3O1JC

Crystal structure of the tors sensor domain - tort complex in the absence of isopropanol
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
300
structure length
296
Chain Sequence
DEKICAIYPHLKDSYWLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAYEHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSGKTNIALLLGPRTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMGNIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensor protein TorS
publication title An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
total genus 98
structure length 296
sequence length 300
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1jC02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1jC01
1C4WA 4E7OA 4UHJA 4RK5A 3Q7TA 5DGCA 3OLZA 4RSMA 2IPNA 4YR7A 3FFTA 5FWYA 2IPLA 4ZJPA 1GUDA 1NXTA 1YK0A 4MR7B 2OENG 3G85A 2LIVA 1NTRA 4RS3A 1FQWA 3LUJA 1EWVA 2E4YA 3EQ2A 3FGZA 1TJYA 1JYFA 3M9WA 4KVFA 3CS3A 4MRMB 2R47A 4MR7A 1ZITA 1PUXA 5IEJA 4KREA 3QK7A 2ID7A 2JVIA 1TM2A 3OMWA 7ABPA 1TLFA 5KQGA 3KKEA 1P8AA 3HM9A 4EYKA 3DGFC 3JY6A 3LUFA 1EFAA 3O75A 4Y9TA 3TO5A 1H9CA 5FBHA 4ETIA 1RXEA 1VKRA 2FMFA 4GPAA 2GX6A 4IILA 4YRZA 4Z4CA 4KPYA 1A0OA 3I42A 3N0XA 4ETNA 3QLTA 3H5VA 4HYEA 4MLDA 4JOQA 1Z16A 1FFSA 3RVOA 3H5WA 3KHTA 5E3JA 3MF4A 2FN8A 5T7BA 3H6GA 3LMKA 3I5AA 3LUCA 1Z18A 2LP4Y 1J56A 1B00A 2DRIA 3EDCA 3LKVA 3D8UA 2PUCA 5KQPA 2FQWA 4Z9AA 3SNKA 3A10A 5GQSA 3O2JA 3BILA 3OM1A 4Q6BA 3IDOA 1WETA 1M2EA 4Z4GA 3GWGA 3ROTA 3IPCA 1QNLA 2MYUA 3RVKA 3MQ4A 3LUGA 3IP9A 2FLWA 2FTKE 2JBAB 2QVGA 3LTEA 3QLVC 3H5LA 1KRWA 3TMYA 3EODA 5BRJA 3CFYA 1P2FA 4KZKA 1P6UA 1W9HA 5BRAA 4L4UA 2F8SA 1ABFA 4JASB 3DBIA 4B09A 4UHKA 3RVMA 2W42A 3GL9A 2JRLA 2XDYA 3OO1A 3A0UA 4W5OA 1BA2A 3KYJB 4G86A 1NY5A 2IDMA 3L6UA 1LBIA 4PZ0A 2RJOA 4NICA 3LUDA 2FLKA 4ML3A 4D6XA 1M2FA 3RVNA 5JS2A 2CHFA 1MAVA 2N9UA 1ISRA 3Q41A 4KNYA 1YK1A 3L49A 2FMIA 2L18A 1DCKA 4NV3A 1JYEA 1JDPA 4H3KB 1NXOA 1URPA 3LUKA 1I3CA 4TMYA 3I09A 4EYGA 1SXGA 4NCAA 5EWMA 4EVRA 4YLEA 2FEWB 2FW0A 1DRJA 3HK2A 1ABEA 3KLNA 1QQBA 2JVKA 1M5UA 1FSPA 3T8YA 1YIOA 4G0PA 3EULA 2VYCA 1GUBA 3GV0A 4JP1A 4RKRA 2NUBA 2VK2A 2I6FA 5CHYA 3C97A 1Z12A 3MMNA 4EYQA 3HO1A 5CNKA 1DCMA 1FFWA 3CG0A 4KV7A 1BAPA 4WWHA 1JFVA 1E6LA 1D4ZA 3GRCA 4IF4A 1YTUA 4JAVC 4YV7A 3LUHA 1Y1LA 3BRQA 1ZHHA 2NT3A 3M6MD 4JB2A 1GLGA 2VUIB 1F4VA 1RZRD 4IRXA 4DN6A 1XWWA 3BBLA 5IEBA 5B3JA 3KLOA 3BREA 3C3KA 3T38A 2OQRA 5TQ0B 4O1IA 3F6PA 1LJLA 4H60A 3O1HB 3TD9A 2AYXA 4E7PA 2M1ZA 2ZWMA 4EYOA 5HSGA 2QV0A 3MM4A 3BRSA 2PE5A 4G0OA 4MQEB 4MR9A 3HSYA 5EWJB 2FMHA 2JVJA 1ZVVA 1ZDMA 4MLCA 1D5WA 4PEVA 3FDFA 3GBVA 1JDNA 3E61A 1T34A 3HZHA 3T95A 5TPZA 1ZAYA 4MQEA 3HS3A 4N47A 1L5YA 2FN9A 3CRNA 4ZMSA 5JNSA 3H5TA 1PEAA 4Z9BA 3ILHA 2H3HA 4RY8A 5IBQA 5GOTA 5TE9A 1JBEA 4P1ZA 3HJFA 4XXHA 4N0QA 4G0ZA 5JS1A 3O1IC 4YP9A 2MYTA 4D6YA 3NHMA 2A9PA 1F51E 3NNNA 4MRMA 5JNWA 3CZCA 1L5ZA 3O74A 4PYRA 4QPJC 1USKA 2B4AA 5KQLA 2GI4A 4Z4FA 4IMJB 4XAQA 1USIA 2NT4A 3DZDA 5EWLB 4OBBA 5IUKC 1PNRA 1DBWA 1DRKA 1KGSA 4YWHA 4Q7EA 1QO0D 4LDAA 2WWVD 1IIBA 8ABPA 1XHEA 3DGEC 3NNSA 1CEYA 1ZH2A 1RXIA 3H1GA 3JPYA 1CYEA 3F73A 2QZJA 2FMKA 3N0WA 1SD5A 2ID9A 1D2AA 3H5OA 1MVOA 2QXYA 4OTZA 4WXMA 4RK1A 2RDMA 4Z4IA 4N0PA 4F11A 3CU5A 3KG2A 2LBPA 1QMPA 4W5TA 3M9XA 6CHYA 1ZGZA 1PEYA 4LZLA 2P4UA 4RY0A 4XLTA 1MB3A 2FQXA 3CLKA 1KRXA 4OLAA 2WMYA 1DG9A 5C5CA 1U2QA 4QYWA 2H0AA 4ZPJA 3SQNA 1RZRA 4ZYLA 4LX8A 3SG0A 2PUEA 1BVHA 3A0RB 4XFKA 3C6QA 3URMA 2VUHB 2L19A 2QSJA 4OATA 1JLKA 2B1JA 3R0JA 1LK0A 3FFXA 3JVIA 2JBAA 1SXHA 1QP4A 4RDCA 4FB4A 4G0XA 3FFWA 4WXEA 2QR3A 2GWRA 1A04A 3GYBA 4EGSA 4ZMRA 1NXVA 4F12A 4XARA 2X7XA 3JVDA 4KK4A 4YGXB 2WY2D 2M98A 3QLUA 3HCWA 3RQIA 3S99A 3RVJA 3RVQA 1NATA 1EAYA 1KMIY 2HQRA 4QICA 4EVSA 4CBVA 1Z2EA 5KWSA 2GKGA 1AB6A 3CZ5A 4KMRA 2WRZA 4RKQA 3KTOA 1JHZA 2FEKA 1U8TA 1PNTA 4KQ9A 2QW1A 5KQMA 5ABPA 2CWDA 2IPMA 4Z4HA 1NXXA 1NXSA 4Z0NA 1DJMA 2JCGA 2FVYA 3T6KA 3Q7SA 2PUGA 2R25B 4RK7A 5CNJA 3ROFA 3UKJA 1YMVA 2PUBA 2GBPA 3DLBA 1YS6A 3P9YA 3QLUC 2HPHA 3N53A 2LUOA 1YMUA 1JX6A 1M5TA 1QQAA 4N76A 2MYPA 2L2QA 4KK3A 2TMYA 4RXMA 5HM6A 1K68A 2MYNA 2A9QA 2E4VA 3JPWA 4MS1B 3QELB 1TVMA 3QEMB 1QO0A 4KQCA 4RXTA 1C0EA 4Q6WA 3OM0A 4EVQA 3LFTA 4F8JA 5KC8A 1JF8A 3NNDA 5JNRA 3CNBA 3HDGA 2A9RA 2PL1A 2HSGA 5KI6A 2PLNA 3K4HA 3RH0A 4O1HA 5JNTA 3LOPA 4N41A 1E2BA 5HQJA 1LBHA 2WJAA 2CHEA 3QELA 4W5QA 1SXIA 2WJWA 5IUNC 3SM9A 1MB0A 1R8JA 4DQDA 1EWKA 4LRQA 4IMIB 2NZVG 5DKFA 1JWLA 1VRVA 2R4QA 3N6VA 5IC5A 2P9HA 5TQ0A 4MS4B 1GCGA 4G97A 1Z15A 1EWTA 2R48A 4LE2A 2QU7A 4H3HB 2LPMA 3GT7A 5DTEA 3VNBA 1VPWA 2RGYA 3VNAA 1DC8A 1BDIA 4JB0A 4FE7A 2E4UA 3Q9SA 4PICA 3UK0A 1W25A 1QPZA 2ZAYA 5B3JC 5EWJA 5IX8A 4XASA 2QVCA 4MS4A 1E6MA 4N03A 3CHYA 3KSMA 3GBPA 1VLZA 3IPAA 4RZSA 3O21A 1JFTA 2FQYA 4WZZA 1ZGGA 2FEPA 3EGCA 3HEBA 1ZH4A 5TQ2B 4MQFB 4LE1A 5JNVA 5TPWB 3OQOA 1JL3A 4RWEA 4L85A 1DZ3A 1JFSA 1Z17A 1EHCA 3C3WA 1OXBB 3KYIB 3OLWA 4RK4A 3OQNA 3N0RA 3OO0A 4JA2A 1NXPA 1YVUA 2O20A 5TQ2A 4MQFA 3TB6A 1BDHA 4TLMB 5TPWA 1U2PA 2MSLA 3C3MA 4MAAA 4PE5B 4YCSA 2A9OA 1XHFA 2PUDA 5EWLA 1APBA 2YHAA 2PMCA 3K9CA 3RVPA 3I45A 