3O1JC

Crystal structure of the tors sensor domain - tort complex in the absence of isopropanol
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
300
structure length
296
Chain Sequence
DEKICAIYPHLKDSYWLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAYEHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSGKTNIALLLGPRTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMGNIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein TorS
publication title An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Signaling protein
total genus 98
structure length 296
sequence length 300
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1jC02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1jC01
2JVJA 5JS1A 2YHBA 4F3TA 3H75A 3MQ4A 4OTZA 3Q7RA 5JNWA 3FFTA 4MRMB 3SY8A 1NATA 4KQCA 5B3JA 2VYCA 3OM1A 1ZGZA 3QELA 3QEMB 3QLUA 3KJXA 4W5NA 3RVOA 2LUOA 2F8TA 1BA2A 2TMYA 2JB9A 3I09A 3IP6A 2IPNA 4RK5A 3OMWA 1ZESA 3CTPA 4D6YA 2VUIB 3LUCA 1YK1A 3CZCA 3LUDA 5TPWA 1RZRD 1KRWA 4D74A 2ID9A 5TPZD 3CS3A 4Q6BA 3CZ5A 4RK0A 1USGA 2QR3A 2VK2A 5FBHA 4YP9A 2FLWA 3O2SB 4L85A 2R48A 4N41A 5EWJB 3SNKA 1B00A 4WXEA 2IPLA 4G0ZA 4WXMA 4YWHA 3ROFA 3FDFA 3GBVA 2R4QA 3BREA 1LBHA 1ZITA 1Z12A 4PYRA 1U0SY 5KQGA 3KSMA 4LE0A 4KNYA 3OO0A 2B1JA 1MIHA 4RKRA 4DADA 3LKBA 2IOYA 3LMKA 4PICA 3MMNA 3P9YA 2HQRA 4MQEB 4MYRA 5E3JA 2FKAA 2O20A 2MSKA 3EULA 2CWDA 4KZKA 2LPMA 4IGAA 1UDRA 4JB0A 3LUJA 5JNSA 3LTEA 5PNTA 3BBLA 4E7OA 4RXTA 1YS6A 3H6HA 3JS5A 1VLZA 2M98A 1DRKA 2JBAA 3D02A 3GT7A 4GPAA 1Y1LA 2X7XA 3RVJA 3ILYA 1BDHA 2NZVG 4F8JA 1VPWA 2FLKA 1OXKB 3RVSA 5JNVA 4OLBA 2R47A 1QP7A 1C0EA 5F64A 2ID7A 1YMUA 1NXWA 5TE9A 3TMYA 1NXTA 4IF4A 3CG0A 1QP4A 3QLTA 2CD7A 4H3KB 1F51E 1M2FA 1EWTA 4S04A 1P2FA 3QLVC 2B4AA 3BILA 5GQSA 1A2OA 3BRSA 5FWXB 4KRFA 3UKJA 4ETMA 2LP4Y 1FFGA 2WB4A 4RK1A 3TO5A 2QU7A 4EVSA 3A0UA 1DBPA 2BGGA 1XHEA 3OM0A 4N03A 2QV0A 5EWMA 2FN9A 2HQBA 4XLTA 1QO0A 4DN6A 3JVIA 1YIOA 1Z2DA 3HK2A 1DZ3A 4MR9A 4W5OA 3GA5A 5DKFA 2YHAA 5KC9A 1FFWA 1S8NA 1LJUA 4RY8A 5CNMA 4RK4A 3HVRA 3O2QB 4FE7A 2NUBA 4FE4A 4MR7A 2NT4A 4M88A 1D4ZA 4IILA 1W25A 1SXGA 1TJYA 1M2EA 3KG2A 1W9HA 4UHJA 1P6UA 4MS4A 4XAQA 2H3HA 4NV3A 4Z4IA 4OG2A 2PKXA 2FQWA 3A3KA 1H9CA 1DC7A 1ISRA 5EWLA 4XARA 1EWKA 1T34A 1FFSA 3CNBA 2J48A 3LUAA 4YCSA 5JNUA 3L6UA 1ZVVA 4LX8A 3H1FA 5KWSA 2QVGA 3HUTA 5T7BA 1PUXA 5KQLA 2QVCA 2ZWMA 4WWHA 3L49A 3CFYA 4IMIB 1TM2A 2PLNA 3HM9A 2MYPA 3UUGA 3KHTA 1NXOA 2ZAYA 4N0QA 1ZGGA 2WMYA 1FSPA 2E4VA 3M9XA 4JB2A 3CLKA 4MS1A 5TQ0A 3RVPA 7ABPA 1JDPA 1AB5A 2FMHA 2FXIA 3HDGA 3I5AA 4JP1A 2OQRA 1L5YA 4ZPJA 3FGZA 4G0YA 1GUDA 4RU1A 4Y9TA 1EFAA 1QNLA 5B3JC 5CHYA 4MR8A 1Z15A 1Z17A 2FQYA 1TMYA 3W9SA 3C3MA 1JF8A 1GCGA 4YS6A 2H0AA 3VNBA 1MAVA 3G85A 4F06A 4W5RA 3QELB 1L5ZA 1NY5A 4QPJC 5IULC 1PEYA 4EVQA 2E4UA 3N6VA 2JCGA 2VUHB 2QSJA 4QYWA 4Q6WA 4L4UA 5TPWB 3C3KA 3MF4A 3URMA 3S99A 1OXBB 1LK0A 2E4XA 4RDCA 4B09A 5DLEA 1LJLA 1ABEA 1QKKA 2NT3A 1Z13A 3GRCA 5GOTA 1Z16A 2L2QA 2HQOA 3JPWA 3H5IA 3KYIB 5IUNC 1BDIA 1D1QA 1U2PA 4RZSA 1BDJA 1SD5A 3OLYA 4IMJB 1PHRA 1M5UA 3OMXA 3IP9A 4KFCA 1Z25A 4YGXB 2P9HA 2OENG 1JFVA 4PEVA 4JOQA 1ZN2A 1EAYA 3KLNA 3N53A 3QEKA 4HNQA 4P98A 4NCAA 3GV0A 2NZUG 3GBPA 1QQAA 4F12A 2MSWA 3EDCA 3KYJB 3NHMA 4JASB 4Z0NA 2FVYA 3K9CA 3GWGA 2MSLA 3A10A 3TX6A 4Z4GA 4RXMA 1DCKA 1APBA 1D5WA 4EYGA 2JBAB 1FQWA 5TQ2A 1EWVA 3O1IC 3JPYA 3MA0A 3OQMA 3F73A 2FMKA 4NICA 3RH0A 3H1EA 2XDYA 3CRNA 1SXIA 4ETNA 3RVKA 4YRZA 1U04A 3EQZA 3EODA 1YVUA 3DZDA 1KMIY 5BR1A 3OLWA 4LRQA 5IEJA 2RJOA 3ILHA 2M1ZA 4LE2A 5CNJA 4G86A 3LUHA 2LBPA 4W5QA 4Z4EA 1M5TA 4O1IA 1E6KA 8ABPA 1JWLA 1JLKA 3O21A 1PNTA 5HM6A 4WZZA 4MQFA 2FQXA 3Q15C 4ETIA 5BQ3A 1GUBA 4IRXA 1NXSA 1DCFA 3UK0A 3CG4A 3DGEC 5T3YA 2RDMA 2V0NA 2HSGA 2JVKA 1XHFA 3B2NA 3LUGA 4XASA 1DC8A 4KMRA 5EWMB 6CHYA 2MYNA 1P6QA 2QZJA 3SQNA 2IPAB 2RJNA 3VNAA 1E2BA 3H5TA 2FEWB 1ZAYA 5FWXA 4Z4HA 1E6LA 1JHZA 2FEPA 2FMFA 3M9WA 4RS3A 4MR9B 2CHEA 2FW0A 3QLVA 4KK3A 3Q9SA 4EYOA 1U8TA 1Z2EA 4G97A 5BRJA 3MYYA 4G0MA 3GYBA 5IX8A 2A9RA 1VRVA 4MR7B 4E7PA 3JVDA 4G0XA 3H5OA 2MYTA 4TLLB 4ZMSA 2JRLA 1ZH2A 3DGFC 3HUUA 5HSGA 2FMIA 1KGSA 2PUFA 2Q5CA 3HJFA 3NNDA 1MB3A 5FBKA 4UHKA 4MS4B 9ABPA 4ML3A 1NTRA 1QMPA 1JL3A 5EWLB 2PL9A 3IDOA 4EVRA 1JFSA 5JNTA 1YS7A 3RVMA 5IBQA 1MB0A 5IUKC 4OLAA 1USIA 3KS9A 2P4UA 1AB6A 1MVOA 2WJWA 4Q7EA 4MAAA 3HCWA 3SM9A 1ZY2A 6ABPA 3IPCA 3OLZA 4MS3A 1U2QA 3KCNA 4Z4FA 4G0PA 3DLHA 2L19A 3HEBA 3IP7A 4NCBA 5HKOA 3T6KA 4ZJPA 5DGCA 5TQ0B 4QYMA 3SG0A 4NQRA 3E3MA 4Z9BA 1WETA 3QLUC 2GBPA 2PMCA 3NNSA 3O74A 3RQIA 4EUKA 4P1ZA 1CEYA 3O1HB 1USKA 3H5LA 3NHZA 3C97A 4MR8B 3IPAA 2IKSA 3N0XA 4JA2A 3E61A 3BRQA 1C4WA 1JDNA 3T8YA 4LDZA 1RNLA 5FWYA 2MYUA 2HJ9A 2PUEA 3SAJA 1DP4A 1PEAA 4KVFA 1TVMA 2PAFA 3I42A 4HNSA 1EHCA 4MRMA 4EYQA 4FB4A 4MPTA 4YLEA 3N0RA 1ZH4A 3C6QA 5DTEA 2DRIA 1QO0D 3RVNA 3QEMA 1CHNA 5I4CA 4RY0A 1E6MA 4GNRA 3HV2A 1I3CA 3NNNA 3HSYA 5JNRA 3K4HA 3I45A 4XFKA 2AYZA 2E4WA 2N9UA 3ROTA 1D2AA 2A9QA 4EGSA 5C5EA 1F4VA 1CYEA 3OO1A 3EGCA 4KK4A 1JFTA 3CHYA 4MLCA 1JYFA 1XWWA 2L18A 2PL1A 4G0QA 4O1HA 2GI4A 4RKQA 4LZLA 3LOPA 3LUKA 5EWJA 3KTOA 