521PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTTGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-RAS P21 PROTEIN
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
total genus 51
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 521pA00
3KKQA 1FL9A 4FXPA 4UXJA 5G53C 1IN8A 4S2EA 3B9PA 5DHFA 5C2JB 4MYTA 2CEAA 2CXXA 2GJAA 5DO9A 4KLZA 3KQNA 5GJVC 1GTVA 3P4XA 5DSZA 3UKDA 3C5CA 4L15A 4OQNA 1HEIA 3E70C 4B3XA 2MSEB 3CB4A 5J47A 3Q5EA 1YR8A 4MDFA 3SYNA 1D6JA 4LJYA 4B3FX 1SXJE 1G8YA 2VRWA 5DYGA 4AKEA 3T35A 3TQCA 5KSOA 4QM7A 3M4YA 1WMSA 1LTQA 2BKEA 1NMZA 1VIYA 1XD2B 2BCGY 4LBWA 3AGPA 2VP2A 4X8HA 4JIMA 1GP2A 1EFTA 1L4UA 4Q00A 1F2UA 1ZD1A 1G3UA 1ZYUA 4WZAE 3GLIA 2H1LA 2P2LA 2ZYTX 3L82B 4MH0R 3ETLA 1QHIA 3P27A 4BLOA 3U7GA 5H70A 4DLZA 4UNQA 3FFBA 2X1VA 1VCOA 4RD1A 2X8AA 4PAQA 3TAHA 2GXSA 1YVDA 3R8FA 4RFSB 5B2ZA 1OXUA 3A1WA 3IO3A 4R2IA 1NBMA 1XXHA 4QG7A 5A0FA 5JRJA 1Z6AA 2GF0A 1VG8A 4W5JA 2O8DA 2W2VA 1XJ0A 4AIIA 1D2NA 4RZUA 2RGAA 4HAZA 4KFRA 4G01B 4NCHA 1S9HA 4OL0A 1U8YA 1UBCA 2QAGB 3I1FA 2JATA 2ZRBA 4BLTA 3M1IA 1HT1E 5FL3A 4HLUA 3K0FB 3GLFB 2MSDB 3H4MA 4QJ3A 3C7KA 4LX0A 5GJCA 2VL7A 3IQXA 1OXXK 1CULC 3X1DA 5JS8A 3BFXA 2IF2A 1MRSA 2IHBA 2Z83A 1E99A 1KI1A 2O8CA 3S1AA 2AXNA 4TT3D 5AUQA 5ANRB 1KAGA 5F2EA 1SVSA 4O0MA 3CWZA 3BJIC 1GNQA 1Q1QA 2OV2A 3K09C 4A0GA 4E09A 1E4VA 1R0WA 2VO1A 4NDZA 1CXZA 1SKYB 4DIDA 3NC1C 3TSWA 3K1JA 3EZFA 2B8WA 3OZXA 2GBLA 4CT4B 3GEEA 2O5VA 1T4GA 1W36C 4W5HA 5FBLB 2QTHA 3QF7A 3PEWA 3Q3JB 3TNFA 3HU2A 1CU1A 4Q03A 2IYQA 4NCNA 1N6HA 3VTKA 1E9CA 1ZUNB 1IBRA 5TV2A 4C0SA 4TL6A 3UMSA 1OF1A 1OJLA 3RVBA 1XMSA 3U60B 3HDTA 1N5KA 3L43A 5JWHA 3MMPA 1ZUHA 5L8VA 4D0NA 2AK2A 3CRMA 4ZDJA 5AR1A 1N5JA 1E2LA 1E2HA 1P4SA 3KXLA 4NYIQ 1YHNA 3GEHA 5AJXA 1J2JA 4Z1MD 4Q21A 4OK6A 2K5UA 4IOMA 4OQXA 3VFDA 3CM0A 721PA 2NMVA 3X1WA 4CEJA 3IIMA 4YMVA 3A1SA 4EQ6B 3K0SA 2FEOA 2PH1A 3LA6A 4O3MA 3WBKA 2VP4A 3SBDA 5HCNA 4TZ6A 1XX6A 3LVRE 5AUPB 3CNNA 4NKRA 1G8HA 4GZLA 2R2AA 1VPLA 4TYYA 5KDDA 2CK3D 3UWOA 2W0MA 1Z8FA 2V6JA 2VYFA 2LWIA 1ZJ6A 2XB4A 4JKIA 1KI7A 3RRNA 4BEJA 3MWYW 4URWR 1QRAA 2B7CA 3CNLA 3KJEA 1KI9A 1N6PA 4Q9HA 1YJ5A 2ZU0C 1R10A 2IYSA 1TUIA 2WBLC 1E1RD 3AKEA 4DHEA 4F4JA 5A5GA 1GWNA 3GFTA 3MFYA 1ZU5A 2P6UA 1KNQA 1YZLA 3KKOA 3GLGB 1E4YA 3FMIA 5JI3E 1II8B 5H1YA 3W9YA 3RWOA 2H7VA 3TLXA 1E79A 1MO5A 2QT0A 2ZE6A 5FTJA 2WOJA 3B1XA 1UEJA 4C3ZA 3NEYA 3B13B 821PA 2REBA 3CKLA 2IEZA 2W0SA 4WXRA 2RGXA 4X8OA 4B2IA 4MKHA 2ZRDA 3TQFA 2IX3A 2A9KA 8OHMA 1JQLB 1NNEA 4EUNA 2QROA 2QUZA 2GCPA 1GOTA 4D4JA 1E9RA 4BE7B 3CH4B 1S9DA 4KLNA 2IUTA 5FOUA 5K8UA 3K0AA 3RANA 1KI2A 1XD2A 3WRXC 2QSYA 2W58A 1OHHA 2ZRHA 1E2EA 4Q4LA 2MSCB 4FI3C 4F7WA 2V6IA 2KE5A 3CX8A 3IHLA 3IBYA 2R62A 2VHCA 1W5TA 3WRYC 2BBWA 4ACBA 4GBMA 4P0TA 1R2QA 3MWLA 5EP3A 3CONA 3AUXA 5AJYA 4RFSA 2DCUA 4YONB 2QRZA 3G0HA 3RHFA 1OXTA 4M1KA 2ZJAA 2WWXA 1SVOA 1EFCA 1G19A 4HAUA 1N5LA 1XTKA 2FSFA 2IYTA 1SVKA 2A5GA 4PSKA 4FMCF 3IIKA 5JCZA 2QAGA 5AUOB 3IO5A 1K5GA 2KBEA 1SXJB 2SHKA 3QKRB 4NYJR 4B3DA 4B35A 1XNJA 1XRJA 1UBGA 1DOAA 3K0FA 1P2VA 3C16C 4PAMA 3QXHA 4B3GA 2FPKA 5FOXA 5FUXA 4C0BA 2ZI7A 2EFDB 5SZHB 1KJWA 2OCAA 4LGMA 2GCNA 4DDUA 4Q47A 1XD8A 1E1QD 3UATA 2BHRA 5BW8A 4RZXA 4LUCA 4V0LA 4BFTA 1GRNA 3QF4B 4P33A 1P2UA 3IGFA 4JLAA 4QBIA 4BUJA 2ZJ8A 2WAYA 3EA0A 1AS0A 3K8YA 4QRHA 5EP1A 2R65A 1TU4A 5HZKA 2J46A 3N2EA 1TEXA 2CVHA 3LWNA 4Y0AA 3B1WA 3EC2A 521PA 4I1SA 2ORWA 3THOA 1NVVQ 3AVQA 1LF0A 2G88A 4PO1A 4PHGA 1T9HA 1RYHA 3U7EB 5JS7A 2CJWB 4B6FA 1R4AA 2A5YB 2H16A 2O0JA 4JLBA 2IWRA 2QQ0A 2JASA 1EX6A 3PV0A 4BZPA 4P4UA 5CIWA 2IXGA 2OZEA 3EG5A 5BQ5A 1FW6A 1C4OA 2H5EA 1DS6A 2G1JA 4JKYA 3GJXC 2OT3B 3UMFA 2ZJBA 1IJEA 3QY0A 1Z29A 3W3AA 2JIZA 1AQUA 3B1ZA 4OQFA 3CO5A 3SS8A 4B33A 3MJHA 1E0JA 4KAXA 3C14C 2WJIA 2G1KA 2BV3A 1R0XA 1KSFX 2NG1A 3NTUA 4JLMA 4F92B 1CP2A 1AZTA 3KQUA 3OHMA 1OFHA 2IF0A 4LJ9A 4OI2A 4GSYA 3I3SR 1TQ2A 1MR3F 2KJQA 5BN5A 1PV4A 4H1UA 2ZJOA 3QJYA 4OJQA 5G3YA 4LJ8A 1XTIA 3K70D 1IM2A 3NHBA 2V55B 4P3YA 4BFUA 2AK3A 1MO4A 2XTMA 4NZYA 5K8TA 3OIUA 2V1UA 2PJZA 3AVPA 4Z8YA 1GRQA 2ZXUA 1CS4C 3LD9A 2AX4A 4C0AC 5C46F 4IVPA 1ZINA 1D5CA 4BECA 2EFCB 1RW4A 4RD2A 1EFRA 3JZMA 1MV5A 2FZ4A 4PC7A 4JLOA 3SDZA 3ZH9B 1E9EA 1T0HB 3BOSA 4DCNA 1G6HA 3GLGA 3TGPA 4IEIA 1KO5A 4C0JA 1W4BA 2QBYB 4FN5A 1II8A 3ZLJA 3KJGA 2JJ2D 3PEYA 1G16A 2PEZA 1F60A 1SHKA 5KNDA 3UK6A 4C0QC 4MGIR 2IHYA 1Z0JA 2XOKD 4BFXA 1OH5A 5TY0A 5GJBA 1QDEA 3LBHA 1OIVA 4BRUA 1XCPA 1UAAA 2R6FA 3LLUA 1JR3E 1NVXQ 2P65A 3SFVA 5JEDA 3CZQA 4IJMA 1OH6A 4UQOA 4OHYA 5IDVA 3AB3A 2WWGA 2QM8A 2C04A 1VYVA 1DAHA 1T91A 3AP1A 1R8QA 4JLNA 3SQWA 4HB4A 1Z2AA 5SZKB 4URVR 2XITA 1XU4A 1G5PA 1Q1ZA 4AWXA 4EAQA 1GAJA 4DDWA 5DIFA 1IY2A 1ZW6A 4V0ME 3W6OA 4GOKA 4EJSC 4EPTA 1U0JA 4PZZA 5J4YA 4PSVA 1NRJB 3VR6A 2WPDA 1A7JA 2VH5R 4PC1A 2PX0A 4DUGA 2NZ8A 3PUYA 2CDNA 4Q18A 5KSYA 4TMXA 4QM6A 4US2R 3LDAA 1T5IA 2DWPA 2QTVB 4M1YA 5JWRA 1CJMA 3EPJA 4CYMA 3QKTA 2ZRGA 4GP7A 2VP0A 621PA 5LD2C 1DTSA 4PQRA 3VR5A 2G0TA 3P32A 4AKGA 2W6JA 3QNUA 1W0JA 2F7SA 4HZUB 1GL7A 3H2YA 2RHMA 4G5GA 