521PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTTGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-RAS P21 PROTEIN
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
total genus 51
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 521pA00
3CX8A 3B7GA 3QXSA 1E32A 2CK3A 1Q21A 1G8YA 3DHWC 4TWZA 3T1VA 2FSIA 1G19A 4FINA 3O8RA 3TH5A 1NP6A 3EXAA 4WOPA 2PCLA 3THOA 5G41A 2UKDA 621PA 3OEHD 3C15C 1AS0A 1PUIA 2OCYC 1E2QA 2W6JA 2FDCA 3SC3A 1N0WA 3I61A 5L3QB 4FMDB 2IXGA 3GCGA 4JL8A 1L4YA 3AUXA 5EQTA 2VYFA 4C0JA 3ZS9A 1WRBA 1E9SA 2IYRA 2DCUA 1KAOA 3W6PA 1OH8A 1XJQA 2TMKA 1WP9A 1XTRA 2JIZD 4JVMA 4LJAA 3SQWA 4FMCF 1OXXK 5M04A 3TKLA 5C1BA 1R0ZA 4EFLA 4AKIA 5CYOA 4DEYA 5E7JA 3CRW1 2C99A 2J59A 1XTJA 4G3XA 2GHIA 3IEVA 1LNZA 3QBVA 4ZDKA 2QGNA 2V7QA 4JVSB 1UKZA 2BDTA 3HR8A 5CB8A 1WMSA 4JMPA 4NCJA 4R7ZA 2J45A 4NP6A 4PHTA 2ZROA 3CM0A 4TYYA 4DSUA 2KI5A 2RGBA 3Q7PA 2JA1A 2RB4A 3B1XA 1DEKA 4K81B 3QKTA 2GEDA 1J7KA 1MRSA 3I8SA 3LA6A 3TUZC 2GETA 4D0LB 1QHGA 1E98A 2C8VA 2LWIA 4XH9B 2AWOA 1C4OA 2RAPA 3L8YA 5FUVA 5GVSA 1KMQA 2JLWA 1UEJA 2WJJA 2ZRFA 2ANCA 3WNDA 1G20E 1YZQA 1G6OA 2D62A 3A1WA 4Q4AA 3V4RA 2YKGA 2WIAA 2ORVA 1G18A 3X1XA 1QZXA 3PCRB 3U5ZB 4GP6A 3THYB 3LBHA 4YMVA 1AN0A 4M9SA 4Q1EA 2BBSA 4MGKR 1N25A 1VMAA 3OE7A 4WXPA 3QXJA 4F4JA 4TLDA 1ZC4A 1KKLA 1XB2A 3G0HA 1NY6A 2G1JA 3RSOA 2P2LA 1OJLA 1II8B 4TL9A 1CR1A 3H84A 3MWLA 2GTPA 4AD8A 3QEOA 3KUCA 1H8ED 1C9KA 2AX4A 2OAP1 5FPSA 3MG9A 2IYXA 3GJXC 1GITA 3PUVA 2GBLC 3DMNA 4RZ3A 2OFWA 2YNMA 1UBGA 2QTVB 4NPHA 4NH0A 4QC2A 4P32A 4S2EA 2A5DA 1N0VC 2H57A 1KO7A 2HXSA 4DDTA 3Q72A 1NMZA 3P26A 2Z4RA 4FCTA 3IKJA 2JAQA 2OLKA 4OHXA 5FL3A 2ZSDA 3EC1A 2ZM5A 4FWIB 3O8BA 1XU4A 3EPJA 2PT7A 5J4VA 4HAYA 3U6BA 1I4LD 1RW4A 721PA 4C9BA 1UBEA 4UNRA 2VL7A 1DAFA 3FYHA 1EK0A 4ZDIA 4KFUA 2EQBA 2J1LA 2QSYA 3HP1A 1SKQA 3IHWA 5JCZA 2ZRNA 1HURA 4QL3A 1GKUB 2GESA 3PUWA 2ZRMA 2WKQA 5DYIA 3DMDA 2XB2A 1GL6A 2RGXA 3QPWA 4HLDA 1I4DD 1BS1A 1NN1A 1D2NA 1U0JA 4UJ5A 4UXJA 1TUEA 2GVDC 4KSCA 3LWNA 1R5OA 1N6HA 4FMCB 3OEHA 5EP3A 2IHBA 4CZ2A 2UZIR 1KDRA 3NBFA 1G1MA 3QKRA 1AIPA 2C98A 2W83A 2XB4A 5H8WA 2FSFA 4A2QA 3CO5A 1KSFX 1Z0JA 3EA0A 4JLMA 1RE0A 1KI7A 2Q6TA 3KJHA 3QUSA 2JJ8A 2PZFA 4DSNA 2QTFA 5BN3A 2JIZA 2PBRA 3K8YA 4OQNA 3K70B 2CCKA 3CB4A 3NC1C 1RPZA 2PEYA 2XTMA 4JKYA 4TMZA 3SYLA 3EA5A 5GVRA 2GJKA 1CRQA 3OIWA 3QKSA 2GZDA 2HF8A 3Q7QA 4M1OA 4LJ5A 4HDOB 4PC2A 1G16A 2QP9X 2UZ3A 4RKFA 4JT2A 2YINC 4B35A 4OHYA 5H1YA 2EFDB 2EFHB 2GF9A 2B7BA 3U3RA 2YVUA 5LB2A 3GEIA 1E94E 3ZZTA 4V0NA 4YMUA 2ZRJA 2NMVA 1W0KD 4YMTA 4YXWD 4LJ7A 4LX0A 4FCVA 2NG1A 2YZ2A 4NL4H 2ZS9A 1Q3TA 1VTKA 1XCPA 2D4HA 2FV8A 1Q44A 2DWPA 2Z6VA 4JBYA 3IILA 1J99A 5KTYA 4A6XA 4MYHA 4EJSC 1XTIA 3R7WB 2WWWA 4DC9A 2FJUA 2VP0A 3PUZA 5KUTA 3VR5A 1JR3E 5J40A 1EESA 5FPHA 4ZDWA 1ZM2A 4D4KA 3U3MA 2WAYA 3CH4B 2JLXA 2XXAB 2ZRGA 4A4DA 1H8EA 3X1ZA 5FUXA 4RCZA 1QHSA 1DADA 1G291 2GNOA 2HJVA 2Q3HA 2QA5A 2QQEA 2ZYUX 3TMKA 5JZVA 1TF7A 1IXSB 1W36D 3A1SA 4U5XA 2FOLA 2OG2A 1ESMA 1HTWA 1L2TA 1ZUNB 3IBGA 2RGNA 3K9HA 2ZJBA 2H8KA 4LJ8A 4QGAA 1CEEA 2XOKD 3QF7A 2ZRAA 5KDLA 4POAA 4RFSB 3QY0A 2N42A 5AK0A 3BXZA 5B64A 1E1QD 1AJEA 2G83A 2VHJA 3CZQA 4KU4A 4H1VA 3QPVA 4Q9KA 4KFTA 821PA 2I3BA 4IDQA 4URXR 3QG1A 3UATA 4US0R 3F8TA 4PSAA 5FOTA 4JLVA 5BN5A 2C2HA 2FEOA 3H2YA 3IBYA 3T5GA 1OFIA 2QORA 4DHEA 3FDIA 1K6MA 1ZM3A 3R8CA 2GA8A 1N6LA 1CR4A 1Z5ZA 2XAUA 3KXIA 2PLRA 4URZR 4RSGA 5J4KA 2OBNA 4IOJA 2ZYWX 4OJQA 3WRXC 2G3YA 3KKOA 1OFUX 2ZSEA 3MSXA 2OCBA 1RYHA 4JLJA 3C5CA 1II0A 2N46A 5EE0A 2ZIAA 3FMPB 2IBMA 1Z6AA 1XCGB 1S4QA 5LDDC 2GZHA 3DOFA 2DHRA 2JJ2D 1OT3A 2GXQA 1W44A 2X1VA 2ONJA 3OIVA 1GRRA 4LYJA 5CYPA 1LY1A 4JLPA 3PEUA 3RHFA 2IYLD 1R7RA 2GK6A 2JGNA 2R9VA 5DN6D 3AGPA 1E2IA 1TADA 2BM0A 2J9RA 4A1FA 5FOSA 5JRJA 3TVTA 3ZZ0A 1T3SA 3MJRA 1E79D 1Z6TA 4M21A 3THXB 4Q4HB 1UBFA 4QHTA 2V55B 4MRNA 5KNBA 4B2PA 4Q9HA 2ORWA 4WZBE 2WJHA 1DBSA 2B21A 3PG5A 3REGA 1G64A 4K46A 3VR6A 2WV9A 1HYQA 2ECKA 3QSYA 3SN6A 2EU8A 4MITA 2ZRDA 4AYTA 4LV5B 4OK3A 4Q48A 2R62A 3EX7C 1JAHA 2A2ZA 1OFHA 2A5JA 2W6ID 3A4LA 1KJZA 3KKQA 4TMVA 3SU8A 1Q20A 3CR7A 3REFA 5H68A 2PL3A 4MYUA 1OXUA 2QEQA 1W0KA 3RS5A 3W8NA 3MWKA 3OIUA 4I1VA 4YXWA 3DO6A 2CLCX 2R6FA 2Q9AA 3NXSA 4X8MA 5DSZA 4NMMA 3CPHA 2BBOA 3J81k 4OI0A 4M9QA 1FQKA 1GM5A 4KVGA 1XZQA 1VDZA 3EZ2A 3GD7A 4JLBA 1K5GA 2Q9BA 5JI3E 1LVGA 4CYMA 5AJYA 4ZI2A 2QPOA 4I1UA 5HE8A 2QN6A 3GJ4A 3ZZUA 2GILA 5B57C 2IYYA 4M2LA 2AHOA 1UFQA 1K5DA 3CIOA 1PLKA 1YZLA 3RRYA 1SXJE 1IN6A 1FP6A 3M1IA 3IDQA 4HAUA 4CEJB 1NVVQ 4NKRA 4R2IA 4MKGA 5BYKA 4G01B 1VCIA 4A92A 1KZ7B 2FG5A 3QXXA 3IIMA 4HB3A 2C9CA 4PTLA 4A36A 2OXCA 2IUSA 2JATA 2V1XA 2IUUA 1QRAA 2XOKA 5HTKA 1XTKA 2GK7A 5CB6A 2WVJA 2CE2X 1UEIA 3PUXA 4TQ9A 3BAFA 5DHFA 4TT3D 1E1QA 2AL7A 1DO2A 2R65A 3TIFA 1Z0DA 2YOGA 3BH6A 5DE3A 1E99A 4XWOA 2HT1A 2WAXA 1JXMA 4PR0A 5E3HA 4M4SA 4M1WA 2ZI9A 4HUTA 3RS7A 1ZRHA 1CULC 4HLUA 5K8LA 4D25A 1RRFA 2IYSA 2PZEA 1LW7A 4B47A 2XZLA 5B58C 4E5UA 4HB4A 4Y0AA 3DZ8A 3WP1B 5CJ2A 2GCOB 2HEIA 1XRJA 2PX3A 4U7DA 2CMKA 5CK5A 2ZVQX 4EJSB 2AK2A 