4HNSA 3MA0A 3E3MA 4HNRA 4G0QA 2AYZA 3DLHA 4IGAA 1Z26A 1RNLA 2JK1A 3O1JC 2IPAB 3QLVA 3OQMA 5IUJC 2FXIA 1BDJA 6ABPA 3F7NA 5PNTA 3IP5A 4EY3A 5T3YA 4S05A 1U0SY 2F8TA 4TN5A 4YS6A 3SAJA 1QP0A 3HV2A 4MGEA 1ZY2A 2FSPA 5DCLA 2PAFA 3LKBA 3HUTA 3SY8A 4G0MA 2HQOA 3H1EA 4S04A 2WB4A 3OLXA 2E4WA 4RY9A 3O2SB 4WUTA 3F6CA 5CNIA 4RV5A 2IOYA 3OLYA 1Z2DA 2JB9A 1DC7A 4W5NA 2PJUA 1OXKB 2Q5CA 3N75A 2E4ZA 3EQZA 3QX9A 2J48A 4HNQA 4ETMA 1NXWA 1YS7A 3HUUA 1DBQA 1USGA 1A2OA 5FBKA 5BR1A 5ED4A 2YHBA 1RPJA 1HEYA 3Q7RA 1ZN2A 3H75A 4MYRA 4KFCA 3QEKA 5TPZD 4NCBA 2BGGA 2IYNA 1D1PA 1LJUA 4RK6A 5TQJA 3LUAA 2PUAA 1PHRA 4LDZA 3UUGA 1K66A 4MPTA 3RVRA 3B2NA 4LE0A 4M88A 3KCNA 4O5AA 5BQ3A 5IULC 3G1WA 4TLLB 2PL9A 2PUFA 4KRFA 3A3KA 3KS9A 4F06A 4MS3B 3W9SA 5EWMB 5KC9A 2FKAA 3GA5A 2NZUG 1ISSA 3IP6A 4OLBA 3EJWA 3IP7A 1AB5A 5F64A 3N8IA 3Q15C 9ABPA 2RJNA 1GCAA 1U04A 4W5RA 1Z13A 1DCFA 1JH9A 3CKMA 3OLVA 2V0NA 4Z4EA 3ILYA 4MS3A 4F3TA 3O2QB 5D2CA 2PKXA 2CD7A 1SRRA 4MR8B 4EUKA 4FE4A 1E6KA 3KJXA 5C5EA 3RVLA 1P6QA 4RU1A 3RVSA 5I4CA 3MYYA 3TX6A 1DBPA 3EAFA 3CG4A 3JTEA 3QX8A 1S8NA 3HXMA 3CTPA 3MIZA 5HKOA 5CNMA 3JS5A 4MR8A 3NHZA 1QKKA 1ZESA 1TMYA 2IKSA 4MS1A 3QEMA 3H6HA 2L17A 4OG2A 3H5IA 2MSWA 1MIHA 3D02A 4YO7A 4D74A 4WT7A 5JNUA 3HVRA 4P98A 4Z99A 2KYRA 3NBMA 4GNRA 5FWXB 4QYMA 1QP7A 3H1FA 4DADA 1D1QA 4NQRA 2HJ9A 2MSKA 3FMVA 4RK0A 4RXUA 5FWYB 4MR9B 2E4XA 2HQBA 1UDRA 1Z25A 4G0YA 1DP4A 1FFGA 5DLEA 5FWXA 3OMXA 3HDVA 1CHNA
chains in the Genus database with same CATH superfamily
4KO1S 5EJ7A 9GPBA 3LC0A 4IJKA 1NRIA 1JG7A 1NC3A 3WK6A 3QWAA 4I5IA 1EFKA 2F2TA 3ZX4A 2BKAA 1NV8A 2TMKA 2AZMA 3U5TA 1E1CB 1QX4A 3DULA 2VDPB 1YK0A 2WTMA 2YOHA 3FPCA 5CT6A 5F12A 1QGYA 4F5YA 5CD1A 4P5PA 1DKQA 1G59A 1HKUA 3T3OA 2Z58A 5LP6F 4XGQA 3M4XA 4Z3OA 2A7XA 4YRAA 4Q4HA 5EXSA 4HY3A 2P9FA 2IYSA 2PSJA 3VDNB 4L4YA 3T61A 1QE3A 4EHNA 2FF5A 3AHCA 3KKNA 2EFGA 2EZUA 4IP0A 2PKQO 5CW2A 1F7VA 3GARA 4D56A 2IV7A 1OREA 5AKKA 2DG2A 3AKEA 5CJ2A 1GPLA 4JI5B 3LU1A 4UDYX 3NM5A 2P27A 2YY6A 1NW9B 1VHWA 2JKYA 4RVCA 4RZQA 3CXRA 3DQZA 1PTJA 1Z8HA 1DIBA 2GHTA 4O2RA 1N0VC 4JDUA 1H8ED 5KYXA 3DFUA 2WKSA 4U7WA 1O3YA 4ED9A 2QGNA 1AUXA 2F9LA 2OT3B 3BSWA 3TRIA 3FXAA 1H3EA 1RXEA 3QXSA 3IBSA 4C2TA 2XRMA 2E87A 5KDDA 1PP4A 1R6AA 2GX6A 1KEVA 4JUFA 5BWOA 3ADPA 5DW3A 2I4IA 1KPHA 2BP7B 1ORDA 3PGA1 1U99A 2HMSA 2EX4A 1FYEA 4YAJA 4LVOA 4EHKA 2AF3C 4YRTA 1B23P 1T2CA 2OK8A 5CIQA 5U4QA 1EQUA 4YP5A 1JS1X 1MO6A 4TL8A 2XTAA 3FBGA 4TKUA 3ZY6A 1PUJA 3EXEB 4WN9B 4XM1A 5EHQA 4EAQA 4W8HA 3F5FA 2ODNA 2FQWA 2HU5A 3A10A 3K9WA 3F78A 1TEVA 4BL5A 4DMLA 2VNAA 2Z5LA 4NOJA 5CXQA 2O48X 1N36B 2HRDA 3E1GA 3LBYA 3GXBA 3BHNA 5REQA 5TB5A 1PGPA 3FNHA 1GPH1 1MW9X 1ZA1A 3AG5A 3HCNA 3QPBA 4DMGA 2FN3A 3LTEA 3E9DA 2Y0EA 2OBLA 4GX0A 5A4JA 4JN6B 3DKRA 5EJ5A 2LW7A 1V95A 3AFMA 3UOAB 3OZWA 2F8SA 5D3QA 1J0XO 4W1SA 1F3LA 4K8OA 2FDCA 1PQ4A 1UEXC 2QRVA 1XDGA 4U0KA 2CYBA 3DZJA 4G5XA 5G41A 2QW0X 1TD1A 4IS2A 4LIPD 1AQLA 2BR4A 5B4TA 2ZTUA 5CA0B 2PCJA 1NY5A 2IDMA 3GT3A 1LBIA 3OUZA 5SY4A 5IDQA 3T5TA 1PYDA 3CPJB 2MR6A 5AIAA 5FOXA 3GA7A 3RQSA 2DETA 3AILA 4JBXA 4US2R 5HIIA 5AVQA 4QDTA 3DONA 5HYVA 5C8YF 3Q41A 1ZRMA 5BWBA 5DN6D 5KJ6A 4J9VA 1PV4A 2BLNA 1N32B 1JDPA 2WABA 2HL6A 5BQXA 3PT9A 4GPZA 4K6HA 3TLMA 1L4EA 1GPBA 3TLGB 1XKQA 4NU6A 4NCAA 5D7NA 3D0KA 2JFZA 2ONZA 2YWHA 4IIBA 3BERA 3AEXA 4RMIA 4Z1MD 4QNMA 5EZYF 2EW8A 1HL3A 4DMKA 3NI2A 4I36A 4NF2A 2PSFA 3WOHA 1WMBA 4I50F 1UBJS 2H92A 2WYHA 3GQBA 2WM3A 4HLCA 2BC9A 4XGNA 2GN6A 4DCSA 2GESA 3G88A 2NN3C 4IJQA 4W63A 1Q50A 3KNZA 3NOVA 4MRAA 1ZISA 4HGPA 4KQWA 5T57A 2JFPA 5HRAA 5CHYA 3ZYZA 2MMGA 3M6FA 5L4LA 3PG5A 4HDAA 5CDYA 2AT1A 5JV5A 1JFVA 3AEUA 4KI7A 4CM4B 4BE9A 3LHKA 2D7DA 1E6LA 2PHZA 1JQ5A 2VYQA 1JE1A 3OCCA 1OKKA 1YKSA 2YYSA 3PRKE 1EZ4A 1W49A 1TGYA 4JB2A 2VF7A 4PG6A 1DDGA 3KTFA 3RDPA 1YBFA 3D6TB 1RHJA 1IHXA 3HB7A 3OZIA 3SS8A 1N34B 4E5UA 4KKXB 4W6ZA 4BV9A 4H77A 3GBSA 2IA5A 5A9SB 5JR3A 4H60A 2FWAA 2VNIA 4EYOA 1A4XA 3GJ4A 1RYZA 4MP8A 2VAVA 1RXYA 1TAHA 1QR6A 4G2NA 1SOAA 4WJLA 1Y4DE 3FB1A 4G65A 1MRSA 5ESRA 3ICEA 1J8QA 2YIMA 2C2BA 5A71A 1H85A 2IV2X 4G5RA 4WNYA 4AQDA 4BKUA 2XUIA 4D9IA 3CVWA 1OAOA 2QS9A 2GJSA 1WX1A 4E94A 3IV7A 1XXHA 4Y2SA 5JEDA 4NAHA 2BD0A 1M6HA 1PR3A 1KPIA 3SMQA 3HS3A 4AIRA 2BISA 3GFBA 1L3BA 1ID8A 2WIKA 2HJRA 4ZALA 2G6BA 3PU6A 2P6RA 1IFXA 5EHGA 2QQ0A 3VOBA 1ESDA 5HKLA 2XA9A 4BOYA 3B51X 3CF6R 4JQYA 1C9KA 2W2KB 5I9LA 4BATA 4CHTA 3FTNA 2R0QC 2ZIUB 2X8WA 3O74A 2I4RA 3DDOA 1VZ3A 4HDMB 4MULA 4RIGA 4DA0A 4KR7A 1SWVA 1Q7GA 1OF1A 1U0RA 4WKGA 3VR1A 1G3RA 1M7GA 4PAOA 4B17A 1NRXA 4KX3A 2I1VB 3Q88A 4KV9A 1KJZA 3IT0A 2AMVA 3EXG1 3UANA 3T41A 5AI5A 3WBBA 1SUSA 2V4UA 1W73A 2R4UA 2G77B 1UM9B 1T9GS 1WCIA 2ZIAA 4LC1A 1RZVA 2JIZA 1AHPA 2GZMA 3EUEA 2FW6A 2VK8A 1V9LA 3MBIA 4W7IA 4X8HA 4YDHB 1S9HA 1U1DA 2J0EA 4UBIA 4BEVA 1TW2A 4BNVA 4LPKA 4WZAA 4F11A 3ROKA 1ADCA 2XCTB 4GI2A 4BFYA 3I0MA 3M9XA 5IVHA 1NSFA 4QTZA 5FAKA 4BZPA 2PJDA 4RY0A 3QVMA 5WRFA 5ALHA 4F8EA 1PWXA 1TMOA 4LNUB 2OXIA 2P1ZA 2XMQA 4QDZA 3IXMA 4PC3A 5EP3A 2VLIA 3ZXUB 3N3AC 2PTGA 1Q2UA 3R3YA 4LBYA 5HMLA 1BJKA 1O95D 1OIVA 3B85A 3X1ZA 4PBRA 4AUMA 