HP1A 3K9LA 5CYOA 1KMQA 4JLMA 1SVMA 2IXEA 2JIZA 1JPJA 2P5TB 3P1JA 4LHVA 4Q9KA 3SN6A 4TLEA 4BLTA 1FNNA 4EPWA 5L8VA 2P67A 1VTKA 4M21A 1ZJ6A 3PCRB 2WAXA 1XTKA 4R2HA 2BM0A 3EZFA 4HB2A 5FPSA 2OFWA 5DN6D 2GESA 2WWIA 1WDTA 4URYR 1ZUNB 4DRZA 5IHPA 1E2GA 3Q5DA 5JWRA 1T3LA 1P2TA 2QE7D 1N6PA 1RRGA 2AWOA 2PX3A 2H57A 3GEIA 2ZJ5A 4PANA 3TE6A 5E95A 3VKWA 4JLKA 1E2MA 2ZRNA 3LV8A 2XEXA 1E9RA 2BKEA 4HB4A 1MKYA 1W4RA 4MYTA 3WMGA 4Q21A 1Q0UA 2L0XA 4EJSA 1W7AA 5AUQA 3I61A 1NNEA 3GEHA 4MDEA 2KBFA 4ZCMA 1CIPA 1G7RA 3UG7A 2QAGA 5CK4A 2W2XA 1ZNYA 3TSWA 1N6LA 4JJKA 1AS2A 1R7RA 3NH9A 3UMRA 1ZIOA 1G3RA 3BERA 4WZBE 4N0EA 2DR3A 4MYHA 4Q4JA 2O8BA 3S1AB 2J7PD 3OESA 2IEYA 2PX0A 3RRNA 3VHXA 3VTKA 2OG2A 3LO5A 4M1KA 4Z8XA 3ZVLA 1ETUA 5KPDA 4KLZA 4RZXA 1W0KA 5EXPA 3ADBA 3AUXA 1T5LA 2C9CA 2ODWA 3PFIA 1Z6XA 1KHTA 1SZPA 3D31A 3PENA 2VHUA 2NO1A 3CB4A 3CF6R 3EASA 3CH4B 4LC0A 2K5UA 1MABB 5HE8A 2B8TA 3ADKA 1PLJA 3GLIB 2AK2A 2VSOA 1DADA 1EFCA 2KE5A 4A2WA 4OI0A 4KVGA 3LFUA 3I8SA 2RMKA 2YJTD 3Q72A 1KAGA 2F55A 2A3RA 3KZ1E 1IONA 4M1TA 3A8TA 2V7QD 2WJGA 4AY2A 2VHCA 2FNAA 2RGNC 2VP2A 1TTTA 3QG5A 1YQTA 5F2EA 2EFCB 5GJCA 4D81A 2A5JA 3PUWA 5C4GB 3PR1A 1VG1A 3QF4B 2YYZA 3B1ZA 1NBMD 1FTNA 1Z83A 2JEOA 2FSIA 4HATA 1UAAA 1ZM7A 3N70A 2O52A 4PHGA 3SU8A 4EPRA 1EFRD 2WKQA 3VR5A 1A4RA 5C4MA 2JLXA 4FCVA 4LYAA 5EE0A 3C16C 3C4JA 4FMDB 5AJXA 1B23P 4EDHA 2JGNA 4OI4A 3TGPA 3V4RA 4IRUB 3BFXA 1F6BA 2PEZA 1G8PA 4Y0VA 4ZI2A 5JSZA 5CYPA 4DT1A 1GNRA 1X86B 2GVZC 5BN3A 1UF9A 1JR3A 2ZRLA 2NPFA 4UKDA 1KSFX 4GOXA 1RW4A 4DWJA 2ZJBA 5CLQA 4IDOA 1VG8A 2P5SA 4P4TA 2QSZA 1QDEA 2IS4A 1E2EA 2R9VA 2ORIA 3L8ZA 2HYIC 2IBMA 4Q7LA 3TVDA 1KI6A 1BMFD 2AWNA 4IOLA 4KFTA 2BCJQ 5KSPA 4PQFA 1FTSA 1GOTA 3AKCA 3VKHA 1T6NA 3ZDQA 2H16A 1Q1BA 1NN3A 1PLKA 2CNWD 2Z4RA 3EC2A 1KO7A 3ZZUA 1PV4A 2AKYA 2ZEJA 3KUCA 1NY6A 2A30A 2OLJA 4JLAA 4OQLA 2JJ2D 2OO7A 3RSLA 3PEUA 3F8TA 1BO6A 1M8PA 2IK8A 4OL0A 2IYWA 4DLYA 4NZYA 5J4HA 2NZ8A 2CJWA 2HV8A 2FSHA 1K8RA 1Z8FA 4JBWA 4DXAA 1E9DA 1FP7A 2GRJA 2C9OA 1G20E 2QAGB 4PC6A 4C9BA 3WYGA 3Q5EA 1KDRA 4LBZA 3CWZA 3WRXC 4A1FA 8OHMA 4KAXA 1JALA 3BB3A 4PHTA 4OK5A 3RS3A 5FPHA 4M4SA 4Q4JB 2JLYA 4OHXA 4YDHB 3FOZA 2NIPA 3FB4A 4BZPA 4U00A 1VYVA 3QKRA 3GLHB 3KJIA 4XVUA 3W90A 2WIBA 4URWR 4LBWA 1TAGA 2VTKA 4ZPXA 3VR3A 3K70D 3QKUA 1OFTA 4RSGA 4KXFB 3X1WA 4G3XA 5A0FA 1IJFA 1KDTA 1Q1ZA 4JKYA 1AS3A 4Q4AA 3DMNA 4PAMA 5FBRB 3TMKA 1R4AA 2CLDX 2W2TA 5EQTA 1NG9A 1H65A 3HR8A 3VX4A 1SKYE 4DUGA 2OM2A 4OI2A 5KUTA 3OIYA 5BN5A 3QIAA 4GMXA 1VCMA 4ESVA 3IPXA 4PQRA 3CONA 4JS0A 3MWKA 4TMZA 2QORA 4RY2A 4B3FX 3PJRA 2WKPA 2MMGA 3T5GA 6Q21A 1Z0FA 4M9SA 4DLZA 1UEJA 3OAAA 3EZ7A 2EFGA 3A4LA 3ETLA 2GJ9A 5B64A 4POAA 2CHGA 4C0QC 2OBLA 4FWIB 4WXPA 1Q21A 4G01B 3GQBA 3K70C 1P9WA 1MRSA 5LB4A 3CLVA 1GRQA 3SFZA 1L4YA 1T91A 3AF3A 2QSYA 4JL8A 4M1SA 5DH9A 2IYQA 1XFAA 2ZRHA 1UKEA 4EAQA 5DI9A 3A1UA 3ZH9B 1ESNA 621PA 3AVTA 2IYRA 2NGRA 4MKGA 2NPIA 3R7WA 3KQNA 5JLJA 4IHQA 3KXIA 3KX2A 1S4QA 4NCJA 3GLFB 3B78A 1Z0KA 4JLBA 2O8FA 3QBTA 2R6AA 2V8OA 2C95A 3I72A 3K9HA 4TT3A 2AK3A 5JJIA 3R9XA 5BYKA 3MUFA 1GNQA 5JSZB 1V5WA 2CE2X 3R9IA 3UANA 3OHMA 3FMOB 1UFQA 3RANA 2ZRGA 3B5JA 4RD0A 2H8KA 1E2PA 4OK3A 121PA 2UKDA 2FH5B 3P4XA 3NBYC 3CRMA 5K8TA 3QUSA 4KJZA 4X8LA 4ZI3A 1YZGA 1YR9A 4BLQA 5LPNA 4XVRA 1KI6B 3CR8A 3VR4A 1KY3A 2IEZA 4O2RA 1CBUA 2G77B 1VYUA 5TDHA 2DBYA 2VEDA 1AM4D 4GZLA 2HEIA 1OB5A 1XEWX 1VIYA 1WE2A 4URVR 1RVDA 4PPGA 3EIQA 2EW1A 1F48A 4OQNA 4URZR 1GL7A 3AVVA 5KNCA 3MSXA 4QGGA 2BEJA 3SR0A 2AX4A 4A92A 1EK0A 1YZLA 1OH5A 2ZJ8A 2CJWB 2XB4A 4WOPA 5E7JA 1E9CA 5K8IA 2OUKA 3N5CA 4QL3A 2G9NA 1JBKA 1KKMA 2CL6X 2YC2C 2ZS8A 3T1OA 3MMPA 4Q19A 3U6KA 2IS6A 1U9IC 1VHLA 2ZS7A 1N3BA 1QHSA 1Z28A 1IY0A 4E5UA 3WRYC 1DBSA 3O8RA 4M0LA 3WBKA 2GJAA 2PZEA 3QKRB 2F1JA 2X77A 1OHHA 1U8AA 4M1WA 2CK3D 4LYHA 1YZNA 1O87A 5A4JA 2KB0A 1XTQA 3SHWA 3B6EA 2WJHA 4IEEA 2BBSA 2GETA 3WNDA 2DFLA 3HU3A 5DHFA 4AYTA 1F2UA 2GJ8A 1UADA 4Q1AA 1QG4A 1KZGB 2ZSEA 4Q4AB 4H1VA 5GVRA 1XF9A 5B58C 3LA6A 1JECA 2Z4SA 2GEUA 3SYKA 3ZLJA 4QJ4A 1JAIA 2QRZA 4Q48A 4IXNA 3U7FB 2F6RA 1Q57A 4IFEA 4JL5A 3SBEA 3TQCA 4O2LA 3KFVA 3GP8A 5E7IA 1RKBA 