4ZV9A

2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
238
structure length
237
Chain Sequence
SNAQVEFTDPEIFAEYITYPSPNGHGEVRGYLVKPAKMSGKTPAVVVVHENRGLNPYIEDVARRVAKAGYIALAPDGLNSVGGYPGNDDKGRELQQQVDPTKLMNDFFAAIEFMQRYPQATGKVGITGFYGGGVSNAAAVAYPELACAVPFYGRQAPTADVAKIEAPLLLHFAELDTRINEGWPAYEAALKANNKVYEAYIYPGVNHGFHNDSTPRYDKSAADLAWQRTLKWFDKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.00 Angstrom resolution crystal structure of an uncharacterized protein from Escherichia coli O157:H7 str. Sakai
rcsb
source organism Escherichia coli o157:h7
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 81
structure length 237
sequence length 238
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zv9A00
4N5HX 4TGLA 1BEEA 4GI1A 4OB8A 5AI8A 4H77A 4X93A 3C5WP 2HFKA 4G4GA 3I2IA 3IB3A 5K3FB 1SOMA 2V98A 1JKMA 4UPDA 3H2HA 4N8DA 1VA4A 2VJCA 4Y2YA 2HHAA 4AO8A 1QIGA 5SYMA 2Z8ZA 3WK8A 2FJPA 2WHPA 1MU0A 3BF7A 4W9RA 4E11A 1CPYA 1QO9A 3C6YA 5JAUA 2EDAA 2BUAA 2OCKA 4X91A 4X6XA 2QMQA 1XQYA 5CH3A 4B82A 5ISMA 2O2HA 1GPNA 3G0DA 4GXNA 5AM0A 3UUFA 3KOOA 4J0HA 3IDAA 5ALTA 1UKAA 5HF8A 1DQYA 4AQDA 1A88A 1UK8A 4I4CA 5C8VA 3H19A 2JGKA 2XB6A 1DX6A 4QDUA 3FLBA 4YK7A 3WKAA 2HRRA 1DWQA 3DEAA 5AK5A 4EZIA 1LPBB 4X92A 2WU3A 3KSRA 5LZ8A 1AMNA 3D2BA 1A8UA 2JGMA 5JAOA 3FVTA 5C8ZA 4XX1A 2H1IA 1R3DA 1CUDA 1QIDA 2XQIA 3BXPA 4DGQA 4X3CA 2WLSA 1Q0RA 3AIMA 3ICWA 3O9VA 4JUIA 5EIEA 3G0IA 5JAPA 2ZJFA 4C87A 1U8EA 4OYYA 4HAIA 5DJ5A 4BTVA 1G42A 1VKHA 5EIHA 2PSDA 1XRQA 2HM7A 3OOSA 4Y2RA 2QT9A 3WL8A 3NOXA 2D0DA 1WB5A 1TIBA 2K2QB 1P0QA 3E1GA 4RE5A 2QJRA 4J0KA 3RLIA 4HZGA 1E89A 2WTMA 4RPCA 2FUKA 2W22A 1XQWA 3B3QA 2XLCA 3H2JA 1UK9A 5CT5A 4G1FA 5HQ3A 3V48A 2X8BA 2YYSA 4BBZA 5ALDA 2Z3WA 4QWWA 4GW3A 1CUGA 2WFMA 1MJ5A 3GBSA 4PSCA 2ECFA 4Y9SA 1QFSA 3R3ZA 4Q1VA 1XRMA 1AKNA 3G0BA 4A23A 3FAKA 4XJVA 3HYSA 2XQKA 1P0PA 3D7RA 4KJXA 2R11A 4XVCA 3MUNA 3H2KA 5HQ3B 3NWOA 4KRYA 3BJMA 4CCWA 3WZMA 5LZ4A 4EY8A 4DNOA 4LYDA 2JBWA 4DMKA 1CUHA 3E0XA 5KBYA 3BIWA 3SX4A 3A6ZA 5IKXA 1THTA 1LPPA 2HA4A 5ALFA 1CUJA 3FLEA 5E2IA 1R88A 4W1PA 1JI3A 1U4NA 3O0DA 4AN1A 1JMKC 2B20A 4KEAA 5T4EA 1YCDA 4ARBA 4UFPA 4OUKX 5A62A 4BTLA 3VISA 1HKHA 4BDSA 5HZGA 1K6EA 2WHQA 4RNCA 1JJIA 2WFLA 5DYWA 4BC0A 4KRXA 1SFRA 1LPOA 5JATA 4FFVA 4LHEA 3EF3A 4L9AA 1QIMA 4C01A 3W9UA 3ZLVA 4WY8A 3D2AA 1GZ7A 5AKEA 2WIFA 1ZI6A 4PSUA 3C70A 4BE9A 1N5MA 2QKYA 5FXMA 1VXOA 3VKFA 4KACA 3VJMA 4EBBA 1FFEA 4X85A 1NU6A 2VF2A 4OB6A 5AIAA 2XMZA 5AKYA 4PO3X 3WWCA 5EHZA 3BF8A 2JGFA 5ALEA 5AH0A 3WIOA 5LIPA 2BUBA 3PUIA 3WWPA 4UBJA 4GBGA 1CUIA 2HU7A 2XE4A 5A6VA 2QJWA 2XUGA 1XLUA 4KAJA 2VEOA 4MXDA 1ORWA 1EX9A 1UOOA 5I9IA 4DSAA 3DL4A 4BP9A 2HIHA 4ZWNA 3LIPA 2Q0XA 1H23A 2YH2A 4FNMA 3FBWA 5JASA 4BZZA 1I6WA 4AB1A 4WCVA 1ETHA 1Y37A 1Z68A 4DNPA 1CFJA 2VTVA 3HSSA 4X97A 4CCYB 1YA4A 2AJDA 2HA7A 4M0MA 1MPXA 1XFDA 2I3DA 1NU8A 3GZJA 1Q83A 4GHWA 3ZWQA 1W76A 4C4XA 5AKXA 4B0PA 5JANA 1DX4A 5HKAA 3STWA 3O4JA 1TKRA 4ZXFA 2HA3A 4J0CA 1QE3A 1MN6A 1J1IA 4CG2A 1EINA 2QM0A 3SWWA 5IVKA 4BZWA 3IVMA 2BJHA 1ZIXA 4XWGA 1EVEA 3OURA 1F0PA 3WJ2A 1OILA 1QTRA 3QBJA 2WU4A 4IH9A 2XMGA 3ZLUA 1LLFA 1BN6A 1XQXA 5T4HA 2OGZA 4IHAA 5ALHA 3WKDA 1G5FA 2H7CA 1UWCA 1QTIA 1E8DA 5DYTA 1H2XA 3G0CA 4H7EA 4G8CA 1YR2A 2VJAA 3FOBA 3WKEA 2AXEA 2H7YA 4BE4A 2C0QA 1ZD2P 4Q05A 5K3FA 1GXSA 2PSFA 5I7UA 1ZI9A 2ZYRA 2G63A 3C45A 2XMSA 2O7VA 4C4YA 3KWJA 4EHBA 3I6MA 3PDCA 4DYHA 5BV7A 1USWA 3ANSA 2I78A 1N5RA 4Y2PA 3P2MA 4H35A 4W1SA 4U2DA 1YASA 4KAAA 5C81A 2ES4A 3D5EA 4AO6A 5FP0A 5A71A 1OCEA 5K3DA 3IUQA 2HA0A 3KWFA 4BAZA 1L7QA 4Q82A 4KR0A 1ZOIA 4K2AA 1E3QA 2CEKA 1M33A 2XMQA 5T4FA 1LZKA 1XZGA 1BU8A 3H0CA 3WK5A 1C4XA 5E4JA 1VE7A 3FCXA 4UBOA 2XI4A 3ESDA 3L1HA 3C6XA 4OU4A 3I2JA 3KD2A 4H0CA 1ACJA 3S8YA 3PFBA 4J7AA 2ZJ7A 1K4YA 3GA7A 2XUOA 2ONCA 2CKMA 1CV2A 2V96A 5AKKA 1YS1X 5FPPA 3WL7A 1HLGA 1H2ZA 3QITA 1CUVA 3QVMA 4X90A 1XZAA 2QUBA 2PX6A 3DCNA 1YSCA 2OGSA 5AOBA 1TCCA 1CQWA 4TPKA 2GYWA 4AMYA 2WIKA 1EI9A 3LCRA 2VQ6A 1VZ2A 2WSLA 1L7RA 2OAGA 4AZ0A 1EDEA 2XUFA 3A2LA 2BGNA 1YS2X 4PSDA 4QEKA 3VJKA 2J3QA 3Q8WA 4P08A 3R0VA 5E4TA 1A8QA 2BGRA 2GBGA 3DS8A 4H7IA 4FNGA 1FFDA 2J4CA 5ALGA 3FWHA 4EY5A 2WUEA 2Z8XA 4OB7A 4AO7A 5ALOA 1GPLA 2PUJA 4H18A 1H22A 3DLTA 4B6GA 3WI7A 5HF6A 3WZLA 3RK4A 5FUMA 1L7AA 1QLWA 2AJBA 1GKKA 3WL6A 3PUHA 5A7GA 4W1RA 1CUXA 1SCQA 1DQZA 1EXWA 2WM2A 5AM5A 5CT6A 3GUUA 3DDUA 4H7FA 4J0IA 1GGVA 1MNAA 3SC2A 3CCBA 4MQMA 1CIJA 5J3JA 4K6KA 4F5ZA 1MO2A 1T2NA 3ILSA 3WMRA 1GKLA 4HVTA 4WDQA 3AFIA 5AI6A 5HFAA 4BATA 3F9CA 3F96A 4X6YA 1K5PA 3UUEA 3WK7A 3U0VA 4ZRDA 3OM8A 5JAHA 3D4LA 1J07A 4WFKA 3QMWA 2GZRA 1IZ8A 1U2EA 4J0DA 1W52X 2OCIA 1AURA 1FFAA 3C6BA 3AJAA 1EDDA 1T4MA 1SC9A 1H2YA 3LLCA 1BE0A 2XUQA 4AXBA 5K3EA 1JJBA 4ZV9A 1GT6A 3M83A 2HU5A 4CIAA 1G4HA 2WIDA 5AHXA 3MUOA 3N2ZB 2BUCA 3E3AA 3VVLA 1XRNA 2WFZA 3QPDA 5I8PA 4B9AA 1QZ3A 3PF9A 1LGYA 2ACKA 4FKBA 1VXRA 3LP5A 2RIPA 4LIPD 5CBKA 4FHZA 2BFNA 3IUNA 4UFOA 3BIXA 1TRHA 3I1YA 3C6ZA 5KWIA 1TCBA 7YASA 1X2EA 1FJ2A 1XRLA 3AZOA 1UT6A 4P93A 2JGEA 4QNNA 3BL8A 4AN0A 1O6FA 3DYVA 4G9EA 1S8OA 2PKYX 2G5PA 5AM4A 3OG9A 5AI9A 4HXFB 3DQZA 