3QLEA

Structural basis for the function of tim50 in the mitochondrial presequence translocase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
186
structure length
182
Chain Sequence
FPDLLPPPPQRPLTLVITLEDFLVHSEWSQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADDKLVRLIPFLEYLATQQTKDVRPILNSFEDKKNLAEEFDHRVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Tim50p
publication title Structural basis for the function of tim50 in the mitochondrial presequence translocase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae ec1118
total genus 53
structure length 182
sequence length 186
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qleA00
3L0YA 2I55A 4UATA 1N8NA 2I34A 5AVQA 2B0CA 5AI4A 3E81A 3WKCA 3ZX5A 2JAUA 3WGVA 3AR4A 3UMGA 5AESA 4BX3A 2HO4A 2GMWA 1RPZA 1Z5GA 5AKKA 1NRWA 1TE2A 5AVXA 4BKMA 2QYHA 1Z4JA 5AKJA 2YJ6A 5ALEA 4XQ0A 1L7MA 4FE3A 4G9BA 4E88A 5AK4A 2EARA 2WF8A 3MMZA 3WKBA 4Y2JA 5AW7A 5ALRA 2P27A 3NAMA 3L7YA 3ZTYA 2YMPA 3WK4A 1RMYA 3IJ5A 4C4RA 3AR9A 3EF1A 3W5DA 3U7EB 2DQSA 4KYTA 3EF0A 2AH5A 2HF7A 1XPJA 2WHEA 2CFRA 1WPGA 4NV0A 4EEKA 3P96A 3RFUA 1TA0A 2B8JA 3L5KA 1SWWA 3J7TA 1VFPA 4NABA 4MWOA 1QH9A 2P11A 4GIBA 4UAVA 1QQ5A 3AR3A 5AKXA 2PKEA 2CFTA 5AKGA 2PR7A 3N1UA 5ALSA 4UMDA 1YMQA 5AM3A 4NFLA 4Y2PA 4EX6A 5IT0A 4HYTA 1XP5A 4UMFA 1Q91A 3KC2A 1T5SA 3IB6A 3QLEA 3PGVA 3S6JA 4UM5A 2MU1A 5AICA 4NAVA 3MC1A 2IOFK 2IOHA 2GFHA 3QUBA 4ZEVA 1IWOA 5AVYA 5AKLA 3FGOA 5AW1A 5AW5A 1TJ3A 3UM9A 1QQ6A 2C4NA 2OA0A 4KX5A 3A1CA 5AKYA 5AM2A 4EELA 1CQZA 1CR6A 5AVTA 5AM4A 5T41A 3WK6A 5A3SA 4UW9A 4DWOA 4HGPA 3OTQA 3MN1A 4IG4A 5AM1A 4UU1A 2IYEA 1EK2A 5AKEA 4YCLA 1L8LA 1S8OA 5JJBA 5AK6A 2BDUA 1NF2A 3QYPA 3L0CA 5AKIA 2WM8A 3ET4A 4Y2RA 4DCCA 2P69A 3QGMA 4Y2TA 2HHLA 3L1VA 5ALZA 1RQNA 2ZG6A 4Y2QA 2P9JA 5AK3A 3R09A 5ALUA 5AVSA 1Z4MA 1Z4NA 3R4CA 4JDPA 3DDHA 2HOQA 4UMVA 3SKXA 1Z5UA 1YS9A 2JAOA 4ZEWA 2R8YA 4Y2XA 5ALTA 2I7DA 4HAIA 2HI0A 2B1RA 4OHFA 1EK1A 4H1WA 4B6JA 2Q4RA 3AR7A 5AI6A 2BDEA 1RLMA 2AUTA 2B1QA 3KD3A 4YH1A 2BY4A 4HGRA 1ZD2P 4J2TA 3N07A 4Y2VA 4Y3UA 4CF4A 2G1AA 2HEGA 3L8GA 3BA6A 3ZTWA 3R9KA 1T9ZA 1L7NA 5AK5A 4YCMA 1FEZA 1L7OA 2PQ0A 2X4DA 3AR2A 5AKZA 3WK9A 3HYCA 4F72A 1QQ7A 3ESQA 1F5SA 3OCXA 3OCZA 3U7FB 1J97A 3FZQA 4EZEA 2CFSA 1ZS9A 3KZXA 4CE6A 1RKQA 3L8FA 3DNPA 3ET5A 3N28A 5AVWA 5AI9A 1U7PA 3ZUPA 2GHTA 1Z4QA 3QUTA 5E0OA 4UM7A 4QJBA 2WF6A 3NASA 3ZVNA 2JARA 3QU9A 1RDFA 1ZD4A 3N5KA 3ONNA 3QU2A 2G06A 5ALWA 1RLOA 4L6CA 5AVVA 3ED5A 1RMQA 2HX1A 3KOOA 1TJ5A 4HGNA 3OCVA 3OCUA 3ZI4A 1ZD5A 4HGOA 5AI0A 2B82A 5ALJA 1Z4PX 4OD0A 1RRCA 1YDFA 1RLTA 5AM0A 2YJ5A 2ZBDA 2OYCA 2R8EA 1YNSA 1X42A 1MH9A 1S2OA 3I1YA 5FP0A 3I28A 4AS3A 3W5CA 3VAYA 4YIKA 2G0AA 3B8EA 1WZCA 4XOUA 3B9BA 1K1EA 1U02A 1ZOLA 5ALVA 4YCNA 2Q5EA 2W11A 2NO5A 4BYGA 2Q4TA 5AVUA 1U2TA 3KBBA 5AW0A 5ALQA 3RF6A 3BWVA 4OFZA 3FVVA 1N9KA 3ZVLA 4KN8A 5IS2A 3OCWA 1AQ6A 3TLMA 2IA5A 4KNWA 4DFDA 2I33A 5ALYA 2FDRA 3MPOA 3W5BA 1ZRNA 3ESRA 3AR5A 5ALKA 5ALNA 1SU4A 3QU5A 2YMQA 2YMLA 4EENA 4GXTA 1QYIA 4Y2YA 3L8EA 4I9GA 1Y8AA 4UARA 4DW8A 3AR6A 4MUMA 2ZBFA 2C9MA 2G07A 3ZW7A 5ALPA 5AW4A 5ALGA 3U26A 4RESA 4HGQA 4AS2A 3U7HB 1ZRMA 1RC8A 2I6XA 4BX2A 2HCFA 1Z4OA 2FPSA 3B9RA 3A1EA 4CNQA 2B8EA 2JAWA 3U19A 2ODAA 2YJ3A 4CF3A 3L8HA 4BNDB 2QLTA 3EWIA 1Z4LA 2C8LA 1ZD3A 5AI5A 1J8DA 3D6JA 3ZWKA 3L1UA 3SHQA 3CZ4A 1ZJJA 5A3RA 2RB5A 1KYTA 3PDWA 1RKUA 3K1ZA 3QU4A 4OCZA 1L7PA 2HSZA 5AI8A 3E84A 2YMMA 2B30A 3WKDA 3WKAA 4UU0A 3W5AA 4XPZA 5AW9A 3DV9A 4BNDA 3GYGA 5AIAA 3E8MA 3OCYA 3HLTA 5AW6A 2FI1A 2YY6A 1O03A 3SF0A 1Z4IA 3FM9A 5AW8A 1RQLA 5AVZA 2VKQA 5AW3A 1Z4KA 2C88A 2ZBGA 4Y2UA 3KDPA 3A1DA 4L6AA 3SMVA 4UMEA 1SWVA 5AVRA 2GO7A 2RARA 2C8KA 2D2VA 5AKHA 4BEVA 5ALHA 4UASA 1WVIA 4C4TA 1YJ5A 5AIBA 3CNHA 1U2SA 4KX3A 1VJRA 5ALXA 2HDOA 2WF9A 3NIWA 5ALLA 1PW5A 5ALDA 3M9LA 3NRJA 4C4SA 3PGLA 3SKYA 1U7OA 2NYVA 3IRUA 3WK5A 1LTQA 5IT4A 4PNHA 2WF5A 2FEAA 2FPXA 4XE5A 3SLRA 3WK7A 5A3QA 4BBJA 2R8XA 2FPWA 4AP9A 2RAVA 3UMCA 3WGUA 5AM5A 2MSNA 4I9FA 5AHXA 3ZX4A 2RBKA 4YIHA 2W43A 3AR8A 3SD7A 2IOFA 5AW2A 2NO4A 1YV9A 2AGVA 3ZVMA 1VJ5A 1NNLA 4ZEXA 2ZBEA 3L0BA 2EAUA 2I54A 5ALMA 3U7GA 3FPSA 2O2XA 5ALFA 2G08A 2G09A 3WKEA 1TJ4A 1T5TA 1L6RA 3NUQA 1RKVA 4O8CA 5ALIA 3QUQA 4FFDA 4CF5A 3I6BA 4IFTA 2YBDA 2EATA 2JGAA 3A3YA 3E58A 1JUDA 2W4MA 2WF7A 2FPRA 3UMBA 1O08A 3ZWDA 1XVIA 4F71A 4EX7A 1Q92A 4G63A 3QX7A 4J03A 4RETA 2FPUA 3NALA 3U13A 4Y2SA 4YGYA 4BEWA 3M1YA 4QQFA 1Z88A 4JB3A 3N8GA 3QUCA 3QXGA 2ZOSA 3OPXA 4BX0A 3NANA 3QNMA 2ZXEA 3QU7A 2FUEA 2YFYA 1LVHA 3I76A 4NWIA 4FYPA 1RMTA 4UAUA 4KNVA 4L57A 3WK8A 2HF2A 3DAOA 2O9JA 2FUCA 3EPRA 1L8OA 2OM6A 3ZU6A 2YN4A 2YJ4A 2AMYA 1WR8A 2OBBA 3F9RA 2GHQA 3PCTA 5ALOA 2WFAA 2CN1A 2R8ZA 3FPBA 2G80A
chains in the Genus database with same CATH superfamily