4Q02A 4DVGA 2RHDA 3LXXA 2PJRA 4MITA 4BZQA 5GADl 5FPKA 1WXQA 2ZETA 3A36A 4JLNA 4DCUA 1VECA 2Q9CA 1SULA 4D4JA 5BW8A 3DMDA 3GD7A 4GBMA 2RGEA 4HAUA 3SDZA 1XPUA 1LW7A 1E3MA 3EIEA 4CYMA 3SC3A 1TUEA 2CL7X 2OLKA 3AVPA 3OIVA 1IN6A 1UDXA 3QPWA 3BB1A 2FX3A 3CF2A 4I1UA 3BOSA 4MKFA 3ZZ0A 2ZTSA 3VQTA 2G1KA 4FWTA 5CIQA 1ODFA 4TQ9A 4CT5A 3QNUA 2O0HA 1FZQA 4Q9IA 1XD8A 4TSFA 2HT1A 3AM1A 1E2FA 3R7WB 1MO6A 3UATA 2I1VB 3EXAA 3WHLA 4K8OA 2JASA 2WMOB 1NKTA 1IN4A 1YR7A 1ZP6A 4JLDA 4HB0A 3VU9A 3G5UA 5KNDA 1NN1A 4HAVA 4Q1DA 4ZKEA 3IO3A 4PAOA 3TNFA 1U99A 2Q6TA 2QRNA 3JZMA 3K0CC 2WHXA 1P2UA 4AG6A 4NONA 4GOKA 1J70A 2ZI9A 3MFYA 5G40A 4QGFA 1L7VC 1OV4A 3T61A 421PA 4E09A 2ZANA 4W7SA 5JRZA 2SHKA 3DEFA 1OXTA 1TU3A 1G8FA 3CNNA 4C4PA 2IHYA 1E79D 1NN0A 4F91B 1E0SA 3J81k 4HDOB 2AXPA 3MJHA 1FNMA 5HR5A 3FFAA 1QBKC 3RRMA 1KJZA 3EAQA 1NMZA 4IOKA 4AURA 2ZUCA 1T8TA 1NN5A 1G5PA 4A8JA 5C46F 3IEUA 3K0AA 1YZUA 3L0IB 4P31A 2V1XA 2AFHE 1XD2A 2ZM5A 1RYHA 3E70C 3VFDA 1W46A 1EX7A 4R2IA 2P3SA 3BGWA 4LCBA 1ZBDA 3E5HA 2BIFA 4LZZA 3QXCA 2ZE6A 2GZDA 3DOFA 4FXPA 5DNYB 3EX7C 2KI5A 4N1AA 2YOGA 1IN7A 3BBPA 4C0LA 2ZITA 2V1UA 1VKJA 1P3JA 1GFIA 2C04A 3CKLA 1A1VA 1KDOA 4PSKA 3MLEA 4FMDF 3X1DA 1Q12A 3KDSE 4PC1A 4MA4A 3W5IA 1U8ZA 3C15C 4PPNA 4M9QA 2J9RA 2ZRAA 1G18A 2C96A 5FOSA 3QEOA 5BYJA 3L8YA 1Z63A 4BLSA 3LVQE 4LPSA 1F2UB 4ILEA 3BS4A 4US0R 2Y8EA 4HUQA 4QBFA 4LJAA 1E9FA 4Q1FA 1GKUB 3A1WA 1R0XA 2ZI6A 3DOEA 4DZZA 4NKRA 3QOFA 3NWJA 2PMKA 3EA5A 2QAJA 1E96A 5AJWA 4F38A 1IQPA 3KKNA 3FMFA 3DDCA 3ZQ6A 4IDHA 1XTIA 3TR5A 3RS2A 1G1MA 2BBTA 2QA5A 1VIAA 3C5CA 4E03A 3RHFA 1TQDA 3DM9B 4PHFA 1VG9B 1QG2A 2BVNA 4JJZA 2A5FA 4WBSA 5H1YA 3UKDA 4ARZA 1CF4A 4I1SA 4TYPA 3A58B 4QRHA 1XXHE 2XGJA 1PJRA 1IAQA 1HYQA 3B1VA 4P4SA 4ZIRA 2IYTA 4QHYA 1S3GA 3DVLA 1TF7A 4A4DA 3ADDA 5EE1A 4DLVA 1MV5A 1UPTA 2X2EA 5BQ5A 5TVKA 3HR7A 1JJVA 2XNDD 4ASUA 4H1UA 3B1YA 3HPQA 4L5BA 1ZM4A 4Q47A 3SZRA 1PUIA 1BYUA 2Q21A 4MYUA 2QPAA 5FTMA 2CLSA 1DAIA 2ZVPX 3EA0A 1COWD 3SJCA 2W58A 1CR2A 2BBWA 1KY2A 5FBQB 4TTRA 3VU9B 4JSYA 1DVRA 1SVSA 3K53A 5IK2D 1W36D 4HYYA 1DAHA 1GNPA 1R5BA 3CR7A 5HZKA 1LY1A 1LVGA 1RYFA 1MO4A 2E1RA 2BCGY 4XOIA 2R6GA 4D0NA 2PLFA 4QM6A 1M7BA 1G7SA 4AKHA 4M2LA 2OXCA 4TYNA 2DWOA 1SVLA 1VPLA 3V9PA 3G0HA 2QENA 5KDDA 1SXJE 1Z2AA 2WPDD 2ZUDA 3HU1A 2QQ0A 3IEVA 1XTSA 1XCGB 3IILA 1VCOA 1FW6A 3L82B 2G88A 3TW4A 3U3JA 1GSIA 3UIEA 5TB5A 1UKZA 1G5TA 4NYJQ 4QJ3A 3THWB 1FOEB 2GBLA 1GRNA 2JDID 1YE8A 3EARA 4A8JB 2IF0A 3GCGA 1SHKA 2WICA 3GJ4A 4PSVA 1G8YA 5HZHA 1IXRC 1E0KA 2ZRIA 3A4MA 2WOJA 1XD2B 5JHHB 2C77A 1E1RD 1CS4C 1WQ1R 2C78A 3K09A 5JWOA 2PCJA 5GJVC 3T15A 2WWHA 4NYIQ 2TMKA 4RD2A 2ZI5A 1KDPA 1YJ5A 4UJ5A 1JR6A 1RJ9A 2ZJOA 1NI3A 3AKEA 2WWGA 5EP1A 1AJEA 3NHBA 2AR7A 3GJ8A 3VNVA 2VYFA 1JPNA 2OESA 4NYJR 3ZJYA 4BASA 1ZRHA 2WIAA 1NVXQ 1OYYA 4IEIA 2FZ4A 2VHQA 2IXGA 2XOKD 5FOWA 3KB1A 4LJ9A 2A5DA 2QMUA 1KI9A 2YHSA 3NTUA 2ORWA 4X8OA 1E98A 1R2QA 2IUSA 3EWAA 3LQRA 2NO9A 3PUVA 5KSOA 4A36A 4TZ0A 1QHIA 3IQXA 1XWIA 4NYIR 1CR0A 2MSCB 2J7KA 2VP0A 4B32A 4MGYR 4A9AA 1EGAA 1S9HA 2C03A 4OHYA 3AVWA 4F4IA 1R10A 4JZKA 1Q20A 2IT1A 2NZJA 2QZ4A 3UXMA 4D4MA 2ZSFA 3AF2A 1H8HA 1CRPA 2CLCX 1W4AA 3BH7A 4LOAA 2AN9A 2C99A 2X1VA 4PO8A 1W5SA 1J8YF 3EPJA 2GA8A 2IYVA 3NDPA 4LSGA 4US2R 1X6VA 3FHCB 3M4YA 3QXJA 4IOJA 4M8NE 4OBEA 1I4LD 3DZDA 3CIOA 1D9ZA 1KO4A 1N6RA 2RGGA 3T12A 4M9ZA 5LB2A 4WVFA 1CRQA 2W6IA 4OQXA 1MOZA 4ON9A 1XDBA 4Q4HA 4KBGA 2ZRKA 4NDZA 4P4SB 1N2CE 3VHLB 4I1VA 4B76A 4ZIRB 3THYA 2JIZD 4D6PA 1UBGA 2ERYA 4H9GA 1XJ0A 3NKVA 4JT2A 3KKPA 2F9MA 1BS1A 2YZ2A 4TMVA 3NHAA 3KXKA 5A5GA 2IW3A 1RRFA 3WMEA 3PUYA 1KK1A 3ZD6A 1ZW6A 3P4YA 5E7MA 1RIFA 4PFSA 3O8DA 3P27A 1EFTA 4TTQA 4LI0A 3DZ8A 4DSNA 1NRJB 2J5XA 1KGDA 1ZAKA 3U60B 4UNSA 1GP2A 4UNQA 2CVFA 5KSZA 1CJVC 5LBIA 5EE9A 1G21E 4BFUA 1LF5A 1W36B 3LWNA 1ZC3A 3FHOA 3U3KA 1HURA 4TWZA 1J8MF 4MDFA 2ZR0A 3EG5A 2VP9A 4V0NA 5JHGB 2RGBA 2WAYA 4U02A 3OE7D 3NBZC 4TQAA 2JLVA 2OFXA 4LDJA 2CHVA 4PO9A 5AK0A 2QM7A 2VL7A 5FL3A 3ND9A 4JVMA 3H1TA 2PJZA 1GVNB 3N2IA 3T1VA 1NF3A 3CF0A 4YONB 4Q9JA 3LBIA 4L4UA 4JLJA 3B7GA 3O8CA 5BN4A 2G0NA 4Q1CA 4MUAA 1KNXA 1W0KD 3LRPA 