521PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTTGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncogene protein
molecule keywords H-RAS P21 PROTEIN
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 521pA00
4C0SA 5KOYA 2ZYVX 2W2XA 1KDTA 2QGNA 2WJGA 3CNNA 3EAQA 3QUSA 4PC2A 1Z6XA 2QA5A 2VPPA 4HB3A 4PC3A 4KSBA 3BERA 1RIFA 3NH9A 5KYKA 2PZEA 2GVZC 4Q7KA 1E2IA 3MAAC 5HE9A 3KJIA 1V5WA 4TSFD 5KNCA 2C9YA 2XXAA 3NEJA 3SHFA 3U6KA 1K6MA 5FOXA 4URYR 3M6AA 1CRPA 3QXCA 2ZE6A 4AWXA 5FPHA 4EPXA 2CLSA 4ZIRB 4ZI3A 2F9LA 1E32A 2LCFA 3VKHA 1AA9A 4D25A 3HU1A 2DFLA 1P7CA 3Q72A 2YNMA 5K8IA 1NJFA 2ZVPX 4G5SA 2GRJA 1E9SA 2WVJA 4US1R 1E94E 3P32A 3RYTC 1DG3A 4EFLA 2D2EA 2VIIA 3A1SA 3A6PC 3THXB 3S1AA 1FPMA 1ESMA 3NHBA 4LV6A 2O8FB 1Z29A 5F2EA 1NJGA 1QVAA 2ZYTX 4RCYA 1II8A 2AKYA 4F4JA 1T8UA 2C04A 3FFAA 4QL3A 3QENA 2JLSA 1FNNA 4HEJA 2CHGA 4OQNA 1W2HA 3CRW1 3OEED 1B23P 4C7OB 4US2R 1AKEA 1XMJA 3OFNA 2FSGA 2FFBA 3A1WA 3TSZA 2GZHA 2C03A 1P73A 3QPUA 2OFOA 1JJVA 1W48A 5JCPA 4XH9B 1SXJC 4JT4A 4D82A 2PT7A 4Q01A 4DJTA 4URUR 3I92A 5K8LA 1NLFA 2IXFA 1CR1A 1Q21A 3CNLA 2OCAA 3TJZA 4DDTA 3UIEA 1VHTA 3TNFA 1TNDA 5CJ2A 1ZC3A 4QBIA 4KU4A 1L4YA 1GRNA 3IO3A 5KSPA 1GM5A 2IUUA 3W6OA 4ACAA 4BWYA 1SVMA 1NBME 4EKDA 1UKYA 1ZC4A 2OBNA 1A2BA 4MGZR 1MO4A 2EVWX 1GRQA 2FJUA 3TUJC 1DAKA 1ZU4A 2XTZA 5KPDA 2W0SA 2OHFA 4QM7A 4FCTA 4L9SA 1YRBA 3VR4A 2VHCA 421PA 4RZ3A 4YMVA 4TMWA 5FTKA 4P31A 2YC4C 2DYKA 5KSZA 3CX6A 1U8YA 2O8BA 2D7CA 1XF9A 4I1UA 5JRJA 3B1WA 1IJFA 1KKMA 3GEEA 3MJHA 5A0FA 5KNDA 1KGDA 3K70C 2ZSAA 1DAEA 3ZH9B 1TQ6A 4FD2A 3AUXA 1LS1A 5FOUA 4HB0A 3EPJA 3LW7A 1GSIA 3I61A 2ZR0A 1M74A 1MV5A 3W34A 3WNBA 4HB2A 4FCVA 1JQLB 1CR2A 4NTZA 1G291 3TRFA 5HR5A 2JDIA 1KJZA 1N6HA 2TMKA 4AG5A 2RHMA 2XJ9A 3Q7PA 4GI7A 4CRWB 2WIBA 1VCMA 2C5LA 2NPIA 2RGDA 2Z0MA 3I3SR 2JLWA 4ZDJA 4NCNA 2O0HA 3IIJA 1WBDA 2D4HA 1ONBA 3FDIA 3EXAA 1FQJA 2J87A 5L3SA 1T3SA 4RD4A 2Z5FA 3RS2A 2QPOA 2W83A 1KMHB 3KKNA 3QXSA 4U7DA 1A1VA 4UNSA 3H1TA 4KVGA 5GJVC 4N3NA 2W6JD 2WJJA 1DG1G 2ZRCA 3N2IA 1XNJA 4MRVA 2FF7A 1P5ZB 3V9PA 4AYXA 3NTUA 4UNRA 4FXPA 1UKZA 2F7SA 1E0AA 3FVQA 1NG9A 1KO7A 2EFGA 4DLWA 4ACBA 1KI3A 2RH5A 1XD8A 4OQMA 3NHAA 721PA 4TYYA 1XPUA 3V00A 2NOAA 4KV9A 1R0XA 2WOJA 1OKKD 2BWJA 3GLIA 1BOFA 3BORA 2QT1A 3QPWA 2OV2A 1KJYA 4DCVA 4HYYA 2EWWA 4HAUA 5JJLA 821PA 3B5JA 4RD2A 1SVIA 3I1FA 1R5OA 1NNEA 1XTRA 3PJRA 2HDNB 5FL7D 1JI0A 5BYJA 4LHZA 3KQUA 2IYRA 3CUEF 1E1QA 4PQYA 5FPSA 1AS2A 1CR0A 4TMVA 1JAHA 2IXGA 4FI3C 1HT2E 1S9DA 1KY2A 4FMDB 3W5JA 1XU4A 3BH6A 4EPWA 1G8HA 2ZJZA 4D0NA 1KKLA 2HLDD 3LXXA 3ASZA 5EE0A 5JBQA 5K8UA 2O8EB 2CMKA 3D3QA 2XZPA 1G7RA 1IN6A 1W0JA 2I1VB 3DHWC 4LZZA 4Q03A 3VX3A 1UBGA 3D8BA 4PO9A 3NG1A 1M7BA 1Z2CA 4B3BA 2HV8A 1RJ9A 3LW8A 1Z0IA 1MKYA 2NO7A 1XXHB 3UMFA 4GL2A 4Q9KA 5JS7A 1U81A 1NN3A 1SHKA 3B1ZA 5FBWB 1G8PA 1GG2A 3K0FB 1HUQA 2VA8A 4NPHA 3RC3A 3QKTA 2VYFA 1HE8B 5EUMA 1G1MA 1JECA 1Q1ZA 5KSYA 3K0CC 4ARZA 1T5LA 4LDJA 1JR3D 1LF0A 3IIMA 1NN5A 2JIZA 3Q7QA 3RS5A 2ZRPA 5JWRA 2FSFA 4Z1MA 4JBYA 1S1MA 1QHNA 1R8SA 3B1XA 1D2NA 2CVHA 2WJYA 2ZANA 5ANRB 2JAQA 3IPXA 2XTMA 4CEIA 4B34A 3CRRA 3VR2A 1YQTA 5JCZA 2WWGA 1GITA 1OYYA 2ZRBA 1G17A 4WA7A 3U3JA 3GLFB 2O8CA 4GBMA 4Q1CA 3THYA 4I1OA 3SOPA 4A15A 2BEJA 2AFHE 3PENA 4P4SB 4OL0A 2W2VA 4V0ME 2A2ZA 1T5IA 1SXJE 5C2JB 2KWIA 1GFIA 3NBZC 2GAAA 3DM5A 4LC1A 3U4QA 1KTVA 4WZBE 1UAAA 3CIOA 2QTVB 1QVRA 4OQFA 3ND8A 2R2AA 3J81k 2YOGA 4BPBA 1T9HA 1N6RA 2OLJA 2GDJA 1E69A 3K9HA 3P4YA 3PUZA 4Q5IA 3FFBA 5DYIA 2O52A 5HKKD 4TLBA 4ASUD 3RAPR 1AIPA 3EASA 4C0KA 1Q20A 1VG1A 1F5NA 4LHYA 5LB4A 1X8JA 1RW4A 4B3GA 3GEHA 4DLXA 2R9VA 5JS8A 1R4AA 3W8NA 2X77A 3EZ7A 3AF0A 4A6XA 3UANA 2BMDA 1Z28A 3R9IA 2EYUA 2QAGB 2CK3A 2RGAA 4KODA 4BLQA 1Z0KA 1XZPA 1Z2AA 2IEZA 1ZNWA 2QP3A 1H8EA 1VYVA 3EC1A 3QPVA 1J7KA 2MSEB 2J45A 3DKPA 4K46A 4GT1A 3WHLA 2PX0A 3OAAA 5K8TA 2V7QD 5J4KA 1XEWX 3OF5A 1S8FA 1T8TA 4B2PA 1K5GA 4XD7D 2EFEB 2R6DA 4RFSB 121PA 1O87A 2FFQA 4LJYA 5FUWA 1E0JA 2FPMA 1KY3A 3QBVA 3A37A 1UBFA 4TTPA 4OI1A 3WBKA 4O0MA 4R98A 4JL8A 1A4RA 3L8YA 4LCBA 1TQ2A 2X19A 4EPTA 1CKEA 4F91B 4QJ4A 4A4DA 1D6JA 4QNMA 1YU9A 3HU3A 1Z6YA 2DBYA 2OCYC 3AVWA 1DAFA 1JBKA 1JXMA 2ZVQX 4MITA 5TARA 1IAQA 2VP0A 4KFTA 2QRNA 4KO8A 3UXMA 2QPTA 4X8HA 4Q4HB 3VU9A 3OIUA 4MKHA 3PEWA 5BN3A 1OFTA 4EAQA 5KO2A 2CCJA 2D3WA 2O5VA 1N0UA 4RKEA 1QHHA 3QXJA 4Z8XA 2ZI6A 1F48A 4G5QA 3BK7A 1MABB 3MFYA 3LVQE 5FBRB 4P0TA 3W5IA 5E7IA 4HAVA 3BS4A 1ZJ6A 2OCPA 2ODEA 3AB3A 2FEMA 2ZUBA 1T4GA 2C78A 3AKEA 4IDQA 3SEAA 4AG6A 4DXAA 4R2IA 5H70A 3X2SA 2BBSA 2IBMA 3ADBA 3X1DA 4HLUA 2OZEA 1W36D 4E22A 4TQUS 4URWR 1VHLA 2IA5A 2OBLA 4N1AA 2WSMA 1CF4A 1XMVA 3NBFA 2P6UA 3NWJA 4IDHA 1MOZA 1XP8A 3K0AB 4B3XA 1Z22A 2V54A 1K5DA 1N5IA 3CF2A 2NIPA 5CK5A 4HAXA 1AQUA 3GJ0A 1E2MA 2CJWA 5F9HA 2CEAA 4OYHA 4X8OA 2ZQ5A 4B6FA 2N1BA 3HYTA 1KOFA 3BIFA 3W8RA 3OEHD 3FHOA 5CITA 3BE4A 3K8YA 1ZD1A 4POAA 1TPZA 1TX4B 3AH8A 4I99A 3GLHA 2RCNA 1LF5A 2OFWA 4DHEA 2IS1A 3F3YA 2PLRA 3OE7A 3WYGA 1JQJC 1RRCA 1PV4A 1TAGA 1E9DA 1KHTA 2P6RA 3KB1A 3SQXA 2IS6A 3TAUA 4Q4JA 