4NYJQ 4C0SA 4NHOA 1GILA 1XPRA 1T3LA 3BOSA 4TMTA 1A2KC 4RCYA 2IUTA 4L16A 4A0HA 4B71A 3U3OA 2WMOB 2CL7X 2JCSA 3A6PC 2VPPA 2IS2A 5EJEA 4TZ0A 5E4FA 3BJIC 4RZXA 3TVDA 5FBRB 3BERA 5JJIA 1SVOA 5DN6A 1JEEA 2QPAA 4P33A 2IF0A 1HV8A 1VHTA 3H1TA 2O8EB 3ZIAD 1G7CA 1E4VA 2RMKA 1E79A 1AQYA 4PQYA 3AGQA 1KMHB 4WIAA 5FBLB 1DE0A 1CJTC 1T0HB 4MKFA 3P32A 4TLBA 3CLVA 1OW3B 1VHLA 2O52A 5L3SB 1W4RA 1KNXA 3K0CC 3L0OA 2DY1A 4DWJA 1IQPA 3BB1A 1TL7C 3N2IA 4AWXA 2WWYA 3LD9A 5E95A 1A2BA 4BEJA 1ZW6A 1T91A 2XEXA 3EASA 2C96A 1G3QA 3SI7A 4N3NA 4M9ZA 3CWZA 3TLXA 1C1YA 1XEFA 1XXHE 3QPUA 4Z1MD 3W9YA 3BFXA 1YR9A 2SHKA 5SZHB 2IS1A 4C0HA 4AC9A 1U2RA 2FFAA 4RD2A 4LJ9A 1AKEA 2F43B 2C03A 3C41J 5DO9A 2AD1A 4KYUA 3GFOA 221PA 1NIPA 3K9LA 4W5HA 5TMPA 5KPDA 1M74A 4PO1A 2QMOA 2ZS7A 3PIRA 4P4SB 4TL7A 2FPLA 2VO1A 1QVRA 1UADA 1QG2A 1G8HA 4RVCA 4HEJA 5L3VA 4TLCA 3DEFA 1GTVA 3U4QB 4NYIQ 4UJ3A 3PEWA 1Q12A 4C2UA 2H1LA 4F91B 2HDNB 4QBIA 2DWOA 3K0AA 1D9ZA 1L7VC 1KY2A 2ZU6A 2FH5B 4A8JC 1SXJB 4RZUA 4B76A 2H16A 3U3JA 4ZCLA 4MRRA 3GLHE 3X1WA 4JVNA 2OXRA 2XSZD 4M8NE 1NSFA 3T1QA 3T35A 1FQJA 4DDUA 2O8FB 5HR5A 4DLXA 1GFIA 4M0LA 8OHMA 3OEED 4G0NA 1KSGA 1YZUA 4TT3A 2BVNA 1AM4D 1RJ9B 5HKKD 1P3JA 2CDNA 1OIWA 2F3TA 3LRPA 2GXAA 1KO1A 5J4HA 1QDEA 2QMEA 3LXXA 1ZU5A 4EIWA 2ZUCA 1G21E 3EZ6A 4UNPA 4TYWA 5HPYB 1EX7A 4JL5A 2H18A 5CJPA 3KZ1E 5CITA 4CEIB 3AVWA 2F55A 2FGJA 1R5NA 1Z6XA 3R8FA 1WE2A 4D0NA 1VCOA 3L0SA 2WWGA 4TLAA 2JLQA 3FMOB 3KB2A 1Z2CA 4V0ME 4PC6A 3SFZA 4DT1A 2ZJZA 3MMPA 1F2TB 1VYTA 4B34A 3ND8A 4L5BA 4LBVA 3CNNA 3IEUA 1QHIA 3SJCA 2NOAA 3IGFA 1Z0IA 2NTYC 1ZAKA 4HUQA 3BH7A 4QJ5A 4B3DA 4TL8A 4XJXA 2BV3A 4Z54A 3QQ5A 4Q18A 1ZMXA 1FP7A 1N5KA 2X8AA 2ZI5A 1LS1A 1FX0A 1NLFA 2FWRA 3KFXA 1X1SA 4FMDF 3RC8A 5HZHA 1GKIA 4GP7A 2O5VA 1QHXA 2WSSD 2YJTD 1NSTA 1KI6A 3IQWA 1QBKC 4HDQB 1O3YA 3AKCA 4HSEA 4Q03A 3ZIAA 5AUOB 1CF4A 2C5LA 1FZQA 3LW7A 3X1YA 4RZ2A 1KI8A 1BKDR 3BB4A 1EFRD 2BCJQ 3OFNA 4DXAA 1DAMA 1G9XA 4D2IA 3GLFE 4QGFA 5KSPA 1NG1A 3TGPA 2G1KA 5CDFA 5JMTA 2HYIC 3UMSA 1Q1EA 1UKYA 4LHWA 1P9RA 1E2JA 5L3QA 5JWOA 4D4LA 2W00A 4PO9A 4EPVA 3BH0A 3F5FA 4URYR 3LVQE 4Q4LA 3AF0A 4Z1MA 5FR1A 1YZGA 4BECA 5EUMA 3L8ZA 4Q4JA 2IX3A 5G3ZA 4B75A 4DLVA 2G9NA 2RGDA 3Q85A 1OB2A 3KX2A 3LX5A 1YR8A 3CRMA 4PQRA 2J0UB 3TUJC 1W7AA 2O8BB 3GLIA 2BWJA 4CEHA 2YWGA 4DSOA 2JLZA 2WPDA 3OESA 2WOJA 1CP2A 3PQCA 2ZR9A 4Z8XA 5A5GA 3ZYCA 3C7KA 1L8QA 2ZE8A 1IM2A 1ETUA 4HB2A 5BW8A 1NI3A 3Q8XB 3QG5A 3SEAA 4UXIA 1G5TA 3E70C 5FTMA 1MKYA 2VP9A 4BE7B 1IXZA 2IEZA 4C0BA 2VHTA 2I1VB 4BRWA 1CIPA 2XSZA 3GLHB 3QI2A 1M6NA 4IFBA 3VR2A 3PUYA 4BGDA 1IAQA 4V0OA 2Z5FA 5G40A 1YJ5A 2CVHA 1NRJB 4G5RA 1E96A 2ZQ5A 5BWMA 2FSGA 3CRVA 4Q66C 5F98A 3OEEA 1U8YA 3WYGA 4LDJA 3SOPA 1KI4A 4JSTA 1OXTA 3W90A 5HKKA 2BMEA 3JVVA 2O8DB 2V3CC 1KI1A 4KITB 1OH5A 2GXUA 5HCIA 1E2EA 3ZD7A 4XSGA 2NGRA 4YDSA 4NU0A 1Z6YA 4IDPA 2WHXA 1OIVA 1IY0A 3PITA 1U94A 2DFLA 121PA 3TR5A 3VU9B 4C7OA 1KY3A 4BUJA 1KK3A 1CR0A 4M1KA 2P3SA 3NBZC 5TVKA 3VR3A 3HJNA 3VKGA 4NYMR 1US8B 5IF9A 2ZJAA 4HZUB 4ZPXA 4DVGA 2B8WA 2HT6A 2VA8A 2YWEA 1ESNA 1XEXA 3ADKA 3WP0A 4F93B 5JS8A 1XPUA 4BRUA 5TV2A 5EE9A 4CVNA 3U61B 4MYTA 4TQUS 5LB4A 4B44A 3UANA 3OIYA 4TLEA 1GG2A 3KKMA 4MH0R 2VLIA 1S96A 4BFUA 5IRCD 4A8JB 2R6DA 2VRWA 4KSBA 4D26A 3MLEA 2WSSA 2IYVA 1D9XA 1XPOA 2ZI3A 1EWQA 2ZR7A 2A5FA 2BBWA 4Q21A 4QFMA 3UPUA 1P7CA 2MMGA 2FSHA 1GL7A 1EFRA 1X3SA 2RGCA 4LSGA 3SDZA 2ZI4A 3P20A 1G8GA 3O47A 1FUKA 5C18A 3GLFB 2CCJA 4B6FA 3K0FB 4Q7MB 1RIFA 4RD1A 3U6KA 4LBWA 3MJHA 4RD3A 4JLAA 3PV0A 4IVRA 2FU5C 1J2JA 4FXPA 3ICQB 4LRWA 5G3YA 1JR6A 3HU2A 1NJGA 2Q21A 4H9GA 2EVWX 3SNHA 1X1RA 2XZPA 3P4YA 2ERXA 1G3IA 2WWFA 3IO5A 1SULA 2IYTA 5FUYA 3R9WA 1V43A 1G4UR 4DCTA 1I2DA 2ZRIA 3KQLA 3LVRE 2ZE5A 1V5WA 4B3BA 5JCPA 4B3GA 4EAQA 5FTLA 3NWJA 1ANKA 4A9AA 2OFXA 5EZ6B 3QE0A 3AVPA 3EIQA 4UQOA 2E1RA 2ANBA 5JI2E 3DKPA 4DLUA 4EFMA 3ND9A 2QAJA 2VSXA 4FD2A 4CT5A 3UWOA 2OCAA 4DUGA 2YOHA 1W47A 4OBEA 2ZE7A 1KO8A 4V02A 4GNKA 3WHKA 4IXNA 3SYNA 2JLUA 5C4MA 1LS6A 3LV8A 3A4MA 1RYFA 2ZJ8A 4P4UA 5IHPA 1E2GA 2VTKA 4BLPA 1SHZA 5GADl 2WTUA 3X2SA 4DLYA 1KI2A 2HUPA 1E6CA 3FWYA 1KOFA 2LCFA 2FN4A 4I4LA 4KFRA 4KXFB 2L0XA 2XTNA 3JVUA 4BLOA 1CTQA 3ZVRA 1Z07A 4II7A 1S0UA 4QRHA 2WSMA 2KBEA 3ZVNA 3TSOA 2OSBA 4TZ6A 5DH9A 4P0TA 3F3YA 1S8FA 1KDOA 4OHWA 4Z8YA 3WYAA 3PJRA 4D4MA 3R7WA 1NVVR 2RGAA 4Q02A 1E2MA 4WZ6A 5GJCA 2NO1A 1XCMA 4AYWA 2REOA 3B78A 3H4MA 2DR3A 4WW0A 3AF1A 4A15A 1JBKA 4QKQA 1NKSA 3AVVA 2OUKA 1VG1A 4DIDA 3CRQA 1D2EA 4K8OA 3WMFA 3THWB 1R4AA 2OCPA 1HE8B 1PV4A 1FMLA 2IL1A 3M4YA 3CONA 5EE1A 5AUNB 4AI6A 3ETLA 1P2VA 3N5CA 1NN3A 1BYUA 1G4AE 4HLCA 3RS3A 4BLRA 2DYKA 4BPBA 2R6GA 5K8TA 3AQ4A 4ACBA 2CXXA 4GT1A 4QNMA 4WXRA 1GNPA 4BQSA 4RD0A 1T4GA 2PLFA 4RFVA 4E07A 1NVUQ 4TMWA 5ANRB 3TW8B 2V6JA 1KDPA 3EIHA 3CRRA 4WVFA 4CRWB 4TTPA 4CT4B 3I73A 4IOLA 1N5IA 1HQYE 4WAUA 1P9WA 3BB3A 1B23P 3GLGA 4ILEA 4BFVA 3R20A 4JT4A 2D06A 1R2QA 1Z08A 2DWQA 3AP3A 2NO6A 4TN1A 4OHZA 3KUDA 3RANA 1MV5A 1YZTA 4LHVA 4N0DA 3B6EA 3GJ5A 2ZVPX 3KQHA 1COWD 3C16C 1AGRA 2ODNA 3RLFA 2JJ1D 2A5YB 1X8JA 