2UZ3A 2VSFA 1XP8A 2AWNA 2Q3MA 4KODA 1VMAA 2H92A 4AYXA 1SXJA 3QKRA 2JLYA 1RRCA 4TQAA 1XCGB 4IKEA 5EXTA 3K70C 3I73A 1N25A 5L3QB 1LB1B 2CNWD 1XEWY 3UANA 4DB4A 1CBUA 1GNRA 4DLYA 1OPXA 2HEIA 4PPFA 1HQCA 2C96A 5EJEA 2B92A 2R6AA 3IIJA 2ZJ2A 4TYPA 1E0AA 1ZIOA 5L3VA 3VHLB 3FKSA 2IS2A 4P32A 3W5IA 2ZSBA 1SQ5A 4Q1EA 2UZIR 4RJLA 3SFZA 1EFHA 4YDSA 1E2NA 2ODNA 1G7SA 2VP9A 3QF4A 3ZVLA 1GNPA 5HE9A 4DLXA 2C9YA 2XSZA 2VIIA 3ECCA 3Q5DA 3RRZA 4ZCIA 2RGEA 4IVQA 1Q3TA 4AYWA 3FMPB 1E2JA 4FMDB 1JAHA 1FTNA 1G1MA 3QENA 3ZS8A 4D80A 4I99A 4JLVA 4X8LA 3U3RA 2WIAA 2CJWA 4PC6A 3C5HA 3OEEA 2L0XA 4YC7A 2ATVA 1OYYA 3MRSA 3K0CA 5DYIA 1NLYA 2ZEJA 2ZI3A 5FOVA 4A9AA 4Q4HB 4BZXA 2IC5A 4BFYA 1G4AE 3VKHA 3VMFA 2XTNA 4LJAA 1XBTA 2W2TA 1HV8A 1UDXA 3EA5A 3FMFA 5L3SB 1NF3A 4LJ6A 4UNNA 5FPSA 2QEQA 2YINC 1VG9B 2FZLA 1FZQA 4EDHA 5M04A 1MRNA 3OF5A 4FMBB 1TX4B 2YOFA 3AVVA 1Q44A 3IPXA 4LPKA 1W0KA 3GJ0A 4LSGA 4WXPA 5HKKA 2WWIA 4CEHB 4YMWA 5FPYA 4OQMA 4LOAA 4WAUA 5JEEA 5KUTA 5EE0A 1D8TA 3BFKA 4C9BA 1OFIA 4KU4A 5JFGA 2CLDX 2HLDD 4MDEA 5FI1B 4ZDIA 3B78A 2HT1A 2ZS9A 1L7VC 2W00A 4M1OA 3ZZUA 3RS4A 4JS0A 1Z6GA 3L2OB 4B6EA 2QP9X 1EG7A 3TUJC 1CJKC 1XDBA 1ZNZA 5AUNB 1T8TA 1Z28A 2F3RA 4A2WA 1TF5A 1G8FA 4MGKR 3T15A 5IT5A 4NBSA 1FNMA 1WB9A 1FFHA 4URUR 2NTYC 2QGZA 1KZ7B 1MABB 2BMEA 3OIYA 2WM9B 3PFIA 4QGGA 1DAKA 1G17A 2BJVA 1T6NA 2N46A 3KX2A 1KK0A 2BIFA 2JLVA 3J81k 2REOA 1R0ZA 1P9RA 1N6LA 2C9OA 1KDRA 1ZAKA 2GZHA 3CRQA 2QBYA 1LV7A 2FX3A 2BMFA 2JDIA 3GPLA 4OHZA 3CF0A 3TR5A 3V4RA 1W5SA 1R5BA 3CIOA 4GDFA 3WMFA 2X19A 2AFIE 3HYTA 1UBEA 1OKKA 2ATXA 4Q66C 4Z54A 3BFVA 1VDZA 3TUZC 2ORIA 2B8TA 1JXOA 4LV8B 2V4ZA 4CRWB 1US8B 1G3RA 3K9GA 4M9ZA 3W6PA 4ZV4A 2JJ8A 2CCKA 3NBFA 2VPPA 2A5JA 2REXB 1G3IA 1L2TA 1P2SA 1X1RA 4ZDWA 3CF2A 1AM4D 3U3JA 5FPTA 2JLSA 2PCJA 1AK2A 4W5WA 4L9SA 3CRW1 1TUEA 3ZIAD 1W2GA 1XEWX 3EXAA 3THXB 5EUQB 4EKDA 3UXMA 4HDCA 1EX7A 4E07A 3AVWA 2FE4A 2ZRFA 1WXQA 1YZUA 4GOXA 4PPGA 4XTRA 4CF7A 2F1JA 5CJPA 3NDBB 2HXYA 4QOSA 121PA 2CBZA 1KOFA 4V03A 3LRPA 4HUTA 5KPJA 4QL3A 3WY9A 1BKDR 4AURA 5SZJA 3CNOA 3FFAA 4YQFA 2J3EA 3CH5A 2A5FA 1DBSA 3SC3A 1E3MA 3ZJYA 1UFQA 4BFSA 4D4LA 3KZ1E 2BEKA 3QXCA 2J45A 1E9SA 5J40A 4C4PA 4HZUA 5KTYA 1GILA 1I2MA 1G3MA 3LO5A 1KDPA 4PZLA 4B34A 2DYKA 5K8IA 1G21E 5E7MA 2AXPA 5L3QA 3UG6A 1KKLA 1Z5ZA 1ZRHA 4PC2A 1ZNYA 4OHVA 2GXUA 1BYIA 1UPTA 1TNDA 4B2LA 4JBXA 4HLUC 2QAJA 1G6OA 2C5LA 1W49A 3NG1A 1Z0DA 1H8EA 5FTLA 4IW3B 5KO2A 3LNCA 5FBQB 2TMKA 2WZQA 2VF7A 4LYHA 1S96A 1JEEA 3TH5A 4EFNA 3CZPA 3SZRA 1OE0A 1ZNXA 5G3ZA 1W36D 3FTQA 4GL2A 2CLCX 4DSNA 2J87A 4QGHA 1L8QA 3DVLA 1ZNWA 4B76A 4CT5A 4EIWA 2DFKB 1E79D 2Q6TA 2GTPA 3B2EA 2IEYA 1BO6A 4NHOA 4YMSA 3LBIA 1GITA 1IN7A 4NCJA 2ECKA 4Q48A 3X1ZA 2CVFA 3SI7A 5D3QA 1DAIA 4IDPA 5IF9A 1COWD 1CKEA 1P73A 4OJKA 4Q4HA 2OFWA 3BC1A 4TL8A 3O8RA 3RC8A 2QN6A 4YXWA 1W44A 3WHKA 1J8MF 5L3SA 2ZSDA 3IPYA 2PZEA 4EFLA 3FB4A 3ZD6A 1KDTA 1GVNB 2EW1A 4IDNA 4RD6A 3MAAC 3TW4A 4TSFD 5B64A 4F93B 5IK2D 1YZNA 1IY0A 3A4LA 4I81A 3SHFA 2FU5C 2FSHA 1M34E 3Q7QA 3GJ7A 3SHWA 2CHQA 2QMUA 3KQHA 1NVWQ 2ZE5A 3AUYA 4ASUA 4PR0A 4LBZA 1NP6A 1E2FA 1A82A 3BBPA 4PHFA 2AD5A 4RD0A 3TR0A 1RJ9B 5F9HA 1JAIA 2MMGA 3FWYA 4BFZA 3TSZA 2QSZA 1X8LA 4Q7LA 3ZS9A 1VCIA 4F91B 5HR5A 4A8JB 1XMVA 4JMPA 5JHHB 5EE3A 4ZDKA 2J7KA 4US0R 4WZBE 2AN9A 5TARA 5BN4A 5LPNA 1MT0A 3TKLA 1S3GA 2JCSA 3OAAA 4DLTA 2J7PA 4LPSA 3ZZTA 2ZU6A 1MABA 2W6IA 3BH7A 2OE2A 4MYHA 2YNMA 5EE9A 3WXMA 3Q8XB 5CB6A 4BGDA 2ZYWX 3HJNA 1JECA 4LHWA 1U98A 3I62A 1YZTA 2GK7A 2XAUA 3H1TA 3F5FA 4KYIB 2IUUA 3RSLA 3HR8A 3P4YA 1G5RA 4R9UC 3WMEA 4QXAA 3T1QA 2QE7D 3ZVNA 4ZO4A 1LS6A 1XTRA 6Q21A 2O0KA 4C0HA 5CYPA 2FV8A 1G7CA 2ZRCA 4TTQA 3ZYCA 4DC9A 3ND9A 1YR9A 1US8A 3W34A 1KNXA 2F1IA 2G0NA 1CEEA 2OEPA 1JQJC 3A8TA 2WJYA 4CW7A 2VBCA 3SQXA 3B1YA 3V9PA 1TADA 4DSUA 3KJHA 1MO6A 4QNMA 3U7HB 4UXHA 1NL3A 2H57A 1W46A 2DR3A 4DDVA 3QG5A 5J4VA 3I61A 3T61A 1FTSA 4QGAA 4KHZA 4U00A 4C2TA 1R7RA 4JL6A 3THXA 1ZCAA 4A0HA 1KI6A 5FH9A 4N0EA 4DLRA 1GKIA 1MO3A 3AP3A 1DG3A 3QE0A 5KYKA 5H8WA 1F3OA 1UKZA 2WVJA 2P0EA 2JJ1A 4B32A 1NKTA 5F98A 3CX7A 2PCLA 3K9NA 4YMTA 4DSOA 3WMGA 5IHPA 1EXMA 1N0UA 2DY1A 5BYKA 1H8HA 1RRFA 3BS4A 4AG6A 2D62A 3KDSE 2RAPA 2BEJA 2GEUA 1U9IA 1KK2A 4RD4A 3E5HA 5CDFE 1ODFA 3AF3A 4TTPA 4QJ5A 3RS0A 1JR3A 1PUIA 4Q01A 1AA9A 1VYUA 5JRZA 2G6BA 1FUKA 3DHWC 3WYGA 1KTVA 5BXQC 2F3TA 4Q19A 2WSSD 2RGNA 4ERNA 2F1RA 4GOJA 1W4RA 3RC3A 2PZGA 1KK3A 2DHRA 4Q9IA 3TVDA 4V0MA 3DMDA 2LKDA 1W2HA 3IHWA 2QAGC 3OFNA 1K8RA 3CBQA 4B71A 2IYXA 1X86B 1CTQA 4M1WA 4GI7A 4IVRA 4JSTA 3C8UA 2V8OA 1M8PA 2QY9A 3VR3A 3Q72A 2OFXA 4II7A 4TZ0A 1DAFA 2B6HA 3KUCA 4M1TA 3BORA 2R6DA 4B75A 4XJXA 1OV4A 4LY6A 1DAGA 1QVRA 4M2LA 1PVOA 2QPOA 1P60A 2CE7A 2JLXA 2IW3A 5FR1A 4AI6A 4G1UC 1W48A 2Q9BA 1G8GA 3DM9B 2WJJA 3HR7A 2YV5A 1BS1A 4UNSA 5KHOC 1T3SA 2Z4SA 2IS6A 3IDQA 1NJGA 2QM7A 2EYQA 4C2UA 2OAP1 1G5TA 2P67A 5P21A 4HAVA 2OLKA 4KI0A 2V7QD 3FPAA 3A1TA 5CYOA 2DFTA 5CJ2A 1SVIA 1AKEA 2XNDD 3NDPA 4F4CA 4U02A 4JYCA 1KY3A 3LAWA 3QXJA 4LJ7A 2YOHA 2J5XA 4A6PA 4M9QA 3GQBA 2OAQ1 4M53A 5JLJA 1IXSB 