1RWQA 4B80A 3H1AA 1LPSA 4S0XA 1BCRA 3DKRA 3OTQA 2B9VA 2PPLA 3GELA 1SCKA 3QYJA 4U2GA 4NMWA 2WUGA 2PVSA 3ESCA 1CRLA 3BWXA 5C7YA 2VT7A 3K6KA 5CH5A 1MX5A 3G02A 3R40A 3AIKA 4BCCA 1HQDA 3VXKA 3ESAA 1CUUA 4HXEB 1JT2A 4V2IA 3WWOA 5CRIA 1Q0ZA 1ACLA 4UHFA 2XT0A 4BVLA 3JYHA 4HS9A 4KE8A 3I2GA 1IUOA 4LKOA 2GBFA 3IIIA 3WK6A 3YASA 1VZ3A 2CUTA 1EK2A 3E4DA 2VAXA 4M0FA 2O7RA 2YXPX 1F8UA 1UXOA 3S2ZA 4FDMA 3SK0A 4FFWA 4E46A 2ZYHA 5CH8A 1UOPA 3PICA 3STVA 5LP1A 2RHTA 5K5EA 2RONA 4MJ3A 2GBCA 1AC5A 3TGLA 1B41A 1E8MA 3QPAA 4GEGA 3QMMA 5ALNA 5HK9A 4K6GA 3AINA 1CUAA 1BROA 1EHYA 4G8DA 1CEXA 1FFBA 5JD5A 2I03A 2ZVDA 5LZ9A 5AJHA 4X71A 3FSGD 3IA2A 1CUFA 5AKLA 4QDXA 3V9AA 2VJDA 1AZWA 3EQ7A 4JH0A 3STYA 2I3ZA 3WK4A 5DWDA 1ZJ4A 4CIBA 5CW2A 1EH5A 3W05A 4PW0A 1QOZA 2HDWA 3GROA 4LXIA 3HRHA 2DHEA 5CURA 1EB9A 3M3DA 4J0GA 4A16A 2WHRA 4CG3A 4EA6A 4UHHA 4UHCA 2OXEA 4AZ3A 3K9BA 1PV1A 2PUHA 2WG1A 5FLKA 5HFNA 3X3HA 3FYUC 1ORVA 3L1IA 4QLOA 5LZ7A 4ROTA 4BCBA 1QIJA 1PFQA 3W2TA 3F67A 4B9EA 4OYLA 5AO9A 2BCEA 4HRXA 1DWOA 4C4ZA 1QIEA 3C5VA 2BKLA 2WUDA 1KU0A 5ALQA 2XUDA 3QMVA 1BS9A 1HDEA 1YAHA 4HTAA 4ZREA 3F98A 2C5FA 5JYCA 3U1TA 1R1DA 3VJLA 4UBKA 2QS9A 4MEAA 2GZSA 3FCYA 4MEBA 5ALUA 3I2KA 3WIBA 3FLAA 3WKCA 1MAHA 5CMLA 4OPMA 2AJCA 4Y2JA 3DOIA 3O4GA 5SYNA 3TEJA 1R9NA 2WHPB 3D0KA 2JF0A 2JIDA 3WYNA 5ALKA 4F21A 1YAJA 2HU8A 4A5SA 1EA5A 1RYYA 1ZD5A 3D2CA 5JD4A 5AKGA 1CUZA 3HACA 2JGIA 1DT3A 3DD5A 3JWEA 2WKWA 2CJPA 2C5GA 5DTIA 5AP9A 5EHXA 2X5XA 4Q3LA 3HXKA 4ARAA 3W04A 1WOMA 1TAHA 4PNZA 1E5TA 1XKTA 2V9ZA 4P92A 2W6CX 4U2FA 5JIBA 1BRTA 3ZI7A 4DSZA 3LS2A 4IH1A 2WILA 2B61A 2QUAA 4K6HA 4H7KA 1PJAA 5AKHA 4LXHA 1QGED 4HRYA 5DNUA 1LPNA 1QONA 5HK8A 2OG1A 2PL5A 3PE6A 5ESRA 2VATA 1J06A 1K63A 1SCIA 2ZJ6A 5AI4A 5ALMA 4FLEA 5ALVA 2Y6UA 3IUMA 4NZZA 5T4BA 4X95A 1TCAA 2QOEA 3ANTA 2HA6A 1R50A 4G4IA 2DFPA 2NW6A 4UBMA 1MT3A 2HA2A 2ACEA 1GPKA 4O08A 3ZPXA 3H1BA 4KE6A 3EBLA 1N1MA 2DR0A 5FV4A 1VA5A 3AZPA 3H04A 4FLFA 4MYDA 3CCCA 3D3NA 4CFSA 3M81A 1MX1A 1ODCA 4N8SA 5AOAA 3CN7A 2DHCA 4C89A 1QFMA 5LYYA 4I3FA 3LIIA 4BCDA 2WG2A 5ALZA 1QIFA 5D7BA 1GQRA 1CUYA 4DNFA 4DNQA 4Q3KA 3WLAA 1QO7A 1AX9A 2XMBA 4ITVA 4CG1A 3WL5A 1LPAB 3FYTA 3QPCA 2CZQA 2Y2VA 3WJ1A 4FTWA 4PF1A 5JADA 3WA7A 1JMYA 2P8SA 4M0EA 1FSSA 4B0OA 1ISPA 2RI6A 2JGJA 3EIOA 2V97A 4KAFA 1KU6A 5CXXA 5JZ9A 4I19A 4JYPA 5EHNA 1XZIA 1G66A 2QRUA 1Y7HA 2O2IA 4N5IX 2PSJA 4L3WA 4DMCA 2HADA 3B5EA 1IMJA 1CLEA 1P0MA 5AK6A 5FRDA 1TK3A 5AK4A 2WTNA 3RKSA 5LKAA 4DM7A 2WJ4A 3TJMA 1W1IA 4PV7A 3FYUB 2D5LA 3R3VA 1UK7A 4DTCA 4DLNA 4E15A 2ZYSA 5ALYA 1WB4A 1R9MA 1BN7A 3EQ9A 3C8DA 1Y7IA 4FBMA 4QA9A 1LNSA 3N0TA 1VOTA 1R4ZA 1LBTA 4F60A 4UBIA 4IO0A 4FLMA 1EK1A 3WA6A 3W06A 1XROA 3FNBA 5YASA 2LIPA 3DJYA 5HCUA 2OPHA 1XZCA 2XMDA 3GFFA 4UHDA 4X7BA 4BRSA 2R8BA 4QDTA 1C7IA 1DINA 3V1NA 2H7XA 4EB0A 4WY5A 3WYDA 2H9YA 4AMZA 3BDIA 5A7FA 5D6OA 3STXA 4MQLA 4BB0A 4KE9A 5C8XA 2OAEA 5ALJA 3O4HA 2GBIA 1UK6A 4H7DA 2IIVA 5FDFA 3FVRA 3R41A 1QIHA 1CUBA 2VT6A 4UBNA 1WB6A 2ZSHA 1YA8A 1X2BA 4FWBA 5E4YA 2Y6VA 2OGTA 3ESBA 4H7JA 4BP8A 1AUOA 3I1IA 2XUJA 1DU4A 4UFNA 1BCSA 1FFCA 4GLBA 1ZJ5A 1JFRA 3B12A 4U2BA 1JU3A 5IVHA 3H2GA 3G0GA 4JNCA 2QR5A 1WHTA 4GWLA 2ZSIA 2IX9A 3A70A 1XQVA 1XZFA 4BYMA 2HA5A 1A7UA 4INZA 1CUWA 2Y1KA 4X00A 3HJUA 2CBGA 2XMRA 2Y2UA 2EEPA 3C8HA 5AI0A 1XLVA 5CT8A 2ZYIA 3OPMA 4HXGA 5CT9A 5LKRA 4ETWA 3OC0A 1WHSA 1XZDA 3MVEA 4QE3A 3PF8A 2AJ8A 1O6GA 5JALA 5AKIA 3C87A 4E14A 5F4ZA 4QZVA 4YX9A 2ROQA 4KE7A 2OQIA 1ODSA 1H2WA 3F97A 2IITA 1W75A 1XZEA 4G8BA 3WKBA 4EY6A 1CUCA 3WWEA 2PSEA 1KEZA 3QM1A 2B4KA 1A8SA 4WJLA 4OSEA 2OCGA 4MWSA 5BOVA 1HBJA 1RP1A 5EGNA 5K3BA 2RHWA 4RE6A 4B85A 2WFLB 4TVKA 5HF9A 1XZJA 3DL7A 4IH4A 1WPRA 4BAUA 1QIKA 5JD6A 4KYVA 3ICVA 3KXPA 1DTEA 5IVIA 1ZGBA 5ALIA 5EHQA 3H18A 4FOLA 1ZD3A 3IUJA 4FMPA 1P0IA 1YB6A 4NS4A 1U65A 2XMCA 3DNMA 2BAGA 4BVJA 6YASA 3DKKA 3TRDA 2AJLI 2XDWA 4PQEA 5JZBA 4CI9A 2C4HA 3KDAA 2PBLA 4L72A 4Y2SA 5DTJA 4BRZA 5ALXA 3RARA 2XUKA 2QVBA 3FYUA 4U2EA 2XQFA 1MNQA 5IH7A 1N8SA 5KREA 3G9ZA 1CUEA 2UZ0A 1LBSA 5EFZA 4ZI5A 3I28A 1EVQA 2QTBA 3R3XA 3H17A 4G9GA 4G5XA 1NX9A 2FJ0A 5IVDA 5AM3A 4N8EA 4QDZA 4FBLA 3ED1A 1IZ7A 4QLAA 5AICA 3AUKA 2YASA 1VLQA 3HABA 4X6UA 3STUA 4UHBA 2RAUA 4Z49A 3W9BA 4WDRA 4Y2QA 1F0NA 2PM8A 2DSNA 1QIIA 5BWBA 4NVRA 1J2EA 3HLKA 4EY4A 4Y2TA 3DOHA 1X70A 5AKZA 2FX5A 1EB8A 2C0PA 1UKBA 5DYYA 1WM1A 5CXUA 4IQ4A 1CQZA 1W6RA 3RM3A 1EDBA 2OCLA 3I6YA 4X94A 3V1KA 3BE8A 2WQZA 4Y2UA 3QH4A 5A2GA 3QZUA 2O2GA 2PU5A 1MAAA 5K3CA 3I6ZA 2XUAA 5AKJA 1E66A 4MYSA 3F8SA 2OQVA 4W63A 3T4UA 5K3AA 4Q34A 3WK9A 4BDTA 2VA9A 1AQLA 3IULA 2XQGA 3G9XA 3PI6A 1LPMA 1OXMA 5BWCA 1ZGCA 5FKJA 5ALPA 2GYUA 4BVKA 4Y2XA 2Z5GA 1BEZA 1ODTC 4J0JA 1MX9A 1ZICA 4OCZA 1HL7A 2PU7A 3I2FA 1UFOA 3BDVA 1THGA 4AX4A 4B81A 4JYMA 3AZQA 3AIOA 5ALWA 5AI5A 4G4JA 3G8YA 2RGUA 5D3KA 4J03A 5JZSA 5CT4A 2DCMA 3R3YA 1HPLA 3V1MA 1WPXA 1W4LA 3WQHA 4EUSA 3WWDA 3HI4A 1XZLA 3NUZA 1GQSA 1TQHA 3JW8A 2QXUA 4B83A 4UUQA 2JGLA 1YB7A 1XZMA 4EY7A 5HKBA 1F6WA 2JEYA 1IUNA 3T52A 4Y2VA 2XQJA 1QJ4A 4GDMA 4WFIA 1VJ5A 3O95A 4MWTA 2QZPA 1WCYA 4UHEA 3NGMA 4BAGA 1AGYA 2HFJA 4P9NA 2DQYA 