3QLEA

Structural basis for the function of tim50 in the mitochondrial presequence translocase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
186
structure length
182
Chain Sequence
b'FPDLLPPPPQRPLTLVITLEDFLVHSEWSQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADDKLVRLIPFLEYLATQQTKDVRPILNSFEDKKNLAEEFDHRVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tim50p
molecule tags Chaperone
source organism Saccharomyces cerevisiae ec1118
publication title Structural basis for the function of tim50 in the mitochondrial presequence translocase.
pubmed doi rcsb
total genus 53
structure length 182
sequence length 186
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qleA00
2EATA 1L8OA 4OHFA 5AW5A 3W5DA 4FFDA 2B0CA 3QXGA 4J2TA 2OBBA 2ODAA 5ALUA 3SKYA 1RDFA 4L6AA 5AKKA 3ZVLA 1L7PA 2JGAA 4G63A 1F5SA 3B9BA 4Y2UA 1Z88A 1RC8A 3WKBA 1N9KA 1NRWA 4EZEA 1TE2A 3ZW7A 1CQZA 1RLOA 2Q5EA 2BDEA 3ET5A 4NV0A 1ZD2P 2B82A 3I1YA 4UARA 2MSNA 3UMBA 2FI1A 4XQ0A 1ZD3A 2Q4TA 4UMEA 4UU1A 5IT0A 1RQLA 3L0BA 3U19A 1ZD4A 1ZS9A 1QQ6A 5AI5A 5AM4A 3B8EA 4Y2QA 1RQNA 2GFHA 4I9FA 4YCMA 5AIBA 5AW8A 1RMTA 2GO7A 3AR6A 3L8EA 1MH9A 1VJ5A 2QYHA 2B30A 5ALPA 3ET4A 4HGQA 4KN8A 4E88A 2WF5A 3BWVA 1ZJJA 2RBKA 4OFZA 3ZTWA 5AM3A 4HGRA 3ZVMA 4YCNA 3NASA 3QUTA 4DW8A 3N07A 3QYPA 1SWVA 1T5TA 2IYEA 2W43A 3AR5A 2P9JA 3U7EB 2G1AA 2HDOA 1Z5GA 1VJRA 4Y2YA 1U2TA 2OM6A 2W11A 3VAYA 1L7MA 2FPXA 4Y2VA 4I9GA 2PQ0A 3EF1A 2C4NA 2I54A 2YBDA 3R4CA 3MC1A 2R8ZA 3WK4A 1Z5UA 4UAUA 4Y2RA 2C8KA 5ALFA 2G09A 3P96A 2FDRA 2FPUA 2WHEA 4H1WA 5AI0A 3ED5A 4NABA 5AKZA 3KDPA 5AW7A 2VKQA 3OCYA 3N8GA 5ALHA 4XOUA 4HGNA 4YIKA 3AR9A 3EF0A 2C8LA 2EARA 1RLTA 2WF8A 5AVWA 4ZEXA 2G06A 4BNDA 3RFUA 2PR7A 5AW4A 3L1UA 4EENA 3SKXA 1RKUA 3FVVA 4UMDA 3ZTYA 2RARA 3U26A 2HX1A 2O9JA 3WK6A 1RKQA 1WVIA 3L0CA 3ZWKA 1L7NA 3IJ5A 3SF0A 3ZVNA 2B1RA 2NYVA 4UATA 1QYIA 2WF9A 3WK8A 5AVUA 3QNMA 4ZEWA 1X42A 2G08A 3L8GA 4EELA 3NANA 2BDUA 5ALDA 3L1VA 5ALOA 3W5BA 4BX2A 4L57A 2RB5A 4Y2TA 2HI0A 3IRUA 4CF3A 4KNVA 3J7TA 3WK7A 2IOFA 2CFSA 2B8JA 3IB6A 5AM0A 2HO4A 4KYTA 5AKIA 3OPXA 2YJ4A 3DNPA 4DCCA 3MN1A 4KNWA 4YCLA 5ALNA 5AKHA 3WK5A 1YDFA 4XE5A 4UU0A 4EEKA 2WF7A 2FEAA 4NFLA 3R09A 4JB3A 3MPOA 2HOQA 4J03A 5AVSA 2YJ5A 5AKGA 3R9KA 4HAIA 4BX0A 1Z4PX 3OCZA 3NRJA 4MUMA 4AS2A 1CR6A 2YN4A 3HYCA 5AM1A 5AW3A 1WZCA 3NALA 5AVYA 3HLTA 5AHXA 4RESA 3BA6A 5ALKA 5ALLA 2JAUA 1ZRNA 2RAVA 1Z4KA 3I6BA 3SHQA 4EX7A 1LTQA 1RRCA 1YS9A 5IT4A 1SWWA 1WR8A 1TJ5A 5AKJA 2HF2A 3M1YA 1Q91A 4UMFA 1U7PA 4BKMA 3M9LA 1O08A 1XP5A 2EAUA 1Z4OA 3QU5A 5ALZA 1J8DA 3U7FB 3FM9A 3N28A 3PCTA 4HYTA 5T41A 4Y2JA 1KYTA 3W5CA 3NAMA 1L6RA 3QUQA 5AVQA 3D6JA 1AQ6A 3KZXA 5ALGA 3UM9A 3K1ZA 1L7OA 2HHLA 3L8FA 4BEWA 2FUCA 1QQ7A 2IOHA 1Z4JA 2NO4A 5ALMA 2NO5A 1EK2A 5AKLA 2HF7A 3QU7A 5ALIA 3E8MA 1L8LA 3I76A 5JJBA 5ALQA 4UM5A 2YMQA 5AI6A 1U2SA 1XPJA 2Q4RA 2C9MA 1S2OA 1RMYA 2HCFA 1S8OA 1Z4QA 2CN1A 4MWOA 1ZD5A 5ALVA 3EPRA 2AMYA 5AKEA 3S6JA 4BNDB 2YMLA 2WF6A 3E84A 2FPSA 1SU4A 3L7YA 4UW9A 3KC2A 3PGVA 3QU9A 3N5KA 3WKDA 4AP9A 3ESRA 3WGVA 2CFRA 1YNSA 2GHQA 3ZU6A 2OA0A 2IOFK 2AGVA 5AW1A 1FEZA 2GMWA 5AVXA 4KX3A 1ZOLA 3A1CA 3WGUA 4QQFA 3ZUPA 3F9RA 1RPZA 5A3RA 2AUTA 1IWOA 3L0YA 5AI8A 1TA0A 1EK1A 4UMVA 5ALTA 3I28A 1QQ5A 3DDHA 2AH5A 4B6JA 5AI9A 4QJBA 4C4SA 2D2VA 3QUBA 2WFAA 4YGYA 1YJ5A 4Y3UA 3E81A 1LVHA 5AVZA 3A3YA 1Z4MA 2R8XA 4Y2XA 4C4TA 3QUCA 4UAVA 2IA5A 2ZBEA 2I33A 3OTQA 4PNHA 4GXTA 1QH9A 2PKEA 2R8EA 4EX6A 2G80A 3AR7A 3FPBA 4F71A 3OCWA 3FGOA 2P11A 4IG4A 1NNLA 4Y2PA 3U7GA 2I34A 4CF4A 1Z4NA 3UMGA 2ZBDA 2GHTA 1ZRMA 3L8HA 2QLTA 3ONNA 4KX5A 5AI4A 2ZXEA 5A3SA 3QX7A 4NWIA 5AW0A 2YFYA 2I7DA 3L5KA 1YMQA 2ZG6A 4L6CA 4YH1A 3ZX5A 3ESQA 2P69A 3A1DA 5AW2A 1Q92A 4C4RA 1VFPA 3WKEA 4YIHA 3CZ4A 3KD3A 3QU2A 2B8EA 4UASA 3SD7A 3U7HB 2JAWA 3KOOA 1U7OA 2HEGA 4G9BA 5ALYA 2FPRA 3A1EA 4JDPA 3B9RA 5AKXA 1J97A 4CNQA 4UM7A 3CNHA 4HGOA 4HGPA 4OD0A 4FYPA 3NUQA 1TJ4A 2ZBFA 1WPGA 3WKAA 2ZOSA 3AR4A 1Y8AA 5AK5A 2YJ6A 1O03A 2BY4A 4XPZA 3MMZA 4BEVA 3E58A 3QGMA 3ZX4A 4F72A 5AICA 5AIAA 3RF6A 4ZEVA 2FUEA 2WM8A 5A3QA 4FE3A 2DQSA 5AK3A 5AM5A 2W4MA 2HSZA 3SLRA 2G0AA 2P27A 3FPSA 3KBBA 3W5AA 1K1EA 2ZBGA 3OCVA 4NAVA 4RETA 5FP0A 1Z4IA 3TLMA 2X4DA 1XVIA 4BBJA 3DAOA 2I55A 5ALEA 5AW6A 1U02A 4OCZA 4CF5A 3WKCA 1RMQA 4O8CA 1T9ZA 3WK9A 4BYGA 1T5SA 1Z4LA 2JAOA 3NIWA 3PDWA 4DFDA 1N8NA 4DWOA 3ZWDA 5AVRA 3FZQA 3AR3A 3AR8A 3QU4A 5AK6A 2YY6A 2B1QA 2G07A 2YMPA 3GYGA 5AM2A 3N1UA 2FPWA 2YMMA 4Y2SA 5ALJA 1TJ3A 5E0OA 3OCUA 4BX3A 5AW9A 1JUDA 3OCXA 1RKVA 2C88A 2I6XA 3QLEA 3UMCA 2JARA 5AVVA 3U13A 4IFTA 4AS3A 4CE6A 3SMVA 2R8YA 5IS2A 1RLMA 2CFTA 5AESA 5AK4A 1NF2A 5ALRA 5ALWA 5ALSA 4GIBA 1YV9A 2O2XA 2YJ3A 3DV9A 2MU1A 3EWIA 1PW5A 5AKYA 5ALXA 3ZI4A 2OYCA 5AVTA 3PGLA 3AR2A
chains in the Genus database with same CATH superfamily