2JVIA 2PE5A 3Q7SA 2R25B 4LE1A 3A0RB 3H5VA 5BRAA 3F6CA 1YK0A 3LFTA 3FMVA 4ZYLA 2L17A 1SXHA 4WUTA 3N0WA 4MLDA 1RXEA 1VKRA 1DBQA 3N8IA 3EJWA 4PE5B 2AYXA 4XXHA 1DCMA 3KKEA 3HZHA 4MQEA 2PUCA 3H5WA 2IDMA 1P8AA 5TQ2B 1JYEA 3C3WA 4YV7A 3O1JC 2WRZA 5IC5A 4W5TA 3F6PA 4ZMRA 1RPJA 3DBIA 3QX9A 1DG9A 2A9OA 4EYKA 4TMYA 1JH9A 5JS2A 3TB6A 1QPZA 2RGYA 2PUBA 4D6XA 1BAPA 2WJAA 4HYEA 4MGEA 5IEBA 3T38A 4Z4CA 4CBVA 1ISSA 5HQJA 3O2JA 2GKGA 2HPHA 2JK1A 2PUAA 4KPYA 4JAVC 5KI6A 1TLFA 3DLBA 4MQFB 4OATA 3N75A 3OLVA 2KYRA 3F7NA 4WT7A 3H1GA 4DQDA 2PUDA 3JTEA 1ZHHA 3HXMA 5KQMA 3IP5A 3HO1A 1GCAA 1ZDMA 2GX6A 4YR7A 4S05A 1BVHA 1D1PA 5C5CA 2FSPA 1J56A 3G1WA 1DBWA 1DRJA 3Q41A 5KQPA 1RZRA 3FFWA 5D2CA 1RXIA 2CHFA 3R0JA 5TPZA 3M6MD 4RK6A 1NXPA 3OQNA 3RVQA 3QX8A 2QXYA 4TLMB 2A9PA 1Z18A 4KQ9A 5TQJA 2FN8A 5CNIA 1R8JA 4N47A 4KREA 4N0PA 1IIBA 2W42A 3TD9A 1A0OA 3MIZA 2FEKA 2PJUA 3QK7A 4RWEA 4Z99A 5ED4A 3T95A 2WY2D 3Q7TA 1HEYA 3D8UA 3GL9A 4YO7A 2F8SA 4H60A 1JX6A 4RXUA 2E4ZA 3HDVA 4RV5A 2QW1A 3LKVA 4OBBA 3FFXA 3OLXA 1Z26A 2I6FA 3HS3A 1YTUA 3EQ2A 1K68A 1A04A 5CNKA 4EY3A 4H3HB 5DCLA 3O75A 1KRXA 1NXVA 2GWRA 3JY6A 3LUFA 4HNRA 2E4YA 1QQBA 4N76A 4MS1B 4MS3B 1YMVA 3RVLA 3CKMA 4RSMA 4F11A 2LIVA 1LBIA 4KV7A 2IPMA 2PUGA 4O5AA 2WWVD 4TN5A 4QICA 1PNRA 1ABFA 5KC8A 3KLOA 1GLGA 3MM4A 4G0OA 1SRRA 2FTKE 1NXXA 1DJMA 4Z9AA 5ABPA 4PZ0A 3OQOA 1QP0A 1JBEA 2IYNA 3CU5A 3EAFA 3H6GA 3RVRA 5IUJC 4RK7A 1URPA 4RY9A 5FWYB 4LDAA 3NBMA 1K66A
chains in the Genus database with same CATH superfamily
1VZ2A 3WK4A 1UWCA 4CKCA 4JJ7A 1XPOA 1IRIA 3VNSA 3N87A 5JU6A 2OHJA 1G1MA 2JKVA 3NQ41 4DJDC 1Q3KA 5CH5A 3SE7A 2FOIA 1NA5A 1BDBA 2ZRQA 3FPKA 1ZCFA 1MBZA 2ZRNA 4RHXA 4NZ9A 4DDUA 1DAHA 4KX3A 2OUIA 2G0AA 4B6GA 5BOSB 5C5IA 2GHQA 1GILA 2VDNB 2GEJA 3LV8A 3GLRA 3BN3A 2GZ2A 3ZZUA 2F1KA 3LK7A 2QR3A 4X93A 1INLA 1XD2A 4KE6A 3GXBA 4UHHA 1SG9A 4L85A 4FFMA 4DM4A 1OFGA 1LF5A 3BAZA 4WXEA 2PKYX 2IPLA 1W5BA 4AUKA 4D9EA 2A0YA 4MKFA 1YD7A 3DWFA 1X7WB 2R4QA 4ZVSA 4BL5A 4BIMA 1ZITA 5IVDA 5NLLA 4J75A 1Y3HA 4Z86A 2BV3A 3SIRA 5KQGA 3PVCA 3OJEA 1G8PA 3OOEA 3KQVA 4KQFA 3HUFA 4QECA 2RB5A 3IUQA 2ARKA 2HD4A 3NKLA 2RSLA 3V32A 1QB7A 4DSOA 1UXKA 2YVLA 4R9VA 2PYDA 1TCAA 1AK9A 2C2MA 3DO8A 1B6TA 3JAKB 1XSEA 3TEFA 2C4UA 4Q16A 2EBWA 2FP3A 4CCYA 4V1CA 4ZI7B 3V8MA 5IT0A 3OZFA 4A82A 3QUCA 2NXJA 2VH2A 1T9GR 2QD4A 2OV1A 4D56A 3NAMA 4EG6A 1VLZA 3HWRA 1MJGM 3NHWA 3UC9A 3ZGOA 2X7XA 1O87A 1SR8A 1TMKA 2GN8A 2WKQA 5F1KA 3WQSB 3I53A 2FEOA 3P20A 4PNZA 5SY6A 5K3FA 4FGZA 4M4SA 1KJNA 1NVVQ 3SKVA 4O02B 5CB8A 2QLMA 1V3UA 3BSSA 4WOJA 1XK6A 4EEKA 2HJSA 1RIFA 3P9SA 4MINA 4I5FA 2IYEA 2Y0CA 4CFZA 4UOZA 1YMUA 4F84A 2PJRA 1Q7BA 1UOEA 4LF6B 1QP4A 1WB5A 2W37A 1R16A 3ZD6A 4H3KB 1F51E 4E07A 3GFBA 3PJDA 1N7GA 1GJRA 2PWAA 1VIDA 2QU7A 1RM3A 2K4MA 3E0XA 3UCFA 4G65A 2AV6A 2Q6VA 4OBEA 2WIKA 4OXKA 3KZKA 3H4MA 4FBMA 4M9RA 5DX8A 1RKXA 5HK8A 4BFSA 3CKKA 3UM9A 1ZM2A 2O8EA 1Q14A 3CO5A 2QUJA 2ZPAA 3KSAC 3KLPX 4TXMA 4RD4A 4F6CA 4R3UC 2NVOA 4WFKA 4EPWA 4YRSA 5K45A 1RM0A 1VPVA 5K09A 4WZBB 2HHJA 3MZ0A 3T7JA 1PR9A 5E1MA 5K6RA 4EX6A 2XBUA 1LZLA 1NI4B 1PSDA 1V3TA 3EA0A 4HGOA 1W9HA 4EUNA 5BQXA 3HJGA 1HRDA 1OQAA 3B7WA 1UPCA 2LNDA 4J16C 4LV6A 4Z4IA 3SICE 1Y7IA 4ENQA 1UXHA 3GWZA 4JQYA 4E51A 2WHXA 4M60A 3U7HB 2LD4A 3OCYA 1EWKA 1N9GA 3OUZA 3CNBA 2GF0A 5EJFA 4ZCRA 5EHXA 4GNKA 4M9CA 1ZVVA 1U6JA 2OR3A 5I47A 2R11A 2QVGA 4MW5A 1T4GA 2NGRA 3LFUA 5T7BA 4YECA 5HRCA 1JI0A 5F7XA 4QYTA 5BO5A 2D0IA 3RIMA 5K8JB 1YUMA 5EIAA 3RSFA 2OCKA 4HMPA 3LCCA 5EG5A 2RJ3A 1NJSA 1QS0B 3LA6A 1ZUNB 4PZYA 4FWTA 4NAVA 1ZGGA 3H4IA 4KLRA 1FSPA 2V3WA 2O06A 1GAEO 3ZXIA 5HKAA 5IH7A 2FMHA 4LXHA 2XE8A 1NMSA 2QUHA 3I5AA 4GS5A 3R8XA 3OLQA 4L73A 3HKBB 4ZGBA 4Z2AA 5ADUS 4RU1A 5EXEA 5DTQA 2PZEA 1K27A 1FYVA 4BB5A 1IC6A 3FPAA 5DLDA 5EIXA 1OSNA 1BDMA 2LE0A 3EXFA 3W9SA 1P44A 2O8BA 1JF8A 1WULS 1Y1KE 3ITNA 3VZDA 5KTKA 4W8HA 1DC4A 2YY7A 2PSEA 1PUJA 5K0NA 3BE4A 3VTFA 1PEYA 3EVBA 5HX7A 5FTWA 3ZIAA 1KMCA 1DOAA 1U2GC 3CUWA 4LVNA 5DIZA 4BUJA 1GGFA 4OJMX 2CLMB 3T35A 2UYHA 4KLZA 1PR2A 1EJ6A 1QHSA 1TM1E 3F4KA 3OZSA 4HDRA 1X7HA 1LEHA 4AULA 5HGXA 3CT6A 4YXWA 3T99A 2IEDA 4YUXA 2HREA 3ER9A 3FHJA 1OTHA 3UJ9A 3KFLA 1O5TA 4CTKA 3THYA 4HQOA 4M0CA 2BI4A 2CHVA 2JANA 4GOXA 2J87A 4R3WA 3IJRA 1ZJ6A 3GJ3A 1IUNA 1UOPA 2AOVA 4MRAA 2XZOA 5DNUA 1O2DA 5CDTA 1Z62A 3B1YA 3GOHA 2JGRA 4TN1A 3WJ2A 5CIYA 2CSXA 4CLXA 1PWYE 4PQGA 2VNJA 2VDMB 4MIKA 4XPZA 2XUAA 5HOEA 3GFQA 5TGDA 3D7KA 4COOA 2EZ9A 3EMKA 4HC4A 2CFRA 1DHTA 3ZH2A 4C0BA 4YO8A 3IIJA 5EVCA 4NE2A 5TV2A 1RCUA 4JN6B 1XJ0A 4KIJA 4PHFA 1HG1A 2WHPA 1J1IA 1OWLA 1G6Q1 1D0SA 4GDMA 4M9XA 1DJOA 1YZQA 3K0CA 4XB1A 1DE0A 1MU0A 3NR2A 3CRVA 4NEQA 3VV2A 2P78A 1XZPA 3I05A 3NHMA 4JASB 2AOTA 2D2VA 3GEHA 3KK0A 1YJ5A 4B80A 6PFKA 4NXMB 4DXHA 3OT1A 3S2YA 3EXHA 1XAGA 2OFXA 4U00A 4YHBA 4RXMA 4ZT4A 5JI2E 2WIGA 5LD2B 1G4UR 2TS1A 5IP5A 4POOA 1D2NA 2ZCJA 3A2MA 3L9WA 2TYSB 3O1IC 4LJAA 4GPD1 2ATCA 4AY4A 3EGDA 2XDYA 4XSVA 3RVKA 3HEMA 3O3NB 1L5QA 3ZVRA 1JEQB 3PUZA 2O05A 2CDNA 4I4TA 1FP1D 3O31A 3OJWA 4OX9B 3LT0A 2Z57A 4UTRA 5AIBA 1GNPA 3SK0A 3QJGA 3JD3A 1L4HA 3R0XA 1LDEA 1X13A 1WXWA 1OWNA 