2DPXA

Crystal structure of human rad gtpase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
165
structure length
146
Chain Sequence
b'SVYKVLLLGAPGVGKSALARIFGGVEHTYDRSIVVDGEEASLMVYDIWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein RAD
publication title Crystal structure of human Rad GTPase of the RGK-family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 146
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dpxA00
2RHDA 4XD7D 4NZYA 1NVXQ 1YZNA 1KK1A 2Z0MA 3GQBA 3KL4A 5JCPA 1BO6A 1OSNA 5FPTA 3TAHA 1OJLA 4MH0R 3GJ4A 4AIIA 3LX5A 1Q22A 1ZP6A 4JT4A 1ZM3A 4KHZA 3A4LA 4KVGA 3GLFE 3TBKA 1S3SA 3CX8A 1U2RA 3GJXC 1Q0UA 3EXAA 2J0SA 2A78A 1NKTA 1ZBDA 1FMLA 1MO6A 1TADA 4IJMA 4K81B 4Q4JA 4RZ2A 3HU2A 1EFUA 2WAYA 4MKGA 3QF4A 4MRVA 3A4NA 2YZ2A 1H8HD 2QMOA 1VG0B 1AIPA 2G1JA 3FHOA 1KDRA 3MUFA 3UXMA 4HLCA 4IVRA 4UJ5A 3GLIA 1UADA 1M7GA 2F9LA 3D6TB 3I8XA 2AK3A 4YXWD 8OHMA 3GPLA 3K0FA 3SOPA 3A58B 3OF5A 2D7DA 1S3GA 2F9MA 1GKUB 5K8TA 4JLKA 5AJYA 2HLDA 3EZ7A 4Q1EA 4Q18A 1IY0A 3RSLA 1PLKA 1T6NA 3U7GA 2HV8A 2IS4A 3IIJA 3LVQE 5FL3A 2XX3A 3B8HA 4OL0A 3ONWA 2WPDD 1D6JA 1E2GA 2ZU0C 3U5ZB 4IVQA 2FG5A 2NO7A 3H84A 1H8EA 3NHAA 3QNUA 4BFZA 5E3HA 3QF4B 2OBLA 3FFBA 1GITA 1IAQA 1QHSA 3SBEA 2HT1A 2IK8A 2BOVA 4FCVA 4FI3C 1W36B 1ZNWA 1W7AA 3A6PC 1YRAA 2ORIA 3BJIC 2V7QD 1Q3TA 2KBFA 2ZE5A 5IF9A 4P0TA 3F3YA 1MABA 1Q44A 1N6NA 3UWOA 1GUAA 5K8IA 2VP4A 3QI2A 1E9BA 1LNZA 4GL2A 4YQFA 3LFUA 1KI2A 4M9XA 2ZRIA 3FKSD 3OHMA 1E2DA 4I1UA 1Z2CA 2H7VA 2Q9BA 3AQ4A 4Q9IA 5L3RA 3W5JA 1Z83A 3PUVA 1HT1E 1XTIA 1Z0DA 2VHUA 4JSTA 4CEHA 3AP1A 1MABB 3WXMA 2OV2A 4V0LA 3EZFA 1CTQA 4FCWA 1U0JA 1ZJ6A 4L4UA 2J7PD 1Y63A 2ODBA 5FOXA 4AYWA 4MGKR 1ZCAA 2H92A 3BGWA 1G64A 1E1QD 1AZTA 1AS2A 2FEMA 2W2TA 4NHOA 4P4TA 5EP1A 1OT3A 2QUZA 2OFWA 2W6ID 3WY9A 821PA 2ERYA 1M7HA 2WSSA 4C0BA 3T1TA 3RC3A 5DE3A 3THYB 4HDQB 4OHYA 4LK2A 3VX4A 1CULC 1XTRA 3RRMA 3ICEA 2JJ1A 1E2KA 3B2EA 4LRWA 2O8CB 3ADDA 3ZD6A 3DHWC 3B7GA 5UKDA 4DIEA 3OZXA 4PXAA 5FFMA 1CR4A 3LX8A 4TZ0A 3IDQA 1OXUA 2GBLC 3TE6A 2PMDA 3EIEA 2DWOA 2J3EA 3FE2A 4QG7A 2QTVB 2P3SA 2HCBA 2OT3B 3FB4A 2BBOA 4OI4A 1Q12A 1O3YA 4V0KA 3B5JA 1I4DD 5KSOA 4LDJA 1NKSA 5SZKB 1E4VA 2P65A 4EPRA 1MOZA 3I72A 3LDAA 2OCAA 4KBFA 3HPQA 1IBRA 2N42A 4QC2A 4JLPA 1E69A 1HEIA 4JIMA 4NYIR 4BLTA 4PSVA 1LB1B 4AG6A 1NN5A 3ZLJA 2B92A 1T0HB 4PSAA 3RRNA 4AURA 2PH1A 5CM8B 3LO5A 1AGPA 3U3JA 3MWJA 1D9ZA 1EWRA 5J4KA 3C16C 4HAYA 3B78A 3EPJA 1YZTA 2VA8A 3EC2A 2JLZA 4KFTA 4Q4AB 5KHOC 2CK3D 2QMUA 3NBZC 1IN7A 2IBMA 1U9IC 2VF7A 4OJKA 1YRBA 5CJPA 1OXTA 1OKKD 1UBEA 4KU4A 3SHFA 3AEZA 4TT3A 3KQKA 3EIHA 5J4LA 4Q9LA 1SXJE 4OK5A 4Q7KA 3B82A 1CRQA 2GJKA 2V8OA 2QENA 4IDPA 4KYIB 5KSPA 2WIAA 2ONKA 3GJ0A 1JI0A 1UBCA 1P7CA 3HYRA 1VHLA 2Q3HA 3Q7PA 3TLXA 1P5ZB 1W0JD 1X8LA 3LRPA 4D4JA 4D25A 2J0QA 2W83A 3SQWA 3SHWA 4MRPA 3EIQA 3BFKA 5FTJA 4LBYA 1KY3A 3ADBA 2J45A 3BB1A 3HYTA 4OJQA 3VFDA 4OHVA 3U3KA 5AK0A 1E2FA 4C2UA 3TH5A 2A5FA 2RHMA 5JZVA 2FFQA 1OF1A 2FMXA 1FQJA 4C30A 1CJKC 1EESA 3OAAD 4A1FA 4D26A 1ESNA 1VDZA 3QEJA 4OQMA 4TQ9A 1Z6XA 5IRCD 4N3NA 4V02A 4QM6A 3Q5EA 4OQLA 2CEAA 2MMGA 2ANBA 4LBWA 2FDCA 3E70C 5G3YA 3B9PA 2EW1A 4IDQA 4Q48A 2XOKA 1FUUA 2DFTA 4FMCB 1DG3A 3QKRA 3I32A 3KUCA 4ARZA 1W1WA 3CPEA 5FOUA 4M1KA 4CIDA 3SE0A 1ZD9A 2QZ4A 2XSZD 3VR5A 4W5JA 1R8QA 1X1SA 2EVWX 2PCLA 221PA 2FN4A 4E5UA 2IEYA 4ZI2A 4LCBA 2GF9A 2QT0A 4PZZA 2BV3A 3TSZA 3EW9A 1S8FA 3MRSA 2GXUA 1IM2A 2QMHA 2V1UA 1E9DA 3K0AB 1W5SA 1SKYE 2J87A 3L82B 1N6RA 5JSZB 5DO9A 1OH8A 4GRAA 1PZNA 4MUAA 4NH0A 2ZEJA 5HE9A 2XNSA 1SVWA 3CM0A 4CRWB 3KDSE 2VPPA 3BC1A 3QKRB 4L9WA 1TAGA 4UXJA 3PUWA 5HPYB 4XJXA 1Z0JA 1U8ZA 5KTYA 2H57A 4FWIB 4TMXA 2BCJQ 4CT4B 2QAGA 1KNQA 3CNLA 1LF0A 4PR0A 3V00A 3VKGA 3P27A 1ZUNB 3K9GA 4RZXA 2BMJA 2QEQA 2RH5A 2CHVA 3GLHA 4RD4A 4RKFA 3T12A 4DCNA 1IY1A 3FMPB 2HJVA 3MD0A 4TWZA 3LA6A 4I1SA 1LV7A 4IW3B 2KSQA 2WMOB 1JJVA 4I1VA 4EQ6B 1E2PA 4TL8A 2WWYA 3QBTA 1RPZA 5CYPA 1DPFA 2WWHA 2AWNA 3WP0A 4DLZA 3LY5A 1YQTA 1SVKA 3D7MA 2O8BB 3M4YA 1F48A 1QVAA 2NQ2C 1NRJB 4TYQA 2C78A 2CVHA 2ERXA 2FZLA 3IEVA 1UF9A 1KDPA 1E79A 1F60A 3H4MA 4QNRA 1CR1A 3EA5A 3M6AA 2IYWA 2VO1A 3GLHB 4JVMA 1UAAA 2QPTA 3I61A 2VQSA 1KOFA 1G6HA 3OEEA 4HAUA 4TQAA 2RGEA 2CLSA 4XWAA 4PZLA 4AKGA 1TQ4A 5DNYB 2CVFA 4M1MA 1R0XA 4C0JA 3IILA 2G3YA 4X8MA 3FMIA 1UKVY 4PPNA 4B73A 4D0GA 3AVQA 4D2IA 4TYWA 4E22A 5FTKA 4MRNA 1N3BA 3VNVA 1SQ5A 2UVQA 2J1LA 4WAUA 2CNWD 3BD9A 4JKIA 2IC5A 1GZSA 2QA5A 4AWXA 1IY2A 2ZTSA 4D4KA 4ACBA 4QJ3A 3V9PA 4QOSA 1XNJA 3GLGB 1S1MA 3EZ6A 1OIVA 1SHZA 3BB4A 2VSFA 3CRW1 2NGRA 3L2OB 2C95A 5C4MA 1IHUA 2RGNA 3C4JA 1KK0A 3RWOA 4D80A 1KJZA 1EG7A 2YHSA 1KGDA 5CJ2A 2IWRA 1MKYA 1MT0A 4XSGA 2IWHA 5F9FA 2ZI4A 5HKKD 1OH6A 2UKDA 4IOKA 3CX7A 3G5UA 1JQJC 3NC1C 2QMEA 3OEHD 4BLOA 4LYJA 5JEDA 2J9RA 3JZMA 5DISB 2ONJA 2PCJA 3BXZA 1QHGA 3O8CA 2WOOA 2LWIA 3K9NA 2WMNB 4GOXA 2I1QA 2AFHE 2NG1A 5KUTA 3UG7A 2ZRGA 1VYTA 1CIPA 1K5GA 5D3QA 2YYZA 4D0LB 2P6UA 4K46A 2QGNA 2V1XA 1W47A 3MMPA 3CRMA 1NMZA 1NG9A 4OKSA 3IBGA 1XWIA 1YR6A 2G6BA 5EQTA 3QJYA 3RLFA 1TPZA 4JVLA 3QIAA 4GOJA 3T34A 