521PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTTGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-RAS P21 PROTEIN
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
total genus 51
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 521pA00
1HQYE 1D6JA 1XZQA 1T5LA 4NDZA 3IIKA 1YE8A 4DCNA 1VIAA 1BYIA 4LHYA 1OH7A 2ZRCA 3CR8A 2ATVA 3SZRA 3W5IA 2WIBA 1GRNA 5EE3A 3B85A 3AVVA 4OBEA 1OFIA 2CHQA 3VFDA 1Z06A 1E2FA 4JL6A 1DELA 4UQOA 4D25A 2N46A 1ZP6A 2X2EA 4HLQB 4B71A 2WWGA 1DG3A 5AUPB 3ZD7A 1XTSA 2B7CA 4Q4LA 3EIEA 4DVGA 3K53A 2GVZC 2XZOA 2ZEJA 1UKVY 2GHIA 4MQBA 4Q1BA 3SQWA 1AQYA 2QROA 1UKEA 1ETUA 1D8TA 4KODA 5DLQC 1GNQA 5JRZA 2XEXA 2H8KA 4IEEA 4M9QA 4MGKR 4U00A 1EGAA 2HV8A 3KFXA 1UAAA 3JVUA 4BLRA 1YKSA 4OHXA 3AVOA 2HJVA 3GJ5A 1RJ9A 4L9WA 3K0AA 4QBHA 4TLAA 5AJYA 4KU4A 1HYQA 3NDPA 4TLEA 2GJAA 4NONA 5BYJA 1G6HA 4BFSA 4DEYA 1GIAA 1XCGB 3C41J 2B21A 3K9LA 1YVDA 1E4VA 2QQ0A 2ZI3A 3CF0A 1B0UA 4FIDA 4JZKA 4ZI3A 5J4KA 2IS2A 1GKUB 1ZIOA 3GLFB 6Q21A 3SFVA 3TVDA 2X19A 1C1YA 1IAQA 3Q72A 3CH5A 5LD2C 3LQQA 2JA1A 1RFLA 1JPJA 1S2MA 4QGFA 3AP3A 4KLNA 2IA5A 1Q0UA 4B3XA 5FOXA 3W3ZB 3EZ9A 1OXVA 3O8RA 1KK3A 1NIPA 4A9AA 4URUR 5DI3B 1Z0FA 5AR1A 5FUVA 3MUFA 5F9FA 3DOEA 3QPWA 1XRJA 1Z07A 1FW6A 4P33A 2IHBA 4OHZA 2EFGA 1RRFA 2VF7A 5F2EA 4M9SA 2NMVA 1MO3A 3MFYA 1KAGA 4Q9LA 1OSNA 2IYWA 5K8LA 3T35A 5A4JA 4UXJA 5HKKD 2R6CA 2MSCB 2E9SA 2I1QA 3CX8A 4KBGA 3TSZA 3REGA 4MYCA 5E7MA 1RIFA 1DARA 4TYQA 2PT5A 1SVSA 5FBVB 3RWOA 4E5UA 4GOXA 1XEWX 4E03A 2JLRA 1G8PA 4KAXA 4OQNA 4XVRA 2AKAB 1VYVA 1OKKA 1N5JA 3UKDA 1E9EA 2QP4A 3TGPA 4YDHB 5FOVA 4C7OA 4B3DA 1JR6A 4HB0A 3AF0A 3L0SA 4IDHA 5FPHA 1P9RA 2C03A 2VP6A 2AXNA 3THOA 2J9RA 1MABB 1G3RA 1SKQA 2J3EA 1OH6A 5EE1A 1E79D 2YC2C 3P4XA 1J90A 4YXWD 2ZJOA 2YWEA 4B43A 1KZGB 5CYOA 1TU3A 2FEMA 1E0JA 1I2DA 1UADA 4DLTA 4M1YA 3QE0A 3A4MA 1SQ5A 3ZZTA 4DZZA 1NNEA 1W4BA 2IHYA 1CBUA 1XTQA 2WJHA 3BWDD 5EQTA 5HE8A 2G77B 3D31A 1F60A 4C0AC 5L3RA 1GTVA 1QVAA 3AVQA 3QXXA 3PUYA 4A0FA 4TQ9A 3T06B 4L9SA 4ZCMA 1KZ7B 3I4LA 1XTKA 4Q5IA 1NVUQ 2J46A 4OK5A 2ZI6A 3VNVA 1VPLA 2NZJA 1ZJ6A 1MRSA 3E2IA 5H8WA 4KV9A 1UKZA 2C95A 2D06A 2XNDD 4FN5A 4EPXA 1YRBA 2BEKA 4A2QA 2OE2A 3RS5A 2V6IA 3HPQA 4JBXA 5HZHA 2BMEA 1JJVA 1COWD 2C99A 3LQRA 4HI0E 5HKKA 3U5ZB 5FOUA 1WA5A 1NG1A 3QENA 4HZUA 4OL0A 2O8FB 3KX2A 1CLUA 2ZUBA 4BECA 2WV9A 4TYWA 1MKYA 4NMMA 2N42A 2D2EA 2ZJBA 3NEYA 1W1WA 3I32A 3C8UA 4M1KA 5CJPA 3WHLA 1II0A 2BEJA 1OJLA 3B60A 4FMCB 5CITA 1R5NA 3AVPA 1YZNA 1R0YA 4B6EA 3EIQA 4ZKDA 3UMFA 2HLDD 2JJ8A 2N1BA 3AVXA 1VG9B 1OFUX 4NYMR 4CEHA 3KJGA 1CIPA 1R8QA 3C5HA 4C0JA 2KI5A 1E1QA 2ZITA 4R2IA 1ZUNB 3SHFA 3MJRA 2QTHA 3C16C 2QSYA 1UBGA 4YXWA 1WRBA 1XCPA 3VR1A 2ZR0A 4RD4A 4B32A 4U7DA 3AP2A 1MRNA 3PG5A 2CK3A 2CVFA 3P32A 2ZQ5A 3U3JA 1FNMA 2GZHA 4XH9B 1SVKA 2QGNA 3OEHD 1N6HA 1XBTA 1F6BA 4HAUA 2HT1A 3RHFA 3L43A 2HDNB 2QPAA 2CEAA 1L4UA 3LBNA 4YDSA 2Z6VA 621PA 4A8JA 1ZW6A 4EJSB 4DUGD 1GL7A 1OFTA 4IDOA 3CZQA 2WKQA 1G3QA 5DYGA 4LPSA 3AEZA 1GILA 4CEJA 4Q9IA 2A78A 4EIWA 1OXXK 3B82A 1CP2A 5EXPA 3T5GA 3BOSA 5FL3A 1GP2A 1SXJC 2XX3A 4FMCF 5FBWB 3EA5A 1KI2A 4KSCA 1DAHA 4ZIRA 4V0MA 5TDHA 3I61A 4OJQA 4OHVA 4DLSA 2V1XA 1XMIA 4TMVA 5FUWA 2ZRGA 8OHMA 1XWIA 1Z6YA 2QBYB 4HSEA 4PZYA 2ZJAA 3BB4A 2ZRKA 4RZUA 3VR3A 2FSFA 4B75A 2JLXA 4N0EA 2VBCA 3KUCA 1M1YE 4L4UA 2BCJQ 4V0ME 4FCVA 3X1DA 2IT1A 1U2RA 5FI1B 5DI9A 1K5DA 2QY9A 3MJHA 4GFDA 2IS6A 3ZH9B 1COWA 3PCRB 5EP3A 1PJRA 4G3XA 1W36D 2KSQA 1NY5A 4CZ2A 4Q4AB 2O0HA 1ZAKA 4QNMA 1R10A 4MUAA 1OB2A 3SS8A 5E95A 3KQUA 1G19A 2CL7X 3DZ8A 1CR4A 5FTMA 2ERYA 4JLJA 2JJ2D 1IM2A 2B92A 2UZ3A 3RRMA 2XOKD 4PZZA 2OV2A 3RS4A 4MRRA 2G0NA 3FTQA 4HLCA 2CCJA 1I4LD 1R7RA 3LO5A 2A5YB 2XXAB 5DIFA 1N0VC 4PPFA 4US2R 2Q3HA 3DKVA 3THWB 2JLVA 1Z63A 1E9DA 2ZR7A 3VR6A 3WRXC 2ZJ8A 1XPOA 4PO8A 5EUQB 2PEYA 5FTNA 1L7VC 2QI9C 4NTZA 4Y0VA 1XXHA 5UKDA 3U6KA 4JL5A 3GJ4A 2WJYA 3FYHA 5FBQB 1DAGA 3WBKA 2G9NA 3BC1A 4PC6A 1V5WA 4Q21A 3LW7A 2FSGA 3CR7A 3K09A 3MLEA 4M2LA 4TL6A 5J5CA 3OEHA 5L8VA 2VPPA 1N25A 1GDDA 4JLVA 2PT7A 4YMTA 5C18A 1QDEA 1XXHE 2IYTA 2ZRPA 3LW8A 4DUGA 1UEJA 1UBEA 3R8CA 1U98A 2CLSA 2FPLA 2PX0A 3AGPA 1RYFA 1UEIA 2Y8EA 2OSBA 3EZ6A 4JLAA 2ZPTX 2IYZA 3GJ3A 1E3MA 1H65A 5FI0B 3T1VA 3ZIAD 2ATXA 2Q21A 3BAFA 3X1YA 1YR6A 4AIIA 3GJ7A 2MSEB 1TUEA 1LS1A 5EJEA 3C4JA 1EFTA 4KFRA 4BQSA 3KZ1E 1YR7A 5FOTA 3AM1A 4IVQA 3LRPA 3PEWA 1Z3IX 2JLSA 5FR1A 1W44A 3A4LA 2FFQA 3CW2A 4M9ZA 2AK3A 5TVKA 4L5BA 3U4QA 3HR7A 4M22A 2DWQA 2OCYC 4WZBE 4QOSA 5CYPA 3VAAA 2B6HA 1PV4A 2H57A 4UXHA 4Z51A 3RS0A 3ZD6A 3EW9A 4KI0A 4RJLA 3NBYC 1VCOA 3KJEA 4D80A 2W6JD 1NF3A 3TAHA 2IYQA 5B30A 1NLZA 1US8A 3B9PA 1W7AA 4JKYA 4TYPA 2C77A 3TW8B 2AFIE 4LJYA 4HLDA 1SVOA 5K8TA 2DY1A 3CRQA 4DLYA 2XOKA 2YZ2A 3HP1A 5KNBA 4HATA 4GSYA 1T91A 3IPXA 5JSZA 2O8EA 2ZI5A 1L4YA 4PHGA 4Q4HB 1KAOA 4A92A 5AJXA 3CRW1 4DCVA 3PXGA 1R5OA 4JBWA 3T1OA 4URWR 1SHKA 1N6OA 1IN7A 1QHHA 5FUYA 5LD2B 1W4AA 4Y0AA 2QG6A 2V6JA 3CRVA 3KQKA 4US1R 2FFBA 3NBFA 5JEDA 5KO2A 1MH1A 4UNPA 4J0QA 1G291 3W5JA 4NCJA 2ZS7A 2HT6A 2NQ2C 2WOJA 3EZ7A 2J0SA 