4BMSA 3SE7A 4ZDWA 1FRVA 1U2EA 3M82A 3H1FA 4PBSA 3WL4A 4D0LB 4DIMA 4JAVC 5CM8B 5F1KA 4JLKA 3EGIA 1RR6A 5J5CA 3J81A 4FZRA 4EVSA 2ODAA 3GGJA 3FYUC 5KNCD 1SKQA 4TTVA 4UEWA 1BHO1 3MFYA 1YI0A 2X23A 2R8PA 1Y0BA 1NLFA 3QVVA 3ZVLA 4ZKDA 1N2SA 2G4VA 1O95D 3B9BA 1F0YA 1DWUA 1FNDA 1LI4A 1H6CA 2XVYA 2AVDA 3OMXA 1GILA 4MIYA 1K4KA 1VL2A 2Z56A 4EQZA 5I7EA 5E95A 3U3KA 3DKVA 1C7ZA 1YHNA 4HADA 5IJ9A 1JVNA 4ND2A 3QFCA 1G55A 1OXBB 2BDEA 1QHSA 2BGMA 3IILA 2B82A 4UARA 1C0PA 5GIOE 2MSNA 3LF2A 4A2WA 5A62A 2VJAA 4RM3A 3ER9A 3KYCA 2IBTA 1Z83A 2XNHA 2R84A 2BEVA 2WD7B 4GVXA 3X1XA 1BVYF 4LJYA 4PO1A 2CUZA 4Q9NA 1P7PA 5IAGA 3GLGE 3B1YA 1CUXA 1LH0A 1UDCA 2NO1A 2GCEA 3IALA 3KQOA 3LQFA 1GQOA 1NV9A 2WWIA 4O2BB 4BZPA 4XM1A 1Q0RA 1Z68A 3ZHQA 1ZJZA 1Z5VA 5JE8A 3O8OA 3VPCA 3GPDG 2ZTLA 4EVQA 2JBAA 2UDPA 5AW8A 5FT9A 3ASUA 2GO7A 2V7QA 1U28A 1N5MA 1TJNA 3X0DA 4DMKA 3QXXA 2EWWA 2XB6A 1KZ4A 2NQ8A 1R9NA 4B6RA 4AW9A 1X0VA 3W6PA 4BZZA 4QRDA 4ZIRA 1W1WA 4DJTA 3HJTA 3VAZA 2HA0A 2IY8A 2ZXUA 1WOMA 1JQDA 2TMYA 3BWEA 1I5OA 3DDSA 1FBNA 4X8OA 1QZTA 2QM7A 2X77A 3JWHA 4FJ2A 5A3VA 1XZQA 3JQFA 4JUIA 3TYXA 3EHEA 4O4LF 2V03A 4ID3A 3UXYA 5FWYB 4LJRA 1KZ9A 3BH6A 2ZBPA 3P4UA 4NBSA 5L7YA 2VJCA 4DJEC 3TIGA 1KVRA 2QQ0A 2OGTA 3KWMA 1BN7A 3R7BA 1P2GA 1X19A 2QU8A 3LX5A 3QRWA 4ROTA 2DUNA 1DRVA 1JAYA 4LC1A 1YS6A 2H59A 3QWHA 4Y2YA 4B45A 1J90A 3K6SA 2WWRA 2QRUA 4OXIA 3I62A 4HXFB 4EG3A 1M1ZA 5BYAA 2P3LA 3IBFA 4IIVA 3TH5A 4LYJA 2M6KA 2BEWB 3W5HA 1Y4UA 4CM6A 5FUMA 2B5VA 2I54A 2BSQA 2RMKA 4HEQA 3WSWA 1Y5IA 2DR2A 2I7TA 5FYQA 1T6BY 1GFIA 1KEKA 5ED4A 4YP7A 5I7OA 3D3KA 3FR8A 4OHRA 1X6VA 4GAEA 1KARA 3FVRA 4JLBA 5DASA 2F90A 4BS9A 4LBVA 1JKXA 5HQJA 3O8RA 1UBGA 4FGJA 5J5VA 3PZRA 1U7XA 4M1ZA 2Q3EA 4GR5A 1L5GB 5L3VA 3CUKA 1VQ1A 1PSZA 5L3QB 5CNMA 1C8LA 3KJNA 5CIQA 1PHPA 4MKGA 1KS2A 1HNWB 1WZEA 1CTQA 3E0XA 1LPAB 2FWJA 2HU5A 2YVUA 1ISJA 2A5DA 3IOMA 4N7RA 2BEUB 3FDIA 4BVBA 1NPYA 5CXUA 3TRJA 1L4EA 1NLUA 4L9WA 4AUEA 1BTOA 3A4MA 1KMIY 1JLRA 4JNKA 1GU0A 3A06A 1ZN8A 3C3WA 3K1AB 5FUWA 1H66A 5HK8A 3CR8A 3QWIA 2QVCA 4X1KB 4TYPA 2HX1A 3BGDA 3TCKA 5BQXA 1GAXA 3NHWA 1ZL2A 5LDDC 4H1UA 1SCDA 4C6TB 3I05A 1GGKA 1M1YA 3GGCA 1UUFA 1IQ0A 2H00A 1R16A 4NLLA 1A98A 1UWCA 1I4DD 2WF9A 2G77B 4RCYA 3MJVA 4PC1A 1BWQA 1WMAA 3DVAA 4YC7A 3WYAA 1A4IA 1M1NA 1QOZA 2GSDA 3A3PA 3WS7A 5CEJA 2ZJZA 1JHQA 4FCWA 4MUXA 3MB5A 1YCDA 2AV6A 3DOIA 3DEIA 4DUGD 1RXIA 4ZYUA 4YFVA 5EZQA 4AWBA 1BNCA 3LV8A 4EEZA 3DXYA 5LBTA 1Q83A 3A2LA 2XMPA 1Q7CA 2XPCA 4LECA 4NG4A 1TIBA 4QBHA 4KNVA 4ZVRA 4F7WA 2UUBB 4TZ6A 3N3BC 5BQOA 1V6SA 1JEDA 1R0RE 2KS6A 2NUTB 2Q07A 3BK1A 4RY8A 4RDIA 2CUKA 4XEUA 5E2BA 2B8JA 2OBYA 5JNRA 2K4MA 3EPJA 4P3YA 4KYTA 1CJVC 2ACEA 3ILHA 1GAQA 3G9XA 3PP8A 3HVJA 4J0IA 3IX7A 3LDAA 3TGWA 3HMQA 5AO9A 5REQA 3C4QA 3GJ5A 3UGTA 3K2QA 1OLXA 1HE3A 4Z1MA 4JB3A 4ZDIA 1EJ6A 5LXTF 2DT8A 5IFKA 1FVOA 5H80A 3FY4A 2ODEA 3O1LA 3EEIA 4YVFA 5C5EA 2IH5A 1Y4ZA 5C7LO 1VP9A 3DLAA 1ESNA 1JTFA 4UXIA 3EXHB 4WZAE 2R8OA 3OCZA 4JBIA 5EIAA 4NBVA 3DOFA 1XDBA 1PK7A 2J7KA 2ZUUA 1P5JA 2FEPA 4ENVA 1NR5A 1KVQA 3EMDA 5AM1A 1O95A 4BATA 4M76B 2RGYA 1IM2A 3GRPA 3L3BA 3FDZB 1E2FA 4X91A 1NMQA 1C3XA 1NFFA 1W4LA 3TKYA 4PPFA 2WVHA 4I4TA 1GZ3A 3TZEA 4EHDA 2F43A 4F2DA 1GRRA 3HB0A 3U7QA 4ESVA 4QKQA 3ICPA 3PQ4A 3SZMA 4C7XA 2X2OA 5LQNA 1FJXA 4GL2A 2XEXA 3B82A 2P0AA 3PDIA 1US8A 4J4TA 3TLZA 3AKEA 1IVYA 4KC0A 4JODA 2ORIA 1NVVQ 4RJIA 1M76A 3P1JA 4TL8A 4ES6A 3ESCA 5KYUA 4MS4B 1KI3A 3V7WA 1JG4A 1IN4A 3CN9A 2QHXA 5K6AA 3IMFA 4PYLA 3AJ8A 3FLEA 4BWVA 4QHYA 1II9A 1SOUA 2YX1A 5LXTA 2L0XA 1G42A 3DLCA 4ZU3A 5HEKA 3FM9A 4EGQA 5F9FA 5JWHA 1N6NA 2PBRA 4MVJI 1LWOA 2QQ5A 3QUQA 2Q3BA 3UMJA 2QMUA 1P9WA 1AQ6A 3D6JA 1SOAA 1QE5A 2LCIA 2QM0A 1WUKS 1X74A 4FFRA 4UTOA 4DZRA 1DUSA 1E1CA 4I4NA 4FKBA 1BIFA 3TW6A 2JB9A 2QP4A 3IQEA 4BRUA 3WLKX 2IYVA 2Y1OA 4B3MB 3HZOA 2W2TA 3T7RA 4I55F 1TF5A 2C0CA 2W6PA 1CZRA 3SF8A 1HNNA 2JD0A 1GQSA 3GFRA 1QGOA 3SZUA 3V2UA 4QNRA 2PKQP 3IQZA 1MAUA 3TL2A 2JRCA 4YAUA 3VZSA 2VDUE 1IXYA 1YZVA 4MMZB 1U2SA 3A14A 1T9GS 2NX2A 4FOPA 3A2NA 3EAQA 3DP9A 4DRXA 2COUA 4MWOA 2ZS9A 3FGPA 4AF8A 5IKXA 4JYAB 5LLTA 2W5UA 4H15A 4HLCA 4IO1A 1KE2A 1LBTA 3QBTA 1W36C 1HDYA 4IDCA 4QEKA 4WZAB 3CLTC 3MQFA 4G0XA 3BXHA 3GXOA 1SCUA 3HDTA 5B1SA 1PZMA 3MJEA 4IHKA 2QE7A 3L7YA 1Y1PA 3RYCA 1KY3A 2ALJA 4XCQA 1CJBA 1QDEA 1YI1A 2DHEA 2QU7A 5HF5A 1JHOA 4A0QA 1NPDA 4F5WA 3NDPA 1TEHA 3LK6A 2QJWA 4ZXFA 3VC2A 1IY2A 3K31A 2F8MA 3ESRA 1XWWA 4RCVA 1G7TA 4IHJA 4LK3A 3VRHA 2FG5A 5JS8A 1YQQA 1FSSA 2FSPA 2O2SA 4G97A 5F5XA 2OA0A 3ZLTA 4J16C 3HKDB 4BN0A 4UEKA 1B0PA 3ETCA 5FRDA 1Y3DE 1G6OA 1SQ0A 4OMDA 1QO0D 1Z0UA 2DLDA 1VA4A 3K8ZA 4KO3S 4IP0A 1QH8A 4XSVA 3RNLA 3UFXA 1WMEA 4C2UA 1U1DA 3U4MA 4W5NA 4GXRA 2CFIA 2DG2A 4IV5A 4XWYA 4BRSA 1VYHA 4TTIA 1CUIA 2R1VA 4AT1A 5M29A 3I9V6 3U1BA 5KNDD 3KEGA 3PQ7A 2ZZNA 2ZYHA 1NAHA 1E63A 4DV6B 2ZB4A 2NU9B 4IH4A 2W71A 3DDHA 2CXHA 2G82A 2R7KA 3K9NA 3KJIA 5CHYA 4EABA 1UXIA 4DXAA 1CY6A 2FDXA 3GFVA 2P4UA 4QUBA 1ZX1A 3LPMA 5CFPA 5JWRA 1LPPA 2C29D 1VL5A 2PX0A 4X66B 4I3HA 1EI9A 1HOTA 2ZJFA 1CERA 1R27A 4J0HA 2ATXA 1N2JA 3MSCA 4AJ9A 5M2QA 2V7PA 5LQCA 4KRXA 1ZUWA 3FUUA 5AVZA 5KWJA 3RS9A 5JAQA 3WV5A 3EOZA 4ACAA 1Y9JA 3SHOA 1N7JA 3PXDA 4XIYA 4I6GA 2QL9A 1SQ5A 2XAUA 3CMMA 1FJHA 4OIFA 4YP9A 1VDMA 2I33A 1H0KA 4EPVA 2JC3A 2OCAA 1XZBA 1B7GO 2PX6A 2ZS8A 2ZR8A 2BGRA 2YHIA 1K66A 2Y1FA 3I5MA 4QREA 5A9RA 3KSZO 5KVCA 2XUPA 5HF8A 2OORC 1TZ2A 2OFOA 4X8HA 2AD5A 1HUQA 1U1IA 3JARA 3AF6A 