2I1VB 1KO5A 4XVUA 4ZIRA 2IS6A 4NYJQ 3T35A 4TTRA 3TK1A 2H8KA 4F93B 1GRNA 3RHFA 3K1JA 4DC9A 3T1OA 2N46A 4ERNA 4HSEA 2J46A 3W6PA 2DB3A 1W36D 1XMVA 1NLYA 2FPLA 3ZQJA 2EWWA 2ZQ5A 1KI1A 2GCPA 5L3VA 2PZEA 1KZ7B 4KFSA 2F7SA 2WKQA 1IQPA 2WBLC 4BWYA 1LFDB 1NI3A 1JXMA 2FZ4A 1G3UA 3THWB 1CJUC 1RJ9B 2VHQA 5F2EA 5JJLA 2D62A 5LB4A 2HLDD 3QOFA 4LPSA 1GL9B 2WOJA 5E7JA 2JEOA 4WW0A 4DBLC 4LWZA 3ZS8A 1TQDA 1YZLA 2BEJA 1H8ED 2MMCA 3FGNA 3TGPA 4LJ7A 3RS4A 1WRBA 4DLWA 1ANKA 1FL9A 4GP6A 5M04A 1G8HA 1R10A 1S9HA 2EFGA 1VYUA 5JFGA 3VR3A 3AVTA 1J2JA 2D7CA 1VCOA 1DVRA 2W0MA 1NN3A 3FDIA 4CDGA 1R5NA 2QTHA 2UZ3A 5BYJA 3X1ZA 4UNSA 6Q21A 2QQEA 1PUIA 4IEEA 2EWVA 2IT1A 4BFUA 2BKUA 4GP7A 1Z22A 4BRWA 721PA 2EFCB 5CB6A 1HYQA 1K8RA 2GDJA 3ECCA 3Q5DA 3KXLA 4NE2A 4PPQA 3S1AA 4HYYA 2GHIA 2ZJOA 3K09A 3NEYA 4NYMR 4V0ME 1AM4D 4JL5A 4DZZA 4AKHA 1HH4A 3D31A 1F2UA 4TLEA 4NDZA 3PQCA 1F3OA 1G6OA 2A7QA 4A0RA 4NKRA 4UNQA 2REXB 1Q21A 3CF0A 5FPYA 2HYIC 4PANA 5JHHB 1GL6A 1UFQA 2FGJA 3O8DA 4A15A 1OE0A 2DFLA 2C8VA 4HZIA 4M9QA 2E1RA 4HAXA 3K9LA 1GNQA 1G3MA 3SYLA 4W9MC 1ZAKA 1XD8A 4TYYA 2ZREA 3KTAA 4HUQA 4IOJA 2ASEA 1F2UB 2Z6VA 2GNOA 1WE2A 2NO6A 2PEYA 2WSSD 3T5DA 1KAGA 4QNMA 1A4RA 4ESHA 2ZU6A 1OPXA 4IFBA 4LZZA 2Z43A 3CNNA 3QVVA 4P4UA 5EE0A 4A0HA 2JJ1D 2QT1A 1HURA 1Z6TA 1KI3A 3CR8A 3NDPA 1RYFA 2ZRHA 4JLVA 4URUR 3QG1A 3WNCA 5CB8A 2I3BA 2JCSA 2WJVA 3DKPA 4UNRA 1UBFA 5DIFA 5EZ6B 4KCGA 2JGNA 4KFRA 4EPVA 1F2TA 1ZU5A 1HY3A 4RJLA 3K8YA 4FMBB 5B30A 4C4PA 4TTPA 2YWGA 3JZAA 5AUOB 3RS2A 4ESVA 1XXHA 3KTAB 4HUQB 4PSKA 4P31A 4DEYA 2WV9A 1RFLA 2VP5A 3GFPA 2ECKA 2Q3MA 5B58C 2RMKA 2DFNA 4N1AA 2FX3A 1AK2A 1GRRA 1ZINA 1P6XA 4GMDA 1VECA 1L4UA 3AVWA 1E3MA 2QORA 2XTNA 3Q3JB 4LHVA 5DI3B 3VMFA 5G3ZA 2R9VA 5FTNA 1Q1EA 3RWMB 1X86B 1F2TB 2XEXA 3A1SA 3KKNA 4A6PA 3K0SA 5TXGA 1M7BA 2BM1A 1XXHB 3CLVA 2CHGA 3K70D 1W4AA 4JYBA 1DTSA 2GESA 2KI5A 4M1YA 1XX6A 2CLCX 1AJEA 2GJ8A 2RGCA 4EPWA 3B13B 3NBXX 3BOSA 1FTSA 4C0KA 4WA7A 2EFDB 4R2IA 1OW3B 4NYIQ 5D3MB 2ATXA 1I2MA 2O0JA 3BB3A 4Z8YA 5HZKA 3C5HA 3QPWA 1FUKA 2JA1A 1JALA 4FW9A 4M53A 4N0EA 5GJWC 4GBMA 2O8DB 1TQ6A 3GEHA 2WTUA 5AJWA 2C2HA 2J59A 1JB1A 1E2HA 1RE0A 4OK6A 4DLVA 5FI0B 5SZIA 2JLVA 3PEUA 4B3CA 4JZKA 1IN4A 2JDIA 2JASA 1E94E 1DAFA 1GG2A 1M1YE 1QHXA 5JWOA 5J4HA 2WM9B 4G3XA 2WWFA 1NVWQ 1T8UA 2AKYA 2FA9A 3F5FA 4AG5A 3RC8A 4ILEA 1R6BX 3AV0B 1XD9A 3B1XA 2B6HA 2IYVA 3TAUA 1BKDR 3VNUA 3OFNA 1L8QA 3VTKA 1KI8A 1G5TA 1X8KA 2RGDA 4U7DA 1G4AE 3OIVA 3QKSA 4P4SA 2QRZA 2XOKD 5JRJA 3FMFA 1ZMXA 4QXAA 3R9IA 1N6HA 3GJ7A 4F38A 4W5WA 3SU8A 4UNPA 3IBYA 2QE7A 4C2TA 1D2EA 2ZR9A 2W0SA 2CE7A 2F1JA 3LW8A 1J8MF 2BIFA 1Z08A 3T06B 2DWPA 2QAJA 5GJBA 2BC9A 1Z63A 4WVFA 4D81A 4TYNA 4ACAA 2NPIA 2QQ0A 2RGBA 4PQYA 4URXR 2JJ8A 1UKEA 3GLFB 4DB2A 3W8RA 1NN1A 1RW4A 4UJ3A 4I99A 2FJUA 4KODA 1E2NA 3QKSB 1N0VC 3ZVLA 3CH4B 4P4SB 1MRSA 3Q85A 2F55A 1A7JA 2IYSA 2ZRBA 2FV8A 4IFEA 2OE2A 4NCIA 1U99A 1RC8A 3CWQA 1T3HA 2WJGA 1T8TA 1NNEA 4Q1FA 5A5GA 1OXSC 2G83A 2QSYA 3IQWA 3PITA 5J4YA 3BH7A 4HZUB 2AXPA 1P75A 2BCGY 3MWKA 4DCVA 3LXRA 3AF4A 4LPKA 4GNKA 1SVSA 3WBKA 1ZCBA 4KXFB 3UKDA 3CZQA 2A5GA 3AF3A 1XD2A 2VRWA 1Z0FA 3MCAA 1IN5A 2WSMA 3HU3A 2R65A 1WF3A 5FUWA 2B7CA 1QBKC 1VYVA 2QROA 5EUQB 5HE8A 5C46F 1E0KA 1KK3A 1P4SA 1S96A 3CW2A 5JWHA 4ON9A 4US0R 1XU4A 1KKLA 4JVSB 2QP3A 1E79D 1G7RA 2YWEA 2DYKA 1YR7A 1G3QA 1PLJA 2F6RA 2OXCA 3O47A 4FIDA 4QHTA 4UNNA 1T4GA 3T61A 3TUIC 3ZIAA 2FPKA 3RAPR 4A2PA 3RANA 3CRVA 4B2PA 4FXPA 3W5IA 1T5IA 5J40A 1LS6A 3OEED 4Q9KA 2BM0A 1W0KA 1NN0A 5JHGB 1XD2B 4M2LA 1VPLA 2GWHA 1JAHA 2OBMA 3H86A 1KI7A 2OESA 3TRFA 1SVMA 1EFHA 5EXPA 1AKYA 1BH2A 1QRAA 1CF4A 5IK2A 3TKLA 5KDLA 2FSFA 5IHPA 4LX0A 2GVZC 2GEVA 3BERA 1P9WA 4BLPA 3ZDQA 2PL3A 1NF3A 1GL7A 1FNMA 3A37A 4HDOB 4QJ5A 4OHZA 2DBYA 1ZYUA 4DT1A 5ANRB 3NHBA 5FL7A 3EX7C 1KO1A 1MO4A 3THYA 3REFA 1KNXA 3NWJA 2QL6A 1E32A 3CH5A 3GJ6A 2HUPA 3I8SA 4LV5B 5KSYA 2BBWA 4A0GA 3E2IA 1EFRA 4PX9A 3GLIE 2CCGA 5IT5A 2ZJYA 3FMOB 1D2MA 2O8CA 1F6BA 2GEDA 5K8LA 1GNRA 2ZI6A 1JR6A 1NJFA 2H17A 4POAA 3A36A 5L3SB 2PLRA 3P4YA 5FOVA 4ABYA 4DLXA 1XJ0A 1MO5A 3L0IB 4ZDWA 4O3MA 1BMFA 4OK3A 2DPXA 3SJZA 1KI9A 4EDHA 1KDOA 2EYQA 3EA0A 4DT1B 3O8BA 1TU3A 1NIJA 3KJGA 4Q7MB 4BZPA 3QKUA 4PHGA 2WWXA 2RGAA 3B1WA 3KJEA 3QE0A 2YOHA 3ADCA 1R5BA 5J5CA 1G5PA 5HR5A 1G21E 4B71A 4PC2A 1DAIA 3QXXA 4RZ3A 1NG1A 3ZD7A 3RS7A 4FMDF 2ZAOA 2ZR7A 5E7IA 4NCHA 3KB1A 3LBIA 4RD0A 4Z1MA 4A8JC 1HTWA 5KO2A 4IVPA 1JPNA 2XAUA 2IHBA 4JLBA 1Z47A 2C5LA 1KO8A 4B32A 3TQCA 3UMSA 2RB4A 3MGCA 4Q1DA 4YONB 1ZU4A 4TL9A 1A1VA 1XEWY 3QSYA 4RY2A 2QP9X 3NBFA 3RNLA 5AWFC 4YMUA 1TEVA 2A9KA 2GXQA 4Q4AA 3SYNA 4ITRC 2NO1A 1SXJA 2Z83A 1UJ2A 5FOTA 2Q3FA 5DHFA 5A0FA 1ZD8A 1MH1A 5P21A 4B74A 2QTFA 3CPJB 3MWLA 4MGYR 4TLCA 3EWSA 3L8ZA 4EPXA 2VSXA 2JIZA 3TVDA 1W44A 4ASUA 3VKHA 2W2XA 4PAOA 3NBYC 4GOKA 4GSYA 4MRSA 1JEEA 4HI0E 5TY0A 2IYZA 3BK7A 3GD7A 1NL3A 1P2VA 2ZE8A 1UDXA 4OQNA 1II8B 4YMWA 4PO1A 3WMGA 5GADl 3W6NA 1DOAA 1JBKA 2H1LA 4QBHA 2ZYTX 3O8RA 1SXJB 1EWQA 4MUBA 1Z0KA 1ELOA 1JJ7A 3BFVA 2HXYA 4QGGA 2OCYC 2CJWA 4BFSA 1XFAA 3LLMA 2YINC 3K0CA 4Q02A 2V6JA 