2DPXA

Crystal structure of human rad gtpase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
165
structure length
146
Chain Sequence
SVYKVLLLGAPGVGKSALARIFGGVEHTYDRSIVVDGEEASLMVYDIWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human Rad GTPase of the RGK-family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTP-binding protein RAD
total genus 49
structure length 146
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dpxA00
2JLZA 4NDZA 1XD2A 3KXIA 1YZLA 4DJTA 5FUYA 1E9FA 3BRWD 3EZ7A 4F4IA 2X19A 4OI0A 2ZSEA 3U7EB 1FL9A 4LHZA 5HE9A 2Q0HA 5FR1A 4C3ZA 3THXB 3SR0A 1U8ZA 3V00A 3AVTA 4TYWA 1N3BA 3ZVNA 4NP6A 3Q7PA 3HPRA 4AKEA 3ZZ0A 4A0GA 4M22A 4QM6A 4QJ5A 1E2HA 4D80A 1YVDA 4LPSA 1VIYA 2NOAA 5L8VA 1L4UA 1OFUX 2NQ2C 4LBYA 1H8HA 2IT1A 4NONA 4C2TA 2IW3A 4NCHA 4FCWA 5F9FA 4S2EA 3U60B 2LKDA 4O25A 3RS2A 1AZSC 2O8CB 4WA7A 2R6DA 3WBKA 3B1VA 4URYR 1TEVA 5FUXA 1MO4A 3AVWA 2VBCA 1R4AA 1IN6A 4G01B 5DH9A 5GVSA 5KNDA 3CZQA 2XTMA 2BIFA 1DAMA 1E2JA 3C41J 3EIQA 3L43A 621PA 4IVPA 3KB1A 4Q7JB 2WWIA 1XTSA 1ANKA 4IVRA 5J4VA 3U44B 1C1YA 2QA5A 1XTIA 2R6GA 3T15A 4JL5A 4NBSA 4DBLC 1W4BA 4BFZA 1COWD 1RW4A 1UDXA 4RZ2A 1UBGA 4IHQA 1YR7A 4BFXA 4PPFA 3VHLB 3R20A 1Z28A 3K0SA 2Z83A 3C7KA 8OHMA 1JQLB 3U6BA 1JXOA 1OXSC 3SS8A 1R0YA 3THWA 2W2XA 4DB2A 1QHHB 4WZBE 3DM5A 4JMPA 1W5TA 4FMDB 3TJZA 4OYHA 4OHVA 1JECA 3GLFB 2WWFA 3OZXA 4Q00A 1ZW6A 2DYKA 4YLGA 1VG0B 4UNPA 4TSFD 5AUOB 2BCGY 5FTKA 2WOOA 2IXGA 3SYNA 4HDOB 3LV8A 4BECA 4PC2A 2CXXA 2KJQA 2BM1A 3W8RA 1SKYB 1YZUA 3LXRA 3PEYA 4LCBA 1ELOA 1TEXA 4QGGA 4CW7A 2C96A 2HF8A 3RSOA 4AKGA 2G77B 4JVNA 4MUBA 4NE2A 2CL6X 2GXQA 1Z2CA 3RWMB 2H18A 4OQMA 1R10A 1SZPA 2XZPA 3QE0A 1VYVA 2OXCA 2Z5FA 3OEEA 2R2AA 3GJ0A 3HU1A 3QPVA 2AK3A 3D31A 3QXCA 1HA3A 2QAGB 4Q9KA 5EP2A 1UEJA 3TQCA 5JS7A 3LY5A 5LB2A 2V1UA 1S3GA 1BS1A 3U3JA 3TAHA 3CF2A 2A5DA 721PA 3IHWA 4HUTA 2XITA 1JB1A 3G82C 1W4AA 3OAAA 4AKHA 4MRPA 3R7WB 2ODEA 2XJ4A 6Q21A 3KQKA 1KDRA 1G5TA 4Q9IA 5EUQB 4ESHA 1MH1A 1TQDA 4EQ6A 5HZHA 3Q5EA 2NO1A 2ODNA 1GKIA 1CBUA 3E2IA 2KI5A 1KSFX 3KKPA 1LV7A 5EP1A 1OT3A 1OXVA 4HZIA 4LJ8A 3SJBA 1V5WA 2FSIA 3RAPR 4V0MA 3PXGA 2RCNA 4Q4JB 1OH7A 2CCGA 4CDGA 2AX4A 3FFBA 2JJ1A 1PV4A 1DTSA 4MDFA 1SVLA 1KMQA 1XP8A 1ZD9A 3EIHA 1OHHD 5FOVA 1E6CA 5E3HA 4TMVA 1G8GA 1OPXA 2HT1A 4JLDA 4YMUA 2FE4A 1FZQA 4Q5IA 4MRVA 1K6MA 2BBTA 4US0R 4KCGA 5EE3A 3ICQB 4NH0A 1OXUA 3I73A 5EE1A 1SGWA 4B35A 2DWOA 1KTVA 4LHVA 1QF9A 1M6NA 4MYTA 1JR3D 2EYQA 3SQWA 3IPYA 2C99A 2WJHA 1R6BX 5FTMA 1W4CA 3NVAA 4OBEA 4DWJA 5IDVA 5FI0B 3U2QA 1NIJA 1UBFA 1CTQA 4FMDF 4HZUB 4B2LA 1VG9B 5TDHA 2ZYUX 2EVWX 1XTQA 3CH4B 4IEEA 1IXRC 5E7MA 1XMIA 2OCYC 2P6NA 4R98A 1OB2A 2RGAA 3LD9A 2ONJA 1NKTA 3WRXC 5KTYA 2FJUA 2MSCB 3P26A 1JJ7A 1KAOA 1ESNA 3EC1A 3LH5A 4TZ6A 5KSPA 2QTHA 4XTRA 2REBA 2WKPA 4MQBA 3GQBA 4IFEA 5HR5A 3T35A 2FPKA 3K70B 2WJYA 2BC9A 1S9DA 3NC1C 2W6JA 1GRNA 1T5LA 2X1VA 3NG1A 4OHYA 2GXUA 1TX4B 4DLXA 1ZM4A 3P20A 1VHTA 1G8PA 2GJ8A 1SKYE 4JYBA 2GCOA 1X8KA 4EFLA 1SHKA 3Q9LA 3GCGA 3DVLA 1OYYA 4BFWA 4Q1EA 1XJ0A 2QT0A 1DOAA 2D62A 3SU8A 2G0NA 2H57A 1E79D 4IFBA 1G64A 1MABA 2AN9A 3BD9A 1NVVQ 1D9ZA 4M21A 4BLTA 1XBTA 4KV9A 4DC9A 1CJKC 5D3QA 3N2IA 4EAQA 2RHMA 4R2HA 1FFHA 3Q3JB 2O0JA 4LRWA 1P9RA 1KMHB 1Z22A 2ORWA 1OSNA 1G5RA 1DAGA 2MMCA 3LX8A 5KNCA 3DOFA 4GT1A 2ZRCA 1MO6A 3WHLA 1ZINA 1NNEA 4E22A 5FOXA 2VP2A 5FPKA 5G53C 1FQJA 2QI9C 1T3LA 2B92A 1K8RA 1G6HA 2J7KA 5LD2B 1GKUB 4GPTA 4QBIA 3K09C 4WZ6A 4HAWA 3W34A 5BN5A 3AVOA 4B73A 3UK6A 4WW0A 2JLXA 5KU1A 1QBKC 2OV2A 4IRUB 3PEUA 1QHXA 4DDUA 1NJGA 3H4MA 3TR5A 3P27A 2PJRA 1Q22A 3F8TA 1NMYA 3AH8A 2CHQA 5FPTA 3V4FA 1B23P 5TV2A 4OQXA 1NN0A 3H84A 5J40A 2H5EA 5EJEA 3GEIA 1VCNA 4JBYA 4AI6A 1CR2A 2Q9AA 5B57C 2EQBA 1PZNA 2Q3MA 2OBLA 3C15C 4HAXA 1RRGA 1KI8A 2FFHA 1OIVA 3QVUA 1KI6A 2PT5A 3VU9A 4V0OA 3VR4A 4L15A 1HURA 4TMTA 3GLHA 2XNSA 2OBMA 4GOXA 2IBMA 4C7OB 2QGNA 1TF5A 5DISB 5EP4A 3K0EA 1Q21A 3TVDA 1A2KC 3FTQA 5UKDA 2CL7X 3CO5A 4BUJA 5CDFE 2ZVQX 3UWOA 3K1JA 4O2RA 4BFSA 1PVOA 3RRNA 3UIEA 1GNRA 1ZD8A 3HU3A 2QPOA 4M1YA 1F6BA 1FP7A 2OZEA 4ZI3A 2FPMA 2BOVA 2ZYTX 3MWYW 2ZE6A 4D0GA 4DSNA 2JLVA 5LBIA 1WQ1R 1NRJB 3UKDA 1L2TA 1XEWX 4JBXA 4IOMA 3ZYCA 2ZTSA 3QF4B 2D7DA 3BH7A 4A0FA 1U90A 1UJ2A 3U3OA 4TLDA 3AQ4A 3AGQA 1XEWY 3QKRB 3GLGA 3WRYC 3QIAA 4LGMA 3RRMA 1T3SA 3ADDA 5JRZA 4BGDA 1U9IC 2H8KA 2ZI3A 1F48A 5FUVA 2FGJA 4GNKA 4A2WA 3GPLA 5CIWA 2ZJ5A 3EPJA 3NWJA 4BLSA 2RMKA 4LYJA 1SVWA 1UDWA 5AJXA 1T8TA 1TU4A 2HEIA 3WP0A 1VDZA 3PR1A 1GWNA 2IHBA 4AK9A 1QHGA 1XJCA 2AKAB 1II0A 4B2PA 5G40A 2ZAOA 4JBWA 2ZS7A 4NCIA 3K70C 3NBYC 1E98A 4JLKA 1EK0A 1W48A 1SXJE 2I3BA 4DDTA 1J8YF 1VHLA 2TMKA 4MRSA 3WHKA 4A6XA 2GK7A 1XTKA 4DIEA 2BBOA 1AKEA 1XMVA 4CIDA 1AZTA 1LFDB 1RRFA 1NMZA 3WBJA 3CRW1 1ESMA 4NKRA 4C9BA 4EJSA 2G6BA 4H1UA 2OCAA 2QPTA 4X8OA 2KSQA 5FBRB 5EUMA 3U7GA 2FPLA 1ZYUA 2WPDA 2ZRFA 3GLFE 1E9EA 4TMZA 4A92A 3IIKA 4IW3B 3I5XA 2ZSDA 2WMOB 1A5TA 3ADKA 2F9LA 4DCTA 2WIAA 4HUQA 4G5RA 2E87A 4QBFA 3LLMA 4RD4A 5CLLA 4JS0A 4KFSA 4KVGA 2MMGA 4CEJB 2VF8A 4KBGA 4EPYA 1NF3A 3KQNA 4JSTA 3B1XA 5DI9A 1H8HD 1GVNB 