2QQFA

Hst2 bound to adp-hpd and acetylated histone h4
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
296
structure length
289
Chain Sequence
MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKIQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase HST2
publication title Structural basis for nicotinamide inhibition and base exchange in sir2 enzymes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 89
structure length 289
sequence length 296
ec nomenclature ec 3.5.1.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 2qqfA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2qqfA01
4BVGA 5BWNA 2JI6A 2JI9A 2EZ8A 2QQFA 3GLSA 4L2IA 2H4FA 2H2DA 4BN5A 4HDAA 4ZZIA 2A1UA 4I5IA 1Y9DA 2Q5LA 1YHYA 2OO5C 4JU8A 2JLCA 1PNQA 4JUCA 3F6EX 4K9MA 2HJHA 4V1CI 1V5EA 2JI7A 5EJ5A 3LQ1A 4JT8A 5FEMA 1M2KA 5DGTA 4MZXA 1BFDA 4Y6LA 1T9CA 1OVMA 4RMIA 3U3DA 3CLRD 2H2GA 4GPEA 4J16C 4FEGA 2PGOA 2VK8A 1PNOA 4O8ZA 4UUBA 2FR8C 4FEEA 4V1CB 4KGDA 4KPUA 1JSCA 4MPRA 4J1TC 5MF6A 4K9OA 3PDHA 3HWX1 4JUFA 4RJKA 3GLRA 4UTZA 5MGNA 3EYAA 1OZFA 3FLMA 3ZG6A 3RIYA 3F6BX 4IAOA 2Q27A 4GP9A 3D4BA 4K9PA 2BRUC 2NYRA 4JUAA 3IAEA 1YTLA 1M2NA 5EJMA 2A1TR 4HD8A 4GG1A 5K6RA 2PANA 2WVHA 2EZTA 4JUBA 2VBIA 1YBHA 3IAFA 3EY9A 4GM0A 4G1CA 4QQ8A 2H2HA 5D7NA 1YI0A 2X7JA 4UTVA 4BVFA 4TWJA 1T9AA 4JU9A 1XLTC 4X3OA 2OD2A 1PT9A 4FVTA 4RMGA 4Y6OA 5DGDA 4UU8A 3EA4A 1Q6ZA 1PVDA 2EZ4A 2VJYA 4JSRA 1M2GA 2H2IA 4BV3A 4K9LA 1PYDA 3D81A 2H2FA 4JD5A 4FZ3A 2UZ1A 3PKIA 2AG0A 3RIGA 4MPJA 1T9DA 1EFPA 2H4HA 3GLTA 2Q28A 1YHZA 4GM4A 1UPBA 4JUDX 4R8MA 4BVHA 5K2OA 2B4YA 5IMSA 5EJ4A 2Q5JA 2OD9A 2IHVA 1MCZA 3FZNA 3CLUD 4UUAA 5K3SA 1UPCA 1Q14A 4UTRA 3JR3A 1T9BA 1YC2A 1NM5C 3CF4G 4K9QA 5EJ8A 3PKJA 2JLAA 2QQGA 2V3WA 1UPAA 2H59A 3HWWA 3OE1A 5K6TA 2VBFA 1O96B 2IHUA 4UTNA 1Q1AA 2VK4A 2Q5QA 5EJAA 1POXA 4Q9DA 5AHKA 4K9KA 1SZCA 2PGNA 4K9NA 1POWA 4MPPA 1QPBA 2FWNA 5BWLA 1V5GA 4BV2A 2EZ9A 4JT9A 1ZPDA 1EFVA 1S5PA 2UZ1B 4IG9A 1OZGA 2C31A 5DEIA 1YI1A 3GLUA 4KXQA 5MFZA 2NXWA 1U28C 1DJLA 3FSJX 1MA3A 5FYQA 4D5EA 1U31A 2EZUA 2FRDC 2W93A 1U2DC 5EJ7A 4RJIA 4TWIA 1OZHA 2OORC 4C78A 1YNOA 1V5FA 5BWOA 4RMJA 4X3PA 1N0HA 2DJIA 2JI8A 2VBGA 4RJJA 4GM1A 4BUZA 1ICIA 1O97D 4D5GA 2VK1A 4QELA 1S7GA 1Q17A 3U31A 3CLTD 1D4OA 2H4JA 4F4UA 5EJ9A 4MQ5A 4RMHA 4BVEA 2WVAA 3CLSD 2FN3A 2WVGA 4IF6A 4UTXA 4BVBA 1Z8NA 4COKA 3JWPA 4L3OA 1M2JA 1PI3A 3E9YA 3ZGOA 2Q29A 4V1CA 2JIBA 5EJ6A 3K35A 1YC5A 1PTJC 3D7KA 2Q5OA 4C7BA 2IHTA 4Y6QA 1U2GC 2AG1A 4ZP1A 1M2HA 4BN4A 2FSVC 4QPZA 5MFPA 3ZGVA 4F56A 1J8FA 1E3TA 1HZZC 4UU7A 1PO7A 2OD7A 1SZDA
chains in the Genus database with same CATH superfamily
4EQZA 4ATNA 4Y6SA 3MTQA 1T3TA 3AJ8A 3K9BA 1UPUA 4MRVA 5B55A 2Q2WA 3C6QA 3K1AA 1KEEB 4FDVA 5TQ0A 4QTYA 1CP2A 1CEQA 1P1CA 2J08A 3V2GA 5JTTA 2Q4OA 5COBA 1HURA 5CP8A 2ZYTX 3BSWA 5C1PA 4IUDS 4IF4A 1KNXA 4LF4B 1OYWA 2IOYA 2Z2YA 3EH1A 3P9KA 4CIVA 3EGCA 3PTLA 2VJMB 3HJRA 1D2AA 2ZB7A 1FPMA 2G1UA 2C8VA 1M34E 4HAZA 5AXAA 2R6CA 1SVIA 3NV7A 2D2FA 2HSGA 1EJ0A 4OJNA 4OHFA 4MUKA 4YAFA 2H8KA 5AK5A 3RU3A 1ESEA 5JJLA 2C92A 2QY9A 3U6BA 2MMGA 3G0HA 1PQ4A 3ER9A 1MVLA 2ZQZA 4RHTA 1FSZA 4Q7MB 4JL8A 1OZAA 4IV0A 1R0XA 1EUDB 1YZYA 2C4TA 3A2NA 3Q15C 4N3AA 4UU1A 2G82A 2PR7A 5ALLA 1KFJB 1JKMA 2OFXA 5IDYA 4F9EA 4MJ7A 1C2YA 4WN9B 1PFVA 3HUEA 4LXGA 3G1WA 4DADA 2R85A 5EXPA 1IXYA 3Q3JB 2Q3HA 4D9JA 1AQNA 3I4LA 1X9HA 2R5WA 3ICWA 3NEJA 3R4CA 1XEFA 2PX8A 1Y7PA 1ZINA 1M0WA 2X9VA 3U3XA 4DIEA 4TYWA 2PH1A 2XZTA 4G2NA 5EJ5A 3C48A 2FEKA 3PPWA 1K66A 4DS3A 1V26A 4EAQA 2DH5A 3KTOA 4E7OA 2I6TA 2BWJA 2WSSA 3MELA 4UVHA 2XB9A 5BWCA 2ZK7A 9ATCA 1BMQA 5JAPA 3M83A 5AUNB 2BBOA 1SK8A 3BZWA 3EGIA 4FBMA 1XHEA 3GJSA 5GJBA 4WN9A 4L76A 1CNFA 2ZOSA 5FOWA 1R4NB 3V8BA 2XV1A 1Z18A 4JJGA 3CUUA 4O4JA 4NPAA 3QPBA 3H6KA 3H1EA 4DLKA 2OCBA 3V8MA 4UM5A 2CKDA 1KQGA 1DAEA 3GEIA 1Q2XA 1R6XA 4XSVA 4DDKA 2PMFA 3CG4A 3PP8A 4E5DA 5AVQA 3X44A 1KI6B 4BN0A 4CVNA 2HMAA 3VHXB 3E6AA 4B3HA 1H9BA 2JATA 2X4DA 2GHRA 2YNMD 3R5TA 3TLAA 5JMTA 3QBTA 5KQRA 2H92A 3B20A 4QBHA 1EB8A 3GNQA 5EZYB 1VLHA 5IKOA 3LCCA 2ID8A 3WIOA 1NW5A 5DNUA 1M5RA 5BY2A 2JGEA 3A4VA 3CSSA 2G63A 3BCSA 1C7EA 1DMRA 1M7HA 2G1JA 2RBKA 3W4JA 4C4YA 4OHXA 1HE3A 2XDQA 3KDPA 1JHZA 1DE0A 3ND9A 4FCVA 1X1BA 1ZL2A 4RA9B 5AOBA 2C58A 4BGUA 4HNVA 1RCTE 3GLRA 1R4NA 1FA9A 2GI4A 3EWAA 1CR6A 1T6BY 2ZZKA 2CMFA 3AJAA 3DTVD 2XYRA 3LPMA 4U2KA 4QNMA 2Z8XA 4JIGA 3FWHA 1VCNA 4MV6A 2E0IA 4L0MA 3ND5A 4BCCA 3GLIA 2D3WA 2Q0XA 5JDCC 4R1QA 3LBNA 1ILEA 2WJGA 4WBNB 4BIMA 3GAZA 1FFAA 5C7YA 1JIVA 2GWHA 3GCDA 4GF5A 1WVGA 5FUWA 4ESEA 5L4LA 1OAKA 4WEQA 2HLDD 3VPFA 3EZ9A 3TOSA 1VPLA 1UKAA 4H4EA 4BE9A 1AK2A 6REQA 3O4GA 2IUTA 1EP1B 1V41E 4BFTA 3C6YA 2VJNA 3R23A 4GPBA 3AHJA 3T0IA 5K20A 4UZFA 3R8CA 1E92A 2W22A 4KGXA 2Q3EA 1M2NA 3HZZA 2D5CA 4CDNA 2O6HA 4EJ0A 2X8WA 4TQUS 3HR7A 4NNOA 1BCSB 3D8SA 4IILA 1SVKA 3GOQA 3H2HA 4KXXA 5DBGA 4GKAA 5LMCA 3KQMA 2VRCD 3KSMA 4INOA 4P9NA 3NHRA 1F9EA 1HQYE 1T91A 3O95A 4WBNA 2IEDA 4L73A 3DOOA 2QTVA 3UYKA 2OENG 4LYHA 3KDAA 5A4JA 5BQPA 2C2OA 2GARA 1XXLA 3Q6MA 2OXTA 4X8HA 3OZVA 4URUR 2C42A 5EIBC 4N47A 3ZWPA 