1EWQA 4ZCLA 2JAQA 4DLUA 1KI4A 1X8JA 3CRRA 5FTNA 4PO1A 2BC9A 4B75A 4PZLA 4FMCB 4LHWA 2VHJA 1KO5A 5JRJA 1XPOA 2D7DA 2QT1A 2XAUA 2CCJA 3T1TA 4K81B 2YINC 1P9RA 1RJ9B 3TKLA 2EFDB 2VF8A 1R5NA 4M9XA 2NTYC 4YMUA 4DB2A 2GF9A 1X1RA 3GLGE 1NY5A 1OXUA 5G41A 2QAGC 1ZUHA 5FUWA 4TL8A 5DGXA 5SZJA 1CJTC 1KI2A 1OT3A 1E1QA 4UNNA 4BEJA 4C7OA 5G3ZA 2FSFA 1OSNA 3AF1A 2ZAMA 3TIFA 3TR0A 2EVWX 1G64A 4I1OA 4DSTA 2B8WA 4S35A 5J47A 1FUKA 1YR6A 3OEHA 3BH6A 1E9BA 2HF8A 4Q7MB 4DEYA 1XTJA 1HE1C 2OXRA 1RRCA 1A2BA 3TK1A 1NG1A 1I4DD 2ECKA 1M1YE 1P9NA 2PL3A 2WSSD 4V0KA 2W6JA 3C8UA 4MKIA 4A0HA 3W3ZB 4HLDA 4KSCA 5D3MA 4Z1MA 3RS4A 4DCNA 4ZDKA 4U7DA 2R6FA 4CW7A 1FFHA 1SVWA 2D3WA 4UNRA 3QJYA 5AUOB 4OK6A 1GWNA 1OB2A 2DPXA 4ZV4A 1YZKA 3B1XA 4RVCA 1XMVA 1KI3A 4O0MA 3RRZA 4DJTA 3O8BA 1FMLA 1ONBA 3H2YA 4Q4HB 1CR4A 3KQUA 3U44A 3RVBA 1WMSA 2J41A 1F60A 1KNQA 1P7CA 4NL4H 4R98A 4FW9A 1UJ2A 1FX0A 3W8RA 4B3GA 4AI6A 3LW8A 1DAEA 1JR3D 4GFDA 4V0ME 2EFHB 5CJPA 4BRWA 4A2QA 1QF9A 1NJFA 3AF4A 2QEQA 4LYFA 1ZM9A 2FF7A 1U94A 4HLQB 3AV0B 2KWIA 4AD8A 3TQFA 2MMCA 4DCVA 5J4YA 3GLIE 2RKOA 5JS8A 3QKSA 5TMPA 2QMHA 3M6AA 1F3OA 4Q1EA 1GL9B 1BH2A 5LDDC 2Q0HA 1O3YA 1L2TA 3CRVA 2B7CA 2UZIR 4ABYA 2ZS9A 1CEEA 1Z6GA 2GXQA 3CWQA 5EP4A 3QBVA 3RLFA 5KO2A 1XZQA 3UK6A 5KDOA 4KV9A 2V3CC 3I32A 2BMJA 5B30A 1G7TA 1VCNA 3TRFA 4EJSB 5JI2E 5CM9C 1XCPA 3GPLA 4JMPA 3FVQA 4W9MC 5F98A 1PZNA 5HPYB 3BFVA 2IF2A 2IYUA 4HSEA 4NMMA 2VH5R 3TAUA 3CRQA 2WJVA 3OF5A 3ZQJA 3QI2A 3AH8A 4HUTA 4JBXA 5FH9A 2WWYA 2BMEA 2ZJZA 3QPVA 3SEAA 1N5JA 1BMFA 2ANCA 2YOHA 4D25A 4RZ2A 2O8BB 4KLNA 3GJ0A 4RCZA 3EC1A 2ZRMA 1Z0IA 2NG1A 4LJ8A 2W00A 2REOA 3RAPR 3W6PA 1M7GA 1ZINA 1XPRA 3GJ6A 1E2KA 1EESA 1QHNA 2NO6A 4W5WA 3FKQA 3O47A 2F1RA 4HAWA 1U98A 1W49A 2W2VA 3TBKA 1IBRA 4AC9A 4B3DA 2V4ZA 3BXZA 2ZYUX 4DUGD 2IHBA 4LBYA 3QG1A 4RKEA 4KFSA 2DWPA 2OAQ1 4AKEA 1VDZA 1XB2A 3TLXA 4B3CA 1S1MA 1TL7C 3TW8B 4IDNA 3M0EA 4XD7A 3AVOA 2IUUA 4C7OB 4HAZA 4XH9B 5CB8A 3OAAD 4PZZA 1LV7A 4GMDA 1KK3A 3AKYA 4MGZR 4TZ6A 2VSXA 1QVAA 4B47A 1G6HA 5FFMA 3KTAA 1MT0A 5KPJA 4URUR 3H0KA 4AKGA 1A5TA 2WWWA 2FPMA 4BUJA 4DEXA 2GNOA 2ZSBA 2MSEB 1FQJA 2OCBA 5EZ5A 4KYIB 5JBQA 1YKSA 5CIWA 5HKKA 2IX3A 1LB1B 1S96A 4LRWA 1LS1A 5DSZA 2DFNA 2OFOA 4LV8B 4NCNA 1P61B 3KFXA 4EUNA 5D3MB 1N0VC 3NH6A 2IWRA 3ZZTA 3IHLA 4EFNA 4YMTA 3CPHA 1CULC 2CMKA 1HQYE 3GJXC 3GMTA 4EQ6A 1N6KA 1Z0JA 3AGPA 1G19A 2XITA 1TU4A 2FGKA 4TT3D 3GLHE 2ZAOA 4FI3C 4BFZA 1OXXK 1XEWY 2GDJA 3U44B 3GJ5A 5EJEA 5FL7A 2ZRBA 3PG5A 3OFND 1FX0B 2E87A 4PC2A 4DT1B 3AP1A 4NE2A 2GEVA 1E0AA 2QG6A 2QM8A 3QENA 1NVUQ 3NG1A 5JEDA 4LWZA 3SOPA 1R0YA 2GK6A 2OBMA 2D2FA 2HJGA 4TL6A 5FBWB 1G17A 3I5XA 4PQYA 1JQLB 2VF7A 1WBDA 1GL6A 1OKKA 4IVQA 4LBVA 3WP0A 4M1YA 5CLLA 2VRWA 4B43A 2F7SA 4Z51A 2G6BA 3NIBA 3PITA 4TMKA 1R8QA 2ATVA 2KJQA 1RC8A 4Q7KA 4IFBA 1DG1G 2R65A 4JSTA 4YMSA 1W4CA 5IRCD 2GVDC 2QBYA 4FCTA 4MRVA 5K8LA 1OYWA 4CGZA 1G7CA 2GXUA 5HE9A 4B74A 3R8FA 3TSZA 5H8WA 4CEJA 2OHFA 2RAPA 4Q1BA 1ZNZA 1XCMA 4KCGA 1Z3IX 2J46A 4WZAE 4OHZA 4YXWD 2ZR7A 2O0JA 4QBHA 5P21A 2ONKA 3QY0A 1II8A 1NBME 2ZRDA 2OCYC 3GFPA 1TX4B 2QPOA 3LBHA 5FUXA 2I1QA 2VP4A 3U7GA 1OHHD 2YWHA 1Q22A 1E32A 4JYCA 4DDUA 2GJKA 3GLFE 2VLIA 2ZYWX 1G8GA 1S0UA 3B1WA 1XMIA 1XXHA 1JXOA 3VMFA 1DPFA 4Q01A 1I2DA 1OH6A 5DLQC 3ND8A 3DO6A 2FEMA 4BFVA 4DIEA 3X1YA 4HLCA 1E2LA 2NOAA 3OEED 2DYKA 4QBGB 4HAXA 2ZJYA 4TMWA 5DI3A 2ZROA 2QTVB 4BFTA 4JVNA 1R0ZA 3QKTA 4QC2A 4EPYA 1E99A 1LFDB 3NEJA 3QXHA 2H7VA 2HLDA 1C1YA 1HT2E 2GTPA 3CPEA 4C30A 4EPXA 1N5LA 4MQBA 3WY9A 1IJEA 5FOXA 5EE5B 1PLLA 4PC7A 4D4LA 1I4TD 2RGXA 2X8AA 3EPKA 3THXA 2G0TA 2QI9C 1Y63A 5FOVA 1KJWA 3KTAB 4ITRC 1QHHA 2WOOA 4O3MA 3LLUA 3LXRA 3E2IA 4JLPA 3BD9A 2IYSA 1GILA 2OEPA 5EP3A 2WSMA 1SXJA 3AEZA 1DAFA 1T3SA 2J0UA 2HT6A 2N46A 3VR1A 1DAKA 2FZLA 1E2NA 2ZI4A 1NKSA 2IS2A 3BB4A 4KVAA 4ERNA 1GKYA 3KKOA 4TSFD 5KTYA 2A7QA 3NC1C 2YNMA 2ZIAA 4EQ6B 3Q8XB 3P26A 2EWWA 5CK5A 1P73A 1IXZA 4CIDA 2PT7A 4NBSA 2VQSA 3W8NA 4FMCF 5E3HA 2O8FB 2ZJ2A 3PUXA 3AVUA 1KIMA 1WRBA 3BH0A 5B57C 4GRAA 2PT5A 3IKJA 5LD2B 3FPAA 2YWGA 2ZRFA 5TXGA 2J59A 1DS6A 4RD3A 2WM9B 3RWOA 1P2SA 4HLUA 1HTWA 1N5KA 3REFA 3SS8A 