2GEVA 3SN6A 4RD0A 5JZVA 2DY1A 4QBGB 4I1UA 3UG7A 5CDFA 3GJ3A 2ZE5A 1NY5A 2QEQA 1IHUA 1YRAA 1G20E 1RJ9A 2ECKA 3HYRA 4B76A 3QKUA 3DHWC 4ON9A 1E1RD 2VIIA 1LS6A 4XVQA 3BH6A 4HI0E 5KSZA 3K70D 2EFCB 2VL7A 3EX7C 4X8LA 5FTNA 5GVRA 2MSEB 1N5JA 3QNUA 1JQJC 4UNSA 5E95A 5CYPA 3OFNA 4KAXA 3I61A 3BXZA 3X1XA 1EFHA 2FFQA 2QGZA 3SHWA 1N6IA 2ZS8A 2CCJA 4DLUA 3EC2A 3VAAA 3CH5A 1U8YA 2OM2A 1BOFA 2RB4A 2A5GA 2ZI5A 3LQRA 4LSGA 3GMTA 3O8BA 4NCKA 4NPHA 1IXZA 4DB4A 3THWB 1Q1BA 2W00A 3B9QA 2GNOA 4Q1BA 4HAYA 3VFDA 1QG2A 3X2SA 4LV8B 2IHYA 3C4JA 2FF7A 3GD7A 5K8LA 4B44A 3O8CA 3VR5A 2RHDA 3BB3A 2BCJQ 2NO0A 1I4LD 2QP3A 4KYIB 4OJQA 4YMVA 5IF9A 5J4YA 1G9XA 4AYXA 1GNPA 2D3WA 5SZJA 2RGEA 3DKPA 2NTYC 4P0TA 4XVRA 3RS3A 3EPLA 2FU5C 3OIUA 1NLZA 2ONKA 2YZ2A 1NBME 4KHZA 3WNDA 3IIMA 4DSUA 1E2GA 5BYJA 1D2NA 2IYLD 2W0MA 1M34E 1G1MA 4C0AC 4LDJA 1NJFA 2BKUA 1KDOA 3DO6A 4TLBA 1LTQA 4D4KA 1XTRA 1UKYA 1XD9A 4G5GA 2GCNA 1R2QA 421PA 1SXJD 3AVXA 2WJGA 1PUIA 3GFPA 1P7CA 1E32A 4A15A 1Z63A 3Q7QA 2V6JA 3V9PA 1S2MA 1ETUA 1KSJA 3K0CA 5BN4A 2FWRA 3PV0A 2YWFA 2F43A 4NYJQ 1WRBA 4HLDA 1Z06A 3KUDA 4LYFA 1ZM2A 3OHMA 1Z6YA 4PZLA 2HXYA 4QJ4A 3SI7A 1AQUA 1VCIA 4DSTA 1W5SA 3P1JA 1IBRA 2PLFA 4NYMQ 4IDQA 3TW4A 2QBYB 3K0CC 2QG6A 1J99A 4A1FA 4TYNA 1FX0A 1ZMXA 4L5BA 3L0SA 2FGKA 3BBPA 1M7GA 4DT1A 2AR7A 4XTCS 2NG1A 3FMIA 5H70A 5C46F 1JR6A 2A5FA 1XRJA 4V02A 1UKVY 4WXPA 4V0KA 3ZVLA 1KI1A 3B8HA 3IKJA 3TLXA 1KI7A 1RRCA 2JCSA 3EPHA 1YRBA 3ZS8A 5A0FA 1Q1EA 4B34A 2O8BA 3B6EA 1KSHA 1XCPA 4XVUA 3C5HA 4URUR 4HLQB 2IYZA 3HP1A 2Z4SA 1JEEA 2VP9A 4R71A 4K81B 2R62A 5JLJA 3GFTA 3U3MA 5EP3A 1VCMA 4RFVA 1D9XA 5LD2C 2QE7A 1W49A 1TMKA 2DFNA 2JIZD 2ZU6A 4HLUC 4Q4LA 4QGHA 4D82A 4AY2A 3TUZC 1IY2A 2GILA 1XFAA 1T6NA 3IPXA 4A2PA 2VHUA 1NG9A 3AKCA 2DHRA 3EARA 2WM9B 3KJIA 4QNMA 1UPTA 4EPRA 3W3ZB 2W2TA 4EDHA 3CNOA 3IBYA 2XJ9A 3LQQA 3OFND 5BQ5A 2J46A 1QVRA 2GJKA 1E4YA 4JVLA 2WKQA 4B6FA 1GSIA 4M9XA 2ZRBA 3O8DA 1YE8A 1R5NA 3T34A 3GLIE 4I1VA 1X6VA 2Q21A 1QHNA 1W36B 1TPZA 2IYRA 3PIRA 1MR3F 4C0JA 1CF4A 1CP2A 4TN1A 3G0HA 4BQSA 2XXAA 3DZDA 1KK0A 4G5SA 2VHTA 1E0KA 3I8SA 1TU3A 3R9XA 2J45A 4C7OA 2J59A 2XXAB 3B78A 5G3ZA 3SYKA 2QQEA 4JLVA 3WYFA 2WAXA 2H7VA 3PUWA 4QOSA 1RYHA 1TADA 2R44A 4NYJR 4Q1AA 5CJPA 2JJ1D 1WP9A 2WVJA 2JASA 1D2EA 1NSFA 1R5OA 3H2YA 2ZRIA 5L3RA 3EIEA 2F9MA 3ND9A 4X8HA 2JJ2A 3IQXA 2FSGA 4II7A 3I5YA 4I99A 5L3QB 4XSHA 3RWOA 2V4ZA 2P67A 2VQSA 2OG2A 2QT1A 2XOKD 4Z1MA 4D4JA 2CE7A 2RH5A 4BEBA 2PZFA 5DNYB 3TAUA 3VNUA 3LBHA 2HT6A 2ZI4A 5JBQA 2ZYVX 3V4RA 4YDSA 5CITA 1Z47A 2PBRA 2D2EA 4GBMA 2JA1A 5GJWC 4NYIQ 4TYYA 2F7SA 3LNCA 2BHRA 5ANRB 1A2BA 1E1QA 3J81k 3ASYA 1YR9A 3QXSA 3T1TA 3QPUA 5A4JA 3R9WA 3TR0A 4DVGA 4JLBA 3AKDA 1MRSA 2BMJA 2FOLA 1S9HA 4MGZR 2H16A 2JLRA 3FMOB 3TSOA 5JWOA 3F0TA 3HR8A 1A1VA 1QHIA 2F3TA 2HCBA 4IDPA 4YMWA 2ZRJA 5B30A 3IGFA 5AUNB 1ZIOA 2CLCX 2CNWA 3LFUA 1AGRA 2OSBA 3KUCA 1DG1G 2OFOA 2ATVA 1BMFD 4PO1A 4LJ6A 3AV0B 3TW8B 3PUVA 3TGPA 2RGXA 5G41A 3B2EA 5JHHB 3THYA 3W6NA 1JJVA 1W2HA 4BWYA 2AHOA 4OHXA 4LX0A 4DLTA 4ZDKA 3CONA 2B7CA 4IDOA 4O3MA 2JJ8A 2ATXA 4B3GA 4PC7A 3QG5A 1KGDA 4XWOA 1AM4D 2BBSA 2F6RA 3A1WA 3BE4A 4B3DA 1KO7A 2REOA 1N6PA 1YZQA 1U0HC 2QBYA 4NHOA 4LJ5A 1UKEA 2BEKA 3BORA 2OESA 1XXHA 4LJ4A 2AKYA 2BMEA 2GXAA 5L3QA 1E9RA 2PT7A 4QNRA 1G41A 3A4MA 1P3JA 5EZ5A 1KI3A 3ZVRA 3CZPA 1W36C 1CRQA 4UXHA 3T1OA 2GJAA 2CVFA 1V43A 4JT2A 2XOKA 1KZ7B 1W0KD 2WWWA 1E2NA 1M74A 4NL4H 3A8TA 2EWWA 1SVSA 2O5VA 2VH5R 3T1VA 3SHFA 3QF7A 3R8FA 5JMTA 1QHSA 3PUYA 4YONB 1C9KA 5KDLA 4URWR 4DLWA 1IONA 4A0RA 4GDFA 1M7HA 4FCVA 3JVVA 1Q0UA 1G19A 3TQFA 4NCNA 4LWZA 1JAIA 2B21A 2IYSA 2QZ4A 2WWXA 4CEHA 5JJLA 3T12A 3WYAA 2FN4A 3MMPA 3PUXA 2O8EB 4G5QA 4BEJA 1MO5A 3MRSA 4MKFA 4YMSA 3TK1A 4KXFB 1M1YE 1MKYA 4XH9B 3VKWA 1Z83A 3MWJA 1KI4A 1K5GA 4JLJA 1W47A 1N6OA 3QKSB 3W3AA 1QHHA 4DKXA 5JJKA 5EQTA 821PA 4ZCLA 1IN5A 3RS0A 4DRZA 3SBDA 4ZDIA 1WBBA 4MGYR 2NZJA 1DAEA 3AVQA 4PSVA 4JLAA 5FPYA 4KITB 4PPNA 1Q57A 3SE0A 1GRQA 3GJ7A 3K0AA 4A6PA 4EIWA 1KO5A 3QKTA 1GL6A 2P65A 3N5CA 4PO9A 2FFAA 3FHCB 5AWFC 2IYXA 1FMLA 3TUIC 5H1YA 2AWOA 2PL3A 2ZROA 4RFSB 4CYMA 2F1IA 5TY0A 3QXXA 4XIGS 4PTLA 2BEJA 3KB2A 3KQLA 3M0EA 1N6NA 1WF3A 2QU8A 4RZUA 1KJZA 3SZRA 2CDNA 4XJXA 4PSKA 3LBNA 2GZDA 3CNNA 3D8BA 3QENA 5BW8A 4JJZA 2G0TA 4BFUA 2QAGA 2PMKA 4RFSA 4UQOA 4HLUA 4PAQA 2PMDA 3GP8A 5E7JA 4TT3A 1OE0A 1Z0AA 4QFMA 4XD7A 1NVUQ 3O47A 2ZVPX 2ZJBA 1E2FA 3QPWA 1P9NA 3H1TA 5J4HA 3SYLA 3UPUA 3GEEA 2PCJA 2W2VA 2QROA 3KKQA 4QXAA 2ZXUA 4L9WA 4PFSA 4C0LA 5KDDA 1DAKA 2QMOA 2CE2X 2IEZA 3BFXA 4BRUA 1T4GA 2ERYA 3LVQE 1CU1A 4TLEA 2WTUA 2PCLA 1CJMA 1G8HA 3BOSA 4RCYA 2EWVA 2NIPA 1NP6A 3CRVA 2R6FA 2B7BA 3JVUA 1SXJC 1YKSA 3GJXC 1DO2A 2G83A 1BYUA 2HYIC 1S1MA 3CF6R 2Z43A 2CK3A 3QKSA 3NIBA 2YWGA 3GFOA 1MV5A 3DOEA 4FI3C 2N46A 4D6PA 1LF0A 3U44A 1UEIA 3MAAC 1VYUA 1NBMA 1XZPA 2UKDA 4GSYA 1Y3AA 1QG4A 4PC3A 1H8EA 1JEDA 2XTZA 3I3SR 4GMDA 5TB5A 3A1VA 2ZR9A 2GAAA 1X86B 1ZCBA 1XCGB 2RGCA 2YOGA 3MUFA 4EUNA 1M2OB 1W2GA 2IS4A 1A82A 1P2UA 1G7TA 4GP6A 4B48A 2PJZA 1JR3A 4JYCA 4TLCA 1U99A 1KDPA 2GEUA 3FYHA 2IUUA 2ZPTX 