4ZV9A

2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
238
structure length
237
Chain Sequence
b'SNAQVEFTDPEIFAEYITYPSPNGHGEVRGYLVKPAKMSGKTPAVVVVHENRGLNPYIEDVARRVAKAGYIALAPDGLNSVGGYPGNDDKGRELQQQVDPTKLMNDFFAAIEFMQRYPQATGKVGITGFYGGGVSNAAAVAYPELACAVPFYGRQAPTADVAKIEAPLLLHFAELDTRINEGWPAYEAALKANNKVYEAYIYPGVNHGFHNDSTPRYDKSAADLAWQRTLKWFDKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title 2.00 Angstrom resolution crystal structure of an uncharacterized protein from Escherichia coli O157:H7 str. Sakai
rcsb
source organism Escherichia coli o157:h7
molecule tags Structural genomics, unknown function
total genus 81
structure length 237
sequence length 238
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zv9A00
5JIBA 3SK0A 2QVBA 3ICVA 5CT4A 2W6CX 5AKEA 4E46A 1UKAA 5LZ9A 1TK3A 1DX6A 1MN6A 4LXGA 5AP9A 3PF8A 3WK7A 1CUJA 1DQZA 1XZMA 2O2IA 1JT2A 1XZKA 5D6OA 1FFAA 4ARAA 2BUBA 1TCBA 1ZI8A 2ZYRA 1IZ8A 2QKYA 3BL8A 4G8DA 1JU4A 5IVKA 1YCDA 2OGTA 4I3FA 4QNNA 2CEKA 2AJCA 4FKBA 2BKLA 1E5TA 5H3HA 4ZV9A 5AIAA 2XUAA 3E4DA 1WPRA 1D07A 3B5EA 1XZGA 4PSDA 3FYUA 3AZPA 5I7UA 3FVTA 4AN0A 1WOMA 2AJ8A 4BE9A 3AILA 5JZ9A 1FJ2A 3C6ZA 3L1IA 4J0JA 4KE6A 4CFSA 4M0FA 4A23A 2Z3ZA 2CMFA 1GZ7A 1QO7A 5AOAA 4DSZA 1LBSA 1GPLA 4Y2VA 2RAUA 5AKZA 1KU6A 5JD4A 2WIDA 4J0HA 5CXUA 3QMMA 4BP9A 2B61A 3OTQA 3I2FA 2XDWA 5ALIA 3STYA 1IMJA 2GZRA 2HM7A 3DJYA 1ETHA 2JIDA 5HK9A 1UT6A 1KEZA 1W1IA 2XUFA 4IH9A 1YR2A 1JMYA 5E4YA 1VJ5A 4X95A 4HVTA 3Q0TA 4QE3A 4BP8A 2V96A 2B20A 1Q83A 4B9AA 5HQ3B 1QLWA 5JALA 1CR6A 3IA2A 5D3KA 3STUA 4B6GA 3AZQA 3OG9A 1MX9A 1XROA 3PDCA 4L3WA 4DMKA 1MX5A 2VT6A 1CUXA 5LYYA 2WFZA 5HK8A 2G5TA 1JKMA 1SFRA 1ZOIA 3QVMA 2ES4A 1VE6A 1UKCA 2DHDA 5AKIA 3UMJA 5LIPA 1E8DA 3JYHA 4QWWA 1EDBA 4UBKA 3WKAA 4U2FA 4K6KA 5SYNA 3OM8A 2O7VA 5A7FA 2G5PA 2JBWA 1XZFA 1HLGA 4BYMA 1J1IA 2Z8ZA 4UBIA 2VSQA 1ODSA 3O4IA 4B81A 3WYNA 4FOLA 4HAIA 4UHHA 1AQLA 3F67A 3ANSA 3C5VA 2R11A 3WKBA 2V9ZA 1XZDA 4K2AA 3PF9A 4X71A 1UK9A 1LPMA 3PUHA 5LP1A 2O2HA 4OU5A 1U65A 4N8EA 5AI8A 2ZJ7A 1BE0A 3MUOA 4H7JA 3EQ9A 1LBTA 2CB9A 4I19A 4MYDA 2WHQA 4S0XA 4DYHA 2OCKA 4BE4A 1P0PA 5C8XA 4I4CA 3WIBA 5ESRA 5HQ3A 4OD0A 4EBBA 1H2WA 1BS9A 3T52A 1L7QA 3F97A 4H7DA 3IVMA 1W76A 3RKSA 3KD2A 5EIEA 1EVQA 2GYVA 3WA7A 3H19A 2XQJA 3QPDA 3VXKA 2YXPX 2FJ0A 2EDCA 1N8SA 4AQDA 1H23A 4AO8A 1ZD2P 1F8UA 5AOBA 3ZI7A 2WQZA 4BATA 1CPYA 3B12A 4IH1A 1THTA 2WIKA 4C87A 1QIMA 1L7AA 2PBLA 4Y9SA 5EHXA 5ALXA 4CIBA 3GELA 5CH8A 1ZD4A 5JZSA 4H7EA 3WL7A 3G0IA 3D2CA 3BE8A 4G4JA 4G4GA 1WB6A 3NWOA 1MTZA 4HRYA 5AI0A 1CUDA 5ALTA 2ZYHA 1DWQA 4CG2A 5FPQA 4UBMA 4FWBA 4MEBA 2XUPA 4QDOA 3STWA 1CUWA 2PSDA 3BJMA 4W1SA 2Y2UA 1TRHA 2VJAA 2XMCA 3P2MA 1JFRA 1QOZA 1F6WA 2C4HA 1ORWA 4QDZA 4Y2XA 3C5WP 2HIHA 3DYIA 2D5LA 3QYJA 4FDMA 4X85A 2XUQA 4M0MA 3V48A 1I6WA 1QTRA 1IUNA 4BAUA 3C87A 1C4XA 2XMSA 2WLSA 1PFQA 4BB0A 2ZSHA 4EY5A 5ALYA 5I8PA 3G0GA 2C5FA 2VAXA 2CKMA 1N5RA 1YASA 5K3DA 3SC2A 3G02A 4DNQA 2JF0A 2X5XA 4XWGA 5ALJA 3AJAA 1YS2X 5FP0A 2WIJA 3RK4A 2PPLA 2WIFA 1OXMA 1U4NA 2OGSA 1GGVA 1M33A 4CIAA 4IHAA 1MT3A 1W4LA 1QIJA 1BN6A 4DMHA 2P8SA 3D59A 1UOQA 1Y7HA 1EXWA 2Y6UA 5AM2A 5AKHA 2XUJA 4H7KA 2HA2A 4INZA 4JYPA 5FRDA 3M3DA 2FJPA 4TGLA 3FOBA 1JJIA 4X3CA 3ANTA 1G4HA 4ZV7A 1H2XA 2AJDA 4FLFA 3OC0A 3E1GA 4H77A 1QE3A 4IQ4A 3H2GA 4DM7A 1DX4A 1NU8A 5AOCA 2BJHA 5HF5A 4MEAA 5CW2A 1VZ2A 1EI9A 2RONA 5AK4A 4U2DA 4PNZA 2PX6A 4QZVA 1RP1A 2OCLA 4YK7A 5HFNA 5K5EA 1YA8A 4W1QA 3R3UA 5IKXA 2CBGA 4TPKA 2HL6A 3X3HA 2XQFA 2VA9A 4BAZA 3BJRA 1XZBA 2Z5GA 3PICA 1XRNA 1E8MA 4D9JA 1CUZA 2WUGA 3FSGA 3C70A 1GQRA 2OXEA 4Y2YA 2WUDA 4BVLA 3R3ZA 1GPKA 1KU0A 2JGFA 1P0MA 5CURA 4W1RA 1DWOA 2DQYA 3PFCA 3WK6A 4BCDA 4Y2SA 4RNCA 2WJ6A 4RPCA 2QZPA 1NU6A 2ROQA 4ZXFA 1QIEA 5CMLA 5FPPA 5BWCA 3ICWA 4QWMA 1ACJA 1E8NA 3OOSA 3GBSA 1MPXA 3FVRA 2WTNA 4J03A 1EVEA 1ZGCA 1BROA 3FWHA 4WFJA 2WUFA 4H7FA 4L9AA 5A6VA 2H7CA 4FLEA 4XVCA 4UFNA 4EHBA 4IO0A 3QM1A 2DFPA 4Q05A 1VA4A 3RM3A 3WJ2A 1Q0RA 4CI9A 2HDWA 1XRQA 3TRDA 1DINA 1H22A 2QOEA 3R3VA 4EY6A 2X8BA 1O6FA 4ZGBA 3H2HA 4PO3X 4WY5A 3HSSA 7YASA 1ZICA 1A88A 1YSCA 4OYYA 2HU7A 5T4FA 2H9YA 3BWXA 2J3QA 1UK6A 3TJMA 4X97A 5A7GA 2DQZA 1XKLA 1AZWA 3V1KA 2EDAA 1LPPA 1X2BA 4DMFA 2Y1KA 2QMQA 4KE7A 5LZ8A 2K2QB 3ESBA 1Z68A 4EY7A 3AZOA 2HFKA 3BF8A 3ED1A 5AJHA 4YASA 1ZI9A 4RGYA 3GZJA 3TGLA 1CV2A 1QGED 2DHEA 2VT7A 4GI1A 4WFIA 1XZJA 1Y7IA 4UUQA 3IUMA 3ZPXA 4BZWA 1BRTA 4UFOA 1QIHA 3R40A 2QS9A 3CXUA 1CUSA 3VISA 4LXHA 4UBLA 5AI9A 3BXPA 1VKHA 4FFWA 4WDQA 3L1JA 3I6YA 4EY8A 2ACKA 3FLBA 1CUYA 5AHXA 2XE4A 1K5PA 4F60A 3HI4A 5DYYA 1CUEA 3D2AA 1CIJA 4M0EA 4QA9A 3H2JA 1QFMA 3E3AA 4Y2JA 4ITVA 1UK8A 1VA5A 1U2EA 3G0BA 1UXOA 5HKBA 5AKGA 3D5EA 4HRXA 2GZSA 5FKJA 3W04A 5DNUA 2RHTA 5EHZA 2JGKA 2PKYX 2WFMA 2WIGA 4CG3A 4B80A 2ONCA 4FNMA 2DSNA 4KE8A 4EA6A 1FFCA 2AJLI 2PSJA 5AI6A 5A7HA 2AXEA 3FYTA 1EDEA 4AMYA 3WMRA 1H2YA 4RE5A 5AM3A 5CXXA 2C5GA 1Q84A 1BCSA 1JJBA 3BDVA 3MUNA 3OURA 2BGRA 5LKRA 1IZ7A 3H1BA 3WL5A 1PJAA 2J4CA 1SCQA 3UUEA 5CT6A 5JARA 2ZJ6A 4B0PA 4OU4A 4G9GA 2B9VA 1TAHA 1R50A 1L7RA 4W9RA 1X70A 4E15A 4ARBA 3G9UA 4LHEA 4QEKA 3KSRA 1T2NA 