5ICMA

17beta-hydroxysteroid dehydrogenase type 14 in complex with a non-steroidal inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
255
Chain Sequence
TRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 255
sequence length 267
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5icmA00
5GZ3A 2CNBA 1SAYA 3PWZA 4XZ3A 1BTOA 4BMSA 5COBA 1DO8A 1TB4A 3UUWA 3KYDA 1U2DA 5I9MA 5IZCA 1U28A 5L9AA 1BXKA 4OL9A 3LT1A 3GVHA 5DN9A 2W2LA 3QSGA 3WFIA 1T25A 3EMKA 5B4TA 2V6GA 5GZ6A 4RO0A 5G2OA 3F3SA 4LISA 4UVEA 2AXQA 3BMCA 4YCAA 3ETEA 3OQ1A 4I5GA 2ZCVA 2I9PA 4XDZA 1HDRA 4NZ9A 2FY8A 2OBYA 3K9QO 5EINA 3M1AA 3ANLA 5F5LA 5C7LO 4CMEA 3F5QA 1X1TA 1Z45A 4CLOA 1GL3A 3GN2A 2EG9A 4FJ2A 4RVDA 3VHRA 4DA9A 2ILTA 5DCUA 3JD3A 3VC7A 4RPLA 4BGIA 4E0BA 3TPCA 2ZKLA 4FGWA 4QQRA 1PGQA 4ND5A 4NPCA 3QVWA 2J6IA 3AOGA 3QWHA 4UUPA 1X7GA 3LU1A 1E77A 4TWRA 1B15A 1A9YA 1I01A 1ULUA 4UEJA 2PD4A 4CMIB 1NAHA 4TVBA 4CMGA 1MG5A 1YBVA 4MVJM 3JD1A 1DC4A 4GLOA 5KWEA 3DTYA 3DMYA 4XR9A 2IZ1A 3EZLA 4TKLA 1R4NB 4YR9A 3CUKA 4HADA 4LGVA 4JJGA 4RZIA 3AY6A 5JBIA 5LDGA 2H9IA 3WGHA 5DOZA 3B1JA 2HMSA 2DBRA 3DBRA 1C1XA 1ZXLA 1P77A 4ZICA 5EERA 4YAKA 4IQ8A 4E5NA 5ILOA 2V6FA 5ADHA 1I33A 1I2BA 5BR7A 5JAZA 1ISIA 2DU8A 4OYRA 4BNZA 1P1JA 4D0RA 2EJWA 3PIDA 1VPDA 4NR0A 4R4JA 4QO7A 3GGPA 1Q1NA 1BW9B 4CR6A 2YUTA 3LF1A 5U9CA 1YJQA 1O5IA 4JROA 4DMMA 4JIGA 4OO3A 3QRWA 1HLPA 1N1GA 2VOJA 3AJRA 3IL2A 1NTOA 2NTVA 2NUAA 1YO6A 1UP7A 2FR1A 4XIYA 1BXGA 3OICA 4ALMA 1U8FO 2IE0A 4YVFA 4RQTA 5L4LA 4CQMB 3E9NA 2GZ1A 3Q9NA 4K28A 2JHGA 4N18A 4O63O 3JQFA 3F9IA 3W8DA 5FFFA 5CG2A 4CM6A 3R1IA 1A5ZA 1MGOA 3QVOA 1PS0A 4FOOA 3OBBA 4ZRNA 3JQAB 3RD5A 4EW6A 2FWMX 1UP4A 3HB4X 4O6VA 1ADCA 2WMDA 3ASVA 4OHUA 1OFGA 1T2DA 2QHXA 4I5FA 4IS3A 3UW3A 4AJOA 2ZCUA 2CF5A 4WNIA 