3HB4X 4R68A 4BZXA 4DL9A 4IV8A 1TM3E 4TTPA 5EIOA 5F9MA 4BTLA 3ANTA 2LWIA 1WPQA 2Z56A 3E8SA 2VATA 2C95A 3K6SB 1PTJC 2CUNA 3QXCA 4M8KA 2JH9A 4XFDA 1D2RA 2B1QA 4KJZA 1Z35A 1EFRA 3EPPA 3HCRA 3ICWA 2X40A 2ZBDA 3KKMA 2QMZA 1LS1A 3UXYA 1QB8A 3ILSA 4GMDA 3O82A 2W8ZA 5J2UB 1MD9A 3R7AA 3FBGA 1BGXT 2V74B 2D7DA 2P9TA 1H9AA 2IL1A 2OHOA 3SQNA 4CKBA 1ORHA 2R8EA 3ZZMA 3QA9A 2QUAA 2RI6A 3H5TA 4ALIA 3AUKA 4F5YA 3NTLA 3EFOA 3RC7A 3A9CA 1NOIA 2AQHA 1NVFA 4H6VA 3SJBA 2GXAA 4ZK6A 4KBYA 2CYAA 1T5IA 3TZQA 4YJFA 1PV4A 4HEHA 3BWMA 4O0MA 1DKUA 4PQFA 1W0KA 1TYEB 4GYKA 5E2IA 1NVWQ 4V0SA 3IS3A 3BXGA 1E1CB 3TTXA 3MBOA 3VR6D 2ID8A 4Y67A 3HKCA 5K05A 3D31A 3ACCA 2BELA 2D1FA 3O8CA 1L1QA 3HVIA 2RH8A 4PIVA 3JQ9A 1GZSA 4UHBA 5CDHA 2WA2A 1Q1BA 1G1AA 2VCEA 2JZCA 1MB0A 1JIVA 3U26A 2J85A 4A2WA 2CT8A 1VA5A 5TMEA 2EDAA 2EFDB 2OZKA 3G89A 4L5JA 2DQZA 4ZOCA 3GHHA 3UWSA 2CVQA 2PUTA 3OAAA 4CMKA 4L9RA 1GTVA 3FCCA 1X7XB 3F1LA 5G0SA 5FYDA 5CLHA 2Y1XA 4HWGA 3WYEA 2IHBA 3Q1LA 4NDZA 5JJ5A 3B2EA 1SC1A 5JXWA 5K6AC 2C5AA 4ZTZB 3FVRA 1ZKMA 3D2AA 4RKFA 1HFEL 1XMOB 2DF8A 2W6NA 1V48A 2GEFA 3CX3A 3IH5A 1MAWA 2IEIA 3B6ZA 3QBEA 4P1ZA 5IMBA 3W6UA 1KFCB 2X8BA 4G5XA 3ZWNA 5MN4A 1NNEA 1UDBA 4GMFA 2JLZA 1HF3A 3G1TA 4P58A 2IKSA 4JA2A 3D8BA 5M7EA 2NXCA 4WTOA 1S2GA 1SC4A 2QENA 1G3MA 2VNIA 1FFAA 2XGGA 3GJQA 4BKMA 4N5MA 2CEAA 4CMCA 4LXTA 5KNCA 1P7WA 5LJIA 2AN5A 1KE2A 4C3VA 1XD9A 3U4MA 2HPAA 3I4FA 1LA2A 4YJDA 2VPZA 2Y9PB 2BONA 3SXPA 5G40A 2WTUA 5C7LO 3WO0A 3DXXA 2HOQA 1T4CA 2NMVA 1XZDA 1GCIA 3GAZA 4ALJA 4JNKA 3C41J 4MV3A 1VLHA 5TRTA 1NSTA 1BEEA 1WHSB 1Z0IA 4FS3A 5FUWA 5KCMA 4BO5A 4ARZB 4MYHA 1R37A 4ENTA 5KWEA 1EDOA 2CXNA 2OQ2A 2Z95A 4GLOA 5LC1A 3B9RA 1XK7A 1X1EA 5IVIA 3GVHA 3PCTA 3A6GA 2HPVA 3CTMA 3DOJA 4RJIA 3KJGA 2X4DA 3AUYA 1ISFA 2GH1A 2ZT6A 1X7YB 5KTNA 1L0BA 2O0LA 2GJKA 2F90A 2Q3HA 5B53A 3P97A 3PUKA 3ZE0B 4OXIA 3CUUA 3EJWA 4FYPA 4LRYA 1ULUA 3EYWA 2Y93A 3CNHA 1NOJA 5AJYA 2I78A 5C32A 4CEHB 5IAKA 1DWUA 4JOCA 1FW6A 5JSKA 3NTRA 2BEVB 1BRTA 1RAHA 1JIKA 4NENA 1QCDA 3B70A 4C22A 4B7XA 3C3WA 4YV7A 3CE9A 2SKEA 3J7AC 5CGQB 1W5TA 1RC0A 1Z6QA 3E82A 1GZUA 4M54A 2ONJA 1ZGAA 4UBOA 2WSBA 1KXZA 3D8HA 4B3JA 1CZHA 1I7SB 1B41A 1P0PA 3G2HA 3HUDA 4TMYA 1X80A 3NMUF 1XCMA 1K7EB 2YY6A 3MTDA 4CTNA 2WJAA 3D5EA 3HBLA 3VOSA 2XCRB 1RQPA 1AKUA 4E0BA 2J5QA 3AESA 1MQAA 1QFXA 2C9BA 1L7EA 2VF8A 5JTUA 3ZVNA 3E1KA 1G7RA 1LWNA 2WAYA 4R2JA 5D3QA 6ADHA 1X8LA 3UV7A 1E98A 1U1GA 2X1VA 4E4RA 2JLYA 3SSMA 2YRFA 3DLBA 2AE1A 4UHEA 3B6JA 3NUZA 1DV2A 1ZA1A 4N18A 3W5SA 2JAPA 3NHPA 4K40A 3DT6A 1UXJA 3M6WA 4EHKA 4G26A 1SGWA 2J3MA 1XHLA 3COPA 3IC5A 2AG1A 4AVYA 5BNIA 2GILA 3ZY5A 3AP1A 3BFPA 4CLEA 1KL7A 3VDQA 1ZD9A 2OQVA 3O93A 1JQKA 1UZAA 3IP8A 3WB1A 3KQKA 2X9LA 4EJSC 1NRWA 3QQPA 3SD7A 2VOJA 4P3NA 3N6RA 3WBFA 5AUQA 1Y48E 4BTEA 1IY8A 4EMTA 5IG2A 2HHAA 1NN0A 2MDTA 3V9PA 4AWBA 4QTXA 5JI3E 3RFFA 1W29A 4EDHA 1ZR2A 1LC0A 1QJ4A 2PBRA 3MS7A 2VZ0A 3QKSB 3QVTA 1ZKDA 3NPAA 3D5TA 1VHLA 3UB3A 3K09A 4HDOB 3X2SA 5H59A 2ZXFA 3IB6A 3FDJA 1JSZA 1ODJA 2NYAA 2BKXA 1Y63A 5C8ZA 3ND9A 4JENA 2O3QA 2WU4A 2Z4RA 3L0BA 1EFKA 4HEA6 4TV9B 2I6FA 2W8BB 4YFYA 2HQSA 1FNCA 4U9IS 2QE7A 1JEYA 1H8HD 1QP8A 5H9WA 2Q1TA 2K7ZA 3KWMA 4Z3DA 3RBVA 4EY3A 2HHHB 1WVMA 5CM9C 4MUBA 2ZAOA 5DN6D 3IAM6 2GWRA 3MG9A 2C0PA 2E4YA 2KW5A 2EX1A 1UXOA 3HXLA 3D6UA 1QLHA 3OE7A 1YMVA 1LTKA 3ORQA 4MS1B 4NY1A 2GN9A 4H0CA 1E1QD 3IGFA 2I6GA 4JLBA 5B30A 4RTLA 1S96A 3Q88A 4UQOA 2IOQA 2QBYA 2WWVD 4B2IA 2P3OA 1PNRA 2ODWA 3IBSA 4YXFA 4BQEA 4C7OB 4NU0A 3SFTA 2I4IA 4GKJB 3WBJA 1LK7A 1KZ7B 3UN1A 1TYBE 1QYWA 3DG9A 4BC0A 4BXOA 5I7VA 2IEAA 3HCPA 4RTNA 3ETCA 1DZIA 1G5QA 3KOYA 3L8CA 3K73O 4Y9SA 4HL6A 3WRXC 1KI4A 3CGWA 1DAOA 3PUIA 1GR0A 2QQGA 1M8FA 1CEEA 2XRFA 1WV1A 3PGXA 2SICE 4LGVA 3FFTA 4CW7A 5A2GA 1VE1A 5BUZA 1NATA 2I7VA 1YONA 3KT6A 2M6SA 2XTAA 1ORTA 5B3JA 1QK3A 3ML1A 3RADC 3CBGA 1T9ZA 3EXIA 1BYIA 1P5HA 1K4MA 4DHEA 4DEVA 1R0WA 4UDYX 1B43A 3GGSA 3K9GA 4FWBA 1V37A 1W1UA 2H1SA 3FMIA 4Y6RA 1XTUA 3IRUA 2KB0A 1JALA 1F6BA 4L5YA 4ZAVA 3SXJA 3COZA 1E0KA 4M9UA 2WIBA 2Y92A 2ZCVA 3SMQA 4UCFA 1JKJA 5FBHA 721PA 4L9SA 1R0XA 3ENQA 3O2SB 3L06A 1FVHA 4TTJA 1FU7A 5EWJB 1U7TA 3B1ZA 4HAZA 4LY0A 3TWOA 3C74A 1QDEA 1GL6A 3OKCA 1J9EA 4US2R 2NVUA 1R6VA 2J3DA 4H35A 2R8XA 4BFWA 1E2QA 5DTMA 4G0VA 5KX5F 4MAMA 5KINB 2I8CA 1CS4C 2YQ4A 5IM4A 5JZ9A 5CYGA 1QH1A 4C2TA 2J0SA 3OUTA 1WXHA 4GI3A 4RCYA 4LY9A 4GXQA 1ZSNA 2VRCD 2IDKA 3Q11A 2OLEA 2WNSA 3KD2A 4C20A 2XOKA 1NJ6A 3Q3GE 1FSFA 1UKAA 1EXDA 2IX3A 4CIDA 1U31A 3SEZA 2ZVQX 4QNNA 4DFDA 4IKEA 4JJ6A 2WU8A 2CXRA 4BWVA 2O59A 3EOAI 3ABZA 2ONCA 5L40A 2D8MA 3MN1A 1Q3HA 4U63A 1M8JA 5KTMA 3P4UA 3FWKA 4AS3A 4LXIA 3SF8B 1NPYA 5DT2A 1TYCA 1G17A 3GT7A 4KLAA 2IYPA 3NONA 1O9GA 3AI2A 3KVRA 1H5NA 1M1XB 3G8AA 4JQZA 1XF9A 5AM2A 5K8VA 1U8UA 2EV9A 3OHSX 2DBYA 4Q3AA 4JLUA 3IA2A 1CF4A 3T12A 4YMHA 3RSHA 1UP7A 3WIOA 4AQYB 4OQ4A 1IU9A 3OP4A 4B3SB 3WE7A 1GM5A 1LTHR 1S3SA 3WYDA 4AY6A 4JYZA 1CDDA 4WBNF 3TBFA 3H9QA 3ULKA 1V1JA 3CG0A 4FYYA 3I01M 3X1DA 8GPBA 2GZHA 3O4FA 5LXTB 1FRFS 3GAMA 2J31A 4KKXB 4B87A 3OQHA 5HA5A 4XYLA 1S4MA 3JSAA 2E7ZA 1TZBA 2YRWA 3TO5A 1KAOA 2UZ1B 1A82A 