5ICMA

17beta-hydroxysteroid dehydrogenase type 14 in complex with a non-steroidal inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
255
Chain Sequence
TRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
total genus 92
structure length 255
sequence length 267
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5icmA00
1WAMA 4DL9A 3I9OA 1GQYA 2PH3A 5F1PA 3GEMA 5F5LA 3BHMA 4FQ8A 5JPIA 4UEKA 5DOZA 4FGSA 1E3IA 1BDMA 3K30A 4OXKA 1O8CA 5MDHA 1HDXA 4J3FA 3RROA 1ZMOA 1NQOA 3BMOB 5CPFA 3VPGA 4E13A 4E31A 4CM5A 3DZJA 4EI2A 2NU9A 3Q2KA 3ZHYA 1S7CA 1V9LA 2VTEA 1E7QA 1Y8QB 3CH6A 4FFOA 2RH4A 3EZYA 7MDHA 4RF2A 2DBZA 1T4DA 4GH5A 3VH4A 4CMKA 5A02A 1R4NB 5COBA 1E1LA 3K5PA 4YT5A 5JFOA 1VSUA 3IOYA 2PV7A 4QECA 1EMDA 4PLFA 4XJTA 3ZNNA 3QA9A 2WD8A 1GADO 3VKUA 4BNWA 5A3VA 1OBFO 3LZ6A 4GLOA 4IINA 4PZCA 2Q2VA 1QP8A 3GLQA 4R69A 5JMPA 2BMAA 3CSDA 3ZU4A 3PQEA 4EJ0A 5B1YA 2D5AA 3INRA 3ZHZA 5ICMA 4A03A 1SCUA 1EZ4A 4OKIA 2Z5LA 2Z95A 1ID1A 8LDHA 4PZDA 3ETDA 2J3HA 4ZA2A 4IDDA 5EIOA 5KVQA 4ALMA 4MVJE 4I5EA 3VKVA 2C2YA 1T2DA 4TRNA 3M1LA 3TL3A 3W4JA 5G0WA 4NJMB 3BYZA 4QXMA 4CMBA 1XU9A 3ZN2A 1NX6A 4MVJI 3JQEA 3UW3A 4IQGA 3D3EA 3GNTA 5TT0A 2NQ8A 4DUPA 1W8DA 1DIHA 4NBUA 1H2HA 2C29D 2NLOA 3PIDA 4AICA 2O7QA 4ZD6A 1EK6A 4RDIA 3S2GA 4YT2A 3QV1A 4YRBA 3GN1A 5IDWA 2CZCA 4YRAA 1I33A 2PY6A 3ON5A 2Y0EA 4TKMA 4RPHA 2QQ5A 1HDZA 1ZZEA 3DZKA 4EJMA 4EUEA 3WX0A 3I6IA 4NQZA 1LDEA 3HNPA 3ICCA 1WZIA 1PL6A 3L6OO 2P9EA 5TJHA 3FR8A 4L73A 2W2LD 1LTHR 4ALKA 1CRWG 3ANNA 2EKQA 4S3MA 1RYEA 1ISFA 3INTA 4URFA 1B15A 3PZRA 4PLCA 3PLRA 3I52A 3KLMX 4QFDA 2V7PA 3EAGA 4GWKA 1QLJA 2GR9A 4IY1A 4JX8A 3OQ6A 4MO2A 4HY3A 4YPOA 1ISMA 3ZV5A 3S1LA 2X23A 3IS3A 1CEQA 1QLHA 3D7LA 4G81A 4NK4A 5L4NA 5DULA 2IXBA 3PFFA 4M86A 4BNLA 2BI8A 1GZ3A 1WDLA 3NT2A 1A71A 3D0OA 1KC1A 5AXCA 2VQ3A 1R15A 4YTEA 4W99A 3M2TA 5G4LA 1WWKA 2VUSA 1I32A 1JKJA 3QVSA 3PVZA 2NSDA 3GT0A 3QVTA 4FS3A 1N9GA 2DBRA 1P45A 1DLJA 3U5TA 4U7WA 4ND3A 2FR1A 3SC4A 3E8XA 3H9QA 2PGJA 2QRLA 4YJGA 4IUYA 4R1TA 1AE1A 2HKIA 3S2IA 1T24A 4E0BA 5K9ZA 3JD3A 3K2BA 4JK3A 4CQMA 2JFFA 3ZHXA 1YBMA 2W8ZA 1U1IA 5AQ1A 4D0RA 4KZPA 1DPGA 2D59A 4ALJA 1NFRA 1R4NA 1E5QA 3JQ7A 5JAQA 3L0DA 2GERA 2RHCA 4WLEA 5L7YA 3VTZA 3BHJA 4U5QA 1WZEA 3WQSB 4E32A 2J3JA 2P9GA 4XYLA 3P19A 5HM8A 4MP8A 1ZO8A 3OHSX 1VSVA 1CETA 1ZK2A 2QZ9A 3PEFA 4FW8A 3ABIA 3EGOA 3PIIA 3WS7A 4BNMA 4AJHA 3ORFA 4GPD1 2X0IA 1Z6ZA 4J91A 2FZEA 3EDMA 3H2ZA 5JC8A 1L7DA 2ZTVA 3OP4A 1OMOA 2A4KA 4FIZA 2B35A 2O3JA 4CM8B 3AY3A 2X1HA 3G79A 1EK5A 5B37A 5IF3A 5HTOA 5K6AA 2ZIZA 4FC7A 3LC1O 4XQEA 4E2ZA 4PVDA 3BHIA 2NVBA 1YB1A 1PJ3A 4PG6A 4OKNA 4BMVA 1A7AA 4FJ2A 4E6PA 4S1VA 4M89A 4RF3A 4BS9A 3LF1A 4YR9A 1HDGO 1Y9EA 1WXDA 3AM3A 1VM6A 4OL9A 2G76A 5JS6A 1HT0A 5KVVA 4ONEA 3WIEA 1M6HA 3GHYA 1H6AA 4BO3A 1LA2A 1GPJA 2B36A 2D3TA 5G4KB 5THQA 3QP9A 3ZWAA 2HAEA 4ZQBA 3BMCB 3E9NA 4PG7A 3V1TC 5HS4A 4CL8A 2QYTA 3KYCB 5A05A 2UUPA 1HEUA 4D41A 3NV9A 1A4UA 2Y05A 4R3WA 1LC0A 1LDGA 4D44A 1ORRA 1P1JA 1E3WA 1LRKA 1LLDA 3DBRA 5ICSA 1MGOA 3JQBA 3KM0A 3PGJA 4BNHA 4E2XA 1C0IA 2TMGA 3OJOA 4YQYA 1Q7CA 5A4DA 1GEGA 1I5RA 3BTUA 1NVTA 3DBHA 3ST7A 1YL6A 1CERA 2CSUA 3RIHA 3R6DA 3WBFA 2PKRA 1G1AA 4PG4A 4RLSA 4YJFA 1XDWA 3JYQA 1HYEA 3WICA 2Y66A 5IAAA 1T26A 4Y67A 1O0SA 4RGBA 3HWRA 4IS3A 4LVCA 4RVDA 3O38A 2ZJ1A 4TRJA 5CG2A 1GQQA 1B8VA 3WTBA 4LRSB 2I3GA 4BGIA 3KXDA 5COAA 2CD9A 1HSOA 5IXYA 5CAEA 4P4GA 4O6VA 4JLWA 5JY1A 3I1JA 4LGVA 4E33A 2AQIA 4BNZA 5EQDA 5LDGA 3A1NA 1PJTA 3FN4A 3ZI0A 3HDYA 1N92A 2PZKA 4XRGA 1HYHA 1N9GB 2JFHA 1SOVA 4D3FA 4O63O 4QQRA 3WGTA 3WSVA 2VOJA 1ZFNA 1T2FA 4HUJA 4YQZA 1C1DA 1E7MA 5TS3A 1N7GA 2GN6A 3PYMA 1DO8A 2G0TA 2PFGA 2O3SA 1L1FA 3WJ7A 3RC2A 1XELA 3W4IA 5JNLA 1D4FA 1ADCA 1P3DA 3CEAA 3DAFA 3GPIA 3M1AA 1LBEA 4GMGA 3WXBA 2PD6A 1E3WB 4E21A 3OIDA 3SLKA 3ONDA 4UVIA 4CLRB 5JDIA 5ENDA 5ENVA 3V8BA 1R37A 2EP7A 3RCBA 3EC7A 4DLAA 3JQDA 1TA4A 4Y6SA 1KEPA 4Y6RA 3WOHA 1ZSVA 1M2WA 3GNSA 4PLHA 3CE6A 2NVUA 1QYXA 3TWOA 1MP0A 3GN2A 5J23A 3T7EA 5T57A 1BSVA 1UDCA 2RBEA 4J2OA 2FZWA 2P5UA 3KYCA 3GY0A 2HO5A 2I65A 1T4BA 4J4HA 2O3RA 3ETGA 4HXYA 4FB5A 1WDMA 3PZBA 4U0KA 2DT5A 1HLDA 1WLYA 2CDBA 1ZKMA 3GGGA 4PCVA 1GR0A 4CODB 4CUKA 4F46A 3FRJA 4YAJA 3GVXA 4R1SA 5DZSA 1RM0A 2YFHA 4B8WA 2Q4EA 4RPJA 2HK7A 1K3TA 1Y8RB 4OOEA 4XRRA 1GD1O 3ICPA 4YYZA 4IIUA 5FFFA 3VHRA 1EE2A 3MJSA 1G0OA 4XD2A 1XLTA 1PQPA 2C0CA 4D79A 5CDUA 5IDXA 5JE8A 1GZ4A 1Y5MA 3RJ5A 2AW5A 2O2SA 4K9DA 4Y8VA 1PWZA 2PWZA 3RUEA 2ZTMA 5JAIA 3PTZA 1P44A 4QX6A 3K8ZA 1QYVA 3GF4A 4RZHA 5EMHA 3RC1A 1NVMB 1EE9A 1Z82A 2VHXA 4U8GA 4HADA 4ZU3A 1X0VA 1Z73A 4N18A 2D2IA 3H65A 4I8XA 1VL0A 4PIVA 5DT9A 2JHFA 4M1QA 2QRJA 4FFMA 4A10A 4TMFA 3QQPA 3H7AA 5TQVA 1HYGA 2YDXA 2DKNA 2PD3A 2QYSA 1LSUA 3N74A 3U4DA 3U49A 4DBZA 4LRTB 2EWMA 3G49A 1HE4A 1X7HA 3ROKA 3MTGA 1ZUD1 4AG3A 5I9LA 3K92A 1H2BA 2C7GA 4JBGA 4KTVE 4HNGA 3SJUA 1PGQA 2VRBA 1ZK1A 1BXKA 6LDHA 2ZB4A 1MG0A 5G0SA 5BSGA 5KJ6A 3I6QA 1EDOA 5CHEA 3LDHA 3DTTA 1JKFA 1V3TA 2BFAA 4H3VA 4F3YA 1YL5A 1Z74A 3UVEA 5KJEA 1VE9A 5U1PA 3IIEA 2PTGA 1G6KA 1DIAA 1DIGA 1A5ZA 