1VI2A 4FB5A 3DB2A 1YQXA 4MVJP 1N7GA 4IQGA 4J7XA 4ZQBA 5T8KC 1ISGA 2YFQA 4EJMA 4B3JA 3A28A 3OQBA 2IYPA 1NQTA 2LDXA 2QYSA 4TROA 2X0RA 3GK3A 4CV0A 1I3LA 1EFKA 2AEJA 2V7PA 3RUIA 3IP1A 4D3FA 3OHSX 4QT0A 3DZKA 2RH8A 1DIHA 3F4LA 1KVQA 1EEHA 4IDDA 2C0CA 2Y99A 4F6CA 1UH5A 2AMFA 5JSFA 2NLOA 5G0WA 1ENOA 3TZQA 4DUPA 4AJLA 1QMGA 1CERA 4CR7A 2B5WA 4BQPA 2HQ1A 1KEUA 1KVUA 2YQ5A 1ULSA 3E8XA 1YL6A 1ONNA 1O94A 1LLCA 3RI3A 1LEHA 1LQUA 2O3SA 2YW9A 3CINA 4YQZA 4R41A 4E4YA 3I4CA 2X9NA 4MKZA 3RASA 2PR2A 5IDYA 4BKPA 4ESOA 1NBOA 3F1LA 2P5YA 3RC7A 4A2CA 2PGJA 1YVEI 1I36A 3JD2A 3MJSA 4EI2A 2Y1EA 4IY1A 1N9GA 4ROSA 1B3BA 1GR0A 3JQBC 4D7AA 4FDAA 2G76A 4WPGA 1J6UA 3VH4A 3PGXA 2QG4A 2HK7A 3I9MA 3ON5A 4BNMA 4HXYA 4O59O 4BUCA 3FBGA 3GLQA 1R0KA 3AUAA 1VL6A 4TRRA 4UVHA 1T4BA 1QRRA 2PGDA 5ILGA 1ISJA 1UDCA 4JJIA 1HZJA 1B2LA 3EHEA 1DSSG 4H16A 1UXKA 4E2XA 3C7CB 1H2BA 1SB9A 3D4PA 4CLRA 3GC6A 4MKRA 5T57A 5TX7A 2X7HA 4KMSA 2AEFA 3VTZA 1R12A 3KRTA 1TA4A 4ZHSA 5A9SA 4CV3A 3GT0A 4QFCA 2OO5A 4YJFA 4BMNA 3UFXA 2NSDA 1YQGA 2VQ3A 3PWKA 2EP5A 4IDFA 4OH1A 2P68A 3MWEB 3HFSA 1HT0A 3C24A 3MTGA 5T67A 2QIOA 2VOEA 2DBVO 3LC2O 4JBIA 4IDBA 1U1IA 4J0FA 4CM5A 3SLGA 3DOJA 4IJWA 3I9NA 1GEEA 5CEJA 4A26A 1H93A 5JO0A 4D0SA 1UZMA 3BZUA 3EUWA 4OXKA 1X13A 1BG6A 3FTNA 5KVQA 4CQMD 3QVXA 1KC3A 4M8SA 3NTOA 1PGOA 3B6ZA 3SJUA 4URFA 3BHMA 3JQ7A 4LSWA 2O23A 5T8KA 5L95A 1M75A 1EUZA 3D0OA 1E5LA 3FCOA 3PYXA 3I52A 5I8ZA 1FMCA 2O3RA 5G4KA 3SVTA 5HTOA 3ZWVA 3WJ7A 1WLYA 2QQ5A 3GVPA 4K6FA 7ADHA 4XDYA 3JQAD 4UEKA 3ZZNA 1DRUA 1T2EA 3GDOA 5H81A 2WD8A 1B3RA 4QTZA 1IPFA 1K2WA 1WPQA 3EYWA 3BHIA 4IJVA 4AJ4A 4M86A 1G1AA 3DBHB 2Q99A 1LRLA 4P8RA 3EAGA 1DRWA 3GY0A 1MB4A 3OEWA 3WB9A 3ULKA 3ZWOA 3KSDO 4BMVA 2ZJ0A 3CKYA 4CM9A 4IPTA 2YV2A 1HETA 2F00A 5CDGA 1KOLA 3G1TA 