2FPPB 4MH0R 5F64A 2WJHA 3UYKA 4TYYA 4N39A 3A3KA 5K01A 2Y6VA 2PMDA 3HN2A 4MV7A 3RLIA 5B1YA 2C7QA 3A1NA 1L7AA 4NR0A 4AJIA 4KG7A 2BSQA 3D5QA 3TZEA 3S2EA 2JH3A 3AR4A 3LUPA 2OHFA 1X70A 2GA9A 4X1KA 1GAWA 3JZIA 2GSDA 4IHJB 5CU7A 1KKLA 1XZNA 2OO3A 4O0LA 5JNWA 2WT8A 1QRUA 1E6LA 4EEXA 4AQYB 3OY7A 4B3JA 4E5YA 2PGOA 1QYWA 4PFSA 2FQXA 4K6MA 2Q9UA 1XRRA 2ZI9A 1U2QA 1Q0UA 4YRFA 2OHHA 2EZ8A 4KO3S 2HC9A 1WBBA 1PEAA 2YIMA 5EZ6B 2J6HA 2CYCA 3R0VA 3EAQA 1EVLA 2WJIA 3GPLA 4FE3A 3IEMA 1EVIA 4ZZIA 3ADKA 3D3QA 4F3KA 3EW9A 1XCGB 4ID9A 1NFFA 4TRRA 2IV7A 4A23A 1GAQA 3ZTYA 2IPLA 2PFGA 3ZH2A 1DAGA 1E2MA 1ULBA 3GVXA 1Z5NA 2AF4C 2KPOA 5F3RA 3ZWPA 4AZWA 4DG8A 4OREX 1JQ3A 4J6FA 5I8PA 5JR3A 1OBFO 3UFXA 1GR1A 2PZMA 4CFZA 2KLHA 1OIVA 4CLOA 1JDJA 4ZYWA 5JZMA 1TM1E 4F04A 3Q9NA 3ILXA 4X0EA 1V3QE 1ND6A 1ISHA 1Y7TA 1F2UA 2PMFA 4L07A 3RTAA 4L8WB 2Q6TA 2VRWA 1J6UA 3GPBA 3UUGA 3R9IA 1CX9B 4DQDA 4ERXA 4A4DA 4ZCSA 3U3KA 1Q7BA 2H2DA 2I3BA 4EUEA 1V4BA 4LCEA 1LZLA 3UB4A 1WCV1 2YIDA 2A92A 2O4CA 3KVOA 3TE6A 3LDAA 1Q83A 1XF1A 3KQTA 5BN4B 1PGPA 4A9AA 1AGXA 1X74A 2GHRA 5H3CA 4BWFB 2YJZA 3U44A 2Y4NA 3AINA 4QDTA 3CG4A 2AG6A 1AHPA 1SR8A 3BJEA 4GLLA 3HXTA 5E4FA 4FYWA 2BCEA 4TLCA 1P0CA 1YMQA 4KXQA 3WGJA 2W2KA 2GZMA 4HV4A 5IT0A 3AOEA 3EIXA 1VHLA 2OCKA 1XCJA 1D5WA 1NRJB 3WRWA 2VHWA 4BQEA 4HQNA 2OBNA 4JUIA 3EJWA 5AICA 1KKUA 2PN1A 3L7OA 3DDSA 2BFPA 2IOFK 3JARB 4FCTA 4RF4A 2GK6A 1G7CA 5C3UA 2XYRA 1C0IA 2JJ2D 2XJ4A 3B3GA 4D9KA 2ATIA 1TJ3A 2B4QA 1P6UA 2ZRDA 5JS1A 2XUKA 3GMDA 3KRTA 1F3OA 1U9YA 1XDZA 4FINA 3VKWA 3VNUA 1Z7EA 1IZZA 3PWKA 1POWA 3DOUA 1T4DA 4CQLB 3IKTA 3GT7A 1PT5A 2QUZA 5I7EA 2Q3HA 3EMKA 1U5BA 3CNOA 3F8TA 4KDCA 2A57A 5CR9A 2J9XB 4UW9A 5C1DA 2DE0X 3VOSA 1G291 3ZQKA 3MN1A 3PR1A 2ORVA 3L82B 5ERGB 1OREA 2YUIA 3MM4A 5E4TA 1WXXA 4KQCA 3HWX1 4D6PA 3U7RA 1M1YA 1ZM4A 3H5OA 3K70B 2UV8A 1ODIA 1EFVB 1V3TA 3BG5A 5CCEA 5I4IA 1SXJE 3NGMA 2Q2WA 3TQHA 3H5IA 3SZ3A 1T0PA 3R0XA 3IBYA 2IYZA 2CLFB 1NBWB 3I64A 2OBFA 4QTYA 4LWZA 1NBMD 3AQIA 2OC9A 3GQBB 3D3JA 1J20A 3QSGA 4XWOA 1NM5C 4RLFA 1E7WA 3OIVA 1CRLA 4LISA 4BZWA 2JLRA 4JENA 4KO4S 1DCTA 3WXBA 3NM4A 1ZI8A 3NC4A 4IIXA 2FSIA 1IJKA 1N0IA 1F9AA 4BNZA 2FQ1A 1IY9A 3F5FA 2A0WA 3WIOA 3E1SA 2Q0XA 5AD1A 3IOBA 2WQ6A 5IW8A 3IO5A 3KUXA 3AL2A 5HX7A 3P9QA 2VZ0A 5K51A 2ERCA 3ABIA 3CR3C 4QOIA 4I1OA 5JYBA 4DMGA 4LMAA 4S1WA 2COUA 5IWCA 1G8AA 2RH9B 4DQUA 1DT3A 1IY1A 3YASA 4IQ8A 1JXAA 3UK7A 3K6JA 5DP1A 4MVJM 3HU1A 2X9LA 1F20A 4OSEA 1NVKA 2IZZA 2RDMA 4PZDA 1R4ZA 2HREA 3LBAA 5TQ0A 1WKBA 2LTAA 1BGWA 2EF0A 2FFBA 4UXHA 4OSOA 4U2FA 5LP6F 2Z9CA 2R1VB 3VZRA 4BE4A 3BCHA 3AVYA 2GLTA 2GPYA 4MI6A 3RU3A 3ZV5A 3EVNA 1ZNYA 1FQWA 2CCGA 3DEIA 4YMTA 1WPQA 1HT3A 1KYIA 3T9AA 1YUMA 3V8NA 1DXHA 1UEJA 4B74A 2MDTA 1W1IA 3E8XA 4CQMD 1Q5PA 4JLWA 1S1MA 3M9XA 2ABWA 2ZWPA 4AK9A 2WA2A 4EUFA 2FEXA 2Y0BA 2HGSA 1GCUA 3H75A 1M0TA 2XE8A 2Q41A 4FDMA 3LWBA 1C3VA 4ZC8A 5HTOA 1LX7A 1XU9A 1NDHA 2C5FA 2Y1FA 3A0UA 3TF5A 4ZAXA 4F92B 2GWHA 5KTRA 4M37A 3LTEA 4M54A 3AVUA 4ZYTA 1OBOA 1QGOA 3E3LA 4EG0A 3IE0A 4PX5A 5IEBA 1FNNA 1H2AS 2QSZA 2FSVC 4L5JA 1HO3A 4LGMA 5G4KB 2UVQA 3I5YA 1HFJA 2GF9A 3QFHA 4I08A 2Q6VA 5EI5A 1UPCA 3LXRA 5G53C 3ZHXA 3I42A 2AMVA 2REQB 4EFLA 1UAYA 2GASA 4J4HA 5T4EA 1W94A 3M4NA 4IINA 2ZW9A 3UGQA 1TUGA 1JHVA 1I2DA 2YCBA 4XAQA 3TTXA 2VJAA 4DREA 2Q2OA 1KR2A 1U0HC 2B4AA 2PSDA 3BT7A 3H2IA 1DCKA 1FRVA 4UXIA 4ZZ3A 1HDRA 1XZKA 4RXTA 4J3NA 1KFBB 1QF6A 2QENA 2VCEA 4JL6A 1PQYA 1PUJA 1NQXA 2IEDA 3SQLA 1VCNA 4M1YA 1IHXA 1UBTS 2VP0A 3LKDA 2OXEA 3OPMA 1GZ3A 3PLRA 1VE7A 4B85A 1BEZA 2WWHA 1CW2B 4BVFA 1C1XB 2EWWA 2I6GA 4D9EA 4KO2S 3ZE1B 3CPEA 2DSTA 1XDUA 3P2MA 4ETWA 3FJ1A 4GLBA 3P4UA 2TMGA 1MEEA 1ZN8A 2WBLC 3AIKA 1LS6A 3EH1A 4IWNA 3DD1A 4EPYA 4EZBA 5IMSA 3MGAA 3L7MA 1ZUWA 3K6KA 2QD5A 1K7FB 3QF7A 2KX7A 1Y6QA 2GEBA 4LDRA 3IULA 5FJJA 4RK4A 4RQBA 1W44A 1UANA 4R8LA 4BVGA 2NYRA 5ITVA 1SQFA 2YHSA 5HF9A 1FSPA 4BVLA 3BGVA 3DEYX 3UPUA 3DR3A 3F3SA 1UKYA 5DASA 1NUTA 1M1UA 2HV8A 3OQ6A 3ZOZA 2GQ0A 1CE8A 3BBLA 4CTKA 4EA7A 2HF8A 4JJEA 2POQX 3VR5H 3P8ZA 3BMNA 2QTLA 4YDHB 3IMFA 4BLOA 3RS7A 2A9JA 4C2BA 2QZJA 2XGSA 2AUNA 2HK6A 3PIRA 3QPCA 4W6ZA 5ALYA 5BWMA 3COYA 1M2GA 4LZLA 1W581 4BO5A 4BO3A 4R69A 1UFKA 2WOOA 2P8SA 3AEKA 4JI5B 1W0JA 3EODA 1VIAA 3EXHA 2IYYA 4R3WA 5DVZA 1TU3A 3HYLA 5C5IA 1W8IA 2Q7DA 1BMFD 2I4LA 3QU5A 2Z83A 4HZIA 1F1BA 3VM6A 3D0QA 5L7WA 1NMZA 3FBGA 3QVTA 4JKYA 4BMZA 4EENA 4LJKA 3SBOA 1JQBA 2Z30A 4QTXA 1E6WA 2F9FA 2X6RA 4G26A 4I1SA 3FNFA 4ALNA 1YA8A 2W6JA 4MUKA 3DPSA 2V4ZA 1DG3A 1ECFA 4DW8A 5H9WA 3M4XA 3STWA 1E69A 3W1EA 3AHHA 1ES9A 4IJQA 4C7OA 1E3WB 1TCVA 2DLCX 4GOJA 1DI0A 4OMDA 3QLUC 3G2PA 4NY1A 3M3HA 2I6XA 4TMFA 2G71A 1DOAA 3GNQA 2MSLA 3F8SA 4Z1MD 4EI2A 2VYVD 5H80A 4O4JF 1XYYA 5EIOA 2XZOA 1WCIB 5I7FA 1MJGA 1TCBA 2QLTA 4GSKA 1S7CA 4PFJA 4B46A 4OMCA 4ESHA 2D1FA 2J09A 1JR3D 4WFKA 3MSXA 3VZCA 1JR6A 3A7EA 3CISA 1A7AA 4RNDB 2G1KA 2IXGA 5BW6B 2Z58A 2UVPB 2ZRPA 1F8FA 4YAWA 2BVNA 1H5NA 2VXOA 4K1LA 3NOVA 1JZSA 4MW6A 4EVSA 2HRCA 1VP3A 1D6MA 2EP5A 1WOYA 4R2XA 3CUUA 3M49A 2IYPA 4P7BA 4OQPA 3HUEA 4BJ1A 3K3PA 4Z53A 4H7DA 3N2IA 2XITA 4CLRA 3QBVA 1GG5A 5C3MA 2X41A 4XLLA 5F7ZA 1VXRA 3L79A 4E0BA 1DFGA 1P9LA 1JDPA 2P9TA 3E84A 2SCUA 1USWA 1CUDA 2CD7A 2R7MA 4FW9A 4MP6A 4WK4B 2FMHA 3WB9A 4KAAA 4CEHA 2R87A 4XX1A 2IP4A 3O75A 2G9ZA 2KYRA 3BD6A 4O4HF 3URKA 3KETA 1NLMA 1VL6A 3QW4B 4H0FA 4F2GA 1N9ZA 2W83A 3QE2A 4Y0NA 1OUMA 3O26A 4ETIA 3LOPA 1E77A 2WSSD 5KTNA 4LY9A 1SOVA 2ZJ1A 4XWTA 2J46A 1E2DA 3GYGA 