4EKNB 5LDHA 1UPTA 2FSFA 1YI0A 1BH2A 1GL3A 1QTRA 4M98A 1K5DA 1TRHA 3VOTA 4GL2A 1QO0A 4GI5A 3OPVA 4UHCA 2WOOA 1CP2A 1HR0B 2O0HA 3QE0A 3KZCA 4X94A 4IDPA 2PX6A 1CRZA 3P5BA 5KVSA 3DTYA 3INNA 2QGNA 4QU0A 5ELXA 1R0SA 1EVYA 1IY1A 3AQ4A 2QK4A 4K86A 3TGLA 4H31A 1IUOA 1E0SA 4ZV4A 1PGPA 4UM8B 4FYMA 4JOSA 2BGTA 1COWA 4JC5A 2R6JA 3AM3A 3RSCA 1KR2A 1RHMA 3FCEA 4FHFA 4IDEA 4MV8A 1IQUA 1CUUA 3VSDA 5CGZA 1RJGA 5DHUA 1I1OA 1NBAA 3KEMA 1UBFA 5FADA 5AVSA 1ABBA 5K20A 1FFSA 1FRVA 2CL6X 2GEKA 5BV7A 4PZAA 3U3RA 3RYCB 3FSEA 4ZICA 3HUTA 1DQRA 4W6ZA 3CXUA 4BNVA 4EJMA 5KQLA 3LRPA 3RUHA 4WWHA 2ZJ0A 1T3GA 3MCAA 1A7UA 4GM1A 1UQTA 3K4QA 3I5MA 4HFMA 2TRSB 1VBKA 3G82C 3KHTA 5EP2A 1CPYA 1TU0A 4JGBA 1BO6A 2YWGA 1RYYA 1WPRA 2P4EA 5ALNA 4PY2A 3TLZA 2O7VA 2E4VA 5C53B 4B3XA 3A6PC 4GPZA 3REFA 1W5AA 4S2EA 5DCYA 1MO2A 3DE0X 2FPIB 2V4ZA 3EASA 1YI8A 3NKFA 2IEYA 4AKTA 3IV6A 1WEKA 3WJ1A 5FNVB 3I4LA 2NNWB 4DLVA 1X1AA 3IBTA 1ST2A 1SAYA 3DEZA 3E4DA 4HEA1 3MWYW 2ZUFA 2JFUA 2PRSA 1DEKA 1GT6A 2JI4A 1UFVA 4BO2A 1DIBA 4M38A 1XL1A 2QJWA 5CJPA 4F9GA 2GM4A 3WHIA 1L5ZA 3HCDA 5EE5B 5HRUA 4AW9A 3D4IA 3IAM1 3P0HA 3TFWA 7REQB 5A1TA 4B3TB 2CJPA 1W46A 3CLSC 5L3QB 1LD3A 4WY8A 4NJMB 4AYTA 4CKEB 4L4UA 1KVRA 3DMNA 3ESDA 3EQ6A 5B1EA 4JELA 1UJNA 1B2RA 3V8VA 3QEAZ 5I3ZA 1VLLA 3QLJA 1C7EA 1NBMA 1QIHA 5EPOA 3WXBA 1FX0A 4P4SA 1MF7A 1SOUA 4HQ6A 5CA1B 2UV8A 5B3AA 4PC2A 3NM5A 4MW6A 3UEOA 2AG5A 2WJZB 3B9PA 1GDDA 4J2OA 1NW5A 3K8OE 1PG2A 4DLRA 4P0QB 3V1MA 1LLCA 3BH6A 2H4XA 1P0FA 3PL1A 3KM0A 2BSAA 3HYCA 4LZJA 1SEVA 1JFVA 2X9NA 3KAQA 1HLDA 1R00A 1A69A 4HNQA 3TN7A 1C30A 3DOIA 4D3FA 2G9QA 1YHZA 3AGQA 2CE2X 4CF6A 2VCYA 3I1YA 3U44B 5CVVA 4X66B 2MSWA 3L46A 2JIMA 5DHPA 2ZS8A 4FILA 3HSSA 4Z0NA 2FVYA 4F46A 2HCBA 2R2GA 4KXLA 1G7CA 4R0NA 5CDSA 3S8YA 4XGRA 1D5WA 3RRYA 3ETEA 4XQGA 3O7MA 2C96A 2Q46A 4IIFA 3KU4A 3OQMA 1JS1X 1ZMXA 3RH0A 1I7PA 4I9UA 5AKZA 4ZDWA 1J5EB 1T43A 1QIFA 1VSUA 3JD0A 5HS6A 3KXPA 5JYBA 1QHHA 1P39A 2JBHA 1JA9A 2P40A 4FHDA 4LVOA 4GQIA 2UUOA 1HEUA 3KQWA 1OWPA 4I1SA 5BMOA 3CNLA 3PXCX 3KUKA 4FX2A 1VHDA 3FVVA 4RZ3A 4KR9A 2P4SA 4K05A 3NLLA 1I7NA 3CF2A 1H85A 1RCFA 1BJTA 2BBOA 2EC5A 3Q15C 3P26A 5KDOA 3RYHB 1IBSA 1OKKA 2X5KO 3DC2A 4HZGA 4XGKA 2Z3VA 2P41A 5EMMA 1A8QA 1Z7YA 5FB3A 3TVDA 1RKQA 3G6WA 4BKRA 4I9HA 3RREA 3AY3A 5JT1A 1G38A 5LL6P 2LZ0A 2HLDD 3FKSA 1ZIYA 5LYYA 1SBTA 4G09A 1B1CA 5FIUA 1SB8A 1ZMRA 2PGDA 4DIEA 1W1WA 3T1VA 2ENWA 3BQNB 3M9WA 4FEEA 2Y2VA 3BHMA 2UVPB 1GR1A 5GPBA 1EX1A 1AXGA 2FWMX 1H5UA 5EA2A 5KNCD 1IY2A 3MT7A 4E09A 2PZBA 2OCGA 1E3SA 4DR6B 1JJIA 1RP1A 2CWWA 3BIXA 4G0XA 4J0QA 1M6VB 1BHJA 1M6HA 4WXPA 2QTLA 3FAZA 1CY4A 1NQOA 1IVYA 2B30A 2QRLA 3I9FA 3FYHA 3T52A 3U09A 2PSDA 1ZNWA 4IRUB 4LCEA 4FGKA 4BP1A 4A8JC 3C45A 2W71A 4L4SA 3NIDB 4IYJA 3IDOA 4TMFA 3N2NA 5DM70 3II6X 4WE3A 3WMGA 1RAFA 1F8YA 4BFZA 1CQJB 1IFXA 2PWBA 2VF2A 1VSBA 3Q10A 4GX1A 4P6VF 1QC5B 3H0CA 1E1MA 1ZJ4A 2IP4A 1SU7A 2WTMA 2AT1A 2ZGVA 1JH8A 3AXTA 3H8JA 3K5PA 4QA9A 5CDFA 3SM9A 3OLZA 1KJIA 3MTEA 1CE8A 4KV9A 4TT3D 2JJ2D 3LHFA 4J2HA 5BYJA 4EVIA 1UP6A 3WK7A 5DGCA 1GA1A 4IFTA 4R2WA 3UMFA 3M5WA 5IU6A 5LYJB 2WFLA 4TYQA 2ZRPA 1F1BA 5MN6A 3OZUA 2ZTSA 2R0QC 3JQGA 3IRVA 2ZJ3A 3QLUC 1TUBB 2JH3A 1OBHA 1WF6A 1Z0JA 4IHQA 1N6HA 2R97A 4H4EA 4K9RA 4PZZA 5DTRA 4EPYA 5IF9A 3BE5A 5LOVB 3LY7A 1FSGA 1I5RA 3TKAA 4UNRA 2REXB 3JATB 1FE8A 2BGMA 4NZNA 5DBEX 1RQ7A 1ZHFA 5IAOA 4K81B 5LWQA 4I55F 3BERA 4UU0A 4ZT3A 3HKDA 1SD2A 4FFLA 1OZHA 3NXKA 1HSZA 1IDN1 1LK5A 3OPXA 5T64A 3S5JA 4YRIA 1U0BB 1AN0A 2QI9F 4Y30A 4AJJA 3CF0A 1XD2B 4DQUA 1I3CA 2VT7A 1W36C 4HFNA 4HWRA 4IP0A 4D8YA 1S2LA 1KC3A 1ZGHA 3HU1A 3L7MA 4Y2YA 2V0GA 2AYZA 4S1OA 3DE3X 3ROTA 4CM4B 4D57A 3V7FA 4F7DA 4M37A 3F3MA 4D81A 1KTIA 1G8MA 1PNVA 4MRVA 4AJKA 1Z4IA 3KSUA 2TMGA 2C2XA 4NBSA 1BU8A 4KQ1A 1XDSA 2HXGA 3C3BA 3MTIA 2BR5A 4JI7B 3CSSA 1VGRA 1WXQA 4JX8A 3H5VA 1EPUA 2JGIA 4PONA 3MMSA 4H3SA 3T3EA 1WDLA 1FYXA 3LFTA 4CCYB 2NQ8A 4CTOA 3SFVA 4BLQA 4X6YA 3NW9A 2CJFA 1PI3A 3EVNA 4D7AA 4QREA 1N2EA 1E9VA 1K4YA 3KZVA 3OVMA 5LCXA 1N7IA 2FPPB 3R5KA 3H2IA 4BEVA 4ZU6X 5E7JA 4Z9YA 1EAMA 5AW4A 4NFLA 3NYQA 3OOSA 2CVOA 3HYSA 1KVSA 5LA6F 4RFSA 4DWVA 3AHDA 2AS0A 2GUGA 5IJAA 3S2FA 2YDYA 2YJ3A 3KJEA 4XDGA 3TW0A 3ADDA 5DW3A 1ADBA 1MIOA 3HY4A 5I9TA 1TRKA 4BX2A 2X1HA 4HZUB 1Z6TA 2Z9CA 1M8GA 1YT5A 4FI3F 1T35A 3U48A 3R3VA 4RF2A 1EBBA 2WNHA 3EIOA 3IPXA 2HBYA 3TNDA 4EAAA 3U5TA 2DCMA 3F1KA 2BMJA 2R00A 1PEKE 2R8BA 1DS6A 3BJZA 4ANFA 3OE1A 4DIBA 2FFJA 3ZW9A 1OU4A 1EQ2A 1LDBA 2HA4A 4J0EA 2FRDC 1YDEA 4MUJA 4OJTA 3Q8XB 4JAVC 4PHHA 4XWTA 3VYSB 1LQUA 3AKCA 4Z9XA 4DDWA 2FUCA 1V39A 1QRAA 1R9GA 2ENUA 3PJFA 4WKOA 5CUQA 4JLOA 2CV0A 3N2GA 4WIAA 4WOPA 3UJHA 1YS9A 3B38A 4IS2A 4QKQA 1K6MA 1DJNA 2I3BA 2WBLC 3HB1A 1TJ5A 2I3ZA 1JLMA 3ILVA 3MJEA 4QBKA 1AS0A 4U0KA 1QUFA 4RYDA 3FUUA 3KUDA 1OLSB 1XG5A 2O48X 4FCVA 4NARA 4WZ6A 3VU0A 4BP3A 1P7VA 4X6LA 5F98A 1WW8A 3CMCO 4AO6A 4R71A 3FROA 2P2LA 2QYSA 1NNI1 2WVJA 2AA3A 5HJ2A 1J21A 3AF1A 3NOXA 2AR7A 5DHRA 3WLFA 4PAWA 3L0ZA 1C41A 3QKRB 4N47A 2XZDA 2W0SA 4JI3B 4REMA 1LQ2A 2QF7A 1MDBA 1X8KA 4P3KA 5JG7A 1RJ9A 1EK0A 1ZH8A 1FPMA 4F5EA 4MRNA 2XXAA 1ZH6A 