3JCZA 2HMVA 3JQFA 4OQZA 2GF2A 4PLZA 3WR5A 4Z3KA 1O94A 3WFJA 2OUIA 2WWRA 3JQGB 4BGVA 4E5YA 3B70A 1DC3A 1EVZA 1ZCJA 1C1DB 1EBFA 4FR5A 4J7CA 2X9NA 1LDNA 2JL1A 1P74A 3RFVA 2PD4A 3E9QA 4MP6A 3VVBA 5LCXA 3FPLA 2WJPA 2X6TA 3KZVA 3LK7A 1BMDA 2VUTA 2GNAA 1P1HA 1A4IA 2VYNA 3JYLA 2HCTA 3GDGA 1V8BA 4OXYA 4DTIA 1LRJA 4BNKA 2BGMA 5CEFA 3OIGA 2B0JA 4DC0A 1FMCA 3PLNA 3PRJA 1GUYA 4WUVA 2FN7A 1AHIA 5JC1A 2RAFA 1NFFA 3WMXA 4C7KA 1PS0A 1U4SA 1XG5A 3ADOA 4F6LA 1OAAA 1UP6A 4ZQEA 1XGKA 2C82A 4CUJA 3PQFA 3GFBA 4P4LA 4E2YA 3L9XA 4LCJA 1GV0A 2E82A 5DBGA 1T25A 1KIFA 1SEVA 4OHUA 1X1TA 4NJMA 1TI7A 2JAPA 4YA6A 4J0EA 1DHTA 3FNEA 1C0PA 3SVTA 4DMLA 4LW8A 3HDHA 5I8WA 1A9ZA 1UZLA 2I99A 4OM8A 3TZKA 3MJCA 4I9HA 5KJCA 1DOHA 4DA9A 1HLPA 2EGHA 5FI3A 3P2OA 2W90A 1IYZA 1AHHA 1JLLA 3F47A 3T4XA 1XA0A 3DMTC 4DIFA 3CMCO 4CR6A 1PR3A 2NUAA 3GRKA 2Y1CA 4YWJA 1KEUA 4XB2A 1QR6A 4AJEA 3INGA 4CLHA 4EDFA 4Q3DA 4EYEA 1MFZA 1R0KA 2VYVA 2HU2A 4KP7A 3RU9A 4DMMA 3OBBA 2YQ4A 3D4PA 4TZKA 1JWBB 4CLOB 4UUNA 4BB5A 3ZV6A 3H9JA 3HZZA 3UHAA 1I0ZA 3D1LA 5DDIP 4ZICA 5CP8A 5A5EA 3MOIA 2XAAA 5EINA 1DLIA 1X7GA 2NTVA 4PGFA 4Z0TA 2VHWA 3VH3A 4YT4A 5ILOA 1HXHA 4AJ1A 3IUSA 3KEOA 2POQX 1GZ6A 4CM9A 1ULUA 1SEPA 4BNUA 2EW2A 1CQJA 3DHYA 4PVCA 3ZWPA 2GUGA 4RQTA 4BVAA 3PJFA 4XCVA 4JQCA 3TOXA 1DBVO 1E7WA 1IULA 4W7IA 4B3IA 3H9EO 1I36A 1E1NA 3N7UA 1PL8A 4M54A 5C3MA 1P0CA 4CLEA 4YAEA 4DC1A 1DIRA 4J1QA 4MVJM 3WWZA 1YJQA 2O3QA 5BSHA 2FPIA 2A35A 3ROMA 1B14A 3U62A 3WB9A 5KVCA 1I3KA 4BQPA 4HBGA 4Z3DA 1LNQA 3RFXA 1J4AA 1T1SA 4CM1A 4Q3EA 4II3A 1MX3A 1P31A 3TOZA 3PWZA 2YY7A 4MVJA 1PWXA 5IDYA 1TB4A 2HK8A 4O59O 2RCYA 4TVBA 4EUHA 4D42A 2NADA 3AI3A 3OM9A 1YXMA 2DU8A 4CQLB 3RD5A 3H3JA 1YS4A 3IUPA 5T6BA 3CPSA 1ZW1A 3I83A 3NAQA 4IDGA 4XR9A 3HUDA 2Q45A 3QY9A 2YFQA 5A3JA 2OOSA 1W0CA 1H0KA 4HWKA 4GSKA 5H81A 3ENKA 3QJ5A 2AEJA 5I8ZA 3S2EA 4CM4B 1GYRA 1PGOA 4D3SA 3NEPX 2GZ2A 3U4HA 1I3NA 1EFLA 2EV9A 3MJEA 4E5KA 2OP0A 4PLYA 1U8XX 3NYWA 4XIJA 3I9KA 1DFIA 3DR3A 1NAHA 4NHEA 5T5QA 3HG7A 3WDSA 3ITKA 2NVUB 5FWNA 3QHAA 4P22A 1K5HA 1U5AA 3M6IA 2PZMA 2VHZA 4OSOA 4WLUA 4B4OA 4PN3A 1LSJA 4FJ1A 2VWPA 3RQSA 4AJJA 5AYVA 4KWIA 2P9CA 4TROA 2Q49A 3H2SA 1U4OA 5JCJA 4LCEA 4MKZA 3DFZA 4D7AA 3GRPA 4XQCA 1B26A 2C07A 3UICA 2WSBA 1TT5A 2FY8A 1DC4A 3WNQA 2Y1DA 2PK3A 4LN1A 1C14A 2B5VA 1T2AA 5JYEA 4XYMA 1KBZA 4XKJA 3CKYA 4LSWA 4EEXA 4EJ6A 4FC6A 4WECA 4WCDA 2C2XA 2JD1A 4HFNA 3DO5A 1CWUA 1RWBA 3ANMA 1WW8A 6ADHA 4IDEA 3GOHA 3KETA 2H1SA 3C24A 1LLQA 3WYEA 3ZH2A 1IZ9A 2P91A 4DLLA 5KTKA 1R12A 1PSDA 2D1YA 2DQ4A 2HRZA 4R01A 1EUZA 1CYDA 1E6WA 1NAIA 3JTMA 1M76A 3FWNA 1ADGA 4TRRA 3LT1A 2NM0A 4WCFA 3RBVA 4AJKA 1E6EA 4GMFA 4BUCA 4MPDA 4XGNA 1XR3A 5A04A 2IRWA 5KCZA 4W6ZA 3IP1A 4ZRMA 1NQTA 3DAGA 5LC1A 1BVRA 1HL3A 3OA0A 3JQ7B 4LSMA 1P33A 5C7OO 4QO8A 2X0RA 4XJSA 1QYWA 1K89A 4C7JA 4CM6A 3B20A 5JO9A 1H9BA 2O4CA 1ISGA 3JQGA 4TWRA 3WGQA 2WYUA 4CV0A 3MWDB 4PZEA 2B83A 2BRUA 4NK5A 3ZWWA 4AJLA 1Z75A 1U2GA 1IPFA 1EQUA 2PLAA 5HWSA 3JQCA 3PWKA 1LRLA 2BI7A 3D4OA 4JP2A 3SEFA 1MA0A 3ZV3A 1NR7A 2DBVO 4NBVA 1CJCA 1Q7BA 2IDZA 4OGWA 4RVSA 4GKVA 3KRTA 1PQUA 4P4NA 3D3WB 1N2SA 1QV7A 1Z45A 3WIDA 4CQMD 1L7EA 3OMLA 4OSPA 3GMSA 1N1GA 3RFTA 2V6FA 3A28A 5L4LA 1C1XA 4TZTA 1K6IA 3L4BA 4XGIA 4QTZA 5KWEA 4B4UA 1C3VA 1CF2O 3IKVA 4CMGA 3RAJA 3VH1A 3EUWA 4PLPA 3KTDA 4YDRA 1LXCA 1N7HA 1PJSA 2WYWA 4CL3A 3C8MA 1Q1NA 3AW9A 3KSZO 1YDEA 2YJZA 4D43A 2VUUA 4L9RA 2JD2A 3LYLA 3GGOA 1F17A 2C5EA 4ND5A 1KOLA 1SC6A 1OC2A 2Y1GA 3JYPA 3AY7A 1HTBA 2EKLA 4L76A 3IKTA 3I9MA 2GSDA 4Q3BA 2OP1A 4WK6A 5L7WA 4IQ8A 4EBFA 5IJZA 1ZMTA 4BNVA 4UUPA 3UCEA 4RDHA 3AI1A 5EQFA 3IAHA 2ILTA 3R3JA 3MJ4A 3WLFA 4RQUA 2Q99A 3ZWYA 2J8ZA 4D46A 1NR1A 3PYXA 1I2ZA 1YWGO 1P1IA 5IZCC 1EEHA 3L4BC 3OQBA 1H6DA 3QRWA 1FDTA 1UAYA 1ENPA 1A9YA 1KC3A 1PJBA 2Y99A 1DRWA 3D5QA 1I8TA 2CMDA 2YV1A 1MG5A 1UDAA 2VYND 4IDFA 4RLHA 1V6AA 3AM5A 1HDCA 2EKPA 3SJ7A 2Q50A 2BH9A 3K9QO 3SLGA 4NJOA 3HN2A 3AFNA 2YZ7A 4MVJF 1E7SA 1NWCA 3JQBC 4MIEA 3QSGA 4IQ0A 1HDYA 1BWSA 2V6MA 2O3TA 5TRTA 3DAPA 4PRKA 4JJIA 3FNGA 4RPGA 3RKUA 1WDKA 4A5OA 1K2WA 3CXRA 3W4KA 4WCFC 3ZW9A 2AQHA 3W8DA 1DFHA 2FMUA 1B7GO 4BKQA 4E2WA 3WQRA 4K6CA 1KVQA 2EF1A 4GSLA 4BHTA 4XYGA 5JLAA 1GUFA 2VRCD 1J49A 2AMFA 3OFSA 3GMDA 2FSVA 1EVIA 3X2FA 3ZV4A 3V1YA 3U4CA 4ZN6A 3DTYA 4ZQGA 3DEYX 4XA8A 2O48X 1VJ0A 4XQ9A 4P8RA 4AJNA 3OJEA 1UZNA 3JD1A 1OOEA 3ZHBA 4ITUA 5L51A 3Q3CA 2I6TA 3PHGA 5KKAA 2J6IA 1KETA 4E5MA 4NBTA 1JN0A 3KB6A 5K6AC 4JIGA 3C85A 2BD0A 4CQLA 1IL0A 1GTMA 1A7KA 2DLDA 3PFWO 4HP8A 4RPKA 5EERA 1KY4A 5IZCA 1Z7BA 4IJVA 3H5RA 4RJTA 1TXGA 1M66A 1BG6A 4L4XA 5CG1A 4G65A 1YQDA 5A9SA 1J6UA 3WGIA 4IIVA 4CMAA 4QT0A 4YJHA 3AM4A 2NWQA 3KOUA 1XIVA 4R9RA 1C1XB 3MJTA 3OA2A 3ETEA 1ML3A 3PK0A 4Z6KA 3DBHB 4R51A 1U3VA 2PNFA 5JY6A 5I7SA 4C4OA 4J7XA 2PR2A 1UXKA 4GGOA 4IJWA 4GL4A 5F1KA 1ZH8A 4UEOA 4B7XA 4FDAA 1YBVA 1ONPA 1PX0A 4YXFA 3G0OA 4OXNA 1ZBQA 1NXQA 4J1SA 2EXXA 3OH8A 3KUXA 3VTFA 3W6ZA 1B16A 1ISJA 4BNTA 2PGLA 4J2HA 2Q2QA 3WSWA 3W8FA 3C7CB 4B3HA 4K26A 2D5CA 3H9GA 5HRUA 1ZSNA 2RIRA 5B4VA 4EW6A 4E4YA 4DVJA 5IFLA 5BSFA 