3QLEA

Structural basis for the function of tim50 in the mitochondrial presequence translocase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
186
structure length
182
Chain Sequence
b'FPDLLPPPPQRPLTLVITLEDFLVHSEWSQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADDKLVRLIPFLEYLATQQTKDVRPILNSFEDKKNLAEEFDHRVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tim50p
publication title Structural basis for the function of tim50 in the mitochondrial presequence translocase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae ec1118
molecule tags Chaperone
total genus 53
structure length 182
sequence length 186
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qleA00
2HHLA 4Y2JA 3HYCA 4RETA 1ZRNA 3I28A 1Z4KA 1ZRMA 5AM3A 3GYGA 2RAVA 2R8YA 5A3QA 5AW8A 2EAUA 1MH9A 4YH1A 5AW9A 1RPZA 3AR6A 2W43A 4QQFA 4H1WA 4I9FA 1FEZA 3NAMA 2HSZA 4UASA 5AW6A 3EPRA 4UAVA 5AKLA 4UMEA 3ZI4A 3QXGA 4BNDA 3E84A 1NRWA 3DDHA 4GIBA 2ZXEA 3E81A 3UMGA 3D6JA 3WK7A 3PGLA 2YN4A 3KDPA 3N07A 1N9KA 2RBKA 5ALFA 4C4SA 2YMQA 3NUQA 3WKAA 4UM7A 3PGVA 5AW3A 1AQ6A 2YMLA 5AM0A 5AKGA 1XPJA 1ZD5A 2FPXA 4YGYA 3SF0A 3ZVLA 3EF1A 3WKCA 4XPZA 4B6JA 3A1CA 1ZJJA 3QU2A 5AK4A 3AR2A 4KNVA 5AW5A 2R8XA 2YMMA 3TLMA 3L8HA 2O9JA 3IJ5A 4HAIA 5A3RA 2GO7A 1QQ5A 5ALUA 2AGVA 2YMPA 1QYIA 5ALHA 3U7HB 1S8OA 5AW1A 3OCVA 1EK2A 1O03A 5AKEA 4KYTA 4AS2A 3ZX4A 2P27A 1ZD4A 2GHQA 5AK6A 5AK5A 5AVSA 5A3SA 4EEKA 4F72A 3QUBA 4C4TA 4Y2UA 3R9KA 5ALTA 5IT0A 4L6CA 5AI9A 3ZWDA 1WZCA 3ESQA 4L6AA 3W5AA 4BBJA 3QX7A 4G63A 4Y2SA 5ALXA 1U02A 4E88A 2JAUA 3IRUA 5ALIA 3WK6A 3M1YA 4EENA 1WR8A 1RLMA 2Q5EA 4I9GA 4DCCA 5AVTA 3U7FB 3OPXA 3KC2A 4Y2VA 4Y3UA 1RMYA 4YIKA 3W5DA 1L6RA 1SWVA 3L0BA 3R4CA 3A3YA 3ZW7A 3FPSA 3NRJA 1RMQA 4QJBA 4UARA 4UMFA 3AR9A 2G1AA 2IOFA 1VJ5A 2OM6A 4KX3A 1VFPA 1X42A 3WK5A 4Y2PA 1RKVA 3MMZA 4L57A 1QH9A 3DAOA 1ZS9A 3SKXA 1VJRA 5AKZA 2JARA 5ALOA 1F5SA 4NWIA 2IOFK 2WHEA 2OA0A 4RESA 2CN1A 5ALNA 3B9BA 4UU1A 2YFYA 2B8JA 3N1UA 3QUCA 4BEWA 4UAUA 1Z88A 5AW4A 2AUTA 5ALEA 5AM2A 5AI6A 4DWOA 3IB6A 2CFRA 2FPRA 4CF3A 1YJ5A 1U7PA 4FE3A 2MU1A 4DW8A 3CNHA 1N8NA 2YJ4A 1Z5UA 2R8ZA 1L7OA 3BA6A 4Y2QA 3J7TA 1S2OA 1ZD3A 4HGPA 4ZEVA 4Y2XA 1L8LA 5AI8A 3UMBA 2B82A 5ALJA 3W5CA 2JAWA 3E58A 5AVWA 1JUDA 5AKYA 4UW9A 4O8CA 3ZVNA 2YY6A 2B1RA 2HI0A 2FEAA 3U7GA 3ZWKA 3L0CA 1LVHA 3NIWA 1CQZA 2FUCA 3WK4A 3AR8A 2R8EA 2G07A 2WFAA 4Y2RA 2NYVA 3U7EB 1RLOA 3L1UA 2WF5A 2I33A 2I6XA 3KD3A 3U19A 4FFDA 3S6JA 3ZX5A 3OCZA 3SKYA 2HOQA 4G9BA 2HF2A 2WF8A 2BY4A 3WK8A 3N28A 3EF0A 3PCTA 1O08A 4UATA 3MN1A 3L8FA 3FVVA 4YCMA 3W5BA 2HF7A 4OD0A 5AVVA 2QYHA 3SMVA 1RQNA 2HX1A 3MC1A 4XQ0A 4CE6A 4NABA 2FI1A 5AI5A 4ZEWA 4BYGA 1U2TA 2ZBGA 2OBBA 3WGVA 2P9JA 5IS2A 3DNPA 4CF5A 3ONNA 1TE2A 1Z4MA 3QNMA 4HGOA 4NFLA 4UMDA 3K1ZA 2WF6A 3OCWA 5AHXA 4GXTA 2ZBEA 5AM1A 1Z4NA 2ODAA 3CZ4A 3OCYA 2EARA 2G08A 3R09A 2HO4A 4OFZA 5ALDA 2B1QA 3NALA 5AVYA 3HLTA 1Z4LA 1TJ4A 2NO4A 4EX7A 3ZVMA 4NAVA 1XVIA 5T41A 3QYPA 2GHTA 3E8MA 2AH5A 3UM9A 1YDFA 1QQ6A 1T9ZA 1Q91A 2P11A 3RFUA 2HCFA 3ESRA 1CR6A 5ALSA 1J8DA 4BNDB 4PNHA 3A1EA 3AR5A 2HDOA 4AP9A 1XP5A 3QUTA 5AVUA 4XOUA 5AVRA 1TA0A 3ZUPA 3P96A 3VAYA 1YV9A 5ALQA 5AW2A 3N8GA 2WM8A 5ALRA 4CNQA 2PKEA 3ZTYA 1RC8A 3L0YA 2B8EA 4BEVA 1NF2A 2QLTA 1WPGA 3QU5A 2GMWA 3FGOA 2PQ0A 1J97A 4CF4A 3EWIA 4JB3A 5AIBA 1Q92A 5ALVA 3KOOA 1IWOA 3F9RA 3QGMA 1YNSA 3QU7A 1Z4JA 2B0CA 3ET4A 3N5KA 1PW5A 4OHFA 1KYTA 5AKJA 3SHQA 5IT4A 4HYTA 4BX3A 2FPSA 1RKQA 2C8KA 3ZU6A 3QLEA 5AKXA 3QU9A 2IOHA 1YMQA 2ZOSA 4NV0A 4HGQA 2EATA 3M9LA 3U13A 5AW7A 3L5KA 4OCZA 2DQSA 2IYEA 1RLTA 2CFSA 1SWWA 3QU4A 3WK9A 5AI0A 4BX0A 2G09A 2G06A 3ZTWA 4BKMA 3NANA 4XE5A 4HGRA 2JGAA 2Q4RA 2W11A 5AK3A 5JJBA 3I6BA 1QQ7A 2ZBFA 1T5TA 1Z4OA 4C4RA 1LTQA 2I55A 2FPUA 3MPOA 4DFDA 1EK1A 2YJ6A 2I54A 2BDUA 3BWVA 4J2TA 5AW0A 4Y2TA 2YJ3A 2I34A 3L8EA 4IG4A 5ALYA 3WGUA 1RMTA 2FUEA 5FP0A 3WKEA 1RRCA 1NNLA 4YCLA 1L7MA 1U7OA 4UU0A 2Q4TA 5AM5A 1Z5GA 5AVZA 5ALKA 1Z4PX 1RQLA 2BDEA 4KNWA 1T5SA 3FZQA 4JDPA 2D2VA 1L7NA 5AKKA 3L1VA 5AIAA 2RB5A 2WF7A 5AKHA 2RARA 3AR3A 2PR7A 3KZXA 3L7YA 3OCXA 3B8EA 2HEGA 1Y8AA 2G80A 3A1DA 4EX6A 1RKUA 4J03A 2VKQA 1SU4A 5ALWA 5AESA 4HGNA 1YS9A 1L8OA 1WVIA 5ALGA 1Z4QA 4FYPA 1TJ3A 1ZD2P 3FPBA 5AM4A 3KBBA 2NO5A 3B9RA 5E0OA 2YBDA 5AVXA 4MWOA 2JAOA 3QUQA 3ED5A 5ALPA 4ZEXA 2C88A 3DV9A 2AMYA 2C9MA 5ALLA 2ZG6A 4EELA 4UM5A 2YJ5A 3WKBA 5ALMA 3RF6A 2CFTA 3WKDA 2O2XA 2WF9A 2X4DA 2MSNA 1TJ5A 3I76A 4AS3A 5AKIA 3FM9A 4KX5A 2ZBDA 1K1EA 3UMCA 3NASA 1ZOLA 2W4MA 4IFTA 3U26A 1U2SA 2I7DA 4BX2A 2P69A 4KN8A 4F71A 3AR7A 2B30A 2GFHA 3I1YA 3OTQA 1L7PA 3PDWA 2C8LA 1RDFA 1Z4IA 4MUMA 5AI4A 2OYCA 5AVQA 4YIHA 4EZEA 2FPWA 5AICA 2G0AA 3AR4A 2FDRA 4Y2YA 3ET5A 3L8GA 4UMVA 3SLRA 3SD7A 5ALZA 2C4NA 2IA5A 4YCNA 3OCUA
chains in the Genus database with same CATH superfamily