2YNMA 1XJ5A 1Q6YA 2WJ3A 2O0MA 1C4WA 3E8XA 1V9LA 5EERA 3I4CA 1IC6A 1JQBA 1QQ6A 3KE9A 5U1PA 1UOEA 1DJQA 1VA5A 5ALPA 1PF7E 5LP6F 3DV0B 3D0QA 4YQZA 5HF6A 2E5WA 4Z3DA 2D2XA 1V11B 1BCSA 5B1SA 1W4ZA 2A6PA 3EIOA 4WDRA 3G0OA 1JEAA 3V6MA 3ZTWA 5C5CA 2C5LA 4A6XA 2Z6UA 1Y8AA 3T4XA 2V9PA 4E51A 4NOKA 3K94A 1R0ZA 1P6UA 3GDGA 4TKLA 3DTVA 4J1NA 2W6MA 3PGMA 4PPGA 4H1TA 1AN9A 1B8UA 4M0KA 5K0EA 2FXVA 5FFNA 4QGFA 3CH6A 1KO1A 2PD4A 3REGA 1G3RA 2GXQA 1VLMA 3HKDB 4IYRA 4G1VA 4CT4B 4MLDA 1QWSA 2VDRB 4UNSA 1H2XA 4MO9A 1SK9A 5CAEB 4MQFA 4YJDA 1TI7A 1J0DA 2HLDA 2PSFA 3PFNA 3PT5A 5EQJB 7REQB 1TXGA 5JOQA 3GEEA 4IDQA 1X7WB 2VC2B 1L5NA 3TTSA 3UIEA 1WB5A 1KI1A 4ZYTA 1I4EB 1JALA 2QSUA 2JLQA 1U7ZA 2LZ0A 4E5UA 2RG7A 1FDWA 1PT6A 1U2RA 1FSSA 4JWKA 3TZHA 2XZDA 3I30X 2QRPA 4C29A 4D4HA 4JSRA 3TWOA 1GLGA 2F64A 5JCPA 3BIWA 3RUCA 3H5TA 1R00A 2H57A 4YRGA 2GTIA 3DBRA 2VRCA 1W44A 3AR9A 3DMRA 4DNFA 3JQQA 5CAEA 1P45A 221PA 5HXAA 3EC7A 4KQ1A 5A6VA 5GGYA 1QLHA 2YXPX 3OPMA 3CLUC 4JQZA 2NVUB 1XQVA 2PMCA 2H2FA 2B8NA 3UAWA 2WF9A 4PX9A 3KUDA 4C2BA 1FTNA 1X7WA 3M81A 4P4UA 5HX7A 1EPUA 4B8YA 4TZ0A 4G9EA 1FMFA 2WWVD 3NGLA 2NPOA 3PV0A 2Y2UA 2O5RA 1XZQA 3QU9A 3QVUA 1CQJA 3G02A 3A1CA 3QG5A 1Y5MA 2GN4A 3PJRA 2UXCB 2PUJA 3LQ2A 3ODGA 4P92A 2I4OA 3RFVA 2AG6A 1KY5A 1JU4A 1ZI8A 3T95A 2HO4A 2RAUA 4S04A 4LQ4A 5MHTA 3KQYA 4L0CA 1TYCA 1YOBA 2QP4A 3EK2A 2LWIA 1R16A 1FFXB 1P7CA 4LOHA 3VPSA 3IT1A 1R9NA 2NVUA 3FMVA 1QHFA 1Y4SA 4MA5A 3EEYA 4QWMA 1DMSA 1W5FA 3PXCX 2FFJA 1YR1A 1EEXB 4G56A 4BQSA 5H9VA 1KH2A 2OMEA 3WNCA 1P6QA 2NXCA 1ZVKA 3C6ZA 2B0JA 1JKFA 3KK0A 4R40A 4FB4A 1Z7YA 1JLLA 1DRKA 1QS0B 1FJHA 2BMEA 3FFBA 4M55A 5FD8A 3ZDAA 5H81A 2P27A 2IBMA 1UM8A 4WXEA 4GP7A 5CCXA 1LPBB 2A3RA 1SHZA 2OQ2A 4BVKA 3OZSA 3UA4A 2WSIA 3TB4A 1EBUA 5A4AA 5I7SA 2A59A 4EKIA 1TT7A 1SXGA 4A0RA 4AQDA 1UXHA 3UXEA 4BMSA 1T9BA 1RPTA 4CKWB 3HEAA 3NCHA 5HQTA 1TADA 4QBFA 1PR3A 4UMEA 5ILGA 4F85A 2CHUA 3Q5GA 1Y4UA 1NM5C 3LY7A 2WZBA 4QFCA 3ONEA 2SKEA 3PKJA 1PLKA 3ADCA 1F2UB 3K6SB 1PFKA 4R8KA 2F8TA 3G3EA 4MRRA 1L7AA 3BB3A 4FUQA 5HF8A 1WSDA 3X43A 1EWQA 4DVGA 2ANCA 5GAJA 1NI4B 1QV6A 1KRHA 1NG9A 1OWNA 1YACA 421PA 4OB8A 4Y9TA 5SYNA 1XAGA 1ORIA 2XA9A 4I4IA 4MTCA 4P36A 4KZPA 3D5TA 7MDHA 3KHTA 2PGXA 1XA0A 5EUQB 3HEBA 2JZCA 2DLDA 2QLBA 4LWQA 3RWBA 3UGKA 1P5RA 2GKOA 3QVWA 4AJKA 5JATA 1R10A 1QR6A 2C9CA 2XQIA 3CW8X 4P3XA 1VKOA 1PWXA 1Y1SA 4CKBB 5H0IA 4D25A 5BN5B 2FZEA 4H4DA 4FPXA 2F6RA 4XVHA 3T9FA 5BURA 1H65A 2WB4A 3IQGX 5J1SB 3PF8A 2JGMA 1L4NA 1EP9A 2VQ3A 2PS0A 2V7BA 4UTNA 1N2BA 1O0SA 2FUG1 2D5IA 1N0WA 2I1QA 3MWFA 3EVCA 4WT7A 2Q8PA 2AMVA 4N9QA 3NPMA 3U5TA 2Q5QA 1N9GA 1NI4A 4W9MC 1W85A 1YKFA 4XYLA 4R54A 5BXYA 1T0BA 2H5IA 3DKIA 4LZOA 2OGWA 4K9KA 1YHNA 1VSBA 1KGSA 2VF8A 3KQWA 1QZTA 1C5KA 2JS7A 1SRQA 2DPHA 1XB2A 1FMTA 1YIDA 4LCJA 4TUYA 2EP7A 3OZWA 2WY2D 3KZXA 1OE0A 5BWLA 4RTOA 2VA8A 1GTZA 1ZUNB 2CDCA 5BN5A 3HDGA 4UEWA 3UTCA 1SG9A 3RH0A 2JLSA 4IFIA 1FU7A 3UXYA 5BT8A 3ZI4A 4DV5B 2HTFA 2CLEB 1RC1A 2X3YA 4JT9A 4U9HS 3WYBA 3ZCPA 1H0HA 1DTWA 3EGXB 4M7WA 3ZWDA 3G8AA 3H8JA 4CV1A 3A05A 3KO8A 2C9YA 3GAMA 4EB0A 1E1DA 1GTL1 1UT5A 3ESZA 1KKLA 1JDVA 1DT5A 1GKUB 1RQNA 4PS1A 4UHEA 4CLRA 3AKYA 4BNVA 3JQRA 4XWAA 3DONA 2FEMA 2H7YA 3DO5A 3UHAA 3K70B 2OK8A 4DCOA 3PC2A 4CTOA 4FDUA 5MN5A 1SBTA 4LDNA 3L8FA 4NMLA 4DIFA 2FEAA 1GV1A 3F6RA 1AZSC 4HCJA 1O57A 2ZREA 1H2FA 2XJ4A 4ITRC 2PWAA 5T64A 5FL7D 5ICCA 1IHDA 1JJFA 2Y2VA 3NHAA 4AZ3B 1EA7A 3HWRA 2ECKA 1FMLA 1F4PA 1XXHA 2NUTB 2PU5A 2X1LA 1MA3A 1WDWB 4H3KB 5B36A 4PVCA 4RVNA 5E2BA 3ZEAA 1PVOA 2R6ZA 3S2SA 2E2WA 3GNLA 4PZ9A 1BX0A 5AKZA 1CUCA 1JHVA 2OV1A 2Z8YM 3OIWA 1Z2NX 1ZGHA 2BHTA 2ZRLA 3P9CA 4U63A 5FBZA 5IVDA 3RR2A 4ZC1A 3G2JA 1I1QB 1G98A 3CX6A 3CISA 5EN4A 1ZN2A 3RU2A 1NJSA 3LBIA 4ID9A 4G8DA 3CUTA 3UXMA 2GQ0A 3IQXA 1K75A 4RYLA 2QPTA 4KHZA 4IKEA 1AG9A 1HT1E 4Q3NA 3BF7A 4MW5A 2IF0A 1V4NA 4DY6A 2IOQA 1VSTA 4AVYA 2IZ0A 2Y1FA 1Z4IA 2GM4A 3NOQA 3K4HA 4ZO8A 1K6IA 1VKZA 1TPYA 3QQ5A 4L8LA 2RHRA 4I9NA 3RUAA 1UR5A 4CBVA 3ZLJA 4A0HA 4IFEA 2FQQA 1G5PA 4R68A 5HA5A 4D6YA 3FNEA 1ZOPA 5MDHA 1YGYA 4I4NA 2AJLI 2ZRNA 4RQBA 1PVVA 4BPBA 1I2BA 3QEBZ 3GA5A 1E89A 1QBKC 5JS2A 2MSCB 4B85A 3WLSA 2IUYA 5U4QA 4HH0A 5C35A 4PGFA 4D2IA 4LQDA 1A4IA 3SBOA 1JIQA 4AY5A 4C5AA 1DUVG 3RI3A 5HF5A 4TYNA 1I3CA 1FS5A 1P60A 1U6KA 3DE1X 1L4HA 4IH4A 4TQ9A 4WCVA 1RWQA 1NFFA 2B0CA 3RSSA 4TSFD 2QVBA 3H2KA 3MG9A 5ED4A 2XYHA 3KYDB 1PGNA 2IQIA 2ZXUA 3TMKA 4TVBA 5FL7A 1NYQA 5BQXA 2FSSA 4WACA 1Z7BA 4HEA1 2C78A 5IDXA 2AFHB 3DTYA 3EEBA 2JDIA 5D86A 2XCSB 1H4SA 2O0KA 1RYYA 1KHHA 1WP9A 2B8WA 3C5HA 4G01B 1QQAA 2WAAA 5B53A 1DQRA 3RDPA 3BD9A 1ITZA 2C77A 1BW9B 4GBJA 5CDSA 1KI2A 3SJUA 3ZJUA 3LX6A 3WQHA 4ZJZA 2DTXA 5LA6B 3KXPA 1Q7BA 3F1KA 1QO9A 3B38A 5NULA 1RRMA 3V7WA 2YH2A 5AW3A 4KVAA 2PO7A 5E9WA 3AFNA 1Y98A 1LS6A 1WPQA 2IIVA 1IY9A 4TLEA 5FA8A 4RHXA 1RWVA 5EQDA 3KYDA 2FJPA 5LD2C 3JTMA 1ZK2A 4FN5A 3U3RA 3NQ41 2G88A 4R8SA 3L0OA 1KBOA 2I6QA 2D0DA 1Z75A 2Q5OA 3FM9A 4PBTA 5DXJA 3TRFA 5K8JB 2AFHA 2CLMB 1RP1A 2XVXA 4HUJA 4UKDA 2IS2A 4DGQA 1DC8A 2CC2A 3MWJA 1KI7A 4D96A 3AKDA 1BW9A 2AHRA 2WWIA 5G3ZA 4R5HA 2VTEA 