3TVTA 1WDTA 3A1UA 5E7MA 2OFXA 5EE9A 5H70A 3I1FA 1QVRA 3AP3A 4TMTA 4DHEA 4F4CA 4BE7B 1EK0A 2OILA 3DKVA 1VIYA 1UKYA 1AN0A 4MDEA 4A82A 1N5IA 2A3RA 2WHXA 1IONA 2ZYUX 4JYCA 3TSWA 1KYIA 2XITA 3SJBA 1M74A 4YMTA 2C96A 3BRWD 2KJQA 5AR1A 1N6PA 4Q66C 2XTMA 4CVNA 1XEXB 2D2EA 2B7BA 4Y0VA 2CJWB 5KSZA 3SFVA 2IEZA 1E9EA 4PHFA 4I4LA 2ZRMA 4P33A 2GCOB 1PJRA 2XZPA 3K0AA 5HCIA 1NMXA 1E4YA 4G5SA 4NYMQ 4IOLA 4PPFA 4DSUA 4OHWA 4R9UC 5JSZA 5AUPB 4L16A 2QY9A 1AQYA 4C0SA 5JI2E 1DADA 3SN6A 3WRXC 2BKEA 3FPAA 1ZRHA 5G41A 4D82A 1I4TD 2FE4A 2ZYVX 4EPYA 2C99A 3LXXA 4KFUA 4ZDKA 4PO8A 1EXMA 4BFYA 2V4ZA 3GP8A 3PUYA 3TJZA 3WYGA 3PR1A 2J5XA 5L3QB 1SKYB 4G1UC 4HLDA 1G41A 4TYPA 4GI7A 1TF2A 1TX4B 2FWRA 4FWTA 3A1TA 1YZQA 1Z29A 4JLMA 5DYIA 4ZCIA 2HYDA 4WIAA 2ORVA 4EQ6A 2F43B 2G0TA 1D2NA 1KK2A 1TNDA 3AB3A 1N6LA 1ZVQA 1AZSC 2WJIA 2NPFA 3U3MA 3I92A 4RCZA 2O8BA 2UZIR 2NO0A 3R9XA 2RAPA 3LBHA 2XB4A 3OE7A 1OH5A 1KSJA 1HQYE 1J99A 1DBSA 4LGMA 2OBNA 2KWIA 4PC1A 3CONA 1ETUA 1XP8A 1G8FA 5DHAA 1XJCA 4FN5A 1QHNA 4LJ5A 1G17A 1IOZA 2R6FA 3NG1A 2X8AA 1Z3IX 3H1TA 1G1MA 1JR3A 4XH9B 4M21A 4W7SA 2R8RA 4RSGA 1C1YA 2IYXA 1XCGB 4QGHA 4YDHB 3ND9A 1TL7C 1G7TA 2NOAA 3GCGA 5CK4A 1A82A 1D8TA 1M34E 2X19A 3I5YA 2Z5FA 1TUEA 2ZVQX 2ZJAA 4H1UA 1W4BA 5JCZA 4Q1AA 4DDVA 2G88A 4US2R 3G0HA 3HWSA 2E9SA 2NO9A 2ORWA 3U7EB 3VR6A 5FPHA 3TW8B 1LF5A 3OIWA 4JLJA 4FCTA 4F7WA 4URYR 2GEUA 3GLGA 4DWJA 4LHWA 3CNOA 5JBQA 2OXRA 2W6JA 4DLYA 5CDFA 1NVUQ 2N1BA 4OBEA 5FBRB 1E0JA 4EJSC 4KJZA 4QHSA 3AUXA 1XZPA 5TDHA 4EPTA 2O8EA 5BXQC 5LDDC 1OHHD 3E1SA 4RVCA 2VF8A 3AVYA 1US8B 3MWYW 3P20A 4AKEA 1CS4C 3EG5A 3WBJA 5SZHB 2DHRA 2D4HA 2JDID 1VG9B 3DZ8A 1Q57A 2GVDC 3ZH9B 1WA5A 2WKRA 2XTZA 3BBPA 1P73A 4C0LA 3QF7A 3JVVA 3GLHE 2IUTA 3UG6A 4DCSA 1DE0A 1G291 3AF2A 3OFND 5JWRA 2P6NA 3KFVA 4HDCA 2OCPA 2O8EB 2ZJ2A 1JAIA 4OQXA 521PA 3F8TA 2QE7D 3LNCA 2GBLA 1SGWA 2GZAA 2BJWA 2QP4A 1D9XA 1YKSA 2J0UB 2VBCA 2VTKA 4KAXA 1HQCA 4QRHA 3A8TA 3FHCB 1NMYA 1ZUIA 4DVGA 1IN6A 5LD2C 5H8WA 1XMIA 1TF7A 1GDDA 3NC0C 4B3GA 3N70A 1YZKA 4AYXA 4O25A 1C9KA 4ZDIA 1AS0A 1NVVR 3THXA 3THWA 1XPUA 1RJ9A 5CLLA 4C0AC 2WZQA 2CL6X 4QBIA 1T3SA 3GJ5A 4AD8A 1U0HC 1U8YA 2V9PA 5JECA 3QXCA 2P5TB 2NTYC 1J8YF 2ZRPA 4C0QC 4AK9A 1NLZA 1QG4A 1EFTA 1SVIA 1T0JB 1ZM9A 2ZS7A 4QBFA 5KYKA 2A5YB 2BBSA 1COWA 1GOTA 2ZITA 5LPNA 2IYUA 1OB2A 1H65A 1OXXK 1A2BA 2KB0A 4GT1A 1XJQA 5G40A 1U9IA 5DH9A 3C5CA 5TMPA 4HLUC 2V54A 1DELA 3W3ZB 2HF9A 3THXB 2YVUA 2GZDA 3PJRA 1KDTA 1OIWA 1R7RA 2HF8A 4LOAA 4NTZA 4PC3A 2JJ2A 4JBYA 3DOEA 1JEDA 4JLDA 4LJ6A 4G5OA 2RCNA 2JLXA 4BLSA 1T3LA 3TW4A 1Q1BA 5DGXA 2P5SA 5FR1A 1GSIA 5BQ5A 1Q1QA 3ZIAD 2ZSEA 3C8UA 2IS1A 5FOSA 3L8YA 4Q1CA 2G9NA 3HR7A 3OIYA 4ZO4A 3RS5A 1Q3HA 4ZDJA 5GVSA 2ZETA 2DWQA 4GDFA 4L8GA 1CJMA 1W0KD 3DEFA 4QGFA 1UPTA 3TR0A 4A9AA 4DKXA 1CXZA 1P3JA 3F0TA 4R98A 3CR7A 4U02A 4IDOA 4RFSA 4YLGA 3VAAA 2ZXUA 4FD2A 2FOLA 2VHCA 3T5GA 5JRZA 1W49A 4XSHA 2P0EA 3KB2A 1Q20A 5IK2D 1N6KA 2XGJA 4YMVA 3MLEA 3W6OA 4NP6A 3MAAC 2IYYA 4HAWA 3P32A 4EFNA 3W90A 4F92B 2PZGA 3IQXA 5FL7D 1OIXA 5FUXA 4MYHA 3QENA 1W36C 4LUCA 4C0HA 3X1DA 1OFTA 4UKDA 5AJXA 1SZPA 1W2HA 1EFRD 2LKDA 4RFSB 4RZUA 4UXHA 1VG1A 2AL7A 4QJ4A 2ZUCA 3SQXA 1AS3A 2XZOA 3C41J 4G0NA 1E0SA 2C77A 4Q5IA 3SBDA 2I4IA 1A5TA 4PAMA 1KI4A 4WZBE 1Y3AA 2WVJA 4H1VA 4JLAA 1Z8FA 1IJEA 3PV0A 4JBWA 1BMFD 1M2OB 1XZQA 2FGKA 1NBMA 4CW7A 1U94A 3HR8A 1LS1A 2PX3A 4LJYA 4NL4H 4BEBA 5KDOA 1KSHA 3L0SA 1E96A 3FTQA 2QGZA 1CEEA 1OYWA 4U00A 4FINA 3M0EA 2IA5A 1QHHB 4KBGA 4M4SA 1ZM7A 5DI3A 4Z1MD 1J90A 1MR3F 1X8JA 1E99A 2J41A 4QGAA 1TUIA 3PXGA 3W3AA 4A2QA 1S2MA 2F3TA 2GETA 2FFAA 5AJVB 3ND8A 3EPLA 1XEWX 3L0OA 3KX2A 4JMPA 3SDZA 1CJVC 3NTUA 2MSDB 5SZJA 1X1RA 1ZNXA 1GM5A 2V3CC 5KNCA 2X2EA 3KKQA 4Q21A 1B23P 2CHQA 1IXSB 1KSGA 4X8HA 1WQ1R 1TMKA 2A30A 3UWKA 3LWNA 4JT2A 3WYAA 3QPUA 1S0UA 1SXJD 2C98A 5JI3E 4LJAA 5KPJA 2J7KA 1E2MA 2CE2X 4R71A 2GILA 2ZI3A 3ZQ6A 2Z4RA 3X1WA 2JIZD 3IHLA 4ASUD 4CZ2A 3BAFA 1BIFA 5BN4A 5D3MA 5GVRA 2KBEA 1KMHB 3GJ3A 2PT7A 4NCJA 2GAOA 3D3QA 1HA3A 1WBDA 4TQUS 1FP6A 3AGQA 4DCUA 2BBTA 1IJFA 4BEJA 5FI1B 2O8DA 3CRQA 4B6FA 3U60B 1GNPA 2MSCB 3BE4A 2FU5C 3CUEF 1VCMA 3CB4A 5FR2A 4CEIA 5LB2A 4WXPA 5CIWA 1KJYA 3TMKA 4BASA 4GFDA 4LJ4A 1G8YA 1LY1A 2VL7A 3X2SA 3BH6A 1G7CA 2FFHA 2ZRKA 4TMKA 4EJSB 1KO4A 3RDPA 3TNFA 1CRPA 1N5LA 1EX7A 2O5VA 2OAP1 3FWYA 3C14C 3B1YA 1OYYA 2D74A 2ZE6A 4HB3A 3NH9A 4BECA 1DO0A 2JATA 1XXHE 4GPTA 2VHJA 1OHHA 1FX0B 4BFVA 2X1VA 3G82C 4HATA 2P6RA 2BMEA 5EXTA 4LYFA 4CEIB 1RRPA 1VHTA 2JAQA 2Y8EA 4L5BA 4QL3A 1SHKA 3PEYA 3LQRA 5EP4A 4B44A 1E1RA 3DPUA 4Q03A 2YOFA 4KI0A 3CRRA 4BPBA 3U2QA 2MSEB 2F1HA 3QXHA 2BMDA 2B8WA 2CDNA 4PQRA 5BW8A 3GLFA 4F4JA 4BUJA 2YWFA 2VP6A 3IIMA 4Q7JB 2FH5B 3M1IA 3U3RA 1KIMA 3Q72A 3K70C 4NCNA 2IS2A 4DSNA 4OI2A 2XJ4A 1PV4A 2ZPTX 1W2GA 1SVLA 2CLDX 4KVAA 4PQFA 5EE3A 3ZS9A 2QBYA 5J47A 5ELXA 1B0UA 2EFHB 3CF6R 2VIIA 1E2JA 3AKDA 1A2KC 1E98A 1W4RA 2PJZA 4HZUA 4K8OA 3SJCA 3BFXA 2C9CA 1FNNA 5EUMA 1L4YA 1QG2A 4M9SA 4KSBA 3AKYA 1ODFA 4US1R 4CYMA 4Q01A 3IIKA 4QKQA 3ZJYA 3K0EA 3HU1A 1O87A 4YC7A 4YDSA 3KUDA 3AF1A 4YMSA 4A2WA 