2WQZA 1JQAA 4MVJD 4DA8A 4I99A 2PGAA 3DXYA 3GRRA 4EY4A 2G4VA 4L51A 1YA6A 3AL0C 3GELA 3S29A 4C6RA 1NC3A 5AW5A 2MSCB 3DULA 2ISQA 4JMLA 4KTTE 3KT8A 1NZFA 2LRHA 1MEEA 3OZXA 3PUJA 3GK3A 5GP1A 3WICA 1B2LA 3JY6A 2BVNA 1PVDA 4H7PA 1R2QA 4NEGA 4BV2A 4DBLC 5L7WA 4R8RA 3CSUA 3VC2A 3ZBQA 2OAQ1 2XUDA 4W99A 3IEIA 3M5DA 3LYUA 4POAA 3EVTA 4F3NA 1GPUA 2I65A 4IH4A 1UPAA 4YGYA 2AH5A 4R16A 2WG0A 1NYLA 5EZSA 3DWIA 4AKSA 4QJ3A 2VBGA 5IK2D 5DEIA 3ORRA 1U4NA 3U3JA 3HMQA 4WVLA 3QVGB 1PVVA 3GCGA 4MMXB 5KNDH 4TMZA 2Z6VA 2BBTA 4IZHA 5IJ0A 3N9IA 1T6ZA 1VGQA 3HP7A 1EKXA 1J2RA 3TF5A 5BSKA 2PSFA 3JZDA 3K20A 2A5YB 4FMCF 2XODA 3DBLA 4UAGA 4DZRA 3RTGA 2WJIA 1KFBB 3GLIA 1PL6A 1PS9A 1ZRSA 3R3HA 1VB3A 4LECA 3AGPA 2ZYGA 4B8ZA 3A4NA 1TEZA 4OHVA 2OXIA 2YHBA 1XJ5A 1RQ2A 1CY7A 4A92A 3FOBA 4WESA 1TW2A 4AJIA 2DPXA 3TLJA 4RTOA 4R1UA 2GPBA 4D45A 4YLYA 4TKUA 4XE5A 2C29D 1YQQA 1BA2A 3RTEA 1X92A 3I09A 3THYB 2JGEA 3IT2A 4V39A 1ZRMA 3ROZA 1DEOA 1HL3A 2IXGA 4DMUB 2ATXA 4J49A 4M0DA 5TPWA 4EY7A 2ZDHA 4IQ4A 3QPUA 2C00A 3DMYA 4O4LF 3DDSA 5TPZD 1XX6A 2R8YA 5FLXA 1WAMA 1ZMBA 2R6CA 2RG7A 5FUYA 3ZDCA 4X8MA 2B6NA 3HA3A 1U7DA 2OV8A 3KUUA 4WL0A 3SNKA 3UB2A 5L3RA 2BJHA 3VR5A 2C42A 2YX1A 4CNQA 4UU7A 2FPKA 1JQJC 1QFJA 5JWOA 1ZZEA 1MPXA 3DHYA 2OOKA 4KUGA 4HDMA 2IS1A 4AZ0B 1J90A 4KDRA 4L4XA 1PT5A 3OJOA 5EQTA 1N5OX 5CIQA 5EOVA 4AZTA 1IN1A 5JPIA 2YVKA 1R0CA 1NULA 1EUZA 2YR0A 3HA7A 4HXYA 1AZWA 2ZJ2A 2XJ9A 2VTKA 4QODA 5KYVA 2HJRA 3CPEA 3EGDB 4HO1X 1KE1A 3VX3A 5JAHA 1IBKB 4LHVA 4R1LA 1KKUA 1SC3A 5DGDA 4RL4A 1FS6A 1V8FA 1SBQA 1M2VB 2PAAA 3EW9A 4IPTA 4LTDA 4TWBA 4BN0A 4CLOB 3BBLA 3IBYA 4OU5A 3RSLA 3DKVA 2VHZA 2DSNA 4HH0A 1TLLA 3CPJB 1V6AA 3L7CA 5A9TA 4BV3A 4D9JA 3DAYA 5DO9A 2D6FA 1B0PA 1K8RA 3QA3E 5EZYB 5LPNA 2O5EA 2H4WA 3TZLA 2HR1A 4EGCB 4I46A 4L8WB 3Q3VA 5EIHA 2FA9A 2PWZA 3AXSA 3G5LA 2ZWOA 5BT9A 4F4DA 5JPDA 2YUIA 5HIIA 2HI0A 3ND7A 4ZEOA 1OFIA 3VJKA 1U8XX 3QV1A 3DE7X 2H5EA 4ZOLF 1C3OB 2MR5A 3BXHA 3IUNA 2AMLA 3TMYA 3UUWA 1G8HA 1ID1A 4OHBA 3MS2A 3I52A 2C99A 4LW8A 4REQA 3N2IA 4NFSA 2VTBA 1C80A 3WZMA 2FZCA 3M70A 3ME5A 1YS1X 4Z54A 3UKJA 2AD5A 5C8VA 1EEHA 2HSJA 4ETMA 2WWRA 1QU2A 2VP9A 3SM3A 3JWGA 4EVSA 3I12A 4UDXX 4L5IA 1SUCA 3TJZA 5KX5A 4GPTA 4YJHA 2JJMA 2FXVA 4MI9A 3HB0A 2WUGA 3R7WB 1RXCA 3QHQA 3ZD7A 2BEUB 2AVNA 3I8XA 4XIYA 4YJ2F 2BF4A 2PKQP 3HMKA 4LPKA 2XAAA 1GPJA 2JCYA 2WAOA 3LCUA 4FR2A 4N5DA 3T9CA 7GPBA 1BD3A 2Z2ZA 3WLSA 1IK4A 4N5NA 1Q7EA 5FTJA 1K5GA 1TVKA 1FFWA 3NUGA 4IVQA 3SBDA 3ZR4B 2VNSA 1CUBA 4IIYA 1BEUB 5GADl 1L8QA 4E33A 1WZ2A 3FYSA 2RHWA 4KYTA 1J5XA 1KNXA 1WHTA 3R5FA 1VPLA 1P45A 2VP2A 3PFGA 1Q0RA 4NV3A 1VKZA 2YMQA 1KO5A 2VF4X 1VMKA 3FF1A 3LH5A 4E4TA 4F6LA 3R7BA 3ITEA 4Q19A 1EZ1A 3E8MA 2DY0A 1N7JA 2ZI7A 1FB5A 4R9RA 3ZOZA 5KWSA 3EN0A 4E14A 4AICA 1X39A 2AF4C 7MDHA 3MJCA 4IG9A 1FU8A 3IOBA 2Q8NA 4EI2A 4WBNA 3VI3B 5HJ5A 1JN0A 3M1LA 1RU3A 5ALKA 3MBKA 1TO2E 1N78A 5EYPA 1E5VA 4A0QA 5C34B 1J0AA 1A3CA 2KPOA 1G5HA 4JB2A 2HXSA 1VI2A 3CRRA 1R0BA 2Q6KA 2BFNA 3CEMA 3P4YA 5DDIP 4FGWA 1GGHA 3TLGA 3IIEA 3G5AA 1Y6GA 3RT9A 5L3SB 4W9MC 2Z0MA 2PEYA 4MYDA 2E48A 4NECA 2VN8A 4P3YA 1SCQA 2CY0A 4ZPJA 5B58T 4D92A 1PJCA 4KQ6A 4A73A 3LO8A 3AIKA 5B3JC 2W58A 4BVFA 4I5GA 3BFVA 4MVJM 5JECA 3DL7A 3IUMA 2R86A 3GUUA 2CJWA 1K1EA 3JZMA 3WNDA 1T4CB 2Z3WA 1MGPA 3A36A 3D1JA 5DOZA 3VNBA 2EJWA 2AUNA 2IPXA 4LZAA 1W5FA 1X9HA 4WLFA 3KV3O 4C05A 1C7FA 4EVQA 4UAVA 2ICAA 4QBTA 3ZEAA 2IJGX 1RWVA 1T9GS 4QYWA 4BUCA 5EKDA 2G6BA 5DT9A 4MVCA 3RUFA 2OO5C 3SZLA 5A4KA 4CF4A 5KOHA 5G4LA 4DDTA 3A9SA 2RB4A 5JMWA 1HMPA 1IEQA 1N9KA 3EDRA 4P4UA 4PM4A 4WW0A 1BIFA 1HO3A 3EQ9A 4IS3A 2XSZD 5T6MA 3QIAA 4K9OA 1OFUX 2VJBA 5A0FA 2AQ8A 5E95A 4HX2A 1U2PA 2IYTA 1XZLA 1FL9A 5B4UA 1M6YA 3MQFA 1ZSVA 2E4AA 3K0EA 1FYDA 4BMXA 3M6AA 1ADFA 2PXAA 1EJBA 2NTJA 2JLUA 1A9XB 3RBAA 2VDWB 3ND5A 1PV2A 1QR2A 2P11A 3LP5A 2WT9A 5ESDA 5IDVA 4BMDA 4CUZA 5E1OA 4BN4A 2RH9B 2BHTA 3PQEA 1P0IA 3KZNA 4Z5XA 2XWBF 1O3YA 3FTCA 4DV5B 1ZK0A 4OK3A 2VLBA 3PKJA 2XKJE 2YUTA 2MSLA 1T0JB 2V96A 3C3EA 4GRAA 1E4YA 4RSRA 2GEBA 4LJKA 1BMQA 3HRHA 4FSDA 4QL3A 3JPYA 1J4AA 3TL2A 3MJFA 1AQJA 1U3DA 2HRBA 3O0DA 1Q2XA 1KMMA 1ZCBA 4ETNA 4EITA 2W6MA 4K9QA 4LRUA 4XFJA 1QKIA 1Z33A 1WKCA 2Z2KA 1W4BA 3JZAA 4PV7A 4RY9A 3F74A 4WCFA 5JH7F 4DLLA 3KT0A 4NCHA 4K6HA 4F3CA 5IEJA 2YRXA 5G41A 4BO3A 2IBTA 2GQ0A 2PMBA 3LUHA 1VJGA 2PGLA 4X3PA 2Z6UA 1I33A 2ZSHA 4O2BB 4Y6LA 5FRDA 1JWLA 5K0ZA 4G4JA 3NX4A 3IVCA 2W2OA 2PYZA 2X2PA 3M1AA 5FI0B 5T8KA 5LVAA 3H2HA 5HUQA 5JSUA 2HADA 1E6UA 1QQ7A 3VPSA 2WJ4A 1POXA 4UU1A 3L79A 3FNEA 3P9ZA 4JBWA 4EWLA 3B2NA 3LS2A 3EHDA 4I5EA 1EYZA 3VJMA 4ZKDA 2IPAB 1V8ZA 2OB2A 2GHRA 3HRKA 4MB2A 3ZE9A 1JQ5A 2COKA 3U56A 1Z0SA 1ZAYA 2AJ8A 3HO6A 1DT3A 4MR9B 1E61A 4QYIA 5LKRA 1C7IA 3CY6A 1Y3IA 4AB1A 4X7BA 2Z2JA 2E6UX 1O5OA 1YAJA 3H1PA 4JEHA 3OSUA 3ZCVA 2J32A 3UXHA 5JROA 1PJLA 1K8YB 4GZ6A 5AM4A 2IYYA 3QVSA 1JEYB 1V2HE 4RZUA 2PUFA 5J1TB 4HNVA 4D41A 1G20E 2UVQA 1HDXA 3F3KA 1UJCA 5KNBD 4R9SA 3B1XA 4ML3A 4MP6A 1XRNA 4U39A 1QMPA 1UC8A 5CLIA 4DB4A 1Z74A 2V55B 3F47A 1KDVA 1MXHA 1NOKA 1TECE 3WLMA 1QQ6A 1E1RA 1VBFA 4L27A 1OFUA 1QF9A 4C1NA 1LPSA 3KTAA 4ZANA 2Y1CA 