3CN7A 4J0IA 1UZAA 4WFKA 3I2GA 2OQIA 1YS1X 3D3NA 3KDAA 2OAGA 1MU0A 4PQEA 1AURA 1R3DA 4AMZA 2WHPA 3WK5A 5IVIA 4WJLA 2ORYA 5AKLA 4OB8A 5AKJA 1LPOA 1SCKA 4PSCA 4WY8A 3HACA 3IUNA 3WJ1A 1XZHA 3M82A 4BDTA 1CRLA 1LNSA 5KWJA 1GXSA 4MJ3A 5AI4A 4K6HA 1XRPA 2ZVDA 2C0PA 4EY4A 3U1TA 5ALSA 3WIOA 3HC7A 2WSLA 5AIBA 4U2BA 5BV7A 4A16A 4BVKA 3PI6A 4B0OA 3WKEA 3A2NA 1A8SA 2HHAA 5AK5A 1MAHA 1XLWA 2VJDA 5JD6A 4NZZA 1IUOA 5YASA 1K6EA 3F96A 1MJ5A 5EIHA 3WWPA 1XQVA 2G63A 5DJ5A 3ESDA 5ALQA 5E4JA 4XX1A 3I2KA 1G5FA 4N5IX 4H18A 1JI3A 4QLOA 4Y2UA 2VJBA 2HA5A 4BCBA 3FAKA 3LIIA 2GBFA 3I2JA 3N0TA 1WM1A 4GLBA 4UHBA 2WFLA 5IH7A 1UKBA 3A70A 1G66A 1XFDA 1VOTA 2HA3A 5K3EA 2V98A 1J06A 4AXBA 5KWIA 4MQLA 1QIDA 4EZIA 3M83A 4FMPA 3AINA 2PSEA 1HPLA 3BIWA 2C0QA 3KOOA 4BC1A 4AZ3A 1SCIA 4Y2PA 4JH0A 5JATA 2HFJA 4C4XA 5D3ZA 5SYMA 5DTIA 4J7AA 4ETWA 3IURA 1ZJ4A 4HXGA 3B3QA 4XIIA 2AJBA 1UK7A 3HABA 4H7HA 2XUDA 1TIBA 5IVDA 3H18A 2PUJA 3IUQA 3C6XA 1K63A 4G8BA 3PUIA 1QIIA 2WKWA 3KWJA 4DSAA 5ALWA 1R4ZA 2OCGA 1ACLA 4BTVA 1YA4A 1CLEA 4DNPA 4G4IA 1N5MA 4J0GA 5DLPA 1CUHA 3R3XA 4BTLA 3LP5A 2JGJA 4CCWA 2IIVA 1R9MA 3HEAA 3G0CA 1WHSA 2QTBA 3I6ZA 5HFAA 6YASA 4WCVA 5CH3A 2QJRA 3EIOA 1MO2A 1G42A 1F0NA 1YAJA 1A8QA 2ZYIA 3CN9A 3HRHA 4GDMA 1E3QA 1A8UA 3H17A 4U2CA 4KEAA 2XUHA 1K4YA 1CUUA 4B85A 2WUEA 3KXPA 4KAFA 1R1DA 3GUUA 4H0CA 3AIOA 2WG1A 3WL6A 3STVA 3H2IA 2Z8XA 4C4YA 5JYCA 4AO7A 4UFPA 5FV4A 5A71A 2ZYSA 3DYVA 2WG0A 5D7BA 1JJFA 2X76A 5ALUA 3AFIA 4JEIA 1LPBB 5BWBA 3WZMA 2HRQA 3IIIA 2GYUA 2GYWA 3WYDA 4AB1A 1Y37A 3YASA 1AX9A 3SWWA 3QPAA 4C89A 3HLKA 4FTWA 5AK3A 3QZUA 3C8DA 5JD5A 1QONA 4X92A 3WI7A 4GECA 3WK4A 2BGNA 2I3ZA 4EB0A 4PW0A 4DNFA 4FFVA 3K9BA 5CT8A 1QIKA 5FDFA 2CZQA 4AO6A 2NW6A 1HKHA 3WA6A 1P0QA 3F9CA 1AC5A 3VVMA 5JAPA 2QUAA 1IVYA 4MYSA 4OB7A 4Y7DA 4K5QA 4N8SA 3LS2A 1FFBA 2XUIA 3G9XA 1E89A 5HF8A 2PM8A 3R3YA 2RGUA 3NGMA 2JEZA 1CUBA 2E3JA 3JW8A 4Y2TA 3C43A 1XZIA 1EK2A 3ILSA 3HZOA 3QMWA 2PSHA 5LKAA 4F5ZA 2OLEA 1UFOA 2XMDA 5ALDA 1AMNA 3GA7A 1CVLA 4HXEB 4JYMA 4C88A 4Q3LA 5ISMA 2GBIA 5T4HA 1VE7A 3STXA 2JGLA 1LPAB 2EEPA 4N5HX 3WL8A 4X6XA 3DD5A 3C45A 3WWCA 1BEZA 3U0VA 1XQYA 3A6ZA 4KAJA 4QDUA 3WLAA 5JASA 1EA5A 3G8YA 1DWPA 3C6YA 1U8EA 1DU4A 5C8ZA 4C6HA 4PF1A 4BAGA 3L1HA 3O9MA 2VQ6A 2ZSIA 1W75A 3O4JA 3S2ZA 2VAVA 1QTIA 3WWDA 5ALFA 2JEYA 2QUBA 2VEOA 3IDAA 4BCCA 2D0DA 4UBJA 2XMZA 3BF7A 2XLBA 2RHWA 3PE6A 4BC0A 4OSEA 5AICA 5HCUA 3RLIA 3RARA 2OG1A 4HTAA 1THGA 4B7ZA 3NOXA 3ZLUA 4NMWA 3UUFA 1TCAA 1RWQA 3SX4A 5AM1A 5JAHA 3K6KA 2QXTA 5EIAA 4PV7A 1QIFA 1VXRA 3BDIA 3AIKA 3DL7A 4KRYA 1MAAA 5ALPA 2UZ0A 4Q34A 2BAGA 4ZRDA 5ALZA 5AKKA 1DT3A 4ZREA 4J0KA 1CFJA 1QZ3A 3FLAA 5AO9A 2XUKA 5EHQA 2WU4A 1MX1A 3G7NA 1CUCA 3W2TA 4JUIA 1CUVA 2OQVA 3FLEA 5JAUA 2XUGA 2FUKA 1C7JA 4BDSA 4QLAA 4CCYB 1YAHA 2VJCA 3FYUC 3EQ7A 3I28A 2RIPA 1T4MA 2C7BA 3GROA 1ISPA 3JWEA 3FSGD 3V1LA 4F0JA 3FCYA 5F4ZA 2HA0A 4GEGA 1UWCA 1JU3A 4WDRA 2WHPB 1JMKC 4GXNA 3VDXA 4X6YA 4RE6A 1GKKA 3H04A 2XB6A 1GPNA 5AKYA 1WB5A 1ZD3A 2DCMA 2PL5A 1BEEA 1AKNA 1W6RA 4KRXA 3DOIA 1EINA 1K8QA 2ACEA 4B84A 1UOPA 5K3FA 1ODCA 1XZLA 5FUMA 4GHWA 4X6UA 4G5XA 1XKTA 3EF3A 2V97A 3KWFA 2H7YA 3Q8WA 3STTA 2I78A 4HXFB 2JGMA 2PU7A 4Z49A 2Z3WA 1FFDA 4U2EA 1SOMA 4MQMA 1QO9A 4OCZA 5CT5A 4UBOA 5FOQA 3G0DA 5JADA 2I03A 2OAEA 3ZWQA 5ALLA 2BUAA 3C6BA 2WHRA 2XQGA 4P9NA 3R41A 2QJWA 2IITA 3WK9A 5DWDA 4CCYA 2QXUA 1ZI6A 1QFSA 3QPCA 5LZ5A 1AGYA 2HA4A 3N2ZB 3DS8A 4X91A 4N8DA 2WFLB 4X90A 4FBLA 3R0VA 4KJXA 5ALVA 4MXDA 5DYWA 4Q82A 5CH5A 2HA6A 5AM4A 2HRRA 1TCCA 3V1NA 1XRRA 4YX9A 2XMQA 4TVKA 2LIPA 1EX9A 2CUTA 2JGEA 4H7IA 4AX4A 3I1IA 1HL7A 2HA7A 3EBLA 4LKOA 1XZAA 2R8BA 4B83A 2XQIA 1EB9A 2J4FA 3QITA 2VATA 3LCRA 5HZGA 5KREA 5ALEA 1B6GA 5HF6A 1CEXA 4OYLA 1B41A 1TQHA 2GBCA 4OUKX 1E66A 1LZKA 3G9ZA 3E0XA 4KE9A 3DDUA 5JAOA 3R3WA 1WCYA 2CJPA 1FSSA 4H35A 4FLMA 3HXKA 4GBGA 4BRSA 4FBMA 5EFZA 4XJVA 1GT6A 4UHEA 2XMGA 4KR0A 4C4ZA 4FHZA 3D4LA 1YB7A 3ESCA 4NS4A 3DOHA 2WG2A 2ZJFA 3V1MA 5CBKA 1N1MA 1EH5A 3DKKA 1BU8A 4DNOA 3CCBA 5BOVA 3WWEA 2WM2A 4BBZA 5ALRA 3ZV7A 5E2IA 3V9AA 3O0DA 4G9EA 2H1IA 1OCEA 5ALHA 3CCCA 2DHCA 2HADA 2YH2A 3WK8A 1ZIXA 5AH0A 5C8VA 1XZEA 5K3BA 1DT5A 1ZGBA 4NVRA 2XI4A 1QJ4A 4UHDA 5ALOA 1HBJA 1CQZA 4P93A 1CUIA 1YB6A 1RYYA 4BRZA 5C81A 2O2GA 3DEAA 1QIGA 4DTCA 2YYSA 2BFNA 1NX9A 1XRLA 4Q3KA 4ZI5A 2ECFA 1XQXA 4ZWNA 1EDDA 3QBJA 5CTAA 1J07A 4DGQA 3WQHA 1UOOA 4DIUA 1R88A 5LLSA 2WU3A 1XZCA 4KAAA 3WZLA 1J2EA 2W22A 5EHNA 1GKLA 4L0CA 1WHTA 4KACA 3D0KA 1MNQA 4J0DA 1O6GA 5AM0A 5AM5A 5T4BA 3LIPA 4GW3A 2OPHA 5DNWA 4QDXA 1W52X 3O95A 3MGAA 2HU5A 2Q0XA 3I2HA 5LZ2A 1HQDA 3O4GA 1ORVA 3ZLTA 2OCIA 4G8CA 4KYVA 1XLVA 4W63A 1BCRA 2J3DA 2JGIA 2XT0A 4AN1A 1X2EA 3QH4A 4G1FA 2PVSA 4Q1VA 1LLFA 2WJ3A 3FNBA 1GQSA 1LPSA 4EUSA 5IVHA 1WPXA 3ZLVA 4OPMA 4IH4A 4AZ0A 3IB3A 1F0PA 4ROTA 1ODTC 5FLKA 1Q0ZA 3H1AA 3IUJA 4X00A 2Y2VA 4A5SA 1SC9A 1USWA 3VVLA 5ALKA 2HU8A 2IX9A 4HS9A 3VJKA 1VZ3A 3DQZA 1MNAA 1ZIYA 2QRUA 1ZJ5A 4C01A 2WJ4A 3T4UA 2PSFA 1HDEA 5AI5A 5EI5A 4QDTA 3DNMA 3I1YA 3VJLA 1C7IA 3D7RA 3LLCA 1DQYA 4GWLA 1H2ZA 3AUKA 4L72A 4X93A 1S8OA 3G9TA 4K6GA 1IUPA 5DYTA 2RI6A 4YPVA 3O4HA 