3TUJC 3A1VA 1CR0A 3NEJA 1FW6A 2BVNA 2V6IA 4NCKA 2WJJA 2R6DA 2GTPA 3THOA 3VX3A 2ZRCA 4NBSA 5BN3A 4NYJR 2BWJA 4X8LA 3L43A 3OE7D 2QBYB 3I4LA 3ZZTA 1G8GA 2HXSA 4DDTA 3IHWA 1VMAA 4TSFA 1E9CA 1WXQA 4BLRA 3PIRA 4Q1BA 2VHTA 1R0YA 1G4UR 5TB5A 4ZCLA 3CKLA 1XF9A 1JR3D 3WHKA 1YJ5A 2ZJZA 5FH9A 2VP2A 5JS7A 4CT5A 4WOPA 3E5HA 2TMKA 1P9NA 2ZVPX 2HT6A 3AVVA 4QM7A 4D0NA 1HUQA 2ATVA 1R0ZA 3SEAA 4Z51A 2REBA 4UXIA 1GRQA 4JKYA 3ETLA 3RSOA 4KSCA 2FF7A 2AXNA 2BJVA 3AM1A 1TQ2A 3BWDD 5JEEA 3DM5A 4TN1A 3U4QB 4QHYA 3QY0A 2ZS8A 4BFXA 2YKGA 4PTLA 4NONA 1MRNA 2W6JD 2W00A 3DM9B 4U5XA 4B76A 1NJGA 5HTKA 5KNBA 2PX0A 4M1SA 3NVAA 1FP7A 2GRJA 4OYHA 4C7OA 2JLUA 3RRYA 4L15A 1AKEA 1UM8A 1P62B 2BMFA 2IUSA 4V03A 1KSFX 2ZYWX 1QHIA 1OFUX 4KYUA 4Q4JB 1EFCA 5L3SA 1X3SA 3U6BA 5FUVA 1S4QA 2ZJ5A 3WRYC 4WZAE 1ZD1A 3KXIA 1XPOA 4Q9JA 4B33A 3T1VA 1T91A 2QAGC 4F91B 1VG8A 3VHXA 4BQSA 2C9OA 3LQQA 4Q47A 1GILA 3GLIB 2ODNA 1ZM2A 4IDNA 2OZEA 3SS8A 4FMDB 4TL7A 1CP2A 3K0FB 4RD1A 4C3ZA 2AD1A 5H68A 1GFIA 4C7OB 3VR1A 3GJ8A 4EUNA 3B85A 4B3BA 4E03A 2EYUA 3BIFA 3QG5A 3NDBB 4BZQA 121PA 5C4GB 3A1WA 4EAQA 3KJHA 1KHTA 1W5TA 1KMQA 1E9SA 3FYHA 5DYGA 4Q7LA 4OI1A 1JNYA 5B64A 2DFKB 3DVLA 4LY6A 4H9GA 4MKIA 2A2ZA 3TIFA 1X6VA 4MYCA 2VP0A 4HEJA 1J7KA 4ZCMA 3D8BA 5LBIA 3AVOA 4MGIR 1P9RA 3AKCA 4M22A 4PZYA 4Y0AA 4JSYA 3RYTC 4TZ6A 1XTJA 1OFIA 3SC3A 4DSTA 1FTNA 4AYTA 4IXNA 1DAHA 5G53C 3EZ9A 5FOWA 2P2LA 3K53A 1ESMA 3Q8XB 2O0HA 3EZ2A 1C4OA 1HV8A 2XNDA 4DUGA 5FBQB 2GXSA 4Q19A 5K8UA 1XMJA 1LTQA 3UMFA 2GZHA 1G20E 2OLKA 2NZ8A 3AH8A 3QBVA 4HB4A 2ZRFA 1COWD 2XB2A 2XZLA 1FZQA 1N5JA 1XTKA 2IXEA 5JJIA 4CEHB 1II8A 1ZW6A 1Z5ZA 2PMKA 1N0UA 4I81A 5C18A 2AFIE 3UMRA 1IN8A 4O2RA 1T5LA 3I62A 5IDVA 1NVVQ 3X1YA 4XWKA 4PO9A 2C03A 5EP3A 2YOGA 1XCPA 4EKDA 2RGNC 1RKBA 2JJ2D 5CITA 4TMVA 4A6XA 3AVUA 5C1BA 5EJEA 1MV5A 2ZI9A 4MKHA 4WZ6A 2C04A 3GFTA 1NIPA 2QPAA 4IDHA 4RFVA 5GJVC 3RVBA 4PC7A 2IX3A 1OH7A 4B34A 4BFWA 1SKQA 2ZSDA 4LHXA 1XB2A 4TL6A 3U3OA 1I4LD 1GAJA 1DS6A 3QUSA 4E09A 5JJKA 2X2FA 5JS8A 4O2LA 5F9HA 3OESA 2JLQA 4XVQA 3MSXA 4BZXA 1XBTA 4XTRA 2CCKA 3QEOA 1YE8A 5FUYA 3Q9LA 3W9YA 1XEXA 3DOFA 1OB5A 5AUNB 1JECA 1RIFA 1FFHA 4R2HA 2NIPA 3HP1A 3TR5A 4DSOA 4D4LA 2F1IA 4HUTA 2QNRA 3KKOA 4BGDA 1JQLB 4DB4A 1UEJA 5CM9C 1P2UA 3RRZA 2GCOA 1VCNA 4DCTA 5EZ5A 1G8PA 3EC1A 1Z06A 1D5CA 4DDUA 1OV4A 4LV6A 5H1YA 3B6EA 4G5RA 3TQFA 4II7A 4B48A 3AKEA 4LYAA 3H2YA 2AHOA 1L2TA 1S1CA 2DR3A 2QI9C 3KXKA 3CF2A 4RKEA 1ZNZA 2D3WA 4JS0A 4LSGA 5DLQC 4B3FX 3LLUA 2WJYA 4JL8A 1P61B 2RKOA 4DLRA 3AF0A 5BWMA 621PA 5L3QA 3DMDA 2CL7X 4MDFA 2D06A 4AC9A 3CX6A 1PLLA 3EPKA 2ZI5A 2AR7A 2NMVA 1EX6A 3GEIA 4MYUA 3K70B 4B3DA 3KFXA 3FKQA 1II9A 2R2AA 3CWZA 2QG6A 4A92A 2F43A 1NBMD 2WIBA 3AGPA 1XEFA 2BDTA 4MKFA 3IPXA 4M8NE 5AJZA 2W58A 2ZM5A 2JLWA 4JLNA 3RS0A 4IEIA 4JJZA 1XRJA 3KQLA 2LCFA 4B75A 4TMWA 2FEOA 4B3XA 3GEEA 3ASZA 2GK6A 3WHLA 3U6KA 3N2EA 2CCJA 3ASYA 1DG1G 5KDDA 1UKZA 2OUKA 3VU9A 4ZI3A 4X8OA 2GF0A 2GCNA 4Z8XA 3W34A 4RCYA 2XXAA 3K09C 421PA 2AKAB 4WBSA 4TTQA 1IXZA 5HZHA 3WMEA 2LKCA 4TLAA 1QDEA 3EWAA 1DO2A 4LV8B 2Z4SA 3Q7QA 4N0DA 2ZI7A 2IYTA 1N6OA 2GJSA 4XTCS 3U44A 4HAVA 4AKIA 3WP1B 2CMKA 4P3YA 3N5CA 4IHQA 5BN5A 3KQHA 5EXXA 5DN6A 1RRFA 3WMFA 2QN6A 2ZRAA 1HE1C 2R6CA 4B2LA 3QPVA 4EIWA 3SNHA 1U0LA 2R6AA 2GXAA 1G9XA 2ZSAA 2Q21A 4WXRA 4AI6A 4W5HA 4LHZA 1OLOA 1ZUHA 4XD7A 3VU9B 2R6GA 3LW7A 3FVQA 4AY2A 4XIGS 4M1OA 4XVRA 2XXAB 3I3SR 4BRUA 5FPKA 3EARA 2IYRA 4ARZB 2V55B 1DAKA 1KO7A 3SZRA 5CK5A 3R8CA 3U44B 1US8A 5TV2A 3NIBA 1G3IA 2G0NA 4B35A 1F5NA 2A5JA 1CJTC 1TEXA 2HEIA 4KV9A 3DL0A 4ZV4A 1BS1A 4CEJA 4FMCF 2IYQA 2CBZA 2Q9CA 3V4FA 3DO6A 1N25A 2O0KA 2CXXA 2ZUBA 3A4MA 4GZMA 4NMMA 1H8HA 3P26A 2JLRA 1K5DA 1FQKA 1ZC4A 2GJ9A 4LHYA 1BYIA 2R62A 1CU1A 2RGGA 2HCJB 3B9QA 4KITB 4YXWA 3C15C 2YC2C 1DEKA 4LBZA 4RD2A 2ZRDA 2ZRNA 1G5RA 1EGAA 2OLJA 1GVNB 3HJNA 2VLIA 4L9SA 3ZVMA 1JPJA 3VR4A 2YC4C 2P67A 2QAGB 3H0KA 2WPDA 3BH0A 5KU1A 3WNDA 1CBUA 4G5QA 4CEJB 2J0UA 1UDWA 1E1RD 1Z2AA 2IYLD 2WJHA 1FPMA 5TARA 3I73A 1TU4A 5F3WB 1E6CA 1J70A 1ZIPA 3ZYCA 1TTTA 1II0A 1OFHA 2V7QA 1AGRA 3CIOA 4JLOA 1VCIA 3SI7A 4LYHA 4IOMA 1W48A 1LW7A 4A8JA 1E9FA 1JR3E 2GA8A 3NKVA 1I2DA 1N2CE 4Q9HA 3OIUA 3WYFA 2YWHA 1HT2E 4J0QA 3SFZA 3P1JA 5EP2A 2QM7A 2NZJA 3FKSA 3MFYA 3UATA 3VQTA 5F98A 5E4FA 3ZGXA 1CLUA 4B47A 1DARA 2FPMA 2HJGA 1RVDA 4V0NA 3JVUA 3AP2A 1YR8A 5E95A 2OM2A 5C2JB 3AVPA 1WBBA 1NLFA 1WMSA 2L0XA 1QZXA 1VTKA 2QU8A 3GLGE 5L8VA 4URVR 5KPDA 5A4JA 3PG5A 4A8JB 5CDFE 3QKTA 2WWGA 3PENA 5KOYA 2J7PA 2E87A 3LBNA 3REGA 3CO5A 2WWIA 3BORA 3RABA 1RRGA 1U90A 2Q6TA 3IPYA 4B2IA 1E1QA 2PLFA 2EFEB 1G16A 2OHFA 5FBLB 4TSFD 4DDWA 4A36A 2OAQ1 2HDNB 3QVUA 2W6IA 1N5KA 4S35A 3VKWA 4Z54A 2XJ9A 2ODWA 2G1KA 4KLNA 1KY2A 4DJTA 3I5XA 2ZIAA 3RS3A 4A0FA 4EFMA 4Q4LA 4DEXA 3MJRA 1ZM4A 3ZZUA 3EASA 1Z0AA 2YJTD 1YR9A 2VYFA 1WB9A 1K6MA 4V0MA 2ZSBA 1R0WA 4BLQA 4LJ9A 2Q0HA 1XDBA 4B43A 1DAEA 4D4MA 1P60A 1UBGA 1MO3A 2A5DA 3IO5A 3FOZA 4M9ZA 2PBRA 2OCBA 1P72A 2ZRJA 1YU9A 2R44A 2WKPA 3DMNA 4MRRA 3ZZ0A 3GFOA 3R20A 3FHTA 1E2EA 3EPHA 3U61B 2IF0A 1R2QA 1SULA 3KZ1E 1KI6A 2YNMA 