3O1JC

Crystal structure of the tors sensor domain - tort complex in the absence of isopropanol
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
300
structure length
296
Chain Sequence
DEKICAIYPHLKDSYWLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAYEHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSGKTNIALLLGPRTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMGNIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein TorS
publication title An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Signaling protein
total genus 98
structure length 296
sequence length 300
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1jC02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1jC01
2QZJA 3DBIA 3UUGA 3Q9SA 4G0XA 1GCAA 4PZ0A 1TMYA 3EULA 3JVDA 3BRQA 4MS3B 4EVQA 2IPMA 3KCNA 2FEWB 4NQRA 1D2AA 4P98A 5GOTA 2FN9A 2L19A 3OQNA 1A2OA 3H5OA 3LUGA 3JS5A 3I45A 5TQ0A 1NXWA 2E4WA 4Z4IA 1D4ZA 3CG4A 4IILA 1P6UA 1PNRA 1WETA 3HJFA 1M5UA 3M9WA 5IUJC 1DBQA 4W5RA 1ZH4A 3N53A 4O1IA 4D74A 1BVHA 5E3JA 1NXSA 4UHKA 3F6CA 3CKMA 4EYKA 3ROFA 4Q7EA 3GWGA 3EODA 4KRFA 7ABPA 1ZVVA 1TVMA 2WJWA 1DCMA 3OLWA 4Z0NA 4YWHA 2FQXA 3LUDA 4W5TA 1BDIA 1APBA 1XHEA 4KFCA 4MRMB 3O21A 2LP4Y 2OQRA 2R4QA 2WJAA 2AYXA 2O20A 1D5WA 4MLDA 2MSKA 5GQSA 3FDFA 2HQOA 4H3HB 1QPZA 1YMVA 2OENG 1ISRA 3QLUA 1M2EA 1L5ZA 4DQDA 3NHZA 3NBMA 4YLEA 3LKBA 3QLTA 4KQCA 4N0PA 3DZDA 3SY8A 3OLZA 4OBBA 4NCAA 4MS1A 2HQRA 4L85A 2FEPA 4MQEB 1I3CA 4Z9BA 4G0QA 4TLMB 4QICA 4S04A 4KNYA 4MR8A 4KVFA 3RVKA 3TO5A 4KK3A 3H1FA 3MMNA 5T7BA 1E6MA 4RS3A 1UDRA 1KRWA 1DP4A 1MIHA 2HSGA 2JBAB 4F8JA 1JFVA 2E4VA 3F6PA 3N0RA 4MYRA 1AB6A 3OQOA 4UHJA 1Z16A 4FB4A 4MQFB 2VYCA 1JL3A 3O2JA 1Z18A 1QP0A 2R25B 4OG2A 2PUGA 2L18A 3L6UA 5KQLA 1KMIY 3ROTA 4Z4CA 2H0AA 4GNRA 3T38A 2JB9A 3I5AA 4LDAA 1XWWA 3LUKA 1MB3A 2JVJA 1Z26A 1EHCA 3RVMA 4KQ9A 3QX9A 4EYGA 1FFSA 4GPAA 5IUKC 4N47A 3LUHA 1SRRA 5TQ2A 1GUDA 3O74A 5EWLA 3SQNA 4HNSA 2RGYA 4JB0A 2I6FA 4OLAA 2NUBA 4XFKA 2PL1A 3H75A 2ZAYA 4ZYLA 1ABEA 3O1JC 1ZDMA 4D6YA 2PUEA 4TLLB 1TM2A 1RZRD 4Z4EA 3NNDA 5IEJA 1NY5A 1LBIA 3SNKA 1A04A 2QU7A 3IP5A 4ETNA 4RU1A 4ETMA 1H9CA 2B1JA 5KI6A 4ZJPA 4N41A 4JA2A 2BGGA 2KYRA 4KV7A 3OMWA 2HJ9A 1YS7A 2FKAA 2FQWA 1JF8A 1NXPA 5T3YA 2HPHA 4MS4B 5CNKA 2LBPA 3OM0A 1W25A 4MR7A 1RXIA 1P2FA 1U8TA 3FFXA 1T34A 4F12A 3N75A 2CWDA 2PUFA 1VKRA 4JB2A 1ABFA 1DG9A 1U2PA 3DGEC 2PL9A 1RXEA 3KS9A 1OXBB 2ID7A 2PAFA 2XDYA 3M9XA 3OMXA 5CNMA 5FBHA 2A9PA 3KHTA 3FFWA 3EDCA 4Z99A 1QP7A 4MS3A 2PJUA 3H1GA 2FLKA 3QLVC 3H6HA 1FFWA 4PYRA 4Q6WA 4HNRA 5EWJA 4H60A 3MA0A 1RNLA 3GRCA 3QELB 6ABPA 2MYPA 4G0MA 3QK7A 4OLBA 3MF4A 1QKKA 4RK5A 5EWJB 3CG0A 3C97A 1C0EA 1RZRA 1C4WA 3VNAA 1TLFA 2RJOA 2E4ZA 3KTOA 3OLYA 3GYBA 4ETIA 1JFTA 3DLHA 2ID9A 4YP9A 1PEAA 2QXYA 1NTRA 2FW0A 4MRMA 5HM6A 4IMJB 3D8UA 1K66A 4JAVC 5IC5A 2PKXA 4RXUA 3Q7RA 3IDOA 2M1ZA 4ML3A 1M5TA 3TB6A 1ZGGA 2FMIA 3CS3A 4MQEA 5JNRA 4FE7A 4TMYA 1OXKB 1RPJA 2JCGA 2P9HA 3NNSA 4H3KB 1DRKA 3T6KA 3FFTA 4RWEA 2A9OA 3F7NA 5FWYB 1JLKA 5JS1A 4WUTA 3W9SA 4PEVA 3A10A 3KKEA 4XASA 5DLEA 1MVOA 1JFSA 3EGCA 1NXTA 3LOPA 3O1IC 3FMVA 3NHMA 4Q6BA 3JY6A 4G97A 4XLTA 1BA2A 1JDPA 3CFYA 3TMYA 5KWSA 1LK0A 4MR9B 1XHFA 2FMKA 3VNBA 4P1ZA 3HM9A 2JBAA 1USIA 4LE0A 5EWMB 4JP1A 2FLWA 3QEMB 1VPWA 5JNVA 3HCWA 4MQFA 3RVLA 1USGA 2VUHB 3C3KA 1USKA 1DBWA 4G0OA 2J48A 4LE2A 2RJNA 1Z2DA 1EAYA 5PNTA 2JRLA 3NNNA 3LUJA 3TX6A 3ILYA 1D1QA 1JDNA 3MYYA 4YCSA 2N9UA 1ZHHA 5HQJA 2QVGA 2R48A 4F06A 2RDMA 1S8NA 2JVKA 4OATA 1R8JA 9ABPA 4KREA 2QW1A 5CNJA 4HNQA 3OQMA 4LRQA 4XXHA 1DCKA 4F11A 3FGZA 1NATA 2CHEA 3QEKA 1ZN2A 1VLZA 5JNSA 5I4CA 4Y9TA 4KK4A 3A0UA 4RDCA 3RVSA 3B2NA 1E6KA 3GV0A 1FSPA 3IPAA 4NICA 2GI4A 5BRJA 2VUIB 3O2SB 3LUCA 2FSPA 3K4HA 2FMFA 3KLOA 4XARA 2PE5A 3CZ5A 4G86A 1YVUA 3QX8A 2QSJA 5DKFA 4O5AA 5KC8A 1QO0D 4W5OA 1L5YA 2M98A 3T8YA 4MGEA 2IPAB 5BRAA 2PUAA 3O75A 4LE1A 2TMYA 1ZGZA 1SXHA 5ABPA 3Q41A 5JS2A 4MS4A 1ZY2A 1EWKA 2LPMA 2WMYA 4RZSA 1MAVA 5TE9A 1U0SY 3HEBA 1GLGA 1LJLA 2DRIA 2PUCA 1SD5A 2W42A 2FEKA 4DADA 2AYZA 2QV0A 3H1EA 2PMCA 3SG0A 3H6GA 5CHYA 4Z4HA 4RK1A 1PEYA 3G1WA 2JK1A 4N76A 4KPYA 3HO1A 4EY3A 2FMHA 1Z2EA 1JYEA 4QPJC 2JVIA 2IDMA 4OTZA 1DZ3A 3H5VA 3C3MA 3K9CA 4EGSA 1YS6A 4RK4A 2HQBA 5F64A 5HSGA 2A9RA 5IX8A 2R47A 3LFTA 4JOQA 4NV3A 2F8TA 2MYTA 1NXVA 3DGFC 3QELA 4B09A 4ZMSA 5DTEA 1JWLA 4NCBA 4IRXA 4WWHA 5IBQA 5B3JC 3BREA 3HDVA 5HKOA 3JTEA 5CNIA 4RKRA 4IMIB 2L2QA 3MIZA 1E6LA 3EQZA 3I09A 3LUAA 1J56A 1YK1A 1Z17A 2QR3A 2IYNA 4LX8A 3RVRA 1K68A 1Z25A 3P9YA 4TN5A 5C5CA 1CEYA 2NZVG 1QO0A 1B00A 3LTEA 2GBPA 3TD9A 2P4UA 1KRXA 3HUUA 3OO1A 3OO0A 2FXIA 3A3KA 4FE4A 3HVRA 2Q5CA 4YGXB 2MYUA 5KQGA 3EJWA 5FWXB 3A0RB 3SM9A 4QYMA 3BRSA 2GWRA 2WWVD 4ZMRA 1PUXA 3LKVA 2PLNA 1NXOA 2MSWA 1EWVA 3H5TA 4G0ZA 5IUNC 1QMPA 5DCLA 2PUBA 5IEBA 5KC9A 1F4VA 2IOYA 3N0WA 1QQBA 4EVSA 3KYJB 1ISSA 4RY9A 3GBPA 1ZITA 4HYEA 1Z12A 3CU5A 3M6MD 3RVOA 3BILA 3HZHA 3CZCA 5C5EA 5TQ0B 4KMRA 5FWYA 3T95A 4CBVA 1TJYA 3UKJA 3GA5A 4WT7A 3RH0A 2MYNA 4MR9A 3O2QB 4ZPJA 4W5QA 1FQWA 5JNTA 1Y1LA 4M88A 3MQ4A 3QEMA 2E4XA 4RK6A 4KZKA 5BQ3A 1BDHA 3LMKA 5EWMA 2L17A 