5AM2A 2ORYA 1XKLA 4YPVA 2WIJA 1UKCA 1UZAA 4F0JA 4W1QA 3FSGA 4WFJA 5D3ZA 1XRPA 1JJFA 1ZI8A 2DHDA 3HZOA 4D9JA 2PSHA 2JEZA 2OLEA 2WJ3A 1B6GA 2C7BA 4B7ZA 4Q3OA 3G7NA 3HEAA 3L1JA 4DIUA 2HL6A 2CB9A 2J3DA 4H7HA 4OD0A 4DMFA 1MTZA 2WIGA 2GYVA 1CR6A 5LZ5A 2EDCA 5FOQA 4J3JA 3G9TA 4QDOA 5AOCA 3A2NA 5AK3A 5DNVA 1ZIYA 5ALSA 2Z3ZA 4L0CA 2J4FA 4GECA 2VAVA 2XUIA 1DWPA 3O4IA 1VE6A 2HRQA 3CN9A 2E3JA 5A7HA 3DYIA 3VVMA 1E8NA 4LXGA 3IURA 5DNWA 3VDXA 1LZLA 3H2IA 3HC7A 1CVLA 2WG0A 4B84A 1XRRA 3G9UA 3IBTA 4OU5A 2VSQA 3I2HA 3BJRA 3A2MA 4BC1A 4XIIA 3ZLTA 2WJ6A 2XLBA 4RGYA 5EIAA 3O9MA 1K8QA 5AIBA 5LLSA 4YASA 1D07A 3C43A 2XUPA 3MGAA 3ZV7A 2G5TA 2VJBA 3STTA 2WUFA 1XZBA 3AILA 5KWJA 1XLWA 4LYEA 4C6HA 1ZD4A 5H3HA 2CMFA 3R3WA 4Y7DA 5AM1A 5ALRA 1CUSA 3K2IA 5HF5A 2X76A 5ALLA 4JEIA 4K5QA 3V1LA 5DLPA 3CXUA 1IUPA 1JU4A 4UBLA 5FPQA 1XZHA 5JARA 4U2CA 3EQ8A 5CTAA 3M82A 2DQZA 3R3UA 4ZGBA 4QWMA 2G4LA 5EI5A 1Q84A 1DT5A 1XZKA 2XUHA 3UMJA 3D59A 4CCYA 4ZV7A 1UOQA 2QXTA 3PFCA 2C58A 3Q0TA 5LZ2A 1IVYA 1C7JA 4DMHA 4C88A
chains in the Genus database with same CATH superfamily
2ZK7A 3CGWA 1A8PA 5JE8A 4NFHA 1JRLA 2FN7A 4OHCA 2BV3A 5DK6A 4TGLA 3P2YA 4IV5A 3PXGA 1E6LA 1Y9EA 2NTYC 1CNEA 3Q9NA 4LHSA 4NPCA 4CU2A 5JUWA 2P9HA 1BEEA 2G8LA 4GI1A 4UM5A 2IEIA 3PE3A 5CNMA 3K72B 1P39A 4QNRA 4IGFA 4OB8A 2WAAA 1TKAA 1RYBA 2H65A 2ZJOA 4H77A 1MDFA 1RXUA 1OMOA 3GLHA 2EATA 4AU1A 2EAUA 2W6QA 3AFMA 3U2QA 1X1BA 3B1JA 4RO0A 4KLCA 1L2TA 3SFZA 2I6SA 3TQCA 1NTOA 1ZGJA 1ZCBA 1H5NA 2D13A 2FG6C 1Z62A 2QVYX 1TT5A 2R5NA 3B51X 4QJBA 2YJTD 1GUAA 2HFKA 2QZ4A 1JKJA 2TYSB 1J8MF 4MI1A 3QYAA 4HQKA 2HKIA 5AJWA 5K3FB 3TW8B 5CITA 4PPFA 1ZQ1A 5GP1A 1JF8A 3GT3A 1YB5A 4LOIA 3IVRA 1SVKA 4E3WA 2UZIR 4DXAA 1C1DB 2WV7A 1H94A 4FEYA 3SXPA 3ZNPA 1QKJA 2XE7A 4FJ1A 2QTAA 1FLNA 2WHPA 4TL6A 4MJ7A 3BF7A 3TLEA 4DV3B 4Q66C 1CPYA 2AT1A 1LDGA 3I5XA 3C6YA 1BX3A 1QCZA 5AXCA 1YRQA 1JQ5A 2PZGA 4X1KB 3NBXX 3KP1A 1SUFA 1JR3E 2UVPA 2EDAA 3TB4A 2JK0A 2VTEA 2H2FA 4IJQA 2FHPA 3TFWA 5KKCA 1FYEA 3H8JA 1BOOA 5EXTA 2OCKA 4X91A 3O4VA 3RB8A 1JG6A 2R1UA 4D79A 4X6XA 2QMQA 3GLFE 1XQYA 3P0FA 1CP2A 3TX6A 3E2IA 4UHKA 3W1EA 2MSNA 3ZR4B 1XAHA 2EKDA 2E4AA 2QNIA 4LY3A 3NNNA 1LNZA 1KE2A 1RQ7A 4ENRA 2X9QA 2RB4A 3V3TA 1CZUA 4A9AA 3G0DA 4U1RA 3ZCVA 2HW8A 2G0NA 4GXNA 3UUFA 2PXHA 3SYRA 3OQMA 1TT7A 3IDAA 3U3OA 3OT1B 4U6NA 4EHIA 1RWXA 3TW8A 4ZIRB 4GMXA 5FWYA 1JXOA 2CVFA 2GAFA 2G76A 4O4HB 4DV7B 4PE5B 3SJCA 4TQAA 4QGSA 1Q1QA 3B82A 4YRGA 1UK8A 4TWAA 4B3HA 3T06B 3H19A 1RLUA 3KLNA 2XB6A 2JCYA 2ECPA 1Z8HA 2QTHA 1DX6A 2G1KA 5J2UB 4DY6A 1X1CA 2GDZA 3QHQA 2HHLA 3FCUB 2AQIA 4YR7A 3NHUA 1ES9A 4WZ6A 5JYBA 4EZIA 1D03A 1D8AA 1YC2A 3QF7A 2HLHA 4BFYA 4GKJB 4X92A 3KKLA 2R25B 2YZGA 1QO0A 1TM7E 1WDMA 5EXDA 1A8UA 3Q10A 8OHMA 2JGMA 5JAOA 3FVTA 3CLKA 3DXZA 2BBTA 4QICA 4X1YB 1CUDA 1R6BX 3MELA 5AOVA 3UHAA 3Q72A 4E03A 4R8VA 3CPHA 1M8GA 3AKCA 3R5SA 5CX1A 5TPWA 2XQIA 3LWDA 4IILA 4ENPA 1VYUA 3O8QB 3ZE7A 3JRNA 3UFXA 1GVNB 4PWZA 3DLCA 4XYGA 3WYAA 1Z39A 4NQZA 2QTRA 4E4TA 4J3FA 3PEEA 3A58B 1ENOA 3MOIA 3ROFA 3AIMA 4EK9A 2REXB 4GM1A 1C7QA 2D7CA 2DE0X 2XMPA 4PAMA 4YXFA 5EIEA 2R44A 1VJGA 2W8BB 5KU7A 4HDNB 3K0AA 5KNBD 3D3QA 4MV9A 1KGSA 3W8NA 1XKQA 3QUSA 4TKZA 1PYGA 5GTDA 1P2UA 1J25A 1VKHA 3F6CA 3JVIA 4I08A 4HSEA 3CR8A 4MQBA 1HURA 4MVJP 821PA 4Y6QA 3TCXB 4KWIA 2QJOA 2WJVA 3L06A 4D9NA 1JZQA 4YJ2A 2V55B 4Y2RA 5EAIA 3V7UA 4L07A 5K8IA 1PL8A 3ZDAA 1NQ5A 3NOXA 1RXCA 1WR8A 2Z30A 1EFAA 1TIBA 1DC5A 2XYGA 2K2QB 1PP4A 4YO8A 3TLKA 3OE5A 4IM7A 5ARDA 1KA9H 4J0KA 3RYFB 3R9XA 4Z2AA 4QTZA 4KW7A 3BMNA 1EFPA 4R68A 1N2JA 2QMZA 1QGDA 3VSAA 3TXAA 2AKAB 4KIJA 3UNXA 1OBHA 2OK7A 4IS3A 4MS1B 4QBTA 3GNLA 4FJ2A 1VE1A 4I8IA 1VJTA 1Y5MA 1YONA 2CDRA 2PH1A 1JFTA 1XQWA 3AB8A 2BDUA 1YWGO 1G3RA 3H2JA 1UK9A 4R41A 2ZBDA 1T6NA 4MGEA 1F9EA 1IPHA 2GCEA 1PZHA 4DG9A 1WEKA 2Y0CA 3ONDA 3WRXA 1N36B 4TLMB 2XCOA 4P7JA 3DDHA 3LCMA 3O74A 4Q9LA 4X1IB 4RYLA 1ZMOA 4BQPA 2PLWA 3BQ9A 4GW3A 3O1LA 3I1FA 4KLAA 2I8CA 4KO1S 4JUCA 5L7TA 2JAPA 4L5YA 3I32A 1K7SN 4LG1A 1XRMA 4Q1VA 3U7JA 4B4OA 2DWQA 1UZLA 1I1HA 2WKQA 3JD0A 4XJVA 3HYSA 1YRAA 5F98A 3U19A 5IH3A 3JQAA 1QNFA 1SWWA 3PQEA 2IIPA 4JOQA 4V3BA 1NE2A 2IHZA 1Y8QB 2Z6UA 3UMSA 3VR5A 2FYTA 2Y4NA 4DHEA 1JHDA 4MINA 3U4MA 4XVCA 4EMTA 3U62A 1ZUNB 4F3RA 1JHXA 1V8ZA 3LD9A 2UZ1A 3H2KA 3KVYA 3CG0A 2AA3A 3BMNB 1FUIA 1O2DA 1W5SA 4QBKA 1CEQA 3WZMA 4Q16A 1VL0A 2BGWA 1XFAA 1RZ3A 4XKJA 4KU4A 5AJYA 3QEOA 1HO3A 1ZISA 3CNLA 4Q4HB 4Q37A 4YCBA 2V1UA 3RVOA 5LQJA 3RKUA 1YCFA 4UNIA 3RYHA 3A6ZA 2J3KA 1BDMA 1U28C 1XJCA 4KDEA 4A2PA 2HJRA 4RXTA 2ZQ5A 3EXFA 3GGSA 3L8EA 5EQTA 3B48A 1Z7GA 2CXPA 2M32A 3FLEA 2H7VA 2V3WA 2F1OA 4O33A 5E2IA 3U13A 3OPQA 4DM4A 2JKYA 5K0LA 4W1PA 1JI3A 2O2ZA 1SHJA 3VTKA 1JLLA 4FOPA 5BUZA 3AFOA 2NTJA 4MQ4A 4JNKA 1Q7BA 4G0XA 1KP3A 1AN0A 5IG2A 4GLFA 4KEAA 2H17A 4L0QA 1XCGB 2XEDA 1YCDA 2CUZA 4MP6A 4UFPA 1FNCA 1TQ4A 3GRKA 2ET6A 2YWFA 3IJPA 4GM4A 4BUCA 3UH1A 1RRKA 1L5MA 4DARA 2PZMA 4YUYA 2DYKA 3AL0C 4BDSA 4F9EA 1K6EA 4QHTA 3AHGA 3AGQA 2HR1A 4L5BA 1Z4KA 4QHSA 2WFAA 2WHXA 1MA0A 4BC0A 1YVDA 2ZIUB 4LDAA 2GZ1A 4J90A 4J6FA 3NIFB 4GSLA 4DLXA 1BCSB 2PJUA 3Q6MA 5ERGB 