2AX4A 3LXXA 2IL1A 4QBGB 2J0QA 1EFRD 1N5LA 1KI7A 2EQBA 2YHSA 4LBZA 3U61B 1YZGA 4JT4A 4MKFA 4TN1A 4XTRA 5FPTA 3W90A 1IN5A 4PQFA 3UANA 4M9XA 4RD2A 1W47A 1OH5A 5SZHB 1N2CE 2IYRA 1NKTA 4LUCA 2C78A 3LA6A 3RS7A 3LBIA 3PFIA 1GWNA 3ICQB 3G5UA 4BPBA 3DZDA 2CCKA 3ZIAA 5KDDA 3KQLA 4QC2A 4DLZA 2GILA 1M2OB 2W0SA 4BLOA 2PMDA 4TMTA 2GETA 4LBVA 4M1OA 1N6RA 3IILA 4BFWA 3RS3A 1TUIA 5FOSA 1GNRA 4I1OA 2RGXA 5C46F 3R8FA 5CDFA 1YRAA 1A2KC 4DKXA 5J4YA 2GCNA 4JIMA 4PTLA 2R6AA 1JJ7A 1QG2A 5F98A 1S8FA 4URYR 2J0UB 4KHZA 3SFZA 4X8OA 1Z5ZA 3SU8A 1H8HD 2GWHA 1RW4A 2W6JA 3ECCA 5CDFE 4R9UC 3QKRB 3CH4B 1TF7A 3TUJC 1W0JD 1OV4A 1IY0A 3ONWA 3B1XA 4IOJA 1YHNA 2V54A 2XJ4A 1BMFD 2GTPA 2IWHA 2BBOA 1V43A 2FGKA 4PO1A 4C0QC 5JCPA 1RRPA 4A1FA 3U7FB 4NHOA 2ONKA 1KI3A 4ZDIA 4CEJB 1IY1A 1EK0A 1OPXA 3TLXA 3AKCA 4WA7A 4AD8A 2WSSD 4HDCA 2GEDA 3C15C 4LHZA 1SVWA 3UMSA 3KB1A 2BBWA 1NVWQ 2QT1A 2P6RA 1XD2B 3MWJA 1ZD1A 3GEEA 4NCIA 2W2XA 2QU8A 5FL7D 4LOAA 3TUIC 1VIYA 1IN8A 4XIGS 3KXLA 1X8LA 5KHOC 3TE6A 1NN5A 2GVDC 4HB2A 5DI3A 1EFRA 3X1WA 5HCIA 1NSFA 3K8YA 3RSOA 1FP6A 1G1MA 1OHHD 2BHRA 2OM2A 3WBJA 3PEYA 4HDQB 4JSTA 1DAIA 3B6EA 1JI0A 4QJ5A 5A0FA 1GAJA 3B2EA 1VTKA 1HV8A 3QXCA 1XEXB 3P4YA 4G5GA 1X3SA 1G7CA 1IXZA 1P5ZB 2ASEA 3LV8A 5FTLA 1BOFA 2XNSA 4ZCLA 1G8HA 3GFOA 5FBLB 2OCBA 1HUQA 4D6PA 2BMDA 2BMJA 3BGWA 4BLSA 3TVTA 2J59A 1PUJA 2A7QA 4B73A 1JALA 3FKQA 3KXKA 2F1IA 1T0JB 1KYIA 2IW3A 5DH9A 3N2EA 2YVUA 4LCBA 4DEXA 2WAYA 4URVR 1QHIA 1IONA 1E2PA 1VG0B 1Z29A 2QTVB 5KDLA 2GCOB 1FZQA 2C9YA 1G6OA 4LHWA 5IDVA 4OI1A 4M8NE 1AGRA 1OXUA 2AR7A 1ZBDA 3V4RA 3AKDA 1FQKA 4ITRC 2XB4A 2FFHA 3SOPA 3FPAA 4U02A 2IUSA 4I81A 1HA3A 1XTIA 2GBLC 2QE7D 3QKSB 3U2QA 4AYTA 4D82A 1H8HA 5B64A 3BJIC 1MABA 2GJ9A 2PH1A 2H17A 5HZKA 4IVRA 4I1VA 3EWAA 2OG2A 3GMTA 4B76A 1GRRA 1W0JA 4BEBA 5L3SB 4BEJA 3KKPA 2VHTA 4BFYA 1EXMA 2QMUA 1BMFA 1Q22A 5EXTA 4IXNA 3FB4A 3ZJYA 1NI3A 4NL4H 3MAAC 4BUJA 1YZQA 2RGAA 4EPYA 3HU1A 1KI9A 3CLVA 3L0IB 2HJGA 4DBLC 3ICEA 1G7SA 2IUTA 4IOLA 4YC7A 3QPVA 2QPTA 4TTPA 4TTQA 2OILA 4C0BA 1W49A 2WSSA 4V0OA 4US0R 5HR5A 2OCPA 1CRPA 1LB1B 2HEIA 2AXPA 3GLGA 1SXJB 2W2TA 3VKWA 1TL7C 5FL7A 5BW8A 1KO7A 2QTFA 1SGWA 2FSIA 2V55B 2ZAOA 4V03A 2NG1A 3I5YA 3GJ6A 1E1RD 2NIPA 3T5DA 1XFAA 2ZS9A 3U4QB 2ORWA 3K0FB 2YKGA 1OHHA 1P4SA 3GLGE 4B33A 2GAOA 2ZE8A 1U0LA 4PC7A 1ODFA 3FDIA 2W6ID 2ZYTX 2J45A 4EPTA 1AS3A 2DBYA 1Q1EA 4HUQB 4QFMA 1OT3A 3U7HB 4TYYA 1SVIA 1KJZA 1T8TA 2AFHE 3VU9A 5CK4A 1P3JA 4G1UC 1G3UA 2LCFA 2IK8A 3KTAA 2ZUCA 5IF9A 5JSZB 3K9GA 4PHTA 4R98A 2XSZD 1P2TA 2Q9CA 1ZD9A 2B7BA 3RABA 2Q6TA 5H70A 5JRJA 2Q9BA 4KYIB 3I73A 2FFAA 4G5SA 2P6NA 3LFUA 4C3ZA 1TU4A 3BFVA 4V0LA 2OBNA 3EWSA 4Z8YA 3DDCA 2PL3A 3LX5A 3THYB 4ZO4A 2VP5A 3IBYA 2D3WA 5BXQC 1Y3AA 4M1TA 4BZQA 3ND8A 4DC9A 2A9KA 3HWSA 2HF8A 3QIAA 4LDJA 2QMEA 3VR4A 3QKTA 1FP7A 2H18A 1WDTA 2A30A 2FZ4A 1HTWA 1RVDA 3K0EA 2BKEA 4M0LA 4B2LA 1S3GA 4AG5A 2ORVA 1VYUA 2XJ9A 2XAUA 4MYTA 3EASA 1T3LA 4EJSA 1P2UA 3BFKA 5AJWA 3U3MA 3U7GA 4V02A 3P20A 4KXFB 4EQ6A 3OIYA 2D4HA 1Z22A 3I8XA 3ADCA 1M6NA 4TLBA 5J4HA 1N6PA 3T12A 3ZDQA 2X1VA 1NJGA 1ZMXA 3BERA 4XD7D 1R8SA 3VQTA 2VO1A 1G3IA 3HDTA 4R7ZA 1E1RA 5E4FA 1P75A 1OKKD 1HE1C 1CJUC 3H0KA 1T8UA 1E4YA 1NP6A 4PPGA 4MITA 5CJ2A 4UJ5A 4D81A 5KUTA 2QBYA 1YZLA 2QM7A 2W6IA 1G8GA 2YOGA 2JLUA 4M1SA 2O8BA 2A5DA 3ZVNA 2ZUDA 1CU1A 1KSHA 4WXRA 3IEVA 3GJ8A 4ACBA 2REOA 3CKLA 3K1JA 4GZLA 1P60A 2VL7A 3K0SA 3HPRA 3VMFA 2ZREA 4AY2A 4Q4AA 4A6XA 4QGAA 2UVQA 3FHOA 4KCGA 4D0NA 3EPKA 2DFLA 1XU4A 5IHPA 2XSZA 5CLLA 1QHYA 1F2TB 4QKQA 2V1UA 4BGDA 3DHWC 2O52A 1OIXA 3RSLA 3HU2A 2B8WA 2IS4A 4PAOA 4DCUA 2XXAA 2PZFA 2VYFA 4NU0A 3AB3A 2VLIA 3THWA 3FHTA 3W34A 4I1SA 4XWKA 1YR8A 5EE0A 1W4RA 1D2NA 3VHLB 4F93B 2CL6X 1CRQA 3U3KA 2REBA 1LF0A 3B78A 3OHMA 1H8ED 2TMKA 2FMXA 1CS4C 5JECA 2ZS8A 3LDAA 3MG9A 4AC9A 1GL6A 3WMEA 2ZM5A 3TQFA 1OF1A 1S0UA 1RKBA 4R2HA 3BORA 4BFUA 5C4MA 1KDPA 2FDCA 4NCKA 1E0KA 3KKOA 1S1MA 2FWRA 2IF0A 1KO8A 3ADBA 3HYTA 4UXIA 2OBMA 2ANBA 4E07A 2PMKA 2BJVA 5DHAA 1LY1A 3WMFA 2GZDA 2ZU6A 4DLXA 5CM9C 1E2LA 1MV5A 3UATA 1ZCBA 4XD7A 1P62B 1ZC4A 4Q1EA 2GEVA 4CGZA 2PJRA 2YOHA 4LV8B 3TH5A 4Q19A 1NN3A 4LHXA 3FE2A 4RKFA 3QBVA 2JDID 3LH5A 4QHTA 4C0KA 2WZQA 2VP2A 4XVUA 4EUNA 3RANA 3OIWA 1E1QD 1KDTA 4W5HA 2BBTA 2BOVA 4IHQA 2GXAA 4GT1A 5P21A 1E2QA 2D7CA 3V4FA 4DDVA 3V00A 2OXRA 2RGNC 5EUMA 4JVMA 3U3OA 3EXAA 3IHWA 1D9XA 1NBMD 4A82A 2WWWA 2WTUA 3F5FA 3MD0A 4F91B 1XD8A 4GOJA 5JMTA 2GESA 1CXZA 2A5FA 3GQBA 1AK2A 2P65A 3B13B 2ORIA 3WNCA 1ZVQA 1G7TA 1Y63A 2CK3D 5DYIA 1NN0A 2ODNA 1ZRHA 3O8BA 3OZXA 4MGZR 4POAA 4Q4JB 3M6AA 5LDDC 3VR2A 4Q47A 2J0VA 1GUAA 3GEIA 1D9ZA 4JLMA 1DOAA 5GJCA 4AKEA 3EPHA 3DVLA 1EFUA 1XNJA 1N6KA 4NYIQ 2QENA 1VDZA 1ZCAA 3A1VA 3AUXA 4Q4HA 3PEVA 2Z43A 1GKIA 4JSYA 1A4RA 3GLGB 2BWJA 1TTTA 1RRCA 1K6MA 2G3YA 2FF7A 1FX0B 5JHHB 4Q1AA 2F1RA 3VHXA 1OYWA 3TUZC 1G3MA 3BK7A 2OHFA 3EA0A 4UNSA 4IEIA 1H8EA 1D5CA 1TQDA 1ESNA 1NY6A 2MMGA 4C30A 2RGBA 3GP8A 2FJUA 4CEIB 4A36A 4TYNA 5JCZA 2JGNA 3I72A 2V7QA 3K9HA 4O3MA 3VU9B 1IXSB 2ZVQX 1KNXA 1KOFA 4G0NA 2O8DA 2ZRJA 1XJCA 