4PYNA 5AIAA 5AW6A 3QA3E 4N3CA 3ZDZB 1GRQA 4IS2A 2YY6A 1T5LA 1U2GA 3CW9A 4KSYA 2WQ7A 2GZDA 2GARA 2X42A 2ZSFA 3ER9A 4QICA 5IC4A 3IPXA 5K4HA 5SZJA 4KHPB 2CVZA 1W85A 1A2QA 1E2FA 3TL6A 2A5DA 2J0EA 3B36A 3HXMA 1JFSA 3FTEA 3VKFA 1OFIA 2RI1A 5I7HA 3UMSA 3A1DA 3AILA 4OQ4A 2OFXA 3SMVA 5GV8A 2AXQA 4G5GA 3OUUA 4IDGA 3VMFA 4EG3A 2VA9A 1ZBDA 3ZGZA 1JN0A 1YA4A 4JJGA 5AKHA 4QRDA 4U2BA 3C8MA 4FCWA 4I9NA 3KPUA 2AN4A 4TOIA 3O8CA 5FAXA 5JC8A 3W1VA 1QTIA 4S04A 1VHJA 1WVIA 1GAEO 1YDHA 3AL3A 5LA6A 2A86A 1H0KA 3CMCO 3SQOA 4C4ZA 3IHLA 3AC0A 3ZHVA 3IDOA 3VSDA 5DNYB 2HK7A 2I4IA 1J8YF 1IHOA 2YHIA 3DUFB 4NFHA 4OU5A 5F33A 3AEQB 2PMEA 4GRIA 3N8NA 3PEUA 3Q0EA 1JMKC 1I3LA 1A69A 1TVCA 1U7OA 3CR7A 3PUKA 3CNLA 3SHFA 1NG9A 2QB5A 3JR3A 1LV8A 5DE3A 3OHMA 1K92A 4P5DA 1SG9A 4FFNA 2QGZA 4QQ8A 2RC6A 4O4IB 3UPTA 2V6MA 4YB8A 3QWBA 1N1DA 3D1LA 3EVGA 4XB6B 3ZGNA 5CAEA 3MRVA 4OLFA 1WRBA 1Z2AA 3BSSA 2HKIA 4AJ9A 4OEHA 2C9OA 3KYBA 1EGAA 4NJEB 1ODSA 1JL3A 1HE3A 2OBLA 1XKTA 4WLFA 4WVLA 3OTGA 3IMGA 3H5WA 3QVJA 5DP2A 3RUEA 3RYCA 1V71A 3RAGA 1UBNA 3QH4A 1D3AA 2FUG1 1JQLB 1C1YA 2XE6A 3EA5A 4A0SA 1Y4UA 5L6MB 2O48X 3ZWYA 1FP7A 3HI6A 2B0JA 4WKPA 1Q0QA 3E0QA 1N2CA 1KEZA 3FN4A 4AP6A 3MCVA 3J81A 1ZA2A 2IU4A 2WRZA 4P92A 2F1RA 4KRYA 3H9UA 5IDXA 4JBIA 4FHCA 2DTEA 1MXFA 4TV9B 3AERA 4X1IB 1OE0A 3BD8A 4KJXA 5IJ9A 1IEWA 4I2VA 1W4ZA 4CM9A 4XJTA 1EE1A 4XSHA 3QUQA 2UUCB 2O1EA 1HQKA 1M2HA 4YASA 2M6RA 3OJXA 4DUGA 1EX7A 3FTNA 3FMOB 2VXYA 1OV6A 3UMBA 3JATB 1DVRA 4O4HA 1BS9A 3D7SA 5FUBA 4CT5A 1KPHA 3UOAB 4PBRA 1LNSA 4BPRA 2O19A 3T6KA 5HJ7A 1HL7A 4RPGA 4MSUA 4Y2SA 4AYXA 2JAPA 2WYOA 4N1AA 1K27A 1LPSA 1U99A 4UEJA 1XTTA 5JZOA 2EFJA 3KQOA 1Q11A 4D6YA 3QUCA 1P6XA 1I0IA 3HEMA 1CZNA 2IC5A 4CTOA 4ZT4A 1VB3A 4BO7A 4P7JA 3SN6A 3ICCA 4FJ1A 1DSSG 4WN3A 2XLBA 2DT5A 4GUDA 1EXDA 4H6XA 1UMDB 1PGNA 4KLNA 1KJ8A 4UCXA 4FYPA 3TLGB 5BYAA 2H92A 1NJ2A 4NE9A 3RE1A 1JP7A 4BZQA 4GI7A 4R2HA 3TG2A 1SA0A 1XDSA 2P79A 1XA0A 3Q0IA 4WLUA 3B12A 4TMVA 1XCOA 1Q1AA 1VGVA 1D0SA 3HY6A 3O3NB 3RSSA 3B1YA 3CRW1 4JLPA 1GPMA 3D7RA 2HUNA 2R1UA 1KKMA 4IY1A 1UC8A 3ROGA 1NLYA 1WR8A 2CJWB 4FHGA 4H9GA 4JP2A 4L08A 4DBLE 4EMTA 2C2OA 3NAGA 2VXCA 2CW5A 1K6EA 3HM9A 4YAUA 3A9RA 2A5JA 4L1KA 1YTUA 2QMZA 4I1VA 3ZNPA 1YAJA 3BILA 4AKGA 2G6TA 2AI3A 2R48A 3TG8A 2IPNA 1GFSA 4XVRA 4QX6A 1CYDA 2J31A 2QW8A 3KR0A 4XGRA 3W3AH 1SG0A 4IM7A 1NG1A 5BSHA 2CXHA 2O8VA 1CCWA 1U7WA 3C48A 4RD1A 1M2EA 2COEA 2ODQA 2WHYA 1VKNA 3RQSA 1FDOA 4D43A 4GWGA 4HNVA 1OJLA 4FXOA 2C7GA 1EEHA 4JEUA 4UBKA 1NVAA 4RELA 2LBPA 2QMHA 2XT6A 2ERXA 4CUJA 4XZ3A 1C2YA 1OAOC 4IKOA 1F8XA 1PJ8A 2IYNA 1SVOA 4CMEA 4HMQA 1CS0A 1PZFA 2JFOA 2QI9C 2R6GA 3EDRA 3LC2O 5ALEA 4HN2A 1D8TA 3RFCA 1PNRA 4F3TA 1L7MA 2C1ZA 2AXNA 2PLAA 2PZBA 3UK0A 4CCSA 7MDHA 2FW6A 4BMYA 3PZBA 1GNRA 3TZ6A 1ZW6A 5EG5A 4YT4A 2Z57A 3TMYA 4ZGBA 4S0ZA 3N8HA 4RIGA 2YHBA 4BMDA 1H6AA 3U6BA 1ONOA 3UO8B 2ZIXB 1XZLA 4RVNA 2HWWA 2CUNA 3G8CA 3C15C 1NAIA 3EF1A 3LLMA 2G8LA 5BXQC 2DFDA 5BN3A 4HDAA 2NZUG 2DUUA 3HXOA 2OVBA 2TRSB 3C41J 3V2HA 3QBTA 2WHEA 3F49S 3OOWA 1EKXA 3LYHA 4JI6B 3K20A 1LPMA 2J0UB 2JBAA 4P34A 5GMOA 4EHDA 3DMTC 3WQHA 3CS3A 1TA0A 1H22A 3VNSA 3ZXUB 1HYBA 1A7JA 2PXAA 3U4DA 3OEWA 3MXTA 3W78A 1UL1X 1W75A 5BO5A 2FZCA 3E61A 4IJWA 7YASA 1OX6A 5I7SA 4O4LB 2OORC 1C1DA 2J3EA 1LK5A 5HF6A 2BL4A 4LQCA 2VATA 2AOTA 4UEWA 2JFUA 1ZIPA 2H57A 3RUIA 4WBNF 4NFSA 4NG4A 3DXZA 1DC5A 2FY8A 2ZB2A 4OHPA 3R9XB 3OLZA 5B4UA 3TZHA 2C3YA 5DBEX 4NFLA 1QWOA 1YBMA 1D6SA 4GZ6A 3INYA 1M1XB 3CH4B 1HDOA 1QPBA 4IQGA 5E1DA 3W34A 4D4MA 1ZK2A 1WS6A 1SUBA 3Q12A 3KO8A 4AO8A 3P9IA 4ACAA 3VO9A 4DNFA 1G7SA 1FF9A 3LH5A 1L6IA 3TOSA 3W2TA 4KQEA 5AW1A 5COAA 3Q3VA 1XEFA 4DB2A 3IUPA 1FDUA 2ZK7A 3NAQA 4OQZA 1CNFA 3FX2A 1UXGA 1V1RA 4KW7A 5EE1A 2W6ID 5TF4A 1W59A 2CLOB 2WUWE 1R64A 3FRHA 2PZ8A 3KV3O 4OFBA 4RA6A 3SE0A 3MWEA 4GOMD 2E6UX 4ND6A 4RS4A 5A6VA 1R0RE 3WNDA 5L3SB 5T41A 1K3FA 1IHYA 2CB0A 2AA3A 2A9KA 3M70A 4G36A 4P98A 3AF6A 3EGDA 3DMYA 2QRVB 2W71A 5EXDA 3BEOA 2G5PA 3A6ZA 4Y6RA 4ZHQF 2DKNA 1SUIA 1DJQA 1EG7A 3AI7A 4XYBA 4L15A 3IT0A 1M2WA 3G2NA 4D1YA 4EJFA 1Q6ZA 1EX9A 2VC2B 3G8DA 1CXZA 4M86A 4PCUA 4W8OA 2B1JA 5DYWA 3RHSA 5CNKA 1KJYA 3NHRA 4KMMA 5LZ7A 1QO7A 4LVOA 4RXMA 5LCXA 3W5IA 4AO7A 4RTSA 3AWDA 4EGAA 4EF4A 5KI6A 3TZQA 3E9DA 4PLCA 3HFJA 5A0VA 2CT8A 4B3SB 4MRMA 3PUXA 3ZY5A 5BV2P 1SAYA 1SXHA 2PMBA 2ZSBA 2XNDD 3IKJA 3AY7A 4V39A 4DQ0A 4E5DA 4HADA 3P9KA 5DIFA 5KHLB 3R0JA 3S2SA 5H4HA 5L8VA 1O8CA 1BHSA 5I7WA 1DKNA 1TVMA 2CLIB 4GKKB 3TW8A 2FZ4A 3DVLA 1MT3A 3TRKA 4AKIA 3VXKA 2Z4RA 3OTHA 3JAWB 2FLVA 5A7HA 5CEJA 1MC4A 1XKQA 1FNDA 1KJJA 2WKPA 1SOMA 4N6OA 4NP6A 3NJ8A 1EK1A 4ZOLB 2ZJ0A 4NDNE 4U5QA 4Q16A 2GN8A 1BKDR 4JEMA 3BMCB 4P7GA 1JIJA 3HMKA 3REQA 4PG5A 3UHAA 5HRAA 3N07A 4UCWA 1DEHA 2CV2A 2PH7A 2VP6A 3L8GA 2R7AA 2QUKA 3FDZA 1PQUA 1RFLA 1TTHA 2VDMB 3G2KA 4LXYA 4BFLA 4YCMA 1USUA 1EIWA 1GN8A 5AKZA 3HYCA 1NUPA 1Z2EA 5JQWA 4ITUA 3DFFA 4KP7A 2OEPA 2Q46A 3EGIA 2O52A 2VDUE 1YZGA 4MJ3A 4E2XA 5JH7A 2ZPUA 3R24A 1OLXB 2P1DA 1MRZA 4MHTA 2MYNA 1SUFA 2X4GA 3K1AB 3O83A 5D87A 5IBPA 5I9NA 5JRDS 5HYVA 4FMPA 2ET6A 1J70A 2OT3B 3B6IA 4UE6A 3G3EA 1SXIA 3A36A 