4HEJA

Discovery of selective and potent inhibitors of gram-positive bacterial thymidylate kinase (tmk): compund 16
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
202
structure length
198
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
molecule tags Transferase/transferase inhibitor
source organism Staphylococcus aureus subsp. aureus
publication title Discovery of Selective and Potent Inhibitors of Gram-Positive Bacterial Thymidylate Kinase (TMK).
pubmed doi rcsb
total genus 80
structure length 198
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hejA00
2FX3A 4B47A 4EFLA 1N5IA 1HE1C 4GT1A 5CLQA 3VU9B 3H2YA 1YZQA 2EQBA 4E5UA 3HPQA 3T1TA 4EPVA 4BFWA 1ZJ6A 1OXSC 2EFCB 1KDRA 3EWAA 1UKYA 1YKSA 3L43A 3WRXC 2ZYUX 4B71A 1M2OB 2R6AA 2GCPA 4RY2A 3IUYA 3G82C 1QVRA 3FMFA 3ZDQA 4ESHA 5KSOA 2HYIC 4BGDA 1FP6A 1GKIA 4Q5IA 5FPTA 4EJSC 2OV2A 4JZKA 1VMAA 3DM5A 1G7RA 2JLUA 1ODFA 1UBGA 3U3OA 3AVUA 1P6XA 1YJ5A 3KB1A 1YZTA 2QA5A 2F43A 1VPLA 2QTVB 4GL2A 1NLYA 2NZJA 1OLOA 3W8RA 1P2TA 5J4HA 1CBUA 1DAIA 3UPUA 2HDNB 1EESA 2HT6A 2QORA 1UBFA 1YR7A 2CL6X 1CJVC 3QXXA 1DAMA 3CW2A 1SVMA 3EW9A 4M1SA 4HLUA 1ZD1A 3QUSA 2ZUCA 2OXRA 4EUNA 4LPKA 3IBYA 1K8RA 2FA9A 2VP6A 1RC8A 1CJTC 3H86A 4LRWA 5DHAA 5CYPA 2ONJA 3QF4B 4JJKA 3EG5A 3T61A 2A5FA 1S9DA 2ZE5A 3MRSA 3U44B 1XF9A 3A36A 1CJUC 3ZLJA 1HV8A 4B6EA 1PJRA 1TU3A 2CK3A 1XPRA 2G9NA 1VG8A 5BXQC 4Z1MA 4Z51A 1TU4A 2C9CA 1H8ED 2P3SA 5FBRB 3LDAA 4TQUS 4MGIR 3C16C 1T9HA 1WP9A 2WHXA 1BKDR 1KDPA 3LBIA 1A82A 2ZQ5A 1L4YA 2GNOA 1US8B 4LHZA 1VHTA 1QHHB 3ETLA 4UNPA 2BJVA 3W9YA 2ONKA 2ZS8A 1KI3A 3K0FB 1NBMD 1L8QA 1ZNXA 4OBEA 3FFBA 5HTKA 1P73A 1X3SA 1TUIA 2F7SA 2WAXA 4BZQA 1M7BA 1MOZA 2ZE6A 1D9XA 1EXMA 3DZDA 4TMTA 4BFZA 5JEEA 3CB4A 4HDOB 1ANKA 2QUZA 5L3QB 1MO4A 4RZ2A 3CF2A 5DSZA 1OW3B 5FBWB 2DFNA 3FVQA 3KQLA 1CS4C 1G20E 3L0SA 4ABYA 2I1QA 3AGQA 3KJIA 5J4YA 4V0MA 2FOLA 5JFGA 2PZGA 4HB4A 1GSIA 2VBCA 4AYTA 4AK9A 2ZJYA 2ZVPX 5GVSA 1X1SA 1D2EA 2XB2A 3A6PC 4Q1FA 2X8AA 1KHTA 1KKLA 1V43A 1W36C 2WAYA 4P4SA 2ANCA 4IFBA 3B1XA 1XCPA 5KUTA 2NMVA 3CH4B 2FPMA 2XTMA 4KFRA 4Q4HA 2AK3A 2J46A 4XOIA 5G41A 4PZYA 2WWHA 3U2QA 4AIIA 2QP9X 2XZPA 3LLMA 4XD7A 1SGWA 4GZLA 5EE3A 2BEJA 1Z08A 1YZKA 4DJTA 2JAQA 1E69A 1TX4B 1PVOA 2IXFA 2BKUA 2PZEA 3EPHA 1Z28A 5KSPA 5E7MA 2GZHA 2ZU6A 2V1UA 1XZPA 2ZJOA 3T1QA 4Q03A 1IY1A 3AKCA 4L9WA 4UKDA 1VG1A 4C30A 1OH5A 1P60A 3KFVA 2CNWD 2JIZD 4D4KA 4IDPA 1UPTA 4G5QA 2J0UB 3KJGA 4DSTA 4RD4A 1G5PA 4HLQB 3W34A 1QHIA 4XVRA 4ZI3A 1N6IA 1Q1EA 3ZH9B 1N5LA 1SXJD 4II7A 4KHZA 1G3UA 1HTWA 2JLRA 2R62A 1G3RA 2FDCA 5CK4A 1ZNZA 3THXB 4I99A 3B85A 2AXPA 4TLEA 1G17A 4X8MA 3FHTA 3P32A 5JCZA 3THYA 3SC3A 1KAGA 3FKQA 4AKIA 4GMDA 3AKEA 1HQCA 2WJIA 3GLGA 1LY1A 4URXR 4KI0A 2AR7A 2YC2C 3VR4A 4OI1A 5KSZA 1PLJA 2D4HA 5FOWA 1VKJA 3W8NA 4RD2A 5LBIA 3GD7A 4I81A 5KHOC 1X8LA 1RRPA 3Q5DA 2IWHA 1J8MF 1ZAKA 1NBME 4M9ZA 4KLZA 2AFHE 3DDCA 3PG5A 4LGMA 4DSNA 1NL3A 2C9OA 1TQ6A 3PVSA 1NMXA 1HT1E 1VIYA 2GHIA 3BBPA 4IXMA 3X1WA 3B1ZA 1KI6B 3BIFA 1DPFA 3KKPA 4P32A 4R2HA 2GWHA 2J9RA 1M6NA 2PJZA 3VHLB 4A0RA 2O52A 3E1SA 2XB4A 4NP6A 4S2EA 1UDXA 5FOUA 2JLWA 3TUIC 2R65A 4HAVA 4B35A 1LB1B 1ZC3A 2R9VA 1R0ZA 1ZW6A 1NIPA 2B7BA 3K8YA 4DDVA 1J7KA 2RB4A 2LKCA 2YOFA 5CJPA 4LYFA 3VNVA 4HLCA 1NBMA 4CYMA 5FL7D 4EPTA 2O8EB 3RRZA 3LFUA 4EPWA 2ZAMA 2VSOA 4EQ6A 2XXAB 3CPJB 3K53A 2GEUA 1KMQA 4DCUA 4DIDA 1TEXA 3FHCB 3EPJA 3FGNA 3MLEA 2NOAA 3K9NA 4Q1CA 2W2TA 1TNDA 1U9IA 2D74A 1X6VA 4HEJA 1JALA 1QHNA 2MSDB 5JCPA 3GLFA 1XMIA 1FTNA 3EIQA 5JWOA 2AL7A 5JRJA 1NJFA 2MSCB 2N1BA 4LYHA 3OIVA 5DO9A 4HATA 4LOAA 3D3QA 1HYQA 2ODNA 3CONA 1RYHA 3THXA 4JVNA 2QRZA 1GOTA 4TTQA 1XNJA 4MITA 3WNDA 4D4MA 4OHZA 1GNQA 2QN6A 2WJJA 4FD2A 2EFGA 4HI0E 4HAWA 1GAJA 4GBMA 3OEED 2OLKA 4DDWA 2P5SA 2XAUA 4ZPXA 2W00A 3BJIC 4PQYA 2ODWA 1GL6A 4YONB 3QSYA 3Q9LA 1NY6A 1E2HA 4W5WA 3SZRA 5JWRA 2ZSAA 4IEIA 4QNRA 3VR6A 4F7WA 2FEOA 4DHEA 1GNPA 4TMWA 4FW9A 4U00A 4DUGD 4URZR 4RD0A 1Q3HA 1W48A 1G8PA 5CB8A 2WIBA 2BM0A 1KMHB 1Z6GA 3SJCA 3M1IA 3UG6A 3FTQA 1BS1A 2ZR0A 4GI7A 4IW3B 4Q9IA 4A2PA 4TSFD 1JI0A 3KQNA 2OSBA 1E0SA 1G7CA 5HZHA 4N0EA 3TE6A 3LQRA 4LK2A 3BGWA 4URVR 3TSZA 4G5GA 1TQDA 2IYYA 1Z8FA 2FEMA 2IYZA 5GJVC 4PFSA 2YJTD 2GBLC 4PO8A 3HR8A 4BFSA 4Y0AA 4XVUA 1CXZA 1ZRHA 2OILA 1GFIA 3CLVA 1TQ4A 4AKGA 1XRJA 1VIAA 2XEXA 4K46A 3EC2A 4FWTA 4EPXA 4AC9A 4EQ6B 4WXPA 4LV5B 4NDZA 1WRBA 1KJYA 1SVLA 2PEZA 3C14C 4CEHA 1G6OA 2HF9A 3U6BA 2FNAA 4CZ2A 1DAFA 1XZQA 2WKRA 4OHXA 4NYMQ 2BBTA 3I3SR 3SYKA 4LBYA 2O8FA 2GXAA 1UDWA 3FHOA 4IDOA 1F48A 2ZETA 2QBYB 3REGA 2HEIA 4BLQA 4RJLA 4Q19A 4HZUB 4TYNA 2DY1A 3ICEA 1W4RA 2H1LA 1JPJA 2QEQA 2FN4A 5DIFA 2D2EA 5DHFA 5E3HA 3U6KA 2PCJA 1TF5A 1SVOA 2GVZC 5D3MB 2WICA 4DLSA 3RSOA 2GA8A 1SKYB 2JIZA 3BRWD 4Q9HA 2XNDD 1G64A 3CNOA 1Q20A 4EJSB 4AI6A 2PJRA 3VKGA 1DAGA 2GJKA 1U8AA 5IF9A 5EXPA 1KZ7B 3QKUA 2W2VA 1RRCA 3KJHA 1Y63A 1BOFA 3T15A 3GFOA 3KL4A 3KDSE 3CF6R 3ND9A 2L0XA 3MWYW 1RZ3A 4JSTA 1COWA 2HJGA 1D2MA 1YZLA 3R8CA 1RE0A 2XSZD 3R7WB 5FPSA 1ZUHA 1AIPA 2R6DA 1KGDA 4HUQA 4M8NE 4EFNA 1N3BA 3H4MA 2ZRJA 1GG2A 1QHXA 4HB0A 1Q3TA 