4R7ZA 2CL0X 3T15A 1XMSA 1W4CA 4ZPXA 2F3RA 3KJIA 3SR0A 1NY5A 4ZIRB 1Z6AA 4DRZA 3CZPA 2QSZA 4PC6A 4URZR 4O0MA 3ADKA 1YVDA 3KKMA 1YZUA 5HCNA 1RRCA 3KQUA 3PUXA 2DY1A 1GIAA 2H5EA 3W8NA 2SHKA 4HB0A 5FPSA 4TMZA 2EU8A 1S9DA 3PVSA 1KAOA 2GK7A 4G01B 1KI6B 1FOEB 1M6NA 1E9RA 1QF9A 2FSHA 2QRNA 3DDCA 4DLUA 1LVGA 1KJWA 4DLTA 1G18A 4JJKA 2CK3A 1L7VC 1P2SA 2PT5A 1N0WA 1KTVA 4OQFA 2VH5R 1R4AA 1QHHA 1OKKA 2ZJ8A 4IRUB 2KE5A 3LH5A 2O8FA 3B1ZA 4GMXA 3IO3A 1U98A 4PHHA 1U81A 2GAAA 1XTSA 3IKJA 2OG2A 3VHLB 4TLBA 1QHYA 2Q9AA 1G3RA 2ZROA 1W0JA 2PJRA 1XTQA 4LBVA 1M8PA 1N6IA 1P2TA 4E07A 3ZVNA 3LVRE 4TLDA 1U8AA 2OO7A 4B6EA 3FFAA 3B60A 5FTLA 5CIQA 5EE1A 3R9WA 1XPRA 1CKEA 2ZUDA 2PEZA 1FMJA 4C9BA 5BYKA 4OHXA 2B21A 4PFSA 4EFLA 1ZIOA 4ZKEA 2ZSFA 2O8FB 4GZLA 2ZAMA 2VSOA 3MG9A 1GTVA 2OSBA 1Z6YA 3J81k 1RYHA 2XNDD 3OAAA 1KMHA 3S1AB 4DUGD 3CBQA 1NSFA 3SYKA 3IEUA 1ONBA 2ANCA 3PFIA 4G5GA 4HB2A 1ZNYA 4UQOA 4I1OA 1PVOA 1DAMA 2RGXA 4HAZA 1BYUA 1R5OA 4OI0A 2K5UA 2XSZA 1R8SA 3TSOA 2GKSA 3SJAA 4LI0A 3ICQB 4PHTA 2O52A 3T1QA 1GP2A 2WWWA 2QPOA 3TUZC 2H16A 4EJSA 2ZJBA 3LV8A 1E2QA 4Q4HA 5DSZA 3R8FA 1G7SA 1TF5A 1JXOA 2GJAA 4PPGA 5EE5B 4A4DA 1E0AA 4CGZA 4MGZR 1DAGA 2YV5A 2OFOA 2FNAA 3AVXA 1Z28A 3IUYA 4D6PA 1FX0A 1KZGB 3R7WA 3QQ5A 4ZKDA 3X1XA 5J4VA 1NBME 2ZANA 3U7HB 3EAQA 2H18A 4DLSA 5CYOA 1AA9A 2JLSA 3QXSA 5JMTA 4KO8A 4F4IA 2JLYA 4JBXA 2BEKA 3AUYA 1VIAA 2IHYA 1BOFA 2VP9A 4Q4HB 3B1VA 1XCMA 2IXFA 5EXSA 1Q1ZA 2W2VA 4LJ8A 2AN9A 4CF7A 1YZGA 1SVOA 2WAXA 2F1RA 1WP9A 4JL6A 2IUUA 2AWOA 2ZE7A 3N2IA 3IGFA 1HE8B 1V5WA 4LC1A 2IL1A 3K9HA 5FTMA 3R7WB 4KLZA 3NXSA 4JVNA 5FBVB 2ZS9A 4IXMA 2DCUA 2X77A 4TT3D 1SXJC 3VR2A 3UIEA 3ZVRA 1WCV1 4NPHA 4Q00A 4LC0A 1T9HA 2FFBA 3LD9A 3P4XA 4MQBA 3UK6A 1GKYA 2AX4A 4MITA 2C9YA 1E2IA 2FSIA 4M1WA 1IXRC 3GMTA 4M0LA 2ZR0A 4DXAA 3PCRB 1E2LA 1GWNA 2WICA 1YHNA 4PAQA 1AQUA 3KKPA 3PEVA 4DIDA 5KNDA 2EQBA 3L0PA 5TVKA 3CPHA 3HPRA 3PUZA 2QM8A 4RD3A 2CNWA 5LD2B 1NSTA 5AUQA 1VKJA 2ZRLA 5DI9A 4MA4A 1Z6GA 3HDTA 1PUJA 4RD6A 4S2EA 4URWR 1NP6A 2B8TA 1E9AA 2OEPA 3C7KA 3UPUA 2J0VA 4HLUA 3K0CC 3UANA 4QBGB 5B2ZA 4M1TA 1ZC3A 3KQNA 3U7FB 3BS4A 2VEDA 1Z07A 1CR2A 2PZFA 3NH6A 2IF2A 3PEWA 2ODEA 4MYTA 4XWOA 1G19A 1Z0IA 5JLJA 3QXJA 2BHRA 4P32A 3WNBA 4QFMA 3MJHA 5FBWB 4IKEA 4XOIA 1OXVA 4HLQB 2IXGA 2AK2A 2G77B 5DN6D 5HKKA 1W46A 2AD5A 3OEHA 2IW3A 4V0OA 2D2FA 1NY6A 1UEIA 1GKIA 3DZDA 5GJCA 5B57C 1RZ3A 3LAWA 3U4QA 1KKMA 1V43A 4NU0A 3V4RA 2FSGA 5CLQA 2REOA 4BFTA
chains in the Genus database with same CATH superfamily
4B3HA 4FDUA 4XD7D 3SVLA 3KL4A 2YTZA 5EIBC 5LSAA 1BO6A 1O5TA 3GRAA 3ZW9A 1FNSA 3GJ4A 3HKBA 4QXOA 4AKTA 3LX5A 4W8GA 3S99A 2AW5A 4QOJA 3MILA 1Q22A 4JI4B 4UBMA 5IASA 1ZOPA 3ETEA 1E7WA 3LIIA 4JQYA 2CZCA 3WK8A 5LMCA 3EDRA 1Y3HA 3SSAA 3CPSA 4CCAA 3G5LA 1U2RA 2R48A 3H1EA 3MINB 5KQMA 1FMLA 1MO6A 3CJQA 4RZ2A 1AG9A 4TRNA 1R8JA 2DX7A 3GCXA 3GW8A 1BN7A 2A0XA 2YHUA 2VCHA 3QF4A 4KSYA 1JBEA 1OI3A 3RW9A 4ESOA 2YZ2A 1DRUA 1GG8A 2G1JA 1ZJ4A 2HLPA 3EGEA 3UXMA 4IVRA 2IPMA 4JFAA 1EJ0A 4CR6A 1ORTA 2PRKA 1Y8CA 2EATA 3GVCA 3JWJA 3H8SA 1LK7A 2VDRB 3KR0A 1A9SA 3SOPA 4W7IA 3D1JA 1GKUB 3HN6A 4RQTA 4JLKA 2HLDA 2J3IA 4N0PA 4Q18A 4BV2A 4G67A 5F1OA 3LZ6A 4WNAA 2EZ4A 1PZFA 4EKYA 2IS4A 3IIJA 1R37A 1FW8A 2XX3A 3LPMA 3LVQE 4FGZA 5ALTA 4MK4A 5GM1A 3S40A 3VR4D 1D6JA 2ZU0C 2ZWMA 4DBLE 2GEKA 3DFKA 3NHAA 1GPWB 3QNUA 3SR4A 2WNHA 4BFZA 1RWBA 4MUKA 3A1NA 5EKXA 3U9SA 3MGBA 3LUGA 4KWCA 5D5QA 4DW8A 2HT1A 2IK8A 2AIRA 3B5EA 3M6XA 1Y6ZA 4MIOA 5BMOA 1PR9A 3NLLA 4YMLA 5I4BA 2AFVA 1Z5VA 3WK9A 5HJ7A 2V7QD 3R7AA 4KIFA 1LKZA 2NXJA 1G21A 3KT6A 4P0TA 2WUVA 3NO4A 3PNOA 4BBPA 3F4BA 4U2GA 2GH1A 2VHWA 2MHCA 3I34X 1BS2A 1FVXA 1GUAA 4UMVA 2BZGA 3H75A 1IBLB 2VP4A 2B36A 1ZZEA 1Q17A 2VT3A 4GYKA 3C6MA 1ZK4A 5LVAA 4NNJA 2P27A 2XNJA 2NN3C 3ZX5A 1KI2A 1QDUA 2OOSA 4MKXA 3OHMA 3BHNA 2QJTA 1E2DA 1Y81A 3DF9A 2H7VA 1GFWA 2PUJA 1OFVA 2Q9BA 3FPCA 5AVRA 1IOWA 2AFIA 1Z83A 2C4NA 5DGIA 5L3RA 2CB9A 4FONA 2DXIA 2E85A 2EHDA 1VBKA 4RA9B 3OPYI 3UYKA 1BOOA 1MABB 3QFCA 1LDGA 4F2GA 1I4WA 3OKFA 3KZKA 2H4JA 3OUZA 3HB5X 4BIMA 3IKTA 2OPHA 1ZJ6A 4L4UA 3SZLA 3TPFA 3A4YA 1Y63A 3ISVA 5HZMA 1EUZA 3M4XA 4DIOA 3M5CA 4J7UA 4WJZA 4AYWA 3OCCA 1VJDA 1A5SB 4MGKR 2H92A 4PLTA 3E7PA 5F5XA 1PG5A 2PUWA 2FEMA 4YWJA 1OXMA 1R27A 2QUZA 2QTVA 821PA 2ERYA 4PR3A 4YV0A 2C31A 2NTEA 2J9YB 3RC3A 3H2ZA 5DNCA 4WXEA 4H7IA 4XYBA 4OHYA 1IRXA 3RRMA 1AKMA 4LXUA 1J8VA 2Z30A 5ESWA 3FVWA 4XPIB 4MUNA 2RDMA 4JFRA 1V6AA 3DHWC 4RFLA 4DNOA 5JOQA 2YXNA 2DH5A 1CRLA 3VVLA 3ZD6A 1O9BA 5LQUA 3ZNPA 2E6UX 5AESA 4C07A 3LCCA 1H5QA 1RQ2A 3JYQA 4KO3S 5IBPA 5JXIA 2ADOA 4TZ0A 1UXGA 2PMDA 1F0KA 1VZ3A 1VMKA 4M0UA 3RRJA 1GGKA 1VJ5A 3R0ZA 2P3SA 1ENOA 1ULHA 2HCBA 3FB4A 2HD4A 4CV2A 2FETA 1Q12A 1TFRA 2PDAA 2OCIA 1IULA 1I4DD 1J0CA 2VDQB 3CISA 2Y77A 4Y2QA 1FLVA 1ML3A 3HHEA 3LDAA 3HG7A 5CVJA 4C7KA 5TMBA 1N8TA 2A0WA 4QC2A 1GQQA 2JHFA 4JLPA 1HEIA 4UDYX 3LL7A 4JIMA 3QXGA 4BLTA 1J1UA 3ETNA 2Q2OA 1ZGZA 4PSVA 1LB1B 2ADMA 4AJ2A 3EXFA 4HQ6A 4L5IA 1CV2A 3PL1A 3ZE7A 4CE6A 3UN1A 2CXHA 4AURA 5CM8B 1HYGA 1AGPA 3LWBA 1KIFA 3U3JA 5BQXA 5BUCA 2IKQA 5BUZA 