3WKDA 5E4TA 3H2KA 2XLCA 4X94A 1CQWA 4FNGA 3TEJA 2H7XA 3FCXA 5ALGA 2C58A 4UBNA 1LPNA 2XMBA 3WKCA 3EQ8A 5FXMA 5EGNA 3FBWA 1R9NA 3DCNA 3BIXA 4J3JA 1XLUA 5AKXA 4UPDA 3HJUA 3A2MA 5CT9A 3DLTA 3VJMA 2BUCA 4B82A 5KBYA 3I2IA 4Y2RA 4JNCA 4BZZA 4CG1A 3F98A 5ALMA 4BVJA 2VF2A 3MVEA 3DKRA 4B9EA 3OPMA 2WILA 1VLQA 3WWOA 5A2GA 2FX5A 5CRIA 5A62A 4Y2QA 4LYEA 4MWSA 4X7BA 2QM0A 1EK1A 4UHFA 3F8SA 2QT9A 5DNVA 5LZ7A 4Q3OA 4E11A 3W06A 4LIPD 3K2IA 1PV1A 5DTJA 3AIMA 2WTMA 5JANA 3NUZA 3GFFA 1EHYA 2XUOA 4LYDA 3VKFA 5J3JA 3W9UA 1XQWA 3PFBA 4LXIA 5JZBA 1OILA 2QR5A 3H0CA 3DL4A 4DLNA 3D2BA 2I3DA 5K3AA 2XQKA 4PSUA 3IBTA 1CUAA 1BN7A 1P0IA 2XMRA 4UHCA 4U2GA 1FFEA 1WB4A 2Y6VA 3W05A 5C7YA 3A2LA 4OB6A 5ALNA 4MWTA 3W9BA 2B4KA 2GBGA 4J0CA 1TKRA 5HKAA 2BCEA 4P92A 1XRMA 2VTVA 1CUGA 2DR0A 1AUOA 1DTEA 2O7RA 2OGZA 4W1PA 5I9IA 3O9VA 4P08A 3ESAA 2PUHA 1VXOA 4O08A 1LGYA 1A7UA 4HZGA 3FYUB 2PU5A 1ZD5A 5AK6A 4DMCA 3S8YA 1LZLA 5K3FB 5LZ4A 1EB8A 2YASA 1CUFA 4V2IA 2G4LA 3HYSA 5K3CA 3QMVA 5T4EA 5HF9A 3I6MA 4F21A 3IULA 4E14A 3C8HA 3M81A
chains in the Genus database with same CATH superfamily
4MP8A 2FKNA 2QVBA 1IQPA 3R2JA 4M8SA 4ZQEA 4YXWA 4EW3A 4PHFA 5JZOA 2JRLA 2LR0A 4DV1B 1NSTA 1TZBA 3ZVLA 4XIFA 2C5LA 2ECQA 3ICVA 1NSYA 1TA4A 4OL0A 5B30A 5B6PA 2AOUB 3BICA 1CY7A 4MINA 4DIDA 1ISRA 5EHGA 5JXIA 4HYYA 4EYEA 3WFZA 1K08A 3HLTA 2DERA 4YRSA 1ATZA 4Z4HA 1DX6A 1H1TA 1XZQA 2Q62A 3WJAA 4II3A 1TADA 3OUZA 2R84A 2WYHA 3HYLA 1ZXLA 4YUYA 1OX5A 4M38A 1QHEA 4ZVNA 1VG0B 4RK0A 3PF8A 4DXDA 5GONA 4TYWA 1DXHA 2GF0A 3I9OA 4ZU1X 3AJEA 1U2DC 1B76A 2C77A 4YUVA 5HHTA 5LOVA 2O2IA 1JT2A 1UBHS 2EW8A 2HIMA 2UYYA 4EX6A 1KKLA 3BMXA 5JXWA 2IQ5A 3ER8A 1PX0A 2A5JA 3HEMA 1E3WA 1FFAA 1RFGE 3EASA 2Q27A 4QOEA 1MRSA 1PF7E 2OFXA 3ONEA 1DGQA 4YDHB 3EF0A 1Z4NA 2QMYA 4EF5A 2BUBA 4JLVA 4YRPA 1XGKA 1FQWA 1IUKA 1ZI8A 2GVNA 2NOAA 4QYMA 3K15A 2D54A 3Q7RA 5HE9A 4AJNA 3Q87B 3RIGA 4HDNB 4TQGA 5BSEA 1A7KA 1ZKMA 4GOJA 1WBJB 5TEVA 1KYXA 2C97A 3OCUA 5LU9A 3G5MA 1I51A 5DTMA 2H2IA 1CHDA 1KAEA 1KXJA 3JWGA 1JXQA 1S8NA 4O4LB 3RK1A 1QWOA 1YCDA 2OGTA 3ESXA 4ZT6A 4ALIA 1AKVA 1NQOA 1I4TD 2B2XA 2CE2X 2CEKA 3C8ZA 4QNNA 4RK5A 4RJTA 1JSLA 1P6XA 2WAOA 3TTXA 1X86B 5CTJA 3RHTA 3OAAD 3T3IA 3M6VA 1WPRA 1D07A 1Z38A 2J3MA 3B5EA 3TTUA 4EFNA 4K81B 4D7AA 3AZPA 4I81A 4KXNA 2R1VB 3DBRB 1Q3HA 4P2GA 4RE6A 2X8WA 4JWKA 4N5MA 5KYYB 2R85A 1TAQA 1VIAA 5AXBA 2HHCA 3K1ZA 4GSLA 5LCXA 1DRUA 1NNSA 3RU7A 4BE9A 4BNDA 3AKDA 1RYZA 4QATA 1BFUA 5JZ9A 1RHJA 2BDUA 3E7XA 5IBPA 4BVEA 1WPQA 5IVPA 4EG4A 4EJSC 3IE1A 4HD8A 3ABIA 4M0FA 4WKGA 3ZE8A 4A23A 2IS4A 1FDRA 2Y1WA 4RVUA 4AECA 4WOKA 4JUCA 4C2BA 2JK0A 2IT1A 4JKYA 4Q00A 4BLVA 4LBVA 3FVQA 1VQ1A 2QJOA 3GCDA 2I65A 2GCOB 3SZMA 3HY6A 1DEKA 4FMCF 4IIVA 2RAUA 3HG7A 5AKZA 1PZHA 1VMAA 4JYCA 4Q9NA 1KU6A 5JD4A 2H57A 3S81A 4DV5B 2AOUA 3DR5A 2AI3A 1N57A 1X80B 3U4GA 5K8UA 2B61A 2OG2A 4AWXA 1EHIA 3C3JA 1NX6A 2ZJ0A 3FTNA 4JJGA 2Q7OE 2ZUCA 3LVBA 4YJ2B 5MGNA 2VNAA 2PNFA 1UJBA 2P62A 1ETHA 2JIDA 4GKAA 2W0MA 1FU8A 3VMFA 5EEHA 2NV2B 2BHLA 4TN1A 1KEZA 1ICIA 2R5NA 1RXVA 3GJRA 1G6KA 1JMYA 1H2EA 1R0BA 2C99A 1IC6A 3I0ZA 3U5ZB 1P7ZA 1K7CA 4Y2GA 3NC4A 5IS2A 3DXYA 4EHHA 1M8GA 3GOQA 2PFGA 1TK2A 3NBZC 3E5MA 5G1NA 2IF0A 1YE3A 5BPFA 5A3SA 3GLGA 2NSHA 1E58A 2X58A 1JAYA 3K0SA 1JQDA 3Q0TA 1Z33A 2DX7A 1T15A 1S96A 2E7ZA 2Q3HA 2W43A 1N2CB 3B1XA 4FYKA 3ZD6A 4PTLA 3UMVA 1H9CA 3I5UA 4OHCA 1MBZA 3ESQA 5F1YA 4MGEA 3WISA 1N36B 4NI5A 1Q83A 3O8QB 3EFEA 1QLWA 4HDNA 1A5AB 1OWNA 1ULZA 2HD4A 3DZFA 1UC4B 4EB3A 1KERA 1HURA 3DCJA 1N0HA 3FOAA 4O4LA 1XK6A 4LSWA 5FBKA 2J87A 2YWBA 3WRYC 4F9EA 2PJRA 3EQ6A 1W8DA 4BNFA 2HBQA 1MX9A 4FS8A 2WD9A 3E9YA 2GQ0A 3MINB 3LFTA 1BDMA 2FW0A 3ETCA 4P22A 4BO3A 5HK8A 5A9SB 2JLQA 1NF2A 1G2OA 4WOJA 5KDOA 5EZQA 2Y27A 1SFRA 2J7PA 1QBGA 3R4CA 2GK3A 2B7LA 3CSDA 1YUBA 1UKCA 2J1LA 3SKYA 4UE6A 5JJBA 2R1VA 3DBRA 4YJDA 5FI1B 3TRIA 2AR0A 1IXRC 4JGBA 1ZG3A 2YXEA 3WYCA 4R01A 4E09A 2Z4SA 3JYHA 2JCXA 4QWWA 5KYYA 5AVVA 1FFGA 1EDBA 3PIDA 4GX5A 4MO2A 5LLTA 3OQHA 3WKAA 1QG6A 1UBGA 3PUZA 4WJKB 3IDQA 4LHZA 1V1RA 3BTOA 2HPZA 5AW3A 621PA 1FTNA 1KQNA 2O0HA 4S1VA 4E3ZA 4KPYA 2J6HA 2JBWA 4ND7A 3WV4A 3PNBA 2YMQA 4OHOA 3HNPA 4FIZA 4BYMA 1DTSA 1X7XA 2BFDA 3QY9A 4HFNA 3O84A 1AN0A 3PHBE 2DGDA 1N5JA 4J8PA 3WYGA 4AU1A 4DM4A 5B4TA 2GCOA 3G2JA 3O4IA 3PHCA 2WUWE 3DQQA 4ZMSA 3WYNA 4QBTA 4DFDA 4YT2A 3FOWA 1XALA 2XT6A 1N34B 4YJGA 1TM3E 1YVDA 3DCYA 5LQJA 4KPFC 1KTIA 2P9CA 4J3FA 2A14A 2JBHA 3A26A 4EYQA 1JG7A 1RHKA 2GJSA 1X80A 1HT3A 4MGYR 2IS2A 2GARA 1JXOA 1ZCFA 1ZAYA 3ZWDA 1IHPA 1MHTA 4EHKA 3W5SA 3LCJA 2XYQA 2HKIA 2OT3B 4HX9A 2I6GA 4BV8A 1HFKA 3V34A 5C9ZA 1NRIA 1Y1LA 1U3TA 2WINI 1H1LB 4DKXA 5LP1A 1U2RA 1Y3DE 2ISSD 2FWIA 3VO9A 2MWMA 1U65A 2X9NA 3NV9A 4KXUA 3FCCA 3GMSA 4MUGA 4RVSA 1LLCA 2Q6IA 4KXMA 2C4NA 4RPGA 1V5FA 2QYTA 4ZAFA 3PI7A 3EQ9A 1IN5A 4H7JA 4RM2A 3ITEA 1U1CA 3WYEA 2QYSA 2VZ9A 4CMKA 1SEVA 4FHCA 2YN2A 1MQ8B 4RJLA 3ACDA 2PNJA 3VZQA 3BK1A 4Y98A 1O6CA 2OCKA 1R0KA 1EX1A 1X7DA 4S2EA 1N2CA 2OR3A 4QRIA 3A6PC 1NVTA 4ZOAA 5A9RA 1R0XA 5ESRA 3L8CA 3LTEA 3O8QA 4Y1RA 1QG2A 3ZS8A 1F4PA 2P7IA 2D1FA 2J31A 1BCRB 2OK8A 3CHYA 3H16A 3MB5A 3N5KA 