3TJZA 1W5SA 2RH5A 2J5XA 3SJAA 4LHYA 3BRWD 3W3ZB 2GBLA 2OLJA 4KCGA 3FHTA 2H17A 2BMFA 2GAAA 2ZAMA 1ZC3A 3MUFA 4OI2A 3DM5A 3W3AA 2O8CB 4D0GA 3NH6A 1S9HA 5CIQA 5FFMA 3THXA 4Q4HA 3HWSA 2ZJ2A 3EAQA 3NG1A 3B5JA 4UXHA 1ONBA 4V0LA 1G8PA 3TR0A 1A82A 3TSZA 3ADBA 4JBWA 1NLZA 1A4RA 3Q9LA 3WRYC 1G3MA 2H92A 3BORA 5FI1B 4B6EA 3VKHA 2ZI6A 1NBMA 3EPKA 1H8HD 2ZS8A 4HZIA 2J0VA 5FL7D 3IHLA 2QE7D 2XJ4A 4F4IA 1NMYA 5DYGA 1XP8A 1DPFA 4Q1AA 1E9CA 2D2EA 3IIKA 2ZSBA 1H65A 1KYIA 2DFTA 1KSJA 1N6NA 3ONWA 4XTRA 1UDWA 4OI1A 2Q9CA 3OHMA 1DOAA 4DSTA 1XMSA 2P67A 1AZTA 4EUNA 2BC9A 5JHHB 4QJ3A 1P2UA 1ZINA 3FPAA 3LDAA 1VG8A 3IO3A 3WNCA 1W36C 3UWKA 1W4BA 3AKYA 5SZJA 1XEWX 1YRAA 1SVWA 3B9PA 2ZREA 4FW9A 4QXAA 2PCJA 3HPRA 3K09A 3QKSB 4CEJA 4HYYA 4OYHA 5JWRA 3VMFA 1D6JA 3CNOA 3P1JA 2WWXA 2VQSA 5AJXA 2ZANA 3OZXA 4ON9A 1IN7A 1P6XA 2IYWA 1UDXA 2I4IA 1EWRA 2W0MA 4B2IA 2JEOA 4IOMA 3CF2A 3WHLA 2IS6A 2QMUA 5KOYA 1BIFA 1SXJC 4ARZB 5J47A 1U0HC 1GAJA 4WA7A 5KDOA 3EW9A 2IF2A 2HF9A 4YLGA 3AF2A 5H70A 1ZU4A 3D3QA 5DISB 3I3SR 1GP2A 2PH1A 3PENA 2VF8A 2FPKA 4IW3B 3DVLA 4MRVA 3CH5A 2BIFA 4DIEA 5K8UA 2NPIA 3T06B 3PEVA 4PPQA 1KIMA 5D3MA 1CU1A 3WXMA 3KL4A 1RRPA 5F2EA 3DM9B 2FEMA 4C2TA 1VG0B 4CF7A 4EJSA 4LPKA 4PSKA 1GUAA 4EKDA 5FI0B 2BM1A 1W1WA 3KKPA 4OQMA 4ASUD 3GJ0A 4M53A 1KDTA 4LUCA 1MO5A 4KFSA 1COWA 4XVUA 1NVXQ 3EARA 2AK3A 3M0EA 2JJ1A 3BGWA 3A36A 2XJ9A 1HT2E 4WBSA 2QM8A 1XFAA 2K5UA 3LO5A 4FMBB 4V0KA 3CF0A 2ATVA 2PMKA 1ZNZA 4PAOA 2D7DA 3BC1A 3UK6A 4RKEA 3ZVLA 1VCMA 1N5JA 3S1AA 4BFXA 3AH8A 3U60B 2O8EA 3NKVA 4LJ6A 1ZBDA 1DG3A 1KMHA 4P31A 1NIJA 3LNCA 3KJEA 3HU3A 1OH7A 4UNNA 1G7SA 2GJ9A 1OH6A 2OT3B 2EFEB 4C0KA 3QF4A 1H8HA 3LLMA 4C0LA 5FL7A 3GFTA 3TE6A 2QE7A 4A0RA 5K8IA 3RWOA 4US1R 2UVQA 1N0UA 1U9IA 5FOWA 2Q0HA 2V9PA 4NE2A 2CLSA 4IXMA 1Z6GA 3CX7A 1Y63A 1W2HA 3LBIA 3I5XA 2FNAA 1Q1QA 4LWZA 4BASA 1UAAA 2VHQA 3GJ6A 4B73A 1AQUA 1WXQA 5D3QA 2ZTSA 4LC0A 4GDFA 1GWNA 3KJIA 1WB9A 4JVLA 2IT1A 1TX4B 3I5YA 2BEJA 3X1DA 4JLDA 3E1SA 1S1MA 4KAXA 2Z4SA 4GI7A 4LK2A 5TY0A 3GFPA 4O2RA 1M7GA 5DGXA 4MYCA 1RFLA 1ZUIA 2ZI7A 5DI3B 2QL6A 1T5LA 1F5NA 5DI9A 2YYZA 1MOZA 1LB1B 1E2FA 3AF4A 3LH5A 2G77B 2O8FA 1Z0KA 1N3BA 2QBYA 3KXLA 4AKEA 2BHRA 2BJVA 3B8HA 2CNWD 2F3RA 2WKRA 1ZD9A 2JLVA 3D6TB 1RJ9A 4Q7LA 2ZRBA 3EWAA 2WOOA 3QVVA 2A5GA 5UKDA 4GOKA 2V4ZA 5LPNA 3OFND 4U00A 2E87A 4OK5A 3RNLA 4JBXA 2A3RA 2CE7A 3TK1A 4BEBA 3U44A 1BOFA 2F6RA 1T8TA 4DLWA 4QNRA 4BWYA 4RD6A 4FI3C 5FBWB 4FWTA 1F2TA 1XD2A 3ASYA 5BQ5A 2OZEA 4D80A 4P3YA 5JSZA 1AGPA 3PXGA 4F38A 1G5RA 3RS2A 1TQ4A 2C95A 5FOVA 4FIDA 2D3WA 4ASUA 4LYFA 1W36B 2WJYA 1X6VA 2H5EA 4DLZA 4EPXA 2VIIA 2P0EA 1X8KA 1T3HA 4OI4A 3W5IA 4QBGB 2ZXUA 1MR3F 1P73A 2NO0A 4X8HA 3UG7A 4TYNA 1KO5A 1Z0AA 2IXFA 1I4TD 3FFAA 3NHBA 3TAHA 3LW8A 3AVQA 2WPDD 3PEYA 2ZUDA 4J0QA 1BMFD 4ZCIA 2MSDB 4QJ4A 1P2TA 1U0LA 1N2CE 2FF7A 4DDWA 2GJSA 4KYIB 4C4PA 3TSWA 2ASEA 2YC2C 4NCNA 1QHHB 5BXQC 3N70A 1OYYA 2PEZA 3BBPA 3B82A 4TYPA 5FPTA 4A2WA 1FTNA 3TNFA 2QAGA 2QRNA 3F0TA 4GPTA 3PR1A 2VHCA 2AXNA 4MRSA 4URVR 2IWRA 4DB4A 3NEYA 1YRBA 1D2MA 1TAGA 2YWFA 1IJEA 4LJ4A 2EYUA 1UM8A 5AR1A 1E0KA 4R9UC 4EPTA 1UPTA 3AB3A 4XD7D 3SJZA 4DZZA 4B3XA 3KQUA 1FUUA 1MABA 4B48A 3TQCA 4ZIRB 4DRZA 5JECA 3HPQA 5JJKA 2ZAOA 4PSVA 5FPKA 1IONA 4P4TA 3VKWA 1G17A 2ZE6A 2PT5A 2W2XA 1M8PA 2J0UA 1ZUHA 2RHDA 2V6IA 3CR8A 4ZI3A 2ODWA 2Z0MA 4F92B 4OQXA 2FMXA 4W7SA 4JYBA 1D5CA 3B85A 4MDEA 3V00A 3CUEF 3NBXX 5BN4A 1T5IA 2ZSAA 4BFZA 2C77A 3BWDD 3FGNA 1AS2A 1XWIA 2B7CA 2GVZC 1VCNA 5CM9C 5JFGA 3IPXA 3ZVMA 3KFVA 2A7QA 4PXAA 2HXYA 1F2UA 2P5TB 4OHVA 1G41A 1GRNA 5CDFE 1M34E 4LYAA 4TYQA 3I4LA 1G3RA 2A9KA 3NC0C 4LGMA 1PUJA 2ZYTX 4EPYA 4X8LA 2BJWA 2J3EA 2CNWA 2IC5A 4R2HA 1F48A 2QPTA 1R8QA 3IUYA 2WM9B 1MO3A 3K0CA 1Q0UA 1VYVA 1VG9B 3KTAB 2O8DA 5TB5A 2O0JA 4HAZA 2A30A 4IKEA 1DAHA 3QJYA 4CW7A 1P75A 5F9FA 1KJYA 1OSNA 4ZKDA 2XNSA 2ERYA 1KAGA 1KKMA 3C4JA 4PX9A 4QHYA 5B2ZA 3K53A 1R0WA 1E2NA 2O0HA 3GLIE 4LC1A 1N6PA 1E2HA 2R44A 5FUWA 1IXRC 3FE2A 3FHCB 4KLNA 4NONA 1VIAA 4US2R 3EPLA 1RZ3A 1S9DA 3NBYC 1FW6A 5JEEA 1MT0A 2V8OA 3H86A 4ITRC 4QBHA 3Q5DA 3AVXA 1ZP6A 4B74A 1G7TA 2P6NA 1X86B 1MO6A 4IJMA 1GDDA 5LBIA 1AS3A 1P9NA 2FFBA 3LX8A 4MDFA 1XXHB 2BOVA 2QGZA 4ZDJA 2AFHE 3PVSA 5EXXA 4KBFA 5JBQA 1SVSA 4Q01A 4TMKA 2HV8A 2J0SA 1RC8A 2BEKA 4E09A 4YMWA 1U90A 3K70D 1LFDB 1ZNYA 3EZ7A 3HYTA 3W6NA 3ZQ6A 2BBTA 5KO2A 1DTSA 1JI0A 1PJRA 1TQ6A 5EXTA 4L8GA 3DL0A 3E5HA 1Z3IX 4ZV4A 3AVOA 4JZKA 3M6AA 2ZEJA 2KBFA 2IEYA 4AKGA 3K0SA 4Q5IA 1OB5A 1BMFA 2Z43A 2QM7A 3FKSA 2J0QA 1OIXA 3BS4A 2EW1A 4YQFA 1A5TA 1DS6A 3RSLA 5KSZA 1U81A 4DUGD 1QHNA 3DDCA 3TQFA 3W6OA 2OBLA 2QG6A 4NCKA 2BKEA 3T15A 4AY2A 3GLFA 2G6BA 5KSYA 4LZZA 4D6PA 3K0FA 2ORIA 4BLSA 1W4AA 3EZFA 1ZD8A 2W2VA 2REBA 4IEEA 5EP2A 1R0XA 3W34A 1HEIA 4PPNA 3U2QA 1IY2A 1YHNA 3DOEA 1A1VA 2ODEA 2ATXA 1XMIA 4GZLA 1G8FA 5EXSA 4EQ6B 1S1CA 3THYA 4QM6A 1G6HA 4BZQA 1QHYA 3BK7A 4QBFA 1CR2A 2IYZA 2CEAA 4M22A 2FE4A 4UNSA 4XD7A 4TTRA 5FR2A 4QGGA 1XMVA 2DFKB 2IXEA 3CKLA 4ACAA 2FA9A 1OXSC 2FZLA 4OJKA 4PQFA 4RD4A 4PO8A 4Q9JA 1JJ7A 1UF9A 2E9SA 1II8A 2IHYA 