3HKDB 2BTEA 1N0UA 3LRPA 1BS1A 1LK0A 3PDIA 4WK2B 1U7PA 2JBAA 4ZA2A 1C4XA 3P71T 3QKIA 3SEFA 1FNDA 1NVBA 2D0IA 4KEAA 5EJGA 1SHJA 3SEZA 3ZI0A 1PW5A 1A7JA 2FSUA 2O2SA 4JBHA 4D0LB 4TKVA 1J06A 1PVDA 1QH1B 3GYBA 1N57A 3IYLW 1U1CA 1X9GA 4FX2A 3PYLA 4YGXB 3UPUA 2NV0A 4RHCA 5GMOA 4AKHA 3VKGA 4UZSA 4EK9A 1GZ4A 1UP6A 3EH1A 4QHTA 2NM0A 4M76B 5FOWA 4U7JA 2GAAA 4LYDA 3SLRA 4G23A 1OU0A 4KMRA 1VYVA 2B30A 4QGAA 4CG3A 2P41A 3NBZC 1KYQA 1U11A 3BK7A 1S4MA 3DE1X 3CUSA 3IELA 4UEOA 1A8QA 2VRBA 1XAIA 4EGQA 3CVYA 1HE1C 2JHPA 2ZG6A 3FKJA 2NZJA 5ARBA 2VDRB 5ABPA 2CJXA 2CLHB 2CWDA 2D3TA 3VR4H 1EFPB 1G98A 1O9BA 3TQHA 1UL1X 4TWJA 5A6VA 3SVZA 4C5AA 1HLDA 2IZ5A 4M37A 3T3HA 1XO1A 3NKVA 5H0IA 1AKNA 3A7EA 3FSEA 1ZIDA 3OCVA 3UCEA 5F21A 5K3CA 1A9RA 3FCYA 2OYRA 3VV2A 4CEHB 2VA9A 4F4HA 2OCAA 2W98A 3OZBA 4LUCA 1IQRA 1YOVB 4N4AA 4UVEA 2V58A 4WJKB 5A1JA 2FFRA 1TC1A 2B69A 3GFQA 4UUNA 2Q5QA 3L79A 4DT1A 5FPKA 1IDOA 1KZ7B 2O2HA 3D7SA 3TVTA 5LKRA 1U6JA 2X3FA 4ECEA 2ZKIA 3WB1A 4FFWA 3ZLVA 4NI5A 4L8YA 3ER9A 4KRXA 3D0QA 1SXJA 4YFYA 1SBIA 4H1VA 1FDIA 4IJ6A 3UXEA 5F5XA 3R41A 1AIPA 1AUPA 1PN3A 1QMGA 3R7AA 3ADKA 5DMHA 2X1MA 1T3GA 2CHEA 1MD9A 4TUYA 5GVRA 4GYYA 3J80A 1TADA 4GPD1 1FP6A 3OEHA 4ME6A 5JSKA 3RRXA 2QRJA 4DIDA 4E5MA 1WZNA 2A1TS 4GSLA 3VMMA 2AG6A 2CY0A 1TD9A 4RD3A 2YCBA 2IS2A 1FF9A 2VBGA 3T15A 3MFQA 2DBYA 3TGLA 4D4GA 4MYHA 5CLQA 1R6BX 4F4IA 5M2QA 3I30X 4X62B 1A8SA 2QLFA 1POWA 1KYVA 2AS0A 3EWNA 3N7UA 3R5TA 4FNGA 5B3JC 3WRVA 1U9ZA 3ASVA 5BMOA 1JDBB 2C97A 3RVBA 2WWTA 4N03A 1OYYA 4I81A 4OQLA 3P32A 4YXWA 4C0JA 3C74A 1EZ1A 1NQOA 1RXCA 2KI5A 1QIEA 4Z3DA 3UKOA 5I9BA 1H4QA 4JJKA 4E4YA 1O9HA 3STYA 1YQWA 4FFMA 5L3QB 3GPDG 4MQFB 1PJ8A 5I9IA 3S29A 4HPJB 4P9NA 4GEGA 1H94A 5HZGA 2ZTLA 3DOOA 2RHHA 5BWMA 3GRZA 4A91A 4GI7A 2FWPA 4PZDA 2GHRA 5FPYA 1ZUD1 4M8NE 4V2IA 2Z2ZA 3BFPA 1N6PA 3ORRA 2RAUA 1U3TA 1C3EA 3B9BA 1NXPA 4JVSB 3PIDA 4I9UA 2I2BA 4JJZA 1EEXB 1P9LA 5H70A 3ROGA 1NZJA 2E21A 3TZ6A 4ZK6A 3BOSA 4NCNA 4CN9A 1F14A 3EPJA 3ZJVA 4R6XA 2EGUA 4E2ZA 1Y34E 3M4YA 3K05A 1HDCA 4L7QA 4ECAA 4UU7A 4LC9A 4PGFA 3UKDA 2VEOA 1SA0B 3MA0A 5LM3A 3A1NA 5IG2A 1Z8FA 4J76A 3VPBA 1I2ZA 2B1GA 3RABA 1GUFA 2PX5A 4AZ0B 1P7YA 4BJ6A 1OFIA 3TZBA 1ND5A 1CDEA 1DAMA 1FLAA 4TTTS 4AP5A 4LRSB 5IUJC 3DV0A 3G2MA 1NDQA 3UT6A 1OKKD 5A4MS 4Q5IA 4ABYA 2OO5C 3AHFA 1RAFA 3RRYA 3W3AA 2V65A 2O14A 4ZVRA 4YQEA 3VJRA 3CX4A 3HV2A 3AL2A 1K8XB 3PX7A 3FOCA 2JDIA 4X20A 5KUTA 4OHYA 5EIBD 2WAXA 3KQUA 3JRWA 1OIWA 5BSUA 3MJCA 2DYKA 4ZV9A 3VZSA 4UAVA 1ZJWA 1GPAA 1T2UA 2YW2A 3QFCA 2E4WA 2DE0X 4MVJF 4RY9A 1NL3A 1K8ZB 3CR8A 4IV0A 3K2QA 3NHPA 2UZ1B 1BEEA 3D4IA 2HA0A 4DNQA 1FXUA 4IFEA 1Z2DA 3I3OA 4RMHA 1EX1A 5K09A 1OB2A 2FWJA 5ITZB 5DULA 3ND5A 2X4DA 1S2NA 1R2QA 3EQZA 1W36B 4IDBA 1FP4B 5HF9A 1L7PA 4PAQA 1ZMXA 2R7MA 4JLPA 1DBQA 1XNJA 4AUEA 2BH9A 3VR5H 2C9DA 3D8HA 1KJJA 1NKTA 3LFUA 1H1LB 3C7DB 4NCBA 4R1PA 2BGNA 2BM9A 2C94A 3C5HA 1XROA 2CJFA 3I6ZA 1C8KA 1N6RA 4NJEB 4QX6A 3IKTA 3CR3C 3OY2A 2OESA 1V71A 4MKFA 5HE8A 2I03A 3KT0A 4DG8A 4E1VA 4XIYA 4CIDA 3JQGA 4UNNA 5J58A 2UUCB 4TOIA 2DPMA 1C8BA 3OI7A 4J0QA 1GA4A 2GCNA 5FYQA 1XB2A 1KWGA 3K8ZA 3R4CA 1WD7A 2BM0A 4HYYA 1HLFA 3JSXA 1W4ZA 2ACKA 2H11A 2JLSA 4DA9A 1N92A 2F8LA 2XQJA 2Q5IA 4FYWA 1JDTA 1FP1D 1N7IA 1GPKA 4PG7A 2HDOA 1G21A 2C4KA 1UKVY 1ATIA 3TQQA 1YZTA 1E2QA 1C50A 1EK5A 4YJ3B 4G1CA 5JUWA 1PG5A 4FE4A 1PJSA 1EIZA 2GXQA 1V5IA 2QTLA 4RU1A 3IT2A 2VDOB 5IDXA 2Q6TA 4DUZB 1ZKMA 1GUZA 2A5FA 5KDOA 3P0RA 4GI3A 4B2LA 1DCTA 1CXZA 4OB7A 5AW4A 2MSCB 2HJSA 2JIZD 1Z39A 2CSUA 2IYLD 3EVEA 2CXHA 2VJNA 4OK6A 2Q0SA 1TAQA 1DG3A 2I6GA 2W4IA 5FAXA 2W2TA 2GM4A 5EL0A 4PCAA 4R2JA 4BB6A 2FWIA 3OP4A 3ABZA 3H6HA 3CH4B 3TNFA 4DZTA 1YD7A 4L51A 4KJXA 4C0QC 2O1XA 1OH7A 2Z09A 3BTSA 2D00A 4TVKA 1TT5B 2HCRA 5AYVA 3WL7A 1FBNA 3DPUA 1KAHA 3GJ7A 3INRA 4C4AA 3VZRA 3EPHA 4Z99A 1E0DA 4L3VA 4KDRA 2GR9A 3DQQA 3DDWA 4UM5A 1M2VA 1U3DA 3AIIA 4H1TA 4UBMA 3UUWA 2UXBB 1WLYA 3FRJA 4YI5A 4F1JA 2NO7A 2YC2C 3INTA 3RWMB 3P0FA 3WHLA 3E0QA 3WSVA 4CF3A 3CZPA 1PR4A 2E4XA 3C8DA 4QXQA 1GTSA 4BMYA 2Y6UA 3H65A 4HJRA 3SLKA 4XDGA 1Z74A 3CMCO 1KDVA 1JWBB 1QH0A 1T5TA 4J0FA 3AEQA 4LF7B 1GPMA 2WKQA 1NOIA 3E5RA 3KLPX 3O8NA 5AW0A 1IY0A 5EMLA 1ZXLA 5JQGB 2PG3A 1KIAA 121PA 3AERA 3F6SA 1EVJA 3HYCA 4PS1A 4TTJA 3R75A 3K9FC 4ID9A 2ZYUX 3RU2A 3UTDA 5COQA 2WF7A 3ECSA 2VHQA 2LIVA 3KYBA 4G1MB 4XM0A 3L46A 2WZBA 2CZGA 1EWVA 3VDMA 1TJYA 3DW3X 1JG6A 3O83A 4F9FA 4CQMB 2Q3JA 2PXXA 2I6SA 4N7JA 7GPBA 3SN6A 1KQGA 1GO2A 2LE0A 4I4IA 2GM5A 2EZTA 4MR7A 5EPEA 5IT5A 2GF0A 3LCJA 1Z4PX 1JFFA 1FVXA 2WAAA 4HJXA 1FA9A 1K06A 2JVIA 4UD2A 4D8YA 3ZHZA 5G2OA 6REQB 1BJRE 1O94A 1OSNA 5BW6B 3NDIA 3UUFA 3WA7A 3TW6A 5DXFA 5I4IA 4L28A 4PLPA 1UBMS 3ONEA 4C0XA 3HJFA 3IQZA 3BC1A 2AR9A 3JQRA 2EJCA 3WJ2A 1NBME 1R88A 5KNCD 4LSGA 1AQNA 2FR8A 1MFPA 1JECA 4FHFA 1EXVA 2DHEA 4RNCA 2Y1FA 4KMOA 2C9CA 4ZAGA 4IUDS 1NI4A 5IJXA 4D80A 1AV7A 3VKFA 3IAHA 2PSEA 4CDGA 3HN2A 3SFTA 4DQUA 1W6UA 2PJZA 4LZOA 4OX9Y 3TSAA 2RIPA 1U0BB 4O8CA 2QT9A 3KHTA 3PF9A 2CVHA 1MTZA 1SXJD 4UE3S 3VU9B 3VNQA 4YCAA 3P94A 1T3LA 3B1VA 3VNUA 1B00A 4OEHA 1CQIB 5CX4A 2A3NA 2PUCA 1TU0A 1M67A 