5FH9A 2O8DB 1G3QA 1ZNYA 2GEDA 2GKSA 1N25A 4B2IA 3O8RA 3CF0A 4IOKA 3L8YA 4OQNA 3RLFA 4EPWA 1JAHA 5EXXA 4I4LA 4G0NA 2V55B 5HKKD 1P75A 4ASUD 4IOJA 4UNRA 3QXJA 1GZSA 5FL7A 4A9AA 4D4MA 5GJBA 3L0IB 2X2EA 1JI0A 2AD1A 1GL7A 5KPJA 2BWJA 2W6JD 4AG6A 4B3XA 2REXB 4GL2A 2W83A 3EG5A 4KYUA 1PLJA 4Q1FA 1P6XA 3LWNA 3C14C 2RGNA 1ZBDA 2YYZA 2BDTA 3MLEA 4EJSB 4CGZA 3E5HA 2GETA 3PCRB 4W5JA 1KYIA 4B74A 1JNYA 3A6PC 2WSSA 4PXAA 2XB4A 1RPZA 4G5OA 3MFYA 2R6AA 1Q1ZA 2WOJA 4OK5A 3D6TB 3TIFA 1AS2A 4FWTA 1OLOA 1VKJA 3WY9A 4YMTA 2O8BB 1FOEB 5CLQA 2UZIR 1NL3A 5F98A 2JEOA 3DZ8A 4LV5B 1S3SA 4U7DA 5HZKA 5EXTA 5B2ZA 2QP4A 3A1TA 4WVFA 2FV8A 3AUXA 4RD6A 1ZNZA 4PR0A 5JSZB 2GXSA 4P4SA 2ORVA 1Z6TA 2YWEA 4WOPA 1G18A 1RIFA 3FVQA 5GADl 2A5YB 2ZJ8A 3AKEA 4JSYA 3QEJA 1TTTA 1AKYA 2JLSA 1KZGB 4OI1A 1XDBA 1IQPA 2CLSA 3ICEA 4R9UC 2RGDA 4N0EA 3TMKA 4QBHA 3CNLA 3FMPB 4Q03A 1Q12A 1XEXA 3LW8A 4LPKA 5C4MA 1CJVC 5E7IA 2WJVA 1N5LA 2YOHA 3EA5A 1ZNXA 2FZ4A 1TUEA 2PEYA 2PLRA 4PZZA 3SJCA 3WNCA 3FHOA 5FTLA 2R65A 5L3VA 3CPEA 2B8TA 4BLQA 4ASUA 4BRWA 1RJ9B 3A4LA 2ZYWX 5EZ6B 2V54A 1TQ6A 3KX2A 4MYUA 4GMXA 4OHWA 5FOWA 2ANBA 2IC5A 2OXRA 1Z6XA 1J7KA 3BIFA 1TF2A 3RRZA 3CRRA 2HJGA 1NVWQ 4A4DA 1G7SA 4OHZA 2FMXA 4GRAA 3TE6A 4EJSC 2WAYA 4TQ9A 2ZRKA 5BWMA 1IY1A 1E2MA 5AR1A 1W0JD 1OFHA 2DWPA 2NPIA 5HE8A 4E03A 3VNVA 2C03A 4TLAA 4GZMA 4HUQB 3FDIA 1XXHB 2Z0MA 4HDCA 2IYTA 1S96A 2ZITA 4H9GA 5JEEA 5JCZA 3B1ZA 4Q7KA 4D0NA 3UMFA 4TSFA 2ZREA 1Z3IX 1P2TA 3K0AB 2AK2A 1G21E 1EX7A 2EFGA 1P4SA 2G3YA 4ZDJA 1P2SA 4MITA 4TMWA 3PFIA 3U5ZB 3SQXA 2AWNA 1Q44A 1KY2A 2IYUA 4IKEA 3I8XA 1S8FA 1R5BA 5GJCA 1YZNA 2C95A 2VPPA 4POAA 1R7RA 1Z6GA 3U61B 2ZR0A 4MH0R 4LJ9A 2JIZA 3SNHA 4EPVA 3FPAA 3ZZTA 2CJWB 1AJEA 3WNBA 1E2LA 2GTPA 4N3NA 4TTRA 2DFLA 4KBFA 1UF9A 3NEJA 4UXJA 1KI6B 2E9SA 5JRJA 1FTNA 4MA4A 2FEMA 1XCMA 4QRHA 3W6PA 3EZFA 4DCUA 4LYHA 3CPJB 5DHFA 1JALA 2CVHA 3M1IA 5IHPA 3CUEF 2XNDA 2ZS9A 5IT5A 2QMUA 3U7HB 1KMHA 2BM0A 2QORA 1YJ5A 2C5LA 2VP4A 4F92B 1R0ZA 1F5NA 1W46A 4L4UA 1W7AA 4Q4JA 1XTJA 3QOFA 4OJKA 4QGAA 2P2LA 4DT1B 3UG6A 2NMVA 4KO8A 3LXXA 5JS8A 4CEJA 1U0LA 4V0LA 1FTSA 4JKIA 5H8WA 1X3SA 1DS6A 4GOKA 2ERXA 2KE5A 2XX3A 2Y8EA 2WZQA 1W36D 4DCVA 3IIJA 4KFRA 1Q1QA 1NKSA 1P62B 4HATA 1ZP6A 5K8UA 1HQYE 1SVIA 2WIBA 4Z8YA 3KFXA 4G3XA 4Q7MB 4B71A 2HJVA 4Q48A 1WDTA 2BMDA 2C9CA 4LYAA 2KBFA 3VKGA 4M1MA 4IJMA 4K8OA 2WJIA 3L82B 521PA 1KAGA 1QRAA 2OT3B 1CEEA 2ODWA 4PHTA 4TTQA 2X2FA 1KJWA 2WBLC 3C8UA 3SC3A 4NYMR 4URXR 1CIPA 2LCFA 5G3YA 1LVGA 1RVDA 3TUJC 1GOTA 3U3KA 3PVSA 4AIIA 2QTFA 2YINC 3B85A 1OIXA 4PC6A 1OH8A 4RY2A 2CEAA 3UMSA 4B3CA 3GLHB 1XJQA 5KDOA 3CLVA 2YV5A 3GJ4A 5LB4A 2XGJA 1DAFA 4JL8A 2ASEA 1SHZA 3QG1A 1HUQA 3JZMA 4PQYA 1GG2A 3DMNA 1ZJ6A 1XX6A 3OIWA 3Q85A 2IUTA 4FMCF 2BJWA 4PZYA 3KQUA 3GJ6A 4OK3A 3AVVA 1SKQA 2ZR7A 1PLLA 3NDPA 2V7QA 4DEXA 2FZLA 3ZGXA 4E07A 4TL6A 3CW2A 3ZDQA 2V8OA 3KJEA 2W0SA 1AGPA 2GDJA 1J70A 4ZO4A 3K9LA 3MG9A 2Z4RA 3AVUA 1U98A 1U0JA 2Q9BA 1CJUC 1HQCA 1NBMD 5FTJA 1UBCA 2G9NA 4LHWA 2EFDB 3ZS9A 2IYYA 4CT4B 1FP6A 3AF1A 4I1OA 2FFBA 1H8ED 1U8AA 3UMRA 1ONBA 2V9PA 2B6HA 2J9RA 2JJ2D 3AKYA 3GJ5A 4W5WA 2QSYA 4ZKDA 1XMSA 5AUQA 1U94A 3K53A 2YOFA 2BV3A 4JLMA 3M6AA 1DPFA 2WHXA 5FL3A 3X1ZA 4BFVA 1AS3A 3IBGA 1PUJA 2J3EA 2X8AA 1CR1A 4MRNA 1ZC4A 2LKCA 2BVNA 1XPOA 3AVYA 2OE2A 1N5IA 2WKRA 1D8TA 4JL6A 1RKBA 3RC8A 1G3UA 3CX7A 3U3RA 2QMEA 2IX3A 2GVZC 3B9PA 1F2TB 1Z0FA 4AURA 4V0ME 4HAZA 3GLGB 3RYTC 1DEKA 1VECA 4DXAA 2YVUA 4M9ZA 4Q9LA 3W5JA 2ZIAA 5JHGB 4Q18A 2ZJZA 2VRWA 4HAUA 3ZZUA 1T0JB 2J7PD 2JLYA 3HJNA 3W5IA 3AGPA 4DUGD 1G8YA 5B64A 2ZRMA 4RKEA 4F7WA 1GDDA 1Z5ZA 4G1UC 1II9A 1E96A 2FSHA 2JLQA 4DSOA 1GRRA 2AXNA 3AP1A 4GP7A 4FCTA 4KI0A 1Z6AA 2P5SA 2QTVB 1L7VC 2QNRA 3KDSE 5HCIA 4Z54A 2XSZD 1XB2A 3Q5DA 4KLZA 3BK7A 2NO9A 4KODA 3R8CA 1IJFA 2GCPA 1HE8B 1HEIA 1I2MA 1CS4C 4IOLA 4Z8XA 5SZHB 1JPJA 1ZD1A 2GJSA 2P5TB 2YWHA 5CJ2A 3VTKA 4MUAA 3EXAA 2IWHA 3THYB 2GK6A 5TVKA 3ZD7A 1ZAKA 5GJVC 1KO4A 4F4CA 5F2EA 2VA8A 4F38A 1UFQA 5AUPB 5F9HA 4BASA 2OAQ1 1KY3A 4RZ3A 1XF9A 4GZLA 1KK1A 4ZKEA 4ESVA 5DI3A 1ZUNB 2J1LA 4ZI2A 2C2HA 3HU2A 1E0AA 3HR7A 1CULC 2QL6A 3SJZA 4YXWD 4IVQA 2D4HA 5TMPA 2J0UB 2VHQA 4HSEA 4W5HA 2CJWA 1EX6A 1FNNA 1E99A 2IUSA 3EZ6A 1NLFA 4MGKR 3EZ2A 4O0MA 1RZ3A 1DARA 1IXSB 4PX9A 1J2JA 2OHFA 1VG1A 2HXSA 2XAUA 4PC1A 4MYCA 5IRCD 3SJAA 4TTPA 1GM5A 4GI7A 3TSWA 2J0VA 4K46A 4V0NA 2IYWA 1W0KA 1MRNA 2VYFA 4PPGA 3RABA 2A3RA 3VHXA 3U7FB 2QE7D 5IK2D 2ZJAA 2XZLA 2ZJ2A 2ZETA 3REFA 3KKOA 4HEJA 3P4YA 2C04A 3CRQA 3K09A 4LC0A 1EFCA 1YZKA 3THOA 2VP6A 4Q66C 2SHKA 4EQ6B 4WXRA 4TMKA 4HAVA 4DHEA 1CRPA 2I1QA 3M4YA 2DFKB 4M4SA 2C9OA 1TF7A 2ZSFA 4E5UA 5KSYA 1EFRA 1GILA 4U00A 4XWAA 5CB8A 2X77A 1TNDA 1OKKA 2XTNA 3MSXA 3AP3A 2QPAA 2RGGA 3R7WA 1UBEA 4QHYA 4OQFA 1OIWA 4HB0A 3SFZA 2IF0A 4AWXA 1U81A 3NTUA 4UXIA 1XD2B 4TYQA 2NZ8A 1F3OA 1IN4A 1PJRA 2BJVA 2ZUBA 4M53A 3KTAB 4Q7LA 1Q20A 1OH5A 2O8FA 5M04A 2PX0A 1COWA 1Z29A 1UADA 2QP9X 1G17A 3R9IA 1OHHA 2GBLC 2QM8A 3OE7D 4RSGA 3LO5A 121PA 2IF2A 4Q1CA 2F3RA 1DO0A 5FI1B 4HB3A 1LB1B 1WMSA 1X1SA 2DB3A 3KXLA 5FPHA 3NEYA 3EASA 1E9CA 4ZIRA 