3JQ9C 4N7RA 3SBOA 2NM0A 1VJ0A 3KLMX 2O3QA 2GF2A 2OFPA 1A7KA 4OAQA 3MTJA 4D46A 1E92A 3WYCA 2P9CA 4RPJA 2GUGA 3OJ0A 1ORRA 1ZEJA 3VVCA 2OZPA 1PTJA 2YQ4A 3JYLA 4IM7A 5TQVA 4E5KA 1VJTA 5JY6A 2Y67A 4DC1A 2R6JA 3W6ZA 1RYEA 2DTXA 3BMOB 1E3EA 1QYXA 2OGUA 4HWKA 2I3GA 3JQBA 1GZ4A 1H6DA 4TZKA 1L7EA 3SC6A 5KIAA 1V35A 1P44A 3HUDA 1M66A 4I1IA 2J8ZA 2RHCA 1HDCA 2P9EA 4PG8A 1HXHA 1M2WA 3S2GA 1HE3A 1Z7EA 3BTUA 4AJPA 1QORA 2RHRA 1LSSA 1NR1A 3F1KA 2CSUA 1KY5A 1PZFA 2CDAA 1QV7A 3HN2A 2GN8A 4O1MA 2EP7A 3PLRA 4RCVA 2GCGA 1YBMA 3K6JA 1GY8A 5DF1A 4UVDA 3RCBA 3W4KA 4X54A 1AXEA 2W8ZA 3QV1A 2IYOA 2VT2A 1YWGO 3KLPX 1ZH8A 4JP3A 3GMDA 2ZQYA 3CMCO 4PG4A 2BHLA 4RQUA 3LF2A 4R3WA 3UOGA 1E3SA 3QP9A 1HDZA 3AK4A 3C1OA 4K26A 4LK3A 3PHLA 1WWKA 4BO3A 3W4IA 1DRVA 3KYDB 4MVJA 2HMUA 2Q49A 3S2FA 3RIHA 1DB3A 3ZN2A 4KQWA 1ZMTA 2G1UA 1LX6A 3D5TA 4H3VA 5TRTA 3IS3A 4JNKA 3PYMA 3ZNQA 3LT0A 2PKQP 3ONDA 1AE1A 1TEHA 2PFGA 1N7HA 2IDZA 1U3TA 1E6UA 1WVGA 2JJYA 4R5MA 5A9RA 5IXYA 1JW9B 1N8KA 4CLEA 4M1QA 4CLOB 4JGBA 3OA0A 4XJTA 5JMWA 5KVCA 2GSDA 2EKQA 4F46A 1E5QA 3KTDA 4NDNE 3RVDA 3ANNA 2BH9A 4IUYA 4CPDA 2G17A 2NU8A 3GR6A 1YL5A 5GY7A 1F8GA 3MOGA 3A06A 2W98A 3PPIA 2X6TA 4CM7A 3H2SA 4Z3KA 1D8AA 2JFHA 2IODA 4QX6A 4XEHA 3LYLA 3GZ4A 1R66A 4WLVA 3WMWA 4CODB 4CV2A 4DPMA 2GDZA 3KV3O 1B7GO 4P4LA 4S1VA 3LC1O 4PLVA 1C0PA 1N5DA 4BOYA 4AJNA 4KTTE 3I9OA 1JU9A 2WDZA 4W7IA 3QWFA 5KKCA 4BNXA 5AYVA 1QYVA 2YFHA 2EGGA 5H82A 3ANMA 3RJ5A 2OP1A 3DBRB 5COQA 5DDIP 1C1XB 3AM5A 4OGWA 1P31A 3PJGA 4EEZA 4B79A 1IZ0A 3LVFO 4KTVE 3FRJA 2EKLA 3RC9A 1PJBA 3SX2A 5COAA 4AJEA 5HRUA 4J16A 3P19A 4HP8A 2GRAA 4Z9FA 2C7VA 3VKVA 4EDFA 1D3AA 3ZWPA 1XCBA 3I1JA 3ZI0A 5I9LA 4YAJA 4CLDA 4CQLA 4DVJA 4U7WA 1YBAA 3TFOA 4YJHA 3NGXA 4FFRA 1K89A 4NFSA 3ITKA 3FN4A 3SC4A 3X2FA 2EW2A 