2ZATA 4WINA 4YMVA 1N0IA 1KFBB 2Q6IA 1AC5A 1ZH0A 1NLMA 2BGJA 5D2CA 5J43A 3UFBA 2I6UA 2HJGA 1GGFA 5C18A 4BUCA 4OUDB 1DEOA 2HA3A 3N7UA 1JIQA 1Q14A 1EA7A 2GHTA 1ZLXA 2GJSA 2O8NA 3MWEB 1JLLA 4LY6A 4N3NA 4U5QA 3UMSA 4A8TA 4B17A 3B3GA 3GNTA 5KQMA 5JXHA 3OQOA 2CXUA 2F9LA 2ZG6A 4XGQA 2UXBB 2FSVA 2GN9A 2G1KA 1V95A 4HS9A 5HBRA 5HTKA 2NVOA 2WU0A 4LNAA 1U9IC 1DLJA 4TMKA 1UPFA 1EFUA 2E37A 2OESA 3ADOA 1WUTA 4BEBA 3NEPX 5T8KA 4YIHA 4JROA 1RZUA 2NV0A 4YDRA 3SAJA 3B9QA 4RX1A 3GYBA 3L7MA 3QU2A 3TIIA 4UUBA 2BM1A 1IH8A 1L4UA 2OGZA 3JQFC 3K05A 3KOOA 4UASA 4UUAA 5J47A 4D45A 1UZLA 4XDGA 4L72A 2HEGA 4L8YA 2FFBA 5DE3A 5KIAA 1DQYA 3E8XA 3O3NB 3VFDA 2ZJAA 1E18A 4BVHA 1T43A 1CNFA 1I36A 1ZW6A 3G02A 4A0GA 1BX1A 1JJBA 5FKJA 2OV6A 5B2EA 5JBIA 1ZI6A 8ABPA 1M6WA 3IUMA 1K88A 3OZFA 4P2BA 1CDDA 2W2OA 5IAJA 1F1JA 4C5CA 1NW9B 3FMPB 4HNVA 5A7GA 4U0KA 4UPEA 4BXOB 3OLYA 1ZVQA 3RG8A 3WWDA 4YECA 2H6EA 3KUXA 4ZOQI 4LHYA 4O25A 3KR2A 4QLAA 2I4OA 3UG6A 2FN8A 4MUGA 2JAPA 5JNTA 3OT1B 1K8RA 5ERYA 4BQPA 3HBNA 3H11A 3ITEA 5F5NA 2A1TS 3HBMA 4DTIA 1NDHA 4PG4A 5L51A 1HTTA 3KLNA 5FTJA 3LUAA 4AIIA 3OO1A 1E4VA 1BG6A 4G0NA 1Y7IA 2XRYA 3L6EA 3T06B 2IIPA 5EHQA 1XXLA 1LPOA 3PUWA 2DWQA 3ZZ1A 2IUEA 4JXKA 3GVHA 1I6LA 4RHEA 4P38A 1JAIA 1U8EA 3CWZA 3EDMA 1FNCA 3ZW9A 4D8XA 3OOWA 2VYQA 1N1EA 1SVKA 1GG5A 4MV4A 1PBNA 2C4UA 4IVPA 2AMVA 2GBLC 3F97A 5DW3A 5A7FA 1XD9A 3L46A 4YALA 3ZVKA 5FLKA 1RCFA 1KP3A 3NIWA 4MQBA 4TZ0A 2Q7XA 4ZD6A 1MVLA 2RAFA 4YP0A 2XT9A 6REQB 5K0FA 5IDYA 1WUYA 1EA5A 4ZP1A 4EA8A 4R68A 4IY1A 1TK3A 4ZN6A 4YRSA 1LS1A 3ICWA 2AIRA 4PS1A 3UKJA 1RI2A 3LRTA 3PFFA 4TL6A 1EDEA 4CR6A 5BW5A 1OCEA 3GJSA 4OHVA 4ZC8A 4D8WA 4D82A 1RZ3A 5AK6A 1R8JA 2XAAA 1GD1O 5A4IS 1YOBA 4PYJA 3QF4B 1D4ZA 1UFRA 2ZIAA 2WQ7A 2G0NA 3T5CA 2JRLA 1DOHA 3KE8A 3AUUA 4A2QA 3KJXA 2RCYA 4YV7A 1J9ZA 1N0WA 3PZBA 1FJ2A 4WH0A 1ZU4A 3NHMA 4DY4A 2MHCA 3ACCA 3AM4A 3N87A 5F2NA 1UDRA 2I9PA 2VRBA 3BJIC 3CM0A 3FSEA 1Y7TA 3O8DA 1Y81A 1LPSA 1RSZA 2QPAA 5EZYB 3U13A 3N2GA 3RHTA 5FAKA 3K1JA 4HATA 1PR5A 3NVKI 4Q3AA 1T8SA 4TMYA 3DXZA 4LZNA 3ICCA 5ALRA 1R6TA 3P71T 3U9LA 2V59A 1AVTA 4RMJA 2G9RA 4A8JB 4E5UA 1ZINA 2IHZA 2WE8A 4RA6B 4RD1A 2OP1A 2NOAA 3DV9A 5U4QA 3SJZA 4IGAA 3HB4X 4ND1A 1Z13A 1YZGA 4DBLC 1CLUA 4K0KB 3AESB 3WJ2A 2JA2A 1M1UA 4MVWA 3SN6A 2YJTD 3VR6H 2C3UA 4F4DA 5IWAB 1X7XA 2R8RA 3DTVA 1QCDA 3TUIC 4CTOA 3DL0A 3HR7A 5LYJB 4R2XA 2FSFA 5F4BA 2P75A 3GXBA 4L51A 4KG7A 4L9SA 3NBYC 3TQOA 2D1SA 5GTDA 2C95A 4HWRA 5F77A 2P9YA 2WSSA 3QVTA 3RUFA 1H3EA 2R25B 1XVAA 5ECDA 2IZ5A 4JU8A 4PXSA 3G0GA 1WPXA 1Y1RA 2CWDA 1WVGA 4HH4A 3W9SA 3PUHA 2V7XA 3AGPA 5KQRA 4RVHA 5KYXB 3ET5A 3V5NA 1G41A 2EFHB 4X63A 3PL1A 4GDMA 3QLJA 1KL7A 3OPYB 3QFFA 1J06A 3QP9A 4FGKA 3DEKA 2XCRB 2C2OA 2Q5HA 3DCJA 1KH3A 4TSKA 2DPLA 1I3LA 1L3IA 1YKFA 2QVZX 4X60A 1KSFX 3DZGA 2HRZA 3HCOA 4G4JA 1W2HA 3IKMB 2D59A 3OUZA 4WPGA 5T67A 3DGFC 2BHRA 2NAPA 5CIYA 3T4XA 1TT5A 4ACBA 4MI9A 3EIEA 4RS3A 4DUPA 1XD2A 4GU5A 4R54A 2B1JA 5F64A 3SEQA 3ZDFA 1O97C 3UMFA 3K70C 3O0TA 2IXFA 1P9RA 2P3SA 3I9V1 3PSHA 1NA5A 4XYEA 1P2UA 2R6R1 1RLIA 2BP7A 2QYHA 3GU3A 5CYPA 5F1OA 4D3ZA 4DWVA 4GI2A 5KTYA 4HUJA 4AJ4A 4EPWA 2R6FA 5JASA 2EFCB 2J0UB 3B36A 3PRYA 3HFGA 3HZHA 4YI3A 5KSPA 2XODA 1WD5A 3U7QB 3FOEC 2DPMA 3HRHA 3F5MA 1R0CA 5TEWA 3P9NA 1J2EA 2BZGA 4Q6WA 5AR1A 2CXQA 1ZH4A 5B7GA 1Z8NA 3DPUA 5EFZA 2QI9F 1HF3A 3ISTA 4YQZA 1N2HA 3SBDA 3ZNPA 4C30A 4TM8A 5H3LA 1K3TA 2CFCA 2O4UX 3JQGA 5KNCH 3EPLA 4XH9B 3RTGA 1TVMA 3PUVA 3CKLA 4J75A 2GN4A 4OQYA 2VRCA 3W79A 2BF4A 4N5MA 2ILTA 1ZOIA 3OZGA 4H1HA 3GLFE 5G3ZA 5ADWA 1K27A 2PD3A 2W11A 4FSXA 3NLLA 1SU7A 3VAYA 5JNUA 2O8EA 4P4UA 2E18A 2C59A 3ANXA 3EJ6A 3KKPA 5E9AA 2P5UA 2FPPB 5AHRA 2ZDHA 3LP5A 1IU9A 4YRGA 5A1JA 2JGMA 3A6ZA 5B3AA 2HCTA 4WMLA 4MKHA 4V39A 3TVDA 1RXWA 3RTDA 1EUCB 4Q1VA 4LDNA 5DH9A 4P53A 1UC5B 3ED5A 2HQRA 4H7IA 2Z9BA 1T36B 3D6TB 3ESAA 3Q3JB 3V55A 4YMUA 621PA 2OKCA 3RVQA 4X1YB 1FDUA 1PR9A 2R2AA 3HFSA 3N8IA 1H8HD 2ZDQA 4ARUA 3VISA 2YZGA 1L3CA 1E62A 1TW3A 4WIAA 4C1NA 4D1YA 5COAA 4PZZA 1S01A 3C3JA 3CH4B 3DDCA 2HIGA 2WAXA 4F11A 5AXCA 2F1OA 3DBHA 5IEBA 2PJDA 2VAPA 3K15A 2OCDA 3LYHA 1MV8A 4N8EA 4M6WA 5I5EA 1XZJA 3H9UA 1KEPA 1BGXT 2XZPA 1AS0A 1E2MA 3L1UA 4PQGA 4WCVA 3TSOA 2VA9A 1Q11A 4FONA 2I7XA 2EZ9A 1G21A 4YT4A 2XKAA 1NVWQ 3R7NA 3WK6A 4E3ZA 4JXZA 1QIKA 3L0CA 4AG6A 2NACA 1U3DA 1JQJC 1BFDA 1E0SA 1UK8A 3PICA 4Y8VA 4BVAA 1PYOA 2H4XA 3GDWA 1NI3A 1EAYA 4PRYA 4EFMA 1JYEA 1PJRA 1CJKC 3P9YA 5C81A 2NGRA 2JDID 4WZBB 4Z7NB 1OT5A 2IXAA 1L9XA 2QQEA 4ND4A 1V4VA 2GK4A 3K0KA 3QI2A 5HIIA 4B4WA 2DQYA 1JFLA 3P32A 1EWQA 2PL3A 2ODBA 2G6TA 4W7IA 1JG1A 4JR1A 2H2WA 4PZ9A 3CB4A 1W25A 1UM9B 5DLDA 4NYIQ 4EG7A 3ZE1B 1T3ZA 4PQEA 5JS6A 2PPLA 2GFQA 4YRZA 3O9MA 3BHJA 3KK0A 4E2FA 1FRFS 2KQUA 3K09A 2Y99A 4ZVLA 2FWPA 2BFDA 1I1OA 1THMA 2QPTA 2WFLA 1JDJA 4NU6A 2HU7A 3DM5A 4AN4A 3RUCA 4DHWA 3G2MA 2E0IA 2RHHA 3P4XA 1D3AA 3F8WA 4IMRA 3WHPA 2B3DA 4XE5A 3JD1A 3RS2A 4MR9B 4Y0VA 2OT3B 1WB9A 2QP9X 3MPOA 4J03A 4IBOA 4BFLA 2FJ0A 5FNVA 4ZTZB 4JMPA 1E79D 1C30A 2YYAA 1XL1A 3JD4A 3FCCA 2Z6QA 1UJNA 2PKXA 4KV9A 5SZKB 1UJMA 4WLVA 1T10A 2DUJA 1E3JA 3TB4A 5AJYA 3HB9A 2PH5A 