5TPZD 1QP4A 3HS3A 4F3TA 4JASB 4O1HA 4IGAA 3RVPA 4W5NA 1U04A 4EVRA 1LBHA 1PNTA 4G0YA 5JNUA 1YMUA 2GKGA 1M2FA 3DLBA 4LZLA 2F8SA 4RK0A 4S05A 1MB0A 4WZZA 3RVQA 2WY2D 2B4AA 3JPYA 2H3HA 4RK7A 2IPNA 3SAJA 4IF4A 4YR7A 4RY8A 3QLVA 1YTUA 1LJUA 3H5WA 4MS1B 1CHNA 5B3JA 2LIVA 5IULC 5D2CA 1D1PA 4LDZA 1DC7A 3Q15C 4MR8B 4DN6A 3L49A 1HEYA 4RXMA 1KGSA 1SXIA 2X7XA 1JYFA 3KSMA 4RXTA 4YRZA 2PUDA 2MSLA 4YS6A 3C6QA 1F51E 4RY0A 1SXGA 5KQMA 1GUBA 1YIOA 4YV7A 2GX6A 1DCFA 1JBEA 3IPCA 3N0XA 1YK0A 5TQJA 4PE5B 2NT3A 1URPA 3I42A 4MPTA 3KYIB 5ED4A 3HUTA 3JVIA 4MLCA 3N6VA 4Z4GA 1EWTA 2FVYA 5TPWA 1Z15A 3LUFA 1A0OA 1PHRA 3R0JA 3EAFA 1FFGA 2VK2A 3OLXA 1QNLA 3D02A 4N0QA 4E7PA 5TPWB 4EYQA 1DC8A 3Q7TA 5TPZA 1BAPA 3CTPA 1AB5A 1IIBA 1E2BA 3RVJA 4EYOA 4WXMA 3KJXA 4PICA 2FQYA 3O1HB 4QYWA 3S99A 3EQ2A 5FBKA 3IP9A 3KLNA 3OM1A 4EUKA 8ABPA 2IPLA 2YHBA 3HSYA 5TQ2B 1BDJA 1Z13A 5EWLB 1P8AA 3GBVA 4L4UA 3JPWA 3MM4A 1VRVA 3RQIA 3CHYA 4XAQA 1NXXA 5KQPA 4RKQA 3HK2A 3HV2A 5JNWA 2CHFA 2LUOA 2WRZA 3URMA 2FTKE 3QLUC 4N03A 4WXEA 4YO7A 1CYEA 3ILHA 3IP6A 4RSMA 3N8IA 3E3MA 3KG2A 2IKSA 2YHAA 1ZAYA 3G85A 1JX6A 3CRNA 3E61A 4Z9AA 3HXMA 3CLKA 4RV5A 3GT7A 1W9HA 4Z4FA 3BBLA 2QVCA 3H5IA 4G0PA 3RVNA 2A9QA 4MAAA 4E7OA 1JH9A 1DJMA 3HDGA 1GCGA 4D6XA 1ZESA 2E4YA 3GL9A 2CD7A 2WB4A 1P6QA 3UK0A 1DRJA 3F73A 1JHZA 3OLVA 3IP7A 5BR1A 4MR7B 3H5LA 5DGCA 1DBPA 1U2QA 3Q7SA 3CNBA 2FN8A 5FWXA 1ZH2A 6CHYA 2ZWMA 2NT4A 2NZUG 2V0NA 1QQAA 3C3WA 1EFAA 2E4UA
chains in the Genus database with same CATH superfamily
3MMPA 3QWIA 3UCEA 2PLWA 3BMOA 3AF5A 1Y4DE 1GCAA 1GU7A 3N87A 3PU6A 1TKAA 3GRRA 5TXGA 5DBOA 2PQ6A 1G5QA 4M7WA 1NJ1A 1B43A 4CI0B 5FADA 1WEHA 3DLTA 1SCBA 4G6ZA 2B69A 3I9V6 4KTTE 5GOTA 4KR9A 2FN9A 1NA5A 3SHFA 2BTEA 3H5OA 3JS5A 4LNUB 3HXLA 2DSTA 2P6RA 3SFZA 3TMAA 4DJEC 5EP1A 1M5UA 3JQDA 3V4RA 1DC3A 4KPGA 4W5RA 1GTVA 3HI4A 1L8LA 2BP7A 4W5HA 2Z08A 4EYKA 3GMSA 1PSDA 5ELMA 4DWOA 3DZHA 1KY3A 1M1NA 1SUBA 1RM4A 4Y2SA 4OFXA 3COWA 4DJTA 4Q1CA 3DFZA 2BGIA 3C6KA 5HNKA 1APBA 5BNTA 4MRMB 2WJAA 3GPCA 2Q7DA 1E2KA 1KP2A 3QVOA 1KEKA 1KEVA 3BBPA 1GPKA 3FB4A 5AJXA 5BT8A 3WL8A 4H3HB 1P29A 2MMGA 2IU3A 3IXQA 3RF7A 1FYDA 1LRKA 1T8RA 2VBIA 3PI7A 2EWMA 5G4KA 4URXR 3FDZA 1GP2A 1L5ZA 2ETVA 5LYYA 4LXUA 1E2MA 2B2CA 2JD0A 2YXDA 4IS3A 4DQXA 1FSFA 3RT7A 4WQMA 4MQEB 1EHYA 4BWVA 4OM7A 1PR5A 3IKLA 5HW0A 2Q45A 2DUJA 2QUZA 5JYDA 2BFFA 4FB5A 1PUJA 2VRWA 1FBNA 2IHYA 3SHQA 1DAMA 4DHWA 7MHTA 5EC8A 4MSUA 4DYVA 1EFUA 2FEAA 2QORA 3IUMA 3OZFA 3QITA 4MUJA 2WIDA 1DEXA 1AA6A 1TM5E 3CYFA 5AUQA 4B43A 4N18A 5KQSA 5HEKA 4PHFA 1JEQB 1GO2A 3BTUA 4IEIA 4WLEA 1WA5A 1XRRA 1O4VA 1E6UA 3D1LA 1N2JA 3QPUA 3N0RA 4LQDA 2HDHA 3UAYA 1GAJA 3HGQA 2XE6A 4Y0NA 3NHLA 5ILGA 1N3LA 2XNSA 4FB4A 1JFFA 1RKXA 4O0MA 2HMTA 2JIPA 2MINA 3NOOA 2F1IA 1Y5NA 4E1VA 5KMGB 3SU8A 2HDNB 3A25A 4AAYA 1WPXA 3DEZA 3ROTA 2TMGA 4XW2A 3U61B 1T2CA 2ZG6A 3T38A 1VYUA 1GGEA 2H29A 2QN2A 2K87A 3CURA 3DC7A 1QFMA 3MD9A 2IHTA 1F7VA 4CM4B 1XQYA 1L7OA 4JLNA 5KAPA 4MKRA 2ZI6A 4JCCA 4RF4A 3BHJA 4XIJA 5KTKA 1V3UA 2B34A 2BTQA 5GJBA 3ILVA 4IFTA 3OTGA 1Q92A 3O38A 4E32A 3D6MA 1YS1X 4YAUA 2I9KA 4Q7KA 1DAKA 1P3Y1 1SOMA 2DECA 1G20A 2JAPA 1TEXA 3W3ZB 4OD0A 3JQPA 1T2UA 5GADl 5FPPA 2WFLB 3FI0A 1FOEB 3IQEA 4O29A 4IYRA 2RHTA 3L8MA 3NCTA 3PT5A 2O57A 5M34A 1W34A 3HMKA 2D7JA 3Q5GA 4TLLB 1RZRD 1NLZA 1KBZA 1U9IC 5TVKA 1CQZA 3SEAA 4BJ5A 1XVAA 1HV8A 1AVTA 1QFXA 5KKNB 1J70A 2QD4A 1G6KA 1TPYA 1JQKA 2I78A 2B1JA 2IBMA 2KX7A 1VMEA 2VVTA 2VPYA 2PDAA 4WN9B 3ZS9A 4AY3A 4ZJPA 3I1IA 4UCQA 4EJ0A 2XCIA 2CHVA 3UUWA 2FQWA 4IJQA 5KTMA 2A5LA 5AVQA 2MIIA 4FS8A 2PKCA 3C3AA 2IH5A 2RH8A 4RVSA 5G1NA 1IAVA 4DYHA 3OTOB 3R6WA 1NUQA 1EA5A 5L7WA 1ZOIA 2NYVA 3EFHA 5K99A 4R05A 2ZTVA 1JQJC 4G4SO 4M76B 5FNVB 2GAOA 4XYGA 5J4LA 3M81A 4JB2A 3ORYA 4UU8A 5FTKA 1DG9A 1U2PA 5I9SA 3VH3A 4DDWA 4JVMA 4PG5A 1P7ZA 4BZZA 5L7TA 4EPRA 4JLPA 2GAJA 3U3DA 1CUJA 4E0BA 2P11A 1U3WA 1L1QA 4KQKA 1JDBB 3ND9A 2O0MA 2XXBA 3QLVC 3GGOA 4ND8A 4OHMA 3QX3A 4J3FA 3EPRA 1BGWA 5GONA 2V7QD 4C2UA 1CT9A 2OV8A 4DA0A 4B3RB 2IYRA 2OXCA 3IVMA 3G9XA 2XB6A 1ESEA 4HI0E 4PLHA 2ZUBA 2C5SA 2VHVA 3LC2O 3QK7A 4EKGA 4C7JA 1P45A 3OUZA 2EVWX 1ZC4A 1OH5A 1ECLA 4LJ6A 4MYCA 3KLMX 3C3CA 1C5KA 4WNAA 3MWJA 1GN9A 4E5UA 3TGLA 2FOIA 3V4LA 6AT1A 4PO3X 4Q19A 1ULZA 3EUAA 1DARA 4TUYB 4HUQB 5JJCA 2CE7A 3AFNA 2CDRA 3TTVA 3RFXA 1NW4A 1QB8A 3LY9A 5JVDF 3AM3A 1RPZA 4N5MA 4I55F 4YYZA 3HYLA 3GFPA 2IH4A 4RTSA 5KCMA 5IC5A 4IHJB 4X1IB 1JDVA 2DBVO 5UKDA 1BGXT 3ZCRA 1EWQA 4P9NA 3VAZA 4ILKA 4MVJI 4J6EA 2JK0A 1A27A 4ML3A 1GV0A 2V3VA 3A9TA 2GPYA 3NCHA 2EC5A 2ZSAA 2FRVA 5LBIA 2R44A 3CS3A 2VN8A 2ERCA 1I7DA 4JXZA 2F4VB 4QOEA 1YVDA 4RWEA 5FO0A 1IVSA 4Y1RA 4A91A 1J9GA 3D6TB 3F7NA 1G9XA 3HB5X 3IUPA 4DE5A 5JS1A 2YQ5A 2CXXA 1CULC 3HKEB 1NJGA 1E99A 1Z4LA 2H8GA 1NXTA 4IXDA 2AW3A 5EIWA 1W88B 3CFYA 3DE2X 2VWGA 1YU9A 4U00A 4L9SA 5BORA 2W6CX 3HEMA 3QU9A 3TI7A 5AI4A 3HU1A 2XUFA 3B60A 2LIPA 1AXRA 2V59A 1QZTA 2YMPA 2ZWOA 4O33A 2OCPA 4HB0A 1C7IA 4OIMA 4PSCA 4F2WA 3K9HA 4AJPA 4BC1A 5IHXA 5K9ZA 4MUEA 4RF2A 4BV3A 3X2SA 1PR9A 3SEZA 4RQBA 5IU6A 1XFDA 4ZO9A 3GX1A 4NH0A 1H42A 2WHRA 2XUZA 3F7OA 1T1IA 