4XIGS 2RGAA 4DSOA 4V0KA 3B1VA 1KK2A 1N6KA 3QENA 1OKKD 2GXQA 2QAGA 5FOVA 4C0HA 3I5YA 2O8DB 5FTNA 3A8TA 4L9SA 2P6UA 3PQCA 1U8YA 4ZDKA 1KK1A 3F5FA 4JVMA 5HR5A 2W83A 1E32A 5HZKA 4ZI2A 3OFNA 1WDTA 4KJZA 1E9RA 1U0JA 2Q6TA 2ZYVX 3AF0A 5DI3B 3A1VA 1E2LA 1L7VC 3OZXA 1D6JA 4D6PA 4KITB 2YWEA 1KI6A 4KFSA 4URYR 4V03A 5F98A 3QPWA 4JVSB 5J5CA 2JJ8A 2GZDA 4Q4HB 1FMJA 4ARZB 1KI9A 1QF9A 5FR2A 2IXGA 2NO7A 3W6NA 4OQNA 1C4OA 3QXJA 1NN1A 4TYQA 1IXZA 2F1IA 2ZRNA 1AKYA 3NC0C 3U3JA 4TLAA 5KNDA 4Q66C 1NVVR 4QJ4A 4TQAA 4URWR 3D7MA 2GXUA 1DG3A 3U7EB 3B9PA 2Q9CA 4US1R 1IN4A 4R98A 1TPZA 4WZ6A 4LYJA 1Z0AA 4QL3A 1Z6AA 2V1XA 4BLRA 2XOKD 3DM9B 4W5HA 2ZM5A 1A2BA 5IHPA 2BCGY 4NU0A 1LVGA 2IYRA 4KFUA 4A0HA 2VLIA 4A6XA 5EE1A 1KY2A 3EX7C 4DWJA 1JXMA 2PLFA 3HU1A 4CEIA 1P61B 2BCJQ 2V7QA 4FIDA 4L5BA 2B6HA 3K09A 4JLAA 4BLOA 3C4JA 4B3FX 621PA 4EDHA 5LB4A 1K5DA 4QGGA 3KUCA 1CF4A 3G0HA 3CKLA 5A5GA 4MA4A 3QXCA 2ZEJA 5J4LA 2IUSA 3W5JA 3QI2A 1MABA 2AWNA 2IEYA 4NCIA 4LJ4A 2BMFA 2QGNA 5G40A 4F93B 4XTRA 2EVWX 1XXHE 3TH5A 4X8OA 1SKQA 5H8WA 1ZIOA 3EZFA 2JJ1D 3EA5A 2R44A 3I8XA 2ODEA 1W7AA 1P9NA 3H1TA 4C0KA 3GFPA 2FPLA 4LJ5A 1G5TA 1ZMXA 3PEVA 3I1FA 2OM2A 1Z6XA 3LH5A 4LWZA 1ZU5A 2MSEB 1MH1A 5K8UA 5ANRB 3SHFA 2FJUA 2EYUA 3KKMA 2QY9A 1Z2CA 4BFTA 1XJ0A 1M1YE 4NH0A 1D9ZA 2W2XA 4UXHA 3QBTA 4LJ7A 3MUFA 5A0FA 4XWKA 1E79A 5EP3A 2HCBA 2GJAA 1XWIA 4CT5A 2RGGA 3NKVA 3SFZA 3X1XA 3L8ZA 2QT1A 2IW3A 2IYLD 4J0QA 2F55A 4A2WA 5IDVA 3MJHA 3T1OA 4DRZA 2ZJ5A 2WPDD 3KQKA 4QM6A 3HPRA 1G19A 1KJZA 1DAKA 2WVJA 3SNHA 5AK0A 3RAPR 1R2QA 2QT0A 3IBGA 3EZ9A 1A4RA 2WV9A 1HA3A 2NTYC 3FMPB 2TMKA 4IOMA 2KI5A 3OIWA 1AZTA 2QQ0A 2OFWA 4NCJA 4QBFA 2VL7A 4DBLC 1HUQA 4HLDA 3UG7A 4QC2A 8OHMA 1NRJB 4JYCA 4WBSA 3GLGB 1LW7A 3DZ8A 1MV5A 2IEZA 1FPMA 5E7JA 1FMLA 3OAAD 4B2IA 1P75A 2NO9A 3AUYA 2AFIE 3HWSA 2H17A 3HYRA 4KVAA 2KWIA 3FYHA 1EWRA 1E9SA 4TT3A 2CL0X 1IN7A 1J99A 2VSFA 4YMWA 4OQFA 4P3YA 1AK2A 2ZAOA 2GXSA 2VP9A 3R20A 2FSFA 4YMTA 2VRWA 2RGEA 4KBFA 3ONWA 3LWNA 2JATA 2X2EA 4JYBA 3U61B 4OKSA 2ORVA 4IOKA 3G5UA 4V0ME 3Q85A 2F1JA 1Z83A 3W5IA 1WBDA 2IYTA 3GMTA 2Q3FA 3TRFA 5AJVB 1W36D 2OCPA 4PX9A 3IHLA 1S3SA 2N46A 3MJRA 2A5GA 3LX8A 1OHHA 4OK6A 2J7PA 3ASZA 1IN8A 1P9RA 4IDNA 4O0MA 5EE5B 1QBKC 2C9YA 4MRSA 4TZ6A 1Z47A 4IOLA 4JT2A 2ZROA 1FOEB 1R10A 4BPBA 4POAA 1Z0JA 2FH5B 3CPEA 2RGCA 5EZ5A 4Q7JB 4PPFA 1W4AA 1II8A 3HU2A 3CO5A 4B32A 1E98A 4TYWA 4NE2A 3A4LA 4AG6A 3AGPA 1ZCAA 1IJFA 1KSFX 3JZMA 1IONA 1FNMA 2FF7A 2HCJB 4KSBA 3TAUA 3I73A 4AG5A 5EXTA 4TYPA 2P2LA 1GKYA 4PHHA 2VHUA 2ZS7A 1XCGB 2GK7A 3O8DA 3RRYA 4B48A 5JMTA 1CRQA 1KK3A 1MABB 4PTLA 4P31A 2IA5A 1Q44A 4D0NA 4DLWA 4YMUA 3CR7A 4MUBA 1FUKA 1PV4A 1T8TA 2P6NA 4WVFA 3H84A 4ZKEA 4PHFA 2Q0HA 3LAWA 3CRMA 3GJXC 4EPRA 3R9WA 1AS2A 4B2LA 4LC1A 4S35A 1VCIA 3SJAA 2IYVA 1W2HA 3WY9A 5KU1A 4YXWA 2OAQ1 1B23P 1AJEA 1NP6A 1VG9B 5G3ZA 4HUTA 1II0A 3SJZA 4D25A 4GPTA 3WHLA 1E1RD 2P65A 3FPAA 3OE7D 4A82A 1VCMA 1MT0A 3PV0A 4QNMA 2D06A 3QJYA 1TQ2A 2XTNA 4UXJA 4B75A 4C0QC 1UADA 4OHVA 3EZ6A 4C0SA 3KXLA 4XVQA 1CIPA 3KFXA 1E2JA 1JJ7A 4LI0A 2OT3B 3B78A 1NY5A 4EAQA 2KSQA 5F3WB 1DG1G 1OT3A 1IQPA 1TL7C 2JGNA 2ZITA 4DUGA 1E0JA 3KXIA 4Q9JA 1G4UR 2C5LA 2KB0A 2F3RA 3EXAA 3L2OB 1LS6A 3QXSA 4TMZA 3RC3A 2QP3A 5GADl 2H7VA 4X8LA 4ZCLA 4HZUA 5AJXA 1NMYA 4UNNA 4F4JA 5J47A 5B30A 2VA8A 2EW1A 4JLVA 2J45A 4OQLA 4MGZR 4N3NA 4M9QA 5TXGA 2A30A 1YZGA 1J2JA 1EX7A 1H8HA 4TL9A 2WSSA 2CCGA 4PZLA 2DHRA 2BC9A 1OH6A 1NJGA 4JS0A 5B64A 1E6CA 2VIIA 3IPXA 4PPNA 4AD8A 3KUDA 4TMKA 2F9LA 2ZYWX 2Z43A 5DNYB 1R0XA 1C9KA 4FCVA 4XD7D 3GLFE 4IVPA 2NO0A 1W5SA 4RZXA 1E2IA 2R6CA 3B1WA 1YHNA 3R7WA 1C1YA 2QNRA 4MRNA 4AWXA 4LJ6A 5EP4A 3R8FA 1MO6A 1Q57A 4YQFA 1XMVA 3PUYA 3K70D 4JLOA 2ZI7A 3NIBA 1T8UA 2BM1A 5H70A 3R9IA 3A1UA 2OCAA 1HH4A 1JPNA 1T0JB 4PC1A 4A6PA 3RLFA 2JLVA 1EFUA 2VHCA 4BE7B 4HAXA 3GJ8A 3IILA 3SE0A 3QPUA 4EJSA 3THOA 2JLZA 1JBKA 2WKPA 1CTQA 3NEYA 3TUZC 5SZKB 4BASA 2FFQA 2RKOA 2AD1A 2VSXA 2D2FA 3EPLA 3NDPA 1XD2A 2HXYA 4I1SA 2CLCX 1XTSA 2HLDA 1ZD8A 4A0GA 2FZLA 5TARA 4RSGA 3K70C 1EFCA 4GNKA 2GEDA 4QFMA 1JECA 4FMCB 4U7DA 4G5OA 1DAHA 3CX7A 2H18A 4KXFB 4NYJQ 2GBLA 4C3ZA 4JLJA 1NSFA 1N25A 4CEIB 1KTVA 5L3VA 3IGFA 1OV4A 1US8A 2IUTA 4CT4B 4FWIB 1Z0DA 4TL8A 4KVGA 4LJAA 3GLIB 2ZRKA 1ZD9A 2J7KA 2GTPA 3QVUA 2OBMA 1GL9B 1GL7A 5FFMA 2QPTA 4O2LA 3GP8A 3LRPA 4OHYA 1Z07A 3HDTA 2H92A 4WZAE 3U7HB 1VHLA 1E9EA 2CLSA 1AGPA 4GOKA 1S8FA 2WWYA 3LV8A 3K09C 4M2LA 3RHFA 2ODBA 4F38A 3AP1A 3AP3A 2FFBA 2CHQA 2FSIA 2XITA 2WMNB 4X8HA 1IM2A 1NLFA 1KO7A 3QF7A 3REFA 3DEFA 2IYQA 4GRAA 1Q1QA 1QVAA 2VYFA 3UIEA 3B9QA 1BIFA 1FZQA 1IY0A 3TIFA 3KB2A 2J0SA 3UMRA 2G3YA 2B92A 4ACAA 1WBBA 4HB2A 5FL7A 3A1SA 1P5ZB 4TLCA 4NTZA 5UKDA 2HF8A 2YZ2A 3DKVA 3K0SA 1I2MA 3BFVA 1UKVY 3U4QB 2X77A 3GJ4A 1YR8A 1G8FA 3MGCA 3QKRB 3BB1A 3QIAA 1IY2A 3A37A 2LKDA 3VKWA 4MQBA 2NZ8A 3ZQJA 4C7OA 1VYTA 2YOHA 2QROA 3IQXA 4PSKA 4AURA 4PPQA 1OYWA 1TAGA 2VEDA 4QBGB 1E2EA 3R9XA 3LXXA 5DI9A 4D82A 4US2R 2G77B 4GZMA 4IFEA 1NF3A 2YHSA 2OEPA 5HCNA 2QMEA 2Z6VA 4NMMA 4DCSA 1XXHB 4DVGA 4RCZA 5FR1A 1ZM3A 3GEIA 4HB3A 4Q7LA 1EX6A 5DYIA 2GEVA 3QKRA 4Q02A 