5BYKA 3K09C 2ORWA 1KSHA 1NI3A 4TTRA 4YXWA 1GNPA 1DTSA 2W6IA 3QOFA 1QRAA 1E79D 4LPSA 5J47A 4MDFA 2J0UA 3DZDA 5KDLA 4YQFA 4NYIQ 5JSZA 4ZO4A 4EQ6A 1U2RA 5JWOA 3L0SA 2ZJ8A 1CLUA 4JYCA 4LHWA 1WMSA 1NLYA 2IYQA 2VP5A 2C9CA 2GJKA 5CIWA 4IFBA 1FX0A 1S9HA 5CB8A 3U44B 2H92A 2VHJA 5DISB 3SYKA 4QRHA 4FW9A 1G18A 4QGAA 3SJZA 4B74A 1ZUHA 4DSOA 1PLKA 4KBFA 2Z4SA 2UZ3A 5DLQC 1W44A 3WNCA 1TF2A 1LB1B 3FPAA 1NVUQ 3UG6A 1W36B 4JVMA 1W46A 1HTWA 2B8TA 2YV5A 3UK6A 1XTJA 2QPAA 2VTKA 3IBGA 3LDAA 4GZLA 1OSNA 1XCPA 4E5UA 1OW3B 4KITB 1OHHA 4M1KA 5AK0A 2ZRLA 4DCNA 1ZM2A 1IBRA 2PL3A 1AS3A 1VCNA 3BB4A 1U0LA 4TYQA 2V9PA 4QBGB 4HDOB 3OIWA 1IY1A 1KMQA 3VHXA 4A0HA 1E0SA 1R7RA 1G8GA 2ZU0C 1M1YE 4IXNA 2AX4A 3CWQA 2QNRA 3PFIA 1XTSA 4G3XA 5JJKA 3CM0A 1ZIOA 1IXSB 4YMWA 5L3VA 3AVVA 1E1RD 1NMXA 5FPYA 1R2QA 2VF7A 4NP6A 3P20A 2BDTA 3RSLA 1OH5A 3OFND 4LBYA 3FKSA 1GUAA 2B6HA 1DE0A 2YINC 4JS0A 2F1HA 2CHVA 3KTAA 5IT5A 3QVVA 2V4ZA 5AUOB 2H8KA 1VCIA 3KKOA 5IRCD 4JKIA 4RD1A 4LYAA 3LX5A 4MRNA 4EJSA 3BH0A 4C2TA 1W36C 3DPUA 2LKDA 4NCHA 2PBRA 3PG5A 4JLOA 2BHRA 1EFUA 4B76A 3R8FA 4KYUA 1TUIA 3B9QA 3QKSA 1GVNB 1Q57A 2QRZA 4TLDA 2IYSA 2R6GA 4Q7LA 4NBSA 2IX3A 1Z63A 1T91A 4N0EA 1E9EA 2J3EA 1P9WA 3KUDA 4D4JA 1CRQA 1EFCA 3GLGE 3DL0A 5A4JA 1NN0A 1KSGA 5CDFA 3AVYA 2QL6A 5DHAA 2EYQA 1OT3A 3IQXA 4L4UA 3PUXA 1CXZA 5TVKA 4QJ3A 2NTYC 5IF9A 1R0WA 2AWNA 1J8YF 2Z6VA 1OE0A 3VTKA 2ZIAA 4JKYA 4C0JA 3B1YA 3U2QA 4IDPA 1G41A 3KKMA 3DOEA 3B7GA 3UWKA 4XVQA 5TDHA 4Q48A 3KQKA 1Z6TA 1QBKC 5GJWC 4EPRA 1X1RA 1G3QA 1SULA 5BXQC 2J0VA 5D3MA 4L9WA 3LA6A 5DH9A 1LV7A 2Q3FA 1ZNXA 2IUTA 3RHFA 3UG7A 3TGPA 1K8RA 2ODBA 3AP1A 3GJXC 1KZGB 1KI7A 3IQWA 4U5XA 2P5TB 1KI8A 4US0R 1M8PA 1CJTC 3DZ8A 1II8B 1X86B 1R5BA 2G88A 2CL7X 2G3YA 2GCNA 2JDID 4CYMA 3NC1C 1UDWA 3QF4A 1KAOA 3UKDA 1N25A 2ZJ5A 2RGGA 4XTRA 3MWYW 5M04A 3PEUA 4D26A 2BCGY 1GILA 1SXJD 1NVVQ 1KDPA 2GK6A 3T35A 3AKCA 1TF7A 4RD3A 4BZPA 3EX7C 2BVNA 3GFPA 4PHHA 2FE4A 3CF6R 3K9NA 3SI7A 4D4LA 5TMPA 1Q22A 5HZHA 2V1UA 1RE0A 1OF1A 2WMNB 1QHXA 5EXPA 4GP7A 4ZCMA 4Q18A 1IXRC 1ZIPA 3MG9A 4BLPA 4QGFA 2OFXA 1RRFA 5FUVA 1CTQA 4DEXA 1HYQA 2GXUA 2CLCX 4K8OA 5FUYA 3TK1A 1EFHA 1S1CA 5FI0B 5GADl 3EZ6A 3QNUA 1U98A 1F60A 1M2OB 1T6NA 2QQ0A 1SKQA 2W00A 1IOZA 1HQCA 1ZUNB 2DHRA 2QZ4A 3NBXX 2I4IA 4DLVA 5KTYA 2ASEA 3HR8A 4NCKA 4CEJA 3ZQ6A 2K5UA 4B43A 3QE0A 1YE8A 2VF8A 1J90A 4FINA 4B47A 1IY2A 1XEXB 3KFXA 1AN0A 2IYTA 4TZ0A 1YJ5A 3Q8XB 5DNYB 1VYUA 3K70D 4PZYA 2PMKA 4KLZA 3VX4A 4C30A 621PA 2EFCB 2PEYA 3C14C 4DBLC 5AUQA 2ZXUA 1E1QD 1CBUA 1XEWY 4HSEA 4V03A 1BMFD 2P67A 1G5PA 2OE2A 4C0BA 2GBLA 5J4YA 1G64A 3LX8A 2ZRHA 1UEIA 2LWIA 3L0PA 3GFOA 3ZIAA 2QG6A 1NMZA 3AF3A 3SJAA 2ZI7A 3N5CA 4V0LA 5JECA 1KNQA 3A1VA 3ECCA 3R7WB 4JLAA 1X6VA 4YONB 4YMSA 3K9GA 1YZUA 2REXB 4DWJA 2C96A 2R62A 3LVRE 4M1SA 1AZTA 1XEFA 5CDFE 4IHQA 4OHWA 1BYIA 1SXJB 4FMCF 2B7BA 1G19A 3F8TA 5DI9A 1UBEA 2G1KA 3QF7A 4BFUA 4ZCIA 4Q1DA 4IOKA 2C95A 3AQ4A 1GTVA 5ELXA 4JVSB 2WJHA 2VP2A 2IYXA 1HA3A 1I2DA 3U5ZB 1OXVA 2JIZD 3I8SA 3PUWA 3RLFA 3T5DA 5C4GB 3U7FB 2ONKA 5BQ5A 2ZRAA 1OIWA 1N2CE 2A9KA 2GAOA 4LRWA 4MKGA 5G3YA 2GVDC 3C8UA 5EJEA 1E98A 3KKPA 3FKQA 3MCAA 4DSNA 4IVPA 4GNKA 4Q4LA 3DDCA 3B78A 4ILEA 3WHKA 4OI4A 2ZS8A 2NO1A 3NXSA 4CT4B 1KK1A 4A8JA 2QP4A 4P4TA 3ZD7A 4BFZA 1QF9A 3VFDA 3IDQA 2WIAA 4Q7MB 1TEVA 2CNWA 3TE6A 4LWZA 1ZCAA 3K70B 1E9RA 5JJIA 4CGZA 3E2IA 3CR8A 3EA5A 1G20E 4QHSA 3FMOB 4TYPA 2VL7A 4IXMA 3REFA 4II7A 1EX7A 2EFHB 4BFWA 2IWHA 2GJSA 3MGCA 1S4QA 4E09A 4HUQA 5DE3A 4B48A 2WKPA 4A2PA 2WM9B 3EARA 5JHGB 1NKSA 3L2OB 2ERXA 5E7JA 3CH5A 4NE2A 4XVUA 2ATXA 3HPQA 4GZMA 3A58B 2PCLA 2YZ2A 1W47A 1W0KD 3IKJA 3UATA 3N70A 4N0DA 1C1YA 2GA8A 2ZITA 1DVRA 2RGCA 4MQBA 4TMXA 1DARA 1E2LA 3GJ5A 2WWYA 1LY1A 3AVOA 1YZLA 1H8ED 1E9BA 1BS1A 3U3KA 2G83A 4H1UA 3TUZC 1KIMA 3IGFA 3OAAD 5DI3B 1O3YA 1PLLA 1N5JA 1KI6B 5AJVB 1LW7A 2A7QA 2WHXA 4OI0A 2WAYA 4NYJR 1IXZA 1P4SA 4LV5B 3Q9LA 4IEIA 1JAIA 3AVPA 2NQ2C 4JJZA 4LJ6A 1C4OA 1RRPA 2ERYA 4CZ2A 1XFAA 1Z07A 2AN9A 4PPFA 4XOIA 1ZD9A 3ICQB 4H1VA 3B1VA 1F6BA 1Z06A 5EP2A 1Y63A 3HJNA 3KZ1E 5CYOA 4FWTA 3K0EA 3VMFA 2QE7D 3I8XA 4UNNA 4WZAE 4G5OA 5TY0A 1J70A 4DCSA 1A2KC 3RVBA 4JVLA 4PPGA 3SFZA 3ZQJA 3FB4A 2JJ8A 1OXSC 4K81B 3RRMA 4BFVA 3MLEA 1XTQA 5D3QA 1GP2A 1R0ZA 1ZM9A 1XB2A 2XOKA 1UEJA 3E1SA 3PR1A 1P6XA 1E2KA 521PA 1SVSA 4BE7B 5KDOA 3GQBA 3LO5A 3L82B 3MWLA 4CT5A 5C4MA 3AM1A 1NG1A 4DLRA 1ZM4A 1HT1E 2XNDA 3AVQA 4QGGA 1ZM7A 3ONWA 2OXRA 3ZVLA 4ZIRA 1D2EA 1XX6A 2YC2C 2ODNA 1YKSA 4DZZA 1A7JA 2PZFA 1CJKC 1QHGA 3PUVA 4TL6A 4PSVA 4UNQA 5FI1B 2H16A 5EP1A 2DCUA 1ELOA 1Z0FA 2XX3A 2QN6A 3BB3A 4EIWA 4OBEA 4DB2A 1HQYE 2VSFA 2DFKB 2ORIA 1AJEA 3LY5A 3PVSA 1RRGA 4HZUB 3RABA 2ZS9A 1N5KA 2VRWA 2QAJA 1U8AA 4QNRA 2GILA 3K0SA 4LSGA 2WV9A 1D8TA 1G21E 2IHBA 4TLEA 3RRNA 2QMOA 4B3FX 5IK2A 2O8FA 5EUQB 4HAWA 4BEJA 1WB9A 1XCGB 4BASA 1TMKA 2H57A 1PLJA 2EW1A 2IW3A 3L0IB 4C7OA 1KI9A 2IF0A 4BEBA 3EPHA 1EK0A 2BBOA 1E0KA 1YR7A 2ZRMA 4ESHA 5CM8B 2JJ2D 5B57C 3B60A 5HCIA 4B35A 2HT6A 5DN6D 1D5CA 3JVVA 1ZYUA 1T3HA 1S3GA 3WNDA 1OH6A 3QBTA 3OE7D 3HYRA 