5ICMA

17beta-hydroxysteroid dehydrogenase type 14 in complex with a non-steroidal inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
255
Chain Sequence
TRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 255
sequence length 267
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5icmA00
1PQPA 1GU7A 2B69A 3K2BA 3KYCA 4D0SA 4CQLA 1KVQA 1JW9B 5H83A 3DMTC 3MTGA 4WJZA 5L7WA 1WDKA 2CNBA 1VRWA 1H6DA 1YBVA 4NIMA 1U7TA 2PKQO 3GVPA 4GBJA 4YRAA 4EZBA 4E33A 4ND3A 4YT2A 3HDYA 5CDTA 5JO0A 5CDUA 4MVJP 2WM3A 2X1HA 2FWMX 3L4BA 3NTRA 4JLWA 4KMSA 4PCVA 4YJDA 5AYVA 4AICA 5ICSA 4IQ8A 1H9BA 4CM6A 1M75A 5KVQA 5IDYA 2NNLD 4Q3CA 3ROPA 2HK7A 2Q46A 3D7LA 1AE1A 5G4KA 1UZLA 4E13A 4EYEA 3AUUA 3B1FA 3BMQB 2CY0A 1F12A 1MXHA 4AL4A 3SBOA 4NBTA 5H82A 3PGXA 5EL0A 2J3KA 3WGYA 2Y68A 3DBRB 4FD3A 4TVOA 1E3JA 4IMRA 2OP1A 3AI2A 5JE8A 3S2EA 5DZSA 5A9SA 3ZNNA 4BMVA 4TQGA 5G0WA 2J8ZA 2YDYA 4E21A 5L9AA 5GZ6A 1ONOA 3VPGA 4AJKA 4RVDA 1R66A 3ZWNA 4BL5A 2QW8A 1F06A 1EUDA 2DTXA 3ZGYA 1WWKA 3DOCA 2P2SA 2E49A 3FNGA 4M89A 4WCFA 3GG2A 3JYPA 3LK7A 4TRJA 4CL8A 4YAGA 1SPXA 5IZCA 1QR6A 4GWGA 3E5RA 3R3SA 4WASA 1X1TA 1PR9A 2H1SA 2PK3A 3GDFA 4R01A 5DP1A 1ULSA 1X13A 2YQ4A 4II3A 1IB6A 2FSVA 1TA4A 1RPNA 1I01A 3OQBA 1IPFA 3DTTA 4IS2A 3TSCA 1NBOA 5AXDA 3B6ZA 4ZICA 5ER9A 3WGHA 1V9LA 2AE2A 4L4RA 5TS3A 2J3JA 4J6FA 1ZIDA 5T57A 4HFNA 4MVJA 1K2WA 3FSRA 3PIDA 2O2YA 4PZDA 3GF4A 3NGXA 5KKCA 1DIGA 2RH4A 2VUTA 4YJHB 3UCFA 4TRMA 1DLIA 2X22A 4XQCA 3PTZA 1G1AA 1N1GA 4CM5A 1NPYA 4GX2A 5IN5A 3ZWBA 3D4NA 2OL4A 1AHIA 1V3TA 3ZU5A 3TZ6A 4DLBA 1JQBA 2CSUA 1HSZA 4FFLA 4K1LA 2WD7B 2NQTA 1TEHA 4KUEA 2WEKA 5TNXA 5IXSA 3H5NA 4J4TA 4WOJA 3RWBA 5FYDA 1E77A 2IZZA 3H9QA 1ORRA 4K9DA 1DRVA 2R6JA 2Q4EA 3D4PA 5U1PA 4A10A 4WNCA 5DBFA 5AXBA 3CE6A 1Y8QA 1FDUA 4WECA 1PZGA 1ISIA 4CMAA 4BNYA 5B4UA 4PZCA 2Z95A 3BA1A 1J0XO 3EVNA 3SC4A 1A4IA 3HB5X 1ULUA 2X7HA 3MTJA 4O0LA 2BI7A 3E9MA 2BF7A 3H65A 4BGEA 3O26A 3OETA 2XPCA 4GAEA 4R9RA 5BT9A 3RI3A 2QIOA 6LDHA 1HL3A 2Z1MA 2PY6A 3OJEA 3OECA 3AOGA 1E6UA 2Y0CA 1GD1O 1KVRA 1TT5A 2ZQYA 1ZSVA 2O3SA 1E5LA 1MA0A 4XZ3A 3RAJA 2X0JA 3X2FA 4BS9A 4CLHA 1AHHA 4M54A 3GH3A 1EK6A 4PRKA 2ZJ1A 3V2HA 2DUWA 2GYYA 2EGGA 1LNQA 1ZKMA 3CKYA 5DCWA 1ZK3A 1NVTA 1ARZA 2WYUA 2ZTVA 3HDJA 3ZV3A 1YQGA 4E5KA 3O8QB 1ZK0A 4IMPA 2PZMA 4OXYA 4DBVO 3GZNA 1AXGA 3D3EA 2NQ8A 1C0PA 1EK5A 1PJ2A 4JBHA 2DC1A 3INRA 4HXYA 3MJVA 1XDWA 1YB4A 3DAGA 2B4QA 1CJCA 1NVGA 4Z0PA 1XGKA 1NAHA 3QIVA 1GEEA 1ADCA 3K73O 3UN1A 3QVOA 1CETA 1EUCA 4CMCA 1AXEA 4W6ZA 3WX0A 1C1DA 2FR0A 2EG9A 3BXXA 3NRCA 3QQPA 5HWSA 2AE1A 4ZRMA 4CV0A 2IXBA 5KJ1A 3H5AA 4GVLA 4GQAA 1HZZA 4D45A 1A7KA 2I6TA 4CMEA 4R3WA 4ZQHA 1HYGA 2VHZA 4FFRA 2VHWA 3ADOA 1PL8A 5A9RA 3NX4A 3P2OA 4GPD1 2PKRA 4CMIA 5JFOA 3W4JA 2GASA 2FZWA 4BHTA 2ZKLA 1E3WB 3BMOB 4ZQEA 2E37A 3ABIA 1EFLA 2VT3A 4MVJM 5A03A 1FK8A 2EXXA 1QYCA 5G0UA 4Z9FA 2PD3A 1ZK2A 3OQ1A 2WDZA 3RASA 4MO2A 5TRTA 4IQGA 3JQAA 2X9NA 4RL6A 3RVDA 2GNAA 3G0OA 3Q3CA 5TGDA 1Y8RB 3H9JA 2EV9A 2V6GA 3AU9A 1LC0A 3ONFA 1C0KA 5JLAA 4BO3A 4RDIA 3DBVO 5JMPA 1T2CA 3AI1A 3DAFA 3GEDA 3QWBA 1ZBQA 1U2DA 4R16A 3VH4A 4DL9A 1H6BA 1QORA 3R0IA 4XQ9A 1D3AA 4J16A 4IS3A 3VDRA 1I33A 4RPJA 3L6OO 3DZIA 4CM9D 4NJMB 4RLHA 4DQVA 3GFGA 1H94A 1GYPA 2C29D 3SVTA 3MJTA 4I1IA 4U0JA 5IXYA 2EP5A 2OORA 1UR5A 1E3LA 1ADGA 4LRSB 4BNLA 3JD2A 1QMGA 2C7VA 4J9UE 4ND2A 1IHXA 2B83A 2W2LA 2YDXA 3AY3A 4DPLA 3WTBA 5I8WA 4RF5A 2AMFA 2SCUA 3KETA 3L6EA 3KSDO 1KEUA 2PZJA 3C7DB 3O4RA 3P19A 3ZNQA 4CMGA 5G0VA 4WUVA 1WZIA 4Y6PA 4E2WA 3JYLA 3SLGA 3FNEA 3DHYA 3IS3A 5A5FA 1VSUA 3WR5A 4QEDA 5CG2A 4DQUA 4XKJA 1LJ8A 3JQCA 2ZK7A 2IEBA 4C7KA 4CMHA 1HKUA 3GC6A 1M6WA 1QLHA 2ZCVA 1PJCA 2W2KA 3GNQA 4MVJH 3W1VA 2HAEA 4J3FA 4MVJE 4RPKA 2C54A 4NMHA 3R6DA 2O2SA 5GMOA 4CUJA 2EGHA 3AM3A 3Q2KA 4JBGA 3IJRA 2GCGA 2J6IA 2Q4BA 5KVSA 1YXMA 3ZW8A 1CIVA 5I9NA 1U3WA 2HJSA 2HCTA 3UH1A 4LCEA 1PJBA 1ZVMA 3EY4A 3OQ6A 4JQCA 4TZKA 4CM8A 5MDHA 4WNIA 4WCDA 4P38A 1BTOA 3WGIA 1CRWG 4OSPA 3NV9A 1EZ4A 3DBLB 4XYGA 4CM3A 1MG0A 3VVBA 3JQGB 3KUXA 3S55A 1EVZA 1X7DA 1P31A 5IDWA 3JYNA 4CMJA 2IZ1A 2TMGA 3WIEA 4GSKA 3VVCA 5COAA 2D3TA 1ENZA 3HADA 2X86A 3GY0A 3HHPA 4E0BA 3LDHA 2RHRA 1ZXLA 3JQEA 1I32A 2EWMA 3T4EA 5GZ1A 1HLDA 4BOYA 3HFGA 1QG6A 4A27A 2P9CA 4A0SA 3LQFA 3BHIA 4PLTA 2J3IA 5CDSA 3UCXA 4FJ1A 2JAHA 3WGOA 2A94A 4HFMA 1EBFA 4YR9A 1KYQA 1VI2A 3RFVA 4ND1A 1IHYA 1SC6A 3ROQA 3GVXA 3ZHBA 3QVTA 2DBQA 3D0OA 4FW8A 4DREA 1N92A 4LW8A 2EKPA 4YPOA 3NTQA 1YQDA 3GZ4A 3VOSA 1KERA 3Q9NA 1JVBA 5JMWA 4XGNA 3HUDA 3GUCA 4UUMA 3AK4A 1YL7A 4B4OA 4Q3EA 1NQAO 1IYZA 1Y7TA 4YYZA 5B4TA 3CIFA 1TI7A 4D3FA 1RM4A 2FY8A 4DPMA 3UFXA 2PKQP 1UAGA 3QE3A 4XIYA 1YKFA 2Y0DA 4IDAA 2JD1A 5DN9A 2OMEA 2EJVA 5JCJA 2POQX 4Q3AA 1KY4A 4CUKA 3RUCA 3BMNA 2AG5A 2CDCA 3FR8A 1P1FA 2E6UX 3PXXA 4ZN6A 1LQUA 3FHLA 4FC7A 4HBGA 4URFA 1WW8A 3A4VA 4NU6A 3T7EA 3TF5A 1T1RA 4K6FA 1FDWA 1H6CA 1RM3A 3C85A 4R5HA 1YL6A 2VHXA 4PZEA 4AJOA 1AUPA 3UXYA 5A4DA 1Q7GA 3GVIA 4CM7A 1B16A 3TPCA 4BNTA 1ZMOA 1WP4A 2ZTUA 4E5MA 1DLJA 3E9QA 4WOKA 2OXIA 4HP8A 4WEOA 3ZWOA 1DSSG 3DAPA 1ZJYA 