1BVUA 4IXTA 3TZQA 4BMNA 3QVWA 3I23A 1O89A 4J1NA 2IYPA 3PJGA 4XGKA 1N8KA 2B5WA 1Y8QA 4F45A 3L6DA 3AY6A 3WFIA 4YEDA 4FN4A 3FD8A 3I9NA 4DIBA 4UEJA 1GL3A 3FTNA 2GGSA 4OYRA 5G2OA 4IJUA 4XIYA 1SNYA 4JP3A 1Y5RA 4KUGA 1JTVA 1U3WA 3CTMA 2B4TO 3FI9A 2VRCA 3W6UA 2X7HA 4WCFB 2CF5A 2ZYDA 1PEDA 2XPCA 3ROPA 4CMIB 4WOKA 1GCOA 5DF1A 4CMEA 1ZIDA 3NDJA 3RU7A 1VKNA 3QWAA 2OFPA 1D3AA 4D3DA 1U3UA 3VZRA 1PU2A 3F1KA 2BGKA 1DB3A 2CNBA 1HE3A 4HV4A 5IXSA 1NPDA 5AXAA 5L45A 1V35A 2P4QA 2ZB7A 1UXJA 4BV9A 4PG5A 1RYDA 3V5NA 1ZK4A 1VKOA 2I66A 1CDOA 4CPDA 1HZJA 5HA5A 4BOYA 1GEEA 4O5OA 1FXSA 3DBVO 4RV9A 1VJ1A 4HFRA 3BTOA 2EP5A 4J9UE 4YJGB 4UUMA 4Y9DA 2E6UX 3E5RA 2NV6A 1BGVA 2DUUA 3TQHA 3MZ0A 3RVDA 1DJQA 5KJFA 1XU7A 2WTBA 1N1EA 3HB5X 3ZNOA 3LT0A 3WYBA 5KOIA 1U28A 4ALIA 4Q39A 1SO8A 1MUUA 3PHJA 5COQA 3DB2A 4XB1A 5T67A 5THKA 1HRDA 2AQ8A 1DHRA 2H9IA 4CUZA 1YDWA 3GEDA 4II2A 1NYTA 4WNIA 4CM7A 4YB8A 2HMUA 1WVGA 4MVJG 4UVEA 5U9CA 4OIMA 2CF6A 3ZWMA 3OETA 1X15A 4CLDA 1M6WA 2X0JA 3ZNPA 4NG5A 2H6EA 3KHUA 3RUCA 3RUDA 1PS8A 2AG5A 4D45A 5T64A 2WD7B 4A26A 2Y1OA 4B79A 2Y0DA 1LX6A 1NFQA 4ZJUA 3L9WA 3JQ9A 3H8VA 1LU9A 1GFSA 1VPDA 4TSKA 4IM7A 4Z9YA 3FCOA 4RF5A 2DTEA 3QW2A 1A72A 1AXEA 4XWYA 1V3UA 4IDBA 1R6DA 1M75A 1G0NA 1VRWA 1GQ2A 2E4AA 3DDNA 4WGGA 1F8GA 4BB6A 3GVHA 3GZ4A 1E7YA 1LJ8A 3PQDA 4WEQA 3NTQA 1NP3A 2NNLD 3O8QB 3O26A 3BMNA 2HMTA 3ADPA 5TGDA 2IZ0A 3DZBA 2X9GA 3GUCA 3A06A 5JBIA 3GDFA 1QSGA 1YH3A 2VZ0A 4MIOA 1ENZA 5G0UA 1ADBA 1EUDA 2VCYA 4Y6PA 5L95A 4AVYA 1RKXA 4J0FA 1B3RA 1U2DA 1LUAA 3L4SO 1CIVA 2R2GA 4GX2A 3QE3A 4CM3A 1PS9A 4R3NA 2XXJA 4HFJA 1JVSA 1PZEA 1TVEA 2ET6A 3JQ9C 4FSHA 5CDTA 2VHYA 3ASVA 1ZK3A 1P0FA 3H6KA 3DFUA 2VZ8A 4JCOA 3PYLA 1HE5A 4CMJA 1NBOA 2OMEA 4W7HA 3I4FA 3ZWCA 3KVOA 1YVEI 3ASUA 1MLDA 1E1KA 1JVBA 2GO1A 2EJWA 1QYDA 2P2SA 4YAIA 3QVXA 3KBOA 3T4EA 1Y8RA 4JBHA 1MFPA 1I3MA 3C1TA 3H9UA 2Y0CA 1IZ0A 4A0SA 2Q4BA 3FNFA 3MJVA 3MTJA 5U4QA 1GYPA 4OH1A 1KVUA 2DPGA 2I5PO 4BNXA 4WE3A 2NQTA 3NT4A 3F6YA 4CV1A 4DREA 1SMKA 1U5CA 3HADA 4WLNA 1YE3A 2J5KA 3Q2IA 1BXGA 1GAEO 2Y67A 1IE3A 4ND4A 4UVDA 4W9NA 9LDTA 1HE2A 4OO3A 3WTCA 1QG6A 2ZB3A 3FTPA 4BL5A 3WNVA 3LU1A 3EVNA 3NTOA 2Y93A 2JFGA 2GZ1A 3FHLA 2ZK7A 4FCCA 1FDSA 4WKGA 2J5RA 1O6ZA 5F5NA 1P1RA 2NU7A 3C7AA 4HX5A 4BO4A 5C7IO 1H94A 2O2YA 3RKRA 2VWQA 2HJSA 3I4CA 3ZU3A 2G1UA 4YJHB 4ESOA 4CV3A 3OEYA 3DHEA 2OORA 4GX0A 4NFSA 3EHEA 4A2CA 2D4AA 4UREA 3OEWA 4DQUA 1FJHA 2VWHA 2ZCUA 2IZZA 3A9WA 4XQGA 4BNFA 4DQXA 1PJCA 1OZAA 5GMOA 4R5MA 4F6CA 3IL2A 3OJFA 2X9VA 3JYOA 5I7FA 3TJRA 3ZU5A 4BNYA 3TN7A 4K6FA 4BO5A 4JJFA 5C37A 3E9MA 4N5NA 2FP4A 4H15A 1A27A 1E0DA 3DZHA 4L0QA 1KYQA 1F8FA 4AL4A 2X4GA 4NZ9A 1S6YA 4DRYA 5JDIC 4KUHA 2X86A 4NIMA 3E18A 5TNXA 2YYYA 2YDYA 5CPBA 3ONFA 3ZWVA 2W2LA 4CJXA 1LQTA 3CIFA 2BFPA 2CUKA 5JYDA 5JCJD 3EZLA 5GZ6A 4MDHA 2W2KB 3G17A 3HFGA 5IZ4A 3A14A 1R4MA 4L8VA 1PTJA 3BTSA 3RUHA 2QW8A 4KOAA 4BO0A 3EYWA 4NPCA 3AI2A 2X8LA 4H16A 2EGGA 2OZPA 4B4WA 2FR0A 2A9FA 1TT5B 2EJVA 3RJ9A 1AN9A 1JA9A 3AFMA 1FF9A 2PZLA 3GQVA 4I08A 3NGXA 2I76A 4BKPA 2J3IA 4YRDA 4M8SA 5JCXA 5G4KA 3ZNQA 1SOWA 3PGXA 3BMQA 1DAOA 3JQAA 1VLLA 1YONA 3TDKA 1JWAB 1UXGA 4IGFA 1HWYA 3FPCA 1BXGB 2F1KA 1E6UA 4UAGA 3RASA 5A5FA 2WE8A 4HKTA 1YGYA 3GFGA 3LLVA 4IMPA 1JAYA 5I7EA 4E12A 5JAZA 1ARZA 4DWVA 5L53A 1KVTA 3O03A 1D1TA 4WNCA 1R0LA 2GLXA 4FPXA 4BKOA 2E48A 1FDUA 1X7DA 3MEQA 3RWBA 2VHVA 3NDRA 4J4BA 3E82A 1E5LA 1NQ5A 1ENOA 3D5TA 2WE7A 1NTOA 3HHPA 4Z9XA 2JAHA 4RVFA 4RVGA 1UXHA 2QIOA 4ROSA 3LQFA 4G5HA 3BMOA 3TZ6A 4DXHA 5BNIA 1NM5A 2Y68A 1GY8A 4RL6A 1YO6A 2A94A 3F46A 4PG8A 2J5QA 1EFKA 2V6GA 3RBXA 3QWFA 2F00A 4BO7A 4U6SA 1E3LA 3C3XA 5JO0A 2G5CA 3GAFA 3E5MA 2HLPA 3KSUA 4HFMA 3VPXA 5CDSA 2JKVA 4QSMA 3GR6A 3H3FA 5IN4A 4XZ3A 3DBLA 5F21A 2BFOA 3BAZA 1VJTA 4W4TA 3F5QA 5DBIA 2PKQP 1VL8A 3JV7A 5TSDA 3UF0A 4J6FA 4XYBA 1X14A 3GNQA 3TZHA 3NDIA 2CFCA 2UAGA 4XYEA 1F12A 2ZJ0A 2GCGA 4CQMB 2Z1NA 5TX7A 1PR9A 1ZSYA 3EMKA 4JBIA 1VL6A 4EZBA 1N5DA 2EEZA 3O8QA 3LT4A 4WLFA 1DJNA 4M49A 4AJIA 4BNJA 4FJ0A 3MWEB 2B37A 1Q0HA 5AVOA 1JW9B 3RC9A 3MCVA 4I5DA 4Q3NA 1IPEA 1R0SA 2CDCA 3CINA 4I1IA 5C5IA 3RUFA 3H5AA 3HN7A 2C59A 1CQIA 4YT8A 2YV2A 5C7LO 3JQ8A 4DBVO 3E1KA 4IDCA 4NBRA 4BO9A 2RHRA 4B8ZA 5L4SA 1DAPA 4W9NC 1TLTA 2C54A 4KDFA 5A9SB 4FFNA 3F4LA 2NTJA 3C7DB 5AOVA 1UJMA 1GUZA 1X0XA 4K28A 1GYQA 4CV2A 1V0JA 4FGWA 4IZIA 3L07A 3BA1A 2SCUA 4BQRA 4PFJA 2BGLA 1QV6A 3B1FA 1Y9AA 2FPGA 3ANLA 3MOGA 5A06A 4YVFA 5BNTA 1KY5A 3L6EA 3FBGA 3K6JA 3BMNB 1P1FA 1PZHA 3VC7A 1U7TA 4Y98A 1I2BA 3WG9A 1GU7A 4FD3A 4KQWA 1B0AA 5KVSA 3JQ6A 4DPLA 1RM5A 1KERA 1F06A 2Q1SA 3U3XA 2Q3EA 4MOWA 2AXQA 3RUIA 1DSSG 3AUTA 4ILKA 1PL7A 1SB9A 4I5FA 1ZXBA 1PJQA 1PGNA 2JJYA 1IUKA 2VWGA 2IZ1A 3CMMA 4R1UA 2NVWA 3ROQA 3F5SA 2B4RO 3Q6IA 1DXYA 3GDOA 3M2PA 1OC4A 4PRLA 2UVDA 2FWMX 1LLCA 2Q1WA 1C0KA 3AOEC 3FNHA 1NASA 4HNHA 4AFNA 1ZJYA 4MP3A 1K6XA 1NWHA 4MKRA 2C20A 1D8AA 2GN8A 2BFMA 1XWFA 2AQKA 1I10A 3BMQB 2JHGA 4QFCA 3I5MA 4MVJH 4H7PA 2W4QA 1V3VA 5ER6A 4AJ2A 1K6JA 2BLLA 2VYVD 3ZDFA 2PKQO 1UZMA 3KO8A 3TPCA 2EW8A 1H9AA 2X5JO 2AE2A 5T8KC 1Q0QA 