4NYIQ 4Z1MD 2V6JA 2GESA 1W49A 3BXZA 3W90A 4BZPA 1N2CE 4V0OA 3RWOA 3CPHA 1M7HA 2E1RA 1H65A 1XDBA 3FMIA 4LC0A 4A8JA 2JDID 5AUPB 5EJEA 1DO0A 2D7DA 4LCBA 4LHYA 4BUJA 4NCNA 2C2HA 2RGBA 4TMXA 5TMPA 4AYXA 1GITA 3K0AA 1OH7A 2SHKA 3PCRB 4DB2A 4M1YA 4FINA 1Z5ZA 1I2DA 2Z4SA 3TSOA 5HE8A 1MO3A 4Q01A 1OIVA 1CR4A 1QDEA 1CR2A 2W0SA 4A0FA 1KO4A 2A2ZA 4RZ3A 1XMJA 4ZCIA 4PO1A 3TNFA 1XPUA 5SZIA 1SZPA 5CB6A 2ZSDA 3EWSA 3NC1C 1W0JD 3A1TA 3GEHA 4QM7A 3E2IA 2OLJA 4M9XA 4NONA 4KLNA 4GP7A 1E4YA 4DIEA 4E09A 5DISB 1E4VA 1XP8A 1KYIA 3FE2A 4LBVA 3LA6A 4Q7MB 1J70A 3VR1A 5CJ2A 2ZRAA 1F6BA 1OIXA 2J87A 2N42A 2ZJBA 4TTPA 4TTRA 5C46F 1JR6A 4MRRA 3CZPA 1KDTA 3WRYC 1NIJA 4ZIRA 3N5CA 1L4UA 1NKTA 1R0YA 1XTQA 4XWAA 2X1VA 3SYNA 2CHGA 1MR3F 1KAOA 1N5JA 2O8CB 3DPUA 2DWQA 1G21E 4D81A 3L0PA 3NXSA 1JR3D 1YZNA 4MKFA 4DLVA 3NBZC 3GQBA 3B60A 3E70C 2W6JD 2B8TA 5FUXA 1OE0A 3BC1A 3GLHB 3MSXA 3NBFA 3THYB 3VX4A 4U5XA 1TADA 3OEHD 4A36A 1YR6A 3A1WA 3BOSA 4M21A 1R5NA 3V4RA 2ORIA 2UKDA 3GEEA 3F8TA 3AKDA 5KPDA 4B3XA 4RKFA 2IL1A 5AJWA 4HZIA 5IK2D 1OH8A 2J0QA 2QENA 4ZDWA 4Q18A 4BFUA 3F3YA 4OI2A 5IRCD 2QG6A 1WCV1 2DFKB 4DXAA 2V6IA 5DYGA 1N0VC 3DOFA 2XGJA 4FXPA 1FNNA 1CLUA 2NPIA 1SXJC 1G9XA 2RHMA 1Z29A 2V7QD 4Q4JA 2GK6A 2VH5R 4RVCA 2OBNA 4BRWA 4ESVA 1GILA 2HUPA 2W58A 2C8VA 3Q5EA 4JL5A 4R2IA 1U8ZA 2ZI5A 4E22A 2F6RA 2DFTA 2RHDA 4LY6A 3GLIA 2B21A 4B6FA 3Q7QA 4C9BA 4DLUA 5FUWA 3TBKA 4MDFA 5FOXA 1G7TA 1VYVA 1XTJA 1X8KA 2GCOA 4EFMA 1XEXA 3LW8A 3B1YA 3FKSA 4RCYA 521PA 5LPNA 1AQUA 2CCJA 4Q7KA 4Q47A 1A7JA 1GRNA 2D3WA 4JVLA 1OXUA 1NKSA 2GCOB 4YC7A 4AKEA 4DB4A 1NN0A 1PUJA 2OE2A 4D4JA 3SU8A 3TGPA 4DEYA 2C96A 3T1VA 4E07A 4RD1A 2CXXA 5C1BA 4YDHB 1U90A 3RS2A 3SBDA 2A5JA 3ZD6A 4TLBA 3ICQB 2J5XA 1K5GA 2JCSA 3EAQA 4CRWB 3VFDA 4B3GA 1OIWA 1KDOA 3J81k 4XSGA 4V02A 2CVHA 4NL4H 2ZJ2A 5FPHA 2O8BB 1JJVA 1IHUA 2IF2A 4PQFA 1R7RA 2EYQA 4LBZA 3I92A 1WQ1R 3VHXA 1N0WA 3WHKA 2IF0A 5JI3E 1W0KD 1XD9A 6Q21A 1EFTA 1LNZA 3CRRA 3MWJA 3LD9A 4URUR 1F60A 1NVWQ 3M4YA 4M1TA 4UNQA 3K9HA 1Q21A 1YRAA 3WXMA 4JKIA 1U81A 3SBEA 5JLJA 3ZZ0A 1D2NA 1PLLA 2IHBA 2F1HA 1SULA 1XEWY 1DADA 5DN6D 4C7OB 1E2NA 2AD5A 2WJYA 2R2AA 2A5YB 4IXNA 4Q1EA 2YV5A 3QKSA 2ZJ8A 5E7IA 5AUQA 4B2PA 1N6HA 3T5DA 2IS1A 5EQTA 2KBEA 5TDHA 4DZZA 4C2UA 1R0WA 1JR3E 1KO5A 1T5IA 3WMFA 1EFRD 1S2MA 1XD2B 3ZYCA 3ADBA 3OAAA 4D0LB 5CIWA 4NYIR 1EK0A 3WMGA 1O3YA 2V9PA 2QU8A 2MMGA 2OFOA 3LX5A 3PR1A 1RYFA 4JSYA 2CVFA 4L16A 3S1AA 1QHYA 5KPJA 2C04A 4LPSA 1JR3A 4ON9A 3ECCA 1BYUA 4CF7A 3KKQA 3PUZA 4D26A 3RS5A 3N2IA 1XCMA 2FGKA 2YWFA 4KU4A 4C0LA 2IYWA 1KIMA 3O47A 3C8UA 2Q21A 5L3SA 3THWB 2PLRA 4KCGA 2FE4A 2BMJA 3VNUA 2J0UA 3PUWA 1II9A 4JJZA 1OXVA 1E9AA 2DFLA 4GOXA 4TWZA 4O2RA 4QHTA 2J1LA 3N2EA 4AKHA 5FUVA 2O5VA 1GVNB 1FX0A 1S1CA 1GDDA 2CE7A 4LYAA 3WYFA 2HXSA 1KKMA 3TR0A 2RMKA 2VTKA 4YDSA 2NG1A 4HLUC 2B8WA 3QG5A 4OI0A 3ZVNA 4Q4LA 4C4PA 3K0CC 5K8IA 2RGXA 4QBIA 3U3RA 2IX3A 4DT1A 1X8JA 2KBFA 2QAGC 1AA9A 2ATVA 3MCAA 4B43A 2W0MA 1UBCA 2ZRLA 5AUNB 2PMKA 1P2SA 3LO5A 1S4QA 1T91A 3RWMB 3RVBA 2VHTA 3T12A 5ELXA 3QQ5A 1GIAA 3ZIAA 1JAHA 3DOEA 5LD2B 4D80A 3U3KA 1BMFA 4E03A 1N6PA 2ECKA 1G8HA 3CRVA 3EZ7A 3T5GA 3GLHE 4GFDA 4M9SA 3RRNA 2QL6A 1IXSB 5FL3A 2BKEA 2ZRMA 4ZIRB 2JLQA 1AKEA 1J8YF 3TKLA 2EFDB 2GRJA 3KX2A 4LJ8A 1ZUIA 3BFXA 1PZNA 4HDQB 2ZSEA 3K1JA 4CDGA 3AKYA 3W6OA 5F9FA 3C5HA 2G0NA 2AXNA 2QSZA 4H1UA 5DN6A 4M1OA 1ETUA 1YU9A 1RRFA 2J0VA 2XNDA 3ZD7A 1D8TA 1GKUB 2QGZA 4LV8B 3U5ZB 1ZYUA 2RGNC 4PPGA 2C77A 4EPYA 4P4UA 1OFTA 4PAOA 5DGXA 4ZDIA 3TQFA 3KTAA 1E2GA 4FMDF 5FBQB 5FOSA 3QE0A 1KSGA 4KYUA 4W7SA 2ZVQX 3BORA 2ZUBA 2Q9BA 4M1WA 3GJ7A 4Q48A 4HAZA 5HPYB 1EGAA 1XTRA 2QSYA 1BMFD 1CULC 2OAP1 2FSGA 2ZS9A 3FOZA 3IIJA 2CCKA 2P5TB 3U44A 3SDZA 3T06B 1FW6A 5KDDA 4G01B 4MGKR 1JQLB 4C0JA 5IT5A 4JL8A 5DLQC 3PXGA 3WP0A 2G83A 3QKSB 1KO1A 3QPVA 1W4CA 3HYTA 1DOAA 1SHKA 4M0LA 4V0NA 2X2FA 3AF2A 4B76A 4Q4AB 5H1YA 5GJCA 3TVTA 1L2TA 1PLKA 1E94E 1XBTA 2HJVA 3NHBA 3UWKA 4ZCMA 2F43B 2I4IA 4FCTA 5FTKA 3I4LA 4LX0A 5KNCA 1WXQA 4A1FA 3SN6A 5HKKD 1VG0B 2IC5A 2QMHA 2GDJA 2KJQA 2ERYA 2Z83A 3Q7PA 5KDLA 1M8PA 1Z6TA 5TB5A 2PEYA 2IBMA 3GCGA 3KKNA 4JLNA 5TY0A 1OXTA 4K8OA 3AVOA 4G5RA 3BH7A 1U94A 2PX3A 3KXKA 5BYKA 3CUEF 5E4FA 4LZZA 1W0KA 4F91B 2GILA 2GF9A 1ZM9A 4IOJA 2ZRGA 5EUMA 5G53C 3RNLA 3GPLA 2ASEA 4QGFA 5AWFC 4L8GA 3RABA 3AVXA 2ZUDA 3WYAA 2G1JA 1UEJA 3MWKA 3AQ4A 4A8JC 3ZZTA 2CL7X 1A5TA 2IHYA 3NBXX 5BYJA 1VTKA 2Y8EA 1E2KA 1CR0A 2VP4A 4Q4JB 2ZPTX 3AUXA 5HKKA 2WM9B 4JBWA 1UF9A 4DLYA 2BWJA 4RFSB 3K9GA 3O8CA 4C0AC 1A2KC 1VDZA 1E9BA 1E0KA 3CNNA 3UATA 3L0OA 1JQJC 2BOVA 4MGYR 3GFTA 1SXJA 2UZ3A 3C5CA 5TV2A 3W6PA 1GM5A 1I4LD 1FQKA 1Z0KA 1E2PA 2DCUA 1KY3A 1LS1A 5JHGB 4FI3C 3ZGXA 4H1VA 4M1MA 5J4VA 4KODA 2CDNA 5L8VA 1ESMA 3PEWA 3DVLA 3IHWA 1CEEA 2ZXUA 3KZ1E 3PEYA 2QM7A 2B7CA 4V0LA 2OFXA 3QNUA 1XD8A 2NO6A 1AZSC 4XWOA 1G3MA 2ZE8A 5FOTA 1MO5A 2G1KA 2REXB 3EIEA 3P4XA 5EE0A 3EC1A 4PC7A 4CW7A 1YZUA 4I1OA 4BLTA 1G6HA 2GF0A 2WJGA 3K0EA 3RDPA 4K81B 1ZC4A 5SZHB 2FGJA 1E1QD 2BBSA 1N6OA 3I72A 1NN5A 5JHHB 5LD2C 5BN3A 3H0KA 2BDTA 4KFTA 3OIYA 2BHRA 1LF5A 2CE2X 2IT1A 4DLZA 