1LNZA 4GP6A 4QBHA 4Q9LA 4LBVA 2J1LA 2QUZA 1U90A 5C46F 4YXWD 3DOFA 2JLUA 2XZLA 2W6ID 4JSTA 4KXFB 4XJXA 5EP3A 4MGIR 4YLGA 1XWIA 5BN4A 3X1ZA 3EIEA 1ODFA 2ZYWX 4OJQA 1OH8A 3TW8B 3QXXA 5F3WB 2FSHA 3AVXA 1COWD 4LY6A 5CYPA 1UKEA 2AFIE 2XEXA 3D31A 4F93B 5FOWA 4PAMA 3VHLB 2OCBA 2GJAA 1NL3A 1P9NA 1E2QA 3E5HA 1NIJA 4NL4H 1ZAKA 4DSUA 4ZDWA 1JEDA 3CW2A 4BRWA 1YHNA 2FFHA 2NZJA 3B2EA 1H65A 4EPVA 2IS2A 1HE1C 1G8FA 5FUXA 3P27A 4KFRA 1JB1A 2QQEA 4DKXA 4DB4A 1GDDA 5KNBA 2YWFA 4LK2A 1KSJA 2Q9AA 1DELA 1G3RA 4TMTA 4CDGA 2Q9BA 1HV8A 2XJ4A 3QKRA 2ZU6A 1UBCA 2DWQA 1TU3A 2FZLA 4HLQB 1KO4A 4NYMR 4YDHB 3H2YA 2ZI4A 2KBEA 5KDDA 2IYLD 1T3LA 3WYAA 3ZDQA 3DVLA 4WOPA 2WJIA 3BB1A 5B64A 1OIXA 3GJ8A 4TQAA 3PCRB 5G3ZA 2O0KA 4AD8A 2CDNA 2CJWB 2ZRKA 3RRYA 4PR0A 3M0EA 5HZKA 1WA5A 3GLGB 4AI6A 3U7EB 1HEIA 1TUEA 3ETLA 2GCPA 2WPDA 4KFUA 3CPEA 4LJAA 3ZJYA 5A5GA 1ZD8A 4YMTA 3SBEA 3SN6A 1PUJA 3K1JA 3WMEA 4Q4AB 2WBLC 5FL3A 1MT0A 4UXJA 3EIQA 2DWOA 2DWPA 2FDCA 4KBGA 3WMGA 1ZM3A 4DUGD 3TH5A 3GLIE 4HLUC 2UKDA 4BFTA 4YMUA 4Q9IA 3B6EA 5JLJA 5HTKA 1BH2A 4TYWA 2ZI9A 4KCGA 4XSHA 2V55B 2JEOA 1KDOA 2ZI3A 4PQFA 5C18A 2VLIA 4TT3A 3LBIA 1D2MA 4PFSA 2FSIA 3FTQA 4ZCLA 4MUBA 1IN5A 3JZAA 4A82A 1VMAA 2AK3A 2IF2A 4B2LA 3KQLA 1Z47A 3U60B 3LV8A 3P4XA 2FPKA 2KBFA 3CPJB 1TQDA 4B73A 2A5DA 3BFVA 4UKDA 1CJVC 3SJCA 1U99A 4F4CA 2WTUA 2GETA 1MH1A 1OLOA 2Q9CA 3C15C 2AHOA 3T34A 4M1WA 3BRWD 2CBZA 3U6BA 3AKYA 3RWMB 4W9MC 4BZXA 5CK4A 1L7VC 3UMSA 2ZTSA 2R8RA 4A2QA 2XTNA 2I3BA 4H9GA 2XGJA 2P3SA 4LYFA 4M1MA 1QHIA 2O8EA 4JLPA 1YZNA 2KE5A 1II0A 3LBNA 2A5FA 2J9RA 3BH7A 4Q66C 3ICEA 3VAAA 1LVGA 4KSCA 4Q02A 4Q1FA 2D7DA 5KHOC 1KK2A 3O8CA 1GNQA 4HDCA 1XXHA 1YR8A 3SFVA 4LHXA 1GKIA 1R10A 2KSQA 1CP2A 3K0FA 2WAXA 3EIHA 4B3CA 5SZKB 3AF4A 4L15A 3G5UA 5DIFA 1CS4C 3BFKA 2ZREA 2GCOB 1F2TA 1A82A 4WXPA 2WWHA 2B21A 2F3RA 3QQ5A 4LYHA 1BKDR 1N5LA 4HI0E 3LAWA 4OHZA 3NIBA 1RVDA 3FHTA 3UWOA 4PSKA 3ZZUA 1TEXA 1X8LA 3MWKA 2R65A 3DMNA 3QJYA 4HLDA 2A5YB 3GP8A 2H17A 1E4YA 1XJCA 1FP7A 1Z6AA 5BN5A 4PZLA 2AD1A 4OJKA 3GLFA 3O8BA 2V6JA 2GF9A 1TL7C 2BKUA 1WF3A 3KQHA 3B9PA 1RYFA 3QI2A 4P4SA 5EE9A 4LI0A 3WP0A 1FTNA 4WIAA 3WP1B 2AWOA 4LC0A 2NGRA 2PH1A 3MRSA 3EPLA 5F98A 3IO5A 4IVQA 4OHYA 4AC9A 5FL7A 5EP4A 3LLUA 1KI4A 4QBFA 4UXHA 5H1YA 1AGPA 2RGNA 1MO6A 4DT1B 2ZE7A 2Y8EA 1ANKA 3KXIA 3Q5DA 5DO9A 1LFDB 1OH7A 3O8DA 4UJ5A 1P62B 2IYWA 2QM8A 4QGHA 3T5GA 1E2PA 5CLLA 3AP3A 1EX6A 1SVWA 2QU8A 3JVUA 4WAUA 2HCJB 2Q3MA 3U3RA 5JHHB 4A36A 4UXIA 3SZRA 1CULC 3ZYCA 3EZ2A 2NMVA 2ZRDA 4EJSC 4CVNA 3EW9A 4QXAA 1IN8A 1FUKA 3A4MA 1U0JA 2QAGA 1TF5A 4UJ3A 1U0HC 3CPHA 1JALA 4PTLA 1AM4D 3FHCB 1GKYA 4OI2A 1VG0B 2HJGA 3BGWA 1ZUIA 1ZVQA 3IILA 1CU1A 1EESA 2FWRA 3FE2A 1N0VC 2WWFA 2IHYA 8OHMA 3QG5A 1JR3A 4BZQA 1VTKA 2QORA 1XJQA 2ZJ2A 1F2UB 4DLUA 1YRAA 4BLTA 4RFSA 2OBMA 1WRBA 5G41A 4A6PA 1W7AA 1Q3HA 2ODWA 3EZ9A 1I2MA 2DFTA 2FN4A 4EFMA 3IEVA 3NDPA 3DO6A 1VCOA 2QENA 1SVKA 4BLRA 3WY9A 1DO0A 1N6PA 4MYUA 2GEUA 3EZFA 4EUNA 4KHZA 4LJ8A 2WWWA 2YHSA 4M1TA 4PAQA 4Z8YA 4A1FA 1QG2A 2SHKA 3IHWA 2HYIC 1EGAA 1NN1A 4ZPXA 2BBWA 2V1XA 2QBYA 2WWXA 3JZMA 3QKUA 3ADCA 2O8DB 1G8YA 3D6TB 3N2EA 2IUSA 2WZQA 5SZJA 2DR3A 4PSAA 1QHYA 1FP6A 2GEVA 2XSZA 3LRPA 4Q4HA 3BFXA 4Y0VA 4EPYA 2ZJOA 2UZIR 1D9XA 3SQWA 2Q6TA 2HF9A 3GCGA 1HH4A 1P72A 4AKEA 5HKKA 4ASUA 2I1QA 1MABA 3ZVMA 3WRYC 3TQCA 1E9AA 2HF8A 3KB2A 2H18A 1DPFA 4BRUA 3FGNA 3NDBB 3Q3JB 5FBVB 2AXNA 2ZS7A 1E9CA 3ADKA 4HATA 3RNLA 4DIEA 3GPLA 2F43A 2MSDB 2JLZA 4RZXA 2MMCA 2FEOA 3NC0C 1IQPA 1KSFX 5FBLB 2B92A 2BOVA 4QKQA 1I4LD 3QEOA 2D06A 3KJGA 4C0QC 2OXCA 4V0KA 2ZRIA 2BC9A 3K0AA 2C77A 2JA1A 3GLHE 2WSSA 2XNSA 3RANA 3THOA 1YZGA 3PV0A 1HY3A 4G01B 4MYCA 3BWDD 3TAHA 3T1OA 3A8TA 2E87A 1P2SA 1S3SA 2R6FA 4DEYA 4B71A 1JPJA 3BJIC 2C99A 1NRJB 2GHIA 3G82C 1X3SA 2GZDA 2GZAA 4GOKA 3LD9A 4LHVA 5J40A 1NIPA 4BECA 1OV4A 1Z0DA 4LYJA 3CH4B 3OIYA 3SU8A 1GIAA 2GESA 4LOAA 3S1AB 2NO9A 1WP9A 4IFEA 2RGBA 2VQSA 2GTPA 5GVRA 2ZR9A 1UADA 4FWIB 3OZXA 4I4LA 1A5TA 1XD2A 5JRZA 2GBLC 4W7SA 1Q1BA 2QY9A 4IJMA 4U00A 4GFDA 2ZRGA 3VKGA 5CLQA 4AYTA 3OHMA 1Z8FA 3RDPA 3MWJA 5AJZA 3E70C 1QHSA 3QY0A 3T1TA 4RD6A 4V0NA 5B58C 3QVUA 1KYIA 5TB5A 2D62A 2FGKA 3TMKA 4D81A 3GMTA 4J0QA 3AVTA 2X8AA 4IOJA 4U02A 1P2VA 3BXZA 4PC1A 5GJCA 1E3MA 1TADA 3CRVA 4PC6A 5JFGA 3U44A 5AUPB 3NVAA 2X1VA 2PCJA 3R9WA 2WWIA 3X1YA 4TN1A 1XZQA 5L8VA 5AJXA 3NEYA 2CL6X 3B13B 4FIDA 3U3OA 1AK2A 1U9IA 2XNDD 3H0KA 3KX2A 2YWGA 5EQTA 3SE0A 1KK3A 4DLTA 1LTQA 1VG8A 1OPXA 2ZEJA 1T0JB 4S35A 2ZSFA 1VPLA 2GXAA 2IC5A 1GL9B 4O2LA 4RD0A 3RSOA 4LV8B 4JBXA 4PANA 3RS7A 1NMYA 5FPKA 1S96A 4DDWA 4TZ6A 2OLKA 2F3TA 2V8OA 3THWA 2AXPA 4I1SA 4X8LA 2BMFA 5L3QA 2P6NA 1NBMA 3GEIA 2QT0A 1KI2A 1XD9A 3QIAA 4A8JC 5KPJA 2O8BB 3ZZ0A 2YWHA 4IKEA 4TMKA 3K9LA 1MO3A 4G5RA 5FR1A 4PHGA 2OEPA 5H8WA 3F0TA 3HDTA 5JZVA 5EE1A 4Q9JA 3FOZA 5SZIA 3RWOA 1PZNA 3B85A 2ZE5A 4R7ZA 2Z83A 1ZBDA 4JMPA 2OUKA 4M53A 4NDZA 4QHTA 3K53A 3SDZA 4MRPA 5FTJA 1YZQA 4ZKEA 1W0JD 2D74A 2YWEA 4Q00A 3V4RA 4AY2A 2ECKA 2F1RA 3KJEA 3M1IA 3MMPA 2RB4A 5P21A 4B33A 1E79A 1QDEA 5FTLA 1GAJA 