1Z73A 2VRBA 2YZ7A 3WGGA 1ZJZA 2VZ0A 5C7OO 4B7UA 4GI2A 4RDHA 5A3VA 3ULKA 3V1UA 2Q2QA 3H9EO 3MCVA 3KSUA 1VKOA 2OHXA 2DLDA 1GUYA 3K31A 1LRKA 1U4OA 4MKZA 3EAGA 3IJPA 2PGDA 3QV1A 1HZJA 3OEYA 1T4BA 3GPDG 1FXSA 3AM5A 3D3WA 5TSDA 1GADO 5I7FA 4DRYA 2I3GA 4GSLA 4HFJA 4H16A 3VZPA 3VZQA 2FN7A 4RF4A 2RH8A 1Y1PA 1ZCJA 4CM9A 3BAZA 3CZMA 2EIHA 4N54A 5T8KA 3UCEA 3RCBA 2Y0EA 1K89A 5DULA 2FPGA 1DFIA 1Y5RA 1DHTA 3ICCA 4CQMB 4BKQA 3DHNA 2QX7A 2RAFA 4L4XA 1ENOA 1LLQA 3WNQA 1HRDA 4RJTA 1LRLA 3WMXA 1SMKA 3DOJA 1BGVA 1EE2A 1HLPA 3AOEA 1VJ0A 2QHXA 1BXGA 3UGKA 1XU9A 5U4QA 3B1JA 1UP7A 2BMAA 2NVUA 3U0BA 3ZI0A 3OFSA 2HMSA 4UUOA 4ZD6A 1T4DA 4BNWA 4RVSA 3P7MA 1E7SA 3EZLA 4EJ0A 1NQTA 2ZJ0A 4NI5A 4ZQGA 2FR8A 3OF2A 1JAYA 3WNVA 2P4HX 4A2CA 1X0XA 4JGBA 4EI2A 2NUAA 1DDOA 5JBIA 1LEHA 2JCYA 4WEQA 4XCVA 3NDIA 3WS7A 1VC2A 3PI7A 4XX0A 2WYWA 1CQJA 1UXGA 4L4SA 4RQUA 4B3IA 2DPHA 2PR2A 3GUYA 2V6FA 4FJ0A 3VC7A 1A71A 2FPPA 3EK2A 4ZQFA 5LC1A 1DRWA 3DWFA 1LLDA 3PDUA 3ITDA 1U5CA 3GAFA 2XAAA 3FN4A 4CM4A 2O3UA 4Q39A 2W8ZA 2ZYAA 4RCVA 5I8ZA 5JO9A 2UUPA 4Y6SA 4KWHA 4LSMA 2JHGA 1GPJA 4N5MA 3G49A 2AQHA 4D3DA 3PLNA 5THKA 3RUFA 5F3RA 3M1AA 1E7MA 2B5VA 3JQ8B 1CF2O 3GNTA 5JDIA 4ZRNA 2BGKA 2GN8A 4I5GA 4MJLA 5TT1A 2ZCUA 1HT0A 1T2DA 2PTGA 3GT0A 4E5NA 1GUFA 3H7AA 4B8ZA 4R1NA 4AJEA 2DPGA 1R4NA 2F00A 1KEWA 3OH8A 4JXKA 5I9LA 3ZWVA 4MOWA 2CVQA 4OKIA 5GY7A 3WSWA 2C2XA 2EW2A 1J4AA 2JCVA 5JCXA 1YGYA 1HE2A 1E6EA 3LF1A 1PS8A 3RKRA 2GPTA 2FOIA 4NBWA 4U6SA 4NNJA 1DFHA 2Q1WA 3WYBA 3E6AA 2GZ2A 3DZJA 1A27A 5BR7A 3QA9A 5F21A 3ZN2A 3PHLA 1N7GA 3D1LA 1YONA 4G81A 2O23A 1NYTA 4UEKA 3VPFA 3LC7O 3K9QO 4RORA 4YAIA 1MC5A 1ONNA 3QP9A 4B3HA 1F14A 3DDNA 3PHJA 4CLRA 1K6JA 4OO3A 5K9ZA 4FR5A 4D42A 2AQ8A 5L7TA 1Q0LA 1K0UA 1OAAA 1N1EA 3JQ9C 4OQZA 1AN9A 1DBVO 1GZ4A 1LX6A 4AJNA 2QRJA 5IFLA 3EVTA 1LLUA 3WMWA 3S2IA 3DFUA 5CPFA 3GK3A 4QSMA 4Y98A 1PQUA 4CLOA 4RZHA 4IIUA 3R1IA 4DXHA 1NAIA 1HYHA 3NJ4A 3ZU4A 3GMSA 3KTDA 2C07A 1ZO8A 2ET6A 4XQEA 2I67A 3ZWYA 3Q0EA 5HA5A 1QV6A 4AJ4A 3WLEA 4BNKA 4FBGA 4QFCA 1TVEA 4O6VA 2OBYA 5HS6A 3RC2A 1WDMA 4YAEA 4K6CA 4XA8A 5DP2A 3IAHA 4U7WA 2EKLA 5A9TA 2GSDA 1I3LA 4BNJA 2I66A 1UXJA 2UUOA 5A06A 1BDMA 1CEQA 1UDCA 3V1TC 4BNIA 4LVUA 1GCOA 4GL4A 2XOXA 3TJRA 1N7HA 1QYWA 4LMRA 1C1XA 4J0FA 3JQAD 1NP3A 3MOIA 4KOAA 9LDTA 4IJWA 4NH4A 4HY3A 1PS9A 1E7YA 3M2PA 4MIYA 3I5MA 3JD4A 3I9JA 3AY7A 1PEDA 2A4KA 4R1UA 1E3SA 1H0KA 2LDXA 2G1UA 3AJRA 1IE3A 2GDZA 3MOGA 4J4HA 1U28A 4XYMA 4BKRA 4HNHA 1NFFA 3QRWA 4IDDA 3OM9A 2GERA 1PJ4A 4LK3A 1PJTA 2HLPA 3PWKA 4PLHA 2PGLA 1FDTA 4YAKA 4YJGA 1UAYA 3M2TA 4BO8A 1XHLA 4R41A 4WLEA 3PLRA 1BMDA 3OA0A 1Y8QB 4L8VA 3WQSB 4CR6A 4NBVA 2X5JO 1H2HA 1V3UA 1U5AA 3ZW9A 1ZNQO 3F1LA 5CEFA 5IDXA 3I1JA 3OHSX 1V3VA 5THQA 4XYBA 4BGVA 3UVEA 3IIEA 2H9IA 2Y1OA 4EBFA 3SC6A 4U0KA 5JNLA 1SOVA 2W2LD 3COSA 1G0OA 1TT5B 4XR4A 3RROA 3SX2A 3JQBC 2BHLA 4MKRA 4P22A 2QZ9A 4GKBA 2IYPA 4BNZA 1B14A 5IF3A 1NX6A 4IJVA 3TN7A 2DTEA 1IZ9A 3G3EA 2IEDA 4CLXA 1VL6A 2E48A 2GN4A 1VE9A 2OUIA 3BTVA 1HWYA 3KYDB 5EERA 3IKVA 4M1QA 5C3MA 5KIAA 1O5IA 2Y1EA 1OBFO 4NFYA 3PHIA 3WBBA 5CAEA 1R0LA 4BKOA 2HMWA 5JYEA 2WSBA 3H9GA 3I9MA 3HN7A 3S2GA 1XQ1A 3VH1A 2BD0A 3TL3A 3AUTA 2HU2A 3ZWMA 4TKLA 2HRBA 3L4SO 4EGFA 5U9CA 1SZJG 4RVFA 2GZ3A 4WLUA 4ZHSA 3F46A 4EUFA 1LI4A 4GGPA 4BO2A 2YV1A 3V1YA 1RYEA 3IUSA 4PLVA 2LDBA 1X0VA 4N5NA 4FFPA 1KBZA 1DIBA 2BI8A 3QVXA 2G5CA 2AQKA 2PD6A 1A72A 3ICPA 2UDPA 1UZMA 1I3NA 2C20A 1UXKA 2QYTA 4DIBA 1YWGO 3FNHA 1DFGA 3KSZO 1W4ZA 1BW9B 3WJAA 2VYND 4RPGA 1BDBA 4KZPA 4CUZA 1Y6JA 4JP3A 2DTDA 3EGOA 3JQDA 1GZ6A 1MX3A 4PLWA 1ZFNA 5BSHA 4WCFC 5EJ2A 3RIHA 3ANLA 2QZZA 2O4UX 5IAAA 2ZB4A 3NGLA 4JJGA 4UVDA 1PSDA 1QV7A 2EW8A 1NR1A 3TL2A 3WGZA 4Y6RA 4MP6A 1LUAA 5TIIA 2V7PA 4BIIA 2HUNA 5G2OA 4IY1A 5CPBA 1NTOA 4YT4A 1ZSNA 1Q1NA 4JJIA 2EEZA 4A73A 4Y9DA 4JBIA 4P4NA 2J3HA 2YV2A 4IIVA 2NU8A 3F47A 2JFGA 1VLLA 3LT4A 4R4JA 2HMTA 5EINA 4UVGA 1ISMA 4XRRA 4DC0A 3W6UA 4PLCA 2RCYA 2Y1CA 1JKJA 1YOVA 4IJUA 2B4RO 2VWQA 1EDOA 2PFGA 4AJ2A 3ASVA 1DIHA 4D43A 3BMQA 5CG1A 4LRTB 3RUIA 3ZV5A 4K28A 2C82A 5CP8A 5AXCA 2HJRA 5JCJD 1MV8A 3QVSA 1Q7BA 4CM1A 3U3XA 4DA9A 1J49A 2NU6A 1R37A 3OIDA 1NQ5A 3VH3A 1JU9A 2HQ1A 2YHIB 4BGIA 4YXFA 3GVHA 4J43A 5ER6A 5I7SA 3QVWA 2GZ1A 1XR3A 3D5TA 4XEHA 1LDGA 4GX1A 2V6MA 1EEHA 5EQFA 4ZQBA 2QRLA 4GH5A 1BWSA 6ADHA 4OKNA 1KETA 1EVIA 3K5PA 3I6QA 1HE3A 4MP8A 4I5EA 2WJPA 2O50A 1I3MA 3OMLA 4I8XA 1K3TA 2GRAA 3DMYA 4A5OA 2WYVA 3I83A 4C7JA 4YJFB 2VUUA 1GL3A 4GX5A 4CLEA 3TDKA 1DJQA 4RF3A 1YS4A 2X5OA 2HKIA 5TT0A 1T25A 2I5PO 3GG9A 3INTA 3OJOA 4UVIA 3G79A 3ONDA 3S8MA 3T4XA 4BO9A 1DRUA 4IUYA 2IODA 1MP0A 4CLDA 3ASUA 3D5QA 1GZ3A 4UAGA 4YJHA 3WG9A 1W6UA 1B8UA 4Z6KA 4DVJA 5ICMA 4KWIA 1PGQA 4Q9NA 3ZWAA 2B5WA 4J49A 3PZRA 4YEDA 4WGGA 4ROSA 2PH3A 3RUEA 3H6KA 4W9NC 1EVJA 1SOWA 3C1TA 1VSVA 3VH2A 1FF9A 1HDCA 2RIRA 4B79A 1RM5A 3K2EA 4G2NA 1H93A 2Y67A 4TZTA 3QWFA 4YBZA 4OOEA 1YB1A 2JL1A 1JWAB 3SXPA 4ALKA 1SO8A 3GQVA 4J7CA 1E5QA 4XB1A 3PYMA 2WD8A 3E18A 4PRLA 1B8VA 4AG3A 4H7PA 1SAYA 3OEWA 3L07A 4CV2A 1V0JA 1HDYA 2A35A 4Q3DA 1GQ2A 2HMVA 