1AZSC 2VJYA 2OQ2A 4Q9LA 5SV2A 4ZI7B 4AJHA 1JG1A 1OA0A 1QGUB 2GHTA 3EC7A 3JQ7B 3GLQA 1YR2A 3UAXA 1J90A 2HZBA 4LDNA 4MDYA 4YY3B 1H2HA 5DSZA 3VU0A 2H4XA 4B3DA 3PGJA 3H2YA 1A4XA 5HFNA 4WA8A 4L6CA 4CMJA 5HIAA 1TMOA 1EB9A 3AHDA 5T8KC 3NVDA 2ZJYA 1T9KA 4R2IA 3PJFA 2RGUA 2XZPA 3KQNA 4YCAA 1YXMA 1JJFA 1TJ5A 2XZTA 3BF7A 3D4PA 3DQPA 2IHUA 4O1HA 3ER6A 4B32A 4EPTA 3AVVA 4PZ0A 1P74A 1WXEA 3FOWA 1G66A 5AI0A 1NN1A 1OR8A 4ENTA 3LXXA 1D1PA 4KBGA 5LMCA 2CNDA 1XQ9A 1E5QA 4R1QA 2J07A 3K70C 1AGYA 1GQFA 1S8AA 1BDBA 1YE3A 2Y93A 3RYIA 4KN6A 1S8FA 2P4QA 2YJ5A 5JMWA 1TZCA 3GLFB 3U7IA 1I6LA 4N54A 1JQDA 1UINA 2MSDB 2IW3A 1R5BA 2NXEA 1G98A 2QAGA 3RGGA 4P4SB 3DOHA 1P2VA 4L85A 4I3HA 4EMSA 1ZXXA 1I4WA 1ZJZA 3C74A 4TPKA 1G8MA 4BFCA 5JS7A 1H9BA 3W5CA 2Z6AA 4IRXA 2IUSA 1YHNA 2VJCA 4C0XA 4BQNA 1WZCA 2R00A 3K5IA 5CVDA 1AKTA 2GPWA 5G1NA 4X65B 1KK0A 5C8DA 3OO1A 1N57A 4CN8A 2NO5A 4DLUA 4TV8F 2DWUA 1QYXA 5KSPA 3IXLA 1TB4A 1KSJA 2E1PA 3TOCA 3W6NA 3I6ZA 2FMXA 3K9QO 5FFNA 1YJBA 2ONZA 3W8NA 5CFLA 1R0KA 4EYKA 1Z9BA 1BCRB 1N2XA 1UADA 3GNTA 5CVUA 4D0SA 1BEEA 3SBXA 2BKVA 4KN8A 4TLLB 1A5BB 1C2TA 1B16A 5KYYB 2ZR0A 1MB2A 4NCHA 2NTEA 1BXZA 1JHQA 1L7DA 4ZT6A 4EMBA 1BWQA 4BPBA 3J7AC 5JQGA 3DL2A 4BLUA 3UJNA 5B55A 5DU2A 1DZIA 1H8HA 1D1TA 2BEWB 2K2QB 3CNBA 3WWCA 3EUAA 2XOKA 5AJVB 2PUFA 1ZRNA 2YHUA 4G09A 4NBRA 5F98A 5IDQA 9ATCA 3JD2A 4MYRA 3KYDA 1XALA 2ID9A 1YK0A 3V1UA 3IQIX 1BMDA 2EGUA 2WHPA 2ZSJA 3TDNA 1ATZA 4OHBA 2B99A 4YCBA 3EIEA 3X1MA 1YB6A 2JGFA 3A6PC 2B37A 1BA2A 1GLGA 2LD4A 2WW8A 2ZAMA 3L8EA 3L8CA 2D5BA 1WZUA 2UVDA 3CH7A 3Q9LA 4DG5A 3JQAB 5CDHA 3GJQA 1H3FA 3ER8A 1GA6A 4G0VA 1LBIA 2C9MA 2IVFA 2W2LD 3CWZA 1FDVA 1DJLA 1YDMA 4NS1A 5GP1A 2ZYRA 5T7BA 4MTCA 3UGJA 2A30A 5FL7D 3VHRA 2HCFA 1MIOB 3LPNA 4JGGA 7REQA 2MSWA 3MAGA 3B6ZA 3K9GA 3L8HA 1OOEA 2V9PA 2IUTA 5DYNA 4YLEA 5CXXA 2NUPA 2RAUA 1B0UA 3E5NA 1QXSA 2GJ8A 1NR7A 4I4LA 5LB2A 1C8LA 2R86A 1ILWA 1G18A 3K5HA 5SZIA 2HIMA 4P53A 4E5MA 3L1UA 4IL5A 3DF7A 2OQRA 2D2IA 1PF7E 1ZVQA 3PNVA 1T35A 2OSVA 4AVYA 4I4IA 3N3BC 1DRKA 4EYGA 3ELBA 3CUYA 4UQOA 4R7ZA 3H97A 2IS1A 2Y67A 1Q17A 4CODB 1GLNA 1PHPA 1YDEA 2G0NA 2ODBA 3ANYB 4KVGA 1WV0A 3AM4A 3MJFA 4X24A 5AI8A 5DW3A 2QRPA 4R1UA 4Q9JA 4P4UA 4Q03A 2KS6A 5IVDA 1A2BA 4WNAB 3A04A 1U7DA 4MW7A 3WGNA 5M2QA 1KH2A 3LKZA 2EKZA 4C30A 1SVMA 3E7WA 4IIYA 5KKNB 4INPA 1P2FA 3KE9A 4TVBA 1N9GB 4L95C 5JNLA 3FLBA 1GTSA 4OLAA 5JTTA 1WBDA 2IIBA 3TFWA 2X9NA 4MRRA 4N5NA 1ZMXA 4MCAA 2Q4DA 5G02A 2ZSDA 3OY2A 1JX6A 1I2CA 3CEPB 3U4GA 5EE9A 2YNMD 3KJHA 4G89A 4J75A 2AS0A 1KVRA 1RQLA 5SY6A 1IB0A 1N0UA 4RSHA 2C29D 3O4GA 5COQA 2ZQYA 4DRYA 2FETA 2EJUA 2QUIA 2IHJA 2WYUA 2ZDGA 1C7IA 2II6A 5FTMA 3WY9A 4I9HA 3BS4A 3C70A 4R1LA 3W5UA 2Q8NA 3KJQA 3BSFA 3NS7A 2BEJA 2DBQA 2CE7A 2NLOA 3ZS8A 3H2BA 521PA 3O0TA 3L4BC 3LPDA 2BKXA 1WEKA 2YZGA 5KNCD 1DELA 2EU8A 2JB9A 1BJKA 4G86A 5D2CA 4TKMA 4PONA 5DLDA 5FB3A 4LY6A 4BNYA 5DGDA 1US8A 2JFWA 1EHIA 2ZULA 4C4TA 1F8GA 1I5OA 1U2SA 1QGAA 3GA0A 4DF3A 2YDYA 1A88A 4JFAA 3PTZA 4BNTA 2XCQA 1RXCA 2Z95A 4RENA 5K3SA 3ILSA 1A4IA 2GJAA 2NACA 3EGOA 3NTQA 1F3LA 4HMPA 4WECA 2RHRA 1IK6A 4RV4A 5F1KA 4LF8B 2HLPA 3CB4A 1EFDN 4P6VF 2WVGA 4KFCA 3ESDA 1JJ7A 4ENPA 2E4XA 2I6TA 2GD2A 4P80A 4CV3A 1MORA 3A4YA 3FXAA 3PE4A 3EHDA 3D2CA 3GZ4A 2R6DA 4LJLA 4XE5A 1TVEA 3T3HA 2GJ9A 3WK7A 3G7UA 4W8GA 3VPSA 3OKFA 3MT7A 4HAWA 1G3IA 3OCJA 4UCQA 4X8MA 1D7OA 3E70C 3ZNQA 3PQ2A 4EHIA 2QVBA 4CKCB 2W5UA 1YOBA 2H7VA 1U6IA 3GH3A 4FFOA 2QIOA 4WVFA 5LKRA 2ZDQA 4L74A 1JDBB 1Y7HA 2BBSA 2F1KA 5JS2A 3ZY2A 3S27A 1R8SA 1KYQA 3GEMA 3OLQA 2WSIA 3M5CA 4H18A 5FPQA 3DV0B 1XD9A 1YV9A 2HSWA 3BRWA 3VU3A 4KQIA 2QBYB 5CLFA 3TNLA 2FMKA 3W04A 4F12A 2J0VA 3TSZA 4BO2A 5DM4A 2VF7A 1L6RA 1S3GA 4AX8A 1JR4A 3WLKX 1MVLA 3RSGA 1SRRA 3NWJA 4WGGA 2Z1DA 1NW8A 2HWUA 1PR2A 2A58A 2FFRA 3K0AB 3ZKWA 3A1TA 4PG8A 4QZVA 2ZRNA 4DCNA 2FJUA 5JADA 3ZWDA 4YK7A 3FCAA 1GQOA 1ZNZA 4LQ4A 4Q7MB 2PQMA 2LV8A 4RETA 3TRHA 4EX7A 4E4TA 3H9CA 1GPH1 1FVHA 1LPBB 2EQBA 3H4TA 3QHQA 4QTTB 5KQGA 4CM7A 2W6ZA 1CRZA 5H02A 2DHEA 4IW3B 2XYVA 2XBLA 1E0KA 3BXEA 1FXWA 1KI7A 1U81A 4JFRA 4Y7CA 5DHFA 2ZI7A 4BMPB 1O9BA 4ER3A 1KMNA 3H11B 4REQA 4UEKA 1TLTA 1Y9ZA 3WWDA 4BX0A 2XCTB 1IVSA 3OPVA 5EPOA 1I2AA 1MC1A 5J2UB 4YAJA 3EGXA 2BJVA 3GEDA 4WGFA 4GLFA 4J90A 1H2ZA 4AG6A 4IR7A 3EW7A 3L3BA 3JQ6A 4LS3A 2GLXA 4V0OA 4ZO6A 3R6LA 1USVA 1SCNE 3KSMA 3RWBA 4RJLA 5IBCA 2ZKLA 4L57A 1QCYA 2E1RA 4W1SA 3WK8A 4C0JA 5A5EA 5IK2D 1UJ5A 2HTEA 2Q62A 1VYVA 1GUZA 1UOOA 4B6GA 5LYJB 2NZWA 2ZT7A 3IAM6 1PNQA 1KI2A 1U3GA 3HEAA 2JI6A 4IIFA 3ZU6A 1Z37A 2IUEA 3L06A 1Y5MA 1ZMTA 4BBAA 1T13A 3BE4A 3AP1A 4YRTA 1NUUA 2AR0A 3ASVA 4FDLA 5A5DA 3X1XA 3OJWA 3PE6A 1PL0A 3D6AA 4XJSA 1RXSA 2B94A 3FHLA 2ZJ7A 5FNZA 1T9CA 2VHQA 4KRFA 1V6CA 1H4TA 2HD4A 1AKMA 2EWVA 2I55A 2PPLA 3DAHA 4G0QA 3U3MA 4I8DA 3WISA 3A1SA 2AFIB 2R5NA 3VPGA 4MGIR 3KOUA 3GELA 1LFDB 4B40A 2DR2A 1Z3CA 3FZEA 2RHHA 3VAZA 2GMWA 1YBAA 4F4CA 2P78A 2BZSA 3FUUA 2B7CA 4ES6A 5KWVA 4HDOB 4LDJA 4NHOA 3OLXA 3ORFA 1MAWA 4PLGA 1OWNA 3FETA 1VE6A 3P2OA 2EW1A 3P32A 1G2QA 3HLYA 3FA2A 3D3EA 4H4EA 2IL1A 2WF8A 4NENB 5DX8A 1NYQA 3Q8MA 3JASB 1QC5A 3S1AA 1KOLA 