5K51A 3FNFA 2ZSUA 1JDNA 4X63A 4CN9A 1W0JA 4QVKA 4C0WA 3LH5A 4MPJA 3GGJA 5F4BA 5K03A 1OBCA 3HJGA 3R6TA 3R44A 4E5KA 2QL5A 2XVYA 1XNQB 4PX5A 3WYCA 2HQ1A 3R3ZA 3AEKA 4DT1A 4FOLA 1IAQA 1N2IA 1ZNQO 5DOZA 5E9QA 5F5XA 4ZVUA 3VDQA 1NATA 1ZISA 3PQ8A 3HB0A 1U0BB 4LGCA 2ZUSA 3T5CA 4KX3A 1T8TA 5K0SA 1IPFA 3DBLA 1KZYC 3AKDA 1X7HA 1XKQA 4N6OA 4RBNA 2HFKA 5REQA 1L7AA 1G5HA 3KFXA 4PYMA 2YUIA 4IUDS 4JB3A 4WL0A 3LXRA 3U16A 2IYTA 4O4HB 3J80A 3OJLA 4FYVA 2J45A 5DX8A 5HIMA 4D8VA 2O3QA 1U0NA 2G9RA 2WJVA 4JJZA 1WHSB 5EMNA 5HP4A 1BRMA 1VL8A 1RM0A 5CX4A 1M0TA 1BS9A 1QO0D 5J5CA 4ZIRB 5KC8A 2DX7A 2OUKA 1JR3E 2O54A 4BVBA 2NXEA 3ROPA 3A9VA 3TD6A 5BN5A 1V95A 1QORA 3S27A 3FPFA 3AVOA 3IAS1 3QNUA 4IAOA 2ZR7A 4AMBA 4F4JA 4H7DA 3F71A 3FRJA 2BEVB 5GOZA 1J25A 4I9NA 1VKOA 2QT9A 1GQYA 3HGTA 5D86A 3OPNA 1LJLA 1C8KA 4MWDA 1RLTA 2A86A 4CIBA 1TT5B 2BGKA 4KQ2A 2YJNA 1ZKDA 1RCUA 2Y0EA 3H17A 3OT4A 2NACA 1K7YA 3AJDA 4MICA 3RGGA 3MS7A 4PNEA 1QAOA 5LBUA 2Q4DA 2I55A 4PX3A 3T99A 3WDMA 5JBNA 4BQSA 5JW6A 4QPJC 3TAUA 4JDUA 3TM4A 1M73E 3RAJA 3VZPA 4KXMA 1MC5A 1H9AA 3NRCA 4C2BA 2N1BA 2BUBA 1Y8RA 4C7KA 1Q7EA 4N0DA 4QQKA 4FD3A 3MXOA 3N76A 3P0EA 4OMFG 1XHLA 3U09A 2X5JO 3LFTA 1FUUA 4QRHA 3P2KA 1G2IA 3DT8A 1ESNA 1YB2A 3QELA 4EG1A 3KKQA 3UWPA 2NWQA 1MABB 2HCBA 3I32A 2P6PA 3JTEA 4FI3F 1TPZA 4GRIA 4YVFA 5F51A 3UANA 3EQZA 3EPJA 3M6IA 4WNCA 4MUKA 1H5UA 4Q9AA 4LDPA 5C5CA 2OHXA 4I2VA 4HYTA 1WTCA 2G9VA 4H7EA 5HTKA 2P4UA 4R1NA 1TZKA 3MB8A 4HDKB 2Q7OE 3SYMA 3OO1A 1LF5A 3WGNA 3N70A 1XU9A 1ODCA 4C0JA 4FE4A 5HR5A 2WQ6A 3HVRA 3B2QA 1EP3B 1QP8A 3NKVA 4PLCA 2OD2A 1LLQA 3O8OB 1VYVA 3H7AA 2GVZC 3X1XA 2FSUA 3DVAA 1T6ZA 2ORVA 1GYQA 2R6JA 1SKMA 1WXDA 3EFOB 4L3VA 1RRGA 2RHJA 2ZIXB 4HMQA 4QSHA 4IVNA 2ZYDA 4KRGA 3O93A 1RZUA 1BHQ1 2ZBRA 1CB0A 1OIXA 2Q3DA 4AS2A 1LTQA 3OCUA 5E95A 3FCYA 3RYHA 2Z30A 4UREA 4U1RA 5DNEA 3REOA 3S6JA 3WKEA 4D4LA 3BILA 5C5EA 4KNVA 1G6HA 5JD5A 4X6LA 5A6SB 2Q6OA 3STWA 1T5HX 4GNKA 2P9JA 1NNI1 1GU0A 1U9ZA 5H70A 5U4QA 4Q39A 1B76A 2GBLA 2AMFA 4LY6A 3HU2A 5JCZA 5DTJA 4R81A 1HE4A 1TYCA 1TA0A 3G1UA 5JCJA 3NV7A 4FOSA 1OOEA 1NJFA 2I66A 3AHHA 3RVPA 4ZOQI 1RLOA 3IIMA 4QARA 1G55A 3IAM1 4MWZA 4PAWA 1YMUA 2X3FA 5A5GA 3EZ2A 3IUNA 4R8KA 3PHJA 3R7DA 1G8JA 2F8SA 3ONEA 4YQYA 2PNFA 3AKYA 3ONFA 1Q44A 2WM8A 2NGRA 5E2BA 3JWIA 3HY3A 4Q21A 2DH5A 4LQLA 4H6XA 4DBZA 3U5ZB 1CZHA 3O4GA 2GDZA 3ND5A 4V3CA 3PFGA 5DRYA 5GP1A 3T94A 5CDUA 5K5EA 3EZLA 2O4UX 3ZNNA 2ZVDA 1YGYA 4JLMA 4WKCA 3JYPA 3FNIA 1OF1A 1G7TA 5JHGB 2F64A 3RC1A 3BMQA 3EPPA 3AIIA 4CE6A 4MR8B 5EMHA 2M6SA 4TMFA 3DR5A 3IX7A 5EG5A 2X7XA 4Y1FA 3SLGA 4HRYA 1P72A 1JHOA 4M46A 4OJYA 2SHKA 3AZOA 3F3SA 1PVVA 4JELA 3ZLTA 5F5LA 2QMZA 3GHYA 3JW8A 3KYIB 2CXOA 3CH6A 1W30A 3WGYA 3OE7A 1GKIA 2C4UA 1ZVJA 1NHGA 2ZB8A 3MK31 4JJ6A 4Y8VA 4O8CA 2O0JA 2GBCA 3F7MA 4DUPA 5JCXA 1WCYA 4L15A 5BV1A 5C4IA 3FOFC 4D0GA 4IPTA 4LCEA 4MROA 4X91A 4IR7A 3A05A 4OJKA 3THWA 2P4HX 4B3FX 4HXYA 1AB5A 1IIBA 1LA2A 4BZQA 4BFLA 3BIJA 3RVJA 4HEQA 4KKVA 3B7GA 2EKQA 2HA4A 3MVEA 3ORSA 4JHXA 2XD4A 4UNNA 3WGJA 4BKOA 4IKOA 1ZS9A 4GPBA 1D5CA 4NI5A 2PV7A 3EZNA 2BFDB 3HADA 5FBKA 4BFXA 5I47A 1GDTA 2CXRA 4KUHA 1SVKA 4V0SA 3N2IA 4DG5A 3N2LA 1BN7A 2J6HA 1BDJA 1Y5IA 4FT4A 4NECA 4RDHA 1P0PA 2HF8A 1ZC3A 3LUPA 4QFMA 3WJAA 4ZI3A 2JGJA 1RXYA 3UMGA 2HXYA 4Z54A 5L3QA 3CHYA 4U4AA 5KNLA 3ZKAA 3A4IA 2AVDA 4I3FA 5KQPA 4PQEA 1LDGA 3FHTA 3MT8A 1T8WA 3DOOA 3PGLA 4GD3Q 4M83A 5D7NA 3KJFA 5IYZF 3THXB 2GVNA 3MHTA 1ODSA 3QLUC 2B5WA 3OWOA 1A4XA 1LEHA 1WD7A 1Z28A 4NV1A 4Q24A 4XFJA 2AEMA 3WB2A 2OWDA 1HRDA 3A6HA 4DSZA 2IKSA 4JY7A 3G85A 4ZVRA 2V8OA 4TRRA 1E5DA 1EM6A 3NAZA 1GDDA 2R86A 2JJ1D 2BEKA 3AM5A 4FEEA 4IDEA 4RPIA 1RIFA 3SXJA 2WDZA 3CW9A 3PZBA 1IBKB 2IBTA 1VFPA 2AEEA 2BDTA 1V39A 4EG5A 1ZHFA 2WYWA 2NQ2C 2A9QA 3QKSA 1QH1A 1DJMA 2XCUA 2JFVA 4B4WA 1GCGA 3P4XA 1N5RA 1XDWA 2D4HA 1QRAA 4PRZA 2B94A 1E9BA 3IIIA 1AQUA 2NOAA 4RMIA 1PX0A 1IWPB 1N1DA 1S2LA 1HYQA 4TMTA 2ON6A 2GA8A 1W7AA 1MKYA 2IUEA 1HT1E 3W6UA 3RSCA 4KE7A 4D8UA 3N8GA 1I2MA 2WNHA 3CRRA 4EX7A 2PCLA 3L8HA 3KJZA 1C1DB 1PDVA 4COOA 4MVJD 4LC0A 1YTLA 1YL5A 3N3BC 3R1IA 2X9NA 3A6JA 4HWGA 5HDQA 3ER9A 4YXFA 1QBGA 2QUHA 1TMYA 4IWNA 4N7JA 1TCCA 2B8TA 4RKWA 2VJLA 4RVDA 4MMYB 1BRTA 4S1TA 1YC5A 3DOUA 2H2GA 2NZ2A 4XIIA 4Y6RA 1XDGA 4EGJA 3ABRB 4U6QA 2DBRA 4PSDA 1VHDA 2PT9A 2Z9BA 3YASA 3W90A 4D74A 1W36B 3HM2A 5EOVA 1KJZA 1GNSA 1WMDA 1YJ5A 4R3UC 2QENA 1LI5A 2VWHA 1A8IA 2CLSA 3WGUA 5KU1A 1SO8A 2QRPA 2FOXA 2FX3A 2ICAA 5P21A 4BO7A 3TE6A 2D5IA 1WSDA 4MJLA 3BSSA 3R77A 3L7AA 3JQ9C 2AOUA 4IMPA 4CIWA 3VO9A 2VXCA 3ZV6A 2O20A 1Q57A 1ZMBA 2ZSHA 3AF3A 3BEOA 2PV0A 1L5MA 1D5WA 1Z0FA 3H6KA 2RHMA 1ESMA 1E7MA 3JQBC 3JYLA 1QJ4A 4HB3A 2FWNA 4X7BA 2H1SA 5I9MA 1JH8A 1NMSA 1QPZA 3M34A 5CFNA 8MHTA 3UFXA 1ARZA 2H5JA 4PHTA 3ADOA 4UNRA 4JUDX 1LPNA 3NHZA 4OM8A 4Q47A 4PQFA 2JS7A 4QJ3A 3A37A 2AFIA 2B8NA 4Y30A 4MUNA 1A9PA 1BCRA 2FEPA 4TWZA 2O8EB 1G17A 4TLMB 1KYZA 3BE5A 1QIKA 1PK8A 3I04A 3IBSA 1YOVA 4IVQA 4WESA 2PMEA 3KC2A 4KK3A 4X94A 1BHSA 1XG5A 1PYDA 2G4VA 2IITA 1PNVA 1K86A 3U3KA 4DS3A 4CIYA 5T7BA 3F5SA 2G08A 5HCNA 1GY8A 4CMIB 5B30A 2QSZA 5E8RA 4PN3A 1DP4A 4TTRA 