4E31A 5I7FA 4PIVA 1HLDA 4DWVA 2VRCD 1LRJA 2JD0A 3LK7A 3KXDA 1BXGB 5AXBA 4II2A 4FPXA 1LA2A 1Q0QA 5IN5A 2VWGA 1PJCA 3M2PA 5DNAA 3ZV4A 1SZJG 3RU7A 1GV1A 5AXCA 3ETDA 1PQPA 4L4SA 4JXKA 2GPTA 4J4TA 1MFPA 3BMNA 4CUKA 3H9JA 3PWSA 4HNHA 2XAAA 4C4OA 4R9RA 3E82A 4XGIA 5K6AA 3FNHA 4IIUA 4BGVA 4WASA 2EW8A 1LC3A 4J3FA 4WUVA 4CLXA 4DIFA 1BGVA 5CHEA 2WYUA 3H7AA 3E5MA 4BHTA 4DQUA 5C7OO 4R3NA 1UZLA 1GUZA 4NK4A 1Q7CA 4QFDA 1VSUA 1UXGA 4AVYA 1W8DA 1JWAB 4MPDA 2VWQA 4NHEA 1R37A 2NTNA 3DOOA 4WKGA 4U6SA 1LTHR 3ADOA 3VPSA 2G5CA 2BELA 4BNJA 1HE2A 4NJMA 2O50A 1ARZA 3NT5A 4Q39A 4IXTA 4UVGA 3WLFA 2ZB7A 3MJVA 5TF4A 4MVJG 1AN9A 3B70A 5JO9A 3ZU2A 1A4UA 3KYBA 2E82A 2PD6A 4NFYA 3VPHA 3LSYA 3WNQA 1DFIA 1U2GA 4MJLA 1K3TA 3KEOA 4FCCA 2H5LA 4PG7A 4R16A 4GL4A 1UUFA 1JTVA 4DIBA 2DT5A 5IFLA 1R0LA 4YT5A 3CZMA 1KVTA 3DZHA 2IZ0A 2BGMA 2Q1UA 2PLAA 1EUDA 3FTPA 1Y5MA 3IJRA 4WLOA 1HZZA 1TVEA 2CMDA 1EUCA 4HFNA 5TT1A 2D3TA 2AQ8A 4JBHA 4TRNA 1N9GB 1FDSA 1NX6A 1FDWA 3NTRA 1Z74A 2VUTA 3INGA 5B37A 4ZRMA 3EDMA 3ZHBA 4Z0TA 1UXJA 1R15A 1VRWA 1KEPA 4E5PA 5JCJA 2A94A 3AUTA 4JP2A 4KWHA 2AQKA 4XQEA 1SPXA 2FR8A 2YDYA 3HSKA 3N7UA 4J1QA 3VZQA 5A1TA 2Y1GA 1BXZA 1HTBA 3IIEA 2EWMA 3CZRA 1S7CA 2X86A 3V2HA 3JYQA 3HDQA 1GCOA 1ADFA 2RAFA 1U4OA 4IJKA 2O3TA 3ZV5A 3WFJA 4YRDA 3GH3A 5TNXA 3RC1A 2YZ7A 1JKFA 2PY6A 4BO2A 1CQIA 1YXMA 3NT4A 4OJNA 5THKA 1LRKA 3UICA 1P1FA 4D79A 3OECA 1W0CA 4Y67A 3WXBA 1KC1A 2I3AA 3HDJA 4YJFB 1WP4A 3P2OA 3ENKA 1J5PA 1T24A 1I3NA 2VHXA 3ITDA 5FI3A 2NQ8A 2VWPA 1EE2A 3GAZA 4PVDA 3RBXA 2Z5LA 3R3SA 2BKAA 3F5SA 2WTBA 3ZWNA 5TIIA 3QHAA 1IL0A 2PKQO 1EMDA 2DLDA 4J1SA 4L0QA 1F12A 1I5RA 2VYVA 1LI4A 4ZVVA 3DEYX 2D8AA 3O38A 4B3IA 2X9VA 3FPCA 4GKBA 1P1RA 2C54A 1U8XX 2FR0A 4MVJE 4NNJA 4TRMA 5I7EA 3HADA 4M54A 3T7EA 2FN7A 3DO5A 1E3WA 