2ANCA 4LBYA 3RS3A 1M2OB 2GXQA 3A1VA 3SJBA 3H0KA 4D4KA 2XXAB 2AD1A 1CR4A 1KZGB 2HF8A 2ZI9A 3CX6A 3TMKA 3EARA 1Z6XA 4G3XA 3L8YA 4A8JA 2F55A 3PJRA 3KKMA 5EQTA 3SYLA 4ACAA 1IONA 1LNZA 2BJWA 3LXXA 3RRMA 3QIAA 3GLFA 4FMDF 3SYKA 4I1OA 1G18A 3B6EA 5FUWA 2ZIAA 4LRWA 1XZQA 2JA1A 4DB2A 1QHHB 4L16A 1GM5A 3F3YA 2ANBA 2CHVA 1M7HA 2HT6A 1YRAA 2FPLA 1R8SA 3DOEA 2IXEA 4LHZA 1PZNA 4B48A 1WBDA 1KJYA 3LW7A 1DADA 2UKDA 5DI3B 4DVGA 4DEXA 3KB1A 1QHGA 1F6BA 1ELOA 2F43B 2NPIA 4CZ2A 1D2MA 2GAOA 1U0LA 3Q9LA 5LBIA 3OIWA 4LCBA 1IQPA 5JSZB 2QT1A 3GLHE 3AM1A 3OEHA 4GRAA 2XJ9A 4HSEA 4JZKA 4NYMQ 2CE2X 3AVXA 5CB8A 1ONBA 3O8BA 2D3WA 4RKEA 2OCBA 5TXGA 2C8VA 3B60A 3LQQA 1XEXB 2D2FA 2YJTD 3DZDA 3THYB 1N2CE 5DGXA 4Q5IA 1E96A 4G5SA 3TUIC 3NEJA 5B57C 2NZJA 4LZZA 3Q7PA 3VR2A 4JLKA 3GD7A 4G5RA 1JNYA 2Q0HA 1KSHA 4DLUA 2GZDA 1W4CA 3OESA 4MITA 1CJUC 2ZAOA 4LJ5A 4R71A 1FOEB 4BASA 1SVLA 2IUSA 1OLOA 3EZ7A 4JBWA 1ZUIA 1E9BA 1ZP6A 1BYUA 3PXGA 1DO2A 1U8AA 2EWWA 4EQ6A 2WMNB 4HDOB 4Z1MA 1FNNA 4W9MC 1QG4A 2VA8A 1UKYA 3TIFA 3GP8A 4TYWA 4O2RA 3AKDA 3U6BA 2CL7X 2RGDA 5EZ6B 4A82A 4DJTA 2QGNA 3M6AA 2ZUDA 2AL7A 3U61B 3CR7A 3LH5A 1OH8A 5BYJA 4DEYA 3CPEA 1KAOA 1YKSA 4PO9A 221PA 1AS3A 3SR0A 1QHSA 3LQRA 4TQ9A 3U3OA 1GL9B 3T5GA 1OH7A 2XZPA 4XD7A 1JXMA 4BLPA 3K70B 4M1SA 4ZKEA 2CMKA 4TQUS 4HDQB 1NSFA 4MRRA 1XTQA 1F48A 2CCGA 2EFEB 2Z4RA 3RS2A 3I5YA 2BM1A 1SXJC 3WBJA 4OK5A 3OE7D 2QP3A 2RHDA 4L9WA 4U5XA 1WE2A 2EFGA 2QTFA 2Q3FA 2OXRA 1U8ZA 1HYQA 1Q22A 3FKQA 5KDOA 1E1RA 4XH9B 3NKVA 2B7BA 5FBWB 3DMNA 4QJ4A 3DEFA 1XMIA 2A7QA 1G20E 4Q1CA 3VNVA 2AKYA 2FSGA 4BWYA 1NVUQ 4AKHA 2HYDA 3AGQA 3A1UA 5FR2A 1S1CA 1TF2A 2ONJA 3LBNA 1XFAA 1Z6TA 2V54A 5FUVA 1II9A 4XSHA 3TVTA 5FPKA 3FOZA 1WA5A 1UEIA 1CJTC 1S3SA 4Q7KA 4CIDA 3BH6A 1QHNA 1KY2A 1X1SA 2RGCA 3PCRB 2E1RA 1E2GA 5C4GB 4PHTA 1EWQA 3MCAA 4MGYR 4A0FA 3KTAB 2GJKA 1J7KA 4FIDA 2GESA 4JVMA 1NIPA 3G5UA 3U44B 5C1BA 4A0RA 2H18A 4OI1A 3PG5A 1DE0A 3BAFA 3W90A 4LV6A 2QQEA 3K0CC 4DXAA 3ND8A 2YKGA 3BB4A 2QMEA 3R9XA 1IXZA 4NCKA 1KI3A 1P72A 2GJ8A 3BWDD 3T34A 3ADCA 2OO7A 1RVDA 4B43A 5FL7A 2FA9A 3PUWA 2QPAA 1E6CA 1TMKA 4LC1A 4S35A 1LFDB 5L3RA 1T8UA 4K8OA 2BMJA 3NBYC 4RZ3A 5EP4A 4HEJA 4C0KA 1RYFA 2FNAA 2OFOA 3N70A 2Q9CA 1Z47A 1CJVC 3ASYA 3O8CA 3ZDQA 4DCVA 2FFHA 4F4IA 3PQCA 4R2HA 3U5ZB 2GDJA 4Q1DA 4KXFB 2RKOA 5CM8B 4Q7MB 4IOKA 1V43A 3KKPA 3VX3A 4NYIR 4A2QA 3RS5A 3PR1A 2PL3A 4I4LA 4Y0VA 2WTUA 2GF9A 3L0IB 5KSZA 3RRYA 4A92A 1ZD8A 4G5QA 2LCFA 1E1QA 1GKYA 1DELA 2WWFA 2F43A 5KNCA 5AWFC 2JEOA 2FFBA 1H8ED 4WIAA 3QSYA 4MUBA 4B44A 3EPLA 2GZAA 4QBHA 1Y63A 5JSZA 1EWRA 5JBQA 2XNSA 2ZS7A 4RZ2A 1NIJA 1QHXA 5HTKA 2ERYA 3EIHA 5FBRB 1XEXA 4KV9A 1YR7A 2IS4A 2DWOA 4HB0A 4QHSA 1HUQA 2V3CC 1HURA 3W8RA 2PT5A 4PC3A 3NH9A 2O52A 4URZR 4GT1A 1NN1A 2NQ2C 3X2SA 5AK0A 2GHIA 1AQYA 5G41A 3TRFA 4JBYA 4D25A 1BOFA 2GCOB 4AC9A 1WBBA 1VCMA 2PBRA 1N6OA 4FWIB 3O47A 1WRBA 1AS2A 2WKPA 4B47A 3IUYA 5J5CA 3TK1A 4ZI3A 2JLRA 4RCZA 1CF4A 1Q21A 2F9LA 2J41A 2IK8A 2GEDA 2D4HA 4KFUA 2FSIA 2BCJQ 4ESHA 1IHUA 1A2BA 2FG5A 2J0VA 2GK6A 3KUDA 4KJZA 3UWKA 2CCJA 2WWYA 4PSAA 2IT1A 4M0LA 1NBMD 5FPHA 3PITA 4KBGA 2YC2C 1B0UA 1ZM7A 4M4SA 1G4UR 3GLHB 4ASUD 2D7CA 4MQBA 4O25A 4P4SB 1S2MA 3I32A 5CLQA 3SNHA 3VQTA 2OSBA 2GJSA 1E0SA 3WNCA 5EP2A 5JJKA 2VSXA 3RWMB 5JHGB 1E9AA 1NN3A 3QOFA 4PANA 2Z0MA 5JMTA 1G291 4PX9A 5A4JA 1VECA 2BKUA 2WJGA 4PHHA 2W83A 3B7GA 3FHCB 2ODBA 2AWOA 1VHLA 4V0OA 2BDTA 1D9ZA 1I4LD 5LB2A 1M7GA 3A58B 1XPOA 1UBFA 2WWWA 1IOZA 1VG1A 3CRRA 4F38A 3BIFA 3VX4A 4Q9LA 1A5TA 1KMHB 1W4AA 1FUUA 1KHTA 2J7PD 2ZSEA 4JVLA 2O8BB 1HA3A 2W6ID 2GETA 2ZRKA 2AR7A 3GCGA 4QKQA 4DRZA 3VR1A 1RFLA 2G83A 2IYWA 4HI0E 1L4YA 2GVZC 2CL6X 2VTKA 2GXAA 3FMOB 4N1AA 2G77B 3EPHA 2R9VA 2ZUCA 1QVAA 5E7IA 1GDDA 3L0PA 5CDFA 1J8YF 2JJ2A 3S1AB 1F5NA 2VHUA 4HAXA 1S4QA 3A6PC 2RH5A 4OI0A 4V0NA 4AK9A 3EZ9A 4AD8A 5KDLA 2YWEA 1AN0A 3U4QB 4IXNA 4PQYA 3JVVA 3T1OA 2J0SA 2ZVPX 4DWJA 3KTAA 3CWQA 1CR1A 5JJIA 1HE8B 1KDOA 4TLBA 2G9NA 5DNYB 3VKWA 3U44A 3RSOA 2ZITA 1N0WA 1RRPA 4AYTA 1ESNA 1UF9A 4NYJQ 5DE3A 4EPVA 3BRWD 3KJIA 5DH9A 1UKEA 1BIFA 2QMOA 3U3KA 2ASEA 3RDPA 4Q4AB 1QBKC 2D7DA 5TDHA 4UKDA 2UVQA 2R8RA 3GFOA 1SZPA 3KL4A 1X3SA 3E1SA 1U90A 1XCMA 1YE8A 5DN6A 4OYHA 1FQJA 4A2PA 4DBLC 1GUAA 4IDOA 2RB4A 5E95A 4KO8A 1NVVR 2HF9A 2VF8A 4TMTA 4EPRA 5KSPA 2E9SA 4Q1FA 4DZZA 1UM8A 3GMTA 4UXIA 2YZ2A 2ZUBA 1OFUX 2XB2A 3V4FA 3ZVRA 5UKDA 2XZOA 1XPUA 2R6GA 3KFVA 2YWHA 3HU3A 4PFSA 4ON9A 1J90A 2Z43A 2ZQ5A 1BMFA 5H68A 3F8TA 2F1HA 4MYUA 4DIEA 4ZKDA 3FE2A 2CNWA 1II0A 4JL8A 4ITRC 1TQ6A 4IOLA 2J0UB 1Z6YA 4K46A 2QPTA 1FX0B 3ADKA 1V5WA 4CEIB 1OW3B 1W47A 4IDHA 3I4LA 4QGFA 1E94E 1P61B 4P31A 5J4HA 1CR2A 1CR0A 2XEXA 3DPUA 4UNPA 2ONKA 1JBKA 5EE5B 1W36B 4GMDA 3G82C 1G7TA 1JJVA 4TLEA 2AHOA 2VP6A 2ZRNA 5G40A 3X1XA 1IXRC 2ZR9A 1F2TB 4A4DA 3AF1A 2JLZA 1GZSA 5B30A 2XZLA 1OXVA 3I8SA 2GBLC 5KOYA 2IYZA 3D6TB 3PEVA 1Q1EA 1JEDA 1OT3A 3LLMA 4LHVA 4NPHA 2AFHE 1Q3HA 1ZD9A 3TBKA 4PZYA 2BMDA 2KSQA 2WHXA 3BERA 2FEMA 1A2KC 2JLWA 1Q12A 2GCOA 3I72A 2NO0A 1EESA 3DOFA 1OHHD 4TYNA 3QPUA 1XZPA 4GPTA 4KVAA 4TYQA 