2W2MA 3F6RA 4MIEA 2IGTA 3WIOA 4NJMB 4DQVA 1RWXA 5KNDH 1YRQA 4K7JA 1YZNA 4UQOA 3ZDZB 1PJCA 2O8BA 4NC9A 5LSAA 4PYIA 3IXQA 3F2VA 3IVCA 2XVAA 3UCEA 5JC8A 3AONB 4UQLA 1FSFA 1DO2A 1PNQA 3Q7RA 3SLGA 4MRMB 5EESA 3PXEA 4KR9A 3LPLA 1Z6GA 4N3CA 3CCFA 2IYSA 3LQQA 1E1MA 4MLCA 4B85A 1PR1A 4NE9A 3D6VA 1Q91A 3GW8A 3OE1A 1YKGA 2QL6A 2ZANA 2G17A 4P31A 4H6PA 4II3A 4ZRNA 2Y0EA 4J29A 1JEJA 3GLQA 3JTMA 3PFNA 2R3SA 4KIJA 5BWMA 3OZVA 4Z1MD 4WY8A 1JLKA 1WQ4A 3BFKA 3ITKA 4XUDA 3OJEA 3FWPA 3OQ1A 4ALJA 4ETWA 4A15A 1ORIA 1H3FA 2ID8A 2V6IA 3IESA 2GTIA 3CJQA 3KZXA 2X8LA 2VBGA 1P0PA 3GCDA 3PPWA 3FCOA 5CH5A 5KWVA 3L8FA 2WP8J 3NDBB 3LQYA 3MS2A 1W47A 4WZBA 1P1BA 4OLJA 1ID8A 4UTXA 2Q2VA 1FTWA 2AUMA 3ILSA 3WB9A 4ZTUB 2NO4A 5JDCA 4IJ6A 3RIMA 3C24A 2HPAA 5FBHA 4OQEA 1MX1A 2PVCA 4EY7A 1NVGA 4ZAVA 2VEOA 3AXSA 4L75A 1QV9A 1DXOA 2JHPA 1CD5A 1BQ4A 4HBGA 3I92A 4FYYA 4CTMA 3QTTA 2O20A 4GL4A 4XDHA 1DTEA 3RYCB 2G40A 1IJBA 1C41A 1WE2A 4M89A 3WJ1A 4DIDA 2OXRA 1AKMA 4P84A 4QTTB 3R7LA 2I29A 3DTVB 3TQSA 1NBAA 3WYNA 2Y0DA 3MTGA 3QBJA 3SVTA 3WLOA 3PQ3A 2GK7A 4G0VA 4X45A 1K3UB 2GILA 3MT7A 2POQX 1PGNA 4OHXA 1RPJA 2WHQA 1U2DC 3EIXA 1U0TA 4D6YA 1NXQA 3P2IA 4UEOA 2O2EA 1N33B 1T5IA 3HABA 3A28A 5DTJA 2YWGA 4PSKA 3WL6A 1EH5A 3ZU6A 4BLQA 1NUTA 2E82A 4IQ8A 2QS9A 1AKQA 1M8PA 2IFTA 2JIRA 2OHFA 1ZZGA 4PX5A 3U0BA 5EHXA 1XLUA 2OK7A 4EY6A 2XCIA 4HQFA 1QP0A 2GTPA 1G63A 2E4WA 5EIWA 1XLVA 2WSLA 2Z4RA 3ELWA 4S1PA 3I2HA 2WUWE 1WXFA 4KFUA 3ROEA 4K9QA 2ZPTX 3LLCA 4C0XA 4FYJA 1GEGA 4RIHA 1MVOA 4V0ME 5EJ5A 2EERA 1HORA 1PJQA 3DAFA 3L0YA 2O6HA 3IHWA 4R84A 2IT1A 4R31A 2C4WA 1QK5A 1ACMA 3X2FA 2IEGA 3PYLA 4B34A 1U11A 2Q2QA 1G2QA 1G6Q1 4LXUA 1UEIA 4CFSA 5CFQA 1N2OA 2DFLA 3PIIA 3N0TA 2W6OA 5DGDA 4BLTA 5L53A 4D0RA 1Z2OX 4QVIA 1JWBB 4EJMA 2FW1A 2B34A 4GT1A 3H87A 1JHVA 1AQIA 3QUBA 1GFZA 3HYTA 4TTQA 4E70A 1ZCFA 4GPEA 2QN6A 3RU7A 2H7VA 1Y80A 4C20A 5GZ1A 4H6VA 1YFKA 1TQ6A 4CQNA 4QULA 1EK0A 1HL3A 3DE7X 3I2IA 2FZVA 2NSJA 4M0EA 4ON9A 1MG5A 2ZE5A 4LMBA 3CQ9A 4N0MA 5TGZA 1Z4MA 2R8XA 4S05A 2YXDA 5IUJC 4JQCA 3IERA 5KNCA 3HI6A 2ZRCA 4KLZA 1M2JA 1SD2A 1T1EA 4YRJA 4OPMA 4D42A 1IRXA 5JS7A 4RMNA 1SCJA 1CRPA 2IYQA 2YHAA 4Z99A 4LDQA 4BFXA 1CG6A 3EBLA 3AR7A 2NZVG 2POCA 2YDYA 1P33A 2NO7A 2Q9AA 2QI9C 3K9WA 4XDZA 3TSZA 3A9CA 1YCHA 2CJPA 3AB7A 3M6VA 5CA0F 2PJZA 2YXBA 2QG9A 2WWWA 1XCOA 1ZUIA 1NKTA 2HU8A 2IYRA 1C1DB 2P9HA 1LQ2A 1MH1A 1P61B 2B25A 2OZKA 2YV3A 2OGUA 4F96A 1P6UA 3LG2A 3LGXA 2JGJA 2O48X 3WZMA 3K8YA 4MI6A 1ZDMA 3IBGA 4P4TA 3R3VA 5A3SA 1W5BA 5EL0A 1YIAA 3CW8X 3MF4A 3MRXA 3O2SB 3RHSA 1QHNA 3HN2A 2C8JA 2PZBA 5BOSA 2XTNA 3L5KA 3LDHA 3CS3A 3NXKA 3TR0A 3ZLJA 4O2BA 1H0RA 3CE6A 5A1TA 1S2IA 4LC0A 3UKDA 1X38A 5EGNA 5D6OA 1T5HX 1VRWA 1XK7A 4H31A 4FEEA 5LBUA 1KYWA 2G36A 2WW8A 1REQA 1Z06A 3D2LA 3SSMA 3F47A 4EB6A 3THXA 1E77A 4UHKA 4W6ZA 5JAPA 1U2RA 2QRLA 3LDUA 4YT5A 1ZK2A 2B83A 5BWCA 1AHHA 1KNQA 4NBUA 2YV2A 2Z4TA 3UWMA 1A3CA 1D1PA 1N2XA 1E9CA 4G9BA 4L4ZA 3VAAA 1WSAA 2IWRA 3LRXA 4RZHA 2WFZA 1CHNA 2H5JA 4ZVQA 4LRSB 3M6LA 4E5VA 5HRUA 1KIFA 3DT8A 2WWHA 1LQUA 2IH2A 4KQIA 4L16A 4UCWA 1KERA 1P60A 4HGPA 5CU7A 3CZ9A 1ZW1A 1USWA 3KXIA 1P4RA 3R6WA 1ISSA 3BEOA 1W4RA 5JDCC 1Y8ZA 2ZJ5A 2WOJA 2VQSA 2HZ7A 2ZYGA 4IPTA 5LBIA 3O84A 4B8WA 1BS1A 2A0YA 2PCJA 4W1RA 5JPIA 4DDHA 5HKBA 3FCAA 3PKZA 1PZXA 3AUAA 4HUQA 3ULKA 4EA6A 4JI4B 1N1MA 1OBCA 1IUOA 1JU9A 3JY6A 1TF2A 3MIZA 3ECAA 2DJIA 4MGKR 3O2JA 4KLRA 5A3QA 3RRNA 1LEHA 4DDMA 4M8SA 4M98A 4F2PA 4LW8A 1VCNA 1NRJB 4WXMA 3TW8B 1RAAA 4RNCA 4B0PA 2JCXA 1MGOA 2ZIWB 3GF4A 1NSYA 2FR1A 3KYDA 1L5KA 5FP0A 4JLMA 1R12A 3W5AA 3AETA 2YOHA 4A27A 1PT6A 1NL3A 1U0FA 2GHIA 2BGTA 3IUEA 2GEDA 2YV1A 3NBKA 4BIMA 2IC5A 2DAPA 1JG2A 1NI4B 4LYEA 1GRVA 5KQGA 1BMFA 1DFIA 2VQ3A 2ZJ6A 3WOHA 5A4MS 5K7SA 4LRXA 2EX1A 2IHJA 5H0IA 2B4AA 3ZHUA 4JL5A 1H1DA 4OGGA 3CJTA 4EHFA 1EXWA 4AAYA 1N8NA 1QH0A 4DFDA 3PC8C 1GARA 3EVFA 4H1TA 5G02A 1QGAA 2I2DA 3DL7A 1NBIA 3H5VA 4DREA 3AR3A 1JI3A 5K20A 1OTHA 2IZ1A 4F8EA 5DHUA 1ZEMA 2V74B 2E4ZA 1ABBA 1ZIPA 3NWEA 4IIHA 4P7FA 3TMAA 4D2IA 4OGWA 3GPCA 2F48A 4ITRC 3FUCA 2RIRA 4X3OA 5FD8A 2VT6A 3W5VA 3HDJA 4IGKA 5C5DA 4O33A 1IIRA 2QD3A 2VHZA 3N7AA 4GE3A 1LVGA 3U3OA 4IJWA 4C4ZA 4JJZA 4N6NA 2E4VA 1CY0A 1EVQA 5FHQA 1NQ5A 4RFSA 3S2EA 4CE6A 5JCZA 4KPGA 5KJ1A 4UUMA 2BFAA 3HVRA 3T3DA 3LYAA 2WSYB 1MCZA 2O2JA 5HM8A 2NZXA 5BYKA 3F5DA 1YMVA 2PL5A 5FLXA 1N2CB 4BVLA 3OTGA 1Z6XA 3AFMA 3K09C 4W82A 3ZV3A 2JI7A 4NPCA 3UB2A 4HTFA 3LL7A 4OOEA 3V80A 1YZUA 4MV6A 3ZNOA 1L8OA 4AP6A 4JGIA 1CIPA 2MYTA 3KEMA 4D92A 4XJXA 3CU5A 3F8TA 3KPVA 3GDOA 3RVMA 5EP3A 4Q1DA 1T1IA 3T8YA 1Z6QA 4QZVA 4U7HA 3MWKA 4YYEA 4CV3A 4DBZA 5ITZB 2I62A 2CJWB 3GRFA 1JWAB 1CE8A 5TC4A 4OXNA 3PQDA 1IN8A 2GZAA 4TQ9A 1P7VA 2IHTA 3WIBA 2IP2A 1Z3IX 4C4PA 4TSRA 3ODPA 2RHCA 1V45E 5DEIA 3Q8LA 5F9MA 2AFIE 3WB1A 4I1SA 4L02A 3MUFA 4D3SA 2WWFA 2OB2A 5HJEA 4X24A 1BFKA 4NBLA 2FCAA 5BQPA 1Y63A 4KBFA 4ENPA 4FGSA 3TZLA 1MHPA 1QHEA 2VTVA 4HRAA 2P8JA 3BFXA 3CLHA 3LBYA 2QRKA 4KOAA 1WTAA 3LLMA 5A5EA 1JZSA 3D8SA 4ILEA 4MWBA 1FS6A 2P9TA 4WDRA 4EL0A 1R2QA 1PW7A 4QXQA 2H92A 2B98A 3PB3A 1NJGA 2RDMA 3FPAA 4DIOA 1XXHB 3E27A 2C0PA 3QMPA 4CL2A 