4NR0A 5IUKC 4UFPA 2H5JA 2P4UA 4MGIR 2O7QA 4X92A 5F4ZA 5JADA 3I5XA 1VHJA 1VL6A 4NZZA 4AWXA 2C8VA 2B94A 2ZRIA 4WACA 3M34A 4YCDA 3UB4A 2IH2A 2Y6UA 1VKJA 4BAZA 4PO8A 3NAGA 5DASA 1YASA 2OB1A 3DMDA 1HYQA 1MRZA 3HEBA 3UAYA 3GLQA 4CIVA 3ZXYA 3EC7A 4ENVA 4IDGA 4IZIA 3FI0A 2VTDA 5CMLA 4JI5B 4QU5A 4RZ2A 1CUXA 5LQRA 4BZWA 3UBTA 5HF9A 3PI6A 4CRWB 1NJFA 3ABRB 3UENA 4E70A 4R0MA 4G2TA 5I9MA 2XRZA 1EVIA 2Q2WA 2ZS9A 1P7YA 3QMMA 4KE9A 2VP4A 1YZHA 2V59A 2FSVC 4KLCA 1R12A 4TQUS 3SZUA 1H8ED 4HDNB 1A76A 1H2FA 2VDLB 3LAWA 1XQVA 1TF5A 3GP3A 4PX3A 1YV9A 2J3IA 3HLKA 1DAFA 2CDCA 4L7VA 5FOWA 4DGQA 5I7EA 1DKRA 5FCDA 4BB9A 3AYZB 2DR0A 2IE0A 2E9SA 2PAFA 2E55A 3VDXA 8ATCA 1HWYA 2PXXA 1DIRA 4XRRA 1CHNA 1JKJB 1WNTA 4IG4A 5CCDA 4GNRA 4W8GA 3E9QA 4YRAA 1P60A 5JNRA 1VDZA 2I55A 3AVTA 4HRVA 1JVNA 1J8YF 2LGJA 3B3AA 4UZSA 3I23A 4X1YA 4Y3UA 3SZOA 5JASA 3UJ8A 1YA8A 2ZFUA 3P0FA 1YR1A 1I2BA 1U3CA 2GESA 1JAIA 1L4GA 2VQDA 5CLQA 3WNZA 4AZVA 1M10A 4ZZ3A 2FW7A 5ALHA 4QDKA 3WSVA 4WK6A 2PE5A 2PIDA 4B43A 3R3SA 4B82A 3O4VA 4ZVMA 3S4YA 3MT0A 3PFIA 5BRAA 3I72A 2NYRA 3RYIB 2HMSA 3D54D 2VR1A 2WDPA 2ZUUA 5I7RA 2NSJA 1CZOA 1QGOA 4EFMA 5LD2C 3LIIA 2EZUA 3N0WA 3QW2A 4HRAA 4MLDA 4M1MA 1LV8A 2QLBA 4MA4A 1US8B 2XRYA 2WWYA 1U5AA 1M34A 5GGYA 4XIIA 5H3HA 1DFIA 1R15A 1L7AA 1I4OA 4EBFA 5KWVA 3VDMA 1U98A 1O6ZA 3CONA 3WYCA 1E2KA 2PRIA 5LQNA 4QM6A 3G0OA 5BSMA 3N8GA 3I04M 5ALUA 4YRJA 3E05A 4B4WA 1LVGA 3R2JA 2N1MA 3HACA 1Z08A 1L9KA 3U81A 5IKMA 1DUIA 1C4XA 2VT3A 2VPYA 3H9UA 1GUZA 1NNLA 2YWDA 3VC7A 2ZE5A 3E18A 1SZCA 1DIOB 2BFDA 2QMEA 2WNIA 3WTBA 3ZVMA 3PLAE 4UMVA 1LPPA 4Z4CA 2YXNA 3QX3A 4NYIQ 2CHUA 2NO0A 1C1YA 4RBNA 1RHJA 4PU0A 3WL6A 1O08A 1F7UA 2W9XA 5HQJA 4OYRA 2QT9A 5JC8A 4UFNA 5ALZA 4KPYA 1VRCA 5CTAA 3O95A 2E82A 4LZPA 5J1SB 1TLFA 1I2CA 2W2NA 2P35A 4GC9A 4HI0E 4RMJA 2HPZA 4HMOA 4GSLA 3FA2A 4BNTA 3B3FA 3R5XA 4UVHA 3H2ZA 1U5BA 3AG5A 4BFXA 1SXJB 4CG1A 2WJHA 3WK5A 2O1SA 1CUVA 3T1NA 2JD0A 1KO4A 3RK4A 3HSKA 4C5BA 1TO6A 3DBHB 2R7LA 1L8AA 3NH9A 4OHWA 1KAQA 3LYHA 3M0EA 3JASA 5JAQA 4X1KA 5JJLA 3EY9A 1JFSA 3TLBA 2CLCX 2VHWA 5EMNA 1K63A 2Q99A 3B5JA 4M9QA 4RSGA 1SU6A 5CNIA 5F2KA 5F3DA 1IVSA 3I62A 2A92A 2A0KA 1YB5A 1L8LA 4NDAA 4TQ9A 2DTEA 2ODEA 4YP0A 5JFTA 2WTNA 2BKUA 2H63A 5LA6A 2C3YA 3ZXSA 5COAA 2EEZA 4DR5B 1QSGA 3LQYA 3W2GA 2ZJBA 2REOA 2YIDA 3AR4A 5I8WA 2LTAA 3FFXA 3PFHA 1JVBA 1RAIA 3VYVA 3PSHA 1AE1A 1LXCA 3BG5A 1FBNA 1PZXA 2HU8A 2FPRA 3G6KA 5CNKA 3R9WA 1EFUA 2IZOA 2ZBUA 2QRVB 5FTKA 1WIWA 3SZMA 1UJ6A 4MS3B 1MO5A 5A4AA 2QSZA 3O4RA 3EGIA 2PMEA 3I2GA 2IHZA 3LPNA 4MW1A 5IJWA 4RVFA 1PL0A 1OJ7A 3CGGA 3DV2A 4O5AA 3OEYA 4ZU3A 5JHGB 1F1JA 3VR4H 1E4EB 5FFNA 3LC1O 4NMLA 3P2IA 3SYMA 5CB4B 2QLFA 5MN5A 2R6ZA 3FMOB 3DC7A 2EWMA 2CLHB 2IEGA 2JGDA 4JJAA 4RVCA 4C7MA 3D4LA 5K3EA 4NF2A 2I3GA 3BD6A 1LX6A 1TKAA 2O1XA 1QHNA 2AN9A 3NBMA 2C5LA 1JKIA 1U7WA 2PSHA 2W2TA 5I4KA 3FZQA 3SSNA 5KS2A 1FFHA 3TSAA 2C2GA 3SVTA 1NV9A 4YK7A 3TZHA 9ATCA 1KDTA 2DFKB 5E3HA 3AR5A 5FL3A 3QI2A 2VIIA 3MAJA 3PRJA 3QH4A 4H4CA 2A7QA 1KYTA 1RWWA 2OBFA 1C8KA 3AVOA 2JLRA 1EDBA 4Z3KA 5BUQA 5C18A 3O3MB 1Q0TA 3WGOA 4LV8B 4CPDA 4L4RA 3ZY4A 1FX0B 1UBLS 3K0AB 2ZATA 4P4SB 2V6FA 4YRQA 2HCJB 1GSAA 1WZEA 4L28A 1PK8A 2NIPA 3D64A 2PU5A 5DI3A 2HM7A 4AIRA 1PIWA 2GFHA 3IP3A 3PUWA 3RC9A 1AKYA 1W0KD 4TMVA 3WP1B 2BFMA 1B00A 2VC2B 1V6SA 1E0AA 1TW3A 3N0VA 2VDJA 4CIYA 2EWWA 3GBVA 3X0DA 4DWOA 1IL0A 1VSVA 3IR6A 4JT4A 4J91A 4AKHA 3V7WA 2A30A 4NONA 1HV8A 1T2NA 1JQEA 1XZJA 3KSMA 1HFWA 4AJHA 3H1TA 4OMUA 2RHBA 1W88B 2FJ0A 2HMTA 3LMKA 4KXVA 5E6SB 1RCTE 1PQYA 1V43A 4E2WA 1Q11A 3JYLA 5FLEX 5KOJB 2Z30A 4OF4A 5H0IA 1VLVA 3JZIA 1UJ4A 3EULA 1QRUA 1DBVO 4XPIB 2PKCA 3ZNPA 4YCMA 3IQDB 1QHYA 3EYAA 1C1XB 1MAHA 1SVOA 2CE7A 2D0OB 1TM5E 1WMEA 3MUNA 4KDCA 2P2YA 4XW2A 5H4HA 4HWKA 1DPGA 3AKDA 4W5WA 3RVJA 3KVVA 2NZVG 3GLUA 1HPLA 2YZ7A 4IUCS 3FRJA 4NV1A 3RAEC 3C8HA 4N5IX 5ARDA 3T5PA 2O07A 3GLFA 1RJEA 1VJ0A 4YJ3F 3C2QA 2BTQA 3K8YA 2Y05A 4MUXA 3FY4A 3ZCSA 2C5FA 2QN1A 2WUFA 4LCJA 2YIMA 4GOOD 1I9GA 1YI1A 4DVJA 2CF6A 1GA4A 4O4LA 2J6BA 3G2PA 3QE3A 3BFJA 4MWZA 4PHGA 2D7JA 1FNDA 2VBCA 3GPIA 4EG4A 3ZJ5A 2H2IA 2DETA 1S3GA 1A2OA 4CWAA 2ZI9A 3VAAA 4Q9KA 4P2GA 4BP8A 4X20A 3I9LA 1CKEA 4E5YA 3D8RA 3CR8A 2W6QA 4TVBA 4F04A 1SUAA 4ZZ0A 3JVIA 1D6NA 2ORVA 2B0JA 2RHMA 3M1YA 4K2HA 4OFZA 3LXRA 3VNRA 2JJYA 2Q2OA 4K28A 1Z2DA 4ZOAA 2VJCA 4BCCA 1AH2A 4EZIA 3L5KA 2XIQA 3H05A 4PLZA 2B83A 2Q3LA 2V7TA 3PF9A 4XQ0A 2V3CC 1VE7A 5DNAA 3DBRA 3N5KA 1LPOA 5CNMA 4BFVA 1VYVA 2UXDB 2O0JA 5JXIA 3OZTA 3EFHA 2B4KA 4XJVA 2V6BA 2ZSEA 3WADA 4AMVA 1BU5A 5J4KA 1Q21A 1YHYA 2BKAA 2O54A 4P22A 1H3NA 3V1YA 4LZZA 3IIMA 1T8SA 3HYNA 1BCRB 4UHJA 5SZJA 5IVHA 1SULA 5BT8A 1GTL1 4UCWA 4XYEA 2B7LA 4BE4A 2KSQA 2YQ5A 3JQBA 3PEFA 4EKDA 3MRVA 3WQHA 4B47A 1G66A 3A6KA 5FUXA 1OI3A 2H6EA 2HLPA 4NYMR 4R3NA 4AUNA 4WKBA 2WZDA 3DH0A 4ZOLA 1VL8A 2YJ6A 1N0WA 3DL2A 2M6RA 3F6BX 2WU3A 3LHKA 3DMTC 5L4LA 4UXJA 5CJ2A 2ZPTX 3VXKA 5MFZA 2WA1A 2FF7A 4KZPA 2AMJA 3KQNA 2AXQA 3AEUA 5G1OA 1SXQA 4P32A 3RVPA 4ZAFA 1SVLA 2F8LA 4QXPA 7ABPA 4WA8A 4PSAA 2FXIA 2G1JA 1H2RS 4P4NA 2XAUA 3GRVA 2ZUVA 3KOOA 2CMKA 4IOKA 3PQDA 3GMSA 4FQ8A 