2DPXA

Crystal structure of human rad gtpase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
165
structure length
146
Chain Sequence
SVYKVLLLGAPGVGKSALARIFGGVEHTYDRSIVVDGEEASLMVYDIWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein RAD
publication title Crystal structure of human Rad GTPase of the RGK-family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 146
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dpxA00
2ZROA 4G01B 3RLFA 1G16A 3PITA 1C1YA 3ZQ6A 1E9CA 1VDZA 2MSCB 2Q0HA 4MYHA 3VMFA 2QE7A 1VMAA 1E9FA 2JJ2D 2E9SA 1Q22A 2YNMA 1GL9B 2GDJA 4PSKA 1E0JA 3GLHE 3P26A 2CJWA 3OFNA 4RCYA 3GEHA 1KZGB 2H16A 1C4OA 3HP1A 3NVAA 5E7IA 1NY6A 1P2UA 1AM4D 4EPXA 5AJZA 3UKDA 3U2QA 2YWGA 1X8KA 2ODWA 2AWNA 4POAA 2BBOA 2VLIA 2VF8A 2KE5A 4TYNA 3K1JA 1FZQA 2ASEA 2WKQA 3I4LA 3QKRB 2PEYA 2F3TA 3AF2A 5KNDA 3MJHA 1GL6A 2NPFA 1ZD8A 3R9IA 4XD7A 1E99A 1OT3A 1AN0A 2J46A 4X8HA 5IDVA 4E03A 3ZYCA 4UNSA 1VYTA 4UNQA 5FBVB 3BGWA 1OE0A 4BASA 3H4MA 1IJFA 1XMIA 2G83A 2HCJB 3IO5A 4IDPA 4UKDA 1TTTA 2GILA 1PLKA 4LYHA 3RS3A 1CBUA 1X86B 2J0QA 1TPZA 4LDJA 4IFBA 4DIEA 2ZAOA 2B7CA 4DDUA 3FTQA 2FF7A 5UKDA 1AZTA 4KSCA 3B1YA 5CB6A 4UJ3A 5L3RA 1CJUC 1KOFA 3TJZA 4ERNA 4PFSA 3DM5A 1SQ5A 1Z0KA 5L3VA 2HDNB 1BO6A 1T9HA 2MSDB 1XTIA 2Z0MA 4QJ5A 4NYJQ 5DSZA 1OKKA 3RSLA 1E2GA 3EG5A 3DMDA 1CIPA 4HUQA 5KDOA 4DB4A 2WBLC 3D31A 1KY2A 4DLTA 3KKNA 3A1WA 1EG7A 3VKWA 1E1QA 3IIMA 3GFPA 4LBVA 3A36A 1NN1A 3EW9A 5JECA 2OBMA 1IN8A 2FDCA 3F3YA 4DC9A 1GKIA 2QAJA 1JB1A 3T1TA 4YMWA 3VR1A 4ACAA 2QI9C 5HR5A 5HE9A 4Q47A 4QRHA 3H1TA 4Z1MD 3GJ8A 4OI1A 2O0KA 1UKZA 4URXR 4KBFA 1DE0A 1SVSA 4JSTA 1SVIA 1CR2A 3FB4A 3SJZA 2AKYA 4BRUA 1SXJE 1W4BA 3DZ8A 2DBYA 1GSIA 2PZEA 3ECCA 4RD6A 5EJEA 3VAAA 3GJXC 3OEHD 2NO6A 4I1OA 4M9ZA 2EW1A 3NH6A 2LKCA 3PEUA 2OCBA 4Q4JA 3SR0A 3TR5A 2JLVA 4TL8A 4JBWA 2V1UA 3KXIA 1OHHD 4L4UA 1M2OB 4A6PA 2RMKA 4MUAA 2JLQA 4IKEA 1OH6A 1P9WA 5AWFC 1M8PA 1G8YA 4DLYA 1I2DA 4JL6A 3QPWA 2IS6A 4DT1B 1KDOA 1W49A 2EU8A 1NNEA 1EX6A 3RVBA 2N1BA 5B64A 2HV8A 2J9RA 1WF3A 3QKSB 4AG5A 1KK0A 1AQYA 2QU8A 2WPDD 3I8SA 4C0LA 3T35A 2CE7A 4I1SA 3SBDA 1ZUHA 3TUZC 2GZHA 3A37A 2QMHA 3UMSA 4LRWA 4FN5A 5KNCA 1XTJA 2W2TA 1FOEB 2FGJA 4NCHA 3ZVRA 5KSOA 2GTPA 4IOJA 1S4QA 3T61A 4JLOA 2CVHA 5AUOB 3C41J 1G8PA 1W36B 2ZRCA 4PZYA 1BYIA 3A8TA 4QBGB 3SE0A 5AR1A 4GI7A 3WNCA 3B6EA 4A1FA 1HT1E 3BB3A 3GCGA 3AVXA 1I4LD 3FMIA 1SXJD 3PG5A 1A82A 2CE2X 1DVRA 1W5SA 4GOXA 4NCNA 4ZPXA 3SYNA 2V4ZA 1CS4C 1LF5A 2VQSA 4P32A 1W0KA 1TAGA 2LCFA 4CT4B 4D80A 1XZPA 1VIYA 3JZAA 1II0A 4RY2A 3TMKA 3V4RA 4F92B 2AWOA 2VIIA 4LHVA 3SU8A 1EFCA 4LV8B 2CEAA 1ZC4A 3GD7A 1D9ZA 4LX0A 1X1SA 3R9WA 1FP6A 2ZE5A 4G1UC 1N6NA 4DLXA 3QQ5A 5BYJA 2ZRGA 4K81B 1WDTA 5BWMA 5JJLA 2NTYC 2P6NA 4Q4HA 4M9QA 4P4SA 3C5HA 5FR1A 3OIYA 1XXHA 4EQ6B 2Z4RA 4ASUA 1KK1A 1QG2A 2EQBA 1K5GA 2BHRA 1R2QA 1VCOA 4XSGA 4C0BA 5J4KA 3LD9A 2IXEA 3CRMA 1CLUA 2NGRA 2CBZA 4D4JA 1T5LA 1DAIA 3DOEA 2ZRDA 3E70C 4FMCF 3UIEA 3Q7PA 4ZDKA 2V3CC 5P21A 4A36A 1VKJA 3SZRA 5C4GB 3ADBA 1OXUA 3IIJA 3DOFA 3FMOB 3GFOA 3UWOA 1O3YA 2GRJA 2ZXUA 3IQWA 5JHHB 1ETUA 3B1WA 1Z2CA 1EFRD 5FOSA 4TLEA 1IONA 1ODFA 5KDDA 4NL4H 2ERYA 2QM8A 1XEWX 1OH7A 3BH0A 1G41A 4LV6A 2ERXA 2ZRLA 3LW7A 1OXVA 2N46A 5A0FA 1UM8A 1EX7A 4IDOA 1E9BA 3TVTA 1Z6AA 4V03A 4B3FX 5DI9A 3RC8A 3ICEA 4IOMA 4B3GA 4Q01A 3THWB 4XWKA 3CONA 3N70A 3B1XA 1GNQA 2PCJA 4ZKDA 2OV2A 3OE7D 4ZKEA 2OBNA 1RE0A 1VECA 3M4YA 2EFEB 4JL8A 4S2EA 1TEVA 4B43A 4BLSA 1FX0B 2FOLA 1JAIA 2XZOA 2V54A 2D7CA 4C0KA 1GFIA 1QHNA 3LV8A 2OILA 1JAHA 4Q18A 2K5UA 2Z6VA 3KFXA 1IXRC 1G6HA 1LB1B 4W7SA 2GCOB 3FGNA 2EYQA 2FSHA 2QY9A 4HZUA 2GF0A 2I1QA 1GIAA 1EGAA 1ZIOA 3A58B 4P4TA 5JJIA 5IHPA 4AIIA 4D0LB 4DKXA 4CZ2A 1E2LA 3RAPR 5C1BA 3CRVA 1U0HC 1NJFA 1UEIA 1II8B 2A5YB 4JLBA 5J4LA 2H5EA 4OBEA 2QSZA 2IYXA 1UFQA 2XB4A 4A0RA 3VU9A 3CX7A 1G5RA 3B2EA 4GMXA 4LOAA 3PUZA 4QGFA 2ZI7A 2REBA 1O87A 1R0XA 5EXTA 4BFTA 2XITA 3IIKA 1YZUA 5EP2A 4PC2A 2G6BA 2AD1A 3THYB 1N5JA 3AF0A 3FPAA 1WQ1R 3A1SA 3PXGA 2G88A 4MGYR 4AG6A 2W6IA 1R0WA 1E2IA 2ZRKA 2VP9A 3AQ4A 3BFKA 3V00A 3UMRA 3QEJA 1HUQA 1D8TA 3FWYA 2FN4A 1NN3A 3WNDA 1E69A 1E79A 1G9XA 1W44A 3FKSD 2I3BA 2IC5A 3R7WA 2R6FA 3PEYA 4YONB 1UF9A 1W4AA 1XD2A 3I3SR 1Z6YA 2BJVA 3WHLA 3AP2A 4KFTA 1ZM7A 5M04A 2WSSA 3ND9A 4JVNA 2ZI6A 5JWOA 4Z8YA 3OESA 2WMOB 3T1VA 1VCMA 4U00A 5JFGA 4XWAA 1COWA 3BE4A 2WJGA 2YOHA 3U4QB 3P4YA 2Q3MA 2C03A 4DCVA 2Q3FA 1ZC3A 2QZ4A 4JLMA 5GJCA 1HE8B 1B23P 3B1ZA 2ZETA 3AKDA 1HV8A 3SYLA 3NEYA 1W36D 1QRAA 1XMSA 4PPNA 4QXAA 3R8CA 4TZ6A 4AWXA 1P6XA 3M6AA 1KK2A 5JRJA 2C96A 3OF5A 4B6FA 4PSAA 1UKEA 4D6PA 1UKYA 4MUBA 4OK5A 4PC7A 2FV8A 2H17A 1FUUA 2FSIA 3TSWA 3S1AB 1UEJA 4MRVA 5JBQA 2BKUA 3NDBB 3GEIA 1RFLA 3K0FA 4FW9A 1ZP6A 4JKYA 1G3UA 3TR0A 4DXAA 1P2VA 4PHFA 1R0ZA 2OBLA 4MKHA 2A7QA 5IRCD 1KI8A 3LX8A 4TWZA 1JPNA 3RC3A 1NMZA 4MA4A 2C8VA 1BMFA 4B44A 5DISB 4DJTA 1Z8FA 1ZUNB 2ZAMA 3MLEA 1W2HA 4ZCMA 1W4CA 5EP1A 3TAHA 3QXCA 4D26A 2WJVA 1KIMA 2JLSA 4EFNA 3EX7C 3RSOA 5DE3A 4JMPA 4EFLA 3EXAA 4LJ5A 4OQNA 2F1HA 3SBEA 2IS1A 1Q20A 3C14C 4BLTA 5DGXA 2CNWD 1XMJA 2XZLA 