3Q9NA 1FA9A 4M9SA 2A0UA 5KJ1A 3FPGA 4D5EA 5EQFA 2ZI7A 1A2OA 3GJ0A 3BAFA 2YS6A 3LC1O 1ZMRA 4MVXA 3OPYI 1V8OA 4GVLA 1K2WA 5ERXA 5IUJC 2OE2A 2E9SA 1MC5A 1O8BA 2YXNA 7MDHA 3RKSA 1DDGA 4QPDA 3EH2A 3JVEA 5A9SA 1GVNB 1GCIA 1COZA 2FOLA 1GAWA 4GMKA 3LCVB 3UKOA 2BFCB 5FD8A 2XQJA 3QPDA 3P9PA 4O1MA 4ZVRA 1ZNYA 5DP1A 2G6BA 2V4MA 2ZE6A 3OF5A 4CUZA 2XGJA 1MUUA 1N8SA 4KQ1A 4HG2A 4AQDA 1NJGA 1UBFA 3H8WA 5BN3B 2PO5A 2YZKA 3WMEA 1ZD2P 1N2CE 4EP1A 5DCUA 3SX0A 1VLZA 3AOEA 5JAQA 2FUCA 2V7EA 5DHSA 3S40A 2ZVJA 3FUVA 1ID8A 3G5AA 1AMOA 2GLUA 2YHUA 4HQ6A 1B43A 1CF9A 2QORA 5F5NA 4BOYA 2YWRA 4HNUA 1THTA 3FA2A 4ATNA 1T5TA 3MJTA 2GAFA 1L1EA 1EWYA 5IP5A 3J7TA 1QIMA 5FUWA 3K30A 3DBHB 4G23A 1JS1X 4CM6A 4Y9SA 3VFDA 4ZI7B 2W2KB 2C82A 1J2TA 1KEVA 1MO6A 1I6MA 1UPBA 4N7BA 4Q3CA 4HHEA 4JJ8A 5KSPA 1T2UA 4K40A 1YVEI 1OWMA 5CFLA 2Q0QA 3QHAA 4XGQA 3GELA 2AC4A 4GBJA 3GLFB 4F5EA 1DUVG 2ETXA 1L5KA 1I5EA 3FDXA 4LCBA 3KJXA 1GA4A 2K7ZA 4JOBA 3WL7A 4JSYA 1Z36A 4P33A 4EG7A 3BSYA 1H1LA 5G3YA 2GDZA 2H0QA 4Z3OA 3T0GA 4C7JA 1K0UA 4X61A 5FBLB 4DS3A 3BE8A 4EVIA 1YIOA 3OIVA 3TBKA 2A1IA 5DX8A 3QE3A 4IFEA 4MH0R 2FN4A 5HX7A 1C81A 3JZAA 4X45A 1D6MA 3HWX1 4PNEA 2VJKA 4JJ7A 3ZE7A 3QPWA 4KQ6A 3N3AC 4I4LA 4HFJA 4K86A 4TS1A 2ZYHA 2GWHA 5DVZA 2TYSB 3RU9A 4MYCA 2DB3A 2NMVA 1ZHHA 4KBFA 4QGHA 3DE6X 2FHPA 4MEBA 1F0KA 3WGMA 3C48A 1X1SA 3LT1A 4FU0A 3RVKA 4YLGA 2JGNA 3CH5A 1U8FO 3K9LA 4KIFA 4LY9A 1S2MA 4W1SA 1YDFA 5GV7A 3PQDA 1KAHA 2AI1A 2XVYA 4ZOBA 3C7KA 3RRXA 5JCJD 2ZPAA 1TRHA 3U6KA 1UPAA 5H02A 4QTYA 1SAYA 2PKCA 2R00C 1TYBE 4TWBA 3BD9A 3D8RA 3EXHC 3BB3A 4U7DA 1F6WA 4BMOB 5LQKA 1MTOA 2PS0A 3FOEC 1ZRMA 1KVQA 1IY8A 4QDZA 4AIRA 1EK5A 3BKXA 2AF3C 2AJTA 3UNXA 4TUYB 3QXJA 2H1RA 4I6JA 2PX2A 3HADA 2OYCA 1MJNA 2BFCA 2PRIA 5L7TA 4K0RA 1QE5A 1HDZA 2P2LA 3HBLA 4X85A 4CIVA 1JNXX 5CLJA 2DKOA 4RD4A 1ZEMA 1CJCA 2XUQA 4Q6BA 3NBYC 3PUKA 4M0MA 1H2AS 1NZJA 2Y1LA 3JVVA 2RH9B 3QKTA 3BPSA 3UAXA 4BAUA 2R6DA 1C4XA 1PNOA 1VI6A 2FMIA 4ZQBA 2B1IA 4WCFC 2PXXA 2YYAA 4MHOA 4JB0A 4UJ3A 5ERGB 1PFQA 4J1TA 1XNGA 3ZJTA 1RD4A 4BB0A 4ARZB 2OHJA 4EQ6A 2B3TA 5AVZA 2NXNA 1P1HA 1XEWX 1YQGA 1A82A 1KNQA 1RNLA 1U0RA 2VNHA 5ALYA 1A4IA 4RDXA 5I8PA 4D9MA 4D99A 3I9LA 2I54A 3HP1A 1D0VA 3CINA 1ECBA 4P86A 2AWOA 2E6KA 2J07A 2WJYA 4ND2A 2IS6A 3CX6A 3DBHA 1P2GA 2NACA 2ONYA 3KHTA 3OZUA 5FFNA 1EK6A 3LPAA 4UU8A 1AA9A 4NE9A 3ZD8A 5LJIA 1ZYUA 1PSWA 2JF0A 2RK4A 1OMOA 1UM8A 4HQFA 4W4TA 2A86A 1E2JA 3AJAA 1YS2X 1I4EB 4M8KA 1K75A 2FKAA 4MCIA 5FP0A 4E5YA 5KDDA 4EELA 1A72A 4I50B 3UV7A 4RNDB 2ZUEA 1B7GO 3A4MA 3HMKA 2OGSA 2YOFA 3M6MD 2LXNA 1GGVA 1M33A 1VP3A 2Y76A 2ZRHA 3IUPA 1BJTA 4HP8A 3GGCA 5KHAA 3T9FA 2Y0EA 1NG9A 2IUTA 3VNUA 4IHAA 1FP1D 4JI3B 2A35A 1MT3A 5JDCC 3KRTA 4O1IA 3HJRA 1AGXA 1Z0DA 1E1YA 5IZCA 1QIJA 4DMHA 3HY4A 2VXCA 2CSXA 5E2IA 2ATCA 4IUBS 2AFIA 1LK0A 1UOQA 3NHKA 5JT1A 3IBSA 4I9FA 2Q46A 4Q4JB 1DTWB 4PFSA 2BSAA 1H6AA 2J3EA 3FJOA 3D6TB 1OXXK 1YACA 4HQ0A 4QULA 4RS4A 5EIBC 3JXEA 4FZVA 2XUJA 1PDVA 4CMIB 5ICGA 3AHDA 3M1YA 5AW9A 5A03A 3KV3O 3CNHA 1FUYB 4Z7OB 5KPJA 2RGRA 2HHJA 2FLWA 2JLRA 3Q2IA 1J49A 5NLLA 3RFTA 2ONZA 1DC6A 4W6QA 4RPLA 1BDBA 4KX5A 1GQYA 4QKQA 3URMA 3H5OA 3W8NA 3QBTA 2YHBA 3DW1X 3GLFE 2A5LA 2IYAA 3G7SA 5AQEA 1XPJA 1RBYA 2GEFA 5KSYA 1GAXA 1TMGE 1T9HA 4M89A 2B37A 1OXBB 1L7BA 2FVXA 3JQBA 5L3ZA 5JFTA 1KEWA 2AJDA 2DU8A 4DEYA 3C14C 3L7YA 4XDYA 1Y3HA 4D3ZA 1D4AA 3GJXC 4LV5B 4FLFA 1XMSA 3RJ5A 4BJ5A 3OC0A 5T57A 1Z8FA 4KXVA 1VG1A 4TUYA 4UXIA 3CVUA 3BGWA 5C34B 1QAQA 3AFNA 1YKSA 2GHIA 2HU2A 9LDBA 3TECE 3A05A 4NE2A 2IHUA 3GLHB 1Y6JA 4PLVA 2WWVD 5FOWA 1AXRA 4NIMA 3RUAA 3SHWA 3TZBA 1QNLA 2Y77A 1E6MA 3A9RA 4K46A 3BMQA 1JFFA 1M7GA 3MWGA 4FCTA 5PGMA 2FMXA 1BYUA 1NXXA 2O3UA 3HXPA 4M1KA 4OBXA 1ONSA 3LCMA 4URYR 1ORDA 3UN1A 3QVKA 4RTKA 2NU6B 5HF5A 4MEAA 4UOQA 2QZJA 4UMFA 3AEXA 3JWPA 3M5PA 5AK4A 5GIOE 4ARZA 1C8BA 3EVNA 4FGKA 2OHHA 4GX0A 4A1OA 4KDFA 2P0YA 3SEFA 3K31A 1DEAA 1T9DA 4CJXA 4PNZA 5K99A 1ZOOA 2MSLA 2BKUA 2H9AA 2JNWA 3NNDA 1VKJA 1GOTA 1EFRA 4YK7A 1H3NA 4MWCA 2EU8A 4OQXA 2D5BA 4OAOA 5LBIA 4QGSA 4YRGA 5JY6A 2OO5A 5HFNA 1YHYA 5LXTB 2DRIA 3ZWAA 1FW8A 4HY3A 3WWYA 1GUAA 1Z83A 2FPPB 3GLVA 4QBGB 3WQBA 4F45A 2OAQ1 1GSIA 1TM2A 1RVDA 2FZ4A 3R3UA 4FILA 3PVSA 5KCZA 3H84A 3N7AA 3PT5A 4I50A 4Z9FA 2AD5A 2AN4A 4TXNA 7REQB 5J40A 4TPKA 1SR8A 3X3HA 1Z4IA 3M2PA 1QAOA 4PRLA 4B5KA 1RLTA 3H5LA 3MBIA 4KOEC 4EUEA 4DAOA 5FBQB 5DHQA 4CR7A 3DE2X 3C16C 3O7WA 4J1NA 1E2MA 1O5IA 1C0LA 1X1RA 1P1RA 2C4KA 4O5OA 3WNQA 3S2UA 2GEDA 4YRNA 4OJQA 2I91A 3OSZA 1YIAA 2N75A 3FPBA 4YYZA 4RIIA 4ZI2A 1ZVMA 4Q4JA 4COOA 2WUGA 1DTWA 1QKIA 2WR8A 3FSGA 1UEIA 1EUQA 1ZN2A 5EJIA 4PN3A 4MUBA 5LSAA 1KBQA 2JA2A 3CUVA 3R3ZA 3C6KA 4NH0A 4BZPA 3IBYA 3THXA 2XTAA 1UBLS 1CX9B 3W79A 1KU0A 1P77A 4EY3A 5FPKA 4ZMRA 3Q40A 3EDRA 3QK7A 3DMNA 1IE3A 2G7ZA 2XVZA 2ZB4A 4KUGA 4PZYA 1SUBA 4JOSA 1DWOA 2L82A 5H16A 4HDRB 1Q16A 4MLDA 5BR7A 1FLAA 1O94D 2FEKA 3T9BA 5ICSA 4OD0A 2CXTA 1PS8A 2J46A 3JZMA 4RNCA 5KYWB 4PYKA 1WUIS 3G1WA 2B8TA 4MUHA 2QT0A 2ZUTA 1YS9A 2Z2XA 3KVRA 2FH5B 4GXRA 1RDFA 2XZOA 4BXOB 2QHXA 3NRBA 1RAIA 3HPRA 1N78A 4HBZA 1TA0A 1C41A 3UMYA 2DAPA 3B6IA 3DDNA 