2Z5FA 1F5NA 3ZS9A 4FN5A 1CJKC 4PAQA 2CJWA 5EXXA 2A5DA 2PMDA 2FFAA 4P4TA 3AV0B 2ZIAA 4HSEA 1Q1ZA 1JB1A 1UM8A 2PZFA 2VQSA 4M4SA 4F4IA 1X1RA 3AF1A 2K5UA 3X1ZA 1T3LA 1EFHA 1U0HC 4BRUA 3B5JA 2VF7A 3LVRE 3LW7A 5C4MA 1P62B 4Z54A 3RYTC 3CWZA 3UKDA 2C99A 4N0DA 1S96A 3S1AB 1WMSA 3BAFA 4OI4A 5HE9A 3V00A 4RFSA 3WNBA 3TSWA 4ZKDA 4TN1A 2WJVA 3I32A 2QMOA 1IJEA 2VPPA 3I5XA 5EE9A 4LDJA 1G41A 2OCBA 2DWOA 2FMXA 3AVPA 1V5WA 3VU9A 4FMCF 3OFND 1D5CA 3IQWA 5EP1A 3A58B 4PC6A 3QKTA 4PXAA 4UJ3A 3WBJA 4AYWA 2V4ZA 2O8EA 1U99A 1NVXQ 4MRVA 4D2IA 3GLFB 4C2TA 1WB9A 2UZIR 5JI2E 3VQTA 4GOJA 5JJLA 3JVVA 1GZSA 3IEUA 3SJBA 3D31A 4DCNA 4GMXA 1E0AA 1RPZA 1NVVQ 2CEAA 3LVQE 1QZXA 5BN5A 2FPKA 2WPDA 5FI1B 1F2UB 4R7ZA 3WP1B 1TMKA 5AJYA 2FWRA 2ZR9A 4G0NA 2EWVA 1OFHA 2V55B 2YNMA 3M0EA 5KDOA 1YRBA 4YMSA 1ZU4A 1MRSA 3EIHA 3WMEA 3SQWA 1CU1A 2ZR7A 3HJNA 1TF2A 2YWGA 3HR7A 4IHQA 4NKRA 4HDCA 3NWJA 3EPKA 1DAEA 3ZVLA 1G8GA 2BMEA 4JLKA 2ORWA 1KI8A 5JWHA 1R5BA 1XJCA 2AHOA 3B7GA 1SVIA 5FTJA 2OCYC 2VP2A 1NMZA 1SXJB 4OYHA 4ZO4A 1OYYA 1M7GA 5JZVA 4NBSA 2R8RA 1E1QA 2RCNA 1FFHA 3FMOB 4HYYA 3KKOA 3B8HA 2YOGA 2XZOA 4JMPA 1LTQA 2X19A 3LNCA 4FMBB 4RD3A 4TLDA 3RS4A 3KQHA 1HE8B 1N6RA 3ASYA 3AB3A 2IXEA 3PIRA 4HUQB 4A8JB 3WYGA 5FPYA 5C4GB 2FSHA 4PR0A 2AKYA 3PJRA 3SQXA 1E99A 4XTCS 1EG7A 2P67A 2ZU0C 3QVVA 4CEJA 1CRPA 2C03A 4EIWA 1I4TD 1Z0FA 2Q9AA 3GJ3A 1K6MA 1PUIA 4OK5A 4MUAA 5IK2A 2QAGB 1E2MA 2DYKA 2QAJA 2QTHA 1IOZA 1GRRA 2ZI6A 3Q3JB 1KI2A 1JNYA 4Q00A 4TMVA 4MYUA 5LDDC 2EFEB 4WXRA 4CEHB 1I4DD 2UVQA 5M04A 2RH5A 1S3GA 2XZLA 221PA 2WKQA 2D7CA 3AF3A 1S9HA 2AN9A 1GNRA 1G4AE 1UEIA 3TK1A 421PA 4M22A 4UNRA 4MDEA 3GJ0A 4QG7A 4AY2A 2A78A 3OEEA 2RGDA 2HV8A 2NO1A 1OSNA 4KO8A 3NDBB 1H8EA 3P4YA 4PC3A 4GSYA 3W3ZB 3U7FB 4PO9A 1DELA 2DBYA 5JEDA 4LHVA 4ITRC 1GUAA 3AVWA 2OZEA 4L4UA 1WA5A 3SFVA 4TQ9A 4QGHA 4PSAA 3FKSD 3LBNA 1FP7A 5KYKA 1JXOA 1W0JA 2DPXA 3GLHA 1HT2E 2ZI9A 1RKBA 4JT4A 1QRAA 1IBRA 2XX3A 4JLDA 4MYCA 4QGAA 4QHYA 2BV3A 3KTAB 5D3QA 3CNLA 3SYLA 3QF4A 2QRNA 1W1WA 2V3CC 2AWOA 4B3DA 1XEXB 3RS0A 4Z8YA 4DDUA 5FUYA 1UJ2A 5JBQA 1WF3A 3SR0A 4C0BA 1BYIA 4PZZA 1TF7A 2YVUA 5G3YA 1Y3AA 1AGRA 3RRMA 1R8QA 4HAYA 1G7SA 1Z0IA 1HQYE 2G0TA 2JEOA 5FBLB 5GVRA 3CBQA 3NHAA 4B74A 4GDFA 3FFAA 4G1UC 4H9GA 5FTLA 5EZ6B 2QZ4A 2ZRDA 4MKIA 2JDIA 4P0TA 5CIQA 1Q12A 4LJ9A 2IS6A 2GJ8A 2WWXA 3VR5A 2AKAB 1QHHA 1E9CA 3PUVA 1UBEA 3VMFA 4Q21A 3SHWA 3MG9A 1XFAA 1AS0A 1U0LA 1IXRC 2OXCA 3DMDA 3O8BA 2QPOA 4R71A 2BBOA 2I3BA 1VCOA 3LXRA 2IYUA 3UMSA 4I1VA 2IS2A 821PA 2DB3A 3AF4A 1F2TB 1G18A 4US0R 4ARZA 2WBLC 2O0JA 3CH5A 2BMDA 3FB4A 3VAAA 5C2JB 1NN3A 4OK3A 2BIFA 4BLSA 3GLIE 2CK3D 2WTUA 3RC8A 3FDIA 2XOKA 3JZAA 4BFYA 2W6IA 2JLYA 2BJWA 1T3HA 3K9LA 2ZRBA 5AUOB 4P4SB 3GJ6A 1W47A 5CITA 1HY3A 1NLZA 2PCLA 2XTZA 2DR3A 3K0FA 4QKQA 1NG1A 3PITA 2ZJZA 4TZ0A 1KJWA 2WOJA 2ZRCA 1KNQA 1WE2A 1Z3IX 4MYHA 2ZRFA 3BD9A 4DLXA 1P2UA 1S1MA 5AJZA 2QM8A 5KO2A 4Z8XA 4B3CA 3RANA 2Q3MA 2GJSA 1KI7A 1KI4A 3BH6A 2REOA 2ZREA 3NH9A 4OQMA 2P6RA 4QRHA 2FV8A 3UK6A 1F2UA 3NTUA 5E95A 3IKJA 1NNEA 3PEUA 4BQSA 3P26A 1KSHA 2ERXA 2I1VB 2O8BA 4RZUA 3P1JA 2R6FA 2WWIA 1JEEA 3LQQA 1RJ9B 2BBWA 3QEOA 3NH6A 4XH9B 1FL9A 1XTKA 5JRZA 2JA1A 4O3MA 1RVDA 3CM0A 3A4MA 1U2RA 1DE0A 2AX4A 4IVQA 3CZQA 4JL6A 3BS4A 5CYOA 1R4AA 4JBYA 3CRW1 1CKEA 1COWD 1MKYA 2O8CA 2WMOB 4KYIB 1Z22A 2HLDD 1RJ9A 1EWQA 5BW8A 3K0CA 2ZRPA 1ZBDA 2LWIA 3GJ5A 1R6BX 3VTKA 4QJ3A 2ATXA 1AM4D 1G5RA 1VYUA 2HYDA 3EARA 2QP4A 5SZJA 2QBYA 2PH1A 5C18A 2O8DA 5B57C 1CP2A 4OL0A 2RGNA 3IO3A 2ZRIA 4NYJR 4DSUA 1S0UA 3TQCA 5CM8B 1ZCBA 3ADKA 5DE3A 4ASUD 4HAUA 4TYYA 3F0TA 2XXAA 1OF1A 2C78A 2CBZA 3O8RA 1A1VA 1CJMA 2WSMA 5CM9C 3X1DA 1HEIA 2WWWA 4M53A 4WZBE 1UAAA 1ZVQA 3UWOA 3U60B 4YLGA 1ZM4A 2ZRHA 3IEVA 2GAAA 4BEJA 3CF0A 1QG4A 1R8SA 4NHOA 4PHGA 1G291 2IK8A 4BWYA 1W4BA 3IPYA 1O87A 3D6TB 1E9FA 4DT1B 1BO6A 1W46A 2CMKA 2F1RA 3CX6A 4BLPA 2GETA 4PC2A 1FQJA 3PUXA 1KO8A 1G16A 1RRGA 3MMPA 3ZVRA 2V8OA 5CLLA 3VR2A 5K8LA 2IUUA 4Q1AA 3X2SA 5JS8A 2FG5A 3BH0A 1Q0UA 1MRNA 1SXJE 4RFVA 2V54A 5EXSA 1ZIPA 2CJWB 1W2GA 3OIUA 5LB2A 4LBWA 1DO2A 3FWYA 2OHFA 4F4CA 3KQUA 3MD0A 1OJLA 5DH9A 3LLUA 3ADDA 2ZI3A 2FZ4A 2YC4C 2CHVA 5KNBA 1XMSA 1E9DA 5CDFE 2QE7A 4KV9A 1G3IA 2VP0A 4F92B 2HT1A 3HP1A 1RFLA 3TUJC 4QOSA 1JEDA 2BVNA 2ZTSA 4BECA 5CK5A 3AH8A 2NIPA 2W6ID 4QHSA 3Q8XB 4IJMA 4W5JA 1E2FA 5L3SB 5EP2A 2ZANA 1ONBA 2JJ2A 2OG2A 3U7GA 1EFRA 5D3MA 4WOPA 4NZYA 2WOOA 1E1RA 2EFHB 1XX6A 3BB3A 3C7KA 4IDHA 4PQRA 2GJ9A 1KI1A 3ZIAD 3JVUA 4WW0A 5FBVB 3THWA 4A9AA 3EZ2A 4EKDA 4LJYA 2NGRA 1KZGB 3AVVA 1J90A 2Z0MA 3ADCA 4OJKA 3ZS8A 1TTTA 1N6LA 4CVNA 1ZP6A 1T4GA 3T34A 2XNSA 2W6JA 1YE8A 5K8TA 3AP2A 1G8YA 1OFUX 1W5TA 4UNSA 4ZV4A 1E2DA 1RW4A 4Q9LA 4B73A 4NCKA 4KSCA 5TVKA 1N0UA 2G88A 2YWHA 3WBKA 2LCFA 721PA 3I62A 3ZQ6A 1SHZA 2CNWA 3ND8A 4DDTA 1DTSA 1XEFA 4MRPA 3B2EA 1HURA 3CR8A 1SQ5A 1ZM7A 2WWGA 1XXHA 3U3MA 3IIKA 5L3QA 5BQ5A 1P7CA 1UFQA 1ZM2A 4MKHA 1II8B 2WSSD 1Q1BA 3AM1A 1OXXK 5J4KA 1F2TA 2VHJA 2ZYTX 2ZSFA 4UJ5A 3PFIA 3M6AA 4NYMR 1AN0A 4JKYA 4BEBA 2H5EA 2J41A 3BB4A 2PT5A 4O25A 1E79D 2WWFA 2J59A 4Q9KA 5GJWC 3ZZUA 4A4DA 1LFDB 