5JEEA 4EDHA 2REXB 4DLRA 1TADA 1ZD9A 4A0FA 4QGHA 1LF0A 3K09A 4W9MC 2VSXA 4V0MA 4TMTA 1JR3D 1XCMA 1KY3A 2O0HA 4QM6A 2VHCA 2J59A 4I1VA 2GNOA 4M9SA 3VR6A 5LBIA 4IOKA 1CJVC 2FA9A 1LTQA 4FCTA 3RHFA 1DO2A 2VA8A 4D4LA 2WWWA 1W0JD 2BOVA 5DI3A 3AP3A 2H18A 4TTQA 1N6HA 2BBWA 4J0QA 5JEDA 2NOAA 1CULC 1Q1QA 2JJ2A 3KJEA 1SZPA 1Z0IA 1DAEA 5B2ZA 4AKEA 2JIZD 3HDTA 5HCNA 2XAUA 4K8OA 5TV2A 3DL0A 1KSGA 4ZIRB 3FDIA 2BKEA 1ZJ6A 4LHZA 4HAUA 2VP6A 2BMDA 2VTKA 3EIEA 1P9NA 2AL7A 3CWZA 1DO0A 1FQKA 4CEIA 4TTPA 4H9GA 2P3SA 2G3YA 3CB4A 2O8EB 4HSEA 4E5UA 4WA7A 1NP6A 1CTQA 4JIMA 1T4GA 4DCNA 2P0EA 3U5ZB 1DAHA 4K46A 4GDFA 4PAOA 1LW7A 4KXFB 2I1VB 2TMKA 5D3QA 3SHWA 1BS1A 2NO1A 1DOAA 3I92A 4AURA 1KSHA 2G77B 1YRAA 2FG5A 1UDWA 2JJ1D 1NIPA 2QT1A 2YOGA 5LD2C 2KBEA 2OM2A 4HLQB 4P33A 4A2PA 2IYRA 4PPFA 2R6DA 2F9MA 3C8UA 2GEVA 1A2KC 2J45A 1GKYA 4WBSA 4TTRA 2GXQA 5CLLA 2IBMA 1DAMA 1VCNA 4W5JA 1GOTA 1FNMA 1I4TD 1R6BX 2OSBA 1XNJA 3WRYC 2QBYA 2IT1A 5FUVA 5HZKA 2DFNA 3GLHA 2F1RA 3KQNA 1H65A 3N2IA 4YC7A 2HCBA 2ZI5A 2OXCA 3IEVA 1G6OA 4TQUS 2O8CB 1ZVQA 2ZRIA 1AIPA 4NYMR 1D5CA 4EPVA 5EE3A 4TSFD 2XJ9A 5EZ6B 4QGGA 2IXFA 5EE5B 1EFUA 1GUAA 2ZUDA 2QPOA 4Z1MA 4QJ4A 1E0KA 3T5DA 4KVGA 1HURA 4I81A 4CW7A 4O0MA 4TLCA 1SXJC 2JAQA 1PLLA 3KTAA 3SI7A 3JVVA 1WB9A 4M2LA 2FNAA 5F9HA 4EJSB 3KB2A 1BKDR 4PHGA 3PUYA 4NBSA 2CHVA 1LS6A 2NZJA 2J3EA 1Z3IX 3SFVA 3BBPA 1RPZA 1R8SA 3AKCA 4WZBE 3K70B 1ZMXA 1IOZA 2W0MA 1A1VA 1Q3TA 1T5IA 4TMVA 4ARZB 2HYDA 2W6JD 2F1JA 3GJ4A 3RYTC 4MRSA 4PHTA 3QE0A 4AYXA 2WWHA 3ZZUA 1TEXA 4F93B 4DCSA 3EPJA 5F3WB 1E2EA 1SGWA 2WPDA 5FBWB 5JSZA 2RGNA 3LQQA 4M1OA 4GZMA 4MYUA 2FMXA 4QG7A 1KI1A 1TX4B 1NJGA 1KI6A 2FU5C 2QGNA 1XB2A 1UAAA 2CHQA 3BFVA 1AJEA 1IN7A 1QHIA 3BJIC 4O2LA 5HE8A 2JATA 2CCJA 1XEXA 2FX3A 3CPJB 3VR4A 1IAQA 4KI0A 1HE1C 1G7TA 5CJPA 4IRUB 3TW4A 1TMKA 2IYWA 4Y0AA 3Q3JB 5KTYA 3PQCA 1G1MA 4W5WA 2RGCA 4RFSA 2QPAA 3B8HA 4LSGA 2H57A 2NO7A 1DTSA 4C3ZA 3B13B 3CNNA 5FI1B 3K0CC 3ZS8A 2WWIA 4WIAA 4JKIA 3EZ9A 5BN3A 1QHXA 2RGBA 4WXRA 2IL1A 3AVVA 2FZLA 2ZVQX 4BZPA 2O8BA 2GETA 3SHFA 5FPKA 3EC2A 1J8MF 4QNMA 3X1ZA 3ADCA 1NLYA 1IY1A 4MKIA 2ZJ8A 4TN1A 1F2TA 2J7KA 2VRWA 1RRCA 1X1RA 2XZPA 2X8AA 4OK3A 4PC1A 1VG8A 3W3AA 1GRQA 1KDTA 2FEMA 2ZANA 3LLUA 3V4FA 3WRXC 2WSMA 1QG4A 4KYIB 4V0OA 2XB2A 5GVRA 3FVQA 2VEDA 5ELXA 2ZJBA 1ZCBA 4A82A 1A2BA 4B3DA 1Z6GA 1G20E 4B2PA 3L0SA 4TMZA 221PA 3GPLA 4JJKA 2GA8A 2KB0A 3RNLA 5J5CA 2AHOA 3TGPA 4F4CA 1HTWA 5EZ5A 3RS0A 1NBME 2PL3A 3IBGA 4N3NA 3KDSE 1W5TA 4DEYA 4RD4A 721PA 2IYUA 2AFIE 4HAWA 3AVQA 2LKDA 3BOSA 2ZYVX 1L8QA 4NZYA 3GP8A 1W47A 1K6MA 2XNDD 3C4JA 1MO3A 4HAYA 1YR7A 2WMNB 1A4RA 4M8NE 4PSVA 3DDCA 2IEZA 2G9NA 1JEEA 1E9RA 3CBQA 1NN5A 4LJ4A 4A92A 1JECA 3K0SA 1N6OA 2Q6TA 2QENA 5FL7D 1KAOA 4TYPA 2RHMA 3CPHA 3IPXA 4KYUA 1NIJA 1P2TA 1SVLA 2YZ2A 3T5GA 4R7ZA 1QBKC 2GK7A 4BQSA 2D4HA 4N0DA 3EZ7A 1E9EA 1CR1A 2IK8A 4Q66C 3TK1A 3MWJA 5J40A 5CK4A 4HZIA 3OE7A 2B7BA 1SHKA 1KO8A 1EWRA 4KV9A 4LC0A 1QHYA 3LRPA 4TT3D 3AGPA 1BOFA 2P67A 1D6JA 2RB4A 4NE2A 3NWJA 1G8FA 4TQ9A 5FOXA 4HYYA 5JS7A 3CIOA 3ZLJA 4URYR 1M6NA 1SULA 1N0UA 1UBFA 3WBJA 2GXAA 2PBRA 3CZQA 3WYGA 1VG9B 2YOFA 4JYCA 2F7SA 3KXLA 3W6PA 4Q7JB 3P27A 4B74A 3SC3A 1Z28A 1NBMD 1EESA 2HLDD 4F91B 4C2TA 1XU4A 1W36C 3KKPA 4C30A 3SQWA 3LQRA 3OEED 4URZR 1GG2A 4CF7A 1XTSA 1PV4A 4ESHA 1OYWA 5TDHA 5LB2A 1UPTA 4HDQB 5HZHA 1ZM9A 4DDTA 3K9GA 4PQFA 5ANRB 1KO1A 3AUYA 4BFWA 4DWJA 1GRNA 4HLUC 2RGGA 1T8TA 4KFSA 1U8YA 1XDBA 4X8LA 1UJ2A 4O25A 3ASYA 3WP1B 3MD0A 4DSOA 2R6CA 3K70D 2BEJA 2XSZD 1F48A 3U3MA 1NLZA 5EXSA 3U3KA 1DBSA 5EE9A 1T3LA 2PLRA 2VHJA 5SZHB 3B78A 3K53A 1ZAKA 5FTJA 2WKRA 4DT1A 3VX3A 1CF4A 5LPNA 3KX2A 5F2EA 3QKSA 4FCWA 4B73A 3FE2A 3KFVA 3VR3A 3BH6A 2XNSA 2QAGC 2MMGA 1JXMA 1OYYA 1GZSA 1SVWA 1JQLB 4JSYA 5FOTA 4XVUA 1Z63A 4Z51A 2BC9A 2A2ZA 2GKSA 2JCSA 3GJ0A 2JLYA 1P2SA 1H8HD 2OCYC 2QUZA 3JZMA 4RCZA 4HEJA 1S9DA 1MT0A 3I72A 4BECA 1FQJA 1QF9A 4XVQA 3G0HA 5G3YA 2A5JA 5K8UA 2CL6X 3IILA 4M22A 2ZI3A 4NCJA 1M7HA 2YHSA 4IEIA 3AF4A 1TQDA 4JT2A 3TKLA 4A15A 1B0UA 1W4RA 4LHYA 1VIAA 1L7VC 4LI0A 5FTKA 1GVNB 1NMXA 3BFXA 1F2UA 4V0LA 1ELOA 4B71A 1YKSA 5KPDA 4LPSA 4NYIR 1KAGA 2BIFA 2XTNA 3C7KA 4LJYA 3SQXA 3IBYA 5EP3A 5D3MA 1IHUA 5FTLA 2NZ8A 1X6VA 4DVGA 1U2RA 5E7JA 4JLJA 3DHWC 4ZCLA 5AJXA 3RWMB 2IW3A 4B33A 4A2QA 1JR6A 5TARA 2XJ4A 2CCKA 3IDQA 3AM1A 4PO9A 3RS5A 1N6PA 2ZRBA 1E2PA 3GJ5A 1S1MA 1VYVA 1R7RA 3RRYA 1I4DD 1UBGA 2DCUA 2P2LA 4A6XA 2OZEA 1FPMA 1P73A 3QKUA 1UKVY 2ZQ5A 3DMNA 3UK6A 4ABYA 2ZJZA 2ZS9A 4Q4JB 1XRJA 4DSTA 3IKJA 3CPEA 5JWRA 4YMSA 1MRNA 1N25A 1XWIA 5C18A 2W2XA 3KQKA 2JDID 3ZIAD 2R8RA 3BH7A 5G41A 1M7BA 2Q9BA 1R8QA 1G291 2GVZC 5G53C 2AD5A 1ANKA 1YR9A 4M1SA 3ADKA 3RRMA 3KQLA 4YXWA 4A8JC 1N6KA 3K0EA 1G3RA 5J4HA 2AKAB 5FTNA 1AZSC 3QF4A 4NP6A 2QAGB 4NMMA 3U7EB 1TU4A 2ODNA 2P65A 3LAWA 5BN4A 5DN6D 2BBTA 2V7QD 4JL5A 4Q1FA 5TVKA 1W0JA 5GJWC 1QHHA 4L16A 4UXJA 2QL6A 4QHTA 3Q85A 1Q44A 4BRWA 5JS8A 1G8HA 3WMEA 3CR7A 4I99A 2UZIR 5EE1A 3I62A 2ZSEA 3D6TB 3EWSA 4L8GA 1OFUX 1JXOA 1QZXA 3I8XA 4LBYA 5L3SA 2BCJQ 4KLZA 1VG0B 5CDFE 4D25A 1FX0A 1XP8A 2VSOA 