3S1SA 1IXZA 2WU8A 3ESDA 3KDAA 3EFOB 4Q3LA 4YAWA 5IANA 3RUHA 3AV3A 5CVUA 3HXPA 4C7JA 3HRKA 4UNQA 5ICMA 1G8YA 1UOOA 4LWQA 4DA7A 1KQNA 5JISA 1S2DA 2PZEA 4Q3DA 3ZE0B 2BPOA 4YV2A 2NUBA 3U7JA 4DEYA 1Y1SA 3FMFA 5HJ2A 2YZ2A 3LBFA 1G59A 1ZJJA 2VWGA 2GF0A 4UD2A 4LYAA 1XQWA 1LRLA 5KYVA 3VHRA 1RVV1 4B6PA 3B1VA 4I5FA 5LP6C 4G0MA 1JTEA 3BFJA 3HCRA 4MW0A 1ATZA 5CLQA 1BJKA 1OPRA 2PHZA 2HA5A 3K2IA 2PEYA 5HM6A 1KFJB 3CZQA 1EMDA 3FWHA 5K03A 2P9JA 1K5HA 3PFGA 4D4MA 4ERXA 4UE3S 1R0ZA 3NC4A 4TL7A 3H2IA 5DHPA 4GYYA 2AMLA 3ZQ4A 1E3MA 3UGQA 4L3WA 1Z38A 3AFNA 3QXHA 1JQKA 4WRRA 3RLFA 3T0IA 4O4LB 1GZ6A 3K9FC 1SUBA 1L7MA 2BDTA 2RCNA 3Q5DA 5IAKA 1BW9A 5KO2A 2IIBA 1DGQA 2SCUA 1IY8A 3D0RA 1UAYA 1QNFA 1VE1A 1XEWY 5K3AA 4TKUB 1B0AA 1R8QA 4CODB 2YV5A 5LMCA 4YMHA 2ASVA 3QEBZ 2FEOA 1X9GA 3N3AC 3SC2B 5CFOA 5I8ZA 3K8OE 2IXBA 3U9TA 1PLLA 2VEDA 5BQFA 1C7QA 1FYXA 2AN4A 3GCZA 3L7BA 4D25A 2OGWA 2GWRA 2HN9A 3ELDA 3ECSA 4MLZA 4HRXA 4WOCA 3W3ZB 2V6FA 3D6NB 3OCYA 3BTSA 2C42A 3P2JA 2JLZA 1VGVA 3ACBA 2WMOB 2VUHB 4PGFA 821PA 2QNIA 3TGLA 1E9BA 4Z5XA 1NG9A 3DMTA 1GHTA 2DFTA 4HNTA 3D6HA 1V9LA 1YXMA 2DULA 4IDQA 2O1EA 4W9MC 4ITUA 1YQEA 3V1MA 4D5GA 3CLUC 1SQ6A 2N3ZA 2Z95A 4ZOEA 4ADSG 3E6AA 4EENA 2ES4A 3ER8A 4DJFC 2SKCA 3H9CA 2WMYA 2JFOA 1M9NA 1Z0SA 1C3OA 1TADA 3CEAA 1HDGO 1WVIA 4M86A 5T3UA 3PIRA 4AY2A 2I67A 5F7JA 4MAMA 5DP1A 1JDBC 2VZLA 1QQAA 3DVLA 3NAQA 2BMDA 1QDUA 4MWEA 4YBRA 4WE3A 3JVDA 3P9KA 5GADl 3GAAA 4PEVA 2BM9A 2ZJ8A 1R0WA 6AT1A 4DCJA 4HT3B 1H2BA 4I0WB 4QARA 4EHNA 1TQ2A 2GXAA 2WZQA 1QHHA 1VBKA 4EVRA 2X0JA 1NDQA 4BX2A 4NZZA 1FC0A 1W2GA 4R1NA 2EW2A 3HSSA 4LVNA 4OJKA 4RY2A 3UXEA 4CNBA 5EZSA 4RTQA 3CXRA 3GLSA 4EFNA 4KDFA 1S8FA 3A1UA 3G13A 3HNPA 3KTAA 4PG6A 4DZZA 1M54A 3E9YA 4JT2A 4K40A 1S0UA 4Q7JB 4CKWA 1DU4A 2OBNA 1Q1AA 2A35A 5FQNA 3HM9A 2YJ4A 2YWBA 4LQLA 3GLGB 3NHPA 2ZRIA 1LBQA 5EWLA 4TT3A 3MN1A 2CDAA 3UAGA 5DT9A 3OX1A 1JN0A 3RJ5A 4GBMA 2N0SA 5TGTA 3WQRA 1I2ZA 2C94A 4IX1A 4O4JB 2P2LA 2FHSA 3AFGA 5HILA 5EZYA 4TXMA 2YVLA 1UBEA 4TV9A 3VNUA 4OAQA 5J1SB 2WD8A 4YROA 5EKSA 1I0LA 1D6JA 3VNAA 1Y9DA 4KAJA 1ZO8A 4XARA 8LDHA 1IQRA 4R7GA 1JX6A 3RSFA 5LQSA 1D7AA 1FFHA 4D8UA 4CMCA 3K0AA 4BO2A 3U61B 2XJ9A 4EGFA 2F67A 3R8CA 3KQPA 1QGDA 4M0KA 4TROA 4DS3A 4GMXA 4YRIA 3DMFA 2GPJA 3O8CA 4HYQA 1WEKA 2D1QA 4BV8A 4MRVA 4QEDA 4X84A 3ZCUA 1T91A 2Y2VA 4MI1A 4G5YA 2J7PD 4K0RA 4BU1A 4V24A 2WYUA 2FX2A 5E6RA 3IR5A 1HMPA 1Y34E 5FOVA 4XYGA 4B76A 2H2FA 5KX5A 5C4GB 1CUBA 3KQMA 5C2JB 3QQPA 5A2QA 4P58A 2HQSA 3A6PC 5C1DA 1IB0A 1TM3E 1RQGA 1SAYA 4J9UE 4PG5A 4XIGS 3A1WA 5EJ8A 2RFLA 3SIRA 4G9GA 4ND8B 1SZJG 4PZDA 4RMHA 3AUXA 3NOOA 2DF8A 1U4SA 4MKZA 1M1XB 3CR7A 2J5XA 3AY6A 5H5JA 4NOLA 4F5ZA 4B2YA 4Y18A 1XTVA 3OUUA 1FS5A 4B32A 1F3LA 3ZDBA 1XFAA 3SC3A 4Y2JA 3PDHA 4GRAA 3TGPA 2FETA 3C7TA 3ND8A 4BMOB 4IWYA 1T5DX 3QBDA 1GL9B 3MWFA 9ATCA 5DBFA 5ALGA 5CXSA 4MKXA 1ACJA 4I4TF 1K5PA 1XG5A 3EFHA 3E18A 1U0SY 3K96A 5MN5A 1C1XA 1Z4JA 3OZRA 4V0OA 4N65A 4F3TA 3O4JA 3WTBA 2QUJA 1OU4A 1TZMA 1NJ6A 1V1JA 1U2GA 2FP3A 4JMLA 1E2BA 4GRDA 5SY4A 4KFCA 5B4UA 1NF3A 3M6XA 2CFOA 2XUQA 2ZGVA 1TYAE 3DYBA 5H70A 3QU7A 2J09A 3DZBA 4P3PA 4RFVA 3JRXA 1EZ4A 3FUXA 4MJLA 5ALQA 1AOXA 3S5JA 2ZWOA 4OYLA 2VHVA 3KKQA 4LV8B 5AI6A 3GLFB 2Q4RA 4LOLA 3KSDO 3LW8A 4AJIA 1S8OA 2VA8A 3WGYA 3P9QA 4BP3A 4G37A 2B9EA 2Y3IA 4MVJF 3U4CA 2EU8A 1EGVB 2GQ0A 1BD3A 1OWNA 1D09A 1HM5A 1UPBA 5AVKA 5TQ2B 2WIFA 3D4NA 1RQ7A 4B87A 2WKPA 3PUZA 1JZQA 5FH9A 2FPSA 2Y0CA 1IJFA 1STOA 4JX8A 3TI7A 4RZUA 4BMYA 2PD4A 3G0DA 5JQWA 1XUOA 1IE3A 3OP4A 4W9NC 5CM9C 2O8VA 1RKBA 2QP3A 3A0RB 3HLYA 3G2HA 1UM8A 5L7WA 4UHHA 3N6XA 4HQKA 1A9SA 4TS4A 2XECA 1XR3A 2QX6A 3COPA 3EGVA 2ZE8A 1P4GA 5DI9A 5HW0A 3ZIUA 2OVFA 3I34X 1DUIA 3PNKA 3BKXA 5JO0A 1C3OB 5DTIA 2OCGA 3AJRA 2GERA 5JQGB 3HHEA 2AZ4A 4K6MA 5ITSA 1Q57A 4DLSA 3G0OA 1OAAA 4P82A 2DP4E 3IEPA 1RHUA 1UXHA 3C87A 4OMUA 4LRQA 4E30A 1E7SA 2P9GA 1J8QA 1V16A 2VT7A 1JR2A 1WXWA 1KK1A 1V6AA 3DZDA 1LSJA 4MO9A 4NZOA 1CEEA 1P4HA 5KOJB 4BZWA 4K9LA 4G81A 2GHRA 4CM3A 5BURA 5AI8A 1KQGA 1Z6PA 3HCFA 2X76A 4J1TC 1E7YA 2JLRA 3KP1A 1RAEA 4BN4A 3CN7A 3I28A 4Q03A 4BLPA 3O8BA 1WQ1R 1AA9A 4EEXA 2NADA 5D87A 2O5EA 3JVUA 2WVAA 4YMSA 3LPNA 1GR0A 5EE3A 3TIFA 3ZHTA 4YLYA 2R4TA 3KE9A 2DFKB 3FGNA 3NW9A 4PR0A 4JQZA 3TPFA 1PQPA 3V1TC 1OFUA 5GGYA 5JVDF 5HXAA 1QYVA 5T6BA 1N3LA 3KLOA 2DPXA 2H9YA 3U3XA 1IHOA 3W90A 4FHCA 4OKSA 2RHOA 4LMPA 5JH7A 2D7DA 3TBFA 1JXMA 1XA4A 3EEFA 1VPDA 3HH8A 3I6YA 3CONA 1Z2DA 4EQ6B 4U3JB 5EAIA 2VHQA 3UWKA 4FHFA 2Z9CA 1TUBA 3W4IA 2O8DB 2WQZA 3AKZA 2HBRA 2H1HA 4CMHA 5BT8A 1SVLA 3VZDA 2FMTA 3IR7A 2CHUA 5DGCA 4EX6A 5CIWA 5LP6F 1VLZA 2OXTA 3K1YA 4Z0NA 1BGVA 3MCTA 2R60A 2O6LA 2WG2A 2B36A 1S2GA 3NJRA 2QY6A 3P2KA 1Y7LA 3B7PA 2B4KA 5KU1A 3P0IA 4K9KA 1CUYA 5PNTA 3FIUA 1W0JA 5DRTA 4CF4A 4ZGWA 1PT5A 5FFMA 5KYXA 3BZWA 2LTAA 1DC5A 2QLTA 5HVNA 3QLTA 4H35A 2AQKA 4RVUA 3BICA 1KAQA 1GV0A 2BR5A 3CNEA 2EJTA 2XIQA 3GG9A 4G1FA 5TF0A 5C4IA 5TR9A 3ONVA 4CKYA 4HNAB 4AXXA 1FSGA 1A5TA 1IL0A 2HUPA 4IJKA 3AL3A 4QRHA 4M1YA 2X40A 2QRZA 2WJVA 1AQYA 2IYUA 4MUHA 1GUZA 1NIJA 3R3ZA 5FPHA 1AXRA 1IOVA 2WJ4A 2ZQYA 3OQBA 4KP7A 1OASA 1SA0B 3ZEAA 