3OD5A 1L4LA 4Y1RB 1XZHA 3FF4A 4G97A 4S1TA 1GV1A 2BSXA 5TF0A 4YO8A 1BFDA 2Y1XA 4RZSA 4FU0A 1ISPA 4EW6A 1YI1A 2H4HA 5I6DA 1UPUA 4YNBA 4EYOA 2F3QA 2G9UA 4X3OA 1GM5A 1GTMA 5BNTA 2AH5A 3JQPA 4ED9A 1LW7A 1VG1A 2QN8A 5T64A 2O3RA 1TJNA 2OKGA 1F0PA 5KMGB 3HL0A 4Y8VA 5L6LB 1OWLA 3IVAA 1SBCA 4MRSA 3T5AA 1R6DA 4QUBA 1MC5A 4INZA 5G3YA 4MEBA 5A4IS 1RYFA 1TU4A 5SY4A 1NSYA 1UFQA 1XJCA 2C7VA 2G76A 4KKXB 1M8KA 3WVNA 4LWPA 2P9QA 2FFQA 3KQVA 4EI7A 1SUAA 2WDPA 2NUAB 3KHTA 3R8XA 3ZY3A 4AF6A 1SXJA 4D97A 2Z08A 4P7FA 1GZ7A 2YWXA 4J7CA 2VZEA 4ZOCA 4JXZA 3EZFA 3GZTB 4Z8XA 3ORQA 1JFLA 2EX1A 5I4KA 5AKGA 3V42A 3H4IA 2PR7A 4K26A 2VAWA 3R3HA 1WMEA 3QM1A 6REQA 1S4MA 4M7RA 4CNBA 4G0XA 3GD5A 4WMLA 1AS2A 4GMHA 3SIRA 1AGRA 2G5TA 4OF4A 3FNEA 1EX1A 3V7WA 1XP5A 3TBHA 4QC2A 3W9SA 3TK1A 4D3SA 1T5SA 1JR3E 1LQUA 3F2VA 1NFQA 4AG5A 1QOQB 5JJKA 4U63A 4E5KA 4H7KA 3AFNA 2IBTA 5LQUA 1XFDA 4JOSA 3OWHA 3DB1A 1UF9A 2G04A 4EQ6B 4DIDA 3EG5A 3U80A 1RR6A 5ITZA 1HL3A 4N0MA 4JUDX 5KSWB 4BN5A 1X9IA 1YS4A 1EFTA 3IOCA 2YXNA 3IT2A 2J3HA 2XUJA 4ALIA 3CJTA 2B98A 2PUTA 2A5GA 5F78A 4KR3A 3UT5A 4LXUA 1FA9A 1YOVA 3H0CA 3UWSA 1YJXA 4AMBA 3M2PA 5IJZA 3OOHA 5JZVA 1D2EA 4HGPA 4WI1A 4XUEA 3OTQA 3Q1LA 4CM8B 3SZGA 3FOEC 3MS7A 4BLWA 1Q15A 5AM1A 1JEQA 1XMVA 2I03A 3G2QA 1Z45A 3GOQA 4J0JA 5A02A 1NFRA 5C4GB 3GPIA 2O50A 4MR9B 1U5CA 4KE8A 4ME6A 4CU2A 2RKBA 3CVXA 2XE7A 1K66A 2IYVA 1DADA 1L8LA 3JYLA 4HDKB 5JJBA 4J0DA 3LX4A 1NBAA 3DVQX 1TK9A 3L6UA 4J1SA 1VHQA 1UK9A 3CYFA 5C1BA 2GFIA 3AM1A 4A6PA 2O2IA 2PNJA 3O8QA 3QEMB 5AVKA 3WI7A 1KVQA 3UMRA 2JIRA 5EMJA 4LVNA 3HVKA 2V59A 3KQPA 4O2AB 5JMOA 1H6BA 4RF3A 2DVMA 4Y2QA 1WMSA 3GFGA 3ETEA 3Q7RA 5AK3A 2QL5A 1KXJA 1HZJA 3O74A 3NW9A 2Z04A 1P7WA 4JODA 1KVUA 3NUGA 3R4CA 3HCRA 2HOQA 1LKZA 2BFEB 3I4LA 5BPHA 1N3YA 2BTQB 1YS9A 4FNAA 4GKVA 2Z8YM 1P31A 2Q07A 1K6XA 3DG9A 5LQRA 1G7RA 3T5TA 5EYPA 4YXFA 1U0SY 3KM0A 3PITA 3KXDA 3VKVA 2B7BA 4XUCA 4COKA 2IHKA 3EC2A 4CMCA 5CCDA 2BGNA 4UTOA 5SYMA 7ABPA 5JSFA 1KK2A 1NASA 3OESA 1OH5A 1JLKA 1F2TA 1T0IA 1ZIDA 2B1QA 1AQUA 3PEYA 1R50A 2X6QA 2ZUTA 5CFNA 3VVCA 1ECPA 3D6VA 4RW0A 4EHBA 1LF5A 5HW0A 4WKNA 1UBJS 1T9ZA 4H1UA 4F0JA 4ZMSA 3IAXA 4J94A 3JSAA 4OBEA 4PZPA 1FEZA 5CPBA 4FKZA 5AK5A 4BUJA 5KYUB 3KG2A 1RC0A 2LE0A 2YVQA 3TUZC 2ZVDA 2PK3A 2QM8A 4GU5A 2H0RA 3O4RA 4KI7A 4QDZA 3ZD6A 3G8YA 3OCZA 4URYR 2P41A 1II9A 3Q8XB 4L9AA 5ULLA 3U7FB 4CLEA 3L9XA 1FBTA 4OGWA 5A04A 1DC3A 3DLIA 4DUPA 3PC3A 3V8VA 4CMAA 2ZE8A 3ET5A 1FLAA 1CZOA 2OV4A 2QRZA 2K2WA 2NV2B 2IUFA 2JGKA 2P6NA 2YN0A 3JRXA 4LDPA 2VAMA 3CFYA 3ZWQA 2WU0A 1BJTA 3ZWXA 4HAUA 1A1SA 1PLJA 2ZWVA 3NHPA 1G2PA 1YR7A 2VRBA 3NHUA 4XD7D 4ZVPA 1TO2E 4DIFA 5DOVA 3T4PA 4QXMA 3ZU4A 1JLHA 1UP7A 2MWMA 5FEUA 2OY0A 3QU9A 5LXTF 3EZ9A 1BA3A 3VTZA 3CHYA 3C6KA 5JDIA 2NU7A 4IIBA 1JECA 1DWQA 1Q7CA 3R7WB 5AVVA 4DNXA 4V2IA 1J39A 3H2JA 4PRKA 3TNJA 4LRQA 3FY4A 1GSAA 4LHEA 2VAVA 4E5UA 4RLSA 3UJPA 1J23A 4Y0AA 3AJ8A 1N5DA 4JX9A 3TJMA 3NPAA 2OKCA 3HTXA 3HGQA 1Z07A 3B7GA 2RGEA 3GXBA 2GUWA 3QP9A 2MTBA 1G19A 1RYZA 3FWNA 4ILEA 1EH5A 1RRCA 3C4JA 3RRZA 5EHQA 1JVBA 3ENZA 4L02A 5AM0A 4LF7B 3QXHA 1P1FA 1SHJA 2XXJA 2YZ7A 2Z2ZA 3LO8A 4I8XA 1Z74A 5FWDA 1SBHA 4YRPA 3VHXB 5KDDA 2NUTB 4KL8S 3MIIA 1MH9A 4BLVA 1G6OA 2NOAA 5DHSA 3RK0A 1S2IA 1JPVA 1XWIA 1VRVA 4L5IA 4PF1A 1HRDA 1C9NA 5FP0A 4N47A 3W06A 3KQKA 4V3BA 3HA7A 1LD3A 2AI2A 3BSYA 4JB8A 2PO5A 5JPIA 2ZIGA 5HDBB 4B09A 1UPXA 4GE0A 2WSYB 2GI4A 3KZOA 4D5GA 3IUJA 4E7PA 3HKBA 4MW1A 1NE7A 3VJKA 1L3IA 2R60A 1Q7TA 4JVMA 2R79A 2IZ6A 3IEXA 4WAUA 3FH0A 4IRMA 4WK0B 4UDXX 2PT7A 3F1KA 2BHSA 5E1MA 5BSGA 1CUJA 1Z22A 1FUIA 2HY7A 3I9KA 1O9GA 5DT2A 5IPFA 3RJZA 1L7XA 5FI3A 1DGQA 4CDGA 5U4XA 3KFXA 1LVGA 4HRAA 3X2EA 1A1VA 1CPYA 1X2BA 2XMRA 1NLZA 1R6XA 3IESA 1GUFA 1VIYA 1DCFA 2HU5A 3ZHZA 1WXDA 2DWPA 3HBJA 4NOLA 1P3JA 3TZBA 1CEEA 1QBKC 1T4BA 4KNWA 1QF7A 4UVGA 2UDPA 4G1EB 2GCNA 1QFXA 2JGJA 1PR1A 5GJCA 3S3TA 3WBJA 1KY4A 4RTLA 4RDHA 1JLLA 1UJ4A 2AJCA 3H13A 3QI7A 1I36A 1GKIA 4J2HA 2Z5LA 5BQPA 4HBGA 4TT3A 4DHWA 2CLLB 4GYYA 3UUEA 3DGFC 5CURA 3CEMA 5ALNA 4NDAA 5GONA 1UBUS 1BRMA 5F9MA 4FGUA 1BH6A 4JYAB 4GECA 3RSOA 5JXJA 4RACA 1WHSB 1Q0PA 2J4FA 2VQ3A 4WK6A 3H5TA 1VPEA 2UZ1A 1Z0DA 1NIPA 3PD0A 2GN6A 4I9GA 4URVR 2G28A 2LDXA 3NDRA 1AUXA 4IWYA 4Q4AA 5FR2A 3ZE7A 4TLBA 4GR5A 1Y4AE 4AS1A 2P9FA 4MUMA 5DN6D 4X61A 4CM5A 1I94B 4MDEA 3PLNA 4YECA 4FT2A 4MS1B 2IYRA 5EWMA 1S2GA 2HDHA 3KU4A 3ITEA 5CP8A 3KLPX 4UEOA 1EXMA 3T7RA 2GN2A 4DG9A 4HQOA 1ZIXA 1HE8B 1GJRA 1QVVA 1XYGA 4OGLA 3ME5A 1AS0A 2BI8A 4JP1A 3P0JA 1B41A 3ANMA 3C97A 3AMVA 3D4BA 1JF8A 1KMMA 2W93A 4M46A 4YXWD 1HNWB 1PR4A 2JCSA 5E7QA 2NTNA 1P0QA 1Z15A 5AI5A 1KI4A 1D0IA 1BVRA 1SCAA 1N2HA 5FUXA 2PH5A 4IZOA 4ZVMA 5L3RA 5TQ2B 1ZJJA 5CLHA 1E3EA 3KTOA 1IEQA 1SKUA 1FJXA 1EDEA 1Q95A 1UM8A 1T8PA 2WKRA 2C5SA 3EIHA 3FOBA 1VG8A 3T5BA 3WGIA 1X1DA 8LDHA 8GPBA 1F7VA 2VP9A 1E58A 1M7HA 1LA2A 3LZ6A 5EZ5A 1EFKA 4TGLA 4MQBA 1NDQA 1N2ZA 2Z3ZA 1RM0A 4MYTA 3BE5A 2HA4A 3QPUA 4N3BA 5FXMA 1O5OA 2W6PA 3FWZA 4Q3NA 4RJJA 4UU0A 1GYQA 4XPZA 5A4JA 4C03A 5EJMA 5KB3A 3I8SA 4L73A 2LKDA 2VHYA 1DBVO 5HIIA 2PJZA 1A72A 4RCVA 4RWEA 1AE1A 5C2JB 1UOEA 3BTOA 3FPGA 