4HUTA 2C8VA 4TLCA 1OXUA 5H68A 1KO1A 1ZW6A 3PQCA 5L3SB 1F3OA 2IXEA 1B0UA 4TWZA 4DC9A 1Q1QA 2ZJYA 3C4JA 1QZXA 1SVOA 5DHFA 2QMHA 1MRNA 3T61A 2RGXA 2YOFA 4OKSA 2VO1A 2A3RA 1W49A 2BJVA 4PO1A 4Z1MD 4E07A 4MUAA 4GPTA 3EG5A 2WICA 3TVTA 4PHFA 2QP9X 2JLVA 3W6NA 3HWSA 4RJLA 4Q1EA 3SYLA 1N3BA 4CEHA 3C7KA 3ASYA 2IK8A 4NZYA 4XWKA 1LS6A 1N0WA 1G4UR 2GF0A 4R9UC 3TIFA 1YZKA 1VIYA 2BBTA 3SJBA 2JCSA 1SKYE 3IBYA 4M22A 1FQKA 5EE5B 3GLIB 2HYDA 2A5GA 5FOSA 3VR5A 2B7CA 2BMJA 1FL9A 3VQTA 5BWMA 1JXOA 1XDBA 1FW6A 4MGKR 4AKHA 2J7PA 2KJQA 4LUCA 5FTNA 1E2DA 4MGYR 4BFSA 5FTMA 4GMDA 2XXAB 1AS0A 2QTHA 2XB2A 2VSXA 1E2EA 1E2JA 4XIGS 1NVXQ 1GKUB 1YVDA 3C16C 3WRXC 3C5HA 4GOXA 3LBHA 4MRSA 2ZPTX 4GRAA 2QMEA 4A2WA 2G9NA 1E1RA 1WCV1 2E1RA 2HEIA 4URZR 2FGJA 2YKGA 1GZSA 4MRRA 1Q3TA 2WPDD 3KXLA 3OESA 3BC1A 4MDEA 1G7TA 1DOAA 1RKBA 2H1LA 1CIPA 2WJVA 3PEVA 2O0JA 4P33A 6Q21A 2QM7A 4UNPA 1KDRA 2REOA 4GMXA 3U3MA 3Q85A 3CKLA 1G7CA 1RJ9B 1X8KA 2CK3D 4GSYA 1D9ZA 3LQQA 1KO8A 2AR7A 1GRRA 1VG9B 2GWHA 3SYNA 2VHQA 4P3YA 2QMUA 5SZHB 3U61B 4QJ5A 5FFMA 4FMCB 2MMGA 1GL7A 4ZV4A 1E99A 2FMXA 2P65A 4ERNA 4ARZB 4RSGA 4MYHA 1CJMA 4TT3D 1UJ2A 5DGXA 5AUNB 1P9RA 1US8A 5JI2E 4PZZA 1N6KA 5LD2B 4G5GA 1GWNA 2X2EA 3R20A 2ZRNA 4OQLA 4CEIB 1UPTA 1XEXA 4OK5A 4ESVA 4V02A 2CXXA 4UQOA 2EFDB 4TL7A 4Z54A 3KDSE 2O8CB 2PZGA 2G0TA 3FYHA 4GOJA 4BFYA 3THYB 4FMDF 1Z08A 3F5FA 3QKRB 3CONA 4RKFA 2J0SA 4O2RA 3H86A 4NMMA 1AKYA 4I1VA 3VKWA 2WOOA 2PEZA 3U4QB 2Q21A 4DDUA 1I4DD 1EFRA 3HU2A 4TYNA 2ATVA 3I72A 2Q0HA 5TXGA 1RZ3A 3ZD6A 4WZ6A 3R7WA 3TR5A 1DBSA 1ZINA 4M9QA 3X1WA 1OB5A 1P75A 4WVFA 3A4LA 1ZMXA 4LPKA 3SNHA 4V0MA 4HAYA 4JVNA 1SXJA 1EG7A 4LJ7A 1MR3F 5LD2C 1WQ1R 4IEEA 3LQRA 2FNAA 3GJ6A 4LJ5A 2LKCA 2VP6A 4F7WA 1FOEB 2F6RA 5E95A 2FOLA 4Q7JB 1SHZA 1VECA 4NHOA 1VDZA 1VKJA 2DY1A 1Z0JA 2QEQA 1CEEA 4RVCA 1ZNZA 3LLMA 2JJ1A 3CZPA 1WE2A 3BAFA 2FH5B 2IYVA 3B8HA 3CRMA 3QSYA 1P2TA 2JLRA 3THXA 1NSTA 1JPNA 2J41A 4O25A 4CF7A 5IDVA 1OXXK 4BLOA 1GL6A 3CNOA 1H8HA 4KVAA 2IT1A 4AYWA 5GJBA 3CO5A 4C0HA 2ZRFA 3ZLJA 3SBDA 4L16A 4MA4A 2PLFA 3KQNA 1NVWQ 3KJHA 1U94A 1KAGA 2P0EA 3GJ4A 4QOSA 2GNOA 2XB4A 4Q19A 4A0GA 2H7VA 2ORVA 4C4PA 4B75A 4FCWA 2W58A 4XWAA 4TLAA 1Q12A 2VH5R 2CLDX 1SQ5A 5HCNA 1M7HA 3TSWA 1S0UA 2CL0X 2OM2A 5E3HA 5DYGA 1BMFA 2E9SA 1AZSC 1W5SA 1BIFA 2EU8A 3CX8A 4JT2A 2H5EA 4E03A 2GJ9A 2BCJQ 2KB0A 3MSXA 4BUJA 1G3UA 1OYWA 1XCMA 5KU1A 1XPOA 1JEEA 3VU9B 4M9XA 1E2HA 4XVRA 2CE2X 3KXKA 2ANCA 1Q0UA 1Z83A 1QHHB 1W5TA 3CRQA 2Z43A 1E2NA 1BO6A 2V6IA 3EC2A 3KKQA 5BW8A 2BMEA 4BGDA 1RPZA 4TSFA 4D0GA 3M4YA 4DIDA 4A9AA 2CVFA 1CJUC 4R71A 3UPUA 4JYBA 2ZAOA 4M8NE 1RFLA 4Q47A 4Q9HA 1GOTA 4WXRA 3T12A 5AJYA 2VSOA 1F2TB 1KO5A 2CCGA 4TL8A 5DI3A 3TBKA 3FMPB 1BYUA 4BLSA 1KI6A 3L43A 4FN5A 4OHXA 2F9MA 4IDOA 4D4KA 5EE3A 1PJRA 1OHHD 3AP2A 4JSYA 4RZ2A 2ZE8A 2EQBA 3BBPA 4JIMA 4KAXA 4GDFA 3VNUA 1ESNA 2NG1A 4FMBB 4TQ9A 3ZGXA 4WW0A 4ABYA 4C0AC 2AK2A 2JGNA 4EFNA 2F55A 3AGQA 4NYJQ 4M21A 1FFHA 3OEEA 3H84A 2VHTA 2NZ8A 3SR0A 4G1UC 4B32A 4RFVA 4PX9A 4Q21A 2C9OA 3IPYA 2FA9A 4D6PA 1XMIA 3EPKA 4ZKDA 2RMKA 4DSTA 1L2TA 3ZS8A 2OSBA 2AD5A 3GLHB 1AGRA 5FBQB 2MSCB 3FKSD 3DEFA 4NYIR 2XSZD 1IN4A 1KMHA 1N6LA 5IHPA 1G5RA 2GK7A 4Q4JB 4IDNA 4MKFA 1E4VA 1G16A 2QSZA 4LGMA 2ZJBA 2ZM5A 2WKRA 4F4IA 3GJ3A 4AKIA 4M2LA 1UFQA 1XTKA 221PA 3I4LA 2J0UB 3HR7A 3CWZA 4NKRA 1YR9A 5JSZB 3VR1A 4EQ6B 1ZCBA 3UMRA 4PXAA 1R0YA 2R6CA 2GJ8A 4HAZA 2Q3HA 3C41J 2J59A 1KI1A 1W0KA 1XRJA 4B6EA 4F92B 2NO0A 1UM8A 2HT1A 2W2TA 2ZSDA 2YOHA 2A78A 3HP1A 4TTQA 4V0OA 3BD9A 3CB4A 1FX0B 1DAMA 2FX3A 3K0CA 1G9XA 2JLXA 3SHWA 1FMLA 3O8RA 4HZUA 1W4RA 1NY5A 1E96A 4LJ4A 1W4CA 3I5XA 4JL6A 4L5BA 1IHUA 4A0FA 1ZRHA 2WSSD 3IEUA 5J4HA 2F1IA 1OXTA 2D2FA 4JL5A 5G40A 2DFNA 1IY0A 2A30A 3R8CA 3VNVA 3FMFA 3ZZTA 1TU4A 3LFUA 3T1QA 1Q44A 4MYTA 2RGNC 3QXHA 1R6BX 1DADA 1EXMA 1OFHA 2JASA 1G3MA 4MH0R 1Z5ZA 2F1JA 1JJ7A 4PPNA 1IONA 1G5TA 2JLYA 1C9KA 4URVR 3TW4A 3AKDA 4B3DA 1FNMA 4RZUA 4JLMA 1W2GA 2DPXA 2N46A 4ZDKA 2XAUA 4LX0A 4ITRC 2GXQA 2KI5A 3MUFA 4C9BA 2QBYB 3EA0A 3VR6A 2QE7A 2Z4RA 3C5CA 4B44A 1R8QA 2P2LA 4QG7A 4DLYA 2QAGC 2QSYA 5EXSA 3NBYC 2C98A 3FMIA 3T15A 2BJWA 2OILA 3KTAB 2OO7A 1T0HB 2PX3A 4C0LA 5HPYB 1XMSA 2W6JA 4X8MA 1Z6GA 1J2JA 3TSOA 4EJSB 1G3IA 1KNXA 3KUCA 3V4FA 2QI9C 3FWYA 4D0LB 2ZETA 3KL4A 4DVGA 1RYHA 3I62A 2ZUDA 2AKAB 4KJZA 3AF1A 3QKSB 1ETUA 1DS6A 1V43A 1P60A 4KFSA 1U8ZA 2HXYA 4DRZA 1WXQA 3AF2A 4G0NA 2PJZA 3PXGA 4CIDA 4HDQB 1OKKA 4JLBA 2HCBA 3ND9A 2F43B 2IYUA 2DB3A 4CW7A 2RGEA 1VYTA 4S2EA 4M9SA 2VP9A 3QEJA 3O47A 4QFMA 4PHTA 2IYYA 1YR6A 1DEKA 1IJEA 1FZQA 2HXSA 4IOMA 3T06B 4JZKA 1NSFA 5HE8A 5CB6A 1Z3IX 1NBMD 1R5NA 1KZ7B 1OJLA 2X2FA 4NYMQ 3D7MA 2HUPA 1QG4A 2YYZA 4MKIA 3GLGA 1E6CA 2HLDA 2OAP1 2PT5A 5J4LA 4IOLA 1FTSA 3LNCA 2JJ2A 1P2UA 4W5WA 5D3MB 3IIKA 1XJ0A 2RAPA 3U7GA 5DN6A 4LBWA 3CBQA 3GD7A 4ZI2A 4IVRA 2ONJA 4Q4AA 3ZIAD 2ZROA 1NVVR 2J7KA 5E4FA 4D4MA 4WBSA 1X1SA 3TR0A 2CCKA 4Q1AA 1XD2B 2XITA 4JLJA 5AR1A 1SKYB 1NF3A 3QF4B 2FFAA 2WKQA 2RKOA 4QHYA 1E2FA 4IW3B 3ZVRA 3AUYA 3AGPA 3RS3A 2G6BA 3RC8A 3A1UA 3X1XA 1COWA 2BKEA 