1X1SA 4MRSA 1W0JA 2QU8A 4IDPA 3MJRA 2V6JA 1HY3A 1AGRA 1VMAA 3VNUA 1N25A 2XTNA 2Z5FA 3W34A 1XP8A 3MWYW 2FFQA 1D9XA 4QXAA 2P65A 1YVDA 4GT1A 4PX9A 3SQWA 1E2IA 1Q3HA 3WNCA 1Z6TA 1AKYA 3WP1B 5J4KA 5J40A 1DTSA 1ELOA 3NEYA 4BRUA 5K8UA 1SKQA 3LAWA 4YLGA 3I5YA 2QBYB 4Q9HA 3DHWC 2OBNA 2YC4C 3ZS8A 4Z54A 721PA 2J0QA 4PTLA 3JVVA 2OT3B 2LKCA 2FMXA 4CEJB 1G3QA 1HA3A 3ZGXA 3ADCA 3LVRE 3PEVA 4YMWA 1TQ4A 4ZDIA 1AQYA 4A6XA 4TMTA 4B44A 5L3SA 1TMKA 2RH5A 5BXQC 1JEEA 1II8B 1ZIPA 4JL6A 2G3YA 5C2JB 2NQ2C 4GL2A 3E1SA 2WMNB 5JJLA 4LHZA 1E2JA 4LJ7A 2H18A 1P5ZB 3A1SA 1D5CA 4BWYA 5L3QA 4E22A 2AD1A 3U7EB 3IHWA 2ODBA 1MO5A 2YVUA 4UQOA 1HT1E 821PA 4QHSA 2PH1A 2G83A 4L15A 1ZCBA 2ZSAA 2DB3A 1H8EA 4A8JC 5G3YA 5EE3A 3NXSA 5FPYA 4CEHA 2VA8A 1MH1A 1IY1A 3T35A 1P2VA 2D74A 3BAFA 3ZYCA 4QGHA 2FSGA 4CVNA 3AVXA 1KKLA 4QBIA 2WKRA 3KXLA 4G5OA 4KSBA 5FTKA 3ZVNA 4OKSA 3K0FA 3THXB 3WXMA 1FMJA 2A5YB 3FGNA 3HDTA 1Q1QA 1E2QA 4BQSA 1F5NA 1QHHB 3L0SA 3Q85A 5DO9A 1QRAA 2REBA 4LHYA 2FPLA 5DHAA 5ELXA 2BMFA 3QEJA 1W47A 3OIUA 3B2EA 4LYJA 1SXJB 2J0UB 3SQXA 4OJQA 1U0HC 4KITB 1DG3A 2JJ8A 2ZREA 4JLOA 2GCPA 1XEXA 4DDTA 1WP9A 4ASUD 1OFHA 4P3YA 1YR8A 1OFUX 1CJMA 2GWHA 3HJNA 3P32A 4XVQA 1K5GA 4J0QA 5FTLA 2QT0A 2OE2A 3EZ6A 1BKDR 4TLCA 4EPTA 2XZPA 4FMBB 1BIFA 4X8MA 1NP6A 3TUJC 4A0RA 1KOFA 4D80A 2ZXUA 3SYLA 3IDQA 2FEOA 2P6UA 2XTZA 4L9SA 4Q00A 3FYHA 5C1BA 4PC3A 3KQLA 5FI0B 1JI0A 2QTHA 1GUAA 2ZRCA 2B7BA 4HI0E 4C0AC 2ODEA 4B6EA 1TEVA 5EP2A 4D2IA 3LX8A 4KYUA 3WYFA 3CM0A 3GLGA 2ZI3A 2JCSA 2ZE8A 1NSTA 2ZU0C 2DWQA 3SBDA 1E4VA 4F7WA 1U0JA 3MCAA 2EWVA 4D82A 3EPLA 4DLXA 2EU8A 2GHIA 4A0FA 1E4YA 3KKMA 2RGAA 3UWOA 2AD5A 3KKQA 4A6PA 2FWRA 4YQFA 2JLZA 3R9WA 2VO1A 4LJYA 2ZJAA 4G5SA 3K0AB 4F4JA 1LF0A 4ZO4A 4KBFA 3PQCA 1J99A 2C2HA 3N2EA 1UKYA 1W36C 2VBCA 1GAJA 4KFUA 5FUYA 1TPZA 1DAGA 4JVLA 3LDAA 2OSBA 5L3SB 1L4UA 4XWAA 1KJYA 2I4IA 2H92A 4TYQA 4QJ5A 4C3ZA 2FDCA 4RZ3A 1KAOA 5AJYA 4B2IA 2XSZA 3I8XA 2QP9X 3ZIAA 3IPYA 4D4KA 1S1CA 4BE7B 5J4VA 5L3QB 1CTQA 4JIMA 5J5CA 3CZQA 1V43A 4V0LA 4DHEA 4W5HA 2JLUA 3A6PC 4II7A 3IQWA 3KJGA 1KI1A 1DEKA 2GAAA 4V0MA 4D0GA 3FKSA 4HUQB 2JLWA 3A1VA 5FOUA 3I62A 1MABA 3K09C 5KYKA 1H8HD 3IUYA 3GLIA 5J4LA 1XMSA 3U4QA 1EFUA 3QXXA 1U81A 4AYWA 4GP7A 2PBRA 3CW2A 1FQKA 3D7MA 1S3SA 3K0FB 4DC9A 1R5OA 4V02A 3EZ2A 2WWXA 1UKVY 1GITA 1KSHA 2IYLD 2ZE5A 3RS0A 3VAAA 4ARZB 3EPHA 4X8HA 3L43A 3FE2A 3R8CA 1P4SA 1FPMA 1IXSB 3OZXA 1D8TA 4TYYA 1Z5ZA 2JJ1A 1GTVA 5FOTA 2DCUA 2GXSA 1N6IA 3Q7QA 2A9KA 2CCGA 3QSYA 5TV2A 2WJIA 4B34A 4KFRA 4PXAA 2YKGA 4D26A 2BJWA 3NDBB 4HEJA 4RD4A 1JB1A 3MWLA 3WMFA 2V54A 2WZQA 3QVVA 5FTJA 3K8YA 3FMPB 1UBFA 3R20A 2GXAA 4AWXA 1Y3AA 4RFVA 1IN5A 4NTZA 4JT4A 3CX6A 1T5IA 5BWMA 1N0WA 1TADA 1EX6A 3MGCA 5FBLB 2OCPA 3ECCA 5JCPA 4A0GA 4EFMA 5CDFE 2B92A 4QHTA 4RD1A 2HCBA 4QM7A 1DOAA
chains in the Genus database with same CATH superfamily
3DLIA 4EJMA 1ZUWA 2HYDA 2RCNA 3QU2A 1YQXA 2C20A 1JHDA 3U37A 5ABPA 3OZVA 1WUTA 3NP7A 1VYHA 3C41J 3DOCA 4YRZA 4HGOA 2TMDA 2WYVA 1JN0A 2E4AA 2Y0DA 4PR3A 3KKLA 5AI0A 1XZHA 4NK4A 4DCSA 1QHXA 1NULA 1SNYA 4O08A 2B8NA 1FSPA 1U11A 2F9LA 4NZNA 2A9QA 3DYIA 3ZS9A 1WA5A 4PF1A 1SUSA 5DN6A 2IKQA 2IYXA 1KVSA 4MV3A 4E31A 1X8LA 4I50B 2WTUA 3IOEA 1ESDA 3T0GA 3CF4G 3I0NA 1Y3HA 2PGNA 1I3MA 3MGBA 1T43A 1WP4A 2D1RA 5BO5A 2Y1EA 4XYBA 4HQRA 2CXRA 4NH0A 5DN9A 2OCGA 4NSNA 4AZWA 4H59A 4J43A 1AGPA 4IMPA 4WCFB 1BCRA 2RBEA 3AP3A 2WSIA 1RPJA 4AYXA 1M1YB 3IUSA 4YAWA 4DBZA 4AL4A 5CVUA 4HWPA 2YFQA 3ZGVA 5FWXA 2VJMB 1KO1A 1OZFA 1PK9A 2WYHA 3INRA 4MW1A 4DPKA 5ER6A 1B6RA 2PQ6A 1WMFA 2VQFB 1KE2A 4UMFA 2FK7A 3HL0A 4J1NA 4X1KB 5HBRA 2XB2A 4EO4A 4QFDA 2GILA 5F9FA 4MQ5A 3UWDA 3GLHA 1Y6RA 1G5FA 2QD3A 1D2MA 4WFKA 1E1KA 1LNSA 1SC6A 2XUOA 3ILVA 2ACVA 2WKSA 4H7EA 1GRRA 1BMTA 1L5OA 2EWMA 3CT4A 4UD2A 4YLYA 1JHYA 4XSVA 3V7YA 4DJDC 2ZSUA 3V6MA 4KKXB 3OEHD 2ID8A 3OCXA 4Y2XA 2QLFA 1SK8A 2WJYA 4GYWA 1SQ5A 3K9CA 3C7KA 1CEXA 2WAAA 3GFOA 2CT8A 3OT4A 1PVVA 1DLJA 1LTHR 1PGPA 1YONA 2C2OA 1TQ2A 4F04A 1XMQB 5KNBA 3F49S 1Z0DA 4NU0A 1ECLA 4DV7B 2FV8A 1DT3A 1A96A 1EM8A 2JLRA 3A6KA 1MHPA 1SQ6A 1XRMA 2CL0X 3BGOS 3BWVA 5E6SA 3VRHA 1ZD4A 4E1AA 