3D81A 3LC2O 4ZCMA 3VPAA 4XEHA 3E3NA 2QRUA 4Q6BA 1VG0B 1LJ8A 1II0A 1OLUB 2EF0A 4FGSA 4KVZA 3IPCA 5KTTA 4YJGB 4OHKA 2JRCA 4JVOA 1G7CA 5CJJA 1KVQA 3MB5A 1QCCA 3H5LA 1XOIA 3GLTA 2B4YA 3RYFA 3T0FA 1P2FA 1E9AA 1LS6A 1W9HA 4OJTA 5KQSA 4GZ6A 4KHPB 2E7ZA 1SC3A 1U4SA 2JFFA 3QYPA 3S68A 5DHAA 4M1KA 5HS6A 4C01A 4J94A 1ZD9A 4RVDA 1A50B 4RJTA 4IF6A 4JI6B 4A8JB 4W5OA 1UKEA 2GZ1A 4ZYTA 1KO1A 4G86A 1RI2A 4X7BA 4ZP1A 3T7EA 1F6WA 4O29A 2PX0A 4QGHA 4RCVA 2P2ZA 2LCFA 2Q1SA 4EB6B 4YMTA 3QEAZ 2J45A 4Q03A 4G0NA 4DHWA 2N9UA 3FLEA 2IOHA 2IQIA 3LWNA 3TNYA 4CKCA 3KQKA 1XJQA 4ZN6A 2BMWA 1KS9A 4BAGA 1O54A 1Z08A 4TROA 4YN3A 1CY7A 2AVDA 2WWRA 1T36B 3REQA 4TMYA 1CR2A 5DHTA 4QBGB 4ZEOA 4DVJA 1Y5IA 3THOA 3KKMA 2C7GA 3A05A 1JQKA 2AMJA 2C7QA 4F72A 4B2PA 3LGXA 1DRJA 1K5HA 5BUSA 4F1WA 1KL7A 1QVWA 4E5NA 4LYHA 5EMJA 1M5UA 2PFKA 5HW0A 3ZGVA 3LWZA 3L1HA 4B3SB 1TFRA 2FETA 4ZODA 3JQAD 5AM4A 1AOXA 1DHRA 5K4AA 3RG8A 4C6HA 4C2AA 4X63A 3P9ZA 4WA7A 3FRIA 4U3JB 4TYWA 4ENWA 1YQXA 5F2OA 3ZS8A 4LGMA 1DWUA 1CY8A 3ZHQA 2WKRA 1RBQA 3TIVA 2YJ5A 3BL5A 1P19A 1T1GA 4R9SA 5TGDA 4LF9B 3A9TA 3W3AD 3I64A 1DHTA 5G40A 1DQZA 3VR0A 3ANMA 1H3NA 1CZHA 1HFJA 2D0OB 4U39A 2O3TA 4BAUA 2OP1A 3D7NA 3JQ7A 2JDID 5IEBA 3D6JA 5CDHA 1T1IA 2AW3A 4IJVA 1G5HA 3JD2A 3MCZA 4D8VA 3EK2A 2FP4A 1ZD1A 3KEQA 1WBJB 2IEYA 2XNKA 2OYCA 2YHIA 3TLJA 1W5FA 2J67A 2X5XA 4TS1A 5AM0A 4ZOCA 4DR5B 4KQXA 4QVKA 5E6UB 4OIFA 1KYYA 2YS7A 4MPDA 1NIJA 5AOAA 3CCCA 3KWLA 3N2EA 2GNOA 4FHEA 1B6TA 3JQPA 6LDHA 1GAWA 2WJYA 3RAJA 1N2CA 3W8RA 4I8IA 4ZWNA 2YH2A 2QHXA 5KYVA 3GRFA 3CZMA 1RHRA 2D5LA 3HCPA 4HFJA 1D2RA 1JDNA 3DW1X 1QJ4A 1OBCA 2BKLA 3LT1A 4KIGA 1BGXT 3I9LA 4S1OA 5D01A 2XB2A 1RWXA 3P27A 3HY3A 3ILHA 2H3HA 4L5YA 5DVZA 2W2VA 3FVQA 4DLLA 2D1SA 3THXA 1UXGA 5IKEA 3R0IA 2QF7A 4J43A 3O1IC 2MYTA 1AS0A 5JWOA 1BWSA 2DTEA 2ZB4A 3ABIA 3ZGLA 4GYWA 1VPTA 3K0FA 2C84A 1TYEB 2YWBA 1YVRA 2O6LA 3ESDA 1L5ZA 1T4MA 1FX1A 2B4TO 3MIIA 3PVZA 4LWZA 1USKA 1NHWA 3ELDA 5LJLA 4IVNA 2AXPA 3FLMA 3K1JA 2CW5A 2X13A 3R4VA 4TRMA 2NT4A 4H17A 3VM6A 5HPYB 4C7OB 3VOAA 3W5BA 5IUKC 3GFPA 1DBWA 3EF3A 4XWYA 2WPNA 1T0BA 4NBNA 1GILA 3NNSA 1KEUA 1OUMA 3SR0A 3F5DA 1WCXA 3L6OO 3X2FA 2BMEA 4CTJA 2F3UA 4KR2A 4MWTA 4HK4A 3GG2A 1VKHA 4ZI7F 3D2CA 2HV9A 4D9CA 2ZS8A 4NMXB 2PD4A 3G9ZA 1PJRA 5DYNA 2I1WA 2WZDA 2HRZA 4FSHA 5JVDB 2XYQA 3SJZA 4KWCA 3BWYA 5A9TA 1G6HA 3QHPA 4ND8B 1SURA 4A27A 4R1QA 2REQA 2CL5A 4OCZA 3QOWA 4I55A 1H66A 4HAWA 5FUMA 3VAYA 4LTNA 1ORTA 2V3CC 4IIDA 1DS6A 4ZPJA 2HNKA 3OX3A 3THSA 1RZRA 1EXDA 2DTDA 3F6RA 4Y2PA 1FIUA 4E4TA 3L07A 1UOQA 5G1PA 1XCOA 1Z62A 1IL0A 4YREA 3VZCA 4TL6A 4I14A 4W4TA 3ZW9A 3Q8LA 2P4SA 2QAGC 2VAMA 1F9EA 2GCIA 1DBSA 4XD2A 2DQYA 4HFMA 4HWGA 2C95A 1L5RA 2H1VA 3VX4A 3U81A 1R4MB 2IE0A 2B0JA 3S44A 4M3NA 3PUIA 4TM8A 4NARA 5B1IA 3RVJA 1D0SA 2J5KA 4EPTA 2OGSA 3DMGA 4ZVSA 4J6FA 1UQUA 2ZTSA 3OT4A 4M0UA 4PSAA 4JVLA 4BHTA 1T0PA 1VLLA 5TMBA 1A1VA 2XOXA 1J0AA 2OA0A 1ODJA 3K96A 3IL2A 3RIEA 1L7EA 1V5GA 2B4QA 2H4JA 4KJZA 3ZHBA 4P5EA 5EJFA 4CW7A 5SZJA 3WK8A 4ZJZA 2WSYB 4UPVA 4GSYA 4O5OA 5KVCA 4Z0NA 3MUNA 1O94D 5EZ6B 2W7TA 2FW7A 4ZVOA 4J03A 2QGZA 3L4BA 3WLHA 4RK7A 5FH9A 1G8JA 1Q12A 4HYTA 5K3BA 3OZFA 3ILVA 1BTOA 3M5DA 3AFHA 3M8KA 3N53A 1G38A 4N49A 1FZQA 2A4MA 4I1YA 3W1VA 3TECE 3PC7A 1ONOA 4WXHA 2MYPA 2R1TA 4X7RA 3PHGA 5ALUA 2O8BA 1K68A 2AYYA 1RLMA 4PSDA 1RRFA 1MF7A 1XWFA 2WG1A 3EXHA 1HBJA 3VTFA 2Q3MA 3KB8A 1K4MA 5KC8A 1GQRA 3C3EA 4TS4A 2KLBA 1JEQA 5DHSA 2A9RA 2ZZNA 3COYA 4U7PB 2EEZA 3G0IA 4MA0A 3QMWA 4MZDA 4M1MA 4D5EA 4EBFA 1RLIA 4MCIA 2B5VA 1W88B 4UCXA 4AS1A 3AVOA 4MV4A 3WMGA 1XZKA 2Y76A 3MHPA 4GOND 2XECA 1I2AA 1DKLA 4R40A 4GKJB 3SM9A 2YN2A 2X1VA 1EWKA 1XV5A 4RM2A 4IMIB 5D51S 1KDRA 1M33A 1DIOB 3L9WA 4RNDB 1RRGA 3P52A 4CTMA 3TEFA 3M6WA 3TPZA 1UOPA 4LE2A 3FUVA 4RO0A 1EWTA 4X5OA 3U44B 2CDRA 4FDMA 5AVVA 2O8NA 5LDDC 4H18A 1L5WA 1XP5A 1JXOA 1UXHA 2W6IA 2ECKA 1Z7BA 2Q50A 4XWOA 1P44A 1W25A 5JDIA 5KYTA 3CSSA 1ZEJA 3FPBA 1SXJC 1VIVA 4LDJA 1FLDA 4EKYA 4GMKA 4TQGA 4HUQA 4K2AA 1YONA 2CCKA 2J3MA 4BO0A 5B4UA 4K3VA 3C1OA 3DBRB 3FWPA 3L0ZA 4RVSA 1JPJA 2J9GA 2FI1A 1RLUA 4FLEA 4R7GA 4D3XA 1HZZA 5DT9A 5IPFA 2H16A 4MYDA 2GSWA 4U5QA 4ZZ0A 3NBXX 4CL0A 1CUZA 4RTSA 2R8ZA 4Q02A 1LK5A 1RZ3A 4DJEC 5HG0A 2LD4A 3AUKA 3OQOA 2XHZA 2X2EA 2OBFA 1UUFA 1UKAA 2QTVB 3KTDA 4X66B 4FOSA 4L85A 3PNOA 3EVBA 1JLLA 3L7NA 3EISA 4KYTA 1OXBB 3OLWA 3U40A 4QGFA 5IKOA 2YXLA 5LOVF 2NO0A 3MELA 4UM9D 4CF7A 2O20A 1DZIA 1FDRA 2PQMA 1PGOA 2FZVA 3EA5A 4Y1RA 3WQBA 4C0BA 1N8TA 4OSOA 4F4DA 2XKKA 3T1YB 3H16A 4PY2A 5ALVA 1YBMA 1IBMB 4FN5A 3NCTA 4NBSA 4G0UA 2C5EA 4DA6A 2DGDA 2VJMA 4K03A 1EUYA 1APBA 3BCUA 4HEQA 4J4TA 1P0PA 2O3UA 3NEAA 1D2NA 3E3MA 3DBOB 4MRPA 2HBRA 1ODSA 4X94A 2B5OA 5HIMA 4PGMA 5JH7F 3NHBA 2GKOA 1QHYA 4HQLA 5SYNA 1KQPA 3W7AA 4K9OA 2IZOA 2IOFK 5EINA 2BM1A 1NM5A 4ZRMA 1ZRNA 2FXIA 2OB2A 4GRAA 4J0EA 4EY3A 3OCYA 4WASA 2EJVA 5GVSA 3DDZX 4TS9A 4I5GA 4O4LA 4EA8A 2YIVX 1TM4E 1CSEE 2A4KA 4IX1A 1H9AA 2PAFA 3PT5A 2JZOA 1ZNQO 3TL2A 2CV0A 3DG9A 5LP6B 3D1VA 3QU5A 1JH8A 2AC7A 1JZSA 5B3KA 2EZ4A 5EIXA 3CE6A 3WAKA 5CB6A 1B7GO 1YDFA 2C5FA 2PKCA 3JCZA 3KSRA 3TQIA 1EK1A 1JZQA 