4N1AA 4F7WA 2VHTA 1DEKA 3LX5A 2ZSFA 2QTFA 2RGEA 2DY1A 3CX8A 3FHTA 1TQ6A 3LW8A 5FBRB 2FFQA 2X1VA 1Q3HA 3UWKA 3U44A 3AVUA 5FH9A 4QC2A 4C0SA 3Q8XB 3WMFA 4WZAE 2CK3A 1OXTA 4LWZA 3EPHA 2HXYA 2OE2A 1RJ9B 2BWJA 2ZSBA 1II8A 4PPGA 2JLRA 1FW6A 1DPFA 2MMCA 4G3XA 5FPYA 2PZGA 2G1KA 2QE7D 3LH5A 4P4SB 3RANA 2ZM5A 1JEDA 4BUJA 3K9HA 1FMLA 2ZJYA 2ZJ5A 4D0GA 3B82A 4JT4A 1TL7C 2OFXA 2J0VA 3AVWA 1PUJA 1UBEA 4MH0R 3IO3A 1XF9A 1F3OA 4QHSA 1IXSB 1E2QA 2R62A 3LBIA 1EK0A 4CEJB 4US0R 5FPTA 4LBZA 1FNNA 5KPJA 4Q9LA 1NY5A 4W5HA 2IUSA 4B75A 4A8JB 1T6NA 1IM2A 3EZFA 3QXHA 4IVQA 4KVAA 1W1WA 4XD7D 3T06B 3TLXA 2XGJA 2XTZA 4LYAA 2AN9A 2R65A 1CR4A 3EC1A 2GESA 2EFHB 4HDCA 3VFDA 2BJWA 2V1XA 5JHGB 5CM8B 2P6UA 2QG6A 5LDDC 3U7FB 2IUTA 1GDDA 1KMHB 2QGZA 4Q7MB 3U4QA 1BIFA 3ETLA 4BLPA 1G5TA 2J5XA 3O8DA 2IYSA 2V6IA 3TSOA 3U3RA 3U61B 1XEFA 4Q1CA 1E2NA 2VL7A 5L8VA 3KUDA 3OHMA 1RKBA 1X8JA 1RIFA 1G3MA 1RYFA 3NG1A 4QBFA 4PAMA 1MR3F 3GJ3A 1HQCA 3SJAA 3CF2A 2WTUA 1OKKD 2F3RA 1II9A 2XEXA 4UJ5A 2GXUA 3UANA 4LJ7A 4NHOA 3FMPB 3X1DA 1DAFA 1LY1A 2YC2C 1ZRHA 1GTVA 1E4VA 2ANBA 4JLNA 4HZUB 1TUEA 4TL9A 1YZGA 2IF0A 1NKTA 4IVRA 2R2AA 1OFTA 4EPTA 1G21E 2QP3A 2IYVA 1N2CE 4OHZA 4Q9KA 1GITA 2ATVA 1CU1A 1K8RA 1W2GA 2C95A 3QJYA 4HLCA 2V55B 2O8DB 5HTKA 1OIXA 2XX3A 4Y0VA 4LJ9A 3CX6A 3EASA 1BH2A 1Z83A 1IY2A 2BCGY 3ICQB 2JLWA 4QFMA 2EFGA 1KTVA 1JR3E 3FOZA 4B32A 4NCKA 4GNKA 3W8NA 2BDTA 3R9XA 4M53A 3EIQA 1EFTA 1TF7A 1NVVQ 4Q4AA 1FTSA 3QF7A 4AC9A 3CM0A 4WVFA 3DEFA 4DDWA 1GILA 3PUVA 1ZUIA 4GL2A 5EP4A 3A4NA 3CF0A 2ZEJA 1MABA 3D3QA 3R8FA 1DG3A 1Z07A 3TUIC 3HPQA 4DRZA 2XOKD 2OT3B 5CK5A 421PA 4UXIA 1OH8A 2J0UB 3ZVNA 1K5DA 2HF9A 2PEZA 5JJKA 4AKHA 1MH1A 1Q0UA 5FOVA 1Z47A 4OQLA 4BEBA 1SVKA 4JVLA 1E6CA 2ZRFA 3RRZA 3OIUA 3KQHA 2IS2A 1U9IC 3EA5A 3U3JA 4TL7A 1VCIA 4GT1A 3PUWA 3VQTA 1X3SA 2IS4A 2GVDC 2X2EA 2ZJAA 2ZU0C 4HLDA 1P9RA 1G5PA 3FFAA 4PO1A 4CEHB 1L4YA 1XPRA 4LC1A 3VKHA 3I73A 1MOZA 1Q12A 2FSFA 1YZNA 2IA5A 1E9AA 5AJVB 2YV5A 1PZNA 2HXSA 2NMVA 5DO9A 1YRBA 3NC1C 1Z5ZA 1ZBDA 4TLAA 3VR2A 2D3WA 4LYFA 3M1IA 3GLGA 3EPLA 4ZIRA 4LY6A 3QUSA 4XWOA 4NU0A 4UNNA 1W0KD 4URWR 4PANA 2GJ8A 1DADA 2ZS7A 4X8OA 4BFVA 2CLDX 2FWRA 5JCPA 2IXGA 4US2R 4BPBA 2LWIA 3BXZA 3EZ2A 1OPXA 2P6RA 4GPTA 1IN6A 3LY5A 1LV7A 4DUGD 4I4LA 4IHQA 5GVSA 2WJJA 1TQ4A 2GZDA 2XNDA 2GJSA 1U99A 5CM9C 1NF3A 2F9LA 2WWFA 4N0EA 3ND8A 2X77A 1V5WA 4DLVA 4CRWB 4OHWA 4EJSC 2W83A 1CXZA 5G40A 3KJIA 2W00A 3L2OB 2QN6A 4B48A 3LBHA 3VNVA 3K70C 2D7DA 2WJHA 2C99A 3KKOA 4KSBA 4GOKA 3SYKA 3THOA 3SFZA 4DSUA 4ESVA 1E3MA 5BN5A 3TUJC 1Q1EA 1Q57A 1KSFX 2QSYA 3TNFA 1ZNXA 3CRRA 4QGAA 4LJ6A 3I5YA 4DSNA 4LHXA 3BAFA 2H8KA 3KL4A 3WYAA 2NQ2C 3L0IB 3LVQE 1G3QA 2ODEA 4C2UA 1PVOA 3GLIA 4TQAA 2NO0A 2WAYA 3EAQA 2J87A 2O5VA 2A78A 2JLXA 2OG2A 3B5JA 3G82C 1S8FA 4L9SA 1KDPA 1RVDA 4CYMA 2C9OA 4II7A 4PZLA 1NVUQ 4C7OA 4C0QC 3EWAA 3PJRA 1KI4A 1ZINA 2EFDB 3O47A 5B58C 3LLMA 1E0AA 1NBMA 2ZI4A 2HLDA 2CLCX 4EPYA 1N5LA 1OIVA 1ONBA 1Z29A 2ZTSA 4FD2A 4TLDA 3RDPA 4EFMA 4KITB 1HY3A 3OEEA 5BQ5A 2D62A 3SOPA 4TMXA 4U02A 3QVUA 5IK2D 2OCAA 3KXKA 1OXXK 4BFZA 5JCZA 4HAVA 1YZTA 1FFHA 3PV0A 3L0OA 3AH8A 5KNBA 2O8FA 1H8ED 5FOUA 1KJYA 3GJ6A 5EUQB 4AYTA 4ZI3A 4V0KA 1US8A 1X8LA 3IQXA 5TB5A 4CEIB 1AS2A 1N0VC 3GMTA 2OO7A 3NDPA 4JLKA 1OSNA 1XD8A 4JVMA 2ZE6A 3HYRA 4OJQA 5BYKA 1WBBA 2XXAA 2Q21A 3F5FA 3ZZ0A 3P20A 5J4YA 1YZLA 3W9YA 3ASZA 5KYKA 2YC4C 5E95A 4ARZA 2HT1A 2QEQA 4FWIB 1UADA 1ZCAA 5L3QA 3W6NA 1AKEA 3QIAA 3OIWA 1MV5A 4PPQA 4TYWA 1R5OA 1HEIA 3CH4B 5IT5A 2GJKA 1Z0AA 3LXXA 1FTNA 1CJKC 4LZZA 4C0AC 3DZDA 2C9CA 2FSGA 3OEHA 4A4DA 1KK3A 2NPIA 3THXA 2D2EA 1PLJA 3K9LA 3NTUA 4FXPA 1E4YA 2ZRAA 5EUMA 1OHHA 5DHFA 3KKMA 1MRSA 1IBRA 4RD3A 3W6OA 4LJAA 4NYJR 1T91A 1E2KA 4M1KA 1XMVA 4EPWA 3D8BA 3T1QA 1HA3A 2OAQ1 4UNRA 3OZXA 4MITA 2W6ID 2A5DA 3BRWD 3RWOA 4QBHA 1OB2A 3BB1A 4QL3A 4HUTA 4HB3A 1XEWY 4PQYA 3AUXA 2BEKA 5BXQC 2QBYB 4AKGA 2IYQA 1EXMA 5H70A 1YQTA 4XIGS 2CDNA 3KUCA 3NH9A 5AUPB 2WVJA 1S2MA 5DYGA 3TSZA 2WSSD 3ZS9A 1T8UA 2HJGA 1DAKA 2Z43A 3CUEF 4F4JA 2QP9X 2HEIA 2UKDA 821PA 3SEAA 4QKQA 2AX4A 4PO8A 3GLFB 2BMEA 1YE8A 1COWD 1NI3A 1A7JA 4B47A 3M0EA 1J99A 1R5NA 4KFRA 1KDRA 1NVXQ 4CVNA 4ILEA 5K8IA 3ONWA 3CRQA 3CWQA 3FHCB 1JALA 2GCPA 4TLBA 1E2JA 4ZO4A 4B3CA 1E2DA 2QQEA 1E9DA 1DG1G 5FOWA 1SXJA 1RZ3A 2EVWX 3OIVA 2E87A 2QMUA 4A0HA 5DH9A 2ZYWX 1KMQA 2GBLC 2IF2A 3V9PA 2DWPA 1PUIA 3FHOA 4ITRC 3FYHA 2Q3HA 3DPUA 5FUWA 1KNQA 1MO6A 2HYIC 2DR3A 3ZIAA 2F6RA 3PR1A 1DELA 3WBKA 3AVYA 1AS0A 4G0NA 3NHAA 5G3ZA 3BC1A 1ZNYA 2FPKA 2DFLA 3F8TA 1OV4A 4E07A 2CL0X 4IOLA 3TRFA 2EYUA 4MDEA 2DPXA 2OUKA 1P72A 3QXXA 1KKLA 3NXSA 5B57C 2IWRA 3VTKA 1KI6B 3UG6A 1NMYA 1NRJB 1BMFD 1OFHA 5DN6A 2V7QA 4LBWA 1A5TA 1JJVA 4S35A 5CJ2A 4L9WA 3PENA 2C77A 2IHYA 4FIDA 1QDEA 2ORWA 1YZKA 5E3HA 1ZM4A 5DIFA 4DLUA 3ADDA 3KJHA 4H1UA 3U6KA 3GFTA 2J7PD 1T0JB 3AVPA 4Q7KA 4URVR 3AVTA 2FEOA 1LS1A 4G5RA 5FL3A 8OHMA 1EFRA 1NKSA 3QKRA 1FUKA 5E7MA 4PR0A 4RZUA 4ZV4A 1VTKA 2IEYA 2DFKB 1U0JA 4WZ6A 1OXSC 3T12A 3VKGA 4PTLA 1MO5A 1FMJA 3K0CA 4P4UA 5H1YA 4GFDA 4KAXA 3ZD7A 2O8BB 1CKEA 2IHBA 1SKYB 2ORVA 4IFEA 