3K9HA 3ONWA 3AP2A 3K0AB 1M1YE 4CEHA 5JWOA 1G8PA 4MUAA 2PMKA 3QXSA 4A15A 3EPKA 1G3QA 4H1VA 2ODEA 2PMDA 4OQLA 2QU8A 1JPNA 1UJ2A 4B73A 3AF4A 4URYR 1NG1A 4KCGA 1XD9A 1S8FA 1T5LA 2OCPA 3GLHA 4CDGA 4P4SA 3EASA 5EZ5A 2ZR0A 1HTWA 3DDCA 4JJKA 1SULA 5CLLA 3SJZA 2HLDA 4Q02A 2ZRJA 2BBSA 1Z06A 4O2LA 1U9IC 1U0HC 1ZC3A 3FVQA 1ZIPA 1MH1A 4A36A 3GJ3A 1VIAA 1KGDA 2OXCA 1YZKA 1Z2CA 2C78A 4BPBA 3Q85A 4JT2A 1R0YA 4N0DA 1ZM2A 2A2ZA 3DL0A 2F6RA 2HV8A 1FP7A 3UG7A 5HPYB 2RGNC 2PLFA 1KMHA 4ABYA 3EIQA 2ZSFA 3BH0A 2O8BA 3GJ6A 4D0GA 3D3QA 3RS7A 3U7FB 4XWAA 4Q7JB 1PUJA 1EFUA 1NJFA 1E0KA 2Z6VA 2D06A 2I3BA 2ZANA 4WOPA 3AV0B 3D31A 4WBSA 5TMPA 2OHFA 3WNDA 2HJVA 2R6CA 2A3RA 4JVSB 3B8HA 3ICEA 3EC1A 4FINA 2ZVQX 1NY6A 1R5NA 1WF3A 4X8MA 1C1YA 1EGAA 1FPMA 1KIMA 2O8FB 3T06B 1QHYA 1XMJA 4C0LA 3E2IA 2Q21A 1P2TA 1M7BA 2HJGA 2J59A 2D74A 3FYHA 3OEHD 3U4QA 3AVOA 5DLQC 4KBFA 2ZYVX 4IXMA 3B82A 2J1LA 1GL6A 3L0SA 2WWHA 3T5DA 5F9FA 3TSOA 2BWJA 4M1MA 3ZGXA 3NHAA 4J0QA 2VHQA 1NMXA 1FMLA 3ZIAA 2PJRA 2FGJA 2GRJA 2JIZD 4LBVA 1I4DD 3B5JA 3WNBA 4Q4AA 1Z0AA 5KNBA 1KYIA 4JT4A 2XTZA 4URXR 2QNRA 1TL7C 4DCSA 2C2HA 4I1UA 5SZIA 2GKSA 4R7ZA 1C9KA 1Q0UA 2X2EA 2WV9A 4Q1BA 2ZROA 2ZE7A 4UNRA 2XJ4A 4LYFA 3MG9A 4LWZA 3T1VA 2NO9A 2ZM5A 1DAEA 1ESMA 3AVTA 1K6MA 1PJRA 2I1VB 1KMQA 1JR6A 1B23P 1SVWA 2JLQA 2J9RA 1Q1BA 4JYBA 1TQ4A 3DO6A 3PUVA 4XTCS 4YMUA 3WYAA 1PLLA 4PPNA 1D9XA 1A4RA 1I4TD 1P9NA 2IYYA 2HDNB 1IN6A 3VAAA 1Z3IX 5CM9C 2YOGA 4LJ4A 3SOPA 4A8JC 4JL5A 2IYRA 4WVFA 1Z07A 4HLDA 4XD7D 2MMCA 4ZI2A 1NG9A 5TB5A 2QZ4A 5B58C 2J0UA 1J70A 4FW9A 4TN1A 2EQBA 3KFXA 3X1YA 1ZM3A 1EFRD 4TL9A 1FX0A 4CEIA 1NN0A 4JJZA 4EPXA 1JPJA 3K09A 4MKGA 3VNUA 2F9MA 4DT1B 4HAYA 1Q57A 3R8CA 1VG0B 3RLFA 2W2XA 4IEEA 3GJ8A 1KI4A 2IYLD 1N0VC 2QRNA 4UJ5A 1N3BA 5EUMA 2QL6A 2VP5A 3IEUA 4D82A 5GADl 4B2PA 1U99A 2XX3A 3BE4A 1KK1A 3ZVMA 3QPWA 3F0TA 3HP1A 4PXAA 2H17A 2OM2A 4DSTA 1F2TA 3AKYA 4NONA 2C99A 3REGA 2A5DA 2FJUA 4BEBA 1KO7A 1SVMA 2VSOA 4Z8XA 4PTLA 1E2QA 5LDDC 3GEIA 3U3MA 3A4MA 4XWOA 4XVRA 1Z08A 2ZR7A 1COWA 2QI9C 2NPFA 3QUSA 3LX5A 5AJWA 1E2MA 1RPZA 1E69A 3A4NA 4N3NA 2I1QA 3L8ZA 2OESA 4M22A 4Q9KA 3TW8B 2WPDD 1Z0IA 4BQSA 2ZJZA 4DUGD 3M0EA 5C4MA 2IS1A 3JZAA 1VTKA 2OUKA 2ZYUX 3K53A 5CK4A 5KPDA 2ZREA 4NMMA 4DCTA 4KSCA 4L8GA 2ZTSA 2BBOA 5LB4A 4TSFA 4QHYA 4TLCA 5FUYA 3AQ4A 3CW2A 5IK2A 3QBTA 1RJ9A 3MJRA 2WICA 1TU3A 4NE2A 1P7CA 4BFWA 5GVSA 2ZI5A 1Z0FA 5FL7D 1S0UA 2X2FA 2ORVA 2HCBA 1VYTA 2IYUA 1N6RA 2C98A 2VHTA 2EU8A 1AKYA 2W6JD 1TF7A 5CITA 1LVGA 1W0JD 2HXSA 5EE1A 4TLDA 1E2DA 1E9DA 5JECA 1SXJD 4AY2A 1NLZA 3MWKA 4TMZA 3W6NA 2KB0A 1Z63A 3LXRA 4I1VA 4DDTA 4NL4H 1XJCA 4MKIA 5EXSA 2PX3A 4GZMA 3ADDA 2WKQA 4FWTA 4BLQA 4KITB 4UJ3A 3EZ6A 4E22A 2EVWX 4D81A 5HCIA 3UPUA 2GJ9A 1OIXA 1P3JA 1ZC4A 3FKSD 3QVUA 3WYFA 3KQLA 1OIWA 4TT3A 4OBEA 3KXIA 3MWJA 3GLIE 4TL7A 2EYUA 3GJ4A 4OHXA 2XSZD 1UADA 3DM5A 1OYWA 4D26A 1WQ1R 2YWFA 2OBMA 5HZHA 1GG2A 1P75A 3C15C 2HYIC 1YQTA 1HH4A 4DLSA 2O8FA 4ILEA 1VCNA 2KI5A 2QE7A 3D7MA 5F3WB 4HLQB 1NBME 1XXHE 5K8LA 4AG5A 3GFPA 2ZSAA 3CRVA 3VKGA 2GWHA 3OEED 1ZVQA 3RYTC 4AKIA 3LW8A 3VU9B 1E2IA 3LFUA 3MUFA 4RFVA 5E4FA 4B3BA 1XPRA 3TJZA 1IY1A 2RCNA 4MGZR 4EJSB 1WDTA 4QBGB 1PLJA 4ZIRB 3LV8A 1N6NA 3BB1A 1WP9A 2NO1A 3R20A 4XVQA 3C4JA 3IEVA 2A78A 3ASZA 1CLUA 3W3ZB 2PT7A 2ZJ5A 2YVUA 2O0HA 3BXZA 3PENA 1CRPA 1ZMXA 4POAA 3B85A 4D2IA 5FOTA 2FOLA 1I2DA 1W0KD 3B9QA 4M21A 1SHZA 2DWQA 2BC9A 2IBMA 2XGJA 5HKKD 3TE6A 1G9XA 4RY2A 5LD2B 4MKFA 3THWB 4OKSA 4TWZA 5J4KA 1ETUA 2ZPTX 3CUEF 4HZIA 4L5BA 1O3YA 4GFDA 3R9IA 421PA 4XSGA 2GVDC 1XJQA 2CLSA 3B1VA 1R5OA 2QP4A 4PPQA 2ZI6A 1DARA 4MRNA 2CHGA 2CK3A 1YRBA 1KO1A 3PUZA 5DISB 2V1XA 2QA5A 2EWVA 2Q9AA 1N5IA 4MYCA 4FCVA 3HU1A 3SBEA 2WSSA 4D0LB 2J0QA 3GJ5A 4QHTA 3R7WB 1DAMA 4LK2A 1D2EA 4BFVA 4D4MA 1P9WA 1NLFA 3R9WA 3MGCA 1Z22A 4H9GA 2KBFA 1OFTA 1UDWA 4MA4A 1MOZA 4LHXA 5J4LA 2O8EB 4IOJA 3QBVA 2C9CA 5JCPA 1EK0A 4MRSA 1YR6A 4DT1A 1OB2A 4FCTA 3QKSB 2JDID 2Y8EA 3NH6A 1IN4A 1RIFA 3EW9A 1YZGA 2WIBA 3NIBA 4TMVA 3JVUA 3U6KA 1OKKD 3U2QA 1X8KA 2FPMA 3FDIA 4FCWA 4RVCA 3W5JA 1LW7A 1Z0KA 1G64A 2WKRA 1DG1G 4LC0A 2NGRA 4KFTA 2NOAA 2X77A 3ZQJA 4E03A 4ESVA 4TMKA 1OB5A 3DKPA 1W7AA 4XVUA 4BLRA 1G7RA 1QZXA 1XEFA 2FMXA 2P5TB 3UIEA 5BN3A 2HCJB 1T0JB 5HE8A 2IXFA 1DEKA 3LY5A 3AEZA 2C03A 3VR4A 1T3LA 4Q9JA 3O8DA 4V02A 1RKBA 2RMKA 1LY1A 2VEDA 1N6KA 1HE1C 4ZCLA 2WMOB 3T12A 3PVSA 4QC2A 4XIGS 5TVKA 2GILA 2V7QA 2G3YA 4MRVA 1QG2A 3BB3A 3CR8A 3P26A 4LHYA 3HPQA 4LI0A 4IRUB 2XNDA 1Q20A 1GIAA 1KO8A 2XXAA 1DO0A 1A1VA 3SEAA 1ZM9A 1RE0A 4K81B 3IILA 4GMXA 2E87A 2RGGA 1IN5A 1TPZA 4A6XA 2QORA 3PEUA 1E32A 2C95A 3LVQE 5DN6D 1LS1A 2OBLA 2WAXA 3WP1B 4WW0A 5D3MB 4C7OB 3CLVA 1XTJA 3BK7A 2JLUA 4DCUA 4ARZB 1KKMA 5FTNA 1KO4A 2ZRAA 1JALA 4QFMA 4RKFA 1QHHA 3KB2A 4XOIA 4Q4JB 1XWIA 3T1TA 4BRWA 5JJLA 2DFNA 4LYAA 2YYZA 4Q1AA 4BLSA 4WA7A 3PUXA 3IKJA 1DVRA 5DI3A 3CF6R 2YHSA 1BMFD 4NP6A 3AH8A 2OILA 1GKUB 2D2EA 5AJZA 5ELXA 1N6IA 2NO6A 5FTMA 4HLCA 4L4UA 3CPJB 4U7DA 3HWSA 1Z83A 4LV5B 3NXSA 1NKSA 2FN4A 2RGBA 3N5CA 3HPRA 1K5DA 3VHXA 4JLJA 1ZBDA 2BOVA 