2P0YA 2AQIA 2XPCA 3NH6A 3KEGA 3VSEA 1JV2B 1QRAA 3HUEA 4Q1VA 1PAUA 3QENA 4Y2YA 1NXWA 2Y99A 1E6EA 4FDTA 5K8UA 1USGA 2B7LA 2B98A 2I2CA 3FLAA 3PCRB 1FX0B 1WB6A 3OVMA 3GH3A 1RPJA 2C31A 4IOJA 1OA0A 2FW8A 3REFA 4CFSA 1OYOA 3SSMA 1CFJA 1M34B 3DM9B 3EFOA 5G3ZA 2ATVA 1R9MA 2PRJA 4QE3A 4C88A 5TR9A 3KDAA 4RSGA 4ZOLF 3GRPA 1HT1E 2O4UX 1SCUA 3M3PA 4D46A 2GZDA 1BYUA 2K87A 1QONA 3FVRA 1E1YA 3PDCA 4CDRA 1F8FA 1T8TA 3L6EA 4L0MA 3PE3A 4O4HF 4QAQA 3KS9A 4RIEA 1HZJA 1KC3A 2HNBA 3DBHB 1OGIA 4JFAA 3TIGA 1CS4C 2D1QA 1VFNA 2IPXA 5F64A 3B2EA 4AJPA 4NECA 4UTPA 5A7FA 3PI6A 3K92A 1NJ1A 5KTMA 3L7OA 3MGAA 4W5RA 2HSJA 3WZMA 1P4JA 3QBDA 3MS4A 3Q3HA 4X00A 1J0EA 3C6XA 1V41E 2PGDA 3T5MA 1CQPA 3H1PA 3SF8A 1X13A 1JLHA 2AOXA 3AMVA 3MGKA 1PR0A 2I8AA 1V43A 4X92A 5BVGB 2IVFA 1EU1A 2PLFA 1ZM2A 2HRRA 5BSVA 2XI4A 2QUJA 5K0FA 1GRRA 1FBTA 1H69A 1JSLA 3DZHA 2B61A 2IOFA 4FFLA 4IYRA 4JBIA 2QYSA 4N7BA 4OQQA 4QBHA 5FRDA 4YMUA 3QSGA 2GBFA 2ZTHA 1ZLYA 4X97A 5CU7A 3LOQA 2DAPA 4E3WA 4XTRA 3NDJA 1DKNA 2IHTA 4F6CA 4GSKA 4INAA 4BFCA 3WHPA 1IZ8A 5E2IA 3P19A 4Y6LA 1N1MA 1Z6AA 2C7VA 3F7OA 4DFDA 1BZYA 1T3ZA 4N18A 4MW6A 2VKTA 3I9OA 4WKPA 1WHSA 1YE5A 3Q87B 2AB0A 4DLNA 1I3KA 2B2XA 4QYMA 1Y80A 2Z8ZA 5FJIA 4Q48A 1Z8NA 3V80A 1ISJA 3BGDA 2F64A 1Q84A 1QBGA 1J8YF 1A3CA 1IN6A 2AOTB 4KVAA 4AT1A 1TMGE 1XL1A 4ZFNA 4D8TA 1X8LA 1MN6A 3SOPA 2VCYA 2IXBA 4EA6A 3QA9A 4CMIA 1NJ2A 3EMVA 1MNAA 4TMWA 2AG1A 2REXB 2OVBA 1ZGHA 4MKHA 2V03A 1EB9A 1XTPA 3RB8A 1QZUA 2NV6A 3LRXA 1GUDA 5EZYB 1QHGA 4U7TB 4I50B 4WEOA 4BLVA 1XQ1A 1GKUB 2FX3A 3EQ2A 3ZWVA 2J0UA 3AV3A 1SCIA 1SKQA 4MV0A 4LFCB 2BEUB 1IN7A 4RPIA 4HTFB 4E46A 1E1CA 3IKVA 4JJ7A 4S0ZA 5IWAB 4ABTA 4QJIA 3GLSA 1S8FA 1UIMA 3AC0A 3I0NA 3U7IA 1C3OB 3MOIA 1G4AE 4F97A 3DE6X 4H7EA 2RG7A 4JNCA 3DP7A 1T1EA 4P22A 4BNNA 5SY6A 5H80A 3QQPA 1MC8A 2B8JA 4IDQA 3HJRA 1I4OA 4KFRA 4PQFA 3IHTA 4Y7CA 5AOVA 3Q8KA 4GHWA 3F5MA 4IDPA 1JDUA 3OWXA 1OYWA 1R66A 2G5TA 2PMWB 5A4DA 5J5VA 1S7CA 1DEHA 2CT8A 2ILVA 5FL3A 2AXEA 1I6MA 4YRZA 1KP9A 3F3YA 4NY1A 1Y3IA 1WABA 2IIQA 5I51A 1I0IA 4YIHA 1H0KA 4HGNA 5CIYA 2QAIA 4JOQA 4L1KA 2ARKA 4OQMA 3GNSA 3H5WA 4WK4B 2WOOA 2JAHA 4XOUA 1NP3A 2PL5A 3DOHA 1YI8A 3WJ1A 1Z18A 3ZVNA 4HQFA 3H13A 1FNMA 3LCVB 4K05A 1O94C 2BP7A 4E4RA 3GN2A 5BN5B 2CFCA 1XN4A 1JRLA 4NJMB 5GQSA 3UAGA 4AKTA 4Z5XA 1XD8A 1JVBA 3E23A 3T1OA 1FYDA 1NX9A 3NHRA 1QH8B 2FR8C 4Q82A 5AH0A 2ID4A 1PL6A 1LA2A 2FG7C 1ZBQA 4E2YA 3LUGA 2R6JA 3B3FA 3WC4A 4EX6A 2QUIA 3W2FA 3E4DA 1KAMA 3WP1B 3EXEA 4WN9A 1PTKA 1P6UA 1DUIA 3W2EA 4L4UA 5KJFA 1L4UA 2SECE 2W6ID 3IMGA 5GV8A 3LAWA 2DWQA 2XXJA 2VXCA 4B4KA 3LYLA 1Z33A 1SBHA 1Z0KA 3GL9A 4N8DA 3KXDA 4XB1A 5FXMA 1L7QA 4NESA 2A8YA 2G0NA 4URVR 1BA2A 521PA 1Y4AE 3VO8A 3A58B 3I37X 1II9A 4NICA 1RI5A 3UJBA 4KIUA 2CEAA 1ZMBA 4P3YA 1LB1B 1NF2A 1GDDA 4FMPA 2QTRA 2ISCA 3FOWA 3GU3A 3LDFA 1CPYA 5J2UF 3HXQA 3ZE9A 4UREA 4NV3A 4DLWA 3FR7A 4OJKA 4NU5A 1GKIA 4A73A 2O7QA 3PGVA 2WWGA 4BKRA 4BO9A 3U3ZA 4NE9A 5DHRA 5JI2E 2R44A 4BQFA 2BELA 3ABOB 1YUMA 3N05A 2VBIA 2W37A 3L8ZA 3PXXA 2VTDA 4NYMQ 3ZE8A 2WU3A 3DCIA 1M6VA 5MGBA 2VQSA 3MS7A 1IM2A 4KB5A 4EEZA 2CYAA 3B78A 5H5JA 1C7EA 4LJKA 5HOEA 5LQNA 1E2FA 4OA8A 4DPMA 4FSDA 4RYDA 1SXQA 3OQ6A 3TLGA 1DRWA 2FSFA 5AJXA 5A0VA 2I2DA 3ITKA 2J7PA 2NUBA 3S2ZA 2JEZA 1IWOA 2GERA 1EVQA 3L6BA 2GEFA 1H6CA 4U02A 4WOBA 4DUPA 4FN4A 2EG9A 3WIUA 4PQRA 1U28C 4YJ2A 2FJPA 1Y1LA 3KOOA 3U3OA 5CB8A 2QG6A 2AWNA 4OQFA 3W9UA 3AF4A 4ZJUA 5EPOA 3IE2A 5CAEA 1QCDA 4YCBA 2OKCA 3OU2A 4GOJA 1ATZA 1GUAA 1PFQA 2VPIA 3KLOA 2JFXA 2ZZKA 3G5AA 2Y0CA 3A6JA 3FYUB 1CY1A 5JAUA 5AJVB 3GLGE 1WF6A 1VDMA 1WXDA 2Q9BA 3O1HB 1RVV1 4EG7A 4GX5A 1WXFA 4RV4A 4EMTA 3F4LA 4L16A 4JQZA 1T9BA 3OFJA 5BV2P 4HDCA 1P1HA 2CLCX 4IQGA 5LU8A 3IUSA 4KH1A 1F2UB 4N5MA 2ES4A 4YDQA 1J25A 1SU7A 2QXUA 4KMSA 2V97A 3RU7A 4CMCA 4I4TF 5A9SA 1ZDMA 2O2ZA 4BIMA 2I67A 4XYBA 3D8RA 4K9MA 1UJBA 4KE9A 4YAKA 5JSYA 2G0AA 1M3SA 1Q1GA 3HSKA 3LCCA 3PQDA 3SDBA 1DINA 4ZKDA 5JNSA 1A72A 2FN9A 5IU6A 4YRIA 2X5KO 2FQQA 4BLWA 1FDSA 4RY8A 4MI9A 1EWRA 4DCCA 4EVIA 1J8DA 2B21A 4OHFA 5TS2A 1JEYB 3ZJTA 1N6OA 5F2NA 4WNAB 1LFAA 1VBKA 2VYND 2V0CA 3ROQA 5D6NA 4O08A 4M8KA 3I1IA 1ZOOA 3AIOA 5GONF 4R05A 3HJUA 5IW8A 2XQKA 1H3FA 4B6RA 3ZDDA 3TS1A 3JQFC 4NC9A 5DSTA 3DWFA 3ZE0B 2HD4A 1G0OA 2NU7A 3EG9B 3VNVA 4MEJA 1E66A 1G17A 3F67A 4IDNA 4B3BA 1YCGA 3HB1A 2A0KA 1E62A 3VPDA 2GN8A 1L5QA 1XFAA 3BBPA 1Y4UA 1JE0A 4XDZA 2F8TA 4CV3A 4CFZA 4CKEB 3FCCA 4HWPA 4DEYA 3ZGZA 4FFDA 4ZXPA 4OAOA 1K7YA 1ZINA 1U0HC 3ZD9A 1GRCA 2GZRA 3T7JA 1P2TA 4HDSB 4DE5A 2PWBA 1YGPA 4N0PA 2Q45A 3QFRA 3PC6A 4V3CA 2LBPA 4BJ3A 2Q29A 4QEZA 5C1BA 5JJKA 2I54A 1XTSA 5IAKA 2IIVA 1PEYA 3V7YA 3OZEA 3EASA 3HYRA 5L3VA 3T7TA 4KC0A 4ESVA 1JFLA 5C5CA 5C53B 5G53C 1UDAA 1QQ5A 3AT1A 3AI7A 1U81A 4DLKA 4RTQA 3P0HA 2OHHA 4FOLA 5TNXA 3L1IA 2X6TA 2ZTMA 2MSEB 4LNUA 3C6KA 4D4KA 3ZE6A 4BMOB 1ZQ1A 3TPFA 1L9XA 3JALA 4M7RA 2WF5A 5EXPA 3D8NA 1A04A 4DG5A 3QITA 3B1YA 2RHTA 2WAMA 5DE3A 4UU0A 4EGJA 2QUKA 1XZAA 3AVYA 1ORRA 2WKPA 3GK3A 2JHAA 4KN9S 4NYIR 4P31A 3IAFA 3ZE2B 5CEJA 1AB6A 1VL1A 1YIDA 1IXKA 1ZU4A 2AOUB 4D43A 7REQB 4TTVA 4BNZA 1H2YA 1QH1A 3FPEA 1WKCA 