1QYCA 4TS1A 1HEIA 1S3SA 4PHFA 4CIAA 1ISJA 1F7VA 4PICA 2GJKA 5HS4A 1ESNA 1IN5A 3TVDA 3IOBA 1R6DA 3H0CA 3X1MA 1R15A 4E51A 4IZ6A 3C1AA 1FL9A 1KYQA 4ZOCA 5TMBA 5A5VA 1HLDA 1QG0A 3AR6A 3IX7A 4HUTA 5D6NA 3PUHA 1EQUA 1AUPA 1IWBB 2XUIA 2W5UA 3E9MA 8OHMA 4F4CA 2IH4A 1UP4A 3DS8A 3IVRA 3OEEA 4UCFA 5HZMA 4B3MB 1HL7A 4AY4A 2ZT8A 3AZPA 3DLCA 5EIBC 1PGNA 1U1EA 2I8CA 3KD2A 3NZEA 4HLQB 8ATCA 3ZI4A 4RK1A 1Q20A 3IQFA 3S55A 3CKMA 1DCTA 2WWWA 1N57A 1WS6A 5KKNB 3HKDB 1QV6A 4JL6A 4ZOAA 1I33A 2MWMA 3NKFA 4Q7QA 4D97A 1S2IA 4WNAA 1AGRA 2HWKA 2IDMA 4U2EA 4B8ZA 3WYBA 5B58C 3RYCB 3WK7A 2QJRA 2HWYA 1G8PA 2Y92A 1KETA 3NTQA 4HN2A 3VX3A 5JV5A 5LLDA 2XCRB 4PGFA 5LMNB 2W22A 2B9VA 2IHZA 3L7DA 4G0QA 2C94A 3R5HA 2RHLA 1NQTA 1HFWA 5K8TA 4V39A 5EC8A 3S2IA 1OB2A 5DBHX 1C29B 1D2HA 4ZI3A 1JFFB 1BFUA 1F8FA 1N5OX 2VNJA 4QUJA 1WW8A 4ALMA 1KYYA 1NU8A 1XPJA 2PUJA 4WLVA 1A96A 1U3TA 1Y8CA 1XFAA 1YZKA 2AXPA 3PQ4A 4IOLA 4TLEA 4I5GA 4W5OA 1CIJA 4II2A 4L8WB 3KQQA 1Z2PX 1SUEA 2DEUA 3ZH9B 4L2IB 1CRPA 1SCDA 4IDHA 5K7SA 5DOZA 4IAOA 5JALA 5CA1F 3U4QA 3KQLA 1Y6RA 3ADKA 2X8JA 4B3RB 3KT3A 2PWZA 4D9JA 3BXHA 5DHTA 3NBAA 2YMPA 2WW8A 3C4JA 5JO9A 1PJ8A 4JXXA 3BIWA 2ZQYA 3GT7A 5KHOC 1ZRSA 4PRKA 2G71A 5LZ2A 5CFPA 2WKWA 3O4RA 4ZV4A 3H5NA 3PBKA 1X2BA 2ZTLA 5F23A 4AJLA 3W5IA 4INOA 1PJBA 2Q8NA 4EKIA 1U04A 3DMGA 3R4VA 3H9CA 1UBCA 4UUMA 2D62A 3FPLA 1BE6A 4O5AA 4DVJA 2PAAA 4G2NA 4F72A 4Q00A 3MMSA 4Y2UA 4CFZA 4YJFB 1U1IA 1TADA 2QQGA 4QPNA 1EEXB 3C5WP 4BO9A 4YWHA 1RQPA 3NBKA 3QOFA 4GMHA 1E18A 4L6CA 3HA5A 2AJCA 5A05A 3REFA 2XQFA 4QUEA 3GUUA 3SHOA 2R8RA 2IP4A 3FJYA 1HE4A 1SVOA 3IOMA 3G9XA 3JQ9A 2QAJA 4TPKA 4MCHA 5JXJA 1DOHA 4E88A 2Y0PA 4KR2A 2AOVA 1V3UA 3M1YA 1UWVA 1VIAA 4TZKA 2Y05A 1RHJA 4AXXA 3BMCA 2Q5EA 2O5CA 5JCXA 3AESB 5D1HA 2XADA 1YSCA 2WC1A 3Q7QA 4H17A 1OBFO 5AJTA 5AJWA 5L51A 5EMHA 3SM9A 3CLTC 4ZYZA 3WNQA 2HCTA 4Y2VA 5JLAA 1UQTA 2OAQ1 2Y66A 4MIYA 2DHEA 5DP2A 4MTCA 4HH4A 5FB3A 3SC3A 1T5HX 4P92A 2MSDB 1HPLA 4FU0A 1ND6A 1Z6PA 1Z2EA 1QK4A 2DFVA 2G63A 3K5PA 4ND5A 4RQAA 4TXHA 4UTXA 3QWHA 4X60A 4D42A 2HXGA 1XNHA 4UMFA 1VLMA 3G79A 1NVUQ 3KKMA 3QEOA 4P5EA 5E9WA 4KX3A 1VJ5A 5MF6A 4EFLA 3BSYA 2ZAYA 1LPBB 4CEIA 4D6XA 2DFNA 2FF5A 1XA0A 4MZDA 5AO9A 1FSGA 3IUNA 3L1HA 5E6SB 5CEEA 1YKGA 4H3KB 5BOSB 2VH1A 3PR3A 3JATA 1B23P 1KNQA 4B85A 4EG1A 4FR0A 4KV7A 1ZS9A 4ALJA 1Y1QA 1M6NA 3SZLA 2BKLA 4DJJA 1MJNA 3K5IA 4Q47A 1HDIA 3DEIA 3QHAA 5KSPA 4QD3A 1K9SA 5AKZA 2QGFA 3H9QA 3WLSA 1AK9A 1M67A 1JSXA 3BK1A 1N0WA 3T5PA 1VHWA 1U3DA 4C0SA 1GHTA 3HUFA 1EZ1A 1IJBA 1N0IA 4ZP1A 3HU2A 2C3PA 1UXOA 3CZRA 3GFBA 3QVOA 1LBQA 3N1UA 4QT0A 4WY5A 1ISPA 5FIUA 2X4LA 1M54A 1U2GC 3NJ8A 4KQGA 1CP2A 2D2FA 2DHDA 1U1DA 4WX2B 4KVAA 1MX1A 1X19A 2IH2A 2FNAA 3GLHA 4OU5A 3TQFA 4DWVA 4EI8A 4Q1DA 5IT5A 4MS1B 1LX6A 4DV4B 1FIUA 2SKDA 4R84A 2I4OA 3QYAA 3UGQA 4H6XA 2F59A 4X84A 1UBTS 2BM9A 1C0IA 4YJHA 5HS6A 4AZ0A 1R6XA 2JJMA 1Y3FE 3DDOA 3H2IA 2VWQA 1T3SA 2PH3A 3PVCA 3PC8C 4IIYA 4RVUA 5ILQA 3WYEA 3BA6A 1X1BA 3LGXA 3DKRA 3JVUA 1SG6A 3M6AA 4YUXA 3M82A 1FK8A 4PTZA 1SCIA 3UMBA 5BOVA 3TNJA 1GPBA 1WCYA 1UKVY 3O95A 2XVYA 2HQOA 2PGOA 2SKEA 1V8DA 3IDZA 3OJLA 6GPBA 2BH9A 1CHDA 1R37A 4DC9A 4F2GA 2CLEB 1K6XA 3ZVNA 4P1ZA 3HV2A 4BKQA 2JH8A 2C04A 3GYBA 3LS2A 2PM8A 4ZK6A 1QSGA 3TTSA 1XWFA 2VHTA 3KQUA 1N9GA 3WYAA 3KTFA 3I45A 1NONA 3D2AA 4NLLA 1Z16A 3FE2A 4ENTA 1BKDR 1FFSA 1UMCB 1NF9A 5LL6P 2R1UA 3FTFA 2CD7A 1W8IA 4A82A 4JUDX 1W36C 3INNA 3V6LA 4UUBA 1VIVA 1ZD8A 3KR0A 3OZWA 3U80A 1K8YB 5L8VA 3U19A 1DAPA 4FXPA 2AZ4A 1E0SA 1XDDA 4RJJA 3NUZA 5JWHA 3T9DA 2ZIZA 2WF8A 2GEVA 1ZD9A 3DUWA 3K09C 1YS7A 3JALA 1DC5A 1W1UA 3Q7TA 1W34A 4UATA 2Q3BA 5DGIA 4BGUA 4MVJM 4IX9A 1H8ED 3B6KA 2KB0A 3LHKA 2IS4A 5LZ9A 2FRXA 3TIXB 2OE2A 4MV0A 4OD0A 3GLGA 4G67A 3S8MA 3VUFA 2V45A 4MR9B 1EVEA 5FOTA 4HNVA 1NJGA 1IHDA 1TU4A 2P68A 2Q1WA 3FNGA 4WFJA 3TQCA 1UOOA 2JGLA 4LVUA 2EX1A 4Z7QB 2ZBGA 1NMEA 2LGJA 2P9HA 3VBCA 3LLVA 4AG3A 2ZUWA 5JWRA 1WKVA 1RWPA 1VPVA 4O4HB 1FMJA 5HX7A 2ERCA 1EFVA 1BH6A 1UL1X 5AYVA 3SAJA 4Z53A 1A9ZA 1DCMA 3HB4X 3ITNA 4JU8A 3SC2B 3WGGA 1I6LA 2X15A 2KHZA 3L6CA 3DGFC 2CB0A 3V5NA 2O8EB 4JNKA 4INPA 2BGJA 5K3FA 3WMFA 3SN6A 2WSLA 5TB5A 1DT3A 1V43A 2YRFA 3D3NA 4IXMA 1FSFA 4EYQA 3OIFA 4UEKA 4HTFA 3R76A 3OPMA 3ZZUA 4IILA 4CETA 4CTJA 1IULA 2HV9A 4JXJA 5DWVA 2CVOA 2QTMA 2AFRA 3SCZA 4Q9JA 1JEAA 3S2UA 5EGNA 3SC4A 3UG6A 5BV2P 1NG1A 5I8PA 5IMBA 2Q6IA 4FMCF 1AC5A 4HDRB 5DI3B 2QU7A 2P11A 4D25A 5AD1A 1JX6A 3FY4A 1JB1A 3NVKI 3NTXA 1LW7A 3GUHA 4MYDA 3I04M 3SR0A 4UTNA 4N76A 2ZS9A 4DB4A 3CRZA 1QVAA 3UB4A 5BQPA 2GJ9A 1Q0TA 2ZYAA 3WVNA 3R2JA 2YH2A 1XOIA 3M6MD 2J6CA 1H5UA 1RZRD 2O54A 2ES4A 4E11A 5AHOA 3DEAA 3CWCA 3K72B 2I3AA 2G36A 5DPMA 2WB2A 5DTMA 1FOEB 1VKJA 3VSDA 4EDFA 4S1TA 3U4HA 3EFEA 2F2TA 2YWFA 1TD9A 4JNCA 4NENA 3SYRA 2MSEB 5FPHA 1BX0A 4UOEA 3F73A 3ZTYA 4I36A 3FWNA 1ULHA 5H81A 3L7CA 1X7XA 1P1HA 2Q4BA 4B3DA 3GNTA 4BEVA 4JDUA 1KI6A 5E1BA 1GT6A 2HFKA 3GT0A 3NHPA 1MB9A 4N3BA 1OVGA 4Y2GA 3NQ41 3UK0A 5BNIA 4DV5B 1YRQA 4DLXA 4YGXB 4KXLA 3KR9A 3SVZA 2D6FA 1CNEA 1TECE 4GI5A 5HTOA 2G4CA 3QGMA 2AZXA 1XCBA 3TG8A 4ZYUA 2F43B 2BMWA 4LF9B 4C7MA 4ZICA 3HK2A 1MG5A 2NN3C 4AP5A 2JFUA 1I2ZA 1X39A 2CY0A 2ADFA 2NZUG 4KXVA 4Z99A 4AJKA 2E37A 3RWOA 2PWYA 2CNWD 3T0IA 4LHXA 1XEXA 1JFVA 2QQFA 4JC0A 1NQVA 4GOLD 1FPQA 3E5NA 1KO1A 2A33A 5BYKA 4GYJA 3G0IA 1OC4A 2V97A 4MV9A 1VDZA 1E4VA 2CW5A 1XXHB 4PVCA 4PPQA 3DVAA 3SG0A 5AJXA 4X41A 1Z6QA 3LPNA 3X1KA 3K1TA 1VHDA 1XRNA 3OTHA 