1TUIA 4NKRA 4U5XA 2WAXA 4Q1AA 5KDLA 3Q5DA 4XSHA 5FI0B 3W34A 5C46F 2F43B 1VHTA 3K0AB 1V43A 4YQFA 2KWIA 5F9FA 2ZRPA 3QVVA 2OCPA 1G17A 2ZIAA 5KOYA 3RS2A 3VNUA 4DCTA 1ZNWA 2VBCA 4FMDB 4HB4A 3AGQA 3QY0A 4FWTA 5KO2A 1ZU4A 1U0LA 3B9PA 3O8BA 2H92A 5GJVC 3I32A 1T3SA 3FMFA 4HB0A 5JLJA 3BK7A 3EARA 5AJYA 2H1LA 1IY0A 1G7SA 3RABA 2CL7X 4C9BA 2P5TB 1YR6A 4PAQA 1KSJA 4JZKA 3QSYA 2R44A 3AVOA 3NC0C 1S0UA 1S1CA 4IDNA 4ZDJA 1AS3A 3H0KA 3F0TA 3U60B 1JJ7A 3GLFE 1AGPA 4DB2A 1P62B 2GXSA 1WBDA 2A5GA 4Q21A 1W46A 2ONJA 3WNBA 4OHXA 3DKPA 2YJTD 4GBMA 5DYIA 1YVDA 2B21A 4EUNA 4NYMQ 2PH1A 5CDFA 4Q7LA 3L43A 4FMDF 4BEJA 5IF9A 3EA0A 2SHKA 3CZPA 3Q72A 2CJWB 3A1VA 3ZJYA 4NDZA 4NPHA 2KJQA 1P75A 5FBQB 1S96A 2GHIA 2E1RA 2ZR7A 4YMUA 3AF1A 4RD1A 1Z2AA 4XH9B 4MRRA 1W48A 4NH0A 4TYQA 1N5KA 2A5FA 4KCGA 2Z83A 3NHBA 2BMJA 1ZYUA 2ZYTX 3B60A 3FKSA 3MFYA 4OK6A 4P31A 5FFMA 5KHOC 4M1WA 2GJAA 1L4UA 4D0NA 4Q1DA 4OI0A 5CLQA 1GWNA 1F60A 2QROA 5FPHA 5HKKD 3W90A 1UDXA 2ORIA 3CRW1 3W5JA 5EXPA 1EFHA 5AK0A 4NCIA 1GNRA 521PA 1Q21A 1UBCA 2RHDA 4XTCS 3HU1A 2W2VA 4M1YA 4WXPA 1JQJC 3TAUA 2DFTA 3QOFA 5KSPA 2R6GA 1AKYA 2C9YA 2QRZA 2VYFA 3L8YA 3PEVA 4Q48A 3IHLA 1DAGA 2JGNA 1KHTA 4MYTA 4D4MA 3IUYA 3J81k 4HUQB 2C5LA 3MMPA 1YHNA 3HU3A 2ZI9A 6Q21A 4YMTA 4JLPA 4LV5B 4MDFA 1EWQA 1GKUB 5C4MA 2VO1A 4HAZA 4LGMA 3D7MA 3DVLA 4MRNA 5CB8A 1N3BA 2W58A 4HLUA 3X2SA 4CDGA 1U98A 5CIQA 2B92A 2WOJA 2VPPA 4BFSA 1QHGA 1SKYE 1Z22A 3OAAD 1P4SA 2X2FA 4A2WA 1TU3A 2AFHE 3LDAA 3MSXA 4Q00A 5BW8A 2XOKA 2GCNA 3CLVA 4JLDA 3QBVA 4FI3C 3LNCA 5H68A 1G4AE 4C0JA 1CR0A 2ATXA 1DS6A 2WIAA 3A1TA 1G64A 1XBTA 1ZW6A 2QAGA 4BZQA 1F6BA 4EQ6A 4TZ0A 5KUTA 3O8RA 1E94E 4HB2A 3REGA 1JBKA 1VPLA 3CF6R 3Q9LA 2ZE8A 3W5IA 2AK3A 4B35A 4R2HA 3VHXA 2CNWA 2F55A 3MWKA 2PZFA 1NVVR 1F2UB 3WY9A 1G8GA 1N0WA 5AUQA 1E0SA 2XTMA 4JLAA 4M1TA 3RRNA 4BLOA 4KFUA 3SJBA 1LNZA 3ZH9B 1OJLA 5B30A 3VHLB 2L0XA 2ZE7A 1NG1A 4V02A 1E96A 1JR3A 4KODA 4NONA 4EPRA 5D3MB 1WA5A 5F98A 4MRPA 1Q1ZA 1FL9A 2QA5A 3HU2A 4WW0A 4M9XA 1GL7A 3NBZC 4PX9A 4FMCB 1R10A 2BBSA 3UATA 2A30A 4RZXA 3UXMA 2ZREA 2R9VA 1YU9A 4DUGA 4Q02A 4RZ2A 1N6IA 1TF2A 3IHWA 4I1UA 3ZVMA 2YVUA 3TBKA 4RD2A 1NN0A 2VP0A 4D2IA 3THWA 2PMDA 3HPRA 3PIRA 4BE7B 3TQFA 3MWYW 1RJ9A 5K8LA 5FTMA 1Q1BA 4JBYA 2C98A 4JS0A 4R71A 3A1UA 4O2RA 2JIZA 3BS4A 1OH5A 2PMKA 4B3BA 3I61A 5CYPA 2OLKA 4E09A 3IGFA 3MUFA 2NIPA 3C15C 2CVFA 1E1RD 1N6LA 1HT2E 1LVGA 1VG1A 2VHQA 1GP2A 4UNPA 1CEEA 1QVRA 1WMSA 4RFVA 2GCOA 4KHZA 2ZUBA 4Z8XA 1WP9A 1QVAA 1Z08A 4CEJA 5CYOA 5A4JA 2ZUCA 2OHFA 3SJCA 2OXRA 2J41A 1SHZA 3LXRA 2FPLA 2WICA 2CXXA 3QF4B 4DLSA 4A8JA 2QRNA 4Q4HB 3HYTA 5GADl 5EXXA 3KZ1E 1XXHB 2MSEB 4C4PA 3WXMA 1TF5A 2JJ1A 1NG9A 2IUUA 3TW8B 3CO5A 4F38A 2GJ9A 4BGDA 3TH5A 5SZKB 2OFOA 4IXNA 3OFND 2G0NA 1QHHB 4OQXA 2AK2A 3O8CA 1SKQA 3AKEA 1KI3A 2IYYA 5FUYA 2HUPA 1P60A 4AY2A 1R5BA 1Y3AA 4G5SA 3THYA 2ZRHA 2QORA 1KMHA 3R20A 4MKFA 1D2MA 1JNYA 4Q5IA 4LK2A 2BVNA 5IK2A 4D81A 3N2EA 3LO5A 1KO7A 1CP2A 1KYIA 5JRZA 5L3SB 3QEOA 2C2HA 3W8RA 3FKQA 4OI2A 1J90A 1OFIA 1KKMA 2WV9A 1KI7A 3EZ6A 3K9NA 4M4SA 1FP7A 3T1OA 5DHAA 2WWYA 1H8EA 4YDSA 3DO6A 4EIWA 2PJZA 1Z0DA 4PXAA 4GP7A 1D2EA 4BFUA 1Z6XA 2VP4A 1U94A 3SDZA 3U44B 2QMEA 3P4XA 4TSFA 4DIDA 1RYHA 2PT7A 3H86A 1ESMA 2KSQA 2AXPA 4HDOB 4ZDWA 4B6EA 4QBIA 1NL3A 4KU4A 3WYFA 3ZDQA 2WHXA 3UMFA 4DLWA 4XOIA 2A9KA 2UZ3A 1OW3B 4NTZA 2O8DA 4QM7A 3BWDD 5GJBA 1C9KA 3EIHA 4PHHA 4IDHA 3AF3A 4Q9IA 1NVWQ 2VP5A 4DHEA 4UQOA 4AI6A 3REFA 1XJCA 4GOJA 1KO4A 2FGKA 1Z0FA 2GK6A 1E1QD 2ZRMA 1HH4A 3MJRA 4UXHA 1HYQA 1ZU5A 3AV0B 3GEEA 4EAQA 1T0HB 5KSZA 3DM9B 2GZAA 2KI5A 1ZNZA 1E2MA 3P32A 4NYIQ 3S1AA 3LVRE 2W6JA 3QENA 2IYTA 2GEDA 3CNLA 1S3SA 2D06A 1Z06A 3NBFA 4Q9HA 1XFAA 2QP4A 2ZSAA 4LCBA 3PFIA 2QMOA 3VU9B 2ZITA 5EE0A 2WOOA 2IX3A 1VHLA 2J0UA 4G5GA 1E2FA 2ZJ2A 5JMTA 2ZRJA 4RJLA 2AR7A 1XTRA 3VR5A 1XD9A 4XTRA 3LWNA 3MG9A 2O0JA 1Z0JA 5AUNB 1Z6TA 4MKGA 3A4MA 2VSFA 3TE6A 4G5QA 2JEOA 2JLUA 4OKSA 3QPVA 2G1JA 1Y63A 1IN5A 4CEHA 3SNHA 3BIFA 3SS8A 5CITA 5FR2A 3R7WB 5SZIA 3K09C 3CKLA 1XD2B 1W7AA 4OHYA 2HJVA 2RGXA 4D82A 4OHVA 2ONKA 1N6RA 2D74A 2WWXA 4BFYA 2EWWA 4LUCA 1XXHE 2CLSA 5DNYB 4O3MA 2C78A 4RKEA 1NLFA 2DWQA 2GWHA 3L0PA 3ZD6A 4YLGA 2RGAA 2NO9A 3HWSA 5KU1A 2V8OA 4JLVA 1J8YF 2ZYUX 2RGDA 2P5SA 4L15A 5CIWA 2R6AA 4BLRA 2H7VA 4M1MA 4LYJA 1RRPA 5JI3E 1RW4A 5TXGA 1YJ5A 1CRQA 1PJRA 1AGRA 3KJGA 4MGIR 2QM7A 1G18A 4DBLC 5HCIA 3ZQJA 2YWHA 4RSGA 5FUXA 4LPKA 2W0SA 1ZD1A 4Q4AB 1XCPA 3Q7QA 1KI2A 3JVUA 3B85A 3ZZTA 3W3ZB 4A9AA 2JJ8A 4RZ3A 2IYLD 2F1IA 1ZM3A 1J2JA 1E32A 1XZQA 5E4FA 3AKYA 4YDHB 4GSYA 1MABB 5K8TA 2J7PA 3K0FB 3A4LA 2O8EA 2IYZA 4URUR 1KZ7B 2GAOA 1NSTA 2KBFA 3NBXX 4IVPA 1NSFA 4IW3B 5H8WA 3NKVA 1BYUA 3RS4A 4AYWA 4YXWD 1SVMA 1SVOA 4IJMA 1E98A 3B1VA 5FL7A 2PT5A 4OL0A 121PA 4ASUD 2JA1A 2FZ4A 2Q9AA 4R2IA 4XVRA 1G4UR 4KLNA 4B2IA 2BMFA 1U9IA 4Z54A 1RRFA 2ZR0A 3AP1A 4KBGA 4BZXA 3E1SA 1RC8A 5EQTA 4HI0E 1J70A 3X1WA 5J47A 3U7GA 3MRSA 4IEEA 3PCRB 2QTHA 2REOA 1MKYA 4CIDA 2V6JA 3X1XA 4TT3A 4B76A 3IEUA 4WOPA 4YMVA 3GLGB 2UVQA 1E9SA 2YKGA 1GAJA 2ZPTX 2GF9A 4QNRA 2CMKA 2O52A 2BV3A 1M1YE 1GNPA 