4DQXA 2A92A 1UP4A 3ADPA 1TXGA 5DT9A 4QQRA 3NT2A 2BKAA 2OO5A 4E5PA 1M2WA 2DT5A 3ON5A 1ISFA 4KDFA 3CMMA 4NQZA 2ZIZA 1RKXA 5JSFA 4QTZA 1I36A 2NLOA 3VAZA 1U7HA 5I9MA 2PGJA 5BSFA 1P1IA 4ESOA 2Q49A 1LSUA 3U4IA 2P9EA 2B4TO 2GLXA 3L9WA 2QRKA 1O0SA 3O8QA 2EKQA 4NJOA 4DLAA 2H63A 2Y99A 3RFXA 4IDGA 2YFHA 4KUGA 2GN9A 3UHAA 1MC4A 3BMNB 4JP2A 4G65A 1BXZA 3BTSA 5KVVA 3NT5A 3P2YA 4P8RA 3PWZA 3LT1A 1WMBA 5JDCA 3M6IA 1ZXBA 4XDYA 3PK0A 3GN2A 5ES3A 3EC7A 1F8GA 1L7EA 4PG6A 2X6TA 2PA3A 5KOIA 5IDQA 4HUJA 3B20A 3WWZA 3GAZA 5A1TA 3I9LA 4GLOA 1I8TA 4PG8A 4ALJA 1UP6A 4BQPA 4RF2A 4IXWA 3L6DA 1JWBB 3RBZA 2VYNA 1U8XX 4J1NA 3IKTA 2PV7A 3ZHZA 5A05A 3F5QA 1LLCA 5AVOA 4BNMA 3C7CB 4E2ZA 1MFPA 3BMOA 5TLSA 1JA9A 5KKAA 7MDHA 4KUHA 4RPLA 3A28A 2GGSA 4OXNA 3W8DA 4IZIA 4OL9A 2NTNA 4XB2A 1D8AA 3ETEA 2O3RA 3WLFA 4GGOA 4DWVA 4N18A 3ENKA 3FTNA 3ZCXA 1B2LA 4ZJUA 2R00A 3RSHA 1Y8RA 5IG2A 1PJSA 3PPIA 1LTHR 3I6IA 4R5MA 5KTKA 4F6CA 1IULA 3EZYA 3KV3O 1YB5A 5A04A 2YV3A 4EDFA 5EESA 3MJSA 3WQRA 1A9ZA 2JFHA 4BNNA 1YJ8A 1DIAA 1I3KA 4NU5A 3PWSA 4R69A 1Z6ZA 4XR9A 3A1NA 4KQXA 4HFRA 1HEUA 1HDXA 4O63O 1R16A 4TROA 1NR7A 4NJMA 1ID1A 2Y05A 1UJMA 3C24A 1Z75A 2I9PA 2NVBA 1ZEJA 5COQA 4BNVA 3DXFA 4QO7A 1EFKA 3HJAA 4M86A 2FMUA 3FWZA 1QSGA 3FWNA 2DKNA 4CQMD 2AEMA 2WTBA 1WAMA 3ANMA 3O38A 1ENPA 3NDJA 2NACA 2W4QA 4BNGA 4FGWA 3JD1A 5A3JA 1P33A 4BB5A 2X23A 2B0JA 1O9BA 1Z45A 2RBEA 3B70A 4PG7A 3F4LA 2BFAA 3BZUA 3OJLA 3FCOA 4WLOA 4D41A 1Z74A 3M1LA 3C1OA 4CMBA 2VTEA 2EF1A 3W6ZA 4FPXA 1P1JA 3UKOA 4N7RA 1DO8A 3EDMA 2NVWA 4NPCA 2B36A 3ZU3A 4L75A 2ZB7A 4K26A 2VWHA 5TJHA 2E4AA 5L4SA 1C0IA 1P3DA 1U2GA 3WWYA 3I9KA 2NWQA 2P9GA 1YO6A 1BG6A 1PS0A 3IMFA 2X9GA 3Q9UA 3RU9A 1KVSA 5KCZA 4NBRA 1HDGO 3PJGA 5K0ZA 4BV8A 2NADA 4L74A 3GVCA 3ROMA 3GGOA 1IUKA 1J6UA 1PGNA 5JC8A 3H2SA 2JFFA 1R4MB 1HYEA 5A02A 1WXDA 4ILKA 1HDRA 4MPDA 3X2EA 4M49A 1SB9A 4AJJA 1YQXA 1DJNA 2CF5A 4RGBA 4E32A 3V2UA 3K92A 4BO0A 1DC3A 4OH1A 1Q0QA 4Z3KA 3OP4A 3MEQA 1ISJA 2DBRA 3AUSA 2FPIA 3ZNOA 3PFWO 3I9NA 3VPXA 2D8AA 2E82A 5B37A 4DIFA 4FSHA 4P4GA 1SBYA 2HO5A 3WFJA 4DIOA 1RYDA 2BGMA 1E92A 2X58A 3DBLA 3MWDB 3ZHXA 2Q1UA 4TRNA 1BVUA 3LYLA 1H5QA 3JQGA 4P4LA 4BNFA 4D3SA 5JS6A 2R2GA 5HTOA 4FIZA 1YDWA 1BHSA 2O3JA 1E1KA 2VHYA 3C3XA 4M8SA 2IDZA 2VWGA 1OMOA 4AJHA 1XSEA 4R68A 1E1LA 1ENYA 2D5CA 2PD4A 1W0CA 4FFNA 4R1SA 4AJLA 3MZ0A 2DFVA 2VT2A 1NXQA 4OGWA 3W4KA 1XCBA 1FDSA 4L73A 3JQ7B 1JVSA 2HMUA 2JCXA 1X7HA 3FNFA 1JTVA 2CZCA 3TZKA 4IINA 2GR9A 3V5NA 4U6QA 2A9FA 1ZK4A 1MUUA 3U5TA 5I7EA 4AJ1A 1HETA 5ENVA 5IJZA 1O89A 1HDOA 2VCYA 1E1MA 2HK9A 3VKVA 4BVAA 2OFPA 4FFMA 4YA6A 2C5EA 3RBXA 1E0DA 4CLOB 3OIFA 2ZYDA 3KEQA 3RUHA 5H81A 3FR7A 1PX0A 3JQFC 3HE3A 3AUAA 2PWZA 5I7VA 3ZZNA 3IP3A 2JD2A 5T8KC 5CEEA 5K6AC 4DPKA 2WWRA 2Q3EA 9LDBA 3PJDA 5GZ3A 1GPDG 4F6LA 5F5NA 2Q1SA 3H5RA 3GPIA 3BMCB 1LDEA 1GEGA 4EEXA 1M6HA 3WGTA 1GR0A 1Q7CA 4R51A 3KLMX 1T1SA 3TZQA 1L7DA 4DLLA 1SCUA 1B3RA 4XIJA 2XF8A 5DBGA 4BQRA 3UUWA 5KJFA 1DAOA 2UYYA 3AOEC 2DAPA 2PH5A 4J2HA 3FI9A 1CYDA 3PJFA 4OQYA 1T26A 1GDHA 2VNAA 4M87A 2PLAA 2VTDA 1LU9A 3BHJA 4UEOA 4BO7A 5ITVA 3R3JA 2Y66A 1EE9A 3PZBA 4YDRA 4D0RA 3UICA 4YACA 2X5KO 2VN8A 3KYCB 3RD5A 4DMMA 4CQLB 4B3JA 3FBTA 4NR0A 1ZK1A 2AQIA 3V2GA 1ONPA 1PIWA 4R3NA 1LBEA 1DB3A 2OBNA 2NSDA 3ONEA 2JKVA 2I76A 4IDFA 4E6PA 5LDHA 4YTEA 1R6DA 4B7XA 5C7IO 1I10A 1JDJA 1PWXA 4ALLA 3Q6IA 1DEHA 4PLZA 4S1VA 3QY9A 3RU7A 3U4HA 3ANNA 5KVCA 3TOZA 4HWKA 3Q1LA 4UEJA 3A9WA 1PGPA 2CD9A 5G4KB 3I3OA 4J91A 1CQIA 3C7AA 4AJIA 1HE5A 1YH3A 3G1TA 2Q1TA 3PP8A 1X7GA 1N2SA 2BRUA 2VQ3A 2X0NA 5A9SB 4BV9A 4Y8VA 2D4AA 1EBUA 4CQMA 5ADHA 4ZVVA 4YT8A 3INGA 4WLFA 4MIEA 4B4UA 4BO1A 5IZ4A 2CF6A 3DZGA 3N58A 1LDNA 3W8FA 1B8PA 4J0EA 3A06A 4WCFB 4CR8A 5L51A 3LC2O 3PFFA 3WDSA 1JKFA 3C1AA 3PGJA 4MVJI 2CVZA 3U49A 3HFSA 1VPDA 5LCXA 5CDGA 3GHHA 4BNXA 5EPOA 3LSYA 1ISGA 1I5RA 4YB8A 5EN4A 1NFQA 1OC4A 1DXYA 1U1IA 2YYYA 2P5YA 3FBGA 4TRRA 2QG4A 2VNSA 4FFOA 2Q2VA 1U3VA 4IGEA 4MINA 3DMTA 5HRUA 3RUAA 2NU9A 4CMKA 4BMSA 4HNGA 1WDLA 4YRDA 4KTVE 4A03A 5AXAA 4OIMA 3HG7A 2I65A 1QYVA 2W90A 3RFTA 2AW5A 3TWOA 8LDHA 4E12A 3CH6A 1PZHA 3WQQA 4FGSA 4HV4A 3NEPX 5BNFA 3RUDA 1LRJA 3GEGA 1HTBA 3KOUA 5FEUA 3GGPA 2D0IA 2FSSA 2CDBA 5T64A 4MDHA 5DNAA 4KP7A 2W98A 3WICA 1TB4A 1HF3A 4OSOA 3A14A 4Y67A 4XJTA 2FZEA 3RC1A 4EUHA 5MGBA 3QSGA 4JROA 3VZRA 2I99A 3G17A 4PLGA 1IL0A 3RBVA 3TQHA 4LN1A 1ZW1A 1Y81A 3KZVA 1BRMA 4WPGA 2IYOA 4ZU3A 2Q50A 3E8XA 1P1KA 3KXDA 4FCCA 1NVMB 1PGJA 1O94A 2Y93A 4ZA2A 4PFJA 3ZV6A 1H9AA 1KC1A 1PJLA 4MIOA 4AJPA 3DL2A 5L40A 1P9LA 3VTFA 2VWPA 3WYEA 3GRKA 3TRIA 3KRTA 3SLKA 4DYDA 3PQFA 1CWUA 5L4NA 1RJWA 3EW7A 3TOXA 1EQ2A 3GMDA 4BB6A 3VPSA 4I08A 1PGOA 3VTZA 1YOVB 3GZNB 3MJEA 3QLJA 4BGUA 1JN0A 4ZGWA 3ZV4A 1C0LA 4ND5A 2JAPA 3WBFA 2B35A 4L76A 1ZUD1 2O4CA 1E1NA 3ZWCA 2WE7A 3AWDA 3NJ8A 2P5UA 1BXKA 2NU7A 4RVHA 3HDQA 4CODB 5AOVA 4PVDA 1GUZA 3L77A 3GOHA 4NBUA 3L4BC 1KC3A 4D7AA 1G0NA 2Y1GA 4BUCA 4X54A 1GYRA 1C1DB 3D64A 4XYLA 4RVGA 3G1UA 5FFFA 2BFPA 3JQ6A 1P0FA 2BLLA 4OYRA 4RPHA 2VZ9A 4ND4A 4DTIA 1S7CA 3VKUA 4IPTA 3E03A 3GLQA 1I2ZA 