4O25A 1MT0A 1E2JA 4RFSA 1HT1E 3EZFA 4JVNA 3KTAB 2A5JA 2W0MA 5C2JB 3SE0A 1AN0A 2VP0A 4ZPXA 4LX0A 5HPYB 3P26A 4B3BA 3J81k 1E69A 1KIMA 1G17A 1FTNA 5DNYB 5TXGA 2JDIA 1LNZA 1N3BA 3CNOA 1E9CA 3NBZC 4AYWA 3G82C 2Q3MA 1EWQA 3D6TB 1S1CA 1YU9A 4LPKA 5KTYA 3QG5A 3PR1A 4HUTA 1VCNA 2P5TB 1E2MA 1R0ZA 2BCGY 1G21E 1TF2A 1OYYA 3LWNA 4O2LA 1NBMA 1KJWA 2J0UA 5GVRA 4CDGA 4GL2A 1IXRC 3IGFA 2J5XA 5DO9A 1C4OA 2DWOA 1KHTA 2PLFA 4F4JA 1OFHA 1IY2A 1E2IA 2C98A 3Q9LA 3QKRA 1UBCA 1VCMA 4TL8A 4CT5A 3H86A 2JASA 1P9NA 5KSYA 3DL0A 4DB4A 3CRMA 1NBME 4C0HA 2R44A 2WJGA 3AVWA 5G53C 5JZVA 1GVNB 1X1SA 1DS6A 1WBDA 3Q8XB 4EQ6B 3GPLA 1BS1A 1GNPA 4CVNA 1O3YA 2ZRLA 1NIJA 2NPIA 4K8OA 5JI3E 4OK3A 4D4MA 1FQJA 1OXTA 3L0OA 1Z0JA 1XD2A 1SXJD 2A2ZA 2Z4SA 3DPUA 3A1WA 3IO3A 4OI2A 2GKSA 2ZSFA 4UJ3A 3T1TA 2RGEA 1E94E 1SKYB 1N6IA 4RVCA 4O2RA 2FEOA 4PSVA 3QEJA 3QOFA 1TEVA 4EFNA 4QL3A 4EKDA 3MCAA 4HAXA 4PC1A 3FWYA 3S1AB 3RRYA 2CNWD 2X77A 2OLKA 2O8BB 3RS2A 4QJ4A 3MRSA 1OIWA 1XDBA 4TSFD 3CNNA 1XEXA 3WP1B 4PO9A 1TQ2A 4BASA 2JLZA 4GPTA 4LJ7A 1P2VA 1W2HA 2J87A 1JNYA 1Q44A 5JJIA 1WMSA 3JVVA 1E6CA 2DCUA 4DSTA 1CJKC 1P6XA 5H1YA 4RY2A 1CJVC 5KOYA 2P6UA 2EWWA 1GITA 4IVPA 4JLNA 3R9IA 1SHZA 2KE5A 3KJIA 2WVJA 3GD7A 2GCOA 4A0GA 2NO0A 1LW7A 4D4JA 2G83A 2IYUA 2GZAA 2LKDA 2NO7A 5KPDA 3TMKA 1T9HA 1RC8A 4IOMA 4N1AA 4DHEA 2VHQA 4XWOA 1FMLA 3QKSA 1E2EA 4NE2A 4IFBA 221PA 5JWRA 4LYAA 4QGGA 4EPWA 1UF9A 4LV6A 1Q3TA 1Z6XA 5L3SA 2QL6A 1NRJB 3RVBA 2UZIR 2WPDD 2YNMA 1VHTA 3Q7PA 1ZNWA 4H1UA 4AWXA 1U99A 2WAXA 1U8AA 4IKEA 1XF9A 3NC1C 1N0UA 3KQNA 2WHXA 3OAAD 4TMKA 2ZJZA 2VP4A 3UG7A 2EFHB 2CHVA 4DSOA 2LWIA 5JHGB 2XTZA 4OQMA 1SXJA 3LY5A 2O8CA 3ZYCA 1NG9A 2C96A 4HB3A 5JI2E 3LXRA 3TQCA 3MWKA 2RGDA 4B48A 4I4LA 1RPZA 2HYIC 2VHUA 3NDBB 2KBFA 3K70B 4ON9A 3VTKA 3K0FA 2VSFA 4JMPA 1FPMA 3O47A 5B58C 2G1KA 1IN4A 5FPYA 2CNWA 1VG1A 1SXJE 1ZU4A 3NKVA 3UWOA 4NZYA 4RZ3A 4TSFA 3SC3A 2WWYA 2JLWA 1AA9A 1DTSA 2OFOA 3A1TA 3B1YA 1ONBA 4HUQA 5CLQA 4B44A 1M7GA 1Q12A 2PJZA 3D3QA 4Q1DA 5TV2A 3UMRA 4DWJA 1ESMA 3EPLA 3QVUA 5M04A 1GFIA 3CPJB 1CTQA 2FPMA 3VKHA 1GG2A 4LJ9A 4S2EA 3WRYC 2NZ8A 3G0HA 4F4IA 2F1HA 1NMZA 4M1WA 3PVSA 4XJXA 3W6NA 2GK6A 5J40A 4A0HA 4C2UA 2OEPA 2EWVA 4P4TA 2H7VA 4TT3D 2WICA 3SYKA 1Z6AA 3R9XA 1KO4A 2DWPA 2EFCB 4TMXA 3GCGA 1Z2AA 3U7EB 2WBLC 4P3YA 2EFEB 5JWHA 4PHFA 3U60B 3THYA 3THXA 1CF4A 3DMDA 2UKDA 3MWLA 1Z0IA 1WP9A 1JQLB 2ZE6A 1KI6A 2ZSAA 1VECA 4A2PA 3LLUA 2WPDA 1TMKA 2O8DB 4PC3A 1AS2A 1II8B 3E1SA 4M21A 1FMJA 4RFSB 4Q7KA 1NMYA 3DEFA 4FXPA 4JLPA 3W3AA 4OHYA 4KYUA 2FNAA 1II9A 3OAAA 4ERNA 3NHAA 3BRWD 5J4LA 2AD1A 4L15A 3BH7A 1TADA 4MRNA 5C4GB 3SR0A 3SNHA 3A37A 3EPJA 1JEDA 3K0CC 1ZUHA 3IKJA 2NO1A 4RCZA 1KO1A 1UBFA 1NVXQ 4E09A 1Z08A 3RAPR 1X1RA 4Q03A 4Q01A 4QJ3A 4ZKEA 1AKEA 1N6NA 4X8MA 4WXPA 2YV5A 2QZ4A 3TIFA 1M8PA 3NWJA 2O5VA 2HCJB 1DVRA 3L82B 1G4AE 3M1IA 5FH9A 4XOIA 3AP1A 2ZVPX 4LGMA 3REFA 5IK2D 2I1VB 1DPFA 3PIRA 5B57C 2XTMA 3EX7C 4G5QA 4D0GA 1TAGA 4RZXA 5AJVB 1AS0A 3LNCA 1GRQA 1U81A 4Q7LA 3QXJA 1F2TA 1OLOA 1U90A 1Z6GA 3L0PA 5JJLA 2BM0A 1JBKA 4TT3A 4BFTA 4RKEA 2GK7A 1PUIA 2GJKA 5IT5A 4Q7MB 3FVQA 4ZDJA 3IHLA 3WYFA 3CBQA 5EXSA 4G5OA 1ZM9A 2QSZA 3GLHB 3IO5A 1J2JA 4IXMA 5FTKA 3FMOB 2JATA 4KFUA 1GL9B 1EESA 4MKIA 4NYJQ 4W7SA 3RDPA 5EP4A 3E70C 2AL7A 3PUXA 1Z28A 3PUZA 4KVGA 2J1LA 2YOFA 2G1JA 1XTJA 5TB5A 2WJIA 1B23P 5FR2A 3A58B 3CZPA 3KB2A 4PXAA 5GADl 2Z83A 1DADA 1HY3A 1G8FA 3MSXA 1XP8A 1XEWY 3QY0A 4PQYA 2XGJA 4LC1A 2I4IA 2ZRMA 4LC0A 1KNQA 1LTQA 3AH8A 1KSJA 3B8HA 4KO8A 2PCJA 3WMGA 2ZRDA 3MMPA 1F2UB 521PA 1KI8A 1ZNYA 5KSPA 2QNRA 5SZKB 1XPUA 2Z4RA 1A5TA 2ZETA 3VKGA 3VX4A 1LS6A 1KK0A 4Q9HA 1X8JA 4H1VA 1J8YF 3AUYA 4JBYA 1SULA 1QZXA 3ZS8A 4CIDA 2VH5R 2OESA 1MR3F 4LWZA 3SYNA 2R6DA 3FOZA 2V9PA 5AUNB 3FMPB 1YJ5A 2BJWA 3IUYA 3LLMA 4PANA 3Q85A 3Q5DA 4A2WA 1E32A 1QHNA 3KQHA 3CX6A 2VF8A 3DMNA 1YZTA 3W8NA 1UJ2A 1ZINA 1NVVQ 5IK2A 1G8YA 2WSMA 4HAWA 1AQUA 4OI4A 1XEFA 3TK1A 2GNOA 2IXFA 3SQXA 2FA9A 5IRCD 2GA8A 1DEKA 2R9VA 4Q4JA 4FCWA 4A6PA 2W83A 5LB2A 4EFLA 2D62A 3I62A 4DDWA 4TLDA 3NBXX 2VIIA 4A0RA 4QM6A 1P2SA 3CWZA 4HLUC 1VG8A 4UKDA 1JECA 3UK6A 5KYKA 2O8CB 1U0HC 4PX9A 2YYZA 3TW4A 1U9IC 4GNKA 4PR0A 1GKYA 3QG1A 1Q1BA 1XMSA 1FX0A 2MSDB 1HT2E 2FPKA 4X8HA 4GBMA 4ARZB 5AK0A 2WMNB 1P9WA 3LVRE 2FX3A 3DM9B 2ZJYA 3ZZUA 3EARA 2FOLA 4CEIA 2ZI4A 4F92B 4JS0A 4DDUA 1X86B 5BYKA 1E0SA 4DIDA 2BC9A 1G18A 2EYUA 4ESHA 2OAP1 4JVSB 3R20A 4JLBA 4IRUB 5TMPA 1JEEA 3GEHA 1VKJA 4WOPA 2F9MA 4MDEA 4AG6A 2Q9AA 4YONB 3U44B 2ZAMA 3VX3A 2FE4A 1Q57A 4BZPA 3NH6A 3AV0B 4C9BA 3CO5A 1G4UR 1TEXA 1Z8FA 5EP2A 2NPFA 4LYJA 2ODBA 2WMOB 2XZLA 3KKQA 1PLLA 2ZRHA 4IOKA 2D7DA 5TARA 1SZPA 2BIFA 4DIEA 3B9QA 3SN6A 3TAUA 4TQAA 3THXB 1F48A 2OFWA 3ZQJA 1G9XA 3BS4A 3PUWA 2YWFA 2GBLA 4KVAA 1G16A 4Z54A 1QBKC 3ETLA 3QF4B 4V0NA 2PCLA 2IBMA 1WB9A 1KI6B 2P3SA 4RFVA 4LHVA 3TSOA 4LJ4A 2IS1A 2ZTSA 2CJWB 1KSGA 4QM7A 3SHWA 3NXSA 2K5UA 2W2VA 2WWXA 4EFMA 1JAIA 2GJSA 1TX4B 1D2EA 1A2BA 1JB1A 5FPSA 2ZYVX 2OFXA 3CIOA 3HR8A 3QJYA 3W6PA 2OLJA 2QT0A 1E2KA 1ZM3A 2PX3A 4LZZA 2DFTA 2BVNA 2ZANA 4M4SA 4F4CA 