4CLRA 4ND1A 2VZ9A 3S8MA 1T2EA 2PGDA 3UH1A 3HDQA 1ZK0A 3FR7A 2I67A 4BO8A 3AU8A 2WM3A 3K73O 4JNKA 3EW7A 5DCYA 1IHYA 1QYCA 2Y1EA 4BNNA 1EVYA 5ES3A 2VOEA 4GX5A 3E6AA 4PLVA 3IDSA 1JQBA 1MXHA 3UFXA 1UH5A 1ISIA 3RC7A 4BGUA 4UULA 1XKQA 5BSEA 3HQ4O 1ONOA 4R16A 1NPTO 2CY0A 3DQPA 4QEDA 2D8AA 3E48A 4DQVA 4KQXA 2IYOA 2D0IA 1H93A 2LDBA 1I2CA 1PGJA 5JW6A 4U0JA 2EIHA 2UDPA 1LDMA 3OJ0A 4J16A 3LSYA 2QRKA 2DAPA 2FR8A 4R1NA 3VPFA 1RM3A 4GAEA 3WGOA 1HDRA 1J0XO 5JMWA 1NVGA 3PJDA 4IJKA 3QLJA 4N5MA 4KUEA 4U6QA 4UUOA 2X22A 3TNLA 5CDGA 2ZCVA 3BTVA 3DL2A 3V1UA 4KDEA 4CMHA 3C1OA 2O3UA 3VDQA 4NFHA 3I9LA 3GA0A 3AU9A 4WJZA 2OGUA 3DWFA 3F9IA 1BRMA 2PA3A 4JROA 1YBAA 2R6JA 4CR8A 4A7PA 4Z9FA 3U9LA 4CMCA 3JQAB 3I3OA 3LC2O 5ITWA 4I9NA 3WWYA 2HQ1A 1TT7A 4FOOA 4AJPA 1JKIA 5JAMA 2I9PA 3ZGYA 2GN4A 2C7VA 4PLTA 3TSCA 1HZZA 1Q0LA 3GUYA 4FFPA 4IZHA 4B7UA 4CLXA 4YAGA 3GG2A 4OAQA 4BV8A 1W73A 3BMCA 2GPTA 3KLPX 2IEDA 3ENNA 5BNFA 4JXKA 4Z0HO 3LVFO 2AHRA 2DPHA 1IOLA 1ADFA 4ZQFA 4CLOA 3PDJA 2CVZA 4R5HA 2XOXA 1YOVB 4KMSA 4NU5A 4FFRA 2HSDA 3DOJA 3GPDG 4NI5A 3VPSA 5KJ1A 1ISHA 3R3SA 3HJAA 2V6BA 1E7RA 5GZ1A 4LK3A 3DMYA 1QRRA 1WMBA 3CUKA 3E03A 5I9NA 1I3LA 1SBYA 4XDYA 4GGPA 1D1SA 1KS9A 2G17A 3QWBA 1NPYA 1YB5A 1YJ8A 1ONNA 3D64A 4UVHA 3QVOA 4CM8A 3O4RA 5MGBA 5CFZA 3WJAA 2VTDA 3WGHA 1DC5A 2HMSA 4XDZA 3OICA 3Q11A 4DYDA 1O95A 3OJLA 3KEQA 2WYVA 1BXZA 3DZGA 1PGPA 4JN6B 3F3SA 4XX0A 4YCAA 4NDNE 2UYYA 3VAZA 2HJRA 1DFGA 1ZEJA 1C0LA 1WP4A 3LT2A 4QUKA 4IPTA 3R1IA 3PHHA 4L74A 3OSUA 1XEAA 3DBLB 2QZZA 2YV3A 3SXPA 1IB6A 3UCFA 5DP2A 4NBWA 5A9RA 5B4UA 4LMRA 5IDQA 3D4NA 4GWGA 3JQAD 3TF5A 3VPHA 3DXFA 1KEWA 2ZKLA 4MVJP 1UXIA 1VI2A 4O1MA 3Q9UA 1DDOA 1XCBA 5DCUA 2OBNA 4NNJA 1UDBA 3P2YA 5FF9A 3Q1LA 3PXXA 2QX7A 1O9BA 2QHXA 1NHGA 2X58A 2ZB8A 3U09A 1GCUA 1MC5A 1RPNA 4DPKA 4LVUA 3OECA 1B8UA 1FDVA 4BMSA 4BNGA 1U9JA 1BTOA 2VT2A 3DMTA 1XYGA 4RVUA 4YJFB 5TF4A 1MXFA 1PZFA 4J1TA 4LISA 5DBFA 2E49A 1T1RA 3QWIA 4J49A 1EDZA 4BKRA 4W82A 4IDAA 3KYBA 1XQ1A 4B3JA 3N58A 5IG2A 2PH5A 1XHLA 1Q7GA 5H82A 1ULSA 4INAA 3JD2A 3LC7O 2X0NA 3LF2A 2EHDA 4YAKA 3GEGA 3GC6A 1P77A 2P68A 2PZJA 3JD4A 5T8KA 5TLSA 1QORA 1PJ2A 4ND2A 5L3ZA 5DOVA 1HETA 1LLUA 5JXWA 3PWSA 4UVGA 3AWDA 3GK3A 4O0LA 3S55A 3V2GA 3WGYA 3GGPA 4DGSA 3UN1A 1JAXA 5KNLA 3IMFA 4E5NA 5CEJA 3WGGA 3G1TA 1P1KA 4NMHA 2W2KA 4R41A 2YHUA 2ZYGA 1AGNA 2IE0A 3AOEA 4CM9D 1SAYA 5CDYA 5F3RA 2BF7A 4DYVA 2DUWA 2DTXA 4IGEA 4E30A 2OO5A 2HRBA 1MC4A 2CVQA 3GVIA 4J7UA 1I30A 5TC4A 3TRIA 3W1VA 5LDHA 3NRCA 4MJLA 4DIOA 2XF8A 2FSSA 1NQAO 3DC2A 4G2NA 3NT5A 4OJNA 2JD0A 4FOSA 3PI7A 1QMGA 1ZNQO 5EL0A 1Z7EA 1TEHA 1PQWA 3FWZA 2YHIA 1E3EA 4AJ4A 3H5NA 1Y81A 1AXGA 1FDWA 1I01A 2FHSA 3EK2A 3DZFA 1IY8A 2XXBA 3B1JA 1LC3A 2NU6A 3IP3A 2B69A 3JD0A 3P7MA 3VZQA 3UOGA 3B6ZA 1UP7A 1Y6JA 4BIIA 2JCVA 3GHHA 1UAGA 2JCXA 3GZNB 4RCVA 2OL4A 3NTRA 4Z0PA 3JQFC 3WGZA 2ZYAA 1HSZA 1QKIA 4IXWA 3UUWA 2BHLA 2GASA 4WOJA 1QXSA 4RZIA 1HF3A 2CVOA 1EBUA 1PJ4A 1ENYA 1GDHA 3X2EA 1UR5A 3B1KA 3FSRA 2DBQA 4OQYA 3KV3O 5FI5A 5FYDA 4N54A 4QO7A 3BIOA 4ID9A 5TT1A 2UUOA 3ONEA 4CMIA 5H83A 4I5GA 1H6CA 1J5PA 2HMWA 2BKAA 4MVJD 4Q3AA 5K0ZA 5DNAA 5GZ3A 1LSOA 3WLEA 3RBZA 1ZJZA 3DBRB 2UV8A 2Q1UA 3NJ4A 4TRMA 3IQDB 2LDXA 4YACA 3BXXA 4ALNA 3KSDO 3K31A 4PLGA 4E5PA 4Q3CA 1JU9A 5F1OA 3SBOA 1SB8A 1O5IA 1WMAA 1E3JA 1ZXLA 3COSA 2BELA 1U8FO 4B4VA 3P5SA 3OQ1A 3IC5A 2HDHA 2ZTLA 3RUAA 4EITA 4GLLA 4BO2A 4GVLA 3G3EA 5B4TA 1KVRA 4ZGWA 2R00A 3KYDB 5DP1A 3K2EA 1MV8A 2VNAA 3QWHA 2CDAA 1HDOA 3K96A 2O4UX 1R4MB 1IHXA 3HDJA 4IMRA 1MB4A 3C1AA 4J9VA 3LLSA 3TFQA 3FBTA 3JYNA 5B12A 2VNSA 1BDBA 2GDZA 1YRLA 5ITVA 4MKXA 2ZQZA 4EGFA 4BO1A 1OI7A 3WMWA 4NFYA 4NR0A 3JSAA 1RM4A 2ZTUA 1NNUA 5EPOA 1ZEMA 3S2FA 3AK4A 3ZU2A 3HSKA 3TL2A 4FFLA 3R0IA 1E3SA 2Q1TA 9LDBA 5TJ9A 2Q46A 1XSEA 4E3ZA 4NH4A 5A9TA 1P9LA 4CR7A 1SPXA 3VDRA 2OHXA 2VT3A 5EESA 3UKOA 5JDCC 1VC2A 1EQ2A 5L40A 3WYCA 4AJOA 5ER9A 4MINA 4TQGA 3AJRA 4WPGA 3CZRA 4J43A 3WBBA 4JJGA 1B8PA 3OF2A 2DVMA 4NU6A 3NUGA 1F0YA 2B4QA 3ZWXA 4A73A 4P38A 4BO6A 3STHA 2GZ3A 2JCYA 5EJ2A 4KTTE 2R00C 2DM6A 1YOVA 5HS6A 3ZWBA 3O9ZA 1UP4A 3L77A 3VZSA 5I7VA 1WNTA 3UXYA 3ZZNA 5G0TA 4JGBA 3I9JA 1LSSA 2C5AA 1XQ6A 4GX1A 3PP8A 1HKUA 3PJEA 3JQ8B 3ITDA 5IN5A 3V2UA 1LQUA 2DC1A 4IS2A 3UCXA 3SC6A 1K0UA 4GBJA 3RSHA 5A03A 1F14A 3QIVA 1SZJG 3D3WA 2WEKA 1X13A 2H63A 3DZIA 1R16A 3HFSA 3PDUA 2E37A 4XR4A 3UGKA 4R4JA 4RORA 2GYYA 1DRVA 2YUTA 4L4SA 4TVOA 1DEHA 5A1TA 1E92A 3Q9NA 3GVCA 3UAGA 3T7CA 1JDJA 1DIBA 2EERA 1BW9A 4WLVA 2OXIA 2J3KA 4ALLA 1YQGA 1UUFA 3AUUA 3W8EA 3IJPA 3ZCXA 2W98A 4XEHA 4A27A 4OOFA 2V65A 1KEVA 3GVPA 2OBYA 4RVHA 2TMDA 4WLOA 4ZRNA 4ZQHA 3TZCA 5TIIA 4RF4A 1I24A 5KKCA 3GG9A 3CZMA 3F4BA 3HB4X 4KWHA 4EEZA 5G0VA 3RI3A 3OIFA 3DOOA 2DTDA 2Q2WA 4I9UA 3ZWOA 1E1MA 1W6UA 1Q2XA 4DPMA 4R9SA 1B3BA 2P5YA 2RH8A 2AG8A 5DN9A 2O7SA 3ZWNA 5AXDA 4GQAA 2NU8A 3TFOA 3H4VA 1YL7A 2FRDA 4N5LA 3V2HA 1GV1A 4Q9NA 3WQQA 1YB4A 3GAZA 4DLBA 1M67A 5GY7A 3EVTA 3U4IA 2AE1A 2G82A 5JDCA 2O23A 2IODA 1Y1PA 3KYDA 1R66A 3HE3A 2AEFA 4J90A 1D7OA 2O50A 4FBGA 1B2LA 3AOGA 5DCWA 1WPQA 5HBRA 8ADHA 3U0BA 