1XWIA 3PHLA 4Q3NA 5AW7A 1ODCA 5LLTA 3P7MA 1N5MA 5AP9A 4QUBA 2PSSA 3RKRA 3E23A 1UMDB 4REMA 4RFSB 3WK9A 1B8VA 2IX3A 3C5EA 3U4MA 1JIIA 1VG9B 3SIRA 3KQMA 4IRMA 1YRHA 4UJ3A 4GC5A 2W8ZA 4H1TA 3RVMA 1ZKMA 4D3DA 2WZDA 3PHIA 2XGSA 4L28A 3EEBA 3SQNA 3F4KA 2A8YA 4AMZA 1WB5A 2C2GA 4HUQA 5C46F 3U09A 1UDWA 5IXJA 1J70A 2Q4RA 1VL6A 1DTWA 2J9XB 2IELA 4LGMA 3UOAB 4YT8A 3SF0A 1TPZA 4WNYA 4C5BA 2F00A 3AILA 1EXMA 1ZUNA 4HSEA 4KV9A 1J2UA 4Y6QA 3JPWA 3GGOA 1TQDA 3KJZA 3Q7EA 4GD3Q 3A1SA 3VOAA 3H1GA 2Z6VA 2NTEA 2R5FA 4G4IA 2C42A 3VC2A 1GKYA 4YUAA 5KNLA 2YJ3A 1FZQA 3F5FA 1TJPB 4IIDA 4BNHA 4ZMRA 4EATA 1P7CA 4WLUA 1D9XA 3FFWA 1TM7E 3SDBA 1KPGA 3GUZA 3B85A 4YQFA 2ZULA 4O0LA 4K7JA 4WZAA 2J3KA 3H1BA 5F9HA 1FFYA 4UVIA 2ERYA 3F5QA 3DAGA 1VL8A 2ZREA 2BKAA 4L9WA 5HJEA 3RD5A 2VDPB 4OGWA 2FLWA 5AJVB 1NVGA 2FFJA 2XQVA 3RS7A 5IXYA 1CUHA 1BRTA 1L5FA 2RB5A 3FCCA 2E49A 4X7PA 3DJFA 1O5IA 2PR7A 4JLMA 3ZHYA 4DVGA 1IM5A 3B8HA 4OHKA 1SIUA 2B7CA 2FXIA 1EB9A 2Z2IA 3H7IA 1EINA 3FYSA 3V4OA 3V7YA 3T7EA 3EW9A 2IODA 2BSQA 3VJKA 4F4UA 1C3EA 3OIYA 3S2SA 3BXOA 3G0OA 5AVOA 1V4VA 3SC6A 3EA5A 1BC5A 2PO7A 2P5SA 3VISA 1VP9A 4O2BA 5GVSA 1BDBA 1XVUA 2DT8A 2XMQA 3D31A 3NNDA 3NP7A 4HGNA 4MITA 4XR4A 4FILA 4DIKA 3I9JA 3SJZA 2HCJB 3AL0C 1Z47A 4KJXA 1RYHA 1EWVA 3AK4A 3ONWA 1HF3A 3BB1A 3ZWWA 1JQLB 2E85A 1ZD2P 1PQUA 1VZ2A 3UXMA 3M8KA 1E5XA 3U17A 3BDVA 4DEVA 5IF9A 2CLOB 2WK1A 5I7OA 2IKQA 5CDYA 1A2BA 3QVGB 4FYIA 1EJ2A 4BKUA 4F12A 2OPHA 2JAOA 2YUTA 1W4BA 2ONZA 3K32A 1SHKA 4K9SA 4RD6A 1NI5A 5CFZA 4U63A 5JIBA 3OZIA 2O3TA 2ZG6A 2WWTA 2H00A 2RHTA 5DU2A 3RUIA 3QEMA 1U7HA 3GCGA 3PQEA 3VJLA 3C24A 1LRLA 3AO0B 4DJFC 2YY7A 3QF4B 2B0JA 4G65A 2OFPA 4HYQA 2ZBDA 3C3DA 5A9TA 2WT8A 1TRKA 1X2EA 2V9PA 3NASA 1VRWA 4JB2A 4MWTA 5IN5A 4C4ZA 1QH0A 4UOZA 3KQKA 1PGPA 5U4XA 2H2HA 5DO9A 4NBUA 1JHAA 1SCBA 1DAGA 1UOPA 2Z1DA 2ZBPA 2QD3A 3PPVA 3ROEA 3H4IA 2H4XA 1E2HA 3E1SA 5U9CA 3QE9Y 3DD1A 1PTJC 1QYXA 3NI2A 2REXB 4R05A 4J0DA 5IUJC 4YRAA 4FKZA 3O4GA 1PWYE 1A8PA 1NKTA 2DLDA 4OBBA 3IIJA 3VOBA 4EA6A 3TN7A 4UVDA 3U4QB 3AKYA 5K0TA 1L4UA 3TRDA 1U0NA 1DO8A 2Y77A 4L4SA 2NPIA 3ZV3A 3ZTTA 5C0OE 2FDRA 4LWZA 4I50A 1RZ3A 2HU7A 4Q4JB 4F5DA 1VLZA 3W1VA 1YBAA 3V4ZA 3HP7A 3SD7A 1B74A 1ECLA 2QRNA 3HCRA 1XVTA 2WOJA 5GIOE 2C4NA 1EK6A 2Y1EA 3H3FA 4RHFA 4Y2SA 3PC4A 4JJZA 1X1SA 4EG0A 1L5SA 2IDKA 3FPGA 3A36A 4R81A 1ID1A 5KWIA 4H3VA 3OKFA 5EEHA 4XJSA 3M4XA 2ONCA 3TO5A 2VHJA 3H5IA 3GYGA 1QLHA 1YCDA 2OZLA 2FX5A 1VSBA 4IHJB 1XNRB 1DAOA 4PSKA 1FUYB 4WXHA 4KE9A 1HNZB 3DCYA 2QE6A 5EKSA 1G7CA 5IM5A 1FEZA 1MOQA 1L9XA 1IXRC 3A4TA 3F3YA 3OMLA 4NBWA 2AI1A 4REOA 2SNIE 1Z6GA 2R8BA 4UAVA 4XQCA 2OG1A 4TWZA 4HZIA 4MINA 4PZEA 3OFNA 3OOEA 4TV8B 4BFVA 4QTUB 2B9EA 4DTIA 4LE0A 4ZQIA 2RGAA 2B4YA 2HK6A 3CUWA 3R5XA 5SZJA 1R0KA 5IRCD 4AJHA 3OE4A 1PTJA 1D2GA 1P17A 4K81B 3BT7A 1E9BA 4XCVA 5KPDA 3IT2A 3E8SA 4JROA 4D1YA 1SOWA 4QUIA 4KWTA 2PR2A 3P20A 4Q02A 5CFLA 2V5AA 1RVDA 3DTYA 2UVDA 3DEFA 4EUSA 5BSTA 1L7EA 1OSNA 1OUMA 4XM2A 3PQ8A 4OHUA 4X20A 4AG5A 5DH9A 3K6SB 4S12A 1NMSA 5GOZA 5DBFA 4FDLA 3DO8A 5BUCA 1M2FA 1UZNA 4AVYA 4MVJA 3CT4A 1AS0A 4RZ3A 4G09A 5ENVA 1T26A 3A1CA 2J7KA 4G5QA 4M9UA 3BL8A 3D2CA 3SSNA 5LP6F 2AVNA 1V2GA 2OFFA 4E1VA 1XFDA 1N3IA 1XI2A 5H8WA 5I3CA 1MRSA 1KOLA 4C87A 5B4TA 1IRXA 4MULA 4C4PA 1K86A 1V1JA 1M74A 3L9XA 3TPZA 2DMRA 2W6PA 2AJTA 4U0JA 4V24A 1BE0A 4M9CA 1X7ZB 4O4LA 3U7HB 3NDBB 3NIBA 3OCCA 4L7QA 3TUIC 3PEUA 1HQCA 1P80A 2PPVA 1TZKA 1OHHD 3LBNA 3OCVA 4K40A 4LRSB 3HXQA 1WV1A 2ZT7A 4PLVA 5JCPA 3GZ4A 1AA9A 2Q6LA 4KYTA 4R7ZA 1PR0A 2QOEA 4R9VA 4X3OA 4X8OA 4BV9A 3PIIA 1RHMA 1YR1A 4E46A 1Q57A 1CUDA 1XWWA 2WABA 4YMWA 4KXYA 1N25A 4AZ0B 1N2ZA 2CLHB 4ZXFA 1TIKA 5LXTB 1YTLA 1VSVA 1KKUA 1GPAA 4GL2A 1V3TA 2FP4B 4TQGA 3VO1A 4DDMA 4Q93A 2V55B 3I8OA 1CJKC 1G8FA 1FDOA 3IAUA 4HNSA 1B6SA 3Q98A 3IE2A 4RYLA 4DCSA 5JNWA 4J0QA 3GLUA 4IO0A 3I04A 4MGHA 1GOTA 5BRNA 3QV2A 3WK6A 1KJWA 2P2CA 1DWQA 3VYTB 4LZPA 1QOQB 2XCUA 2FW9A 1YHZA 5IBPA 1O8BA 3K8OE 2H1VA 1FTYA 3KC2A 4Y3UA 4AJIA 4WCDA 1E2GA 2MSKA 4LJ8A 5IPFA 3C14C 3TX2A 3W5DA 2HGZA 3NRJA 4JBNA 4MW1A 2ZRJA 2REQA 4QJBA 5F73A 2IPMA 4QODA 3KDAA 4O25A 5FV7A 2NLOA 3X2FA 4C21A 4U7DA 4QQKA 1Z6XA 5TARA 2W6CX 1XDWA 2HK8A 2QKYA 3I12A 3VR3A 3RSFA 3QOXA 3P9ZA 1G20E 1H2ZA 1VCMA 4IWYA 4KO3S 3IBGA 1EFRD 1MTZA 2HWXA 2XI4A 2A3RA 2Z2XA 3HHEA 3VZPA 5DJ5A 3OZAA 1A8UA 5HJ7A 4XGKA 5E9QA 2D3TA 3JAWA 5FFMA 1YOBA 1X80B 4KP7A 1E94E 1PZGA 3FCAA 1JLMA 4YONB 3GLGB 1OB5A 4CV0A 3LC0A 4ABYA 2R4QA 4HNAB 3OH8A 1DVRA 2WIAA 3CSUA 3EWNA 4IY1A 4BQRA 1PFQA 1MT0A 2PWAA 2B6NA 3BE6A 5FWXA 1ZI6A 2IF0A 4MKZA 3OIUA 1O6GA 1BOFA 4MRPA 4UTZA 4QVIA 3KSRA 2FRDA 3ICWA 3NYQA 2CJXA 4UU1A 2GAFA 4QICA 3IR6A 1AKQA 4QYTA 1LBIA 1VIDA 4JLSA 4ESOA 5JD6A 2A9RA 5FJJA 1B3RA 5EZYF 4FYMA 3AF5A 1CQIA 1T8WA 1N4DA 2WJ3A 1AKEA 1XAJA 3DOFA 1SCJA 4ZV7A 4EW3A 3TZKA 3I0NA 4IM7A 1PDWA 4ZOEA 2NSDA 4XASA 3HKBA 1QYWA 4XIJA 4IIGA 3NHBA 4HTFB 3EPPA 4DHWA 1KFJB 2JLVA 2D1RA 2IXAA 1CNMA 2Q7DA 1E1KA 2H1WA 3J7TA 4KH0A 3BDIA 5AI8A 1X70A 5ICEA 3P71T 4E09A 1R7RA 1P60A 4EI7A 1W36B 2NXNA 2Q5IA 3DLIA 3QKTA 1M0SA 2JAWA 3UYKA 2JIZA 4BVLA 1DOAA 1GNVA 2BGKA 1JDUA 3Q6IA 