5C5IA 2AZMA 3K70B 3PP8A 2WWWA 5EUBA 1V8DA 1N92A 3C0KA 3E8XA 1IY9A 1CG6A 4RS4A 5AK0A 2RCYA 1EK6A 2VH2A 4YCAA 2WAOA 5ANRB 3F6YA 3MWLA 4P5EA 2VPPA 3T5TA 2NT3A 4WBXC 3EPHA 1IAQA 4Q18A 1MQAA 2VJLA 3GJ0A 1S8FA 4ZJYA 1B1AA 2EGGA 3OFJA 3AUUA 3KTAB 4PHTA 4XM2A 4BNIA 2I7DA 2FR1A 4I46A 4EUNA 4B5LA 3KJNA 1XNJA 3CLUC 1WSWA 2O1EA 3W5DA 2AFIA 2BR5A 3U4AA 4F5WA 2EKBA 3N0WA 4L8VA 5AKEA 3OPNA 2IU4A 2I54A 3AF6A 3TKAA 3C4VA 1JHUA 2DWCA 3KL2A 4B8WA 1R8QA 3U37A 2R6JA 5BNWA 1Z6ZA 1GZ4A 4F1WA 5CYGA 4PICA 3RFVA 3LY8A 3L02A 4B45A 5M5BA 4CKXA 3W4IA 2QZ9A 3NAZA 1VXOA 2FOXA 1CETA 3P4UA 3UWPA 3FDJA 5H5JA 3X1MA 1II8B 4ER5A 4G0YA 4I7EA 4YYZA 4DPLA 1FFEA 4X85A 4Q47A 2VF2A 4OB6A 3L4KA 1IHUA 3C5CA 4FWIB 4F96A 1J0EA 2LE0A 3AVOA 1EP3B 1M0TA 2RDMA 1L8LA 3K6JA 2V59A 4PO3X 4MNTA 5DCWA 3M1IA 3J7AC 4LEIA 4HAXA 4HY3A 3RVMA 5EHZA 5ELXA 2O14A 4W5HA 2I3GA 3W79A 3O8OB 4OGWA 2JGFA 1K06A 1SKUA 4K88A 3FKJA 4RENA 5LQAA 2O2XA 3WS7A 4YVFA 3RS9A 3WIOA 1M8JA 4S12A 3PUIA 3R7DA 4GX5A 4S3MA 5LXTA 1KY2A 4OI1A 1ZIOA 2OBMA 3EZFA 4Q1BA 4CKYA 2VHTA 1NM5A 1EM6A 1W6UA 3B7WA 1FDIA 3KLOA 4JASB 4QYXA 3NHBA 3P9SA 2DEUA 1XT6A 1PSDA 2QJWA 1PLJA 1RM4A 4BMYA 2NO1A 3FPSA 4GRDA 2VP2A 1QYXA 5EESA 3VA7A 2VYND 2I1QA 1JE0A 1Z2OX 1E20A 2NXNA 3DFKA 3NATA 4QBHA 1WXHA 2HJHA 2AFHA 2BKUA 2KE5A 2ZULA 1YOVA 2FPLA 2HQBA 2Y93A 3MJ4A 4B4DA 1ZC3A 1M1NB 4DSAA 3DL4A 3NJRA 4XIJA 3UB3A 2O8CB 3O84A 3SQNA 3O3NB 5JZOA 1OIXA 2FZEA 4ZODA 1RXVA 3AVYA 4K87A 4XGKA 4EGJA 1J2YA 3QYFA 5F33A 4YDHB 2YICA 1TUBA 3U5TA 1V11A 5J5VA 1FTWA 2WVHA 4NE9A 1JWAB 2Q0XA 3OA0A 4YRJA 2H85A 1H23A 1JGTA 1L1RA 2JW5A 1TNDA 2W8ZA 2YH2A 3C3CA 3CFYA 3MXTA 4KSCA 3FBWA 4U5XA 3T9BA 2HXYA 4K9DA 4R8LA 1O95D 5J59A 3WGMA 8ABPA 2OGUA 2JD0A 2N46A 3FB1A 5TS2A 1AB6A 4B71A 4WD3A 2PD4A 5C4MA 2H1LA 3TGPA 3OIWA 2E6KA 3N6RA 2O7QA 3MYYA 3MT9A 2EG9A 2OR3A 3EDCA 3KX2A 2QD1A 5IDQA 4HWRA 4OATA 1LFAA 5DU2A 4PO8A 3OT5A 2P41A 3TB6A 4B31A 2VPIA 1GL6A 3AHJA 5KJ1A 1WQ1R 1U3FA 1RM3A 3HWWA 2JFQA 3TCNA 1CFJA 2QSUA 1KS9A 2OM6A 4FZRA 1OFVA 1RRCA 4X97A 3T6KA 5TVKA 1M1YE 4LHVA 4QIHA 2HLDD 4RK1A 3U48A 1JLRA 2J9FA 2WTXA 1GNQA 3EVEA 1HA3A 2Q2VA 3H2BA 3MF4A 2AJDA 2B2NA 1BZYA 4GX1A 1XU9A 1MPXA 1XFDA 2JI6A 1PUIA 3JRXA 4N49A 3ES9A 4PR0A 3JQRA 3LHFA 2FTKE 1R00A 4IOJA 1NF2A 4ZCLA 3LJKA 2W4MA 4MLDA 3Q6NA 1DX4A 3CLTC 5FJIA 1Z5VA 2C2MA 2WTEA 5A9SA 5A04A 1R0YA 2QSZA 3AI2A 3WY9A 4LV6A 1TTTA 3HDJA 3K0FA 4M9XA 4ZCQA 1UJ6A 2R7AA 4X8HA 5FA6A 3TQIA 1T8RA 3O4JA 2OHHA 3G59A 3P97A 2P4HX 4X20B 5AJZA 1IOLA 3G9QA 3ZXUB 3NM5A 4C3UA 1QGZA 4K9LA 1Y1PA 3Q41A 3WGQA 1E7SA 3DVLA 1QE3A 1CY6A 1J1IA 1MN6A 1WZCA 2A5JA 2P9FA 2QLMA 2WYIA 3EN0A 2HSDA 4LYGA 3UVEA 3GVIA 2IH5A 1KVQA 4YJHB 1ZLXA 4UTZA 2Y1OA 4E5KA 2CXHA 3G2KA 2A8YA 1RKVA 3ZHXA 3LYUA 1QKIA 4O2RA 2ZT6A 2UZ4A 3QBJA 3FCOA 2A9JA 3SQLA 1R6AA 3I9OA 2H1OA 2XMGA 1NUAA 2P5TB 1LLFA 1BN6A 3KUKA 3LWZA 4LK2A 5I5GA 3ZEAA 4GR4A 1I2DA 5I9SA 4HLDA 3NDBB 2H7CA 1AKQA 2RIRA 1VFNA 5KHAA 1TQ8A 2R62A 2M6KA 4LJYA 1AQ6A 4OIFA 5GINE 2JIBA 4GOJA 2FLVA 2P6NA 4ETIA 4LJ7A 1E2DA 5F12A 2KI5A 3IP5A 3BRSA 4FD2A 3HJFA 3AR9A 3EXIB 2W6PA 4B7CA 2C0QA 2NQ8A 1IRXA 5EWLB 3PTLA 1ORHA 1II0A 2HI0A 5KTNA 1SUEA 2XADA 5FBWB 4CHTA 4YRNA 1JDPA 1ZI9A 3K1YA 3D6HA 4YJHA 3WIVA 1S0UA 2IY9A 3AJDA 4OOEA 5FO1A 5I4CA 3AEZA 2ERCA 2JH8A 1FRNA 1MVOA 2C88A 1NMXA 1PUXA 1WW8A 2IYLD 2F62A 2VWQA 2VDQB 3PDCA 1NRJB 4L3OA 1USWA 2H63A 1MJHA 2J32A 1B1CA 4MMYB 4CBVA 1DBSA 1NR1A 4NJMA 4QOSA 3HH8A 3P2MA 1YDFA 1F20A 1RBMA 4UE3S 4ZP1A 3HP1A 4U2DA 3KTFA 1JJVA 2MSKA 5DLYA 3FWYA 1PNVA 5DM60 1KC3A 3EIEA 1OF1A 4RTRA 3L7LA 4ZVRA 5BYKA 2I9KA 1V9LA 1DAEA 1OFTA 3LF1A 4EWLA 5HGXA 1T5DX 3KWFA 3QLVC 4DHWA 3AGPA 3RK0A 1Q20A 2VHEA 5EQFA 2VK4A 3K09C 3T7CA 4EJ0A 4PRYA 4CM5A 3PB3A 4Q82A 2XZOA 4A8TA 4MVJD 1M2WA 1X1RA 2QLTA 3EPPA 4W7SA 3V4FA 1XA0A 4AROA 2JLZA 2D6FA 4K2AA 3LRXA 3M49A 4KMRA 2QRVA 2AR0A 1P7ZA 1QBGA 1WVMA 5HX7A 3BILA 2NSLA 3OAAD 3ZZUA 1MUUA 4G5FA 4MUXA 5T3YA 1C4XA 4Q9KA 1HK7A 3FCXA 5E4JA 4LMAA 4DJFC 1OVMA 4TLAA 4URWR 1OLUB 4ZI7B 3L1HA 1Q92A 2BFOA 3COYA 2IKSA 4C2BA 3VKHA 2ECKA 1R9JA 1YD7A 2C9YA 2RHRA 5TMBA 4QJ5A 5HUQA 1V11B 1C9NA 3EIFA 4Q3AA 1U1IA 3JR7A 3I2JA 3KD2A 3ZZ1A 1DKNA 4ZD6A 1UZUA 3C3AA 3BK1A 2A4MA 3C39A 3D5TA 3F3SA 1NPDA 1M5TA 1ZBDA 1BGWA 3KVRA 3WLOA 2DY1A 3E61A 5L9AA 3S8YA 4DE5A 4J7AA 5HS6A 1Z37A 6PFKA 4Q4CA 4P3NA 1Y6FA 3VVCA 4WBNB 1Z5WA 4OM7A 4S1WA 1FA9A 4RCYA 2CKMA 3JQ8B 3QENA 3JVVA 1TF7A 1QX4A 2V96A 2CL7X 3C3PA 2YQZA 3GLUA 3IC5A 1HLGA 3C98A 3Q3GE 3PUXA 4MGZR 1P7VA 2YXNA 4GPTA 3EA0A 3QVMA 4C05A 4EO7A 2ZDGA 4RXMA 4CM6A 1SOUA 4QREA 4JWKA 1KI6A 5EIBC 3ZDCA 4LAFA 4JXZA 4CTMA 1KMHA 5KTYA 4R1MA 1DXOA 1YSCA 1ZA1A 2OGSA 2NO6A 2YL2A 1OHHD 3IAEA 3VUEA 4PNPA 1KZYC 2JS7A 2QMOA 2FSHA 4TS3A 3T3IA 2IBTA 1LTKA 4TPKA 4G3XA 3KQQA 5FAXA 3QVTA 2DJIA 1Z5NA 3MGGA 1TVMA 1NQXA 1O97D 3SSMA 2WIKA 1V96A 4Y0NA 1EI9A 4LISA 3GJ3A 4X20A 2OAP1 1NHGA 5CDFE 1MORA 1Z0ZA 5HIJA 4W5WA 2M6SA 5CJPA 3R75A 2OAGA 3HWX1 4CF7A 4HAUA 2MYNA 3ESYA 3GLHB 5G53C 2XVZA 2PD6A 1KQOA 3T7TA 3JATB 3MINB 1DMRA 2W2XA 1ODKA 2ONZA 3R7LA 3V2GA 5C53B 4OREX 1Z33A 1EIZA 5BSMA 3JQ8A 3AVUA 1UAAA 4KQJA 4MR9B 1WPQA 2R1ZA 