3DFZA 1G8SA 3S1LA 2IDKA 4JI7B 1TK2A 1HDCA 1RCFA 2B36A 3CRMA 3FZGA 4INAA 4RHYA 4Y18A 3RARA 5CVTA 1X80A 3MAJA 1BCSA 5DW0A 3M6VA 1KNXA 2YYSA 4EG8A 5AW8A 1IFXA 3GRUA 3LTNC 1TO1E 3QLJA 2VKQA 1CV2A 4BZXA 1NNSA 3OZEA 1LDEA 2BRUC 3A70A 2EIHA 3QHAA 2ZRCA 4L5YA 5CNMA 5HS4A 4YI3A 4Z4EA 4IDBA 4L6AA 4XVCA 5FCDA 4XIGS 3LY8A 4HEHA 2C8KA 4RCYA 1A77A 5I7OA 2J9FA 4BEVA 4FOTA 3OE5A 1E4EA 2GX6A 2WU3A 4RM3A 2HHHB 1DKUA 1ZH0A 2ZREA 3LFTA 1V5GA 2YVLA 1EHCA 3EVTA 1U2DC 1ZK0A 2SICE 1C3XA 4JJKA 4J3JA 1CDEA 3CNHA 2WJAA 2B8TA 2Q49A 3AY0A 3LA6A 1VPDA 4RVDA 1NPTO 1YR1A 3OT1B 4RE6A 5JZ9A 1DDGA 3WAGA 3OLVA 4GP9A 4Z0HO 4K9LA 1ACMA 3BIOA 4FZVA 4YV1A 4NCAA 1H93A 3MA0A 4JU9A 3DO8A 1RRVA 4H77A 1J5XA 2IV2X 2FEAA 4J3FA 2HJRA 4QECA 5J5AA 4B75A 3GNSA 3AONB 5G41A 3CRQA 3THWB 3FVRA 1LBHA 3U40A 1P61B 1SB9A 4QQNA 3R3JA 2V0GA 1CR1A 1T43A 1G5FA 4TSRA 5K0TA 3OQOA 4QU0A 3VBEA 4PWYA 3PQ4A 4GEGA 1STOA 1Y8CA 2NVBA 2P9HA 2RGBA 3AVQA 3CLSC 3ZGLA 3QKRB 2G7ZA 2VJQA 1IN6A 2E4VA 2YV2A 4YIHA 4HDRB 2CDRA 2IKQA 2BFBB 5EWLA 3SD7A 1F7UA 1O0CA 1KSGA 4MKXA 2P62A 3IIIA 4N7JA 3O7WA 3V3KA 1R0XA 1PSWA 3HVJA 4PO8A 4KXFB 4MJXA 1PBNA 1C14A 2QJTA 4QUGA 3TSYA 4ZN6A 2O2XA 2X7HA 3A11A 2ZTMA 1G5HA 3GL9A 3IV6A 5CK4A 4C6TA 4MKIA 3V46A 4C6SA 4BEBA 1PGJA 2ECPA 3PTLA 3N2YA 1PWYE 3ZV6A 3F90A 1IM8A 1ZJ6A 3SJ7A 1R12A 3AEUB 5HCNA 4YN3A 3A3YA 4U6QA 1CY2A 1E6CA 4IUYA 1UKCA 2W4MA 4L22A 1KFCB 1BW9B 2B5OA 3PA6A 1NMYA 4KODA 1PZEA 2D7CA 2DFPA 4HQRA 1S5PA 3KEOA 4DKXA 2VPZA 4GQIA 2GLUA 1QHYA 5FV7A 4JCCA 3PPIA 4OHOA 3GUHA 2YV1A 3E82A 3H6HA 4AKSA 2EOAA 3BCSA 3DGEC 3M4JA 3NALA 4MRAA 2PA0A 3U13A 3D7NA 1A4RA 4AMGA 4ALKA 5A9SA 3KWLA 4QQFA 1J0BA 1DC7A 1ZUIA 3ADDA 2BKLA 4QU8A 4BZZA 4ZZ1A 1JSXA 3SF8B 5IUKC 5CXUA 2OENG 3DW1X 4QYXA 4WW0A 4EL5A 1HKUA 1PLLA 3GY0A 2P2GA 1O89A 4V03A 3AF0A 2XB9A 1P62B 4KV9A 5IN4A 4B3HA 1E4OA 2CNNA 2N42A 5I7AA 3QE4A 4PGGA 2GEKA 1CKEA 1S9HA 2FSVA 1UWVA 3L93A 3LC7O 4LZOA 4WFJA 1E1QD 4HVLA 5IDWA 2J7PA 3AHCA 1QM5A 1JIXA 5DLYA 2VWHA 1PUIA 2P5SA 4S2UA 2VI5A 3FGPA 3GGPA 5MHTA 1V8FA 5ADHA 5KHAA 1NURA 4HXFB 5IHPA 2WTBA 3KUDA 4H6WA 3LV8A 4JS0A 1FDRA 2ECFA 1AO0A 1TYEB 2OBBA 2ZCUA 1BRTA 5L3VA 2OO7A 1ICEA 3UV6A 1HE4A 2GHQA 1K9VF 3IT1A 2YWBA 1XYVA 2VR1A 2DUMA 3MLAA 2R8ZA 3OBBA 3OIFA 3OJCA 5ILQA 2QKYA 2AYYA 1YJCA 2OV3A 4INJA 1VKHA 3L0YA 5K0BA 1ZMRA 4LF9B 3O1HB 1XD2B 1TF2A 3Q3IA 4RD4A 2X8AA 4YREA 2DPYA 5JXIA 8OHMA 2A9PA 1XZ8A 1YVDA 5LDDC 3RRFA 2GN9A 1ZIOA 3FPLA 3PHBE 5E1BA 2SHKA 1PAUA 4CLOB 4CCWA 4YUXA 4FX5A 4EGQA 1P0FA 4U2CA 1C3JA 1JPNA 5G0WA 1ZGHA 1F2UB 2FW8A 4YMHA 2N3ZA 4LRWA 3PIDA 3L7AA 1N78A 2JFZA 1DUVG 5AKJA 1RHKA 4FUTA 4EZIA 3WYEA 2FK8A 1RT9A 4QRIA 4L0MA 4NICA 3A6LA 5CDTA 1BX1A 1U0TA 5LFAA 5BORA 3NAMA 1XX6A 1W2GA 3TQRA 1YB4A 4KBYA 1XDGA 3DBHB 4O1MA 2VH5R 1FVFA 1DUIA 1IRIA 3HV0A 1M3SA 3I53A 3KB1A 5HM6A 3T1TA 5KTMA 1Y5RA 3GVHA 3KPYA 3FPCA 4HUQA 2PUBA 2HU8A 3FG9A 5IYZF 2ODWA 1JI0A 1MAUA 1KGSA 1T4CB 2W2KB 3O3MB 4OKIA 3EVAA 3X2FA 3EMDA 2GRUA 4ISBA 4U2GA 4X66B 3FUWA 1WPGA 5DCUA 3UJ8A 3GAFA 4E2WA 3HB9A 1RU3A 3P96A 4KUGA 4MO2A 5C32A 2XMCA 4OO3A 3PWTA 4ZOQI 4FOLA 1BD3A 2BEVA 4OI2A 3RC9A 5TE9A 3VR6D 4I5EA 4N8DA 4XEUA 4ZVOA 4D5EA 1H3EA 2VK1A 1E9RA 2FWIA 2YDXA 3JZAA 4C08A 3UATA 4A82A 2HR1A 4IFEA 4Q3DA 2CYAA 3V55A 1OLSA 3QEKA 4WK2B 4B9AA 4UAVA 4XJVA 4FGZA 1U5BB 1NOJA 4NFYA 1FS6A 4EG1A 3BF8A 3DXFA 4ND2A 2BR3A 1RWMA 2NXWA 2CL7X 1QG4A 3GN2A 3KPVA 1P39A 4ZPXA 1AQIA 2GZRA 1H65A 4UMDA 2Q5CA 1N2IA 4WFQA 4Y2PA 4B7XA 4E1AA 4EX6A 1Y3DE 4YAEA 3V1YA 1SIWA 3NOQA 3HN7A 1M1YB 1XVAA 3SZLA 4D26A 2BE7A 3PQEA 4YDQA 1AT1A 3NATA 3SXUA 5A06A 3HE3A 2FOIA 2QJFA 3FGOA 4PHHA 1N7HA 4DJTA 1OFUX 3K70D 4JEHA 5G0VA 3WRXA 3IBTA 1E3TA 1Y6GA 3BX1A 3PPYA 1P4SA 1EZZA 3KV1A 2W2TA 4PRYA 3PXDA 2VUHB 3M3PA 4CZ2A 3BHIA 5JO9A 5KNDD 2YQZA 3RRNA 4MW5A 4LK2A 4BRSA 4UUAA 1IIBA 3G1WA 4UU1A 2I6UA 4TRNA 3NIBA 1Z8FA 4TQAA 3L01A 5T3UA 3TE7A 4KFRA 2WYIA 3EQ2A 3TQTA 1TC2A 1BXRA 1JHRA 1XEAA 5DT9A 2PZJA 3IXQA 1H23A 2O20A 2PH1A 4D7AA 5DEOA 2R11A 4BWVA 4C0KA 2RH4A 2OM2A 1AD2A 3QENA 2CHQA 5TQ0B 3EPKA 3PR3A 5EJ6A 4Y2TA 3E9CA 2WB4A 3LX5A 1AB5A 4MVJE 2B4TO 3QE0A 1XD8A 3W1WA 1EFCA 1FFHA 3A9TA 3G13A 3NU1A 4MUIA 4D57A 1VMIA 4I46A 3E48A 4POOA 4EP1A 2E49A 2QXTA 3KL2A 3K96A 1UBEA 2QXYA 3I2KA 3N8DA 4RMHA 1UCFA 2QHXA 4UUMA 5DBOA 4BNDA 2FX5A 2I1LA 4OSPA 5HKOA 1U0BB 3ZNOA 2O23A 2FCAA 3AM5A 2C9CA 5CJ2A 1UOPA 3RNOA 1YAHA 3TOVA 4EPXA 3DYBA 5FOSA 5JTUA 3U4HA 4Y30A 1H1LA 1E94E 1MAHA 3HKDB 4UFOA 3C3AA 3SY8A 3PFIA 5FOUA 5JAPA 3GBSA 3WFIA 2VNAA 5JFGA 2X8LA 4KREA 3SEFA 2OBMA 1W52X 3PDIA 2CHUA 1ZH2A 3F7TA 4I55F 2POCA 4DYDA 3DKVA 4J2TA 3CLUD 3GP5A 2ZS8A 2GZ1A 2HEGA 2ZQ5A 1HZZC 3CLRC 3I34X 5BR4A 4LV6A 4EY8A 1KWGA 1ZKDA 1CDZA 1Q14A 3QPAA 4S0XA 3AVXA 2H3HA 1YFZA 1Z7YA 2BJHA 5B2FA 1O6ZA 3EZNA 4INOA 3RLFA 4K6GA 3RVLA 1JQKA 1XU4A 3DFMA 3DMHA 1ZVKA 2HUPA 5AOBA 3TCXB 4BE9A 1GTG1 4D9NA 3UAVA 4BBZA 3GAZA 2XTNA 4DE5A 1DU4A 1QNFA 2HQRA 3K31A 4ZVNA 4C88A 5KWEA 1T3TA 4UE2A 4G07A 1SC3A 2XECA 1Z62A 3WAJA 2JNWA 5B3AA 3SR4A 4NG5A 3FRIA 1E66A 1K5HA 1R9JA 1KZ4A 3N7TA 3DV2A 4J76A 2EZTA 4MKHA 4Z49A 1EE9A 3ZUPA 5AVXA 1I0ZA 1CRQA 2CVHA 2PSJA 3A14A 4IX1A 