4MGKR 2DHRA 3BERA 1CRPA 4G5OA 1IQPA 3HJNA 1U90A 5KSYA 3MGCA 4JVSB 2O8CA 1YZQA 4TYYA 4WAUA 1KI9A 5DI3B 5J4VA 2QT0A 3P1JA 1G19A 3FFBA 2HT6A 4BWYA 4HAXA 4RKFA 3QXSA 2WWGA 3KB1A 2B8WA 4Q19A 5C2JB 4TL6A 2CK3D 4LHWA 1XTQA 1OF1A 3QPUA 2Q9CA 1CJTC 3B7GA 1TQ2A 4XJXA 2PLFA 1M74A 4ACBA 2QNRA 3DKVA 3HR8A 4FCVA 3TVDA 1RRGA 3WMGA 4D4KA 3MWLA 4EJSA 3T34A 4US1R 3K8YA 5AJWA 2GEUA 4MQBA 4EKDA 2ZJOA 2FFBA 3MCAA 3PUXA 5FBLB 1GRRA 2FJUA 3H2YA 1GM5A 4F4IA 1S9HA 2RKOA 1LFDB 2XSZA 4C0HA 2PX0A 4TMWA 4PC3A 1IXZA 4DEXA 1JPJA 3LBNA 3BB4A 4GP6A 3U3OA 2Y8EA 3KQUA 1P5ZB 1CJMA 3L8ZA 3NEJA 4TMKA 1U8AA 2GAAA 3GLIB 2QPTA 2RGNC 3UPUA 1G7CA 4DDVA 2ANCA 5HKKA 3T15A 4C7OB 4QOSA 4CT5A 4Q4LA 4GZLA 1I2MA 4PQRA 4V0NA 4DCUA 2JASA 3QG5A 4JBXA 3LA6A 1XJQA 2EWVA 3QG1A 3QNUA 4JJZA 3U7HB 2FFAA 4AKIA 1H8HA 5JI2E 2J0SA 4Q9JA 2WKPA 2BM1A 2YINC 1KGDA 1HQYE 3CR8A 2BM0A 2NG1A 4Q1EA 4Q1BA 2FE4A 3GQBA 4BFXA 3GLFA 3NBYC 4M21A 1G3IA 2ODBA 3SN6A 1OIWA 3H84A 1KJWA 4BLQA 4ZI2A 4DLZA 3U6BA 2C04A 3GJ7A 2V9PA 2HF8A 1E79D 3CW2A 1E2HA 3VX4A 2O8FB 3GLHB 4HATA 1U81A 3AB3A 2J1LA 2IWHA 2CCGA 1US8B 3C5CA 2FFHA 2DWOA 2QQ0A 3E2IA 1QHSA 4MYCA 1R0YA 2PJRA 4R9UC 4P0TA 1OB5A 2ECKA 2XXAB 4X8MA 3PEWA 4IXMA 4Q03A 3IPYA 5HPYB 4MGZR 2VF7A 2Z5FA 3AEZA 3WHKA 3OAAA 2PCLA 1IJEA 1S3GA 4OQMA 1KO5A 4AD8A 2Z4SA 4OQFA 4B3XA 4AK9A 5L3QB 2WZQA 2ZR9A 4FMBB 3MAAC 5A5GA 1ZM2A 2YWFA 3KTAB 4B2LA 2YYZA 2OFWA 3WP0A 4CGZA 3EPKA 3G5UA 4KO8A 3GLGE 4GRAA 3THXB 1M7GA 3C16C 2OLJA 5JZVA 1AA9A 2RH5A 4DZZA 1P61B 2RCNA 2VP2A 2B8TA 4V0ME 5LD2B 2DB3A 2WJIA 5DLQC 1OLOA 2VH5R 1P3JA 2A3RA 4JYBA 5FPSA 2G0TA 4QJ3A 1YR8A 3A6PC 3TIFA 1XPOA 3PVSA 1P7CA 2JDIA 5JWHA 1IN4A 1MO4A 2EFCB 4R98A 4OYHA 2QTVB 5TMPA 2FH5B 1D2NA 1WCV1 1AK2A 3ZGXA 1XTKA 2N42A 2FPMA 4IDQA 1DARA 1AQUA 2YWEA 1J7KA 2RAPA 1M34E 2D2FA 2ZVPX 5JSZB 1XCGB 1ZIPA 5LB4A 4GMDA 1U8ZA 3I5XA 3X1YA 5SZJA 1JI0A 1R4AA 2WJYA 1G7RA 3N5CA 3QI2A 1KNXA 3KKQA 1XPUA 3NIBA 2DYKA 3I1FA 3Q5EA 4A0GA 1WE2A 1TNDA 4RD0A 3ZVLA 2ZU6A 4H1VA 1ESNA 3TQCA 2VHUA 1N5IA 4OI4A 2AXNA 3RS7A 1XEXB 1F5NA 2B6HA 3BORA 4PZZA 2OAP1 1WXQA 3B9QA 4ZDIA 2F43A 4OJKA 4RVCA 2WM9B 3LFUA 3K0AA 1T3HA 2OEPA 4E22A 2OESA 2JLZA 4B34A 1SXJB 4RFSB 4ZCIA 1KJZA 3BD9A 1WRBA 4PC6A 1D9XA 1XX6A 2I4IA 3GLIE 2PX3A 2CHGA 4KJZA 4ON9A 4LJ8A 4P3YA 2ZRNA 2ZSDA 3QBTA 3E5HA 4M0LA 5TY0A 1E1RA 1L2TA 4L5BA 3QKTA 2X19A 4FINA 4U7DA 2WIBA 2GBLA 3L82B 3UG7A 3CNOA 3QXJA 3HR7A 3CH5A 621PA 2ZS8A 1VYUA 1F2TB 1XJ0A 4QHYA
chains in the Genus database with same CATH superfamily
3LUGA 4RNCA 5J1SB 1D4ZA 4ZU6X 1POWA 3V4VB 4TVKA 1G16A 3GV0A 4R1OA 3ESZA 1UQUA 4ZD6A 4CV1A 3WVNA 4CTOA 2Q0HA 2QE7A 4WL0A 1E9FA 2JJ2D 2C0CA 3IPRA 4BFCA 3BZBA 1WXFA 4JVOA 1Q22A 1WXXA 5DLDA 1VMKA 1U7TA 2AUNA 2YQ5A 3QE2A 2L82A 3A3NA 3G17A 3GLHE 3NM6B 1YL6A 2Y1WA 3OFNA 3P26A 2B3TA 1KZGB 3PL5A 4I6EA 3HP1A 4OMCA 3UT6A 3NVAA 3HCDA 2MSLA 4RVDA 3DOOA 4YRZA 3L8GA 2CXNA 3M1LA 4FYHA 1P2UA 2C4WA 2PNFA 2I3GA 3IB6A 5SICE 1T8PA 3HRHA 3O4RA 1Y42X 4MQ5A 4NABA 3UKDA 4D42A 4YX9A 1CD5A 1R4NB 3N6VA 4BV9A 5MFZA 4MPJA 2B8JA 1QGZA 1QH1A 1Q0SA 1NYQA 4TYNA 1DT3A 1FZQA 2AR9A 3Q3HA 2ASEA 3E8XA 3ZV3A 1HLFA 4F9EA 5HF5A 5CIYA 2XYQA 1MW8X 3IVCA 2WWVD 4QU9A 2VATA 2Q5HA 1KXJA 3A11A 4IMRA 4DWVA 1ZD8A 1T4MA 1DXQA 1KYXA 1AN0A 1E61A 5IDVA 2OCGA 1IPHA 3BPSA 1T6BY 1WV1A 4ZYWA 1KOJA 2PZJA 4UNQA 4AO8A 1FYWA 1RYNA 5FBVB 2GH1A 3TOZA 4BASA 2G83A 4MYDA 1PLKA 2OAEA 4I19A 1CBUA 2W48A 5IJXA 4CMKA 3O2QB 4YJ2B 3IVRA 3KYIB 4UVGA 2XGGA 1AQNA 3COVA 1AZTA 2DSTA 2JFPA 4DLBA 3R3UA 1E18A 3M6LA 3MBKA 2C4VA 5K20A 2BZGA 1O4VA 1Z0KA 2RK6A 1V71A 3MA0A 4QJ5A 1MGPA 4U2CA 4X63A 5DSZA 5GONF 2DM6A 1OKKA 3RSLA 4DNPA 1EM8B 3DMDA 1I51A 2Z1MA 3D31A 4DLTA 3A1WA 4YEDA 2ZDQA 3WL7A 1N34B 3JAKB 3QTLA 1IEXA 5C1OA 2WG0A 1IN8A 1MB0A 5I7UA 5BV0A 4UBLA 3F3YA 1QUEA 1X94A 4KXUA 1GKIA 4DABA 1HM5A 4N0PA 1JB1A 1NTOA 3ZDYB 3KEMA 4ENSA 3GJRA 2VK8A 3KUXA 4PCAA 4YJ2F 5BNWA 4INOA 5HE9A 5HR5A 2WAOA 4WNIA 4JQYA 1HNWB 4QRHA 1E1CB 4RVNA 1ZCZA 4GWKA 3MMXA 1EZ1A 1EUQA 1WWKA 4TKUA 1JMVA 4WEOA 4KBFA 1DE0A 1NT4A 4K9KA 2ZATA 4XPIB 3SJZA 2O54A 1OAOC 1W4BA 1XVLA 1USGA 2VJDA 3DZ8A 4RD6A 4LXYA 4E13A 1L5VA 3IP8A 4QUGA 5GGYA 4JXZA 3GJXC 5SYMA 2NO6A 3N53A 1YMQA 4HLNA 4C0WA 3EA4A 4KP7A 3KSUA 3CUKA 5DFAA 4ID9A 3WR5A 2VG8A 2V1UA 4HVCA 1MX5A 2J3IA 4IGKA 3HJHA 2ERCA 2WTXA 4GOOD 4O6VA 4OAQA 4IKEA 1OH6A 3PF9A 1P9WA 1R8JA 1ZXBA 4DLYA 4JL6A 4R69A 3O4IA 2X9LA 3FCOA 2IS6A 3QLEA 5T6MA 3QLJA 4RIGA 5JAPA 2OGWA 5KVVA 2P4SA 4HEA6 4QDJA 1QIJA 1J21A 1KK0A 1RMQA 4KZKA 3CUVA 4ADSG 1EQ2A 3LFTA 1AXRA 1OD6A 2H0AA 1AT1A 1HKUA 3O4JA 4MA5A 1LW6E 4C0LA 2UZ0A 3Q7EA 5DX0A 1Z5PA 3PVZA 3Q6IA 1NQVA 5DCYA 2NV6A 4I1SA 2K2WA 2GR9A 3DV0B 4EY3A 3O31A 4R01A 1DO8A 1YC5A 4N6NA 1L5SA 1WQ3A 5K3BA 3L1VA 4L27A 4LRWA 3USZA 2R4UA 2RHHA 2VWHA 4C3UA 4KN5A 2B1JA 3V8NA 4IOJA 1S4QA 1TDJA 8GPBA 3IVMA 1HYHA 2H6EA 2A4MA 4RAOA 4GKVA 1XVTA 3B6EA 3PBKA 3R3ZA 3WGYA 4B3RB 4YFVA 3WYNA 1V1RA 4XFKA 3VR1A 1DVRA 2A5LA 3OCZA 3WK6A 4EITA 1VB5A 4P32A 1HFWA 1YVUA 2GWRA 1SWVA 5A0VA 4IJKA 3ZYZA 3NT4A 1VIYA 3TMKA 4GYYA 3CO0S 2GPYA 3TLMA 3GQVA 2QDKA 5A3QA 5DNCA 