2YQ5A 4R68A 1OFGA 4BNIA 4R54A 2GD1O 4N7RA 4IBOA 1GPDG 2NACA 3NJ8A 3SX2A 5ILGA 2I3AA 3AUAA 4B7CA 5BR7A 7ADHA 5FEUA 4GI2A 4L4RA 2WDZA 2NTNA 5JSFA 2DFDA 2QG4A 2Y1FA 1H6BA 4ZHSA 3ZW8A 2X5OA 2FPPA 2WD7A 2YW9A 2HUNA 1RJWA 2IXAA 2WMDA 2X5KO 5CEEA 4D0SA 2ZQYA 2GN9A 4J4TA 2HK9A 1U7HA 3NGLA 4L75A 1W4ZA 3VH2A 4GVXA 1BW9B 3G1UA 2GRAA 3A4VA 4YBZA 1H5QA 1NHWA 1YKFA 4TKLA 4K1LA 1ZVMA 3VOSA 4RPLA 4YJDA 3DOCA 1KVSA 3F1LA 3NKLA 3Q0EA 4M55A 4ZVVA 5KIAA 1FK8A 2VN8A 1DC6A 2EG9A 4LMPA 1E77A 1Y7TA 2IEBA 1LDBA 4M87A 4WASA 4CM4A 5ADHA 4EUFA 3AUSA 3GH3A 4OMUA 1LI4A 5L9AA 5BQFA 4BGEA 3VVCA 1LEHA 1X1EA 3PHLA 3PPIA 3FF4A 4X54A 3DHNA 2P4HX 4PLWA 3EY4A 4MIYA 5AXBA 1U3TA 2H5LA 1EUCA 3GZNA 1AUPA 3IJRA 4CMEC 4RO0A 1EVJA 1PZGA 2AEMA 2ZATA 4GKBA 2DFVA 1LDYA 1T2CA 5I9MA 3ULKA 3DONA 3NX4A 2Z1MA 5L7TA 5EN4A 1YQXA 2FOIA 3PHIA 2AA3A 4WEOA 5BT9A 2YHIB 3VZPA 1PJLA 4BKUA 1DRUA 2A92A 3BZUA 1PIWA 1BHSA
chains in the Genus database with same CATH superfamily
1WAMA 2H0AA 4RKFA 4DL9A 5C8DA 1E63A 4UQOA 3RYIA 4LF8B 5YASA 4CKBA 2X8WA 2PH3A 4H0NA 3RTAA 1KYYA 1TECE 4FQ8A 2W6JD 2ATIA 1SHZA 2BR4A 1XP5A 3CBQA 3G5AA 1OGIA 4UEKA 5TMEA 4FGSA 1KDYA 4JI8B 1E3IA 1RXSA 1G8AA 2AC4A 4V0NA 1BDMA 4RDCA 5FHRA 4O4HF 4OXKA 2ZS7A 3DYBA 1RJ9B 2XTMA 2EZTA 3BD7A 1HDXA 1N8NA 4L8FA 4XSVA 4DBVO 4Z6KA 1VSTA 5A5GA 2FQQA 2YN4A 5CPFA 1I6MA 2QMEA 4LE1A 1TW3A 2IK8A 4BFSA 3BWMA 3DV2A 1EDBA 4Q4CA 5JD3A 5JNTA 3H16A 1G2QA 4WOPA 3V97A 3UTDA 3F9CA 5FUXA 3A37A 1Y8QB 2NN3C 3CH6A 3EZYA 4LYAA 4MKHA 3Q4GA 4RF2A 2EG5A 4HMQA 3S6JA 1R4NB 2Z3ZA 3AV3A 4Y2YA 4WK2B 1MQ9A 1A5TA 4TKZA 3DF7A 5B1HA 1EMDA 5BV2P 4TYNA 3F3YA 3ZNNA 3KPJA 2ON6A 2WD8A 3W05A 1ZA2A 3OFNA 3S7TA 3VKUA 4CN9A 4EZIA 1DARA 1IN4A 1CRQA 4IXDA 4UUAA 4GKJB 1PVOA 3LZ6A 5FI5A 3W04A 2HSJA 2WIAA 3PSHA 1QP8A 1TUBB 3O8LA 4QPCA 4R69A 3WB1A 1KH1A 1O87A 4ZVOA 2VDVE 1IONA 4EJ0A 4QREA 2P1ZA 1M8GA 5IVKA 5JECA 3LW8A 5ICMA 2V9PA 4F3TA 4EJ2A 1SCUA 4X85A 1O58A 1HRKA 3IKJA 4YHBA 3C4VA 4EGSA 2C2WA 2Z95A 3DXZA 8LDHA 3FUWA 3KSMA 5DM2A 3ETDA 2J3HA 3B38A 2BZGA 4ZA2A 5EP3A 2Z2JA 4KLZA 5KVQA 1ZOIA 2ENUA 4I8IA 4MVJE 4ALMA 1BHO1 4DFDA 1QH0A 1X2EA 3BWCA 5AO9A 3LO8A 3QEMB 2XWPA 3HP1A 3KKNA 3SICE 3K15A 2A57A 1GPMA 4MQ5A 1SIOA 5AJZA 2BSQA 1XU9A 5EMLA 1L5GB 3ZN2A 1E61A 4MVJI 2ZDQA 4MI1A 2A3NA 4IQGA 5TT0A 2XNKA 4R8RA 5ALXA 2GM9A 4B6FA 1EEXB 4ILEA 4KYTA 3IPYA 3E0XA 1T4CB 4NBUA 1H2HA 3B2NA 3PIDA 2IYAA 1QDUA 2O7QA 3FPJA 5JSYA 1GTL1 3C7KA 4KAFA 2V9ZA 3I04M 4TM7A 5E6RB 3U49A 3QV1A 1NF8A 5AJXA 4KPFC 2JPDA 2VLIA 3G82C 2V3VA 2HDWA 1JKMA 3AHFA 3ON5A 4FYHA 2HA0A 2Y0EA 1KI3A 3IEKA 3QIAA 4RPHA 4TKMA 1ZZEA 1XLWA 3DZKA 2QMOA 3HFJA 4EJMA 2QUJA 3RSFA 3UMBA 3WX0A 2AF3C 2XQKA 3EISA 1GPKA 4NQZA 2YMMA 5JH7B 5WRFA 3ICCA 4MS4A 1VHDA 3GW8A 3LPCA 4I9GA 1QR2A 2RGNA 3FR8A 4IO1A 1RYHA 1YI0A 4MX8A 3QBVA 3D2LA 1CTQA 2KS6A 1Y42X 1J21A 4S3MA 4U7TB 3SZGA 4MUEA 4EQZA 3KQKA 1N9KA 1ZPDA 3DEIA 4RANA 3JQQA 2FKNA 3KVYA 4HPJB 4F3RA 1LZLA 2ZYHA 2PZGA 1QF7A 4AO6A 3GFQA 4JVNA 4JMLA 5U4XA 1QLJA 1XMJA 5IC6A 4GWLA 2NG1A 3OQ6A 4JX8A 4TXNA 5J4KA 4HY3A 4YPOA 4KBGA 2Y0PA 3IBGA 1H05A 2CCGA 1CEQA 3DM5A 1XEWY 1AB6A 2E5FA 3ILYA 4NK4A 2IDKA 1JZSA 4GECA 2VPPA 1NOKA 1QGAA 2UUBB 3DL7A 1X1SA 2PR7A 3D0OA 3EDYA 1KC1A 1DKLA 1JVNA 1RQLA 2G1JA 1FYEA 2QT0A 2V0NA 3HKCB 3ESXA 4FKZA 3SHFA 4C87A 3J81k 4KI0A 3HYNA 3L05A 3S7ZA 2XCRB 3TE6A 1IM2A 4RHCA 1HPLA 2JIOA 2VUSA 4A2QA 4BCBA 1TRHA 4K03A 1I32A 1JKJA 3QVSA 1PFKA 4RQAA 1QQTA 1PHRA 2E9SA 3KG2A 1N9GA 2DHDA 1R88A 2JI8A 4KIGA 1DLJA 2R68A 3GPCA 2H2HA 4FHEA 5DSXA 3E8XA 3H9QA 4WZAB 2QRLA 3CLVA 1DU4A 1KAMA 4YASA 2BBWA 1C1YA 2WVAA 4R1TA 4D99A 3DV0B 5HOEA 4BVKA 3MXTA 2P79A 1G18A 1O6GA 4NWIA 1VB5A 4CQMA 1UKZA 4RS4A 1FU8A 4HRAA 1U1IA 3A6JA 3DEFA 4NEQA 2Q3CA 3UK7A 2D59A 1I7SB 1D5CA 1G21E 1Q5PA 2ZYRA 3P0FA 4HT3B 2NZYA 3EVCA 1R4NA 1E5QA 4G9GA 5JAQA 5FTLA 4F3NA 1V26A 2GERA 5L7YA 3FDXA 5JALA 2QMHA 3BHJA 3PXEA 1WZEA 1KI1A 1UANA 1KXJA 2DHRA 2HSEA 5INTA 1ZUNA 3P19A 5HM8A 1TJ4A 5F9HA 1U0NA 1CETA 3PT9A 4R0VA 5KTYA 1VMIA 3PUJA 3FKJA 3REGA 4MW0A 3ABIA 421PA 3PIIA 4AJHA 1K5DA 2P1DA 4JU8A 4JHXA 2CMFA 3ONNA 2E87A 3EDMA 3PQ3A 1UJ5A 1OMOA 1EWRA 4ML3A 4ARSA 2P9BA 2VBFA 3B82A 3HABA 3IQIX 4K6KA 5HPYB 3CVVA 1P9WA 2XNSA 5IF3A 4LRQA 3KKMA 3VKGA 1H0SA 2XTZA 5DYIA 3PKIA 3TLMA 2AYYA 1MO4A 4N8SA 3RVPA 4E2ZA 2NVBA 2H4YA 1HH4A 2CNOA 4PG6A 5H7XA 5CYFA 4OKNA 4U39A 3ZX4A 1A7AA 1ESDA 4C4ZA 3FDZB 1KJYA 5JXJA 2AKAB 1AK2A 1AS3A 1ECGA 3KK0A 2WMOB 3IEPA 4FEGA 5K3DA 3RAFC 1DBPA 4DCOA 4ZIRB 4V0SA 2RHGB 4LC9A 1DX4A 1RS0A 1T5LA 2BTEA 4C4XA 2G76A 5FL7D 3MBOA 2VEDA 2V0CA 5LLDA 5TY0A 5EHZA 1L5RA 2Z9DA 2F8TA 1YZ3A 3H8JA 4U1RA 3J80A 2B36A 4FHZA 3QP9A 3OWHA 4UTRA 2HAEA 2PUHA 1P4AA 3BMCB 3Q3IA 1GPNA 4FOPA 3EZXA 4PG7A 4CL8A 1YJBA 4EJSC 2DETA 3LO5A 5E4FA 5ALVA 5TMPA 2YN0A 3Q5DA 4KVFA 4R6XA 4Z9AA 2Q5LA 3IIJA 3MJDA 5ESRA 5EUMA 5FLKA 3QX9A 1PFUA 1WUIS 1SXJD 3AG6A 4OPMA 4C5CA 4FFBA 5AVYA 3KQMA 1LC0A 3PRKE 5ES4B 4XM2A 1ORRA 1Z7WA 4G4GA 1LRKA 3OQHA 4UU1A 2W2PA 3TTUA 1BWQA 1SK9A 1V37A 3JQBA 3ROZA 4QUBA 4OX9Y 3PUHA 3D6MA 3KM0A 3PGJA 4MLPA 4QUHA 4R81A 2Q5OA 