1J99A 3W3AA 1NY6A 3PITA 3CLVA 1DAIA 3AVUA 2YJTD 5FOTA 4AURA 1FMJA 5G53C 4YDSA 1TQ4A 4R2HA 5KSOA 2G0NA 4Q1BA 3A4NA 2JATA 4PO8A 5UKDA 1EWQA 3WYFA 2IS4A 3ADDA 2OAQ1 1M7GA 1MRSA 2FU5C 3KFVA 3R9XA 3BOSA 1IM2A 2G1JA 4M4SA 5EZ6B 5TV2A 5JEDA 5J5CA 2OG2A 2ZJAA 4Z51A 1XXHE 1M6NA 2UVQA 1L4UA 1UF9A 2IEYA 1SZPA 1E9FA 4F38A 4OK6A 3PUYA 2IWRA 3REGA 2ZAMA 5B2ZA 4CEJB 1YZTA 1PUIA 4HZIA 2J5XA 3TKLA 3W6PA 2J46A 3THWB 2J7PD 2CNWD 1W1WA 5L3QB 3TLXA 3IUYA 4PAOA 5LBIA 1P3JA 3W9YA 4B2IA 1N6NA 1JNYA 1VIAA 2ZUCA 2G77B 4YC7A 3CR7A 1NLZA 5CJPA 3GJ7A 3NKVA 2C2HA 3EWAA 3SC3A 4KYIB 2BIFA 3HPRA 3ZVNA 5DSZA 4DCUA 5GVSA 1S2MA 3K09A 4M0LA 5EXTA 4NH0A 2GCOA 4KLNA 5B30A 1L8QA 2CHQA 2EWVA 1FUUA 1M34E 3MD0A 3GLFE 1JR6A 4JLDA 1G6OA 2R6AA 3VR3A 4DUGA 4M1YA 1E2GA 4A92A 4JBWA 1DAGA 1XBTA 1J8MF 3RS0A 3AEZA 1U9IC 1ZNYA 4XTCS 4JJKA 1G6HA 3CF0A 2QTFA 1NKTA 4I81A 2V7QA 3TQFA 1N6IA 4C3ZA 4EDHA 2B8WA 1XPRA 1G4AE 3AV0B 5L3RA 1CR4A 2IYZA 5LPNA 3QG1A 4IRUB 2CE7A 2ZI5A 4OK3A 2REBA 4XD7A 3B82A 2PMDA 2JLQA 3CX7A 1TTTA 2BM1A 4NONA 2BM0A 2VP4A 5E7MA 2WMOB 2BV3A 4PPQA 3ZS9A 4XSGA 1RC8A 2ZSEA 5FR2A 3L0OA 3Q5EA 4TMZA 4CEHB 2FV8A 2L0XA 4DT1A 2AL7A 3H4MA 5JMTA 4NCJA 1II9A 2N42A 4M1OA 2NO6A 1EFTA 1OIVA 5FPTA 4URXR 4OQXA 3I5YA 3PEYA 2QROA 4HLCA 4A8JB 1UKVY 4HB4A 3DKVA 4KI0A 4Y0AA 4AK9A 5F9FA 4P4UA 1UDXA 4QC2A 2FPLA 5FH9A 4JLVA 4D2IA 2ZRJA 2FG5A 3TVDA 1N6OA 5LDDC 4O3MA 2W0MA 1JR3E 1IN7A 3CZQA 1EFRD 2ZR7A 2HJVA 3G0HA 3LH5A 3T1VA 4NCIA 3I73A 3U7HB 2XOKD 2IL1A 4HUQB 2GXSA 3PIRA 4ON9A 5EZ5A 1DO2A 1SVLA 3IHLA 3L8ZA 3RS4A 3P26A 4OHVA 2XZOA 1WBBA 3LXRA 4XWOA 1DAHA 1ZP6A 5FOVA 1KJWA 2OT3B 4D80A 2V3CC 1W4AA 4W5HA 1OB2A 2PJRA 3NH6A 4P32A 2YVUA 1OFUX 4RCZA 5LB2A 3TUIC 4AIIA 3WBJA 2ZYUX 1SGWA 1F2UA 4DLZA 2A5JA 1MO5A 4M9ZA 2J0QA 5J4VA 4NU0A 2VBCA 1I4TD 4RY2A 4W5JA 1W4BA 1Z0AA 2QGZA 2JJ1D 4LBZA 1XTIA 5JWHA 5JEEA 1ZU5A 4ZDIA 5KUTA 1OFIA 2GKSA 4BQSA 5EXXA 4DCTA 3I32A 1Q1EA 5IK2D 1H8HD 2ANBA 4JLKA 1EWRA 1Y3AA 4C2UA 2OESA 1US8B 3LWNA 3OEHA 3P1JA 4LJ9A 4DLSA 2O8DA 5CM9C 3OIVA 2VHUA 5CIQA 3DMDA 2GEDA 2RHDA 3DM9B 2NPFA 5JI3E 3GFTA 1HURA 3MJRA 1NP6A 3A1TA 1KK0A 4A0RA 4QM6A 5AJWA 2P5SA 5AWFC 3WMFA 3W90A 2R44A 3SS8A 1WDTA 2FZ4A 4L8GA 4BFXA 4TL9A 1G7SA 1AQYA 5C1BA 2BEKA 1PVOA 4JLNA 3WXMA 1GNRA 2ZSBA 2VEDA 3A36A 4PQRA 4AKGA 3W3ZB 4PC7A 4DDVA 1P61B 3EWSA 3RRZA
chains in the Genus database with same CATH superfamily
4XPZA 5DVZA 1MPXA 4C0SA 5KOYA 3CNNA 2WJGA 3EAQA 3OETA 4A8TA 2N3ZA 1Z6XA 4FBGA 4HB3A 4LZNA 4PC2A 2PX6A 4QUIA 2ZSUA 1RIFA 2G07A 2GAIA 6ABPA 3K2BA 2O05A 4HWGA 4HY3A 3AEKA 1XRPA 2PDAA 3RTBA 1E2IA 3K05A 4FDAA 2C9YA 2H2WA 4MS4B 4J2TA 1CDEA 1FDVA 1QRDA 2C3YA 2Y9MB 1CRPA 2Q7OE 3QXCA 3D4BA 3ACBA 3Q8LA 3H0EA 1JFRA 1I7QB 3SC6A 1V11B 3H16A 3H99A 3OUTA 2O1SA 2FMIA 4OVKA 4ZHQB 3FJOA 2OL4A 2DFLA 4F6RB 4YECA 3I37X 5KVSA 5K1ZA 2OC9A 1RYEA 2ZVPX 3K8OE 1OX4B 4US1R 1E94E 1N5RA 2BI4A 4PVDA 1DG3A 1NVEA 3OD1A 4EFLA 2HU2A 2VIIA 3O3MB 3A1SA 1DZ3A 1KVRA 2QUHA 3S1AA 3VR0A 3EXEB 4JP3A 3KEFA 1IUOA 1VLHA 4L7QA 2H0QA 3RH0A 1ORWA 1V1RB 3RG2A 1IZ0A 3UV6A 4HRVA 2FWBA 2ZYTX 3LYUA 1U0RA 4RCYA 1V8OA 3MINA 2VHYA 3FFAA 3PQDA 2COKA 3GYBA 4TWJA 4HEJA 3NT2A 2QRGA 3UPDA 5C53B 4S1TA 4US2R 3P9XA 4GP9A 3EZLA 4ZJZA 1AKEA 1P9OA 2QDXA 1XMJA 4P3XA 4Q4CA 1CT9A 4YFYA 4DG5A 2WV7A 3WFJA 4MCIA 2C03A 1P73A 3QPUA 5CRIA 2NP7A 2OFOA 3I01A 1JJVA 3UUGA 3RUHA 5JCPA 4BQNA 5CLJA 3DCIA 4FDVA 4H6VA 3R3JA 3VDMA 3H9JA 2VPXA 4U2GA 4URUR 4EUFA 2D2VA 1NLFA 4AXBA 4PZUA 4JX9A 3LE8A 4F6LA 4ZCQA 3GMDA 4M89A 3CNLA 4GDMA 3S2UA 1YHYA 3W4JA 1RADA 1PR3A 2OOSA 2P91A 3TNFA 5A4IS 2OBBA 4K9OA 4KE6A 4KU4A 2DPMA 1W0CA 3N5KA 1VIMA 2BFOA 4KYVA 2ZYHA 3AZPA 4BU0A 4PG4A 2QVBA 2ZBUA 3G59A 2BZ0A 4BEVA 1A71A 4BWYA 4XRRA 1M2OA 1V8ZA 4MA5A 1VOTA 3JAWB 3UUEA 3PNSA 3ESAA 3HUFA 4P22A 1V6CA 1BXGA 2QRUA 3K1TA 4HOYA 1QS0B 3U40A 4QM7A 4EBBA 1GKLA 1ORDA 4FCTA 4O6VA 2YRXA 1DQNA 3VR4A 421PA 2M6RA 2BL4A 3G17A 4RZ3A 4REQA 1WXXA 3MBOA 5FNVB 2BF4A 3ULKA 3NCHA 4P31A 5IUKC 4BKPA 4DCPA 3T7JA 1CUAA 3CX6A 5LWQA 1W6RA 1V5IA 2EP5A 3L7LA 4WERA 5JO0A 1KJNA 1R50A 3Q3VA 1KKMA 2X6TA 5F5LA 2NZYA 3UAZA 2WVGA 2CVZA 1Y6JA 3BSFA 2ORED 4XJVA 1RWQA 4BO1A 1TMYA 1WDLA 2QVYX 3RROA 3ZH9B 4FD2A 1C9MA 1LS1A 2Q5LA 4HB0A 4LW8A 2YS7A 4JR0A 3LW7A 3ZIDA 1PFKA 3H5NA 3OM9A 2W37A 3CPSA 2ZR0A 1M74A 1MV5A 1H85A 3SQOA 2BISA 2MWMA 5B1DA 1J0DA 1XV5A 4FCVA 3D02A 1JQLB 2AEJA 3T54A 2NT3A 4NTZA 4DS3A 5IBCA 4YASA 4R5HA 1SIOA 2JDIA 4WY2A 4CUZA 1T2EA 2TMKA 3CMCO 2AMJA 4F3KA 5LR6A 1KTIA 4NCBA 2XJ9A 1ZH6A 2HXGA 1E59A 2O2IA 4LMBA 4DFDA 2WIBA 1GL3A 1VCMA 2C5LA 2EF0A 2NPIA 2RGDA 2BHNA 3CG0A 1LC3A 3OQIA 5BSUA 4LZAA 4CU2A 4ZDJA 5IT4A 2O0HA 2JCVA 3OZWA 3JYNA 5K3DA 5JPDA 1ONBA 3UT5B 1WBDA 5BV1A 1OGIA 1FQJA 1Y1KE 3BDAA 2J87A 3OIGA 3TJMA 3NHRA 1A2OA 3AEXA 4B6PA 2LPMA 4BL5A 5L3SA 4HDNA 4CLOB 2QPOA 2Q8NA 1CYEA 3FDXA 5JSKA 2EQ5A 3O3NB 2GN4A 3RAFC 1A1VA 4N3NA 4IQGA 1K8ZB 3S1SA 1W59A 3WGIA 2JI9A 1DG1G 2WJJA 4RTPA 2GAJA 3ZLVA 3PDWA 5C5IA 1I0LA 1NYTA 1UKZA 3QWFA 4PGMA 1NG9A 3UW1A 1KO7A 3KD3A 2FK7A 1T9CA 5D01A 4RLSA 1TT5A 2TYSB 4XQ9A 4E1AA 1XPUA 