4CF6A 4RHUA 1LVGA 2IX9A 2OE2A 3O8DA 4GMFA 4AF8A 4UTZA 1DADA 1CT9A 2G5GX 4QC2A 1XZHA 3BFVA 2Y1EA 4B87A 3I4CA 5A3RA 1Z07A 2AUMA 2BHRA 2B6NA 2QKYA 2I4TA 1E3QA 2FVYA 2OMKA 3B5IA 3ETNA 3GEIA 2C8VA 2CLLB 4MUXA 4AULA 2PUGA 3HKEB 1QIKA 5JZOA 3N8KA 3ROXA 1M2JA 3BSSA 4HNHA 3VPFA 2ZSEA 5EGNA 1IEVA 4Z7NB 1EFPA 1E9VA 5LQUA 2R60A 1GPUA 2WTXA 3CSUA 2OAQ1 2MYNA 3G59A 3E2IA 3EPPA 3FY4A 4L4XA 1R6DA 4PPNA 1AZLA 1V2GA 2XA2A 3BHMA 3IIKA 5J2TF 5BURA 3WLQA 4D5GA 3HI6A 3P8ZA 1UBLS 3MD9A 1GN9A 3G6WA 1MMFB 2AN9A 2D62A 4BNFA 4CEHA 4KN6A 1FXWA 3UA3A 1FMTA 5BWLA 5JRJA 1Q1AA 1YOVA 1NTOA 5C7IO 2QTGA 3K70D 3DDSA 3BA1A 3N9IA 5GV7A 4RTPA 3CIFA 4MUBA 2PT5A 2QTMA 2WJAA 4CODB 4HGQA 2YWCA 3BE6A 3LXRA 5AXAA 2D06A 3HDYA 2CDNA 1RYNA 1A9YA 1EVZA 5DTMA 2QY6A 5EYPB 1ML3A 2H1LA 4OUDB 4PYQA 4CCYB 1VKZA 1DPGA 4MS4B 5I7VA 3KOZA 1YVDA 2YVAA 3GRRA 2IGBA 3DMRA 1HRKA 3EXHC 4IDCA 1FCJA 2BI7A 5DIZA 1ACJA 3MWGA 4IGIA 4BNIA 1Y1SA 2EU8A 3Q5DA 4J49A 4A1OA 1AGNA 1SCJA 4MLZA 1AN0A 1W1UA 3OF2A 1P7ZA 1EKXA 3JAMA 1JHYA 2WBLC 2VL7A 4IHJF 4GL2A 2QVCA 4CI9A 3F8TA 1E89A 5IFLA 1LXCA 1D9XA 3PHHA 3EZ2A 5FDFA 2ODBA 4MQ4A 3EIHA 1L4KA 5IJ0B 4YX9A 2C88A 2BEVB 3MZ0A 3NUQA 3RJ5A 3UJCA 5KNBA 5CUQA 2WHQA 1PVVA 2V5VA 1WMDA 1ADBA 1CDZA 1CRQA 1UZLA 4PC1A 4HF7A 5EE9A 3PNVA 4QECA 4DNFA 1VIAA 4N5LA 5DHPA 1RXSA 3G2IA 2ZVJA 1FXSA 1AY0A 3IQGX 3QSYA 1XXLA 4HEJA 4HVAA 4MPRA 4UMFA 3ZS9A 5BSFA 2DWUA 2YIJA 3NLLA 4JKOA 2VO1A 2ZFUA 3JV7A 3N0TA 3NKFA 1X9IA 1WJGA 3E2PA 2OV3A 2JJYA 3S1SA 4IDEA 3I2YX 4KYVA 4MB2A 2AKAB 4MQFA 2G17A 2BHLA 4ZZ2A 2XVAA 4NCHA 4U6NA 4YRLA 1YCHA 2G7MC 5JLAA 4XWKA 1H65A 1QLWA 1W30A 2HLNA 3M6IA 3EWSA 4LJYA 1VA4A 5EWLA 2OHOA 2YHAA 3GNTA 2OHFA 1QXSA 3K9CA 4CKBA 1YH3A 5IVKA 1OFGA 1MB4A 2GLXA 2IUSA 2RGGA 2J7PD 2WU1A 2GZHA 3HFRA 4UHBA 5AXDA 3TXAA 5AKIA 5T6MA 3FWHA 3TUIC 4HH0A 5K3OA 3GP8A 4YR9A 4IGAA 4N3GA 3QLJA 4IRUB 1OAAA 2O0KA 4CF4A 5I4KA 4KIFA 4OP2A 2Z56A 1Y98A 1Q2XA 3M6XA 4G5HA 3BMCB 3PQ3A 1SU6A 4O63O 4TN5A 1G1MA 2G25A 5T3YA 1SA0A 2YOFA 3R77A 2VXOA 3D59A 1UBHS 3O38A 2FSPA 2V6MA 3KBOA 3RV3A 4WH0A 1KK0A 1A9TA 5M34A 3KUUA 4A2QA 4HVCA 2POQX 4D25A 1PWHA 1M1YB 1P61B 1O6ZA 4N7RA 3H2YA 5CNIA 2JB9A 1N7HA 4HQ6A 2F62A 3HR7A 4CLHA 1OXKB 4ARIA 2QBYB 3N75A 3KT3A 1IB6A 3AG6A 3E58A 2J48A 2XUFA 2MCFA 3EIWA 3OZVA 1DIRA 1YS7A 3BL6A 5ECWA 3FSGA 1LI5A 5K0NA 1A2OA 5FBKA 2UZ1A 3PJGA 5FI5A 5IRCD 3A32A 2PKYX 4MYRA 2O7RA 3QEKA 5ITZA 4WL0A 4WCVA 5IWCA 5JZBA 5KWIA 4E07A 3BE5A 1VMKA 1WP9A 4TLAA 1IY8A 1K66A 4Q16A 1ONPA 1VLVA 2G1UA 2HFJA 3C43A 5FUYA 5TX7A 4M88A 5AT1A 5B4VA 5JXGA 4DR6B 1SCQA 2J5BA 1U2DC 2XB9A 5BMVF 1Z2PX 4V0RA 5KYYA 1NWCA 4CLEA 2HF2A 3SQMA 2PUFA 1A71A 4F06A 2W5UA 1ZKDA 3R6LA 1EFRA 5EWMB 2CNNA 5GIOE 3TNJA 3T9FA 4HCJA 1RWPA 3BWXA 3DXZA 3EJWA 2PN1A 4BV2A 4BMZA 2Q9AA 1CVRA 1FW6A 4FXPA 1YQUA 1GCAA 1QP8A 5LZ8A 2ZBEA 4EECA 1TDJA 4KP7A 3LC1O 1JH9A 3U13A 4B84A 4B76A 2PA0A 9ATCA 3TZQA 1WHTA 3EGDA 1CX9B 3EN0A 3HYNA 2PU5A 5D2CA 4BNKA 4CE6A 1WV1A 2JGLA 2XUHA 3QGMA 4C0SA 4OJYA 1P1FA 2NO1A 1AKEA 1E5VA 4ZHQF 2EYUA 4FDAA 4OHPA 4G25A 2ORED 3U80A 3ZCQA 1NOKA 3GZJA 4CNQA 1TA4A 3IE1A 1XDBA 3V4FA 2P35A 2MIIA 1NMEA 1Q20A 1RLTA 3CB2A 3CZRA 2A67A 3NCHA 5B7NA 2ZJZA 2NYVA 4ZD6A 3I1FA 1ZR2A 3NHZA 2ZR9A 3D7MA 4MS1A 4H16A 1YUBA 4GLOA 1HQCA 1ZHOA 4KDFA 1IQPA 5EIWA 1J1IA 2ZJAA 3CPEA 3C4QA 5K2OA 2JFGA 2ETXA 2EARA 2HHJA 4MQLA 1VIYA 4O0LA 3NOQA 4WT7A 1Q92A 4OGFA 3RYIB 3ZCXA 4D0RA 1AZWA 3HA7A 2Z95A 2VWHA 3INGA 3U31A 1AUOA 2C2XA 4DHEA 1YT5A 2PX2A 1SVKA 1T10A 2XEDA 3COSA 3KSZO 1TZKA 4A03A 3KX2A 5BNZA 1Q16A 4V03A 5FBVB 2B1RA 4LOIA 4Y1GA 2P90A 4B43A 3SQDA 3EGOA 1PSDA 1JPNA 3FJ1A 3N76A 4G0YA 4A23A 4NCKA 1W85B 2OD9A 4XVRA 2H07A 3B6KA 3G13A 4Z9FA 4G84A 4CWAA 1IBRA 3PNQA 2IHNA 3RUIA 2UYQA 2XGMA 4LJAA 5TEWA 3ETGA 4U6QA 5C51B 1TU4A 4I6EA 4PBSA 1JR3A 2P78A 1DC4A 2XAAA 3H2IA 4LI3X 2EOAA 4PYIA 4DGSA 2DERA 2H1CA 4TV8A 3PLAE 3AHEA 3UF0A 2OENG 2ZS9A 2VT7A 3THYA 1P9RA 2AEEA 3NVDA 4JEIA 2PK3A 1M8JA 5FHQA 2F3RA 1QE0A 2DQKA 3LP6A 3FKSA 4OI0A 4FCWA 2O5CA 4KXXA 1HWYA 3DWGA 3GCGA 3KBBA 4FZJA 3IKJA 3SZUA 3ZWWA 2JAPA 5LIPA 2Y05A 5CW1A 1D9ZA 4V1CI 3RC8A 1W4BA 3EQ9A 5T4HA 1YJ5A 5IJ9B 2GPJA 5T4BA 1HQDA 2OV4A 4XSHA 3BYZA 2YV1A 2JLZA 1R0CA 3CH6A 4L7VA 2FR0A 2D8AA 3I5MA 1UJ5A 3LPDA 3AVPA 3UOGA 4OH1A 1WF3A 3GEMA 4B3XA 2HB6A 2ZRCA 1SUPA 4R8RA 3UWMA 1QHXA 3NVMB 3QBJA 1HV8A 1CKEA 5A04A 5AMXA 2R1VB 5ISMA 4OY3A 4ZZ1A 5FOSA 1U1FA 3R0VA 4BBPA 4G1VA 4TMTA 1JNYA 1ZI8A 3I8XA 5AM5A 4XD7A 4CMEA 1PYGA 5KTNA 3L7JA 3P5BA 3PS9A 3U26A 4B3GA 3I76A 4R8KA 2GOYA 3SX2A 2ETVA 1K7CA 5KU1A 3ENKA 2F00A 3K6SB 3G5UA 3WLTA 1UT6A 2EFYA 4J90A 4COKA 3K31A 2VFAA 1IUNA 3H04A 3T5BA 4B8ZA 2NSLA 1NUHA 3T9CA 4A8PA 1D4OA 1A8HA 1GNVA 4XIIA 4K6KA 4X44A 1IHDA 1GN8A 2H85A 4IEFB 2UUAB 1TYAE 3WLAA 2I78A 3MC1A 1EHIA 1BE0A 3YASA 1UIRA 1Y33E 2OFWA 2QG4A 3NS7A 5AKGA 4BTEA 2ORYA 3EZFA 4HAIA 4DV5B 1BHSA 2PH5A 1A2QA 3H2KA 1KO8A 3V1UA 2QT0A 2ZYRA 1RYDA 3DEZA 5GADl 2X4LA 3L6DA 1EGHA 3TMYA 4Y0NA 3TBHA 5AP9A 3KETA 3FOFC 4NMWA 2OECA 1OWLA 2RB4A 3L8HA 5F77A 2H2HA 2NAFA 1JEDA 2W2PA 4DLUA 2GFQA 4YTEA 1OLUA 4UHKA 1L2TA 4RY2A 2WUFA 4DLTA 5ICCA 1V8OA 3PB3A 2PKWA 2O19A 