5T6MA 1LA2A 5LA6A 5LYYA 2GXUA 1EXNA 4GUDA 3A0UA 2GAFA 1Y8QB 1W19A 2X0FA 1C7QA 1B74A 1CX9B 1Z0JA 2BT4A 2OB1A 5AKIA 1Y3BE 4OSPA 5JVDA 3IQDB 3PUWA 3LPCA 3OWXA 1DC3A 5FNZA 1J7JA 5AW9A 4E09A 4F45A 1Z63A 2HBZA 1A97A 2YC2C 3P0FA 5CA0B 3L6EA 2C2HA 3ND8A 2WWRA 3W5IA 3OD5A 1Z0UA 4B4WA 3DOCA 3PZRA 4J0CA 4MCHA 4DIOA 2RJOA 3SVZA 4E31A 4P58A 2Y93A 3CKLA 1PUXA 3FPLA 4YIKA 4L4RA 1CXZA 1MVNA 3GRVA 2V7VA 5KDLA 3AR5A 1E5QA 2XNHA 1TVCA 1L5KA 2ZJYA 3R8XA 2DPYA 1K7YA 1NKSA 1Q5PA 2I3ZA 3CN7A 3DVSX 3K05A 1ZJYA 1Y8QA 3D8RA 1NASA 3P94A 2IHKA 1I0IA 4J03A 1UK7A 2QWXA 3IE1A 1YT5A 4M7PA 1Z33A 4Y7DA 4LWOA 2BKEA 4CFZA 5FLYA 3RUHA 5AI0A 4NJMA 5ES3A 1N5JA 4BXOB 1HYEA 2J48A 2YHAA 4RKEA 5D5HA 2EHDA 5FWAA 2O8BB 2ONYA 1C0LA 5CA0A 2FG7C 2WYWA 2Q6OA 4P53A 1MX1A 2I3BA 2Y0DA 2JLCA 2X5KO 4UM9D 3EGWA 3P9PA 3O94A 2Q2NA 3FKJA 3Q8WA 2R1TB 5F51A 3V46A 3P20A 5HOQA 3LW7A 3A11A 1L5HB 4EHAA 5I7VA 3BULA 2HSEA 4OXNA 4D4IA 2JHPA 2NN3C 1KDRA 2XOKD 3U7HB 2POQX 3LWDA 5EXTA 4PLCA 3TSWA 1SUDA 3GZ4A 1VPVA 1KZ9A 3I1YA 1JE0A 1WCXA 3IHTA 3S2ZA 3T4UA 4K9RA 4EMTA 3O03A 4RTPA 5EOVA 3MRVA 1U63A 2V59A 4BNGA 1HDXA 1DO8A 4UZSA 5I8WA 2XAAA 5SY4A 4IZOA 5C5EA 1YJ5A 1RZUA 2O8BA 3TXXA 2ZBVA 3JARB 3G0GA 1AQYA 3QUTA 4Y6LA 3ZCUA 4ZZ2A 1A9YA 3D8TA 3UMCA 2XEXA 3MXOA 3TNFA 3KYCA 2R1TA 1EUYA 4TKZA 1T1SA 3SS8A 3QXJA 3AR7A 4W7SA 2PT9A 2GEJA 4CMIB 4HNTA 3FPEA 5BQOA 1CY6A 3U2QA 1QDLB 1Q21A 5G0VA 3TVYA 3K8YA 4NLLA 3FDZB 1BNCA 3VTKA 1GA1A 1OBCA 4KQMA 5CB4B 3KQQA 5HUJA 1QGZA 4OAQA 3TLGB 1L8AA 1O6FA 1KAHA 3E48A 3BHMA 2CUZA 4X8MA 2BTOA 1MRNA 5FJJA 1FZQA 3VAZA 1I6MA 4OU5A 1SKBA 3FVRA 1FFCA 3K4QA 5LSAA 4I1RA 4QL3A 1H4TA 3ILYA 5DMHA 3SBEA 3M6IA 4LZPA 4I5EA 3ZLTA 4CT5A 3S1SA 1VL6A 1KJ9A 4BNKA 1TKCA 2ZJ6A 5ALTA 1ZOLA 1AHIA 5BWBA 4ARSA 2IXEA 4MPRA 1LZKA 4NDAA 4PGAA 3TEJA 4I8DA 4K9OA 4AQ7A 2CZQA 2Q7XA 3CR8A 3IVMA 3TAUA 4V0NA 3ZK9A 2KSQA 4LE2A 4ALNA 1UZLA 2VSQA 5FP0A 3FDZA 4MLCA 3I62A 5CB4A 4KK4A 1SKYE 5G0UA 4EG4A 1FP6A 3ESXA 3AT1A 1GZ7A 4JR1A 2O57A 3I2JA 4LZAA 4N3NA 3RJZA 3PXXA 1GAWA 4DLAA 2Q27A 3CPHA 1MX3A 5K8IA 1MW8X 2P9GA 4Q03A 1HZZA 3JQ9C 4W8OA 5D1HA 3P71T 4M87A 1MHTA 4KUGA 4LRUA 1N3BA 2RGGA 3AR8A 3L02A 5CG2A 2XOKA 4K6OA 1EFUA 4M9CA 2QF7A 2GEDA 3IR7A 2OCDA 2J3EA 1SKUA 1WPXA 4IQFA 1NLFA 2VYND 3BDVA 3D3QA 1YCDA 4OAOA 1TQ4A 1J2UA 2O7QA 4KQ9A 1J4AA 1UFQA 1KMNA 1EHCA 2VT6A 4RV9A 1MR3F 4DYVA 2PKXA 1XTUA 3TKAA 1O95C 2RHGB 2JCYA 4Y98A 8OHMA 1OH7A 1AS2A 1DEAA 3BQMB 3QHQA 1PV4A 1T2AA 1MZPA 1BMDA 1T9HA 2GJKA 2PL1A 1QWOA 4HYYA 2AZDA 1OXMA 2Y4NA 3HB1A 4Q9LA 3JVEA 5CMLA 1T9GS 3ZE9A 1ZD9A 3ONNA 3RBZA 1Z07A 3IP7A 2EZTA 1A5ZA 1KYXA 4JJEA 5F2OA 3CF0A 1YBHA 3M1YA 1JFSA 2WYHA 1FBNA 2HWWA 3O2JA 1KJJA 3JAKB 3I5XA 1VRVA 3GGDA 4J0KA 4EZIA 4G1CA 1UXKA 3OLCX 5EIHA 3TNJA 4LZLA 5AHWA 3WDSA 3EWIA 4J4HA 3A04A 4YJKA 5EPOA 5A9TA 3U9LA 2X8AA 4IV8A 5B4UA 1T5IA 1XZIA 4XCQA 2H2HA 1TQHA 3IP6A 4G0MA 3L7BA 4MUIA 5B1HA 5I9SA 4OYRA 3ZDZB 5ECWA 3PL1A 1ZEJA 1FQKA 1P4JA 2R3SA 3P52A 3W5BA 4BFCA 4OSEA 2F9LA 4MTLA 1FYVA 3UAZA 2QT1A 2P3QA 2I4NA 1GCAA 4YC7A 4TWJA 1G18A 1HLGA 2GMWA 4ERNA 1ZWKA 2Q5FA 2OD2A 1DPGA 1OILA 2JBHA 1U8UA 4TV8F 4YCDA 1SD2A 3FFAA 5H3HA 3UAGA 4V03A 1WEHA 3A6EA 2NZ8A 1Z13A 3P9XA 1JI0A 4BMNA 5BUQA 4HLUC 1HX7A 4BNMA 2O05A 4RSGA 4EYKA 3QUQA 4BX2A 2R1UA 1NOIA 2XMGA 1L4EA 3ENVA 3OIGA 4W63A 5DGDA 5FPSA 3SHFA 3T5CA 3UMSA 1JDNA 1Z2DA 2VYNA 3CVOA 2PUHA 2GRUA 2P62A 5GADl 3IOYA 3ZTYA 2EHJA 1CZLA 3IAXA 4YONB 2FPWA 3UJHA 2DG2A 2BZ1A 2REBA 1SXPA 1X2EA 4Z0HO 4BX9A 2ID9A 1YD7A 3PVZA 1W1WA 4RTKA 3LD9A 3X1DA 4E6PA 2BAGA 1A82A 3EZNA 5SY9A 1X80B 4HWSA 5AVYA 5CJPA 2NSDA 1ISGA 4HNAB 4W5HA 1IN1A 4DAEA 3W9BA 3N8IA 4CF6A 1K7EB 3FFTA 1R5JA 2X77A 4DPLA 3OWOA 4EVIA 3T9CA 5IM4F 3DLBA 3M70A 3R77A 1AKVA 2BE9A 5G0TA 3BFVA 2Z2ZA 3U40A 5B30A 2VA9A 3ANYB 5A6SB 4ARBA 1UBRS 3B2QA 3SZ3A 5EZYF 1PZFA 4MV3A 2C7OA 3O26A 4ZEOA 4YR9A 5EKXA 1D4FA 4MVJH 1TRKA 5DLDA 2ZXFA 4GOOD 3WBBA 5CEFA 5C46F 4ZDWA 3VA7A 1K5DA 1J20A 1WMAA 2ACWA 4GLBA 3EF3A 4PR3A 1SIWA 3D3NA 1X1EA 5FTLA 5HCNA 5HE9A 1Z4OA 3ZQ4A 3QF7A 2NWQA 1SZPA 2J4DA 3AKZA 3E4DA 4HNAA 5ESXA 4L8GA 3TBFA 1TJ3A 1OC2A 2ZI5A 3HG7A 1JTEA 1TEXA 2WLTA 4NZMA 4BO8A 1ZVQA 1WXDA 4KQEA 1XKXA 1LLUA 5K9ZA 2JJ2D 1TCVA 2NP7A 2HF9A 2JIMA 4BBJA 1W5BA 3L0YA 4OGLA 1PKXA 3C85A 1CZKA 4FDAA 5A6SA 2H29A 2BFFB 1SVOA 3B1ZA 5ICGA 2ODBA 4F11A 4U6QA 3U4HA 2LIPA 4NCNA 2WYIA 4JX8A 1W73A 3NBQA 1WW2A 4JBXA 3V48A 4AFNA 5SV2A 3V4ZA 4D4LA 5AW2A 2RKOA 4PNZA 1HNNA 3SGLA 1WY5A 3G5TA 3A25A 1H1LA 1R6BX 3E0XA 3F8WA 1ZH6A 4HF7A 3WRYA 1MJHA 1UMCB 4R2HA 5AICA 3PQ7A 1UPCA 3RSGA 4MMZB 1Q14A 2ZP1A 3SI7A 3DMPA 2DEUA 2C5BA 1P1FA 2IZ5A 4KQIA 4EB6B 4O0LA 1QQ5A 3FZQA 2W6JD 3O8NA 2IEIA 3K0SA 4QYXA 4B3IA 2YICA 1FLVA 1X39A 5B1DA 2NO0A 2HHLA 4ZDJA 2BFFA 1E1YA 5C32A 4YT5A 3G7UA 1X70A 3LCVB 2ZXEA 4UEQA 1A2QA 2YHSA 2AE1A 3GT7A 3PFKA 4RKFA 2WIFA 3DLTA 5DRYA 4G5XA 4N7BA 2DAPA 1GZDA 3QY0A 3UHJA 3VGPA 2DBZA 3JWGA 1JMVA 1IRIA 3VM6A 2PX3A 3B12A 1YZ3A 2BBSA 2HU8A 4L27A 5BO5A 3RGGA 2JW5A 3OAAD 1N36B 1IEWA 3UJ7A 3F3YA 2QP3A 3QI2A 4BEJA 5CDTA 1CDDA 2HV9A 4EB6A 2CUTA 4H3SA 4RXMA 3JQ7A 5ALXA 5EP3A 3QFHA 3D6HA 1GA6A 1NLYA 