2NOAA 3DZCA 4LRXA 1UXJA 4N7MA 1EINA 2X4IA 3JZIA 3R5HA 1TJNA 4HPXB 1ILWA 4AN1A 1YO6A 1BOFA 1RWNA 1MRZA 3IHTA 3ASUA 5IN5A 5ICEA 3OZVA 1NF8A 4MZDA 2EDCA 1H3EA 1ZMBA 3GLVA 1DKPA 3QPWA 4Y2JA 2L82A 2X0KA 4HAUA 2B8EA 3PHBE 1M8JA 3B5JA 2FRDC 3FPCA 3JATA 3I1FA 5B7NA 5BYJA 3KQUA 2CLIB 1OJ7A 2JFWA 1E1QA 2XOXA 1ECBA 3CUEF 3IP3A 4PQYA 1AS2A 1CR0A 3W5JA 2G4CA 4FI3C 3OJFA 1F17A 3DUFB 4N48A 3CLTC 1UJCA 4ZMBA 3TZLA 2FPXA 4DA4A 4FZ3A 4PN7A 5A0TA 1JKFA 3IULA 4EG0A 2O59A 1KKLA 1W73A 1RAHA 3A9WA 5JVDB 2G17A 3S29A 3UPTA 2FN9A 1JPVA 1Z26A 5TJ9A 1E7RA 1X14A 2QLTA 5HF8A 5LQRA 1P17A 2XZPA 3CHYA 2GM3A 3DHWC 1K27A 2ZYIA 3S7ZA 3VX3A 1UBGA 3IE0A 3D8BA 3LT2A 4WA8A 3ZD8A 4ADSG 1NJ6A 4K0RA 3WBBA 1B1AA 4IZIA 3ZCVA 1SOMA 2H1WA 2WYUA 3LW8A 4GPAA 2M6KA 3UMFA 3HCDA 5BWOA 3B1ZA 1QGUB 1G8PA 1FW8A 2PRIA 3USES 1ZVJA 5TR9A 1FZTA 3EVNA 2PKYX 3QKTA 2M98A 3QLVC 3UK0A 2H1SA 5CDTA 1G1MA 2XECA 4IUBS 3D7LA 5KSYA 3K0CC 4ARZA 1P80A 1V8DA 1SFRA 9ABPA 2NVBA 4D45A 2FEKA 2ZIWB 1JB9A 2XUQA 4ZK6A 2GJ4A 3Q7QA 3SQNA 3W3AD 4AKTA 4LWQA 1SOAA 2O2EA 1Z75A 5AICA 2XODA 2FSFA 4Z1MA 3KO8A 2E89A 2IZ5A 1S1MA 1Z34A 3MQ4A 3B9BA 3EUWA 3B1XA 1UBKS 4WCFB 5K0BA 2XTMA 1U0EA 2GFIA 4B34A 3OE5A 4EELA 16PKA 1T1GA 2ZBEA 1IHDA 1E1KA 3K6RA 1B14A 3OLCX 5BN5B 2ZRBA 1DBIA 2YRFA 3T4UA 4ARCA 3U3JA 3GLFB 1XJWA 2O8CA 2OECA 4XIIA 1RXEA 4Q1CA 3THYA 4L0CA 3V55A 4A15A 5C8XA 2FLWA 2V74B 4J4HA 5HQ3A 4LE2A 4ND8A 4QUDA 3UMMA 4OL0A 1NAIA 4UU7A 2A2ZA 1KJJA 2I6UA 1SU8A 3BF7A 5DTJA 1DKQA 1UBSB 2A3NA 3VR5H 2OBYA 1GFIA 3QA9A 2GAAA 3FPKA 4MR8A 4W8HA 1QQ6A 4BYGA 4G0PA 3U4QA 3D6MA 3DZBA 2GD2A 4XVHA 1R0RE 1KTVA 4FBLA 2Z57A 4KXYA 1Y3IA 3GRCA 2YXEA 3MJSA 3QYJA 4HWOA 1T9HA 3J81k 1MIHA 4NNPA 1E60A 3T3HA 5HJ5A 4BPBA 4E11A 3HR4A 3P4YA 3PUZA 4Q5IA 1DC6A 2GCEA 4I50A 4E5KA 3DZFA 4N82A 4EHIA 3IV7A 3LZDA 4ZXFA 3WTBA 1I24A 3MYRA 2P41A 2R7AA 3OZBA 2CZQA 2GRUA 2Q62A 4X6LA 1JBQA 1VG1A 4C0KA 5A4KA 3BQNB 3RRFA 1X8JA 4HGOA 3S2YA 3QRWA 3GEHA 4KGZA 5JS8A 1S8AA 2XVMA 2G1UA 5DLDA 4A6XA 3OIDA 2EW2A 5THQA 1Q7BA 3LUGA 2Z1NA 3QOYA 5DLYA 3R9IA 2DSNA 2CV2A 4LXQA 3D1LA 3VSBA 1D4FA 2R7KA 2ZBGA 2ZT7A 1Z0KA 2DF8A 3HWRA 4PXYA 1RHRA 4U6SA 3RK1A 3UCXA 1Z62A 4RFLA 1LSOA 2ZKIA 3T6KA 4CEIA 1VYVA 4LXUA 3T95A 2J6CA 1X0VA 2MSEB 3B1KA 3TIVA 3NDRA 4NH4A 2IXAA 2LZ0A 3I05A 5JH7F 4ZALA 5IYZA 4RTMA 1XDZA 4TZKA 5JFOA 1THGA 2GN8A 2V0CA 4MV6A 3ZGOA 4YJ3A 3RBXA 2O0MA 9LDTA 5GY7A 1S8FA 1T8TA 2ROQA 2ZP1A 3EC7A 3I42A 4XD7D 5A4MS 2W2PA 3VBEA 2GZ1A 3I9V1 4JWKA 1CVLA 121PA 4MI9A 4N3CA 4PRYA 4G37A 2PE5A 3E6AA 1H23A 1E0JA 1A2QA 3STWA 2NV6A 1U5BA 1WKVA 2ZAGA 3CZ5A 5TMEA 3D0RA 1O5OA 5EWMB 3A37A 1QU3A 3L9WA 4BMOB 1MAWA 2EEPA 2R6ZA 4O0MA 5HKOA 1UIRA 4LCBA 2W9XA 2W98A 1EQ2A 4MQ5A 1CKEA 4EPTA 4YRSA 4QJ4A 1KVUA 4F91B 4KR7A 1SC4A 4JD5A 1KIFA 4UASA 3W1WA 3EYAA 4F21A 1BN7A 1Z6YA 2DBYA 2MDTA 3GOQA 4XUDA 4Y3UA 3CE9A 2FPRA 2WP8J 1XC7A 2PZBA 1DAFA 3M83A 4RK4A 2ATCA 3LY9A 1VJ5A 5L3ZA 4CG1A 5C8VA 2X3YA 4L73A 1CFZA 2HSWA 3GQVA 4J3FA 3VU9A 2WKWA 1J20A 1WM1A 4MYRA 1XHEA 5BN3A 1JSZA 1ZA1A 2BLNA 1RSZA 1QFYA 2HZBA 3HKDA 4OYRA 3ZNNA 5JSHA 4Z8XA 4FUQA 1RM5A 1EUQA 1Z4LA 3CVVA 4EGQA 3ELWA 3D4LA 2XWPA 3OFVA 3PYLA 4KK4A 1SNYA 4P0TA 4AQ7A 5H16A 1E4EB 4WNAA 3TLZA 3USCS 3X2EA 4IZOA 1X8XA 1ZJ6A 2OCPA 5EQJB 4ZTBA 2ZUBA 2PWAA 5J63A 4R2IA 3OLVA 4UC0A 2VH2A 2BBSA 1Z82A 2OZEA 4X6UA 1CHDA 1CZKA 2XKBA 4FP9A 4QUBA 1W36D 2XQFA 1CUYA 2BAGA 1ZX1A 3IAM6 3WWZA 1GQOA 2JW5A 1W1UA 2DUNA 3M4ZA 5IJ9A 2R8XA 4N1AA 3QHPA 1EWVA 4MUKA 4JGGA 2FR8A 3GVPA 4V24A 2P6UA 3C1AA 2CKMA 3HBNA 3O4JA 4IDHA 3UMGA 2I22A 3U4MA 4TOIA 1IXKA 1DQPA 4QD3A 1HBJA 1Z22A 3FCYA 2VUHB 3GHHA 2V54A 3TLMA 1JAYA 1V16A 2IKSA 1N5IA 3ESBA 1KFCB 4JJFA 4A3SA 3WWEA 1JIJA 1NV8A 1PJ2A 2NZXA 3A6HA 3DEHA 3OTQA 2OQVA 3ZKAA 4RQTA 2CJWA 4LYDA 4Y18A 3WWPA 4AJ4A 2CEAA 2ZIXB 5F9HA 4X8OA 1AMNA 1V7PC 2ZQ5A 4B6FA 3STVA 1AHNA 3FWNA 4B3TB 3HYTA 4OO3A 4L9RA 4FX5A 2PBFA 3E3MA 2C1ZA 3DWFA 2P2YA 1N3IA 3U26A 1FFDA 4LOHA 1C7JA 3E8SA 4BO3A 5KWJA 2M6LA 5BOVA 4PRLA 4GBED 2IS1A 3F3YA 2I6QA 2PLRA 3H4TA 3OE7A 1TAGA 2C4KA 4DQVA 3G5TA 2JGEA 4KO4S 4TTRA 1KSHA 1DI0A 1OWLA 2QHXA 2AF3C 3A6KA 1E20A 4LDAA 4V38A 4WLUA 3TOCA 3NYIA 4WEOA 4BQRA 5TX7A 3VAZA 5J47A 1MC1A 2ONYA 2PUWA 4EQ6A 3AV3A 4M7OA 1U2RA 5KINB 1UBNA 2DVMA 4NRDA 3L0SA 4BDTA 2K4MA 2I99A 1IDN1 4F45A 4Q39A 5CAEB 4MDYA 5IVIA 4TWBA 3H7IA 1SBTA 1W19A 4U9UA 3R5JA 4K86A 2GJKA 2JAUA 3PNYA 3KLOA 1FX0A 2AXEA 4J0DA 5CB8A 2H92A 1VPWA 3HJHA 3BG5A 1L9XA 4M37A 4QRHA 1Y4ZA 4ALJA 1G18A 3F9CA 1BCRA 2C8JA 3GAAA 4LHSA 3SJZA 4IIEA 4B74A 1PLKA 1V3UA 4WLVA 3WV5A 1U0TA 1LLFA 2WYHA 4XB6B 1W44A 4J7AA 4CIVA 3WNCA 3UG6A 1ULSA 1PZHA 3BHMA 3IJPA 3E8XA 3KHKA 3LC1O 4JVMA 4NDNE 1W46A 4BNDA 4BMZA 4CKXA 1W36B 2OLEA 3F2IA 3F3MA 3U39A 1P74A 2VTKA 5AVOA 1OSNA 1ZFNA 4E5UA 2FWMX 4B79A 1OW3B 1ONSA 2VKQA 4CM4A 1E5DA 2NTEA 4EB3A 5DW3A 5EMKA 3A04A 4F56A 3VR5D 1ORRA 1QZTA 4P9NA 4EB8A 3OIWA 3VHXA 1E0SA 2ZG6A 3ET4A 3RK0A 3COVA 4JSRA 3FUUA 3BXGA 5D85A 1EWTA 3AESA 2Q3EA 2UUCB 5EIBC 4IXNA 2GASA 4NHEA 5E9QA 2A1UA 4C4TA 1GAWA 1XTSA 3D3EA 1SBNE 4F3YA 5JJKA 4QDZA 4EG8A 