4QOFA 1AURA 1P80A 1V1MB 3QOFA 3TNLA 1P4GA 3AKYA 4DPLA 5KNBD 1RE0A 1ZXXA 2O5EA 1KO4A 1U5BB 3V32A 2EX1A 2NZWA 4REMA 4YNBA 1RXUA 1YRBA 4XWGA 2XIJA 5AVYA 3VVMA 2L18A 2YWGA 3I23A 4ZI7B 4JGIA 4YI3A 1WG8A 2JI9A 5TSDA 2BKUA 2MHCA 4F45A 3DVLA 3I8SA 1S2MA 3H05A 2FPPB 5AHRA 2C2YA 1PR1A 1F1BA 2O1WA 4K26A 4E6PA 1DJQA 2OG2A 1W5BA 3V34A 4ZIRA 1V1RB 4Y2VA 3RTDA 2Y93A 1WPGA 4KG7A 4O02B 4QARA 1T36A 4IZHA 1VC2A 2XCRB 1IUOA 4ZCTA 3VYVA 3H3XA 1S2DA 3U4HA 2PS1A 1JR4A 2C0QA 3EY4A 2GVZC 2I6FA 4X93A 4M1SA 3AYZB 1WDWB 4QVGA 4JA0A 4WWHA 3UOWA 3WDSA 3DZGA 3ZCTA 3DAHA 1KKLA 2BFEB 2O8DB 3SHVA 3H4IA 2J6IA 1MDBA 3OURA 3GGOA 3TAHA 4K9RA 4PLYA 3V4RA 4JL5A 4HT3B 2IELA 1PX0A 2R11A 3GUCA 4XQ0A 3M3HA 3R9XB 4V0LA 3L7MA 3WMXA 1RTKA 2F7SA 3H11B 4ERNA 2Y6VA 4M99A 2HRBA 1C0PA 2H7VA 2PV0A 3BGWA 4PLCA 5LUBA 1ESZA 1X38A 1N2HA 4AI6A 2XTJA 3G02A 3L7YA 4IRMA 4WLEA 1HI9A 3NIDB 4KSCA 1JU9A 2GKSA 1AD2A 4BMNA 4DV2B 5EXEA 4OQPA 3ZWOA 4EL0A 3PNLA 3ZJYA 1KK3A 1NR7A 3H0CA 3UA4A 2IEDA 3B9RA 5MGNA 5I7FA 2PWZA 4ARBA 3FSGD 5ESWA 3B6IA 4LGYA 3I6MA 3LWDA 2WTBA 5IVIA 2WINI 3DP9A 3GGCA 2W2OA 1RP1A 1WDKA 3QVJA 2PH1A 3NZEA 4P3NA 5EAIA 2O8CA 1DSSG 2VXBA 5ENVA 5JS6A 4PFSA 4II7A 4L74A 4N47A 5IZCC 1XIVA 3IBFA 2GB4A 4R54A 3CN7A 3RAPR 1BHJA 2Y3IA 5TE9A 4AAYA 1MABA 3CKKA 4EHDA 4YCLA 5D3KA 4MVYA 3ZDCA 2ADMA 1SUEA 2JHGA 4OGKA 4RD6A 4E32A 1W5TA 4N0QA 5AHWA 3T7SA 3UMFA 2OPBA 1TCUA 4AQYB 3V1KA 1EFRD 4BO7A 2BGMA 1A8IA 4C2UA 3OFKA 2J3QA 1R6UA 5D1HA 4J07A 3GF4A 5K2MA 4QPJC 4CM6A 3ZX5A 2B35A 1FQJA 1SCAA 4Z4FA 2ZIZA 2P5YA 4HS4A 1E1QA 3MT7A 4QSHA 4LN1A 4E5SA 2X9GA 1F60A 1ZUNB 2ASEA 3KQMA 4WVLA 5KOIA 4JSTA 4Q4AA 3DT6A 1FQKA 1JW9B 3GP5A 3PCXA 4RHYA 3PNSA 4EFDA 5FEMA 1KJYA 5CDSA 3P9CA 5JBQA 1QO0D 3OP1A 4MUEA 5JFOA 2WWVD 4F38A 3NHJA 1C7IA 1VIDA 2FPMA 1XDUA 2IQ5A 3ZZNA 4EZEA 3DB2A 1NLMA 2QOEA 3H1GA 1HYBA 3F73A 3OZAA 5EE1A 4LZAA 2RKOA 3KUCA 3KOWA 3NP9A 2WMNB 3PEUA 4Q7JB 1MP0A 1T8UA 1DIGA 1VJRA 1PGNA 3NYQA 1CLEA 1C2YA 2C4VA 2GN4A 1JUDA 2QG9A 1EA7A 3OQVA 1ID1A 4IFBA 4WVFA 4ANFA 1Z82A 3NX4A 1MH1A 4KBYA 1HYEA 1C30A 4R8MA 1C1DB 1ZGZA 1EP1B 4R4JA 1H2RS 2RHWA 5CLGA 1DWQA 1WDTA 5SY9A 1UBEA 2RBKA 4NU0A 1Y8AA 2JCXA 5LBUA 3ROEA 3TRFA 1OB5A 1PJ3A 4OB6A 1OI3A 4N01A 3DBLA 5FR2A 4OMUA 3MTBA 2H52A 4QYWA 1E1MA 2XOKD 1T9GR 3ABQB 2EDAA 3DWIA 3I2FA 2JKVA 4ZVUA 3WY9A 5IBCA 3A0RB 2IU4A 4JYAB 3VI4B 1HFEL 3GDHA 3GLRA 4ND8A 2AI1A 3R0JA 3ISVA 5HZMA 5CD9A 3ZWBA 3O91A 2I3BA 1SMKA 2RCNA 4DLPA 1NF9A 1LRJA 2ORWA 4OA5A 4C0HA 5LOVB 4X9XA 3TIFA 4LV5B 1JR3D 2XD9A 4TUYF 5HJ5A 4WXRA 4C7KA 5HRUA 1N6HA 1ZJ4A 3KVOA 4LQLA 4WKOA 2WY2D 1ZVMA 5AVSA 1CUWA 3ZHCA 2I4MA 4PYMA 1SVUA 4GZMA 1W2WB 1SKUA 4WJZA 1DKRA 2ZUUA 1O77A 1R12A 3FKSD 1KDPA 1CYDA 1T5BA 1O6CA 3MUEA 3GCXA 4LYGA 4AWAA 4QT4A 4H15A 5JDCA 2OZVA 3BFKA 4M0KA 5K0CA 2VQEB 4YBRA 1NMYA 1IOVA 3KTOA 4QBFA 5JH7B 3ETJA 2HBYA 3QUQA 5IHPA 1LD3A 2N1MA 1QCZA 3RGGA 1CUHA 5IKMA 1JQ3A 4XIJA 3EH2A 2HIMA 1PL8A 1QIIA 2DTXA 1Y5NA 2QW1A 1UBNA 2FE1A 3BWVA 2QMOA 2PPVA 2ZI6A 3JASA 1OJLA 1SZPA 2G4LA 3UAOA 1TJPB 3QEJA 3WYBA 3PUXA 4Y2HA 4O2LA 5IM4A 4MQ5A 3OD1A 3EG5A 2PRZA 4RA9B 4YV2A 3ROFA 2LWIA 1SKYE 2GBPA 3A6PC 4LW8A 1FPMA 3H42B 4URZR 4YUVA 4C4TA 5E3HA 1ZCJA 4MROA 1XLVA 3K72B 2I4LA 3SEQA 3TSWA 5HM8A 4Q1BA 2BGWA 1P1CA 1QCYA 4EMBA 4E1BA 2DSTA 4PCVA 2DB3A 2QQEA 3VHXB 1HH4A 1HETA 3WWPA 5KTYA 1OTXA 4QQKA 3WNVA 4PLTA 3GIDA 4EVQA 4ATNA 1SC4A 3E81A 3HN6A 3A06A 3DOEA 5LJIA 1WSBA 3EXIA 1OGYA 3NTXA 1BOFA 3A26A 5AK5A 3Q8MA 3PEYA 10MHA 2IGTA 3B70A 4II3A 1FS6A 3GAFA 3I6QA 4O1HA 3WSWA 4AZ3B 1YZHA 1AXEA 4FD2A 3UW1A 3L5OA 4R1NA 1RMYA 3JWJA 1DRVA 1QFJA 4ZPXA 3VUEA 5IAGA 4EY7A 3GRKA 4WNIA 1BIFA 3T3EA 4IG4A 4ZOLB 1WBBA 2V7EA 1GGKA 1X42A 1JWLA 3S1AA 5EHZA 3WK7A 4O4HB 3IHLA 4O2BF 2BSAA 4WUVA 5GGYA 1W88A 4G4GA 4OK3A 3IUNA 1U3VA 2GCEA 2QX8A 3GT7A 1VPWA 2LGJA 1R3DA 4KAXA 2NP7A 4XDYA 3WLLA 2RGYA 4WCFB 5IXYA 4A15A 2ROQA 3IUMA 4WW0A 1X7ZB 4P3OA 4PAGA 1WPQA 4K0RA 1R4NA 3RI3A 3ZKWB 4NTZA 4L73A 2B4KA 5I8PA 4YGYA 2X8LA 2G4VA 3V4PB 1R4AA 3MRVA 3U44A 3A4LA 2Z1MA 4LWQA 4ENQA 1IJKA 3KSMA 2C5GA 4PZUA 4G2TA 1QGOA 4W7SA 2Z2IA 4W7HA 1P72A 4PTYA 5FO0A 1WPRA 2TYSB 3UICA 4BNMA 4B7UA 2IS1A 3FNIA 2HMAA 1X8KA 4TL7A 1JXQA 3T7AA 3H2JA 1YR7A 3SYMA 4E5KA 2ZJ5A 2NUPB 4H1HA 4AYTA 2VTBB 2YQ5A 1CJCA 2HSWA 3DBRA 4A8HA 1P0QA 1EUDB 3ZNOA 4RK4A 2R6FA 3N0RA 3JWGA 4RDIA 1N3LA 2QIOA 1O0BA 4NV1A 1F4PA 5JZVA 3IMEA 4FYHA 3ZW8A 3TE7A 3ZTYA 5IBRA 3NMUF 3O95A 1S7GA 1L1EA 2IHVA 5IS2A 3OTWA 2JA2A 4BU0A 3KELA 4PYLA 4TVSA 5CYPA 3G8AA 3KSDO 3SICE 4QAJA 2PDAA 1JLSA 2C29D 3BIWA 3Q1LA 2IXGA 3SLGA 3LUPA 1T43A 2G9NA 2JK1A 4M6WB 2VXYA 3R7DA 3ONWA 1J97A 3AVQA 3P4YA 3GLGB 4REQA 1OQAA 2REBA 2OFFA 2A3RA 1P7CA 3A1UA 3RHZA 3FNFA 4ITUA 2HU8A 4RKEA 4BYGA 5CLJA 2PGAA 1XZCA 5MFZA 1U80A 3KAPA 2VJQA 5EKTA 5HZKA 2ZSHA 3H1EA 3VKVA 1LY1A 5AKEA 4HDKA 4YECA 2V6BA 3VR6H 3T9AA 4BX2A 5SICE 2IHUA 1MLDA 1XYYA 4MWZA 4NZYA 4G5OA 1RWWA 2AOWA 3QVLA 1D8TA 1WZUA 3ANLA 4RTNA 5LQSA 5I7AA 4ISBA 4WSOA 4Z54A 5F5LA 5BN4A 4AY2A 4Q4JB 1A8PA 3QX9A 4J4HA 3WI7A 3HCOA 4UMEA 3WQQA 5C1DA 4QTUB 4W9NA 4BZXA 3LF2A 2QXTA 4WECA 4EEKA 3U60B 2VAWA 3OT1B 4YMSA 2Q7OE 4BLOA 