3GN1A 4CMIB 2ZTMA 4I5FA 2GF2A 2VRCA 4WK6A 3SJ7A 4NFSA 5JAZA 5L95A 1G6KA 3WOHA 5DF1A 3GHYA 1DC6A 1YBAA 5CFZA 3Q11A 1R0SA 3F6YA 4B4WA 1UXHA 2DVMA 3E48A 4OOFA 3GEMA 1PL7A 3ZWWA 4YWJA 1OC2A 3FTPA 5FWNA 3JD3A 3NDRA 1P1HA 4GVXA 5DOZA 4IXTA 4I5DA 5ILOA 4S3MA 1F0YA 3JQAB 4RV9A 4XGKA 5F5LA 3LT2A 5CDYA 1XKQA 4J7UA 1SNYA 1R0KA 3DQPA 3DBHA 1GYQA 1V8BA 4EITA 1LC3A 3AFMA 1QXSA 5IZCC 5T6BA 2AHRA 4F45A 1IZ0A 1HSOA 4PN3A 1KS9A 5JY1A 4PG4A 2HDHA 1N9GA 2DBZA 2DM6A 2O48X 3NKLA 2GO1A 2UAGA 3NT4A 3PQDA 1QYXA 1Y9AA 1B7GO 1QP8A 2WE8A 3E82A 1FJHA 4IM7A 3H3JA 4OMUA 5KJ6A 1WZEA 1WNTA 5G0TA 1GQYA 1VL8A 1YE3A 5LDGA 1U4SA 3RJ9A 3FPCA 3TZHA 1T2EA 4HX5A 1PWZA 1Z7BA 1ADFA 5C5IA 4E30A 4BO4A 1FMCA 4U5QA 4IDBA 2IE0A 1Q0HA 2OOSA 1DC5A 1KVUA 1O95A 1XYGA 5F1OA 2CVOA 5BNIA 3I4CA 4TSKA 2YY7A 4ONEA 3ZWPA 3EYWA 2X0RA 4Q3BA 2YUTA 5T5QA 1GV1A 1NM5A 3DBRA 5F1KA 1YVEI 4KQWA 2Q99A 1JAXA 3LLVA 2J5KA 1P0CA 2FR1A 4TMFA 3DO5A 2CDAA 1PR3A 5JAQA 1M66A 2AXQA 5B12A 2AG8A 3BYZA 3KYDA 1WVGA 1JLLA 2W2KB 5C7LO 1E3IA 1DAPA 1WMAA 4PGFA 2VUSA 3V8BA 2ILTA 3CUKA 3GA0A 1MFZA 5DOVA 3UAGA 4OAQA 3RC9A 1GCUA 3HNPA 1XLTA 1DOHA 1T2AA 1W73A 3B1KA 5TJ9A 3K30A 4NG5A 1BVRA 3TNLA 4CM8B 4UREA 2WMDA 4FC6A 1XQ6A 1UXIA 2O7SA 5L4LA 4W9NA 2FHSA 4IGFA 2NM0A 1RWBA 3KO8A 3LVFO 4GMGA 4PLFA 5T67A 3C8MA 3HZZA 3PQEA 3IL2A 3LF2A 4RLSA 1VJTA 1EVYA 1C14A 1DIRA 2AEFA 1OFGA 1PJ3A 2IXAA 3CINA 4Q3NA 1B15A 4B4VA 1XIVA 1BW9A 1OOEA 2Z1NA 2TMDA 2C59A 1KOLA 3AU8A 2UV8A 3TZCA 3PHHA 2GUGA 4R1TA 4FB5A 1XEAA 2WD7A 4CMEC 1NPTO 2YHUA 5JY6A 4J9VA 4KDEA 2J5RA 4EEZA 1GY8A 1YL5A 1BSVA 1F17A 2J5QA 1X14A 1ISHA 3DZHA 8ADHA 1PL6A 4IDEA 3QJ5A 3UF0A 4LCJA 4JIGA 4BMNA 1N8KA 3VPHA 1P45A 4W99A 4R9SA 3K6JA 4CR7A 3DR3A 3ZHYA 5HM8A 3OIGA 5JAMA 3QWAA 4R54A 1P44A 2D59A 5L7YA 4DBZA 2ZATA 3K96A 4JN6B 1ZH8A 3ZNPA 1TT7A 2OZPA 3RKUA 4W4TA 1B0AA 3IC5A 1T24A 3KHUA 2GD1O 1J5PA 4BNUA 3H2ZA 3O9ZA 4BNHA 1SB8A 1B26A 4EUEA 3DHEA 4YVFA 1MB4A 4II2A 4ALMA 3RJ5A 1NQOA 2G17A 4FN4A 3D4OA 1C3VA 4M55A 3LLSA 5FI5A 2D1YA 4Z3DA 1E7RA 1KEPA 1B3BA 2P4QA 3IQDB 1KY5A 3S2FA 4EW6A 3JYQA 1D1TA 1SEPA 4YCAA 4WLVA 1NHGA 2O7QA 5JW6A 4AFNA 1RM0A 1DC4A 1V35A 4YQZA 3IUPA 5B4VA 2YHIA 4XWYA 4F3YA 3OICA 3F9IA 4UVHA 3BIOA 2O3QA 1KVTA 3TFOA 4FOSA 4WE3A 1E6WA 2ZB3A 3WJ7A 3PVZA 4D79A 1UZNA 4QXMA 4IJKA 2AA3A 3IDSA 5DBIA 2P91A 4TWRA 2Q2WA 4FJ2A 1HDZA 4JX8A 1E3WA 4GKVA 1H6AA 2PNFA 1YRLA 1WPQA 2HK8A 4LMPA 3MWEB 3NAQA 4EJMA 3JTMA 4U8GA 4YJFA 1DHRA 3NYWA 3VDQA 4CV1A 3FPLA 4JJFA 1K6XA 3D3WB 5G0SA 3CEAA 2DU8A 2YFQA 5KJCA 3HQ4O 3LC1O 4A26A 1I30A 4A7PA 3LT0A 3MJCA 2BFOA 5DCUA 3WYCA 3PJEA 1HE4A 4MVJG 4H3VA 3CSDA 3T7CA 3E1KA 1ML3A 4MKXA 4UVEA 3H4VA 4UUNA 5JDCC 2X0IA 4O5OA 3EHEA 1LXCA 4PLYA 5JC1A 1I24A 4HADA 4UULA 1Y9EA 3NUGA 2IZ0A 3NTOA 3PYXA 3ZWXA 4I9NA 5L3ZA 5DDIP 1IPEA 3DZFA 2FP4A 2EJWA 5G4LA 3SEFA 5BSEA 1LQTA 2NTJA 3GR6A 1YBMA 1IOLA 4FDAA 1BXGB 4NHEA 4XYEA 2NVUB 1P74A 4GWKA 2BH9A 4O1MA 2VYVD 4L0QA 1NFRA 3DZKA 3ITKA 1T2FA 4KTTE 4IQ0A 4W82A 4CPDA 2YJZA 4B8WA 1PU2A 3VZSA 3QHAA 4RO0A 3S1LA 2G76A 2F1KA 4ALNA 2R00C 3O03A 4N5LA 5AQ1A 5C37A 4TKMA 2C5AA 3JD0A 3ROKA 1NASA 3U9LA 3OJFA 1UH5A 5BSGA 1K6IA 3JYOA 4BO6A 1QLJA 5KWEA 3IOYA 2VOEA 3GFBA 4RQTA 1UUFA 3AY6A 2HRZA 3GGGA 3PIIA 4L9RA 3GDGA 3W8EA 4CM4B 3FRJA 1ZMTA 3HSKA 1U8FO 3GRPA 2ZYGA 5FI3A 1XWFA 2V65A 3CMCO 2ZB8A 4J2OA 4CL3A 3F5SA 1A7AA 2HSDA 2YQ5A 5KJEA 1NPDA 2EHDA 4IBOA 1XG5A 1M67A 1XA0A 1E7WA 4LSWA 4LVCA 4FOOA 4EJ6A 4DUPA 3GDOA 4MP3A 1FDVA 4NK5A 5ENDA 1E3EA 1Z7EA 3OBBA 3OJ0A 3L0DA 2D2IA 2NTVA 4FQ8A 4MVJF 4O59O 1EMDA 2JD0A 1NWHA 3EMKA 3U4DA 2NV6A 1I0ZA 4FS3A 1ZEMA 1R4NB 1GAEO 3LZ6A 4XJSA 2I3AA 1SEVA 4J7XA 3OSUA 3I4FA 3ZU2A 2BGLA 3DONA 4OXKA 3CXRA 4DC1A 3ZH2A 2DUUA 3ST7A 4INAA 5HBRA 1X1EA 4XD2A 1HXHA 4XRGA 1XELA 2B37A 4B7CA 2C2YA 5F1PA 1QKIA 1AGNA 2H5LA 4W7IA 4D44A 1YJQA 2C7GA 2O3TA 1WLYA 4E3ZA 4F46A 4JCOA 3I9OA 3RQSA 3UW3A 3JV7A 1NWCA 5JAIA 4CLRB 4J1SA 3KB6A 2FRDA 1EQUA 3JQFA 1VL0A 5K6AA 4GX0A 3BHMA 5KNLA 5JXWA 2PZLA 4NFHA 4BO5A 4WKGA 4H15A 1LSSA 1P1RA 3WGQA 2ZTLA 3F1KA 3WTCA 4YQYA 1I2CA 2Z5LA 4OM8A 3PHGA 1MGOA 1A5ZA 1EDZA 4JNKA 4JK3A 3DFZA 3KVOA 4ITUA 2QYSA 3DEYX 3MJ4A 4BKUA 4QECA 5BNTA 1U3UA 2OP0A 3STHA 1F8FA 3CPSA 3WIDA 2VZ8A 3WFIA 3N74A 2GN6A 1VKNA 3JSAA 4BKPA 3BTUA 3PEFA 3N7UA 5EIOA 4LGVA 2VRCD 3DOOA 1ZZEA 1ZSYA 1DPGA 1GTMA 1JKIA 1W8DA 1QRRA 4W7HA 4YAJA 4J1TA 1P77A 4E2YA 1YDEA 1D7OA 4PG5A 3H3FA 1PZFA 1D4FA 4IZHA 1IY8A 4DMLA 3H8VA 3JCZA 1LDMA 2XXBA 4RVUA 1C1XB 2CMDA 1EUZA 3E5MA 3ETDA 1NNUA 3AI3A 1MLDA 1VM6A 3DZBA 4I9HA 1CERA 4MVJD 4G5HA 5JYDA 3VHRA 1M76A 3ENNA 2C0CA 4Z0HO 4OJNA 1R4MA 4XQGA 4NZ9A 5L45A 1OI7A 2XXJA 1X15A 4Z0TA 1GV0A 3DC2A 4DGSA 3WSVA 3FF4A 2X8LA 4YJGB 1Q2XA 5L53A 1R15A 3KEOA 3JQ9A 1CDOA 1R12A 2X4GA 1VJ1A 3HB4X 5B1YA 4PIVA 3EUWA 3F3SA 3QWHA 2QQ5A 3K8ZA 1U3TA 3ZDFA 4YRBA 2G0TA 3W4IA 1KEVA 5TQVA 2Y1FA 5IN4A 2UVDA 5TF4A 5DCYA 2BFMA 4XGIA 3KLPX 2H6EA 3I52A 5TX7A 2OGUA 3Q2IA 4ID9A 3OA2A 4QX6A 5JDIC 4E31A 3TFQA 3PDJA 4ALIA 3HN2A 4HKTA 5ITWA 1D1SA 3F4BA 3DB2A 4GMFA 4E4YA 3U4CA 2BELA 2DBVO 5J23A 4UUPA 2VYVA 2RHCA 3HDHA 