3CM0A 3ND7A 4EL0A 1OLXB 3FIJA 1IXSB 2AUTA 3L1IA 4GECA 4X1YB 2DQSA 4IEFB 1E1RD 1L8XA 1J8DA 1UK6A 3GGCA 5KAPA 3S4YA 1I7DA 1RM4A 3C3WA 4NV0A 5L7TA 2VF7A 2IVFA 1C7RA 3MHPA 3TPCA 2BDTA 5GM1A 1E1MA 3OFND 3ZR4B 2P0AA 4HDKA 2D5AA 4JS0A 4G1FA 1S2GA 3D2LA 2F1HA 2Y1XA 1X9HA 4H60A 3VNQA 3FYSA 1NPDA 5B7GA 5IT5A 1DLJA 1LH0A 3IBTA 3QVVA 1RHQA 3R40A 5AUOB 1VCIA 2QYOA 4JKIA 1YVRA 5MHTA 2ZCJA 2GWRA 4LYAA 1TECE 3E7XA 2GD1O 2Q9UA 3LX5A 4MLDA 4C2TA 2O8FA 4U2EA 4G0XA 1GGHA 1LZKA 2Z5VA 3VJMA 4EI7A 3R8FA 2C4TA 3B9QA 4D4GA 3SJUA 1EGVB 2GAFA 2VHXA 4F72A 1RHMA 3JQQA 2H07A 4ENRA 3D3WA 3PSAA 4NBSA 4Q7LA 1SG0A 2WEKA 4S2UA 2PZLA 1G2IA 3NANA 3UT0A 2HWKA 1TZ2A 1KSGA 2VTVA 3AVYA 3HN7A 4KYTA 3ZE0B 4KXQA 1VCHA 3A9UA 3VDNB 3HBAA 2X0IA 3JD3A 1ZGAA 1R0WA 2OORC 4C6RA 4HVAA 1OE0A 4ZMSA 2QN9A 2OV8A 1TU0A 2O2JA 3KQPA 2ATIA 2WJPA 5LL6P 1G41A 1OLUB 1PO7A 2D8MA 5AI9A 3KKMA 4LRSB 4L5CA 3EB9A 1JAXA 5LJLA 5TS3A 1QZZA 3QYFA 3H9QA 2HA2A 5TDHA 3EXHB 1T2AA 4Q48A 1K08A 3KOYA 3UWKA 3D7NA 3BMQB 2GB4A 4MLPA 1N8NA 2QZSA 3AY7A 3NM6B 5IEBA 5KMGB 4L9WA 3LA6A 2C0QA 3W7VA 1TO2E 1ZNXA 2XVXA 3Q12A 2ETXA 4AECA 2BKLA 4BQOA 2GPTA 5HP4A 1A8IA 4OLFA 1FMFA 1DRJA 4H7PA 3II6X 4AWAA 4MICA 5CVDA 2QD3A 1ODCA 2EERA 2VNSA 4G6ZA 4AF6A 3RBAA 1P19A 4D0RA 4O33A 1V71A 1U9ZA 1JHOA 2WE8A 2ZSKA 5EIFA 5SYNA 4QO8A 2CLHB 4CYMA 5CDGA 1WOMA 1EQUA 4G36A 3KOOA 2PFGA 1T26A 2HA5A 2RGGA 2AFRA 3H11A 4M55A 3PEUA 1NF9A 2BCGY 1GILA 4OP2A 1WBJB 4JQCA 1KDPA 5DLEA 1A5SB 2PMCA 4M0CA 3EX7C 1X1CA 3R7SA 2BVNA 5HIMA 1B00A 3K9NA 1OYOA 4YJGA 1L5RA 3FYUA 2IKQA 4HQ6A 2V1UA 4X71A 1RBMA 3I58A 1ZCZA 3WRVA 1OF1A 4NICA 1QHXA 2H4WA 2YDXA 1NC3A 4GP7A 1RXVA 1Z25A 2IY9A 4OD0A 1FP4B 4QGFA 2D13A 4YCNA 4ZO9A 4ZAXA 2FMUA 1NNI1 5FUVA 4O4IF 4RVSA 4MRMA 1PJ3A 1JDVA 5FUYA 1OI2A 4D1YA 4RV4A 5GADl 5A5VA 3KR1A 3P9QA 1WOYA 2YMMA 3CKYA 1OZGA 3QNUA 1F60A 3EAFA 2JHCA 3RFFA 2W00A 2DLDA 3FF4A 4GPBA 2C00A 2QZ4A 3DZHA 3FH0A 2C8KA 2I4IA 4P58A 4DLVA 1PQUA 4UQLA 1CUDA 3HR8A 4NCKA 3L4BC 2JAWA 2VLBA 3U7RA 2VF8A 1CY6A 3ZGVA 3QNMA 1Y3CE 4B3RB 1DBWA 4TZ0A 3JRXA 3KFXA 1CJSA 3D6NB 3Q4GA 4O08A 4P35A 1YJ5A 3Q8XB 4MVJA 5DNYB 1VYUA 3K70D 4CQMB 2PMKA 3ZZ1A 4CLRB 1ZD4A 4WN3A 3V7WA 3LG2A 4GEKA 1XVLA 2HWUA 1IYZA 4MHOA 5AI5A 5E0OA 4HT3B 4PLTA 4RQUA 3L8MA 3UUWA 1S02A 4HSEA 5K0FA 4DMUB 1G5PA 1N9GA 2XD9A 3LX8A 1X0XA 4MWSA 3NBAA 5KC9A 4DGQA 2OG1A 3ZIAA 1K7XB 3FSEA 4F2DA 2QG6A 5GQSA 3I9LA 3N5CA 3ECCA 4IH4A 1IBSA 1V25A 5TF0A 3R7WB 3F1LA 3FVWA 4J7UA 4WK2B 4DE5A 4RPCA 3FD8A 4RVDA 4EG6A 1XEFA 1NATA 5EKSA 4DMCA 1O95D 3NHFA 1BYIA 1VE3A 3CUSA 4JCCA 4R9RA 2B7BA 3UMYA 1JVBA 4ZJYA 2AR9A 2G1KA 4L5YA 2JBAA 4JUIA 4IOKA 4BYMA 1ZJJA 3AQ4A 1SHUX 1USUA 4XWTA 2GO7A 1IDOA 1C7ZA 2VP2A 4JVSB 4HQKA 4YMGA 3OLWA 1FSFA 1NFQA 1D8AA 3KRTA 4Q37A 3ZWNA 1JHPA 2FMTA 1OXVA 2JIZD 1MN6A 3H9EO 3JASA 4V0RA 4CV1A 3I01M 2FMKA 2MIIA 2O4CA 4QXRA 2C61A 2ONKA 2R8OA 5BQ5A 4ENQA 2ZRAA 3LSYA 3R6GA 1CQIA 1OIWA 4UZEA 1TKBA 1YUBA 2R1VB 2A9RA 3CF4A 1DKOA 5G3YA 3JW8A 5DWDA 3LUFA 2DC1A 2WM8A 3RD5A 1SIBE 1BWRA 3KLNA 4D8YA 1SUFA 4M7WA 5C7OO 2RHLA 1JEYB 3GPBA 4ZV7A 3PC4A 4Q4LA 3T1YB 4K88A 3DDCA 2HMAA 3B78A 4UE2A 3FJYA 3DPSA 2QD4A 2W22A 2ZS8A 3EBLA 3WHKA 1I33A 3WL3A 3OQ1A 2XUHA 3OUZA 3O91A 2R00A 5JQGA 4P4TA 1BX0A 2NO4A 4D3SA 3VFDA 2GZRA 4YRLA 1YULA 4KVZA 1NW3A 3M3HA 3E81A 1TEVA 5FLKA 5EZQA 4MKZA 5ADVA 3K70B 1E9RA 3IAS1 1UMKA 1DFIA 3E2IA 1CY8A 5FUQA 1Q0RA 2HUNA 1MJFA 1JFTA 4TYPA 3FMOB 2AYXA 4LYGA 1PJBA 2WP0A 4M0KA 1HRKA 1NVBA 1G98A 2OTCA 4IXMA 4II7A 3REFA 3WLEA 2IWHA 4NABA 4J9UE 4L8LA 5CXXA 3TQQA 3L5OA 1B6RA 5EKXA 3O26A 2WM9B 2PQ0A 3EARA 5LOVB 2ERXA 1R18A 4TKLA 3MGAA 1VB3A 3MRVA 4NE2A 3K1ZA 4HADA 3E15A 4YP7A 4CN8A 2ATXA 3HPQA 4GZMA 3H6GA 4DLBA 3A58B 5HUJA 1FTYA 3N74A 3N8NA 1W47A 2XB9A 3O4RA 2BRUC 1M6HA 1IQRA 3SX2A 4D9FA 2GA8A 3FNHA 4XW2A 3H0CA 1PWZA 4PG8A 1DVRA 3STHA 4E2YA 4MQBA 3GLQA 4J1SA 5AHKA 4ZYVA 1AA6A 4GVLA 4LMAA 1H2RS 2V4MA 4YHBA 3QX3A 1DARA 2F2TA 3GJ5A 1YBMA 2WWYA 2GF2A 1F7VA 1Y6RA 2C7OA 3ETGA 1H8ED 2GARA 3SLGA 2DWUA 3LUDA 3D3KA 1T0PA 2XW6A 3ZWKA 2G83A 2LTAA 2IH5A 1R4NA 1N92A 2BFCB 4LXYA 4MV7A 4D4HA 3M6IA 3IGFA 1A69A 4MMXB 3GGSA 4TT8A 4LE1A 3ILSA 4LQDA 1N5JA 1JDJA 4CR6A 2UXCB 1RTTA 3ELBA 5KHLB 3WGKA 1LW7A 2C5FA 5IKXA 2E4WA 3OD5A 2HTEA 2J08A 4NYJR 1NTRA 1P4SA 1Y6QA 3IV6A 4LV5B 2CV0A 1FU8A 3JWJA 3IAXA 5FWYB 1JAIA 1RLTA 4ETWA 2A57A 1PFYA 3N6RA 4U0KA 4F5ZA 2A4MA 4LJ6A 1K7EB 2H2DA 1Z07A 3OY2A 1ZZGA 1B76A 4IL5A 1U0FA 3OU6A 1OAOA 2WJ4A 2VZ8A 4LYEA 3NT4A 1Z06A 1KYQA 5EP2A 1SXGA 1X1EA 3DA8A 3HJNA 4UAUA 4NEQA 5EA2A 3TTVA 2FFRA 5DP2A 4G09A 2P35A 5EI5A 3ACDA 3V4OA 3TFOA 1OYVA 1FS4A 5LNK1 5TY0A 4C4YA 1J70A 4GPD1 1VRCA 1JAZA 3PPXA 3O2JA 4N54A 4AMBA 3DEIA 3RVBA 4DCSA 4CKWA 1SBCA 2MT9A 3NHWA 5L6MB 3HXTA 3FB4A 2W4IA 1LNQA 4GVPA 3RRMA 4BFVA 1X2BA 1H94A 3EFBA 1TVCA 1YA4A 2J4DA 1UEJA 3UC5A 1YB7A 4DSAA 3RU3A 1P6XA 3ZY3A 1O4VA 3GQBA 3D0QA 2JNWA 4XEHA 4YBRA 4WFKA 1ENYA 3AZQA 4MV8A 2HNBA 4DLRA 5C4MA 1ZM4A 3ZVLA 4C7VA 4QGGA 5KYUA 1W93A 3DSRA 1B73A 2YC2C 1GLVA 1PBNA 1ODSA 1OTXA 2V0GA 4DZZA 4H4EA 4PSVA 1M8KA 1J0CA 2GBFA 3FLMA 