4XSGA 4ABYA 3GJ0A 2VSOA 1CJTC 3B1VA 4LJ8A 4RD6A 3SBDA 5FFMA 5FTJA 3A1UA 2BDTA 3QPUA 5LB4A 4B2IA 1TQ6A 3IPYA 2WWHA 2JLQA 3IIJA 4DT1B 2IWRA 1XZPA 1X6VA 1M74A 2HF9A 2SHKA 4G5RA 2IX3A 3L8ZA 1OH8A 1HURA 1KDOA 1XCMA 2VHCA 2ONJA 4FD2A 3QVVA 3K70C 3QNUA 2CLDX 1CR0A 3RYTC 2X8AA 1GSIA 1QRAA 5KNDA 1T3SA 3K70D 4B3GA 1DG1G 3TSWA 2R6FA 4GOKA 1NMXA 3S1AA 2HXYA 2WWIA 4LI0A 3N70A 4D4KA 5BN4A 1ZM4A 2NO6A 1E9SA 5AUOB 1SKYE 4LBWA 1QHXA 2BV3A 4NP6A 1J70A 2ZR9A 4TL7A 1AKYA 3T61A 4BLPA 1DE0A 4KFSA 3TBKA 4DXAA 3CF2A 4X8LA 1XD9A 5EE5B 2B8TA 3FKSD 1CJMA 4NBSA 2DFKB 5ELXA 4RD1A 4TMWA 3B1ZA 3KJHA 1FL9A 1QHGA 4HDOB 1BIFA 1NN1A 1XX6A 3CONA 2CMKA 3CPEA 3GLIA 1KSFX 4GRAA 4L16A 3TKLA 3BH6A 1ZUIA 4Q7JB 2X2FA 2ZU0C 1U94A 4M53A 4FMBB 1RZ3A 1KY2A 1I4TD 3IEUA 4JLOA 4P0TA 4TMZA 4R71A 3ND9A 3RWMB 3I92A 3ZS9A 2O0JA 3T34A 3UIEA 2D2FA 4FI3C 5GJWC 4KITB 2R8RA 5CK5A 3GLIE 3AKEA 1G41A 1E9AA 4PFSA 4U5XA 3PJRA 2ANCA 3UG6A 4YMUA 4LRWA 1JR3D 1M7HA 2ZI9A 1KJYA 3I8SA 3QEOA 4MYUA 4NPHA 4WVFA 5DN6A 2ZXUA 3FGNA 3EIHA 421PA 2V7QD 2VA8A 3CM0A 1HEIA 4CF7A 4PPQA 1KTVA 2C04A 5D3MB 3WP0A 3OE7D 1ZM7A 1FOEB 4WW0A 4DJTA 5DSZA 2WJVA 5EE9A 3I5XA 1BO6A 1EG7A 2ODWA 2YWHA 3WY9A 2F6RA 1DBSA 3N5CA 1Q1ZA 2EW1A 3RLFA 4AKHA 4NYIR 3M0EA 5LPNA 4QBIA 4DCTA 4QHYA 2QORA 2AWOA 2FG5A 4TL9A 2ZE7A 4OYHA 1OXSC 4XWAA 1AJEA 2GXQA 5F3WB 4DCSA 3TJZA 4DLWA 3CRRA 4WZAE 4CW7A 2C9CA 1Q20A 2CVHA 4YMSA 4CT4B 2F43B 5G41A 2JAQA 4MH0R 3ZVLA 4JJZA 4HYYA 3AVTA 3W6OA 4JLKA 3EC2A 4F38A 3P1JA 2AD5A 5L3VA 5J47A 4TTRA 1TPZA 1N0WA 4KSBA 5EZ6B 1N5KA 2VTKA 4B6FA 3FKSA 2FN4A 1J7KA 2PLRA 2RGGA 1Z0KA 5BN5A 1XTRA 5AJZA 5KSZA 4B3CA 5G3ZA 3VNUA 2OXCA 1TF5A 4IJMA 1EFCA 4FWTA 1E98A 1UDWA 2RHMA 4K46A 2RCNA 4TLCA 2CCGA 2ODEA 3O8CA 4P32A 4IDPA 5FOWA 1NLYA 3QBTA 2DHRA 4Q9KA 3TRFA 2WIAA 2FV8A 3IQXA 4M1MA 2F3TA 4A8JC 4QHSA 2DFNA 3T15A 1K5GA 3DKPA 3GFTA 3OF5A 3ZVRA 1JR3A 4TWZA 3BBPA 1W0KD 3WXMA 3ASZA 4PZLA 3RRZA 2GF0A 2GAAA 1PZNA 5GJBA 4JKIA 1I2MA 4JLDA 2FZLA 2AHOA 3BE4A 4EAQA 3QI2A 2KB0A 5KSOA 2PBRA 1XB2A 3JZAA 4UNNA 2QGZA 1IBRA 1II8A 2QQEA 2W00A 1JR3E 2CXXA 3OE7A 1JPNA 3ADDA 2VSXA 1IQPA 1XJQA 3ZVMA 1U8ZA 1GM5A 2IEYA 3BD9A 2QRZA 3ZZ0A 2NOAA 1P61B 5KDOA 2P67A 1R5BA 1A1VA 4G01B 1N5IA 4HEJA 1E2GA 4HAZA 4BLTA 2DB3A 3F8TA 4QXAA 2G6BA 1XMJA 3Q5EA 1BKDR 4Q1CA 2AK2A 2QAGC 4C2TA 2A5GA 1ZNXA 1IHUA 5EP1A 3V9PA 4PSKA 1SVMA 4MRPA 2JIZD 1U8YA 3R7WA 2NGRA 2E87A 1X8KA 4UNRA 3X1XA 2YINC 3DO6A 4Q48A 5HTKA 2F55A 1PLKA 2G88A 3A36A 2Q3FA 2IC5A 4LSGA 1R2QA 4D4LA 4TQUS 2RGNA 4P4SB 1AIPA 3KUDA 4IDQA 5EZ5A 2V4ZA 3DOFA 4LYFA 4Z8XA 1KMHA 5JS7A 4RD3A 2MMCA 2WOOA 3AKYA 5F9HA 2D74A 3BFXA 5CB6A 1HQCA 4GMXA 4MA4A 1IJEA 1T4GA 1G5RA 1XPRA 2R2AA 5K8IA 1GOTA 2XTNA 1ZNZA 2F7SA 4GP6A 3SDZA 3U6BA 1TQ4A 3KFVA 5L3QB 1BYUA 1Z0DA 2BM1A 2R65A 2VEDA 3F3YA 4OKSA 2BBSA 1ZD8A 721PA 3UPUA 1E79A 3PITA 3GFPA 1Q1QA 1VHLA 2FH5B 4FW9A 4JL8A 1S3SA 3SJCA 1P72A 3MWYW 2J7PD 1JXMA 2EU8A 3KL4A 4H9GA 2NTYC 3K09C 4B2PA 3H84A 2PZEA 2P2LA 5EXXA 1YQTA 3R9WA 1YZUA 3BXZA 2ZJ5A 4LBYA 3NEJA 3GLHA 1DO0A 3SJAA 1UPTA 1EX6A 1VMAA 1FNNA 3HU3A 2XB2A 1W0KA 2QMOA 4HZIA 1YR9A 4Q1FA 5JBQA 3O8DA 5FBRB 3OFND 1J99A 1NLFA 4XSHA 1W46A 4NYMQ 4WZ6A 3GLHE 4MKGA 3OIUA 4LJ5A 2WKPA 4Q02A 2H1LA 2I3BA 2AN9A 1KKLA 5JWOA 1Z2CA 2OBLA 1Q3HA 2F1JA 4NCHA 4RZ2A 1IOZA 2AWNA 4JJKA 4E22A 1R4AA 4OK6A 3ZQ6A 1F2UA 2KJQA 5FUXA 2XNDA 1KKMA 4DSNA 1UFQA 2DR3A 3TR0A 3GLIB 2R62A 1FUUA 4C0SA 3LVQE 1W36C 4NCNA 2H5EA 2HYDA 2OUKA 2QAGA 2QUZA 2DPXA 3MGCA 2JIZA 3SJBA 3ADKA 3D7MA 3NIBA 3PV0A 1R6BX 1ZM2A 4JT2A 1RJ9B 3K0AB 3NG1A 5CB8A 5J4VA 1E9RA 4QRHA 2GCPA 3AVYA 1I4DD 3IQWA 2QM8A 2ZRFA 2HLDA 1QF9A 4BRWA 2O0KA 2JJ1D 1ANKA 2EVWX 1LFDB 2RGCA 4QGHA 3ZGXA 3HJNA 2GDJA 2ZSDA 5JJKA 2PEZA 3DM5A 5KPJA 2EYQA 3IDQA 4PAQA 4PHHA 4URZR 1NJFA 5CM8B 2G0TA 4I99A 4BFZA 2J7PA 5BN3A 2YC4C 2IXGA 4GDFA 3WNBA 1P73A 2Q0HA 4L8GA 4CRWB 4QBFA 2ZRBA 3OESA 4IW3B 4OQFA 2IYLD 3M4YA 1NSTA 4Q00A 4ZI2A 5BQ5A 4HAYA 1WCV1 4NH0A 1G7RA 4OHWA 4ARZA 4DSUA 1TNDA 2J7KA 2ZYUX 2GJ8A 3OFNA 1WQ1R 4P31A 4KLZA 4MDFA 1KGDA 2OCAA 3CWQA 3B7GA 4HB4A 4BWYA 3TNFA 5BWMA 4LK2A 3PENA 1ZC3A 5G40A 3EC1A 4Q18A 2VRWA 1ZYUA 5JEEA 1KDRA 4MGYR 3EZ2A 2Z5FA 2OZEA 2ZIAA 5DISB 1LF5A 1KO5A 1OW3B 3NHBA 2ZSEA 4ESVA 4C7OB 1WBBA 4B34A 3QF7A 4F7WA 4Q9JA 1DAMA 4A4DA 3BB3A 4D2IA 4O0MA 3NH9A 4KJZA 3U44A 3A6PC 1A7JA 1XMVA 2ZRIA 1AZSC 2V8OA 1L2TA 3AVUA 2WJJA 4AYXA 4D26A 4Q66C 3E5HA 3RRNA 4AK9A 1KK1A 2V3CC 4FCTA 4A15A 1AZTA 2VQSA 3CUEF 2FSHA 2CL0X 2RB4A 1JAHA 1Q21A 3H1TA 1G20E 3PEUA 3ASYA 2CBZA 1D2MA 5ANRB 5H68A 1EFHA 1M7BA 1OE0A 4ASUD 2PZGA 4N0DA 2JJ2A 1PVOA 5G3YA 2RMKA 3IIMA 3NC0C 3QF4A 5FPKA 3L2OB 2P0EA 4JYBA 1QVRA 2R6GA 2CJWA 3C7KA 2JJ1A 1WF3A 1P7CA 3K9NA 3QQ5A 4B35A 3NTUA 2F3RA 1KI4A 1ZIPA 5HCNA 4EPRA 2RH5A 121PA 1QHSA 3A1SA 4S35A 1KY3A 3LAWA 1VYTA 1UDXA 2C8VA 1E2DA 1MO6A 1A82A 4BFVA 3Q3JB 1YZKA 1SVLA 4JVLA 4AURA 1S9DA 3A8TA 3QSYA 4DT1A 1S9HA 2W58A 2H92A 1QG4A 2IYYA 4XVQA 3PQCA 1Z0AA 3D8BA 1E9FA 3SBEA 4DRZA 2AKYA 4D0LB 1JQJC 1BH2A 4ZCIA 3R7WB 3TR5A 4HZUB 1XJ0A 2CDNA 5KU1A 1T6NA 4WAUA 4URXR 3OEED 3OIVA 