3JQ7B 1URPA 1JDTA 1XL1A 4WVLA 3PQ8A 2PT7A 2PZ8A 2ZBGA 1FBNA 3IE2A 5FPPA 3VX3A 1EVLA 4ACAA 3IO5A 4LCJA 1Q0SA 3F74A 4OXKA 5FWYB 3THWB 3M4ZA 2J0SA 3PR3A 4KC0A 1QO0D 1Y7LA 1FFXB 3BM5A 5IMSA 1R5NA 3LK7A 1YCFA 4TWRA 5DPMA 5CDTA 2BWJA 1PO7A 3ORYA 2GEVA 1R6UA 5EKTA 1WCV1 1BROA 1INLA 3F2IA 2AWNA 3OT1B 4MUYA 2LVBA 3ME5A 4DE5A 4CIDA 2E4XA 4H7FA 4MUKA 5DULA 4XVCA 2FSFA 4JENA 4URZR 5KNBD 1N2IA 2OEPA 2C9MA 4LJLA 5KYGA 2J4DA 1DJOA 1QGOA 1M6EX 1PDOA 2POCA 3HGQA 2BEUB 1LWNA 3BXZA 3JYOA 1BMFA 3L9WA 1ECJA 3BERA 3LAWA 4CI9A 3U0BA 2OORA 4JOQA 3GUZA 2J6BA 2O54A 3RRFA 5LXTA 3W4JA 5FLEX 5B3JC 3QUQA 3QXHA 3KKEA 4WVFA 3ZE6A 5C51B 1JVBA 1A2QA 1KH2A 3R3VA 3TNYA 2GN4A 4EY6A 1L9XA 7REQA 4ZGBA 3N86A 4JNKA 4MVJG 3KEOA 3BZBA 3KLNA 3WGKA 3EVGA 3IIJA 1EMDA 1XPRA 5C5IA 1Z63A 1CS0B 4LC0A 4KU4A 1KEEB 2CLEB 5FNVB 3OIFA 3JYLA 3LWBA 4PX5A 3U37A 2V8OA 2YVLA 1VCHA 5TARA 2ZAOA 2HU7A 2XHZA 1NHWA 2ZT5A 4N5NA 3UGQA 5IT4A 4PXAA 4BMXA 2VK1A 5FADA 3BWXA 3C8UA 1WCIB 3CZRA 1PWZA 3BGIA 4Y3UA 2OP0A 2COKA 2PGIA 4ZDKA 4MQEB 5BWLA 2W6OA 3LGAA 2HCTA 1NQ5A 3GVXA 3O90A 3SI7A 4N48A 4DLRA 3KETA 2DQZA 3TEMA 1XKLA 1AZWA 2BGLA 3GT7A 4U7HA 2Q9AA 4ZYLA 4JR0A 2NT4A 5JYCA 1LPPA 2CHEA 1YBMA 1L5FA 3HGTA 4HDRA 1NP6A 3MS4A 3EEIA 3ZHVA 3CS3A 4DN6A 4FR5A 4DMFA 4OLAA 5A5DA 4FP9A 4IICA 2K2QB 5KYWA 3ESBA 3JQAA 3W8FA 2BEWB 3O2QB 5DOVA 1NW8A 1XRSB 1IEVA 1MIHA 1ODJA 2MYPA 1ZA2A 2P9EA 5DH9A 1UQUA 1HDIA 1CZOA 2TECE 3VHXA 1KZGB 4DYVA 3D6NB 4DZZA 5AUNB 3RADC 2PCLA 4M49A 1GCUA 3QUTA 4JVLA 1GZVA 1CV2A 4QL3A 4YGYA 4DRYA 3OFVA 1QGED 2PS1A 2MYNA 2WEKA 5LQAA 2BOVA 3QVLA 1UXIA 1QANA 1BG6A 1ZJYA 3CF0A 4QOIA 5E7IA 2HWYA 3UXHA 3ICCA 4WV3A 1XZJA 2P5UA 1BW9B 1II0A 4EI2A 1LD3A 1U4SA 2FR8A 2X4DA 2XNJA 3GGJA 4ILEA 2CK3A 2X9LA 4L0QA 5CX4A 3U3ZA 2D8MA 3UQZA 3GXBA 4QLBA 4XIGS 1DC3A 1X1DA 3CXUA 3E5NA 3GGPA 1OT3A 3OT1A 5AW2A 1HE1C 1KORA 2Z9CA 1DJMA 4Z1MD 1L1QA 4FSHA 4JI7B 4XQGA 3ZNQA 2PAFA 1XA3A 2NT3A 3KZNA 1YONA 2YWXA 4NK4A 5FWAA 1VRWA 2NXCA 3JQDA 3RTDA 4YXFA 2IEGA 4FFWA 1YDHA 3CLSC 4ZCTA 4MWOA 1M1YB 1DAHA 3FJ1A 3L1JA 5JMPA 3RBXA 2BEUA 4G09A 2JGRA 3O74A 1R4MB 3ZYZA 8ADHA 4ZICA 1DCMA 1VYUA 5TMEA 1IIBA 1TTTA 4MQUA 5BSWA 1V3UA 3ZKWB 1RI2A 1VJ0A 4I6GA 1HNZB 3RRNA 3P32A 3OEHA 1S9DA 1EFCA 2BI4A 4L74A 5AHXA 4CDMA 1Y3AA 1ENPA 3TSCA 5I4KA 3QNWA 1E2BA 1K5PA 3UKDA 4E3WA 1TF5A 3A1WA 3HI4A 4ENVA 3JVDA 5THXA 1UJNA 2PQ0A 3H2JA 3LW7A 3MUFA 4B3JA 5FBHA 1JA1A 1GGKA 3DV2A 5FNVA 1KEEA 4RZXA 4OGKA 2BTQB 2IHNA 1RPAA 1VA5A 1U2EA 2YNMA 3K5WA 3M8KA 4F72A 4UM9B 2CLSA 4TT3D 1R8QA 3THRA 4D92A 4XX0A 2I4IA 5HKBA 4A6PA 1FFHA 5AKGA 2JG3A 3PK0A 1SJ9A 1UPCA 1WCIA 5DU2A 4A4DA 1Q1GA 2VHEA 5K2MA 3MTBA 1L1FA 1VJDA 2I6TA 3KM0A 3MWLA 3W04A 4QFDA 3VHQA 2Z2ZA 4MQEA 4PAMA 5EHZA 1ZIPA 3BGOS 3EVBA 2BFEB 3FE2A 3WLFA 4FWTA 1KI8A 3R7WB 4IZIA 3TZLA 4EO7A 5HFJA 1JEEA 4MR7A 4FGWA 1U0BB 3CNNA 3K70B 1L3BA 1L8AA 4QFCA 2VEDA 2FP4B 2ONCA 3E0QA 2C2HA 2PN1A 1V35A 2RGDA 1YOBA 4GZ5A 4KE8A 2PSJA 1PN3A 5TPWA 1YL6A 4CCSA 3ZJVA 5E7QA 2ZRNA 2II6A 4BB5A 1EDEA 2GTHA 1OXVA 5EHIA 3KT8A 1L2TA 1E4VA 2QI9F 4LA4A 221PA 4MW2A 4RA9B 3UB3A 3VR4A 2XR1A 4RE5A 3T5PA 5G0SA 4HB0A 1NBMA 4C0KA 4U7TB 3BK7A 3PCXA 3HHEA 3ECAA 2W6NA 4BV3A 3WLOA 2ZUUA 1UKYA 2A58A 3EZ7A 3R09A 4OP1A 1V0JA 5HNKA 2BH2A 3V7FA 4CMBA 1TCUA 3CB4A 3SVTA 1L6IA 1SCQA 3Q3EA 3ZWPA 1AKQA 3KCQA 5KYNA 3S70A 4X7PA 2P77A 2ZJ6A 3D7KA 4N40A 3IVAA 1ZM7A 1YHNA 3SIRA 1LS1A 2ODQA 3KDSE 2R0QC 1Z5OA 4XB6B 2C7VA 3QJ5A 2NNLD 4DLWA 1T0BA 4DAEA 2QL5A 1TAHA 3CWQA 1F06A 4IF4A 4KWEA 4PU0A 4I4NA 2OCDA 4IZ6A 4RFVA 1DXQA 4IJQA 2ZWMA 1L7RA 4I66A 4N3BA 1X70A 2H1HA 4CLXA 1PVVA 1M1YA 3PC6A 3PFHA 1HUQA 2O4CA 3CN7A 4KGZA 1UZAA 1O0BA 1DG9A 4YXWD 1MB3A 1T36B 2Z58A 3TB6A 2Z5VA 1LVGA 5KWSA 2OQIA 3ZKWA 3UW3A 3D3NA 3QGMA 5EINA 3QWAA 3OPYB 1NBME 2IEAA 2J9RA 2OZEA 4NYJR 1U0NA 3WJ7A 4WD3A 1YZFA 4LOIA 3CW9A 4A7PA 1DAOA 4M36A 3TW0A 1KMMA 2OC9A 1B23P 2P5SA 2V4UA 3JS5A 5C5CA 1ZHOA 2OOSA 1FYWA 3TWOA 5IVIA 4A6EA 3DHYA 3U9LA 1P9WA 2BTQA 2WVJA 4IKOA 5DP2A 1K6IA 2QUHA 3PRHA 4QYTA 1VPDA 4M0KA 1J6UA 5ADHA 1QVRA 4Z2YA 4AZ3B 3AKZA 1CT9A 3GWGA 1M5RA 1YZUA 2YIVX 4YCLA 3WJ1A 1T9GS 3G8CA 3II6X 3KO8A 4EJ0A 3QU5A 3D6UA 3P9KA 4LDZA 3E7PA 1G1AA 4ZVTA 3VHLB 4QVIA 1M1YE 5JROA 1JIJA 2NVWA 5AI4A 2BFEA 1REQB 1XRPA 1YJBA 4RLQA 1T8TA 3P9CA 5J63A 3R7WA 1T2FA 2XTJA 5C4MA 2ZVDA 2WV9A 3UA3A 2BGGA 2NO4A 1VLHA 3B5JA 3JU3A 4D41A 1K6JA 1OKKA 1PGPA 1OGIA 3E22A 3PTLA 3U1TA 1L7OA 1E2IA 3GDFA 4U2BA 5BV7A 4BVKA 2FP4A 3VU1A 3L7LA 2DH6A 4B0OA 1B6TA 3A1DA 4G36A 3WKEA 2ZR8A 1KDYA 3WBKA 4NR0A 1SXQA 4KRFA 4W5RA 3B51X 3FWPA 1K7FB 3OU6A 2GXSA 4Q39A 4XYMA 2ZJZA 1FUKA 1QFYA 5M7EA 1EESA 1MAHA 2GXUA 4RA9A 5FTJA 1XLWA 3RSGA 3IPRA 3LY8A 2OV2A 1Z56C 4OL9A 4NZZA 1WW8A 4EG8A 1AQNA 4DHEA 1F4LA 5AD1A 2HW8A 5K0TA 3LD9A 1MMFB 3QF4B 1BVRA 3CYFA 4MS3A 1L8XA 5KKCA 4IHJF 2V5VA 3PQ7A 4D8YA 1ZRSA 1G20B 3MTIA 1YS4A 4OHBA 1UIMA 3C3KA 1G7SA 3D8SA 1ISFA 4P98A 1AV6A 4WKNA 1XQVA 3QEOA 2G63A 1U7PA 3L06A 5DJ5A 3H1EA 4JC5A 3AUJB 4P7JA 3GAAA 1E9AA 4ALKA 4B74A 2ECOA 4R0MA 3FNGA 5E4JA 3S1LA 3I2KA 1P2DA 1EWVA 3HB5X 2UZ3A 1GTG1 2R5WA 4Q9JA 4F06A 2I4MA 4QLOA 1BA3A 3EISA 3K0BA 6Q21A 2PBRA 