1BDHA 4LF9B 3U7HB 4IOMA 1XFDA 2GBCA 4TLCA 4DUGA 2PD6A 1YI8A 3QENA 5SYAA 4KCGA 3CIFA 3B70A 3BCSA 2WHYA 1V16B 2B8WA 4JDPA 3B9RA 3KL4A 1DBWA 5D51S 3UAVA 3R9IA 2V65A 1YJAA 3N5CA 3QM1A 1E32A 4MW1A 5H4GA 3FYUB 4LFBB 2NPIA 4KN9S 2ZE7A 3ABQB 1N0HA 2CLOB 4R1SA 1I6WA 4R8RA 3AR4A 1OR8A 1V3UA 2F4NA 3TZHA 1KDPA 3B6JA 3DE6X 4BLVA 1FPQA 2OUIA 3EF3A 5HFAA 1R5NA 3O90A 1K7CA 4GOJA 1E2DA 1V71A 4D6XA 3EEOA 2Z6AA 3MGAA 1JMYA 2Q1YA 3LC7O 2QV7A 2IVFA 2QA5A 5IYZA 4IRUB 3V34A 3L04A 2YW2A 2PUCA 3R1IA 2PWBA 1ZITA 1QKIA 4P4LA 3HEBA 1JF8A 1R37A 1P5FA 1EINA 1CP3A 1O5TA 3ZZUA 1JA9A 4V03A 1B6RA 4OGLA 1GYQA 2JIZD 2PUTA 5G4LA 3SX0A 5JXJA 2XA1A 3QE9Y 4EW2A 1FXSA 4ESEA 4BUJA 2HRCA 3BIJA 2RAPA 3HL4A 4DA8A 4S24A 1N6PA 2B0JA 4NMMA 3ZJ4A 5IXJA 3UMYA 2FLKA 2VPXA 5AW6A 4FYXA 2LIPA 5T8KC 4D9JA 3WKCA 2HU2A 5IWCA 5K3OA 1UIRA 3FAKA 4JA2A 3TM5A 5KCZA 2R1ZA 5BSKA 3IQFA 3UOGA 4DZTA 2PMFA 3HUUA 1Q1BA 2QB5A 4G8JA 4YASA 4JEHA 3QVLA 1Y3AA 1I3MA 1QU3A 2CNOA 4XLZA 3C6QA 3R5KA 5CUQA 4AC9A 2DETA 3WL5A 2JIMA 5BN4A 2ZWAA 4KITB 1ZIOA 3L1KA 2WHPA 1NTRA 4E5PA 2EGGA 3OWXA 3QHPA 1G3RA 2JIOA 4Q4LA 1UBSB 3SC2A 2HBYA 1ZYUA 3L05A 1QYDA 1W1UA 1UZNA 3TJZA 3AJAA 3LMKA 4BE7B 4ECAA 3Q1LA 1U8UA 1QP8A 4CG0A 3E9RA 2IUFA 5DRYA 5E0OA 3TG8A 1QGZA 4EJSA 3OX4A 4C14A 1WB6A 2P67A 3AHIA 4KGDA 1R4NB 4JITA 4DJJA 3DEZA 3GWZA 4WDQA 3LI2A 4LXYA 3VUEA 4U39A 3ORRA 4IDNA 1ZONA 4KXYA 1E60A 5ALWA 1VE9A 4CKCB 4PE5B 2FN3A 1C1XB 2C3OA 2A9PA 4E33A 1YBHA 1U65A 3D5QA 1LLCA 3ZI4A 5ALXA 2YWXA 2QOEA 2UAGA 3PS9A 1ST2A 3OTOB 2J0QA 5DGIA 1SC1A 2Z5VA 4MB6A 3ZNQA 5BWNA 2OKGA 4RK1A 2YICA 2Q21A 5JARA 4RMIA 3E0QA 4Z7JA 5LZ2A 2HNBA 2P7IA 2I65A 3MNFA 2X86A 3CBGA 4YUWA 1NBME 3BL6A 3Q6NA 5FNVB 1J23A 3IA2A 4HQOA 3W8EA 5IC6A 1G291 3ZCPA 4PZUA 5CEFA 4G63A 1R0XA 3LDFA 1KSJA 3IOYA 3P0JA 3LCUA 4WKPA 4DLAA 2V3WA 4RAOA 4C4YA 1N9KA 5TF4A 1TE2A 3NIFB 1RYBA 3SE0A 2C2HA 3SFZA 4MTLA 2I6TA 1PSDA 1IXRC 2IIVA 4HAWA 1HE5A 3ASYA 5B1DA 4TVSA 2J3JA 2PZJA 2UVPB 2NUPA 4J6EA 1R0LA 1U94A 3GGDA 4TMFA 2IPOA 2ICAA 2O4CA 2ODNA 3MGKA 2GPAA 3H86A 5K8UA 4RV4A 4C7MA 1V8ZA 4M6WB 1UPUA 2HHCA 4FPXA 3AUTA 4XTCS 1Q6YA 2XADA 3EMVA 4FT2A 4ZXPA 5TQ2A 4D98A 2KLBA 2P90A 3EBOA 1BXRA 3MCWA 1A97A 4DDWA 3SI7A 5AI5A 3QX3A 1PFVA 2D2FA 3C6XA 3FFXA 2Q9CA 4RMGA 4BBAA 4DCSA 4KSCA 4U2DA 1J7KA 2HK6A 3TTWA 2VDLB 1ZMRA 2E2WA 3WO1A 2GPSA 4M9SA 3H2GA 2ACVA 1KH1A 4FFPA 5BMVF 3K30A 3CBQA 1CZKA 3OBIA 5BYJA 2OILA 5THQA 1H69A 5FWYA 4R0VA 3I83A 1MPTA 1EFAA 4EJ2A 1IY9A 3NWPA 2WZBA 3WLPA 5KTPA 1SU6A 3QZUA 1G0NA 2XH8A 2YWDA 2HNKA 2ZUWA 4NAUA 5A04A 3Q2OA 4IXWA 3G2NA 3OE7A 3T0FA 4YR9A 1SBHA 2WF5A 4YUAA 1NC3A 1NI5A 4PZ0A 2DQKA 3MILA 4QRIA 1WHSA 1GTVA 1P4AA 1R0SA 3T4EA 1PZNA 1II0A 2A9OA 3B7GA 1CULC 3KSUA 3DTVD 2LZ0A 2AZXA 2HCBA 1T9KA 4YJ2B 1ML3A 3WLIA 4CLHA 1QDLB 3FCYA 3ZDYB 1QV7A 4CCYB 2J6BA 5DF1A 1WSDA 4ZCSA 3MPUA 4AD8A 1ZVMA 3V4ZA 5KJCA 1ENYA 3UENA 2SNIE 2WWXA 2CZQA 2XWQA 1UQTA 2OO5C 3LXUX 1J1UA 4E5YA 4V38A 5BMVA 1KEVA 2J9FB 2FH5B 2FPPA 2XUIA 3AEXA 3DDOA 3FKSA 3HN7A 3Q7TA 4JEIA 4C76A 1JEOA 4NYJR 5DK6A 4Z9BA 3ZV5A 3AVXA 2CLCX 1G7CA 2PGLA 5EP1A 2G09A 4YMLA 4DR4B 1W88B 4H7JA 3GOQA 4WKBA 4CRWB 2GK6A 1YK0A 2VXBA 2YZKA 3PT5A 1R0YA 1AQUA 5AI0A 4YUYA 2NSYA 2QT9A 3OAAA 1FFCA 1KIAA 3IO5A 4NNPA 2OHOA 4WL0A 4ZT4A 3FTDA 3EUEA 3NNNA 3F2IA 4DIBA 1CJCA 1O6ZA 1Q77A 3TJMA 2P78A 2VKQA 1W7AA 5G4KA 2BGKA 1QOQB 3NG1A 4HGNA 5BN4B 3NHAA 2DPYA 1FDTA 2AE1A 2Q9UA 1WZIA 4S2UA 1PVVA 1CUUA 2CDBA 3O82A 1WB4A 4RGYA 1TUEA 5CM2Z 2WINI 4D99A 2GLXA 4RF2A 5DT2A 4EITA 2FSVC 3CLSC 1XZPA 4MAFA 2GJ4A 1OH5A 3GFPA 1HG0A 2HR1A 4ZEXA 1N9GA 4INAA 4JT9A 5FTMA 3TSAA 3GVXA 2CV1A 3ONWA 2QZZA 1MHTA 1HH4A 3FVVA 1VHJA 2FUNB 1DJOA 1OLSA 2RARA 3WP1B 1EFRA 4XASA 3C70A 4O4IA 2W6ZA 3ZWKA 3OJCA 1YVUA 3I58A 1U5CA 3KZ1E 4LE0A 5H8WA 1UKBA 3T3HA 3A6DA 1O2DA 4QBGB 5EWJA 4KEAA 2ONJA 1XZKA 3TMKA 5B55A 3HJCA 3KB2A 4QJ5A 4B40A 5AVUA 5JZOA 1FZQA 4GOND 3I0MA 2I99A 5B30A 3S8EA 3H5AA 3HKBA 1CVIA 5JNWA 1TM5E 4KKXB 1FNNA 2GCOB 3LQ1A 3M1AA 4MS1B 4NYIR 3HB1A 3I2GA 4PGMA 1RZVA 1F7UA 2VXOA 3QVKA 2G0TA 4E4TA 4RNDB 1FX0B 3U16A 2O8FB 3D1LA 1MIOB 3AIMA 2PX5A 5GONB 1VJCA 3PJDA 1E9RA 2PUFA 3KOYA 2DEUA 2XGGA 3BWDD 2X41A 4FE7A 2WJHA 1VYVA 3KLPX 3H9EO 4A4DA 1N78A 3QOYA 1RRVA 1YQXA 1QCCA 1QGUB 4YCLA 3ONDA 4AZ0B 1PFQA 1NBEA 5AKHA 5ELMA 3JW8A 5FUXA 3I09A 2XE7A 1YE8A 3ZWYA 3S5UA 3LKBA 2EYQA 5AVSA 1PHRA 1VSTA 3G5LA 1AXGA 2Y6UA 2UVDA 3NP7A 3AEUA 5E2IA 4QQRA 4D56A 2PL9A 2YJ5A 2F3RA 2OZLB 2AXEA 4C89A 4LAFA 4JQOA 2IYOA 2D2EA 3HVUA 4HAIA 1ODTC 2MYPA 5K3EA 2EKBA 1L5VA 1NVFA 1ETUA 2J3DA 3FDFA 3NRJA 5E8RA 5ARCA 3V7FA 1TPYA 1TM2A 1EVEA 3H9QA 4WWHA 3ZK9A 4BVFA 3L0DA 4YT8A 3AG5A 1B73A 1G9XA 3KOUA 3PRJA 4YJFA 2ZYDA 4MA4A 1D1SA 4PGGA 2QN9A 3Q88A 4Q34A 5ALKA 1RLJA 5DSZA 5ALLA 1AQNA 3M6WA 2X6TA 4FIZA 2Z5LA 2ONKA 4C08A 1OILA 3N8DA 4EG4A 5IUKC 1H93A 4K9OA 4LOAA 3SHQA 4LQDA 3ABRB 4AX8A 2WSMA 3Q8KA 4QU9A 4H7FA 1JEYA 2CXOA 3HV2A 2NV6A 3GY0A 5C7IO 3DS8A 1TTPB 3IVAA 3R5FA 4DQKA 4WZBE 5B58T 3WE7A 1U7PA 1YTLA 1ABFA 2IS6A 2OHIA 1R8YA 3M9LA 1MFZA 2FW9A 4IO0A 5B3JA 5A4AA 3G7SA 1X2BA 4AY3A 3EOBI 4X6LA 5AJXA 1IBCA 1OZGA 2H11A 3LT5A 4JLUA 4ERNA 3PCTA 2EHDA 