2C61A 3RIGA 4BX8A 4OB7A 4ZDWA 4B3CA 1I3LA 1QB7A 3NASA 4XVQA 2CK3A 3RYTC 1EE1A 4KXWA 4IW3B 1Z18A 3NALA 5B2EA 2IE0A 2YMLA 1FRVA 1NWHA 1IXSB 4ZQCB 1R4NB 5EIBC 1PJAA 2WU3A 5BT9A 3R0XA 4BNFA 4OYLA 4Z1MA 1OD6A 4LDAA 4RPJA 1YULA 4HTFB 1Z62A 1JEYA 1I7LA 3UMFA 4B4UA 1HLFA 4IHAA 3SDZA 1GNQA 1QHIA 3ZV3A 4MI1A 1XQVA 3R74A 6NULA 5IUKC 3BD7A 3D3QA 3AVXA 1GCUA 2OXRA 2QXUA 4WLUA 1M2VB 1JIIA 4CL2A 1SBCA 3RKRA 1L4YA 1AK9A 4KH1A 4OL0A 1C7RA 4W6QA 5HIKA 3SX2A 4MV4A 1A98A 1Z6XA 2CLDX 4ZJZA 5U9CA 4QOIA 4OK6A 2NTEA 4RE6A 1QGUB 2JI4A 1PLLA 3P0RA 3FDXA 1R9JA 4NPCA 3RIYA 4AMZA 4Q03A 4D6YA 2C2YA 1CEXA 4GMKA 3OWXA 5CJJA 5IEJA 1CQJA 4KEAA 1LBIA 1NFQA 4EFMA 4G5RA 1YACA 5B3KA 1M6HA 4V0MA 4CHTA 1CQIA 1NT2A 4TKZA 3WNZA 1GGHA 4E5DA 4B4VA 1BE1A 4DWVA 1WEKA 1ENZA 3AYZB 1RYMA 3KR2A 4QXRA 2JGFA 1YS7A 2W7TA 4BRSA 1MB4A 5EIOA 4E51A 3BWDD 1BMDA 4TMZA 3TKLA 2DFNA 4QATA 1A8PA 4G0WA 1RKUA 1XEXA 4FFNA 1W25A 4MR7A 2B7BA 5JDCC 3UC9A 2R1TA 3DDUA 3DR3A 2FW7A 3NVDA 2GR9A 1NUPA 3P0IA 1MTOA 1EX9A 1UDAA 2D7CA 3ETHA 2W6IA 4RMNA 4RD4A 4PS1A 1QIFA 1X7WA 4DREA 1KERA 2GEBA 5A9TA 4BJ6A 5IDYA 1V25A 1LTKA 1E1RD 1INLA 4ZI7A 4XVCA 3REGA 2ZSDA 3Q11A 1YONA 1P7YA 2OG1A 4K9NA 3RK4A 4DY4A 2VJDA 2LKDA 2D7DA 1WTAA 3KHTA 5ALOA 5IDVA 5LA6F 1ODKA 2ZFUA 3SKXA 4R0MA 3L77A 3PYXA 2EJWA 4MS3A 1BMTA 3B1YA 4U2CA 3K1AB 5FWAA 4EJ2A 4Q6WA 5FI5A 4AG5A 5BVHA 1RMTA 3PLRA 2JFWA 3NFRA 3L05A 1WZEA 1E5LA 1PS8A 1Y7IA 3ES9A 5HCUA 3EDYA 4ZZ2A 2Y1KA 2ZETA 5FR2A 4GHWA 4MQBA 2JLQA 1I30A 2NXCA 1ZO8A 2SBTA 1U0FA 4DV7B 1RBMA 2V6GA 2XUJA 1HE1C 2YVLA 1Z3IX 3OZDA 1DG3A 4NFYA 3L8YA 3RE1A 4EITA 3KVNA 1WV1A 1VMKA 2PK3A 3LHFA 3O3OB 1FPMA 4EY4A 5ALYA 3OKCA 1JJVA 4UFPA 1USUA 2DWQA 2A9KA 3R0IA 3SFVA 3ZJVA 1OYWA 2XT0A 4KMMA 5A4JA 3BJZA 3U40A 4QTTB 1U28C 4RABA 2ISQA 5C3UA 4BTVA 4CM9A 5I3ZA 3QEBZ 2HK8A 3HKDB 3USES 2X4IA 1P8JA 3G59A 3RS7A 2OHJA 1KIFA 3IODA 3QTBA 4P7KA 4RXUA 5HA5A 3FIJA 3T1OA 4L6IA 1MAHA 1NX6A 1SGWA 1YR1A 4WUVA 2I03A 3CSDA 3O2NA 4YP0A 1WF6A 3FMFA 5HRAA 1SOVA 2ASEA 1FF9A 2CMGA 3ESQA 3STUA 2VQFB 3AESA 2I62A 3RIEA 4OQ4A 1RP7A 1NL3A 1AS0A 1V4NA 4Z3KA 4KN9S 3E2MA 1J5PA 2CLFB 4LJ8A 4GI1A 3T6KA 2H1OA 3H8SA 4YECA 3RWMB 4ZYYA 3KDSE 2XTAA 3QUAA 1WQ3A 3H5RA 4GX1A 1XYYA 2FNAA 1ETUA 2CFTA 4YQZA 1MB2A 2C58A 3GCDA 1UJBA 2ECQA 3KKMA 3LQYA 3DS8A 2HGZA 4I6JA 5JISA 3HG7A 2AZDA 1CUUA 5D5PA 3ENWA 1TMGE 3OHMA 4FZVA 5MDHA 1F4LA 5CLGA 1QZZA 2CEKA 1Z56C 4MEJA 5JQWA 1LDYA 4NCXA 1JTFA 3VGPA 1YZKA 1VPWA 4MB6A 4PPGA 5A0TA 4M8NE 3T4EA 1PIWA 4R1SA 2VS1A 4PC1A 3IERA 5AKHA 3V7WA 4LE2A 4XCQA 5I7UA 3KWMA 2P7HA 3IUBA 4CLRA 5E1DA 4BEVA 2Z8YA 5HMLA 1IONA 2WW8A 4FWBA 5BN1A 1MNQA 4WFKA 2WWYA 2VHUA 3HR7A 2J3HA 4RCVA 3L41A 3R3UA 3B3FA 4D3FA 4JYPA 3AVWA 3DXZA 1NYRA 3NC0C 4F06A 1Y3DE 1V8BA 4MV0A 1ZVQA 2R6FA 3W2GA 4E08A 2QW1A 4C78A 5BPHA 5JROA 1XNJA 2IEYA 1RZ3A 4BO3A 5CNJA 4HNQA 4OP1A 3T3IA 2CZGA 4XXHA 5KS2A 1MENA 3MGKA 1ZVMA 3JQFC 3LCUA 3UH1A 1IEVA 3PFFA 1QFJA 5IAJA 1SD1A 5K01A 4MVJG 1ZIDA 1MX3A 4P3NA 1KSFX 3GXBA 4BOYA 1PJQA 3BQ9A 3UXYA 2HMVA 4LOAA 1T6XA 3ZWWA 3CZQA 3TZQA 3ODPA 4AFNA 3QWBA 2VEOA 3L1VA 5DYIA 5EZSA 1NI4B 3OCCA 5THKA 4HGZA 1ZIYA 3OPXA 3CZ5A 4L75A 2X0RA 2H54A 3CKLA 3HJBA 4YQFA 3IEMA 3TQSA 4DCPA 5CB6A 4HR7A 1MQAA 1UBRS 2DHDA 3RSOA 4V1CI 1P1KA 1KO5A 3ZUPA 3FHCB 4KYIB 5ABPA 1QDLB 5F3DA 3SEQA 4MS4A 4ANFA 3V8MA 1ZUNB 4KRXA 4GI3A 1EVQA 3O94A 3ZU4A 4IH9A 4U7DA 4PQGA 1D4AA 3H1TA 3MBIA 4QUEA 3WK4A 2HBZA 3D9QX 1G3RA 4KU4A 3E9RA 4ND2A 3B1XA 3VYVA 2NG1A 1Z0JA 3G1WA 2QE7D 4HEA1 1NSTA 3GLUA 1U1FA 1Q91A 3F8WA 1H5QA 2HT1A 1MG0A 1VFNA 5EHGA 1JG1A 4IV5A 4EGSA 3MPUA 5E6UB 5LVAA 1UDCA 1Y34E 1AF7A 2OWEA 2PYDA 2XYRA 1V16B 2XVMA 3EG5A 3EG9B 4KQMA 3EIQA 3KLPX 2A9RA 4P6VF 4BIIA 1CXZA 2UKDA 4C4XA 4D9KA 4OB6A 2C98A 3Q2IA 4L2IA 1MORA 1P19A 2CMKA 4DR2B 5FR1A 4ZEMA 1N3YA 2DH6A 2EZTA 1CRQA 4TQAA 2XKAA 1L4KA 3MTGA 5SZJA 5BYBA 3ZY2A 2P9ZA 1GGKA 1OFIA 1ZM7A 4XWGA 3BA1A 4DYDA 3GJ6A 1VCMA 3IXLA 3UXHA 3K9FC 4J4HA 5IKOA 3RW9A 2WHQA 1WVIA 3N3AC 1N2CE 3DMDA 2GHIA 3DT6A 4KXLA 1UKCA 2Q07A 2QR5A 2Q1SA 3A6FA 3GFGA 1HORA 4IFIA 1CP2A 2A0WA 4P4SB 3WWZA 1GAWA 3HJNA 3BGSA 3FWPA 1YS9A 2J6IA 2OV3A 4GZ3A 3H8WA 4J0JA 3BE4A 3BWMA 4LC9A 4RUKA 5FWXB 1DQZA 2F67A 1MT0A 2ACVA 4YP7A 2PLNA 3ZTYA 2REXB 3LY7A 1BKDR 2JKZA 2H0QA 1II9A 2DEUA 1YRBA 1F4VA 3IIKA 3M2PA 2PL5A 3DEHA 1MXHA 2G4CA 5M29A 5JH7F 3OQHA 3KAJA 1R50A 3BWBA 3B1JA 3HH8A 4RY9A 4IV0A 1K5HA 3CLHA 1D0SA 1JI0A 1KFJB 3CLRD 3CT6A 3IDQA 5CA1B 1T3TA 3D4LA 4RLSA 3PZRA 4EUNA 1R6TA 2IYYA 3RS2A 3T1VA 1ZHOA 1C3OA 4ZGWA 3WNCA 1MGOA 1Y1QA 2COEA 2BUAA 1MN6A 3KFLA 4HPWA 4DCTA 1Z73A 5JJKA 1KDVA 1ISGA 1JPJA 1KP9A 4K3VA 1MP0A 3RRFA 1COZA 3FGPA 4XIYA 2G36A 3M4NA 4F85A 4QEKA 2ZUWA 2WDPA 4ESEA 10MHA 3IOCA 4MTCA 4WNYA 3WAJA 4M88A 3R5XA 2QJTA 2J0EA 3L0DA 1LDNA 1U7DA 4M1OA 2C9YA 4MVJM 4HPJB 4JQCA 4RE5A 4AL4A 4CKCB 1O8BA 1AGYA 1ICEA 2DG2A 3JRNA 2EFYA 3QXJA 3V1LA 5K0EA 1PNTA 4G0YA 2NVUB 4KE6A 3SBOA 2PZ8A 3WXBA 2VNKA 4CLXA 2CXHA 4CNQA 3FWHA 3GJTA 3VHLB 5WRFA 1DKQA 4ZI5A 3S0JA 3AIMA 1DAGA 1K4MA 1SK8A 2HSDA 3I2FA 3A1DA 3N2YA 1EZ1A 3O5AA 3Q6MA 1F2TA 3Q8KA 1J06A 1T9HA 3L6CA 3OEYA 2Q2OA 2OKCA 4NMXB 4XUGB 