2D5AA 5A5EA 5CHEA 4XDZA 4I9UA 3WXBA 4C4OA 2PZKA 2Q45A 1N5DA 2JJYA 3JQ7A 1NHWA 2JHFA 2CUKA 5EQDA 3GNSA 5CEJA 2YW9A 2Y1DA 2X9VA 3H9UA 4NDNE 1KIFA 3PYLA 1Y5MA 3U09A 1PQWA 3DTYA 4Z9XA 1K5HA 2G82A 4NK4A 1GQQA 3QW2A 1LA2A 3PRJA 3QWIA 2AEJA 4J4BA 3AM4A 3L9XA 1TLTA 1QYDA 1LSJA 1O8CA 1PZEA 1A4UA 3HWRA 1PJQA 1GFSA 4QT0A 3FD8A 4J90A 4QUKA 4TVBA 4Z9YA 4PVCA 2DQ4A 4GLLA 4CV3A 5HS4A 3KYBA 4YT5A 1Z82A 1PTJA 5TC4A 4DYVA 4E2XA 3IP1A 2EERA 5COBA 7ADHA 4AVYA 3KBOA 4IDCA 4LISA 1OZAA 3RC7A 3AW9A 1S6YA 3BTOA 3SJUA 4CJXA 1MG5A 3BMCA 3WB9A 3ORFA 1V6AA 2P68A 3ETGA 4OHUA 5FF9A 4D46A 5EMHA 1LDBA 3CZRA 1L1FA 1UDBA 2CFCA 1XU7A 2DFDA 1I2BA 1MXFA 3UOGA 3E9NA 3U62A 3CTMA 3KM0A 2VOJA 2V6BA 3I23A 3JQ8A 2EP7A 3DBHB 5ILGA 1U9JA 3JQBA 5BQFA 4E5YA 2ZQZA 1LSOA 1O6ZA 4WLNA 1LDYA 1H2BA 2VHVA 4J1QA 1A9YA 2IRWA 1ADBA 4QFDA 3LU1A 4RZIA 3P5SA 1E7QA 1N9GB 4PLPA 5JPIA 4QO8A 1UDAA 3AFNA
chains in the Genus database with same CATH superfamily
1PQPA 1JH8A 3NM4A 3K2BA 3PSAA 4WVLA 3IH5A 2C94A 3AKYA 4MW5A 5FWDA 4M9QA 1Z6TA 3BGWA 2PSDA 4Q7MB 4CKZA 3NHBA 1PE0A 1UWVA 13PKA 1VLZA 5L7WA 4QUHA 1WVMA 3LKBA 4LJYA 2W6OA 4NRDA 2HSWA 1P5FA 5HE8A 1P5RA 3LOPA 4F4IA 3H1BA 2YWRA 1ZY2A 2BW0A 3DOIA 4BV3A 3GDWA 4M9ZA 1ZHHA 4RSGA 1FRZA 1BCSB 1H9BA 1L5YA 2YJ4A 3I0MA 1XZBA 2ODQA 3SJZA 4Q1AA 3BFJA 5IDYA 3UHPA 3BXOA 1IAQA 2NNLD 4A8PA 4LXGA 4M7OA 4Q3CA 1S3SA 3Q3EA 2HK7A 4RTSA 1RMQA 1AE1A 1KMHB 1UZLA 3D7LA 3I2FA 1V25A 3B1FA 2BHTA 4LKOA 1RBYA 1XA3A 2B30A 2CY0A 2HJGA 1KI6A 3EGCA 5T41A 4GI3A 3C7TA 4KIJA 2P90A 3PGXA 2J3KA 5FBZA 3V2IA 1I4EB 1Z25A 3SQMA 1E3JA 2JBAA 3GBVA 2JIPA 3P52A 4BN0A 5AD1A 1P0IA 1NBMD 1XZHA 5C1OA 4BMVA 5KSWB 3FI0A 1YZ3A 2NTEA 4TQGA 5J9FA 3VSEA 5AM4A 3KU1A 3MJRA 5TPZA 4JQOA 3M6XA 1FTNA 1L4HA 4GLBA 2FZ4A 1R66A 2K5UA 3PD1A 4BL5A 4E7OA 1CZOA 3L8MA 4TLDA 3OI7A 2QW8A 4ZT6A 2DTXA 2FW0A 2Q6KA 2ZDQA 1Q6YA 1Z15A 3UJAA 2E49A 3DD5A 4MA5A 1ZCAA 4AYWA 3B51X 2C7QA 3IUBA 4MPTA 5CW1A 3RVQA 1QGUB 5JVDA 2PKCA 2H48A 4CL8A 5K99A 3K6SB 3HUUA 1XZDA 2HSEA 1QR6A 3M9WA 4GWGA 4KLRA 4PBTA 4YXWD 5AVSA 4BWGA 3P9SA 1VA4A 4TTJA 1H3FA 4GZMA 5EEHA 4W5RA 1UFRA 5DP1A 1ULSA 1TYBE 3SE7A 3TKYA 4GIBA 4II3A 2FSVA 2XEDA 1CY8A 1ZWKA 3KFXA 1COWA 3H2YA 3EGWA 4IS2A 4TKVB 1S2IA 1FFCA 5AXDA 2ATIA 1BN7A 3B6ZA 4K6HA 4XWAA 5DIZA 1QU3A 5B7PA 1HG0A 4L4RA 1SG9A 4J6FA 1ZIDA 3GOQA 5CA0F 1R27A 3AERB 3EVZA 1E9VA 1K2WA 1M2OA 1RHUA 1GGNA 1URPA 4RMHA 2WV7A 1DUSA 4PZDA 5BV1A 2GEJA 2RH4A 2OG2A 3V42A 5KWIA 4DEVA 1V4BA 3E7PA 1G1AA 3OE7D 2IDMA 4GOKA 1BNCA 1N1GA 3IDQA 1NV8A 3PDWA 4IQFA 4Q1DA 3UJ3X 5HZMA 4UHDA 4BC1A 2E4XA 4YP5A 1AHIA 1FNSA 1T5SA 4GZLA 3BM5A 1GNVA 3E27A 3O8LA 3SAJA 1TEHA 3PXAA 4W5NA 4UATA 2NOAA 4BATA 4ZP1A 1IN8A 2EATA 1T10A 3OMWA 2DHDA 3UGJA 3D0QA 1JFFA 1PG5A 3AVOA 5FYDA 2FFQA 2O2EA 3GJ8A 3RWBA 5FV7A 4Y2RA 4PO1A 1SJ9A 2R6JA 3PQ3A 4C4XA 5DBFA 2ISQA 4IDQA 5C2JB 3GP8A 1FJGB 1FDUA 3QELA 4RMJA 3ILVA 4WECA 4CMAA 4BEVA 4PZCA 2Z95A 3DXYA 3R6WA 4WADA 5B6JA 5HKBA 3P20A 1A4IA 4V2IA 3VSBA 4BP9A 3MTJA 1AQUA 3TTTA 1V95A 4YRSA 5AW3A 1FUKA 4BGEA 4R9RA 4JASB 6LDHA 5TGZA 4PX9A 2P40A 2IJGX 2X42A 1E6UA 2X0KA 3GI1A 4ZO9A 4DSUA 4EVIA 2ZQYA 2O8BB 1EYZA 4P32A 3VR0A 2VDWA 2AMVA 1J9EA 3GT7A 4AX4A 3OZWA 1N2GA 3ROGA 2OR3A 3K3PA 4FFBA 3GH3A 4PZYA 4MWSA 5CVJA 3SYRA 1Q19A 2X0EA 3T5TA 1LNQA 2W6MA 3BVPA 1N4AA 4D5EA 4CKCB 1ZK3A 3P97A 2NN3C 2NUTB 1ARZA 2VXYA 3UC9A 3ZV3A 1YQGA 2XVMA 5SZIA 1BHO1 3S4YA 2A0WA 3SBXA 4OXYA 5FLXA 3V4VB 1JHXA 1K7FB 4F2PA 2YY6A 3NPAA 3UXMA 3QUBA 4E15A 2BONA 1C0PA 3FPAA 4G0ZA 4MVXA 2G09A 1JHPA 2GA9A 3E4CA 4PAWA 2Z9DA 3T9EA 2HCJB 4MWEA 1XDWA 1YB4A 4BX9A 4JGGA 1THTA 2R1VB 4Y9UA 1NVGA 3HJUA 1XGKA 3NCTA 3KWJA 4H3HB 4MCAA 2BFBA 3GBPA 4CMCA 6AT1A 1AXEA 2UZ1A 3HVJA 4W6ZA 4B6JA 3BXXA 3B48A 4K86A 3BSWA 4JBXA 2AJTA 3TFWA 2AE1A 3NKVA 5KJ1A 3QFHA 4GQAA 4DCTA 4CEIA 3DEZA 1CUZA 2NZJA 1A7KA 1P5HA 4I4IA 1E4VA 4ZQHA 1HYGA 4M9XA 2VHZA 3SOZA 1K9VF 1MRSA 1HFJA 3L0YA 3ADOA 5A9RA 1PT6A 4BQOA 3NX4A 4HB0A 3SK0A 4JR2A 2GHTA 5CK5A 2W93A 4BASA 2GASA 2FZWA 1CY6A 5DN6A 3H1EA 2BGGA 2GH1A 4BUZA 4ZQEA 4Y0AA 4QDJA 1RYFA 3T6KA 2HF8A 2AZTA 3HSYA 4JEHA 4OQMA 3HPQA 5FUVA 5A03A 2VL7A 3IHLA 5G0UA 1YVUA 5H70A 4I0WB 2WDZA 5CH3A 4QVIA 1L5LA 4IQGA 5FNZA 3JQAA 4RL6A 4HYQA 4NQRA 1FNBA 3G0OA 4R6XA 4JOSA 1FP7A 1U2TA 2H4WA 4KPGA 3ZJVA 1WB6A 1C0KA 1R0BA 2FPUA 4OFWA 1TZKA 1CVLA 2MU1A 3AI1A 2C5GA 5FBKA 2BMVA 4F3RA 1NQXA 1B41A 1CJSA 1Z56C 3GEDA 3FMPB 1QTQA 4JNCA 3TSYA 2ZJ7A 1QTRA 3AKCA 3RBAA 3WGUA 3W9YA 4DL9A 1UKCA 2I55A 4J16A 1Q3TA 2NVOA 4QUGA 2I4TA 3OLCX 4ND7A 3E3NA 5J4LA 3DZIA 2PZBA 4Y6OA 4FYXA 3BB4A 4AY5A 3GFGA 1KYWA 3ZLBA 1H94A 1LF0A 1Y6RA 1QQ5A 3MJTA 5BR4A 1XYYA 1J1UA 4U0JA 1WMDA 1PN3A 2PXHA 1O58A 1VSQA 3L06A 3OG9A 4L72A 4Z54A 1ZAYA 1HC7A 4OYHA 1ADGA 2WIBA 1RE0A 1P6UA 1W85B 3HCFA 5LWHA 1ORIA 1SUDA 1E5DA 1P4JA 2YJTD 3EARA 3K1JA 4QYMA 3COWA 3LW8A 3NHYA 1QAOA 4KX3A 1XD8A 5ECGC 3STVA 2IELA 1SVSA 5L8VA 2B83A 4V3CA 1KK0A 1JPUA 5AW7A 3IEIA 4NCKA 1Z4QA 4DA8A 1WCIA 2V59A 2QAGB 2VK4A 2ISCA 1T8UA 2XMSA 2X9QA 4DPLA 2II6A 5I8WA 4RF5A 1CQZA 1NF9A 3PQ8A 3L6EA 4D92A 3F71A 4KDRA 