4B3BA 2IS4A 1Z6YA 3OESA 3MFYA 3UXMA 3BFKA 2GKSA 5KSYA 4ZDJA 4P33A 3BK7A 3NG1A 4D0GA 2O8FB 2CLDX 4ASUA 5HCIA 4LUCA 5FH9A 4B33A 2F3TA 1Z2AA 2EWWA 4B44A 2ZSBA 4Q4AA 1ESNA 1W36B 4NPHA 2XSZA 2REBA 5BN4A 4JBXA 2PL3A 5CDFA 1XPOA 2WIAA 1T3SA 3GLGE 1GRQA 1G3QA 4N1AA 4TSFA 3CWQA 4A15A 1DS6A 4CEJB 1UKEA 2F9MA 2H8KA 4D4LA 1Q22A 3BWDD 3EASA 3L82B 4BZXA 4YXWD 4IDQA 1TEVA 2J7PD 2JASA 4WA7A 1XTIA 3UANA 2MMCA 1KSJA 4WAUA 1OKKA 4Q1DA 3AVYA 1DARA 2QE7D 3SEAA 4JIMA 3X1YA 2J3EA 3BERA 3NBYC 1LF0A 1QHGA 4JLPA 2C95A 3K0AB 3TVDA 5FI0B 1ZINA 1SVSA 3BE4A 4LV6A 5F9HA 3QEJA 2R6GA 4UXIA 4RKEA 4Y0VA 3CIOA 2QMUA 5B58C 5F2EA 4XJXA 4BFXA 3Q72A 1JAIA 4G5SA 3L0IB 2WZQA 2ZJAA 3UMFA 1QHSA 3L8YA 1NI3A 1E2QA 4IVRA 4ILEA 2EU8A 4TL7A 5JJKA 2H57A 5DI3A 1GWNA 3K70B 3B6EA 2NQ2C 4KBGA 3DMNA 121PA 1NG9A 4G3XA 4MKGA 2IYSA 4DCVA 4U02A 4LHWA 4JLBA 5AR1A 1GP2A 3IIMA 4XSHA 2C98A 3HU3A 3P27A 3WNCA 3V9PA 1Z06A 1G1MA 3CRQA 1NVUQ 2IWRA 4I4LA 2NPFA 4OJQA 2PBRA 1KNXA 3DO6A 1T0HB 2WJHA 2PT7A 3TW4A 1TUEA 4PHTA 2PX0A 4FCWA 2QQEA 3ZVMA 3LY5A 1XU4A 2Z4RA 2E9SA 4W9MC 4WIAA 1T6NA 1QG2A 3P20A 4RD6A 3RS3A 3TAHA 3DL0A 3B13B 2AK2A 2GZAA 1P72A 2YYZA 4IRUB 1ZNYA 1XB2A 2A7QA 2ANBA 4L15A 3OE7A 1YR9A 1ZNWA 2A3RA 5H68A 3RS7A 4DC9A 1FTSA 1LV7A 1U98A 2VF8A 5P21A 1GTVA 3KJEA 1IN6A 3AVQA 3PENA 1OFIA 4QBHA 4CGZA 4BFVA 1DEKA 4LHXA 4B34A 3EA0A 3I61A 5JS7A 3OHMA 4DEXA 2QI9C 2YINC 3I8SA 1FX0B 4MYTA 1F3OA 1XEWX 1M74A 2G6BA 2OO7A 5FPKA 1OB5A 4UQOA 1E96A 1NSTA 4QJ5A 3DHWC 1XJQA 3B82A 3QG1A 2RAPA 5KOYA 3QOFA 2JJ1A 5KTYA 2E87A 4NCHA 2KE5A 1P9WA 4M1KA 4TL6A 4TT3D 4DCTA 4PAMA 2DWPA 4DKXA 3C15C 1AS3A 3IDQA 1P4SA 4DLTA 2JJ2D 2VP5A 5J40A 1DVRA 2QPAA 1R5OA 2O0HA 5A4JA 3DKPA 2OUKA 3N70A 1BH2A 5BWMA 1E3MA 4ERNA 3D8BA 4PSVA 3MWLA 3A4NA 2XJ9A 3AVTA 3SI7A 2D62A 5GJBA 1FUUA 1AQYA 3TR5A 3VX3A 2OESA 5JSZB 3VKHA 2XJ4A 4A92A 1M34E 1P2VA 1OHHD 5JJIA 4JLMA 1W44A 4OHWA 3TMKA 3W3AA 4IKEA 3QXHA 3AEZA 3TW8B 4PANA 4I1UA 3MAAC 4GP6A 2Q3HA 5JSZA 3CX8A 4FMDB 1YQTA 2JLXA 3QBVA 1VCNA 2VHQA 1T5LA 2GCNA 1P3JA 3NEJA 2FFHA 4LSGA 1H8HD 2VO1A 2FU5C 3E5HA 1YVDA 5L3RA 4KAXA 2OBLA 4YMVA 3TLXA 5JECA 3QY0A 5EUQB 3OF5A 4ACBA 1RIFA 1KOFA 2IYXA 3C41J 4QXAA 1KMHA 1ZUNB 1Z63A 1X86B 4MH0R 3T35A 5FTMA 1IAQA 3U4QA 4DLRA 2GVDC 3RSLA 1N5KA 3VR3A 2QTFA 3SOPA 3ZJYA 1VECA 2O0KA 4OQXA 2JLSA 1IN5A 2ZE7A 1B0UA 3OEHA 3LBHA 3SS8A 1SVWA 3NVAA 5B2ZA 2GAOA 1N6NA 1SKYE 2H16A 4IEEA 4Q1BA 1OB2A 4CIDA 2YKGA 3TJZA 1CR1A 2A9KA 4R9UC 2ZI4A 3V4FA 1DBSA 1U9IC 2BEKA 3IO5A 1ELOA 4A2QA 2P0EA 1OPXA 1KK0A 1SVKA 1UKZA
chains in the Genus database with same CATH superfamily
3N9IA 2FX3A 2G80A 4HD8A 5CLQA 1P2DA 4U6SA 4WXMA 3WB9A 1YZQA 2EQBA 1SG0A 1ORRA 3CO0S 4E08A 4DY4A 2AOUB 4O4LF 4C14A 1M8FA 2EG9A 5LU8A 1KZYC 4GRDA 2XMQA 3VSCA 1PWYE 2O3QA 3HJRA 3L43A 4MQEA 4NDNE 5BUSA 1WTCA 3ICPA 3LFTA 3RIEA 1M2OB 2B2CA 5CURA 3ZZ1A 4EB8A 1BCRB 5ADVA 3IKLA 4X71A 3RKSA 1P5FA 5KSOA 3BSFA 3NTOA 1NQWA 5CD1A 1FP6A 1NLUA 2YXLA 3GFVA 4KO2S 4CLOA 2Z6QA 4KK3A 3B3FA 4JZKA 4ZXPA 1RDFA 5T41A 1VMAA 4E4RA 4H1WA 4FEAA 1P6XA 1L7MA 1SZDA 3I01M 1YZTA 1JLMA 1KH2A 3WK6A 4KPUA 1LK5A 4MA5A 1NLYA 1ZBQA 1PFQA 4MEAA 4PZPA 1DAIA 2D13A 4LWOA 3EVFA 5BO5A 4BVHA 1A9XA 1EESA 1S2IA 2OWEA 4GQAA 3WL8A 1JFRA 4CT0A 1U7WA 2WWTA 4CETA 4LGVA 4KIJA 3WRYA 2Z9CA 1U2QA 3PFBA 2A4KA 1CX9B 4II3A 4M1SA 5FV4A 2PO5A 3QUSA 2H1FA 2MDTA 3TINA 1T2AA 3HLTA 3H86A 5JPDA 2G9RA 4JJKA 3EG5A 4E5PA 1EZ4A 5JO9A 1V7CA 1S9DA 1MA0A 4HNRA 3KVYA 3OT1A 1RBZA 3MRSA 4MUKA 4FWBA 2G6TA 3DO8A 1CJUC 2Q0XA 1W88B 1HV8A 5AICA 1PJRA 3PNLA 3V8EA 2AQIA 2GJ4A 2E21A 2NP6A 2OQRA 3S7TA 5BXQC 3K6JA 1K1EA 2H1CA 1XQYA 2P3SA 4X62B 4FFBB 3DO5A 2DFVA 3C1TA 2WE8A 4BLUA 4OJTA 4J6EA 1AT1A 2X14A 1E5TA 3LBIA 3R5SA 4I4TF 3I64A 5JYCA 2YN4A 1L4YA 5DXAA 2UU9B 1O8BA 1US8B 4R8RA 4CM1A 3EDMA 3ETLA 3HKEB 2ECPA 4FT2A 2P9TA 2JGAA 2ZS8A 1P44A 3BTOA 3SF8B 1F1BA 4WLNA 3TEMA 4Z0HO 5K0NA 3F6PA 3FFBA 3QVOA 3K4PA 4XWYA 2H9AA 3DE3X 5H9VA 1P73A 4Q6WA 2F7SA 4YASA 4XYLA 2WAXA 3B70A 3DZDA 5JEEA 1D9XA 1EXMA 5EHIA 4U7TB 1ANKA 3F3SA 5AM5A 4NESA 5DSZA 2XDYA 3EE6A 3RUAA 2RHTA 1E61A 3KQLA 1PZXA 3HJTA 3F3MA 2DWCA 4EECA 3BRWA 3AGQA 5J4YA 4NNPA 8AT1A 4V0MA 2FOLA 1J6UA 4HB4A 1H2YA 3UMYA 2ZJYA 3H13A 1UJNA 5IYZF 5JCOA 1LDGA 2XB2A 4BEWA 4JI8B 3TNDA 1E1MA 2X8AA 3E9YA 1L1FA 3T6KA 3EVEA 1KHTA 2FP4B 2II6A 5F9MA 3C1UA 3NYIA 3A6EA 2YL2A 1XAHA 4AKSA 1D8AA 5EESA 1E7MA 3IDFA 4LC9A 3RVLA 2PN1A 1RXEA 3HFJA 2PBLA 2AK3A 1SD2A 2J46A 1I24A 3QEKA 2WWHA 4JJ7A 4XGIA 2QP9X 5ERYA 2WY2D 2XZPA 3PHLA 3LLMA 3PGXA 4XD7A 2QRHA 4Q9NA 4DNFA 5LQJA 1HMPA 1R6DA 3OZFA 4GZLA 5EE3A 2BEJA 2BFCB 1EJ6A 1USVA 3UC5A 1QQ7A 3ZOZA 3UBTA 2X9VA 5DHTA 3KLPX 1VXOA 1TMGE 2EP7A 3QU5A 2GZHA 4IVNA 5E7MA 3ZDEA 2ZJOA 1E7WA 4C43A 5K20A 4OP1A 2EJWA 1LPOA 1X87A 3AKCA 4L9WA 3BIOA 4UCWA 1VG1A 2V7UA 3W3AD 4UOEA 1P60A 5C32A 2BZ1A 4NU5A 3ZW8A 2JIZD 1TC2A 1YJQA 1NTRA 3ETDA 3PWZA 10MHA 4XM0A 1E4EA 3I01A 3O6VA 4CU5A 3L6EA 4DSTA 3W34A 4HLQB 5I5EA 2JHGA 2OWDA 1PT5A 1N6IA 1JQBA 3AHGA 3QKWA 4ESOA 3I6QA 3ROPA 1JT2A 4II7A 1HTWA 2JPDA 2XYPA 3A6HA 4ME6A 3RC7A 3PE4A 1G4HA 1XAIA 2QTRA 2XOXA 4P7JA 1FA9A 2HHJA 3RAFC 