5DT9A 4UVIA 1HDXA 4JQCA 1M76A 3GOHA 1PL7A 3FR7A 1JLLA 1PSDA 3U4DA 1DBVO 4JLWA 3A9WA 3C1AA 2CVQA 4PGFA 3JQ7B 4YYZA 2HO5A 1A71A 5G4KB 3U3XA 2ZB4A 4FJ0A 1G6KA 2J3JA 1BWSA 1Z75A 2FOIA 4L8VA 2ET6A 4NBTA 4MIEA 2WE8A 3F4BA 2B35A 1SB8A 3MJTA 3DDNA 2JCYA 3OMLA 2C5AA 4KOAA 5T5QA 5IDWA 1IYZA 5KKAA 2I99A 3GNQA 4DLBA 3Q11A 2VHZA 5A04A 2DTDA 4OOEA 3L77A 3PHJA 4ALIA 3KETA 3LDHA 3UVEA 5EJ2A 3L07A 4NBVA 4RVHA 5BT9A 2H1SA 2B83A 4OKIA 4W7HA 4H15A 4A27A 4GMGA 3RC2A 1Y7TA 4YXFA 2O4CA 5BSFA 2HMWA 1ZIDA 4AG3A 5GZ1A 2D0IA 1EQUA 3AI1A 5CPBA 1XDWA 2HRBA 3B1FA 4HX5A 2VYNA 3GHYA 5TJ9A 2YDXA 1NNUA 2RIRA 3NJ4A 5B12A 4DYVA 3PJEA 3V1UA 2J3IA 9LDTA 2QRKA 3VPFA 1HE5A 1WXDA 4GVXA 3TJRA 2JAHA 2GZ3A 1YS4A 3NT2A 1V9LA 5CDTA 6LDHA 1O0SA 1GEGA 4NH4A 1T1SA 2G82A 4EUFA 2C59A 1T4DA 2WYWA 3C8MA 3P5SA 5A05A 1IZ9A 3U9LA 3RROA 4OSPA 3PTZA 1O89A 2UUOA 5ICMA 1E3LA 1ZBQA 4FFPA 1QLHA 4RZHA 2HLPA 3D4OA 2O4UX 3KUXA 1QYDA 4GX0A 3SJ7A 1HDYA 1AXGA 4IIVA 4BNNA 1P0CA 1NPDA 3RFTA 1D4FA 3LLSA 3HNPA 3O03A 4BB6A 2NV6A 3VH3A 3DOCA 4BO1A 1X7DA 3OH8A 5CDSA 1E0DA 5A03A 2PGLA 1CJCA 1UJMA 3D5QA 3OETA 1JAYA 3EY4A 1NQOA 1T2FA 3MOIA 5A4DA 2EIHA 2BFPA 1ZNQO 2OL4A 5BNFA 2CZCA 4YJGA 4FFOA 2DKNA 2Y1OA 1JWBB 4IXWA 4PN3A 2BRUA 4TSKA 3DHNA 2BFOA 5L4NA 5IXSA 3U4CA 1DPGA 5L7YA 4UAGA 3AY7A 3H4VA 3RQSA 3IKTA 1B8VA 2EJVA 2NWQA 4ZD6A 2HDHA 1PQWA 1ENZA 1JDJA 3K2EA 1B14A 2LDBA 3OSUA 4GI2A 3FNFA 1ZEMA 4E2YA 1GUFA 1GDHA 4L76A 4XCVA 4ALJA 1ONOA 1L1FA 4WNCA 3CSDA 5ICSA 5JY1A 5U4QA 2JCVA 4A7PA 2IRWA 1GAEO 1UDAA 1AUPA 6ADHA 4U0KA 3PFFA 4MOWA 1XEAA 5DCYA 1HDOA 2SCUA 4XQCA 3H5NA 2BF7A 3LZ6A 4B4VA 2Q45A 4U8GA 1DC3A 2GN6A 1DAOA 2QW8A 1TI7A 3TF5A 5DBFA 2Y0CA 3IKVA 5F1KA 1Q2XA 2E37A 2R00C 3U5TA 3CE6A 1IULA 4E5YA 2P91A 1E1LA 2JFGA 4OM8A 3VDRA 3UN1A 1KETA 5A5EA 3NYWA 