4Y1RA 4FIDA 4Q4DA 4MW9A 5EJ2A 3TQRA 3IVXA 1W1IA 2V54A 2Z09A 4Z2AA 1KQFA 2E4XA 1P7ZA 3OLWA 3RTAA 4KR0A 1M8KA 4UNSA 1ST3A 1M2HA 1H5QA 4URVR 2VAMA 2UYOA 1ZNXA 4OHBA 2X5JO 4KWEA 4CEIB 2ADMA 3T1VA 1T0PA 1RQRA 2AI1A 4HDNB 4URYR 5ILOA 2F3TA 2D0OB 4CIAA 2IUUA 3FOCA 4DA4A 1ODLA 2Q3MA 3E53A 3E1GA 3FRIA 3I32A 4X95A 3IOCA 3UXHA 1FFXB 3IMCA 4R01A 3VR2D 2PRKA 3WGHA 4G3XA 3L8CA 1C8VB 3BJZA 3DE0X 3NBAA 2WBLC 3G17A 3QELA 5EYPA 3DH0A 3H2SA 1MIOA 1XV5A 4GPZA 5TMEA 3RAPR 2YMQA 2ZJ3A 2ZIXB 4HXYA 3G8DA 4KPEC 1OLUA 2HCFA 3O9ZA 2FQ1A 3GUZA 4LDZA 3OT5A 4OL0A 2GEKA 3W2FA 4C06A 4LJ7A 1WIWA 2RG7A 5IKMA 2A8YA 1PJ8A 3AETB 4JCCA 3FMIA 3IDOA 4EFKA 2H8KA 3WRWA 2R7NA 2BBOA 2BMVA 2YMLA 1JVBA 2WF6A 4US1R 4YO7A 3ZEIA 1IZ8A 2B6HA 3AINA 2OHHA 3O8QB 2XQVA 2WE7A 1DS6A 1SU4A 1DZ3A 1LVUA 1Q7BA 1R4ZA 2A9RA 2J0VA 3I9MA 4WZ6A 1DRWA 3GX1A 5FXMA 1HX7A 4A16A 4BGVA 2YHUA 1DELA 5EA2A 3WLHA 3WGZA 3CX8A 3RUAA 3VNQA 5AFSA 3V2IA 3HC7A 2ZAMA 1V1MA 1YJ8A 3BGVA 1WY5A 3C43A 3EEBA 1OVGA 2EHJA 5CPBA 4YPOA 3KJZA 5DMHA 3TZ6A 1MRZA 2WK1A 1EVZA 3HJRA 4WLNA 4WNAB 2X8JB 4FLFA 4ZT5A 4A82A 5HKKA 5G1OA 3TQIA 4DILA 3FWZA 4R16A 2HPZA 3UH0A 2IXDA 3BERA 1ULBA 4XLTA 1ZSVA 3R7AA 3P26A 2QBYB 1TFRA 3QV2A 3HJAA 3DB1A 5G4KB 2ZR9A 3IO3A 1LC0A 4BMVA 4EGCB 4ARCA 1Y42X 3K6SB 3DLPX 4FFBB 2GH1A 4IM7A 1R50A 3W2TA 1SQFA 4RTRA 1GPUA 5MGNA 1ODFA 3D0KA 1YHYA 2JATA 3GA0A 1CUDA 4CCAA 1E3WB 4O2AB 1Z6YA 1OH6A 2XUOA 3L43A 1GPH1 2ZRFA 3UOWA 1GIAA 3UFXB 2CL5A 1BCRB 1LJUA 1VLLA 1WXDA 3ROGA 3G8CA 3RKUA 1K5GA 2K87A 3NYQA 4N4AA 5KNDA 2BKAA 2C07A 4F12A 4V0KA 5AI9A 5I3CA 5KB3A 4MEBA 1DZIA 5KVSA 1MF7A 4Z4IA 3X1KA 4TTTS 1S8NA 3WSVA 5IBRA 1XEFA 3GZTB 2VTEA 4BNTA 4Y98A 5DNEA 4NHOA 2CD9A 3SXPA 3GOHA 4KFRA 3CPEA 1BE0A 1CEYA 1TLTA 1H2WA 3RFFA 3GP8A 3F71A 3PDUA 4ZT7A 1SCIA 1O6GA 2JCSA 3BGSA 3QPDA 4MUEA 4YEDA 2IV3A 5BSGA 3G2QA 2V96A 3AY3A 3ZU2A 1AK1A 1PZFA 4JVLA 3I5UA 3KQVA 4NYMR 2VPZA 3WDKA 1IVSA 1CNMA 2ADOA 3HPRA 4CHTA 3PD1A 2P11A 2R1VB 1OWMA 3OICA 3O03A 1A9YA 1FOEB 3RVKA 5LZ8A 5IMSA 2GXUA 1EFVB 4P83A 4J4BA 4DADA 4L4UA 3BXOA 1CU1A 3D7RA 3DOHA 2DR0A 2OLJA 4RACA 1K0UA 1MQAA 1YS4A 4G86A 3SHFA 5DCLA 4ETMA 4A8PA 1C50A 1RCUA 4ZA2A 4IDPA 3BXGA 2AHOA 2OAEA 4FGUA 5CW2A 2O3UA 1U04A 1YMQA 1Y3HA 3HUDA 3MT9A 4CKEA 3T3PB 1IQUA 1HFKA 4DVJA 5T4HA 1JAHA 4DG5A 2XBMA 4GR9A 2C2ZA 3TEMA 5EGSA 1UH5A 4RTPA 1H5NA 1T2AA 1M5RA 1U1EA 2EJWA 3AVOA 1SUWA 1UFVA 2PKCA 2C31A 4AK9A 4BCDA 3D0QA 3CZ4A 4Q3BA 4RDXA 1UBOS 3GCXA 4INOA 4RENA 2WYIA 1BU5A 4O2RA 1V11A 4GR4A 4LSWA 3R77A 3RFTA 4JEMA 1YB6A 4EI8A 4EHKA 1J24A 3GNSA 5DISB 4YAKA 1OBVA 2XMRA 5EXSA 3RSLA 3ITDA 1KTVA 1W5SA 2VWQA 1MC4A 1YQGA 4FUTA 3U31A 4BY9E 3QEJA 4XUEA 2BT4A 2HIMA 3OOSA 1WG8A 4FS3A 4Z9FA 3JQBA 5BOSB 4UE6A 3KQHA 1DRKA 9MHTA 3CYFA 4LHSA 4GZLA 3SWWA 1DAFA 3WKAA 3GNQA 5JRDS 1KAEA 5B53A 2PGAA 3G8YA 2DY0A 3PKJA 1ICEA 1NW6A 1S9DA 4YQYA 4WCFC 5E6SB 4D9NA 5CA1A 1RHMA 4B75A 1XJQA 2WKQA 4JELA 4DT1A 1KY5A 1VRVA 3A9SA 4LQCA 4DSTA 5IM4F 2DY1A 1E4EB 2MSKA 4XYMA 3DFZA 2DWOA 2E48A 3RUEA 1YO6A 1TF7A 3ON5A 3EVDA 2EQBA 5F3WB 1QLHA 2C7OA 2X2PA 3KT6A 1VG9B 3PDJA 2PQ6A 2VH1A 2GTHA 2VSQA 16PKA 3V8QA 1QS0B 3IKLA 4MRAA 4HDSB 2DTEA 2GVDC 2W4MA 4C7OA 1G7SA 1A8SA 5I47A 4ZOLF 3ZGXA 2OZLA 3CR3C 4QDUA 1BE1A 4MV8A 3SS8A 5FPKA 2N1BA 1C3JA 1QSGA 3KLBA 2XOEA 4IJ5A 3QELB 5IN4A 1A8HA 1JHAA 4RKQA 1GFWA 4B3FX 2HF9A 4P8RA 1Y3FE 4FYHA 4M3NA 5E6RB 4BFZA 3RRMA 2W2LD 1U02A 3ZWVA 1SN7A 4XWOA 3SS9X 3RYTC 2BMWA 1RMQA 1DBSA 1CR0A 2VK1A 3BGOS 2H52A 4MUFA 3ENNA 2VDQB 3CISA 2VJPA 2HSEA 1T5SA 2PLNA 4JT4A 1CQJB 2ANBA 4RY0A 1SMKA 2NXEA 3DBLA 2J1LA 1ECBA 1EUYA 3LFTA 3M6MD 4DKJA 3KQKA 5CGZA 1P45A 1IQPA 1FX0A 2NLOA 5HPYB 3CCCA 1FNBA 3DTYA 5T4BA 2IPMA 4A2PA 5CRIA 1UWKA 3FJYA 1LBIA 2HQOA 5HFJA 4X7BA 4WUVA 2VUIB 1GAEO 5K0ZA 1PT8A 3IVMA 4PM4A 1QHGA 1N6HA 3CH5A 4NY1A 4DCUA 4J8PA 3SIWA 4BBPA 5B6JA 4HLUC 3A10A 2PJRA 3LFUA 1FLDA 1JILA 1TUIA 1E7MA 3D59A 3T35A 1WU7A 2D8MA 3PPXA 3EVTA 1DMSA 3RDPA 3FKQA 5ICGA 2V7WA 3TK1A 3OCXA 3LP6A 1U0RA 2C88A 3OCCA 5KHOC 1G20B 3HJBA 4FFVA 1R4MB 4LJ9A 3HCEA 4XGKA 4XWTA 4QVKA 2VJOA 4J49A 1DHRA 4QPZA 1XQYA 3G0IA 4MQ4A 2O3TA 2VJKA 2CLSA 3RSSA 1PVDA 3ZXXA 4MO2A 3CNNA 1JYFA 3DDNA 3FBWA 1PKEA 3FCUB 2CVHA 3DD1A 2FWBA 5TY0A 3QLVC 5DHAA 3NR2A 1SPBS 1R15A 2FFQA 1PW5A 2OCKA 3EXFA 4WY2A 2OYCA 4C29A 4OX9B 2Z1NA 4G36A 2F1JA 4WOPA 3K20A 3M34A 4B3BA 1XVTA 1CY4A 4IICA 4OHFA 4CM8B 1HEYA 5C37A 4CF7A 4FFDA 1T4DA 5GIPE 2OBBA 3TRDA 3DLHA 3OQPA 1TO6A 3OJXA 4B3RB 3JPYA 1XWFA 2CEAA 4MROA 1RW4A 3TVYA 4CIDA 4EG0A 3WZ2A 1F5SA 5IP5A 3ZXUB 3ZCSA 421PA 1E20A 2WPDA 1L5FA 2ZTHA 3L6OO 1MOZA 3HKCA 2RHBA 2Z58A 1B0ZA 4AXBA 4Z4CA 3WIEA 3ZJUA 1IG3A 4FMCF 2LVBA 3H2JA 1K75A 2VHWA 1FDOA 3WNVA 3HWRA 3TNFA 2VF8A 3M4XA 3P0FA 3TZKA 2X1MA 1XPRA 1EVJA 1D9XA 3RYIB 3TKAA 3C6MA 2Q28A 4HB0A 2M6LA 1XA3A 4JSRA 2OG1A 4LE1A 4LDRA 1VSQA 5JMOA 3B6EA 3A4NA 5L4NA 3VR0A 4V1CA 2Q4TA 2P79A 2NSDA 1W59A 2VR1A 3GT0A 4F3KA 1OXVA 4UU1A 3WRYC 4CCYA 1SELA 3W8FA 4AWXA 4XB6B 3IBYA 1YH3A 2FRXA 3JAKA 4L4RA 2J3QA 4EIWA 4URWR 1Y8RA 3UHJA 5LA6F 3BX1A 1WXIA 2QNBA 3C74A 3DKKA 3MCAA 4YP6A 5L6LB 1M34E 3JQDA 2QXYA 3EOAI 3K2EA 4ZVVA 3N59A 3VO1A 2DVMA 