1D9ZA 1R00A 3K31A 1EI9A 3R3HA 3B2NA 3KJQA 6NULA 3VU1A 2GERA 1WZNA 5J4KA 1M33A 4YQEA 1DX4A 4KQIA 1VLMA 2LUOA 4BVFA 5DWDA 4CTMA 1YZTA 1L1EA 2EJUA 2ISSD 2XUOA 3WLQA 1ZGJA 4LFAB 2J4DA 2VHZA 4HJRA 1LPSA 4DA7A 1FTQA 2CK3D 4ZI7A 4GZ5A 5ILOA 3LNTA 2BAGA 3OX2A 3Q3EA 3PIDA 4OJKA 3S2YA 5JQGF 3DFZA 4ZQEA 4HY3A 1M2JA 1MG0A 1OXTA 1UBEA 3R3WA 4BB0A 4I6JA 2CV0A 3KQKA 5KYTA 3EIHA 1GKKA 2ZQYA 2I34A 2Q4RA 5EYPB 4Q9LA 3SK0A 3TN7A 1I7LA 3CKKA 4OU5A 3T95A 1LBIA 1XRPA 3WKDA 4RZHA 4EHDA 5JJCA 3UGKA 1CRQA 1P0PA 1MTZA 3QMPA 5ARCA 2AQKA 1UBCA 3ZHZA 1A95A 2P75A 3Q7PA 1CUVA 1X8LA 3T3IA 4D25A 3LRPA 3NVDA 2J0QA 1Q6ZA 4RK1A 4WDQA 3SHWA 3TBHA 1GNLA 3N0WA 3HNRA 3EPRA 5FTJA 1YMVA 2HQ1A 1V5IA 2RI1A 1QV9A 2ZTMA 2WJ6A 3KJFA 5HF6A 2V4UA 2BKVA 4GLJA 3HYTA 4YP5A 4HTFA 4OJQA 4OHVA 5C1PA 2BGMA 4MVJM 2X0FA 3U3KA 4C2UA 2VXYA 3DP9A 3NFRA 3TB4A 3DWFA 3IVCA 3O6VA 1WDLA 2GZRA 1CY0A 1KJQA 1NP3A 1OF1A 3MJ4A 5G4LA 5GZ1A 2EJCA 3DOUA 5DNAA 2P5UA 5M34A 2QM0A 1T24A 2WVAA 2UVPA 2UZ4A 2YV2A 3JD0A 2L2QA 3A3PA 4OQMA 3BZWA 2Z1DA 4TQ9A 1Z6XA 2HOQA 3GLSA 4LF6B 1RZRA 4OQLA 2Z8ZA 3PFWO 2G70A 1I0IA 2CEAA 2JIPA 4AS2A 2O3RA 1Y4UA 2FSUA 2EW1A 2YDXA 3LUFA 2J3QA 2HIAA 1W1WA 1W25A 4M1KA 2QB5A 3D54D 4CIDA 4U39A 2ORYA 2ZK7A 3SOZA 5I9MA 1DWOA 1T34A 4NK4A 1XQYA 5EIHA 1R8QA 1X1SA 1QIFA 2EVWX 2PCLA 4BNKA 1OBOA 3RSSA 1L7DA 4DR2B 4K0KB 2VSQA 3JQ8A 3DHYA 4BTLA 3WG9A 4GICA 2JFFA 4Y9DA 1ICEA 2QLBA 3MRSA 3BN3A 3O9ZA 4HAIA 3PNKA 1JFRA 1IM2A 4O4LF 4QTXA 5DSTA 2V1UA 3K0AB 5DASA 1W5SA 3ABRB 4J7XA 4C21A 2IHVA 1ZN9A 1N6RA 5EJFA 5DO9A 4GRAA 4TZKA 1I1HA 3COSA 4NH0A 3N6VA 2XNSA 5A4FS 4K1LA 2IV7A 4OXIA 4NJMB 3QKRB 4ZU1X 1TAGA 3V80A 5HPYB 3SHVA 4KHPB 3QSGA 2CFIA 1Z0JA 1XNGA 3I39X 2FDXA 2G9UA 1MC5A 2AYXA 1DQSA 2XE7A 1EX1A 2CUKA 4FBGA 3UQZA 2BCJQ 4WCFC 3L7MA 4FYWA 3AR7A 3ZZMA 2QMZA 3P9KA 2OWDA 4AAYA 4Q3NA 3V00A 5FOQA 3FAZA 1X74A 5EKUA 1CT9A 2XMGA 3JD3A 4ITVA 2VPXA 4RZXA 2BMJA 4RMHA 3GLHA 1RAEA 4RD4A 1DRJA 1ARZA 5FT9A 1RVV1 2HJVA 3HBMA 2ZTLA 4CM9A 2O2IA 3MD0A 1P31A 3H4VA 2RBGA 4I1SA 4OHKA 3QYJA 4J4HA 4UUOA 3M5PA 2GYVA 2YW9A 1CY7A 2G0AA 4Q0MA 4YJ2B 3SY8A 1DNPA 1NVGA 4TL8A 2D0PB 4GX1A 1KAMA 3DDZX 4TKMA 3B38A 1PNQA 1WU7A 1QCZA 5FQNA 3OWOA 3U7QA 2WWHA 3OI7A 2AWNA 2XADA 2VNKA 4RVDA 5LYJB 2ZYIA 2J6CA 1OLUB 4YRQA 1F48A 1QVAA 4KR9A 4GM4A 1HGXA 3CLRD 4IWXA 2CVHA 4N6GA 2C3YA 4BJHB 3STUA 3IEVA 1UF9A 1QTIA 2V9CA 1RQLA 3HL4A 4B6GA 1CR1A 3M6AA 4JUBA 4E46A 2GLUA 1HEUA 4IP0A 4YREA 3DYVA 1SCUB 4J1TA 1X1QA 3I52A 1T26A 5D1HA 4D6XA 2FMKA 2YY7A 2R97A 5FF9A 3T3NA 4YRMA 1YJCA 4UOZA 4XWAA 4HAUA 4PNZA 4TQAA 2CLSA 4AIRA 4YNBA 3KCNA 2BF4A 4PZLA 4QFBA 3BWCA 5DX1A 2EEZA 4EJ0A 4F45A 3GNSA 4ZK2A 5JBIA 1R0RE 3CVXA 3H5RA 3O3NB 4B73A 3LQ2A 1QJ4A 3HGQA 1BCRA 3AVQA 2YZMA 5IT4A 4FLFA 4MRNA 5B6PA 2WTMA 5TQJA 3A11A 3IQDB 1I51A 1LLUA 2UVQA 2FWJA 3HEMA 2EWMA 3HACA 2IC5A 4MVJE 1RXYA 2OZKA 4Y2VA 4B45A 1PHPA 4QPZA 1BN6A 1LWNA 2VQ3A 2XKBA 4D4KA 2NU8A 4JI0B 4R1SA 2O48X 4PAWA 4IMJB 2X0KA 1JTFA 1S1MA 5CMLA 2AJLI 5J2TA 1HFJA 2IQ5A 2QPLA 3MM4A 4YAOA 1RCUA 4XYMA 4RQUA 1RQNA 2QX4A 5JAZA 4IFTA 5J2UB 5GINE 1PF7E 3L2OB 4IUBS 3EODA 1L8OA 1WD5A 2C95A 3NRBA 2I8CA 4U7GA 5CGQB 4XOUA 5C4MA 1BJTA 3BX1A 3ELBA 5KYVA 1KGDA 5EZQA 4RSHA 3A9VA 5CJ2A 3ILXA 2IWRA 1MKYA 1P3DA 2M9MA 3E05A 1OOEA 2QVYX 3IMEA 1W96A 3NASA 2ZI4A 5F9FA 3KHTA 5HKKD 2P2YA 4H2DA 4IOKA 2SICE 5BVGB 3CX7A 4XB6B 5AI8A 3OEHD 4Z2AA 3ZWOA 5KZMB 3U4MA 2X0IA 3DR5A 4LYJA 1VKOA 4MHOA 1V4BA 3TBFA 4N82A 3IUPA 2B94A 4C7JA 4GOXA 1XKXA 1QC5B 5LKAA 2I1QA 3I01A 4WESB 1T8RA 3Q0IA 1CIPA 2PWYA 1LPNA 3KJXA 3NZEA 5D3QA 4K46A 2B34A 1NBOA 1V5GA 4TVBA 3PQ3A 2P9GA 3UHJA 2V1XA 5ALOA 5DFAA 1FNBA 3U49A 1HDRA 5HA5A 4RMJA 1P5RA 2XEDA 3TE7A 3ZZ1A 1PVVA 4K86A 1O6BA 3V9AA 3B3QA 1GJRA 3O8LA 3U3XA 3PHGA 3RVKA 5JZ9A 2CVZA 1D0IA 4JVLA 4MNTA 3UJ6A 3T34A 4MWOA 2ZIWB 4EHHA 3AX6A 2Z6UA 4ZIRA 4NYJQ 5AXAA 3AIKA 1JMKC 2ZBRA 3HJGA 4EHLA 3Q2KA 4DIMA 2ZT7A 1M5RA 4QU5A 4Z9AA 3FUTA 5IARA 2VYNA 2DAPA 2XYPA 1OVMA 1T5SA 2YVQA 4KVZA 1W36D 5IEBA 2DB3A 1WUTA 3CEAA 1LPPA 3LBFA 1N5DA 3BMOB 3C39A 3E9YA 1O0BA 2V7UA 3A6KA 3QMWA 1SBZA 4ZU6X 2Q4TA 1IQPA 1M0TA 1SHUX 1ZK3A 2FW0A 2E4UA 4X20B 1LFDB 4CGYA 1XVIA 5B36A 2FZ4A 4FBLA 2IZ6A 4WERA 5CA1F 3OCJA 1TZMA 5KYGA 2QT9A 3F8WA 1V9SA 2QNIA 4CG2A 4WZBA 3E03A 1GL9B 2WOJA 1T6BY 1I5RA 4YAFA 3ZY6A 5HZGA 4MHTA 3E18A 3QTBA 3S2ZA 2QWXA 5F33A 5MN6A 1ZOLA 1GZVA 4CL3A 2JLCA 3T3GA 2BEJA 5CDHA 3TGPA 3RS4A 1RPTA 4UAJA 3TDNA 1ZR4A 4KWTA 1FDSA 4XLZA 4QRDA 3G13A 1RXIA 4X71A 3P2KA 3BJMA 3H5TA 5C5IA 5B3AA 4JJ8A 1Z8DA 4RIIA 5BSHA 2Z1NA 3OU7A 1IMJA 3U39A 4FKMA 3VR3A 3AVTA 1F4PA 2FFJA 1J2JA 1CS0B 1MW9X 2FSSA 1WMDA 3OFVA 4FFRA 1L7QA 1NN3A 4Y1EA 5BSUA 1R5NA 1DX6A 3L79A 2CMFA 4WCDA 1JNXX 1PO7A 4DFDA 6Q21A 4YJ3B 4DZTA 5E2IA 1XSEA 4IEEA 4NZMA 3QVGB 4LK3A 4BFUA 4BKRA 1JFTA 3RUEA 4BMVA 1HPLA 1L8AA 3QOWA 3A6HA 3BMCA 1HYQA 2JA2A 2D1RA 3Q5DA 4K05A 4PPQA 1MAHA 2GN6A 4P9NA 2JKZA 1W34A 2OHJA 1ZH2A 2GO1A 1TUBA 2P2CA 1VIVA 3I53A 3I9JA 3KKEA 4NYMR 5TF4A 4DZZA 5AOVA 4DIUA 4C0WA 1GRVA 3VPFA 1KAEA 3JSXA 4TLEA 3BT7A 4M83A 4QWWA 4I4NA 5ITZB 3ZU5A 5AK6A 4E21A 2GZ1A 