2V1XA 4JT4A 1ZRHA 5JFGA 3SDZA 4H1VA 4EFNA 4U5XA 2HV8A 5CM8B 4CT5A 1W4RA 3RSLA 3OIVA 4OL0A 1WA5A 4Q4HB 1KJYA 3PUZA 2RGNC 4HB4A 3DL0A 1P5ZB 1R8SA 2WJJA 4L9SA 2QRZA 1E1QD 3CWZA 1TAGA 5CM9C 1WCV1 4MKGA 5FOUA 4B33A 1Z0JA 4LV6A 4XD7D 4CF7A 3ADBA 3K0FB 2F1HA 2OUKA 3KKMA 3LW7A 5TXGA 3VR3A 4OKSA 4Q4AB 3NBZC 4J0QA 2Q6TA 3CIOA 4PO8A 1YZGA 2OAP1 5DN6D 5KNBA 3EWSA 5FUWA 1NLYA 1Z0DA 3OAAD 3ZLJA 2WWGA 2OCPA 2V7QD 5AJWA 1N0UA 3IEUA 3IDQA 2WWHA 1P9WA 4GOJA 2CCKA 5JI2E 2FSFA 1SVOA 1CKEA 1M7BA 3PITA 2JLWA 4A36A 3UATA 2ZI6A 4V03A 2LWIA 4A2QA 1CJTC 3ZQJA 3LA6A 1FX0B 2QRNA 1G6OA 2C8VA 3FFAA 1G4UR 1S1CA 1Z08A 3DM9B 2BMFA 4B47A 2ORIA 2BBWA 1E0JA 1VMAA 1Z0IA 3NBXX 1FUUA 2A5JA 3Q72A 1VCOA 1F2UA 1X8JA 4ZPXA 3X1DA 3G5UA 2ZRGA 4FIDA 1JR3E 4MKHA 4MGIR 1MOZA 2PX3A 4NTZA 3RS5A 4US2R 3IQWA 1EWQA 5ELXA 4ZCMA 1ZVQA 4NU0A 3VKHA 1G7CA 1DADA 3QUSA 3B13B 1G5PA 1CR4A 4TL8A 3DEFA 2OEPA 3A1UA 1YHNA 3BC1A 4QJ3A 3LVRE 2JATA 2ZEJA 3VMFA 5DI3B 1T9HA 1U9IA 3BWDD 2ZI9A 5DYGA 4PHFA 4PQRA 3VQTA 2JDID 1SXJA 2GA8A 2V6IA 1J90A 2OLKA 4B32A 2RKOA 1P61B 1KNXA 3FB4A 2R8RA 2ZE8A 1IM2A 4GFDA 2H92A 4QG7A 1E69A 4DCSA 3EW9A 4I81A 2GWHA 4NMMA 3CKLA 2KBEA 3QJYA 221PA 2Q9CA 2GF0A 5FBQB 5JECA 1IOZA 2IS2A 2EFHB 2NPFA 2VP0A 4DCNA 4JIMA 2D7CA 1Q3TA 5TARA 4M1WA 2GBLA 4NCJA 2YC2C 4Q1DA 3OESA 5EXSA 3GLGE 1XMJA 1FUKA 1N5KA 4CZ2A 5LPNA 2OFWA 3F5FA 5FR2A 1E2EA 2O0KA 4EPXA 5KPDA 2F55A 4W9MC 3CWQA 3BAFA 1KOFA 4RVCA 1CXZA 3EZ9A 1TQ2A 2V3CC 3AF4A 4E09A 1OFTA 4LOAA 4C30A 1GAJA 4LJYA 3IHLA 2ZQ5A 4LUCA 3MJHA 3RVBA 3AVPA 5JJIA 1N0VC 3B82A 2UZ3A 2WPDD 1N6KA 3VX3A 1ZU5A 2HLDD 1DAIA 3C16C 4QC2A 4OQLA 1NMXA 2ODBA 4UNQA 3ND8A 4UNNA 3ECCA 1SVKA 3FMFA 2OFXA 2W6ID 4M2LA 4KU4A 2IXFA 4PHGA 3FKSD 1XWIA 3RS7A 5KUTA 1NI3A 3KZ1E 4OI2A 4KSBA 4YC7A 1XPUA 2O8CA 1OV4A 5D3MB 5H68A 3GLIA 1SULA 1GFIA 5J47A 1HT1E 1S0UA 1X8LA 3QY0A 5JWRA 1E9SA 3U6KA 4M1SA 1ZNWA 3QVVA 1E9DA 4KLNA 3IEVA 4ZCIA 3AUYA 3B1YA 4S35A 4DUGA 2GRJA 1DE0A 2N42A 1EFUA 2C77A 2ZRHA 3WMEA 2J0SA 2QY9A 1E1RA 4C0KA 1NG1A 1VIAA 1E9BA 3FWYA 4AYTA 1NN3A 3NXSA 3ZJYA 1KNQA 2PZEA 1QZXA 1FNMA 1NVXQ 1E0SA 3SBEA 3I92A 1TUIA 1E9AA 3MWLA 2Q3FA 1T0HB 2XNDD 1U2RA 4B43A 3AM1A 3DKVA 1TL7C 3ADCA 1OXTA 2GAOA 2IL1A 2J87A 4BZPA 1UM8A 1HH4A 1C4OA 3MGCA 4P31A 5KYKA 2FG5A 3QBTA 3B7GA 5BXQC 5BYKA 2WWYA 2O0HA 3TH5A 2ZJYA 4ZV4A 2CHVA 2FX3A 3PQCA 4LBVA 4TZ0A 3P32A 4RD1A 2XZOA 1G3MA 4DLSA 3U4QA 3EA0A 5DE3A 5HTKA 3CBQA 4Q9JA 1O3YA 3MWKA 2I4IA 1LW7A 3QQ5A 3IUYA 3WP1B 3AEZA 1XEFA 1XZQA 2EU8A 3ZD6A 4AD8A 4YDHB 2HLDA 1G16A 4LI0A 2N1BA 2QAJA 5A5GA 3DMDA 1G3IA 1XXHE 4LBWA 1W1WA 5JI3E 1RE0A 2W58A 2WMNB 3B1WA 3TRFA 3WXMA 4AC9A 2AXPA 4LZZA 3PEWA 2VSFA 3ZIAA 4ITRC 5EXPA 1Z2AA 3CX6A 3BFVA 1F60A 4PPQA 3A1SA 3QKRA 1N6LA 2FH5B 4ARZB 3QI2A 3JZAA 5F3WB 2VSXA 1EXMA 2KB0A 2GCOB 4FMCB 1KK3A 1P2VA 4M1TA 3I72A 3BB4A 2OLJA 1N2CE 1OFIA 1S4QA 2ZE7A 1D2MA 1KO1A 1NN1A 3VR6A 3TVTA 3X1YA 3D7MA 4TYPA 2CHGA 1E4VA 2CL0X 2GZHA 4QKQA 3H86A 4ACBA 1E2DA 4CEHB 3KJGA 1DBSA 3LAWA 3K9GA 1II8A 2CNWD 2WICA 4Q47A 4A8JA 5C18A 4XSGA 4MDEA 4N1AA 3TBKA 2DBYA 1AN0A 4HYYA 4TWZA 3WMFA 3EPKA 1DG3A 2GF9A 2VF7A 3BS4A 3RANA 1CLUA 4HB2A 2A7QA 3A36A 1YR8A 4BZQA 1D6JA 1L8QA 3KTAA 4UKDA 1KHTA 2K5UA 1OJLA 4P4TA 4BE7B 3NKVA 2YC4C 2ZM5A 2FA9A 4FXPA 4CRWB 4LC1A 2WSSD 2HF9A 3FKQA 3L8ZA 1K5DA 1H65A 2XEXA 1ZM3A 2EW1A 2YHSA 2ZI7A 1BKDR 3A4NA 5AJVB 4M1KA 2IWRA 3RNLA 1EWRA 1VPLA 3AP2A 2OCBA 4R2IA 1O87A 5AK0A 1GIAA 1SVMA 4LY6A 4ARZA 4DZZA 3KFVA 5C4GB 3OEHD 1HE1C 4ZDWA 3T5DA 5CK4A 1HYQA 2YJTD 2HYDA 3S1AB 4B6EA 1YZTA 4A0HA 4P3YA 3LLUA 3ASZA 4M0LA 4OK6A 4W7SA 1AA9A 5JWHA 4DDWA 4WBSA 2J0QA 1E3MA 1BYIA 5FOSA 4TT3D 4JVSB 1US8A 4A8JC 3KXKA 2A2ZA 5DIFA 4RCZA 4IDNA 4FD2A 1JBKA 2QENA 3BJIC 1HY3A 3NDBB 2A30A 2J7PA 3OIYA 3SOPA 3T06B 4Q4AA 4KSCA 4QL3A 4YQFA 5DN6A 4FWIB 3CR8A 5C2JB 3K0FA 3REGA 1Q3HA 2D2FA 3BGWA 1OYWA 3ONWA 1QHYA 2GZAA 2CBZA 2PEZA 3BH0A 2FNAA 4Q21A 1N6HA 1WE2A 1R0WA 2E1RA 2GESA 2CLDX 2OBNA 2XSZA 1EG7A 4P4UA 2OILA 1VTKA 4IEIA 1XU4A 3D3QA 1GL9B 3RRYA 3KKNA 2PZGA 1R0XA 4F4JA 1N6RA 3ZQ6A 3W90A 1MABB 4C0QC 3VU9B 3P4XA 2FDCA 4XWKA 4QM7A 2D74A 5DGXA 1Z8FA 4DLVA 4ZIRB 3X1WA 2ZJOA 2UVQA 1GNQA 2H1LA 2G88A 3RC3A 1OB5A 4BLOA 3GLFA 3THXA 2IS1A 4QHSA 2VP5A 4Z51A 4RJLA 1J8MF 4YXWA 1OH6A 1ZM7A 1ZU4A 1VG8A 2IYVA 5DLQC 2ZUCA 4C4PA 3OEHA 4TMXA 2BKEA 2QN6A 4RD3A 4MRRA 2DR3A 1LS1A 4Z1MD 5L3SB 4JZKA 1F2TA 2P6RA 3HPQA 3TKLA 4JLPA 1ZUIA 4B3BA 4DLYA 2VHCA 5DO9A 1P72A 3IILA 5K8IA 1NN5A 5J4LA 5C1BA 4N0DA 4UJ5A 3GLIB 1SXJB 1AS0A 2VSOA 3NC0C 5FBVB 3LRPA 4FW9A 4RZXA 2IYQA 2ZRLA 3BERA 3MJRA 4HZUA 3PJRA 3FHTA 4C0BA 3AB3A 1IAQA 3CR7A 4US1R 1KK2A 3E70C 5IK2A 2ZRPA 3T1QA 2WSMA 1EFTA 4P32A 1B0UA 4D81A 1LF5A 2C98A 3MCAA 3DPUA 5FPSA 4Y0VA 1HV8A 3I62A 1HT2E 1E2PA 4IXMA 1KI2A 5DSZA 1P60A 4M8NE 1XEXB 4DDVA 3T5GA 2C9YA 3NH9A 2PH1A 1T91A 3LX5A 3ZH9B 2YKGA 1ZIPA 1OKKD 1KDTA 4PSAA 4BFTA 1SQ5A 2DFTA 1US8B 1Z07A 3QSYA 1G8FA 2CK3D 2P6UA 5EE0A 1YR6A 1BH2A 2EYUA 2KWIA 1NIPA 2HDNB 4F91B 3UWKA 1T5IA 5CIQA 1RFLA 1FPMA 1YQTA 2ZAMA 2GHIA 4QHTA 4PAMA 1X1RA 5SZKB 3E1SA 1P73A 2EFEB 3QF4A 1RRPA 3VR2A 3DDCA 