3HKEA 3QHPA 4TLEA 1G17A 4M88A 4YLEA 2G08A 3FHTA 6NULA 1YB7A 2I29A 3OC0A 2FWJA 1NJ8A 1IBMB 4A0SA 4QU5A 2J8ZA 2ONYA 2MIIA 3FKQA 3IAM1 3EXIB 5C34B 3SBXA 4CLXA 3W0LB 2I76A 1MTZA 4I1IA 5F12A 5TT1A 3TPFA 3WMRA 4AO8A 1HQCA 2WJIA 4D42A 1WUHS 1LY1A 2PZ8A 1POXA 1AHNA 2AR7A 2YC2C 2REQA 1ISPA 3A2NA 4PO3X 4S0ZA 2D4HA 3QLTA 3STYA 5AW7A 4NS1A 3Q6MA 3T9FA 4RD2A 2HO4A 2QUKA 3DWFA 3A6JA 2Z04A 4MINA 3HKDA 4P38A 3FMGA 4BO3A 2X4DA 3OQJA 4M9ZA 4KLZA 2BUAA 1HDOA 5DXFA 2COEA 3K2BA 2FSVA 2AFHE 1Z62A 2ZWPA 4MQFA 4WADA 2R86A 3DFZA 4LGMA 3L1KA 1Y8QB 2P3OA 4DSNA 5KS2A 1NMXA 4GXTA 3VPSA 3KKKA 4X3OA 3NI2A 4C1NA 1C81A 5B7QA 5AVYA 5DXJA 4YRPA 3IUJA 4Y2QA 2IYFA 4H4CA 2FUKA 4JB8A 3V6LA 2XYHA 3MOSA 3WGTA 3NHFA 2INGX 1AB6A 4NP6A 1UDXA 4TKVA 1AB5A 1M72A 1NONA 3CX3A 4HAVA 1L7QA 2PX4A 3K8YA 4B35A 3C6XA 1H4QA 1NP7A 1J7KA 1RT9A 3PDJA 1ETHA 1OWMA 1UPFA 4MJ3A 3PLAE 4HLCA 1NBMA 2D7JA 3W1EA 4CYMA 2B4TO 1XZEA 3LFUA 1VJ0A 1ZHFA 1Z39A 2VSOA 3MJSA 4YDQA 1AHHA 3GAZA 3BBLA 1VKNA 2YVKA 2ZR8A 3HGMA 3QWFA 4DCUA 4JEIA 4BQIA 3EFOA 3FGNA 3H5NA 3NUZA 3N0XA 4YJ3B 5A4KA 2W2TA 3SKVA 1VBMA 3U16A 1GYRA 1X6VA 2ZUSA 4R83A 1JALA 4UFOA 1QHNA 3M9WA 3BL5A 5EIAA 2MYUA 4ZO9A 4D45A 1W96A 3EIQA 1E60A 2FN7A 2X0KA 1XQ6A 5B3AA 1EUZA 3JAWA 4P84A 2G67A 4GWLA 5BQPA 4UTPA 4RMHA 4RX1A 1HYQA 2J9YB 1RRMA 3PRJA 1KPGA 5LZ4A 1I8TA 3ZU5A 3THXA 5DFAA 5I9LA 1N2CA 4HWOA 2ZZMA 4NHEA 1QV9A 2QRLA 4ZVOA 1V39A 5CHEA 1C0LA 4YYEA 3NBUA 4HI0E 4WKCA 3G17A 3PD7A 1GAJA 3VOSA 3OEED 2FVYA 2OLKA 4XA8A 1F2VA 2P5SA 2PR7A 2W00A 3BJIC 4ZPXA 2ODWA 1NBAA 2JIMA 5BSHA 1FSPA 1NY6A 3O2JA 2BGKA 4W5WA 2VJYA 2QTZA 4Y1RA 3SZRA 3KUKA 4LE1A 5ITZA 4IEIA 1O94D 3PRKE 4UEJA 3CLRC 5ALEA 1A7AA 1QIGA 4K7JA 3VR6A 4F7WA 1OTHA 2XY4A 4FW9A 5A6SA 3BE5A 2YN0A 4KQXA 4URZR 4RD0A 4AMGA 4EG4A 5HFJA 1W8DA 2Q46A 2ZYIA 2BM0A 4YCSA 5IHXA 3M1IA 4Y6LA 2VWGA 1U02A 5B4VA 2ZR0A 1B00A 3FYSA 1OREA 3B48A 5IH3A 4A2PA 1QKKA 5EXEA 4AP6A 2VS1A 2AQHA 5B55A 3KQNA 5ALKA 1BU8A 4MV1A 1E0SA 1DXHA 1J9ZA 1JHMA 1G7CA 4G9EA 4N0EA 4DMKA 5A7FA 1C9EA 4DV2B 1P0CA 3IXLA 3LQRA 5J2TA 1J09A 1VLVA 1U9JA 4G5GA 4QUHA 1PR3A 2H54A 2OAGA 2IYZA 4I6JA 2IQIA 5CGZA 3FTCA 3PQ5A 4PFSA 5AOAA 2E4UA 4PO8A 4G4IA 1OWLA 3S2GA 5AOCA 4CUJA 1CXZA 1ZRHA 2CDRA 5HS6A 1TQ4A 1XRJA 1VIAA 4B45A 3V8VA 3CUWA 2PM8A 3ND7A 4OOEA 4K46A 4YNBA 5BNFA 1W34A 5CCBA 1DDGA 4AC9A 2BMWA 4RL4A 4EQ6B 1MCZA 2Y1WA 4JBGA 4LV5B 2YYYA 4WXPA 4XI9A 5ALMA 4NBWA 1SVLA 2F1OA 2IV3A 4CEHA 3FTFA 1UP7A 3MQ4A 4BQNA 1ZK0A 2PUVA 4I4NA 4FILA 3M34A 2FNAA 3LT2A 1RPJA 3F7MA 5CEFA 1DAFA 2WKRA 1HE2A 3ZV3A 1Y1SA 1PQWA 4L5YA 3T0IA 1X7HA 2PX8A 1A96A 1UDWA 1XCBA 4OQZA 3RFVA 2QV7A 5ULLA 3WBBA 4BJ5A 4Z4GA 2GHTA 5FNVF 5MN6A 2HEIA 5IAEA 5PNTA 4BLQA 4H7KA 2HQ1A 9LDBA 4Q19A 5JIBA 3UGTA 1ONOA 1W4RA 2VDWB 1JPJA 4MVWA 4QGBA 4X1IA 1KDZA 3SQDA 2FN4A 2JH8A 4AS2A 1FRQA 1TVCA 1XO1A 4DNQA 4LE2A 1QK4A 2YBDA 3ESZA 4R1SA 4YWJA 4C5AA 2HCRA 5CB4F 3U6KA 1S2DA 1SVOA 2GR9A 2RGUA 4OXRA 4TYMA 4ZICA 3PC7A 4BC0A 5D3MB 5IANA 2CLOB 3RSOA 1OZAA 2GCEA 2HOQA 2JIZA 1EDDA 4KI7A 4BS9A 1WOYA 2X41A 3FZYA 2K7ZA 4KXNA 3EGDB 4AI6A 3O1IC 1DAGA 2DH5A 4G0PA 1ACLA 4HNUA 1T43A 1X74A 2AF3C 4ZI7B 3GFOA 5AW9A 4IFIA 5DX0A 1T5TA 1PWXA 1VL2A 3SIPA 1GPWB 3B52X 1I51A 4IKPA 4LXTA 1HBJA 1T4BA 2BGTA 4Q6BA 2CUNA 1XE3A 3KSBC 2QB5A 4EFNA 4HP8A 1H6CA 1EUDB 2JLBA 2BY4A 2Q4DA 5COAA 4KPFC 4LOHA 3SCZA 1RI3A 2VHWA 2DQZA 2RGAA 1ECFA 4D3ZA 3B1VA 4O8CA 1KK2A 2VBIA 3ESBA 3KPWA 3QLVA 4EATA 3HRHA 5LA6A 4DV5B 2I1LA 1L4HA 2CV2A 2CUZA 1NNSA 3V7FA 4C0HA 3WNVA 1D6MA 3A8TA 4L9SA 3ILVA 3HADA 1WLSA 3PQCA 4LYEA 3HHEA 2D0PB 1Z2DA 4JVMA 4G41A 4ZI2A 3AIKA 4V0QA 5EJ2A 5IC5A 1EX9A 4GR9A 1E9RA 3KOUA 4I8IA 4KQWA 1T4CA 4ZMBA 4RZIA 3WLFA 2HNKA 3ROKA 1VI2A 2HA3A 5BWBA 3GGGA 5F98A 1CIVA 1JHQA 3QPWA 1U0GA 5J5CA 3NZEA 2GZDA 2LVBA 3IJPA 2PBZA 4L9AA 4MK4A 3WGMA 3ZYZA 4LQ4A 1L8AA 4Q3KA 1NTOA 5AQ1A 2LUOA 3QHAA 3HA2A 5BMOA 1YCGA 3QXJA 3EXEA 4TYQA 2CHUA 2F1IA 1AKYA 2NVUA 3EX7C 2MSWA 3GRVA 1QFSA 3RTDA 1I0LA 3GFGA 2HIAA 4Q66C 4F9GA 4KWTA 3ZE8A 4URWR 4ARSA 5EZSA 1Z16A 3PVCA 3H4IA 3K1TA 1DRVA 2Q9CA 3AI1A 4QOFA 3RVOA 8ATCA 1IULA 2YZMA 1X1BA 2XUGA 2MR6A 1Z0AA 4Y2JA 3RYHB 1M0TA 4BLRA 5IWCA 1SBZA 4W5HA 1FBTA 3FOBA 3T3PB 4C5CA 1LVGA 2IYRA 1MXFA 2QR2A 3K0HA 4A6XA 3U7RA 1YS9A 5IBRA 3RIGA 1Y4DE 3N2KB 3RYFB 1W87A 3HU1A 2B98A 4FEEA 2RK4A 3TQRA 2ARKA 2V7QA 3F96A 1WVMA 4JUAA 4Q37A 3H17A 4RTKA 1JHZA 4EFDA 3NASA 1BVHA 4DV1B 2HWXA 3JQ6A 4P8RA 5DM4A 2Y0CA 4QQFA 2OA0A 2CVPA 1E8DA 3S55A 4B3FX 4D3YA 5MHTA 4CHTA 4ZRNA 4QGGA 2WF5A 3KUCA 1CF4A 3JQ7B 4IG4A 3V1MA 4CFYA 3B9RA 5A5GA 4G23A 4L5AA 1G42A 4MA4A 2X0EA 2ZEJA 3D64A 4OH7A 3QI2A 4IHJF 4R0NA 5DWVA 4XZ3A 5JE8A 4ECAA 1MABA 1VHQA 5M5BA 1A04A 2QZZA 3BM5A 4EGAA 4LJ4A 2QGNA 5G40A 4S1WA 4EBFA 4F93B 3UAYA 1A9RA 5AESA 4OBXA 3DT8A 1YE5A 5CA0F 3I05A 3DTVD 5JTUA 4A0QA 5H8WA 1ZIOA 2JJ1D 3LT0A 1JWBB 1QYVA 2G71A 4C0KA 5KTMA 3G2MA 2FPLA 4LJ5A 4C6RA 1G5TA 1BXZA 1ZMXA 2QK4A 3TZQA 3TG8A 2OM2A 2WWRA 3LH5A 2W2QA 1L5QA 2J85A 2H4YA 3MINB 4IIVA 1K88A 4J3JA 5ANRB 5K8UA 4WGFA 5EMHA 4TV9F 1E4EB 3ZHRA 2VPZA 2QY9A 1OC4A 1Z2CA 4Y18A 2IU0A 3U4HA 4CL0A 1PAUA 4LYGA 1XJ0A 