2FR8C 4FLFA 4N0EA 2QRUA 5HF6A 4YV2A 1EXDA 3W2TA 1PT5A 2IE0A 4IGAA 1C3VA 1SG0A 2HBRA 3CLUC 3NXSA 3T3PB 2JLUA 1SB9A 3B1FA 4DIEA 1VYTA 3KSBC 2Z5GA 5E9AA 2BR3A 4TL7A 3ZKWA 1N2OA 2HA7A 3P9QA 1LCIA 1W2HA 3I1IA 4U2FA 5CB6A 1R4NB 1ZN7A 5BWLA 4P2BA 3O1LA 2PZEA 4RK7A 4Q01A 2WJZB 3E0QA 3PDHA 2Z8YM 5EL0A 4CLRB 3HP1A 3D7KA 4ZFNA 4G01B 2HJRA 3JV7A 2NYVA 1W49A 4Y2RA 4D5EA 1MLDA 1KY4A 1UBEA 3GNQA 1XNQB 1JPUA 2Y1GA 2PZFA 3JXEA 3S6JA 4CKYA 1D2RA 4QULA 3LQFA 3K2IA 4B09A 4BP9A 3GFRA 3LIPA 1DQYA 3Q3HA 4DY4A 4EB8A 1W2WB 2IYUA 1KI6B 1FUEA 5TIIA 4X8HA 1M6VA 2ZJ6A 3EWAA 3CY6A 1HTBA 1PJ4A 1Z6ZA 4DPLA 2J59A 3LRPA 3JQ6A 2QW0X 4A6EA 1CF4A 2OV3A 3HNPA 5IJXA 3TVYA 1FNCA 1T6YA 1HFEL 3ASVA 1SC3A 3ENNA 3QX3A 1SK9A 2V5VA 1Z28A 1SCQA 2CD9A 1N2EA 2HX1A 3ABRB 3ITDA 4MQ5A 5EHGA 4CE6A 3MTJA 5CT9A 3HCFA 4H1VA 4EBBA 2UUBB 2FJ0A 1FZTA 1JTVA 5ULLA 5A03A 4KGVA 2CT8A 1D5CA 5C5IA 3QKRA 4D6YA 1HMYA 1M1YB 2G9ZA 4HYEA 3U7JA 1XDGA 2W2LD 2FG6C 2IJGX 4KIFA 3DYIA 3OCWA 2DKFA 4GXTA 2XMDA 1QO0A 1GSIA 1TF5A 2BR4A 3PQCA 4L95C 4ZGBA 1BE8A 4FNGA 2QBYB 3O3CA 5IX8A 5B5SA 1E2JA 4IDPA 4Q16A 1YDEA 4RMIA 3HLTA 3I3OA 2AXQA 2CXRA 1U9YA 3CNNA 2I87A 2QVGA 3FDJA 3SFVA 2GTPA 2F3QA 4ED9A 4S04A 5F3WB 2BFFA 1I6WA 1EFLA 1A4XA 2YV3A 4LJLA 1XAGA 3K5WA 4Q7JB 2DPGA 1RD4A 2A1IA 2AH5A 5HK9A 4BV8A 2IF2A 1SOAA 3AG6A 2ISCA 1H05A 3RSGA 4D96A 2YIDA 2IUSA 1KK3A 1QQ6A 3PC6A 5F4ZA 3VKWA 1T24A 5IKPA 3ZCRA 1AQNA 4DSTA 1NX9A 4YCBA 5FPTA 4FI3C 3ESRA 3V9AA 3FYUA 1HO3A 4WKNA 1Y98A 1OLXA 2ZIEA 3OX2A 1I32A 3T6KA 2DUMA 2ZAGA 3DXFA 1IZ7A 2QLJA 2ZCVA 3HKEB 1WBJB 4MVYA 3SYMA 1XRMA 4PC7A 1ZSYA 2QDXA 1R18A 4BMVA 1GZ7A 1NVTA 1XMJA 3CCBA 4WI1A 1VA5A 3HZOA 2YXEA 3FFXA 4B6EA 1SUCA 5GONA 1OKKA 4A27A 1EAMA 1EFKA 4NPHA 5IVIA 4YMUA 1P5FA 5KTTA 2A9KA 3QW4B 1STOA 2P6UA 2R7MA 4FDMA 2BYTA 3W77A 3DPSA 2PZAA 4DMKA 3JZMA 1JQBA 4QUKA 4Q7LA 1WDLA 4JJGA 4MGKR 4TTAA 2HMYB 3L0YA 3D8UA 4UNNA 4ZCIA 4ROTA 5B3KA 2DFLA 1NF2A 1O96B 1NZDA 1R5JA 4OH1A 4JSYA 1BXKA 2QXYA 3IKLA 2FFAA 2P79A 1ORVA 4LGVA 2BI7A 2KX7A 5B7PA 2VHCA 4HNQA 4JB3A 1D7AA 2XQJA 1RYZA 4EPXA 2GO1A 4Q0MA 1XUOA 3NONA 5HZGA 5JYEA 4I4NA 2B0CA 3OLWA 4CM4B 4ZIRB 4CLEA 3H2ZA 4LJ7A 4V0RA 1DQPA 4IJKA 4OHFA 1GNQA 4BVJA 2RE8A 1KJZA 4URUR 3PLRA 4NEQA 1KVTA 4D5GA 3D59A 3FKJA 1HGXA 4MWGA 1EK0A 1UJ6A 4NJEB 1GZ3A 1EVIA 4N41A 3FNBA 4KIGA 4QO7A 1QV7A 5CDUA 3N2IA 1B15A 2XB4A 3BERA 3BZWA 2JFZA 4LWOA 2VSOA 2PN1A 4M1OA 2FWNA 3ZE1B 2IXGA 2Y9PB 5IK2A 4G5HA 2EATA 3LHDA 3JU3A 1GYRA 1WXXA 5BQOA 4TXJA 2O2JA 1FSPA 1AK1A 1KTVA 1ZESA 3FIUA 3UW3A 4TUYF 1OXXK 5MGNA 4ZVKA 2WG0A 2JA2A 3GH1A 5FO0A 2XQKA 3CMCO 1UBJS 3S1AA 2OHJA 4URVR 1ENYA 3LUFA 5GV8A 1ZCFA 2I62A 2XNHA 3H8SA 1XVLA 3G2QA 2AZTA 1KYVA 4JMPA 3LX6A 2R8PA 5DBEX 1NUUA 1TGYA 2WE7A 2I4TA 3C97A 2AEMA 3GRCA 3PXDA 3DBLB 3KLOA 4DLPA 5JNLA 5B3JA 4ZO6A 3CQ9A 5IEJA 3WOHA 4R3UC 1TEXA 2X0DA 3KXLA 1XQYA 3LL4A 5DK6A 1TQ6A 5EJIA 3EC2A 3SZGA 3WAGA 1WD5A 2NNWB 1TW2A 5D3QA 1U2PA 2ACEA 4B7AA 4DZTA 2I3GA 4W5TA 1M72A 2DSTA 2JD1A 1UDBA 1CR1A 1T5TA 2PRSA 5P21A 1KVUA 2LCQA 5TX7A 3MJRA 5GM1A 1JLLB 4BP3A 1EK1A 3KXDA 2IXTA 3R40A 1YZGA 4DLWA 4RMNA 3ISVA 3C98A 1HE8B 1Q74A 1ZIOA 2Y76A 5DLQC 1E5VA 2HMSA 3GFVA 3CPEA 4KIJA 3VU9B 5B55A 1UEXC 3ZHBA 2WU4A 1NNLA 2I2AA 1R9MA 4RZSA 4E22A 3X1YA 1KH1A 1KI8A 3NR2A 1IHXA 2Q4TA 1YQUA 4FHZA 5CP8A 5C32A 3U61B 3AEZA 2QVBA 3AEQB 4GRAA 1JHRA 1XC7A 2BM8A 3ECSA 3E35A 5I45A 2QRQA 4KNWA 4W82A 2ZIFA 3KFVA 2YWEA 3EARA 1J90A 3FIJA 4I50B 4QOEA 5AIAA 5FBWB 1NURA 3DOEA 1HDOA 2ZSDA 1RC1A 3AR3A 2GZ3A 2DBRA 5EP3A 1D2CA 1OZGA 2L69A 5CLGA 3T4UA 4INAA 5BT8A 4GPZA 5CA0F 1E60A 1MRNA 4FPXA 3G7UA 4EG3A 2R00A 3PE4A 2B2CA 2YDXA 4XQGA 3N70A 3D6FA 1NT4A 3F2VA 2F55A 1U0TA 4XTCS 3F74A 4BN5A 4FGZA 2X3YA 2XKKA 1L8XA 2XOEA 2JHPA 3OU2A 5DX8A 3KPJA 2QSJA 3F7OA 1Q11A 4W9RA 3DQPA 3EXG2 1CHNA 3BFPA 2UUAB 1SKMA 3FI9A 3KV3O 1N77A 1FDWA 1NN5A 4DG8A 1M8JA 3KE9A 4QYMA 2DUUA 2ONYA 3UJNA 4EL0A 4MW2A 1G8HA 1KMQA 1N0VC 2PLFA 3ML1A 1BQ4A 2GEFA 4TKVA 2WP8J 3LF2A 2Q7XA 2NUAB 1JG7A 3H8VA 4ZT3A 3LT4A 5FI0B 3ED5A 4BBPA 1QH1A 3ETNA 3H65A 4QRHA 3AOGA 5FLEX 3GZNA 2AR0A 5MN6A 1T3GA 3II6X 4MPJA 1E9SA 4ZVSA 1IIRA 1JA0A 1QVZA 2WJGA 2GLXA 2RCNA 3NHUA 3BMOB 4M1QA 3DFZA 2HJSA 3E1GA 3FOBA 3JD2A 2DY0A 4YCAA 3ZLVA 2I76A 2MSNA 3CRMA 4REQB 4W99A 3PDIA 1E9VA 1AQIA 1E6MA 1FMTA 1DIRA 1SBIA 1XTQA 3PSHA 4YAFA 4S1NA 5AKIA 3AFIA 4OI0A 2VHZA 3JYPA 3WBFA 1JVSA 2QDKA 2VJQA 4GVPA 4TLBA 4DC1A 3WIUA 3DUFA 1H22A 4F1WA 5K3OA 2FB9A 5EQTA 1ZOLA 2Q21A 2W4MA 3SEAA 4YJ2A 1FTGA 4A8JC 2OO7A 2XTZA 2ZE6A 3T3MB 4RANA 2QV0A 1GTG1 2Z9BA 4B73A 1MX3A 5I5GA 3NYWA 5JSUA 5JMTA 1JHYA 1Y4AE 2XOKA 3QKWA 4L8GA 3ER9A 3PDUA 1Y34E 1Z38A 4D0SA 5GM2A 2FSVC 3LIIA 1R8JA 3ZDCA 4NMWA 3HE3A 2D8AA 2IEYA 2OYCA 2XYHA 5LIPA 4UZEA 4H7KA 4EUFA 4EZEA 4YRTA 4LWPA 3ENKA 4BC0A 1SVUA 3N7AA 2C29D 1N6KA 4N8DA 3L4BC 1TM5E 3H8WA 2PEYA 4KQEA 2EGGA 1JDTA 1FNSA 5CM8B 5I4KA 5MDHA 1WUKS 4P7BA 3NU1A 3OJCA 3ZXUB 3NYIA 2HHLA 1F38A 3MEQA 1K7CA 4OY3A 4CIYA 4TYNA 2CNDA 2DH5A 1B6TA 1U5CA 4KDFA 1JQKA 1XZHA 4UOQA 3T61A 5CBKA 2BBTA 2H92A 1WSAA 2RAVA 1UBHS 3UB2A 3UUGA 5BUSA 5PGMA 2IVFA 2XUGA 4H7DA 4AJ4A 3UPUA 4CI9A 4YH1A 1K08A 4N4AA 