2QROA 3FYUA 5I45A 5EPOA 3WAGA 4XGNA 3KCNA 4ZT5A 2BTOA 3E61A 3RKUA 3UG6A 5JJKA 3AJDA 2VHZA 3QUAA 5DFAA 2GRAA 2OCAA 1DJMA 3AFOA 1EQ2A 4D9FA 4YMVA 4QKQA 2FJUA 1G4AE 4B3IA 3AEUA 4BV3A 4HN9A 5IJZA 2QN3A 1O97D 2KPOA 2V7QA 3AYXB 3A6DA 1LJ8A 1TEXA 1NLYA 1HI9A 3OI7A 4MQEB 5EZYA 2JFPA 4QFMA 2WF6A 2P90A 5AVJA 4MS4B 5ICSA 3GDGA 2BEKA 4WZAA 4YASA 3STUA 1HL7A 3C6QA 3JD4A 2C3UA 1ZD1A 2RH4A 4UM9D 1CUSA 2ECQA 4B6OA 1XCLA 5ED4A 3HNPA 3PEFA 1NBMA 3TTTA 3DCIA 1Y0BA 4B6QA 2V65A 4BXOB 5KNDH 1W44A 3O1IC 1KFCB 4LZNA 4BEWA 4BV2A 4LJ5A 2R84A 2GK3A 3NYWA 1EFRA 1X3SA 1OZHA 1ISGA 2EFJA 3ZGYA 4JFRA 1QTNA 2G9QA 2PD3A 1SBQA 3RS8A 2GZMA 3A37A 2JPDA 3P0IA 1NX6A 2ZKLA 4I6EA 4LKRA 3P2KA 2AE1A 5L4SA 3L8DA 3RYCA 2QIOA 2VJDA 3L4JA 1RRPA 1NQ5A 4LDQA 4ND6A 2C4MA 2W93A 1E1MA 2RC5A 3CEAA 2OAEA 3DKPA 4Q18A 1ZK2A 3ASYA 5DCWA 3AVTA 1O97C 1NJGA 2ZYTX 4D74A 4NU6A 4DKXA 5DYTA 3EXIA 2BR5A 1DNPA 2DY1A 2Z2YA 4MP8A 3F6YA 4M1MA 1BCSA 1M2KA 3V4PB 2AKAB 1USGA 1AY0A 4ZT6A 2W6MA 2BKUA 3OBIA 4D5EA 1MW8X 2XXJA 4LHEA 1WCWA 3BC1A 3GFTA 4WKPA 1X8KA 4TTVA 2D5BA 5LQDA 1RYNA 2EEPA 3G68A 2L2QA 4TS4A 1T5DX 2ZATA 5F3WB 3HXMA 1XTRA 2CXQA 1PWZA 4HUJA 4DSOA 4ZO6A 3IT0A 2Q2WA 4G4IA 3BD6A 1L5GB 3RT1A 3P9ZA 2CNWA 2WE8A 3QOXA 3GN2A 4M0DA 4YRSA 4BBPA 1YXMA 4CQJA 1EDEA 1FRZA 3B3JA 1SY7A 1UBMS 2AXQA 2JJ2A 2ZR8A 1R12A 1YI0A 3LY8A 5F4ZA 5FJJA 3IP1A 4MJXA 3IDAA 5J5VA 6ADHA 1U1IA 3AF6A 4WBNA 2H1IA 2FG7C 2PTHA 4PIPA 3RU7A 4U3JA 1M2FA 1SCAA 1QHGA 2QGZA 1XP5A 5JPIA 1Y82A 1L3IA 3BIWA 4OHPA 4D81A 2RB4A 1RI4A 4AWAA 3C14C 5IASA 2ANBA 3CZ5A 3R5JA 2A0UA 1HE8B 5JMPA 3TLJA 1TF5A 2O1WA 4LE1A 3PEWA 4OQFA 2C88A 3WQRA 4C07A 3PUZA 4KR7A 3B9QA 2O06A 4MUBA 2NQTA 4RJLA 4EKIA 1R6TA 2Z43A 1EDDA 3L0PA 2FZVA 3Q2KA 3BVPA 4HX5A 1OLUA 4JR0A 1LRJA 1QNLA 4CDGA 2HU8A 5JMWA 3I9V1 3EGIA 3S4YA 2DOKA 3LY5A 1IU9A 2XKJE 1MRNA 3FPJA 4D3XA 1GCIA 1UFOA 2E48A 2WE7A 4K40A 4Q3LA 3SQDA 1B2RA 1J0BA 2GAOA 2NWQA 2WB4A 4GDMA 4W63A 1FFYA 1FP4A 2NPOA 1E5XA 3NT4A 4OAPA 5HKKD 3LBNA 1D6MA 2YW2A 4K2AA 3TW6A 3GJ7A 1J7JA 2R1VA 4J75A 4NMXB 4V3BA 5AM4A 1SGWA 4IKOA 5TQ2A 4D92A 2ZYVX 5HKLA 8GPBA 5IDQA 5A0VA 1D04A 3EGXA 2IUEA 2YTZA 1LBQA 4FCWA 3QQ5A 2EP8A 3UOAB 2BDTA 2H17A 3S68A 3SHFA 1CEYA 2X0JA 4ARBA 1UPFA 1Z29A 2UVQA 4HG2A 3V9AA 4I8XA 2Q9BA 2AHOA 3TQOA 4LJ4A 4G1UC 5BVGB 5AW7A 2CSUA 4N5LA 4DW8A 2I2AA 1V7QA 2UZ1B 2FKAA 5HQ3A 3L06A 1J23A 4F93B 1C3JA 2W6PA 1YRYE 2NP6A 3BILA 2YASA 2OBYA 3H1EA 3CC8A 3LNCA 3O74A 4LAFA 1IUKA 3FSRA 2QVCA 3MF4A 4X3PA 3WV4A 1AQUA 3P9XA 3FIUA 2CCKA 4KRGA 4CKXA 2PV0A 2DPLA 1TM7E 3EA4A 2P0AA 2I8CA 4LC1A 4M53A 4DLTA 3I2JA 1AKVA 4NJEA 2GYUA 2VK4A 3MJDA 1F4LA 4LISA 1D7OA 5D8DA 5HSGA 1YDMA 3R3HA 5M3BA 3GJRA 4CL8A 2Q07A 1ODSA 4B0OA 3CXRA 4IMJB 5AICA 6PFKA 5TSDA 4X62B 5EJ9A 2PLAA 3QKSB 1FS5A 4NEGA 4NBNA 1OZAA 4BCCA 4I1RA 4KXYA 4JB3A 3CUSA 2W83A 2Z1NA 1N8KA 1XZBA 2EZ9A 3ONWA 2PBZA 2QG4A 3SDBA 1E6MA 4Y6PA 2G5TA 4J29A 4P3PA 1R0LA 4O25A 1CUVA 1QS0B 4RE6A 5DLPA 3V2GA 2XVZA 4BFYA 4INAA 2AXNA 5ECWA 2J0SA 1KYTA 1NMYA 1U2DC 3W7VA 2W0SA 1K7FB 4E3ZA 1A5ZA 3PXCX 4P0QB 3Q7IA 2D0IA 1IVYA 3C43A 3R3SA 2Y99A 2NO0A 1SZDA 3H8JA 1GIAA 2BM1A 1LS6A 3IKLA 1KTVA 1I3CA 1YH3A 3QNWA 3FZGA 4Q9LA 1FUUA 5AR1A 4BLPA 2V4UA 2N42A 1V1MB 4MQFB 1BOOA 1U1DA 1XWFA 2G63A 2FF5A 4IDBA 5GZ6A 4JWKA 4CF3A 5B3LA 3P45A 4I6GA 1ZNXA 1E2HA 3FR7A 1OFVA 4FX2A 3T7JA 4IZHA 5HTOA 5M04A 1E9VA 1NL3A 1U5BB 4HNRA 5G0VA 2FLVA 4HDQB 1BYIA 2QP4A 2P0EA 4F86A 4IOMA 4C0KA 2HRRA 3IHTA 3SKYA 1SUBA 3UENA 4G0PA 4LGMA 4RY0A 4AS1A 1VJTA 3HJTA 2D7CA 2PWPA 2W37A 4BQIA 4OXQA 1PEYA 1LLQA 1WW2A 4E2YA 3DE3X 1ZYUA 1EFPA 4CEIB 5CNIA 1HZZC 4YJHA 2BWJA 1PFWA 5D3QA 3RW9A 2CNLA 3QXSA 1OLXB 2WJ6A 1EP9A 2VDQB 3D8HA 3K2IA 1MR3F 1G291 1H93A 2HLDD 4PHHA 2Y1WA 3E18A 4UVEA 3W6NA 1U8YA 4Y2HA 3OPXA 4P6VF 3RC3A 1T0IA 2VWGA 3EFHA 4O4JB 2J0VA 3TUIC 4NOKA 5FBVB 2ETXA 1Z4JA 4YAKA 4EOGA 5D3ZA 4ZGWA 3MBKA 4L8FA 4QUIA 3OU7A 3I9MA 1L7AA 3VGJA 5AJVB 5IJAA 3CW9A 1XHEA 3KR0A 3IT3A 4BAZA 4EARA 4BLVA 2ASEA 1U04A 2R6DA 3GY0A 2NZYA 3DP7A 3N6RA 3FTPA 3IBYA 4TV9F 5LBTA 4C87A 3ND6A 3F6PA 1M0SA 1KR2A 3TH5A 3CIFA 3L84A 4LHXA 3EXEA 4M36A 5ALMA 2PUAA 3KT3A 1AV6A 2H3EA 