1FYFA 4YQYA 1AS0A 1O08A 2PUWA 2ZBPA 1GEGA 3D4LA 2PRZA 5A4DA 2VYFA 2EQ5A 1ILEA 1L8XA 1NVTA 1OREA 1WULS 3QEKA 1WD5A 3RVQA 1YL6A 5K6RA 1W1IA 1SVNA 4M3NA 4MCHA 1M1YA 3SJBA 2W7TA 2CSUA 3WBFA 2C1ZA 1G1AA 4IIFA 3D6TB 3WRXC 3BEOA 4Y67A 5JNSA 5EUCA 3HWRA 4X60A 4E7PA 4WVFA 5FT9A 1WXWA 3JZFA 4WCVA 4HLCA 5AHOA 1JR4A 5CG2A 4AUEA 3WTBA 1SK8A 3A1CA 2J9ZB 1F7UA 3KXDA 5COAA 1VBKA 5IXYA 3E53A 3EN0A 4G41A 4OGKA 5CAEA 1W8IA 4P4GA 4MS4B 2BR3A 4DA8A 3E23A 5JY1A 1QUFA 4E33A 4ENUA 3PFGA 4BV3A 2YMLA 3A6HA 3QPAA 3M6LA 4BNZA 4CBVA 5B6PA 4XUCA 4DUGA 621PA 5KREA 4OJYA 2YS6A 1MOPA 2PMDA 4PYRA 1ISPA 1A7JA 5IJ0A 2JAWA 2H4FA 4QQRA 4UUQA 3D1JA 3G0GA 4EB8A 2PZ8A 2FHPA 3WGTA 1YKGA 1LWNA 3V7WA 2VOJA 1QG0A 1ZFNA 1YRWA 2DE0X 3FZQA 1C1DA 5AUNB 1XCMA 3JU3A 2GN6A 3PVSA 3A31A 1GT6A 2AVNA 4KJZA 3P32A 1RZVA 3WJ7A 4PWYA 4GZMA 3TOVA 3V4RA 1S02A 3W4IA 3R3UA 3GPIA 3CEAA 4GMGA 3DAFA 3CX3A 1U6JA 3ESAA 3L8DA 3ZHCA 1T36B 2FMKA 3S2YA 2X1MA 3SLKA 3ONDA 1ONBA 1OVGA 2VO1A 1IMOA 3NS7A 3GIDA 1JLMA 2XMBA 1R37A 3OU7A 4GMXA 1MH9A 4H1TA 4AYWA 4DLAA 4E5VA 1XYVA 1G63A 3YASA 1GTSA 2GILA 5CX1A 2JAXA 2QJFA 2H06A 1EXVA 1QK3A 4PLHA 2NVUA 1RWOA 1ZU4A 3GN2A 5J23A 1B2RA 2O0LA 4GVPA 4B74A 2RBEA 3DXXA 4JP1A 4J2OA 2VJBA 3DBOB 5CA1F 4L9SA 2FZWA 5D3QA 2DHQA 3OFVA 4MKFA 1LFDB 5JD6A 3G85A 3G2OA 1IY2A 3F7NA 4HQ0A 1TF2A 3IV6A 2O3RA 4MV3A 4W63A 1QFMA 5EKUA 1ZM9A 4C89A 1TTTA 4FB5A 3BE6A 4LV8B 2COEA 3EAFA 3PZBA 5LL6P 4V2UA 4YRLA 3ORYA 2DT5A 2GAAA 1CR2A 1XXHE 1A2BA 1ZKMA 2G6TA 4ZKDA 1GR0A 3GU3A 2QBYB 1MAVA 3AKCA 1K7SN 4AMUA 3GVXA 1LX7A 3VYVA 2AB0A 1FQKA 1VGQA 1Y89A 2MSDB 4IH1A 4RPJA 3NIFB 1DNPA 2PEZA 2Z9CA 4OOEA 1BE8A 3ICPA 3RVLA 3D02A 2HFKA 2NZWA 2YXLA 1QE0A 3EXIB 1QVZA 4G5FA 4JENA 5FFFA 3VHRA 4CFYA 4F6RB 2CN1A 4KCGA 3NAMA 5A5VA 4XD2A 3R5SA 1XLTA 2NXJA 5JE8A 2B1RA 4LXQA 2A1IA 2LNDA 2OFFA 1WKCA 2ORED 1VL2A 3WBJA 1V1MA 3A1EA 4QX6A 2YBEA 5FL3A 4FN5A 3U26A 1GZDA 1NVMB 2W2XA 4PX2A 4D5GA 1COWD 2VHXA 1E1CA 2GMWA 5C46F 1SOAA 4C4PA 1X0VA 2Q2OA 4OY3A 4KBYA 1DRJA 4XVQA 4N18A 3ZGZA 4DCPA 2VDJA 4I8XA 3QY0A 2E0IA 5KCMA 5T7BA 1DP4A 1Q3HA 1XTZA 1V47A 5HTKA 2ZT7A 1G64A 1OE0A 4CF4A 3EGVA 1H4TA 1GKIA 3LCJA 1GRCA 2DWUA 2HLHA 4V0OA 2VAPA 2P77A 2X0EA 1R00A 3BWDD 1HYGA 1R3DA 1F8XA 1U5BA 2KWIA 2JK1A 1G16A 1M1YE 2QYSA 3COYA 3KXKA 3R2JA 1QYIA 4HD8A 4LRTB 3K09A 4JT8A 1ZH4A 1I7NA 3G49A 4UZFA 2CUZA 1X7HA 1WP9A 1CR6A 3IUNA 3EQ8A 1S1MA 1ZUD1 2JKYA 3IJ5A 3OEEA 5E6UB 4AG3A 4F12A 1KMNA 1H2BA 3HU3A 5HQ3A 2FWNA 3Q0IA 1KQPA 3QEAZ 4KIUA 1MGPA 4M1TA 3O8RA 3SE7A 1TJ5A 5BSGA 5DI3A 5KJ6A 3DSRA 2V8BA 3LDHA 3TEMA 3DTTA 4IVPA 5IUNC 5CNIA 2PA0A 1N2BA 4IHJF 4OA8A 2F7SA 1UBOS 1V3TA 4KXMA 1JHZA 2IYRA 4GFDA 4RPIA 1VE9A 5U1PA 5BVHB 4IVNA 5AOAA 1DIGA 5EQTA 5EHXA 1QWOA 3JQFA 3D9QX 1V5FA 1CR4A 3SK0A 1X80B 2GF2A 4PLZA 3I04A 3QKRA 3WR5A 4EB3A 4EM6A 3BFKA 1QF6A 1A96A 2WWRA 4L95C 2ZJ5A 3SFZA 1C81A 1U2DC 4MKGA 4RH1A 1XTIA 2RARA 2Z2IA 4FFDA 3CNLA 2ZROA 1C1DB 3EGXB 3G6WA 3HJRA 4FR5A 4J7CA 3WZMA 3ERCA 4YUXA 1JAIA 1P74A 1FSFA 1JDNA 4CZ2A 1J0EA 1IMJA 2QRHA 3ISTA 4ACAA 2WJPA 3SQMA 5BRAA 5KC9A 1GAQA 1GSIA 5FUYA 5KWSA 1RIIA 4ZYTA 2VYNA 3JYLA 3PE6A 4JJ6A 5EJEA 1QVWA 1Z63A 2W2NA 3GDGA 4EELA 1V8BA 4EVRA 1SVLA 4DLRA 1W9HA 4OXYA 1U2TA 4GBED 4Y1RB 3AL3A 3FPHA 4XFDA 2BGMA 1RW4A 3HKDA 2B4AA 3URMA 1DAGA 1CDDA 5BY2A 5JEDA 4GPIB 3PRJA 2D13A 2WAOA 3I5UA 1MIHA 3O93A 4QPNA 1AHIA 1SZDA 3HU2A 1U9IA 2F48A 5LBIA 5TDHA 3WMXA 4C7KA 3UFBA 1U4SA 1XG5A 1T0PA 4MWCA 2R1VB 3HCFA 1OAAA 1UP6A 1VBFA 1C3JA 4KWEA 4CUJA 4B6EA 3NTVA 4DWJA 5GGXA 4WT7A 3NWOA 4S04A 1JFLA 4QIHA 3A1UA 1TAQA 1KIFA 4OHUA 1X1TA 1TI7A 2ZE8A 3F7OA 3HP4A 2GNOA 2EGUA 5BSRA 1ZJ5A 2ZW9A 2C7PA 1QO0A 1DHTA 3NPAA 1C0PA 3KKZA 3SVTA 4LW8A 3LA8A 3UM9A 1R0RE 4EYGA 1WSWA 1P4SA 3FYUC 3MJCA 4MWOA 4G26A 1Z6PA 1AZWA 1Y48E 1DOHA 5KJCA 2J3MA 4GO1A 2OV4A 2HGSA 2EGHA 4HEA1 4JT2A 3DLAA 3P2OA 1N3BA 4J29A 1JLLA 5ERXA 5HXAA 3T4XA 4UNIA 4AN1A 4BZXA 1YZYA 1JXQA 1HQYE 3VZDA 3CMCO 3LBYA 2QJWA 3GRKA 2AFIA 5DTJA 3PFHA 2F55A 1GGKA 5AI8A 2C9MA 2QRQA 3BFXA 5DM1A 3GWZA 5CLJA 1POWA 5ALWA 1Q0TA 3D8HA 3OO0A 2OCXA 2W2QA 3RHSA 2JDIA 1OPRA 2R8OA 3GUZA 4I0WB 2JC3A 1V5IA 4N12A 2NP7A 1SUPA 3RJZA 4FI3F 4NL4H 4L0DA 2BDTA 2IYXA 3BXGA 4EDFA 4PTYA 4FUTA 3IHKA 3P0IA 4DMMA 4ENPA 4KG7A 5AVSA 3M0EA 3U6KA 1OI4A 1YR3A 3D4PA 3BK7A 3OZIA 1JWBB 3TQOA 1P80A 2B1GA 2QTWB 1II9A 3QJGA 4WXPA 4YCDA 5TXGA 2EQBA 3HZZA 1H2YA 1SXIA 2IPLA 1KDZA 1I9CA 1BD4A 1WCYA 1ESNA 2YYSA 5CP8A 2RK4A 2XAAA 5A6SB 2WZDA 3GCXA 1HGXA 3NI2A 3I09A 4MDYA 5F7JA 3E7DA 4GUAA 3VYTB 5B7GA 5JZBA 3I39X 2QMUA 3VH3A 2RGGA 3LL4A 2OTCA 1C8BA 3BL8A 2BTQB 2IPNA 4AP6A 3FFTA 1J9ZA 3HM2A 4R6WA 3KEOA 2FGJA 2POQX 3UHPA 2SKCA 4R2XA 3HCDA 4J07A 4CM9A 3OLWA 2B0CA 2F1IA 3DHYA 1MVNA 2WR8A 4RQTA 1FNNA 1N2XA 2R7MA 4O2BF 2W70A 4IOKA 3AYZB 2JFVA 1DBVO 3V8RA 3KAKA 2FF5A 1XZCA 1NVAA 3NVMB 2LPMA 1TADA 4FYKA 4TS9A 4EY4A 2Z2YA 4YV1A 3IUBA 4RIGA 3EWSA 2JIZD 1Q6ZA 1NW7A 1MN6A 1DIRA 3OLZA 4IFIA 2PX3A 3MSCA 3NVAA 3Q0TA 2O3QA 2XXAA 2P3OA 2G67A 5I4BA 3H97A 3ROMA 3WB9A 3KXLA 2HPVA 1FVHA 2R87A 3AR3A 1UBLS 2LKDA 2XE8A 3GLTA 2XMSA 5EXTA 3RFXA 