2YJ4A 2P4SA 3G49A 2Q4EA 4IQFA 2QX4A 4XWOA 2IIPA 4DCOA 1A0OA 5FTNA 1Y8RB 4EPTA 4OQMA 1NMXA 5B6IA 4XEUA 3A6LA 2FG5A 5FYDA 2OWEA 1OSNA 1L5NA 3N0TA 2YOHA 3SJAA 1T36A 2GN8A 2LIVA 4UHBA 4DADA 4DV4B 1WDLA 1HORA 2QLJA 4IEIA 4DCMA 4EVSA 1TEZA 3OPYA 1GFWA 3T9DA 1IAQA 3ELUA 5CLFA 5LDHA 1N75A 2HY7A 3BIOA 4IUDS 2N1BA 1WHSB 5K3EA 2B30A 4FGJA 1XFAA 4U02A 4TKVA 4ZT5A 3AH8A 1EDOA 1F51E 1P5FA 1IQRA 3MMNA 2GUGA 2JFYA 2Q41A 1P1IA 2JZNA 3DNPA 4MQLA 2PR2A 3LBNA 4FUQA 3M83A 4QJ5A 4EZIA 1SQGA 3AINA 4JLAA 3DBVO 2R86A 1HPLA 1I33A 2X1LA 5C1OA 2OGWA 3LNCA 2C0QA 3NT4A 1VRCA 2PBZA 3FMIA 1K3UB 1C1XB 1KFEB 1L6RA 1SCIA 3WO0A 4AZ3A 5C7OO 2VDPB 1KY3A 2BR3A 3IP5A 4ND4A 3U5TA 4F5YA 1Z5NA 2HFJA 2V0GA 4BKUA 4DWOA 1E7YA 1Y4AE 2BMJA 3GJ8A 4H4EA 4HC4A 1F1BA 4PHHA 521PA 1IDN1 3MAJA 5SYMA 4QUEA 4YAUA 3WGUA 1YK1A 1E9CA 2V6JA 2FMUA 3O4RA 1MDFA 4TMXA 3QLUC 1WY5A 3H86A 3DMHA 3ETNA 4CTKA 3GF4A 1U8TA 1LK7A 3NALA 2O2XA 4FZJA 2B36A 5K8IA 4XIIA 5DHPA 2CL0X 2FEAA 4RCZA 5F5LA 3S2IA 2XVAA 2Z56A 3HO6A 4HVCA 2DM6A 2Q1TA 3H99A 4W5HA 1OIVA 1TMOA 2HV8A 1CYDA 3F3YA 3PJDA 3H18A 1EUYA 4NMLA 4XFDA 4WXRA 4LJ9A 4RU1A 4QHYA 3C6XA 4NL4H 1JDPA 1EUZA 3S8MA 3AFOA 1E92A 2P9JA 3ACBA 3HRIA 3PUIA 1TJ5A 2A33A 4M37A 5JLAA 1VL5A 1GA1A 2J7PD 1H5QA 2QMZA 5IG2A 2JAXA 1F5SA 2WJZB 1POWA 1R4ZA 3E48A 4AW9A 3T95A 2PX0A 4R05A 2HJSA 4QYXA 4X62B 5KQMA 1OH6A 1R8JA 4YV7A 3NAZA 1CLEA 4G0WA 4CF3A 1QRTA 1UXKA 4WXYB 3ZZMA 2DBVO 2CUKA 3O8BA 2OLJA 2W6PA 4IIEA 4GLOA 1X7ZA 1Z17A 4KQMA 4J0GA 1PJRA 3JD3A 3NGLA 3Q7IA 1CUHA 1TVMA 4L16A 1JIQA 5EJ4A 3HJBA 1K6XA 4IMPA 1W2GA 3N2GB 4HNHA 3WIDA 3ZLUA 1JQLB 2ZBRA 3H9BA 3U3RA 5F12A 4CCWA 3OQNA 2O8CA 4HWGA 4MWGA 3CVVA 1O94C 1DEOA 3A3YA 4YJHB 1R9MA 4UCWA 4X1OA 3V97A 2JIZA 4C03A 3GIWA 2Q5FA 3G0CA 1DAFA 2BFMA 1T1SA 1WHSA 4K9MA 1Y98A 1RJ9A 1JSZA 1M2WA 1N6NA 1DADA 1G20E 2FPIB 3K05A 2AQKA 3M4YA 4X8LA 3V8BA 1HTWA 2HRCA 2D0OB 4IJUA 1P2FA 4RQTA 2QJRA 1MO2A 4F4IA 1ESEA 2EP5A 4KK3A 3H8VA 4LMBA 1G17A 1YAJA 2F48A 2ZYIA 3CN9A 2JDIA 1Y34E 4GWKA 1ABEA 3VR1A 2R62A 3P94A 1C1XA 3A4TA 3FFTA 3NETA 3OPQA 2AOTA 4ZTUB 1A8UA 3H17A 1C3OB 4MV8A 4PO8A 2DBYA 1JLHA 2P6OA 4JB8A 4N5LA 1K4YA 4XRRA 2DLNA 2R66A 2BIFA 2WJIA 3FTQA 3GJQA 2WUEA 3OFNA 1WLSA 1J99A 2O4UX 3MJ4A 1L4MA 3AUUA 3OKPA 5FUVA 5KQLA 1PWYE 4KVGA 3C0KA 4KAFA 5LWHA 4ZTBA 3E9ZA 1A1VA 1LLUA 5CNMA 1N6HA 1DEXA 1C8VB 5LYJB 1S5PA 4V24A 3T15A 3TNDA 3AIOA 2WG1A 3I9V6 3SFTA 1RXWA 1I7PA 1ZITA 4R1PA 3UTDA 1E0SA 4EJ6A 3OHMA 2R25B 5FTLA 2XA9A 4MPJA 2BHNA 2YHSA 1Z18A 1T8WA 5FR2A 2H1CA 3VPAA 1FDIA 5INTA 2V7GA 1P2TA 1GTVA 2EG9A 4JXKA 4RO0A 1ZR2A 1B8OA 3W2EA 4ZANA 2V7UA 3AEYA 4HXYA 3PQEA 5FV4A 2NAFA 2EVWX 2VJPA 1PFUA 1PJZA 3U7GA 4JUDX 1M2EA 4FE7A 4KREA 4JASB 1QFJA 4WZZA 5EZ5A 1LPBB 2WHYA 1OI4A 5LWQA 2R6JA 1NASA 4RH3A 3P20A 4J90A 3QU7A 1DQNA 3IIIA 2GYUA 4L4UA 2IHYA 3AEQA 1RHMA 1V8BA 3UYLA 4B3CA 2OHGA 4EEZA 3GX1A 4GXQA 2RGNC 3MCZA 1AX9A 1W4ZA 1UKEA 2Q6KA 2WF8A 3PLRA 4Q3EA 5FQNA 4HMPA 3V4ZA 5A4MS 5KHLB 3AJRA 1Y5MA 5F4BA 1R2QA 1MKYA 4P80A 2I2FA 1O77A 4HDSB 2ZE8A 4LQ4A 5F1OA 4C89A 2R97A 5L51A 1RE0A 4FTWA 2C3UA 3QZUA 3O8LA 2BF4A 2FYTA 1UXGA 2QX7A 2W5UA 1Z6QA 4KQ2A 3SDSA 4R8MA 4X92A 3TH5A 1A95A 1PK8A 4GECA 4HJXA 4WNAB 4XJTA 3CO0S 4KLRA 1MOZA 2GPAA 3GHYA 4ZCPA 3PXAA 2O2YA 4BBAA 4Q03A 2GJ4A 1F2DA 3AUFA 1BVUA 2Q21A 3B6ZA 3L6BA 1PZFA 2RK3A 1NF9A 2VJMB 2Z8YM 3O8NA 4PW0A 2BGMA 4X44A 5HKLA 3V8MA 5K0FA 3N2GA 3CX8A 4KG7A 4Q1DA 5J1TB 4DNFA 1AS0A 4HEA1 5ED4A 2PJUA 4S3MA 2VK8A 3T7SA 4JU9A 4A15A 1QIKA 2CZQA 2HMYB 3DMYA 3QFTA 2JFNA 4KL8S 4YJHA 3CNOA 1A9YA 2IE8A 3N39C 2NX2A 4AO6A 5CDSA 3UGJA 3DL2A 4I1RA 2XKJE 4NV1A 4UAGA 3SP1A 4MZXA 3BSSA 3ZCUA 4P5EA 2XCOA 5JPCA 2QL9A 2EFCB 2MSCB 3DVQX 1HKHA 3K4QA 1M8KA 4GAEA 1E1QA 2PCJA 5AMXA 2V0CA 2I1VB 4A10A 3VISA 4BUCA 5AW7A 2YXLA 2PWBA 3AMVA 5CU7A 3EPJA 1IN6A 2V3CC 1WE2A 3INGA 4AJKA 1WZUA 2UZ1B 3HUTA 3PD7A 3AYZB 3OWHA 1Q0HA 3CZQA 2FMFA 3R6TA 4OB7A 2WMDA 3LUPA 1JDZA 1CDDA 2YWEA 4MYSA 1C3OA 4V2UA 4Y7DA 3ZBUA 1OB5A 1XTZA 2GTIA 3DFZA 3LS2A 4N8SA 1YCHA 1F8YA 3NWBA 4CVNA 4HV4A 1G3QA 2AHOA 1H0KA 1UAAA 3MCUA 3CNBA 2OMEA 3LO5A 4M1WA 3CUUA 4R9SA 2O2JA 3R0QA 2IOFA 3UMFA 3G9XA 1E89A 1GPUA 3PA8A 1A9SA 5LYJA 3TE6A 3DHVA 3PDHA 3NTRA 4C20A 2NZWA 2DPMA 1EP1B 1PYOA 1RAAA 3JD1A 4IIJB 4C05A 1Z0ZA 2HPHA 1Y6RA 4PHCA 3ZXIA 1QYCA 2VQFB 2JEZA 4Z4QA 5U4XA 4RV4A 2YV4A 4RULA 1C4WA 2IEBA 3ITNA 3LPMA 2GETA 4L75A 3GFOA 3T54A 1A98A 3TLZA 3HJFA 3TAHA 2P2CA 3M3PA 1PT7A 1PGJA 2IUUA 3C85A 1NBAA 3DC7A 1BFDA 2EBFX 4AJOA 5C8YA 4RZHA 3GYGA 2ZS7A 4I55F 1CHNA 4IGFA 3SLRA 2BELA 4JLOA 4XRGA 4E4YA 2NLOA 4IFTA 1RM4A 2ZIVB 5KYVA 1NJ2A 5KU7A 4ZOLB 4UTRA 2DLDA 3QE9Y 3QMWA 4M3NA 4JEUA 2PSHA 3HCPA 5E2BA 5F52A 3T5DA 3MWJA 2DYKA 4DLTA 1QF6A 2VPYA 1LXCA 3PLNA 2IZOA 5JECA 5LKAA 4KLCA 5HA5A 1ZD1A 1NUHA 1V26A 2H11A 3BWYA 3I1JA 3KG2A 4LZZA 3AG5A 1GFIA 3QBVA 1UFOA 2R87A 2XMDA 2ACWA 3OLVA 3M6UA 1YTLA 2G72A 3HUDA 4PPYA 4Q18A 5ALDA 4EFKA 2FG6C 1LVUA 1ZNWA 1SBIA 2OZVA 4JGGA 5P21A 4WESB 4C88A 1Q7TA 2IOYA 3TXAA 4F04A 1YB4A 4WNAA 4XUEA 3RQIA 4IDCA 1UMDB 2P79A 3NM5A 2CT8A 4DLXA 3UANA 5LKRA 3IFSA 4BJ1A 2VJMA 3U44B 4RABA 3VH3A 1WABA 2YV5A 2E49A 3BL6A 