3NC0C 2V9PA 3WP0A 1RRGA 1XB2A 3KKNA 4HB3A 4HUQB 3QPVA 1ZU4A 1NMYA 2ZRLA 2LKCA 4FMCB 3QI2A 1WCV1 4PO8A 2IWHA 3THYA 1JI0A 1U94A 4NH0A 4ZCMA 1FQKA 1H65A 2Z5FA 4KVGA 1J99A 2NO7A 4JVNA 3SN6A 2GEVA 4WZ6A 1HT2E 2DB3A 5KU1A 2FGKA 2QENA 3VU9A 3ICQB 1AZSC 2ZJYA 4DKXA 1X6VA 5FBVB 4EJSA 3AF2A 1TTTA 2ZS8A 4FD2A 4ZIRA 2H8KA 4YXWD 1IJFA 1E98A 3FHOA 1XTSA 2VLIA 4W7SA 3GLFE 3H84A 3PIRA 4US1R 1SGWA 1AGPA 2YC4C 1P5ZB 2I4IA 2AKAB 1F2UB 4GNKA 4OHWA 4RCYA 4QNRA 3W8NA 3GLIB 1HY3A 2FDCA 2P6NA 3NWJA 4RSGA 1BH2A 3AF0A 3QEJA 4R98A 4EFMA 2EFHB 5DI9A 3FHTA 3A36A 3THWA 2PLRA 1E9FA 1OSNA 2FH5B 5DHAA 3NVAA 2IYVA 5EXPA 3IQWA 1O87A 2Q3HA 1XXHB 4HATA 2PEYA 2O8DB 4OI4A 1SKYE 3L0OA 3SJAA 2B21A 2IL1A 4YDHB 5FI0B 3ZZ0A 3D8BA 1ZCBA 3KQKA 2WSMA 3IBGA 4NCIA 5E3HA 4KYUA 1E2PA 4EPWA 2VHJA 3R7WA 3MSXA 4OK3A 1JJ7A 3OAAD 1R6BX 2ZRMA 5JI2E 4MRPA 2QG6A 1XF9A 5GJWC 3EZ2A 4D6PA 2ZRIA 2O8EA 1MKYA 4JSYA 1NI3A 2N1BA 5FOSA 4Z51A 1VKJA 2N42A 3SJCA 2GAAA 3WHLA 3OE7A 2P3SA 1FP6A 3QKSA 4JLPA 2NIPA 4LDJA 1GRRA 2O8CB 3K9LA 1U2RA 4LYJA 4CVNA 1W1WA 1Y3AA 3A37A 1M6NA 5E7JA 3BD9A 1SKQA 2ODWA 4HYYA 4QBFA 2XOKA 1KSJA 5FTKA 3TAUA 4TMWA 2HUPA 2ZRPA 1AJEA 3RNLA 1IAQA 1T3HA 2WJVA 3EWSA 4JLDA 4PAOA 3EWAA 1G41A 1UKVY 2DFLA 2DBYA 2FFAA 3EAQA 2FWRA 3ZD7A 3QG1A 4XWKA 3QEOA 1TAGA 4DLWA 3AVUA 4G0NA 4IDQA 3RAPR 3EIEA 4HB2A 4M9XA 1P62B 5CIQA 3I92A 2ZAMA 2R44A 3C41J 4KFSA 1U81A 4IFBA 2ERXA 1M74A 5C18A 1AIPA 1E2KA 4V0KA 2JAQA 3ADBA 2GNOA 5FFMA 1KJZA 1TEVA 4P4TA 3SE0A 3V00A 5JZVA 3CPHA 2ZE8A 5FOWA 4C30A 2BVNA 4A1FA 2VQSA 5AJVB 2DPXA 4BZQA 1JB1A 2JJ1D 2WOOA 1RZ3A 1AGRA 4TLAA 2FFQA 5GVRA 4PQFA 3FGNA 4KSBA 2BBTA 1ANKA 2CL0X 1P6XA 1KSGA 1KI6B 3REFA 4GP6A 1YU9A 1H8HD 1OXSC 4G5OA 3AVYA 3GLGE 1NN5A 4M9SA 1YZQA 4NYMR 1RC8A 1NSTA 4CEJB 3DKVA 1S1MA 1JR3D 1NY5A 5BWMA 5D3MA 1HQYE 1DPFA 3N2IA 4C7OA 1TQDA 2FF7A 4ARZA 1GSIA 3I5XA 3H86A 3LX8A 4IFEA 4CGZA 3K0EA 2ZETA 4DLVA 1VHTA 1GFIA 4Q4JA 4YLGA 3EX7C 5EXXA 2GA8A 3ZQ6A 4RD3A 4TTRA 1PLKA 2A30A 3QXXA 2PZFA 3QKUA 2P5SA 3P20A 3BGWA 1CRQA 1ZM4A 1LF5A 3NBXX 3OFND 4NU0A 3MLEA 4ZPXA 3DZ8A 4EPYA 3P1JA 3QQ5A 1QF9A 3I8XA 2IA5A 4NTZA 2BM0A 3UMRA 2OG2A 4HAWA 2P6RA 1KI8A 4M8NE 3OIVA 4B3CA 3AKCA 2JGNA 2OCYC 2OLJA 2YWGA 2KWIA 2ZI4A 4B74A 2OBNA 1X8JA 3NBZC 3QVVA 5CK5A 3MD0A 1FMJA 1CIPA 4IHQA 4E5UA 3KXKA 3HYRA 3RABA 4HUQA 3SU8A 2QMHA 5IRCD 2WJHA 2C77A
chains in the Genus database with same CATH superfamily
5B4TA 2OOKA 2B5VA 1SZCA 1EXNA 3R23A 1IN8A 4S2EA 4BKRA 3B9PA 4YRFA 1GZDA 2HTFA 2BI8A 4PXSA 1XYYA 2CEAA 3S8MA 2GJAA 5DO9A 4KLZA 4EW6A 3KQNA 5KTMA 3OUTA 3ASUA 5KEIA 1N7GA 3ZU3A 4HXFB 4OQNA 2PBFA 4AY3A 4B3XA 1MFZA 2HMUA 1PBTA 1CZNA 5TNXA 1YR8A 2D5LA 4QEKA 3DJFA 5IT9A 2QYTA 1IPEA 2VRWA 3L8FA 4X45A 2RH9B 4C4YA 5AK4A 4M8KA 3ED5A 5IAGA 4EECA 5BPHA 3M4YA 3OKFA 1LTQA 1WZ2A 5K01A 1JKJA 2JJMA 1QNLA 3HV0A 5DOZA 2H00A 1L4UA 3BJEA 3MK31 4B0PA 2XWJI 4CCAA 4AF6A 3GLIA 2P2LA 2ZYTX 3C3PA 3L82B 5D51S 4QXPA 1CERA 1O5IA 3ETLA 3IUMA 4G0OA 1QHIA 3O7WA 1SRQA 3P27A 4JCOA 4K7JA 4IIEA 1UQUA 2P90A 4BLOA 2JGLA 3U7GA 3LG2A 4MQEB 2PV0A 3FFBA 4BN0A 4RD1A 2FX5A 4KE7A 2V5VA 4I6JA 4FMPA 2B99A 2GXSA 2BKAA 1MCZA 2CD7A 4RO0A 1ZOSA 1G98A 3PC3A 2C58A 5B2ZA 4R2IA 3IO3A 3C1TA 4QG7A 4MPRA 4W5JA 1TZCA 1K75A 2PWAA 3DYVA 2C3PA 1V16B 2RAUA 2VR1A 3DT9A 3R6GA 3T8YA 3VOTA 3ZX4A 1G2PA 4HAZA 3ROFA 1ZL2A 1X9HA 2Q5OA 2WTBA 2CVQA 5D8DA 1KP3A 1X7XB 2Q1WA 4KIUA 1U8YA 2QAGB 5KOIA 2C0QA 2H9AA 1D0SA 4EI9A 1CDEA 2JAOA 3FCCA 1YDMA 3KSZO 5FL3A 1Y6ZA 4JJAA 1F6WA 1XHLA 3FCXA 4QJ3A 5JCJD 3C7KA 2EZ9A 2GRAA 1Z6ZA 2VXOA 4CKEA 4L4YA 4DMMA 4I4TB 5EPUA 3WL4A 5GJCA 1WDWB 2VL7A 3GCDA 3IQXA 3V8RA 2AN1A 3ANMA 3X1DA 1MRSA 1DC5A 1E99A 2BGTA 2HO4A 2WAMA 3G89A 3VZRA 4H59A 2BGKA 1GAWA 3KT0A 2GAJA 4O4HA 5AUQA 3ZU2A 3VR5H 3BD6A 3CWZA 2R7LA 3HBLA 1QXSA 1Q1QA 2OV2A 1W5BA 4CTOA 2Q3EA 2I9PA 3SY8A 2ATCA 1U2ZA 5LSAA 2FVYA 2VK2A 2RGUA 3NC1C 3TSWA 2OECA 1SBQA 4RL4A 4GQAA 1Y8QA 1NDHA 2PS3A 4ALLA 5AKHA 1KA9H 4L22A 5AJUA 2NUAA 3E7XA 1T4GA 5F7JA 1VI6A 3VTFA 1YE3A 1BCSA 3PEWA 1GAEO 4QU0A 1CU1A 3VR2D 2GX6A 5F33A 2IP4A 2BCEA 3SM9A 1XMXA 4CMAA 5CVCA 4S3MA 2AC2A 4BQEA 5G4KA 1WABA 4QU8A 1UZLA 3TTXA 1N33B 1K27A 4K40A 3UJBA 1L4NA 4TPKA 2XNKA 5JWHA 4ZI7A 4OFBA 2BFOA 5T4FA 3SIPA 2GBFA 5KTSA 1TM5E 3KOOA 4X62B 2PKRA 2AQHA 4NYIQ 1YHNA 5M5BA 5AJXA 1J2JA 4G1BA 3O38A 2ENWA 4F12A 4XJSA 5EJGA 1EVJA 5BNIA 4B3RB 3ZPXA 2K2WA 2VJMA 3GMIA 3K31A 4OK6A 3OE1A 4YS6A 4RJTA 2K5UA 1IOWA 4HUJA 5AW3A 721PA 1CLEA 3K5HA 4YFYA 1DXOA 1H05A 4CU2A 3ERCA 1GQYA 5JDCA 3M6LA 3GUVA 1WULS 3O3OB 5DP2A 4ZEVA 4M9CA 4ZI7B 2XMRA 3WG9A 2PH1A 5KVVA 4GYJA 1XVUA 4QYSA 1MPXA 2IZ0A 3UNXA 4O3MA 1U0TA 1YONA 2VP4A 5DTEA 2B25A 3SBDA 5HCNA 4TZ6A 2ZYHA 3NALA 3T38A 4DDHA 3CNNA 4YUYA 3BQ9A 1UXGA 3CISA 3D0RA 4UEJA 1QRDA 4BNUA 1Z39A 2B7LA 3DMTA 2Y3IA 5KDDA 3KOMA 4RPCA 1FXWA 3UWOA 4AECA 2W0MA 1Z8FA 2FW7A 1NF2A 4J1TA 1T6YA 2AJCA 2RB5A 2VATA 2WYWA 3JR3A 3LHIA 1VPTA 3OM1A 4HFMA 1PAUA 4G24A 4WT7A 3TDMA 4FGWA 4IHAA 5AHOA 3MWYW 4MARA 4DIOA 3OCXA 5I5EA 5KZMB 3CNLA 3KJEA 3UHFA 2HA4A 1G60A 1YJ5A 1XSEA 2J4CA 3LGAA 4ABTA 4BIIA 