4MYHA 2J0UA 4CEIB 3L0OA 1BIFA 1ZC3A 2WV9A 5KSOA 5B58C 1NSTA 4R7ZA 2VTKA 4KJZA 3W9YA 4BPBA 5DHAA 1FQKA 5KHOC 3FKSA 4KVAA 2IXEA 3I1FA 4EPTA 2DWQA 3ETLA 4Q02A 4FN5A 2QQ0A 4D25A 4B75A 1T8UA 4FMBB 2ANCA 2JDIA 1IJEA 1KKMA 4D0LB 5JEDA 3GLHE 4AYWA 4OI4A 2IK8A 2VO1A 4EFMA 1LY1A 3CM0A 4JLNA 4Q01A 3QBVA 2A78A 1GITA 1QDEA 1ZUHA 5DYIA 2JAQA 1KIMA 3MD0A 3W8NA 4LHXA 2ZSAA 4WAUA 2VLIA 2B8WA 3NBFA 3FGNA 4ILEA 1II8B 4Q9HA 5FL7D 4A8JB 4C2UA 2VEDA 5CYOA 1VYTA 5HCNA 3BB1A 1AIPA 3EAQA 2QMHA 3K9HA 2ZSBA 1Z0KA 3PEVA 1KSGA 4AG5A 5KOYA 2AFHE 3T61A 1FW6A 3CX8A 3CRMA 2I1VB 1G7RA 5AJYA 5P21A 2F43B 4PHHA 4C0SA 2VHJA 3NHAA 3LBIA 4IXNA 2ZRDA 4D26A 1WB9A 3HYTA 1KO8A 3KQHA 4QGFA 3CB4A 5AJZA 1YU9A 1UKZA 2J5XA 3VR1A 2IS6A 3VX4A 5CK5A 4ACAA 1AK2A 4JJKA 4JLOA 2ZU0C 3OE7A 2FEOA 4PANA 4KFUA 1I4TD 3B60A 3WYGA 1D5CA 3U4QB 3QXHA 5J5CA 2P3SA 3NH6A 4NYIR 2IEYA 5FBLB 4DLZA 1G3RA 5K8TA 1JXMA 1L4YA 2AD5A 1I2DA 4I1SA 4WIAA 1A7JA 5FFMA 4PAOA 3GEHA 5EE9A 2YNMA 4L8GA 5HPYB 1DELA 2GJ9A 3ZVMA 4HLCA 1EESA 3N2EA 2L0XA 3CPHA 1OF1A 2G1KA 4Q4HA 4A82A 1CR0A 2DCUA 3S1AA 1LNZA 3OEED 4P33A 3ZIAD 3N70A 2O52A 2GVDC 1RYFA 1AQYA 3K9NA 3Q8XB 4F93B 4TL7A 1BO6A 3BFKA 4RD2A 4MKIA 4TL9A 3I32A 1MO3A 3HDTA 4RKFA 3GJ8A 5L3SA 4U02A 3RDPA 4B3FX 4D2IA 3UXMA 1WBDA 4X8MA 1NY6A 3B5JA 5JSZA 1NVVR 2H17A 1DAHA 4NZYA 1M8PA 5CB6A 4LJ7A 2NO6A 2DPXA 1GTVA 3LDAA 3WMGA 1WXQA 1ODFA 4C0HA 3L2OB 3QEOA 1XD8A 3A58B 1GKYA 3AF3A 4LJAA 3K8YA 4LK2A 5JCPA 1UAAA 4O2LA 1HTWA 4WZAE 1N0WA 2O8FB 4M1OA 4D4LA 3KL4A 5BN3A 5FBWB 2P0EA 1W0JA 2R6CA 3TSZA 4LBZA 1E79A 2C78A 4Q19A 2Q3HA 3SEAA 4JVMA 2D06A 4BLPA 3IO5A 2ZUDA 4L16A 2RGBA 1A4RA 1T3HA 2QM7A 2ZRAA 1XNJA 5EE5B 3UANA 1BMFA 2ZANA 2ZRNA 1OXXK 5E4FA 4JKYA 3RHFA 2F1JA 4ABYA 1I4DD 3TNFA 1E2QA 2F1RA 4KFTA 4TQUS 5D3MA 3EWAA 3F3YA 2IA5A 2QUZA 4URVR 3SFVA 1IN8A 1E2KA 2HUPA 1Y63A 2NO7A 3PG5A 1FMJA 2A9KA 4Y0AA 4BZXA 4XOIA 1IN7A 2Z6VA 1F2UB 2OO7A 3H0KA 3AF2A 3IO3A 4CEIA 2HCJB 4M9SA 1JPNA 2W6IA 4TQAA 2QAGC 4DIDA 1PLKA 2CMKA 5J4KA 1EGAA 1RC8A 3OF5A 5KO2A 4DLRA 3RS4A 4UJ3A 4EKDA 1GUAA 4BFYA 1KKLA 4P4SB 3C5CA 2O8DA 3L0PA 2RAPA 1TQ4A 1E2IA 1W44A 1ZM9A 3NHBA 2QSZA 1DVRA 2AFIE 3AF0A 4HDQB 4URZR 5HKKA 2JLUA 1OW3B 4M9QA 1E94E 1QVAA 1R8QA 3HWSA 4LHYA 2XB2A 3FE2A 2O8EA 1ZCAA 2AL7A 2MSDB 3A37A 3I4LA 1GP2A 1EFRD 4CVNA 4DEYA 1IY0A 1KI9A 5LDDC 4AKIA 4FINA 5SZIA 4ERNA 4IDHA 4BLRA 2JGNA 2G1JA 3KJHA 3FOZA 3W6OA 2R9VA 4PQFA 1MT0A 3PENA 5FOTA 1G4AE 2NGRA 2J41A 1G291 1XPRA
chains in the Genus database with same CATH superfamily
1AQLA 1HR0B 2NV0A 4PW0A 1EWTA 4L3WA 2I9PA 1PZFA 3R5JA 3UAZA 4DJTA 1NASA 3ZXSA 2YVLA 1JHRA 2EF1A 2KHZA 2ZB2A 3EZ7A 5LL6P 2WQ7A 1OAOA 2X19A 2ZSEA 3KSMA 4GD3Q 2AGVA 1MJGM 2XCIA 3F98A 1UZMA 5ALZA 1T2AA 4RL4A 1KQFA 3IBCA 5FR1A 4NCBA 2VSQA 5DLEA 1JB9A 3A1FA 3ANTA 3JQ9C 4FVTA 4TROA 3FSJX 3Q7PA 1N0HA 1F9EA 1OFGA 1TAHA 4N7JA 4IH4A 4M22A 3E8SA 4A0GA 4QM6A 2YBDA 4MW6A 1E2HA 5HQ3B 5IG2A 3JASA 3PE3A 4KR0A 4LJLA 1X1TA 5LUBA 4H7PA 1Q3KA 3W7BA 2Z3VA 3X3HA 3L84A 4KXXA 4DNQA 4N41A 1LFAA 2DJIA 4C6TA 2WUDA 2AC7A 1FMCA 3DE0X 4FBGA 3DTYA 2XKAA 4OHUA 4EATA 2IW3A 2AXQA 4NCHA 2LIPA 2ZPUA 4G85A 4S2EA 4L0MA 1QVVA 1J0EA 3LK7A 5B2FA 1A8HA 3MW8A 3HY6A 1DB3A 1VMIA 3IMCA 3UQZA 1WZ2A 2KQUA 2R6DA 4LJRA 1TEVA 4H7DA 1GZUA 1DIAA 5LU9A 3I9JA 2PVCA 1SK8A 5IJAA 3ELDA 3TOCA 5C8ZA 2VBCA 5CDTA 5C7LO 2R1VA 4JC8A 3CZQA 2LE0A 2XQFA 4KXLA 2A7XA 3W9BA 4K2HA 1E2JA 4E7OA 3EIQA 1L7RA 2FPRA 4N6OA 621PA 2YFYA 3A04A 3FVVA 3BXHA 4DPMA 4DM4A 1RCUA 3CLRD 1XTSA 3K6JA 4KIFA 3ND5A 3T0GA 1N0IA 4QO8A 3T15A 2Z57A 1L5KA 1PZXA 4B4OA 5A5DA 3L1VA 5CAEA 2QU7A 4LTNA 1YC2A 3KZXA 1Q19A 4D4HA 3E7DA 4ENTA 1RW4A 1DAPA 2G72A 4IHQA 3WK7A 4BFXA 3ZV4A 4O4JF 3K0SA 2Z83A 8OHMA 3HUFA 1NULA 3JY6A 4HDKA 2DJ5A 3CMCO 2QVCA 3JQGA 4IXWA 4WK2B 4JP3A 3A6HA 4ENUA 3DCJA 2R5FA 1O9HA 1VI2A 2W2XA 1QHHB 2ZBPA 3CEAA 1XU7A 3GHYA 4TT8A 2DPGA 2JRLA 2PUWA 4WASA 3DM5A 5GGYA 1W5TA 3BCHA 4ETMA 5FAKA 1JECA 2AMLA 1BW9A 5TC4A 2R5WA 3LCVB 4IDFA 4YLGA 5HG0A 1KY4A 1RAIA 3GUZA 3HB4X 1Y5MA 3LX4A 2VZEA 5FTKA 3BG5A 1N7JA 4WFIA 3SYNA 3LV8A 4AMUA 4BECA 4B4DA 2KJQA 1SKYB 1YZUA 4BRZA 3PEYA 4YQYA 3UT0A 1ELOA 1B41A 1ODCA 4L85A 4M0CA 3SQMA 1LLFA 2HF8A 4MUIA 3WQBA 4JVNA 1KVSA 1SQGA 3G0IA 4MUBA 3JVEA 4XQEA 2CL6X 4M0PA 1Z2CA 1R10A 1SZPA 4HQFA 4IIJB 1M0TA 2OXCA 3G9XA 2R2AA 3OEEA 3HU1A 4Q9KA 1P8JA 4FFSA 3UGQA 2QAGB 2PKCA 2WAOA 1UEJA 3TQCA 5MN6A 1E3JA 5AM1A 2OPHA 1FB5A 5J1SB 3KKEA 4J2TA 1URPA 1IB0A 3GRAA 2RKWA 3HKEA 3KOUA 3HZOA 1Q6ZA 3JAKA 3HC7A 3L8GA 3R0ZA 4Z9YA 3U3JA 3U17A 3WLMA 4IMIB 3IE2A 3NI2A 5DEOA 3BTOA 2VJYA 3OAAA 3PC3A 4GYJA 1ZGBA 4HGZA 4MRPA 5IAEA 3R7WB 3PGXA 3VPCA 4GOND 4E15A 1L5GB 1VLZA 1UZNA 2YXDA 1VXOA 1H69A 1X7YA 2GGSA 2FF5A 3LBFA 4UARA 3SHVA 3W06A 4EQ6A 3E27A 4ESHA 3Q5EA 5HZHA 4ETWA 4Y30A 1GKIA 4HBGA 1I7DA 5ICCA 5HF5A 1UJCA 1CBUA 3L92A 1V5IA 5ALOA 4DM7A 4YCNA 1E3DA 1LV7A 3M4JA 3TXYA 5EP1A 4M88A 1G8AA 1OXVA 1KS2A 1JHQA 4WA8A 3C3EA 3RAPR 1KRXA 4PRKA 3SEZA 4V0MA 1W5EA 4Q4JB 1WL8A 2IZOA 3IBTA 4CLOB 3INYA 2B8JA 5IKOA 4J91A 4LF8B 1FDRA 2AX4A 2O2DA 2ZAIA 2D6FA 2W4MA 2IHUA 1IULA 4IO0A 3MHPA 