5EP1A 1ELOA 1QLWA 3BB3A 1OLSB 4O02B 1SK8A 1FJHA 4EIWA 5K6RA 3OA2A 1KQGA 1HQYE 2BTQB 4PLWA 2VSFA 5F2KA 3GBPA 5GTDA 1DC4A 3T38A 1AJEA 1RRGA 3TXXA 3RABA 1TA9A 1FS6A 1EZ1A 2F59A 2GILA 1GTL1 1R0BA 1ECFA 3FYDA 3GJRA 3ILHA 1KYWA 4LSGA 1ZGGA 2LUOA 2WV9A 2ZCUA 2IHBA 3AY0A 3JQBA 2QMOA 4O4LB 2RGYA 4TLEA 3TOZA 5F7XA 2BKXA 3QTBA 4J9VA 4GX1A 3MQ2A 1RI1A 1Z4OA 2QSJA 4GWGA 1TMKA 3COYA 4AZSA 1JEAA 1GLGA 2EW1A 2PA0A 3T3PB 1UWKA 1K7CA 3P9RA 3H8VA 3R5FA 1EK0A 1LGYA 5KJEA 1GZ3A 3SK0A 2P7HA 4ESHA 2ASVA 1Y7HA 2IU6A 2XADA 5F12A 3H1FA 5F4BA 4WBNA 5K99A 4B35A 1Q7RA 2DUWA 2HT6A 4RK5A 4ZJPA 1IE3A 5JNRA 3HK2A 1BG6A 4V2IA 2CF6A 3SGLA 1ZMRA 3IE2A 2CJXA 3WNDA 2H4FA 2J8ZA 2QAIA 4JB2A 2VDKB 1GNTA 3CC8A 3EPRA 5C31A 3W78A 1LNZA 2QUZA 5ALQA 1EIWA 4MPPA 1LBSA 4D6YA 1EVJA 2W6ID 3BKXA 4L7VA 5IH3A 1O94A 2B36A 1SUSA 2UYYA 4I9NA 4P2BA 4WOJA 3D8NA 4YIHA 5AVVA 5L40A 4FFMA 1SUBA 1XAJA 1UODA 1K6IA 2PRSA 1U80A 1LBTA 2VJCA 2XWBF 3TW8B 5H3CA 2OK8A 5C1DA 5CYPA 3MVEA 3FN4A 4JIGA 1TT7A 3T99A 4RL4A 2QLNA 4IJKA 2ZB7A 1X7YA 3PE3A 2YN0A 3MXTA 3PI7A 3RC7A 2O3JA 2PS3A 2FFHA 2NZJA 1JG1A 3BGIA 3RVQA 4AS1A 1H65A 1HE1C 1VC2A 3JQAA 3P27A 2P9YA 4KFRA 5DJ5A 1L5LA 3ZCQA 1W94A 2CWWA 1JB1A 3DEJA 4CCYB 4ZZ2A 3LOUA 3TQIA 2R85A 1IEQA 4CFSA 5KNBA 4CDGA 1KSJA 3DQQA 1G3RA 2KLHA 2OQRA 4J0EA 2Q9BA 2R5WA 3HKBA 4TMTA 2GPNA 2WIFA 1CY1A 4PZ9A 5B3LA 1JEOA 3Q87B 5DYNA 3TI9A 4F8EA 1XG5A 3FWPA 3C48A 4JU9A 5EJ9A 4NYMR 3O3CA 2NAFA 5JAQA 2Y92A 4AICA 3H2YA 3OOJA 1JEQA 2OY0A 5CNMA 3VZSA 3ZDQA 3OM8A 3ZWMA 3DVLA 4CM8A 3D9QX 3PWKA 3Q3CA 1PQ4A 1MB9A 3GJ8A 4TV9B 1E3WA 3DT6A 1U6KA 4YACA 4EATA 1FYDA 3CLKA 5DEOA 2CDNA 3JARA 3NHJA 2B5OA 4Y6PA 1QO9A 3E48A 1UPAA 5EHGA 4G0WA 2O5RA 3M70A 4JYMA 2ICAA 3G0IA 3U7EB 1HEIA 2R87A 3BQ9A 4KFUA 4LJAA 4HXGA 5A5GA 1ZD8A 4EP1A 1VGQA 3C1UA 1MX3A 2R4QA 4D3DA 4YMTA 4LRQA 3SN6A 3K1JA 2ILTA 2WBLC 3WR5A 4DIBA 5BNTA 1MT0A 4X97A 1XNGA 3ABSB 3OPXA 4O4HB 3DBHB 1YWGO 3MW8A 5E4JA 1Y1PA 4G4JA 5BNWA 1CE8B 3DGEC 3DFZA 3NAGA 4YCLA 4RH1A 1RABA 2EGUA 2WRZA 1ZD3A 1YI8A 2UKDA 1C3OB 2H9YA 2Q27A 3B6EA 5EFZA 5HTKA 1DFHA 4L02A 3T0FA 4ZYXA 5JLJA 3LOPA 2E5WA 1EUDA 3TCKA 2ZI3A 2IGTA 3FFTA 4G85A 4EA8A 4PQFA 3N6VA 5C18A 2G71A 2GGSA 3K3PA 2Y1FA 4X3OA 5JCXA 1KOJA 2ON6A 5LUBA 5A0VA 3TOVA 4AMUA 4BIIA 4MUBA 1IN5A 4YIKA 3PC8C 4Q3LA 5JNTA 1CUFA 2XKAA 2ZJ6A 4TS9A 3ZNPA 3T9EA 5AK5A 4BUZA 4CR8A 2KBFA 2X7XA 3FCEA 1D04A 1JZQA 4DILA 1XGKA 7AT1A 1JILA 2A5DA 3BFVA 1YQXA 3SJCA 4UHJA 4F4CA 3LVBA 1IHXA 4AZ0A 1BHJA 3C15C 4YPOA 3G8CA 2G28A 3R09A 5HILA 1FMTA 3U6BA 4MQEB 3RWMB 1N1MA 2P4SA 2VQ6A 1HLDA 5CK4A 4JLSA 4UE6A 3R3SA 2ZTSA 5LQCA 1NI4B 3ZGZA 1AQ6A 2XTNA 3DDHA 5HZMA 1B42A 4JLPA 1KP2A 4MVJG 4XQ0A 3LBNA 1M1ZA 1QB7A 4Q66C 4HG2A 1PK7A 1LWNA 1VJ1A 1FLNA 2WJZB 1ADGA 1LVGA 2WVHA 4JB8A 5DM1A 1B16A 4WESA 3ISJA 5EMJA 5LQAA 3BICA 3M6UA 2NU9A 1YR8A 3FOFC 1AH2A 4LHXA 1R10A 4QELA 2WUGA 2FDXA 2QLJA 2X42A 2XE4A 4N65A 4IICA 3OWXA 2WQZA 5AIAA 1U1IA 4DHWA 1CUBA 2WAXA 2FZWA 4B3CA 2B78A 4O3FA 3AF4A 3HCOA 2W71A 3N7TA 3G5UA 4L15A 3G79A 4L0DA 4OF4A 3SKXA 3WGOA 2R7LA 3D4PA 5C1PA 3B3QA 1F2TA 1IU9A 4WH0A 4LYHA 5B1HA 2A0FA 4OJYA 5ECDA 4BNUA 1N5LA 2BR3A 1I0ZA 2L17A 4HI0E 3AY6A 4AWBA 3ZWVA 3HDJA 4KQMA 3H97A 4MW1A 3IEPA 2UXDB 2YV1A 2R65A 3MB5A 4XM0A 2FAXA 3GP8A 4IIJA 2WDZA 4PBRA 1O9BA 1V7ZA 4KPEC 2DJIA 1R4MA 2PL5A 4OM7A 2VTEA 1XJCA 3O73A 4YMHA 2AD1A 3OE4A 4ZVKA 5BRJA 2YZ7A 1O8BA 3Q9SA 1OC4A 1TL7C 3RIXA 3ZHUA 5AW1A 1BC5A 3EIWA 4E3ZA 1WF3A 1WY5A 2NXWA 2LCIA 3NZEA 3WB9A 1Z5PA 3MK31 1RYFA 4P4SA 5EE9A 3M5CA 4LI0A 3R4CA 4EFKA 5ALGA 3ZCRA 2AWOA 1I5EA 4O4JF 4LC0A 4ZYUA 4RVNA 4YRNA 3SS7X 2FLVA 3MRSA 5DWQA 5I7HA 4UPDA 2H1OA 3IO5A 2X5NA 5LP6C 5HJ7A 3HXQA 5FL7A 1CZUA 3PDIB 3LLUA 3HABA 3T3OA 1QC5A 1AGPA 1QLHA 1MO6A 1T9BA 1WSAA 4ITVA 3I2FA 1ANKA 5DO9A 3MUNA 3ZWCA 1LFDB 3O8DA 1P62B 3H2KA 1W8IA 1BE8A 1KZ6A 5HQJA 3OZDA 4JROA 2IIQA 2H1HA 2YVQA 4XR4A 4CI9A 2G67A 4AJIA 2QU8A 3VJLA 4EYKA 2HCJB 3U3RA 3OSUA 2GHRA 4HPJB 4LZPA 3SZRA 2GX6A 1CULC 3DOJA 3EZ2A 2RH9B 3BRQA 4KMMA 3RSSA 4ID3A 7MDHA 2ZRDA 4EJSC 3O2NA 4HGRA 1VE5A 4QXAA 5A5FA 1IN8A 1BCSB 3A4MA 3I6YA 3IP8A 1CEXA 1MJNA 2P9TA 5BW5A 3M89A 2ZJ4A 1ATIA 3JQPA 4UATA 1ZVQA 3HL0A 3AUKA 1F6WA 3IILA 4RA9B 3KYDA 2BFAA 3TMAA 4IDEA 5LLTA 1L5VA 2FPSA 3EAGA 4ZVNA 4CKEA 1DIAA 4LOLA 4R1QA 1P29A 1BHO1 4OP3A 3WA6A 2OXFA 1WHSA 1ZIYA 2HK6A 1WXGA 2UVPA 4RABA 2OHGA 2OUIA 4JELA 3V2HA 5ARBA 4DG9A 1LPBB 4RPJA 3ZCTA 4RTLA 1FVHA 1JE0A 2BPOA 2CUZA 2V5AA 1F9EA 4TTSA 5EGNA 4AN4A 1YRAA 1CY7A 3AOEA 2EFJA 1ZG3A 1OWPA 5DHQA 4A6PA 1H0KA 2Y1GA 1GNLA 2QUJA 3V1TC 3PJRA 3FW1A 2ISSD 1SR8A 5JDCC 3TZKA 2FN4A 3OM0A 1Z0ZA 4MCAA 3IEVA 4UM7A 1VCOA 1YC2A 4KE9A 5K3OA 2OD7A 4C29A 3WY9A 1HE2A 4G0YA 4I55F 2OAEA 2GEUA 4QO7A 5I7AA 3DPIA 4UDOA 3AWIA 4A1FA 4KSYA 2PT6A 2XYVA 4D8VA 2HYIC 3DBLA 1EGAA 3GT3A 4TUYB 4P54A 4NBNA 3ADCA 1L4KA 2O8DB 1I2ZA 5DXJA 3AFOA 3P2MA 2XDWA 3MLBA 2W6OA 4H15A 1YS6A 5ITZA 2Z6QA 1MDFA 3MAJA 3H1GA 1QHYA 4RTQA 3ER8A 1Q50A 4EPYA 5B4UA 3BJEA 3BFXA 2WTEA 1IUNA 1MMFB 3L93A 2RC6A 1PNRA 2Q6TA 4BNXA 1C81A 1PV2A 1WXWA 2FTKE 2D5CA 1O8CA 2Y66A