4E2FA 3ZKAA 4XX1A 1ABFA 4ZHQF 4N12A 1F9AA 2DMRA 1W5FA 3AUFA 5G0VA 5JRJA 1W0JD 2WOJA 3U7QB 4EPTA 1B00A 2WICA 4K81B 5K0CA 3FNEA 1ZMRA 3LXUX 5HCIA 3EDQA 4UCWA 1EJBA 5EC8A 5D87A 5EYPB 2QN3A 1TNDA 3RRNA 1K8RA 1P5ZB 2H4YA 1DCMA 5HG0A 1DX4A 2ZZMA 2HK6A 1V26A 5JHHB 2GM5A 2A84A 2YYAA 3N70A 5K3FB 1L5ZA 3GC6A 1PDWA 1RZ3A 1M6WA 1NN5A 1PR1A 2R7AA 1QLHA 5B58T 2V9CA 1PJCA 1R4ZA 2W2KA 4MVJH 1V16B 3VNSA 3JRNA 4MR7A 3BWBA 1JG3A 4Q03A 1NBIA 2O2SA 5CXXA 2EGHA 2ZG6A 5KC9A 1HURA 3ICOA 3PUZA 3Q2KA 4JBGA 4YONB 4OQPA 5ECYA 4DSAA 1PO7A 2J6IA 1BU5A 4PQYA 1EAMA 1H5UA 2FFJA 2Z5FA 1CIVA 5I9NA 3NEAA 4DKXA 2W4IA 4V0RA 5FI0B 3GYGA 3NTXA 3FNRA 3WMGA 2FPIB 3UH1A 3ZQKA 4XVCA 1PJBA 1UBFA 1ZVMA 2CHEA 2QUBA 3HA3A 4JQCA 4RK0A 2OEPA 4E22A 5EHXA 3O2SB 3BWEA 5DNDA 3W5BA 5DHRA 4HB3A 1PYDA 4AW9A 2CDRA 3NV9A 4MUGA 4IILA 2IV2X 1ZP6A 3RM3A 1GUBA 1AF7A 1X7ZA 2WM9B 5ANRB 4CM3A 4DDUA 5JD5A 3OFNA 3S55A 5FPQA 1X7DA 1RZRD 3PNBA 4DR4B 2HF2A 1OAKA 5KEIA 1RRGA 2XMBA 3ITEA 3LLUA 4GSKA 4V02A 4ZANA 3VISA 4AXBA 5LXTA 1ENZA 3ROFA 1VHJA 4ENUA 3D6AA 3PL5A 4G5YA 4MULA 1ZXLA 1GFIA 4DQ0A 5DBOA 3PXCX 1HLDA 2CCJA 4UTVA 3I01A 3KR0A 4BOYA 3W2FA 1GU0A 3HFGA 4V03A 4A27A 4DOMA 3FE2A 4QOFA 3NIGB 5CDSA 5EKSA 2OBFA 5KB3A 1TTQB 2X8AA 2JAHA 4P31A 2N47A 3WGOA 4D0LB 3GCWA 3LVRE 5TMDA 5JI3E 2OB2A 1K27A 2P6MA 1VI2A 2QNIA 3EGIA 1PYGA 5FL7A 2XRZA 1VP3A 2V5UA 4L95C 4O4IA 4QPNA 1IK6A 2Z2JA 2PUFA 4HB2A 3ROQA 3CPHA 2CHVA 5KMGB 1G63A 2ES4A 1G9SA 5FHRA 3PNPA 1NVEA 3R20A 4RD6A 2C88A 4AD8A 4UQLA 1JMVA 1GPMA 1L4FA 1NW3A 5C32A 2IPNA 4XM2A 3NTQA 3FPGA 1YQDA 4WN3A 4JB8A 3VR4D 1KERA 4Q0MA 2PCLA 4L5IA 1OBVA 3HUDA 2HHLA 3PGA1 4B4OA 5BN5B 2H3EA 2KBEA 1IYZA 1Y7TA 3UMBA 3Q9SA 1C9KA 4D3FA 5CB6A 3DE1X 1J8DA 3PXDA 4N3BA 1NUSA 2JEYA 4QXAA 1VYUA 3NU1A 5CM9C 2W42A 1EXWA 4K0RA 4PSCA 3RRMA 3I32A 4IMIB 1DXOA 4HNVA 2JFBA 1ORDA 2JD1A 3NW9A 3T7IA 2W6ID 2EJVA 3DS8A 4FHZA 5FPHA 1T0IA 1DCKA 1XZ8A 2J31A 3L1UA 2X41A 4IWYA 4EHFA 3U60B 2J48A 1KEEB 2JFVA 3EZ7A 2WJVA 5EUQB 1GQSA 3HI6A 4ZN6A 1NW9B 3FHLA 5K09A 3MSXA 1OV4A 5LQAA 4Q19A 3CGWA 1IY1A 3FMIA 3KPWA 3KXKA 2OHGA 3O73A 4LYJA 4PGAA 5H3CA 4DJEC 3OOHA 3TF5A 4K6FA 3S68A 1JECA 1Z6AA 1H6CA 3C85A 1QIKA 1G3UA 2AZMA 3F5DA 3JVEA 4LDJA 1RI5A 4OTZA 4L4UA 1A9RA 5E1DA 2JLXA 4ZVNA 4N0EA 3AIMA 2QAGC 3ABRB 3GVIA 1MIOA 1C0EA 3A3OA 1YD7A 2NZVG 1KDZA 1QK4A 3AZPA 4E5MA 1TYAE 2FWRA 2ID8A 3IV6A 4M6WA 1DUVG 1ILWA 4EG8A 3FRIA 3RTEA 2VH1A 3IVGA 3AW8A 3DAPA 3OPYB 1AQIA 3FZYA 2COEA 1OIWA 1NUTA 1RT9A 4JYAB 2A6PA 2HWXA 4Z7OB 1OYYA 4GI2A 4RDHA 3WBJA 4FDTA 3MWEA 2K7FA 2X0FA 2HREA 3KSUA 1PR4A 2NP7A 1Q0PA 2DLDA 1TU0A 1SBCA 3K31A 4X8LA 3J7TA 4MKZA 4Q1CA 2YHSA 3QV1A 5IT5A 2OV4A 3AM5A 3BCHA 1QAMA 3S44A 1TC2A 3D3WA 2O7RA 3KYIB 3LQKA 5IKEA 5KPJA 2I3GA 3A4YA 3D4IA 4F97A 1R6TA 4H16A 1R6AA 4FOLA 2HT6A 2YICA 4N6GA 3C14C 3A04A 3K70D 3FLBA 3WSTA 3DP9A 2N42A 5FO0A 3CZMA 5CNMA 3EA5A 2EIHA 1YU6A 3UM9A 5LB2A 1P4AA 1WF3A 3NHUA 3NQ41 3OZ7A 1D2MA 4PHCA 1K89A 5KTMA 3I2IA 4CTJA 2XB2A 1DHTA 4AN4A 1GHTA 4GP7A 4CQMB 4BKQA 5IC4A 3DHNA 4JLAA 4KO4S 2QX7A 4LQDA 2D74A 2XGSA 4L4XA 4RSRA 1ENOA 1TRKA 4XWGA 3WNQA 1WV0A 1OHHA 3N8IA 1SMKA 2DQSA 3DOJA 3LLMA 2YFYA 4BZQA 1HLPA 1X1SA 3M6FA 4RPCA 5CLIA 1KNQA 3UGKA 4B3MB 2YWGA 2PMCA 4IH9A 3BF7A 3CRMA 3ZI0A 1Y6GA 4CTMA 4ZD6A 2QN8A 4QYXA 4E94A 1ZM7A 1R6XA 3IGFA 3P7MA 2FWAA 4PU0A 3HBNA 3IHWA 2ZJ0A 4S1PA 4EJ0A 3P2IA 1ZH6A 5FTNA 4EY4A 1PUJA 2F67A 2I8AA 3AEKB 4IGAA 4Q16A 4WUTA 4BBPA 4DNXA 4EKEA 1X0XA 2R6CA 5FPYA 4BJHB 4UTRA 1VC2A 3PI7A 5E2IA 4XX0A 2WYWA 1CQJA 4DSNA 3ZI4A 1MVNA 1QYRA 1U8EA 2KJQA 1K7YA 2DPHA 3PTLA 3QIAA 3DFIA 4JYPA 4O4JB 2R6GA 4F4CA 2HT1A 3GJSA 1CEEA 1NBAA 3HB7A 5LC1A 1FYFA 1BXRA 1LLDA 1WB4A 2WM8A 3E61A 4L1KA 3HYTA 4RA6A 1YMQA 2R48A 2XAAA 5K0NA 3HY4A 3FN4A 2VDVE 4GMDA 1OT5A 1CTQA 4LC0A 2P75A 3R24A 4UAJA 4Z2YA 4MPPA 4EA7A 2WJ4A 3R6LA 3HKCB 4KSBA 3R5JA 4E1VA 4KR6A 1FZTA 2ZRJA 1QHSA 1SC1A 3BWCA 5IKOA 3RG2A 3G49A 4IVNA 3Q7PA 2HC9A 5THKA 2EFHB 5D2CA 3HNOA 4NEQA 3OZTA 3IRUA 4G5XA 4GECA 1ZOIA 1A04A 1H2YA 1QGYA 2GBPA 1WSDA 4M8KA 1CF2O 5ALEA 3VC2A 3GRCA 4V39A 3BIWA 3DA8A 4KH0A 1MX5A 2BGRA 3KR2A 3KOWA 4ZRNA 5KTTA 1E2KA 2QRQA 4I5GA 1N2CB 4FEYA 1BOOA 1J23A 1WJGA 1T2DA 2PNJA 1BKYA 1JUDA 2PTGA 4JI2B 1GUFA 2J0VA 2JFPA 4B5KA 5EJ7A 2V6IA 3LH5A 4R1NA 3PPYA 1VLMA 4AJEA 4XFKA 3N2GA 5I9LA 2O8FA 1KEWA 5DYYA 3TJZA 3TW8A 2P69A 2YHBA 2WYHA 2VJMA 5DLDA 4C6SA 2O1EA 4URWR 5AFSA 4FNMA 5DBEX 3EEOA 4TL7A 3RGWS 3RRXA 4JI1B 3UMJA 5MN5A 4EA8A 2FOIA 5GONB 5HHTA 1D2GA 4HATA 4NNJA 3H9CA 3OJCA 3HUTA 2DG2A 2GZ2A 4R2JA 2P35A 1DS6A 4RZ3A 3IBCA 3HFRA 3U3DA 2Q8PA 4F4HA 1MAAA 4RD2A 2A5GA 1AKTA 1T4MA 3VSDA 1L7QA 2VNJA 2YN0A 1YONA 2P78A 2PXAA 2ZVQX 3D1LA 3IPCA 3U4QB 4UEKA 4DW8A 4EABA 4CFSA 3I6YA 4LY0A 3QP9A 4YAIA 1JLSA 1K8ZB 1EB8A 4OO3A 2R6R1 4D42A 2BE7A 2V74B 5L7TA 2ODWA 3E1GA 1C81A 1Y4DE 4MV8A 5JRDS 2JVKA 1QCZA 1SXJE 1O08A 2J1LA 3EXEA 1GZ4A 1LX6A 2QTNA 4AJNA 3LY5A 1CP3A 1Z4MA 5IFLA 2HNBA 2XI4A 3TECE 1K3UB 1R5JA 3OY7A 2NV2B 3DFUA 2BH2A 1P3Y1 3AHCA 2PBZA 4QSMA 3QK7A 4XUGB 1U3DA 4URXR 2ZI7A 1XMXA 1EUDB 3EQZA 4W1SA 3JWPA 2BEUB 