5JS8A 1FTSA 1T3HA 3B1WA 3AF4A 4QG7A 1Z6TA 4N3NA 4NYJR 1E2NA 4FMDB 4Z1MD 4DB2A 1KMHB 2GXUA 3AF2A 4NKRA 4XTCS 3BH0A 4ZDKA 4ZDWA 2HCBA 2RAPA 4V0KA 4MUBA 1KK2A 4CEHB 4II7A 2QAJA 1W5TA 4P4UA 4HAVA 1FFHA 3CNLA 2H16A 4K81B 4EPVA 1OIVA 1JXOA 3RC3A 4MRSA 2IUUA 1VCIA 4FINA 4DLVA 2JLYA 1NL3A 2C9OA 4RD0A 1HE8B 2CE7A 4ILEA 5SZJA 5DHFA 1G64A 4QNRA 4EDHA 2FGJA 1E2HA 1F3OA 3ZLJA 2XITA 1ELOA 2KWIA 3B5JA 1W4CA 1R0WA 4A8JB 3KXIA 4ASUA 1RE0A 3IBGA 3X2SA 1CEEA 1CR2A 4B3FX 4ZV4A 1DAFA 5E7IA 3LD9A 3FFBA 2QRNA 2C2HA 2F9LA 2J41A 1G5TA 2E1RA 3GLFA 4FMDF 1EX7A 2KBEA 4ZIRB 1T5IA 4TZ0A 2QMHA 4BLQA 4GZMA 1RRGA 3SYLA 2A3RA 2FU5C 4OJKA 1NVVR 1U0JA 2C5LA 2HXSA 3WNDA 5D3MA 4OQLA 4C0LA 2IYSA 3HYRA 2YWGA 1DO2A 2NO9A 1OB5A 3U3RA 3Q7QA 3GLFE 3PUVA 2IYVA 3FHCB 3K0CA 2ZI7A 3SI7A 2RHDA 2QAGB 2QEQA 4B74A 5GVSA 1HH4A 2VP9A 2OAQ1 3W9YA 3N2IA 1Z83A 2VHJA 4WBSA 1WXQA 2ZRAA 4KFTA 3CPHA 4MGIR 3OEEA 2QP9X 4B47A 5KNCA 3RNLA 3UXMA 1RYHA 2ZE5A 1AGPA 3C14C 4RCYA 3QKUA 2F43A 1LV7A 4CYMA 4Z1MA 3QUSA 4I1UA 4RSGA 1NKSA 2RKOA 4WIAA 2GF9A 1UKYA 1KI1A 3KKMA 2ERXA 4OI0A 2GXSA 5A5GA 2BMFA 4LV5B 4UNQA 3EAQA 4GP7A 2ZRNA 1IN6A 4LJ6A 1MO5A 3W8RA 2ECKA 3A4NA 3WYGA 2YJTD 3RC8A 1XXHB 5E7JA 1W48A 3BB1A 5K8UA 1CULC 1DAEA 4C4PA 4W5WA 3KDSE 2CE2X 1O87A 3LBHA 5JFGA 4MYHA 1W5SA 4DDTA 4W9MC 1WE2A 1Z47A 3WYAA 5C1BA 5GJVC 4OQXA 3BIFA 3SEAA 5AUQA 3FMIA 4BE7B 4EJSC 1AM4D 4JYCA 2IXEA 3T1QA 1E99A 3FMFA 1T0HB 5JLJA 2ZROA 1C9KA 1G5PA 2ZJ2A 5DGXA 4DLRA 3CF6R 3AF1A 1S4QA 3I3SR 3AF3A 3I1FA 1K8RA 1W2GA 2CLCX 3CB4A 4MRVA 4W5JA 1J8MF 2JEOA 4BFXA 2REXB 3GJXC 4GI7A 4FWIB 3VR5A 4LY6A 3LX8A 4IDNA 1L8QA 2QN6A 2WKRA 2XZPA 3QXSA 4BZXA 1R0XA 2QPOA 1ZU5A 2QP3A 5TY0A 4AI6A 3H2YA 4IFEA 2CHGA 4LYHA 1W36B 3AQ4A 2GEUA 4DLUA 4YQFA 1GZSA 3AGQA 4TZ6A 3F0TA 1US8B 1E9BA 1CKEA 3FFAA 1KMQA 4YLGA 1DAKA 2O8FA 3QXHA 4YMWA 2P5SA 3L8YA 1LVGA 2L0XA 3JZMA 5E3HA 3KKNA 4ACAA 2O8EB 4PQRA 5B2ZA 1M34E 2JCSA 2WWFA 4PPNA 3UWKA 4P4SA 4KBFA 2WM9B 5D3QA 5LBIA 1S96A 3C5CA 1E96A 5DN6D 1E0AA 1QHHB 2ZYWX 5AWFC 2OO7A 4PSAA 3WHKA 4GMDA 2ZSBA 1N6LA 5CIQA 4PAMA 1FUKA 4AKGA 5CIWA 2QA5A 2IEZA 5HE9A 1MOZA 2LKCA 3H4MA 2QE7A 4LJAA 5L3QA 2Z0MA 3X1ZA 5DE3A 1PLJA 2OT3B 821PA 4PC2A 1IJFA 2EFDB 1CR1A 3SJZA 4HLUA 3NVAA 3CX7A 1EWRA 1F5NA 1UM8A 4MKHA 3EG5A 2IYXA 2HUPA 4BRUA 4YMVA 5SZIA 1U9IA 1MO4A 2DYKA 4AKIA 2BKUA 2IF2A 2GRJA 3P27A
chains in the Genus database with same CATH superfamily
4ETWA 2A1UB 3RJ5A 1XZQA 2VUTA 2XUGA 3HJAA 1HKUA 3IULA 1YE8A 5T8KA 4CXMA 1ST2A 1BYIA 1Y7HA 4LHYA 3T5PA 2BRUA 2PWZA 2XT0A 3ROGA 3SF0A 2JHAA 1NVEA 2W2KA 4HEHA 4ZODA 4RTNA 1BMQA 1FQOA 3SZRA 4GGPA 1I7LA 4EYSA 1GRNA 3LUCA 4YJHA 2H0QA 3L49A 4OBEA 3O3NB 2WG0A 4FBMA 3WLOA 2RIRA 3KSMA 3PFFA 2JGLA 4UQOA 1H0SA 1Q17A 4ENTA 2HSJA 1H23A 1XPJA 5BN1A 2OD7A 1DEXA 5I7UA 3ZD7A 2Y1KA 4FS8A 5EUBA 4Z4GA 4P7JA 4L72A 3V8PA 2ZJ0A 4GBJA 2VT6A 3K53A 4BQPA 5EMMA 4JOCA 1AN9A 2J85A 2ONYA 3SQWA 5ELMA 1EK5A 3DL2A 1O5IA 3VYRB 1D8TA 1A76A 1EIZA 4IIHA 1W96A 1GNQA 3E9CA 5JRZA 4MGKR 2H8KA 4U00A 3RYFB 1VPEA 4RORA 5MN5A 1U8FO 3QBEA 4NENB 1O97D 3SF8B 4V1CB 1KC3A 3JVUA 4EY7A 2SKCA 1C30A 1YKSA 3SXUB 4BGEA 2HJVA 2F2TA 3OP4A 4G0WA 4NK5A 4OP1A 4M76B 2IXBA 4AN1A 3DQZA 3NDPA 2GJAA 3BM5A 1CVIA 1YS4A 5BYJA 1VJDA 2DLDA 5FWXB 1IZ7A 1XCGB 3C41J 3DVQX 3TRJA 2C31A 3IBTA 4JZKA 2ZI3A 2I2WA 2YJ3A 4JU9A 3L79A 1SD2A 4N18A 4U2GA 5J4KA 5L7TA 2AQIA 3HWX1 6Q21A 3SFVA 3GLFB 2X19A 1SKMA 1FFYA 2Y76A 3CLTC 5LD2C 3OIDA 2D1TA 1JPJA 2JNWA 3EMBA 4H3SA 1YOVB 1Q0UA 2IA5A 1FP1D 2JS7A 5DHSA 3UWSA 4UHDA 2QTMA 3EYAA 3TM4A 3J7AC 3DTVB 4TS3A 2P9GA 1OAOA 4J0GA 2OGWA 4URUR 1Z0FA 1HEYA 4KL8S 2WUGA 1C4WA 3HCWA 3HBFA 3TCXB 3I9NA 3E3NA 5F9FA 3PJGA 3NYRA 5A04A 1XRJA 3BGVA 4ALMA 3G13A 3PRYA 1WF6A 4V0QA 3CNEA 2IH2A 5HQJA 3GUCA 2NMVA 5D6OA 3MFYA 3NNNA 9MHTA 4Q9LA 1KAEA 3LBAA 4PEVA 4RYDA 4CG3A 1R00A 1PYGA 3KHSA 1IPHA 1C7RA 4UXJA 1QX4A 4Y6SA 1I2AA 2MSCB 2E9SA 2O48X 3IT0A 1WZCA 3O92A 3KAKA 2PBZA 3O1LA 4HWOA 1JEAA 4LMAA 2R1VB 2C1EA 4QX6A 4MYCA 1GCGA 3REGA 4KE6A 1DARA 5IXYA 5DIZA 1MQSA 5I4BA 2PSHA 5DBFA 3CXUA 2UYGA 2PT5A 1WVMA 4PYNA 5AJUA 4N40A 5FBVB 2JGAA 3OKFA 3SC4A 1HL3A 4GOXA 3Q8MA 3U7RA 3K5WA 4OLHA 3NBAA 1ZICA 2EKQA 3FZQA 4LDPA 1U0RA 4NU6A 1VYVA 4OQNA 4MR8B 4XVRA 4ECAA 1N5JA 1BU5A 1CWUA 2H4XA 2NPOA 3LS2A 4RLFA 5DXFA 5TQ2B 1AQJA 2BUBA 4TUYB 5DM4A 3THRA 4P38A 5IBRA 4B3DA 2C61A 4CIWA 1JR6A 1LTHR 4HB0A 4O4IF 4B6PA 2IBTA 3B36A 3THOA 2AXNA 1NNUA 3OIGA 2PGAA 1SKQA 4FDMA 2FETA 4ED9A 1OH6A 1E79D 4IF6A 2QUIA 4PBSA 4YXWD 1LNSA 2I1WA 1GAXA 3A11A 2ZJOA 4NJOA 2YWEA 3OZFA 3EXEA 4OMCA 1KZGB 4YTEA 3UAXA 1HMYA 1O4VA 3DE0X 1ECLA 2C20A 1SC1A 4HD8A 5JZMA 1B42A 1Y6RA 3PUIA 4Y2TA 1NVBA 4YJ2F 4KE7A 1SQ5A 4CE6A 2HPVA 4LJSA 3E2MA 3JTMA 5GONA 3WYDA 1T0IA 4ALLA 1XTQA 4AUKA 3BMNB 3S7ZA 1QVVA 4QU9A 2Q5HA 1R8JA 1ZDMA 2G77B 3DLBA 4TLMB 2F48A 2JIPA 1YVEI 3H5TA 4EW3A 3DKRA 4KBYA 1O57A 2C2YA 2LP4Y 3R5KA 4Q9AA 3OCXA 4YWJA 1RWPA 3DMTC 4F45A 4MINA 1YE3A 4BIMA 3STWA 5G0WA 3QA9A 4ZCMA 1HNWB 4WEQA 2JARA 3WFIA 1NBIA 2NU7A 5CD1A 4J0CA 4OX9B 3VNVA 3DKKA 3OPVA 2JEYA 4NY1A 4QYMA 1VPWA 2ZDHA 