4DLWA 4YA6A 5D1NA 4RHEA 2ZPAA 2QD2A 4KLNA 3UBMA 4DEXA 2WNIA 2BKVA 4JL5A 5AI9A 3W6OA 4BKOA 3M9WA 2OGZA 5THKA 4GZMA 4GH5A 3KKLA 3PD7A 1XBTA 4DMMA 1I7DA 4MPTA 2IODA 2B2NA 2IYWA 2RKWA 2JJ2A 3N7UA 5FTMA 4Z3KA 2EYQA 2PA3A 1MJGA 2SKDA 3AFGA 5JY1A 3DFUA 4Q3LA 1Z26A 2ZBUA 4IGEA 4ND1A 1E7SA 2R1VB 3G88A 3BL5A 4HLCA 3TL3A 4DR6B 1X3LA 1XF9A 3CNEA 3PT9A 4UHJA 2HF7A 3NHKA 4KMMA 5J2UA 1QRUA 5B3AA 3JASA 3BRWD 3OD1A 3NM5A 4ECEA 1ST3A 1APBA 4IXNA 4B8ZA 4KE6A 3OE5A 1GCIA 3IRVA 2JAQA 4V0SA 4B81A 2EDAA 3L4KA 5JXIA 1NX9A 4XIFA 4HJXA 5JDIA 1YTUA 3PXUA 1ZUHA 2XHEA 4ETMA 1XTIA 4ARCA 4G0ZA 2WWTA 2ZIZA 3V4VB 2ZBPA 3WKDA 2RGYA 1EFVA 4ZQCB 3ZJ5A 3KDSE 4NCKA 1OBFO 4YNBA 3H4VA 1JJBA 3A7EA 3D4OA 4K6GA 1LBHA 1GKYA 1ORRA 5J2TF 1DRUA 2CL5A 1FQJA 2B4KA 2C31A 3BMQA 5DLQC 2X22A 5KYYA 1EKXA 3HDHA 4GI2A 3HV2A 3FYHA 2P4EA 1E61A 1IUKA 4FU0A 4BYGA 4DBLE 5H16A 1TTQB 3EQ2A 4LJAA 1UJ4A 4GWGA 2N1BA 4LF9B 3I04M 1NOJA 2FR8A 4LE0A 4WCFB 3PWSA 4WMLA 4BP8A 1HLDA 1JR3D 3MD9A 3OZDA 2OAQ1 4GX2A 3AYXB 3ENZA 2N3ZA 2MSLA 2PUAA 3BD6A 4WH0A 5B37A 5F2EA 1JF8A 4NENB 3E2IA 4I08A 4ESVA 3U13A 3DOUA 4ZRDA 4MW0A 1MXFA 2FDRA 5H68A 1R0CA 4Q9AA 1QORA 1OLXA 2HA5A 2XT0A 4BZPA 5HJEA 5BOSB 5KJFA 1IJFA 1IHPA 2YUTA 3HE3A 1SOWA 4RTMA 4RQUA 2XVMA 1RYZA 4XUEA 3KB1A 5EGSA 1PP4A 3ABZA 1EJ6A 2R7KA 1BQ3A 1Y1KE 2HQOA 2R7AA 2FKNA 3TDNA 5HG0A 3H5WA 2PFSA 2HA7A 4YMGA 1G5FA 2O1EA 2ZI3A 3A6ZA 1RAHA 5TPWA 4D4KA 5LJLA 1QHNA 4F04A 5LL6P 1EXDA 4TXMA 3JV7A 3UB3A 3GUYA 1K0FA 3VC2A 1Y7LA 3BRWA 4U39A 1XAIA 5KQSA 3B3AA 3VU9B 1TKBA 2BM9A 3M6WA 1MFPA 2N46A 4GXNA 5E6SA 4RD3A 1WQ3A 2CUNA 2ZYUX 1CF4A 1G9SA 5CH5A 1UC4B 5CB0A 3H84A 3THSA 2XPCA 1WUTA 2KQUA 3EAGA 4M9RA 1L5GB 2A9JA 4IQGA 1VMDA 2B9EA 2QTBA 1O5OA 1PEKE 1UF9A 4D97A 1NY6A 1H3NA 2APJA 3CZPA 2XZPA 4FFRA 3K8ZA 5EWLA 3WQSB 1RXYA 4QYSA 3ITDA 4OFXA 2C2MA 3W4KA 1KY2A 3LPLA 2Y0CA 5JD4A 4NBWA 3U1TA 3JVVA 3UF0A 1Q17A 5D5PA 5DBHX 4R2KA 4FDLA 3NVDA 1D4OA 4N40A 1QPZA 2OXEA 2ODNA 4KO4S 5CA1B 5F3WB 3B1WA 5JARA 4ND5A 5EY5B 1KFEB 1JDPA 2OBXA 4BVLA 5C5IA 4ER3A 4X6YA 4RHUA 5A1JA 3DLAA 4C7XA 1XRRA 4PBRA 1QTNA 4IF6A 2TRSB 5IVIA 3RC1A 3TH5A 4KPEC 2H3EA 4UTXA 3MCUA 4GMDA 1JIIA 3COZA 5IZ4A 4BVBA 1MLDA 2AWNA 5KPDA 2YKGA 1OFTA 1R5NA 1IUOA 1JDUA 4BKRA 1P29A 1ZU4A 2R79A 4ER0A 2GA8A 1GHTA 4UBJA 1KQOA 3N2EA 3LZDA 1VCMA 1K8XB 3OJFA 3ESCA 4ROSA 4TRNA 5CA1A 3NC1C 4DLXA 3O4HA 4B84A 1E7WA 1FXWA 2Z95A 4L4YA 3MS4A 4RUKA 4W7IA 5CK4A 4ZGBA 5K0BA 3TUIC 3BXPA 3K35A 4IVQA 2R47A 1P31A 4DXHA 3OLWA 2R4UA 2GEFA 4G63A 5E1BA 3VNRA 3ZUPA 1U2GC 3U7FB 5CT6A 4YAKA 4FEAA 2HMVA 2VZ8A 4RK1A 2NXNA 4JODA 3FDFA 4PSAA 4R2XA 3R3SA 4DEVA 5BNZA 3RS5A 4AD8A 3MGCA 5HJ5A 1AJEA 4X6UA 4KKVA 4ZKEA 1UOOA 4D99A 1P2BA 1N6OA 1O8BA 4G1EB 1Z6TA 1X94A 2AXPA 1KWGA 1IN6A 1E3TA 3JTEA 4A2PA 4WDQA 4DMLA 4FYPA 1OR8A 1FFHA 3BHNA 3T99A 2NZUG 3W9UA 4OJYA 4HH4A 4WFKA 3NJ4A 2D06A 2O3UA 1MF7A 2PUVA 3CNNA 1WP4A 3DBHB 2IS6A 2OILA 2GH1A 2YN4A 2CNBA 1Q11A 3C0KA 3GLSA 4HAIA 2Q9AA 1R3DA 2B82A 2TS1A 4QEKA 2A5YB 1P9WA 3K1ZA 2ADFA 2C2KA 4H9GA 4W9RA 2Y1LA 2FOLA 4BNHA 1WCYA 4QUDA 5DHSA 5C4IA 4B40A 2XKAA 2EP5A 1UPTA 2GBIA 4H1UA 1J06A 4KPGA 3IV6A 2IHZA 3OI7A 3EHEA 4US0R 1J39A 4ZJYA 5L6LB 4NFSA 2XQVA 1GO2A 2OUKA 1GRCA 3B60A 3C3WA 3NNDA 5BQ5A 5C31A 3FTFA 3UNXA 4XWTA 1LNQA 4ES6A 1UC5B 1X1CA 1OV4A 1CY1A 2UXDB 4JU8A 1KE2A 3JWIA 1ZJ6A 3R7SA 3DBHA 2HDHA 4WKGA 1W34A 1Z0DA 1KORA 2IPMA 4EUHA 9ABPA 3NYRA 4BLQA 2BSQA 1J90A 1G17A 3UGTA 1I5EA 2FAXA 4MEAA 2ZIWB 4HQLA 2HOQA 2K6GA 2XVYA 2VYQA 3VX4A 1IBCA 1JQLB 1KH3A 1OFIA 2EOAA 2IIBA 5HPYB 1Y80A 2JAOA 3PC6A 4MW1A 2YYZA 2EXXA 1YRAA 5FEMA 2NT3A 2QG9A 1O0CA 3KG2A 4PSKA 4AY2A 1F14A 2EARA 1QDEA 3MB8A 2E1RA 1HM5A 2ACEA 3IE0A 3GVCA 4OH1A 4P4SB 4DSZA 4P5EA 2YQZA 4C76A 1PJZA 2OBBA 2XWJI 1BGVA 3SJAA 3IHLA 1FS6A 4HDKB 3VPHA 1ISFA 2J3DA 1UK6A 4DA9A 1GPDG 5IC4A 3G5LA 1QMPA 4MSUA 3L6DA 3W8EA 1YDGA 2P90A 2OLKA 1XCJA 1ZSNA 2OPBA 2H2GA 2IXAA 2H2AA 4XWGA 4KWCA 3KB2A 5CDHA 2PSDA 2C2WA 3PWZA 4JBYA 2ZR0A 5KOIA 4FEGA 4J16C 1P7YA 4IX1A 4KXMA 5IJXA 3VISA 4I4TA 2PGOA 4HNRA 4MP6A 1CUXA 4C5BA 3TUJC 2CB9A 1BU8A 3K2EA 5ES4B 3F6CA 2K7ZA 1HMPA 4YAIA 3CNBA 3K5IA 1TL7C 1N9KA 1QH1B 2XR1A 2XUKA 3OLQA 1RACA 4L9WA 5HRUA 4P4SA 2VT3A 3G2LA 2Y1DA 3D2AA 3V55A 2PKYX 1JH8A 5FUYA 4CG1A 1SRRA 4F46A 4HDKA 4NI5A 4UBMA 1KOLA 4BIIA 3PDHA 4D80A 5CFNA 4EHDA 1DQPA 1ZJWA 2VPYA 5E38A 2QD3A 3IJPA 4DV2B 4H77A 3P2YA 3FLMA 1MABB 4M49A 2RDMA 1OMOA 1CFZA 3CEHA 3GD7A 4RAQA 2JD1A 3R20A 1WR8A 1ZQ9A 3RT7A 3IT2A 4JC4A 4FR2A 1S6YA 1OV6A 3UUWA 4WLNA 5ALGA 4HL6A 4HXEB 2P9BA 3RV3A 2NNLD 4GP9A 4TTAA 2PT5A 4DR7B 3KYIB 3EPLA 4CEHA 1CKEA 3PUHA 4HFNA 3EPHA 1IE3A 2V1UA 3CRRA 3WHLA 2JIOA 3FPHA 3GQVA 3C15C 3VFDA 4JUAA 4BAUA 2J7PD 4W1RA 1ZCAA 4EDHA 2R25B 5B6PA 3SN6A 2CNLA 4IZHA 3JQPA 1AUOA 1MABA 1R7RA 1Z34A 3K5PA 1TT5B 1RAEA 3D7MA 2A1TR 3DQZA 5HKLA 4ENTA 4XR4A 1ESNA 3U60B 3UWPA 1L1RA 4CN9A 4Q93A 1JEQB 5TARA 1YR6A 1LTKA 1P2TA 5IEBA 1R0YA 3VR3D 3W8NA 3WBFA 4YQFA 1XQ9A 4FLFA 3WLOA 5K6RA 1LDGA 2WJYA 5CGZA 3KT8A 4I3FA 3PGVA 3S44A 1JFVA 1WBJB 3MLAA 4S2UA 1GR0A 1BC5A 3DC7A 4R9UC 4D92A 4EKEA 2XITA 4JOQA 3WLPA 2FEXA 4EP1A 2UXBB 