2C5LA 4CM1A 4NEGA 2ZUBA 4Q3EA 5FOXA 4V1CA 4A23A 4II3A 2XUHA 1MX9A 3HB7A 3TOZA 1IVSA 2E3JA 4R8MA 3JASA 4BFZA 4D4HA 1PWXA 4D4LA 1XD2A 2BJWA 1ECBA 1TB4A 2DKOA 1IY1A 1FPMA 2OBLA 4O59O 4EUHA 2Q7XA 2IP4A 4YR7A 5JXGA 4X94A 5J63A 3A05A 2PKWA 4D42A 1PWYE 1GUDA 2G4VA 2NNWB 2Z98A 1E5TA 4G0MA 4R1LA 4YJ2F 3VR2A 1YXMA 1PDVA 3G68A 3QOYA 3H3JA 2O1XA 3IUPA 3NAQA 4FDMA 1U9YA 3WLNA 2Q45A 2P8JA 4G86A 1DKPA 1ZGHA 4OGLA 4HTAA 2IHBA 2O7RA 2XSZD 1KNQA 3BXEA 2HIMA 2I29A 4G0YA 4LX8A 2A5LA 4RMGA 2AEJA 1T4CA 4G01B 1QF9A 5I8ZA 3EXFA 4V2IA 2CWDA 3TTVA 2JRCA 3EMBA 1RRKA 4LHEA 3QF7A 1I3NA 4FM9A 2A0XA 3CRRA 3BXZA 1UMBB 2EJBA 5DO9A 1ZS9A 3RVMA 3KL4A 2IGTA 1SFRA 2UZ1B 4MUNA 4P4SB 4PLYA 3THRA 3ZE2B 3NYWA 3R8CA 1T2NA 4XIJA 3D43A 1JEQB 4JLDA 2VF7A 3QI2A 3W9SA 2HCFA 2I55A 2FPPB 3GJ7A 3ITKA 3O7WA 5DYWA 5H0IA 4D9MA 2ZRQA 5FWNA 3EXEA 2M6LA 4OAPA 1FLAA 1K5HA 1WW2A 3OZVA 1U5AA 3PEVA 3MYYA 1H3FA 4OSOA 4WLUA 5LLSA 5K0FA 2BFCB 1Y5IA 1TF5A 3IVAA 3D6AA 3QYJA 2UYGA 4G85A 1G3IA 2ZREA 4RJJA 2F67A 4DLVA 1NI4B 5DNVA 1B4DA 3GLUA 1NOIA 4LCEA 4KR6A 4MKZA 2X7JA 3EUFA 3GRPA 4D0LB 1B26A 1ORIA 2C07A 4QLBA 3SYMA 2WSBA 1KH3A 4B6PA 4YP9A 1RWNA 2J3DA 4C1BA 1D0SA 1RACA 2Y1DA 4LN1A 4PF1A 5JQGF 5A2GA 1N4AA 1KTVA 1T2AA 4KRFA 2QZ4A 3E22A 3NFYA 1IOVA 4IIJA 1GTRA 4P86A 2AOTB 2GDJA 3AR2A 4LSWA 4R05A 1PNOA 4EEXA 1EFCA 4URYR 3KJEA 4B09A 4D81A 2C2ZA 1VSBA 4WECA 1HG0A 3F74A 4WCDA 2C2XA 5AOCA 3K1JA 4E3WA 1CWUA 4IDEA 1SUWA 2YINC 2E4XA 1VCOA 5KTKA 1VRCA 3SF0A 3C6XA 3M8KA 3R5FA 5BYKA 2G4LA 3R6GA 1I6KA 4BVHA 1E6WA 2EJUA 3OZWA 2F1JA 1NJ6A 5AKEA 4PYOA 4TQAA 4M4SA 1EM8B 1E1RA 1GZ7A 1KU6A 1N2EA 3IT0A 4GXNA 2IITA 4LKRA 1DPFA 3ICEA 2PMWB 4IHAA 2QLTA 1RHJA 1QQBA 3PVCA 1TCCA 1Y1LA 4G37A 4XGNA 1E0JA 2Q3HA 1XLTC 4H7EA 5A04A 1H8EA 2PSEA 1JG3A 1VG1A 4WHMA 4COKA 1G3RA 3B3AA 3BS4A 1F1JA 2FWIA 3DAGA 2HT6A 4KBFA 3NONA 5LC1A 1JE1A 3GP3A 4C20A 1HK7A 4L9WA 2VP2A 2CB9A 3N8GA 4R2MA 3TD2A 2V6JA 2GXSA 3K70B 1ECFA 2X0RA 4XJSA 3NWEA 5K3BA 1NXXA 2VQFB 4HH4A 4CM6A 2ZSHA 2Q9UA 3LFTA 2J46A 2O4CA 3A1DA 1ISGA 3LW7A 1DKRA 2WVJA 3JQGA 3SQLA 4JOSA 4DN6A 3QVMA 4PZEA 5HJ5A 1HOXA 4HEQA 4M76B 1UMCB 1Z75A 2CK3D 1RDFA 4G23A 4XEUA 4BMDA 5HWSA 5TGZA 2ZOSA 1LRLA 3W8NA 2QGFA 1G7CA 1B1CA 2C9BA 4L85A 3C3CA 2Z30A 1OFTA 4V0QA 5LMCA 5HYVA 4RIHA 4EDHA 2EEPA 3WK5A 2IDZA 1RTKA 2QVBA 4BAZA 5KQLA 4OGWA 4DY6A 2OHJA 1TGVA 4BRWA 3EA4A 3HS3A 3UNXA 1Y6QA 2QD2A 3ESYA 1EK0A 3STUA 2ZJ2A 4EFKA 4P4NA 4JFAA 1TFRA 5K6TA 4H9GA 3KQHA 1Z45A 1HM5A 4Z5XA 5KINB 5LA6F 4A1FA 2HJGA 5BYAA 1Z38A 1XK6A 2IYUA 4OSPA 3RFTA 5LZ5A 1QTNA 1K7XB 3A28A 3RSGA 2KI5A 2NU6B 1VKJA 2C8JA 1WKVA 1K6IA 4QTZA 5KWEA 3BF7A 3KX2A 2XOKA 1OVMA 4L9AA 1E9AA 1Q7RA 5KAMA 1CF2O 2XMQA 3IKVA 4GMHA 3VH1A 3TEJA 2W4IA 4RTLA 3NDPA 5IFKA 2QR3A 4PLPA 3AZQA 1W1WA 3GB9A 1U0EA 4O4LF 4GDMA 4C6TA 4UMFA 4IJ6A 3PGMA 1WCIB 4CL3A 1XEXA 3HCAA 2AG1A 2NO5A 1Q1NA 3KSZO 5DM60 1FP2A 4DLTA 4YDHB 4KO8A 1L7PA 3LYLA 4MDFA 4CTNA 3GGOA 1F17A 4Y7CA 4Z99A 2LD4A 3PT5A 1RJFA 3G2IA 5AVKA 1Q77A 4UEQA 1YBHA 4JLMA 1HTBA 2RGXA 3OZBA 2ERYA 3I9MA 3U9SA 3TECE 3CRNA 1HORA 2AD1A 3T7AA 1K7CA 1JR3D 3MINB 2A30A 4B71A 4EBFA 5IJZA 1CDZA 4UUPA 2QAGC 3UCEA 1K8ZB 4QQFA 5CT5A 3UC5A 3WKDA 4EY5A 1I4OA 2OT3B 1ORHA 3MJ4A 1NIJA 2M6RA 5ECYA 5JH7A 1WHTB 4ON9A 4PSDA 3ZWYA 2O2ZA 1TL7C 2ECOA 4I1RA 4ZVNA 1JA0A 2IXTA 1NR1A 3JAMA 1YRQA 2O5CA 2HSWA 1Q14A 2J9FB 5IZCC 1S89A 4LHZA 2I80A 2V03A 3EQ7A 1J8QA 4QGAA 1YA6A 3IIMA 2Z04A 1FDTA 2C57A 4S0ZA 1AO0A 1KC3A 4G8CA 1XN4A 4QYXA 3OOWA 1DRWA 1DAMA 3D5QA 5K2OA 2YKGA 1KI6A 2YV1A 3E22B 3IVGA 4IIJB 4MCIA 4RLHA 3DNMA 1V6AA 5D51S 1HDCA 4QOHA 1L5OA 2BH9A 4QRIA 4F0JA 4NJOA 3LY5A 1X77A 3TRJA 2AR7A 1NWCA 3MTBA 4MVJF 4MIEA 4Q4JA 4TQUS 3U48A 3ANSA 2R8XA 2V6MA 3AY0A 4RPGA 3FNGA 1FJ2A 3BVPA 4H4EA 2AQHA 1NI4A 1OA1A 4GOLD 3GP8A 1AGRA 3OIWA 3IAM1 4AZ3B 4E2WA 2JFNA 4BE4A 1VE6A 2KHZA 2RGBA 3WQRA 1Y3HA 2EP8A 3RS3A 4G0PA 2EF1A 4GQBA 3NHRA 1XL0A 4PTLA 1QGOA 2XRMA 1FTNA 3EWNA 4PZ9A 4G8BA 3CG4A 2ZULA 4O2RA 2VRCD 1GU0A 2J3EA 2JGKA 3GMDA 5FPPA 1EVIA 5G1NA 3OZAA 2OK8A 4IVQA 2WQ7A 1HA3A 4GM0A 4ZN6A 1JHUA 5IW8A 4XQ9A 2PUCA 3G7NA 4P8RA 1QC5A 4Z49A 1UZNA 2YWBA 3PUVA 1CS4C 3R24A 2QDKA 3H2HA 3KNZA 1Z4LA 1KBOA 2Q27A 4DV3B 4DSOA 1P18A 2G8NA 2A9PA 3REQB 1QIEA 3MWYW 3IE0A 3M4ZA 1ZCFA 2J41A 3W9YA 1I2DA 4E5MA 1Q0SA 4ZGGA 1L4MA 1I1QB 3MMSA 3KB6A 2OHIA 4US2R 1EVQA 4EHJA 5K6AC 1QGZA 1XF9A 1XDZA 2Q62A 2CVPA 3C85A 2BMVA 2GCPA 4P36A 1A04A 3R0QA 1VE3A 5FPQA 4RPKA 3DC7A 1E2GA 3PGLA 3KWLA 3F4KA 3BDIA 3H5RA 4N0DA 1LTQA 5EHGA 1L4KA 1OU0A 3N6RA 1O97C 2QN3A 3EDOA 3SHTA 4L4XA 4NYMR 4WW0A 5AKLA 2CJYA 1FS5A 1YQDA 3IQWA 4ZV7A 5B58T 1J6UA 2IP2A 3WGIA 4IIVA 1R9NA 1T8UA 2IC5A 2ZIEA 4QT0A 4CMAA 4URXR 4GI3A 1UZAA 3SZMA 4FWIB 4R9RA 1C1XB 4K9SA 3ETEA 4RE6A 3DBHB 5CHYA 1U3VA 2HN9A 2PNFA 3GJQA 4WIAA 1KZ4A 1XJQA 4URVR 2PR2A 1IUOA 3HYTA 3BDAA 2VF5X 1F1BA 1WUYA 1XZLA 4DILA 4NDZA 1XTQA 2OE2A 1BXRB 1A1SA 1TO1E 4FDAA 1GITA 4B7XA 3GDHA 4M1MA 2WUWE 1GU1A 2GJ8A 3UAVA 1XDUA 1ZBQA 3CZQA 1NXQA 4J1SA 1TAGA 4WTOA 2A0WA 1K7YA 1RABA 3RDPA 3IT3A 2X40A 5BMVA 3IKLA 2IY7A 4FYVA 4KSCA 4RSGA 