2IYSA 2WBLC 2GI4A 5KKAA 3KXPA 1GWNA 3MFYA 1ZU5A 2QVCA 4V0SA 2P6UA 3Q87B 4REMA 3GLGB 3PGVA 3JRWA 3WNQA 4BMNA 4YRSA 2HOQA 1L5RA 4L07A 1TRHA 3QGMA 5LYJB 2PU5A 4DKJA 4TUYB 1CDOA 5FV4A 2O3RA 1M2VB 4UCWA 2O7NA 4DIBA 1MGOA 1IZ0A 4BVFA 4ETNA 1RACA 1XR3A 4KXNA 1ESCA 3B1XA 1UEJA 2YXDA 5G0WA 2E85A 4BAGA 4B2IA 5A03A 4X66B 2BEVA 1PZEA 2ZRDA 2XVZA 1UBMS 1EDEA 2RFLA 2HRQA 4ZAZA 4XM1A 4D9KA 1JQLB 4EI2A 3F46A 3O4JA 8OHMA 2H2AA 2QROA 2GCPA 4QNNA 5K09A 1GOTA 2Y1DA 1DL5A 2RHWA 1ZLYA 3OX1A 2XV1A 3BWVA 2AB0A 4JB2A 1E9RA 3K8QA 4JGGA 1UBOS 1S9DA 4KLNA 3L77A 3EZXA 4JELA 5EMMA 3K0AA 4Z1OA 1XHEA 1KI2A 1NE7A 1YL5A 2JGEA 4I1YA 4MKRA 1E3IA 4F3TA 1AO0A 4E15A 2JVKA 3MYYA 4HDKA 4BDSA 1E2EA 2MSCB 3JZDA 2OORA 1N92A 2KE5A 1OGYA 3ENVA 4PW0A 3IHLA 5TQ0B 3IBYA 1YQDA 2FMUA 2R62A 1ZD4A 2VHCA 1RMTA 4INZA 3H2HA 5EG5A 3N59A 1GRCA 2W43A 3OU6A 1FRFS 4G36A 3JD2A 1OD6A 4K9RA 5EMHA 1R8YA 1H2ZA 1P5HA 4UCQA 4ES6A 1NQAO 1AUVA 1NYTA 2CT8A 3MWLA 3ZQUA 5EP3A 2OZKA 3CONA 1Q3KA 2NXWA 3DEAA 4RFSA 1ZHOA 3AOEC 3WJ7A 1R4NB 4GSKA 1GCOA 3F9IA 4NU6A 3RHFA 2E4ZA 2X5NA 3K2QA 3GNQA 3E18A 3ORRA 2WWXA 4RTSA 4NOKA 4TTJA 5L7YA 5TJHA 1AH2A 3NGMA 1M2FA 4RTNA 1SVKA 1M2JA 1V8BA 2QRMA 3EEQA 3NO4A 4H1HA 5B12A 3NDJA 2PRKA 3DXFA 2B1RA 3G8BA 3QEBZ 1TJ3A 3IO5A 1MC4A 4FYPA 1SXJB 3KOZA 2YIMA 3DYIA 3J7TA 5KYUA 2FY8A 4B35A 2R7MA 1MG5A 4LDZA 3C16C 1OPRA 5HWSA 4B3GA 2P77A 4L5AA 1KY5A 2ONZA 3NCTA 1E5QA 1XCBA 2ASVA 1LZLA 2JIRA 2VTEA 1A9PA 4WNAA 3QPDA 1WB6A 1XI2A 1OWMA 4WZAB 4C0BA 2ZZNA 2PDAA 5CA0B 3AV3A 3LCMA 4AJHA 3Q6IA 2W6MA 1XD8A 1Z37A 4ZODA 2TECE 2AQKA 3FGPA 4DBLE 1W6UA 2WVHA 3WVNA 3EFBA 3S2YA 2JD2A 3QF4B 4OBBA 3LYLA 4CIVA 5C1PA 3SVZA 3ET4A 4UVEA 1A3CA 2YCLA 2B4AA 3K8YA 3SR4A 2J8ZA 1W8IA 3RFUA 4I2VA 4KIGA 2OHXA 4IXDA 3P0EA 1Q7RA 4Y0AA 3B1WA 2XWBF 3BEOA 3GN2A 521PA 1R37A 4GYYA 4QLOA 4S1TA 5CPBA 1PJ2A 4PHGA 2XCQA 4YAOA 5JS7A 4UU1A 1WIWA 4HGOA 2A5YB 4XJTA 1K2WA 2Q1SA 3ZGYA 4D1YA 2QQ0A 1JR4A 1GZ4A 2JASA 5AOAA 3ED1A 4DIMA 1EX6A 4PO3X 4DNFA 2PL9A 2IXGA 4X64B 4R9RA 1ZUNA 4ZCPA 3HHPA 5BQ5A 4B82A 4BMYA 3A0UA 2X9NA 2H5EA 4MI3A 4UTRA 1PFGA 2PKWA 3G9QA 3EK2A 2C1XA 3ORYA 4RH1A 3USCS 3UAOA 4ENUA 1ZH0A 4ZZIA 3WLKX 2UDPA 3E8XA 1Z29A 4HPJB 1X7HA 2JIZA 1AQUA 3W3AA 3RVLA 4BNWA 3HDVA 1QP0A 4HN2A 1RWVA 3WJ2A 2B1IA 2G1KA 5LM3A 2QW0X 1LPOA 2YWXA 4JLMA 4X1YB 3Q2IA 5C0OE 2IRWA 4AJPA 4RTLA 5ALVA 5KX5F 3S55A 3L9XA 4WY5A 2GFHA 4H4EA 2C2GA 1ZMBA 3DTVD 2ID4A 1WCIB 2JI8A 2WDZA 3OY7A 3L7LA 3F47A 1OFHA 2IF0A 3UK0A 4OI2A 4PLWA 3CG4A 3WLSA 1TMOA 2BFDA 3BM5A 2KJQA 5EUCA 1UM9B 4DFDA 5I7WA 2AOUA 2PZLA 4IV5A 2DFVA 1J42A 2ZJOA 3NNDA 3DZGA 1R9GA 2G71A 3JAWB 4OJQA 4FVTA 1V2HE 5C1OA 1I2AA 4DV2B 4G41A 4KRXA 1E6UA 1KFBB 3E3MA 1UT5A 1IM2A 4ZEOA 2H2WA 5BSKA 4LNUA 4WUVA 5EWLB 3HUTA 4LXGA 4DILA 4EY8A 1MO4A 3OIUA 1C0LA 1UBNA 2D3TA 3KRTA 4H31A 4LG1A 2DR2A 1GRQA 2YY5A 2CEKA 2PJUA 2O3QA 4QUBA 3TX6A 2HQOA 4NG5A 3UB2A 1PTKA 2YRWA 2RK6A 2OSVA 3K9CA 5K0LA 2BKLA 2Q27A 6PFKA 2QUIA 3FNBA 4NU8X 3AY6A 1T0HB 3BOSA 3VDQA 4CMEC 2RG1A 3J7AC 1KJNA 1W4BA 4JEMA 3U4MA 2Q1YA 1P7VA 2P68A 3NTOA 4MULA 1U3GA 2XUKA 4R8RA 5JIBA 1F60A 1SHKA 2EGGA 3RUCA 4H2DA 2F8SA 3KOYA 2J0EA 3N7AA 2R8ZA 1FW8A 4BFXA 4MQUA 1R3DA 1R15A 2GN8A 5GJBA 5DGDA 3RNLA 4BRUA 1L3BA 2R6FA 4HMPA 3K4QA 1KRXA 3SLRA 2H4XA 4QDUA 3E0XA 1W88A 5A4MS 5LFAA 3RG8A 2OHIA 3G2MA 2AYZA 2EJCA 1XZLA 2C04A 2WWGA 2YJNA 4C6TA 4DYVA 2C42A 3SQWA 4HB4A 1Z2AA 3INTA 5SZKB 3EDMA 2IOYA 4DR7B 4OPMA 4M6WB 4EAQA 4DDWA 1GAJA 4AULA 4R54A 3U3XA 1TGYA 1VLJA 1NA5A 2HDOA 2FW8A 3QLUC 3U4GA 4BU1A 3FNRA 3LP8A 3W6OA 4GOKA 2CMDA 1X2EA 5J4YA 2QLMA 2ID7A 4HWGA 3VR6A 4F6RB 2NU8A 2NVUA 5JXIA 2PX0A 3IJPA 3UJ6A 3OLQA 5DGCA 3D4BA 1PQYA 4IIJB 4KMRA 4TKLA 5BRAA 2IKQA 2Z1MA 2AFRA 1OVMA 1YS7A 3CGWA 4Q18A 3EHEA 3I1IA 5KSYA 4TMXA 4WSOA 3HWRA 2FOXA 4RDXA 4QM6A 1HF3A 2HL6A 3EVTA 3LDAA 1FY2A 3B1KA 4DTIA 5A02A 2RIPA 3L4JA 3QYPA 3I37X 4NARA 5DT9A 1I80A 4QASA 5EKDA 2AH5A 4HDMB 5K20A 5JWRA 4G2TA 1RQLA 1TTHA 2ZRGA 3QKTA 4FLEA 2HK6A 1Z0SA 3L6BA 4UTXA 5LD2C 1MENA 4PQRA 4UTZA 3VR5A 2OV3A 3WZ2A 1XO1A 2G0TA 2ZJ4A 3JYOA 1Z6PA 2X7JA 3HNPA 4KIFA 4RA9A 1OZ0A 1U8TA 2P4UA 5DIZA 5C3UA 2F7SA 4BZZA 4HZUB 3H2YA 2BSXA 3PLAE 2EBWA 1XP8A 2AWNA 3OWXA 1BHJA 1VMAA 2EBUA 2I8LA 4AYXA 3QKRA 5MN6A 1QQTA 2F8MA 4TQAA 3L6EA 4AF7A 3NAQA 1XCGB 4IKEA 5EXTA 3HC7A 3I73A 4EQZA 3OOEA 2X1MA 1XEWY 4RPKA 4YDRA 1VLMA 2VPXA 1OPXA 1PR1A 1HQCA 2C96A 1GG5A 1SBCA 2GEJA 3EGWA 5EJEA 2B92A 4PZ0A 1U3WA 1WUJS 1E0AA 2YDYA 4IIYA 3ZWOA 4ARAA 3FVVA 2GYVA 5BQ3A 5KQPA 2WUFA 3MGAA 4P32A 3W5IA 1BU5A 5T67A 3LU1A 4KNVA 5AXDA 2UZIR 3SFZA 4R2KA 3RYCB 2CD9A 2DBQA 2M2IA 2IPMA 3BREA 1M1XB 2XHZA 3JATB 3O0TA 4DLXA 3CEPB 1MAWA 2IIBA 1MO2A 3BUSA 3DO5A 4AYWA 4ZCIA 1Q3TA 3RBXA 1NDQA 2K2QB 4CIXA 1CDDA 2Z8YM 1PV2A 1FTNA 1Z7WA 1ESZA 4IG9A 3WKBA 3ZS8A 4OMDA 4YRKA 4CU5A 4K28A 4MVJM 4JLVA 4NBWA 5GIOE 4QOEA 3PLNA 2JI9A 1X15A 2RK3A 3SZOA 3CLUC 4LRTB 4NENB 3B9RA 3VOBA 2C7RA 3ZZMA 2L0XA 5BNTA 3WICA 1I8TA 5DN9A 1RM0A 1JYSA 2ZEJA 2ZI3A 4A9AA 4Q4HB 2C92A 1NLMA 1LX6A 3URKA 5EZSA 4BFYA 1XDDA 1GKLA 2HRDA 2XTNA 3PNLA 4RS3A 2W2TA 3E9QA 