2X9QA 4JLAA 4DUPA 2W43A 1RWOA 3EZ7A 4HLCA 4X3CA 1TTQB 3WK5A 9MHTA 1WDMA 1T9GR 3TSAA 1JP7A 1XHLA 3DYVA 1UFQA 4RD0A 1PYOA 4XLZA 4CMIB 5KVCA 1JMYA 3IV9A 5E6UA 4QQRA 5DYNA 3F4BA 5KNDH 1NQWA 5JNSA 3DVLA 3ZV5A 1CY7A 1B0AA 1Y9JA 4G0PA 3V4RA 3ETLA 1Z63A 1NG9A 3FVRA 2IKSA 5J5VA 5CDFA 3AY0A 3D6JA 4OP1A 4X8LA 2QXUA 3WWZA 3EH2A 4IS2A 5TXGA 3RIEA 2VP5A 3JASA 3P4UA 3GMDA 3JQ7A 2BSAA 4FFVA 5CRIA 5ILGA 3W9UA 4BNFA 2Z8YA 4F3RA 1HR0B 4J7CA 4MS3A 4IIVA 1S3GA 3LI2A 4EO7A 1TCAA 4KQCA 3PGVA 5AW3A 5BNFA 3OEHA 4GWGA 4ZD6A 3IQWA 1YDMA 3F78A 2CUTA 5JPIA 4QSHA 5JE8A 2IUYA 4AMUA 4J8PA 4EFNA 4Z51A 4ZAYA 4H6PA 1KDVA 3B70A 4J94A 3DZIA 4XLLA 5DV9A 3G1WA 2V7UA 1MP0A 5K6AA 3TDNA 2CVQA 1E79D 2X8BA 4JA2A 4BJ6A 1OOEA 2ZI4A 3JAWB 1C14A 1C3OA 5JYDA 2H8GA 5FUVA 1Q7BA 1GU0A 2X0EA 3I2KA 2AG5A 1E0DA 1U8ZA 4Z86A 1BKSB 3JZDA 4FEAA 3QW2A 3EEOA 4HAIA 2JJQA 2LP4Y 1L1FA 3WRWA 1CY4A 5E4JA 4D43A 3L18A 1GSHA 4OBEA 9LDTA 4DRZA 4BVFA 1LD3A 2FFBA 1J9ZA 5D86A 3L0SA 3P9SA 1IHYA 4W5JA 4BQIA 4C6RA 4CMEC 3EMBA 4HQ0A 2AOXA 4ESHA 1SELA 1WDTA 4CTKA 4EHBA 3AIOA 3BUSA 3AWDA 1T3ZA 4XLTA 2WU3A 4MHSA 3WO1A 1QO7A 4DR2B 4P36A 1BE1A 5JRZA 2ZJAA 1XEAA 1KDOA 5LOVF 3M70A 3A4MA 3R7FA 2BF4A 2D5IA 3K20A 5JSZB 1ZQ9A 3QKSA 4EFKA 3D3EA 4OOFA 4OV6B 3DSRA 2JFWA 1LVUA 4PEVA 1RT9A 3F6BX 3HWSA 4YECA 1IEVA 5BN3A 1HT1E 2NTJA 2BMJA 1C81A 2PLNA 2P6RA 3RFTA 1UZMA 2HKIA 2ORWA 4I9HA 4GZLA 4QBTA 2GJ4A 2PV7A 5KVSA 5EIWA 3PPXA 3T1TA 1L2TA 3A26A 2Q41A 3ISTA 4L8FA 4CF7A 1YO6A 2CV2A 1T2EA 1U7ZA 3R7AA 4LJRA 3ZKWB 3FHCB 4ARCA 2J41A 3K8YA 3A11A 1R66A 2RKBA 5DT9A 3HM9A 1AN0A 3ZW7A 3LWBA 4QXRA 1ULUA 2MSCB 2P2YA 1I7NA 2WD7A 3CH6A 1IOZA 3LC1O 4X6YA 2JJ8A 2WG1A 3BD6A 3DL4A 5DB4A 5GWXA 3T5GA 2NXWA 2D7CA 3G5MA 3FROA 3LOPA 4BVAA 4YR9A 2J0SA 2B2XA 4E5NA 4N0PA 1HNNA 3FGPA 1I2CA 3MLBA 3K1AB 3IIKA 4G24A 4PTYA 2H8KA 2JJ2A 4RPKA 3AFOA 3SS8A 1NMXA 1CC1S 1GPYA 3EZLA 3QXSA 4NHOA 2VYQA 4CMCA 1SXJA 1UBSB 4XJXA 2FWIA 2O57A 2PMCA 1E5LA 3HI4A 4K2AA 5AR1A 4KL8S 3OEYA 5BW6B 4AX8A 1G5IA 2KSQA 1XKXA 3C3AA 2B99A 4IGEA 2D4HA 3C4VA 4L8VA 4YLGA 4AUKA 4AYWA 5BSWA 3KUCA 1HH4A 5GGXA 4TMFA 3NNNA 5KSYA 2XMRA 3H4MA 3RTGA 4CT0A 2VJMA 1Z6YA 3IUBA 4FDVA 3ZDQA 5CD9A 6AT1A 4ZRDA 2IHTA 3RU7A 1DKOA 3PLNA 4IMPA 4KFTA 4BATA 5JT1A 4D9GA 2RD2A 1B1CA 1SUFA 1VI6A 2GETA 1G2IA 3QPAA 7ABPA 2JGIA 2VNHA 3Q5GA 4QHYA 3PEFA 4B33A 3JWJA 5FPYA 2FLVA 2UZ0A 3EASA 4RGVA 2O48X 4MICA 4TYPA 1UJ5A 3ANXA 2EKLA 3LZDA 1CJBA 3RVPA 4JI0B 3ZGZA 5IAEA 3GJZA 2FOLA 4OJQA 3DWGA 3JW8A 5ER6A 1NJ2A 3AEKA 1AUVA 3A1UA 4B9EA 4J3JA 2BFFB 3FYCA 3B38A 3A3OA 1YJXA 2A5DA 1IOLA 2CNNA 1R6UA 4G1BA 5KTRA 1IZZA 4EITA 4E5VA 5D5HA 3VPGA 2IYXA 3AU9A 1KAMA 2OY0A 4QX6A 4J07A 1U3VA 5PNTA 1D2AA 1CNFA 4E5YA 4UFPA 2J5XA 2AFHA 1KOGA 1OLXB 4MUXA 2R751 2HTFA 3EA4A 3GJ8A 2XTMA 4O8CA 4CCYB 1ZM3A 1H1LB 1CQXA 3BQ9A 2PBFA 2QN6A 5J2UA 3E3LA 1POWA 1K5GA 4K46A 4B4OA 5CCBA 2V4ZA 3OQIB 5JCOA 1JILA 4CM6A 2IBMA 5GONB 3R3XA 3COWA 1TF2A 4HFNA 2CFOA 1DIGA 4CFYA 2H1HA 2GM9A 3K3PA 4XQ9A 4ERNA 4HLUA 5FI1B 4WUVA 4JEMA 1JAHA 1QB8A 3TXYA 2F64A 5K51A 5MFZA 5C1IA 2NSLA 2WG2A 3FWKA 3RIHA 1FNNA 4GDFA 4FHCA 2AJ8A 3KBOA 3L6DA 5DOVA 2DKOA 1CRLA 3AB8A 4E1AA 3SJAA 1DEAA 1QZ3A 4MOWA 1U8YA 2VHEA 2WWFA 3AHIA 3FVVA 4YCMA 5IWCA 1M7BA 5JS8A 3OWHA 4GWKA 1TC2A 2J3EA 3IAEA 2NZ8A 2PX3A 2VZ8A 1WXWA 3O9MA 5CM2Z 4NABA 4NDZA 3VR2D 2FI1A 2M6SA 4ZEWA 2RB4A 4R2MA 3ITEA 3S81A 1I13A 2QMUA 1E7YA 4O2AA 4QFCA 1WQ1R 4LWQA 2CDNA 2GRUA 3R0QA 1O94D 3ONNA 3ZU4A 4BFCA 1SHJA 1UKAA 1OX4B 3LOUA 4EP1A 3UMYA 1V6SA 4IFEA 2ZYRA 1OI7A 1CCWA 1MW9X 5LB4A 4RTOA 4HRXA 1YL6A 2GYWA 4K8RB 5F1YA 1H65A 2CBXA 5IUNC 1Z62A 2CUNA 2EARA 4YP7A 1KSGA 3LT1A 4NFYA 4IH4A 1RXWA 5A71A 4IVNA 4DUYB 3ZIUA 1WCIA 1TYAE 3BSFA 3HDQA 1H2EA 1PCXA 1NXSA 4YRJA 1Q21A 3DEKA 3VU0A 2MMCA 1QIDA 4EVIA 4K1LA 1RW4A 3AERA 4RA6B 1ENPA 2JFYA 1RAAA 1P4AA 3E8MA 4MV6A 5H4HA 1FW6A 1HQKA 4QYWA 3LECA 3TKYA 2ET6A 4EKGA 4O3FA 4F7WA 2QIOA 1Z8DA 1KDZA 3U3JA 3NX4A 2G6BA 2HF8A 1GDHA 5SY4A 1Z29A 3NGXA 5HPYB 3QVKA 5HWSA 1JJIA 1Z5NA 2PVSA 1MB3A 4C2UA 3FZYA 3N2EA 3CTPA 1L3BA 2BFCA 1WAMA 2Y0CA 2HDOA 4RPGA 1V1RB 2CLKB 4X45A 1R50A 1YOVB 3RREA 3KWLA 2J0QA 3CZQA 2FWRA 1RM3A 1XVAA 2YWXA 1QDLB 1XYYA 5C4GB 2HXYA 1F20A 4E7PA 1C8BA 1E1RD 2WHYA 2FEKA 1KJ8A 1QFSA 1V1MA 3OT1A 4PZAA 2Y27A 4HNUA 2YVUA 3BFVA 3Q6NA 2YVQA 4UM8B 4OQNA 5DEIA 1JEQB 4DXDA 2GCGA 1NL3A 2PIDA 1D6JA 2QLTA 3N7TA 4H16A 4H7PA 3H84A 3QQPA 2P41A 2WOOA 2XNKA 4JLKA 1U31A 4I4TB 3IAHA 3OF2A 4OGKA 1EX7A 1NVBA 3EIHA 3EVEA 4ZDKA 1PK7A 2RC5A 4R4JA 5BSUA 1DEHA 2G70A 5ALVA 2G17A 3KOOA 1NVEA 2NVOA 5BN4A 3C6MA 1L4NA 1C4OA 1MC1A 2GTIA 4MR8A 1FU7A 2E89A 2PLRA 4RLSA 4LRQA 2ZRHA 2BLNA 3ID6C 3PC3A 4HUJA 4B45A 4FCWA 2ZI5A 5DYIA 4C22A 3MXOA 1XZPA 3ESXA 4Z49A 4V0MA 2FHSA 2Z04A 1RJFA 4GP9A 1YVUA 3SWWA 4WCVA 1RSZA 4W9NA 3DB2A 1AG9A 1P0PA 3SEFA 1GLNA 1E2QA 2A5JA 3C74A 1Z5PA 3AP1A 1MA0A 1WXFA 1ZJZA 2AMFA 5FLKA 2OXCA 2NVBA 3I2JA 3R5FA 3W8FA 4F04A 5BRAA 2QMYA 1MEOA 2HL6A 2IZZA 1R0RE 3MT7A 3UAYA 3CO5A 2XBMA 2HDWA 4IIJB 3TFWA 1OLSA 2ZR7A 1XLTC 3A4IA 3B3AA 4OLJA 1A5SB 4Q05A 2VUUA 3I58A 3PC2A 1H66A 1PUIA 1SULA 2IYEA 2PLAA 1S2GA 4IGKA 4IDFA 4CDGA 2PXAA 2MSLA 