1FX0B 2QQ0A 4LHZA 2F1HA 4B2LA 2LKCA 1PLJA 2EYQA 3D8BA 1ELOA 2OO7A 4Q47A 4M1TA 3IPYA 5E7IA 2XNDD 3ADCA 2D74A 2ZU0C 2WKPA 2GCNA 2OILA 2NIPA 3L0IB 3AP1A 4JLKA 2GRJA 2N1BA 3VQTA 1HUQA 3EPHA 2GEVA 4BFTA 1WQ1R 2IYQA 1E2KA 2FPMA 3A58B 3HYRA 4H1UA 4PAQA 2X19A 3DPUA 4ZKEA 3ZQJA 1KHTA 3SZRA 3ZS8A 5IT5A 1OHHD 2ODBA 1AZSC 3U7HB 5CM8B 1JXOA 4HB0A 3TUIC 4IDNA 4QGHA 4DCUA 2HLDD 4OK6A 1TMKA 1N5LA 1EX6A 1E3MA 4JSYA 2QI9C 3LQQA 2WWIA 4Q4JB 4IHQA 1U8AA 1MRNA 1DAIA 4KHZA 2QT0A 3A1UA 2QT1A 3I8XA 4BLTA 2REXB 5FTNA 3AKEA 3L0PA 1XTSA 4TSFD 1JPNA 3T61A 5E7MA 2NQ2C 2OHFA 3GLIB 4MUAA 4CEHB 5SZKB 1NLYA 5EE5B 3T12A 2CJWB 1XJCA 1F60A 4IOKA 1UKEA 1GZSA 4Q9LA 4Z51A 1ZIPA 2FFQA 3THWA 4PZLA 3MFYA 2B8TA 5CLQA 4URWR 2P6UA 4L9WA 4QG7A 2GAOA 4R71A 1XJ0A 1XX6A 1OKKD 2P5SA 4PZZA 3GP8A 2PX0A 4GMDA 1Q57A 2WZQA 3CZPA 5GJBA 1CBUA 2VSFA 3FMIA 1AK2A 3WBJA 3ZLJA 4KI0A 4ESVA 1YR7A 2JLRA 2G0NA 2P6RA 3QKUA 4M1MA 4PHFA 1DARA 2JDID 1Z29A 2QMHA 3NIBA 1RRGA 3NH9A 3ZDQA 3W8RA 4Q1DA 4TTQA 3TW4A 1ZNXA 3KQKA 2IW3A 3T1TA 2OBMA 4M9XA 1NBMD 2Y8EA 4I81A 3VR4A 4L15A 4AKHA 2B92A 1GKYA 2JASA 1NMXA 3A8TA 5ELXA 1R6BX 2ZETA 1TQ2A 1M7HA 3EC2A 4PAMA 5BYJA 1HY3A 4C7OB 1JJVA 4MGZR 3LQRA 2DBYA 3WMEA 1E9BA 3B1YA 3K0EA 4Q1BA 2Q3FA 1OF1A 5FPYA 1IY1A 2NO9A 1DAEA 2HCBA 1LF5A 1P72A 1UJ2A 1XEXB 1JQJC 1XNJA 1R0YA 3KXKA 3ECCA 2GKSA 3TAUA 1GVNB 2VHUA 3CBQA 3ZJYA 1IJFA 3CF6R 2CLDX 3EIEA 3UG6A 2EWVA 1JR3D 2G88A 5KSOA 2RGNC 3QBTA 3U7EB 2O8CA 3RYTC 3WY9A 3FB4A 5TARA 2EFGA 2XXAA 1P62B 1XTQA 2XNDA 2AD5A 4DB2A 1NJFA 2IK8A 4DBLC 2WWHA 3VHXA 2D7CA 3GLGE 4URUR 5EE3A 4LBYA 2GXSA 3ADDA 3O8CA 1XBTA 1ZCBA 1E0AA 4G5SA 4M1YA 4RFSA 3FFBA 4RY2A 3G5UA 1YR6A 5EUQB 4AG6A 2NZJA 1KI3A 1MO4A 1TU4A 2OM2A 2V1UA 4NBSA 1W2GA 4LY6A 1DELA 1Q1ZA 2DFNA 1E0SA 1G7RA 1W0JD 2VH5R 4A82A 1OHHA 1P4SA 1J90A 2EFCB 3QENA 1GOTA 1WCV1 4Q4AB 4IEIA 4W5WA 4F7WA 2R6AA 4PANA 5EP1A 2HLDA 1E9AA 2VP5A 4BFYA 1SVKA 4GFDA 4NYJR 2ONKA 2YOFA 2GZAA 2CCGA 4LYHA 4GMXA 5HCNA 1JALA 3K09C 3VX4A 2GEUA 4G1UC 4S35A 2QROA 1IN4A 3GEEA 1R8SA 4LJYA 4TSFA 1GL9B 1PLLA 4O2LA 3AUYA 5A0FA 3I72A 2CHGA 4TMXA 3FHOA 2CHQA 1CJKC 1DAGA 3SJBA 2JLSA 1U98A 1VIYA 4AYXA 5JJLA 1NBME 2ZRCA 3L43A 3B13B 5KDDA 4DDVA 1OKKA 5AJVB 2AFIE 5AUPB 4ARZA 1KI9A 4XIGS 1Q22A 2GCPA 3C14C 1N6IA 3WYFA 4LI0A 2X2EA 3DZDA 1ZYUA 2PZGA 4F4CA 2JDIA 2QENA 5L3RA 1RVDA 3LAWA 1ZM4A 3MRSA 4FCWA 4Q19A 2XZOA 1L4UA 5FTJA 3TRFA 2P65A 1TPZA 3C5HA 2XX3A 3UMFA 3KDSE 2KE5A 3LBNA 5CK4A 1NNEA 5J4YA 2VF7A 4DJTA 4I1OA 5AJZA 4Q7JB 3FVQA 4XOIA 2NO7A 4JIMA 1RRCA 1Z22A 2PMDA 2EWWA 2RGGA 1JEDA 1XEWY 3SE0A 3QKRB 4HAVA 4DEXA 1HE1C 5FBVB 4UNQA 3ZD6A 4HI0E 1CKEA 1F6BA 4B32A 4ESHA 4IVPA 1P2SA 2VSOA 5EZ5A 4B33A 4EPWA 1XDBA 4PZYA 1B0UA 2V54A 5AWFC 1SVIA 3RRMA 1RKBA 1QVAA 2F7SA 4NYIR 1CRPA 3T5DA 4ERNA 4BZXA 4MKIA 1YKSA 3MAAC 4DCVA 2WICA 1TQDA 4LOAA 4NYMQ 5HE9A 2DB3A 1Z06A 1SGWA 1SZPA 3NVAA 3VTKA 4XTCS 2FFHA 3A1VA 1JR3A 1G5PA 1ZCAA 2QZ4A 4MA4A 1EFTA 1OE0A 1Z63A 1IN8A 3B2EA 5KYKA 2OESA 1YZKA 1SXJD 5B30A 2D2FA 4U02A 3QXCA 1T0JB 1KZGB 1W4CA 3DKVA 2YV5A 1E4YA 1U9IC 3B1WA 1PZNA 1NG9A 4E22A 3GLGB 1YE8A 3IIJA 3WMGA 4CIDA 4G5OA 1E1RD 3H0KA 1OPXA 1EGAA 4I99A 2F1IA 5JS7A 2NZ8A 1IN5A 1KGDA 4HLUC 4X8OA 1FL9A 1VKJA 3FKQA 4R98A 1W0JA 1R10A 1CJMA 3AF3A 3Q3JB 4O25A 4PPGA 4YMSA 3K9GA 1E0JA 2KSQA 1EFHA 1J8MF 1SKYE 1TU3A 5C2JB 1Z0FA 1GIAA 4DLSA 1SVLA 1EFCA 1UBCA 4PPFA 3RAPR 3VFDA 1QF9A 1VPLA 2WJIA 3I1FA 2GJ8A 1Z2AA 3A1TA 2GCOA 5IDVA 4AG5A 1II9A 3IQXA 1FPMA 3AP2A 1Z47A 2F9LA 4LBZA 3B1ZA 1FFHA 2AXPA 1OFTA 5EP4A 4DLTA 4B3FX 2XGJA 3AVUA 4DLRA 5DI3A 2CBZA 3VHLB 4XSHA 3VNUA 4Q1FA 2QP4A 4IFEA 2X77A 2ZJOA 4AK9A 4XVQA 3NEJA 1GRQA 4JS0A 1N6KA 4LHXA 1Y3AA 4KBGA 1GNRA 1TUIA 4Y0VA 2AKAB 1OYWA 1ZD1A 2MSEB 3VX3A 1LF0A 1WBBA 2ZJ5A 3AVTA 2ZITA 3N2EA 2IYUA 1BH2A 5JWHA 4D82A 1OXVA 3GEHA 5LD2C 2WJGA 3RRZA 3JZMA 3RVBA 4A0FA 2ZSFA 5IK2D 2I1QA 3OF5A 5CLLA 5L3SA 3QNUA 3U7GA 1EG7A 4JLNA 2F1RA 1IBRA 2QNRA 3SS8A 1SHKA 2RCNA 2JLYA 1M2OB 2FX3A 1XF9A 4GOJA 3K9NA 3LFUA 3T34A 2VP4A 2R6CA 3U3KA 4DCSA 4NCHA 4L4UA 3AEZA 3RS4A 1I2MA 4WZAE 2QRZA 521PA 1ZIOA 4MQBA 3RWMB 5F9HA 1JQLB 5KPJA 1PVOA 4OQLA 1FNMA 5FOUA 2F43A 2KJQA 2W2TA 2AWNA 4CGZA 1CLUA 2F1JA 3QOFA 1JPJA 1YU9A 4HAWA 4PC3A 4P4SA 4UKDA 421PA 1OLOA 3G82C 4MUBA 1YQTA 1YZNA 5J4LA 1FNNA 4LV8B 4GSYA 4MGIR 4TL6A 3U4QA 5G53C 1NVWQ 2QAGC 2ZRLA 3UXMA 6Q21A 5HZKA 1SXJA 3RRNA 3LLUA 3CWQA 1KI6B 2WJVA 3B1VA 4N1AA 2GF0A 1QHHA 1ZVQA 4AIIA 1W46A 2BKUA 3B9QA 4A2PA 1SVMA 4OL0A 1SQ5A 3A37A 5D3MB 1F3OA 1E1RA 4KV9A 3L2OB 4C3ZA 3L82B 3WBKA 1XZPA 2ZPTX 1UKVY 2FZ4A 4PC7A 3T1OA 3SYKA 5DHAA 1LV7A 2QUZA 1P60A 3BFVA 3I32A 1N6OA 4ZIRA 4O0MA 3RS0A 1NL3A 3SQXA 4IVQA 3ASZA 2JJ2A 4IDOA 4CEIA 1XD8A 1DVRA 1S3SA 2DPXA 4XWKA 1WDTA 1SKYB 2O0KA 3A4NA 3EWSA 2OE2A 4PHGA 2YC4C 3CW2A 1G3UA 2W58A 4EPRA 4KJZA 4NCIA 1DG1G 4IDHA 3EG5A 1WF3A 2PJZA 3S1AB 3FTQA 3GMTA 3UMRA 4ABYA 2A78A 1NF3A 4NZYA 1M1YE 3U7FB 2MMCA 2RGEA 3SFVA 1EXMA 2PJRA 4DCNA 4G5QA 4Q00A 1MH1A 2IA5A 2CL6X 1XD9A 3V4FA 5C4GB 1DO0A 1T6NA 3QIAA 4A6PA 4NTZA 4JYCA 3K1JA 1TF5A 1O87A 2J46A 1NKTA 2WIBA 