1YUBA 4H15A 1T1SA 3U6KA 1XTPA 2GZAA 1EFAA 3M4JA 1Q2UA 3VM6A 1CG6A 1P80A 1U8CB 3RRNA 1ZXXA 4YJ2A 2JGJA 2WM8A 1UJ2A 4NBLA 1YO6A 2OUKA 5EFZA 5JW6A 1WVIA 1XU4A 3QNWA 3U4CA 4X91A 2XZPA 2QRJA 5AXAA 1TB4A 3HUEA 4PYIA 4CTJA 1TT5A 2NU6B 4F4HA 4U5QA 5B7PA 3N6VA 4GZ5A 3SBOA 1WG8A 3GMIA 3K16A 2JFWA 1CIVA 3ILXA 4G89A 2WLTA 3MUOA 4KR0A 2P65A 3KEGA 1TYAE 1HDZA 4L9AA 2P8SA 1M1NB 5HBGA 3GFPA 4HATA 4YIHA 1HK7A 3BMCA 1ANKA 2G25A 4J7XA 5L7YA 1B42A 1E2LA 4E3ZA 4H7FA 1LFAA 1BGVA 2XUKA 1C1DA 1XBTA 3OJ0A 4Q34A 2QYTA 2ZE6A 2BHSA 2OKGA 1Z13A 4G36A 5GOTA 3TIFA 1Z16A 1YJXA 1Y5LA 3PQFA 3QUAA 4ZT2A 3WYFA 5F77A 4EG0A 2ZBQA 3DHWC 4EGJA 4QAJA 3FXAA 3GRKA 1FJXA 1EFPA 3V1TC 4NCIA 3I9MA 5IBCA 4B3MB 3CF4G 4XSHA 1SD5A 2DBRA 3LVRE 4IMJB 1RI4A 1GG2A 2ZYSA 4OJQA 1E8DA 3BD9A 1AO3A 1DXHA 1W52X 3PQ3A 3IPRA 2PSJA 3A1EA 3STXA 2HCTA 2QE7D 2QR5A 2P9HA 2R6HA 2BR3A 4IUBS 3FLEA 3IXQA 1TKRA 3TPFA 4C30A 1WSAA 2H51A 5KJCA 3OE7D 3PG5A 5B1SA 1U4OA 4F12A 2W2KA 4X7MA 1HDYA 2PXCA 1KO8A 4J0DA 1Q1EA 4P4GA 4ZQEA 4DWJA 3WGVA 4RANA 3ZJTA 3L41A 2X5OA 4FFBB 4L74A 1ZJ5A 4HTFB 1LI7A 3V8RA 3BPSA 2Q41A 4ZHQB 4G56A 1C0IA 4N40A 1H93A 2YYAA 3WRVA 4ZCLA 4JUCA 2FN4A 5DP1A 1JWAB 2X5NA 4RYLA 3RK0A 3LPAA 5EMLA 1BYUA 2IY8A 3U37A 2A7XA 2GPYA 1XXHB 3DZDA 1U7UA 5CX4A 5M2QA 4IEFB 4YIKA 3N2GB 1BROA 3HHPA 3VDNB 1F7VA 3ZU2A 3EMDA 2IHVA 5JJKA 1Y3CE 4NEHB 3T3DA 1R3DA 4PRLA 2F59A 3MWFA 1PJTA 2FW1A 2WDZA 3KPUA 4MA5A 5E9AA 4M1WA 4C1BA 3VR1A 2H16A 3BGOS 5THXA 3CIOA 1RVDA 2W98A 2ZPUA 3CURA 3G3EA 3OPYI 4B85A 5BQ3A 2YWCA 5DHAA 3UW1A 5JVDB 1KDZA 3TR0A 2XQFA 2R6AA 4ZVRA 3NT5A 3KYDA 2VP6A 3FVWA 2V0NA 3I37X 2B6HA 1NE2A 3H83A 1C3XA 2WJYA 5SY4A 3P2OA 4HDSB 4BMYA 4RFVA 4W1SA 3E58A 1CD5A 2PKQO 3FUCA 3U3KA 5JXJA 1E6LA 1EEXB 3SX0A 1E69A 4EFDA 1Z3IX 4LFCB 2BFEA 2CHEA 5K1ZA 1I2DA 5FA6A 4UUNA 3JD2A 2F3PA 4JWTA 3GC6A 4KK3A 5EHQA 3TVTA 3UMGA 2CNKA 1Z2EA 4MUIA 2G9UA 1UR5A 4G0MA 1PD1A 4MPJA 5LIPA 1VRVA 4EMSA 2IEZA 1AXEA 1IXRC 3TQSA 3WSTA 1V26A 4OD0A 1RVV1 2EJVA 2ZRAA 2DHEA 3LCMA 4MI6A 4RFLA 3H84A 1MDFA 2OV6A 1NPTO 1BTOA 4HYYA 3ZE1B 4DCJA 4YC7A 1A9QA 1N2OA 1QR6A 4OHOA 2FE4A 2HSWA 3CZQA 4AZWA 2DC1A 3RANA 1ML4A 3HBJA 1JXMA 3P94A 1GG9A 1SBCA 1YS7A 2C31A 2HBQA 2WIAA 3GH3A 2R7AA 1KVQA 3K0FA 3QF7A 1OXXK 2OLKA 5JH7A 1RQGA 3ASVA 3HPRA 4G41A 3CEHA 2WJWA 5H4GA 4DJJA 3PCRB 1DNPA 1O7JA 2I6UA 1I30A 5PGMA 1IONA 4DXAA 3DMPA 1TMOA 1RC8A 2GLXA 4U6NA 1ETUA 1J0CA 2X0RA 3EOZA 3L8MA 3LVBA 1QVVA 3QFTA 2X41A 1TA4A 1TQ6A 1Y5NA 2YVAA 4JODA 1JG3A 4DREA 1DDGA 3F98A 2VJMA 2XNDA 3JQPA 3LHDA 4CLDA 4DLSA 3OA0A 4RADA 5EPUA 1WZCA 3GLIB 1FUUA 4ZEVA 4ZYUA 2O8NA 4FTWA 1XLTC 4PLFA 3LK6A 5AI9A 3AB7A 3S28A 2C9OA 3W2EA 1WY7A 2CNDA 3UMYA 3DHEA 3SGLA 1MB4A 1HNWB 3DOHA 2Q28A 2WF6A 3FTDA 3H5LA 4KTVE 4TSKA 4QEKA 4UCQA 4EHAA 1L4UA 5BY2A 3ANSA 2CZQA 1IN7A 1KYIA 1P74A 1QAOA 2DWQA 3PVZA 4OA5A 5BQ5A 4EB6B 4LDZA 4I1IA 5C4IA 4KR2A 2A9JA 1FLVA 2MYUA 3ONVA 6LDHA 2HJ9A 3IAFA 3E0QA 3ZU4A 3LDHA 1OHHA 2YHIA 3OTOB 1Y9ZA 3H11A 4UW9A 4BNKA 2WYUA 3I42A 2V7PA 5U4QA 2RIPA 3T54A 3SE0A 2P5SA 2FI1A 1QO0D 2UUPA 2Q45A 4UXHA 2QKYA 4GOND 3SLKA 3NHRA 4H17A 1U8YA 1SXJD 3OJXA 4UOQA 3WWCA 3PD0A 2D5BA 3FNRA 3K4HA 2X9GA 3C24A 5KCZA 3NATA 5ALQA 4BRWA 2PG3A 2C4WA 3BL8A 3U9TA 3PC4A 2J4FA 1WDWB 2QAGB 3EGCA 3OFJA 4FFVA 3BWDD 1ESZA 1P3Y1 2PJDA 1KSHA 4B7CA 3DUWA 4HDMB 3F46A 1Z4OA 2PL1A 2ETVA 3Q0TA 4ZQHA 4X97A 2G40A 2OESA 3HJHA 2OV4A 5ECWA 4D44A 2HFJA 4IJWA 1LS6A 5F3WB 2PD6A 3T1TA 1XU9A 2C8LA 3A9TA 3W2IA 3A1VA 1WO8A 4WMLA 4DQKA 4B7AA 2FH5B 1DVRA 3X1WA 4CKWA 2JK0A 1W85A 2AEFA 2X4IA 3VC3A 5LQSA 4W9NA 1ISMA 1R18A 3G0DA 2CNNA 5CXQA 1VB5A 4DR4B 1J39A 2ZR0A 3AF0A 4QPZA 4DBZA 1FTGA 1B8VA 3B7GA 2HRDA 2X13A 3SQWA 5LQMA 2BKLA 3TTWA 8ABPA 4ZK2A 4JLSA 4GH5A 3SLRA 4A0GA 4B3FX 2F55A 4BEBA 2QRKA 4C0AC 4NRDA 2X9QA 3WHLA 1FJ2A 2EZTA 4KYUA 1JHUA 1N2CE 1N1EA 2PCLA 4UARA 2FQ1A 2KMLA 2BZ1A 2O2JA 2OXRA 4EYKA 4DGSA 4MVXA 4F3RA 1IDOA 4D6XA 2WPDD 2QB5A 1DMSA 1I4LD 4DLUA 4J8PA 1CQZA 4JXKA 2NAPA 4BNIA 1RWBA 5EJ5A 5GAJA 2FEMA 2JLXA 3E2MA 1LDYA 3KSRA 1WMAA 3NS7A 1DV1A 5DPMA 2VTBB 2QDXA 3GN2A 4Q1VA 1AV6A 1XCGB 3EIEA 2G5PA 3AVPA 1WUHS 4WEOA 1ADGA 2XVXA 3F7NA 1LDMA 1U8AA 1ZOLA 4HUQB 5LJLA 4BU0A 2AFHE 2QX8A 2XUZA 2P4QA 5KX5B 1ZHHA 2VSQA 2P9YA 1I0LA 3TRHA 1U0TA 2OILA 1NIJA 2EBHX 2G0NA 3G1WA 2O8CB 3BQ9A 4FOOA 3F9RA 3KQMA 3LQFA 5CCEA 3JALB 4XGIA 4CLHA 4ER0A 2GPTA 1N3YA 4A26A 5LLSA 4DLPA 4XGQA 3R0JA 3GCXA 3LX6A 4I8IA 1EFVA 3O3OB 2Q0SA 3EG9A 3YASA 2IHTA 1NNUA 5TS3A 1JP7A 5HFJA 1EUDB 4P7KA 5FQOA 1IIBA 2BCJQ 4X62B 1PYGA 3DDOA 4Y2TA 5FBWB 2EP5A 4OQEA 4ON9A 4GLJA 2VP5A 1L5WA 1UWKA 5C31A 2LVBA 3E9YA 5LZ5A 2WY2D 5KSOA 5K2OA 3BS4A 5L3ZA 4P84A 3HL4A 1K7SN 1JAXA 2CNWA 1P2TA 2R1TA 1O57A 2VSFA 4CMJA 5FAKA 5JAIA 4IIGA 4Y6GB 2BFAA 4ALMA 1D9ZA 2C92A 3ED1A 1Y3AA 4AY5A 3KELA 2C2ZA 1RRPA 4PR3A 3M81A 5EIBC 1PFWA 3O75A 3OTGA 5HEKA 1XP5A 1VMEA 2C1XA 1R74A 1X0XA 3EF0A 1H2BA 1MC5A 1R8XA 4KVZA 4H0FA 3ZWVA 4IV0A 5A02A 2BMFA 5B3LA 3IALA 3WMEA 2I7DA 2A33A 1QFSA 3SCZA 1PWZA 1JV2B 1S9HA 4FJ0A 3U4GA 3OFNA 1VQ1A 1SRRA 4BV8A 9LDTA 1NXXA 4O2AB 1S8FA 3E23A 4OXQA 1Z4MA 2B2CA 5E2AA 4IDBA 1EP2B 1FF9A 1K86A 4PZ0A 