4OU5A 4NSNA 4QBKA 3NNDA 4AM8A 4TUYF 1UKZA 3DDZX 4IV5A 4CKCB 4GYYA 4HRVA 2Q1WA 2XNDD 4EPXA 2R79A 4REQA 1YRBA 5ERXA 1GAQA 3G8DA 1ZMOA 2OE2A 3HP4A 4O8CA 1JTEA 4PYLA 3MYYA 1KIAA 3ROPA 1FP4B 1U1CA 3RD5A 3STUA 1IBLB 5HKKA 5B58T 3JY6A 5DVZA 1K9SA 4HZUA 2B2CA 4NHEA 3ET5A 3ZV4A 5IVHA 3SIXA 3TQOA 1T3ZA 4TMFA 3KR2A 2RKWA 3ZLVA 3K6JA 4PTYA 1XVAA 3KWJA 3B60A 3N7TA 5CITA 3AVPA 2EBWA 5I7WA 3UMFA 4X1KB 5AM4A 2W6MA 4DMLA 2N1BA 1MBZA 4YRFA 1WPQA 4J7UA 3BQNB 3R41A 4LKOA 4G24A 4LCEA 2PT6A 4GUDA 3SIPA 1FYFA 2KI5A 1E1QA 1X0XA 2VK2A 3GFRA 1EZZA 3JWEA 4M1ZA 3L7BA 2A4KA 1X42A 4QQRA 2OY0A 1IG3A 3VR6D 2DETA 2TS1A 2PKQP 2X9GA 4E5MA 5ETJA 3SHFA 3GBSA 4CTKA 2P5UA 3TECE 1UKBA 1UBGA 2QSYA 5C35A 1LLUA 2X42A 5HFNA 3GJRA 4AMVA 3DFUA 2RHJA 4DLBA 1ZMRA 1MAVA 5IASA 3UMYA 2UYYA 4YB8A 3ER6A 3VR4H 1MZVA 3OQVA 3BVPA 4NDNE 2ZQ5A 1BVRA 5G2OA 3OEHD 1XBTA 1FYVA 4G5YA 1KARA 2HDNB 3EOBI 3K0KA 3L43A 3RHFA 2CBXA 5KWIA 1ZW6A 4DUGD 1GL7A 3HCRA 3RYIA 7MHTA 5DYGA 4F6LA 3AJEA 3B5IA 3EQ8A 3GQVA 1QVWA 1U7UA 4KK4A 1N5RA 1X92A 3IOYA 2PTGA 1AQ6A 1OXXK 1PBNA 1CP2A 2AXEA 3TSCA 3VZBA 3WJ7A 5FL3A 1JSRA 4J75A 2XX3A 1NQVA 1Z7GA 2AZTA 5KNLA 3P0RA 1K3UB 1QO9A 1M1YA 4XDGA 4M8KA 1RAIA 2NTJA 4MYSA 5TDHA 5A62A 2Z6AA 4JCOA 4OJQA 1RBYA 2VJNA 5HM6A 3IJ5A 2BLLA 4GWKA 3UJCA 5KTSA 4XYLA 1XZEA 1YK1A 3IQZA 4F5DA 1T1RA 1XMIA 1Z5OA 4TMVA 4XJSA 2ZRGA 2HW8A 8OHMA 2PRIA 3U7QB 3OZBA 4DIUA 4HSEA 1QH1A 2I99A 2ZJAA 4Z2YA 4RZUA 4H0CA 4M0CA 3WJAA 4G65A 2RAVA 1VKHA 1M1YE 4AIRA 3JARA 2EFJA 3X1DA 1ZL0A 1VB5A 3PGKA 3GW8A 4WNAA 5DI9A 4B40A 2AJDA 3ZH9B 4KRFA 1QOZA 2WYWA 3HP7A 5I4IA 1Q6YA 1FFXA 4N03A 2B1RA 1QIDA 2KSQA 3G2HA 3KQVA 2FPIA 4X5OA 4QSHA 1P1HA 1V7ZA 4QNMA 4KQMA 4KREA 1R10A 1OB2A 4ZI7A 2GRAA 3K31A 3KPUA 3FZYA 1IJKA 2VJOA 3LRTA 1G19A 3KQUA 2CL7X 1IQRA 2FEPA 2COKA 2ERYA 1W35A 3F4KA 5KNBD 1F20A 2VPYA 1WVIA 3TRKA 1Y7PA 4R2KA 4HLCA 2A5YB 1VZ3A 1GXSB 4US2R 2Q3HA 3DKVA 4KWEA 1WU7A 5B6IA 2ZR7A 3UJHA 2E4XA 3SVLA 4BN5A 5IT4A 4WN3A 1TGVA 5FYDA 1PQWA 1QB7A 1W6UA 1WPGA 4NTZA 3ZX4A 4TXJA 1MNQA 1NE2A 4A03A 3WBKA 3TDNA 2NSDA 1I3CA 1BEZA 4PC6A 5JNLA 2JBHA 4OHFA 4ROSA 3IIEA 2C42A 1HFWA 3FY4A 4YP6A 2D5LA 2FSGA 2WG2A 3CR7A 2Z8ZA 3MLEA 3UV7A 3WOHA 2QTRA 3NHZA 5CH3A 1GDDA 3PP8A 2AQHA 2PT7A 4MUYA 2ZRPA 3LW8A 3ZJTA 1RCTE 1VBFA 3R8CA 3LY8A 4OFWA 5A3RA 5ALXA 4EGQA 3AY7A 1BN7A 2W43A 4AUNA 1CR6A 3H0CA 1RXIA 1BGVA 3GWGA 5FI0B 3T1VA 1NJ2A 3NLLA 4JOBA 1VA4A 2IOFK 3N3BC 4KFRA 1YR7A 3ITNA 3M6UA 2HMVA 2XDAA 1DPGA 1QE3A 4JP2A 5EQFA 3D4OA 1JKJB 3EFHA 4ZFNA 1U28A 5I7EA 1GGNA 1OLUA 1Q92A 4JHXA 2AJCA 3CW2A 4M9ZA 2AK3A 5THKA 3A2LA 1Q14A 4TRMA 3ESQA 2EZ8A 4L5BA 4RTKA 2BI4A 4QDOA 2OCYC 4QOSA 1YMUA 4HFRA 4NFHA 4PIMA 2AFIA 1CX9B 3VAAA 1D6NA 2H57A 4UXHA 1PV4A 5C8VA 1IB6A 3H11A 1B76A 5C5EA 5I5EA 3QLVA 1GLVA 2P69A 1INLA 1A4IA 4WE3A 1JXQA 3OJEA 3ON5A 5EY5B 3KJEA 4D80A 2GLXA 3D0QA 4R2JA 3Q2KA 2BL4A 4L8WB 3B9PA 5JPIA 3UYLA 2MHCA 1O77A 1LK5A 4JKYA 4M49A 4ZT6A 1Q0LA 2AFIE 4ODIA 4LJYA 4XUDA 1SVOA 3IURA 3OJCA 4H77A 1LK7A 2ZDQA 3AOEA 3NTXA 4HATA 1VGVA 3IPXA 1L4YA 2GVNA 2CZGA 2O6HA 3A9SA 3KFLA 3VPXA 5ES4B 2ODPA 1LQUA 1MB4A 4BNZA 1FA9A 4DCVA 1R5OA 1OX5A 3KQTA 1N6OA 2YJ6A 3WG9A 5LD2B 3NTVA 3UAOA 1GZ3A 2QG6A 3FOFC 3LKZA 5F3DA 1B8PA 2PL5A 3F6PA 5KO2A 2FFBA 1AKRA 1JLHA 1WZEA 4UNPA 4BFCA 4CQMA 1SKUA 2OL4A 4NCJA 4II3A 1T36A 1ECCA 3L77A 3DTVD 3EZ7A 4QYIB 3LXXA 1QE5A 3BAZA 4LDRA 5ARCA 4ER3A 1IVSA 1BROA 2EQBA 2HUNA 2I78A 3SAJA 4MKFA 4XTRA 3RVMA 4DM3A 4YYZA 3GYGA 1IN5A 4W9RA 5DTIA 4IQ4A 3PKJA 3UOWA 3LDUA 3TZLA 4PLFA 2Z2JA 2A0KA 3B52X 3IDFA 3ENNA 4M9XA 4RD2A 2CVZA 5FCDA 1NATA 1NKTA 1XKLA 2DM6A 2XB6A 3LA6A 3RS7A 5C5DA 5JZBA 1P1KA 3U09A 3N0WA 2C8JA 1U7DA 2Y1LA 5IU6A 1XALA 3EFOB 4L51A 1ISMA 2AFVA 3G5UA 3ZHSA 4P54A 4BPBA 3KRTA 2IHJA 4JXKA 5KQRA 4BKPA 3KDPA 3R3JA 2NAFA 3OE5A 4MW6A 2JIBA 4LVNA 5ER9A 4C14A 4BLOA 2NVUB 2WJAA 2DU8A 1UDRA 4LRSB 1NM5A 4M1OA 3IILA 4Z5XA 4HVAA 1OCEA 4K03A 4YRIA 1FNSA 5AVVA 4S12A 1GNRA 5AVQA 3K9CA 4I1OA 5FEMA 3R8FA 1GZ5A 4I46A 1DQYA 1TZBA 4KP7A 1DV2A 2GDZA 3EVAA 5DBIA 8LDHA 1IM5A 4A27A 2RI6A 2Q6IA 3VJRA 1JJ7A 3B2NA 2G80A 4NIMA 5F2NA 4Y2PA 4XWWA 3IC5A 3C6YA 3SFZA 4X8OA 3MT9A 4DQKA 3SU8A 2GWHA 4H60A 2WVAA 3HZHA 1GNVA 1KXZA 4Q37A 2H8GA 1OV4A 1ZGZA 3DYBA 3JALB 4GQAA 1FFBA 4JT9A 1QR2A 1EFLA 4IOJA 1NF9A 2XJ4A 2GTPA 1RLMA 2BBOA 2FUNB 3DXYA 3K16A 2X8LA 3T41A 4X1YA 5KYXA 4RIGA 2AYXA 1RRPA 3HJHA 5DYYA 13PKA 4NHOA 1XZBA 3GDOA 4O08A 3AUSA 4ZDIA 5REQA 4CEJB 3R3XA 4CKYA 3OLYA 2IPNA 3AKCA 3DAPA 1GQRA 5HZGA 2OCIA 1RRVA 1VHWA 1JIUA 2GEDA 1NQAO 2A88A 3B1KA 3COPA 4OGLA 1V6SA 2Y05A 4YHHB 1ZG3A 4EZBA 5AO9A 4XX0A 1XD2B 3MINA 1PGPA 2H85A 3F71A 1PTJA 3GEEA 3L0YA 4NCIA 2UUBB 3P0EA 3RJMA 2F64A 1X8LA 1E66A 4QUEA 5CPBA 1EXDA 5DTRA 4WLOA 3NJ4A 3ULKA 2DT8A 2VBGA 3K8YA 2DR2A 1FP6A 3COSA 3P2JA 1O94C 2J9YB 5FO1A 1WQ3A 1WR8A 3CLSD 2PUHA 3IELA 4WFIA 5HIIA 2PPVA 3B6EA 2PRYA 3EISA 3OUZA 2H29A 2PL9A 3B2EA 3T9FA 5C8DA 4C08A 1Y6FA 3RUDA 1L5HB 4MVJF 1X3SA 1GQFA 1P5ZB 1TYDE 1UMCA 2QTZA 4L8FA 4ZCLA 1P45A 4BNIA 4K88A 4D6PA 2BMDA 6NULA 3BGWA 4MQ4A 3LLSA 4OREX 3TVTA 4EHFA 3A1NA 