2DR3A 4ZHSA 5JBNA 2W2LD 4MP6A 1TUBA 4FMCF 4GGOA 4ZC8A 3GJTA 1EGMB 2VDWB 3GPIA 1PVOA 2W0SA 1NG1A 1BDMA 1Y5MA 1AG9A 4L4RA 3Q72A 1MAAA 4ND1A 3EX7C 1Z83A 4BBZA 1DQSA 4QU5A 1FX0A 1LZLA 3JRNA 5EUQB 5CFNA 3OX1A 1M34A 1C1XA 2APJA 2GNPA 4FE3A 1X6VA 3LQQA 3SEAA 4M38A 3WNBA 4IO0A 4BN5A 1I7PA 3PQ4A 4ROTA 3CNNA 2VSQA 1Y6RA 4GG1A 1O96B 4Y6QA 1U04A 2R84A 1QOZA 3BIJA 4LRXA 4RL6A 1HDOA 2I87A 4KR9A 1R5OA 1UC5B 3DBHA 4QUJA 4DRXA 3A1DA 1N5LA 4RANA 5KJCA 2CGEA 1AQUA 2Q3CA 3DFFA 3IMKA 5BSEA 3H9BA 4ZANA 2CNWA 2QMEA 4AWBA 2G67A 1PZNA 3NHAA 4ALJA 4OHMA 3BWCA 3PZBA 2BMJA 2Z9DA 4EF5A 2P6OA 3GJZA 3VPSA 3EDOA 5T4FA 2Y1XA 2QL5A 2Q4DA 2Q2WA 5AKHA 4F2DA 3DOIA 1C0KA 2DT8A 1ADYA 2EGGA 3N7AA 4IDHA 3SE7A 2AEFA 1MEOA 1Z36A 3DKKA 3KL2A 3QEMA 5BVGA 1CF9A 4RD0A 1Y3CE 4J2HA 1VHDA 2WG2A 1TVKB 1FE8A 1SHKA 3LNTA 2WKWA 1CY0A 3T7KA 4K9PA 3CV3A 1SOMA 4P98A 1W1WA 4PHTA 5DLPA 3UTCA 1SR8A 2OCYC 1LPMA 1N2ZA 2R3SA 3OY7A 5H02A 4AJ4A 4MUAA 3O4JA 1A7UA 5CJPA 5ERGB 1Y9ZA 3FMFA 3HU1A 1OHHA 3ZY3A 2GHQA 1HM5A 3FMVA 5DIFA 1WCV1 5J2UB 3TKAA 1ONSA 4JD5A 1MBZA 1Z4OA 3HPQA 5ADVA 1KMQA 1EE1A 2P7HA 3GAAA 1E4OA 1XEAA 1CIVA 4ETWA 5SYAA 4YUXA 2BE7A 1OA1A 5SV2A 1DAKA 4URFA 2O54A 3CZQA 3KVVA 1MX9A 1N6NA 3NXSA 5DX1A 2QJOA 2P9JA 2XGSA 3HCEA 3HP1A 4JBNA 4NJOA 1H4VB 1UPXA 1AM4D 2TRSB 1IG3A 1NTRA 2C1EA 2CBGA 1ACLA 1OZFA 3GUYA 3LD9A 3QF7A 4Z8XA 3DT9A 1K63A 3C3JA 3FGZA 4Q18A 1C4OA 2W43A 1KFCB 2B20A 4J3NA 3VR3A 1A9SA 3O6VA 2V1UA 1IXYA 2GXSA 5IM5A 3CBQA 1AQYA 4GE0A 1QOPB 2RGBA 2QGFA 2VSOA 2XOEA 4GXNA 4M1EA 4MSUA 1FS5A 3GIWA 4J3JA 2YWEA 3EJ6A 1IZ0A 2GJ4A 4HTFA 3H2ZA 4KO8A 1STOA 1PJBA 4L4ZA 4UZEA 4Q9HA 2DEUA 3K94A 3ZD7A 1CUDA 4P86A 4QL3A 5EXDA 2H1RA 2XCSB 4AUNA 1BMDA 3UG6A 4BWFB 1GHTA 2D7CA 1YFLA 1BD4A 2ZROA 4MGYR 4BO5A 1VCIA 4CVNA 2FPXA 4QJ3A 3BZWA 5ALZA 3WAGA 4KPYA 3QH4A 4BRSA 2JIQA 4D4HA 2CNKA 4LCJA 1D2EA 3LXXA 3R3SA 5LQCA 3T52A 1E7MA 5JMTA 2A57A 3NT2A 2FN8A 1VB3A 4I4TB 3TSZA 4C3OB 1MXFA 4C6RA 1V3TA 4M83A 4Q9NA 4ASUD 2H57A 3GHYA 4XQEA 2HJWA 4XR4A 4B73A 3S4YA 4F6RB 1E2PA 1VLQA 2ST1A 4KGDA 5IVDA 2V5UA 4FWIB 3JVUA 2OWEA 2NTNA 4U2KA 3SMVA 4CZ2A 4DY4A 3DR3A 1NURA 2AFHB 1KJIA 4Z4GA 1GGVA 2AXQA 1Q0PA 1QNLA 3NUZA 3OQIA 1PK9A 3IIMA 5B2FA 4EF6A 1R3UA 2F1KA 4RABA 2YBDA 1L5GB 4B3FX 4KBFA 5GONB 1NN1A 3HKCB 1ZN8A 3O92A 3OJCA 4LXGA 4NJMA 4BKOA 3Q40A 2PSHA 1G3MA 4NATA 3MQ2A 3VX3A 4DR7B 1N78A 4FYJA 2UZIR 4Q1AA 4JASB 4NNJA 3I58A 1QH8A 1GSIA 2H2IA 1RTTA 2RHRA 3EDQA 3TLZA 1G16A 3Q85A 4M60A 5EFOA 1Y1PA 4OMFG 4RZUA 4UUPA 3THRA 3HZOA 4FGLA 3IR5A 1UEJA 3I12A 2VNKA 3HVIA 4RORA 1Z75A 2HXYA 1Y8RB 5EGSA 4JXKA 1OXMA 2IUUA 2OGTA 2NW6A 3NONA 5HF6A 1LUAA 1DCKA 5CH8A 1E4YA 2GN9A 4E70A 1ECPA 3FYSA 1OX4B 1XU9A 4YLEA 2FEWB 4JS0A 3A6GA 4IL5A 2C4MA 3E9MA 3PD1A 4KXNA 4YBZA 1ABEA 4EW6A 4TWRA 2QN9A 2JVKA 4NU8X 1YFJA 3F90A 3LPCA 4KQ1A 1R0WA 2K4MA 3WL6A 1BWPA 4WXPA 3UMRA 1GUBA 1JQAA 3R7LA 2ZJ4A 1MHTA 3OJFA 1L5HA 2JGFA 2BJHA 5DYTA 1IWBB 2J09A 1C5KA 3ZLJA 4HXEB 4AKEA 1Z3CA 2WYWA 5BO5A 3HPRA 4PWYA 1B43A 2ZR0A 2XNSA 2C9BA 4QFMA 2V96A 4B3CA 5LU9A 2J5QA 3NT5A 3OTIA 1X1RA 1W29A 1CJTC 3AZQA 1QHHA 3OOEA 3OPYI 4IPTA 1P1KA 5K0GA 5IT0A 2ATEA 3T9EA 5JATA 1M5RA 2G70A 2MOKA 2NV2B 4QUHA 2N0SA 1GEEA 4S3MA 2GCOB 1IAQA 1NONA 4QFCA 5FI0B 3TD9A 1UK8A 2M1ZA 2XVMA 2ZWMA 2QV0A 1ZH0A 1TUIA 2QD3A 3D3WA 2CHQA 2HO4A 1EFUA 1F17A 2ZS7A 3IP1A 1E0AA 3IEIA 1L8XA 4HGOA 3WNCA 2PBLA 3FYDA 4GI1A 1VHTA 4S1TA 4MDHA 5A5DA 1UT5A 2R00C 3RHFA 3GLIB 4MLCA 3IDSA 3E22A 3ND9A 5LQJA 2YXBA 1DQYA 1L4YA 1ISFA 1LK7A 2H8KA 3Q2IA 4I9GA 5HCUA 3TZHA 5CR9A 2IHKA 3GBVA 4PC7A 1KYXA 1DT3A 4ZQBA 2X4IA 4X65B 3A9RA 4M0PA 4WZ6A 1F2UA 4EJSA 5HJEA 1U0JA 1I51A 2O0HA 3GG9A 3MLAA 1C1HA 3PQ2A 3Q3JB 1PG2A 3HQ4O 2ET6A 4GUAA 4OYRA 5ALEA 3PFHA 1RD4A 5EMNA 5KYYB 3ZD6A 2LTAA 1W0KD 5J2TB 2OCGA 2I3DA 3FPSA 1AN9A 4XPIB 1CJMA 1QYDA 5G1NA 2OBYA 4MRMA 3SGLA 4ZQGA 1M1NB 1FFEA 2NTYC 1PQUA 2JFQA 3GOQA 3PFKA 4FIZA 4R9VA 4W99A 3T5AA 1TNDA 1V96A 1Y9EA 1GU1A 4M9SA 3DNFA 2GK6A 1VSUA 3B6ZA 3B53X 3IQDB 3PX3A 1TQ8A 4YWJA 4HFRA 3UIEA 4IMJB 4WNAA 2NYRA 4YRSA 1J39A 2QM3A 4OHWA 3DOFA 3SC4A 3RG2A 5BNTA 1DO8A 4HSEA 1TO2E 1IMOA 5JAPA 3K5HA 4C0LA 2GNAA 4HLUA 1Q1BA 2BT4A 4HVTA 1KI9A 4MIEA 4NX2A 5ALKA 3M3DA 3RSQA 1QWSA 3W4IA 3QV1A 3KK0A 3GRUA 4FW9A 4KQ6A 1CEYA 3EG9A 3O31A 4YAGA 1AUVA 1SU8A 1U7DA 2BONA 5F98A 5KS2A 3J7TA 1ECBA 3SZLA 4B9EA 1JQLB 2FRDA 3QFHA 4Z4IA 4XJTA 4RK1A 3ZWXA 3QU7A 1T4CB 4MI3A 1K7XB 2UYGA 1DO2A 2P9ZA 4KQHA 4ZZIA 621PA 2KBEA 2D2XA 1GV0A 1WBDA 1SQ6A 2W6ZA 3BRWA 1BXRB 2WLSA 3Q9NA 2IS6A 2O8VA 4JLUA 4PV7A 4RTMA 1TA9A 4HNUA 2DH5A 3EOZA 2H0AA 1G9XA 1OHHD 3SP1A 1GZ7A 1WLSA 4C2BA 2FPSA 2PUEA 5FUVA 4B3HA 5AKYA 2JFBA 1DJOA 2BRUC 2CMFA 2FPGB 2WIJA 3BB1A 3F71A 4FB5A 2JIOA 4GXQA 2I2FA 3MCVA 3FFXA 2KMLA 3K15A 2BBWA 3KPWA 4RPGA 3R8CA 2QMYA 4G0XA 3U4CA 1U2SA 3A3OA 3FFWA 3JR3A 4Q05A 2NVUB 2H63A 3RK1A 3W8NA 4P0PB 3WMRA 1OFUX 2A14A 5J5CA 4UXIA 4P54A 2C4NA 3ZK9A 3TW8A 1XTIA 2BZSA 1SVNA 4UUBA 4JI0B 2WG0A 2B83A 4U4AA 1VG1A 5FPSA 3SZMA 1D2HA 2NXEA 3USES 3WGNA 2R68A 3JXEA 1EAYA 1EX9A 3LLVA 1DELA 3EQ8A 2A9VA 1GSAA 2AL7A 5F4BA 2IXFA 4ZEXA 1LPNA 1LLCA 2FEKA 3VR3D 3HMQA 4BVLA 1U8TA