3OQ1A 4ZV9A 4EUHA 3A6KA 3TE6A 2A88A 3GDOA 3WIDA 5BV0A 5K01A 3EZ6A 2UYGA 3B52X 3GA5A 2RHBA 1NSYA 3H83A 4JZYA 4YCDA 2F3TA 3QEAZ 1W25A 2ZJFA 4DOMA 1QU3A 4PTLA 3G89A 2BONA 3I9V6 2GN4A 4LJSA 2FE1A 3MGBA 4BO7A 3D0RA 2PT6A 5GQSA 4RTJA 1TGVA 4BB0A 1QQ7A 2R2AA 2RHMA 2B2NA 1F9EA 1MDBA 3DUFB 3WTCA 3K92A 4HZUB 1VKOA 1Y3HA 4ZCMA 2MYPA 2PA3A 3OF5A 4GRDA 2QZ9A 3CLRD 1WPQA 4YR7A 3TAUA 5BQXA 5J2TA 2HEIA 2NO9A 4GSLA 4P7KA 5HDQA 3ZWBA 5IT9A 1N6PA 5BUZA 3EDRA 3PEYA 3MK31 1G5TA 1HZJA 4WDQA 5B4VA 3FTEA 4MDYA 4YA6A 3AB7A 5CLQA 1K89A 1T3HA 4AMVA 1V5FA 4TLDA 2FSPA 4XM1A 5GY7A 5DULA 5FUXA 4IIBA 1MGOA 3KYCB 4BNWA 4XIIA 3KALA 1FFXB 4N9WA 4D26A 1T5SA 1S9HA 2R1TB 4UUOA 4XGNA 4XWYA 4UREA 3UWMA 3JX9A 1RXEA 3PC7A 1T9BA 4EB3A 2XCTB 4U8GA 1GG5A 1VBNA 3DH0A 1SQ6A 3M89A 4YPVA 4R0MA 4CKBB 2XUPA 1L1QA 1UC9A 3A37A 1G63A 1NBEA 3LQ4A 4Q1CA 4X90A 2CLMB 1D5WA 2BN4A 5DIFA 5LBUA 3WLLA 4CKCB 1NOKA 4Y7DA 5E3IA 1Y8AA 2HHCA 3HCPA 3Q3GE 4Y6SA 2QXTA 4BTVA 2YTZA 1G5HA 2O3SA 3NC0C 1S96A 3HC7A 1Y7LA 1HRKA 1IBLB 2NP6A 4BPRA 1M7HA 1T91A 1L4BA 2HA0A 1AK2A 1EFTA 3CW2A 1Q1EA 4LKRA 3NVMB 3U37A 4FYPA 2FW7A 4JA0A 1KDYA 3VKVA 2RGWA 2Z56A 4ZQBA 1SKQA 2PGNA 2QNRA 2JEZA 1M6YA 3FWPA 4GMFA 4JBHA 2PRZA 2CWWA 2VPXA 3PQDA 1N2GA 3QJGA 4QQNA 1LDEA 1U2ZA 1WUTA 3VPAA 2JRLA 3QRWA 2YBDA 3DZFA 1NTOA 3A8TA 5E6UB 5TS2A 3ZHRA 1NXPA 4MWOA 4E6EA 4K6MA 4Q9KA 3S44A 4B9AA 5I9LA 1I4WA 1W1IA 4A8JB 3HXOA 2EKQA 2XD9A 1KKLA 3IBCA 4EY3A 3GCDA 5ALLA 2EEZA 4DCJA 1JI0A 3ZD7A 4AT1A 4M98A 1SVSA 1N5RA 2YJ5A 2Y1KA 4WMLA 3MIZA 4ARVA 4XGQA 1BJKA 5B57C 1U8XX 2WUWE 3WKDA 1K4YA 1L5WA 2C4MA 3V8NA 3JASB 4G5SA 1EX9A 3GVHA 2Y71A 2C9CA 2EIHA 4UHEA 3H05A 3EEYA 1ZMTA 2QPOA 3FM9A 4UDOA 4LCEA 1BSVA 4OBXA 4WWHA 2AE2A 3U39A 5C7OO 3MBOA 3E5RA 1HURA 5JQGF 3SHVA 1J39A 1KY2A 1C1XA 2O2GA 3CB4A 2VK4A 4NOKA 4Q6WA 5L3RA 1TM1E 2TRSB 3CF4A 1XZIA 3M3HA 2C5EA 1NF8A 2BHTA 3O2JA 3USZA 1MQSA 4JI7B 2G9QA 3EIQA 1Y42X 3H5TA 2GXAA 1XZKA 4BJHB 2IHKA 4B32A 2X76A 1C3OB 4N5HX 2AN4A 3W8RA 4W8GA 1L4MA 4BP1A 2CC2A 5IM4F 4HO1X 4L72A 2I4RA 2HZ7A 3R7DA 2XBLA 4X1KB 1II9A 3VBEA 3D4NA 3DW1X 3D3WA 4IXTA 3VPBA 4JLNA 3OQOA 3TVTA 2JDIA 3H16A 3L8GA 2ZQ5A 3PL5A 4WBNF 1MO2A 4TMVA 4E5KA 2AQIA 3B1JA 3P27A 2BOVA 4QOFA 4FS3A 1DIHA 2EX0A 3SOPA 4BU1A 4Z54A 3AINA 3LO8A 2JIQA 4U7GA 2YYYA 5HIKA 1XJ0A 2O14A 2ODNA 3EDQA 3HJFA 2P1ZA 1Y9DA 3EFHA 2X0KA 5JMWA 5BSKA 4F2PA 1VBKA 1ZIDA 1X1TA 4W4TA 3PU6A 3E3MA 1GNPA 6PFKA 4PXYA 4AY3A 1K8RA 4B6SA 1KZGB 4BLUA 4C7OA 3O8QA 2X2EA 1HOTA 2X7XA 4ZCPA 1EEHA 3X1WA 2Z3WA 4CL3A 4NZNA 5IDXA 3RDPA 1T1SA 1TKRA 1OAOA 3EOZA 1RHUA 4B87A 4AXBA 3LPDA 4P7GA 4BCCA 2FK7A 2HPAA 4KQKA 3ENVA 3PR1A 3M6IA 1MC8A 4PG6A 3RRFA 3K0CC 2X7JA 3ELWA 1QPGA 1DIAA 2GFIA 3E81A 3BGOS 3I64A 2OFXA 3OPNA 3KUXA 4XWGA 5ESXA 4AB1A 3ZYZA 3TDMA 2VA8A 2J31A 2WJVA 4MLDA 2PQ6A 4PHTA 4RSRA 3RVJA 4BUZA 2QI9F 2GCOA 3MQ4A 4KPUA 5CU7A 4ALKA 1W48A 1LPSA 1SB8A 2QT0A 5HF5A 4XDZA 3OZDA 3WKAA 1O8CA 1T5BA 3G8BA 2VDMB 3NJRA 1XD8A 3LKZA 4JWKA 5IP5A 2PUWA 1NYLA 1WF6A 4RFVA 1A1VA 4L9RA 2O8FB 1RJEA 3PDJA 1XTSA 2FPXA 1WSBA 2BKXA 3DE4X 1PN3A 3C45A 1U5AA 2ZP1A 4HS9A 4DLTA 4F6RA 2E5LB 1LZKA 2I29A 1M8GA 4ILKA 1XQ9A 4DA9A 5CBPA 3RADC 3WWYA 7GPBA 4DCPA 1JPVA 5DM4A 1EHYA 5I7SA 4WSOA 3AETB 4RVDA 4D45A 3L8HA 4S0ZA 1ANKA 2C97A 4TTVA 1H85A 2WILA 3NV7A 4DMFA 2PNFA 3NIFB 3O7WA 1YE5A 3HA3A 3EXIA 3EZ2A 3IKMB 5AJHA 1QC5A 3HSKA 4J1QA 1WMAA 3RUAA 4BY9E 2FPIA 4PLFA 1OI2A 1SHTX 3K1JA 1QORA 5FA6A 3DEZA 3W04A 5FNVA 1FLAA 4PZCA 4LBYA 4EGCB 4KXQA 5DWQA 1BVRA 1QE3A 4C7XA 4BNIA 3V80A 1XDUA 4D0LB 1TYCA 4HVTA 5B7QA 2ANBA 1KDRA 4Q1EA 2BM0A 3COSA 2AC7A 4ZANA 1EWTA 1CDZA 2HQSA 4OI2A 5F7ZA 2V54A 3R9KA 5FR2A 4EJ0A 2W9XA 5D6OA 1D6NA 1ULTA 2YICA 3L8CA 1RADA 1Y4SA 1VPWA 2L82A 4LA4A 3F49S 1KVQA 4ZQGA 2CXSA 1ESEA 2OHFA 3OESA 3BCUA 3H75A 4E94A 3QFFA 4NX2A 2ZIXA 1DXHA 3HR8A 2IS6A 2AFHB 2YZMA 1QLJA 2NM0A 2O3JA 1HG1A 2A0WA 2AI2A 3MB8A 2GFQA 4ARZA 4MLZA 3EPKA 2FPKA 3UY4A 1X1RA 2YQZA 1DBSA 4AKIA 1M7GA 2BMFA 2PMBA 4C29A 2DC1A 2QUZA 4BNNA 3A3YA 2CWDA 4K9PA 1RMQA 1VJGA 2L2QA 1DXQA 3WFZA 2IEDA 4GBED 1OFUX 3AI1A 1Y1PA 4D0NA 1JEOA 3WRXA 3OX1A 3LG2A 1R8SA 3N6RA 2GYUA 2JB9A 2XCQA 1RKVA 1XZDA 2RH8A 3G5LA 4O4JF 5LQJA 1QH9A 5DWDA 4UQLA 5JAIA 1YIAA 3GJQA 1PVVA 3MRTA 4H9GA 4ZARA 5ICSA 3AF6A 4DE5A 1AV7A 4LY9A 2HJWA 1N1DA 4LTMA 3RK4A 3W9YA 1CQPA 1K2VN 5IF3A 4QGSA 4QGGA 5ALOA 1JVBA 4BNKA 2Q6KA 5HE9A 1L4HA 3EOAI 4R40A 1CUAA 3KYBA 2WTAA 4CIXA 1KA9H 1W6UA 5DZSA 1H4SA 1WCV1 1BD3A 4HH3C 1WETA 3RBAA 2AN1A 5KCMA 3KU1A 4IOJA 1E20A 2FVYA 2RKWA 4KOEC 4NCJA 3BXFA 4R2HA 3QMPA 2JI4A 4RD1A 4MJ7A 2BWJA 2XA2A 2HT6A 1FYFA 2XNDD 3PFKA 3ZUGA 2V7QA 4M8SA 3R3WA 3I2IA 1QG6A 2XPCA 4GOOD 2YC4C 3UJ3X 5J58A 1QFZA 1XCGB 3KS9A 3C41J 1QRUA 1EESA 2PGXA 5EQDA 2RAUA 4DW8A 1PRYA 3T1NA 4M0FA 3OOJA 2YJ4A 2GD6A 1PIWA 3AERB 4F2HA 2HXSA 3X0DA 4ECAA 1T15A 2V7GA 2VP4A 2WKQA 3P0EA 2XD4A 4R31A 3RS9A 5LJIA 2EGUA 2PPLA 2O2CA 2NO1A 1Q19A 2PX8A 3E58A 4NFHA 2A58A 3LYHA 2NUTA 1U0EA 2OV4A 3AEYA 2BRUC 3MQFA 4RORA 3IMKA 3PUKA 5FKJA 1R1DA 2PO5A 1OXSC 1U28A 2XRMA 2WKPA 2EU8A 3CW8X 2XYRA 4UBKA 3BULA 1JIXA 4C1NA 1E2LA 3V7WA 3LY8A 3C15C 4B6FA 5JAUA 1GM5A 2JFVA 