3Q7TA 1JJFA 3V4RA 2XZTA 1NW7A 3PR3A 1UFKA 2VIIA 3U4AA 1YF3A 1U02A 2HGSA 3IOBA 1MU0A 4RLSA 4YVFA 1W8DA 4RMJA 5JXIA 2ZZMA 4P3XA 2GO1A 1V7CA 3OOYA 4WCVA 4F97A 4XGNA 1N2GA 3VNRA 2NYVA 4LISA 2ZE5A 3PDUA 1PIWA 4IIYA 4DIFA 2LVBA 2GBCA 3WTCA 5JSHA 4ZQCB 3KZCA 4DILA 3CYFA 1F0KA 5I9IA 4BB6A 2VWGA 1BVHA 3FVWA 1AMOA 3IRUA 4JUDX 5EIAA 3U62A 4EJ2A 1YB6A 1XXHA 2HWXA 4EQ6B 5LIPA 1KK1A 1BFKA 4HDNA 3WLPA 1LLUA 3L06A 1NM5C 1RYEA 1YDEA 1Y34E 4XSGA 3EJ6A 1JIKA 5CR9A 2PUCA 5J4KA 3LD9A 5JQGA 5CD1A 3BXPA 1CLUA 4M8IA 2CBZA 4D4JA 1NNUA 1Q0ZA 3JD4A 5ICCA 1XZ8A 5FWXB 4Y30A 3UIEA 5EMKA 2DKNA 4ZDKA 4WNYA 1DWQA 1ZK4A 4I5FA 2OENG 1BRTA 4OB8A 4G6ZA 5ESWA 2CBGA 1OXUA 3C8DA 3JWHA 1OLSB 1PZGA 3SGLA 5B7QA 4N40A 1N92A 1A77A 3NHLA 2QI9F 4RPCA 5DW3A 2GRJA 4KX3A 1JVSA 3UAGA 1Z2CA 1EFRD 5I8WA 1NU8A 3LLSA 4TLEA 5JG7A 4Z2AA 3W8FA 3I9KA 3L6OO 4HSGA 3TB4A 4PGFA 2QN3A 1VLMA 4NL4H 1CRLA 2ESRA 2IQ5A 1FA9A 2E3JA 2QM8A 3F4LA 5BN4B 1BDJA 1V8DA 1C14A 1XZJA 2NAFA 3BH0A 3DHYA 2ZRLA 3OCWA 1OXVA 4GPZA 4GC5A 4JQSA 4MR9B 1JHVA 4LMRA 3WISA 4HQ6A 4KQCA 3RREA 4B3FX 3KUUA 3LOPA 1RCTE 1VL0A 4IOMA 4NNPA 2H9AA 4KHPB 1C3OB 2M98A 3ZDXB 1QMGA 1YMUA 2X0IA 6REQB 4RF3A 2BFCA 4JYPA 2XODA 1S3FA 3Q15C 3Q2OA 2W70A 4BMDA 2X6RA 4D6XA 4D97A 1QDUA 1KMIY 4EZIA 1JXAA 1K68A 3IESA 1CUWA 1GR0A 3ZGZA 1TKCA 1RE0A 2OBNA 3LG2A 4JDUA 4YRFA 3R23A 4JL8A 4S2EA 4F9GA 3W1VA 1TEVA 2HKIA 2E6UX 2FOLA 3VJRA 4C0KA 2BAGA 4IO1A 4YJFA 2FPRA 2JD0A 1JAHA 1P7WA 4EY6A 1RWVA 3GJSA 3RUHA 1SOMA 3DCNA 2RHWA 4BRSA 1IXRC 5CNIA 4HF7A 2EYQA 2YHIA 2QY9A 4HZUA 5LQDA 3A3KA 4KL8S 4EF5A 2FKAA 3DD1A 1ZUWA 4WDRA 4HQNA 3A58B 4QAQA 4MWDA 4YJHB 1O9HA 4R2MA 3C6BA 3LC7O 4CZ2A 3OJEA 3RAPR 3AYZB 1GGFA 1U0HC 4ZT6A 1ZX1A 2NW6A 1EHIA 1YS1X 3NHJA 4JLBA 3FYCA 5F1KA 4OBEA 3RGGA 4YWHA 3CLHA 3ND7A 2F4NA 4GMXA 4JP3A 5CRIA 4PN7A 1A9YA 3HJUA 3SICE 5ARCA 2QLJA 4ALMA 4ETMA 4BX0A 1FFGA 4TUYA 4EKYA 4N9QA 3IIKA 3DNMA 4UFPA 2H7XA 3Q3EA 4XYBA 1R6UA 2FUCA 4MINA 2HHLA 1ECPA 5CAEB 2C2WA 2ZYHA 5EKSA 4ALLA 1JIUA 3THYB 1GG5A 2CLOB 1N5JA 3IV7A 3WLMA 4FYXA 1FXWF 3HL0A 4AG6A 2W6IA 3BRWA 3I52A 1JKXA 6AT1A 5LA6F 3CUYA 1JGTA 1U9YA 3IOCA 4AJLA 3EUAA 2WYWA 4UEWA 5B3JA 1D8TA 2ZT6A 2FN4A 1NN3A 5IAJA 2Q6OA 3R7WA 3DP7A 1O58A 5CT9A 1KERA 3I4FA 3W1EA 2XMGA 4TXNA 1UF9A 1P2BA 1U5AA 2DBRA 2G40A 1Z6YA 2XWSA 3RJ9A 4YCCA 3C48A 4JCCA 4YAEA 3QMWA 3L77A 3DDZX 3ITDA 2FCRA 2H1SA 1PQWA 2ZI6A 3N7TA 2WHQA 4I4NA 3DFFA 1RADA 4Z8YA 2WMOB 1YULA 3PDWA 1VCMA 3VUEA 4DR5B 5F1YA 3UJDA 4NOLA 3OICA 3QW4B 1ZWLA 1H5UA 2I2XB 1COWA 4ODIA 3BE4A 2WJGA 4PIMA 4XWAA 4UU0A 1YZHA 4KH1A 4ARCA 2N47A 1C8BA 2O6HA 3KYCB 4UBJA 1JQ3A 5C8ZA 4RA6B 5KOIA 4JLMA 1B23P 4ES6A 5EJ5A 1UR5A 1HV8A 4FHFA 5GOTA 1XZEA 4COOA 5BR8B 1UPXA 2GASA 4EJ0A 3G68A 3PRJA 2V6FA 1Y3BE 1XMSA 3PC8C 4PPNA 4QXAA 3D0OA 3L07A 4J3FA 3OA0A 3FJYA 3IX7A 5JAZA 1A5ZA 3BD8A 3BKWA 3D1VA 4D6PA 4UU7A 2FV8A 3K8ZA 2ZBQA 5CFNA 3MQ2A 4TSRA 1EDEA 2RHJA 4ZVVA 4PYIA 2WHYA 3TSWA 3S1LA 3O5AA 2P1DA 4I2VA 3RVDA 2IYOA 5JBQA 5D6NA 4J29A 2HQOA 4WVLA 5BORA 5K45A 1X74A 1YK0A 4Q4DA 1MVLA 1RFLA 1TK9A 1OX4A 4W9RA 5AOAA 4IDCA 3KQSA 1I7LA 4DXAA 3FVTA 1Q2XA 4CWAA 3JD3A 1RXVA 2XZDA 2J08A 2OBLA 2AZXA 4MO2A 2EW8A 3AU9A 4MXDA 5IRCD 2QM0A 2DXIA 4FMPA 2JHPA 1CUSA 4GQIA 3RC3A 4ZYUA 3V6LA 1ZGCA 3ORHA 4E2XA 4DJTA 3O4FA 4RHXA 4O63O 1FTGA 3MLEA 3KO8A 5AXDA 3G2NA 3EIOA 5IAOA 3F78A 1QBGA 2PAFA 1CUDA 3QXCA 1GPAA 2EQ5A 5PGMA 2P3QA 1L3CA 2FOIA 2JLSA 2Y71A 2ZIEA 3ABRB 3KVVA 4HGZA 3SF0A 2IX9A 1C0IA 2G25A 3EXAA 2IS1A 2QGFA 4F04A 3Q3GE 3GARA 1PZXA 4HDMA 3UH1A 3A9RA 1JV2B 1XMJA 4DMFA 2RGYA 3I04A 1UBNA 2J8ZA 3K1TA 1I3KA 4YB8A 3CT6A 5JS6A 3T7KA 3K4PA 3L18A 3T5MA 4Q82A 4A0FA 4EA7A 3DDSA 4MCHA 1OZHA 4LE0A 2XYHA 4QGHA 4UOEA 2FRXA 3ZD9A 1XCMA 2O0HA 4GYKA 4QM6A 2HGZA 4E5YA 4M0EA 4AP9A 4OL9A 3WADA 1B2LA 2C59A 5CPFA 5LBIA 1QGUA 4IOKA 1ODSA 4FCTA 4D6YA 1ZK1A 1XEAA 1XKTA 4OA8A 3RHFA 4D4LA 2BOVA 1FDUA 2AZTA 3MPUA 1ODJA 1ST3A 5GAJA 4TTQA 5MHTA 3HA3A 1XVVA 3BXOA 4CMEC 1NRWA 2XEDA 4M0DA 4J0QA 4HH3C 5K3AA 5JEDA 1EPUA 1CULC 2E85A 2JJ2A 1O6BA 3Q9NA 2H5LA 3R24A 5KAPA 3SBXA 4H35A 4HNGA 5AKKA 9GPBA 4P7BA 1HDZA 1DAEA 3BRCA 4BP8A 4EDFA 2JIDA 2JIZD 5HCNA 1IQ0A 2XAUA 4OOEA 3U56A 3A9TA 1C4WA 4DLPA 3VNBA 5MDHA 3PX3A 1QONA 4HAUA 3HK2A 1NJ8A 4LF4B 2VTKA 2AZ4A 2OXEA 1P9NA 3EIEA 3QKIA 1U1DA 1E5XA 4CEIA 2CVPA 3EVDA 1T4CB 1SC6A 3HSYA 2HSWA 2BMVA 5JMOA 3UMBA 1RACA 1ZZGA 5HF9A 1ZNQO 3TLAA 3KJFA 1B43A 3L7KA 1SA0B 4LRQA 4WBXC 1OUMA 3V3TA 3A0UA 3VO9A 4CMIA 1A72A 1RHRA 2DY0A 4R84A 4UCFA 3HA5A 3JZFA 1Q95A 4QEKA 3WICA 3W77A 3CSUA 2IW1A 5FLYA 4K46A 3P9CA 3QVLA 4L8LA 5AKGA 5C1PA 2HCFA 1XQ1A 2WJAA 3C1OA 3SXJA 1D6SA 3VJKA 3ZWBA 4LQLA 4B83A 2UU9B 1BS1A 2NO1A 4OHPA 3ZW9A 1Z45A 3BIXA 4AURA 5DHRA 4RU1A 2QT1A 1RWMA 2OM2A 2ZIXA 3F96A 3DT8A 3GG9A 4P33A 2J6IA 3VVBA 1K8YB 2R6DA 2W9XA 5F35A 1NVDA 2QX9A 2HTEA 1QGYA 2J45A 1U2EA 2IDZA 3DYVA 4FNOA 1LBIA 2MOKA 1RRVA 3L04A 2ZBFA 3RBZA 4BP1A 2NXEA 4CIXA 2I6UA 2CHUA 2I4MA 4RV9A 5CLLA 2XQFA 3TM4A 3HN2A 1DAMA 4CM9A 3ZJ4A 1IUOA 2O2SA 5AM1A 3SE7A 4EO9A 3PTAA 4W1PA 1FNMA 4FQ8A 2XTAA 1OAKA 3QU7A 3ZLBA 5JRDS 4ZTZB 3WRYC 4PLFA 