4A8JB 3CJTA 2FPIB 3LECA 4O25A 1N2CB 3HL4A 1T5TA 2EF0A 1VXRA 2QQGA 3KYDB 5FAXA 1P81A 3N28A 2OV1A 2Q3JA 2G3YA 1XKXA 5BWCA 3FLEA 1CK4A 1DC7A 5IXSA 2O2ZA 4B17A 1GUZA 2EYQA 4JVNA 1Z4OA 2X2FA 3GEPA 1OXSC 3FKSD 5K2OA 1JYFA 2R1VA 5EXDA 2XWQA 4G8DA 4IDGA 4OJQA 2OVFA 2OPBA 3C6QA 5CLQA 3UZUA 1FS5A 1TUBA 5KQMA 4YXWA 5C1BA 3GLIE 3VPSA 1ID8A 5CFPA 4NNOA 1DDOA 4RM3A 1WXFA 2O7QA 1IPEA 2OLEA 3CRVA 3FRIA 4RA9B 1P4AA 4JENA 4YN3A 3TSCA 4RORA 4RETA 2CCKA 1YRAA 2P5YA 3WL7A 2R1UA 4F93B 4OGWA 1XTQA 2AFVA 4BPBA 1OW3B 4LYEA 2VOJA 3R0JA 3L82B 1E0SA 2OP0A 3WL4A 1Q74A 4XIFA 1JPNA 3EXIB 2IK8A 1EFRD 5FB3A 3B8HA 3UHFA 1VA4A 2OORA 2Q8QA 4H1WA 2O1XA 5LYJA 3NWPA 1IQUA 1A1VA 3ZJ4A 4COKA 1JR3D 1ZD3A 2NNWB 1XZGA 2O0HA 3C0KA 3H1PA 3S99A 2Q3BA 4OHRA 4Y2PA 2W6NA 3G2LA 3FSGD 4FYYA 3VR2D 4A0QA 1E0KA 1QAQA 3OP4A 2RH9B 4AKSA 1Z0DA 2W58A 5TQ2B 1E1YA 2HMUA 3GMIA 4A73A 1YVRA 1AS3A 4XWTA 5T4BA 4EPYA 2C20A 4XAQA 3F1LA 2G80A 1BOOA 3FPCA 2LUOA 3R5HA 3KOOA 3KUDA 4HUTA 2OAQ1 3ZJUA 4YRDA 4IIDA 2JGEA 2GA9A 1W0CA 5JTTA 4B74A 3NEPX 2CL7X 1AHPA 2P6UA 2Q0QA 3GW8A 3ZXSA 4EA9A 1GTG1 5I9IA 4MMXB 4TQUS 2ANCA 5F3WB 2VDWB 3JQGB 3CMMA 5INTA 3WX0A 3VPHA 3KM0A 4NX2A 4Z4FA 5E6RA 5B3LA 5K3FA 3A2NA 3ZHOA 5LOVA 2V6FA 3ME5A 4IDHA 3UMJA 1I7NA 1HPLA 2P9FA 2W6JD 2PMKA 3PC3A 4LQ4A 1G3QA 1PU2A 1QLJA 1GTL1 1H93A 1A2BA 1KMNA 2AWNA 1DRJA 2JFZA 3E9ZA 2BC9A 2P0AA 3CVVA 2F3PA 3OWHA 3UC5A 5KUTA 1QC5A 1U7HA 2EDAA 2OK8A 3AGPA 1Z88A 3PQ4A 1X1AA 3CNBA 3EXHA 1SY7A 1ZH2A 2H9AA 2P2NA 3NBQA 4IRMA 5DM70 2XAAA 2NUPA 5DPMA 2WWRA 3N2NA 2QD3A 1P4JA 1LSOA 2OHIA 4ENQA 1N7GA 4KUGA 4IDNA 3QTLA 4IICA 2NO0A 3TFQA 3PX7A 1T9KA 2ATCA 3C3XA 4HX9A 1QIHA 2C2BA 1ADGA 3ONWA 4KIGA 4R1TA 4Y3UA 2XKJE 4ALIA 3INYA 1ZLYA 3CF2A 5JARA 3IP1A 4B6RA 1H2FA 3UA3A 2DZDA 3RLIA 2XRZA 5CVJA 2VJYA 2AKEA 5KB3A 1AX9A 4GOKA 4Y67A 3G2OA 1HQYE 1NXWA 3D7NA 1GITA 4H0NA 2A5GA 3FZQA 4IILA 4NWIA 1V9CA 2CNNA 3N05A 3FTCA 3DEJA 3GJ0A 4GECA 3KZNA 1TRHA 3OFND 2A8YA 4U2KA 4BFZA 3L9XA 4RELA 1KEWA 1C4KA 3ZW8A 4PGHA 2CFIA 2G77B 2ZKLA 4EQ6B 2X22A 1ULTA 1H4QA 3ZVKA 4A27A 4HFRA 3STVA 1PX2A 2B2XA 2QGNA 7ABPA 2P9BA 3K0CC 1RYZA 1X8LA 1B6GA 4FPXA 3WBFA 2WILA 3EZXA 1L7VC 3ZQUA 6REQA 4HHEA 2R4QA 2DR0A 5DHUA 1JPUA 3B78A 2QRJA 3EMBA 2YN0A 4MJ3A 2Y0DA 4MLDA 5KIAA 3CSSA 1LF0A 3KXKA 2H8KA 4O63O 1EFPA 5LB2A 4AN4A 1JQBA 3HYCA 4TLCA 2RH5A 4TXHA 1XNGA 2JANA 2O05A 3L84A 4I4CA 4GX2A 1QUFA 4P54A 1S3SA 2PGXA 3WQRA 1KYVA 4WZAA 2EL7A 3UMRA 2PT5A 1I3CA 3N0TA 1CQWA 1RCTE 2CYAA 5FL7D 2NNLD 3TRFA 4YRRA 3VKUA 4AWBA 2Q1XA 2R4UA 2WAMA 3Q6IA 5T8KA 3JAWB 3UV6A 3D43A 1G0OA 1JWBB 4DLWA 3B70A 3Q5EA 5B5SA 1NNLA 3R3WA 5K0NA 1AUVA 3LPNA 4OSEA 4EWLA 3U3RA 4E15A 2UUOA 2C57A 4RIIA 3E1SA 4UBJA 1E9FA 3JQ6A 3PR1A 1DVRA 4G81A 2OYRA 2HSGA 1K6JA 2WHPB 2W6OA 2ZE7A 1UKEA 2Q5JA 3DOEA 2Z2XA 4KO2S 4CM1A 4N5LA 3OQOA 1WBBA 4B7ZA 5BNIA 3GP5A 3A6GA 4PG7A 3T0FA 5I5EA 1KY2A 1QG4A 1Q20A 2I2WA 4LY0A 3MBKA 4KQ6A 4IV8A 2IE8A 3JQCA 1L5HB 2LGJA 1DJPA 4AZ3B 5JJBA 3PHGA 5ALQA 1JHUA 1ZL0A 3FPAA 5G53C 3B5JA 3SQDA 2QM3A 3GJ5A 2E2WA 4NV0A 3LGAA 5KVCA 3LP5A 4P0QB 1CY7A 1UAAA 1PFYA 1MUUA 1XWWA 5AVOA 3S29A 3QH4A 2W22A 2XUGA 3VKGA 1EHCA 1NI3A 4WOJA 1UXKA 1HMYA 3BK1A 3QVTA 2IZ7A 4N5DA 2C5FA 1H23A 2A1TS 2O3UA 4J1NA 1L5SA 1QKIA 1ZR2A 3D3WA 2PKRA 5E0KB 4D80A 5CFQA 1N36B 4KO3S 1ZIPA 2VUUA 2WWFA 1A5ZA 3OOSA 3SJAA 4FR2A 4KR6A 2IXAA 3ANYB 1GJRA 2A67A 1JNYA 3DV0A 3HJTA 4GPIB 2WF6A 2ZPUA 5EQJB 5CCEA 1HT3A 4BVJA 3RJZA 4BGVA 4RGVA 1W36D 1PV1A 4AQYB 1Z06A 4URVR 1MJNA 2C1ZA 2AQHA 5AQ1A 3NTUA 4GOND 4OOEA 1PEDA 3CVUA 1IJEA 4QO7A 3VVCA 3GT3A 4UTZA 1GA1A 4C5CA 2H11A 4DAOA 1SEPA 4L22A 5KDOA 1NFRA 5T3YA 5E1MA 2HHCA 2O6HA 2HJRA 4FFBB 2ZIEA 3LCJA 5BSFA 3J81k 3ZWOA 1J8YF 5B1EA 1GRNA 4AURA 4ZOBA 3GRAA 2RKBA 1YZVA 2Z6VA 2OYCA 3ZGVA 4DLKA 1MBZA 4E88A 3BIXA 1J7JA 3MGCA 3IDSA 3C8MA 4CEHA 3CF4G 4L1KA 4Q3DA 3UT5B 4AECA 1M1ZA 3CWCA 2VPQA 3L4BC 4OA8A 3W2FA 2UV8A 3OMXA 3K0BA 3VXKA 2A3RA 1P9WA 2MCFA 1Q0UA 1UXHA 2BZGA 2GARA 4HBGA 4JZYA 1IMJA 5E6SA 2X1HA 3UJ3X 1MD9A 3E48A 2OBYA 4V38A 2CT8A 4EMBA 7REQA 1ACMA 3L7YA 4JD5A 3RIHA 4R1LA 1ZI9A 3EGDB 2XRFA 3CINA 1ZMXA 1E1KA 1Z2AA 1VIDA 4RHTA 4YJ2B 5AW5A 3K6SA 1GG9A 2FX2A 4K03A 4Y2TA 2Y71A 1H69A 3ENKA 2CJPA 2Z2YA 2IY9A 1F20A 3GEEA 4OLJA 1Q3TA 3AHIA 3H5NA 2AGVA 2G6TA 2I1QA 5CDGA 4LYFA 1BCSB 2BHRA 3VFDA 4XYBA 3OLYA 2IZ6A 2IX3A 1WZUA 3RWBA 4CT0A 1RQGA 1FVXA 4M49A 3DLHA 3MAAC 4KXNA 3T1YB 4UUPA 4F5WA 1BN6A 2FVXA 3SYNA 4AULA 4JFRA 2Z2IA 3N2GA 4GMGA 5LJIA 3CGWA 5HM6A 3M1LA 1V96A 3ILSA 4IMJB 1FRQA 1PJ2A 4Q1AA 5FOSA 2GM3A 3B3QA 4WCVA 1JH9A 1RWBA 3TXAA 3IFSA 5LXTB 5TS2A 4H1HA 1B0ZA 1S8OA 4OSOA 1SCDA 5KYXB 3L40A 1R3DA 2YVQA 1LTHR 1O0SA 1T5DX 2M1ZA 4EQZA 1P73A 3T3MB 3PHCA 2J6CA 4OI2A 1N25A 4A26A 2FJ0A 4A92A 1RBYA 3IJEB 4O2AA 3U48A 1CETA 1GSOA 4NBTA 2DCMA 2JCGA 4IXWA 1Q1AA 4NMLA 4B9EA 3JX9A 1KI4A 3BT7A 1I2BA 3AONB 1L6IA 4TV8B 3UV7A 2DTXA 2IHBA 2Q21A 1MJGA 4KQ1A 2HPAA 2MSEB 3JQ7B 4FBMA 1OWLA 1SG6A 2B25A 4Q6BA 1ZGAA 3FMVA 4XLTA 5EWMA 2PUJA 3FFAA 2JLVA 1K5DA 2AC7A 5BVGA 2XB2A 3L18A 2OO3A 3UB2A 1KK3A 3BL5A 4XH9B 1Q95A 4C3ZA 1I5OA 1KQ3A 1PD1A 3ABZA 1XD8A 4KLCA 5GZ1A 2HADA 4AN0A 2BF4A 