2YHUA 1GCGA 1FFWA 3AKCA 3H3JA 3Q85A 5COQA 1LTKA 3K71B 4PZ0A 2GWHA 1C1DA 1XTPA 2QTTA 4TXMA 1LS6A 2FOIA 3DNFA 4KMRA 4J3FA 1OW3B 2G07A 2X40A 4HEQA 4IDBA 4N39A 3IT3A 1UPAA 1BFKA 1Z13A 1EE1A 4XDHA 1NXWA 2LWIA 4I5DA 2CF6A 1Z17A 3FPCA 4CKWB 2BFAA 2Q0HA 2J4DA 1S02A 4H1HA 2P40A 1YR3A 3WK8A 3H6HA 5AUQA 4BMNA 3ZQ6A 3PPWA 4MRNA 5CLFA 3DE3X 2G4LA 4FHFA 3NEYA 3PR2B 3ETCA 5TVGA 4DNOA 4BO0A 4N7RA 3TW8A 1EG7A 4TLCA 2D3WA 3MC1A 4Z5XA 2QZ4A 3OZEA 3KKZA 2AHRA 2X41A 2QAGA 3S40A 2Z09A 4AYTA 2F8LA 2WJPA 4TWBA 2OXIA 5T4FA 5HR5A 3S27A 4EECA 1KO8A 1SBNE 3JRWA 1YF3A 5DX1A 3ZJ4A 4J0HA 4LJ4A 3ZHZA 3KSAC 4GSYA 3H4TA 3QNMA 3VNUA 2ZB7A 3QFSA 3NBMA 4R1OA 4LRTB 5G4LA 2QVCA 3Q4GA 4MPPA 2CVFA 3CZ4A 4ZREA 4L85A 2W6OA 3L07A 3MWJA 1PHPA 3RT9A 4DDUA 2BJHA 2I99A 1Z4LA 2QUAA 3QPUA 4DM7A 2IU0A 5BYJA 5KYUA 3CZPA 1V7PC 5HUHA 1XVIA 3MXTA 2I3DA 1W0KA 1MAHA 3MAJA 2GHTA 2C2MA 3U3DA 4IOKA 4CT5A 1A50B 2Q45A 1LSJA 3BXGA 3HR7A 4BPBA 1TZ2A 2NXCA 2PGLA 5J4LA 3SM3A 1YR2A 3IL2A 2D7DA 1H6BA 1HSOA 2CHGA 4NYIR 4X66B 5CPFA 5EMJA 4RDXA 1OA1A 3A2NA 1BHSA 1UAGA 1GO2A 5AK0A 4EHKA 3ZCUA 4CI0B 1O4VA 3BF8A 4EI2A 1SC6A 1SQSA 2ZQZA 3PNBA 4YJ3B 1W6RA 3V4PB 1WNTA 2O0HA 4Q3EA 1ZC4A 2X5NA 3K73O 4MCAA 5CDSA 3RAFC 3ZHOA 2QF7A 3CLSD 3O3NB 1LH0A 1O54A 2P9QA 2FQXA 1ZO8A 3RYHA 3OQMA 1MW8X 5LBIA 4F8YA 3ZHXA 5BR4A 5IDQA 2OBNA 2PKYX 2GARA 4HPXB 4ZDIA 5J4HA 2JG3A 2JGEA 4C04A 3RU9A 2IYVA 4IF6A 5JS1A 1NLFA 2VNKA 3W8NA 3QEBZ 3V48A 4LMRA 3D4IA 5CLLA 5H7XA 3T3DA 4CF4A 3AXTA 4EI9A 3KVOA 5AIBA 1Z34A 1GVNB 1IWOA 1P0CA 2RGXA 3EDYA 4F4FA 1JHXA 2WFLB 3LF1A 3MBIA 4FWIB 3T3HA 2RH4A 3RC1A 1NE7A 1J06A 2H9AA 4GPBA 3WLEA 4IW3B 3EEFA 3A9WA 4CGYA 5A4DA 4M7WA 3OLQA 3WXBA 4YRSA 4M83A 3ENQA 1DAMA 4AYXA 3LUKA 2QLMA 4BQEA 1U0OC 3R7WA 1US8B 2HLNA 4NXMB 1ZGBA 4MJXA 1GV0A 2G8NA 3IERA 4YUWA 1WUYA 2JFHA 4FIZA 4W5QA 5EIXA 1HDZA 2GD0A 3EFBA 4M37A 1YMQA 1DWPA 3D6UA 1U7XA 1W5BA 2VS1A 5IYZF 2QX6A 3IAM6 1I2BA 4GUAA 3ZDDA 3P2OA 4KIUA 3OQNA 3L7LA 1FPMA 4PANA 4DRXA 2EBHX 3K9NA 5JASA 2OOKA 5FD8A 1NT2A 1EFHA 4GW3A 4IEEA 5CB8A 3BWYA 1COWD 2QA5A 2Q4DA 4X1IA 5HIJA 1BS9A 3STUA 5H4GA 1CULC 2IXBA 5JDCA 2IPXA 4PM4A 2W2VA 4O4IB 3DLHA 3I9V1 4D46A 5CT8A 1B43A 3L79A 1NQAO 3SXUA 2Z9DA 2UU9B 1N6NA 5DCWA 3CF6R 1AS2A 1GPJA 1KMCA 2W37A 3JQ8A 4G4SO 2A94A 2WPDD 4LXIA 5IH3A 3ZN2A 3R7LA 2F62A 4WT7A 1SRRA 2VRWA 2VDVE 1KK1A 3MAGA 2C57A 2HV8A 3VR4H 1SZPA 3SGLA 1XP8A 1APBA 3NHSA 3ROGA 4JI3B 1JR6A 1N3BA 1Y81A 1MO5A 1XTVA 3I72A 1O9HA 3MPOA 4ZZ3A 3K35A 5HSGA 1MZPA 3SE7A 1SUDA 2NV0A 1C1XB 4D81A 1MV8A 5AW0A 4DR1B 1IATA 4E30A 4DIBA 3CCFA 3PA6A 4FGKA 4FTWA 3UAOA 1IHUA 4TVOA 1SOMA 1JHMA 5A9RA 4LG1A 4WBXC 1EUCA 4K9LA 4R41A 1OI3A 1WB4A 2V3WA 1QWOA 4PXAA 4MV4A 3KLBA 4CLXA 1REQA 1UAAA 5AVZA 1M8FA 5B1YA 3EFOB 1ZHFA 4D4GA 1TM4E 3ZY4A 4EARA 3A6EA 2D00A 1E59A 4OYHA 1EIZA 1ZJ6A 4B6OA 5KYYB 4PAGA 4JCCA 3WHLA 3FOZA 1D0SA 2Z4SA 1UJ2A 1KC1A 1RWQA 4TT3D 4XSGA 5EWMB 2VDWB 1OMOA 3B1ZA 3T5TA 1ZVKA 3TLCA 4NR0A 3RVRA 3ZDFA 4UXJA 3KHKA 1AVTA 1YH3A 3NS7A 3ERCA 1FSZA 2CL7X 4HEHA 4CM7A 4MCJA 1GFZA 3MA0A 2INGX 3H11B 5G1OA 1ZW1A 3OPQA 2KI5A 3N0XA 1GCUA 1YTUA 2ZE5A 3HBLA 4HQOA 2P2GA 3R8XA 5AESA 2VSXA 1L8OA 3MHTA 1K8ZB 4XSHA 4Y8VA 1RYMA 1WVIA 2E18A 3RKSA 1MA3A 2WJIA 1CZLA 3F97A 3DMDA 2Y2VA 3GRYA 2XT9A 3RV3A 4D41A 3LZCA 2N0SA 4DJAA 3VAAA 3IQGX 5E1OA 3H04A 1ORWA 4NY1A 4L4UA 4WZBA 2BELA 3U5TA 4B81A 5DGCA 3V32A 1SC4A 1U9JA 3LLMA 5G40A 2F67A 1QP0A 3I83A 2C9YA 2DHCA 3AYZB 3CX7A 3QUQA 4ISBA 5D2CA 2E4ZA 2V6IA 2OV2A 4BBAA 2CLSA 2Q5JA 4UM5A 5LNK1 2I2XB 4MV7A 4QTYA 1TZBA 4FCCA 1U2RA 3BL5A 1Z6AA 4U5QA 5DVZA 4KPUB 4XVQA 3Q1LA 4L78A 1C30B 2RK3A 1KP9A 4CKXA 2I6UA 3K7EA 4LYAA 1IPHA 1Q1QA 4GLJA 4RF3A 1ULZA 3H4VA 4LFCB 5JYCA 3D1JA 4FNOA 3AUUA 2HU2A 5CA1B 4KJZA 4DAEA 4RY0A 3TWOA 3EXFB 1TKBA 3DBIA 3KQWA 2WQZA 4XX1A 4ZC1A 4F71A 1NV8A 3AR7A 4WL0A 5CBPB 4EG7A 2XY4A 1I8TA 1LX7A 1K8XB 2GH1A 3K0SA 3B1XA 4JI2B 3FNIA 5AI4A 5B36A 2JGDA 5DNUA 1ABEA 3MWDB 4OQQA 5A4AA 3IHWA 4ZVUA 2QR5A 1HDCA 2OAGA 2VIIA 4DLNA 3B13B 1IPEA 1OV4A 3HJUA 3WNCA 3RKUA 1GZSA 5LP6C 2RIPA 3A4YA 3T5MA 1KJ9A 1H0HA 2HWUA 5ALZA 4CLOA 3TSCA 2H0AA 5EJAA 1LF0A 1SVWA 2FPIB 3ZVKA 3NHJA 4Q1VA 3HVIA 3AUFA 1Y37A 2PZ8A 2NSYA 1UBOS 3I5MA 4Y9RA 4IHQA 1DL5A 4F2DA 4BKPA 5IWAB 2PEZA 2R7KA 2DYKA 3LC2O 4HC4A 4X64B 1M83A 1SHZA 1UK8A 2XYGA 4Y2JA 1JA9A 1VDMA 4ZI7A 2Q4EA 1P5HA 3VTFA 3DG9A 1ZYUA 2I4MA 4JELA 3HBAA 5FFFA 1QGYA 2EG5A 3WNVA 2WR8A 3BGVA 3KE8A 1EJ6A 1XBTA 3NBFA 1H8EA 1T0IA 2A5GA 2ZS7A 1TJYA 1I2MA 1V8FA 1XQVA 3KUKA 4YRMA 2RAFA 3ORQA 2IZ1A 2GHIA 1GRCA 1VG8A 2O06A 3OM0A 1IEQA 4I9FA 5DW0A 5J40A 4JQYA 2V7VA 2VXOA 3O75A 1YZLA 4K03A 2HB6A 4OJMX 4RDCA 1F4PA 1V35A 3PHJA 4MMXB 4RTQA 2OOSA 3AHEA 4UMEA 2Q6VA 4PG7A 2FPLA 4JODA 5K0JA 4HQFA 1AOXA 1KAGA 2TS1A 2OESA 2ZCUA 4GMDA 1TXGA 4DR3B 1T6XA 2QT9A 1IYZA 2XJ9A 1K7YA 4KYIB 4RC9A 1Y5IA 3CEJA 2W0MA 4G5GA 2BGUA 1A7KA 4C4SA 1ZINA 3IAS6 5CEJA 2YMQA 4L5JA 4HDSA 5A3VA 3UJHA 1P9WA 2ID9A 5FBZA 3TBKA 2QTCA 5LP6A 3DULA 3EODA 1RXSA 1QF7A 5AM0A 4MUIA 4CZ2A 3MSXA 4DDVA 3ONVA 4FFRA 4OB7A 4B43A 1ZI8A 2JJ1D 1YUBA 2PBRA 3B6ZA 1CY0A 3F6PA 3GJ7A 3IBSA 3IBTA 3KLPX 3L1KA 4ND8B 5AW5A 2NU8A 1G1AA 