4DJJA 4XYMA 1JALA 1DP4A 3FKQA 5KVVA 1IYZA 3D4PA 3KXKA 2IW3A 5ICCA 4COOA 1Z16A 2GLTA 3UWMA 3N2EA 2W6OA 1ZD2P 3BA1A 2YXEA 1V45E 4BATA 1Y3DE 2GPBA 3U26A 1LPAB 1E2PA 1C7EA 1RLJA 2QTVB 5KTOA 5BW5A 1G6OA 4XLLA 4OI1A 2VWHA 4ARAA 5B1EA 3H83A 2FFHA 4BZWA 2PKCA 1XZAA 4U02A 2H7XA 1OD6A 4JI4B 4RF5A 5K4HA 3ZD8A 1QH8A 2GBLC 5KCMA 1YJ8A 3AUUA 3U2QA 2ZYSA 1PJBA 3HA7A 5B64A 3D2LA 1MABA 2GJ9A 2EV9A 4KKXB 5AKLA 1PGOA 5F77A 5DTMA 1VL5A 4PZDA 1W0JA 4Q3OA 1GFWA 5D00A 4ZT2A 2B94A 4UBKA 4BEJA 3KKPA 2VHTA 3DLPX 4NOJA 3RK0A 1E3JA 3O03A 3ZEIA 2CXNA 4IXNA 1I13A 1Y5NA 1LXCA 1NI3A 1I14A 2NSHA 3FB4A 2RGAA 3MAAC 1BFUA 3PDJA 4BUJA 1DWQA 4D96A 5EIFA 1JLRA 3IALA 4CU5A 2IUTA 3IAEA 1AB6A 3EEQA 4LDNA 3O7WA 1NQ5A 1MH9A 4C0BA 2O54A 4V0OA 4LZPA 4BX0A 1BDBA 5HR5A 2R87A 1DLIA 1JDBC 2AJTA 1F8FA 4YN3A 1YL7A 3GGJA 2AXPA 1J0AA 3GFBA 5JAOA 2P3OA 3ESCA 5FL7A 5BW8A 3AVXA 1KO7A 4NFYA 4JODA 3WK4A 1TZKA 2V55B 3VJMA 3NHRA 1BS2A 4YP1A 3LCMA 3T5DA 3BCHA 2ZS9A 3RUHA 1YQUA 2ORWA 1NC3A 3U4QB 2YKGA 5DBGA 1P4SA 5LSAA 3NGMA 4DNXA 2QG4A 2CFCA 4NJEB 4OFZA 4B33A 1LKZA 4WCFA 4C7KA 4EZIA 2AG5A 3HH8A 3RS9A 1QJCA 1P0PA 1UZUA 2W6ID 1JHVA 2E1PA 3FOAA 4R31A 3UENA 4OXYA 1VKZA 3FCOA 3WFJA 5DZSA 1X87A 4MR9A 5JARA 3NHMA 2Z3ZA 5IDXA 1YC2A 1C0LA 1SVIA 3TOSA 3WC4A 1SBQA 1T2NA 4IMJB 2I80A 4G1UC 2CXQA 3D6MA 4K7JA 2BI8A 2LCFA 1Y6GA 1E5QA 1X74A 5LUAA 3M6VA 4JX9A 1C7QA 3TG2A 1CS0A 5I51A 1YA6A 1P2TA 2Q9CA 4OGWA 3SMQA 3QVGB 1RC0A 4MSUA 3ZI4A 3P0IA 5H70A 4EITA 4ZZ0A 1FW8A 2UUOA 4KYIB 3I73A 2FFAA 3GVHA 4XGKA 1AV6A 1AHNA 1OYVA 1HF3A 4PYQA 4NULA 3EWSA 1ZN7A 1WY5A 3HFJA 3LX5A 3R0XA 3WQQA 1NT2A 3TTXA 1MO2A 3THYB 1C7ZA 4LXYA 5BXQC 5JZ9A 1L3CA 1LZLA 2ORYA 1CB0A 2OP1A 1LI4A 4M1TA 2ZWMA 3ND8A 5IP5A 1XK7A 4DC9A 1DIOB 4DV3B 5IDQA 2NZVG 4DABA 1W36B 4CLRB 1BVHA 1HE3A 2PR2A 1FP7A 3D1JA 3B48A 3OZTA 2Q6VA 5AW7A 3OTOB 5AI0A 2AT1A 2FZ4A 1HTWA 2ZXEA 2BKEA 4M0LA 4LNUB 4C3UA 3W6UA 1BXKA 3HCFA 1IZ8A 3IVCA 4KMMA 5ITVA 3CGWA 3VBCA 1DGQA 2HF2A 3W3AH 4DQXA 4I5GA 3U7GA 1OXBB 1Z2OX 4UVIA 4EQ6A 4DTIA 2D4HA 3PGMA 1IHDA 1Z22A 3DTYA 5GP1A 5JRDS 2W2NA 1FZTA 3RR2A 1RS0A 2LIVA 4TLBA 5CX1B 3ZDQA 1HLGA 1VL0A 5IBQA 3LKDA 3LPNA 4FGJA 2J6HA 1TVEA 3MGGA 4JYMA 4QXOA 4ZYZA 1SBTA 2VO1A 4MW2A 5LNK1 2C4KA 4MQMA 2BFDB 3IR5A 1E1RA 4MW7A 4R7ZA 1YJQA 3RTBA 5AW5A 1C3OB 1RKVA 5KAPA 4C0XA 2L2QA 3WIUA 1J8QA 3WTCA 1CJUC 2F1KA 3AR8A 2MIIA 2G5PA 3TXXA 4BBJA 1R0LA 3LVFO 2XBLA 4MITA 3MRVA 2QBYA 2WJ6A 5CCDA 5CA1B 5KUTA 1YBMA 5LMCA 4MW0A 3D64A 5B3JA 4W1RA 4AS2A 4OB8A 1G8GA 2OXTA 2JLUA 1NPTO 2M98A 3W04A 2ETXA 3CHYA 2A5DA 3ZVNA 4H2DA 5LYYA 4WXRA 4G41A 4YQEA 4QT0A 3SM9A 4LF4B 2PT9A 4REOA 3K1JA 2X8WA 1ULTA 2G76A 4PBTA 4RF4A 2QSJA 3K0SA 1ZN2A 3HPRA 3EDRA 3NGLA 2ZREA 4MJ3A 3J81A 2O14A 2CLLB 2DX7A 1JE1A 1URPA 3LO8A 4KCGA 1NQTA 4D0NA 1ATIA 1B41A 1J42A 1FP2A 2V7VA 2XSZA 1WY7A 1U3VA 1Z34A 1QHYA 2HSWA 1NJ1A 2P4QA 5CLLA 5C80A 2ORED 4Q3NA 2O52A 3HN7A 3HYSA 2RH9B 3RSLA 4P3KA 3HU2A 4OFBA 5AXDA 1MMFB 5IZCA 2M1ZA 3DE7X 4MIYA 1XRSB 4RETA 3HCOA 5CM2Z 5E4TA 1H6AA 5D5PA 4E08A 1TVKA 2VLIA 3DT6A 4ND2A 3THWA 1UT5A 2G40A 3F4BA 3RKRA 4I1SA 3CLTD 2WIFA 4JEUA 4UBOA 3SBXA 5H80A 4C76A 1K7YA 1XUOA 1W4RA 4YIHA 3N6XA 4D3FA 4KDCA 1PJZA 5KOHA 3SICE 1V3VA 2E5FA 3VHLB 1U2GC 3FYUA 3AM1A 4MQFA 3ESYA 3TNLA 5I7RA 1L5FA 3DQQA 3ITEA 3ECSA 5KQPA 4RMGA 2REBA 1LF0A 4WACA 5HRAA 5LXTB 3OHMA 5CA1F 4HX5A 3K4QA 3G02A 3WMEA 1SU8A 2C2KA 2BFFB 1HT0A 3FLAA 3TQFA 1EE1A 2RBGA 5HFAA 3TZKA 2QJTA 1NT4A 4QODA 3M6IA 5FLXA 5GMOA 4J2OA 5HUJA 2G9ZA 3BORA 2V3WA 2JFQA 3VYTB 1XJWA 4OQPA 4BQRA 1S1MA 1T2VA 3KPJA 4FLEA 4EFDA 3MWDA 2OBMA 4R9SA 3CLRC 1EX1A 2PMKA 2BJVA 1FNDA 1LY1A 5K01A 2GZDA 3UATA 4HPJB 2WNSA 5BORA 2HK6A 1JFFB 1EK6A 2IEBA 4CGZA 1N0HA 4MLZA 4PRKA 4Q1EA 1ETHA 2H9IA 4E4YA 2PJRA 4BVJA 4YV0A 3KVNA 1WL8A 2R0QC 3FE2A 1FXSA 3LH5A 3QBVA 4C0KA 2QIOA 5CPFA 2XUOA 3PXCX 5TSDA 5EZYA 2FQXA 2TMGA 3H2KA 4EUNA 1WZ2A 1R37A 2AG8A 4J9UE 3OIWA 5JS1A 1R9NA 2P9QA 3Q6IA 4W5HA 4TPKA 2GXAA 1FJHA 3GFQA 1NLUA 3AFIA 5KWVA 3I45A 2OXRA 1VJGA 4QTXA 4E33A 4AMGA 3HJRA 4RHUA 1NBMD 3TKYA 2FEWB 3ZCRA 2EGGA 3MD0A 3OQIB 2OYCA 2HMAA 3OQOA 2HA5A 3Q7TA 1XD8A 2GESA 3GQBA 5IC6A 2P65A 4IKOA 1QYDA 3WNCA 1ZVQA 4YFYA 1GARA 1G7TA 3SVTA 5DYIA 1TE2A 4QOHA 3SR3A 2UUCB 3MS7A 4Q4JB 4R54A 3VKUA 1N9GB 5LDDC 4Q47A 3KYDB 3GEIA 1QB8A 1SU6A 2ADOA 2QTGA 2YRFA 5GJCA 4AKEA 1YE5A 3DHVA 4TRNA 1XNJA 4NYIQ 5HKBA 2VRCA 4FFLA 1IDN1 4R40A 2XNKA 1T9ZA 4QO8A 3BE5A 4XVHA 4DMUB 2WB4A 1GKIA 1MIOA 2D5CA 1WMEA 2BWJA 3RU2A 1PW7A 4BGUA 1TC2A 2R68A 2DWCA 1PT8A 5JXIA 3EDCA 1ABFA 4PLWA 2O2EA 2OD2A 1CUJA 2X1MA 2FF7A 3FDXA 2CYAA 1RJDA 3ETDA 3IAAA 3R3ZA 4RWZA 3U9SA 2AMJA 5SYAA 3KB6A 4FFDA 4BP3A 1DIHA 2HNAA 4MXDA 2AFHB 1KEUA 1TYAE 1HPLA 3FG9A 5J9FA 5CA0B 2P6OA 3IEXA 4TKLA 1QGED 2IZ1A 1ZLXA 1TIBA 2JBAA 1BOOA 3GK3A 2VAPA 4N7BA 2GYUA 4L8YA 3S5UA 2WUFA 3FHJA 3SSAA 3OU7A 1ESNA 2QV0A 1NY6A 2MMGA 2OHIA 4M6WB 4D9FA 3ZHBA 4L2IB 2ZXFA 4TSRA 4A36A 2QQFA 4KQ2A 3CVYA 3PGVA 1GA4A 2ZVQX 4YUZA 1KNXA 1RJEA 2O8DA 3WL8A 2ZRJA 2X0JA 4I1PA 1XJCA 3NATA 4QULA 1CCWA 2WHPB 5DGIA 1HT1E 1P5FA 4C20A 4JT8A 