1ZZEA 1N5IA 4F4HA 2YNMD 1E6WA 3HXPA 5FX2A 3OZAA 1ND5A 2R0QC 1QP7A 3UT5A 2AG5A 1ACJA 3Q6IA 4ZHQA 1OXVA 4MO9A 4WXYB 4ARSA 5B1YA 3QBDA 3V8EA 2OYCA 1JHZA 4Z4GA 1CUBA 2I6TA 1P0CA 1MN6A 2UDPA 2Y92A 4HNQA 1U90A 1C1XB 3HO8A 3LA8A 3O1JC 1H4QA 4TTPA 4JQOA 5DNEA 1QSGA 2WVAA 3DLBA 3UZUA 3RG8A 1BC5A 4DBLC 4M0KA 2P1ZA 3LHFA 4KI0A 3PJGA 2C4UA 2XDQA 3ZR4B 4OHUA 2WT4A 4HDNB 1JVBA 1KK2A 3GV0A 3B8HA 4HPXB 1I2AA 1XBTA 3RBVA 3VYRB 5IJ9A 1G41A 4FEEA 1WDLA 1DIBA 1L7OA 1T3HA 4OP2A 2IDJA 1VOTA 1YI1A 2RHCA 1GNVA 1Q95A 4P3OA 1TUBB 4MUNA 1NW3A 3KB2A 2PD4A 1T35A 3G5TA 4TLAA 5JSUA 1RDFA 1F3LA 1V45E 3STVA 4C43A 3L7JA 3JAKA 4Z7JA 1TMYA 1LW6E 3B1KA 3VXKA 3N2GA 4IXTA 4OQMA 2Q5IA 2J87A 3O3MB 2O8VA 4QEKA 4ER5A 3LUBA 4TXLA 4LV6A 4KX5A 4NYMR 5EJFA 1AUOA 2VI5A 3TJMA 1OZ0A 2JI6A 1VZ2A 1K6EA 2FPGB 4XB1A 2QY9A 4MVJP 3QW2A 3ZYZA 4EA9A 2OHHA 3BJRA 1X94A 2Z6VA 4FIZA 1RZ3A 4NZ9A 3V1LA 4DIDA 3H4MA 3WIBA 3LT2A 3L0OA 3M1IA 4QYIB 3WIDA 3BDVA 4ACAA 4B6FA 1R6BX 2FCAA 3PV0A 4WN3A 1Q3KA 2PEYA 1ATIA 1PZHA 2XQVA 3R24A 3E9MA 1T9HA 4NBUA 2N1MA 3H11B 1U3UA 1GXSA 1SUWA 3JYLA 3PPYA 4H7FA 4ZI5A 3HGQA 3R8XA 1RXSA 1WXGA 1XZGA 4MROA 3THWA 1RMTA 3I4LA 3G2IA 3DPUA 3CQ9A 3H2ZA 1QLHA 1B0ZA 3JX9A 4OHRA 4QPNA 2W4MA 3RJZA 3T5CA 2VTVA 5H4HA 1AC5A 4EHKA 2WV7A 2XCIA 1YK0A 1F12A 1A4IA 1KPIA 4WXRA 2VT7A 3CCCA 3E15A 4FQ8A 2BT4A 4R2MA 2R5FA 3DS8A 3MMNA 3AEXA 1DRVA 5FULA 1NSFA 5DI3B 4NC9A 2HXYA 4I99A 3U7QB 3N59A 4YCNA 2GM3A 5IANA 3HWWA 2B2XA 1DLIA 3EDCA 4ZU1X 1JFTA 3EWSA 3FYTA 1J06A 1Z35A 4AQDA 4HXFB 4L8GA 4TQUS 1RLMA 2HJSA 3T7SA 4REQA 3G2KA 1JAHA 4KUEA 4AX4A 2P8SA 1JQKA 5B3AA 3RUEA 4WAUA 3ZBQA 5EPEA 3QFFA 4KHZA 2RI0A 3BSYA 3ESQA 3QKWA 1KK0A 3QFHA 5JY1A 3W6OA 2C8VA 1OH8A 2C92A 3RUFA 1HT0A 1EJ2A 2HV9A 2WWVD 2GUGA 3TMYA 1DHRA 4B4OA 1WX1A 2A88A 2ZR9A 5CXSA 1JJ7A 4KO1S 4MMZB 1SVIA 4BBZA 5CITA 1IZ7A 5JYEA 3CISA 3IKMB 4MVJA 3ZUGA 4WOCA 2H1OA 3KJEA 1P81A 3UHPA 1QH1B 3V7UA 1PUJA 2WBLC 3BXHA 5CU7A 4PONA 4C0SA 2IY8A 4EBBA 4EW2A 3F67A 5C3MA 4NFHA 1PGOA 2C7BA 3CMMA 3B60A 3N8IA 4GI7A 1R0SA 3GH1A 4OJYA 5JVDB 4HDSA 1N2SA 3P9KA 4B7AA 4I81A 5EMLA 4UHHA 4NI5A 1I7LA 4NPHA 1WCYA 2IC5A 2QN9A 1NLZA 1YL5A 3ZHTA 4QATA 1FFXB 1Q83A 1TRHA 1J07A 2HQBA 5F3DA 5TGZA 4ZGGA 1IFXA 1TM2A 2IQIA 2JEZA 1ZGZA 3D8SA 4XCQA 2OORC 3ANSA 4TWBA 2ORED 5MN5A 3FVRA 1C2YA 4LV5B 3MJTA 4NP6A 1M8KA 3PD7A 4JYBA 2V74B 3OJWA 3IQDB 4MULA 1V7CA 521PA 4AJLA 5JMTA 2VJYA 1E7RA 2CLFB 5ECDA 2BMDA 3NHMA 1JE1A 3DMTC 2RSLA 4URXR 5JZVA 4GKKB 1UPXA 2OZVA 4W9NC 3FDIA 3LP5A 4IG9A 3MUEA 2QQ5A 4UXIA 2WJZB 2BFCA 2QGNA 2W6QA 1K6JA 2XNDA 4I9HA 1GLGA 2VEOA 4DCTA 3DR3A 2EYUA 1BFKA 5DMXA 3KQHA 4BU1A 1BROA 2B5WA 4L85A 4HDMA 3KOOA 5JCZA 5F2NA 5MFPA 3CHYA 4GE3A 4JLSA 5AKKA 3F8WA 4RQBA 3O5AA 4FP9A 2P91A 3FBWA 2I2DA 1AZTA 3NOXA 3WLOA 4UD6A 4CCSA 4PG8A 1J1UA 4RV4A 3Q8MA 1FLNA 5B3KA 1W1WA 1HDZA 2XYVA 2YDYA 2Y4OA 2XNHA 1IEWA 5TY0A 3WB0A 2RC6A 4I36A 3KVNA 2OXIA 3ZXIA 3ENZA 1Y1RA 1KZYC 1GGFA 4EQZA 4BLRA 2VJOA 1RI3A 1HK7A 2VP6A 3SSNA 2FQQA 2VK2A 3WX0A 3WLRA 2QN2A 3BWXA 4AIIA 1KJ8A 1PW7A 3KVVA 4AY3A 2BFFB 1P60A 1ZC4A 2LCFA 4LXIA 3EPKA 2YL2A 2O2HA 4RD6A 1RQNA 5KX5F 3RSFA 1RPAA 3I5UA 2PRJA 4R1LA 2EFEB 1JJAA 3WXBA 1LBSA 4IF6A 4IW3B 1UWVA 1JAZA 1E7MA 4U6SA 4Y1FA 2Q3LA 3I12A 5EXEA 4F6RB 3N2ZB 1E9SA 4S04A 2J9GA 3OZDA 2AJCA 1ESMA 4DLKA 1WU7A 1C7ZA 4MP6A 2CWDA 5UKDA 1LLUA 1CU1A 1KJQA 2Z9DA 3OPNA 3ORRA 3FKSD 4XFJA 1E1RA 1GPWB 1Z08A 3ZBUA 1HDOA 4CCYA 3QVWA 2Z83A 3U6BA 2P7HA 4CEHB 6REQB 3Q1KA 3TQSA 2R6CA 3DZIA 5BWNA 1N7JA 3M9LA 3BFKA 1EUCA 3TNYA 4C3OB 2NV0A 5EMMA 1PZEA 3UVEA 1R9MA 1X1DA 1PW5A 3JAWB 4S2EA 2HA3A 3RYIB 2XMGA 5IMBA 4HMOA 4CKWA 4R9UC 1LV8A 2KBEA 3PD1A 4F92B 2AEFA 3PIRA 1E20A 4INPA 4R2WA 2C5BA 2GK7A 4R3UC 1K97A 4MW2A 3FCUB 4GMHA 1AKUA 1XCBA 1IAVA 2W2LD 2JJ1D 2YIVX 3K94A 1NLFA 2P8JA 4FJ1A 1QRRA 4Q03A 5C1PA 1QIEA 2B99A 3ILYA 4ZI7F 1LPBB 1AHHA 5YASA 5L3VA 3SOZA 4G0NA 4L08A 2AF4C 1LNZA 1OIXA 2FSVA 4M9RA 1ZVQA 4Q16A 4IY1A 3TIXB 2EBWA 3LVFO 1TT5B 1ZX1A 4ECEA 2PUFA 2ATCA 1U4OA 1W35A 2JLQA 3QXGA 1KZ7B 4BMVA 3LC0A 3PC7A 5E4FA 1B8VA 4U2CA 3AUKA 4TKVA 3RUCA 3DE0X 4P4SB 4ZQCB 1RXWA 4IXMA 4WBXC 4KP7A 3ASZA 5JO0A 1TQ6A 