3LUGA 4DBLE 5EWLA 1SVLA 3X2FA 4ALLA 1ZD9A 3EIHA 3GV0A 4R8RA 4TMVA 5U9CA 2XDYA 2AOWA 2FW9A 4M54A 1OPXA 2EEPA 1G5IA 2GDZA 2OZLA 2FDRA 1ZY2A 1XWFA 2HK7A 1RYYA 4OG2A 4TVOA 1KEVA 4WDRA 1O6CA 3FDZB 2C1EA 4KCGA 4CQNA 4JC0A 4KE7A 4PGGA 4QARA 4V2IA 4MV9A 5TR9A 3I73A 1DWPA 5F7XA 1I01A 1JLKA 1FUIA 1KTVA 1M6NA 4W8OA 2Q9UA 2QG9A 3GJZA 3ABIA 3ZX5A 4G65A 1KBOA 2J5BA 1W4CA 4OQYA 4OBEA 4BFCA 3DB1A 1G8MA 2PZLA 5IDVA 1Z15A 4DWJA 4DYHA 3SYRA 2HADA 1ZH0A 3ILYA 4FDUA 1H2ZA 3G9UA 4MV4A 1PIWA 4B2LA 3AQIA 1VG9B 1KYQA 1OR8A 5FQOA 4HFNA 1DKRA 3WIBA 1GTMA 1T36A 1XMIA 4UE2A 1NF2A 1RWWA 1TDJA 2P6NA 3DTVB 5DULA 3WB9A 2RGAA 2ONJA 4ZTBA 1NKTA 2OQIA 3GA5A 1H66A 3HXTA 5BNFA 5C1DA 3BRQA 1T4BA 3K9FC 3EC1A 1QH1B 2RHCA 4HMPA 5KSPA 5IANA 4TZ6A 1NYTA 1QCCA 2ACKA 2XQIA 1PJ3A 4MQBA 3OJOA 4ND1A 4YUWA 4PS1A 5HR5A 2FPKA 3UJ3X 1L4LA 3ER6A 4XD2A 1RRMA 1THGA 2VWQA 2CLHB 3DOUA 1GU7A 1GZ4A 4U6SA 3P20A 2AFRA 1G8PA 2VDWB 3O3MB 4QODA 3FTEA 4IF4A 4MS3B 4EFLA 3GCGA 1IRIA 4H3VA 4AJEA 1EXWA 1H3NA 2DH5A 4HNAA 1A69A 1APBA 4Q1EA 4EY7A 3T5PA 1XJ0A 3ZHYA 2D62A 2G0NA 4V24A 4BJ5A 4CIBA 3KYIB 4GVLA 4IFBA 5DP1A 2P8JA 3N3AC 2GR9A 3KJNA 3C48A 4NC9A 2GZRA 3UC9A 3WTBA 4Z7NB 4DV2B 1CJKC 4KDRA 3N2IA 1TT5A 4C6HA 5DNUA 2RHMA 3TSCA 3HJGA 4I55F 5F35A 3GAMA 3Q3JB 1HDXA 4LRWA 3ZV3A 1G5RA 3DOFA 3ZX4A 1WG8A 3HY3A 1MO6A 3WHLA 4E0BA 3MUEA 4CG3A 1NNEA 1EFAA 3ORFA 4PLHA 3AX6A 2GD6A 1JNXX 4W9NA 4YMGA 1M9NA 2CHUA 2VP2A 4ZYWA 1EVZA 1NRWA 5BPHA 4JXXA 1UBOS 4E1VA 1FQJA 2QI9C 4Z9FA 5E9WA 5KNBH 1G6HA 2P7IA 3N8NA 5LD2B 4R8LA 1HYEA 3OM8A 1GKUB 3NYQA 1I4OA 1A8QA 3VJKA 3OEWA 1P1CA 3AJ8A 2BFOA 4F71A 1M2EA 3ZCPA 2GEBA 1YB4A 4PM4A 4B73A 1HSZA 5CCXA 4RKYA 2H0AA 4IRUB 5EWJB 3OOHA 4DJAA 3DE1X 1NJGA 2X8BA 3GELA 1LPSA 3MILA 3TX6A 4AJ1A 4DREA 3GDFA 1HZJA 2IHNA 3B2NA 2NVUA 3N8IA 2YVKA 4L5JA 5GQSA 3EWIA 3GVIA 4PEVA 5JSFA 5AIBA 3RAEC 3AH8A 2CHQA 2XGGA 5CB0A 4YCAA 2HQBA 4AN1A 5J40A 5EJEA 4BKPA 2DHDA 2VUTA 4K86A 4D8TA 1VCNA 3I9FA 5JXJA 5KVSA 1SQSA 2Q9AA 3OO1A 5JVDF 2Q3MA 4WCFA 1TT7A 2FPSA 3ANSA 4K1XA 5A03A 3IXQA 2CXQA 3A7EA 4RKQA 4EGAA 2ODQA 4I3FA 3VU9A 4V0OA 3VR4A 3QEMA 4L15A 4TWIA 3H2KA 2PS0A 4TMTA 2IXDA 3GLHA 3VKFA 2QAIA 4EG0A 3FUWA 1KWKA 2NTNA 3D4BA 4AJJA 2IBMA 2QGNA 1TF5A 2AMVA 1N8NA 3P7MA 4NVRA 5K99A 3H9JA 1G20A 2BHTA 4FHCA 2CZQA 3FTQA 2Y67A 2WZDA 3CO5A 5C37A 5KYXA 1SOWA 1RPJA 1OI4A 2CVQA 5GOTA 5ALIA 3PFHA 2GPWA 5AVKA 4G23A 3AY6A 1PVOA 3L3BA 3AB7A 2E85A 1LQTA 2XVAA 3JSXA 1XDUA 1UIMA 3D3WB 3HU3A 4JLUA 4E3WA 5CBPB 2OMEA 4OGWA 4E5NA 2FPMA 4DMKA 4D0GA 1OU4A 1Y1PA 2B9EA 2HIAA 2I22A 3L7OA 4KQ1A 2C5SA 2O50A 1JG4A 4M87A 3T0FA 4MWCA 2XD9A 2XT9A 3UN1A 2GMWA 2NTEA 1NRJB 2QRVA 4U0KA 3B70A 4BKQA 3F1LA 1QGOA 1XEWX 4JBXA 3ZYCA 1IHPA 2TMGA 3UJ7A 4DR3B 2ZTSA 2XE6A 3M6XA 3OMLA 3I6ZA 3MJDA 3WL7A 2C7GA 3R6DA 4CCWA 4D44A 1TKCA 4B3MB 3MWGA 4TX1A 2OQVA 2ZWIA 3LX6A 3U3OA 1LV8A 1NMEA 1ZNQO 3AQ4A 2VJLA 3BGVA 1PDOA 3B1JA 2XMBA 3GY0A 4NDAA 1ZGJA 1YU6A 2PQMA 3WRYC 3O9VA 4B83A 4D8UA 5C1PA 5I5EA 5K9ZA 3GLGA 1YFLA 3RRMA 4X64B 3ADDA 4JR0A 4OAOA 1TI7A 4UVGA 1GPUA 3MWFA 4FEEA 3ED1A 5EWMB 5BWLA 4W7IA 5F12A 5CX1A 2V7EA 3A2KA 1BSVA 1SVNA 1KIFA 3KCNA 2Y05A 2EF0A 4OHCA 3N1UA 3PF8A 5E1BA 5AJXA 3C8ZA 2IP4A 3LCRA 4YRFA 1TTPB 4KXVA 4LGYA 1MXFA 3LKBA 2OG1A 3PP8A 4AK9A 5E3JA 4HH4A 1QQBA 3D0OA 5CT8A 5M3BA 2ZAOA 4B2PA 3JQRA 1KIAA 4CUJA 4KQXA 3K70C 1KFJB 3GVPA 1E98A 1I3CA 2G63A 4JLKA 2OGUA 3LK6A 4JH0A 1SBZA 3QMMA 3JXEA 4JSRA 1WV1A 2BEWA 3KPWA 4MRSA 2VRCA 1PW7A 2GSDA 3OZTA 2M9MA 3HKCA 4ND7A 3ZJ5A 2DQKA 2WJPA 3ZGNA 4DIEA 3Q41A 2V6BA 3PE6A 2FW1A 4FHZA 4GLLA 4N0QA 3BN3A 1N5DA 4TXHA 4EJSA 4CLXA 1PJ2A 1LPBB 2OCAA 3RC2A 2NTVA 4MJ3A 2AJ8A 3OIGA 2X0KA 3AIOA 3O2NA 5ADHA 3BK2A 2DFVA 2OZKA 1XRQA 2ZRFA 2QX9A 3IIKA 1SO8A 3OQHA 1A96A 1MC4A 2I29A 2VDNB 2QVBA 4KQMA 3ZEAA 1AKNA 3ADKA 3LOQA 3F8SA 2QUJA 4DG5A 2WIAA 1PK8A 3AR9A 1VE1A 3N28A 1VIMA 3I5MA 5BUZA 2Y1XA 2MMGA 2PY6A 1AO3A 2OAEA 4EPYA 1T8RA 3D1VA 3KQNA 3W1EA 2JFBA 4BY9E 1H8HD 3OA2A 2HAEA 5EXEA 2GEVA 5B36A 2ZCUA 2BE9A 1UMKA 1V2HE 2RHLA 2VQDA 4QBGB 4RD0A 4RPHA 5JZVA 4RPJA 2OBBA 3DD5A 3GHHA 4EG7A 3DXFA 1NDQA 3ITEA 1IHUA 1LKZA 2JZNA 2OLEA 4QOJA 4QUBA 3UHJA 5KTNA 3KWLA 4ON9A 3M5PA 3DE5X 1E1RD 3VVCA 1WY7A 2VIIA 3SKYA 2ONYA 2A0XA 3Q15C 4XVQA 4CIWA 2VJQA 2ZKIA 1CK4A 2MOKA 1ZHHA 4MWDA 5HXAA 1SQFA 4OFXA 3K70D 3NAZA 2EFCB 4CUZA 2QZZA 1JUDA 1UKAA 3GG9A 5FTNA 2BH9A 1VIDA 5GVRA 4Q3AA 4HXYA 1NJSA 4UNSA 4RH0A 3EZXA 4KAXA 3ZWMA 3I61A 3VPGA 3NP9A 1HSOA 1EFHA 5PNTA 3X1XA 5BW6B 1SEVA 3MIZA 3WA7A 3EC2A 4QTYA 3VAAA 3NATA 4LSGA 5ULLA 2A5GA 2XB8A 3LQRA 4BDTA 5HUQA 3GMTA 3V4LA 5TIIA 1IXZA 3D59A 3O9MA 1QB8A 3KALA 3SYTA 2H11A 1UFOA 3B9QA 3VRHA 1LDYA 5CB4A 2Z1NA 3IEIA 4UTOA 3UB2A 1MJHA 4AP5A 1E7WA 2IHYA 3IT3A 2FF7A 1C1HA 1J1ZA 2UYYA 3GD7A 1M2GA 3NT2A 3UTCA 5JZMA 1LD3A 1CB7A 3G8BA 3VR5A 3C8MA 1E3TA 4WX2B 2RHDA 4CODB 3MS2A 1PD0A 3NZEA 2PSSA 2NO0A 1I4LD 3K15A 2JBHA 4IYJA 3KSRA 5MFZA 4HDRA 5D84A 3CFYA 2FHPA 2Q29A 1GNPA 4RE6A 2C0QA 4O2AB 5SZJA 4DEVA 1WCYA 1TXGA 1UDBA 4TN5A 2L42A 3RS3A 5MGNA 3MWDA 4P0PB 3GQVA 3WDSA 3MCWA 5CA0B 2GEFA 1T2UA 2Y1GA 4RGQA 2OR3A 2FQ1A 