4XKJA 4UXHA 4ER6A 1D9ZA 4LJ7A 4LFBB 5A0FA 3VOTA 2R48A 1KEVA 3BKWA 2O8EA 1KIFA 1YJXA 4CT5A 3IC5A 4CQMA 1DHRA 1YQWA 3LDUA 2QW1A 3NKVA 3T52A 3SFZA 2BN4A 1IZZA 4QTYA 1QHFA 3MJHA 3I30X 4NENB 5BWCA 1Q11A 1UDAA 1ADYA 2PRKA 4UC0A 2IY8A 1HMYA 4EH1A 2WVJA 3Q7SA 2HTEA 4K9NA 3W6ZA 4FQ7A 5A5FA 1H3NA 5JT1A 1R2QA 2Z3VA 3F6YA 4DN6A 1C0EA 2O8NA 2VC2B 3FN4A 4IOMA 5FRDA 4M0KA 3WGNA 1R88A 1N8KA 2OFWA 2QQ0A 1WSBA 4LMBA 3RR2A 2XECA 3FCXA 2SKEA 3DAPA 3UG7A 1W1IA 3H1AA 4KQMA 1T0BA 3S0JA 4EW6A 1TYEB 4WZAB 2GTHA 1LW7A 3NC4A 4PE5B 1AGYA 4BO6A 2WIFA 2O8CA 4QXPA 3CVWA 4ETIA 4FDLA 1BVYF 3Q1LA 1R0SA 1FPMA 4Q7EA 4RVOA 3HWSA 3B5EA 3CZMA 2H17A 3HBFA 5HSGA 4CF6A 3OPYI 4K6OA 3L6UA 4NF2A 4J0GA 1E9SA 5EWLB 3E0XA 5G0SA 4KUGA 1JBEA 1FJHA 3DCNA 1T2DA 4TT3A 2LW7A 3WGOA 2DBVO 1Z73A 5ALUA 2GXSA 1NATA 2VP9A 2ZB8A 3R20A 1T8PA 2FSFA 1TM2A 4M8KA 1X80A 1EYZA 2VTDA 3MSCA 3RU2A 2ZXFA 1ATZA 2VEOA 3KQWA 2F90A 2WA2A 2I8CA 2QTVA 4JYBA 5BWNA 1YD7A 4OKSA 2IPXA 3HB4X 1JYFA 1UKBA 3DR3A 3WYBA 1L4NA 4ZJUA 4IOKA 1YL7A 1EVZA 1JEJA 4MUIA 4V0ME 2VK4A 2F1JA 3ND6A 1OMOA 1Z83A 2CXQA 2VOEA 2XXBA 4PYJA 2HIMA 3GUYA 5EMKA 3TXYA 1RWXA 1XTPA 2N46A 2A5GA 1BCSA 1OHHA 3LX8A 3PGA1 5JD6A 3FRJA 3SR3A 4XIYA 3ZWYA 4YRMA 5EE5B 3WRVA 3RT7A 1LBEA 3E3LA 4JT2A 4OHFA 4M0EA 3DUWA 1U9CA 3EFBA 5EIBC 1VCHA 1NW3A 1Z0JA 1NVEA 3M82A 5DHUA 3BHIA 4CCSA 2XA1A 5EZ5A 2LCQA 1J8QA 4PPFA 4GWKA 3N0WA 3HU2A 1NXSA 1ZJ5A 4RENA 1E98A 4TYWA 4HRVA 1ZCAA 4F6RA 1E20A 4DTIA 2HCJB 1NYQA 2EATA 2PL1A 2Q07A 4KSBA 4O2BF 4OHBA 3TAUA 3UJ7A 3UV3A 4BE4A 3U19A 2VI5A 4IIBA 1OZHA 2C0PA 3K2IA 3DFKA 2EXXA 2P2LA 3RRYA 3BJZA 3PL1A 3AOGA 3C7CB 3HSSA 5THQA 4EY6A 4M86A 4B3TB 1P1RA 2XUOA 4P31A 1M34B 4Q0MA 4CTMA 3WIDA 4OU4A 1FFYA 1F4VA 1U8TA 3AHEA 1T8TA 3OM0A 1WHSB 4FU0A 4M98A 5COQA 5CTJA 5EQDA 2CHFA 3RUFA 3BTSA 4G2TA 4R8KA 3CMMA 3ZDXB 3T5TA 4EGQA 4RTLA 2OCDA 2JI6A 2C8JA 3G89A 3EZLA 5TIIA 3KJFA 1RI5A 4PHFA 4RY0A 4CHGA 3QOXA 4LJSA 1TA4A 2Q0HA 4NR0A 2PAFA 3OQHA 1FC0A 4O4IF 4RBNA 4CKWB 5KTKA 3GJXC 5LFAA 5T67A 5LLDA 1XMOB 3CZCA 2VT2A 4PY2A 2DOKA 2GRUA 3NS7A 4QNNA 3EGWA 5CXQA 2RD2A 2G04A 4QWMA 1UPUA 3MXTA 2XCTB 3NUQA 4LFAB 1DSSG 3ADOA 4G63A 5KU1A 3WADA 1I2ZA 3FVRA 1D03A 4IV0A 1B23P 1OUMA 1B76A 2BFCA 3NGLA 3R1IA 4QDOA 3S5JA 5LP6F 5MGBA 4YHBA 4WCDA 1H2HA 4Y98A 4KQGA 3WDKA 4ZMRA 5G3ZA 6PFKA 3Q7TA 3USCS 3DL2A 4ZFNA 2POCA 1Q16A 2P4EA 3PWKA 4NQRA 3OE7D 5TVGA 3ZE0B 4BFLA 4QNMA 1GFSA 3P9NA 5CLIA 3V34A 2ETXA 5I9MA 3F8WA 3WDLA 1UADA 3WKAA 1L8OA 4JR1A 5K0ZA 2OB1A 4MWZA 1XN4A 1GYPA 2F3QA 4MOWA 1E2JA 1JJ7A 4R01A 2OT3B 3GVPA 2AFHA 2LP4Y 1UM9B 3B78A 2KSQA 1PD1A 2JGNA 2WR8A 1E0JA 3PBKA 1OWNA 3L2OB 1NOIA 2C5LA 2KB0A 3EXAA 4TMZA 2OUIA 4JCOA 3WXBA 4B7UA 3UAZA 4D9IA 2W6NA 5GADl 2X8LA 2XUHA 1UJCA 4IY1A 1NMYA 5I01A 4EO7A 3AB7A 4LXXA 1KYTA 5B30A 3DV9A 3NHYA 2X22A 4YREA 2WAOA 2EX1A 1IJBA 4NV1A 5D5PA 4M9QA 4ZQIA 4GKBA 4GUDA 1YZGA 1J2JA 3H9BA 5TEVA 2JFXA 3IR6A 5B53A 1CY6A 4W8HA 1C9JA 2MWMA 3B3JA 2DHRA 4PZLA 3U40A 3I39X 5AOBA 1NJGA 1PT8A 1ZK3A 2QZPA 5B64A 3IPXA 3GEBA 3DG9A 3SF8A 1CEXA 2BFFB 3AI3A 4AD8A 2VXYA 2WIGA 4RK6A 4TMKA 2QUHA 3ICVA 2F9LA 1U4NA 3CSSA 3N6RA 2WNSA 3K8ZA 3BCSA 1BGXT 2W90A 4K28A 3GLFE 2NO0A 4ZVNA 1Z56C 3O7WA 1A72A 2BFFA 3Q8WA 2C84A 1Q77A 3EIXA 2G09A 4X3PA 4B7ZA 5BUQA 2VTVA 4GUAA 4EKEA 1DWOA 1TMOA 1YHNA 2JAUA 4PBRA 3GQVA 4ZOAA 3TW0A 5CNIA 1OBVA 4FOTA 4AWXA 3O4GA 1Q57A 2WC1A 3JZIA 2CBXA 3URMA 1IHDA 1Q6YA 4ARIA 1FYVA 1SUDA 1T8UA 2I66A 3II6X 3GDFA 1CYDA 3DE7X 2Q6LA 4LA4A 4B5KA 5H70A 1M2JA 3R9IA 1HH4A 3DOCA 5ES3A 1Y8RB 3EAGA 1Y9EA 1V5EA 2GK3A 2JLVA 2VHCA 4IJKA 4BE7B 4G8JA 3GY0A 1WXHA 2WJWA 4M9UA 3SE0A 3EFHA 4EJSA 1QLWA 1WEHA 1KYXA 4FZRA 2DTXA 4JR2A 4RTMA 2J9XB 4CMAA 2Y0DA 3WV4A 3TUZC 4IH4A 5KDLA 2FFQA 2OZPA 3FFXA 4BASA 4ARAA 3D0RA 2D2FA 1NI5A 1UBLS 1ULZA 3NDPA 2HXYA 1QZZA 2C2GA 3DDNA 1XTSA 2HLDA 3IAAA 2BFAA 4TV8A 4UUPA 4A0GA 1SG6A 1RJWA 3P2EA 2QVLA 2X2OA 1F8XA 5DGTA 3S40A 3QX8A 1T4MA 3QLJA 4GNKA 2GEDA 3WLTA 2UXBB 4D2IA 1XAJA 3D81A 1DBRA 4AY4A 4PHCA 1FP4A 2GBLA 1AO3A 3D3KA 2PKEA 1ZUWA 4IH9A 4JLJA 1NSFA 5F78A 2H0QA 1DAPA 4R9NA 3S28A 5I7HA 4G56A 3UJPA 4CQMB 1OA0A 3IGFA 1OV4A 1US8A 4UEWA 5AHWA 5HQTA 5K6RA 2NTNA 4FWIB 1M1XB 4LJAA 1W1UA 2HCFA 1RMTA 2HZBA 3IT3A 1U2PA 2J7KA 3LWDA 2GTPA 4MQ6A 3T5CA 2C5HA 1BGWA 2B2XA 2YJNA 1P4HA 3FXAA 3LRPA 3O91A 1IUOA 1Z07A 3HYNA 3GJTA 1RVV1 4LTMA 3CF4G 4ZPJA 2JIOA 4BNMA 3LI2A 3ZGYA 1PS9A 1H3EA 3B6KA 1QIIA 4EUFA 3U37A 1WD5A 4Q12A 3GPCA 4M2LA 2D4AA 3KPYA 5ALSA 1BMDA 4FJ2A 2EKZA 3COSA 4KOAA 2FFBA 3MYYA 4MS4B 4BVKA 3FBTA 1IM2A 2AN4A 1NAIA 5AVSA 5LQAA 2KS6A 3PR2B 2VT7A 1CE8A 4GRAA 3TOVA 4D44A 3PJFA 2VYFA 4XXHA 1R16A 2ZDHA 4RVNA 3ZHYA 1IY0A 3KB2A 4ZEMA 4LXQA 4J4TA 3OLWA 1WBBA 4NCBA 5FL7A 4BZZA 3CISA 4IXWA 5CX1A 4WV3A 1PR5A 1THTA 3DKVA 2OK8A 3LPMA 5BYAA 1CZUA 1RHJA 5IJZA 2ZWAA 1QO0A 1OI3A 5E4JA 2R3SA 1QDUA 3MGCA 3R9XB 1XOIA 2QI9F 3BA6A 2C57A 3GPIA 4QVGA 5BN5B 1IY2A 3A37A 5CVDA 3ZQJA 4MQBA 2NZ8A 3G68A 4GSKA 3DBIA 2Z5VA 2YOHA 2RAVA 3NTRA 2WP8J 4GRIA 1S7CA 2QROA 3IQXA 5IP5A 4AURA 1HKUA 2NU7B 3C3WA 5F7JA 4Y3UA 4QBGB 2CSXA 1E2EA 1BS2A 1ZSYA 3H04A 2QYOA 2FPPB 3LXXA 