4QECA 4CM9D 5FI5A 1E7MA 4K1LA 4YAEA 4J6FA 3U62A 4CQLB 4YJHB 4S3MA 3GHHA 1E6EA 1XHLA 1H5QA 2C2YA 2OOSA 4R69A 5KJCA 2B37A 4XGNA 2JKVA 4DLLA 1V3TA 5HM8A 2YV3A 2O7SA 2OHXA 4CM8B 5KOIA 4AJ2A 4CM4A 2VHWA 1ZKMA 5FWNA 1MC4A 3D3WA 3DZBA 3OA2A 4KUHA 1ZJZA 3WSVA 2XF8A 4AJ1A 3BMNB 4JJFA 4WEOA 2Y1DA 4IGEA 2EEZA 2GNAA 2Q2VA 2BGLA 1WZEA 2CUKA 3NDRA 1BDBA 4WOKA 1B8UA 4YBZA 4J7CA 3RBVA 2Y66A 3TWOA 3GVCA 1EQ2A 3QWBA 3LLVA 2E4AA 3DHEA 1UZNA 3KVOA 4IQ0A 2YHIA 3ZWYA 3GDFA 1FDUA 3KO8A 2VWHA 4A0SA 2J3KA 4J1NA 4RORA 1WAMA 1KEVA 1ZUD1 4WLEA 1BDMA 3QIVA 3PEFA 5JAMA 2AQHA 3LQFA 4NJMB 4XRGA 3CH6A 4OMUA 4Z9YA 2UUPA 3ABIA 1I8TA 3ETGA 4C7KA 4JCOA 3DFZA 5ER6A 1CRWG 3H3FA 4MVJD 2O2SA 1Z6ZA 2IEBA 3G49A 2Y1CA 4BO5A 4NFHA 2X22A 1U4SA 1ZSVA 4KDFA 1TT5A 3RUCA 3G0OA 1ISHA 4DXHA 1V3UA 4IDCA 4BNTA 4J1TA 2TMDA 1YQDA 4WLUA 4EJ0A 1LJ8A 1HL3A 3VH1A 3M6IA 3S8MA 5G4LA 1JQBA 2V6BA 2I65A 1SO8A 1EE9A 3NAQA 4U5QA 2ZYGA 4BV9A 1KBZA 4FD3A 4F6LA 4J7UA 3O8QA 1LDMA 2QZ9A 3W4JA 3DBVO 3RUAA 1LQTA 1AGNA 3K96A 1X15A 1Y5RA 2R00A 1B26A 4ZU3A 1GQYA 5L7TA 2NADA 4IJUA 2FMUA 2P2SA 4RGBA 2QRJA 4IMPA 4J91A 1EDZA 1GCUA 4J9VA 1SEPA 1KIFA 2DFVA 2X8LA 4OXYA 1NFRA 2PZKA 5A3JA 2XXBA 3N74A 4ZGWA 1ISFA 5KJ1A 1NWHA 2HCTA 1C14A 4AJIA 5AXDA 5MGBA 4LVUA 1C0LA 3JQCA 3UAGA 1A72A 3PDJA 4Z6KA 4W9NC 3IMFA 4ND2A 4FN4A 1DLIA 1OZAA 4YTEA 1Z7BA 4W82A 2ZYAA 3D7LA 1DDOA 1P74A 2DM6A 3GG9A 1NVTA 4L9RA 4WEQA 2X58A 3BTOA 2GLXA 4XIJA 4J2HA 3JYPA 1T1RA 3HE3A 1SC6A 4GPD1 4E33A 3H9EO 4NBRA 3BIOA 4ITUA 3WQQA 4LCEA 3RAJA 1O6ZA 1Z73A 1DFGA 2TMGA 3S2EA 2EERA 2WD7A 5BNIA 1E3WB 4UREA 4GBJA 2WEKA 3BTVA 3PDUA 1UR5A 1MX3A 2W4QA 1RPNA 2HRZA 3DONA 3UGKA 1V3VA 3DQPA 4DMLA 2PKRA 2IXBA 3GUCA 3WBBA 3GNSA 4YRBA 3I23A 5HBRA 1XU7A 1E7QA 2VT3A 1NM5A 3WBFA 4WK6A 3WNVA 4PRLA 1JKIA 4FFNA 