2Z5GA 1DG3A 4RKWA 5L95A 1E3LA 4GWKA 4GLLA 1MUUA 2BR4A 1SKQA 2LCIA 5IC6A 2FW9A 2CVHA 2ZE7A 1X8LA 1MH1A 2HSWA 4YGXB 3B7WA 3IKLA 3IP3A 3RVPA 2PYZA 3T1QA 3TEMA 2OOSA 1DBSA 1DWPA 4JLMA 1JEQA 4URYR 2D59A 2NZVG 1OVGA 3VZDA 3H0EA 4Z86A 3ZK7A 4TN1A 4C4TA 1AE1A 4Y2VA 2X0EA 3SBXA 5EMHA 2OORA 2PZGA 3GMIA 2JANA 3OCWA 1KSGA 2PD6A 1R8QA 2FUCA 1UK8A 1P5JA 5SZKB 2CNDA 3VKFA 4FGLA 1OSNA 3B48A 4KRGA 4WRRA 3KSBC 1G59A 3GRAA 1NZJA 4C1NA 5TRTA 4DLSA 3I83A 4J3FA 1ECCA 1KP3A 5EE9A 1B3BA 5DI3A 4JKIA 4G9BA 2IP4A 1NBMD 4JVOA 4MINA 1GQSA 1TIKA 1VJ0A 4CUJA 4ARIA 2BJVA 1WCV1 1Y1RA 2ECFA 2Z1DA 2VSFA 2DM6A 2QRHA 3UT5A 3WAKA 4XIYA 4XIGS 4EEZA 5IPFA 1DB3A 3WGMA 3ZY3A 1E7MA 1J25A 1WZCA 2R00C 2XB4A 3LQYA 2CNWD 4EIWA 4MHTA 1VG0B 2D7JA 5FX2A 1E3JA 5FWYA 1UBKS 1MO5A 3RYCA 4KAXA 3V8VA 3VR5H 3PUIA 4J6EA 3TOXA 2QLLA 1VJRA 1NF3A 1ZXBA 1ZD8A 4O63O 5I3CA 3VR3A 1VJTA 4H6PA 4IJUA 2IGBA 2W98A 4X6XA 5ICSA 1M2WA 1O58A 4WV3A 2CUKA 5EJEA 1Y6JA 2UVDA 3Q85A 1KBZA 4Q3BA 4B9EA 4A5OA 3R3UA 5HNKA 1E6MA 1ZOSA 3AXSA 1CIJA 3WHPA 1P9NA 1KMIY 1F20A 2KJQA 4PC7A 1A4XA 4RJLA 1E2GA 2FPRA 1LDYA 4LZWA 5D7BA 5DRTA 5HCIA 5DKFA 2OG1A 1OAAA 5MN4A 4OUKX 3QXGA 2PMWB 2VBCA 1QX4A 4G36A 2IHNA 2O1XA 2EJCA 4BLTA 4EA8A 2BHRA 1OYYA 2I9PA 2XRFA 4PCLA 2O2SA 2Q4TA 3ELWA 1Q7TA 2PZBA 4XTRA 3N74A 2WIDA 1H3FA 3CH7A 4LAFA 4CM9A 1VMAA 3ME5A 4PQYA 2EGGA 2H0AA 4L8WB 4RXTA 3BH0A 1K8YB 5AK0A 4BTVA 3PPXA 3I9V6 1XP5A 2H4HA 3OJ0A 3HYSA 5WRFA 2TMYA 1R6TA 5ITWA 4L02A 4E30A 3WRVA 2PVSA 2R96A 3I2GA 4RTSA 2J3MA 5YASA 1F48A 3GB9A 2E82A 3EF0A 4IWYA 3RIMA 1SCJA 3BCUA 4PN7A 1Z2AA 4B79A 2A84A 2C96A 3VI3B 1T36B 1ZUIA 1U2EA 2B4YA 5TJHA 3UAYA 3W6UA 2AFIA 1XZLA 4KIJA 1GRRA 4RGQA 4XYMA 4JXJA 1TUGA 2DQSA 5TQJA 2V7GA 4ND6A 2UV8A 4I6JA 4RIFA 2RB4A 3PNPA 2WILA 2C8KA 4I55A 3STWA 3PQCA 3FZNA 1V7CA 3IUMA 3KXLA 4NFYA 4PC1A 4UUAA 1A5SB 5K3SA 1T6NA 2JLZA 1XKQA 1ZNQO 2ZYHA 3NO4A 3PQ2A 4PX3A 4URZR 5EZ5A 3JQGA 3OM9A 5ILQA 3MCWA 1LUAA 4MR8B 4DN6A 1E5DA 1P8AA 1I01A 3E0QA 1KY3A 1JJVA 2XKBA 4HYEA 4QG7A 4QUKA 1EB9A 5EIWA 1YUBA 1HT3A 4YUXA 1Y1TA 1RKQA 3HRIA 2YIDA 1JHPA 1TA9A 4ARUA 2GPSA 3K0FB 4M1WA 4F4JA 3T1YB 2AQ8A 1T36A 4EHIA 1GG9A 1VE1A 4DILA 5BR4A 4GNKA 4YAOA 2VRWA 1HRDA 2OLEA 1NT4A 2NUAB 4DREA 3OEHD 4EY8A 2QQGA 1FUUA 3ED1A 5GPBA 4CZ2A 1TQ2A 4J6FA 4CR6A 2F17A 4B4VA 1UPAA 2K5UA 2XF8A 4NEHB 5IBCA 5JXGA 5K8CA 4F3KA 3FR7A 1LXCA 1EE9A 4MR8A 3WGUA 2VDWA 1R66A 2NXJA 4LYAA 4LJYA 2I4TA 3OQ1A 1U0BB 1XLWA 2X58A 3WL3A 4DRZA 2NZYA 5GONB 1JQKA 3TBHA 5B58C 2GN2A 3O2NA 2OQIA 2FGJA 3ZVRA 3MWEA 3HSKA 3CMMA 2QYHA 3IR6A 4WUVA 3ER6A 2DFTA 3N53A 3UV3A 2IHUA 1OROA 3ETLA 3OBIA 3RSZA 4B73A 1CF9A 1NY5A 3NEAA 4UAJA 1MBZA 3WL8A 1T8WA 2HNAA 3AW8A 4FGWA 3Q0EA 1NQOA 2P0EA 5DYWA 5EJAA 5EQTA 2F9FA 4K2AA 1JT2A 1XCBA 3ZXIA 2X9LA 1VHTA 3AEKB 5HYVA 1LI5A 1QH8B 3VNBA 3DKRA 3RAGA 4EHJA 1MB4A 3F3KA 3HDTA 2AZXA 3Q5DA 4ZRMA 5ETJA 4F0JA 3U3OA 3UPUA 2YMLA 5GONA 1AQ6A 2CCJA 2WT9A 2WWXA 3I45A 4L9AA 4AJ9A 1CR0A 3TTUA 4DSAA 1T3GA 1CK4A 1EH5A 4GOXA 1T2VA 1SB8A 4S1OA 3SEZA 5FOTA 2IBTA 1YOVB 4TTRA 4IOKA 2VDOB 3QWIA 3LUHA 2RGRA 3ELYA 2OHGA 1KK2A 2D0OB 4CQLB 3FG9A 3O8QA 4NTZA 2DFLA 4AJNA 1ESDA 2PZJA 2BGNA 2ZYSA 3BGVA 4FE7A 3WQBA 4AJ1A 5ITVA 2C7PA 2PUFA 3CC8A 1DQZA 4X5OA 1DT3A 3RYFA 3BMNB 2BUCA 3AEKA 4MYDA 1PR9A 1UBJS 3LKDA 4G1BA 4AN1A 4EG6A 2V8OA 4LRSB 3AHFA 4UC0A 3HCRA 4BLUA 2BGTA 1QGAA 4OHKA 2VDJA 3LZ6A 4HNHA 2VNKA 3GLUA 3EJWA 3RTGA 4ETWA 5JBQA 1RZVA 4ZO9A 1KPHA 1HETA 2NACA 4HJRA 5CLQA 4DMCA 1EK5A 1GFIA 1PUIA 1YOVA 1G6KA 1UADA 1JHMA 3P0EA 3KKKA 1ANKA 2E89A 2BKXA 3AOEA 3EPPA 2XB8A 3O0DA 5KX5B 1V4VA 5CBPA 4PXSA 4Y9RA 3W3ZB 1A9XA 3R5JA 4QTUB 1G19A 2HLPA 1OLSA 1RPNA 2CXSA 3IV7A 3ZNQA 3ZWNA 1UJBA 5F7JA 1JNYA 1KL7A 2J59A 1KARA 4XTCS 4NCXA 4NHEA 4GKJB 4K0KB 2GZ3A 1CNMA 4YHBA 3VR1A 4XLTA 4EI9A 4F93B 3X2FA 2Q4BA 1I9GA 2P4QA 1U6JA 2FOIA 2R5NA 2VSOA 2ZJFA 4UHCA 1CRLA 1Z5NA 1Y8ZA 1XD8A 5CDUA 1CB0A 1OX4B 3GUCA 3GAAA 4HGPA 2VSNA 3C1AA 2O2YA 4P3OA 4PR0A 2VSYA 4B0PA 5K0ZA 3FHOA 3K3PA 2ZIXB 5KX5A 3AERA 1T13A 2GZSA 1QUFA 3N2LA 1J33A 1S4MA 1JTVA 4BFVA 3IAS1 2HGSA 3EGDB 4KAFA 4HDNA 1RWXA 2QPLA 5D8DA 5K4GA 3TR5A 3OLZA 4BUJA 4UPVA 3L0SA 2WZDA 4RPKA 4D81A 1R9MA 4Q9HA 1NAIA 4CF4A 2DFVA 3DDNA 2Z56A 1WMEA 2GRJA 5DNVA 3ELUA 4AAYA 4X1YA 2Y8EA 4TTQA 1N25A 4O08A 4OFBA 1OX4A 1UBUS 2C7VA 4ZALA 1JDSA 1FUYB 2JC3A 1VDZA 1AZWA 5LLSA 1URPA 3NZEA 3IEIA 3V4FA 5DMXA 4MQBA 3NBUA 3PS9A 2Q49A 3AX6A 1VB3A 2ZIXA 3QM1A 4Q1FA 4WECA 2EGHA 2HU7A 1NUPA 2I2BA 3CLKA 1QIFA 2PRYA 1IAQA 2YN0A 3E18A 2RAFA 4GPD1 4QATA 5FKJA 2XEDA 4UHDA 5C2JB 3IVRA 3EGDA 4Y6RA 1SUWA 1CQIB 4BFXA 1KERA 2P6MA 2CBXA 4JGIA 5DGXA 5FI0B 1QQ7A 1JR3E 2FUEA 5TVGA 3D8UA 3GD5A 4CE6A 4ZV9A 1NVDA 1MAHA 2VZ9A 3PXAA 2J0QA 3UGQA 3OIYA 4G8CA 4PZ0A 4IJKA 3LBYA 4ZIRA 1FBTA 2WP8J 1Q7EA 4EVQA 3QXXA 5LVAA 2PGLA 4I7EA 2MINA 2IYFA 4UCXA 2FG5A 4M9ZA 3V8QA 1VPDA 5HQJA 2PRJA 4EAAA 2A2ZA 3IEVA 1G2PA 2N0SA 2Q1UA 1BOOA 1GNSA 3D2CA 4XGNA 1DAHA 3PEWA 4F7DA 2GCOA 1O03A 3NFRA 5KSYA 2Q2QA 1CQIA 2ZUSA 1GGJA 3KLMX 1MX5A 1ZHFA 3KTAB 5IARA 5FEUA 3KCNA 4POAA 3AEQA 4KQ2A 1K9SA 2P2GA 2W8BB 3A1NA 3LQRA 3RRYA 3WOVA 3PTAA 3RS9A 