4DSUA 4P7GA 2P1DA 1SCAA 1FEZA 1E2GA 2V98A 4JYPA 4J3JA 4MRAA 4BNKA 1D2NA 2W0MA 4C05A 4EAAA 1RXCA 5JO0A 1GJRA 4EF6A 4KQKA 3EG9B 3MCZA 3ED5A 5JAPA 5C80A 4D4KA 1J6UA 1G63A 1XD9A 2ZQZA 4G5GA 2H51A 3UT5B 4KO1S 1SXJD 4ARVA 5KX5F 3SM3A 3AVXA 2WJGA 1PUIA 5EJIA 1P7CA 1E32A 1JHXA 1ORIA 4J9UE 4ZRMA 4KR6A 1ZIDA 1K5HA 1TYAE 5TQVA 3WHIA 3T1YB 3EGIA 3QVWA 1JVBA 5HCUA 4JI1B 1X80B 2R6R1 1W87A 2CNNA 2A84A 3QPAA 3PV0A 5DTRA 2JAHA 3N8HA 1WRBA 3R44A 3G6WA 5AOBA 1Z06A 2NUPA 3KUDA 4C7XA 1IYZA 1ZM2A 2YRXA 1PJSA 5AKYA 4WACA 1BU5A 3GL9A 4R0MA 1FTYA 2IEAA 2DQYA 3DDNA 3G0GA 5A62A 3KM0A 1EJBA 1W5SA 1F12A 2WF8A 4Y2JA 4HDAA 3P1JA 1JDTA 2VNAA 3LUJA 1DBQA 2VT2A 4G0QA 3LPCA 5DTJA 2Y71A 1Y1QA 1ZWLA 4IDQA 4V3CA 2QG6A 3OPVA 4X6YA 1OBHA 4HNSA 5B3KA 1NE7A 2HQSA 1OWLA 2G28A 1V47A 4M37A 1FX0A 1VIVA 1ZMXA 4JJ8A 4RV4A 1KMCA 4WI1A 3TXAA 4BNDA 1M7GA 3G13A 4HDSB 4DT1A 4XTCS 3AEXA 4EYKA 4UTVA 4GICA 4OMCA 1UBKS 1Z2PX 3VOAA 3ICVA 3ZY6A 2A5FA 3D6VA 4MO9A 3TRJA 4V0KA 4P6VF 5DYWA 5EHXA 4OSPA 3SF0A 1KJ9A 5ILQA 2BFEB 2XUPA 3IKJA 3I9NA 4F56A 3DBLA 1RT9A 4F2PA 1TEHA 1ZUNA 3OSUA 3ZS8A 1HNWB 2B8EA 4B34A 1PGNA 1R8XA 4LSMA 1VGQA 3C5HA 5KYUB 3KPYA 4URUR 5AW0A 3ANMA 3O7WA 5JYEA 5KYTA 3KTDA 4F3NA 3IB3A 5F51A 4MPTA 2VP9A 4YECA 4MWEA 2QD2A 3K32A 4E46A 1Y6ZA 3ENKA 4HPJB 4PYMA 5EP3A 5TQ0A 2AG5A 1D9XA 4KTTE 4BU0A 1W49A 2JIZD 2HREA 5KJCA 4QGHA 3TUZC 3MTAA 2JI8A 1PR2A 3MINA 3I04A 4R7ZA 4EECA 1LJUA 1ZI8A 2BKAA 2JHFA 3Q87B 1XFAA 2DHQA 2H1RA 5IW8A 2C7OA 4TXMA 1NG9A 2BFWA 1DWOA 4L0CA 3EA4A 2AFIB 3QUCA 4NMLA 1F5SA 2DHRA 3BMOA 4XQ9A 5A4KA 4QNMA 5KCZA 1DT5A 2W2TA 2ZAYA 3CNOA 3O8QA 2XJ9A 1ZGHA 2I2XB 2GCIA 3OFND 3PI7A 2J46A 2GJKA 1E4YA 1OWOA 2W6OA 3ZK9A 2ZRBA 2CXPA 4YRAA 3PNVA 1AUQA 1YE8A 2F4NA 3PKJA 2Q21A 5A9SA 1DP4A 1AOXA 3GLVA 4WKPA 3ZE8A 1W36B 1TPZA 2M6KA 4K6HA 1F7VA 1XRPA 4TSRA 3VZBA 2Q4BA 4IKPA 3T8YA 3G0HA 4CMJA 3PICA 4GYYA 1O0SA 2JH9A 3DZDA 1TKRA 2VHTA 2QN8A 2XE8A 2ZR8A 4MHTA 2H6EA 1Y3BE 4G0ZA 2WVHA 5IMBA 5FI3A 2W2PA 4F1KA 1V9CA 1OWNA 2Y2VA 2XXAB 3HACA 1Z8DA 1NF8A 3ZHZA 1NNI1 1XA0A 2DQSA 1YONA 4JLVA 1GZVA 2WAXA 3RTAA 5K5EA 2FE1A 4Q6BA 2PS9A 5CXUA 3PGVA 1OLXA 3PIDA 3FYCA 4PZEA 1OYVA 3FNIA 5J9FA 1JA9A 5CJPA 3A6EA 2JASA 1P91A 2R8PA 1QQTA 3CBGA 3GLQA 4QO7A 3TRHA 2QD4A 5L3RA 5LDHA 1AGYA 3LYHA 3R3UA 2XB9A 4MW5A 5C8VA 3LQ1A 3VXKA 2I8LA 3PC8A 4CI0B 3TZKA 5ERGB 2V4ZA 2XW6A 1CYEA 3IE0A 5JCPA 2VQSA 2QT1A 2XOKD 2Z8YA 4JQOA 4MVJD 4OP2A 3W9UA 2RH5A 5IC6A 2ID7A 5G0UA 4BEBA 2PZFA 5HGXA 4U7FA 2VWHA 4YRNA 4MVCA 3E8XA 3LBHA 1YDWA 3NM4A 2HT6A 2JNWA 3QK7A 4RZQA 5DTIA 1SCDA 3W79A 2ZI4A 4D99A 5JBQA 1LVHA 2BHNA 2WJAA 1X7DA 2IRWA 4LDPA 1NI4B 4YDSA 4PLFA 5EJFA 4DGQA 1USIA 4W1PA 5J2TB 1C5KA 5ITVA 4PG8A 1GT6A 4YUVA 4K40A 4W5TA 1H85A 2F7SA 2FWIA 1L5SA 3KKZA 3OH8A 4ZAYA 2BHRA 3LT4A 3A27A 3N7AA 5K0JA 5LQUA 4Z9XA 2H4XA 3O94A 1E1QA 2ZVDA 1SIWA 3DPIA 4Q34A 5IFLA 3QPUA 3R9WA 1TJPB 2P35A 3E35A 5K1ZA 5ITZB 1ZMRA 5H3LA 1EJ2A 2FOLA 4Z49A 4MGZR 5JWOA 3V4PB 4UTRA 3WIUA 4ZI7B 1A1VA 3RG2A 1A04A 2F3TA 2YASA 4YMWA 2ZRJA 1OLXB 2FPGA 2JKYA 4NZPA 3UK2A 2CLCX 4X1YA 3IULA 3LFUA 2OSBA 4MWZA 1T24A 3DO8A 2OFOA 3JQAD 1XFDA 1CHDA 1RXEA 4XB2A 5EJ9A 4S1PA 2X1HA 1QAMA 1ZSVA 1DWQA 1Z73A 3TW8B 1TLTA 1V45E 4QYMA 4RPLA 4BNDB 2RGXA 4G6ZA 3B2EA 2NSDA 3CQ9A 5IAKA 4BWYA 2AHOA 4OHXA 1HDGO 3KTFA 1W35A 1UR5A 4C08A 3EZGA 4GWKA 4DYDA 2ZXEA 4QQNA 4G26A 5E1DA 3WJ2A 4B7ZA 4I1YA 4MULA 9ATCA 4B3GA 1IUKA 4ZAWA 4QREA 4C1BA 4MCAA 2REOA 4ES6A 1N6PA 3OCJA 1ULUA 3Q3IA 4EG4A 2QBYA 1JI3A 3AUKA 3G0DA 3EFHA 2Z2KA 4FFWA 2BPOA 4K26A 3S7ZA 3OA0A 1I32A 2P90A 1YDEA 1GZ6A 3UEOA 1EAYA 1A8PA 2GXAA 1Y7LA 4MYRA 1MAVA 1G41A 1MQ8B 1SD2A 3A4MA 3AC0A 4WNYA 4GX0A 4GX5A 1P3JA 5EVCA 1KI3A 2Q7DA 2XNHA 4WCVA 5DHPA 4ZJYA 1I80A 4AY4A 1XYVA 1SCUA 2RHOA 1HPLA 3EYAA 2PJDA 5CA1F 4J0CA 1J20A 1YZYA 2PPLA 3ASVA 3C6MA 4UNIA 2DSTA 2RSLA 4JT2A 1L6IA 1KZ7B 1W0KD 1EWYA 4YA6A 1D5WA 2WWWA 1VSUA 5FO0A 3OZGA 3OZAA 2EWWA 1SVSA 3ESZA 4NU5A 4ZO9A 2JHCA 1GN8A 3QF7A 1FSPA 4PYJA 2Z2ZA 3AETB 4N01A 5G1PA 3PUYA 2JARA 2VF4X 3W5HA 1GFWA 4NNOA 4INZA 4DLWA 4CEIB 2QTCA 3DMTC 3OCCA 5JAOA 2JA2A 4FCVA 4GDFA 1Q0UA 3TQFA 2Y92A 4NCNA 3H19A 1MA3A 1M6EX 4I55B 4ENRA 2P3OA 3HJTA 2ZPAA 2EGUA 3AETA 3MMPA 2O8EB 1HNZB 3H0CA 1YVRA 3RYCB 1I1OA 5E4TA 1G1AA 2H4ZA 3MRSA 1X19A 4L27A 4BOYA 4J7CA 5BR7A 1M1YE 1MKYA 3IKTA 3MWJA 4KE6A 1OAOC 3DVQX 4XXHA 5DWQA 1RYMA 2QTWB 1K5GA 1IM8A 1JDSA 2Y1WA 4LXUA 4ND5A 1FLDA 3Q2KA 4R8SA 2HDOA 2WNHA 3GMDA 3W3AA 4M8SA 4X91A 1FRZA 1PFQA 3C3XA 4DKXA 4LYYA 4DRZA 4EYSA 3COSA 1GG9A 2BAGA 2O6HA 4MR7A 4MGYR 4F21A 4ZDIA 1WBBA 1FRFS 3EIOA 3AVQA 4PSVA 5C5EA 3OTGA 4JLAA 3A9TA 3K8ZA 4TKZA 4F3KA 1KMNA 2DAPA 4RS4A 4DWOA 2WP8J 5ALFA 3KKLA 1ENZA 3KUUA 4UREA 3A0UA 1N3IA 3G2QA 3QKTA 1GL6A 2QX6A 4ALJA 4HO1X 3G6KA 5EJ7A 4OO3A 1YR1A 1DC7A 2XBMA 1JPVA 2FFAA 1FQOA 5AWFC 1ARZA 3ZV6A 1FMLA 3FETA 1AUOA 2PL3A 3UJCA 5IM4A 2F1IA 3OM9A 3OCUA 3QXXA 1YB2A 4XIGS 2I6UA 5K09A 2BEJA 3KB2A 2GPJA 1LNQA 2WSYB 3RNLA 2A1UA 1QQ7A 4XLTA 1QK4A 1W5BA 1PD1A 3J7TA 2GPTA 3D8BA 1Q0ZA 1YS2X 2C5BA 1UT8A 5IEJA 3WSTA 5A4IS 1RKVA 5B12A 3B5IA 4RFSA 4DKJA 2QYOA 3TQHA 