3QF4B 5CIWA 1WA5A 4TQAA 3RDPA 3AM1A 3GJ8A 2W6IA 4GRAA 2Z83A 5JHGB 1E9EA 1J8YF 4Q9IA 2IWHA 1BO6A 1CJVC 3JZAA 4EDHA 1TF2A 4AURA 5JEDA 1LTQA 3GJ3A 3FKSD 2YWHA 1E69A 4EFNA 1ZJ6A 2J7PD 3R9XA 3RABA 3KQNA 3LY5A 2QSZA 2QU8A 3KTAA 1M7BA 1HQCA 2J7KA 5FOXA 1FOEB 2OEPA 2FGKA 4XWAA 2AR7A 2Q3MA 3NHAA 1HT1E 1E2PA 5EXPA 1KTVA 3NDPA 4GBMA 4MRPA 5JLJA 5GJVC 1P5ZB 1E9RA 5IK2A 3OAAD 3WNBA 3MWJA 2CHVA 5SZIA 1TEVA 3E2IA 4N0EA 3ZH9B 3O8DA 3CNLA 3GQBA 2C9OA 3ICEA 3D7MA 1FMJA 1S2MA 1E9FA 2VBCA 4BZPA 4GZMA 2GDJA 5DNYB 2C78A 4M1SA 1EFUA 4ZO4A 4B3CA 1XXHA 3FOZA 1Q1BA 2CL0X 3EZ9A 2HYDA 2QP3A 3VAAA 1U99A 1XMJA 2ZRHA 1AKYA 5L8VA 4BFSA 2QBYB 3QXHA 3GPLA 1A7JA 5TDHA 1D8TA 2OAQ1 3MCAA 2ZRPA 1E2DA 2O8BA 1JB1A 1ZNWA 1YVDA 4JJZA 2ZUBA 1ZM7A 2CK3D 4LPSA 4PHHA 5JRZA 5DIFA 2IS4A 2X2FA 4LCBA 3C8UA 2H7VA 1DAKA 2WBLC 5FH9A 4ZCMA 1GSIA 4OQFA 4JLOA 1CXZA 2RKOA 4FN5A 3U44B 5F3WB 2R8RA 3GLHA 1OV4A 1X8LA 4YDHB 5J5CA 2YHSA 1KSHA 1ODFA 2W6JD 4C0QC 3D31A 1CJUC 3AKDA 3BFKA 4DKXA 5KHOC 1XD2B 5LD2B 1IHUA 4LV6A 1TTTA 5JSZB 2BMJA 4YC7A 4YONB 3W5JA 4EQ6A 2LKDA 3TBKA 4D4JA 5KNDA 4E03A 1VECA 2VP6A 3SBEA 5A4JA 1NN0A 2ZYVX 4NDZA 1Z28A 4JL6A 4I1SA 2AKYA 1N6RA 4MKHA 1KK1A 2RHMA 3VU9A 3ZGXA 5KU1A 1NN5A 2V7QD 2VP2A 4KLZA 4KO8A 1IOZA 3SHWA 3UKDA 1T8UA 1JECA 2ZRKA 1T9HA 2J87A 3FMFA 4V0MA 2W0SA 1US8A 3MGCA 2GWHA 2HJGA 2CVFA 4HZUA 1NY5A 3CPJB 4BLQA 4V03A 3K0AB 3BIFA 3HR7A 4O3MA 2OV2A 3SBDA 4G5GA 4Q1CA 4MGYR 5FTKA 1KJWA 4B43A 3P27A 1KNQA 1K8RA 2QTHA 1KK2A 4GOXA 1HA3A 3PFIA 2QAGB 3AV0B 3BE4A 5C46F 3QVUA 2ZR0A 4W9MC 4Q7KA 5AJWA 4OKSA 5TXGA 1KK0A 4A8JA 2VEDA 1KO4A 2KWIA 3Q5EA 2F9MA 3KJGA 3KKNA 3CPEA 4PFSA 4C30A 3B60A 1R5BA 1QG4A 2BCGY 1VYUA 4QOSA 3MD0A 3MWYW 1E2LA 1P61B 1ZM9A 5GJWC 2J7PA 3OE7D 1E9DA 4PC1A 1MABB 3RC3A 3SHFA 2XITA 1W5TA 3CX6A 4JJKA 1BYIA 1JAIA 4CDGA 3LXRA 1CS4C 3NTUA 2R2AA 3QEJA 4HAXA 4JKIA 2G0TA 3BD9A 1WBDA 4A0GA 1TNDA 4HDCA 3KB1A 4C0AC 4HATA 1J70A 1FTSA 3HU1A 3SR0A 3R9IA 4DT1B 3OAAA 4QM7A 3I92A 4BFWA 1HH4A 2CJWA 1JNYA 1S3GA 1W48A 5FBQB 3NDBB 2NPFA 4KVAA 3K70C 3HDTA 5KNCA 4RJLA 3VR1A 2ZJYA 1Z83A 4HUQB 4L9SA 5P21A 4KODA 3I62A 2WMNB 4QHSA 2B6HA 2KB0A 4W5JA 1F2UB 4HLQB 3V9PA 1GNQA 1TEXA 1W49A 1Z8FA 2HCJB 1AA9A 2OFOA 4XVRA 3GJ7A 3UIEA 3AVYA 3VNVA 4IRUB 2AN9A 2GJAA 1Q3HA 3P4XA 2C9YA 2XTZA 5AUQA 4GL2A 2J41A 4D81A 2MSCB 2QY9A 5DLQC 2C04A 1U8ZA 2BMDA
chains in the Genus database with same CATH superfamily
3STUA 5HOQA 1E1LA 1GZ7A 4BVFA 4YRJA 1JZQA 2R6ZA 4TWZA 3T1VA 2Z3VA 4A3SA 1QQTA 1UZUA 4FINA 2XKAA 4X62B 1FFGA 4HDRB 3THOA 3P2JA 3NHYA 1RKXA 1V5IA 1GPWB 2I2WA 4RPGA 1CS0B 1ENYA 1AS0A 2ZT6A 3ZWDA 5KWJA 2GBIA 3BMNB 2OCYC 4RPHA 1LSJA 2VZ0A 4K1LA 3D3WA 5L3QB 3M1AA 4FMDB 3UK0A 3TTWA 1B26A 1LPNA 5EQTA 5M34A 3HHPA 3L1JA 4C0JA 3F4BA 1W1IA 3ZS9A 4Q7EA 2DCUA 3AXTA 2DTDA 2R84A 2TMKA 4RETA 5AYVA 1EK5A 2ZJ1A 3SQWA 4TWBA 3U49A 5JLAA 5J2TA 4LQ4A 5FO0A 4I4TB 4ZV7A 1S3IA 1VBNA 2HU5A 3NATA 4L08A 3DG9A 4NQZA 4QATA 4YJDA 4EFLA 2RHLA 5CYOA 2PMWB 2ILVA 3TZLA 2RK6A 1L7OA 3VAYA 2ZBEA 1HYGA 5TS3A 2LTAA 4AJIA 5L51A 3EBOA 5LMCA 2ZSHA 5F5LA 3UTCA 1PR1A 5H02A 2BI4A 5DCLA 3VNQA 3E22B 2G04A 4WBXC 2Q0SA 1I7DA 3OA2A 3UFBA 3L07A 2OB1A 3HXOA 3T3NA 3V8QA 5JAQA 4TYYA 3ASUA 4V3BA 4K81B 4CG3A 3QKTA 2QN1A 4ZI5A 1JAYA 1A2QA 3I8SA 3LA6A 4ER3A 1YRLA 3N6RA 3G3EA 4D0LB 4EEZA 1E98A 2C8VA 2LWIA 5GV7A 2KLBA 3RODA 4K9MA 1Y37A 4XA8A 5DBGA 1M2EA 3F49S 2JLWA 5FUVA 3A26A 3RJTA 1SUFA 3NBUA 4C29A 2WJJA 4IIYA 3CXRA 5K6AC 1NZDA 1V25A 3WGIA 2PX8A 3V4RA 5J2UF 4YT4A 5ESRA 3JQQA 1E6EA 1G18A 3PCRB 3RRNA 3EDQA 4ABTA 4R6WA 1VJGA 5IC5A 3H8SA 1JE1A 1CT9A 3STVA 3QXJA 2JFYA 1CRLA 4PYLA 3TKYA 2A33A 1V11A 4DYDA 1ZC4A 1KKLA 1S2GA 1E62A 2I54A 1Q74A 2ZAYA 2ZP1A 4H7EA 4A5OA 5JVDF 3KWFA 2P75A 4XJSA 5D87A 2H1CA 4TL9A 1V8DA 1EVKA 3Q10A 1SCDA 1C3XA 2RE8A 1NF2A 5L7TA 4AD8A 5HWSA 1KE2A 1C9KA 2GN1A 2LZ0A 3JTMA 3UAZA 2OAP1 1NBEA 1SQ6A 3FTNA 2IYXA 4C03A 2GBLC 1UPUA 2DSNA 3W2EA 2WUFA 1EQ2A 5DW0A 4NJMA 3ZGOA 2QTVB 4ER7A 1LRJA 4P32A 4S2EA 2A5DA 2W37A 2NAFA 2YL2A 2HXSA 3AY6A 2X13A 3ONDA 1XVTA 4L1KA 4M9CA 4CKCB 1NMZA 3JRWA 3MTEA 1TM2A 4YAFA 3IKJA 3P0IA 2OLKA 3EF0A 5DYYA 2ZSDA 3T5CA 3KM0A 2ZM5A 1SUIA 2D8MA 2G9VA 1BWPA 1XU4A 4F96A 1QQ6A 1AA6A 5ICMA 3P94A 4HAYA 5J4VA 2OR3A 3B3QA 1DJMA 4JELA 4C9BA 1UBEA 1TCAA 1AMUA 3AL0C 2ECQA 3JALB 5F64A 2WHYA 1MF7A 3GPDG 4XRGA 5BSGA 1QIKA 2PO5A 1YF3A 3NOVA 3IV7A 2IXAA 2VAPA 2ZKLA 5FWYA 2J1LA 2QSYA 3NBKA 1RXSA 4PZPA 3JX9A 5JJCA 1E7WA 4QL3A 3M3HA 3TMYA 4C76A 1GL3A 2WKQA 4NG5A 5DYIA 5I9LA 5HQ3A 3DMDA 1NU6A 5L6LB 2XB2A 1U1CA 3AYZB 3EQ9A 1I4DD 3AK4A 1NN1A 1VL1A 3K05A 4FFSA 4P86A 1DKPA 1EIZA 2H59A 3C1AA 4G24A 3QFRA 3VH1A 5B6JA 1BSVA 1MIHA 1U0OC 3DCYA 2XT9A 4RVHA 1R5OA 4CZ2A 2BUCA 3H4TA 2UZIR 2XRFA 3SFTA 5B5SA 2C94A 1AIPA 2BTOA 2XB4A 2GM5A 4A2QA 1N2JA 1PYGA 1KSFX 1Z0JA 3EA0A 4YP9A 2D6FA 1XKQA 4G85A 2BZ1A 1V26A 3BHJA 4FX2A 1PNQA 5I7SA 1E89A 2IX9A 3FIJA 3DV9A 2A1UA 1JJFA 1B14A 2JVIA 2DM6A 2PZFA 2QTFA 1ORWA 1YCHA 3VYSB 4OOEA 1JDBB 1CW2B 2CCKA 3BRQA 3CB4A 1OASA 4B76A 4QECA 2XTMA 4Q93A 4ARVA 4N7BA 5F21A 4CM7A 4FE3A 2GK3A 2VDRB 