4YP6A 1ISJA 2AG0A 3W79A 3JR3A 4MMXB 4W5WA 1WVMA 5DGDA 5F9MA 3CXUA 3WSWA 2FWAA 4H3SA 4F84A 2OXTA 4K26A 2GK3A 2D5CA 3EFOA 1TRKA 3VMMA 3HSYA 2WPDA 3RTDA 5LP6C 4EW6A 4HNSA 3OLCX 1GLGA 4I6EA 4LHSA 4XIIA 1R9GA 4GIBA 5KYVA 5IFLA 2XZOA 2ORVA 2NAFA 1U1DA 2NVOA 3AIOA 4BMNA 2VS1A 2CFRA 4F71A 5GONB 3W5CA 1HURA 4F3CA 4LXUA 4EA9A 1GPUA 1YS2X 1NSFA 3OTWA 4XGKA 2Y4OA 1PD1A 3S5JA 5BSKA 2ZE5A 1Y8QA 1Y5NA 3L6DA 4ZVMA 5KDOA 1JLRA 1L7RA 3CVOA 1KAOA 1MJFA 4AZ3A 5EWLA 1OGYA 2XQFA 1Z08A 4WN9A 3IDAA 5CLLA 4DIBA 3QPUA 3FTNA 1N5OX 3L2OB 2B6HA 4L3OA 3WA7A 3L7OA 4V24A 2WV7A 3B51X 3PNVA 4CCYB 3K7EA 3FCXA 1EFDN 1SH7A 3QUSA 4J8PA 4ZEOA 2EJTA 1YSCA 1E9BA 2HCRA 2WWTA 4GLJA 4JP3A 1OWPA 1XTKA 4KUGA 1GPYA 1JTVA 1U3WA 5KMGA 1UBHS 2F8LA 3CTMA 3FI9A 2VRCA 2QTZA 2YJGA 3SX0A 4RZXA 3G8DA 3ROPA 5CT8A 2XZPA 1KE1A 4UMVA 3EEOA 1SIUA 1LVUA 1PUIA 1TKRA 1ZIDA 2PUVA 3N2GA 1ABEA 4DCCA 4X45A 1KPIA 2ZRMA 2C0QA 2OESA 1BMFA 3I2IA 5BUCA 3MMZA 1YDHA 1U3UA 3WMFA 1PU2A 3QLVC 1G5TA 3MAAC 5JPCA 1Q1GA 1DB3A 4TKUB 4E88A 2Q7OE 2CNBA 2JI7A 3GLFB 1Q0RA 3D31A 2NYAA 4M1ZA 5AKKA 3VOTA 1PK8A 1V35A 1BOFA 1E18A 1KF0A 2A0YA 5GOTA 4BV9A 4HNVA 3V5NA 1ZK4A 1VKOA 2FDXA 4B9EA 3MPOA 2Q4DA 5HA5A 3N6XA 2PMBA 4X6YA 4O5OA 4DJJA 2O9JA 3EF3A 2C7BA 4ZOEA 1TQDA 1KDOA 3KDAA 4J9UE 1I1HA 3CRMA 3FMIA 4OREX 3KU4A 3L4KA 2OM6A 2QAGB 2XJ9A 2AV6A 5SY6A 5FQNA 2VK8A 2JH3A 1DJQA 3KFVA 2ZUTA 1XU7A 2WTBA 4MEAA 2K5UA 1N1EA 4MJ3A 5LYYA 3WYBA 3ASZA 3N6VA 1WOYA 3N59A 2RGEA 2Z8YA 4ZARA 3FJYA 5I4IA 2RG1A 2A59A 2D2XA 2OILA 2SECE 5CNJA 4J0KA 3L49A 2AQ8A 4IQFA 4JBLA 5G02A 4Y2QA 1UBSB 2LCFA 1N6NA 1Y7HA 3VPAA 4CUZA 2D7DA 3PX2A 1NYTA 1ST2A 2OCAA 2YQZA 4MVJG 5FULA 1M6WA 2CBGA 1E4OA 4NE2A 2YWCA 4ZAVA 3VSDA 4WMLA 1NOJA 1SC4A 3I45A 4RK4A 3CNBA 3KHUA 3KZKA 4MAAA 2AG5A 5HF6A 3RUDA 4D45A 2WD7B 1VL5A 1C7ZA 2Y1OA 3ZLJA 5FA6A 1R8YA 1J25A 1EZ1A 1J8FA 3D8UA 4Y0VA 4UAJA 4ZJUA 3JQ9A 2MSNA 3MF4A 3CF0A 2B61A 3H8VA 1H9CA 3VDNB 5EHQA 5EJ7A 1GFSA 1U3GA 5F2OA 3K70D 3KPYA 4TSKA 2Q3DA 3OE7D 3HH8A 1E20A 4IM7A 3LTEA 4KGDA 4LBZA 4R1PA 4RH0A 4RKEA 3S2UA 1E1QD 4XWYA 1J8YF 1V3UA 3P9YA 4A2WA 1G0NA 1G3QA 1GQ2A 4TSRA 2FRDC 4OQXA 3G2KA 4QBKA 1E7YA 1LJ8A 3JATB 4WEQA 2HLDD 2WIJA 3V6LA 1N33B 4W5TA 1Z17A 4MW2A 1S3IA 4QTUB 4RLQA 4BN4A 4PNEA 3HWWA 4H7IA 4QYWA 2GZMA 3TLBA 3DZBA 4D80A 4NTZA 1ATZA 1DELA 2X9GA 2XHEA 4IG4A 4KN8A 3LKVA 3KCQA 3S28A 5HW0A 5CCBA 3CVWA 3GDFA 1EM6A 1QSGA 4H2DA 3G6KA 5DXAA 2VZ0A 3H1TA 4Q7LA 1EUDA 3R7FA 3SQDA 1QTIA 2A2ZA 3AC0A 4AVYA 4CI9A 4H0FA 4I4TA 5HRCA 2V59A 3L4SO 5ITZB 3EGDB 1CIVA 2R2GA 1O94C 3OPYI 5J43A 3QE3A 3RE1A 3D3KA 3EVDA 1FSSA 2XXJA 3N86A 3QITA 3LL7A 5KWVA 1TVEA 2ET6A 1RP7A 2HU7A 1K8YB 4Z4CA 5CDTA 2NYVA 3DNPA 5AW8A 2FMFA 3I5AA 2O6LA 3H6KA 1P0FA 4L28A 2IOFK 4JSYA 3PYLA 2IV7A 1QFSA 1F5NA 1KOGA 1RYBA 1L5WA 3L7KA 4DABA 3EY9A 4W7HA 3I4FA 3PUIA 2AX4A 3KVOA 4R8KA 3ZY6A 1SVSA 5CJPA 4BVEA 5K4HA 3K0EA 2WIFA 2H7CA 3H1AA 4EKIA 1CX9B 1QYDA 5HRAA 1QC5B 1Y0BA 3BWXA 4B0PA 4B35A 3E9ZA 5B2ZA 5BYBA 3T4EA 1JFRA 4HAIA 1LZKA 1U28C 1N0IA 1NVWQ 3W2GA 4HGQA 5CJJA 1MFPA 4WXHA 3C1TA 3H9UA 2OWDA 3MNFA 5KOYA 2Q4BA 2AFVA 2XNDA 1W4LA 3MTJA 3MWKA 2GTHA 1GG5A 2A5DA 4X84A 2VDMB 5U4QA 3LH5A 2VSQA 5LYJF 2PJRA 3H5WA 2I5PO 4HS4A 4WE3A 1W19A 1PJZA 2NQTA 2PKCA 3ZJTA 4MW1A 1MJ5A 3OE1A 5IKPA 1B0UA 1MW8X 3JWPA 1CUBA 1U5CA 3HADA 4WLNA 3IBSA 1XFDA 3H9BA 1H2RS 2HQSA 3NO4A 3V8PA 1A9TA 2OPBA 3ZK9A 5HIKA 1RCTE 3QU9A 3UGTA 4ND4A 4UVDA 5CXSA 4YMUA 1HE2A 1JG2A 4OO3A 1UODA 5J1SB 2ZUWA 4YDQA 4Q9HA 1OZGA 5FOTA 4DQDA 1TYDE 2MINA 2IIBA 2R7KA 3N0TA 1JEQA 2JFGA 3E3NA 5KNCD 4DR5B 1FDSA 2PS9A 2J5RA 3I8OA 4TV8B 5E9JA 5K7SA 1P1RA 5ELMA 4ROTA 4E03A 4HX5A 4BO4A 1B6TA 1H94A 2O2YA 13PKA 2FW6A 4LXGA 4YJHB 1VMEA 4G1VA 1MB2A 3H0CA 3OEYA 4U6NA 1S3SA 4DUYB 3CR7A 4NMMA 1CRPA 1JZTA 2JGMA 4A2CA 3OEWA 3HEAA 2CUTA 3KTOA 2ZB2A 4DQUA 4DDVA 2ZCUA 1NLYA 2YUIA 2GKSA 2ZYWX 3R7NA 4XQGA 3IAS1 4DQXA 1PJCA 1QRAA 3OY2A 2ISCA 2XDAA 4F6CA 5HJEA 2B34A 2O8DB 4M2LA 4OQQA 2BFDB 2CLLB 3AEKA 4UTVA 3CE9A 4XJVA 1MABB 1ZNYA 3R6TA 4IQ4A 5C8YB 4J7AA 4IWYA 3BGSA 4WL0A 4BO5A 4Q03A 2XQJA 3KQTA 5T4HA 4CN8A 1L7OA 2OZEA 4M7PA 4N5NA 3UUEA 4TYYA 3K5IA 1FUYB 3CW2A 1E0DA 3DZHA 2WB4A 4MW6A 5ALKA 3MRTA 4FYXA 2GPNA 1N5KA 1MT0A 1QAOA 4INZA 5CIQA 5F2KA 3BWYA 3VTAA 5LR6A 3FFBA 2FCAA 3OM8A 3KKEA 4YK7A 5E2AA 3T0GA 4KUHA 4FEYA 3UC9A 3LTNC 1KA9H 5K0BA 2QX6A 1U9IC 1W2HA 2HWXA 2WIBA 1OH5A 3BIXA 3IXMA 4RA9A 2W2LA 4MV8A 1QS0A 1JBQA 4RFVA 1EHCA 4CJXA 5IULC 2HA6A 2P2LA 1RHQA 2BFPA 4LXYA 1EWVA 2KB0A 3EZLA 3CLUD 2ONKA 3FYTA 3IEXA 1B42A 3C3EA 6REQB 3EG9A 4C4SA 1KJ9A 5HHTA 4NPCA 7REQA 5JU6A 2LZ0A 3ESRA 3HI4A 1NQUA 5GJBA 4UM9B 5ETJA 4IOLA 3QFRA 1E2JA 1JA9A 3KXPA 3EX7C 2NUAB 3I9V1 4IKOA 4E07A 2PZLA 4OFBA 2I76A 1HO3A 6ABPA 1O96B 2J3IA 5EMJA 1FYWA 3KR0A 4F91B 5HZKA 1SOWA 3PGXA 1JLLB 3BMQA 1DAOA 3TDKA 1M8FA 1YR6A 3WWOA 4HX2A 1D0IA 1T9BA 2QQEA 3DJFA 2PQ2A 2C98A 1JG1A 3OUTA 3EIOA 1ZN2A 2NSJA 3FLMA 2BL4A 3DOFA 1J8MF 3TNYA 1E6UA 3MUNA 3OOEA 1JSZA 1T2VA 2ZVJA 3IV7A 3TRDA 5ELLA 2FTKE 1YGYA 3GAAA 4HRYA 4RK1A 3LLVA 4IMPA 2ZE7A 2PU5A 5EFZA 3FUCA 5JAZA 1F6DA 1ARZA