4OAOA 2RAUA 2PZKA 3ZWXA 4B6PA 5CFZA 3LYAA 4US2R 5C5EA 4IFEA 4CI9A 1SR8A 1NF3A 5AW8A 4HGPA 2PGXA 4DVGA 3KOZA 3GEIA 4NIMA 5HG0A 3QKRA 4OV6B 4NYIQ 4Q02A 1L9XA 2V6JA 5AD1A 2ZRQA 3BXZA 1OQAA 2R1TB 3JCZA 5HMMA 1H65A 3FMIA 2JFHA 4FNGA 1XNGA 3EJWA 1C3OB 5CEJA 5AUPB 1V4NA 5D87A 2PH3A 1O6CA 2YWDA 5EVJA 3ZY3A 5EJEA 3VVBA 3AJDA 4CM8A 2D7DA 4LHYA 1DRKA 3GNTA 2H8GA 1I4EB 2VUUA 4E32A 3GIDA 5JS1A 1I6MA 3QPAA 1FQOA 4RXMA 1T1SA 4OGKA 4TMXA 1U2TA 4YP9A 3TLMA 3ZWQA 5IMSA 5KZMB 2NNWB 1AMNA 1XYYA 2G5TA 3KT8A 4DB2A 4M1YA 3LF2A 1M5TA 1B6SA 3QPCA 2DBRA 2YWBA 5I7WA 5EKTA 1MO3A 2LZ0A 1ACMA 4Q01A 2AR9A 4KX3A 3NO4A 2W0SA 1JG3A 1KO4A 3A9RA 2A2ZA 4RZ3A 1XMJA 3EEOA 5THXA 1GPMA 1NVGA 1U28A 3D3WA 2AA3A 1Y3DE 5SZIA 5CB6A 1Y6FA 1UP6A 3HDVA 4YRKA 3GEHA 4LY0A 3RSHA 2FY8A 1SQ0A 1PNRA 3RTCA 4DCPA 1U0TA 2OAEA 3ETEA 3ES9A 4NONA 1CEYA 1PT9A 1BJRE 3ZGOA 3KS9A 4GP7A 1E4YA 1E92A 5KMGB 1MVLA 2JHPA 1H2WA 5DISB 4BO1A 2Z95A 4KKXB 2BFBB 5K1ZA 1XP8A 1ESCA 1Y3IA 1KYIA 3L93A 1XAGA 4Q7MB 1A0OA 2P9GA 1I9GA 3BZBA 4CMBA 5CJ2A 4RQAA 1DIHA 3C85A 4M9RA 4QLOA 4EHAA 1E58A 3ANMA 3WRYC 4YXFA 2PXHA 2YZKA 4ZIRA 2Q2NA 5ALGA 3MTDA 4DIEA 4EA6A 3B89A 3B51X 1MR3F 2O8CB 1I80A 2IYOA 3GJYA 3DPUA 4M6WA 5KEIA 1IM5A 1DINA 1LLFA 1G21E 4TUYB 3IDAA 4AXXA 1JGTA 2DX7A 4XRRA 5L7YA 1O5TA 3NKLA 3B60A 1DV1A 2W6JD 3BMQA 2GNPA 3HQ4O 3BC1A 3HJUA 3OJCA 4NMLA 3D3EA 4L8FA 3MSXA 5FUXA 3TB6A 3VX4A 2VDVE 3U7IA 1W581 3PGJA 2L69A 5KCZA 3BOSA 2XR1A 4DMLA 1XALA 4MWTA 1UM9A 5JNUA 3AKDA 3SXUB 5KPDA 4PCUA 5KJCA 3T3DA 4Z4CA 4HZIA 5DHSA 1Y1RA 2O54A 1YK1A 3E9DA 1V1MA 2BFMA 2QENA 5HZMA 4RORA 3U3DA 4AMUA 1RADA 1M9NA 3M8KA 2WRZA 4QYTA 5CW2A 4JI2B 1P4AA 3SZMA 2IEBA 1V4VA 4C08A 5ADHA 4FXPA 1FNNA 5DBGA 1F3LA 1CLUA 2ZYDA 3QITA 2WWVD 4AJKA 1G9XA 2RHMA 1L7AA 3ZTYA 5HRUA 3EH1A 1KYWA 4Q4JA 4IDEA 1VMEA 2VH5R 4DJAA 1YTLA 1Y48E 3GUCA 1Q7RA 2C8VA 1XHEA 4ERXA 2Y9PB 3A4IA 2YQ5A 5K6TA 1QK5A 1JVBA 5JZVA 3HWX1 4CLEA 1IJKA 3TMYA 4UM5A 5AVTA 3O4JA 3I42A 2Y4OA 2B61A 1W4ZA 3HL4A 4X7BA 4B6FA 1ZN7A 1A4IA 2WZBA 3ASUA 4MRAA 2B4YA 3TBKA 2P91A 4MDFA 1JHRA 1G5HA 3U3XA 2GCOA 4RCYA 3UHJA 3V8RA 3PYLA 2FLKA 521PA 5ILGA 3VR6H 3W7VA 4D3DA 2JRLA 4WJKB 1SUIA 1X2EA 2XWSA 4H3SA 4YVFA 1RXUA 1IIBA 2AB0A 4E11A 2ZBUA 2RGRA 3TB4A 4DYHA 4CM9A 1OXUA 1SQFA 4U5QA 1LJUA 1W6RA 2GCOB 4P82A 4D4GA 4YUZA 4D8WA 2QM3A 4DB4A 1NN0A 4RPIA 5CA1A 4ZHQF 4W63A 4FOPA 4YAFA 1OFVA 4D4JA 1L5HA 3SU8A 1AE1A 1WKVA 4MSUA 2PY6A 5CCEA 2GM3A 4WNAA 1OA1A 5C1BA 1F0YA 1JKJA 2J5XA 2JCSA 4E13A 4KQ6A 5C7YA 2A1TR 1OIWA 1J9EA 1QHEA 4ZZ3A 1U04A 4BNKA 4NL4H 1U31A 3TLYA 3TZCA 4Q3OA 1JJVA 1IHUA 1Z26A 1AVTA 1ATIA 2IF2A 2MSKA 2NYUA 2EYQA 2Q0SA 3AUUA 3I92A 1WQ1R 4PTYA 3WHKA 3ZDBA 4R1LA 3HXMA 2EJTA 1V35A 1VRWA 3EEQA 4IDAA 4RKYA 5F7OA 2H2WA 2COKA 5C81A 6Q21A 2Q5CA 3W4KA 3LD9A 4UUMA 1F60A 1HXHA 4K03A 1HFKA 1JAYA 1BHO1 1TJPB 3FG9A 4LRSB 2Z8ZA 5YASA 5I45A 3JALB 1PFWA 3M1LA 4JKIA 3D6MA 1U7UA 3ZZ0A 2Z57A 3I4CA 4HRXA 2IHBA 1XQ1A 1PNQA 1T2UA 2P77A 5ARBA 4IXNA 3M83A 4MAFA 3R0XA 2X40A 3A9TA 4L4XA 5DHRA 4DZZA 1CERA 4DQXA 4C2UA 1R0WA 2C4MA 2PA3A 3OJFA 5IDWA 2GM5A 3WMFA 4U9UA 3PQ6A 4ZVKA 1S2MA 2XA9A 4JA0A 3LPAA 2F62A 1JG7A 2XCUA 2AC7A 1U9ZA 1N9GA 2XMGA 2OCIA 3EXEB 5ARCA 3TE7A 1CV2A 2FEXA 3T7CA 4NYIR 2HJWA 2JL1A 1O3YA 5DBEX 1QGOA 4ZVVA 2PE5A 4WOBA 3KB6A 4FYIA 4P34A 1VE1A 2X8JB 4JSYA 5I8WA 3R7SA 3S1AA 1ZKMA 2EARA 2CVFA 3OWHA 4DSZA 5KPJA 3ORRA 1A5BB 3FYUB 3NRJA 3L02A 1XCMA 2Q3DA 3DFIA 4GG1A 2QRGA 5JD3A 3RI3A 2QUJA 2YWFA 2IYWA 1KIMA 2CLFB 4FYVA 4WZAA 3VAZA 2VNKA 1P0IA 4KCGA 5B1EA 1SVNA 3GGSA 2BMJA 2Y68A 3BMOA 1LKZA 1II9A 1V41E 2G72A 1KXJA 3LWZA 5DOVA 4BLVA 3TLBA 5KINB 1REQA 5KYXA 4TWZA 4QHTA 1Z4PX 3N2EA 1DO8A 1N2SA 1O9HA 2GARA 2I7TA 1Q17A 2FZWA 3K35A 2IIQA 2NX2A 2QF7A 4YAJA 4Y1EA 5CPBA 2PQ0A 2FRVA 2CE7A 2W2NA 4KQKA 4LYAA 1Z2PX 3KC2A 3LHSA 4ZMSA 1MEEA 3OCZA 4UDYX 4KR7A 4KXMA 2R84A 4FKZA 4FB5A 5AM2A 1QOQB 4KFCA 4UATA 4KDFA 3O74A 5IBCA 1NW7A 2B3DA 2UDPA 4Q4LA 5DEOA 4DIMA 5BNIA 2OQ2A 3NAGA 1EI9A 5JDIA 3KD3A 3U3RA 2IX3A 2B4QA 3AERA 3E7FA 3T1HB 1CT9A 3EAFA 2BJHA 2BSAA 4EF4A 2V58A 1NF8A 5DCYA 5AUNB 1YZHA 1S4QA 1T91A 2QLMA 3TIXB 3V3TA 2IH4A 2HSWA 3FVTA 1PTKA 1GIAA 2HJ9A 4WLVA 1AX9A 1JAHA 1YT5A 4FGUA 3ZIAA 5JAZA 5LD2B 5JDIC 5U4QA 5JBIA 3LA8A 3C8HA 3GLHE 5AKJA 2FG7C 3NRCA 2QL6A 3OP4A 2HFJA 4CDRA 3RRBA 1SIOA 1ZK2A 4G5FA 2HDOA 3JXEA 3NT4A 1C3EA 2FQXA 5CVVA 3FGZA 2GRAA 3EK2A 3TLGB 3NM4A 2EFDB 2GRJA 3KX2A 1ZUIA 4CDGA 2ZSEA 4ICIA 1OLSB 3C5HA 3W8EA 2G0NA 3T5BA 2J5QA 1D7OA 2P6MA 4M1OA 4Z49A 2ATIA 2JCVA 1SUEA 1YZYA 2XNDA 5KTRA 3ZD7A 2Z2XA 4LV8B 2QGZA 3EUEA 1ZYUA 3KR0A 3C3DA 2BH9A 1Y6GA 4PPGA 2B25A 4EITA 2C77A 2GZ2A 4OATA 1IB0A 3SF0A 1FSZA 4ZDIA 3EGIA 2DVMA 4HN4B 3KTAA 5A3VA 3TQFA 5KMGA 1E2GA 2D1TA 4FMDF 1M67A 5T8KA 3QE0A 2QN7A 3VJKA 4B40A 2UZ4A 5EERA 1YB5A 1JVSA 1V7ZA 3CR3C 4MMXB 3WL7A 1X7YB 1F38A 1ZGHA 2IV2X 4TSKA 1PJ3A 1FXSA 3MJTA 4HN2A 3CLKA 2KX7A 4IKOA 1NWHA 2JFVA 2E0IA 1EGAA 2WZDA 3DC7A 1CULC 4O63O 2WABA 2R5NA 3D8HA 4BNYA 3EH2A 2DM6A 2ZS9A 4KN5A 1NUQA 5AI4A 1XVVA 3F6EX 2BTQA 3E4DA 4RO0A 3U44A 1CDZA 4EX7A 2W2PA 4HWPA 5JXWA 1RWNA 4AROA 4MVJM 4Y6PA 3CUYA 1AKQA