5AW5A 2XUFA 3RC8A 4M0CA 2FLWA 4JI6B 1WMEA 2B3TA 3U56A 4MSUA 3DAHA 2AK2A 2QN3A 3DHYA 1PX2A 4AJNA 1GJRA 4PSDA 3A2KA 3VJKA 5KQSA 4KRFA 4Q1CA 3UATA 1YQEA 3ZGVA 2AN9A 4RPKA 2AJTA 1IJKA 2GJSA 3WTBA 3P0HA 1UANA 4K9QA 3B5JA 2CNDA 3OQVA 4B43A 3DDOA 2BJVA 3N05A 3I76A 1DV1A 4L8FA 1YS9A 3M2TA 1YIOA 1FTGA 4TM8A 2P1DA 4TL8A 5ALGA 1GZ5A 4XWYA 4MR7B 1JDTA 3AVPA 5C37A 1JAIA 5ALOA 2W00A 4MI6A 3HXLA 2PUJA 4G0VA 4BLQA 1NQAO 2GO7A 4L8GA 1QVZA 4RF3A 4C6RA 4FYWA 1OB5A 2VJNA 1CD5A 3OOYA 1WU8A 3ZJ4A 1SXPA 5LD2B 1OWLA 3Q1KA 2VRCA 2VWGA 3WZLA 3DBOB 4TSKA 1L7AA 2DUNA 5D00A 1LTQA 2FUNB 4MUMA 1U8TA 3VYTB 5JC8A 3BIJA 1USIA 5BOSB 1QVVA 1P0CA 1PQUA 5C2JB 1V6CA 2HWKA 1W7AA 4JI1B 5EPUA 5A7GA 4G97A 4ZU6X 1CUXA 2H07A 5C5CA 2QU7A 5LOVA 1PJQA 3EXG1 3SIRA 2JAUA 3U1VA 1P62B 4JZYA 3ROPA 4ZRNA 4LA4A 3SKVA 1PV2A 6NULA 3RYCA 1SZJG 2PA0A 3QSGA 5AM5A 2WSMA 3OX2A 2O8BA 1Z2CA 3LHDA 1A27A 1WBJB 2GERA 4BFVA 1SVNA 4NNOA 4TMWA 3NYWA 1G6HA 4YP5A 4QYWA 1GTJ1 3ZIDA 3MJCA 5EE0A 1P5HA 3QVXA 5DVZA 2BZGA 2ZE7A 1NG9A 3NDIA 4MJLA 1MNAA 4YRKA 1T2EA 1JDUA 2QAGB 1OBFO 3CCBA 3E3MA 5GJVC 3BBLA 2V6MA 3M3PA 4CYMA 5A3JA 2AQ8A 1RAGA 5G40A 3TFOA 4RJJA 621PA 5BNFA 3RIGA 4F5ZA 2IEAA 1KETA 2HV8A 3L9WA 4QQFA 3KB8A 4U7WA 2FW9A 4AUMA 721PA 5M04A 4E5UA 1PVVA 2HBYA 2QVCA 2WMYA 3O0TA 3I9V6 4NENA 1T2NA 1QUEA 4OQDA 5CM9C 5FTJA 3VPCA 3T0IA 1AA6A 4KR6A 4D0LB 4Q19A 5FJJA 5AI6A 5EMNA 5HFAA 4C3OB 3KZ1E 3F9CA 2E4WA 2GPAA 4C43A 4O5AA 4QOHA 2OHOA 1J49A 2GK7A 2A5DA 3ODPA 4XDHA 5ADHA 2AFHB 3UUEA 3LDGA 1VP9A 2X5KO 5EZQA 4BLPA 1YBFA 3U0VA 2ISCA 3NIWA 2A6PA 4G67A 3FA2A 4TKUA 1C3LA 2FFAA 3AKZA 4HJXA 1ZD8A 4LF9B 1Q6ZA 1B8PA 2OUKA 3BL5A 1HDZA 4HFJA 4WFKA 1X14A 1XSEA 4V1CI 2DH6A 1NVUQ 1PDWA 2VCHA 1CVIA 1A3CA 5B64A 4BIMA 1IZ8A 1T2DA 3GIWA 4QOJA 5HKLA 1KDYA 1U2EA 4P3KA 3EEYA 3PRJA 3UJ3X 4ZTZB 1WOYA 4J0DA 4EG8A 3KQYA 2TSYB 2VA8A 4E6EA 4KR2A 5K8VA 4GE3A 3C6BA 2CUKA 3AJAA 2R0QC 3QG5A 3S2EA 2G1AA 3AFHA 2BCJQ 3AESA 4OBWA 5KO2A 3A9SA 3HJAA 4OJQA 1SC9A 4TXJA 3I23A 1EFPB 1O6CA 2FW6A 3K0CC 4RMIA 2NM0A 3NP7A 2NUPB 3QFSA 1SVLA 3I6QA 5DF1A 4WK2B 3Q8KA 3T3HA 3ZWKA 4U7TB 2XUQA 2W6MA 2Q5EA 3DH0A 3KOUA 3OU7A 3A31A 3PSHA 4IIJA 2VC2B 2C29D 2JL1A 3ZIAD 5CVUA 3DOCA 1T8WA 3PEFA 4ESOA 4MQFA 5DTRA 4RY8A 3F7MA 1JEYB 3MUOA 5IM4A 4NCIA 4UNNA 3UJ8A 2XGOA 1XRNA 2WFZA 4QEDA 1VGQA 4I2VA 3KAJA 2PCJA 4Q9JA 4RESA 3UANA 1Z2AA 5I8PA 3QLJA 2PHZA 3IBSA 2ZU0C 3IOCA 1DBWA 1YFKA 4BNZA 3RUFA 1D0IA 4ZO7A 1XKXA 1KO8A 3EZNA 3H6HA 1R4NB 1WA5A 4PC1A 4FKBA 2WPDD 1VXRA 2QX6A 3DDSA 3LVBA 4G09A 4XZ3A 4DCMA 2AOUB 2AW3A 5DM2A 4EYKA 5KINB 3LP5A 1YMQA 2ZIZA 2RGBA 4P53A 1CRZA 4KR9A 1C41A 4FHZA 5CCEA 4KSBA 1NPTO 1KKMA 4UFOA 4XQ9A 2YZ7A 5J47A 4IW3B 4TSFD 1MLDA 3AKEA 3I1YA 4DYDA 4KO2S 1T8PA 4CKWA 4TTAA 1D2CA 1XDGA 1KGDA 3DUWA 3QVKA 4AKEA 3W4KA 3UOWA 1XRLA 2HSEA 3AZOA 4HH4A 3HSKA 2JGEA 3M9WA 3BL8A 3EUWA 1VIMA 3DYVA 1EUCB 2ZE6A 4J1QA 4LMPA 3PA8A 2NXWA 1ZUNA 4P83A 1F2VA 1QH0A 5E7IA 2NQTA 2CCKA 4RC9A 1HYHA 3EODA 5EWJA 5IJ9A 2ABWA 3AJ8A 5U4XA 2R96A 2UDPA 1EGQA 4LBWA 5KYVA 1XCLA 4GQBA 5CDHA 1OY1A 2HJVA 3VR6D 1HH4A 1C3XA 4S0XA 3LT5A 3H5NA 1P18A 4Z7QB 5B3JC 5LMNB 5KSPA 4D3XA 4FGLA 4HAVA 2CYCA 5B7GA 1AQNA 3QYJA 4B73A 4NMWA 4GQAA 2PVSA 3ESCA 2I99A 1HDXA 3IOYA 4P4NA 2WC1A 4YJ3B 3KV1A 3FYSA 4NFLA 4KR7A 5FWAA 3GN2A 4CMCA 2D1YA 3K6KA 4WOKA 1MX5A 3ISJA 4Q7QA 2ZI9A 4MVCA 5IZCC 1Y5LA 3WG9A 1HQDA 4H4DA 3H5VA 1LCIA 3VXKA 2IHKA 4DQ0A 3HA3A 3ESAA 3WGLA 4EOGA 1R2QA 3NANA 3KDSE 2PH3A 4XQ0A 4YAKA 3KETA 3X2SA 4PZ0A 2H3EA 1XTQA 3PUKA 4HADA 4KQKA 3ETNA 5CRIA 3TKYA 1XP8A 2DU8A 1C1YA 4I99A 2WICA 1XNRB 2BFFA 3LT2A 1KJ9A 2PIDA 2VSYA 4EGAA 1QP4A 5BW6B 1X1SA 2BLNA 2C2ZA 2Z9CA 3I37X 4M38A 4YRPA 5GADl 3I2GA 3CC8A 4KO8A 2GBFA 2HCBA 4ZDJA 3QU5A 1N2CE 5MF6A 1WCIB 1IJBA 3GQBB 2OYRA 3YASA 3QVWA 1HDGO 3GT0A 1D9XA 1E64A 1GSIA 3H4IA 1EK2A 4QODA 4NQRA 3NDRA 5ECDA 3T7DA 4M0FA 2O7RA 1JBQA 1EP9A 5K9ZA 2CNWD 3PIDA 4GYYA 1F8UA 1LLUA 1P2VA 3M6LA 4EHDA 1Q5PA 1K9VF 5LDGA 3KXDA 5C3UA 3WDSA 2FP3A 4FDMA 4YQYA 1GARA 3S8MA 4GYKA 2XB9A 1NJ1A 4E46A 2ZDHA 5A4FS 1PD1A 1UOPA 2Y1XA 3KJFA 3QVJA 3ZS8A 4ND7A 1VSQA 2MCFA 2Q7DA 1CY8A 2YWJA 2RHTA 3TIVA 4HV4A 3M33A 5EYPA 3W2FA 1FQJA 2F9LA 3OT4A 5K5EA 3GWZA 3TG8A 4XTCS 1PNQA 3BWMA 4GMGA 2LBPA 1QK5A 4MS4A 4MUGA 4MJ3A 4JI7B 4KODA 4KHPB 4HLUC 1G64A 4U0JA 4YRRA 3QPAA 2HK6A 2PG3A 3KYDB 2ADOA 1F12A 4RPJA 3AQIA 3BXZA 5ALNA 1ONSA 5AVOA 5IT4A 3LV8A 1CUAA 1D6JA 5BVGA 4DV4B 4PC6A 4U4AA 4B46A 1BROA 1EHYA 1GAWA 1V1RB 1UDRA 2AS0A 4H6PA 5IS2A 2BGIA 1CEXA 1QPBA 2PWBA 2N1MA 2B1IA 4P3PA 2ZROA 5JD5A 3OF5A 4ZZIA 1Q7TA 3G5TA 2VPXA 5FL7D 1NNI1 4WY2A 3ZH9B 4BGIA 4CMEA 4E6PA 5CA1A 4TMTA 4X71A 5HCIA 2GN8A 3FLMA 3AEQB 4FBGA 4MQFB 5ER9A 3B3GA 3ZI4A 4WT7A 3H5AA 4MB0A 1RJEA 3NGXA 3EJWA 3HB1A 1E6EA 3D6NB 1O8BA 2AFRA 3G8BA 5AJVB 3V9AA 3Q8LA 1O94A 1FVFA 4OQXA 4AX8A 1Q0UA 3HVKA 2JBAA 3P9ZA 4N0PA 4OXYA 1ZNZA 4MPJA 1AZWA 4YHBA 1E3WB 1MOPA 2YBDA 5DE3A 1MAWA 3CHYA 5DWDA 3A9CA 4IOLA 1T3TA 3LFTA 3A7DA 5C8DA 5CFPA 4IY1A 3K6SB 4EG4A 3BMOB 3IDQA 2B82A 4J1SA 2BFMA 3BXEA 4NMXB 4PLGA 1UJ2A 1IM8A 5E6RA 5HG0A 5KU1A 4B6PA 1XZPA 2IDZA 4WEOA 3PGA1 4CM4B 3HO8A 3QELB 1MXHA 3N74A 