3RAJA 5GVRA 2GJKA 2X23A 3ANMA 1D03A 5K8CA 2E4AA 1JA9A 4DA6A 1JGTA 1P4HA 3QGMA 2GZDA 4IJQA 2PUHA 2V5VA 4ZVOA 4IYRA 3HY3A 4FHEA 2FQXA 1ABBA 5KYYA 2QP9X 2UZ3A 3KU4A 2R86A 3C3CA 4RKFA 2DFDA 4MW0A 4OHYA 1PS8A 3ESDA 5H1YA 3W7VA 2GF9A 4CMEC 1RMTA 3SAJA 2ETVA 3U3RA 1UJ6A 4I1PA 3K2QA 3RSSA 2P4UA 1IZ7A 3EFBA 3EQ7A 2NMVA 4FGLA 3I1JA 5JVDB 5E8RA 2ADFA 5E6RB 5A5FA 1QUFA 5IBPA 1X1AA 2QYSA 1U2DA 2J3IA 2YZ2A 2R1ZA 4IV5A 1UJ4A 4MCAA 3T9FA 3V1YA 2I91A 2FHSA 4HZGA 4HMPA 4CM1A 2XR1A 4PRYA 1Q3TA 1XROA 4C5AA 1GKLA 2XRZA 2DWPA 2O0LA 2NT4A 2JK1A 1GU7A 1K7SN 2O06A 1BZYA 1G38A 4ZAGA 4KAAA 1ZJWA 3PE6A 4EJSC 5EY5B 5AVTA 3R7WB 2JHAA 1FVHA 1GV0A 1FUYB 2FJUA 2GTHA 1UPBA 2VP0A 3MVEA 3QX9A 2Q6OA 3PUZA 3RUDA 4CLEA 5KUTA 1JR3E 4C88A 2WM2A 3PHHA 4C0XA 1N78A 2CXOA 5JT1A 2BSQA 1JQBA 4JWTA 1PVDA 3R6LA 2ZRGA 4ONEA 3X1ZA 2CN1A 5FUXA 1UBTS 4RCZA 5SY4A 2HJVA 1T5BA 2ZYUX 2QA5A 3H2HA 2WKSA 4CV2A 3L7DA 3A1SA 2VHXA 4U5XA 2XQVA 3WOHA 5BNTA 4RTRA 5D3ZA 4U9UA 3K9HA 1DUVG 1EXNA 4LJ8A 1CEEA 5EIEA 4B85A 2XOKD 1I30A 3QF7A 1GA1A 4NF2A 5I9MA 2VJPA 3FSGD 5T6MA 3PTAA 1QVVA 3BL5A 4CF4A 5FA8A 4O4JF 2FDRA 1N1GA 4AN0A 2HHHB 4RHEA 4DHWA 4IKPA 1L8OA 3EDYA 2G83A 3CZQA 4CCYA 4YRIA 1RNLA 4MWZA 5MDHA 4BNGA 5G0SA 2GM4A 3QPVA 2O20A 2P78A 4Q3EA 1WD5A 4Q9KA 1OWOA 3KKKA 4HEQA 5EZSA 4EATA 3OOEA 1Q0RA 1UOOA 1NATA 4PSAA 1D6NA 1O08A 3H2YA 2HIGA 3L7LA 1T2AA 1L4EA 3A10A 1IZYA 1NC1A 2FZKA 3FDIA 3R8CA 3TL6A 4PQGA 1NQWA 1NW3A 1UXGA 2C7GA 1N6LA 3O95A 4R1LA 3U4AA 1JWAB 4URZR 4WFQA 1Q2XA 4IOJA 3EHEA 2A1IA 2VCYA 2VDPB 3SDSA 1KORA 1PL7A 2J6BA 1CC1S 1EH5A 3ZW7A 2OVFA 2IHUA 3R41A 1PF7E 5DSXA 3IT2A 4CN9A 1T5TA 3FOCA 4GGMX 4YXFA 4RZIA 2XXJA 4QYXA 5TPWB 3X1MA 1T9CA 1ZOLA 3ROPA 3ZU5A 3QUCA 1YS9A 3JQGA 1IUOA 2IBMA 5ITZA 2DX7A 4J1QA 5F23A 4UE2A 4RQTA 4YDRA 4AXXA 3TJRA 4W1SA 2FX2A 5LDDC 3IV6A 1JEQB 4RDCA 2FRXA 4K0RA 3O1HB 4E2XA 2QQFA 4CIVA 2PVSA 2X8JB 2I4RA 1O9BA 5K09A 3UWDA 2ZATA 1JFTA 2ON6A 4FD3A 3PEUA 4J0FA 5SICE 3RHFA 3CUSA 3FRHA 1K9SA 4AY6A 3SY8A 4UDOA 2R9VA 4JQYA 1G8KA 2BM0A 2J9RA 1KFJB 4P80A 4AMZA 5JRJA 3TVTA 2QLJA 3LUHA 3ETGA 4KNVA 3U31A 2E85A 1AUOA 1J56A 4M21A 4CNQA 3THXB 4IQFA 2DFPA 3TD9A 4UOZA 5KNBA 2WT9A 2ORWA 3CLUC 1DJPA 1E3QA 4OTZA 4Q9HA 5EJ9A 1FXWF 2B21A 4HH3C 4NE9A 3QSYA 1HYQA 4YAUA 3SN6A 2BFDA 2KHZA 4UAUA 4R3WA 4MITA 4V0QA 5E6SA 4LV5B 4KV7A 3EX7C 1EDDA 5IFKA 3RFXA 1OFHA 3NDRA 1PU2A 2VQDA 3CLSD 3FCEA 5H4GA 2E6KA 3EF3A 1U0GA 1W0KA 4K9KA 3W8NA 2IHNA 4Z0PA 1NE7A 4IJVA 5FI3A 3TO5A 4L4RA 1SR8A 3R8XA 5EMKA 3EIFA 4OXNA 2EZTA 2PZ8A 3LC1O 2GN2A 4NMMA 4NU5A 4QRDA 4FYWA 5DSZA 4IGAA 3PPIA 2V6BA 3CPHA 4MKZA 5LYJA 1Z3CA 3OUTA 3H65A 2VPZA 1WDMA 3G2JA 4JJ7A 3RKRA 4D8TA 2FW9A 5FHRA 2A9RA 2VHEA 4GLOA 3TINA 1XZQA 3QTTA 5IEBA 3EZ2A 5DM4A 4PE5B 5DRTA 2GZMA 3QLTA 1LBQA 3BRWA 2VWQA 5AJYA 3PFWO 4ZI2A 5LOVF 4K26A 1VKOA 3MWDA 3GJ4A 5EJFA 3ZZUA 4O4JB 2GCEA 2BELA 4H7IA 2O2EA 3NT5A 4QULA 4X60A 3UK2A 5B57C 4CR6A 1SXPA 3BSFA 1Y8RB 3CIOA 2P9ZA 3JV7A 4XR9A 1VMEA 2Q5LA 4BLVA 1USWA 1NVVQ 2JI4A 3C0KA 4MKGA 3TMAA 1EJBA 2GKGA 3QMVA 2FG5A 4ML3A 3QXXA 1VIMA 4KRGA 2C9CA 2GN6A 4MOWA 4PTLA 5L4SA 2IUSA 3FFXA 5CM2Z 2JATA 1UWVA 4DMUB 3EULA 1GU0A 4HS9A 4MLDA 2Q2VA 5CB6A 4LJRA 2WVJA 2NTNA 1UEIA 1L4NA 2W90A 4J0DA 4K86A 3GMSA 4QXPA 3E7DA 4TQ9A 2VOEA 1QE3A 4TT3D 4YUAA 1C7EA 1DO2A 2AUMA 4DA0A 1IM5A 4QQNA 1J49A 4B6RA 4MHOA 1E99A 1U3CA 2XODA 4YJHA 4XWOA 1YDFA 5JJ5A 2Z2XA 3QWAA 4PR0A 4M4SA 4M1WA 4OLBA 1TUBA 1E1DA 3IP7A 4HWSA 2ZI9A 4FKZA 4FILA 4ZOLF 5IKOA 1NV9A 1ZRHA 3AU8A 2Y77A 1NXWA 3AUKA 1QTIA 2NYRA 3OURA 1G6Q1 4A26A 5K8LA 4D25A 2OM6A 1CPYA 2PZEA 4FC7A 4GICA 2IOHA 4U3JA 1LSSA 3QWFA 3KCNA 1WU7A 5DM1A 5B58C 4E5UA 4HB4A 1I1NA 3OCUA 3WP1B 2W9XA 2N47A 3M5PA 3DMGA 1L5SA 3FYUC 3PB3A 1YOVB 1XTBA 4FDLA 5FWXA 3SM9A 1K4YA 3W77A 2CMKA 1JYFA 5LZ7A 4J90A 2ZVQX 4EJSB 2BAGA 4FB5A 3E5RA 2ZR8A 4NHOA 1XPRA 3PXUA 1GADO 1FVXA 4YAJA 5A4DA 4L16A 4YFYA 4ZI7F 1ZVVA 1C9YA 2Z3ZA 1P39A 4C6TA 4ZXPA 1WKCA 4RK7A 4BMOB 4CCAA 4TXLA 3VR6H 2I66A 1ZAYA 5ALUA 2VPPA 1HZZC 2EBFX 2RG1A 3A6PC 5EJEA 1KFKB 1JRLA 2Q4BA 4H2DA 4UQLA 4TZ0A 4AZ3B 3WKAA 2H3HA 1CZUA 2WNSA 3ORSA 3FLBA 2HM7A 5FOQA 5F33A 3C70A 4CLHA 4HAIA 3BERA 3VC7A 5HFJA 1SEVA 4K3UA 4LOIA 2OV8A 4RZQA 3USCS 1DRJA 1A9OA 1JEEA 1DQNA 1NFRA 4J91A 5FRDA 3ZHYA 3ZWQA 1K7EB 4BZZA 2IF0A 2P27A 9ATCA 3OE5A 3FSRA 3HCRA 3DOOA 5AICA 1E4VA 1E79A 1AQYA 2OK7A 1ZBQA 2PH7A 2ZDQA 1TMOA 1XNGA 3AGQA 3BKXA 1P33A 3SM3A 4QVGA 1RAFA 3KHTA 1VRWA 2VDNB 2HHJA 2OO5C 1SUAA 3I3OA 1JJAA 1VLVA 3M6IA 1S4MA 3IELA 3P32A 4TLBA 4ETWA 4N8DA 1OW3B 2O52A 3ZDEA 3QYJA 1W4RA 1YAHA 3B3GA 3GGDA 4AQ7A 3K0CC 2OZVA 4Z9YA 1IQPA 1E6MA 3VZBA 5DP2A 4BQIA 2ISSD 3GUUA 1CJSA 1BU8A 1PSZA 2BLNA 3EDOA 1VHQA 2QVYX 4YS6A 5LOVB 3UMYA 4H7DA 4X94A 1T91A 1SUCA 3IUMA 3G2HA 5HM6A 1G3QA 3ABSB 3FDXA 3PQ5A 3SI7A 5LP6B 3E9EA 5EWLA 2HCTA 3HABA 3QPUA 2OD2A 2RGUA 2X1HA 1U2RA 2AOXA 4PU0A 2FFAA 4AC9A 5K4HA 3AC0A 3L49A 2RGYA 1Y5NA 1CR6A 2AD1A 2ZAIA 4W5HA 3T9CA 1NIPA 5JXHA 2YUIA 2NYAA 1M74A 1PEKE 2RHGB 3C8MA 1NNUA 1UPXA 3NIDB 4CIYA 1Q0TA 3NHRA 4RDXA 3DFZA 3OPNA 4TL7A 3K32A 4Z7JA 1OTXA 1QVRA 