4P80A 3NORA 3QF7A 3C7DB 3JQ9A 2JLSA 2ECFA 3B6IA 2R2AA 2D3TA 4GXQA 4BNLA 3WL8A 2UXBB 2CXXA 3HN6A 1OAOA 1SUFA 1IZZA 1P75A 2JFXA 4FOOA 4N7RA 5JQGA 5FEMA 2H59A 3DVQX 3MRTA 4QVKA 4RBNA 3V48A 4ENVA 3Q9LA 4HYEA 4LY6A 2QXYA 1BQ3A 3F6RA 2IELA 3JSXA 1NPYA 2PO7A 2O9JA 3FX2A 1WSBA 2A0FA 4JLMA 2EC5A 3H9EO 3KOWA 1JPJA 4O4IA 3P1JA 4Q9KA 3SN6A 4A1OA 2QUBA 3AONB 4Q7EA 2NU6B 3DDWA 4QUBA 4Y1GA 5L8VA 4N3AA 4WOJA 3ZY2A 4RTLA 1RXEA 5IJXA 3AWIA 4O4JF 2WAXA 4GUDA 1PR4A 3C8HA 4MRMB 2XMPA 1RP1A 4HB2A 3H2HA 1CSEE 2Q4OA 2GESA 2WWIA 4C2BA 4UVHA 1QANA 4QDKA 4DRZA 3P2YA 5JWRA 4R2JA 2IYOA 2B2CA 1N6PA 3G59A 5JANA 2ZJ5A 3OJOA 5E95A 1O6GA 4JLKA 1CUIA 4FFBA 4EF5A 5JZBA 1CY6A 2CDCA 1XRQA 1TCBA 1U4NA 4FLFA 3KXDA 4CM3A 3V46A 5B6PA 3JQGA 1H2YA 4RZIA 1XQ9A 3EFOB 4JUIA 2L0XA 1W7AA 3I61A 1NNEA 2KBFA 2XVMA 2OCIA 5C7OO 5IFKA 4IZIA 3KYDB 1G7RA 3UG7A 2Q5HA 3AXSA 1CV2A 3HCBA 1LPPA 2Q1XA 2R7NA 2AC7A 2GYWA 1CJBA 3CH7A 3CN9A 3L7AA 3OO1A 1R7RA 4QYSA 4WY5A 5DWQA 5FI5A 2I7VA 2WQ6A 4ZOQI 3EEIA 3SM9A 1GR1A 2OXFA 1Z4QA 1X9HA 3ISJA 4N0EA 4MYHA 1I30A 1XLTC 1Z4LA 3S1AB 1DDGA 2Q2NA 3D5EA 1M0WA 4LS3A 5KYGA 3ZVLA 4H4EA 4EY7A 1ETUA 2XGGA 1I01A 3EF3A 1W0KA 1UBRS 4WLUA 1T5LA 4UE6A 2B4QA 1TB4A 4L8YA 2O20A 1SZPA 2JGDB 3PENA 4QPCA 3SC2A 3Q9NA 2JHFA 4QSMA 5CT8A 1BXGB 5DTMA 3W3AH 5B4VA 3DYVA 3D1LA 3EASA 5HF6A 4CTOA 1X7YA 2VPIA 1E7QA 2H8GA 4QLAA 4F3YA 5LU9A 1GZDA 3LL4A 1PKEA 1NJ2A 3ADKA 1JQEA 1I6MA 1QR2A 4YFVA 1PLJA 3AFNA 3AO0B 3GLIB 1NLMA 2CXNA 3IAUA 4C21A 3TW8A 2C7PA 1R27A 4KVGA 4WDRA 3I8SA 5B7PA 4EGCB 2I22A 3GGOA 3TQHA 4C22A 5CEEA 1CUYA 1KRWA 3U4MA 1YJCA 1NUTA 3Q72A 1KAGA 4A91A 3TZQA 3E7PA 1GPUA 3KZ1E 4M1TA 1I2CA 2GNPA 3ZJ4A 1QE0A 3HXTA 1LBTA 3A4IA 3QNMA 4DRXA 2XKKA 4PM4A 3GEMA 2VP2A 4LFCB 3MLBA 3RHSA 4B7UA 4C4OA 1RD4A 3M8KA 2CJXA 4JJ7A 2TSYB 1NU8A 4REOA 5CHEA 3A6GA 1K7EB 3O4IA 1G63A 5C4GB 3PR1A 1VG1A 3QF4B 3ABSB 4MINA 4TOIA 5AKHA 4EY6A 2VTBB 3FPBA 2J5RA 3BMOB 1Z83A 4ZGBA 4COOA 3N70A 1AHNA 1DZ3A 5JU6A 3VNRA 3K2BA 1X74A 3JQQA 1VE1A 2WKQA 5J2UA 3ENQA 3PSAA 2NU8B 5C4MA 1MB4A 2QR3A 2JLXA 3HCEA 2PSEA 1OU4A 2Q0QA 5EE0A 4N7JA 3VJMA 4HXYA 4D56A 3EVZA 3O31A 4U7FA 4ZTUB 2J07A 4IRUB 3BFXA 2M98A 5BQPA 3RE1A 3Q88A 5JSZA 4FN4A 3BIOA 1GNRA 3TF5A 4RC9A 2DWCA 4ZQFA 4LOKA 4NDAA 3Q98A 4DG8A 3V4VB 4CLRB 1X80B 1JR3A 2ZRLA 1SC1A 4DWJA 2BMAA 2IW1A 1OI3A 3I9OA 5KVQA 3TZCA 1BWSA 4OHYA 3ADOA 3PFWO 1Y3FE 4JOSA 3W04A 1BS2A 1Y6ZA 5AVXA 4Q7LA 3TVDA 3VAZA 5KIAA 3AUTA 3LI2A 4IX9A 5ICGA 1F7VA 2XT6A 1ONPA 5I7WA 1BMFD 4IOLA 4I1YA 3MCWA 2BCJQ 1PWHA 5KSPA 1FTSA 3AKCA 1AUPA 3ZU3A 1UL1X 1Q1BA 4GSLA 1NXVA 4P35A 5I48A 4QAJA 1KO7A 3K92A 1I4EB 2AKYA 4JC8A 5AQ1A 5C8VA 2ZEJA 1TA9A 3KUCA 4H08A 1L3BA 2ZYIA 3V4RA 2OLJA 3OOWA 4ENPA 4MCAA 2ZIZA 3MEQA 5H4GA 4G97A 4C14A 2GJ4A 4RM2A 3OKAA 5A5VA 1AQNA 5HGXA 3PEUA 4ZOAA 2HXGA 1ZJ5A 1BO6A 2QW0X 3F8TA 3EMVA 3FOCA 1GZHB 2JARA 4RYDA 1IWOA 2FSHA 1K8RA 1Z8FA 4R7GA 1DTWA 2C9OA 1W52X 3KYCA 1G20E 4JHXA 3BXOA 4MQ6A 5ALDA 4UBOA 3OTQA 4B87A 1KDRA 1H4TA 3T5BA 1E5VA 3I0ZA 2H07A 3OPQA 2F8LA 1JALA 3WRXC 4PHTA 4GZ3A 4H7IA 4RWEA 3RS3A 1PJ8A 1JYEA 1WU8A 4RLFA 4X20A 5FPHA 2YY6A 4C5CA 5H3HA 4BZPA 1S2NA 3PJDA 1M1ZA 1IZ8A 3KJIA 2O2JA 3QKRA 4H60A 5AVOA 3VHXB 5JZSA 3DV0B 3B6ZA 2C7VA 4LBWA 4RKWA 3NMUF 2VTKA 4FFMA 1T4MA 1IG0A 3SD7A 4FW8A 3K70D 4C5AA 4OKNA 2ZTLA 1OFTA 3QKUA 5ALUA 3C97A 4IL5A 3GRRA 4KXFB 3UMVA 5ADWA 4C89A 4KTTE 2O19A 3F7NA 4NFLA 5E9AA 5BSVA 3JWHA 3OJEA 1AXRA 1N2GA 3L0CA 4PAMA 3V80A 3TLMA 2CLDX 5E9WA 2P6OA 1NMQA 4TM7A 5EQTA 1U1CA 5AW3A 5JS6A 4YY3B 1EXWA 4UQPA 1H65A 3HR8A 2QYTA 4QU5A 3ND7A 4WDQA 3RYHA 3VX4A 1RJFA 5BUCA 1MOSA 2DHQA 4ZQBA 4DM7A 3ITNA 2HFKA 1XSEA 2VK8A 3PDHA 3QIAA 1DWPA 4NRDA 4PEVA 3T3GA 2YUTA 3UAXA 4DM4A 2H5JA 4JS0A 2W70A 3AEKA 2QZSA 5GMOA 2QORA 1QJ4A 5WRFA 4RVUA 2LE0A 4IICA 4BOYA 2WKPA 2E18A 2MMGA 4LTNA 3BICA 3PXUA 4IPTA 4PGGA 1ZAYA 2WM3A 2AUNA 3MUOA 4NR0A 4LNUB 2EFGA 3VVBA 3OD5A 1YDEA 4BIMA 3DAOA 1XMPA 1CY1A 1L5QA 3NVDA 2CHGA 3LIPA 4POAA 1Q21A 3ESDA 4G01B 3K70C 1SCIA 2CB9A 2JC3A 2WU1A 1H42A 2DRIA 2HWKA 3CLVA 4NBVA 4NV1A 2ZJ1A 5BSTA 2QSYA 5DH9A 3AJ8A 3GBVA 4BB0A 4MWBA 1JWBB 5KYUB 1XFAA 3DC7A 3HQ4O 1EK5A 