3T94A 5E9AA 1DTEA 4RZSA 3NUZA 2YOGA 3GMSA 4OXIA 1OT3A 1YZFA 2YTZA 1QFJA 4FTWA 3QPWA 3WO1A 1JJIA 4B46A 5SY6A 2I67A 4JLJA 3OQNA 4QXRA 3LFTA 3Q0EA 4UBNA 3RPEA 2DSNA 4O08A 4F9FA 3B36A 2B1JA 1WSBA 1ZUNA 4LX0A 4KYUA 3CLTC 3OLZA 2JIDA 2MHCA 4K1XA 4O6VA 5C1IA 5BW8A 1SUWA 1GRRA 4PPFA 1X7WB 3RADC 4ZGGA 4YAEA 3VHXB 3IAHA 1FFXB 4P2BA 4U7WA 2EKLA 1U6IA 2E5WA 2PG3A 3I0NA 3R4CA 2RD2A 4BNJA 2D1SA 2UUOA 1GNLA 5JSZB 1A8UA 1BDMA 1TGYA 4G37A 3PDIB 3B6EA 4IW3B 1SUBA 3Q85A 4GM4A 5AICA 4F4DA 3WAJA 1QYWA 1TK9A 4TTTS 4YHHB 3CVOA 2XR1A 1XJ0A 4HWGA 2JHAA 3Q72A 2XCSB 4XSHA 4NH4A 1PS9A 4MIYA 3M2PA 1GPUA 1XCGB 1PYOA 3GLUA 4QASA 2KM1A 2G8LA 4QQ8A 3EF0A 3AY7A 2ZU0C 3I9JA 4E70A 5LNK1 2LDXA 3R7AA 1WW2A 3TLZA 2G1UA 4J4HA 3GT4A 3MOGA 1TYEB 1EP3B 1VCNA 2IWHA 3EXG1 1NFFA 1EVLA 3TIIA 3ZZ0A 4IDDA 4EMTA 4DQKA 1S01A 2AV6A 1II0A 1Z9BA 2QRVA 4PLHA 3CG4A 3T7KA 2YASA 1Y8CA 1S89A 3IAUA 1UAYA 3M2TA 3NC1C 4L5AA 5D1NA 3TUJC 4R41A 2J3MA 4WLEA 1MZPA 5DLYA 1BMDA 1Z5GA 4PGHA 1M6YA 4DCUA 3OA0A 1Y8QB 1W34A 3BJZA 4A2WA 1H2HA 1W93A 4FWBA 1U5AA 1Z5VA 4PBSA 2XDQA 3GD7A 4ZVSA 1IC6A 4C08A 3BICA 2P4UA 1XCJA 2XUHA 1EFCA 3BL8A 1CJVC 4FYMA 4IDNA 3I1JA 5DTQA 5A5GA 5CEFA 5IDXA 4NCHA 4G0PA 5GOTA 4D4MA 1RBQA 1XAHA 2BFDB 3UVEA 3ZCQA 2H9IA 4TTIA 1TIBA 5LZ8A 1FSFA 3DM9B 2OPHA 3SC6A 1N6KA 3L8ZA 4TKUB 1RIFA 1KIAA 4P3KA 1TT5B 1MNAA 1ZGHA 2PXXA 4NBNA 4JX9A 1UK6A 2NO4A 1TF5A 3CSUA 2G8NA 4K9LA 3PC2A 5UKDA 2JATA 2ZULA 3H13A 3IMCA 3M83A 2IYPA 4GKBA 3AKZA 4IJVA 2DTEA 4Q01A 3K9LA 1FXUA 3LBNA 2HHJA 2QMQA 2WZDA 2PU7A 3GZJA 1YJ5A 2VF4X 1AKWA 2OUIA 1E0KA 4PS0A 4F85A 2HU7A 4QKQA 2G4CA 1Z47A 2DQKA 1HWYA 3KYDB 1M0EA 3CC8A 5CXSA 5CITA 3L2OB 3ILXA 4KR7A 1X1CA 1PNVA 1O5IA 3NOQA 1WCXA 2Y1EA 3L7AA 1WG8A 1KP9A 5CK4A 3WBBA 1BO6A 1SQ5A 4NCAA 3U3OA 3KAQA 3WKDA 2XHEA 2HA4A 2I7TA 3KJZA 1JAZA 2ZRHA 4BU0A 4Y1RB 1EUCB 1UBRS 2EU8A 4KI0A 1UK7A 2HU2A 5TPWA 4IGIA 3TEJA 4EGFA 4TTVA 5U9CA 1SZJG 2GZ3A 3CWQA 2PKYX 2Z2ZA 3MMSA 3F46A 3PDCA 4I2VA 4U39A 2RH9B 3H0EA 5DM1A 5DRTA 5EIAA 5M3BA 4Z0NA 1JDSA 2OVFA 1DARA 3ZHOA 4BO2A 5GAJA 3UMFA 4Q3KA 2LDBA 4NZOA 4OHPA 5D5QA 4KRGA 5ESXA 4N5NA 1T0PA 4F96A 1UK9A 1RRKA 1YI8A 4CGYA 2G5CA 2AQKA 1HRKA 1MO6A 3I6BA 3ICPA 3IX7A 4FI3F 3TLMA 4G1FA 1UZMA 4OIFA 5K0JA 3U3RA 4TUYB 3SF8A 4IKOA 3ZHVA 4KVZA 3LUBA 2WJYA 2C5BA 3EEBA 4LXQA 2YNMC 4Y1EA 2A58A 3FNHA 2XTJA 1DFGA 2IOYA 4C4SA 2AYZA 4XW2A 3BFPA 3EGXA 4KWEA 5F4ZA 4ARSA 2QSYA 1H0SA 1HY3A 5IVDA 2WG0A 4BBZA 1XTKA 2AF3C 1G20A 1TOAA 3A4NA 2GQ0A 1KH1A 1V1MB 3OLYA 4R9UC 5JYCA 4JP3A 4RHFA 2BY4A 3BXGA 1WPGA 1U0EA 1IY9A 3BIXA 1SIOA 4Y2VA 3ZPXA 1E99A 2AGVA 3L1VA 4PLWA 5K0TA 5JTUA 1ODIA 4WCFC 3EIXA 4P3XA 4WZBB 3RIHA 2OVBA 4X1YA 4M0MA 1ANKA 2O4UX 3VNQA 4HO1X 4UHEA 2YS6A 5DE3A 1CZRA 1Y3AA 1RXSA 4UDYX 1Q16A 2JAWA 3BRQA 1Z8HA 4CKBB 2WVGA 1NW8A 1OLXA 4EGSA 2HRCA 2B2CA 3TL2A 4AX8A 1BD4A 4EMSA 4TQAA 4Y6RA 3OHPA 1XC7A 4MP6A 3IEVA 1ZH0A 2I7CA 2QTHA 3BWDD 1YMUA 5BSMA 1ZICA 4R2LA 5ITSA 3O83A 2I9KA 5AM5A 3VR4H 1S8FA 3FOCA 3G6WA 1YS6A 5LQKA 1LQ2A 1CJMA 4GE0A 5CPBA 4RE5A 3VZDA 1ZSNA 4TMYA 2ZI6A 2AN1A 1QHXA 1UC4B 4JBIA 2C9BA 4P4NA 2BZ1A 3ANYB 3LGSA 4IIVA 3OF5A 2OC4A 4U7JA 1K97A 4OJKA 3TR0A 1S8NA 1XXHE 1RWQA 2JFGA 3ZVLA 4AWBA 3LT4A 4B84A 1XEWY 2YX1A 4YJ2F 5DXFA 3THOA 3O82A 2XNJA 1XMPA 1IJEA 4RCYA 2EQAA 1BCSA 1OSNA 4QXQA 2Q3BA 2D6FA 4FNAA 4I81A 3HKEB 4X7MA 4F5ZA 2IHZA 1YOVA 2O2GA 3HO1A 1YVPA 5CTJA 3X1DA 4KFTA 3I72A 1EDOA 2BEKA 4L8WB 4F3KA 1KMHA 3ASVA 3V55A 3MUNA 1EFPA 4MQBA 4I1PA 1TZJA 3KL2A 4UTXA 1MB2A 3F2IA 2C82A 1TZBA 5T7BA 1N2BA 2HJRA 2V45A 3IHKA 3Q6NA 3T3MB 1GG2A 4F4UA 3L0BA 3QVSA 1FNNA 1HOTA 4NXMB 621PA 4DDWA 2OHOA 4HAOA 4DA9A 1EPUA 4IIEA 3C70A 1OXKB 2QL9A 4YGYA 1T3GA 2F1IA 2JFOA 1JU9A 1N2OA 1EU1A 2HQ1A 3LY8A 2ALJA 3GVHA 3RS9A 4J43A 3KPVA 2IUYA 3M0EA 1UC5B 1MQSA 1MRNA 2D0OB 3IT2A 3O2QB 2XUFA 1LDGA 4GX1A 1O5TA 2VAMA 4JZKA 4BY9E 4U9HS 4C2BA 2J9FB 3RHTA 3WO0A 6ADHA 1QGUA 2RI0A 2K2QB 3K6SA 1XTTA 1EVIA 3WYNA 1R88A 3N07A 1JFRA 3BF8A 2W6QA 3WWDA 2XCUA 3EH1A 4LRYA 3EIFA 4MP8A 1I3MA 1JZSA 4I8XA 1OFUA 2GRAA 3W5DA 4ES6A 1ZLYA 3KTFA 4IX1A 4BUJA 3SYKA 1K4MA 2IEGA 4D8YA 1ZGBA 3H5VA 1YF3A 3TZLA 2VATA 1P3JA 1SCAA 1YS4A 4QODA 2HKIA 3GJZA 1T25A 4UVIA 3OJOA 1TCVA 2XEXA 1A0OA 3G79A 4D9CA 4F1KA 3FKJA 3T4XA 4Z51A 1DRUA 1JDUA 1ND6A 3AERA 3FNQA 3T0FA 5JJLA 3UIEA 1P17A 3B7WA 4CLDA 5HKLA 3JZAA 3D5QA 3P26A 1FFWA 4M9CA 1VYTA 3WXBA 3WG9A 2WWTA 4YLEA 4K9OA 4A1FA 3FM9A 4Z6KA 3OSZA 1N5IA 4IIGA 3AEXA 4BFWA 1PGQA 3B2NA 2B5WA 4QBGB 3ZWAA 2QV0A 3GGDA 1WB5A 2ZUSA 2C5HA 2PLRA 3RUEA 3HP7A 4R8LA 2XMCA 3C1TA 2FP4B 1O96B 3BIJA 3VH2A 3HR7A 3KUUA 1L7VC 1A7UA 1JVNA 1H93A 1JYSA 2PQ0A 2GN1A 2XVZA 4MW7A 1YJBA 4YBZA 1XZIA 4Y3UA 1JEQB 2JGFA 2QROA 4OXRA 4BMPB 1P7CA 4ALKA 1HQKA 3CGGA 1E5QA 3I42A 3AP3A 5LUAA 1BKDR 1Y37A 1JHZA 3VGJA 2F8LA 4YPFA 3T15A 3LV8A 3L07A 2MSEB 2UZ0A 5TQ2B 2M1ZA 5C46F 4Q3DA 1GQ2A 4TT3A 1PEYA 2A92A 1W6RA 1Z4OA 4UZFA 1UP4A 4JT4A 1SK8A 5JR3A 4WFQA 1XPRA 1DX6A 2OO5A 1M2WA 2DT5A 2E2WA 3ZGNA 3ON5A 3K9CA 3NS7A 4P98A 3IEMA 4A15A 2O8BA 5BR8B 2VK1A 1OWMA 1L9XA 1SKYE 1Y3FE 2ZIZA 4POOA 3KQKA 1I36A 