3HQ4O 2R8PA 2O3QA 2EEZA 1DQZA 5HZKA 1GAXA 2J09A 5L7WA 2DFNA 1T5SA 3HGTA 4FR0A 2HCBA 2ZI5A 4P82A 3IEVA 2HU2A 3QPBA 1YBAA 1TFRA 4TXMA 2YL2A 1ZVQA 2SNIE 4ZQIA 3UUWA 3GRFA 1QVWA 1SM4A 1WKVA 1D5CA 2E5LB 4MULA 4EAAA 1MJNA 3K96A 2AFIB 3L7OA 2Q5LA 4EPVA 2F90A 3C0KA 1QHEA 5J59A 2YZMA 1CRWG 3C87A 4QGGA 1MB2A 5EJ4A 1DLJA 3NHKA 5TPZA 1ZMBA 4FGLA 4QJ4A 4RV4A 3C6XA 4L4RA 3UWMA 5F7XA 4PRKA 5ABPA 1YOVA 4IHKA 1XG5A 2CJXA 1MC8A 1EXVA 1WNTA 1WB9A 2HY7A 1JN0A 5BSKA 2FW8A 2HK9A 3CXRA 3V1NA 4NBSA 2W2KA 4AJKA 1KQ3A 4BIIA 2J3EA 1X7YA 4E5VA 3GBVA 1RPZA 4ZQFA 1FUYB 1XV5A 3N2KA 3WK4A 1G63A 3N58A 4X3CA 1V26A 2POQX 1IOZA 3G2KA 4KN9S 4KSYA 3ECSA 1ZR2A 1T5IA 1LFAA 2OP1A 3Q98A 4TMVA 4YO7A 5FAKA 2XECA 1AZWA 1XFDA 3FPJA 4OB7A 2F1JA 3GJ4A 3RYTC 1H2WA 2AV6A 1CZLA 4MRSA 2WWHA 4X54A 4AYXA 3WWYA 1TEXA 1Y3IA 3B1KA 1JP7A 2NU6B 3EPJA 5F3WB 2FWJA 3F7TA 3S68A 1ZXLA 1EK6A 2HK8A 3FR8A 3OLZA 2HUNA 4KRYA 1RABA 4ZXFA 2I3DA 1TX4B 1SB8A 3BWCA 5KQMA 4WLUA 4Y9DA 1EFDN 1MHTA 2Q2QA 2JIBA 4DOMA 2QGNA 4H6PA 1GPKA 3EZLA 3OWOA 1AJEA 4HWGA 2IBSA 4AIRA 2PX5A 5BSRA 4XX0A 1MCZA 2JEYA 2WUVA 4JELA 4QX6A 1XCLA 4YBZA 4YRPA 5J23A 2GYYA 1ZD5A 1FFEA 2CCJA 5JAOA 1CIJA 4D4IA 3NIGB 2HL6A 2ZT7A 5JJCA 3RKSA 5IDXA 3VR4A 5E8RA 4C5CA 3TZQA 1VPTA 2G4VA 1PT8A 1HE1C 2Q8QA 2W6NA 3E3NA 4D9GA 5EQDA 3TW4A 1M0SA 3IYLW 2IYWA 3KU1A 3UOGA 3R0ZA 1X7WA 3D6VA 3DMTC 4X91A 2RGCA 4V38A 2JPDA 3RJMA 1QAOA 3PLNA 4F5YA 2VLBA 3B13B 1RBYA 3OF3A 3K0CC 3C3PA 3VGJA 3ZS8A 1NTRA 2JGDA 2H5JA 2VDPB 4JKIA 4L5IA 4H08A 3E7DA 4Y2TA 2FWIA 1O8CA 4NBNA 2O07A 2WIFA 2YRWA 2J4CA 3C7CB 4Q24A 1G59A 3MT7A 1AD2A 4MKIA 2C2ZA 2P0YA 1WHSA 2J7KA 1TW3A 4X92A 5LQUA 3L3BA 4PC1A 1GQSA 2C82A 3W3AA 1GRQA 4Q3BA 3EOAI 3FI9A 3VPAA 5DNAA 2FEMA 2ZANA 1TECE 3V4FA 1LBEA 3AUSA 4DNXA 3K73O 3WRXC 1FXSA 3KDPA 5AVTA 3NJ4A 4HQOA 1IEVA 3AR5A 3GHHA 2XB2A 5GVRA 3CBGA 4JHLA 3O8NA 2GMWA 3ZGOA 5ELXA 4OUDA 2ZJBA 1P9LA 1ZCBA 2PRZA 5U9CA 3OZSA 4ZZ0A 2FR0A 4B2PA 3L0SA 1ISJA 3MTJA 4TMZA 221PA 3ESXA 4D4GA 2CY0A 2OCIA 2GA8A 3BXFA 3H5WA 4JJKA 4MEAA 5E0KB 2L69A 1V4BA 4CM1A 2I87A 5DM1A 1F17A 5J5CA 5T6BA 5THKA 2QW8A 1O0BA 1HTWA 3UWDA 1TJYA 2PL3A 1NYLA 1BXGA 2GK4A 5H81A 721PA 2NP7A 3E22A 1J0BA 2AFIE 2GRUA 3H19A 3PNBA 3QPDA 4KWTA 5ALMA 1JZSA 1L8QA 1K0FA 3LY7A 1G98A 4AQYB 1PKEA 3NPMA 4JT9A 1SEVA 1LSSA 1SY7A 2JGIA 4KR0A 1A4RA 1XCBA 4M8NE 3DMTA 1NBAA 1OYVA 4F2PA 3QEBZ 1JLSA 1SOWA 2QRQA 2Z58A 5EJGA 3A6ZA 3CBQA 3HB5X 4LJ4A 1JECA 3R2JA 1N6OA 2Q6TA 2XUIA 1KAOA 2EKLA 3F2IA 2R8YA 2RD2A 2IOHA 1UBSB 3S55A 3SNKA 3VKUA 2PVSA 4F8JA 2EHDA 1NIJA 1P2TA 1RR6A 2YZ2A 3O7WA 4YMIA 2J32A 4ARIA 4BQSA 1R66A 2EGUA 1SZCA 1IY8A 1ZITA 1YOBA 1MRZA 3EZ7A 1UZAA 4UE2A 1CR1A 2IK8A 4Q66C 3G59A 4JJEA 3QJGA 3ZEIA 3ICCA 5ESRA 3E15A 4HHEA 5F9MA 5J40A 3ZNNA 5LN1A 4HZIA 5T4HA 2OG1A 4HWSA 3ZWOA 4IJVA 5EWLB 3TO5A 3PC2A 5CVUA 1MAVA 1OXKB 2J6HA 3AGPA 1P6QA 1ZHHA 4O8CA 4BJ1A 1D6JA 1HT3A 1I3CA 4G97A 4I4TA 4Z4GA 3NBAA 1G8FA 1N2IA 3BAZA 3GGJA 2H11A 3QYJA 3DE0X 3ZLJA 4DCCA 2VXYA 3VU0A 2A58A 4OQEA 4TKVB 5CBPB 5HKBA 1SULA 3GA5A 3WBJA 3KVRA 2PBRA 4ZOBA 1Q0QA 3MJSA 4XPZA 3CZQA 4S24A 1BFDA 2QAIA 2YFHA 4JYCA 1JKJA 4RK5A 4JI6B 3P27A 4P5DA 4HYEA 2OQ2A 4RQTA 3FTFA 5K7SA 1EESA 4D99A 2HLDD 5JTUA 4UHDA 1XCOA 4C2TA 2UYCA 1L8XA 2ZB7A 3PGVA 2OHIA 1AOXA 1I24A 3T9CA 1ADFA 5C7OO 1LXCA 3B3AA 4FB4A 4D8UA 1GG2A 2IZ5A 3BMQA 4I50B 5A1JA 3A06A 3DA8A 2AF4C 2JCGA 2OZLA 1OYWA 2M2IA 4RGYA 5KKCA 4HDQB 1SHUX 4PQFA 4ZJZA 1GNTA 3QM1A 5A7GA 2IIPA 2PUJA 5CFQA 1GRNA 1T6YA 3MVEA 5KNBD 3BWVA 3OI7A 4KFSA 5TQVA 3ZU2A 2AQKA 3OFVA 3RC1A 1YUNA 4X8LA 1FDWA 1KY5A 2J33A 2OV6A 4JXXA 3WP1B 3GFVA 4GHWA 1XVIA 1F48A 2R0QC 4FFRA 1KQFA 3WLFA 2OY0A 5EXSA 3VHQA 1O8BA 2VDUE 4CKWB 2PLRA 1DXHA 5SZHB 5TQ0A 3ZHOA 4AQDA 1KYYA 4O4JA 1ISIA 1GUBA 3K53A 4GPIB 4DT1A 2WKRA 3N8HA 4MW9A 3H6GA 4BO7A 1L4GA 1QO7A 3HYLA 3KX2A 4QTUB 2BKAA 1BCRA 4IINA 3FE2A 3OQBA 2COKA 3WAKA 1YMVA 4I50F 2YX1A 2MMGA 1JXMA 2FEAA 3AJRA 2NU9B 1Q7RA 3X2FA 5TLSA 3BFJA 2QXYA 4FR5A 3FLBA 4JSYA 5JSYA 5B1YA 5IWAB 2GKSA 4M0KA 4YCSA 5EXDA 4Z0HO 2R7AA 2XNKA 3NOVA 2FPPA 4IQGA 3JZMA 4ZXPA 1DTEA 4MV7A 3SHOA 1DEOA 1MT0A 1FQJA 4WZAB 2Q2VA 4IY1A 4EI2A 2VPIA 1IMOA 1T2AA 2A5JA 3WIDA 1SR8A 4BBJA 4FJ0A 1RWBA 4NCJA 2AF3C 4IEIA 3TKLA 3EGEA 3M7IA 4UTNA 5DT9A 4FILA 4LGCA 1AUXA 1HG0A 1OZFA 1QYDA 4LI0A 1GVNB 2HF2A 1EVZA 3H1AA 5I7SA 1CDEA 2ECQA 5F3RA 1XSEA 2BP7A 1HNXB 4J9UE 4NYIR 3T6KA 4CLDA 3EFBA 1U28C 1PU2A 2K7ZA 4FYKA 2QZPA 4DQDA 1V8BA 1Q0LA 3EXFB 3E5RA 4I4IA 5A02A 2FZGA 4QT0A 1MNQA 1SQ0A 2PGNA 4ZVRA 4D3SA 5FTLA 2O3TA 1U2RA 5DM2A 4L28A 1PGOA 4L3OA 1BEEA 3LL4A 5CEJA 4E1VA 1HORA 2PM8A 3RWMB 2GNPA 4B33A 4UHKA 4A2QA 1SUAA 1KC1A 1WCIA 1JR6A 1A9TA 2GZSA 2CCKA 3IDQA 4PO9A 3KZNA 1N6PA 1M6EX 1E2PA 1NOJA 3GJ5A 1TYBE 1ZA2A 4RWEA 5EKDA 2FSSA 3SZUA 3HBNA 2Y2UA 3KJXA 3RRYA 5GIOE 4YHHB 1QUFA 4DV2B 4UBIA 1WMAA 5BWOA 2P2LA 2J9ZB 4JU9A 3KSBC 4DRXA 1PZFA 2O0LA 2OZEA 4CMCA 3FCEA 4QUBA 2D8MA 4MPTA 5ICMA 4GBED 1VL2A 1CEYA 4NOMA 2MYPA 4B7ZA 4ND8A 5F7OA 2ZS9A 2HJ9A 4UARA 4TTAA 4DSTA 2MT9A 3HKCB 3OKPA 4FOOA 3W78A 4PR3A 5IM4A 5JWRA 3CVWA 3U7RA 2ET6A 1HETA 2G8NA 