4A03A 1CPYA 3H5RA 1E1DA 4U2CA 3V97A 3RU3A 4QGAA 4F92B 3THWA 2W2PA 1RZRA 2HN9A 2NOAA 2QTWB 3DZCA 5JS2A 2P78A 4GXQA 5ALHA 4FE7A 5KYVA 4WFIA 2B7LA 4WH0A 7MDHA 5FTJA 3JTMA 3PNSA 3T7DA 1U63A 1CYDA 1VIYA 2Q3MA 2PS0A 5A4FS 1BMQA 4BP8A 3KXPA 1X1DA 2ID7A 3G9QA 2PYDA 4ZA2A 2HREA 4UDXX 4Z1OA 2QRKA 1YB7A 1CVLA 4H7IA 4HV4A 4IEIA 4CR8A 1ZY2A 2F48A 1WY7A 2HBYA 4Q15A 2ODWA 2Q2WA 3E18A 5A3SA 1DAIA 2Y6VA 3MINB 3OO1A 4PC3A 5ES3A 3TIVA 2BSXA 3QUBA 4U7TB 5CNMA 5D1NA 2XGOA 1U7DA 4ZC8A 3HA2A 5I4BA 3RJ5A 1KYWA 4GI7A 1GUBA 5FOUA 1CVIA 4OK5A 3RTCA 4H27A 3MWLA 3DOOA 3THXB 4Q4DA 3EJWA 1FJGB 1ZAKA 2VRBA 4L6AA 4NU5A 1A4UA 4QJ3A 2X0JA 3ORFA 1SBCA 4CG2A 2YV2A 5JWOA 1H5QA 1TC1A 1EU1A 3F3KA 1XJQA 1U02A 1YKSA 3DV0B 3KUDA 4B3IA 4GKKB 3GLFE 3COZA 1CFZA 4IP0A 4K26A 1L7VC 1GCAA 3RYFB 4EENA 3WIEA 4DR6B 4S2UA 2UXCB 1P1FA 3EQ8A 2CNWA 3GUVA 4NECA 4MK4A 1ZH0A 1JU4A 1ELOA 2GCIA 2XVMA 4HDNA 4F5WA 3ZBUA 4OLBA 3GLRA 3PIRA 1NW8A 3NM5A 3NHMA 3P2JA 3VXKA 3L0BA 1PG0A 4V0LA 4KWHA 1Y9ZA 1USUA 3FFTA 4PR3A 2LKDA 1FVOA 2GZSA 3IA7A 5BO5A 1P81A 2NO7A 4BLOA 4BWYA 4JVOA 3PFBA 1K7XB 4TN1A 1RQRA 3ETEA 1JNXX 5LZ8A 1R3UA 3NHZA 2B36A 2VTEA 3CNBA 2W2XA 2PFSA 2WHXA 2OVFA 3QUSA 3I6QA 5ECGC 4R3WA 1U8CB 4EGQA 3CB2A 1SJ9A 1V6CA 1WVGA 3IDAA 2X9GA 3LUPA 3QK7A 5FBKA 3DAFA 3H1AA 4Y6LA 3L06A 2E5FA 3RLFA 3ZWOA 1QK3A 5IJ0A 1ZNYA 5U4QA 4DA4A 2JA1A 4MKHA 4CM5A 2W83A 4U00A 3P2EA 4Q4HA 3SKXA 3ONFA 3NXKA 2C7VA 4ER0A 1BG6A 2GN0A 5ESRA 1QTNA 2ZYWX 4YN3A 5BVHB 3A9VA 2NNLD 4F1KA 1UXJA 3G8YA 4MUBA 1GN9A 5EZYA 5MHTA 2EZ8A 5EIOA 5ALNA 4WKOA 1QOPB 4LZOA 4YDSA 4XD2A 2ZSKA 4XB6B 3DEYX 5GAJA 4XQEA 3WHKA 4ZZIA 1P0FA 2QRJA 4I4IA 4J0EA 3AM3A 4N3AA 3NHFA 4QPPA 2EIXA 1U2QA 3OMWA 2NGRA 1Y8RA 4UNQA 1HKHA 2W98A 2ZYUX 1P8JA 3QSGA 4DWOA 4FMCB 2BFDB 1PEKE 1EDOA 5ABPA 1WB9A 1OGYA 4IUBS 2W4IA 2ZUSA 4IGIA 4DMUB 5GIPE 4NNJA 3B89A 3GEPA 3U3OA 3L0PA 2O52A 1Y1KE 3KIPA 3JWGA 5G4KA 2NU9B 1WY5A 4D8YA 3GLQA 4KO8A 1P5ZB 3CH7A 4P4GA 5U1PA 5M34A 5DYTA 4CQNA 1HC7A 1AUOA 1OLUB 3UN1A 3ADCA 2MOKA 1TMKA 4N12A 2G25A 3QMVA 4JZKA 2I6SA 2YXDA 5AVWA 2RJ3A 3H86A 5EPEA 5FTNA 2F8MA 4DNFA 3TTUA 1H9BA 1XCPA 2OG2A 3EY4A 1FJXA 2Z2ZA 3KSMA 1M2OA 4WA8A 4KHZA 1EWQA 1ARZA 1IHPA 1U0GA 1AURA 1CVRA 4EY7A 1LB1B 1N6LA 3Q2OA 3I92A 3FJ1A 2BFEB 5EZ5A 3UMVA 3WYNA 4PW0A 2Q3DA 5ECDA 3SFZA 1Q6ZA 4O63O 4PWZA 4TL8A 2N47A 1VXOA 1EP2B 5JMOA 5G0UA 5FBVB 1FP6A 2CKDA 3DW3X 1ESCA 1MOZA 1V5EA 1Y48E 2BW0A 3KAPA 4NIMA 4QEKA 2O6LA 3ZQUA 5LQNA 3MWEA 4JBGA 3TLBA 4QPJC 1T9DA 2E21A 2OCKA 1G60A 1TW3A 4PWYA 3SKYA 3EMDA 5CAEA 1CQWA 3IYLW 1ACJA 3OM1A 4P80A 4EG8A 4TTSA 2XB6A 3A31A 3K9WA 5HQ3B 4K9DA 4R7GA 3EF0A 2PVPA 4C2TA 1JEYA 3AVQA 4I99A 1YL7A 1Z7GA 5JXGA 4ZVNA 4H7EA 2PWBA 2FMXA 4YDHB 4RXMA 1D03A 1SCNE 3TNFA 3W3AD 4WVLA 3SMVA 1J09A 1G6Q1 3ICQB 1B2RA 3KYJB 4TYQA 4KREA 3WFJA 3DC7A 4GOKA 5DYWA 5H83A 3CVJA 5HKBA 1LFAA 2P9JA 3B7WA 3GMIA 5HVNA 4RK0A 3GXBA 2IIVA 2NO6A 3RGWS 2C82A 2GCEA 4MAFA 2FN8A 3KJXA 2WU8A 1BX1A 1T4CB 2YDYA 4E70A 1S89A 3FMOB 4JP3A 5AM1A 4ZMBA 1XN4A 3E3OA 1XIVA 1ECFA 3OY2A 1PYDA 3PNLA 5EJ9A 4QWWA 3SQWA 5BORA 3N2KB 2FJUA 2P5UA 4ID3A 4QBGB 1P4JA 4KBFA 3OJOA 4D82A 1WQ4A 1N92A 3C7KA 1MB0A 1RCUA 2IT1A 1PAUA 3HRHA 1XZ8A 2UYQA 1J22A 3C6XA 3WLKX 1PWEA 5HQJA 2FWBA 3VPCA 3DTVB 4X1IB 3MLEA 4TVKA 1QUFA 3EUFA 4UC0A 2VOEA 1KJQA 4O2BF 3OUTA 2GT1A 2EV9A 1QVWA 1KRWA 1Z2CA 2P8JA 1O5OA 2OB2A 1KVRA 3SXUB 1K7SN 3P4YA 2M6LA 4HT3B 1FRZA 1CR6A 1MC4A 4YP1A 2YIVX 1X7DA 1R8YA 3E7XA 3OE1A 4ZODA 1WJGA 1IQRA 4QKQA 2KE5A 4FHEA 1AKNA 4PV7A 4TXNA 4YJGA 4YWJA 1PGQA 5K0GA 5L3QB 1JFSA 2V7BA 3AWIA 4IV0A 4W5RA 3W6ZA 2FWMX 4LJYA 4LX8A 4LDRA 1EK5A 4NDNE 5AW2A 4Q12A 4YROA 2QE7D 3RQSA 2WB4A 2VBFA 4EB6A 4IX1A 2EHJA 4J6EA 1MCZA 3Q12A 3BEOA 2RJOA 1EMDA 3MJ4A 3NTLA 1U9IC 3R6DA 4JIMA 4P7FA 4R54A 4PVDA 4TT8A 4ZQFA 4XI9A 4J91A 2UYCA 1DIBA 3N76A 4G0MA 1FFHA 3NVAA 5CK4A 3HADA 2I91A 2BFBB 1TD1A 4NARA 1Q92A 1GRQA 1U80A 1WVMA 3SNKA 1JSZA 1NBIA 1Z4JA 3SFTA 2V4UA 3ZWXA 3K31A 4DIOA 1WZUA 2WD8A 4ZKEA 3NTRA 4QREA 2G4VA 1PW5A 2Y93A 2R65A 4IVQA 3NEJA 3FZNA 2PTGA 2OCBA 1BTOA 3PXAA 3R9XB 2FPSA 4JBWA 3PYXA 4HN9A 2V7WA 5HJ2A 1GGVA 2AE1A 3IAM1 4D3XA 5BSRA 1KJJA 2P8SA 2HC9A 1V6AA 6REQA 4A6DA 5K0EA 2YZ2A 1JAZA 3IPYA 2N1BA 1ZUHA 2HJGA 2WSMA 4DV6B 1B0ZA 3FNFA 2WLSA 2VAWA 3MT0A 1L4GA 2CDBA 2CZCA 4EH1A 4DLUA 3F67A 3PFNA 4PG5A 3W2HA 1FFCA 2OWDA 1J2EA 1UKCA 2FG5A 3K05A 1LF5A 1XTIA 2FZ5A 2WSBA 2XQGA 2OHIA 2H29A 2Q4OA 3NOOA 1W19A 2GBLC 2I1QA 3E9YA 4P4SB 1NXXA 4M1MA 5DX0A 1WHSA 3FSEA 4MYUA 1E2BA 3H5LA 3P5SA 4IDEA 5JZ9A 1CS0B 4PHGA 3UJ9A 3V4LA 2IE8A 3WSVA 1VFNA 2YV5A 5KJFA 1ZR4A 5CLHA 4LF6B 1OHHA 4XUGB 1GXSA 4PX5A 3MILA 4FW9A 1L7QA 3WICA 2CVZA 3L7BA 1S4QA 3E7FA 1G0NA 2HPZA 2W11A 1YDWA 2VEOA 4HFJA 4OLHA 1I3CA 2C2OA 4OEHA 2IXEA 3OTIA 4HDOB 5LDGA 4LC9A 2Y1CA 4WQMA 1JQ5A 2AWOA 4TN5A 1NMQA 2C2WA 2FW0A 4OH7A 5TR9A 2C7PA 2HCBA 1KRXA 2I54A 3DC2A 3FTNA 2GRAA 4X97A 3QE2A 2XT0A 2QTVB 1K0FA 4UU8A 3L8EA 1CW2B 1IWPB 3G2MA 4IG4A 3C3WA 3H2YA 4E5DA 3Q9SA 1FNDA 2YNMC 1O95D 5KQLA 1ZG3A 1Z7EA 1OJ7A 3JYNA 1W4LA 3K8ZA 1L5HB 3C3EA 4V2UA 1EWKA 3C7AA 2VHVA 5KYWA 2RAPA 3BS4A 3UH1A 3ZHVA 1QIJA 4EA8A 1MO6A 1VSQA 4OHRA