1JE0A 3F2IA 3TFOA 1YZUA 2QTGA 1BNCA 4GAEA 3GT3A 4QZVA 3HGMA 2XD9A 5KYGA 1MX5A 4DKJA 1VBMA 4BFTA 4B1FA 1FYEA 3HBNA 4OTZA 4B79A 1PFUA 4JBGA 3MCZA 3CWQA 4QOSA 5F52A 2DEUA 2QM7A 2RK6A 2ZRFA 3SY8A 2BEWA 4BZQA 1YC2A 2JD2A 4PZEA 4QFMA 2CXXA 2CBXA 2RK3A 5JAPA 1QFMA 1IPEA 1K9SA 2LUOA 2W00A 4M49A 3IHLA 1BKYA 4U9HS 3T15A 4A91A 2MT9A 4QNRA 2J0EA 3B2QA 3WGIA 4KFRA 1J1UA 4TM8A 1F2TA 4R2HA 4DCSA 3KKLA 3IHKA 1J25A 4PFSA 1V3QE 2FK8A 1MT0A 1XCOA 1Q77A 3ND8A 4N8SA 1L7RA 2QS9A 2SCUB 4WKNA 1A8PA 2QN3A 3ET4A 3L4BC 3CLHA 1RYFA 4IF6A 5D5PA 4FCWA 5JD5A 4N12A 1U9IA 1QZTA 4DM7A 1P9WA 2QUZA 1KO7A 3ESZA 3IDAA 4UHDA 1G2PA 3UPTA 3L7AA 5JMPA 1MV8A 1W30A 4AYXA 4TQAA 2Y1GA 4J1TA 4MVJE 3ZX5A 2W6ZA 2Z1MA 4F71A 3OZWA 1YR3A 1O94C 1KEVA 1OTXA 4B3DA 3V3TA 3VX4A 4C4ZA 1W4ZA 4NYJQ 3MAAC 4J29A 2ZIAA 4P82A 2VSXA 1I2ZA 2GFQA 4OV6B 4DA9A 4KNWA 5A9SA 5CFLA 3BEOA 3VSEA 4B31A 2RFLA 4PXAA 1FXSA 2IOYA 2JLSA 2G77B 4PICA 2ECQA 3F67A 1KAGA 5TY0A 2PZMA 2VH5R 5KAMA 3EZXA 1MJNA 4N7JA 4QHTA 5DGHA 5E3JA 3SR3A 2ZIUB 1UEIA 3IUYA 4RJJA 4RVDA 1FFDA 3TS1A 4AT1A 3L1IA 3QGMA 5ITZA 1NG9A 1G5PA 5HJEA 3RWMB 2MIIA 3UT0A 3ZDZB 1BWSA 5JNSA 3X1JA 3TL6A 4OY3A 4WCFB 3EFEA 2SNIE 2YN2A 4FZ5A 1KEEA 2XEXA 3D02A 4GPAA 2JASA 1THZA 4UM5A 3SS8A 3SZ3A 4ENSA 4JXZA 5AKJA 1SH7A 5AFSA 2XYQA 2JGAA 3B51X 3VQTA 1L5FA 3N2KB 3S7ZA 1ZINA 4JK3A 1NHWA 4R7ZA 5WRFA 1UKCA 2VBIA 3OQ1A 2V45A 4LJ4A 1SKQA 4RGQA 5IVPA 3MLEA 5I4IA 3OQ6A 4ZO8A 3B8HA 3B53X 3E9ZA 3PXXA 4LGCA 2ZK7A 4US0R 1LX7A 4E12A 1EFCA 3K53A 2CXOA 3MYRA 1NXWA 2VDPB 1T1JA 1UMDA 4U4AA 3ELYA 2M9MA 2R6R1 4IF4A 1UT6A 3LWDA 1C3LA 2IUFA 1YQXA 1PKXA 4Q7QA 3QLVC 4D25A 5JBNA 5E0KB 4HGPA 3GLKA 1DTWA 3H19A 3WDSA 2L42A 1UPBA 3HKEA 1ESEA 2BD0A 4QSMA 3V80A 4BZZA 4YP7A 3GJ0A 3PFBA 2ZSKA 3K0HA 3PNMA 1YIOA 5LZ9A 3ZHUA 4UVGA 1OX4B 1TF2A 1Z5PA 1ZCAA 4ENWA 1DZ3A 3IMFA 2ZJ8A 2Y2UA 3H99A 5FOSA 1EB9A 1NX9A 1J2UA 4QBIA 1HMYA 1NT2A 2NU7B 4DJFC 1WNFA 1I6WA 2PVSA 3PTZA 5LQKA 3HVRA 2A3NA 5ESRA 5EJ2A 2IUSA 1KY2A 2E0IA 4KE7A 1KQNA 1REQB 4INAA 4G5OA 4WI1A 1FYFA 4J1SA 1D4ZA 4QOFA 5DZSA 4BNFA 4EHIA 4F9TA 2JLVA 1RXVA 3KTAB 2J5BA 5IH3A 5HF8A 4V0MA 2VCHA 3E53A 4F60A 4OPMA 2YYSA 3AHJA 1J0EA 2VUTA 1L4MA 1CB7A 2FQWA 3R8CA 3S40A 1JHMA 1PNQA 4IWNA 2XVYA 4LYHA 1OE0A 4YJ3A 1DDIA 3O73A 3BCHA 3W79A 5GJCA 1TIKA 3AVYA 5HCIA 3FYCA 3VHXB 3VYRB 2F1RA 4Z0TA 3PLNA 1X3SA 3WO1A 1E77A 1FNMA 3EE6A 1RM5A 1Z36A 3V9AA 2PH3A 1CY6A 4JH0A 1E1LA 3S1AB 3TUJC 3LW8A 1WW3A 1JMKC 3H2SA 4LXXA 1ZOIA 2G7MC 2QOEA 5SZKB 3RWOA 3PUHA 2VYQA 3BD8A 5A05A 5TLSA 3D9QX 3NT4A 1JDPA 4EIWA 3WYGA 1XDZA 3HA2A 3AJ8A 3U3DA 3CH4B 3Q85A 3JYPA 1G42A 1ML3A 3QIVA 4Q82A 2JARA 3A4YA 4MHSA 3VOBA 4RTJA 4TX1A 1PJZA 4L07A 1Z2AA 1CCWA 1WCIA 3GDFA 5EC8A 1TMYA 3B3GA 2DJIA 2VYVA 3RYFB 4LDQA 2KE5A 2RHGB 2OXEA 1PR6A 1JDSA 2Q8QA 4QPJC 5HKLA 3AEKA 3AKZA 3FOFC 5FEMA 2E4UA 2QNBA 3E5NA 4V1CI 2JCGA 1T6NA 2XVZA 3SU8A 3MHPA 1ZRHA 5DGXA 1USUA 4IIXA 3WVNA 3BBPA 3WGKA 1XRRA 1U0HC 3GJ5A 3PRKE 4N3CA 3IUBA 1SUSA 2XNJA 2HCFA 3PZBA 4QX6A 3IILA 1U81A 1LJLA 2EX0A 4G63A 1JKFA 2BFFA 4HJXA 4G8BA 4UNSA 3PXGA 3JPWA 1O95A 5I8PA 5IUNC 2DMRA 4LHXA 4P86A 3L8GA 1VE3A 2AZDA 4B84A 3WRYA 4KNVA 4OUKX 3OLYA 3MNFA 3PENA 2YCLA 1BCSA 4JU8A 4F2DA 1SA0B 3RTDA 4HMQA 4EHHA 4C0JA 1Z9BA 2J0UA 3DO5A 1VP3A 4H1WA 4OLBA 3ANXA 1LNQA 4Q3NA 1XN1A 1PFQA 3GV0A 4MWEA 1SWWA 3U0BA 5JJIA 1GRRA 1G59A 1G8JA 1KY5A 3BCRA 3EDCA 1GQRA 3IT0A 1H2HA 2CL5A 3QW4B 3SC3A 5BPHA 3SQDA 4NZOA 1NF8A 2PSSA 2ONZA 1NW3A 2D5AA 3RT7A 5LU8A 2H17A 1CFZA 1B26A 1Q3TA 4B74A 4CM6A 1N6KA 4B45A 1X86B 5DGTA 1FU4A 1L9XA 2GVDC 2PX2A 2MU1A 5HFNA 2AOWA 4YACA 5KYUA 4DYHA 4GGMX 2W7TA 1NAHA 4EAQA 2EF1A 1U04A 3WYAA 1VL2A 4N6OA 7ADHA 1N0IA 1YVUA 1A8IA 4BRZA 1TK3A 5CB6A 2JCSA 2RJOA 3OTQA 4MYTA 2QTNA 3DZJA 4IHJF 2V6JA 2Q9CA 2QP9X 4UEOA 1XRSB 3BDVA 1H3FA 3L0DA 4M76B 5DM60 1YACA 2HU5A 4GOJA 5FDFA 1UKZA 3GQBB 1JHVA 1W34A 5LUBA 4WZZA 3RFUA 3NANA 5A3QA 1VPTA 2PA0A 4PG8A 4NOJA 1C29B 3A6DA 1O97D 4A6PA 4LX0A 3L2OB 1L1EA 4J7UA 4TVKA 1BX1A 1G3IA 3L6DA 3P9XA 4UZEA 2RDMA 2ZBFA 3BGIA 1PJSA 5K3SA 3TSCA 3UANA 4F1WA 1Q12A 4P36A 1CF2O 4J7CA 1GUYA 5GONF 1RKVA 1T36B 3C85A 3PE4A 4B33A 2GK4A 3NBUA 3U9LA 3IE0A 2EARA 2VNAA 4MW2A 2IW3A 4NH4A 4TLEA 2ILVA 4HD8A 2FMFA 3ICQB 2A9VA 2OV3A 2XD4A 1II0A 4LOKA 3AR9A 5A9RA 3DE5X 3HE3A 2I3DA 3GIDA 4GX2A 3RAGA 5KNDA 3AX6A 2H2AA 1N4AA 1DELA 2A9RA 4FIDA 4MI1A 2Z1DA 1E6WA 3HGTA 4WJLA 3JVDA 4OI4A 4BO4A 2WSSA 1YZLA 3CUKA 3ITKA 3ROEA 1L4LA 1J0DA 3L7OA 1SPBS 1ONOA 2X77A 5G0WA 4L8VA 1Z88A 4AXBA 2HU2A 4WOBA 5AI6A 3V4VB 5MDHA 1O4WA 1H4VB 1A9TA 2CJYA 5EWLB 4DNXA 2GBLC 2RKWA 4ROTA 3TR5A 2X76A 4MJXA 5K3CA 1FDWA 4LY6A 5LMUB 2PNFA 1VE9A 1T3ZA 4J2TA 5JYDA 3FPBA 1BMDA 5G4KA 4CMEC 1GG5A 3HFSA 4HBGA 1Q7RA 3Q9UA 1TCBA 1ZMTA 3A1SA 3AETA 4W8OA 1Y80A 5DNVA 2I2DA 3TVYA 1N6RA 4BWYA 4LKOA 2X2OA 4P5DA 4FFPA 1MJFA 5BV0A 1GTZA 4CDGA 3B1WA 3VHLB 2NU8B 3FRIA 1QOZA 2J6IA 3G49A 2XB9A 2W2QA 1UK9A 1G6OA 3NGLA 3UMVA 1XEXB 2ZWAA 5H81A 3RV4A 3L1VA 4JD5A 1OAOA 3VJRA 2W48A 4DS3A 3QBJA 1G16A 1NMZA 3ZC3A 2GBPA 3NDIA 2GO7A 4M86A 1HRKA 3KSZO 1EFLA 3H2JA 2J41A 3W6OA 1RABA 4N5HX 2AKYA 2ORWA 4B4VA 1XZKA 3BRQA 3FPSA 1JDNA