1A1SA 1IG3A 2W2XA 4J4HA 2JDID 4BO5A 4D9BA 3CEPB 3G88A 1AE1A 3W9SA 3RVLA 3ZIAD 3BH7A 4PGMA 2GN2A 2Q9BA 3UMCA 1R8QA 1G291 3DT9A 3RK4A 1ANKA 1U7PA 2NZVG 2J3JA 2YWJA 3PGA1 3OQ6A 2Z9CA 1N6KA 4XRRA 5C0OE 3GW8A 5ITZA 2EJWA 4GX2A 5FTNA 4FKZA 3QF4A 4M99A 1YS6A 2QAGB 1MVNA 1V5IA 2A0XA 4NMMA 3GJYA 3ETJA 3I8OA 1TU4A 1WMDA 5IH7A 2WHRA 5EPUA 3RKRA 4E14A 2IPAB 3A27A 1DBPA 2V7QD 3SCZA 3ZBTA 4IQ8A 3N2GA 5I3ZA 3VVCA 3EMVA 3NFRA 3OA2A 1QHHA 4GLLA 2YFKA 4I0WB 4ARUA 3VTZA 2QL6A 3Q85A 4EUFA 2LBPA 3ZCSA 1WO8A 2XB6A 1JQBA 1J49A 2TECE 1WULS 4ZVQA 1UQRA 2B99A 3FIJA 3I62A 3DCIA 1LSJA 2ZSEA 1NUSA 3C39A 3D6TB 1DU4A 2EQAA 3LXUX 1GPMA 3IUBA 1VLHA 5IH3A 2DZDA 2FSVC 2R4TA 3GA7A 3ILYA 3ORFA 4UBKA 5CP8A 3ITKA 1PYOA 5CDFE 5DCUA 1V8FA 3MINB 4GI3A 4OQPA 1FX0A 1MEEA 1XP8A 2XKBA 4O02B 2VEOA 2OTCA 4K03A 1DEKA 4UDXX 4FSXA 4I6GA 3AEKB 3AERB 1N5OX 3H2SA 4JUAA 3FHTA 1ZOPA 1FCJA 4KUGA 4QSHA 3HUEA 2XUFA 5FBRB 1FBNA 3PDIA 5CBKA 4RDCA 2BGKA 3Q8XB 4WZAE 3A9CA 4A03A 1OXTA 2D0OB 2INGX 4HX9A 5KWVA 1Z88A 2O2XA 3B5EA 4X00A 2HXYA 1RQ7A 1RJ9B 4PG4A 2BWJA 1II8A 2O7NA 2C3MA 3H99A 1A8PA 1FW6A 2I2BA 1NBEA 2EKPA 2HMTA 4YCAA 3CWCA 5F78A 3DMPA 4QTZA 1WPRA 3RANA 4B9AA 4BUJA 3K9HA 1Z4MA 4CG2A 3BWXA 1AY0A 5JD5A 3GX1A 5HRAA 2DF8A 1OFGA 5C51B 1ZJZA 1M2JA 5ALVA 1OR8A 4IHJA 3SS7X 2EG9A 3KQQA 2X5XA 3HV0A 5HFNA 3AVWA 1PJAA 2PZ8A 1Q3KA 4HTFA 1PUJA 4GPAA 4UTVA 1EQAA 1OXBB 4S1OA 5LZ9A 4DR7B 2IPLA 2XBLA 3LBIA 4ZCSA 2FEPA 3HC7A 3ABIA 3IDAA 4US0R 1XRNA 2ACWA 2XQJA 3JYLA 5BRNA 3U3DA 4Q9LA 1HYEA 3QRWA 2BGRA 3AIIA 4EG3A 3F6CA 1LX6A 4QQFA 4B75A 5C35A 1M76A 1PSDA 2YIVX 1DT5A 3QXHA 4KVAA 4AFNA 5FWAA 2O23A 3R7FA 1VPWA 1M1YA 3T06B 3TOXA 2DETA 1YK1A 5AKYA 5KWEA 4X94A 5TNXA 1CR4A 3CHYA 1W8IA 2VSNA 2QG4A 1GQOA 3GWZA 3I2FA 3RARA 3AX6A 2WWRA 2ZQZA 5CM8B 3GRKA 1CUIA 3U48A 5LDDC 4HWKA 4OBWA 3EVEA 4Y6PA 1DFIA 2HMSA 2TS1A 1BIFA 1B15A 1G5TA 1Z82A 5KJEA 3E4DA 1MIOA 1SC4A 1XEFA 4LWPA 2P6MA 4Q1CA 1E2NA 4GI2A 3UT0A 2VL7A 3JALB 2W8ZA 3OHMA 5A62A 2EW2A 1G3MA 3KYDA 1YIAA 4PAMA 3GJ3A 1HQCA 2B69A 1PSZA 3CF2A 4TXJA 2WTUA 1GV1A 1Q7EA 4R0MA 4WCFA 4NHOA 2ZJ6A 2CFIA 1DAFA 8ADHA 3K1AA 3SXUA 3ZOZA 4JBLA 3AONB 4D7AA 3CRZA 1K5HA 3LY8A 1J9ZA 4Z0PA 4Z3KA 1TUEA 4ZZ3A 1ZKDA 2QUHA 1NUHA 4IVRA 4UHHA 5ELMA 2G76A 3ZGYA 1B8OA 2YRFA 5G4KA 3NMUF 4KACA 4QU5A 1MEJA 2O06A 2WG2A 4ITUA 4HGYA 5B53A 5B5SA 5K0BA 2V7BA 2IYVA 3O1HB 1XO1A 3TRJA 4Q9KA 8ATCA 1GITA 1M83A 2C95A 1W2GA 2ZBPA 5LYJA 3NIWA 3WGNA 1UKAA 2YDXA 3CX6A 3OZ7A 3EASA 2FZEA 4W82A 2GM9A 2BFPA 4F3TA 3EOBI 3B9BA 4NG5A 4OQ4A 2EFGA 2HX1A 5KX5A 1KTVA 1ULHA 4P0QB 4JYZA 4B32A 4NCKA 4HH1A 2J4DA 1U3GA 2WM2A 5BWBA 5IKXA 4AC9A 4MUJA 4OM7A 3CM0A 5HUJA 1ONPA 2FEWB 4OMUA 2IQIA 1ZUIA 5DTMA 4C03A 3A4NA 2D5BA 4MWGA 3KKKA 4G0ZA 3EEQA 5L6LB 3HPQA 4YRLA 2YS6A 1X80B 3DTVB 3CH7A 5CH3A 1WTAA 4DRZA 3E3LA 3V1UA 4MUXA 1V5GA 3VI4B 4HAIA 421PA 1NPDA 5B4VA 1K5DA 4Q3KA 2I6XA 3ZVKA 3W5DA 1B0ZA 4O2BB 3EW7A 2FPIA 2YMMA 3L46A 3QE3A 5L3VA 2IELA 2VYVA 3ZGNA 1CX9B 3NEAA 3RRZA 3KQHA 2IS2A 3UJHA 3OM0A 3EA5A 2JFXA 3H9JA 3D6NB 1VCIA 2MIIA 4GT1A 2P6PA 3UZUA 3LP6A 1PO7A 1RM0A 3FXAA 4PG6A 4PO1A 1STOA 1B93A 2ZYAA 4B6QA 3VDXA 4CEHB 4Y0NA 1XPRA 4LC1A 3RG8A 4CLOB 2FSFA 5FNVA 3L7LA 1E9AA 4MGHA 3CF4A 5BPFA 1QIHA 1V7PC 2HQRA 3LCUA 4PIPA 1XZGA 1YRBA 1YVRA 4HKTA 3EGDB 3U9SA 3HCCA 4LYFA 4FLEA 4GPD1 4HPXB 5LQJA 4FSDA 1QGDA 4PGHA 4ZIRA 3ROMA 4YJ3F 5TT1A 3W7AA 4O2BF 3VZPA 1W0KD 1K97A 2HMYB 4RVHA 5ALTA 4GG1A 3TAXA 2GJ8A 3GCDA 2TRSB 2VOEA 2Z8YM 3C1AA 1ORWA 1QH0A 2W8BB 2ZTVA 4MV9A 3VZCA 4BFVA 4E5PA 4US2R 4EECA 1JJIA 3V3KA 5ALJA 3SLGA 4KMRA 3WKBA 4EGSA 1EVIA 1TC1A 3ELBA 1RWWA 1P2DA 2IJGX 3QVSA 2QL5A 4P80A 5CYFA 3QXGA 2HWWA 4ZOEA 5E6UA 2GJSA 1F2DA 2F9LA 2VHYA 4BX9A 3EFHA 1NAIA 2J85A 2XCOA 3COYA 3ND8A 4QPJC 4U7GA 1JYEA 1PG0A 4KQKA 1D2RA 4DIMA 1OYOA 4TS1A 4LMPA 5AIAA 2HA4A 1J6UA 3D7LA 4NR0A 5G40A 5HS6A 1SQGA 3MXOA 4RIIA 2HQBA 2QN6A 2NWQA 4B48A 4ZTBA 1JBQA 4CQMD 3HEBA 1RIIA 4GVPA 5ESDA 2D7DA 2C99A 5EIBD 4ESVA 4DSUA 1I5OA 1Q57A 1XVUA 5LOVA 3DPSA 1I4EB 1QRDA 3TNFA 1TEZA 3CRRA 3ANNA 1N33B 2PA3A 4UE3S 3PSHA 2FMFA 5D5HA 4C06A 3BL5A 1M2GA 1KRXA 3FDZA 4ZVMA 3FSEA 4F9TA 3BAFA 4KZPA 1QLWA 4JOQA 3I12A 1JHRA 3FKJA 2Y1FA 3LVQE 4I5GA 4TQAA 2Q27A 3G9ZA 5JOQA 3EAQA 4GLFA 2O5VA 2OG2A 4L9SA 5EL0A 4CYMA 3IEIA 1GSHA 2C9OA 5I7WA 1DAOA 2BKVA 3NBMA 2EIHA 1U9CA 3D4OA 3EWAA 3EY9A 4RCVA 3PJRA 1KI4A 4DYVA 1D6NA 1Z56C 1PL0A 3AM5A 3NHWA 1GGJA 4G5HA 1UM9A 2BT4A 3AQIA 2DT8A 4I5DA 4LQCA 5BMOA 1C9DB 2HLDA 2X4LA 1HSZA 4K28A 3KE8A 3DDWA 4CMHA 3F1LA 1N5LA 4MIEA 1V37A 5H3LA 1PRYA 4TLDA 3NDJA 1PW7A 2EJVA 2C3UA 2RHLA 4O33A 3RDPA 4F4DA 2Y1EA 5THXA 3O3NB 3D8HA 4PTZA 4TMXA 3QVUA 3FD8A 3VNSA 4IDFA 4F11A 4K86A 2E89A 3KXKA 4ENWA 3IP5A 4I9NA 2OWEA 3G5MA 1QYRA 4IDDA 3REQA 3N9IA 4MI9A 4ZT2A 1T1IA 2R5FA 4QICA 3PV0A 3L0OA 2VTBB 4Z7OB 4YIHA 3AH8A 5FXMA 1TM1E 2WYHA 4TZKA 5KNBA 1N2EA 4YREA 1GLNA 1KJYA 1C1DA 1PSWA 3H16A 3L84A 4W8GA 5ECDA 4ZI3A 1TYCA 2DFVA 2DLNA 5J3JA 5TB5A 1A5SB 4WBNB 4I46A 3IVGA 3GMTA 3O4VA 1G5QA 1T2DA 1VPVA 3D8UA 5H4HA 4JLKA 3CVXA 1VBKA 1X7ZA 3LCCA 2ZE6A 4OJQA 4Z9YA 4ZAXA 5BYKA 4AO7A