1BEZA 2O1WA 3EIWA 1IUNA 2HNBA 5KS2A 1R50A 2TECE 4A15A 3R6LA 1VPDA 1Z37A 2CJFA 1OE0A 2YVLA 3H9BA 1SKUA 1F8FA 2C8VA 3S44A 2ZUEA 4PWZA 3ZDDA 2J6HA 2KLHA 2Q1SA 4ROSA 2DUUA 5K0GA 1JH9A 1QVVA 4UHDA 3SYLA 3MTEA 4H7EA 5FI5A 2EF0A 3REQB 4C3UA 2D5CA 3KAPA 3RAFC 3KTAA 3RHSA 4RIEA 4KEAA 3ZNOA 4F4HA 4IOJA 2DTEA 5FLYA 3DOHA 3OCVA 3DEKA 3PTLA 3C7TA 4J7AA 1KPGA 1N2XA 3GG2A 2NO6A 2WSSD 4JWKA 4QD3A 5KHAA 3SLKA 1JAXA 4BVBA 4CM4A 5K8VA 4QNMA 1C7QA 4Q1VA 1AHHA 1KA9H 1R1DA 3KR9A 4TXLA 1ECBA 5CDTA 2B20A 2QT1A 2YYAA 3NDPA 3CR8A 4IIBA 2OM6A 1X1EA 3N8KA 4G5YA 2A9FA 1CK4A 1Z7YA 2I3BA 2PTGA 5H83A 4EHFA 4UNRA 1UBFA 3QYFA 8ADHA 2JAHA 3WISA 4KCGA 4E14A 5DM2A 4EPVA 4RIHA 1HY3A 5TLSA 5B30A 4C4PA 4TTPA 2FPXA 4KMMA 1NI5A 1SXHA 1CERA 3JZAA 4K40A 2OV8A 4JGGA 1XXHA 4QO8A 3VISA 4YMHA 2P9TA 3BAZA 3NP7A 2WV9A 1ZFNA 3N3AC 4PG8A 3OUTA 5ARBA 3PLNA 4P92A 3V42A 4X24A 3IKLA 1GCGA 3BXXA 4LECA 4NG5A 2VJCA 2DFNA 3NBMA 4L9RA 1TT7A 3WB0A 2FX3A 3WWPA 1XTUA 3ASVA 1GRRA 1T2FA 1P6XA 4WOKA 4LXHA 5EIEA 3CG0A 4TPKA 4NZPA 2DT8A 1VECA 1M66A 1U11A 3FUUA 1J5PA 2BGGA 2WILA 4P84A 2RJNA 4I5IA 3DR3A 1NC3A 5G3ZA 1X7WB 3P52A 5FTNA 2P3OA 1X86B 1F2TB 2LTAA 1OBCA 2PQ2A 2VBIA 2WE7A 1ZD3A 3A1SA 3KCQA 2HBZA 4JNKA 4MW7A 5F12A 3TL2A 1GARA 4NZOA 4BTVA 3TFWA 3CLVA 2QRVA 2Z2YA 1UOOA 3AI7A 4QEZA 4UBLA 1O95C 3TLZA 2KI5A 2GESA 1XWWA 4FBMA 3PHJA 2CNOA 3E23A 3FIJA 1AJEA 2QUKA 5JTUA 1JEJA 4WSOA 3KK0A 4P38A 2DRIA 2R5WA 2X7JA 3O94A 4PYOA 2IVFA 4XD2A 4F2WA 1YRWA 4QRIA 2ARKA 3JQ9A 1WO8A 3FB1A 1FTSA 1SHTX 4C0KA 1JVSA 2FCRA 1TW2A 4QYMA 3IV6A 3LWDA 5KQGA 4M7PA 3N28A 1U6IA 5G1PA 1ZUWA 3RWBA 2FHPA 2IDZA 1J7JA 3HKEA 3RYCB 3KQVA 3J80A 3TD9A 1V96A 4I3FA 2ATXA 2IITA 3N8HA 1QAQA 2I5PO 1I2MA 2O0JA 4TKUA 4W63A 2O50A 3PNPA 3BDAA 1FUKA 4PBRA 4FQ8A 5JMWA 3MC1A 6REQB 2EF1A 1U7WA 4QDZA 2VF4X 4DA8A 3OQMA 1PT7A 5GJWC 2X8BA 1GG5A 2R87A 3HFJA 1ST3A 1OWOA 3OWXA 3VC1A 4RTNA 1MAWA 1F0YA 1TQ6A 2R1UA 3GEHA 2J59A 4MDYA 1JB1A 3UMBA 4DLVA 4U9IS 5FI0B 3N39C 4MUFA 4HT3B 4CXMA 2X5XA 4U9HS 4R7GA 2VYVD 3KYIB 4CCYB 3GEGA 3ZCUA 2XWQA 3CLHA 2VNAA 1AMOA 4EGAA 3PGXA 5JYEA 3Q87B 4B2YA 4AY3A 1E8MA 1GR1A 4NJEB 1QOQB 2AQHA 1RZUA 2OK7A 4JLUA 1WTCA 4ND7A 2IV3A 4HCJA 3RBXA 1T4MA 1R6BX 3ZYZA 8MHTA 4IJ5A 3B1XA 2B6HA 3IP8A 4HRYA 1BKDR 3IX7A 3OFNA 3VRHA 2QUJA 3ANYB 1G5TA 1X8KA 3MCVA 4JC0A 1V6SA 1X9GA 3OIVA 3SM9A 1X38A 3QKSA 4OYYA 4YGYA 1RRKA 2G8NA 5JRJA 2A14A 4R51A 1EX9A 2Q8QA 1M3SA 3SU8A 4WX2B 3CUVA 3COPA 1UFVA 2I66A 3MINA 2ZR9A 4IGIA 4PNPA 4LVCA 3L9WA 3KTOA 1Z08A 2XE6A 4M6WA 4OFZA 1I10A 1S8AA 4F12A 4NBUA 2I6TA 3SQDA 2Z8YM 5GJBA 3ZWPA 2HQSA 4ZVVA 4R2KA 4OGGA 2N47A 2IP4A 4YCAA 2RGBA 4OOFA 1TIKA 2GJ4A 4PQYA 4DB2A 3RT9A 3AW8A 4Z3DA 3HRHA 4L22A 4D9NA 4UJ3A 2H2IA 3LDGA 1KEPA 2G4CA 3E9RA 4Y6PA 1O4VA 1NI4A 2GASA 1N0VC 3H9GA 1NVFA 3CH4B 3QA3E 2P90A 4P4SB 5ALZA 3SQOA 2IYSA 2NWQA 4DIFA 4OXNA 4ED9A 2IH5A 2JAWA 1YTLA 1PGNA 3BD8A 4RBNA 3V33A 1ST2A 1T8TA 3O31A 3WNZA 5A5GA 1OU0A 2XV1A 1JE0A 1OXSC 2G83A 1G4HA 2ZSHA 5J4YA 3BH7A 4HZUB 3VU3A 1D03A 2GPJA 5BSMA 4HD8A 5KSWB 4HX9A 4NE9A 3DUFB 4J0FA 3ELDA 3FWNA 2AKEA 3WQHA 2BGWA 1E4EB 4GGMX 4DCVA 2QN3A 3N0VA 3AF4A 1R12A 3M4JA 4IZ6A 4W1SA 3WBKA 3G0DA 1U1FA 4XEHA 4F7DA 4OM7A 3BIJA 4GVLA 3UKDA 1ULZA 2WHRA 5IYZA 2A5GA 1ZVJA 3CRNA 4LY0A 4NBTA 2VRWA 4QOHA 2PFKA 4KQ6A 5HKLA 2XWSA 3HJHA 3NGMA 3VZQA 1NRWA 1U7HA 5DLPA 3VNAA 4Z7NB 2ODTX 1JQ3A 1E6MA 1KEEB 2PG3A 5GPBA 1FLNA 1RXEA 5K45A 2VS1A 4JY7A 3PGJA 2BZ1A 1ZOIA 1GPJA 2C29D 2FB9A 3N2GB 3WLSA 4US0R 1Y7PA 1X1TA 3GD5A 5L3ZA 3OPNA 1XU4A 2ZROA 1E79D 2YWEA 3O47A 2DYKA 2ZWPA 1G3QA 4HEHA 4MVXA 3WLJA 4EJMA 1YBAA 2PPLA 1OTHA 4FEAA 3PK0A 2NNWB 3RAPR 3TMAA 4C7MA 3NM5A 3AEUB 5JNUA 1NASA 3CRVA 4LQDA 3RANA 4B2PA 1T5IA 2WYOA 1IK4A 4EZIA 4B7AA 1JWAB 2FX2A 3OEED 4RA9A 4Q9KA 4FFNA 2BM0A 1ADJA 2PH3A 5EJ6A 4ZHQF 3JQAB 1CDEA 1XQ1A 1JAHA 4EK9A 5EXPA 4WLEA 3G79A 4OHPA 1AKYA 5FWDA 2AMFA 2GNAA 3F6PA 2BFDB 1LZLA 2YY6A 5F3DA 3TKLA 4TS1A 1G55A 1K06A 3UFXA 4E4YA 5BQ3A 5IHPA 4OFWA 1DEXA 1GTSA 3VHQA 2R2GA 3FHTA 4BLPA 3O92A 2PL3A 3CNQS 2YIJA 2BEVB 3TQRA 1RLTA 1FX1A 2Q3JA 3A37A 1R18A 5FULA 2QJWA 1XAHA 1ZYUA 4DT1A 1UMDA 5ANRB 1CD5A 4FM9A 3RAEC 2BFFB 2VAMA 3A1FA 4RMNA 5FL7A 1ZWLA 1ZCFA 1KO1A 4REQA 4O0LA 1KNXA 1MAVA 3VBCA 3N74A 5KHLB 3MWFA 5KSYA 1VJ1A 1PVDA 4P7GA 2BBWA 3S2EA 3E61A 4A0GA 3E2IA 4XPIA 3RARA 4I5FA 2CCGA 2P1ZA 2ZJYA 3BWVA 3FMOB 4E30A 1SEPA 1RBZA 1RI1A 4A27A 2FZWA 3NNDA 1GNRA 1JR6A 2IEIA 4V39A 3BILA 3IELA 5L3SB 4RHUA 3PQ7A 4GQBA 3AI2A 5CH3A 1DAOA 1Z5UA 1VGRA 4YV7A 1XJ0A 1CWUA 4MCHA 4G5FA 2O2ZA 4O3MA 2X1LA 1BMFA 4OK3A 1J56A 1EFLA 1O6GA 4B5KA 1KDOA 2EYQA 1TU3A 1PAUA 3CXRA 2AG0A 3WWDA 1T1GA 3KB8A 3V1KA 1Z5NA 1FQWA 1NW6A 2RGAA 3KJEA 2YOHA 4G8DA 5DM4A 1VCHA 3S81A 4GZ6A 5EIXA 1RM5A 1NFFA 3E2PA 2YZNA 2HJSA 2AE2A 1EFVB 3NBKA 5HR5A 2R6ZA 1G21E 1EZ4A 2HJ9A 3D3KA 3QXXA 4PC2A 2X8LA 3L8HA 2P4QA 4FMDF 4RZ3A 2WYWA 1KBQA 2W11A 2ZAOA 2B1RA 4NCHA 4RD0A 5A9TA 10MHA 1HTWA 1VSUA 4IVPA 4X6XA 1H0HA 3WJ2A 1Z2PX 1JPNA 4M0FA 4MMZB 3OOSA 3R5SA 4ANFA 3ONVA 5CYFA 1VPTA 4DR5B 3KRTA 3SXPA 3KYCB 4NMLA 1PT6A 1C0IA 3V1NA 3W05A 4BP3A 2RB4A 4DJFC 