2E6UX 1WDKA 3RUDA 1NPYA 1XR3A 4RF2A 3STHA 4A03A 5L4SA 1F0YA 4J2OA 4PRKA 4RDHA 3PXXA 4UUNA 4BV8A 2UVDA 3HWRA 5K6AC 4R01A 4ZQGA 5TLSA 2ZIZA 1LDEA 2NU9A 5FYDA 4JN6B 3PRJA 4RPKA 4IZHA 7MDHA 2HK8A 4LRSB 4YJDA 3RFVA 4OKNA 5KVSA 3OIFA 4AICA 3PHHA 4Y9DA 4UUOA 2JD2A 3H2ZA 2OBNA 1ADGA 4BO6A 3DFUA 1PJ3A 4YA6A 3OJFA 3DC2A 1A7AA 2RCYA 1Y9AA 3RKUA 3E03A 3V8BA 3VH2A 4IS2A 2Y05A 4RDIA 3UKOA 1RM5A 4GX1A 4M89A 3FNEA 3BA1A 3S1LA 5ENVA 4RVUA 4JK3A 4NI5A 2D5AA 2PTGA 4BO8A 2GGSA 4A10A 3L0DA 4MP6A 4Q3NA 1YB5A 4QEDA 2C2XA 3V1TC 5JDIC 1K0UA 2DPGA 5F21A 4DTIA 3DAGA 1C3VA 4RVGA 3ASUA 2CY0A 2OORA 3FF4A 3RBZA 4YT2A 1BVRA 5G0TA 4CL8A 3EVNA 3QQPA 5IG2A 4XGKA 3HJAA 4Q3BA 5KJEA 2AHRA 3ZGYA 5JCJD 4R68A 5BSHA 3IP3A 3PZBA 4W9NA 1MV8A 1PGNA 3ZV3A 1WMAA 2CDBA 1ISMA 4IDEA 4M55A 3R6DA 4D3DA 4RF3A 5HS4A 1W73A 4ALNA 3K30A 2NVWA 1UAGA 4NQZA 2Q1SA 1H0KA 4I9HA 3WMXA 3QVSA 1YL7A 3Q6IA 3H9QA 5JYEA 3BHJA 4EUHA 3VPXA 1B16A 5CP8A 2D2IA 9LDBA 1EFLA 3GGGA 5A9TA 4L73A 3Q2KA 2VHYA 2X4GA 1R0SA 1ZVMA 1P1IA 3FWZA 1WW8A 1LDBA 1Y8QA 4HFRA 5IJZA 4XB1A 1XIVA 3WLEA 4YJGB 1NHWA 5EQFA 4J43A 4OXNA 5EMHA 1NVMB 3K92A 1P3DA 2DC1A 1XYGA 1D1SA 4N5MA 5TT0A 1FJHA 3ZWAA 1QYWA 4NBUA 4I9NA 1O95A 1ONPA 2YYYA 3WS7A 3T4XA 4CM8A 3IQDB 3L4SO 4TVOA 5JFOA 2FRDA 2HU2A 2I6TA 1FDTA 4G2NA 1LU9A 4L4XA 1C1DA 2VUSA 2B4TO 1BMDA 1ZO8A 5EQDA 1PGJA 1HYEA 4YAIA 5J23A 2ZQZA 3GVXA 4CUZA 3WDSA 3AFMA 1I3KA 4CUJA 4INAA 4XD2A 1K6JA 1DXYA 3RSHA 2QRLA 4MIYA 1U3UA 3I4FA 3IUSA 2A9FA 3IJPA 2PH3A 5IAAA 3SXPA 2JAPA 3WOHA 2QX7A 1GPJA 1IE3A 2ZK7A 3DHYA 3H9GA 1I2CA 3HZZA 5JXWA 3OF2A 4XB2A 4BGUA 3VZRA 4P4NA 3JQDA 1KY4A 1YDWA 1QXSA 3GEDA 3Q3CA 5A3VA 5JNLA 4ZA2A 3NRCA 1PJQA 4R51A 1H9AA 1PZHA 5AXAA 2GN9A 2AG8A 2DPHA 3LT4A 2IZZA 2QZZA 3W8EA 5B1YA 1JA9A 1QSGA 2VUUA 1ZXBA 1GYRA 3K2BA 