1W88B 3WQQA 3Q40A 1UP4A 4LXHA 4QXQA 5LLDA 3NTVA 4H3HB 621PA 1UZNA 2NGRA 3GP3A 3KQNA 4GUAA 2XWQA 4BMPB 1PNRA 3NTLA 4NCJA 4UUQA 4RIFA 4XQ0A 4D44A 1C1DB 4JLBA 1MOPA 2XYQA 3ZV4A 3MMSA 3KD2A 4NVRA 2C95A 4BB5A 2V5VA 4UVIA 4FGWA 3PVZA 1UJCA 3TM5A 5L6MB 3AHIA 1QE5A 3R9XA 2Y71A 3LC2O 3NTRA 2C54A 3LPMA 1V5WA 5E38A 1CQIA 3B6JA 3RTGA 4WKBA 3FMOB 1ML3A 2R96A 3A9TA 3KEMA 2H8KA 3MD9A 3ZC3A 4DMHA 4ZJUA 3JQAB 5K9ZA 5D5PA 2WUEA 3NBYC 4JP1A 4Z2AA 1MBZA 5G2OA 3QOWA 3STWA 4YT8A 1JWLA 3ONEA 4NXMB 1YIOA 3THRA 1DTEA 2NXJA 3ZU6A 2Q9UA 5JY6A 4XVRA 3W6ZA 5LWQA 4Q37A 5BR7A 3RIEA 4W5RA 4PX5A 2ZUFA 8LDHA 9MHTA 1IPHA 2QD1A 1Q0SA 5KMGA 3TTUA 2G77B 2O3RA 2V9CA 2AN3A 2NAFA 2WU4A 4L5CA 5EGNA 4W7IA 1VIYA 1ZESA 3RFTA 1OB5A 2D0PB 1CX9B 1KVQA 3B6MA 4M0PA 2ON6A 3K6JA 5K0GA 2OP1A 2QTNA 4URZR 2W8BA 1ZQ1A 3UCXA 1HFWA 2IPXA 2E2WA 2JIRA 3MSXA 4QGGA 3PDIA 3UGJA 3NWOA 1U2EA 3OSUA 5I7RA 1OH5A 1H1TA 1RNLA 2CJWB 2XB4A 4YP0A 2EJBA 4QL3A 2G9NA 3FJ1A 4EHIA 2AG8A 1SPXA 4OHCA 5L6LB 3R6GA 2IS6A 3OE4A 1U9IC 3U4DA 2OL4A 1IY0A 1SPBS 3WRYC 2R8YA 1HFKA 3PQDA 2W6ZA 3IKVA 1J0CA 4A2CA 3VR2D 5GINE 5KTOA 1OHHA 1XAJA 3AIIA 4KWEA 1IOLA 4M1WA 4CDRA 4YAGA 4LYHA 1DDIA 3M9WA 3T7DA 4E2WA 1ZOOA 4IDAA 2FX5A 2KB0A 4U2GA 3B6EA 5AW6A 1JA0A 3QHAA 3HU3A 1V3TA 1E7YA 5DHFA 4D4IA 4WJLA 3UPTA 4N48A 4FWBA 3WWPA 3A1CA 1QG4A 4PLYA 3SG0A 4Q4AB 5AK3A 5GVRA 2FG6C 2QRVB 1A9QA 1V6CA 2HU7A 3LA6A 1TCVA 3L4EA 1PGQA 4OO3A 1TTHA 2NNWB 2ACWA 3ZLJA 5FD8A 1E3LA 3U7FB 1T6XA 2F6RA 4FGUA 5BN5B 3SBEA 3ROZA 4BQPA 1OYOA 4BVAA 2UAGA 3TN7A 3GP8A 3UUWA 3CLUD 4OSEA 1RYYA 5LQCA 4DVGA 4ZZ2A 4BKQA 5T41A 1IJKA 2V59A 1NE7A 3RSZA 1RXCA 4LCJA 3MINB 2OCKA 3A36A 2WU3A 4JLNA 3VR6D 3E0QA 1GN9A 2Q9CA 2FWJA 2YBEA 4MMXB 3GD7A 1U3TA 3SDZA 3CVWA 3SC3A 2PKCA 3OIVA 3ZCTA 1ZSNA 4CM5A 1D2HA 2WIDA 4V0SA 3BB1A 3FNQA 2FX3A 3EYWA 3HWRA 2AYZA 2LXNA 4FDUA 4MKFA 4WA8A 4YRCA 1QC5B 4IWNA 3VO1A 3L0DA 2G1KA 3ABQB 5C34B 3K2EA 2A1IA 3I64A 4X1IA 3QNUA 2O0HA 4Q9IA 1TK3A 3F5DA 4QDTA 5AIBA 2RHRA 1C3VA 1P18A 1L8XA 1UK7A 1MO6A 2DHEA 2RCYA 4W8HA 3WHLA 3RJ9A 2JASA 3NCHA 2WMOB 4MR9B 2IV2X 1NKTA 3AHFA 1ZP6A 5DNWA 4KYTA 1G8SA 4BKOA 4RTRA 2V45A 4UW9A 5KNDA 5CTJA 1NN1A 3CLUC 4BN4A 4Q1DA 2DR0A 4ZYYA 4ZKEA 5BSEA 3IO3A 1E2BA 3HFRA 2HHLA 1U99A 2Y1LA 4LXUA 2Q6TA 2DEUA 3UAOA 4WXMA 5IKOA 4EKEA 1JDZA 1YF3A 4F3RA 3KELA 2J6HA 3M6LA 4PW0A 1VRVA 4NONA 1GGKA 1UC4B 3I58A 2DLDA 4QGFA 1GDTA 1N2ZA 4F2WA 4I3HA 2QLJA 1J8QA 2ZANA 2SHKA 1OXTA 2P2GA 3MCUA 3CNNA 2X2PA 1WAMA 1E79D 1QYDA 1Y5RA 2BMWA 1Y8RB 2IHYA 2WA1A 2JIDA 3KDPA 4ZAZA 2XWSA 4YRDA 2FRXA 1X13A 3KB8A 1GSOA 3N8DA 2YVAA 2AXPA 3ETHA 5BT9A 1DUVG 1FNMA 3QEMA 4WZZA 3OCJA 3DAYA 3RRMA 2JH9A 1UWCA 3BGIA 3OIFA 1AV7A 5LOVF 3QE9Y 3TL3A 1E6KA 3LGXA 3L41A 1SC9A 1T8TA 1NN5A 1W8DA 1JR4A 1TZ2A 3OKCA 5C46F 1UKAA 4Z9FA 3T7EA 3IBTA 3HWX1 3R23A 4W82A 1SXIA 1O94D 4J1TA 4P31A 5EJMA 3TPZA 3DULA 4F21A 4F06A 3DVAA 4DFDA 4BCBA 2V7VA 3VFDA 1EX7A 5F12A 2P3SA 2RI1A 3E35A 3E5HA 1LBEA 2R6JA 4RZHA 5AOAA 4AJNA 3BMNA 2ZE6A 4QXOA 3WOVA 5DNYB 4LF7B 2OBFA 3K16A 4XDGA 4KNVA 2VFAA 3BBPA 4FZVA 1ENPA 2V1UA 1O0SA 2BFAA 3VC1A 1P3JA 3P97A 1DCKA 4BEVA 3R5TA 5KYXB 3SJ7A 2OZPA 3RSQA 2EX1A 4IQGA 2EGHA 4N39A 4PSKA 3W5CA 2TS1A 1H2HA 5IBCA 2XRYA 3IC5A 3VYSB 2DC1A 1TVKB 4OH7A 4M9QA 3SZGA 1RYDA 2M6KA 3WLIA 2ZRAA 1SHTX 3WGYA 4B2YA 3QLVA 2REQA 3NNNA 2G06A 4Q6WA 4TTJA 1WY7A 5JROA 5D5HA 2PV7A 3VDRA 3K6SA 1F2UB 4IGFA 3EVAA 4US0R 3IDSA 2JF0A 4IJQA 3ORFA 4FFPA 1E9FA 5BQ3A 3TWOA 3ZCVA 5LZ2A 3A1WA 4IS2A 3A3NA 1O94C 2CUNA 3QOFA 4NKRA 3EVNA 3VSCA 2HW8A 1K9SA 1BG6A 1Q6ZA 4K03A 3FOEC 4F38A 2DFVA 2A92A 1OWOA 5SYMA 2EBFX 3ZQ6A 5IAKA 1XTIA 1QB8A 1YQUA 3TR5A 5DM1A 2GCGA 2Z04A 1YL6A 3S8MA 4E03A 3RHFA 5FP0A 4D9MA 4IGEA 1ISSA 1HLGA 1TQDA 2D0OB 2HIMA 4PHFA 5EKUA 5JAUA 2BRUC 2MIIA 1ISPA 2ZXFA 3DBIA 2A5FA 3MWFA 5CM2Z 3BA6A 1XZAA 3I1JA 4QXRA 3ABZA 2HA2A 1GYQA 4IQ8A 3U56A 1Q6YA 3KSRA 1XXHE 3UJAA 1PJRA 3PI6A 1TKCA 4JT9A 4KO2S 1HYQA 3G8DA 1CY8A 1UK6A 2XNCA 2Y6VA 4JZYA 3HADA 4P4SA 5IC5A 2RHTA 3Q3IA 3UT6A 4QHYA 4XARA 3DMPA 3DVLA 5EKDA 5JSFA 2ZJ4A 1UPTA 1VHWA 2X2EA 3ZHQA 2GS9A 1VL6A 2DAPA 3UHFA 3HR7A 5F2OA 1HYGA 2VDVE 3FVVA 1GO2A 2PVC