2P9GA 2HREA 1OYVA 1QG2A 3LQKA 4TRRA 1G8HA 4HEJA 4GOMD 3P71T 4LHSA 3EGXB 5L3VA 3V8NA 4LXYA 3DEFA 3ZXIA 5KNCD 4UJ3A 4MRMA 2JGEA 2VK2A 3O73A 1CE8B 4ZPJA 1UFRA 1QR6A 4F91B 2DWOA 2ZU6A 1L7VC 2Z95A 3IERA 1PZMA 3GT7A 4A8JC 4PIPA 4BGUA 2ZDGA 4MS4B 3GVCA 4HOYA 4ZCLA 2Z8ZA 4MUNA 3GLHE 2COEA 3W5CA 4JVNA 4YT8A 2XSZD 5DLPA 1ZNQO 3VR2D 4KL8S 4OLAA 3P5BA 2O8FB 1ML4A 2ZZNA 4QPDA 2HMTA 4JHXA 3WG9A 4ODIA 1Y8CA 2JD1A 3MSCA 3DW1X 8OHMA 3A4TA 4RK0A 1YBAA 2OP1A 2X9VA 1A27A 2DQSA 3SP1A 1LC3A 3V7WA 2BVNA 4QBTA 1OU4A 2CNNA 2PKQO 4J0HA 1YDGA 4D3DA 1P3JA 2CDNA 3UOWA 1YUNA 2ODQA 4KH0A 3ZV3A 3O8OA 1ZPDA 1QDEA 2QMEA 2J6HA 5M3BA 1T4MA 4B1FA 3U9TA 3RB8A 2NP7A 1EX7A 1O54A 5CJPA 3LZCA 5CITA 3AVWA 1NXOA 5F2OA 1NAHA 3WNVA 2WM8A 3N86A 1R5NA 4XQEA 3T0IA 1LLDA 2J9XB 1U9ZA 4M6WB 4U63A 3HQ4O 4Y7CA 3GA7A 1VCOA 2ZB3A 2PYIA 4BGEA 5DYTA 1Y3IA 1Z2CA 3KB2A 4G25A 1JR6A 3COWA 3MMPA 4BU0A 3IQHX 1NI4B 1M10A 7ADHA 2EL7A 3VNAA 5BQ3A 4LBVA 4RHFA 5F5XA 4M60A 1OWNA 4IZ6A 3UA4A 3VDRA 4HUQA 2NTYC 1TKBA 2HK7A 2NT3A 2FCRA 4QTXA 4PW0A 1ZMXA 4EP1A 5HCUA 1EUCB 1ZH0A 3J7AC 2X8AA 2ZI5A 4M7RA 1NPTO 4XEHA 3HCPA 4LWQA 4BP1A 4DJ5X 4FDUA 3CUYA 1X1SA 4LVNA 3QX7A 5CHYA 1RTTA 4IILA 5DB4A 2JIQA 3E3AA 5TR9A 2VG8A 5HIAA 2WSSD 4B5KA 1TCBA 5K3DA 4P9NA 3WQRA 2QOEA 4N9QA 3DEZA 1HT3A 2C5LA 3D6FA 4GU5A 4E70A 4GWGA 5I8PA 4ZT4A 3B3AA 5JDIC 1PVVA 5AW7A 4MW1A 3DUFB 2BCJQ 3RFTA 3IP1A 3EPPA 1DAMA 4G9EA 4OXQA 4DXAA 4D2IA 8AT1A 5CU7A 3WLPA 1UMCA 2CYCA 2JGDB 3ZCTA 3V6LA 4HAOA 2PVCA 3HBLA 1KY4A 3TGPA 1M34A 3UO8B 3K8QA 1I6MA 5BUQA 4LHWA 4H16A 3WWOA 1J7JA 3QV2A 4YI5A 1VJDA 4D4LA 3K72B 3MNFA 1PEYA 2Y27A 3A6KA 2UZ4A 2W00A 1MOPA 4YREA 2JBHA 1T6XA 4EPVA 1YS1X 2CHEA 4PGFA 2C9BA 2HSDA 5FD8A 3PXEA 1DMSA 1UIRA 3G8DA 2FRVA 3LVQE 7REQA 2JAXA 3AF0A 3I6BA 4PYNA 1YIOA 3DWIA 4BECA 3ETEA 2IZZA 3FI9A 4IS3A 4MLCA 4XCVA 2H0RA 2ZYIA 5BYAA 1KFBB 3IS3A 4KQ9A 1XI2A 4ZGWA 4XUEA 2XMSA 3LX5A 3QVJA 1FW8A 3LO8A 1H0KA 1PZEA 3V34A 1YFLA 4FKMA 5E9QA 4PQRA 1PRYA 3D4IA 3EGOA 2O8BB 2AUNA 3A9SA 2OQVA 4P0QB 4N40A 1BA2A 1XDWA 3IEKA 2WOJA 1CP2A 4Z8XA 3ZYCA 5EJ6A 1IBCA 1HQDA 5FP0A 1CUSA 4RGBA 1MN6A 5DULA 4AVYA 1BGVA 1CZLA 1TMGE 3GOHA 3TTXA 3WIOA 3WOVA 4BX2A 1ETUA 1O94A 1JPUA 4HB2A 3DT8A 5FAKA 2F8SA 3K6RA 3QG5A 1P19A 4KHPB 1EE1A 1Y6RA 1T5SA 3MLBA 1QH9A 2O7VA 1IXZA 2VP9A 3K2IA 4WN9A 4C0BA 1KVRA 1ORTA 3GLHB 1IULA 2WYUA 4GXRA 2RBGA 3K5IA 3PHIA 1BHJA 1YJ5A 1ISFA 1NRJB 1NWCA 2YIJA 2ZQ5A 3FGOA 3VKUA 5BWMA 2C5BA 4D9MA 4WK2B 1EJ6A 2DHEA 3OEEA 4XR4A 4CMIA 1UXKA 1T8SA 5IJ0A 1A98A 4EG4A 3N2NA 1OXTA 2FE1A 5HILA 1VHJA 5HRUA 2BGNA 1UXHA 2FXVA 1TQHA 2QTLA 3JVVA 4YRAA 2O8DB 2I55A 5IHXA 4ND8B 2R3SA 2C4UA 1KXJA 2WD9A 4FJ2A 5HCIA 1OH5A 1E2EA 1TE2A 4C4YA 3AJ8A 2Q29A 2WHXA 3FR7A 3HA5A 4IDPA 4XPZA 5D86A 1MXFA 1TJ3A 2X7XA 5T57A 121PA 3D0OA 3TR5A 3VU9B 2IQ5A 3STWA 1KY3A 4O29A 4BUJA 3H11B 1CUDA 4BNXA 3COJA 2IEIA 5TVKA 3VR3A 2X9QA 1TAQA 3HJNA 2WB2A 4R9VA 2AZ4A 4XJVA 3FFTA 2QUHA 2ZJAA 3OY7A 4HZUB 2B8WA 4AJOA 1BXGB 3H9QA 1PKXA 1Z6QA 4EO7A 4UBLA 5ETJA 2B4TO 2VYND 3WJ1A 3ADKA 1R12A 4REQA 1H6BA 1TK9A 5C51B 2AUTA 1XPUA 3AW8A 3IUQA 5TV2A 3HH8A 4TQUS 5LB4A 4X61A 3RO7A 3D64A 3IUJA 2VH2A 2AG0A 3H2GA 1JT2A 1V6AA 1DC8A 5CGQB 4Q9AA 4CTMA 1PR2A 3QITA 4A8JB 4R8LA 4OFXA 4LX8A 3TW6A 4K6CA 1ULTA 3DUWA 3DXYA 5HZMA 3MLEA 4XIYA 1ISMA 1PGJA 3FJOA 4BP8A 3ANNA 4C4TA 4N76A 1MHPA 3H0EA 1EWQA 2O2DA 1KA9H 1HE2A 4BMXA 1OAOA 2GAFA 2FSHA 3VDQA 3DTVA 1XVAA 2HIHA 4HQ0A 5IVPA 2A0KA 1Z4LA 3LY9A 1U8XX 1G8GA 4ND2A 3L4KA 5C18A 1XQVA 1QYVA 4X7MA 3KR0A 4B6FA 3QV1A 5A6SA 5EQDA 2Z2KA 1AY0A 1RBYA 2ZBRA 3KQMA 3MJHA 4QXOA 2J5RA 3KWJA 2O2HA 2P79A 1E9VA 3MBOA 5D7NA 3OCXA 4MQEB 2OXIA 2FU5C 4OP3A 1IPHA 1JF8A 2R2GA 1ZFNA 5G3YA 4PXYA 4RF4A 1PD1A 3HU2A 1NJGA 4QXMA 3PUKA 4UVGA 5FI5A 5LC1A 2QN9A 1X1RA 3SNHA 5K51A 3OI7A 2H48A 2TSYB 2Q3DA 2WWFA 4QOJA 4DSZA 1N8TA 1QZUA 3VR5D 4G0VA 1V43A 3AG6A 4D92A 4EO9A 1I2DA 1OXMA 1PGPA 2JHPA 2R8BA 2ZE5A 3LVRE 4KRXA 4L76A 3W3AD 3ZWCA 5T3UA 1JQEA 3MQ4A 5AKJA 3F6CA 3HBAA 3W9BA 3VO2A 1IZ0A 3DW3X 3LQ2A 4H0CA 4R8SA 1EEHA 3AVPA 3EIQA 4UQOA 3NO4A 2ANBA 1XCBA 3HCCA 3KOWA 5JI2E 2JHGA 3H2JA 1QGUA 1TT5B 3MMNA 1GQOA 4EFKA 4CCWA 1CF2O 1M1XB 4J0KA 2GRAA 5CYGA 3SXUB 5HJEA 4UASA 2CLHB 1DWOA 1RQLA 2BT4A 2YOHA 4KACA 4RA9B 2ZE7A 1KO8A 4V02A 2AHRA 3BE8A 4IXNA 3SYNA 3UMJA 4C5CA 3H3FA 4FOOA 3LV8A 3A4MA 4UHCA 2NVUA 5K3FA 2VYQA 1NVTA 1PNTA 1SHZA 2IGBA 3RIEA 4BLPA 2WTUA 2OBBA 3FWYA 1BA3A 1H2HA 3OLWA 1EVEA 1IC6A 1H0HA 2LGJA 2ZWVA 5ITSA 1N8NA 3JVUA 4HY3A 2H08A 1FF9A 1WDWB 2YQ5A 3IQDB 4ID3A 1S0UA 3RTBA 1S2LA 1K68A 3GJRA 4QXRA 2EF1A 4OQZA 2DWUA 1EFPA 1TM1E 1T9GS 3UHOA 3WYAA 1KDOA 2ZUWA 4JXZA 5KVCA 1P6QA 4X93A 5JCJA 5KJ1A 1QDLB 4FFMA 2YCBA 4FQ7A 5I9BA 2P91A 5KX5B 3W5HA 3BFPA 1CFJA 4X95A 1W8DA 2VKTA 3GJTA 1N34B 3ZHXA 3LE8A 1BXRA 2CD9A 2PBZA 2O5RA 1I7NA 2WFLA 4WW0A 4FXOA 3AF1A 5H4HA 4DE5A 1NKSA 4JBIA 2OLEA 2YHAA 3ETCA 4HWKA 3WMFA 4BVGA 4Y30A 4X92A 1NRIA 1CUUA 2JFVA 1Q5PA 2E4VA 4DXHA 3BTUA 3PGJA 2K7ZA 2B99A 3LS2A 3RS8A 5AUNB 3NEPX 4NBWA 1TDJA 3OECA 1P2VA 3KEGA 1XGKA 5HHTA 1NN3A 4DNXA 1BYUA 1W88B 1B4DA 