1NUAA 2ZJBA 4OP3A 2ZJ3A 3VAZA 1U2DC 1U7HA 2ZRKA 2PGJA 4WI1A 2IHVA 5EVJA 5HSGA 4I8DA 3COVA 4MDFA 1LSUA 2ZOSA 1N6HA 1TO2E 5IAGA 1C9EA 1GZUA 4NJOA 5AOAA 3EMDA 3RV3A 3V4LA 4WJKB 4MGKR 5EUCA 3RSSA 1LCIA 2ZI3A 3FF1A 5IJ0B 1IEQA 4MV1A 1CUHA 1A1VA 3DL0A 1ML4A 5HF8A 1YIAA 1MJFA 2ZT7A 1JG1A 2GN9A 4NHOA 3AH8A 4G1VA 1OIVA 2NPFA 4MB6A 1AA9A 1BXZA 1F6WA 2E9SA 2R1VA 3BTSA 4MJ3A 2OORC 4MS3B 1BVYF 4X1IB 3U1TA 2IZ6A 2H5JA 5AESA 3PJRA 2QSZA 2FQYA 4AUNA 1OTXA 4RSHA 2FSFA 5CB0A 4ZVOA 3IDOA 1BAPA 4AAYA 4B2IA 4JLSA 1ZXBA 2EF0A 5ES3A 2GILA 1MC8A 3GN2A 3OKCA 3EC7A 4OV6B 4A91A 4F5DA 3TCNA 3GLIE 3CVVA 2X6TA 2PA3A 4L5BA 2P9FA 3QBJA 1GAJA 2WSIA 4UNRA 2AC4A 1KR5A 2QUIA 4G8CA 2QPLA 1I7PA 3L7YA 1U4NA 1UMKA 1A9OA 2CXQA 2FUKA 2L82A 4V3BA 4PG8A 1I8TA 5FTJA 4KJXA 4P3PA 2EZ8A 2ZUEA 1VHQA 1U8XX 1WZNA 5CIWA 5I7HA 1LVHA 1XDSA 2QN9A 3FUCA 5MHTA 4DXAA 4BNMA 3C7CB 5TLSA 4XWKA 1L2TA 5CA1F 1LWNA 1A5TA 4ODIA 4XFJA 4ZAVA 1EXMA 2B9EA 3A3KA 4ABYA 3ZR4B 2G07A 3E3LA 3FYUB 3GJQA 2NTNA 2C04A 4XB2A 5DGDA 3WLFA 3F7TA 3VKWA 3SXUB 1RWWA 3H2JA 1QRAA 4EF5A 2GXQA 1B2LA 2HO4A 3ZCXA 2V4MA 5IM4A 2PUCA 2WUDA 4XB6B 1CDEA 3I34X 2XBMA 3PPIA 3LCUA 4ZI7A 3I2JA 4KBYA 2E4WA 3O5AA 2J3QA 4EDFA 1VI5A 1P2BA 1Z5OA 3CONA 4MGYR 4RXMA 5EESA 4CNQA 1RWNA 1ZM2A 3ED1A 4UM9D 4LVOA 1SHTX 1QRSA 1FCJA 3KOYA 2LV8A 1P4HA 5F3DA 2IV7A 4AI6A 2GAOA 1GTVA 4QELA 3NGMA 3UANA 8ABPA 2PE5A 3JX9A 1AKRA 5A0FA 3C8HA 3OCJA 1R16A 4TROA 1NR7A 4EAAA 2Y05A 4JXXA 2GFIA 1UJMA 2PZ8A 3KLBA 1PNRA 5AM3A 1G6OA 1XRPA 2O0HA 5B30A 4QO7A 1WUHS 2YN4A 4ME6A 4U8HA 1NDUA 2WTBA 3O38A 5HKOA 4DB2A 5TMPA 1ENPA 1CZUA 2C78A 3HABA 3NDJA 4WOCA 3G7NA 4XTRA 1KXZA 4BYMA 5A3RA 1C7ZA 2HV9A 4PZLA 2GX6A 3STXA 3I45A 4PG7A 4AY2A 2H29A 4IZOA 1P7YA 1B73A 1A1SA 1LFDB 1Z74A 5AIAA 1N7JA 3C1OA 2QAGA 3DE7X 1NXXA 1WKVA 1PR6A 1TKRA 1TAQA 4PPYA 4Q1BA 4R2KA 2RC6A 3UKOA 4Q05A 5DHAA 1J56A 1EWYA 1N6IA 3A58B 3EDMA 4ZAZA 4DIBA 3BXEA 2B36A 5IYZF 3FMOB 3RARA 2GPWA 4K26A 4N8SA 4UEQA 1OUMA 3U7QA 1Z37A 4TV8F 4L7QA 1UKVY 1YS1X 3OZAA 2P9GA 4M36A 4YUYA 4R81A 1YO6A 4DG5A 1NQWA 4N6OA 4MW4A 2JJ1A 3QEKA 3IMFA 5HCUA 1YULA 2WA2A 1HEIA 2QRZA 4BFCA 2PIDA 5EYPA 2MR6A 5AKIA 4RTKA 2GFQA 5KDLA 3HJBA 4NBRA 1NZJA 3GFRA 1FTWA 5DI9A 1AK9A 5K3FA 3HYLA 3NKFA 4HSGA 4MRPA 2PUGA 4UM5A 5JBQA 1ONSA 2QN6A 3LGAA 4BLQA 5G3ZA 4FBLA 2IU6A 4ZVQA 1V16A 4MWBA 1O97C 4MS4B 5A4AA 5JAPA 1TD1A 1T5LA 4G8JA 3UT0A 2AK3A 1HDRA 2N1BA 2VDJA 2W8BB 2PL9A 3N28A 3IELA 4XPZA 4DS3A 4W8OA 4H31A 1YQXA 4EF4A 3RAPR 4E32A 3AVXA 3K92A 3H2IA 1JMYA 3IIJA 4RIIA 4MAFA 1X86B 1T36B 3RT1A 1RJGA 4YCLA 1C8VB 4J03A 2FPIA 5C7YA 3X0DA 2SNIE 2D2FA 9ABPA 1L0BA 2D8AA 2YOHA 4LF7B 2E82A 2D1TA 2HBZA 4BLVA 4KXUA 2Z9BA 2L0XA 2J7PA 2QX8A 2HO5A 4FSHA 1YZHA 3LQQA 5A4JA 2BGMA 2CXTA 3PQ6A 4EECA 3ZHXA 2J67A 5I7WA 2I6UA 3KVNA 3LYLA 5JUWA 2WP0A 2P1ZA 4BNFA 4Q9JA 1DKLA 1J7JA 3IUMA 3FHCB 3LXMA 3M70A 4PCLA 4YAFA 1U0GA 3ZQ6A 5CXUA 4C0BA 4D9JA 4M9RA 4BEBA 2AJCA 4YS6A 2OWEA 4BFTA 2JLZA 2AKYA 2VWGA 2XJ9A 3IXMA 2EX0A 4PTLA 2CK3A 3O1HB 1C4OA 4JLMA 3BD7A 4L0MA 2W2XA 3G2HA 4NV0A 1M34E 4JU8A 1ENYA 4FFNA 5M29A 1G59A 1ODKA 4RH1A 3KQNA 4AY3A 4B3DA 5B3JC 4IVPA 1KQOA 1E1RD 4H1TA 3HBLA 1M6VB 5CNIA 1FDSA 5FOVA 3MRSA 1OWLA 4BQEA 5CFMA 1QQ6A 2WAMA 1JI3A 4I3HA 1KDPA 4DA6A 3FNFA 2QTCA 2TECE 1VLVA 4QULA 1KAMA 1L4YA 2GR9A 2OENG 1PVDA 2JEOA 2QU7A 2XDAA 3CQ9A 3RS8A 3V5NA 5KMGA 3THYB 4CTNA 5DGXA 3FYUC 4JP5A 4RSMA 1IB0A 1J99A 1MB3A 3T4UA 2VPIA 1PD0A 4A8HA 4HDMB 2M32A 4G41A 1RP1A 2HK9A 1FMLA 1CQXA 4TL9A 4BVAA 2OFPA 4S05A 4FFMA 2GA8A 1E0DA 3OIFA 2L2QA 1WE2A 2ZYDA 1SOAA 3KKOA 3LA6A 3A4MA 3Q98A 4GRDA 1AKEA 2NXJA 5EHGA 5BN5A 4KREA 2M1XA 2VAWA 3GRYA 1WKBA 3SKYA 1FFHA 3AUAA 1TAHA 5I7VA 3NG1A 5CEEA 1E96A 5T8KC 4DPKA 4J94A 4GS5A 5B2FA 1AVTA 5HJ7A 3A1WA 4WKBA 1R8JA 3HM9A 2YWDA 3E8MA 4PSAA 2NYRA 3LUJA 1OXXK 1JB1A 1M6HA 1GR0A 4R51A 4UNPA 1RZUA 4QAQA 2QM7A 5IW8A 5DX8A 5DBGA 3CUUA 4ETNA 3R7WB 4CIAA 1M2FA 2ASVA 4FOPA 3UUWA 5KJFA 1DAOA 2UYYA 3FFAA 1KEEA 1VIAA 1ZR2A 3SYTA 4C7MA 4CW7A 9ATCA 1VIVA 1D8TA 5CR9A 4OQYA 3IVXA 4FONA 1XYVA 5AW5A 1GDHA 2R7KA 3FGOA 2Z98A 3SHOA 1SXHA 2PLAA 2VTKA 1LU9A 3HFJA 3PXEA 1QJCA 1HNNA 2Y66A 2F3TA 4MW9A 2HXYA 3P0HA 2AI1A 4HMOA 1X9GA 1NXPA 3AJ8A 2IGBA 1VSBA 3G5UA 4BWVA 1KO8A 1EJ2A 3FBTA 2WUGA 2PSHA 1DQPA 3LQ2A 1K66A 3OPYA 3FOZA 1XP5A 4B3SB 3U6KA 3M33A 1C30B 2AOVA 4L5YA 3ZCRA 4BXOB 1RVDA 2FN3A 5H9WA 1DB3A 2NSDA 2E3JA 2MSCB 3OVMA 4XM1A 2B3TA 1BE1A 1R6DA 4YTEA 4B7XA 2I3BA 3A6FA 5C4IA 4W6QA 3EFOB 1DEHA 3IYLW 3L0PA 5KSZA 1HA3A 2A9OA 3IJEB 4S1VA 3U4HA 3MRVA 1AM4D 3SOPA 3ANNA 3KQMA 4MWDA 4UEJA 1ND5A 3UG7A 2FP3A 3I9V6 4CF7A 3ADBA 1R18A 1DBWA 4QO8A 1E2QA 2SECE 3DVQX 4I1YA 4LXYA 1TIPA 2P6PA 3DSRA 2WPDA 5J63A 4ZEWA 2Z08A 3VNAA 4PAMA 5JCOA 2XNCA 1O95D 1YQTA 1L8QA 1UL1X 3NC4A 4NPHA 1HNXB 3BD9A 3GGCA 2ZR7A 1XWIA 2BRUA 2Q1XA 1QVVA 3FAZA 4LKRA 4F3CA 1RTTA 4BVEA 1EGHA 1R9NA 2BGNA 3FOWA 4JWTA 3NFRA 5A9SB 1HEYA 4BV9A 3CA8A 5FTLA 4QTYA 1LNSA 1CZNA 1YNOA 1IY0A 1EBUA 2D4AA 3PT5A 4CQMA 2FEKA 1CHNA 4EFMA 6ABPA 2OCBA 3OZRA 4ZVVA 4EJSB 1LBTA 4HVCA 2QE7A 1GSAA 3X1KA 1LW7A 4YT8A 3INGA