3ENQA 4MVWA 4N5HX 4UDXX 2ZIEA 4X6XA 3T5BA 2PY6A 3DKVA 5CLHA 2O5RA 3TMKA 5JJLA 2C9OA 4N1AA 3A6ZA 2AD1A 2FWNA 1M7BA 1CP3A 2KI5A 4KAJA 4Y0VA 3ADDA 4GMDA 3OLYA 4F3CA 4LJYA 3G8YA 4N6GA 5IPFA 4KZPA 1T35A 1KRHA 2P2GA 4K03A 3UZUA 1HDGO 1NN5A 1TJ3A 1U8EA 4ONEA 1VG9B 1FS4A 4BKRA 1JAXA 1IMOA 2JJ1A 2RH5A 3BE5A 3DEJA 5K0NA 4TN5A 4ON9A 2BEVB 4HB3A 2O7QA 5H59A 2O5EA 4OMDA 1BX3A 2UZ1A 1E1LA 4FMDB 2OA0A 3CTPA 1E69A 3TZKA 5EE5B 4YRJA 3TI7A 2UYCA 1E5LA 3A9VA 3CKMA 3RVBA 4LKRA 3V2HA 4BX0A 3GNTA 2AFHB 4IRUB 2JIPA 1QK3A 4KFSA 5H5JA 3KKOA 4JUAA 3OU7A 1HFEL 2ZBEA 3GHHA 4A03A 1T8PA 2PFKA 4BS9A 4HWKA 3GU3A 3VR5A 2HQBA 4IAOA 2A4KA 2NO0A 3BTUA 4F85A 2QW8A 5AVTA 5DNEA 2LE0A 1QTQA 1EXVA 1HQYE 3TLGB 4PHTA 4GYYA 3TTTA 2GJKA 3PHIA 4OSEA 4ASUA 1UFQA 5CPBA 1KYVA 2IJGX 4LI0A 1X7HA 2P2ZA 2P9TA 1JHYA 4FBGA 3WGLA 1MRZA 2GI4A 2OG1A 4HI0E 3L04A 2EW2A 4HTAA 3D5QA 4D8VA 1PFGA 1TVKB 5EJ8A 4M1MA 4BNUA 3FBGA 3M9WA 4F6RB 3VNSA 1EQAA 1RWQA 5LC1A 3KTDA 1QH1B 4WFQA 1M2NA 1X77A 1K6MA 1U1IA 3BXOA 5LVAA 1E4EA 1TM4E 4K9OA 4QJ3A 1NFRA 4ZOLA 1E9FA 1UJ5A 3SEAA 2KMLA 4B7CA 2C5EA 4TL6A 1SHTX 3T7AA 1TC1A 5DNCA 1PS0A 3QUSA 3L0YA 1VXRA 1D3AA 3BDIA 4P4TA 4S1TA 5GPBA 2MCFA 4NX2A 1AJEA 2BM9A 2DE0X 4AY4A 1ZM2A 3FB4A 3QMPA 4X54A 5AW6A 2NSDA 3HYNA 2ZR0A 3VKGA 3Q7QA 1C9YA 4R2HA 1E0KA 2F1IA 2VF8A 4OVKA 3CPJB 3QYAA 4OK6A 5B1IA 1UMDA 2WJAA 4B31A 4EKYA 3EWIA 1TOAA 1TGYA 3JTMA 4YVFA 5ALZA 4ZRDA 4YT8A 3TOXA 3OBIA 4DNXA 2IV7A 1M2GA 4EYOA 3GT4A 3U44A 1D7AA 4I0WB 1YIDA 1XDGA 4BCCA 4LJRA 4PZLA 1N7IA 3MOSA 3L1VA 2B7BA 5DRYA 4KVFA 4D9HA 2OAP1 1EFRD 4PIMA 1FTGA 1WMSA 3L8MA 3ZI7A 4BU0A 3NDIA 5I3CA 4HO1X 2IH2A 3Q8XB 5EHQA 3GLQA 3SY8A 1EUDB 3G7NA 5DI9A 3LOUA 3KJZA 4ZJZA 1UJMA 3W5DA 3LFUA 2H17A 2PUVA 4RZIA 2PGNA 4NJEA 3FFAA 2GFIA 3IVRA 5FL7D 5IDYA 4DEVA 4TV9B 4JIMA 4RM3A 3SXUB 2FMKA 1NNUA 1Z8NA 2BVNA 3AK4A 3KL4A 2BEVA 1NIPA 1W0KA 4UTXA 1QU2A 1SBNE 3IH5A 5KNBH 1ADJA 3IPYA 4NU5A 5T3YA 3FRIA 1C7JA 2G07A 3MFQA 4IUYA 4BDSA 4CCYB 3T1HB 1YAHA 4A27A 2VJCA 3DE5X 2GSDA 5AIBA 3ICEA 1NA5A 4RKEA 2I2WA 2YQZA 1DFIA 3D3EA 2OV6A 2C7BA 5JV5A 3JWEA 3MCAA 2QX6A 3FSGD 2HJ9A 4Q15A 3CH6A 4W6ZA 4F0JA 5F4ZA 2NO9A 3DE1X 3FUTA 4QHSA 3TAUA 1D03A 4ND1A 3FPCA 3V2GA 3D8UA 1J5PA 1OIXA 4AUKA 4GEGA 5E3JA 3UIEA 2XKBA 1JU3A 3HNRA 2AS0A 2EF0A 1NN1A 4WACA 4GFDA 3S27A 1E7WA 1HSOA 1OOEA 1T9GR 2FEWB 3MOIA 1I5RA 1SNYA 3H04A 4L4ZA 4GR4A 3B3JA 4OIFA 4WBXC 3GPCA 1HYQA 3KAKA 4F5DA 2ILTA 5L3VA 3WL3A 4IIFA 1OBHA 1VPEA 1YFZA 1TVKA 5DCYA 4JROA 2IPNA 1YNSA 4F6CA 4ML3A 4UU7A 4AJHA 4NK5A 3EPPA 1BXRB 4F6RA 4GKBA 2AG5A 3K1YA 3E4CA 5BN4B 1MXHA 2JI6A 3DEHA 1QH1A 1O95A 3PNQA 3LX4A 2OV4A 4KSCA 5K3FA 2JH8A 3IAXA 1DB3A 3IODA 2QTNA 5A05A 5FUMA 1CQXA 4X6UA 5CEFA 1WUTA 3M7IA 2FRDA 2YS7A 2X22A 3EF3A 2V97A 1SVWA 2QAIA 4FDVA 5MFPA 3ZUPA 3HFRA 4M9ZA 4RJIA 1NJ5A 3STTA 4BEWA 1Z0UA 5C1IA 1MGPA 2G08A 3DAGA 2QVCA 3MHPA 3OY7A 3QQPA 4KW7A 2R9VA 2XIQA 3QA9A 4HXFB 4XWTA 1S8AA 4BP3A 2TMDA 2PU7A 1OQAA 2H16A 1GSAA 1HT2E 2Z3WA 4Q3NA 2XCUA 4A92A 4DGSA 1Z06A 1GRVA 2BFWA 1P2BA 3TFQA 4MQMA 4U39A 4Y6LA 3J7AC 4AKGA 1QO9A 2ZR9A 2JBAA 2OP1A 3M5WA 4LVNA 1R0WA 4DV2B 2IYUA 1NG1A 3RHFA 4NBUA 5CT5A 2QG9A 1DIGA 3VYTB 1BMFD 3A6HA 3G0DA 2HWXA 3AR7A 2I03A 1HI9A 2OAEA 3IEKA 3VJRA 1EUDA 2OHFA 4DBLE 2AZMA 4U8GA 3FNEA 2I22A 2ZOSA 4RPHA 4XSGA 2XWPA 5T8KC 5DLEA 4AG3A 1UMCB 3L01A 3VDMA 3RANA 4TV9A 1N3BA 2ERXA 4GLLA 4RD6A 1Z34A 2XNKA 3DXFA 2IOHA 3GEHA 4BVHA 4YAJA 3TQIA 3H1TA 4CCYA 3UJ6A 1J8VA 3IHLA 2J5BA 1E6EA 1ZI6A 2O8VA 4JKIA 2I6QA 4TV8F 4PE5B 1KAQA 3BHNA 3X1WA 4MRAA 3JWJA 3N2ZB 4TMTA 4OBEA 3L93A 3NBXX 3QWHA 1QZUA 1XMJA 3BILA 3I23A 4LPKA 1OYYA 4LRSB 1GLVA 3QI2A 4KJXA 2VPTA 4WX2B 1VIMA 1PHPA 2M6KA 1EFUA 5CH5A 1W44A 2HA6A 2FE4A 2NQTA 3FW1A 4UUMA 5AM4A 4AP5A 4M7OA 1J8MF 1X15A 3DNFA 3SYLA 3V1NA 1XRRA 1AA6A 4B79A 4YX9A 4F7WA 2PWZA 2HO5A 3ICQB 1Y5NA 1DBPA 1ES9A 1F60A 3JQAD 2LIPA 4YIKA 1EX9A 4E5VA 3HO1A 4JLBA 1E1MA 5F5XA 1GGJA 4LVUA 4XYGA 1PFKA 3UH0A 1BXRA 3IPXA 4EITA 2O8EA 1WZNA 2ZROA 5BN4A 5CFRA 4TL8A 3GP3A 4DQXA 2GCNA 1V96A 2F3SA 3D6HA 5I7SA 2RAPA 3AY7A 2FF7A 3JCZA 3LCRA 3OOEA 2HHHB 3FCEA 3QEMA 5HZGA 2F67A 4JMLA 1B6GA 3P9XA 2WOJA 1G9SA 2CVPA 2OO7A 3B38A 4FMCB 1B41A 4OYLA 4GBED 4WH0A 5DN9A 2CXHA 4ARUA 2CK3D 1LZKA 2YFYA 2RHGB 1G8KA 2GGSA 5E6UB 2VDQB 4Q9AA 5HDQA 4RW0A 2Q5LA 3CRNA 1F5NA 3AF0A 1KWKA 1PJQA 3RT7A 5CDHA 4OHYA 1WCYA 1DCKA 2CW5A 2E4VA 3DPUA 3NANA 1U2QA 1FX1A 2DR3A 4KMRA 4M8LA 4XJSA 5D1NA 5IBRA 1BQ4A 4H35A 2O2CA 1KE1A 1QCYA 4KB5A 1G5HA 3D1JA 2QQ5A 4GBGA 4HGPA 4BRSA 2PMBA 4LJ5A 3K9NA 5I7FA 4HS4A 4PLGA 1II8A 2ZBPA 1YO6A 4RZUA 3IIEA 3Q7EA 5THKA 1HOTA 4KMMA 3DFKA 3PFNA 2C59A 4KR0A 4IQ8A 3GLTA 3SQNA 1EJ0A 1G5QA 2QIOA 2VCEA 3OEHD 3LV8A 4Q02A 4QU9A 1WMDA 3UMSA 1UMCA 1DRVA 1O4WA 1NVEA 1N6OA 2HT6A 3DMTA 4PIPA 3T1QA 3D4LA 1ENZA 4JI0B 2IYEA 2FDCA 1RKUA 1XOIA 5HJEA 3W1VA 1WU8A 3CMCO 2K4MA 3EFBA 4OHXA 5BT9A 4QUGA 2QE7A 1SU4A 3RRYA 5G53C 2YNMD 1TPYA 3LBFA 4ZO6A 3VAZA 1JKXA 2ZJFA 3ZX5A 1DKMA 1P61B 1ZN8A 1OXUA 2QROA 3DKKA 3WDLA 1DE0A 5JSHA 3LT4A 2JLVA 3FTCA 3NAQA 4DVJA 1JZSA 3E70C 3CCBA 2IBTA 4ZZ2A 5LJLA 1JIUA 3TFWA 3TKYA 4OEHA 3WXMA 3KQNA 3AOEC 1NY5A 