5C0OE 2WAXA 3EWSA 4EF6A 3PNQA 1Z38A 2OLJA 1GDHA 3OEED 4UNRA 2XCSB 1RDFA 1ZD4A 2XF2A 1EUYA 2JCBA 5BWOA 3TX2A 2QU8A 4R2LA 1IXSB 3QU2A 4HO1X 2CJPA 4TQUS 4S35A 4AWBA 3LWZA 5HJEA 1JG3A 2DETA 1KPGA 1Z6QA 3H6GA 1G5RA 3MWKA 4YBZA 1IXRC 4UZFA 1Y9EA 1A5SB 5A9TA 3PE3A 1Z6AA 2I1VB 3SVZA 4LRSB 3D6MA 3H19A 4G5QA 4A36A 2O5VA 2OBXA 4HP8A 1QKKA 1CY4A 2E18A 2XUHA 2BTOA 1MTZA 4NMWA 5K0SA 2ACWA 1NVUQ 4GI1A 1OYOA 1V3UA 3EZLA 1CE8B 5EGSA 4R9RA 1DC8A 1EVYA 1SUPA 4R54A 3R5TA 2YASA 4IQ4A 1VB5A 1DKMA 1Z5ZA 2VOEA 1PZMA 4A0QA 2O8EA 1X3SA 3H2GA 3M6WA 3NWOA 3TAHA 5LIRA 1KMHB 1EI9A 4ZAYA 5J4KA 4G01B 2VPQA 4BFZA 4RPLA 3PQ8A 2G0AA 3EXHB 3F3MA 4KXYA 3W8EA 4V1CA 3LT4A 3ZLJA 1Z12A 1JFRA 5ALVA 1IM5A 2L42A 1NPYA 4QYTA 2W11A 1KOGA 1BVHA 4M0FA 4EPWA 4HQ0A 1CQIB 2PG3A 2YV4A 1JYFA 1C41A 3DTVA 3MYYA 1E3DA 4HQLA 5ALQA 2JEOA 3CEAA 2ZRQA 3AFGA 2C07A 3KSDO 4KFTA 5CLQA 1QG2A 4LYYA 3TFQA 4IIGA 1JT9A 2NMVA 2DRIA 1H5QA 1G6KA 1R00A 2XHZA 3BFPA 2ZIAA 3D2BA 3IR5A 3X2SA 1HH4A 2ZM5A 4JLKA 3EDQA 4OK5A 3G0HA 1RCTE 3H16A 5EC8A 5K3FA 5BNIA 2EYUA 3GRAA 3WIVA 3VTKA 4G1CA 4GSYA 3T7JA 1QFYA 3BH7A 1R4NA 2ECQA 2O3UA 1Z8HA 2A7QA 3PC6A 4PQYA 2VT6A 5DHQA 4HB0A 3IBSA 3R3YA 4WXEA 5ALKA 1N32B 3IQWA 4KQWA 1WUKS 1VYTA 2WIGA 4QXQA 2D0IA 2H08A 2AJLI 3OQHA 3M1AA 3V4LA 5K0JA 3SQXA 1WIWA 3HWRA 3R6DA 3GFQA 5IXSA 2GT1A 5HNKA 4DV1B 1HG1A 4Y2YA 4KE6A 4ND4A 3I1FA 1KH1A 1T6YA 1RJDA 3OPYI 4R9VA 4DXDA 5AYVA 3QFFA 5IYZB 4XDGA 4G1UC 5CT8A 3T7KA 3BPSA 1O97C 5ALPA 2HJGA 1OIXA 2SCUB 3AB8A 3DMRA 3I9V1 4EB6A 1GKKA 5CA0A 4YAGA 4CEHB 3IUMA 3HMQA 3G9ZA 1WA5A 2MOKA 4ZDWA 3N2LA 2NP6A 1U3WA 1XRLA 1NW6A 4BJ3A 1X86B 4MGEA 1N2BA 3A25A 5CA1A 4AQDA 1ODFA 1X13A 1B42A 1RWBA 2HHAA 1R0LA 4DHEA 2QX9A 4P0QB 3ZWKA 1LDYA 2IHVA 2NZYA 4YYZA 5B7NA 4DVJA 1WM1A 3DEAA 5KTTA 4ZQEA 4X7MA 4HFRA 4BLPA 2BKEA 3FHCB 3LRTA 4L4ZA 4R8RA 4YTEA 5G1OA 1W85B 3KQYA 5HJ2A 2C7BA 1YS1X 3WJAA 3P9YA 1MO2A 3HA5A 3NGXA 3PDWA 1XAHA 5BUZA 1Z63A 3L6DA 5FNVF 2EKPA 5H83A 4NMHA 5HGXA 2X5OA 3R8FA 2ST1A 4RJTA 2QNRA 4X54A 2A4MA 3FYHA 1NU6A 3GZJA 1KNQA 3GB9A 3C5HA 4L9RA 4IS3A 3BIWA 3IQFA 1N7GA 4XQEA 3TXAA 4DWJA 4WD3A 3U3XA 3V2UA 5JSQA 4C7MA 3N87A 5KEIA 4KGZA 4Q02A 3DJYA 1MN6A 2FRVA 2VDRB 5LA6B 1JFVA 1EINA 4B4VA 4Z0NA 3AW8A 1O03A 3SIPA 3EHEA 1V95A 3M5PA 2A14A 2ETXA 3RUHA 1PTJA 2GO1A 3MNFA 1Y5LA 2WKQA 2O0JA 4CGYA 5MF6A 4FLFA 2NUBA 2BFCA 3DAYA 2WWGA 5AO9A 4WLEA 2EP8A 5I8ZA 2GCPA 1JLRA 3AJAA 1MABA 1ZKMA 4RZXA 1G6HA 3GLIB 1KP2A 2RKOA 4MA0A 3KKOA 1RI1A 5DEIA 1WNTA 2E82A 3HXKA 1N75A 4YMSA 4WUVA 1W87A 1KP3A 1ZXLA 2OLKA 1MDFA 2C42A 3G0DA 2PGNA 4M1OA 3RYCB 1SVNA 1VOTA 1XRNA 4WPGA 1AXRA 1E3MA 4LA4A 4A8JB 3C7TA 1OI3A 3ZN2A 4ZCRA 4CWAA 1C0KA 1VRCA 2RK4A 2MYTA 4XIFA 1G60A 1N2CB 2HDOA 2YV5A 3H1BA 4N9WA 4F2WA 1O1YA 2JANA 3AFHA 5K20A 4D4JA 3MJ4A 3V48A 4DCMA 2EFCB 1Z56C 2DFNA 1J0CA 4B48A 3CVUA 4X8OA 5IT4A 3VR5D 3PWSA 3D0RA 1DEOA 5IJ9B 1MO5A 2HBZA 3D31A 3IEVA 1EZ4A 2AVDA 1ADYA 1Z83A 3M8KA 4M0KA 4FYYA 4MPPA 1M0WA 4CKZA 3MMNA 3FI0A 4FFBA 1MW8X 2E5WA 2P1ZA 5CBPB 5BW5A 1ODTC 4UVHA 3EQZA 3P27A 3HNRA 1RYEA 2YTZA 2VBIA 5FR1A 4F9GA 4UUQA 4Q9AA 3INRA 4I55B 4QGAA 4WE3A 5EUCA 2I87A 1AQLA 3EVBA 2ANBA 1MGPA 4US0R 4AKEA 4QVIA 2GKOA 2PBLA 4GWLA 3MGKA 4KK3A 4MWZA 4KRXA 1VKOA 4YDSA 1NVXQ 1QG6A 1XTBA 2HMAA 4IV5A 1GAJA 4G0WA 1ACLA 4HG2A 4Z54A 1FFYA 1ZK4A 2B78A 3EWAA 3L0BA 2NZ8A 1I1QB 1Z6XA 1JYEA 1Q2XA 3FUTA 3QOFA 4FZ5A 1XKXA 3P5BA 1VL8A 4KU4A 4KO8A 5KYVA 4LNUA 4DN6A 3NM6B 2H59A 2C2KA 2YW2A 3FJOA 3GLTA 4L8YA 4O8CA 5E6RA 1XZEA 1ZOOA 5FA6A 5FNVA 5IDYA 3UWDA 5HUHA 2G25A 4M1KA 1TTPB 3ENWA 3GFRA 4CF5A 3H8VA 2C7RA 1SA0B 1P4AA 2X86A 4R84A 2AG1A 6LDHA 4M1QA 5FBRB 5TJ9A 3FSGA 1V5EA 1PZGA 3IP8A 4GXRA 4LK3A 1DDIA 4Q9HA 4DCSA 5C4MA 3LP8A 3WLQA 1IRXA 1KVSA 2PHZA 4BCCA 2O7RA 4DTIA 4YMLA 3FIJA 4HAYA 1T9GS 5BY2A 4GW3A 3QMVA 4MVCA 5DSXA 3R3UA 4NBSA 3LLUA 5CB4F 3BREA 4RFLA 3F73A 1GCIA 2DM6A 4MARA 3VR6A 4M7PA 4CCYB 2V96A 2FGJA 2GD1O 1C7EA 1KEKA 3BRSA 1NT2A 4C0AC 2XRYA 3D54D 3KPWA 1W6UA 1XMXA 3FTDA 3QU7A 2YFYA 4UE3S 5JI2E 4CG1A 1E4YA 2QV7A 3EXAA 2D0OB 3HDVA 3MUFA 1JXQA 1YE8A 3KKQA 1SU6A 4GXQA 4F3YA 1RMTA 3ICPA 4UAUA 4WRRA 4KNVA 5IAGA 5TMEA 3UKDA 1KI9A 4D9HA 5KCZA 3OO0A 2HT6A 2GVZC 4NK4A 1G20E 4O59O 1JJIA 4RHEA 5CNIA 4ESOA 3EFOA 1CQWA 3K8OE 2GYUA 1IMOA 5KSOA 3IT3A 4A1FA 4IOMA 1CS0B 1E3QA 3EIUA 4R68A 1XO1A 1FMLA 4AJ1A 2QTTA 2QTAA 1QGZA 3AIOA 3WADA 5DCWA 2FMFA 9LDTA 2CZQA 5EP4A 3IS3A 3NYRA 5I7UA 1CVLA 3K32A 3E8SA 5ESDA 4G23A 4C7VA 4EKIA 1RACA 4UHEA 3TSOA 5IH7A 2XMDA 4MB6A 3TR0A 1EWYA 2FSUA 3CU5A 5I47A 2BYTA 5E6UA 2XSZA 4D3YA 1WQ3A 2GTPA 2J5XA 1C29B 1M67A 1MPTA 2I4RA 3K1TA 1HR0B 2Y92A 1HY3A 3E5RA 4OOEA 1QS0B 2JAUA 4EHLA 4DUYB 3TVTA 2CLCX 5KNDA 5ESRA 4BX3A 1PR3A 1L5WA 1Q0ZA 1VPTA 3C45A 3EXFB 4A27A 2GD6A 1ZICA 5B2EA 2AFVA 1N36B 2NSLA 5ESWA 4URXR 2DPGA 3BDVA 5KOJB 5EMNA 3ZZMA 3QMMA 1TE2A 4X6LA 1JKIA 2C58A 3UGTA 1HT0A 1RAHA 5HCUA 1JDUA 1IBCA 1NKVA 2ZSKA 4Y6QA 4XQ0A 1EUDA 4CUZA 2X58A 2DLDA 1I4TD 1XT6A 4CFSA 1WLSA 2GBGA 2R96A 5AW7A 4E5NA 1CQPA 1O54A 4G41A 5J23A 3JZFA 1TEVA 2AOTB 2VDPB 4FTWA 2Y2VA 2EBUA 1DHTA 1C8KA 1MR3F 2X3FA 1E8NA 2H4WA 4ROSA 1FPQA 3G2MA 3TLAA 4HTFB 