3W6NA 4NBVA 1P3JA 3QX8A 1OT3A 4LXIA 4NBWA 4GP7A 5FBQB 4PS0A 1T6ZA 3M6VA 4J16A 4RAQA 2D4HA 4YCLA 1FTQA 3D7LA 1C9EA 2WZQA 1GY8A 3ZW9A 3FE2A 2WHRA 4L6CA 3E9QA 5T64A 4PPGA 2KMLA 4A16A 1P1CA 2NX2A 4UHCA 4CG3A 2PGDA 4EA6A 1PV1A 5BN3A 3QKRB 1QG0A 1Z38A 4YA6A 4P5DA 5FLKA 4UXHA 1ARZA 1EAMA 2AR9A 4EJMA 5BT9A 4AP9A 1EFVA 4ROTA 3TSCA 1MP0A 1A50B 1QNLA 2B5OA 4UMFA 2AXNA 2QLJA 1KFKB 5DHSA 3Q3IA 4B9EA 4OJMX 3QWAA 2GWHA 5B55A 1DWOA 1I1NA 3QVLA 1KVUA 3P9NA 4XW2A 2XXAA 1FFYA 2GESA 4BXOB 1NC3A 2UZAA 3C5VA 3FPCA 1B76A 4TN5A 3L8MA 2SNIE 4JJ8A 2BC9A 3RWBA 4M37A 2GSWA 3QMVA 4Q4AB 2BKEA 3W9SA 1N4AA 4A6PA 5ADVA 1YZ3A 3GDOA 4JP1A 4BZXA 1X7GA 3TE6A 2C5FA 3B8EA 4Q01A 1C0PA 1PJLA 1CF9A 5JYCA 1NXVA 3ZDFA 2CGEA 2HWYA 3TZBA 4ALJA 3WBJA 1R1DA 1CYDA 1Z08A 4UMVA 5FCDA 3WV5A 4CT0A 4MI3A 4UBKA 3JQAB 3E5RA 5JVDF 3UJ6A 2QS9A 2IKQA 4EDFA 4Y2GA 1SXHA 2GZSA 3FNIA 3IAM6 1NL3A 4EFDA 1TTPB 3DZCA 2RSLA 1YZVA 2IEGA 4BKRA 4DSNA 1M0WA 1W29A 1ZN9A 2EP5A 2QROA 4M2LA 1NY6A 1PFUA 4JJEA 2R6R1 3WIBA 4US0R 3FLAA 2QJTA 2PYDA 5C0OE 1MAHA 1H4SA 4N48A 3DOIA 3HB4X 2GPNA 2OUIA 3O4GA 5SYNA 1X0XA 4FDTA 4OBEA 1JPVA 3GD5A 3TMAA 5K0CA 1LX6A 3S4YA 4KCGA 2Q1UA 1WCXA 2F8MA 2FPWA 2WHPB 4RABA 9ABPA 5DT9A 4QG7A 1I0ZA 4FGWA 3DVSX 2GB4A 3ANXA 3CZCA 3MUEA 1N77A 2JK1A 1KP2A 4FGKA 1P80A 5AW0A 5HJ5A 1N6KA 1YBVA 1WWKA 2QG6A 2WMDA 3KK0A 1YACA 4ODIA 4OO3A 4F21A 1ZH8A 3GLIA 5KYXB 1XCJA 1U9ZA 2IW1A 1MZVA 3PQCA 3RTBA 5BR7A 2AVDA 3C3DA 4IINA 3AR8A 3P94A 1X38A 3THOA 4YAGA 4DLKA 3QEKA 2MHCA 3O75A 4PG4A 3T7JA 2WKWA 4DLLA 4RGQA 3ZNNA 4RA6A 2FG5A 2FOLA 2UZ3A 3BRWA 4K28A 4XIGS 2P6PA 4O3FA 2I7CA 2C0CA 3MPOA 4FU0A 1AO0A 1BXGA 2IXDA 4O2BF 2A14A 2DLDA 3PT5A 1RHKA 2V7QA 1WOMA 4PPYA 4O4HA 3KG2A 3W7AA 2DX7A 2IYAA 4O2BB 3HHEA 1T3GA 3FPAA 3CF2A 1TQ6A 1N6NA 1QH1A 2B4TO 3KVOA 1C4WA 3MD0A 1T5BA 4C7JA 1USVA 1E6KA 2ZB4A 4R2JA 3ZI7A 5FPSA 2FWPA 3N70A 3CINA 4AFNA 3KQUA 1FUKA 5FBHA 2QZZA 3I8XA 2I7VA 4INPA 3ZQKA 2X19A 1BW9B 3MW8A 3I09A 5B30A 1JDSA 1QHFA 2OSVA 2ZATA 3HRIA 3LCJA 1Z34A 2P3QA 1PR6A 4K6HA 4NRDA 3OTIA 4XCXA 2GUWA 5AKHA 3JQ7A 1WETA 4LXHA 3J80A 4R54A 3KWMA 1UIMA 3DZJA 5DNUA 3RYIA 3N5CA 2HYDA 5KNCH 1OW3B 4N6GA 3H99A 1ZGZA 5HK8A 2OG1A 1G8KA 1HRDA 3DC2A 3GXBA 4JU8A 2JRCA 4NPAA 1E7QA 4P4SB 4TMZA 5FTLA 3S5JA 4ZHQA 1DG3A 5TJHA 4D9EA 4A8PA 4XCQA 2PBFA 4GMFA 3W3AD 3ITKA 3H65A 5KIAA 1Z82A 1PVOA 1J06A 1O03A 2CE2X 4YRSA 1PHPA 4KFRA 3QY9A 4NOLA 5BMVF 1SKBA 3K6SA 1VPWA 1V43A 1OT5A 2B69A 1PZMA 2AUTA 4CLDA 5CXQA 4JCOA 4MRVA 3GRRA 3FPLA 1I7NA 2WD8A 1J97A 4W6ZA 4QUJA 4M8NE 3T54A 4F8YA 3I73A 3KYCA 4G4SP 2VUIB 3VV3A 5ALVA 2B3DA 3SP1A 3H5OA 3IEKA 4PU0A 4CF4A 5CA0B 2I66A 4D4KA 5I9TA 2V3CC 4QVGA 2JH3A 5FEUA 1HSOA 3C48A 2ZM5A 2R97A 2I2WA 4DLPA 5T4BA 1JHOA 1E4EA 3FRHA 4IL5A 1FF9A 4WK4B 5K0GA 4MHTA 3QKRA 4QO8A 3ZH2A 4KOAA 4ERXA 2X2EA 2J5BA 4XQCA 5IAGA 5J5AA 4JXJA 1D2AA 3HDGA 2JARA 4O4IA 1U0GA 3BREA 4RU1A 4XSGA 3UJCA 1KO4A 3DVAB 3OLVA 4PAGA 1J22A 1VKJA 4XD7D 4IR7A 1H6BA 2DFPA 2BBSA 3NS7A 1TMOA 5TGDA 5KYUA 1RC8A 1TLFA 1OC2A 1F60A 2IYPA 2Z3VA 1NMSA 3GJ5A 1LFDB 4O08A 3CNHA 4J9VA 3ZPXA 4PCLA 1V2GA 2IOHA 3ZE1B 7GPBA 1KXZA 1YOVB 5HGJA 1FVHA 1HDOA 2I33A 3EGDA 1T3HA 4FXOA 4CRWB 5JT1A 2HXGA 3PXUA 4OYRA 2P65A 4JGBA 4DS3A 1BQ3A 4PYJA 1L5HB 1N1MA 3ZXSA 1IXRC 2YR0A 1V3VA 4E7OA 4IMRA 4LWPA 1JXAA 3MTQA 3TYXA 3UHOA 1E2MA 1W48A 4D02A 1E1CA 3A7EA 2BM1A 2HPZA 5KKNB 1ECJA 1SVOA 4DCSA 4CEIA 1DARA 3HWSA 4MKFA 1Y8RB 2J5QA 3B6MA 3ZWBA 2GLTA 1XTSA 1UMCB 2VPZA 1SZDA 3D3NA 1U2DA 4TWJA 4CFSA 1K4MA 3M81A 3R7FA 5EUMA 3ZHVA 2OOKA 2F1JA 3A26A 5JJKA 3QY0A 4P3YA 5J58A 3HVRA 4N8SA 4Y98A 3BVPA 3CN7A 5CDGA 5T5QA 1UM9B 4KV7A 4WBNF 4J76A 3VV2A 2EJBA 3CEJA 1V4VA 2EVWX 3ELBA 3JTMA 4I3FA 5LYYA 3CX6A 3IE2A 3IUPA 5I3CA 3L7BA 1HL3A 3LO8A 1A9TA 3WL4A 3QBDA 4XGRA 4UM9B 3I3OA 4B3IA 1QTQA 5AW6A 4EHNA 3H7IA 4U7DA 1GOTA 3FDIA 4JYZA 1PFKA 4FONA 2E87A 3UK1A 3VZDA 4B6RA 2VHZA 5F23A 3HXPA 3A11A 3JYLA 3N6XA 4NNPA 4KVFA 1O3YA 5F64A 5HPYB 5JCPA 2PT7A 1LDEA 2CHEA 3C74A 2QV7A 4S1TA 4S1OA 2QTLA 4YO7A 1RRGA 5JQGB 2EWVA 3CYFA 1KK2A 4ITVA 4UATA 5JR3A 2C4TA 4IXMA 2NOAA 4DILA 1PYOA 3WL5A 4A0SA 4IZ6A 2OMKA 5JSFA 5ADWA 1M6YA 3KAPA 3G2PA 2DUMA 2GLXA 1SB9A 1ZR2A 5BSWA 1Z2NX 3WJ1A 1Z7EA 5HMMA 4WQMA 1MRSA 3HV0A 1W1WA 4LBZA 1MHTA 4K9NA 5JADA 2B2CA 4C4PA 2BF4A 3VO2A 2P8SA 3ANNA 4ENWA 1AK2A 4ARZB 2LDBA 4B79A 1WVGA 5LQRA 3L0ZA 1OAOC 3NZEA 1AQJA 3MWKA 2B4RO 3M4NA 4OFZA 4YAFA 5BRNA 2ON6A 2PJZA 3OQIB 2V6GA 5IMBA 2V97A 4KAFA 1IHPA 1KXJA 3MWDB 5DSTA 1FNSA 4O63O 3MCTA 1VCMA 5IAOA 5KSYA 4HUQA 2ATEA 1NONA 1Y1LA 2QTMA 3TMKA 4F46A 3QLEA 4JL8A 5KJCA 3NMUF 4TYQA 1OGJA 1DEXA 1QRSA 1J2RA 3TW0A 2UYOA 1IBKB 3MM4A 5AHRA 2A1UB 4YAEA 3EIHA 3VZBA 4RY9A 1BW9A 1CEEA 1ILWA 2PKRA 2Q3LA 4IHJB 2C7RA 4ZAFA 4TVOA 3GD7A 4Q02A 3O8NA 4DLUA 1S4MA 4L3WA 5FFNA 4CDGA 2HADA 4EEZA 1OZHA 4GL2A 1HXHA 4FZ3A 4R40A 1X42A 4V0NA 1EVZA 2O3TA 2IS6A 2PAFA 2EP7A 3LE8A 1SBZA 1DO2A 1CCWA 1NVAA 3OZIA 1RAFA 4RD1A 1KAHA 2AVNA 4OMUA 1FBNA 2JZOA 2WTNA 5FRDA 3REGA 3RT7A 3FWKA 3X0DA 1IDN1 1YR9A 3P9PA 2AZDA 4TZ6A 3MK31 1Q1ZA 3T5GA 3TH5A 3AV0B 2OWDA 3TJMA 1U5BB 4IDAA 1NURA 4RD0A 1G20A 4MQUA 1DQRA 5JAZA 2YW9A 