1GUFA 4GRDA 3UXHA 3CZ4A 4D9BA 3SQXA 1W1IA 3LBHA 1DCFA 4KLCA 4QUHA 3L0DA 4DA4A 4EO7A 1P1IA 4IP0A 2C5GA 3QPVA 5LLTA 2BGJA 2XWQA 3EQ6A 3NDPA 4IJ6A 5EJFA 5GVRA 4K7JA 1P4HA 1SC1A 4ZJUA 4L4XA 4AX4A 4QXMA 2ZTUA 1ETHA 1P18A 4Q37A 4NJOA 1T24A 3MW8A 4M2LA 4REQA 5AK6A 4BNYA 2J67A 3OQVA 2QD1A 1J8YF 2EW2A 1E7YA 4ARAA 1L7PA 2BFOA 3OP1A 3OURA 2Q5CA 1TF2A 1B76A 4H2DA 3KTAA 1NATA 3M1IA 3NANA 2OQVA 1YS6A 3URKA 1W46A 2POCA 2W8BA 2QN9A 3W7AA 3OA0A 1AY0A 2RMKA 1W2WB 1G1MA 2W6QA 3NP9A 2IYYA 2QR5A 3EIFA 3TD6A 3Q3VA 1E1MA 3HN6A 1F51E 3BORA 3JVUA 4GSKA 3SDZA 3R9WA 3DSRA 1HA3A 1Y6QA 4ZVRA 4C03A 1UEIA 4HDAA 4Y2HA 1RP7A 3A31A 4LIPD 4KGVA 1C7IA 2P11A 4YYEA 4BNIA 4NABA 1L8LA 1LVUA 4M7RA 5DHTA 4ZT3A 4DOMA 5ESRA 2QBYA 1FDUA 1G8KA 1NMXA 4FX2A 4RCZA 4FW8A 1MW9X 1SXJB 3C4QA 3LCJA 2HF8A 1XZ8A 5F3DA 5DM1A 2QTZA 4I14A 1I0ZA 1BX3A 4S2EA 4CEIB 4WADA 3MJ4A 2PCJA 3AVOA 1K5HA 5AO9A 5KNBD 1TJ5A 3NVAA 2QD5A 1SFRA 2I6GA 1KAGA 2XNDD 4NMMA 3MOSA 4WFQA 4NFLA 6NULA 3BKWA 2Q4DA 1Y1QA 4IO1A 4D3XA 3O90A 3AONB 4ZMSA 2HCRA 3WWCA 1TIBA 2F90A 2WM3A 4D9GA 2P5SA 2ZAOA 5KQGA 1FL9A 2EVWX 1ENPA 2K2WA 2Q5IA 4UNPA 3LWBA 4Q00A 1UBOS 1FRVA 2ZTMA 1C9NA 4WXPA 4DLLA 3II6X 1OA0A 1WOYA 3N6XA 1E5VA 5CLGA 3A3KA 4L3VA 5DHFA 4AI6A 4PCUA 3N2KA 1SXJA 4WHMA 4ABTA 4AUKA 5IM5A 2FV8A 3Q7EA 3GH3A 1MOZA 4G0OA 3TEFA 3LECA 3FYCA 4HWRA 3G23A 1QP8A 1IHUA 1MPXA 2JRLA 4ZANA 2FQWA 4MUJA 1JYFA 3IP5A 2NO9A 4I50A 2E48A 4WASA 3SNKA 3VU0A 2KBEA 1E9FA 1MKYA 2ZRQA 3T54A 5ITZB 3J81A 2NMVA 4DSOA 3Q3CA 4M8IA 1U8XX 3PFCA 2QQEA 2DTDA 3PC4A 1EDDA 1XZEA 4Q4AA 4CRWB 4JP5A 1CS0B 1EK2A 5FUVA 3THRA 1S4QA 2FSIA 5IP5A 1N2HA 1I4WA 1IQPA 1OTYA 3OQ6A 4AURA 2ATEA 1PG0A 4RCYA 3RK0A 3DR5A 4I5FA 2HA0A 4QULA 3VJMA 1IIBA 4F5WA 3O1HB 4CIWA 4DSTA 4FYXA 1YCGA 3TQSA 1LPPA 1IBLB 4BMZA 4GYYA 4CIXA 3QKRA 2HDWA 1KZ6A 5TMPA 1B1CA 2VJLA 4FCWA 1E8DA 1RMTA 3Q88A 1X13A 2FK7A 2OCYC 1JDBB 4IIJA 4RJKA 4HAOA 1Z5ZA 4XB1A 1M1NA 5TQ2B 1HE8B 3IOMA 1SN7A 5KU1A 1DKQA 3DMDA 1UMBA 3CYFA 2EV9A 3DC2A 4BLRA 1HOTA 5BRAA 2GJ9A 2WWHA 2FR0A 1RKXA 2P1ZA 2NO1A 3K70C 4RE6A 5M2QA 2QX8A 2UVQA 4KFRA 1C4XA 3T7DA 3VV2A 1ML4A 4G1FA 1GCOA 4CLEA 3FPCA 1U9IA 4GBMA 1RRPA 3OU6A 4YFVA 2UUCB 1ISMA 4IJWA 2JBAA 3M82A 4U9IS 4ZI7F 4UTOA 4AMBA 5AW4A 4WNCA 3TF5A 1YB6A 5G1NA 2XMSA 4CIDA 4D3ZA 1G8JA 4ZO4A 2QLMA 2WIJA 3WLKX 4HAYA 1O0BA 2QK4A 4AN4A 1IL0A 2FLKA 3B3JA 5TJ9A 1QM5A 5JYBA 2CDRA 5TQ2A 5JV5A 4R0NA 2FPIB 1D3AA 2NAFA 4K6FA 4YR7A 4S35A 4CNBA 1T15A 2P7HA 4G8BA 3AM1A 2D00A 4X1KA 3KSAC 1VE9A 4EW3A 4A27A 1WV1A 3C74A 3DE2X 3NKLA 4LJ5A 3WYNA 2Y66A 3ZHUA 3VVBA 3E9DA 1R5BA 3TSYA 4GE3A 2ZUFA 4GUAA 3RYTC 1EFRD 1B0AA 1BXZA 4KE9A 4MUAA 4WXHA 4C6TA 2ZUUA 5D3KA 2OV8A 1V5IA 2SKCA 2BLLA 2C8LA 1UP4A 2FVYA 2YINC 4JUBA 5JH7F 2VBIA 3C8HA 2P5TB 3LTNC 1U28A 2G8LA 1XR3A 1ECLA 1N33B 1P7WA 1YR3A 3OOEA 2PWBA 4R8LA 1GFZA 1T25A 3WLEA 4HH1A 1L7VC 4GYJA 2O50A 4D26A 3JQ6A 3NTRA 4XPIB 1RJFA 1WL8A 2XGSA 5IS2A 3B5IA 4XCXA 3SSNA 4F5DA 1T2EA 1AQIA 3EX7C 2O2JA 3ZDFA 4X3CA 2TECE 2ZJ4A 1UWVA 6YASA 4ZQHA 3PC3A 3VVCA 4XM0A 3C5VA 1IY1A 1DPFA 4JU9A 1NQTA 4BCBA 2F8MA 1GGHA 2C54A 3DCYA 4L5AA 1H2WA 2V0NA 4IDAA 2X76A 2GZRA 2WR8A 2V54A 5CT9A 1SHLA 3FOCA 4EPRA 1SPBS 5KQLA 1RYBA 1OOEA 4U4AA 1LWOA 5ECGC 1XX6A 1XVTA 4WCDA 2QN6A 4QU5A 4X8OA 2HUNA 1P1RA 3LSYA 4PLZA 5AK4A 2H4YA 1EE1A 3MUNA 4ENPA 4RESA 1HWYA 2VZ0A 3PCTA 3OCXA 1BDHA 4P0QB 1TA0A 1BKYA 1CQWA 3DZBA 2AF4C 5HUHA 4RD2A 5LQRA 1V8DA 3NTOA 3P2EA 1TIPA 1N9ZA 3JQEA 5CIWA 2NO5A 1Z3IX 1XJ0A 4PHHA 1ADYA 4MW2A 5CEJA 4C05A 3STXA 4KOAA 4TVSA 5K0TA 3F8SA 4DV3B 3VVLA 1GDDA 3BREA 4O4HA 3GLKA 5CCBA 1DKOA 1EFRA 3OZCA 5C80A 1NWCA 1DIGA 3LVRE 1DAPA 2VPWA 2DJ5A 2GN8A 2W6ZA 3ASVA 3ENKA 3JWEA 4H60A 4MQ4A 1KI8A 2BN4A 2YXBA 3G49A 4OJMX 2GBCA 2Z57A 2FLVA 1LD3A 4FZRA 4G41A 1RWWA 4FHGA 1JBQA 1FFGA 2DGDA 2A33A 1BVUA 2YR0A 2YJTD 1P2DA 2JGLA 3B7GA 3A3YA 1KAMA 3CT6A 4D9NA 4BKUA 5LKRA 3STYA 4X84A 1MFZA 3BJIC 1T9DA 3EZXA 1OXTA 4UHBA 5HW0A 2WB2A 4MCAA 1PT5A 1MT3A 3KPWA 1W5SA 4EPWA 1S2DA 1AQLA 1KO5A 4YX9A 1SH7A 2PLNA 3GN2A 3CUSA 4KZKA 1RQGA 1GPYA 1I30A 3LRPA 1OHHD 5KSWB 2C7GA 1PTJA 3B2NA 5HFNA 4B7AA 5F1PA 4RDIA 4FJ0A 5BN4B 5KMGB 3NAGA 4QM7A 2DQZA 2Y27A 2IU0A 4NYIQ 1H0RA 2YYYA 1O87A 2ZDGA 3FPJA 4FYYA 3MOIA 4HNUA 1XCPA 4TWZA 1PCXA 5EMNA 1H2ZA 1VI2A 4BO4A 2AFIE 2Z4TA 1R8YA 3UCXA 2CXRA 1I5OA 1M1UA 3T5TA 5L6MB 1PYOA 2ZUWA 3L4BA 3DYVA 3RREA 2B1RA 1P4AA 1TX4B 1NBME 1A50B 4BJ5A 1DAKA 1N1MA 4NECA 1PX0A 1SVSA 4C7MA 3QMVA 1N2JA 1JAYA 4V0MA 5I9BA 3WKEA 2HQ1A 3AMVA 1AZTA 3HR4A 3P9ZA 4NATA 3W8RA 2ZSHA 1W76A 5TGZA 2I66A 5JNTA 1JFLA 2D2EA 3L7MA 1X7HA 3X1MA 3ZI0A 3QXSA 1E2PA 3OMLA 5BN4A 3OJXA 5CXQA 3AVUA 1E79D 3QLTA 3BFKA 1WHSB 3L7OA 3LLCA 5AT1A 2I9KA 1CUUA 2WKQA 1GZ4A 4FE3A 4K9QA 1QAQA 3AVPA 2A9VA 2ISCA 3AO0B 3KV3O 4XGKA 4W6ZA 3OY2A 5BV0A 3ZHOA 5EWJB 3EN0A 3LFUA 1YSCA 2QLJA 3KLPX 2IYZA 4JUIA 4UEKA 4B32A 1ZA2A 3G8CA 5B7GA 4MW9A 3W1VA 1FJXA 3MLEA 3PD0A 5JSHA 3HGQA 4IXWA 4HI0E 4MRMA 3TNDA 4D3YA 3J81k 4MDEA 3DM9B 1ULBA 4HB0A 3GA0A 3VU8A 3ZW9A 1I7PA 1YIAA 1D4AA 1FW8A 3M2PA 3DO8A 1ENYA 4O4IB 4XH9B 3JQFC 4DR3B 3P4YA 2H8GA 2WJVA 5DTIA 3GBSA 1MJGM 3L0IB 