1T5OA 2EC5A 3DDHA 1SIOA 2NVUA 2WF6A 4JBHA 1SBZA 2OHIA 1W93A 4R54A 5AUOB 5B12A 5K8JB 2Y99A 2XXBA 5G3ZA 3F73A 1VCIA 3I04A 4YV1A 4FS3A 3D1VA 1GARA 1KOGA 3WNBA 3N0RA 1CU1A 2QZZA 3FHTA 1XG5A 3WK8A 3WGIA 4IJWA 3A2KA 5EWLB 3IQGX 2OD2A 2IW3A 4IIGA 5FI3A 4E6EA 1ZOSA 2NGRA 4QVGA 2OBBA 4DR3B 3QX9A 4XWKA 4MWZA 3KJFA 1DT5A 3LQYA 5CUQA 1ZGBA 3A9SA 5DI3B 5B53A 2WY2D 2QB5A 5B37A 3VR4D 2IDKA 4XB2A 2ZITA 3PGXA 2WM8A 1DKOA 3HRKA 3KXKA 5ARBA 3FIUA 2WQ7A 1NBMD 1CQZA 1FVOA 1NJFA 1OFUX 1V5IA 2QN8A 3L77A 4IVQA 4P93A 1XXLA 4J4HA 3ZU3A 3F0TA 1DEHA 1YB6A 1RYYA 2JZCA 2SKCA 2E18A 1WKVA 4ZYYA 4MCAA 2V65A 4GPIB 2RGEA 2QT1A 5C81A 3H97A 5FOTA 4BYGA 3ZDCA 2A59A 2FLKA 3AR9A 3FHOA 4M46A 2G88A 5CB6A 2X1MA 3DEAA 1NW4A 2Q1XA 3IR6A 1RACA 3SM3A 4PLZA 3SU8A 1NVVR 2I55A 5CB8A 1A8HA 3OQ6A 3D8BA 1Z4QA 4YI5A 4MLCA 4G5HA 1KKMA 4ZI5A 3NYWA 2GHQA 3ST7A 4AULA 4V1CB 4RYLA 4R2KA 4ZWNA 5C18A 2Q5HA 1H69A 4DGQA 1NKVA 1MC8A 1P3Y1 2H4FA 1BZYA 3VO1A 2CDCA 4DIUA 2LBPA 3ER6A 1C80A 1YT5A 2IFTA 1AVTA 1I4OA 1TYCA 3UB2A 4EH1A 3K5PA 3RVOA 4RV5A 5A5EA 1U1GA 3PNKA 2AR7A 2RJOA 1BWRA 1CIVA 2YIJA 4ZQFA 3MBKA 4PX9A 1J2EA 2VRBA 5EHNA 3DFMA 5DMXA 4ZAVA 4YMTA 4YMLA 2GAOA 1TJPB 2BFOA 3DOCA 3LXRA 3G85A 2OXTA 4FGUA 1W5TA 1JJ7A 4KACA 3TNLA 1D1SA 2SCUB 3M9LA 4OX9Y 1KRXA 1GEEA 3FVVA 4FDAA 2IOFK 4ZVSA 3GRCA 2CLDX 3SVZA 1TB4A 4FCWA 1T9CA 4INPA 5B58T 3D0KA 3OJOA 5EYPB 5HRAA 5IM4A 2O20A 4IFBA 4YP1A 3H0KA 1O6GA 4R0VA 2Q5OA 4UM9D 3ZHTA 5BSKA 3CZ9A 4E5SA 5CCDA 1FC0A 5AM5A 4H6PA 4QXAA 3SZUA 4GW3A 1BHQ1 4H6WA 4V0KA 3BCSA 4B34A 1KY5A 1HXHA 4HDSA 4W8HA 4F4FA 1L8QA 2FB9A 4Z0NA 4XVUA 4M98A 4M9UA 3L07A 2RHBA 3ZJUA 1ORVA 2ZRBA 1V47A 1XLVA 4HNGA 5I47A 2H2WA 1XEAA 4LNHA 2JIQA 4PBTA 5KQGA 2JGIA 3BXGA 3IOYA 1U8XX 2QRMA 4PRZA 4CDNA 4J1TC 2X6QA 2F8LA 2WSBA 3I53A 4LF8B 3C39A 1OKKD 3K70D 2VHCA 2IYLD 2W42A 1ZJWA 5LP6F 3R8XA 3A10A 3ZE1B 3EZ6A 4ZAGA 4KX3A 4B8ZA 1JNYA 2IEYA 2O3TA 5EWLA 5C37A 3NHBA 2I2XB 4EUSA 4C6TB 1ZWLA 2AR9A 2XMPA 2IPXA 5LB2A 2QN3A 5DI3A 2CF5A 2XNHA 1TUBB 4LBZA 4OXRA 5IX8A 1U31A 1P72A 4HAXA 5DBEX 1ZMTA 4QELA 1ZJ6A 3U9TA 4CL3A 3N2NA 3CM0A 2AN9A 2Y2VA 3MTDA 2PLFA 1MC1A 3DZHA 3EUFA 1USWA 1AQ6A 2BGJA 3RIEA 4PC1A 4RHEA 1V3VA 4K9KA 4IINA 1Q0QA 2AXNA 4E5NA 2ID4A 5IZCC 1K66A 3V7YA 3F6RA 5CD1A 4EW2A 3B13B 4QUIA 4REMA 5KVAA 1W30A 5COBA 4LHSA 2RARA 2I7VA 3AL2A 5JNWA 2IYPA 3VMMA 2DT8A 3QYFA 2WMOB 2WJ4A 3NHWA 3T4UA 1X19A 2PSFA 1I3CA 1DJPA 4X60A 4UATA 5TJHA 4DA7A 2WNSA 2QA5A 2HPVA 3D7SA 4JVNA 4UXJA 1ZAKA 2NQ8A 4ZOCA 1BE1A 4JL8A 4BVGA 4GYKA 5C7IO 1G5RA 3D6JA 3I1YA 3UKJA 3ZH9B 4U63A 4RLFA 4GKKB 2OMKA 3TPCA 5AVYA 4RQBA 1YD7A 2VTDA 1ZMOA 1BC5A 3RJMA 1DQYA 2ZSKA 3ELYA 3S99A 3TNFA 4MICA 3HXOA 2BM1A 3AUKA 1XP5A 4DANA 3UVEA 1BWQA 1Z5PA 3CO5A 2HXYA 2SCUA 3GVIA 3JQBC 3N8HA 4FOTA 3RFFA 1KTVA 3G9TA 5KTKA 3I72A 1I94B 2GTPA 1D8AA 1SOUA 4TOIA 4YQYA 5A3VA 1CEEA 2QWXA 4DDMA 1RAGA 1QV9A 2MR6A 1A9PA 4NJMA 4FNGA 4L4RA 4NTZA 4PCLA 3STHA 3V8RA 3OFSA 4OFZA 2FPLA 4ZALA 5GJWC 4YT5A 2BR4A 4MHTA 1C8LA 2JIBA 2R6HA 3C3XA 2E4UA 1AKWA 3NOOA 3U4AA 1YVPA 2I6FA 3L4EA 1K7XB 1LPNA 3AWIA 4QODA 1R8YA 1NYRA 2Q2WA 2XBMA 3RAJA 1QMGA 3A9WA 5H0IA 1N6RA 3EQ8A 5FXMA 5FTMA 3DD1A 3FBWA 4RD1A 3DCNA 1APBA 1HL3A 2VBIA 1NVVQ 1ZUHA 4H0FA 3RUEA 4CM7A 3PDJA 3TSAA 1JDBB 3EVEA 4FT4A 3AI3A 3R6WA 2AMLA 4J3JA 1Z6ZA 5IWAB 3R9XB 1DC7A 1BXGB 3HU2A 3BMCA 4BKPA 4ZHSA 1ZESA 3N2EA 1VGVA 4JI1B 4CT5A 4LYFA 1UJ6A 3ZDRA 4C6TA 1L5YA 5FPSA 3A36A 5CK5A 2AG6A 1O89A 3GLUA 2YC2C 3HA5A 3IJEB 2OO5C 3GW8A 3GEPA 4TWIA 1TUBA 1DMSA 3BHMA 4ZOEA 5J1SB 4UVEA 3HXQA 1JEDA 2W6IA 3K4HA 5H70A 1P17A 3A4YA 2AHRA 1DAIA 1JMVA 3VJMA 4LDRA 2C4MA 2OESA 1PAUA 3MG9A 4LFCB 1ZVJA 3PPWA 1AHHA 2QTTA 4JNCA 2CYAA 1CW2B 3F98A 2V7XA 2O1SA 1MQ9A 4JLSA 3AP2A 3WLPA 4YAKA 5C4IA 2X0NA 5G0TA 4HN4B 5ALMA 2PO7A 3FGZA 3OPXA 4BVJA 2EFEB 2Q3JA 2XE8A 2HF9A 3C3PA 3MVEA 4OJNA 4E5MA 4B9EA 4WI1A 1ND6A 1V48A 1VLQA 4MULA 3G9QA 5A62A 3FD8A 2XYGA 1FMLA 2Q3FA 1KO1A 1O9GA 4QARA 3NIWA 4O33A 1Z5VA 1JALA 4P4SB 5TMBA 1XVAA 3SZOA 2R3SA 3C3MA 1Q20A 3I9KA 1K8RA 1CNMA 5K03A 4HGRA 2HMSA 4NCXA 4YP6A 2Q45A 4G56A 2X13A 3FZQA 4P53A 1ZCZA 4QECA 5LA6F 4AKEA 5JS7A 1AQYA 4JB2A 3ZGNA 1Y6QA 4YP9A 1RYDA 4DL9A 5K0ZA 4V38A 5F2NA 1T0PA 2YIMA 3EAFA 3UHFA 5IXSA 3O2JA 4Q3OA 3UWPA 1X1BA 2C2ZA 2P3QA 2ZCUA 3Q85A 2JIZD 1GVHA 3U2QA 1PV1A 5BNWA 3GT0A 3WS7A 1NMYA 3PIIA 4D25A 4HH4A 4H59A 4PWYA 4V3CA 3ZJ4A 5U9CA 2WTMA 1I6LA 4EOGA 4N0MA 1PV4A 1F1JA 1YQ9A 2VH5R 4LNUB 1P8AA 1PQYA 2TMKA 4OFXA 5H8WA 2RKOA 4WQMA 3F4LA 1V2HE 2HH9A 2XUOA 2WAMA 3P9QA 1VE3A 4ZYWA 5JXHA 2QRHA 5J3JA 2VJNA 1JZTA 2JDID 3S2GA 4NY1A 4O4JA 2WRZA 4G2TA 1UC8A 4C0AC 2W2OA 3A6GA 1QG4A 2HREA 1E0AA 5ER6A 2FPXA 2RJ3A 3IEUA 2GNOA 3O75A 4TKMA 4BASA 5HOEA 3NYRA 4DR2B 2IPAB 4JODA 4JQSA 3UCXA 1JEYB 1PL7A 3OFND 4QGAA 5P8WA 1CERA 4DLNA 3FPEA 3QTBA 1SBCA 2A5GA 1TLFA 3IVCA 1HDRA 5CNKA 5KS2A 5J23A 1ULAA 3ADKA 4NF2A 5JMTA 1QRSA 1BN7A 1P80A 3SQWA 1P0IA 3AW9A 4DQDA 3UV6A 3R74A 3R9XA 4G5GA 4WINA 1BXGA 2OHOA 1PUJA 2IZ1A 3K0EA 4U2GA 4BGEA 1R9GA 3NC0C 3HCCA 3SBEA 5HJ7A 5IF3A 3G5UA 2OORC 5CFMA 3FUXA 2D4HA 2IEZA 3VNVA 2Y6VA 3W05A 1X7YB 2I6XA 3BX1A 5BV2P 3MTAA 2NUAA 1L0BA