4FEGA 3DQZA 1C0PA 3EA5A 3FMFA 5L3SB 1AKRA 4UNNA 3SX0A 1MQSA 1U1CA 2YINC 3STHA 2H1IA 2GCIA 3KK0A 1FZQA 1MB3A 5ALUA 4PFKA 1RHRA 4EDHA 1BS9A 3OF5A 4L8FA 3FNGA 4FMBB 2YOFA 3Q8MA 1Q44A 3GJ0A 3P71T 3PHLA 4I4TF 4YAJA 4RYDA 1H1LB 4F06A 2WWIA 1IM5A 2BHTA 4CEHB 2GCGA 4DS3A 1LVHA 4OQMA 4LOAA 3RVDA 5E0KB 5EE0A 4DE5A 3CVYA 4B6OA 1QRUA 3MERA 5KI6A 4LY0A 3QVGB 1NHWA 1TCVA 4KU4A 5FADA 1NSYA 2PLAA 1M0WA 1UZMA 2G70A 2XWSA 3B78A 3VNSA 1YS4A 2W00A 4HXYA 3QFSA 3ZZUA 4L6CA 3OTWA 4WK4B 4YAWA 2QM3A 3L2OB 3I04M 4B6EA 5IKXA 4EATA 3FPBA 2A1IA 1UQTA 1CE8A 5BN4B 3DE7X 4AJ9A 1ZNZA 5AUNB 5BW6B 3H9GA 1Y8ZA 4BKOA 1V45E 3O31A 4N48A 1G8FA 2PD3A 2HSZA 4ZVQA 4NBSA 1FNMA 3T15A 1RLTA 5ER6A 4V1CB 2NV2B 2J3MA 4C4TA 4YV7A 3OIYA 5KKNB 1WQ3A 2GYUA 2JAXA 4XPIA 4ZU3A 2QI9F 3VAZA 1T6NA 4EELA 2BIFA 2JLVA 4WADA 1TECE 4CDMA 3O8NA 2REOA 3CLKA 1H0SA 3SQOA 3RT7A 2V7XA 1KDRA 1RPTA 1YGPA 2PSJA 2VOJA 4NFSA 2H06A 3B9BA 1BMDA 3R3HA 2BMFA 3MTBA 3U40A 4OHZA 4PNZA 2O7SA 5TPWB 1XXLA 1GGMA 3OA0A 3EW7A 3NHZA 3L7BA 1AKQA 2BGLA 2FWBA 3OC6A 3WMFA 1RKQA 1NQVA 1UBEA 2Q4DA 5IBRA 3JQ7B 3WGYA 2QKYA 4RTOA 4EG0A 4QDKA 1DQPA 5HS6A 3VGPA 3REQA 4RH3A 1FNBA 4K0RA 1ECBA 2FXIA 1UMCA 3HN2A 4AJ4A 4M9ZA 1XKTA 4L4ZA 3GDGA 2OXIA 2VWHA 3W6PA 2PZKA 2HSEA 3KJXA 2CCKA 2XYPA 3UFBA 3HWX1 2L18A 2VPPA 4J4TA 2W6CX 1G3IA 4S1OA 3SGLA 3OZGA 5KVAA 1X1RA 4ZI7F 4QD3A 1UP7A 1TIBA 2HI0A 2LUOA 2XF2A 3OBIA 4U2BA 3D2AA 3M34A 3Q9SA 4GPD1 3G6KA 4CF3A 4ZQFA 3WRWA 3MJEA 2X2OA 4JJ8A 4PS1A 1XEWX 4X20B 1E66A 1ZGHA 4Y1RA 4ZEMA 5EUQB 1KOJA 4Q0MA 3THXB 1IUOA 2WTEA 4AF8A 5IC4A 1X1BA 5KNBD 2R5NA 1XMOB 2ZRFA 4OP3A 5K3OA 3E81A 5CJPA 2F9FA 5THXA 5IMSA 3NDBB 4EKYA 1FSFA 2UUCB 1U4SA 2YZ7A 3DOJA 1PQWA 2NLOA 3K92A 4OJTA 4CM4A 3LRPA 4REQA 3ADOA 5DSTA 2RARA 4KWTA 3WY9A 4HUTA 5KPJA 3IQGX 2QTVA 1E3EA 4ZZ3A 5A9TA 2XUGA 4AT1A 2R1VA 3LZDA 2NYAA 2EJUA 1U65A 4ID9A 2C7BA 3CG0A 3AERA 1E3MA 1UFQA 1NU6A 4F97A 2HQSA 3KZ1E 3A1EA 5LYJF 1T8WA 2J45A 1E9SA 3MC1A 1NXQA 5FA6A 2W48A 4B6QA 4EB6A 4LX8A 2HMVA 5D7NA 2QHXA 4C1NA 1CZLA 4UEQA 4XUEA 4TKVA 5K8IA 1X7DA 3FWZA 4B9EA 4YDQA 4EGSA 2AXPA 5BYAA 3UG6A 1KKLA 1ZRHA 2FK7A 4HRYA 5AO9A 1Y6GA 2FPGA 3I3OA 2CNBA 4C87A 1XOIA 1WU8A 1ZRSA 5KHAA 5LNK6 1YCHA 1CF2O 3EDCA 3HFJA 3R6DA 1Z68A 4ZVMA 1UPTA 2NTJA 5FQOA 3RFCA 3G9UA 5ALXA 2H9YA 3P9SA 4JBXA 4B2LA 4D3YA 3DDWA 2QAJA 3ILSA 2GNPA 3NDIA 3H87A 1IG0A 4GX5A 1D07A 4BGIA 5JATA 1Z0DA 2YIDA 4RUKA 3CNEA 4JLUA 5FBQB 5KO2A 3OICA 4XXHA 3CZPA 3LY7A 2ZBEA 1OE0A 3NAGA 4EA7A 1P77A 3JQAA 3PDIA 1SKBA 3DKRA 4IF4A 4WQMA 3T5TA 4PLZA 3FDFA 4QGHA 3DVLA 4H4CA 4B76A 4QXMA 3E7PA 3FR8A 4MWSA 4EIWA 1E79D 1NQOA 3QYJA 4I5FA 4X7PA 2IH4A 1SXIA 2X0DA 4OLBA 3DB1A 4NHOA 3UM9A 4D0SA 1GITA 1GCUA 5JQWA 2QDKA 1DO8A 3F1KA 3LT5A 5DWDA 4RMNA 5BSTA 2XT9A 1BHSA 4TMFA 5D3QA 5LP6C 2ZSIA 4D97A 5BORA 5IF9A 2JNWA 3QHAA 8AT1A 3L7IA 4CR7A 2ZZMA 1IG3A 3HBNA 3RC8A 4MMXB 5JPIA 2DH6A 1JG1A 3RIYA 4AO8A 4JDUA 4JT9A 2PZEA 2WJ3A 3F6CA 3S6JA 4KE6A 1B93A 3WV5A 4A27A 4DPKA 4RD6A 4G63A 2FEKA 1GTG1 3R6LA 3UJHA 3UPTA 5JFOA 1BX0A 4X1OA 4RE5A 1OR8A 5I9MA 2YYSA 5ICCA 1YZNA 1NBEA 4I81A 4BJ3A 4YUWA 4ZA2A 5BOSB 3VNAA 3V46A 1KVRA 1L7MA 3ICWA 1NASA 4KQ6A 4AFNA 3ITDA 1WXGA 2CHQA 3GQBB 3KQHA 2ZE5A 4AICA 3BN3A 4R7GA 2MT9A 3NU1A 1E2FA 1WVIA 2Z1NA 3OA2A 2AD5A 3IA2A 4PHFA 3EMVA 2Z6QA 1D2AA 1PP4A 3UMRA 4BBZA 3PGMA 4YJDA 5CBPA 2PRSA 3PUHA 4DNPA 4UVHA 4F91B 2FWMX 2CBGA 3DBHB 3ZS9A 4KQHA 3EIUA 2ZT6A 4L50A 4MPDA 4RHTA 2FJPA 1XMVA 4KRFA 1ISGA 3GHHA 1C81A 2J7KA 4WZBE 4KMMA 1PL6A 4CM8A 4DV5B 2PGAA 2EKDA 3FOFC 1S3IA 3H18A 4IF6A 5T6BA 4B5KA 3UMMA 1MABA 2C9DA 4RHEA 2DT5A 3PX3A 3BH7A 4G0QA 3KVYA 2YNMA 3FGZA 3GA0A 1V2GA 4KPUA 4J49A 4RV4A 2JJQA 3BTOA 2DFPA 4LHWA 2NPOA 3O2QB 1BEUB 2WUGA 1U98A 5L4LA 3PYMA 3H1GA 4HVAA 4BE4A 1GPLA 1LZKA 4CG0A 2XCOA 2UXBB 4NLLA 4QDJA 4Y30A 4OHBA 2GLXA 3O92A 4A8TA 5JVDB 2Z57A 4MYDA 4Z9BA 3PFNA 2Q5LA 2PQ0A 3RK0A 2Y76A 2Q3LA 2XDAA 1VKZA 1XTRA 3IHTA 3OP1A 3AUUA 4M49A 3VDRA 3WZMA 3ZY5A 1IZ8A 3EIWA 3ZD8A 4C0HA 1G7CA 2A5LA 4BB0A 2EJVA 3ZYCA 4DC9A 3Q98A 4QQRA 3MOIA 3D6HA 1VKRA 1Y82A 4OB6A 4MPJA 5IW8A 1ZVKA 4BMXA 3D2LA 5BXYA 2G0NA 3RUIA 4DSAA 2OEPA 1JQJC 2O20A 1NXTA 5B3AA 5T3YA 1Y6QA 1AA6A 3SQXA 5TS2A 4DSUA 2FQ1A 3ZNNA 4EYKA 3U7HB 1M0TA 1Z15A 2FZEA 4MI6A 3I61A 3ELBA 4YTEA 3QG5A 3LP6A 4QGAA 2IP1A 1Z7GA 4QODA 1U6KA 1QSGA 1CJBA 1XAJA 2QX4A 3G2IA 2PIAA 1R7RA 2MU1A 3CSUA 2P2YA 1ZCAA 4J0DA 1RWMA 5DBGA 2XB9A 1J07A 1CG6A 3ILYA 4AJOA 4DG5A 2ID9A 4QDXA 3LY8A 1NQTA 4LF6B 1RM4A 5K6RA 5H80A 1Q0TA 4JEIA 1JSCA 3QE0A 4K6KA 4OGKA 1XN1A 4DAEA 1H4TA 1WM1A 2BFBB 4O5OA 1NKTA 1TO1E 1W93A 3CX7A 4AMGA 2PUVA 4FLFA 1QIFA 3A3NA 5KYYB 4RWEA 1W8DA 3LKVA 5BYKA 1E2BA 4BAUA 4PE5B 2XCRB 2NT3A 2RAPA 2BEJA 2UYGA 3NUZA 3QU7A 5EHQA 4O2AB 3UMBA 5LQNA 3W5CA 2GTIA 1ODFA 4QJ5A 4BO3A 3OZBA 3ISJA 5EIFA 3RS0A 4Q01A 1AA9A 1VYUA 2D13A 5JRZA 4OL9A 3UB3A 3WYGA 2YJ4A 5SV2A 1NRWA 4OUDB 3UN1A 1L7RA 5BXQC 4EA8A 4EHFA 5CFMA 1QKKA 3LCUA 1Z5WA 2I29A 2B69A 3ZV3A 5JYCA 1W4RA 1QONA 5IJ0B 3D3JA 3SSMA 2JFBA 3KJFA 5C1IA 4F2WA 4F6LA 2I62A 1KK3A 2R5FA 1T2EA 4DA7A 2BM8A 3TVDA 3VU0A 