3M89A 4OSOA 3HFGA 4FLMA 4RF5A 3HKCB 3BSFA 4TWRA 5FL3A 2BD0A 1TJNA 4IMPA 2EYUA 3O8RA 1U5BB 4LECA 3T1VA 4CNQA 1XMQB 1BX1A 2XCIA 3ZDDA 1OYVA 2OC4A 1SZCA 2P41A 2XCUA 2YIJA 1N57A 4BWYA 5HOEA 4RLQA 3H9EO 1B8OA 2WNSA 1CZHA 3HJBA 4PLHA 3UCEA 4FWBA 2EGUA 1WKCA 1C7FA 4ZI3A 3IDFA 3H2IA 4O2BF 4DMRA 3GDWA 2IKQA 5TPZA 4XLLA 3SKYA 2Q6KA 3OTWA 4QFBA 4TXJA 1JAZA 2BFPA 1FDVA 1QK4A 1U0GA 4EITA 3CZ5A 1E2UA 3I23A 3QE0A 4AWXA 3NT4A 4YPOA 4Z4IA 2C99A 4B80A 3KL2A 1OZGA 2NU9A 1G9TA 4YAWA 3OKAA 5E4JA 5JBIA 3HXQA 1E79A 4EGFA 1B3RA 3CZQA 3I12A 4G26A 1ETUA 1UBMS 2QM0A 3GFFA 2X8BA 3BKXA 3E53A 1N34B 1YB4A 3LK7A 2MTBA 4EYOA 4OLBA 4B6QA 1V2GA 3N7TA 4M99A 2G1KA 2WZCA 1G0OA 1VYTA 2BFEA 2HBQA 4MK4A 4ZCQA 2NXWA 3OA2A 3ZLVA 4Z1MD 1GPMA 1I0LA 1ZIYA 2PQMA 3OZBA 4HDMA 1EWYA 4LI3X 1A95A 4AL4A 1N2GA 1DKNA 3EFHA 4BAZA 3O2SB 3NDRA 1Q19A 2BH2A 3AXTA 1EEHA 3B3GA 4KP7A 4MQEA 3ZD8A 4A26A 2QTFA 2DBRA 3B1KA 5BYJA 4A8JA 2X2EA 1EVYA 1UXJA 1ATIA 3UOGA 3PC8A 1U31A 2OT3B 2EZUA 3RIHA 2CHEA 2O7VA 1AHNA 1A98A 3UO8B 1YF3A 2AFVA 2I62A 3AKCA 4V0OA 3OU7A 1BWSA 3CX7A 1FFDA 2ZSUA 1GL6A 3GPBA 3F6YA 2HH9A 5FNVB 3S1AB 1U2DC 2QROA 1HUQA 1WX1A 5AVTA 4HFJA 4KXWA 1OCEA 1Z6GA 2LPMA 4EPTA 1OB2A 3RLFA 2UZ0A 3O8LA 5CVUA 1IN5A 5FA6A 4OXYA 5KREA 5JYEA 4HOYA 3TGLA 1N78A 2P3SA 2CXTA 2G83A 4C2UA 3CGWA 1PE0A 1JNXX 3ZGLA 3NALA 4QOGA 5B2EA 4C7VA 3R5KA 3WLTA 5BMVF 2AUTA 3EFOB 1U8YA 4KR2A 3GJ5A 3VV3A 1FTWA 1J0AA 1L5FA 3DOJA 3SZGA 5DO9A 3K71B 3PL5A 3GWGA 3RC3A 5JPIA 3I72A 3K1YA 4BUZA 5FUBA 4EK9A 3CV3A 3IESA 4TMZA 4FMDF 3HU2A 1ICIA 3N07A 1O97D 1YR8A 2FCAA 3NCTA 4HQKA 4LYDA 1SEVA 1ZGCA 5FNVA 4X93A 3S1AA 2NTJA 6CHYA 5KIAA 4OJKA 5TF4A 1NULA 4LVNA 4NK4A 3HMKA 2W6ID 1C29B 2YS7A 1YCFA 5K2MA 3L84A 2QENA 2JFPA 1D5WA 3NTVA 5K3FB 4RVUA 4M0MA 5DCYA 4PGGA 4MQ5A 1OU4A 2DWPA 3TOCA 5CDFE 1I7SB 1FP7A 4C2TA 5D3ZA 4AN0A 3ZVKA 4PCVA 1BA2A 1XLUA 3W1EA 5JSYA 5TSDA 4EZEA 1R12A 1S89A 1QV7A 5BWMA 1OWMA 5KJCA 4J0FA 1XWIA 3N0TA 4KODA 3NB0A 4Z1MA 1T6ZA 1S8NA 2IQ5A 2PL9A 2J3JA 2IYQA 3LXMA 1GYRA 1RLIA 2FF7A 3FYUB 2JZOA 4F5YA 4L8FA 3KHUA 5LYJB 2YN2A 1BH2A 5IABA 1DVRA 1FJ2A 1RJWA 2PMEA 4H7FA 5E3IA 4B6SA 1JJAA 2F4NA 3RUIA 3ODPA 1F8XA 2VWQA 3LBAA 4N0MA 2EJBA 4Y18A 5K3BA 3W2GA 1C1XB 2VF4X 5K3FA 4DNQA 5KTSA 2UZIR 3OFND 1ZW6A 1A9QA 2IX3A 2GM9A 4LX0A 2HXYA 3CO5A 4M86A 4E2WA 4TMKA 1HE2A 4I0WB 1ZN7A 3EUEA 1NDQA 4R9NA 5CXUA 2G5TA 1XMPA 2AK2A 2JFOA 1SHUX 2YYSA 3Q9SA 4QJ5A 1R0KA 1SB9A 2ZSKA 3WGQA 4MVCA 2ZZNA 4NMXB 2IFTA 1Y6RA 3DZHA 2QRJA 3C70A 3N1UA 3OOWA 2P9CA 3OUTA 2HDOA 4OHCA 5GP1A 5KU7A 3MUFA 1RHQA 4MGZR 1QO0D 2I4LA 2YHIB 3DVAB 2UUAB 2VHTA 4M9QA 5EL0A 4GOKA 4OH7A 4YJHB 4NOLA 2H65A 2RK6A 1K86A 5FTJA 4LYFA 3TIGA 2IBSA 4G9GA 1ONSA 2GCEA 3WISA 3PVSA 3W1WA 3SYLA 1S8OA 4H7KA 5CNJA 4RM3A 3V1MA 3GARA 4D45A 4H7HA 2REQB 4H6WA 5I9TA 4A6PA 3ID6C 4D6XA 1ZR2A 1Z7WA 1CYEA 3MRXA 3LQ4A 4RZUA 2AN5A 1KYYA 2W6IA 1MENA 2HJWA 2QAGB 3R6GA 1Z56C 3LUCA 4GEGA 4TPKA 1SCIA 4YEDA 5C8ZA 1XCOA 1M2OB 2PLFA 2YHIA 1VYVA 3K9HA 3PE3A 4C7JA 3IIKA 2G80A 1HF3A 1WZNA 4YJHA 4KJXA 3IUEA 4LMPA 4NS4A 4G4JA 5ARCA 3E7WA 1G55A 3JZIA 4ZVSA 4XRGA 5HTKA 2CMHA 1L7OA 1D2MA 1VL8A 3EGOA 3PJFA 4KB5A 1VIAA 2WSYB 2Z58A 4F8YA 4JVLA 5DF1A 2Q0HA 3UENA 4ARZB 1AB6A 2P2SA 3SEQA 1ISIA 1ODKA 2REQA 4RGYA 4OBWA 3JAWB 4NAVA 5A1TA 2R6FA 5HTOA 5E9JA 1JPNA 2GJAA 2ZUTA 3H1AA 4J7CA 4JB3A 4KFTA 2C9DA 2YWDA 3USES 4A0SA 4ZYVA 2QAGA 3OFNA 1V8FA 2HM7A 3KU4A 3WR5A 4XOUA 1M2OA 1TMKA 3QEJA 1W4BA 3DNPA 1PNQA 4CLHA 1NJ2A 2YRXA 4RFLA 1TK3A 3I2FA 3QTBA 3ZZUA 4ALJA 3QPUA 5SZJA 2G9ZA 3KKMA 3LRTA 2DOKA 3C6KA 1PAUA 1X74A 1FYXA 3BIOA 1UJ6A 1G20A 1X2BA 2A5FA 3NUGA 2ZU0C 4LQCA 3KUXA 3ANLA 1DXQA 1BKDR 3L0CA 4KHPB 1QO0A 4HZIA 3JVDA 1MO2A 3LJKA 1VJCA 5LDDC 2XXAB 4RHCA 1Y4DE 2PJZA 3NBZC 4O2AB 3INRA 3AP2A 2R6JA 2XE6A 1GR1A 2VDPB 1ST2A 3KYJB 4DQVA 4KDEA 4CETA 5THQA 1V1RB 3SHTA 5IF9A 2QRMA 3BRSA 4DQUA 3D6MA 1K5PA 2ETVA 4I9FA 4Q7EA 3QUCA 5JYDA 2XUAA 1RYNA 1TAHA 2YVQA 1UJNA 1XDWA 3PCXA 2NQTA 1ZEMA 1PJ3A 4INAA 5K51A 1I3KA 3WDLA 2UUBB 3RROA 3AGQA 4LKOA 1C1HA 1XZPA 4HBZA 4UBIA 3DAFA 3NASA 2XXAA 4WFIA 2RGAA 5CRIA 3HJTA 2PX5A 4CKWA 2FR8C 3ZKWA 4NMHA 3E1GA 4XUGB 3FCYA 1L1EA 1GOTA 3KEFA 3E03A 4X95A 1XJCA 1Z3CA 4CTNA 3TJRA 1J0CA 1QVZA 5LMNB 4Q0MA 1I4TD 1JKJB 1IUPA 2VUTA 1QJCA 2CBGA 4WKNA 3L1VA 3UFXB 1F7VA 3K0CA 4KDFA 1JEDA 4B3JA 1F3OA 2DFKB 2WWWA 3B3FA 4CMEC 1NZDA 4DA8A 2PFGA 5EKSA 5EKUA 2PWYA 2HRZA 3WGKA 2ID7A 2X4LA 3ZIAD 2D4HA 4DQDA 1NR7A 2YMMA 1Z6QA 1JGTA 4LN1A 5JXJA 1CERA 2VAXA 4PC6A 1H8ED 2FHSA 3D8BA 4WCFC 3ZH2A 4CF5A 2ZJ0A 2HA3A 4M1EA 5AM0A 1ULSA 3GBVA 2OP0A 3IIJA 2LV8A 3L7NA 1C3OA 2BRUC 4FFDA 4MLZA 4W7HA 5HQ3A 3GUHA 2DT5A 4UQPA 1RJDA 1R50A 2X8JB 2O2XA 4YRDA 5UKDA 3SX2A 2VH1A 1QHYA 1SXIA 4PX2A 4F91B 3PNLA 2J09A 1JKJA 1MU0A 2QTLA 1ULAA 3DR3A 5JMWA 4JI4B 4U7FA 3NIWA 3KPYA 3TCXB 2QOEA 5DCUA 4G86A 2HU2A 4DMFA 3WYAA 4N6GA 3OZXA 1SKMA 1YS9A 1ZMBA 4N54A 1ZK0A 1X8JA 1W8DA 1L8QA 3EIUA 1SU4A 4TLCA 3DNFA 4KH1A 3P32A 1SQ0A 4J0EA 3BGIA 4RH1A 5CW1A 3R7FA 2RKBA 3VSBA 5CLJA 2I7TA 3G7NA 1BZYA 2DHCA 2HR1A 1RAAA 1J99A 3IJ5A 2IE0A 2WKPA 3EY9A 4BX3A 1Z82A 1DC6A 1EE2A 2J07A 2OVFA 