4EK9A 3RVLA 2Q2QA 2JFPA 1UPTA 2PR7A 1M33A 4RZHA 1KFEB 3VOAA 5JRDS 3M49A 3H9JA 1FFAA 1G60A 2EP8A 1HYEA 3I0ZA 3L0CA 3U9SA 4BLTA 4FGSA 4E03A 1X1DA 2VEDA 1WAMA 3DAFA 3HSKA 2H2FA 1A5SB 5PNTA 5HJ5A 1SVIA 4F3YA 1PNOA 1Z22A 4YCSA 1I24A 1N2BA 5LQCA 3HVKA 4J7AA 1TA9A 1E3SA 2YZKA 1U80A 2YH2A 4CF3A 3CR8A 4OREX 2C5AA 3UOWA 2PS3A 1GM5A 1U1IA 1BWRA 2X0IA 4GKBA 4INAA 4QNMA 5BWMA 1FTSA 1QTNA 2O8BB 1ZM3A 5JBIA 2EF1A 1IG0A 3JXEA 4PYJA 3W34A 1R0XA 4MKFA 3TN7A 4YR9A 3R9XA 5ERXA 4QQNA 2GN9A 3FYCA 3H18A 1Z0SA 5EEGA 1SUFA 3I5MA 1F2UB 4B3HA 4F91B 5A5FA 1NQXA 3TOSA 3G68A 4N0MA 3AF1A 3EZ9A 3F8SA 4K6HA 4TRNA 5HFNA 1CNMA 3UNXA 5ITZA 1UIRA 4GRDA 1U3UA 3U3ZA 1XN4A 1RQNA 1SCQA 3GNQA 3QX8A 4HXEB 2EZ4A 1VECA 1UEIA 4URHA 5HILA 4ERXA 5IFLA 3OH8A 1KKMA 1NU8A 3B52X 1QS0A 1T25A 3VPAA 4AKGA 3DO6A 5FUMA 3LT1A 3NIFB 1V6AA 5IT9A 2H2DA 1V7ZA 3KVRA 2CUTA 5F76A 4G63A 3EQ9A 1Z68A 2LPMA 1KI6B 1KYTA 1XTKA 2QMOA 2AG1A 4H3SA 4V0NA 3VZQA 1U0SY 4HOYA 1V11B 5F1KA 3O92A 4B3SB 3IMKA 4C6RA 4B4KA 2AYZA 3H1EA 4FMCF 1G18A 3LU1A 3ZH2A 4FKZA 3GG9A 1MH9A 4JVSB 2D2EA 2ISCA 3CBQA 2YJ4A 1VHJA 3GGPA 2Q27A 5KNBH 3G2HA 4CQMA 3HCAA 1I51A 4AMUA 3KPJA 2GNAA 3OOEA 4TSKA 5COBA 2Y3IA 4EI8A 3BGWA 1EUQA 2TMDA 4AIIA 2HQBA 2Q3EA 1KZGB 1T3LA 2VJNA 3FNQA 1ELOA 3QE3A 3M5PA 5DU2A 3WMFA 1I6WA 1YDGA 2OQIA 2ZIZA 4NV3A 3WLEA 2AMYA 5EMKA 1Q16A 4M38A 5TMEA 1FDOA 5DTEA 4GEKA 3GRZA 4LKOA 1T15A 1C3XA 2VT2A 2KHZA 2XCOA 3EUEA 3IDAA 4UCWA 1Y4ZA 2CCJA 3C4JA 1D9ZA 2ZRKA 3IC5A 5M5BA 1KC3A 2A0YA 1J0DA 2XHEA 3C3BA 4D4IA 4Q3KA 2FE1A 3R6GA 3O47A 3E05A 1WDKA 4ATNA 1ODIA 1WW8A 2CLEB 2B83A 4J1QA 1ZMRA 1HBJA 3NYIA 3AY6A 2AFHA 1PSZA 4JJKA 4D7AA 5A3RA 3THYA 3GLKA 3LQ1A 1DO0A 1I9GA 1IBMB 4B6JA 4MWOA 2P41A 4KWIA 5DM60 1YJAA 1LZKA 1TMKA 2GWRA 4IH4A 1PUXA 3EGXA 1JG3A 3GLVA 4BRUA 5H68A 2WF8A 2KPOA 2YV5A 3BMOB 3C6ZA 1C7QA 4F9EA 5JQGF 5EP3A 3WKBA 4GE0A 4GVXA 3N0WA 2J33A 1CUAA 3WWYA 2R7KA 4EI2A 2WR8A 5H80A 4U02A 3OKAA 3PX3A 2HU8A 1E1QA 3AX6A 1Z5PA 1Q7TA 1ZITA 4LJYA 4OA5A 5BMVA 5CEEA 3RVOA 3NPAA 2XCTB 2P5UA 4E07A 1OWMA 4JXXA 3T95A 1FMLA 3MJHA 1M83A 1PVDA 5FLEX 4I5FA 4Z8YA 4LJRA 1HWYA 1QYXA 1N6KA 4ND3A 2BP7B 3LSYA 4TS3A 2E21A 3HCOA 1V37A 4NCJA 3TSYA 2K7FA 1WG8A 1M1NB 3UENA 4J2TA 1CR6A 2QAGA 3MQ4A 4RK6A 1R6VA 3EVBA 5BQ3A 2GN8A 4TRMA 2E37A 3GEIA 1D6MA 1U2EA 1TF5A 4J29A 1F8YA 5KJ1A 3QHAA 1KSJA 2XE4A 4WXPA 3TQTA 4EO7A 3F4KA 1G20E 3OX2A 1YNOA 1QE0A 3OZEA 3FYUC 4IDBA 3B2EA 1O08A 3NHPA 4ZQHA 3WDKA 1RWMA 1WUKS 1EIZA 1OXVA 3N0VA 5G4KB 3FDZB 4BDTA 1NVMB 4RHEA 4AJ2A 3ADPA 1HGXA 2FUCA 3LRXA 4C22A 1B8PA 1COWA 2H65A 3CH4B 5CXXA 2O5RA 2YTZA 2BSXA 2G04A 1P74A 3B20A 4IVRA 4MWEA 4N8EA 3A14A 3M4JA 4S1WA 4X6UA 4MYHA 3AVQA 2HDWA 3Q4GA 5G3ZA 1OC4A 16PKA 1AQYA 1NX9A 1UWCA 4B44A 3EA5A 3VVMA 5CVUA 2BFFB 2FB9A 3LP8A 1P80A 2J9FA 4PAOA 2WICA 3ESCA 1IUNA 4WY8A 1DQSA 5JFTA 1UZLA 3QA9A 1QF7A 4TM7A 3FOBA 3N0XA 2V6MA 1GGVA 4RYLA 1I4LD 5A02A 5DH9A 4WZBA 3P9XA 3JVIA 3JD0A 4Z4GA 4F46A 5JLAA 3T7AA 1GUFA 1L1RA 5GMOA 5EJFA 1JFFB 2XMCA 2MINB 3OZAA 2VZEA 4H3VA 4FFVA 1IK4A 4R31A 5CJPA 3ZZ1A 4CDNA 4IIGA 5EUBA 5TPWB 1BYUA 2B37A 1IMOA 2WFMA 1KL7A 2NTYC 3CTPA 1XTIA 3AY7A 3E8MA 4GLFA 5CLHA 2CXNA 5SY6A 2JHAA 5HUQA 5LLTA 3F3YA 1SHZA 4P82A 3TD9A 3SHTA 4NS4A 3W2IA 1DBSA 2VSYA 1K98A 1R0LA 4LFCB 1V35A 1EK1A 2Q6IA 2YJGA 5JAIA 2BTQB 5D3MA 2IPLA 2FWAA 3DAPA 1JV2B 3HCDA 3ZI7A 3E4CA 1O95D 1PJ4A 2VUSA 2DFTA 1C0PA 2PFKA 3AP3A 1YSCA 3AUUA 1POWA 1SG0A 2JIMA 4G89A 5DGTA 5YASA 3U0VA 4BC0A 3WA6A 1A1SA 3DE7X 3H19A 1ULBA 1L7EA 1G20B 2PGOA 3LLVA 2WQ7A 3X2EA 2ZBPA 2QF7A 5JNWA 1SR8A 1F12A 1V8PA 3L6EA 4QGHA 5DZSA 5AK3A 5A04A 5JMWA 2Q4EA 4CL8A 2YWEA 5GTDA 1HR0B 3E3MA 2VDKB 4Y6LA 5CBPA 4UEJA 5CLLA 4B75A 4YV2A 4TYYA 1JX6A 3E5RA 1CNEA 3D54D 3PL5A 1A7KA 1K4KA 1UKBA 2PZMA 3CJQA 2RK6A 4B1FA 1GUAA 2ENUA 1DLIA 3LPCA 4BLUA 1XDSA 3L7NA 4XKJA 1QE5A 3I9LA 3JQRA 4ZQEA 2V7UA 3HDGA 3ROEA 4KR7A 1TIPA 1XA4A 3OTWA 2P1ZA 2VNJA 3EMDA 3NAGA 2D59A 5B58C 2OTCA 2W37A 1T0JB 2ZRAA 2HKIA 1LSUA 1LPOA 1GPUA 5D5QA 4BS9A 1W0KD 4UHFA 1MZVA 2FN8A 4YPOA 1T1EA 3LHDA 2JH9A 3KKLA 3RKSA 4TYMA 1JAZA 3HEAA 5EKSA 2NZUG 5KNCA 4XSGA 4BE7B 2QVBA 2F00A 2GRJA 5HKKA 2OGWA 2DOKA 3GT0A 4LXQA 1YO6A 2IQIA 2ZSEA 3WYNA 1N1MA 4BQFA 3U4IA 4BNXA 1XCMA 1NBIA 2C7PA 2H00A 4RD0A 3KE9A 3ZDRA 1KAOA 2LD4A 1YZHA 1QK5A 1KP3A 2LV8A 3KCNA 4KTVE 4MITA 4ND8B 5LZ8A 5GONB 4Q93A 1RRPA 3GGGA 3TBFA 3UQYS 4RPHA 1F0NA 2WAXA 1T2VA 3IAAA 4TV9A 3TG2A 1P31A 3FWNA 2DFDA 1JDSA 3SKVA 1NXSA 3F6CA 1UJCA 1ORRA 1W4BA 1H2XA 1Y8CA 2GK4A 2J31A 3CKMA 4WNAB 1CNFA 5FUVA 3SVZA 5KYYA 4BASA 3FJOA 3OQ6A 4YWHA 1U0RA 5CVVA 2XF8A 3ZVMA 5JCPA 2H51A 1ZD9A 5TVGA 1BO6A 1ISMA 2DUMA 3N7AA 3QPWA 4Q3AA 3UJPA 3O8RA 3BXOA 2LP4Y 1M6EX 4CF4A 2PGAA 4JL8A 1DHRA 1EGQA 2B4QA 4FI3C 1VJ5A 3FSRA 4HS4A 1JSRA 1IY9A 3HJHA 1WS6A 5ADUS 2VP4A 5LXTF 1XELA 3WKDA 1JWAB 3ZY6A 4Q3OA 2BW0A 4KAAA 4BU1A 4DQDA 4N48A 2AOTA 4E4TA 3AUFA 2KB0A 2CVQA 4MGIR 3BX1A 4WCFC 4MRRA 1ZWKA 2IKQA 1RWOA 5EXPA 3BMCA 3R7FA 5AXDA 1Z39A 1FIUA 1Z0ZA 2AIRA 3NR2A 3A32A 4JB8A 1K3TA 1YJBA 1DC6A 2PD6A 3CLTD 3PX2A 4Y1RB 5AKXA 4ZEWA 4EJMA 3RVKA 5C0OE 1TKBA 5KWJA 3CZMA 3U19A 4GWKA 1UZNA 2GASA 5ENDA 