1DDGA 4LI3X 4XYLA 1DOHA 1JLLB 3AYZB 1SCNE 2DPMA 2IYXA 3CBQA 4IZHA 3UY4A 3BMQA 4LJKA 1M9NA 1XNHA 1KETA 3M6FA 1JQDA 5LDHA 3OJCA 1E60A 3K30A 3RSSA 1WEHA 2R85A 2V8OA 3C3YA 3ZUGA 3TTYA 4B4UA 2CZGA 2OFXA 4OH7A 1VJRA 2CC2A 2ID8A 4AY4A 3L92A 3KUCA 4M1TA 1SELA 3SLKA 2CMGA 2HRBA 1EA7A 1D0VA 3L0CA 4X6XA 2ZIVB 4IIJF 3BORA 3EGDB 1E8NA 4AWBA 3SX4A 5DYYA 4XJXA 2O2DA 3LPNA 2Z95A 3H17A 1ODLA 3O9MA 2DT8A 4TKZA 3T3OA 1PVOA 1V8ZA 2IW3A 4M54A 4G1UC 5DNDA 3VR4D 6AT1A 2WM3A 4N47A 2PBLA 4CKBA 3VPSA 2OV1A 2D6FA 2QXYA 5A4FS 1WVGA 4Z9AA 1U6IA 4LOJA 3UT5A 5J3JA 1B8OA 4JA0A 4Y6OA 1MGPA 2X40A 1GKKA 2Z4SA 2JCYA 2IS6A 4M0UA 3NCHA 4PG6A 4CKYA 1NJGA 1L9XA 3IT2A 3NVDA 2O0LA 3R77A 4YMLA 1A97A 4KDRA 2NO4A 4L9AA 4QUAA 5CYOA 4ER3A 3MQFA 5DVZA 3MPUA 2IEAA 1FMFA 4KPYA 1P31A 1S2DA 3GNSA 4Q16A 1LPAB 2FOIA 3ECSA 2YOHA 4A6PA 3BWEA 2QOEA 2UVPA 1MU0A 4F5DA 2CDAA 1JQKA 2WWTA 4MR8B 3HB4X 2J9ZB 3TJRA 2YICA 1ILWA 1V9LA 2E4UA 4LBYA 4Z9YA 2GXQA 3A10A 3RS3A 3H0KA 2OHOA 2R8EA 1KZGB 5F3DA 2WEKA 4HQLA 3ABQB 5A3QA 1P74A 1DZ3A 1ML4A 4NXNB 4NY1A 4XARA 2PWBA 4A8JA 9MHTA 3KKMA 5DM4A 2HW8A 4ACAA 3A11A 5B5SA 3LXXA 2DXIA 1TQ8A 1P18A 1WEKA 3DBRA 3OVMA 1XT6A 5A4KA 1G18A 2HIHA 3B6EA 2ZIAA 5CLGA 2W6OA 5FUWA 2JA1A 4MQ5A 3TTSA 1QHHB 2NUPA 4L16A 3F3YA 5E8RA 1M7HA 3KZMA 4HTAA 2FPLA 2RJNA 2WW8A 1K68A 4CNQA 1R8SA 4JP3A 3F5MA 3TW0A 1J2TA 1D7AA 1XDUA 1PZNA 4B3IA 1FRZA 1RHKA 3GDFA 1WBDA 1KJYA 4BFCA 2OFFA 4TZTA 1PZFA 2NTVA 5AVVA 2PS9A 4F9TA 1FVXA 1NVEA 3KB1A 2BTOA 3GAMA 1IULA 5EC8A 1JZSA 1F6BA 1EM6A 3TPCA 3ESBA 4AJLA 1AVTA 2F43B 1C9MA 1YK1A 3T0FA 3TXXA 2NU9A 3HB7A 4CZ2A 3R5HA 4FDMA 2RC6A 4KR3A 4MVWA 2XMDA 1N2SA 4NRDA 4WFJA 1Q83A 2B0JA 1CK4A 4JH0A 4LCBA 1QLJA 4OLHA 2QT1A 5JLAA 2VRBA 3ETCA 1PSZA 4I55F 3AVXA 1MORA 2ZKIA 3O8BA 3PQ3A 3FVWA 3ONFA 1EH5A 1QPGA 1Y3IA 3B60A 5IZ4A 1XEXB 3WAJA 1EHCA 3CEJA 5DGXA 3IAHA 5CD1A 4G5SA 1UWKA 2JIMA 3NEJA 2FEPA 3ETNA 4QREA 3K9WA 5B57C 4LZZA 2ZR8A 3T7EA 3VR2A 1DDIA 2ZIUB 1V25A 3C4VA 4WBNB 1TEZA 1SIUA 1JNYA 2PT6A 3N6VA 3Q0IA 3ZHYA 3ROMA 2QD4A 5EI5A 1ISSA 3DTNA 1KPGA 1KSHA 3B3QA 3LCRA 3O73A 5CXXA 4B17A 1W4CA 1AU9A 1P39A 1L4EA 3E8SA 3ND7A 3QVJA 1NDUA 3IAM6 3MLAA 5GGYA 2QUKA 1B42A 1LGYA 1OXKB 1XRMA 1BQ4A 2E82A 2J33A 2GN1A 4ZWNA 1U2DA 2YN0A 4ATNA 4BV8A 3EZ7A 3NB0A 3P9PA 2PLNA 1TW3A 4KKXB 5C80A 3M9WA 1U8XX 2Y1EA 1OJ7A 3ROPA 3UK1A 3COYA 5IVIA 4ARBA 5J58A 1QGZA 2AFIA 1WOMA 4D74A 2UYCA 4DUZB 4J0IA 2AJ8A 4GX0A 3AKDA 3Q7RA 3QOWA 3BIWA 1QFSA 2CL7X 4ID3A 5EZ6B 5FO1A 4A82A 3U6BA 4DQXA 3M6AA 3VBEA 1OFGA 2AL7A 4RY9A 3DAYA 3LH5A 1GA4A 4KXUA 5IAJA 3U61B 1U28A 2NQTA 1AHHA 3AHIA 4NU5A 3A27A 3W5VA 4F8EA 1UFKA 3V34A 1B2LA 5JNSA 1CZUA 3QX9A 4DVJA 4EMUA 1AS3A 3HMQA 3SR0A 1HDIA 1QCDA 3LQRA 4MOWA 3NJRA 4TQ9A 2NUBA 1YQWA 5ITZA 3P4UA 2YUTA 4RSHA 4XD7A 2WD7A 1XQYA 3WLLA 4M1SA 4ZKEA 3KWFA 1AXEA 2VSYA 4FQ8A 4HDQB 3C3KA 1P2BA 4P92A 1IQRA 1VGRA 2PZBA 4MVJD 1J25A 1F48A 2CCGA 5F77A 3ST7A 3VDMA 5E3IA 5LQAA 1UFVA 2YHBA 1TYEB 2Z4RA 3IS3A 4H0FA 3F6YA 4H27A 4UUAA 4XWTA 5IJZA 3H4TA 2PUBA 1KL7A 2RHDA 2WM8A 4MMYB 1WE2A 5JQGA 2QTFA 2IFTA 2OOSA 1N1MA 5CVEA 4LGYA 1U8ZA 3KAJA 5LC1A 3NT4A 2K87A 2V45A 1DC7A 4BLVA 4YHHB 4KO3S 3T3MB 4FZVA 1BEEA 4N01A 3FBWA 3NKVA 1RSZA 2B7BA 3DMNA 3IKLA 5AT1A 5FF9A 4EKIA 2ZCJA 3DEFA 4LF9B 1XMIA 3STUA 2A7QA 1QOZA 1UT6A 4Q1CA 3WV4A 1IPFA 3PWTA 3IIEA 2CV0A 3AGQA 3A1UA 5FR2A 5LQKA 1XFAA 2OB1A 2V54A 4LMPA 3TVTA 3B70A 1VHWA 4P4GA 1JDTA 3P19A 1WA5A 1UEIA 2P4HX 3WK6A 1QLHA 5JAMA 5HF6A 5I01A 1EUDB 1O6BA 3O03A 4M7RA 1K0FA 2AXEA 4Y2UA 4YFVA 1FSPA 1G21A 1E2GA 4O0LA 1XAIA 3AZQA 3MCAA 2V03A 4QTXA 3PDCA 4MGYR 5C4GB 4CDRA 1JJIA 1I0IA 3BF7A 3B8EA 1ZJYA 3U49A 1J7KA 3ZWYA 2RGRA 4FIDA 3C8ZA 2P9ZA 2JH8A 3U44B 2PQMA 5C1BA 5EVCA 4C89A 3PG5A 2ZDQA 1IUNA 4UHHA 3KYCA 5KOHA 3JCZA 3ND8A 5DX0A 3R9XA 4BQIA 4XGQA 3TI7A 4CM5A 4KR0A 2XQKA 3BWDD 3NM6B 4ECAA 3HCWA 3ZOKA 4G0VA 1C3JA 3QFCA 3SR3A 3UHAA 2B4QA 4LC1A 4PGFA 4N3CA 3JQQA 1KJIA 4MLPA 1GT6A 2I71A 5ADHA 1FUEA 4RPHA 4AZSA 5EP4A 1Y33E 4EZEA 1PD1A 1U8CB 4HEJA 3NMUF 3ELYA 2OFOA 3DDNA 4Z3KA 3RC1A 2DULA 4ZTBA 2XUZA 3BKWA 3OPXA 1YQUA 3LBFA 3WWEA 5IYZA 5AI4A 1HBJA 3QMPA 3O8CA 1JILA 3FWNA 4FFDA 2XCUA 4AZWA 3V2HA 2GDJA 1Y4ZA 3H2JA 3E27A 3HLTA 3ZJ4A 4EL0A 4TYMA 1XWFA 4MWEA 5DCLA 1IUKA 3KYDA 5ALWA 4N5NA 1NAHA 1AV7A 3AB7A 1E8DA 2XTJA 3DOUA 4RHUA 4RK7A 5EWMA 4TM7A 2P9CA 2HGZA 3AUJB 4LJSA 2VQFB 3QH4A 4GRDA 4GE0A 2ZSJA 4HS4A 4RA6B 2IEBA 3RRYA 2Y99A 1PT7A 1ZJ4A 3EVGA 3OY2A 3TM4A 4A92A 4HGYA 4JYZA 5F7OA 4RVOA 1M34A 2IZOA 1GKYA 4NZOA 1DELA 2WWFA 4R1PA 2JFNA 1FF9A 3COVA 4BMDA 5AWFC 3H75A 2HADA 4FU0A 2Q2NA 3F4LA 1Z2NX 2QRPA 3L0YA 2WUWE 4MUBA 1Y63A 3L7AA 2XNSA 3JQBA 1DLJA 3MRVA 3UUGA 2NSDA 4ANFA 2AOVA 3OT4A 3VI3B 3EZNA 1MVOA 4Z3OA 3U7QB 1ACJA 2ERYA 3EIHA 1T10A 3LFTA 1CUBA 3DEYX 4HB0A 1HUQA 2O2SA 3GRYA 3OJWA 3V1KA 3W8RA 4PC3A 3X2SA 4DV6B 4UBOA 3AKZA 2GS9A 2V3CC 2NQ2C 1I2CA 1O6CA 2LGJA 1RBMA 5AK0A 2G5CA 1YJAA 4Q3OA 1DKMA 1PSWA 4JBYA 4D7AA 5M2QA 4NCBA 1CY4A 1I1OA 1VP3A 2EKZA 4I9HA 3TBFA 1VCMA 4D25A 3X43A 1DMRA 1UC9A 2PA0A 4P5DA 3ZE2B 3WMWA 5I47A 4FWIB 3U7JA 2DU8A 2JGDB