3FDFA 4EA6A 4JDUA 1ZU4A 3ZK8A 1F20A 1UJ5A 2PUVA 3EA4A 4O1HA 5B55A 4QAQA 3L40A 4O2AA 3H1BA 5JQGB 2OGWA 2PTHA 1ZGAA 2R60A 3JQFC 3O3MB 4HX2A 2GA9A 4KYTA 1WJGA 2YCBA 4NBWA 1YS7A 3PT5A 1ZXBA 1UL1X 2SCUA 2ZXEA 3MTAA 3GBVA 3O2SB 1K7XB 2WTAA 4ITRC 4XGNA 5A0FA 5DHFA 4L8YA 3TSCA 1VB5A 1MH1A 1SBTA 1OFGA 3CPJB 1DL5A 3MWLA 4BJ5A 5T5QA 2YHIA 3EWSA 2VSXA 5BWCA 3BF8A 4XWYA 2O5EA 2W2XA 4MUEA 5D86A 3UOAB 4QTYA 2YZKA 3RG8A 3NBYC 1JT9A 4WBNF 4L6AA 5G0UA 3LF2A 1NQXA 3QVOA 1JEEA 2DC1A 2FUG1 4KQ9A 2IYZA 1JKIA 3BK7A 1XVVA 1NL3A 1C3LA 1P2VA 3FCEA 2ZE8A 2OD7A 4TV9F 3VPSA 4W5RA 3LI2A 1I3OA 2BEWA 2XVZA 5IBCA 2OECA 2R7NA 4G65A 5THKA 1OJ7A 2NSHA 1B43A 1ADYA 1OYOA 2G4LA 1SBCA 1Y9JA 3OQJA 3RVSA 3U5TA 4R1LA 1CZHA 2ZPAA 4QBHA 1XU9A 4RTKA 3K94A 3P9PA 1SXJB 4M8LA 5DMHA 1Z0KA 3D3JA 4HH3C 5HYVA 1Q1AA 4QUKA 4NXMB 1GGHA 2E55A 1EVZA 2CJWA 5KYNA 2RAUA 1XFAA 1S2LA 5BNFA 5LIPA 3LUAA 1K0UA 2P9FA 2W4IA 3K0CA 4JP3A 3TVTA 3ZNQA 5CD9A 2O59A 1WDTA 5E7MA 5EE9A 5H70A 1Q2XA 4IXDA 1JDZA 2A94A 2K6GA 4LRYA 3VOTA 3WLOA 3WLKX 1BX1A 2CLIB 2YQZA 1QH0A 2WJ3A 3I1FA 3I04A 4TMTA 2WAMA 5EPUA 4DHEA 2OILA 4MP3A 5HRCA 3SXUA 1AN0A 1R15A 2HCTA 4P4NA 1ND6A 2V7XA 1YSCA 3HJUA 2ZYUX 3TSWA 4AMYA 2XITA 3OF2A 2UXBB 1J4AA 4LMPA 1CSEE 2GBFA 3BRWD 1JL3A 2EBWA 2KJQA 2BP7A 3SAJA 4O4LB 3TTUA 1DXQA 1EQUA 3K32A 1FB5A 4IKOA 4M37A 1DQPA 2A59A 2GD0A 2C92A 4RDCA 2GN4A 3N7AA 3EQ6A 4HQOA 3HJTA 3SFVA 1THTA 1E9EA 1OA1A 2P6MA 4PHFA 4UHCA 4UUPA 1RWPA 1RBMA 4TLLB 4P33A 3K9FC 3RGGA 4EMSA 2XZPA 3GMSA 3K0AA 3E53A 3QE3A 5HCIA 4RGYA 2F62A 4PPFA 1Q6YA 3GVXA 1AQYA 2FP4B 5JI2E 4OLBA 2E7ZA 1DADA 3SN6A 4R6WA 2V7EA 3FPAA 1KARA 5ES3A 1I4TD 1KQ3A 4AN4A 3DTVA 4LX8A 1L5WA 1RI2A 1CUDA 1XZAA 1ZKDA 2C99A 5HF8A 4TUYA 4HEQA 3F1LA 4INAA 2V4ZA 2N75A 2RH4A 3ADPA 3HABA 4ZCQA 1TAUA 1THGA 3PR1A 2J5XA 3Q12A 3FSEA 3JPWA 1KYWA 2ZKLA 3FCXA 3A4TA 2V0CA 4B5LA 2LPMA 4FWTA 1GPDG 2N0SA 2XDYA 3CUTA 1PJCA 1Z29A 2NW6A 3FHJA 4HNRA 1T2CA 5DYIA 1RZVA 3WBFA 5EJAA 2EGHA 3ZUPA 3E3MA 3D3NA 3EQ2A 4WIAA 5KOJB 4TTIA 1ONSA 1HDCA 3OIGA 1U2SA 2F43B 2G0TA 1D2NA 2WMDA 1QRTA 3VH4A 3SDSA 2WJIA 3DBHB 2NPFA 1GLGA 4RCZA 1YCFA 2NO0A 2UZIR 4XGQA 1POWA 2X4GA 1FYEA 1NF9A 2CXPA 3OE7A 3FDZA 4OAOA 4R2LA 1OH5A 2FN3A 1IY8A 1FP2A 2HLHA 1J99A 3LQFA 3OUUA 2OBNA 2GD1O 3TW8A 4YUYA 3L1UA 4BATA 2HSJA 1PFVA 1XJCA 3C3DA 3D7KA 3UTCA 1G17A 4PZEA 1LNQA 1SCUA 3DE7X 4CBVA 1IXYA 4OX9Y 3H1TA 1G1MA 3DFIA 4GPBA 2GN1A 2I7CA 2R8RA 3LM8A 3Q8LA 3PXEA 4NFLA 1TT5B 1XLTA 4DLNA 5AK3A 1TL7C 3JD2A 3QMMA 4GUDA 1BWQA 1V1MB 5CK4A 4KPUB 5KBYA 5C1OA 1Y98A 1HO3A 1U9YA 2Z9DA 2C8JA 4FSXA 5EXEA 3DE4X 2X19A 3AJEA 2Z5FA 1W4BA 4B87A 4CKEB 1KYQA 3HA2A 4IINA 1NJ6A 4PFJA 4Y7DA 2PM8A 2ZAIA 1TQHA 3HWSA 4E5NA 3U7EB 1NPTO 1SZJG 5F1KA 5FPHA 2GPTA 2BGTA 4LQ4A 2JGFA 1KP2A 3HVUA 2HQRA 4FCTA 1HKHA 4HGQA 3RUIA 5K3OA 3IRVA 4URYR 3TZQA 1LQUA 1WKBA 2I65A 2QTTA 3WK5A 5HX7A 5KWEA 3KAKA 2W6JA 2XNHA 3MERA 4G4IA 2CF6A 2FXIA 4JMLA 5CDFA 3JTEA 2N1BA 4DLYA 1N2CB 3E48A 1D4OA 4L3WA 4OBEA 5J2UA 4JCCA 1E0JA 2FPIB 2E4AA 3IERA 1UOPA 3VU8A 3I01M 3ZI4A 5EINA 4KGDA 2YQ5A 4GNRA 5BXQC 1QF7A 2XHEA 3FZGA 2UYQA 3QVWA 2PZ8A 1HDEA 4RA6B 4RVCA 3AVYA 1JWBB 4AKEA 1CS4C 2R1TA 5IXSA 4C87A 3WBJA 3FTCA 3DZ8A 3ZWYA 2X86A 1X94A 1SBQA 1BS9A 5BVGA 3KOUA 1GTG1 3TSYA 3ROQA 4AJHA 4E5SA 3O7WA 2WKRA 3QF7A 3QX9A 3K73O 3NYQA 4P2BA 3P9NA 5LXTF 4DGQA 3FG9A 3NVKI 3IA2A 2D5IA 2IUTA 1DLIA 3GLHE 4G89A 4A0QA 1G291 3WYBA 2BMAA 1JG7A 2ENUA 4C5AA 5K0ZA 2PUAA 4LZOA 4M7WA 2P6NA 3ISJA 3KFVA 4J9UE 5LYYA 4AMBA 2J4FA 4HQLA 1BKYA 4B6PA 1EGHA 4PXYA 4FE7A 5JD4A 1P17A 5J63A 3BWEA 4CDMA 2QE7D 5H80A 1QU2A 1P0CA 2FDRA 3N58A 1BU8A 1YKSA 3U37A 1N77A 3FHCB 3CLRC 2PUTA 4AJOA 4O4JF 4B3GA 1TF7A 3UWDA 1YB1A 1YZKA 3RFVA 1J9ZA 5CA1B 1UT5A 2Z08A 3RI3A 1GN9A 3ZD8A 4BKUA 2RHRA 4JB8A 3PPXA 1P2BA 1K68A 2IGBA 4Q6WA 4U3JB 2GN2A 2BH2A 2IODA 4X20A 1JHDA 4QDTA 1WZCA 1NVVR 1UP7A 1V3QE 3BE6A 3MQ4A 4PS0A 5EGSA 3R8XA 4YP1A 3KEFA 3THXA 1M0WA 3TLBA 4UPEA 1XPUA 1TK9A 4BQFA 2F67A 4X60A 3TPCA 2CL6X 4U2FA 3VXKA 3BWYA 3GJ5A 1U0HC 5JECA 3PJGA 5LQMA 2X9VA 3MCTA 3NEPX 1BDHA 1MVNA 4AK9A 4NFYA 3H0CA 1GDHA 4UU7A 1JHAA 3NOVA 1KZYC 1EFTA 1TTHA 1I0LA 5NLLA 1WPGA 4E13A 1N0IA 3NWPA 1CRWG 4GOLD 1SR8A 1AZLA 2BBSA 2PKXA 5DXFA 5JVDA 2JIRA 3R7LA 2KB0A 5JNWA 5G40A 4OFBA 4LE2A 5AW5A 1ZMBA 1CS0A 4BX9A 4F0JA 4YR9A 1JPUA 5FDFA 1EDDA 4AW9A 1PEYA 1L3CA 2GM9A 2O57A 4FQ5A 3AUAA 2JW5A 2EX1A 5EKTA 4YJ3A 1ZQ1A 1U3TA 4EGQA 3PJDA 5FWXA 5IT9A 5BV1A 1XKTA 4UBKA 4FHFA 4ZQBA 2JJ2A 2L82A 3QVGA 5BO5A 5K9ZA 3SNKA 4LJSA 3WADA 3J81A 2AUMA 2P4EA 4JLDA 5SYAA 3PR3A 2QQGA 3B1JA 1U0EA 1JA1A 1J8FA 4D9KA 5LA6A 5MN5A 2JLXA 1SBIA 4WY8A 4MQUA 1V1RA 5FR1A 3F46A 2IY9A 3C6QA 3QBDA 1N2EA 1QVWA 3C8UA 1DEHA 4OUDB 5EJ2A 4CTOA 3RT7A 1MP0A 1Q3HA 4LTDA 4DCJA 4ALMA 3AERB 5FV7A 2COUA 2XE4A 1UXOA 3KVNA 4L8GA 1CJMA 1W0KD 3DEFA 3BXOA 3TR0A 4DKXA 4A9AA 1GHTA 1R6UA 1P3JA 2EJBA 4O4HF 3CR7A 4CMGA 4EI9A 4HVCA 4RFSA 1LPAB 3O83A 5AXDA 1EFPB 5IWAB 1TZCA 3JATB 4QT4A 4H6XA 5LOVA 3AM4A 3OTQA 2P0EA 3NWEA 3A1DA 1OZ0A 4QQKA 4CNQA 2YQ4A 2XGJA 1N5MA 1R0KA 4YMVA 3DTTA 1N7HA 1NXWA 2WYIA 4FHEA 3REQA 4DPMA