2IP4A 1LVUA 1UXHA 4JVNA 4CJXA 3L4KA 3PQ5A 4FX5A 3DLIA 4UATA 5C2JB 3SE0A 2A9OA 4UM8B 4ZPXA 3ILXA 3V9AA 3ODGA 5HPYB 3P26A 4B3BA 4E4TA 1RADA 3CNBA 1KIMA 1G17A 3RB8A 5TF0A 3RIYA 4EKIA 1T8RA 4ENPA 5AFSA 4XZ3A 5DNYB 4ISCA 3FM9A 4PFQA 3CNOA 4YFVA 2RH8A 1T6XA 1VHQA 3AWDA 5DDIP 1FSPA 1XMXA 3HFRA 5EWJA 3NBZC 1P1FA 1THZA 4NZOA 5AVUA 4RSHA 3KT8A 3U1TA 4EVSA 5B5SA 2A9VA 3OWXA 1NW3A 3D6TB 1S1CA 4YMIA 2EIXA 5FF9A 1VJ1A 5K2MA 2OPBA 3PR1A 3PHLA 4FOLA 1VE6A 3DEAA 5A7GA 3MPUA 4J76A 2BCGY 2FZCA 3PA8A 4FGUA 2R1TA 5CA0F 4D9HA 2QL9A 2C7BA 3OOHA 3N8GA 2J5XA 2ZVDA 4D9BA 2WKSA 2E0IA 4XWYA 2WFMA 3B5EA 3AESB 3BWCA 2PRSA 3NPMA 3NQ41 1JFRA 4LTMA 1E2IA 4WBNB 3JQ9C 4LGVA 2ZPAA 3O21A 3QKRA 3VSCA 1JLMA 1VCMA 1DX6A 1ENYA 4CT5A 1VJ5A 1PWHA 2CVQA 3DWEX 3B70A 3HDGA 1GR0A 1HMPA 2GAIA 2JASA 1ZW1A 1NI5A 3KWMA 5U4XA 3CRMA 4MB6A 1SK9A 2DT5A 2YXBA 4HWTA 4KAAA 3V1KA 4H6PA 3VMMA 1ODSA 1WBDA 2D54A 4AX4A 1UQRA 4ETMA 1BS1A 4BO9A 4BJ1A 2OORA 1NIJA 3P2MA 4B4KA 2RAUA 4HNAA 1JDBB 2NPIA 1CUZA 2JHFA 4JQZA 2GUGA 4QE3A 3T95A 4AWBA 3GNSA 3O8RA 3AKZA 3ZE6A 2YQ5A 4IQ8A 1ZR2A 3DPUA 2A2ZA 2QYSA 1ZCJA 2EP8A 3A1WA 3N7UA 3T1TA 4WESA 4ZALA 2L19A 1SUWA 1N6IA 4G4JA 2QRVB 1S2GA 1WOMA 1W8DA 1J6UA 2TMYA 1EXVA 3HVIA 1SNYA 2O6LA 4QL3A 4EKDA 3PQ4A 4GSKA 3N2YA 3S1AB 2CNWD 4KWIA 2X77A 3BD7A 2O8BB 1NFFA 4QJ4A 1VSTA 1Y1SA 4Z3OA 5C3UA 1HKHA 4C0HA 1XDBA 4TSFD 1Y8QB 2YV2A 4UUPA 3HNRA 4B3MB 1TQ2A 4WBNF 3I53A 4GPTA 4UBMA 4LJ7A 4W5RA 5JFOA 2VAVA 1T8WA 4Y67A 2X6RA 4MI9A 3NU1A 2H2IA 3EMVA 3RVLA 1T9GR 4DV1B 2DCUA 2OAGA 2Y3IA 1CJKC 4RVNA 3UAZA 4R8KA 2P6UA 3B1FA 2EWWA 1GG5A 2H0AA 3PFWO 3H8JA 3D8SA 3M5DA 2DJ5A 4G1VA 4JLNA 1SHZA 4W82A 4PZ9A 2I3ZA 5IAJA 3R9IA 1DJMA 3GI1A 1SQFA 3HM9A 2WVJA 5COQA 2GCOA 4KX5A 3FYTA 4P6VF 3NORA 4D4JA 2LKDA 4JBHA 4GWLA 4JJEA 1ORTA 3BGIA 3KK0A 4K5QA 1XXLA 2NVBA 1G2QA 3FNFA 4N1AA 4W9NC 4DHEA 1O95A 3A0UA 2PWAA 1Z5GA 3KC2A 2A59A 1E2EA 4GLJA 4IFBA 1PUXA 1M33A 1B0ZA 2WF8A 3GG9A 3MMXA 3HY4A 4K9PA 4WWHA 4DG9A 3T52A 2QLLA 4LYAA 1TO1E 2OKCA 4Y8VA 2WD7B 3MBIA 1QIFA 5CURA 1V9SA 3JQ6A 3VC3A 1NRJB 3IT1A 2UZIR 2VXBA 1GPUA 4CUZA 1W9HA 3Q7PA 2GN2A 5DLYA 1UBKS 3AY0A 5D5QA 7ADHA 4ALKA 2HJWA 1YNOA 3TEJA 1XF9A 3NC1C 5F76A 3HUEA 2OGUA 2G6TA 1P5RA 1CJBA 5EJIA 4R8MA 1RZUA 4JI2B 1EWKA 4XRGA 2RIPA 1YI1A 2REQA 1SUBA 1ZA1A 5HP4A 4XCVA 3HXPA 3JAKA 4OQMA 3DVRX 3IJEB 5K5EA 5ADUS 3UAGA 1GTG1 3OCWA 2XADA 4HB3A 3V97A 4B48A 2MSNA 2HYIC 5A1TA 1JMYA 1HOXA 2OHXA 4GMHA 4ON9A 4R1NA 3ZDEA 2JCGA 1LDBA 5B58C 4DUPA 4JBLA 3HNPA 5DP2A 5DU2A 4MK4A 5JATA 2ZG6A 1CE8A 3IQIX 2C2WA 3UWOA 4TRRA 1BCRA 3FCYA 3T38A 3EWNA 1JG4A 2GHRA 1XDSA 3Q9UA 1JA0A 1DTSA 4HUQA 1I6MA 5JLJA 3KD2A 1AUOA 1E5XA 1VIVA 1M7GA 3G5LA 2PJZA 3NWEA 4KO4S 1Y4AE 4RH3A 1UJMA 1ESMA 4NZZA 3UMRA 4DWJA 5M04A 3EPLA 4EGCB 4DQVA 4NBTA 1G63A 1E3DA 1EHYA 2FPMA 2W8ZA 3CINA 1JIJA 2XVAA 4G0QA 1FMFA 2RKBA 3WGTA 4FZRA 2XWSA 4F4IA 1GFSA 1XLTC 1RI4A 2F1HA 3E7XA 2DPYA 2SBTA 4XJXA 4JR1A 2GK6A 3C6MA 5AK6A 5I8PA 3IAFA 1QGUB 4C2UA 4K9OA 4V39A 5JUWA 1JEQA 2PWPA 2HHLA 3B9RA 3CR3C 2DQYA 3R9XA 3PRJA 2N9UA 2EFCB 3GG2A 1U4SA 1K3FA 3UXYA 4YX9A 4B7UA 3U7EB 4P3YA 4OX9Y 3UAYA 3JR3A 1NU8A 4K2AA 3R23A 4PHFA 1QTRA 3IR6A 1KJ9A 3N9IA 4IXWA 1V1MB 3MWLA 3VI3B 1WP9A 3FMGA 2I1LA 5KZMB 4CV0A 1KI6A 1VECA 1FJ2A 1SUAA 4Z7NB 1TMKA 4U2EA 1G5HA 2DKNA 4PC3A 3SOZA 1PCXA 4UQPA 1ZGJA 3G2JA 3M8KA 1II8B 3E1SA 1BXZA 3DV0B 2PUAA 1P2FA 4FXPA 4IIGA 2H65A 1XDZA 5IH7A 1TCAA 2MYTA 2V7WA 3K30A 4KYUA 3EDQA 3WVNA 2P2YA 4A91A 1IRIA 4ERNA 3NHAA 2XBUA 2ACWA 2PMFA 1WEKA 3PYLA 5JSYA 1NVKA 1LJ8A 4EECA 4QOJA 3SR0A 2PPLA 2RG1A 1X1DA 4UAUA 2MJLA 1JLLA 2E6UX 3K0CC 1FRFS 1WTCA 4FGLA 5G1NA 5CB4B 3KV3O 5A9RA 2CMDA 3G88A 5CVDA 2D59A 4CKXA 5I9BA 4F46A 3PQFA 4J0FA 4Y2SA 4X8MA 3KUKA 1KQGA 5ED4A 1HE4A 4WXPA 1ZESA 5ILOA 1WB6A 4ND7A 4A5SA 1HDYA 2VUUA 6YASA 1FYWA 5EI5A 3Q1LA 3WKEA 3EZLA 3K1AB 4DR6B 4Z4FA 2G25A 1M8PA 4F4DA 1FFSA 3TTUA 2PZ8A 3TLAA 3FHLA 1GPNA 2O5VA 3D3WB 3JSXA 2PH7A 1T5DX 2XQJA 1OROA 3M1IA 4IP0A 4PG7A 3AP1A 3P5BA 4XOIA 5JNTA 2I1VB 3T3EA 3ZQ4A 2WZCA 4G5QA 3G5MA 3WK8A 2K7ZA 1D2AA 4WGFA 5AJVB 1ML4A 4B7CA 2WSBA 3ESZA 4BNDB 1VSBA 2WUVA 3E15A 1H69A 4MWTA 2COEA 4CFZA 1M54A 1K86A 1T2FA 3WSVA 1QQTA 3LQ1A 3F46A 4TROA 1AHHA 3ONDA 3PDIA 4L28A 2DULA 1OWLA 4RKEA 2GJKA 4BFTA 3R0JA 5HRCA 3ZDRA 3F78A 3IHLA 1NNEA 1HOTA 1XI2A 3CBQA 3I9LA 3ITDA 4G5OA 1ZM9A 1ZQ9A 1AG9A 1P1BA 3GUYA 3UJNA 4FE3A 1W5FA 3GLHB 3IO5A 1J2JA 5FTKA 3SEZA 1Y80A 4KFUA 5AKYA 1GL9B 1QGZA 4EMBA 2ENUA 1FFWA 3JWGA 2OQVA 3E70C 2AL7A 3DC2A 3KM0A 4B46A 1MC1A 3TZEA 1TECE 4GD3Q 2VQEB 5HTOA 1NUHA 2J1LA 1B1CA 2X2OA 4G1FA 5A7HA 4QD3A 1XTJA 4DA7A 4ROTA 3M9XA 3AZQA 4UNIA 2Z83A 1HY3A 5A2GA 1G8FA 4R8LA 5BSVA 3QY0A 3FTEA 5K09A 5KHOC 3QELB 4ALNA 4OJYA 1Y7TA 4OHKA 2KMLA 3MCUA 3IL2A 2PCJA 1YTLA 1MG5A 1XHEA 1F2UB 2ZRDA 3M5PA 4CKBB 5DK6A 1GGVA 3KSZO 3QOXA 1FC0A 1GV0A 2QNRA 5SZKB 3SYRA 4MW9A 5AJTA 5BUSA 1AY0A 2OGTA 1SCQA 3O4FA 3SLGA 2JKVA 1KK0A 3HCPA 4XJTA 1RYYA 5LDGA 2BH2A 5EKUA 1J8YF 3VPGA 5E6RB 3UQYS 2WU4A 1SULA 3SYTA 1JE0A 3MOSA 1M10A 1K2VN 5BW4A 3KQWA 1MR3F 3QQPA 2VYVD 2L69A 2X9VA