1YULA 1XVVA 1RWWA 4AUKA 1C0EA 4M76B 1UK7A 3KZKA 3B8HA 3G68A 3Q12A 4YJFB 1GZHB 4IDPA 1EHCA 4S24A 4C06A 3ZE2B 2ZYSA 1HFJA 2GRJA 2A5FA 3DEFA 4CQLA 4HLUA 5KWSA 2ZJ8A 4N01A 4FR5A 1V95A 2H4JA 2R87A 1GKIA 4JBNA 1Z4QA 2GHRA 3AESB 3D0QA 1Y7PA 4NG5A 3WSTA 1SXIA 5JJCA 4R0MA 3DV0B 2P9QA 3C8MA 4RD2A 2C7QA 4KZKA 4ETMA 9LDTA 1Y7IA 2PKCA 4D92A 2ODPA 4QA9A 3OI7A 1LNSA 1XYGA 3HM2A 3LC0A 2C4VA 1NAHA 3N0TA 3GEHA 2A9QA 3N8DA 4QFBA 1R4ZA 4X5OA 2WSIA 2BGUA 4UBIA 2Y71A 3FSJX 2JCXA 3CRQA 4BO7A 3CBQA 4FLMA 4QPPA 1J1ZA 1H8HA 3DAFA 3IP1A 4QPZA 2XIJA 3ESXA 1P75A 1BFDA 4OM8A 3LUBA 4AC9A 3T7AA 1XHFA 1G21A 1Z6AA 3A3KA 1NXSA 3F8WA 5K6TA 4XIYA 1GZ3A 2IHTA 1SKQA 1V6AA 1S3FA 2QPLA 1K75A 5HCUA 4QT0A 1GU7A 5G4KA 4ZAXA 5FIUA 3B9RA 4JBIA 3DV2A 3C8UA 1QS0B 4KTVE 4H17A 5THKA 5T6MA 4I55F 4EHLA 1AH2A 3CZAA 1UP7A 1C0IA 2XOKD 3I8SA 1Y3BE 4X6LA 2GZ2A 4RGBA 2WM9B 2FUEA 5IEBA 5REQB 4TXNA 4X7BA 1L8QA 1PEAA 4U7HA 3QRWA 4UMDA 1SN7A 4H3HB 2GH1A 1QHEA 2C5BA 2HMVA 3EULA 4JFRA 1DINA 3V1NA 3IDFA 1RYFA 4WY5A 1GL3A 4IYRA 5DM4A 5H82A 2FGJA 1L5NA 3WYDA 5CYFA 1NVWQ 2OD7A 3H9BA 4Z0TA 4DJ5X 3T41A 4CV2A 3K73O 4EIWA 4NDZA 1RFGE 3BDIA 5A7FA 3RE1A 2D5AA 2Y0EA 4RK5A 5EJMA 1FSPA 4P33A 1NSFA 1P61B 2HO4A 4M6WA 3JWGA 1YS7A 2H11A 4MQLA 2JJ1A 3KTAA 4OFBA 4C7XA 1BMFA 2PVCA 4I5IA 5DN6D 4FMCB 3EVZA 1ORTA 1RCTE 1GP2A 2WR8A 3OLYA 4R01A 5T57A 1CNFA 2A9FA 1GR1A 2CNBA 2DCUA 3O4HA 1UQRA 4NI5A 1OH6A 2PUEA 1LRKA 3MQ2A 1R0SA 4IQFA 1GG5A 2IIVA 3OUZA 2PRYA 3ER8A 3DDCA 2ZJZA 4QGHA 2Y92A 1MQ8B 3HR8A 3E7WA 1HZZC 2IYFA 1E1RA 3LOQA 4L0MA 4MV3A 1RLIA 4R31A 4TTSA 3S1AA 3T3OA 4MDHA 1T2VA 5FV7A 2PZJA 3LRTA 3FUXA 4OJKA 5E4FA 1T0PA 2AHRA 3WNVA 2ZSHA 4G81A 4PSKA 5IHXA 2YWHA 4PX2A 1YA8A 3LT1A 3FVVA 4MDYA 1TM2A 4MIEA 3VU0A 3OOWA 4IRMA 1NRIA 3Q7IA 4FYMA 1D6NA 3RVJA 2QEQA 1LB1B 3X1DA 3FUTA 2R85A 2BMEA 4O2BA 1S9DA 3COPA 2IP4A 4M3NA 4K81B 4QFCA 1M34E 1UEXC 4NX2A 5A5FA 4H9GA 2F3RA 1PNRA 1Q57A 2PCLA 1FS4A 2VTKA 2GNOA 1CHNA 1P60A 4GLBA 1RU3A 4ROSA 1KI4A 4HX9A 3EJ6A 1C9DB 2G9QA 3LX8A 4J3NA 2AYYA 4QRIA 1RQLA 1FFXB 4A91A 2COUA 1MMFB 1YIDA 2XHEA 4UZFA 1KYZA 4EYGA 5BN4A 4F93B 1BO6A 1Q3KA 5J2TB 4DCPA 1STOA 4NEQA 5C4IA 5JHGB 4RORA 2A0FA 2EXXA 4YDQA 3F0TA 4ZDIA 3A4MA 4O4JF 4ZAYA 1Q3TA 2QR5A 1WHTA 3VAYA 1HEUA 1F1BA 1YJBA 3A70A 3ROGA 4V39A 4CQJA 4URVR 4WW0A 3ZNOA 1S4QA 4LC0A 4CR6A 4EVRA 1DPGA 4BWYA 4UTVA 5EE9A 3WADA 1Z6GA 4HWOA 3RSLA 4BYMA 5B53A 4G86A 4Z4QA 4MVJI 4WASA 4F71A 4NCBA 1TA9A 1GV1A 3AYXB 4KPUB 4X24A 1LWOA 4BN5A 4L5CA 2BOVA 2I1WA 1JAHA 2QL9A 2HOQA 3DEKA 2CV0A 4CDNA 4N40A 2XMRA 2N9UA 3DE3X 4BPRA 4DPMA 5DHUA 1ZEJA 3GNTA 2PKXA 4MRSA 5BVGB 2ZJAA 5DULA 2GA9A 1YQUA 3OP4A 4OFXA 5CT8A 1DRUA 4MS4B 1MVLA 2H08A 2ZYIA 1P19A 4MVYA 3RIYA 1Z3IX 1PDOA 5CT9A 4OH7A 2BHRA 5FAKA 3OQ1A 1UBCA 3PNSA 1E1QD 4LF7B 4GNRA 1CZNA 1SXJE 1ZFNA 1V16B 1GQQA 1WHSA 1XZDA 3BMCA 2AR7A 3ZGLA 4CMGA 1B7GO 4ZCTA 4EHKA 3PF8A 2NZ2A 4EKEA 2AJ8A 2XWQA 1RE1A 2R7MA 3GLSA 3R9XB 1C30A 1U94A 2P2LA 4E14A 1YE3A 2EYUA 4N03A 3OZXA 1J0AA 1U11A 1ZCZA 3JQCA 5KWEA 3ORFA 2VT2A 3KQLA 1B0ZA 2ROQA 4BNXA 4Z3OA 1NUPA 5B6IA 2KLHA 2XB8A 2DBZA 1D2MA 2V6FA 4RQTA 2J6BA 3F97A 2JLVA 5FB3A 2Y1CA 2ZJ4A 1QR6A 5D1HA 3MA0A 3A1FA 1IEVA 1L4NA 3E3NA 4AJ1A 3QM1A 1CQIB 2DPYA 3FMGA 4MX8A 3BA6A 1SVSA 1KY4A 2JJ2A 2WKRA 5I9LA 3WLSA 4G07A 2ZTLA 3TM4A 2DGDA 4X1IA 4OX9B 2I3BA 3DAYA 5FPYA 1ND6A 2F3SA 5INTA 1UBEA 3M6UA 1Z7BA 1SUCA 1FC0A 3O8BA 4RVHA 5DFAA 5K3BA 2ZRKA 1XA4A 4YMTA 3LWNA 1QRUA 2O8EA 4KQWA 3OPVA 4ZK6A 4JT2A 1BJKA 1UBKS 2NQ2C 3OCWA 4NSNA 1JR3D 1G18A 3HCWA 2HREA 5BSRA 4F8JA 2NZYA 5FLEX 1ITZA 5BVHB 3QMPA 1B2RA 2RC6A 1TA0A 3M1AA 4S1PA 1ADFA 2BE7A 1SU4A 1MO5A 4Y6RA 2X5NA 1GPBA 3DL0A 3NEJA 4E2ZA 1E2NA 1VHLA 4EW6A 4W8HA 4TWIA 5JD6A 3I9NA 4F92B 1BH6A 3PHLA 3ICVA 1ZSYA 1H4VB 3IRVA 4AY4A 1EFDN 5EJ2A 4KKVA 4ZN6A 2O05A 3AF5A 1DTEA 2PMWB 2YV5A 3CGGA 2J6IA 1R0CA 4MVJG 5DXFA 5BPHA 2XAAA 5JECA 2ZG6A 3HWRA 5EHQA 2Q6LA 4FEGA 5LUBA 3S44A 1V3UA 1N5OX 3NAGA 2Z09A 3K1ZA 4XPZA 4BXOA 1SD1A 5CVEA 4PAOA 3OO1A 4LJAA 1M74A 3IUJA 4FMPA 4Z0NA 1RQGA 2X6QA 1YB6A 3CIFA 1JYSA 1U65A 2I34A 2XMCA 2VNIA 4PBTA 3MLEA 4HF7A 3C7TA 4HX5A 3UK2A 3L49A 3DKVA 2JPDA 1VI5A 4PQEA 4RYDA 3V2IA 3LA8A 2JLUA 3W5HA 4ZI2A 3AVWA 4HDOB 3GLRA 1Q0LA 3NBAA 4KH0A 1CTQA 1Z7YA 2AYZA 4CLOA 2B8JA 3AI7A 5ALXA 2QVBA 5DH9A 3RARA 3RGGA 3C85A 4CIYA 1OROA 5I9NA 4U2EA 1X7XA 2W11A 4GPIB 4ECEA 5DASA 2EHDA 2J3HA 2ZCUA 3FNGA 2FDXA 4QQ8A 4GBED 5AM3A 1A5SB 3CKMA 2O1SA 3OTGA 3RIEA 3PNOA 3UV6A 2Q2NA 1U9YA 1N8SA 3BB3A 1E9FA 4GC9A 1PCXA 4DTIA 2B5WA 3GVHA 3QUAA 1CUEA 3JZDA 1M5RA 1GFZA 2NTNA 1LBSA 4KX5A 3AYZB 3OQPA 3Q9UA 5EFZA 4DAEA 2Z6VA 4ZOCA 4EQZA 4V0QA 3VH4A 5IJZA 1I24A 1LI7A 4D9HA 3LBFA 3PFHA 4QEZA 4AZ3B 3SZGA 1GGEA 4G5XA 1N2EA 4JU9A 3TD2A 3H97A 3FHCB 3OQNA 3TSYA 1OH8A 1V3QE 2MINB 3IBCA 3KR0A 1EBBA 3E1SA 4J4HA 3VYWA 5EWJB 2I29A 1G8JA 3O8RA 3ICOA 1ZMBA 5KNCA 4NP6A 4HUQB 4OQZA 4FBLA 4RM2A 1QHNA 4MPDA 1W8IA 4L28A 1U7ZA 4TZKA 3NWEA 3QUCA 3T7IA 5I4IA 3A6FA 3AUKA 1UF9A 4Q00A 3EWSA 4RA6B 4F91B 3HABA 4UHBA 3R6GA 1YKGA 1QK3A 4Q21A 2ORED 4HTFB 3RYCB 1AN9A 4N6NA 4UE2A 4Z49A 1M6WA 3DFMA 2PM8A 2F9MA 1ZRHA 2C2KA 2DSNA 5BQ3A 