1BRTA 4D9BA 2VATA 4XD7A 4J3FA 2DPYA 2IPMA 2W7TA 2PT6A 3SYLA 3HVUA 3PDWA 1Y4UA 2PCJA 2QN2A 3QLJA 1QSGA 3GEMA 3I1YA 3ZE2B 2VUSA 3EQ2A 2I9KA 1V6CA 1UANA 1ZEJA 2DP4E 1QYWA 5MHTA 2Y9PB 4I5EA 1W52X 2FQWA 4AP9A 3GGCA 1YK0A 3JAWA 3SLKA 4R9NA 4BRUA 1VL1A 3FWHA 3UAYA 1ISPA 3H2GA 2ERYA 3LQYA 2PCLA 3BOSA 2EWVA 5HQJA 4CM3A 1YNSA 3WMRA 3CRVA 4W82A 4MV8A 2R6FA 2B7BA 1HLPA 3JVUA 2HYIC 5B6JA 3MXTA 4H31A 2UZ1B 3N53A 1WUKS 2JCYA 2A0WA 2QTAA 1U7DA 2CK3A 1IN1A 1YCHA 3RQSA 5DOZA 1UC9A 5LWQA 3EEFA 2EIXA 4X1YB 1N7GA 2N46A 3U44A 2H1OA 3ACCA 4MQ6A 4ROTA 3JQDA 5KNCH 1BFDA 1JU4A 4H6WA 4NI5A 4W5QA 2Q4TA 3QHPA 5IVHA 3R7SA 4D5GA 4IBOA 1GA4A 4I50F 4XIYA 1O97C 2O2YA 2C00A 4CTMA 1JEDA 3JTMA 4GECA 1C1XA 1JDNA 3ESAA 4MB6A 2ZR9A 5LBTA 2GAAA 3G0OA 4GR5A 1U1DA 3AR5A 1QGYA 3D7LA 3HFRA 4LX8A 1XCGB 2ISCA 1YQGA 2YOGA 2B0JA 2YQ4A 4OYRA 4TKVB 3JCZA 1M2OB 3D3EA 3MAJA 3PPYA 5FUMA 3GXOA 2IS4A 1G7TA 4B48A 4YDQA 3GYGA 4KWTA 3S6JA 3R4VA 4JYCA 4ZEMA 1QF7A 3T3EA 3TQIA 4RORA 1T10A 2ZIFA 4O5OA 2ZPTX 5FH9A 2YQZA 2VBFA 1N25A 3N59A 4QBKA 5FUBA 3CUSA 4IOKA 2CLLB 3GBVA 3RLFA 3OIDA 1JAHA 4HR7A 4FE4A 3MB5A 1U2DC 1ADJA 1N92A 1C7QA 1T6XA 2VNKA 4FOLA 4B17A 4CLRA 2JCXA 2BMWA 3TLGB 1W5AA 3ZWOA 3NRBA 3W5AA 3K20A 4UNRA 5BP7A 3KAKA 2HZ7A 4HQ6A 3QXJA 4JYMA 1FYFA 1XMOB 2AZXA 3L8MA 1FFBA 3AHCA 3J80A 4JODA 5GJBA 2ZUWA 2X2EA 1JI0A 2XYVA 2AD1A 3M82A 3QLTA 1Q6YA 3ORRA 1P2FA 4RS3A 3F9CA 2BWJA 2ZJ6A 1TJNA 4I6EA 4GXRA 4K9MA 3HTXA 2E0IA 4GL2A 3HWX1 2W83A 3SLGA 5DNWA 3FVRA 3LGSA 3M81A 2DF8A 4G1EB 1Q77A 1ZXXA 2BDTA 5TEVA 3E5HA 1NBWB 2QM3A 2AF3C 3BKWA 4ER3A 1VPDA 3GAFA 3A6PC 3AB8A 2IDKA 3DL7A 2YN0A 2NSHA 4FLFA 3FWZA 4PXAA 4Y3UA 4R1SA 4MIOA 1BFUA 4J1TA 1XL1A 2PGIA 2WOJA 2Z1DA 3O8LA 4OK5A 3D6TB 2H2IA 1AS2A 1OLOA 2HDHA 3O1HB 4ZVMA 2QR3A 4B82A 5KMGA 1FOEB 2Q2WA 3UGKA 3T95A 1YL6A 4C4ZA 4CFYA 3NMUF 5F98A 3P9YA 4DJFC 1C8LA 1S3SA 5KX5A 2O1XA 3HCBA 4ZXPA 5JV5A 5EI5A 1GGVA 2EAUA 4NIMA 3BZBA 2GNPA 2XBUA 2DT8A 3MAGA 5KJ1A 1JJAA 4Y0NA 3ZKWA 2HU8A 1QIJA 3B1FA 3PHLA 3QTBA 4FSHA 4MCJA 1JIIA 2ORVA 4YALA 1RIFA 4A2WA 3FVQA 4JSYA 1EFLA 1O95C 3AL3A 3CE9A 4R84A 3L4KA 4ARIA 3QRWA 3FPCA 1NQWA 4NG4A 1GZ7A 1PJ4A 2AG6A 2Q1WA 4LXGA 1T6ZA 4OBBA 5C5DA 4RLQA 3LPDA 4KXUA 2L69A 1E1DA 2FKAA 4R9UC 4N0EA 3HEBA 3MTGA 4BMDA 4ZCRA 1AV6A 3ANYB 1Q12A 1XEXA 4DCOA 3G9ZA 3NTXA 3SXUA 3UICA 3QNWA 3G2LA 1XV5A 3FNEA 1CJVC 3ORSA 1FNCA 1KR2A 1PT9A 2I67A 2JI7A 4DNPA 4JJ4A 2WJVA 1N5LA 2FQXA 4ZFNA 5FYDA 5SY4A 1TUEA 3WNCA 1CZKA 5AM2A 2FWPA 4NABA 3CPEA 2JGIA 3DBVO 1EXVA 1P1HA 3NPAA 2OECA 1L4NA 5HBRA 3UMBA 4S2UA 3D8TA 2BT4A 4BKMA 3A4LA 1I51A 3FOEC 2J67A 1UJMA 4OHWA 2OWEA 1X0XA 1J8DA 2ANBA 2QK4A 2I3AA 3JS5A 2OXRA 1Z6XA 4WWHA 2VSYA 3BIFA 3EBLA 4LJSA 3CRRA 1NVWQ 2OCLA 2LR0A 5LC1A 4OHZA 4B85A 4EJSC 3ICCA 2WAYA 4TQ9A 4OQQA 3I2JA 1JTFA 4Z2YA 3TDNA 3DZKA 1UXKA 1E2MA 3LP5A 3U0VA 3UPDA 4AJKA 2XCRB 1CSEE 4Z86A 4ZK6A 5BUCA 2UDPA 4OLAA 2D0OB 2W22A 4HVAA 4KI7A 5HE8A 2CSXA 2Z98A 5G0VA 4LZAA 4CIDA 3NUGA 4TLAA 5HF8A 1R6DA 1DRWA 3FDIA 1XXLA 1KAHA 3DAYA 2X7HA 3Q3GE 3R5FA 4HUQB 4IICA 2X6QA 5F52A 4YQZA 2UYGA 5B4TA 2ZITA 5JEEA 5JCZA 4Q7KA 3ORQA 3RTGA 2QRUA 2ZREA 2OHGA 3JQCA 5IKXA 1Z3IX 2YWJA 3IR7A 3HGTA 1E66A 3ICPA 4HEHA 1QNFA 3RRXA 2RAUA 3TNLA 4KQ9A 3FJOA 1LPPA 4FFLA 4CM4A 1HM5A 1U2ZA 4QYTA 1P2SA 4MITA 4TMWA 3SQXA 1P1BA 2H4HA 4CM6A 1L7QA 1Q50A 4DDKA 1XKTA 3DMHA 4IKEA 3U0BA 1M83A 3PQ4A 5IUNC 4M0KA 3NNNA 1RMYA 2C95A 4M7OA 3FCUB 1O58A 2OL4A 4OQEA 4UBMA 2CW5A 3UKDA 3B53X 4GPEA 5ADUS 5A3SA 1Z6GA 4ZVSA 3WLIA 3U61B 2PGJA 4MH0R 4LJ9A 1YK1A 2JIZA 3CNEA 5FOQA 1FJHA 1JIUA 1QFZA 2V0NA 3IA2A 2PGAA 1ISIA 4DE5A 4BNFA 4MCIA 2HHAA 4KBFA 3NYRA 1GD1O 4BV2A 5ITZA 1IE3A 4UXJA 3OHSX 3MRTA 3UW1A 1KI6B 2IHTA 5KOJB 4UHEA 4NWIA 5JRJA 2PS1A 2OO5A 1JSZA 4HUJA 2CDBA 2HMYB 2Z6AA 4LIPD 4G0PA 4QRHA 1Z4KA 4XA8A 3CPJB 2JD0A 2ZDQA 5EHGA 5LUAA 3M1IA 4EW3A 1CERA 2H4FA 3GJYA 2PDAA 3PXDA 1P4GA 4A73A 2XNDA 5AFSA 4B7CA 2ZS9A 4LXYA 1RXWA 2C3YA 4LFBB 4GX1A 3IP9A 3HVRA 1XE3A 1YJ5A 3MGBA 1SKAA 3U1BA 4R2WA 1ADCA 1N2CA 1NVGA 2HK9A 3G9TA 5ILGA 1P77A 5BRAA 2PFKA 2Z2IA 4OJKA 4QGAA 2NMVA 4KO8A 3U1VA 2YQ5A 3LXXA 3U4CA 4RANA 1FP4B 3CVJA 1FDIA 1VZ2A 4JKIA 1DS6A 3I76A 2HA4A 2HI0A 2XKBA 2XX3A 3PC6A 5BN5B 2P62A 3CNBA 4GM4A 5AI9A 3IIJA 3GG2A 4HVTA 5A7GA 1BJKA 4DCVA 2R11A 5IULC 3CW8X 4RWZA 1RR6A 1HQYE 1NVTA 2BGLA 3HCNA 3N0RA 4Y18A 1E3IA 5AYVA 2O0LA 1CQPA 3W7VA 4AZ0A 5HTOA 3CLUD 2C9CA 1FA9A 3ZXYA 1NM5A 1XA4A 3ESXA 3P9SA 3B51X 4FT4A 4LYAA 1KZ1A 3AEUB 3JR7A 5G02A 4PXYA 4R1NA 2A94A 4NNPA 1V3QE 2ODWA 2R3SA 2ODAA 4O2BF 4UBIA 4HGQA 2WDZA 4NYMR 4YFYA 3GRPA 3JAKB 1S8AA 4BBAA 5DYYA 2BE7A 3I83A 3TZBA 1ZONA 4CL8A 3UXYA 3OQBA 2JGEA 1YL7A 4Y6PA 5LOVF 2GRUA 1UBNA 3RSZA 1NPTO 3UO8B 1JF8A 3KJFA 2G8NA 4RVDA 4ZI7A 1OH8A 3EG9A 4XFKA 5K0GA 3QV2A 4NHEA 5M34A 3ROTA 3TDKA 2MR6A 3INRA 4TKMA 3FCEA 3DF9A 3SSMA 4KN8A 4G9BA 4AZSA 1SHZA 1Y3FE 4L0QA 3JZMA 4ZOAA 1X9IA 3DMNA 4UMDA 3CEHA 3D2BA 4EKYA 4Y98A 5BUSA 2TS1A 2BJWA 3DCIA 3USCS 4A0FA 1DBIA 4NBRA 3KQUA 1N2XA 1QFXA 1TUBA 2VDRB 4R1UA 3RGGA 4W5RA 3TLEA 1G59A 1R6UA 3ZGXA 1UC8A 2FVXA 2IIBA 2RHRA 1ZVKA 3EGCA 5DRTA