1K8XB 4FOPA 1KI6A 4P58A 3TN7A 2ONCA 3I4CA 1Z17A 1F14A 1BO6A 2JIDA 3GT3A 2A35A 1NI3A 3CRRA 3DKKA 1THZA 2X0FA 3GLGE 1V48A 4Q7QA 2Y8EA 1R3DA 2FLKA 4N0EA 1G38A 3EQ8A 4BKUA 1HQCA 1S2LA 4RABA 3RFUA 4AULA 1E7SA 3C3PA 5CH3A 4TN5A 1B43A 2HT1A 3JWGA 3WZLA 1N5OX 4MGYR 5IM4F 1XZCA 1PFYA 2I76A 3GHYA 4J9UE 4LKRA 4C14A 2GYWA 1V5WA 4X95A 4DSAA 3P9PA 2HSEA 1XWWA 4LF6B 2WWWA 2ZIUB 1W9MA 3G2HA 5B3JC 1L3BA 1X1QA 4DV7B 4RA6B 3WB1A 2EQAA 4ZTBA 1ZN7A 3KAQA 3PLAE 5KSYA 3RSLA 4EG5A 2YW9A 5C53B 1V45E 2BMAA 2CFTA 2HCRA 2AX4A 2ZRGA 3BHNA 2BZ1A 2PVPA 3LDGA 1E7MA 4U2DA 2J5RA 5F5LA 1L5OA 1E6MA 3URMA 3F7OA 5ALSA 3MCWA 1ZHFA 2C2WA 5BXYA 3HCNA 2WHQA 4QPCA 5I4CA 1EESA 3KC2A 2XVMA 3KTDA 4I1YA 4C22A 2G83A 3ODPA 2J0QA 2K5UA 4UM5A 3DLBA 3F4BA 4LWQA 1U7UA 5DXJA 1PS0A 5EEHA 1XLWA 1YZNA 3WLOA 2V5UA 4RH1A 4B47A 5HRUA 4NNJA 4NU0A 421PA 2VFAA 2RGWA 1Z75A 1VCIA 1CLUA 3O8OA 3CKYA 3GIDA 4FYXA 1QU2A 5JJIA 3MD0A 2ZJAA 3GFTA 2XQVA 4NV3A 4KYIB 1IY8A 4MINA 5EKSA 3TTWA 4AIRA 5IP5A 4MHOA 3DR5A 1L8QA 2NM0A 2VN8A 5K0LA 3NHJA 3FFXA 3M83A 5HE9A 3QX9A 2XGOA 5JNVA 4LC0A 3PQ3A 3C5WP 4R0NA 5LOVF 4A5SA 4ONEA 2F6RA 2IUUA 1SCJA 1SU8A 3KYCA 1IOVA 2PRSA 3RC7A 3ZV7A 4Y9SA 1VSQA 1T8WA 1Y1TA 4GR4A 3TW8B 1VL2A 1GPBA 2JD2A 4RKYA 16PKA 3T4EA 1RXUA 2OYSA 3D8TA 1SCQA 1V5IA 2D4HA 1W0KA 1HSOA 3AJ9A 4FJ2A 3C1UA 1V96A 5D3ZA 3ET4A 4MS3A 4BCDA 3LL4A 3REQB 1TM3E 3PUIA 3ZWVA 4K2HA 4JXJA 4AWAA 1CVIA 1PT9A 5IVHA 1OVMA 3LI2A 5BR8B 1XNJA 4QO7A 4TMKA 4BB9A 4O2LA 3KK0A 2P9JA 3FDZB 1RI3A 4P82A 5ALUA 3HSKA 1DMSA 1T6NA 1TUBA 1VLHA 3K92A 1Z4NA 2ORWA 5GINE 4UNPA 4AROA 4JDPA 2PYIA 1G9TA 4Q4DA 5G0TA 2ZUFA 2YWHA 3I5UA 3V4OA 1YCFA 2YXPX 4HVTA 3T7AA 3C98A 4YJGA 1EJ6A 1RQRA 5JH7B 1MT0A 1XB2A 5BWNA 5DM60 3EBPA 1RYHA 2E3JA 4BO9A 3AOEC 3VR1A 3I05A 5BQXA 4X63A 1OSNA 4IKEA 2KI5A 3VPFA 2AFHE 4LC1A 4H6VA 1G9XA 1TADA 4QBGB 3R7DA 4B6JA 1FQJA 5CIYA 4IJVA 2NWQA 3TGLA 4U3JA 4V38A 2QX6A 4RV9A 3THSA 3PRYA 1GNPA 4HGRA 3RIGA 4CF4A 4K6HA 1QDEA 4RVSA 4AY3A 1ZCBA 4QDKA 3Q41A 3ZDCA 4YUVA 1NTRA 4PVCA 3H1FA 1U6KA 2HWYA 3MFYA 1L7OA 5E7MA 4BJ6A 4IHQA 1QQ7A 2QLFA 1VPLA 3KNZA 4ATNA 5K8LA 5GJBA 1L1RA 2B8NA 1RM5A 3A6EA 4YEDA 1CJVC 3LU1A 4IVPA 3WYAA 5K2OA 2RE8A 1QYDA 1AQJA 5L3SA 2CNWD 3SG0A 4XM1A 3RSCA 1K6JA 1E9EA 2CFSA 3B9QA 2HLDD 1ZS9A 3QLVA 4JT8A 4CE6A 4E6EA 3DOJA 2M6KA 3RYFA 2WPDA 3T8YA 3K9WA 4QDJA 2BP7A 4ROTA 3F96A 2P9ZA 4X60A 5M29A 1KK3A 5FOVA 3RYIB 3P45A 3SEQA 2QVYX 3L40A 3CKLA 3AKDA 3CT4A 4IXNA 4C29A 2A0XA 2ZB3A 4ZT3A 5LB4A 2QAGB 3DEZA 1N8KA 4UTXA 4YT5A 2WEKA 1LC0A 1QRAA 5LLSA 4ZVLA 2ZRHA 3AGQA 3ZVNA 1CWUA 2O3JA 1DBSA 3NDPA 1W4CA 2UZIR 4R01A 1R6VA 2VS1A 4BNLA 3TUIC 1H2YA 3ONNA 2BFFA 4K9RA 2D3WA 4OFXA 1XA3A 4WY5A 4RF2A 1YB7A 3B1XA 1ESCA 1GADO 2AKYA 3LDUA 4OXKA 3ED5A 5KSZA 5EQDA 1NF8A 4IH1A 4A6EA 2O8CA 3K5PA 2FAXA 1UBFA 5AJXA 1P29A 1QP4A 4KR6A 1ZFNA 3LT0A 3M5WA 2WOJA 5DNWA 4QYWA 3WG9A 4FWIB 1U4SA 2VRCD 2W2VA 1FFBA 2BR4A 3K0BA 3HL4A 4LEIA 2UZ3A 4OV6B 2KW5A 4ZQBA 3ZKAA 2OO5A 2AXPA 3KZNA 4LOHA 3AL0C 1W46A 3BZBA 4P4NA 1QVWA 3ABQB 3I6QA 4F4IA 2ZBDA 4J0GA 5D1HA 5F73A 2C5LA 5CMLA 2BMFA 4CL2A 1YS7A 3AG5A 4JP8A 1BFKA 3L2OB 1B0PA 3AEXA 3C1AA 4B81A 1PQWA 2XV1A 3IVCA 1ZSNA 4G65A 1OBHA 4RK7A 2H1FA 3I28A 3NOOA 5ADVA 4A6DA 4H3VA 2PPVA 4L72A 1P9OA 3RT1A 1VCHA 1TZJA 4DCGA 3B8EA 1YASA 2Z6VA 1JG6A 1K1EA 3KYDB 4IFBA 3WMXA 2WJPA 3RIYA 2WHPB 2Y66A 3ZWNA 2R0QC 2QG9A 3L7DA 3FZYA 1VTKA 4G5SA 4IKPA 4MK4A 1GARA 3DJFA 3ORSA 4TSKA 4URFA 3UZUA 1SPBS 4ZQGA 2GAIA 2Y4OA 2JAXA 4Q1FA 2D06A 2JZCA 3GJ3A 5DGHA 5KQRA 5EP1A 4BKOA 2OP0A 2ZJ6A 1MQAA 4LSGA 3T5GA 1P1RA 5M5BA 1E1RA 1RSZA 5T4FA 1KZ7B 2H65A 3HCDA 4CDNA 2VYFA 1TEXA 3RAFC 2QRQA 4DA6A 2Y1WA 4X90A 2ZBRA 4CEIA 5WRFA 3EIWA 3IP3A 1TMGE 3CCFA 3U39A 4MKZA 1UDWA 1KIFA 1R74A 2IODA 1CUGA 1RLJA 2XQJA 4UM8B 2J3QA 2JJ8A 5HF5A 3V3TA 1DO8A 2NUPB 4BFSA 5BURA 1WG8A 2FRDA 1JYSA 2OL4A 4HRVA 4LYHA 5KJEA 4BO1A 3IYLW 4X7PA 2IYFA 1MFZA 2QQ5A 4XIYA 1L4UA 3R1IA 5JBNA 3DTTA 2DB3A 1HNNA 3Q85A 3S2FA 3D9QX 1X1SA 1IL0A 2C4MA 2XTMA 4QLAA 5K4AA 3VPBA 5HK9A 5I51A 3N2ZB 2OFPA 3H5LA 4Z9BA 3CY6A 3G0OA 4HH1A 3UKJA 2TYSB 3LG2A 1Y3AA 2B92A 1Y1PA 1YJ8A 2NPOA 4O29A 1EDDA 3SDBA 2W37A 3W2HA 1PK8A 1RXWA 1UMBA 1KHHA 1DRWA 1Z29A 2JFPA 3C6XA 4JWTA 3ZW7A 3ZQ4A 1E8MA 2ZZMA 4NBUA 2OQVA 3ROEA 8ADHA 1S1CA 1B2RA 3SP1A 2X23A 2GGSA 2XNJA 3U60B 3ZVKA 3H4VA 1YB1A 3ESYA 2Q7XA 3U19A 1T2VA 4Q18A 1OXMA 4CF3A 2Y05A 2O7SA 5DRYA 3AIIA 3IURA 1A97A 2DPMA 4P3OA 3WBBA 3INGA 5E4JA 5C9ZA 1Z73A 2A3RA 2OD2A 3OE7A 2RHMA 1IG3A 4Q3CA 2R7LA 4REOA 1UEIA 1Q0RA 5CYOA 5F2KA 5L7YA 1HDZA 4FLMA 3FE2A 4A26A 3AETA 4AFNA 2CEKA 4TS4A 2FXIA 1LJ8A 1TA4A 2CJFA 2HDWA 1FMFA 2Q99A 4B35A 1ZMOA 3KWFA 4L4RA 2I62A 3QX8A 3LHDA 5IULC 5HILA 1DIBA 1V5FA 1F38A 1KBZA 4WNCA 1L7PA 1VIMA 4JGIA 4G1MB 3U3JA 3U3OA 3UICA 5LMZA 4N48A 3S28A 5IAOA 1UXOA 1N5JA 3MUNA 3SK0A 2W6MA 1H85A 1H5UA 2QVZX 4ON9A 3QVMA 4ID3A 2PX5A 4R9NA 4OLHA 2WJZB 1IAVA 4EDFA 1US8B 3K9CA 4L3WA 3A7DA 3VR4A 2RGDA 1L1EA 2ZB8A 3RSQA 3H2KA 3EXHC 3KLMX 5A1TA 2ZI5A 4YCSA 2VEOA 1FYEA 4NYIR 1IJBA 4LGVA 3NHKA 4LHSA 3JAKA 1CB0A 2I80A 1OBCA 1E5TA 2VYND 2WG2A 2XYPA 4Q05A 4XGQA 1WV1A 3B1JA 3H17A 3UAGA 3IPYA 1VMDA