2WWIA 3VC2A 3VYUB 2BHTA 1H9AA 2PKQP 5EZSA 1ISHA 5TT0A 1OUMA 1TB4A 3CUKA 3U60B 1D09A 2CHUA 4EY4A 1E96A 3L0YA 3F9IA 2Q9UA 1DG1G 3GT7A 2WINI 5I7EA 2EF1A 4DR3B 5SYAA 4M8SA 1X70A 3TBHA 4D0RA 2UUBB 4NXMB 4DCUA 2FX5A 4P32A 4XLTA 4ZQBA 2JH9A 4KDCA 1PKXA 2G1PA 5DYYA 4XR9A 4MDEA 2GAJA 4NYJR 3X2FA 3N2GA 1CQJB 4R05A 3FOEC 4DB4A 2AUMA 4UUMA 4FW8A 3RV3A 1OE0A 3U17A 4B76A 5D1NA 1ZOLA 1GHTA 4IQ4A 3HUEA 3I52A 4WCFC 1W93A 4DIBA 4IV8A 2W93A 2O48X 3IKMB 5KJ6A 2VJQA 3I6YA 4GXRA 4C78A 4HZUA 2HGSA 4KB5A 1TO6A 2HB6A 3A6HA 3K31A 1CZKA 1PJBA 2OP1A 2GA8A 3ST7A 2YWGA 3DF7A 3BK2A 1RNLA 4Y2UA 5COBA 4KMMA 4ZI3A 3U44A 2Y9PB 4IOKA 1NDQA 4G0OA 2VYFA 2Z1NA 1YH3A 3KCNA 1EFKA 3QZUA 5A2GA 1KBQA 1AT1A 1ZONA 3OMWA 5KCZA 1PRYA 1M67A 4R1LA 1T3LA 2Q3HA 4FB4A 4L74A 4COKA 2PKEA 3LQ1A 4Q24A 1GGKA 5CCDA 2GZ3A 3DLIA 4MYSA 1XD2B 4UCQA 1GZ6A 3F8SA 4PPNA 2OQVA 3AP1A 4DSUA 2BZ1A 4DSTA 4R5MA 4AS3A 3EWIA 2JIZD 1QFXA 3GC6A 4ZO6A 2QY9A 4C7OA 3DAGA 1MEJA 5DTEA 1CXZA 3UA4A 4NBLA 3VPSA 3LKVA 3IULA 4BO3A 3ZS9A 4PZ9A 5C52B 5BWMA 1IOWA 2DTXA 3PI6A 2DJ5A 4ZJUA 4F3YA 2ZAMA 3BGVA 1T5TA 4DABA 3QOWA 3HNOA 3ZCRA 1TEZA 3KSAC 2IHBA 3D7SA 3NWJA 2GYUA 4J16C 3ASZA 4UM7A 2REQB 4BVKA 5A1TA 2QA5A 2QXYA 1IMOA 1K4KA 4J0JA 2H1HA 4BO2A 4X7PA 4AP5A 1XE3A 4UEOA 3LPLA 1YK0A 2W2OA 2I4TA 2FR0A 2IF0A 4JOSA 4KP7A 3RHFA 1YU9A 5L8VA 1N34B 4P3OA 3BD9A 4B81A 3MMNA 4JYMA 4Z9FA 2D1TA 2NUAB 2FPPB 4O4IB 3BMOA 4OHOA 4CE6A 1YRHA 1T3ZA 4Q9AA 4FFMA 2WYVA 5E6RB 4F56A 5C3MA 4BKQA 2GJ8A 4IMPA 3AVXA 4LDNA 2ETXA 2HF2A 4GO1A 3QVVA 3ASYA 1IEQA 3NAQA 1E3WA 2JC3A 5CT4A 1ZOSA 3VRHA 4JUBA 3JVEA 3R3YA 5HOQA 1A1VA 3OJCA 4K0KB 5FI0B 3FAZA 1O9GA 1JKJB 3WQHA 2CFSA 3WWDA 4EUSA 1KI9A 3HI4A 1SCDA 4CR8A 4JLKA 2GSDA 2HRDA 3CNBA 4GMDA 1LI4A 5JWHA 1GQSA 2D2XA 1S7CA 1DXQA 1SC4A 2FN8A 2XT9A 2JLXA 1E2PA 1JFLA 4UUQA 2JGLA 1XXHA 2NNLD 3O4RA 3PNBA 4HDRA 2EJUA 5COAA 3ISTA 4UJ3A 1QVWA 3KQVA 3OFKA 4DIKA 5IKMA 2CXTA 3WOVA 2JEYA 4JBLA 3R6TA 4Q4JA 4CEIB 2ZUVA 3ASUA 3T52A 3GCZA 5EEGA 3T3GA 3IPXA 2GX6A 5B6PA 3P26A 4N5LA 4Y2VA 3NORA 2HYIC 3IBGA 1Y81A 2Q4DA 3AJEA 3UAZA 5E0KB 1NBMA 2BSQA 3K0AB 3LBNA 4WFIA 5GV7A 5GM2A 5THXA 1K0UA 1UUFA 3BGDA 4MWTA 2QZPA 3TD9A 1V41E 1WCYA 3ENVA 4UHEA 3T9DA 4MK4A 1UKZA 2BFAA 4P9NA 1Z16A 2ATXA 3DHVA 2HMSA 2LD4A 1WIWA 4YPVA 3HGTA 2WIJA 1UKCA 1MC1A 2BL4A 3WRYC 3TW4A 3OTOB 2Q2QA 3FNFA 3OZDA 4US1R 1PAUA 2ZIVB 1Y82A 2P11A 1G4AE 4W1QA 1GFSA 3I9LA 4ZA2A 2FWJA 3E7XA 3FPGA 4FCCA 4G36A 3UT5B 2DHDA 4D9JA 4X63A 1SOAA 1NBEA 1I7LA 1M6VB 1SUSA 2JEZA 4BMCA 1PJ8A 2P6MA 1C2YA 2C7BA 2X7XA 3OQIA 1C5KA 4BB6A 3S7TA 3JTEA 4W7HA 4ZI7F 4W5TA 4LZNA 4D6PA 3K9WA 4HGPA 3V42A 2FPGA 4MTCA 4ARCA 2Y0DA 1RMTA 4ZKEA 3SHOA 2Y66A 3FWZA 3CPSA 1UJ4A 3L1JA 1X9IA 3IQIX 1H9BA 3UWMA 4DR6B 4Y8VA 4RVUA 4GBJA 5L3ZA 2R6ZA 2SKEA 4OJYA 4BNLA 2XRFA 2PUVA 4G63A 3U4DA 3O92A 4Z1MA 1IXKA 3ZCTA 1PX0A 2BMWA 3MSXA 2HF7A 2OZKA 3LUHA 5KYXA 1TM1E 4H60A 2EKPA 3GEEA 5T3UA 4PCUA 1JSCA 3I3SR 4C7VA 1OLXA 1WCIA 4D0SA 5FPKA 2GAOA 2GXQA 2IPMA 5LZ5A 2R7LA 3DTVA 1I10A 5B1HA 2H29A 5FOQA 1N6RA 5IKOA 2V65A 3HY3A 4IUCS 3UFXB 4QDOA 5HZMA 3L46A 2DLNA 4DPKA 5DCYA 4OGKA 1NN5A 4LDJA 4JX8A 4JMPA 1ZIYA 2AI2A 4GECA 2EBWA 5B1YA 5FTMA 2QRGA 4P7BA 2ZWVA 4I6JA 4M1QA 1JNYA 2OEPA 2G04A 4GH5A 1XEFA 2ZIEA 3IAS1 3IV9A 4MGYR 2HPVA 2CXRA 1R8XA 2P90A 1QQ6A 2P2SA 1TK9A 4D6XA 4QJ4A 5J4KA 3VSEA 2WWTA 1Y4ZA 3IJRA 3LGXA 2VAWA 1A1SA 2WU0A 4QXAA 1OQAA 5FA5A 4J4BA 4XPIB 4G0MA 3T94A 4IJVA 3EFOA 3EGEA 3LECA 1KMNA 4W5RA 2UVDA 3FSRA 4DUPA 5FQNA 1JP7A 2IP1A 3PQ4A 4GWGA 5BPFA 1TQ2A 3DEYX 2PS0A 1LD3A 1U2DC 4TKLA 3RTEA 1TAGA 4R9SA 1AM4D 3CZ4A 2YXDA 2QD3A 4O4HF 4LXGA 2W6JA 1IN7A 5E7QA 3IURA 1B43A 4DB2A 3LBIA 1RI1A 1VLLA 2EERA 2DMRA 3QBEA 4I9FA 3EYWA 1H4TA 2BM8A 1OPRA 3DA8A 4MCJA 1P4GA 2BR4A 2CZGA 2GEJA 3C3JA 3CZPA 1XRRA 3RT9A 5GGYA 4B84A 1CZRA 1NP7A 4X62B 3MN1A 5GZ1A 1UMDA 1UPFA 4KDFA 3OZWA 3DG9A 3IMKA 2VDNB 4RK6A 4ZVOA 5KYNA 1DADA 5KX5B 3NBMA 4RZSA 4LYAA 3BJRA 1KJ8A 4GC5A 4WKCA 3T7RA 5HKKA 4I6EA 3CVVA 3IUBA 4JI4B 2J0UB 2XCIA 1G3QA 4XIIA 5DNCA 3L0CA 1VHJA 2QNBA 3MRXA 4RGYA 5G0WA 1KPHA 1KDPA 2ZIFA 3O9MA 4QX6A 2IYZA 1Y6RA 2R5FA 4IF6A 3KJIA 5JV5A 4GSYA 2Z1MA 4IOMA 5LLSA 2CNNA 1NR7A 4LFAB 2CLIB 1TU0A 1W88A 1Z5ZA 3QXHA 5ENVA 4R1SA 1CJCA 3D3KA 3C43A 3R44A 2XUPA 3SYMA 4ENVA 1C1DA 4JELA 3ZV7A 4Y6SA 4CF3A 1ZVVA 1YTLA 1JNXX 4FK8A 4EG3A 4YXWD 4MVJA 2YJ3A 1EJ6A 1N2GA 3L1UA 4COOA 2WUFA 4U9HS 5JDCA 1YVEI 2R8EA 1TKBA 3PDJA 2GCOA 1K3UB 5KWJA 2Z95A 1E5LA 1SXJC 1QCCA 2ZSBA 4GPEA 4LYEA 3DE1X 1UJBA 2CLLB 4WECA 5H3HA 3G85A 1YJQA 3RS3A 1H1DA 4WFQA 4KFSA 2XCTB 4G1UC 4D1YA 1GNPA 1YB1A 4UU0A 3QE9Y 3FCEA 2OPBA 3K2IA 1N5IA 3HV2A 3KJEA 4B87A 3O9ZA 1B16A 3SJAA 4I0WB 2F59A 3HYRA 5I9BA 4I36A 1KMCA 3CXUA 3FTCA 2AG8A 3UOAB 4MWBA 5JARA 2Y76A 4AIRA 1UBFA 2CL6X 1FDTA 1G98A 1SCNE 3BWBA 4HKTA 1ZVMA 4Z4CA 1ZCAA 3D8UA 1TZBA 3IRUA 1O96B 3X1ZA 2PFSA 4RK7A 3DZIA 3ETDA 4ID3A 4YN3A 4CR7A 5JJ5A 2C9DA 3CLTD 4F1KA 5HIAA 4YGYA 5F9HA 4BE7B 3W1WA 3C3BA 1WUHS 4XDYA 3GGPA 3A4LA 1NP6A 4FDVA 4XIFA 4OQ4A 4NYMQ 4KUGA 3RYTC 4CCYA 2X2OA 2QXTA 4XJXA 4YRZA 2RHBA 1KORA 1ZW6A 1QG2A 2HCTA 2EF0A 2QQ0A 4JAVC 3KCQA 3T5CA 3WGJA 4BVGA