2XNHA 4HLCA 4GZ5A 4O4HA 4BLRA 1TIBA 1PZFA 3LT1A 4KGZA 4RH0A 2ZK7A 4BPBA 4KXYA 1T8PA 4JGBA 5ALEA 4WXRA 2Q5EA 1GNPA 1RC1A 3V2UA 2YV3A 3H87A 2FEXA 1KBQA 1ENPA 2I65A 3L02A 3BMXA 4K87A 2ZCUA 4WCFC 1NVUQ 3MINA 2JJYA 3N07A 5ANRB 3PQFA 4FEYA 1KDPA 4ZT2A 3CRRA 5I7EA 1K88A 4HP8A 3I73A 1Y4SA 4DKJA 4IOLA 1QORA 2DRIA 5FFNA 1AHIA 1HQYE 3RVRA 1P5FA 2HQOA 3BB3A 3OCCA 4GYJA 1B23P 1WZEA 1KQFA 2CDRA 2H2AA 3OJOA 3EQ2A 4NV1A 1TW3A 5D01A 1R2QA 1WY5A 3IE1A 1J39A 3VPBA 2NO6A 4TN1A 3U7IA 3KUDA 4EYEA 4J0IA 1I0IA 5BRJA 4FFBA 1P0FA 4MIYA 4KXWA 5FWNA 3R6GA 4NG4A 1W52X 4BJ5A 3E7XA 3IESA 3AIKA 1AGRA 4QUEA 4WY2A 3RLFA 3ZCPA 1Y42X 4RWZA 4EA7A 2JJ1D 5K3BA 4MJ3A 3UT5A 2VDWA 1X8JA 3TJZA 1OZFA 2RH5A 2R5WA 3P2KA 4IHJF 3KXDA 2PBLA 4AS1A 2OO3A 3R74A 2XCSB 4HGYA 3W3ZB 2PY6A 3OZSA 3JRNA 2VK8A 1U5BB 2QM3A 1CUBA 5K0FA 1IVYA 4U7TB 1V6SA 1X7ZB 2BMFA 3F98A 3WKEA 2I3ZA 1NVDA 1UMKA 3AG5A 3CC8A 3HDGA 3X44A 2O8CB 4M0EA 3NH6A 5FFMA 5CIQA 2RJ3A 4N39A 4Q4HA 4QPCA 4NEGA 3MJFA 3O92A 3EHDA 4FZRA 4P3XA 2ZJ2A 2CJYA 3G9UA 1TECE 4QUAA 3AEUA 4JA2A 3TR0A 1G8PA 2YY5A 3PIIA 3TSZA 4MARA 5KVSA 1QJ4A 1H22A 4DIFA 2YWXA 3MELA 3NDIA 2HRBA 3TFQA 3WRYC 4NATA 3BORA 5FI1B 4Y6LA 1QANA 4YQEA 3UGQA 4B9AA 1RLJA 2ZI6A 1NBMA 4OATA 1DJLA 2ZS8A 1ARZA 5C1DA 2QE7D 2XJ4A 4NICA 4UTVA 1YDMA 1CWUA 4GX5A 1XQ9A 4JOSA 2AFIA 1X74A 2D2EA 3IIKA 4PAGA 1MH9A 1MC1A 1E20A 1KL7A 2ATEA 3FYTA 4I14A 1L4BA 4Y2RA 2D3TA 1RPNA 2W4IA 1JSCA 2C7QA 1N6NA 1QDUA 4RMGA 1Q17A 4XTRA 2XV1A 4GM4A 4P81A 2QPLA 2VHZA 4PLTA 4MWSA 1L5WA 3JQAD 3SEQA 4D6XA 3IB6A 1IJKA 4QZVA 4BQNA 1HXHA 4D98A 3PD0A 4EUNA 1VE6A 3UUGA 2FPXA 2KS6A 1L8XA 4TV9B 1P2UA 5AM4A 4LMPA 3WNCA 1A8UA 1ECPA 2DTEA 2EZ9A 1M2OA 3EYAA 4R3NA 4I55A 3W1EA 3V8RA 4B83A 4DJJA 1MNAA 4S1VA 5FB3A 5SZJA 1YRAA 5B2EA 3B9PA 2ZREA 1JLKA 3UVEA 5YASA 4CEJA 2JGIA 3CKYA 2ZIEA 3EZGA 2OHJA 1D6JA 3P1JA 5JASA 2JLAA 1PHPA 3M6VA 4ER6A 5JFTA 1P6XA 4G0XA 4JODA 4HDNA 5TQJA 1W1UA 1UDXA 2I4IA 4E30A 3E9ZA 4IL5A 1B0ZA 1N2OA 5IT0A 2VT2A 5KOYA 1C4KA 4BN0A 2JK0A 2WTXA 3Q87B 3VPDA 4DMFA 5KDOA 1ORRA 2ZYGA 3WRVA 4BMZA 3B2NA 5EZYA 3EW9A 4H6XA 3AF2A 5KOHA 3D3QA 1W30A 4M54A 1QC5B 3QUAA 1SIOA 3I3SR 1GP2A 5CD1A 2PH1A 3PENA 4B7UA 2R00A 4FU0A 3C7AA 1KOGA 3DVLA 1I7QB 4EZBA 1XHFA 3SC2B 3QWIA 4WA8A 4LDQA 3WZMA 4BNIA 1KC3A 4DIEA 5AVYA 4IIDA 3T06B 3PEVA 3A2MA 2OHIA 3CEAA 2YHIA 1K8XB 2JFUA 4UFPA 3GJZA 1KRWA 3NB0A 1A71A 2YV2A 4QYSA 4IHJB 1VMIA 1AGXA 2GSWA 2LRHA 5F2EA 1TC1A 3DM9B 4CODB 3DULA 3WLHA 1LDBA 2E21A 1Z39A 4JP8A 4TV8F 4LPKA 2EG5A 1VYHA 2JFHA 2WUVA 3IH5A 2G4LA 2HHAA 4O2AF 3LUPA 4L72A 2BM1A 1W1WA 3WDLA 3O4JA 3MMXA 4OA5A 2FCAA 3QQPA 2PQ6A 1R8YA 2QTTA 2XA1A 2EF0A 2F1OA 1COWA 2H2HA 2WPNA 4HK4A 4XVUA 1YDWA 2JARA 3AL3A 4UFNA 2H65A 3JQ9C 3HVHA 4BMSA 5EEHA 3K0KA 1EK6A 1P7PA 1YS6A 2FWJA 3A36A 4G0QA 3HP7A 5EIBC 2QM8A 3LO5A 4FMBB 3HB9A 1IOWA 3T95A 4QAJA 3ZCXA 3BXXA 2ATVA 1MGOA 3VV3A 4N41A 4PAOA 3UK6A 3WFZA 2RKWA 3PQ8A 1HO3A 4REMA 2C07A 4MMZB 4XX0A 5DTQA 1XELA 5KTTA 2AQIA 4XLTA 2RHTA 1YQEA 2O7NA 4MV7A 3TWOA 3NKVA 5HMLA 4LJ6A 3SICE 4DCOA 2C84A 4FZ3A 1TYEB 2ODAA 2MSKA 1SU8A 4K6KA 1W35A 1LBTA 3OM9A 1ND6A 2AR0A 3KJEA 3HU3A 4MSUA 1NXTA 4OPMA 3UAWA 3U37A 5JYEA 4ND5A 1OH7A 2OQ2A 4UNNA 3ZBQA 1KIFA 1UCFA 3K4HA 1PT6A 2XUFA 4IVNA 1R50A 3DBRA 3KOYA 2EFEB 3QBDA 2CJFA 1DFHA 4WCFB 4AG3A 2WSIA 3GELA 2Z8XA 4C0LA 5JSUA 5KWEA 1OFGA 3CZAA 4P98A 5K8IA 1XDDA 1I2CA 2OP0A 2UVQA 2HUNA 3N0RA 1N0UA 4DQ0A 2Q0HA 5CVTA 3PUJA 3I01A 4O2BA 2VAXA 2FETA 3UHAA 3I5XA 3LXMA 1Q1QA 2F48A 3G9TA 4XB2A 2VHQA 1WXQA 2P7IA 4Y9UA 5D3QA 2ZTSA 4LC0A 3IMEA 3VGJA 4GDFA 4JVLA 2VF4X 3ELYA 5EYPB 2WIDA 3IDOA 4D8XA 3LQ1A 5ICCA 2Q2NA 3EXEA 3E1SA 1GPH1 1H05A 5DFAA 3DTYA 4LYYA 5HUQA 1MAWA 3K0BA 3QU2A 4KPFC 1HX7A 2GPJA 4CQNA 1BMDA 3AFHA 4JSRA 4L2IA 3BWYA 3VSCA 1DP4A 4OJTA 2PZJA 3VU3A 4HQFA 4L8FA 1WETA 3CR3C 1RPAA 1F5NA 4YRQA 5DK4A 4JB8A 1BTOA 5ALFA 4NLLA 1LX6A 4X45A 3DWFA 4DMGA 2IDZA 3L0ZA 1DIRA 3LP5A 3ESXA 1MOZA 4DM4A 3BA6A 3I04A 1P17A 1E2FA 3RVNA 2HMVA 3LCMA 2G77B 3PRKE 1Z0KA 2HN9A 3I58A 3DV0B 1Y1PA 2CDBA 2F67A 3WIVA 1WZIA 1DQPA 3B8HA 2CNWD 3N0WA 5CT5A 5LJLA 4C04A 4DCJA 3N8HA 4RKRA 5MN5A 1QQ5A 2ZRBA 3EWAA 4QO7A 2AMVA 2BW0A 2QTCA 3QLUA 4BAZA 4IIJA 2VQEB 2A5GA 5TJ9A 2VHYA 5D84A 3PS9A 1EWVA 4GOKA 3SX0A 3WYNA 1Y5IA 1YC2A 2VYCA 3FPEA 3UOAB 5ALRA 5E1MA 4YO7A 3TK1A 3RU7A 2AB0A 2R25B 4RV4A 1T8TA 1CB7A 5ALIA 4PNEA 4CPDA 2AMJA 3CG4A 4QNRA 1T2VA 2DE0X 4RD6A 1GYPA 3DZFA 4B5LA 4BX9A 1EXVA 3D8HA 3JWGA 5C5IA 3JAKA 3ASYA 5EMNA 1XYVA 2D4AA 2OZEA 4WKNA 3JU3A 1KE1A 1T8YA 1G5RA 2WF5A 3KWMA 1NMEA 3EVZA 2D3WA 3LPMA 4FIDA 2XGOA 2BMVA 1GQSA 2VEOA 3E48A 4G36A 4LYFA 4N5DA 3JR7A 4I3HA 4AQDA 1NR1A 1SFRA 3IUBA 3QE3A 5G4KB 4WOKA 1CUFA 1SCUB 1ID8A 3P0JA 1PFYA 4LIPD 3OETA 4DDMA 1X8KA 4JI1B 3ZDDA 1T3HA 5E1OA 2DLDA 2PYZA 1CUVA 1MR3F 1DFGA 2NO0A 4X8HA 3WSTA 4TYNA 1KO5A 2IXFA 3DR5A 1I4TD 2AI3A 3BKWA 4NBUA 5E2AA 4EUKA 5AVKA 1E6LA 5FLKA 1M2FA 4AZWA 1RP7A 2ZUDA 4NQRA 1CZNA 1R4ZA 4ZCIA 4JUIA 2QN3A 2MSDB 2HRQA 2XUAA 1X9GA 4JR2A 3EEBA 1OZAA 1U0LA 1VKHA 2FF7A 1U3UA 4DDWA 1MFPA 3OF2A 1DJQA 1Y33E 4C4PA 4DWVA 3DZHA