4IRUB 8ABPA 1K98A 1P81A 5F2NA 2PXAA 5TMDA 1LLFA 2JH8A 4OKSA 2ZYVX 4EY3A 1GITA 1I2AA 2YOFA 1XPOA 5KS2A 3Q72A 4P4GA 4LV6A 2ZE8A 4EJSB 5D7NA 5G0SA 3GEHA 2WOOA 5AVKA 5GTDA 1I80A 1J1ZA 5JIBA 3RIEA 2RIRA 2X7JA 3U7JA 3IS3A 4EY5A 1UH5A 3QVVA 3VHLB 2UUOA 4JLPA 3RSFA 4JR0A 3NWEA 3RVMA 3USZA 3WAJA 1RW4A 2DWQA 4JSTA 2OKCA 1HT2E 3B89A 3ZIAA 4B1FA 5JASA 1G5HA 1XVVA 1ZY2A 3BDIA 3LUFA 3UJ6A 5JLJA 1EK6A 5IT9A 8ATCA 3ICCA 3L6UA 3UC5A 1H8EA 4ENUA 1E69A 2B99A 4QWWA 2I2AA 5T6BA 5FPPA 4UUQA 5CFQA 2VHZA 1KJIA 1WNTA 3SEFA 3CO0S 1WTCA 3C6XA 4A0GA 4EJSA 5L3QB 2OM2A 1MQAA 1YAJA 4FXOA 1MIOB 3SDBA 1GG2A 1ZRNA 3A2KA 1XUOA 2EKPA 2F00A 2F1RA 4RMNA 3A9VA 3FYTA 1M2GA 5I4KA 1PG5A 1VRWA 2H2IA 1K5GA 2BEWB 3ZY6A 1QFSA 2H5LA 1PQWA 3TSAA 1NV8A 3OT1B 1TKRA 4K40A 3FUCA 3ZW7A 4AYXA 5ICEA 4UE2A 4PYRA 1XEXB 2KX7A 4W5NA 3UH1A 2IXFA 4P86A 3FOZA 4RV4A 3DA8A 5E7JA 1LI4A 1T9ZA 4FOTA 3WK6A 4Z4HA 1INLA 1UBTS 3EUAA 1BE0A 1SA0B 1TPZA 3H11A 2G4CA 3IKJA 3NHZA 4H7DA 4JROA 5L3QA 5FIUA 1MB3A 4JIMA 4IGKA 5M34A 3B78A 4KXYA 3OKPA 4U5QA 3UKJA 3V1UA 5JROA 5EJ2A 1WLYA 2AOWA 2QTNA 4RH0A 1VMEA 2OQRA 1ZI6A 3UANA 3BBPA 1NONA 2C1EA 3WJ2A 2ZI4A 5HHTA 4JZYA 4PINA 2ZJZA 3H9JA 4C0WA 1QYWA 4QZVA 3OT1A 5M04A 5GWXA 4IINA 1TM2A 4JXZA 2QSYA 1UODA 1XDDA 3F3MA 3HBLA 4N0DA 4Q16A 5AMXA 4NCAA 2CEKA 4DYDA 4Q05A 3MPUA 2BEUA 4DJFC 1JTFA 1WIWA 1UPBA 4QGSA 3AF6A 4ASUD 1MB2A 3MERA 1B6GA 2QRQA 1TGYA 3AUFA 2RI0A 3N3BC 4U7JA 4C14A 4TUYF 2L19A 2C5EA 2QUBA 4WZZA 1DFIA 2O9JA 2YHUA 4HX5A 1SIOA 4B47A 4IHQA 3NGMA 2A1TS 1PUJA 2Q3LA 4B7ZA 1U7PA 1UBGA 1ECGA 1GADO 5CIQA 1LTHR 2IHVA 4LXIA 4ER7A 3D59A 3ZS8A 1V6AA 4P34A 3CLUD 1NQVA 2CVPA 4G65A 2Y9MB 3L06A 2QMOA 4KQHA 4D9FA 3L4JA 3CVJA 1RT9A 3GFTA 4G6ZA 2X4IA 1Y9ZA 4JI5B 3NJ8A 4FGUA 3TE7A 2J5QA 3IBYA 5J5VA 1LSSA 2CFTA 2XNKA 4I1PA 4A36A 1A27A 5FI5A 1B6RA 2DC1A 1YMQA 1V7PC 5HF9A 4M1SA 3SXUB 1W29A 2GF9A 3B51X 2XADA 4MXDA 1QOQB 4N6OA 2VKTA 4RQTA 1WW3A 5HBGA 1AGRA 2XTAA 3O74A 5BNFA 4KNYA 2ZI6A 4TKUB 5AVOA 1E63A 1QIDA 5FWDA 1E1RD 1NVWQ 4Q12A 2ZFUA 2FPSA 2DPLA 2O4CA 2D8AA 1NI3A 1CRWG 4RPLA 4XM2A 5AHXA 1YQGA 5LZ2A 2GBLA 2VQEB 1W0JA 4LOKA 3R9XB 5ALHA 2WJWA 4BMVA 3PIRA 4HTAA 1VZ3A 4KO8A 2E4XA 3LSTA 4OXIA 1BO6A 4W99A 3I6QA 5IWCA 2OPHA 2BJHA 1ACLA 1O5TA 3SXUA 3WNQA 3QKTA 3DEKA 3A6GA 4UVGA 3F78A 1XPJA 3EC1A 3HB7A 1DEOA 2BMAA 4UDXX 4ZFNA 2EKZA 1MEJA 1U5CA 4TKUA 5FPYA 3GBPA 2FMFA 3QE2A 1WSAA 2ZVJA 3H0CA 3IPRA 3NRJA 3OPVA 3S68A 4ASUA 3ZQ6A 1OWLA 4HX2A 2R6GA 2GN6A 4MGKR 1OXVA 1XD2B 4ZCTA 3R44A 4FBLA 4BQPA 2AV6A 3QFRA 4JFRA 5DTEA 1K2WA 2MDTA 2Y6UA 1OFUA 2XUDA 3IERA 1ZO8A 1U04A 3U7EB 2B5WA 1QPBA 2FWNA 4RLHA 1JIXA 3NM4A 2VNHA 4OXXA 1N75A 2H1FA 2VK2A 4BX8A 4S05A 2PTGA 3KL4A 4UCFA 1E9CA 3A4NA 1USVA 4FGSA 4YRJA 4BP1A 1EJBA 1RR6A 1G8SA 3VR6D 3QPCA 1S5PA 1PZXA 3BYZA 3KAPA 2HC9A 5AW5A 2M6KA 4C22A 1M8GA 3HB5X 1XPUA 1NUTA 3ORFA 4IZIA 4PLWA 4YJ2B 3S55A 1YRBA 2G7ZA 5F2KA 3U6KA 4YHHB 1KIAA 2YIVX 1CUDA 1CY7A 3OIDA 3NPAA 1P19A 2B4TO 3EQZA 4V24A 3NHFA 1KOJA 2J0UB 3KVNA 4RCVA 1E1RA 3UZUA 3TQFA 2Z30A 3IRUA 1NF8A 1Q92A 3I9MA 5ER9A 5FQOA 3WZ2A 1HFEL 5JI3E 3QVGB 1D03A 13PKA 2ZRPA 1FSPA 5DNEA 1QIGA 4KX5A 1Q0PA 3SM9A 5H02A 1W7AA 4QDTA 1U3VA 1GCUA 2OGTA 2COKA 2QU7A 1X1SA 2XQKA 1SBCA 1W1UA 1Y6FA 1R3UA 2ZBGA 1TJPB 4X85A 3DEJA 4YIHA 4RIIA 3HCDA 3V2IA 4I5GA 4XJTA 1O9BA 4NMWA 2BFCB 5KB3A 2CJWA 2BFBB 4YREA 5PNTA 1DAOA 2ZUVA 5BNIA 5ESDA 1GUYA 2H54A 5HS6A 2ZKLA 3K0HA 2J0SA 1Z2EA 4LZZA 1GZUA 1OBOA 1XQYA 1E3EA 1GP2A 2J0UA 3IVAA 4R01A 4C3VA 3ADBA 1UMKA 5KNDD 3HA2A 4U2BA 1Z08A 2ENWA 3V3TA 1KSFX 1CS4C 2M6SA 3CXUA 3N5CA 3IP8A 1Y37A 1HEYA 2H63A 1OZHA 2OORC 2PUTA 1CUGA 4MV8A 3OZUA 1XVLA 3T3PB 1ZS9A 3FOBA 5IAOA 1PJQA 1QFZA 2AS0A 2C9OA 2DUMA 3NKFA 3QLJA 2CK3D 1GGMA 3S1LA 1NM5A 5FBWB 1E3IA 4KXNA 4AM8A 1RSZA 3PJDA 4R9RA 1U9CA 2BFCA 1DAMA 2EWVA 3OIFA 4QJIA 4RJJA 4ZOEA 5KI6A 4BMOB 1ENOA 4HX9A 3ST7A 2O2EA 2IPOA 5JVDF 2B4RO 3UJ9A 3I9OA 3QV1A 4U7GA 1W4LA 3RRFA 3VR6A 4E88A 3ZE0B 4D5GA 1D0IA 1YBMA 3QQPA 4W82A 2EJUA 2QTWB 3VZSA 2ZUEA 3IIIA 1QYDA 4RIEA 1W6RA 1QGUA 4RNDB 3RRBA 2VTDA 5JNRA 2VSXA 2VG8A 3EFBA 5FHRA 3NHUA 4WLFA 4XD7A 5DCWA 4DCVA 4CWAA 1L5MA 1JU3A 4LDPA 2A5DA 4QEZA 4YP0A 3BWVA 5BSWA 3S2EA 4EZBA 4B44A 4P0PB 3I28A 1H2RS 1CY4A 1L7MA 1SOUA 1THZA 2I1WA 5K0LA 2HHAA 3USCS 4IYJA 4LUCA 3QUSA 3BFJA 4HLNA 1A2OA 4D8VA 4XDYA 3QFSA 3PEYA 1U7XA 1L4BA 2ENUA 2I6SA 2KE5A 4UBOA 4DV7B 1Z8NA 4COKA 1E1CA 2I29A 4L3OA 3JQ8A 2F1KA 3AW9A 3H5LA 2HMSA 4FYWA 3ND7A 4J0DA 4KGZA 1OIWA 2E85A 4IIXA 4KR0A 1L4KA 4M88A 1GKIA 1V48A 4RY9A 5ALUA 5TE9A 5E6UB 1I3LA 2P9QA 2XUFA 4JLSA 5FADA 4L9RA 4DIKA 1NWHA 2B1IA 3PGKA 4RGVA 5KNDA 3A06A 3BWMA 4W5QA 2Q50A 4MR9B 2W2QA 3C6MA 5EXDA 5EINA 2Y05A 4G1MB 1Y9EA 4LRQA 3TB6A 5TB5A 2OHXA 1PWZA 1XVAA 2XVZA 1UOPA 1Q20A 5HIIA 2L42A 4BLPA 2CK3A 1BH6A 1KEUA 4UFNA 5D2CA 4G0VA 4PHFA 1PSZA 4KK3A 3PR2B 3G9UA 4ENVA 4LRTB 1V1MA 3UPDA 2JFBA 2XCRB 5A0VA 1F3LA 1DIRA 1HDYA 2KBFA 1J8FA 1WSBA 3H86A 4QU8A 2XODA 3MRSA 1K4MA 4KI0A 4OK6A 4A3SA 4FKMA 4D1YA 2IDKA 3C24A 1PO7A 5CVCA 2G3YA 1KJWA 4W4TA 1NXXA 1Y4ZA 1MT0A 4IHKA 3PTZA 3T8YA 5EEHA 1SIBE 1DJPA 2XYQA 2J3KA 3QE3A 2JI9A