3NVMB 3AVVA 4F6LA 1OQAA 1VL2A 4Q9JA 5DE3A 3UHJA 4CMJA 3IBYA 3WJ1A 3IJRA 4ZFNA 4MVXA 3UJAA 3D4BA 1WVMA 1JU3A 2JI7A 3P26A 1VQ1A 4QU9A 4DGQA 2GK3A 4WIAA 4LYAA 2PX6A 1J8VA 2H4XA 3NVAA 4HNAA 3SX0A 1ZR4A 1Z16A 3GFBA 2ZS7A 2OVBA 4AD8A 4RTOA 1YAHA 3T5MA 1WX1A 1MX1A 1BMFD 1V48A 3CTMA 5J1TB 3TE7A 3VOBA 4D3XA 3IALA 4LIPD 3PJDA 3IQHX 3L6UA 1Y81A 2COUA 1JBKA 1XQ9A 1AKMA 1VYHA 4GNRA 4RZUA 1UH5A 4DXAA 3RADC 2FRDA 3GDFA 1G42A 4J7CA 4FFRA 4QQ8A 5KTTA 1F38A 5AHRA 2BFCA 1T1RA 1PQWA 2Z95A 3TEMA 1XJ0A 2WLSA 3UB3A 1QRUA 3FD8A 2D1YA 2WSSA 5AT1A 3T7RA 4AKIA 4EUEA 5JOQA 3IPXA 2WD8A 2P9QA 1JAYA 3AEKB 4DT1B 4Y6SA 4UVGA 3SQNA 2PRYA 1F7UA 4FCVA 5JZVA 2DPYA 3DL0A 1UP6A 1ISPA 1ZN7A 2W8ZA 1KYWA 4POOA 2P3SA 2V58A 2R97A 3DBLB 1AKQA 1CZRA 3VQTA 1B2RA 4P7JA 3MG9A 4KVGA 2W2LA 4A0RA 2GZ1A 1C1YA 3FY4A 3OIYA 1GRVA 1MC1A 4V03A 3MN1A 2HMYB 3DQPA 4A2WA 4MA5A 1HDXA 3Q85A 3P0HA 4JROA 4BFTA 3DG9A 5BV8A 1HDGO 1NVFA 2OXIA 2BONA 3SNKA 1JXQA 3S2FA 4ER0A 1KH2A 2QU7A 3KEQA 3LHSA 2GAFA 5GONF 1N5KA 4TTPA 3U1VA 4WKPA 4MLPA 1Z0AA 5BN5B 4CW7A 4DBVO 3HDYA 3QFRA 1OVMA 1FNBA 4OXNA 5GJCA 2XX3A 4RZXA 1JF8A 5JXHA 4I8IA 5CNKA 3GFSA 2QB5A 4Y0AA 4FCCA 1JHRA 4Z1OA 1R0KA 5AI8A 2FFBA 4X0EA 4RV4A 2VTBA 2DQZA 1Z5VA 5AJTA 4AN1A 3QE9Y 2FGKA 1E4OA 3NORA 1G7SA 1PZGA 3E5HA 2Z6QA 2RJ3A 4Q4AA 3ZY5A 5G0TA 4QX6A 3VH4A 1ABFA 4UTPA 2Z2KA 1OLSA 1ECJA 1XB2A 4BKQA 4DRXA 4ZK2A 4PZAA 3JD3A 2PANA 1T1JA 4HO1X 1N1GA 3AETA 5HIIA 3TEFA 4C4RA 2QTRA 2H1CA 2HWUA 3RAGA 2RC5A 1JKXA 1Y8RB 2FLKA 2MJLA 3T7IA 5H5JA 3TQCA 1EI9A 3CRZA 3R3JA 5EL0A 3M6XA 1JZSA 2J4FA 5BW5A 1PQYA 4D0LB 1W9MA 3FZGA 2JI9A 1BH2A 3IRVA 1GLNA 1WXWA 3QELB 4H60A 4OEHA 2IV7A 1TM1E 2RB4A 5AI5A 4L5YA 1U1CA 1J2UA 4QWMA 3LA8A 3B5IA 2W98A 4IBOA 3C2QA 2AH5A 3VNAA 5BN4A 4XYMA 4XTRA 3VUFA 2VJMA 3H9QA 1W8DA 4HD8A 2BKUA 3Q7IA 3V4OA 3F6BX 4OXYA 3G0HA 1SUEA 4UDYX 3W5VA 4CMHA 1NC1A 5D7BA 3GROA 5L3RA 4GUAA 9GPBA 2CV1A 1FP1D 2R96A 2C3UA 1NYQA 2CB9A 1HSZA 3OEED 5HDBB 1GQQA 3VNSA 3P9KA 3DVAB 4JAVC 1SVOA 3I5UA 1ABBA 5J9FA 1PZHA 2XVAA 1K7SN 2TRSB 4D4JA 4L28A 1A95A 4GZ5A 4JOCA 4GKVA 1U6IA 4Z86A 3GEBA 3W04A 5B64A 1NR1A 1DRWA 1NHWA 3IAXA 4QU0A 3UF0A 4OU5A 2EW1A 1I3MA 3RYCA 3NUQA 5KOIA 2OLKA 3RYHB 4MYUA 4XUCA 3W2TA 4YMHA 4H3KB 3PPYA 2A0XA 2QPLA 1TEZA 2BJVA 3L04A 1P33A 1U1GA 4QYSA 1GZSA 3AVTA 5I7RA 3DOJA 4E6PA 3AY3A 1JFSA 4GMHA 3ZU6A 1V5GA 1J7KA 3RFUA 3B38A 3QBVA 2GN0A 1ZK1A 2OCLA 4PNPA 1NW3A 2JFHA 1ZEJA 1CQPA 3P96A 3GPDG 2B0JA 2X8LA 2E82A 3GH1A 4LVOA 4DWWA 4FCTA 3RSLA 5A7FA 2QV7A 2Y1CA 3FUVA 4RC9A 1JDBC 3HCWA 3N39C 5KTNA 2VBGA 5JDIC 3IOMA 4MUIA 3D7LA 4KUEA 4YMVA 1CRPA 5ERGB 3TI9A 2VYQA 1KJ8A 1KI9A 5CX1A 1ZKMA 3ZD8A 2AUNA 4BNGA 4JJ8A 4HX5A 4NBUA 4UQOA 3KUUA 1O77A 2GAIA 4D56A 3TR5A 2WIGA 4PNZA 3V8BA 1GDHA 1ID1A 1S2DA 3EIFA 1GCOA 4X90A 1RABA 1SQ0A 2JLAA 2BD0A 4AVYA 1AZWA 2IDKA 1L7MA 3ICVA 1WOYA 3IILA 2BMDA 2II6A 5AOAA 1YI1A 1VJDA 2NU6A 3EY9A 1GZ5A 2GF2A 3BMQB 2ATEA 2VT3A 2PKYX 2G7MC 2V5VA 3FGZA 4FZ3A 4CM3A 5KHOC 1UT8A 1OZ0A 2DLDA 2J5XA 3CRQA 4X41A 1TK9A 5IAEA 3SC3A 1ZRSA 3P4YA 1IHUA 4JUIA 1Z5ZA 1MA3A 3FBWA 3GEGA 3I39X 2ZULA 3SHOA 2ERYA 2AZXA 1BS2A 2WG1A 3LC1O 2D0DA 1W4LA 3OLCX 3TR6A 3VJLA 4TMWA 4OLBA 3FCXA 5HZHA 4G1UC 5F7ZA 1GGFA 3F9RA 2JIOA 1D9XA 2VP9A 2FLVA 3FUWA 4JYBA 2I4LA 3IUYA 2JI8A 2AJDA 2WAYA 3IA7A 1VI6A 3K30A 2W2OA 3T8YA 1KMHA 1MU0A 1Q19A 1P0IA 4H2DA 4ZOCA 4AKEA 1O6FA 3O75A 3PGVA 5AHOA 4C4TA 3THWB 1E0AA 2O14A 4HVTA 1RAGA 1ZOOA 5GV7A 2C4HA 1ZY2A 4F96A 2UVPA 1R4MA 4WY2A 5J2TF 1RQRA 4GDMA 3DHNA 4NABA 3S2ZA 1Z4IA 3C8DA 3P2EA 5K3AA 2HLDD 1ACLA 3WY9A 3ZIUA 4X85A 2XAUA 1O54A 2W42A 4NZZA 1JXOA 3ORHA 5E4TA 3TRDA 4UOZA 1XTPA 4FOPA 4ND1A 3FVQA 4CTJA 1NDUA 2PFSA 1JUDA 2A14A 1TJNA 2FMHA 2QW8A 5HBGA 1J8FA 3V97A 5L3QB 1N0WA 1N8SA 2OAP1 1PR3A 3BH0A 3C3MA 1XIVA 3DD1A 4DR6B 3H97A 2O7VA 2ZJBA 1KOFA 3HBFA 3OTQA 1EGVB 3X1DA 1MFZA 3K9LA 4P08A 2Q5LA 2R47A 1RRVA 1Z47A 2CUKA 2XQJA 3L02A 3Q98A 4C3VA 2MSCB 2W00A 3E9EA 1AGXA 1JLHA 3MNFA 3F6YA 3KEFA 5CFZA 3A1NA 1RWXA 4ZMBA 1Z17A 5LZ2A 3JAMA 2Z1DA 4HN4B 1TD1A 2NN3C 4QSMA 1YCDA 1VI2A 3LSTA 2Y1WA 3QKSB 5DFAA 4CLEA 1QH1B 5A2GA 1X3SA 1QGOA 1E7SA 1OX4A 2AFIE 1IZ8A 1UWKA 1JE0A 1CV2A 2OCAA 2Z4RA 2NYRA 4RZIA 4DIDA 1S8FA 4ACBA 1FLAA 2GK7A 2DTEA 3BFJA 2DLCX 5JZ9A 2MYUA 3RLFA 2ZRMA 1I94B 1W85A 1YR6A 3M6FA 1G5TA 2FW8A 3SM9A 3ZJYA 1FYWA 1UPUA 5IAKA 4IUBS 4JLSA 4K9OA 2NU9B 1RAFA 4OHXA 1PR6A 5H3CA 4MA0A 4ACAA 3ICQB 1QMPA 3K2QA 3RSQA 2EG9A 1JMVA 1SG9A 2RH4A 5EERA 3RJ9A 3CUUA 3G9ZA 4D9FA 2J3EA 4JWKA 3I92A 1LQUA 4QXOA 3K20A 3GBPA 2H9YA 4GT1A 2A1IA 4UXIA 4AUEA 3DXFA 4NYIR 3UPTA 1U7XA 2FI1A 4WASA 5TMDA 3ZEAA 5CCXA 2P2YA 3OZCA 5G2OA 1M76A 1P0CA 1ZBQA 2G76A 2WTXA 4HLDA 4KMRA 2FJPA 3C8UA 3ESZA 4L3OA 5IKPA 1KQNA 2DU8A 3B7PA 3OESA 1FFHA 3HB4X 4WD3A 1E2EA 3VSEA 1LV7A 1ZN8A 4IUCS 5JASA 1OGIA 4FIZA 4DLBA 4GM1A 2QUJA 3FCEA 3KTFA 5JNTA 2F1JA 3QEMA 3UTCA 1XSEA 4KZKA 1ZJYA 4FFDA 2H5LA 2JCBA 3W5JA 1B8OA 4W9NC 3UYKA 2AOUB 3A4LA 3E23A 1W8IA 3ZVLA 2G1JA 3FDIA 3KSBC 1VMDA 4D4HA 4FDAA 1QRRA 1W4AA 2RGAA 4N3AA 1MHPA 1QCZA 3QEAZ 3BSFA 3VNQA 1S2MA 2HPVA 2CB0A 3SJCA 3UFXB 4UOEA 3VR6A 3L1KA 1I7SB 2E49A 2BMEA 2R8EA 