4F9GA 2AG8A 3K0FA 5TMDA 3S0JA 1CEXA 4F60A 1BA2A 3ETEA 1JDNA 1EM8B 3THSA 5HKLA 5C7YA 4PXAA 2C92A 4FOTA 4NNOA 1OE0A 2CLLB 4B9AA 1X1RA 2B30A 3E7XA 1AN0A 1N7HA 3A9WA 4BO6A 3OT4A 3U1TA 4L08A 1FTYA 2YIJA 1WXQA 1U9ZA 2C2MA 4GMKA 1WLSA 4AB1A 3NRCA 4L7VA 4Y9DA 4ISBA 1COWA 3SEZA 3NT2A 5JZBA 5IC4A 3PE6A 2E4AA 2ZW9A 4HGRA 1Z0IA 3B6ZA 2ZE6A 1EJBA 3HWX1 2JFWA 4XWAA 3E5MA 5BUSA 3TPCA 4KO2S 1NQUA 1I2AA 4WADA 2PX8A 5KWIA 3EA4A 1FMJA 1JDBB 1Z5GA 5AJWA 1E3LA 4B82A 3GGPA 2CV2A 1ZP6A 2HPHA 1PGPA 2JCGA 2OQRA 3SX4A 3TI9A 5HQ3B 2OCLA 1NFQA 3ABIA 1E4YA 1QHHB 1ORWA 2OM6A 3N2LA 4AJ2A 4JYPA 1W0CA 1U7HA 1R0KA 1HNZB 2VJMA 1GDHA 1QYRA 3HADA 4LTNA 5KTMA 5J2UB 2VHYA 3LRPA 4PYKA 2BZ1A 3WBBA 1QIIA 4AJLA 5L3SA 2WIJA 3F5QA 4H3KB 1PTKA 5CJPA 2ODTX 2YOGA 2Q3LA 3GMTA 3WYGA 1SXJC 2CF6A 4M8LA 3FLMA 3OC0A 1SCAA 2R86A 1FA9A 1EFTA 4TTSA 3RS4A 4MP3A 2IY7A 5EWMA 3RC1A 4RZSA 4JZYA 2NIPA 5CDHA 1RJ9A 2HT6A 1B3RA 4DNPA 5BV2P 2AX3A 2JHCA 3BK7A 2W98A 3A9RA 1ZCJA 4GGPA 3DFFA 5JPCA 4MPJA 5JQGA 1K7YA 1GPAA 2C8LA 2Y2UA 1K3FA 3BD9A 3NM4A 2HMUA 2JLVA 1IEWA 3FUTA 1HFJA 3GJXC 5EY5B 2PR7A 4WEOA 5AW4A 2LE0A 4G84A 4OX9Y 1CY7A 5LZ9A 1R5OA 4D4LA 3VJMA 5EHGA 1E5XA 1P1KA 2YASA 1FFXA 3PVZA 4OQQA 1Z3CA 1FLAA 1VZ3A 4FKMA 4S2EA 4BEJA 2R44A 1OTXA 2XTMA 1V1MB 2EXXA 4ZTBA 4ZEWA 3W1VA 2QVLA 1Y98A 3P9SA 2PIDA 2HB6A 4C04A 1IN6A 2IEBA 4EF5A 2TMDA 3NHSA 4RZ2A 5JTTA 5EUQB 4AROA 1NVKA 2JGEA 4KFTA 1JHYA 4DPMA 1HXHA 3FF4A 4GEGA 4IVRA 2F3PA 1VFNA 4AZVA 3UJBA 3HQ4O 4WOKA 2QUAA 1OIVA 5AXAA 5BWBA 3I5YA 2YRFA 2ZIVB 4KHPB 2IHKA 4HOYA 2Q5OA 3C85A 2RK3A 4I81A 2OTCA 2PLAA 1CFZA 1TUBB 2CXRA 1IN7A 1KO5A 3AC0A 3E5RA 4M1OA 3DEAA 1DBRA 4O5AA 3AIIA 1XJWA 4CKEB 2EP5A 2QJTA 1VPWA 4A03A 4IXNA 2D5LA 4RM2A 4P0PB 3D9QX 3IE1A 1UFQA 2GN1A 2CLMB 1P44A 3CX4A 1JBQA 4YWHA 3V8PA 2J87A 4R5MA 3UUEA 3CZPA 3HEMA 3IAAA 4EHHA 1SBQA 3NQ41 3PWSA 1PV1A 1WCXA 3GVIA 5JSQA 3LLVA 5DPMA 4MARA 1GCAA 3S2GA 2F55A 2A57A 2PH7A 3V8NA 2YWJA 1XEWX 4NKRA 1W6RA 4Q02A 3RAJA 4LGCA 4KWTA 1D2RA 3BMNA 1AHNA 3OEED 1UBFA 2JAUA 4BNNA 1DWQA 3LTNC 3C7DB 3A6LA 3D54D 3UN1A 5FNZA 1NVDA 2ZTSA 3U6KA 1N5LA 1Z7EA 1MGPA 1MJFA 3KQTA 4GQIA 4H4DA 5E6SA 3BC1A 1BC5A 3S55A 1CS0A 2PGOA 1F8FA 1U6JA 1NJ2A 2IKQA 4NP6A 1MAWA 4J43A 5G0WA 4FJ0A 2XHZA 3KPYA 1YBAA 3LCMA 2FEXA 3L82B 3M1YA 3PDCA 1V7ZA 5ENVA 1XRSB 4GZMA 4M88A 3REOA 1BS9A 5TPWB 4FQ8A 4I1UA 1J99A 1SCBA 1XAIA 2IXTA 1O94C 3DVRX 3ITNA 3QU5A 5ALZA 1ISMA 1GCIA 1ZVKA 3LUBA 4IIYA 1NZJA 5D5HA 5H1YA 3ZY5A 1NXSA 4WERA 5KQSA 1RXYA 1S02A 2CHFA 2ACKA 3BXFA 1Q7TA 3L9XA 4IGFA 3DDUA 4L0MA 2HRDA 4Q7MB 3OQNA 2LXNA 3I6ZA 4QG7A 4WECA 1U80A 1Z18A 2P40A 1V96A 3UJHA 1U3UA 3WDLA 2JIPA 1L4LA 2EKLA 1WKBA 2GZMA 2HHLA 3DZHA 3EHDA 3H8JA 5JXGA 3GEDA 3IAUA 1IRIA 5HWSA 3CE9A 3N74A 3GJRA 1LLQA 3GBSA 4B7ZA 1AKEA 4M1TA 1GPYA 1VMDA 4REOA 1NY6A 2BD0A 2QJRA 1IAVA 1RYFA 4L76A 1TCAA 1Q15A 1XL0A 1KOFA 1ZK1A 2BFPA 2FF5A 3BGIA 3IIKA 4J6FA 3SQMA 4BMXA 1EVKA 1L8LA 3LCJA 1VLMA 1WW8A 5AXDA 3N2IA 1X14A 2I78A 1TTQB 3JZIA 3WMXA 4CMJA 5JIBA 1SR8A 3IJPA 4ZO9A 4ID9A 4AYXA 2P65A 4CKZA 3VO8A 1NNI1 1ZD5A 2HPVA 4G0OA 1E58A 5C46F 3N76A 3PFWO 2CL6X 2QD2A 4WZAA 1P3Y1 3GVCA 3C2QA 3LLSA 3DZIA 4HWGA 1K6MA 1Q50A 4LXTA 4OO3A 4BWGA 1W34A 2IP4A 1CHDA 1AZSC 2PBLA 5BW4A 2BAGA 4EOGA 3ZGZA 2FB9A 4AKHA 3WR5A 3ZKWB 3EZ9A 3GLVA 3H84A 1CB0A 4ZOBA 1YOVB 2VYVA 2VP6A 1KPGA 4H59A 5GP1A 3TL3A 5FDFA 1PJ4A 3O4RA 3H0EA 4ZCRA 3FWKA 1HSZA 5FX2A 1YFJA 2PS3A 4M8IA 1FXUA 4N54A 1XJ5A 3VHXA 4RKYA 2JZOA 2C9DA 1VB5A 4NE2A 1L5HB 5DNWA 4B73A 2G9VA 2QMEA 3JYNA 1FY2A 4ZVOA 5CCBA 4HAYA 4NS4A 1P4SA 2C8VA 3LPCA 5AVXA 4UBOA 3VPSA 4ZZIA 2CVOA 2ZBRA 4J0GA 3RKSA 3WGUA 1N77A 1E1CB 1W4ZA 3O3MB 1FMTA 8MHTA 4XFJA 1OJLA 2VNKA 3U37A 3T54A 4HWTA 1SXPA 5FADA 1UP4A 1PR6A 2YUTA 2R9VA 1H9CA 4YY3B 5T7BA 1WHTA 2VDKB 5K3SA 3OQ6A 1YZHA 4UMVA 3JU3A 1DARA 1T3GA 1XP8A 2ORYA 2RH5A 1QQ5A 5HZHA 1BOFA 1G3QA 3R0JA 1YZYA 4LXXA 4EZIA 4R2HA 3IAEA 2ZYAA 3WA7A 1CFJA 4IRXA 4CUJA 3GHYA 2Q5JA 3U4DA 3IC5A 2D2VA 2CB0A 2I91A 2G1UA 4Y2HA 5JCOA 2JGDB 3WGIA 1XKLA 1KMQA 2DHDA 3D3QA 3U9SA 1QZUA 4Q3OA 3ZY4A 1WD7A 1LVHA 4ZOCA 3PCXA 2PUAA 4IZOA 2JGFA 2XEDA 1AUXA 2X19A 3P97A 4JBHA 4WT7A 1ES9A 4NS1A 3RGWS 3UPDA 5IASA 2ZAYA 4AMGA 1XPOA 5HDBB 1YB1A 4IS2A 4UAVA 2P9ZA 4WUTA 1DKNA 3S28A 1VIYA 2ZJ0A 1XCLA 4DCVA 2GKSA 5TVKA 2VOEA 4EMSA 2WNIA 4QUAA 1KSHA 3PEVA 3IT2A 3FPBA 3ZWPA 5ECWA 5F76A 3P0RA 3VX3A 2QNRA 2QQFA 3NKFA 2ILVA 4G2NA 2FZGA 3QX9A 1SKMA 5AOVA 3NBZC 3ZW8A 2P2SA 1YDHA 1WMBA 1Z2AA 2XOXA 1DEKA 1SD1A 1W44A 3CWQA 5JH7F 3LL4A 1FDRA 2PKRA 3QKSB 4BV2A 4CDGA 3H9JA 4MKRA 1NVVR 2JGLA 1Z2PX 3A1FA 3B1FA 3K9QO 4BC1A 4BHTA 4I1IA 2HFJA 2WTUA 4GLBA 2QVBA 1M7GA 3BTVA 2Q8NA 4E31A 5LIRA 2VQFB 1Y7PA 4UPDA 2P9EA 2I2XB 2RE8A 3DOUA 5GQSA 4Q3KA 2Q0QA 1P6XA 2OSBA 3TO5A 3TLBA 1VFPA 1PSWA 3DKPA 2RH8A 4AJOA 5KYGA 3LX8A 3WNZA 2GPWA 1BWPA 4YONB 2YUIA 3OAAD 3MWDB 3N2NA 2HXGA 2BN4A 3G2PA 2BHTA 1EGMB 2Q8QA 3B1XA 3N2YA 4G9EA 4P92A 3TEFA 3AP2A 4AJHA 2IYYA 2ISSD 2W6MA 3OZCA 3WWEA 4KR3A 1U7OA 4PHHA 2AJTA 1IBRA 1Z26A 4XVQA 2UU9B 1WWKA 1GCGA 4ZRMA 5AJZA 4AIRA 7REQB 1SG9A 4QUIA 3CVWA 1XZGA 3LECA 3VSEA 4LNUA 3VSCA 3NUQA 3QA9A 1T2VA 1TJ4A 4ZAGA