1V8OA 4IF4A 4R51A 3QLVA 1JHPA 4EKDA 2IC5A 1PG5A 2AFIB 4ENVA 4JIMA 1OLUA 1BCRB 1TYBE 1XWIA 4V24A 3HLKA 5IULC 1O3YA 1THZA 5T41A 1U8FO 1VLQA 4V0ME 3Q15C 4U5QA 4HWKA 5IM4A 1HO3A 4RXMA 1YOVB 4NU8X 3KOYA 4WESB 1I6MA 4YRZA 1CUCA 5B7NA 5IKEA 4FX2A 5EN4A 3LL4A 4AJ4A 3HVIA 4RTKA 2VF4X 3OHSX 4NCKA 1PJSA 1L3IA 5AFSA 3V4ZA 4R1PA 2ZB4A 1D8TA 1VSVA 5JSHA 4ETWA 2OSBA 1QBKC 3ZE1B 3C16C 1RWQA 1HDRA 4O2BA 2YYZA 1RXVA 1XMSA 3MJSA 1DWPA 3X1YA 1S3IA 2JGIA 3K0KA 1EWTA 4FGUA 3ZDAA 2I4IA 2R9VA 2IYUA 3TNYA 1BQ3A 2GD6A 1FP4A 1CUSA 4MUFA 5SZIA 3PG5A 5L3SA 3P2OA 4ZAYA 2HHLA 4OXQA 1TCUA 3OKPA 721PA 1B6RA 5ARCA 3LX8A 3TLEA 5K0CA 4E2YA 2Q1YA 3SSMA 4MDYA 1BAPA 2LRHA 3QKIA 1G4AE 2C4VA 1Q1ZA 3PUXA 5B12A 4B46A 1N6OA 1OV4A 3T52A 1JEYB 3KFVA 4C0BA 2GTPA 2VDQB 4M0MA 1EX6A 5DBHX 3VYUB 3A36A 4FMBB 1EU1A 1W96A 3SYTA 5ETJA 4JJGA 4G24A 2I3DA 3TPZA 2AXQA 1I4WA 5EZYA 1FNNA 4BCDA 2XDWA 2ZVQX 1U65A 2ZTMA 3VBEA 1KAQA 3IQGX 3HV2A 4OF4A 4MXDA 3VZCA 4F6CA 1E64A 2DR2A 2FMUA 2JGAA 1J2YA 3PC2A 4WXEA 4YO7A 5DYGA 1QQ7A 3I2HA 4HJRA 3ZWDA 3W2HA 4DILA 1NUUA 2R7MA 2QS9A 4GOXA 4XGIA 4QLBA 2PSFA 2WI8A 1JB1A 4PRKA 3KG2A 3CKYA 4OGLA 4ZXPA 1CQJB 4LKRA 3ZDDA 1C9MA 1MV5A 3L8FA 2XCLA 2Q6TA 2HLNA 3CLKA 3D64A 4QG7A 4EDHA 1CQIB 3ELBA 4PIMA 3W7AA 5HTOA 4ARSA 4ZHQF 3AHFA 5FOTA 4LHSA 4G0PA 2CJXA 1PEKE 4DZTA 3OX3A 4H27A 4UDOA 3EEYA 3K8ZA 3O4IA 4IIYA 3WYEA 3MT0A 2I76A 4BP1A 3ZWAA 4KI7A 5AMXA 1I01A 1VLHA 1WCIA 1XEXB 2WWGA 1OJ7A 2O9JA 2GMWA 4MR7B 2R1TB 2A9JA 3VI3B 4TSFA 1X8JA 3JWGA 2ZB7A 2JPDA 1ZGHA 2AWOA 1NZJA 3W2EA 1Z5GA 1X7WB 3CIFA 1O97D 3FB1A 3NRBA 4DQUA 1K06A 3BXPA 4ZI7B 5L6LB 1SZJG 3MCAA 4URWR 4EBBA 4ND6A 2WKRA 3ZHUA 4EG3A 3WMWA 1CLUA 1U8AA 1NQAO 3FA2A 3Q9SA 4IQ4A 5G3YA 3DLBA 3OF5A 2IGBA 4MS3B 2E3JA 1HYBA 4UHEA 3NT5A 3BORA 2JCVA 3RSFA 2FFHA 3HZZA 3G0DA 4NQRA 2R7LA 3CR3C 4C0XA 4LXIA 5BN3A 3OQNA 3IOBA 3LUGA 2YZMA 5TQ0A 3I45A 1X8KA 2ADOA 3B9QA 3S2SA 3RC9A 1PCXA 3BS4A 4FMPA 3IAM6 1ZNXA 2GPBA 5DGIA 4QBTA 1QQ6A 2PLRA 3QYJA 3RU2A 3V1MA 1J24A 4DKXA 1XVLA 3W5BA 2XA9A 2PRSA 3OPQA 4UC0A 2QZZA 1FXSA 4MZDA 2V5UA 1DCMA 1L6RA 4Z0NA 1LPPA 5HCIA 3PNPA 9MHTA 1LRLA 3D6JA 2JZOA 4YMLA 1U8YA 3NAQA 4XCXA 3GOQA 3UGJA 5CUQA 3FOCA 2VXYA 3T7DA 4TRJA 4WH0A 4RQUA 4DCMA 2MSKA 2DHRA 5HHTA 4A0SA 1VP3A 5FQNA 1JZQA 4FC6A 3WB0A 4DIOA 4F6RA 2QTCA 3GP8A 3H3FA 1QGAA 4ZPXA 5LDGA 4PCVA 1NN3A 3WLAA 4C0AC 2RGDA 4R8LA 3AESB 3CZ9A 5B37A 2FGJA 3C48A 4TTTS 2XADA 4LYDA 4QOJA 4YCBA 3OEHA 4WVLA 3SKYA 3VSBA 5EQDA 1QM5A 1CY4A 3CPSA 5LZ7A 4FM9A 1CSEE 5DBIA 2G07A 2GF0A 4M9SA 3O90A 4CDRA 1AO3A 2JGMA 4MKGA 5ENVA 1L4HA 2VF8A 2WFAA 3EDMA 4K8RB 1F9EA 1YB1A 4NIMA 4RHXA 1M1XB 4ARZA 3INNA 1KRWA 2I7XA 3WLHA 3W5IA 1H8HA 1LPAB 2WMOB 3PT9A 1TMOA 5GM2A 4AZ0A 4E31A 1QO9A 1JDZA 1CKEA 3ICWA 1T6BY 1IUOA 5AK6A 5AW6A 1Q21A 4E5NA 1AQJA 4DHEA 2WG2A 1JA0A 1T35A 5K8LA 1F2VA 4TWIA 1QP0A 1O9HA 2C0PA 1WPGA 2QPOA 1LBTA 4ZOAA 4CLRB 1Q2XA 1Y7HA 1HG0A 3ODGA 4QFDA 2H0AA 3RWOA 5LNK1 4KOEC 3I5AA 1C9NA 4QQFA 2RGUA 5DSXA 2BBOA 2RHWA 4YAFA 3QPDA 3AEUB 1RVV1 1Z26A 5FFFA 4DJJA 5EKTA 4F3KA 3I61A 4QM7A 1QV6A 1R64A 2VK1A 3GUYA 1OAOC 3LY8A 2QNRA 2P1DA 4FUQA 3MWEA 3MINA 1UDXA 1GQSA 4ARBA 1BG6A 3B53X 1GUDA 4QPDA 4AICA 3EJ6A 3W3AA 4Y2RA 5AM5A 4YRPA 2O2SA 2GCIA 1NYLA 1VSBA 4M1KA 3MPOA 4A03A 2ZSBA 3TAHA 1OHHA 3FMPB 3NWJA 4KN6A 1G0NA 2MSNA 3FROA 3OA0A 3I34X 3K5WA 4BZXA 2P1RA 1JSCA 2ZAYA 4GVPA 5AHXA 1ABEA 2P35A 2H1LA 3H8JA 2BZ0A 1FX0A 1N5IA 3L06A 3SJUA 4CTNA 4E1AA 1T4DA 3EGEA 1AJEA 4Y9SA 1YQDA 1H8EA 3NBUA 4IJKA 2XIJA 2GEDA 2PSSA 3BWVA 4NJEA 2I1VB 1V41E 1RWWA 3K70D 4F7DA 4N41A 3SIRA 3U7EB 1AV7A 1FJ2A 2BGGA 1MJHA 3WFZA 4A36A 4P36A 4MS4B 2OY0A 1Q6ZA 2NSHA 4LZOA 4TQGA 4V3BA 2ODBA 5DTIA 4DUZB 3M1AA 3UT6A 3ZD9A 3BB4A 2C99A 4LXTA 1SQFA 2IDZA 2CNWA 2OD7A 2WU1A 3QIAA 1AZSC 4K87A 4Q3CA 2FYTA 5GJWC 3OE4A 1YCFA 3K2IA 2WM2A 4JI5B 5HS4A 5GGYA 5IH3A 2IHUA 1W49A 1DPGA 2V7GA 3HN2A 3KKOA 5AW9A 2ZRNA 3E82A 3QM1A 4GUDA 1OGYA 2IXGA 4EB0A 2NPOA 2WVJA 3G5MA 3IO5A 4O0LA 3ZIDA 1RW4A 5BQFA 4GBED 2XW6A 1RAEA 3GC6A 4K9PA 3REQA 1KI8A 3TIFA 2VAXA 2FG7C 4C4AA 3OFVA 4L2IB 4EHNA 4YAWA 3CX8A 3MJVA 1CZNA 2Q5OA 4KV9A 4OKSA 4OHOA 1F8XA 2J6BA 2QDXA 2FX5A 3ASZA 3L0YA 4IDCA 5AM2A 1QVVA 2CXUA 4OYYA 3EVTA 1W1WA 3SEFA 2FP3A 4XD7A 1RHKA 3LK7A 4U7GA 2ZJ4A 4E94A 1PL7A 2FMXA 3P94A 4EFNA 5BSEA 4UEKA 5J4KA 5T4FA 5K05A 4JUBA 1W46A 1E3TA 1W0JD 2O2DA 2GJAA 2Z5LA 4Z53A 2W93A 3UCXA 1XMJA 2J7KA 3RBVA 2DWPA 4M55A 3RI3A 4E4YA 3DE0X 5EKDA 4DSTA 1DFIA 1LFAA 2R6ZA 5J63A 3MERA 4CF6A 1YB5A 5BR8B 2POQX 3U44A 4XUDA 4HDOB 3KPYA 4RPLA 3U6BA 3OX4A 3FHLA 4GKKB 4RCYA 2WTAA 1XLUA 2BF7A 1ZAKA 1H2HA 1KH1A 1E63A 1U7OA 1YZTA 2G6BA 2PZAA 4PYIA 5F12A 4D41A 2P9HA 4FR0A 3AKZA 3MEQA 1XRQA 1NU6A 1HX7A 1OX6A 4X6YA 3KR1A 1JLKA 5JAOA 2XUQA 4U3JA 1N75A 2O06A 3WNBA 3ML1A 4PRLA 1C3JA 1C3OB 4BMNA 5KNBA 1LBEA 3LOPA 4N7MA 3C8ZA 5EFOA 5CT6A 3MWLA 5ESXA 4B4DA 1U6JA 2H17A 5DO9A 1FRZA 3UQZA 3VTFA 4LE0A 5D1NA 2BDEA 2KI5A 4HH4A 1IJBA 1GSHA 1QF9A 2BKAA 1X7ZA 1UM9A 3E5MA 3HYNA 3OSZA 3PD7A 3QVGA 4L76A 4WCDA 2OE2A 3U7QA 4KPEC 1G8FA 4MK4A 4XJXA 5C51B 1J0CA 3PNLA 5A6VA 1QWOA 5L51A 3RSZA 4R9UC 6ADHA 1K75A 3HP7A 2I91A 3VAAA