3P7MA 3NGLA 4TQGA 3ICCA 1PIWA 3W6UA 4E21A 1NWCA 4B8ZA 4PLZA 4WECA 2W2LD 4UEOA 4BNFA 1ZJYA 5JDIA 3VZSA 2VYND 4II3A 4CJXA 1GYPA 2Q2WA 1LDGA 3R0IA 3Q1LA 2VNSA 4HY3A 3WGTA 5JC1A 4CM4B 5CG1A 1QP8A 2DUWA 1QG6A 5JMPA 3BMQA 2HJRA 3EZYA 3D3WB 1O9BA 3WG9A 2RH4A 1XELA 2GD1O 4KUEA 4LCJA 4XRRA 2F1KA 3M1LA 4E6PA 2X0NA 3DL2A 4H7PA 2JFFA 4WCDA 3C3XA 2Q3EA 2I66A 4YEDA 2DQ4A 5CDYA 1F17A 5EN4A 1I0ZA 3ZNPA 1EZ4A 1A4IA 3DBLA 1QKIA 2NACA 5JS6A 3E5RA 2I76A 4R1UA 3QWAA 2YHIB 2JD1A 3OP4A 4P22A 3PLNA 1D7OA 3I5MA 3H6KA 4TRJA 3RU9A 3GUYA 4B4WA 2OUIA 4XYBA 4PFJA 1EVYA 3U09A 3LC7O 3CTMA 2C5EA 2ZTLA 3WR5A 3QY9A 1BSVA 1RJWA 2Z95A 4FGSA 2NQTA 5LCXA 4NU5A 1YDEA 1PU2A 4GSKA 3V2UA 3RUHA 3DAFA 1RM3A 4HFMA 4XR4A 4DRYA 2ZJ1A 3CEAA 4TKMA 2ZB3A 1C0IA 3PIIA 1MP0A 1TT5B 4IDAA 2C29D 1GFSA 4GGPA 1XQ1A 3JQ8B 4JBGA 3HHPA 1UP6A 2NU7A 2V6MA 3WQRA 3WIEA 2Z1NA 5JW6A 4EEXA 1CDOA 1PS8A 3A4VA 3AM4A 4RF5A 5G0UA 1Q7GA 2BFAA 1U5AA 3E9QA 2C7GA 1M67A 3TZKA 1Y9EA 2DVMA 1I30A 3CMMA 1HSZA 1ML3A 2P5UA 1CF2O 1HWYA 3OJLA 4BNIA 3RFXA 4BNHA 3I9KA 4W6ZA 4E12A 1Q0HA 3WYBA 4EYEA 2FP4A 3O8QB 5THQA 1QR6A 1TXGA 3UCEA 3ZDFA 1PS9A 3KEQA 1YH3A 2WM3A 1IB6A 3UF0A 2DBZA 3L9WA 1E1KA 1Q0LA 4ZJUA 3ZW8A 3LT2A 5TS3A 2X1HA 1H9BA 1KVRA 5EPOA 4J4HA 1HYGA 4DPKA 2OP0A 2J5KA 5DOVA 1P33A 3GNTA 3OEYA 4UUMA 5JCXA 4FFLA 3EK2A 4IDGA 2J5QA 1NP3A 2CFCA 3G17A 4I9UA 4R5HA 5A06A 1UXHA 1LBEA 1ZFNA 3HB5X 1GZ3A 2E49A 3ZWWA 3JQ6A 4BO4A 3D3EA 2RBEA 4CMJA 5ER9A 4D44A 2P9GA 1I32A 5BSGA 5C5IA 4PVCA 1E3JA 4HNGA 4IMRA 5BSEA 4W4TA 1IOLA 1GTMA 3Q2IA 4BKQA 4LMPA 4MVJH 1X1EA 2NVUA 2AG5A 2B5VA 2YV1A 5JPIA 5BQFA 4DBVO 4FW8A 3HFGA 2PD3A 3GZNA 1LUAA 4B7CA 3GEGA 3TOXA 3QJ5A 3NJ8A 4CLHA 3BYZA 3QWIA 2JCXA 5CEFA 4NMHA 1E6WA 4NJOA 2HKIA 4TMFA 3GDGA 4F3YA 2VN8A 2R2GA 4BNYA 3F46A 1JKJA 1KS9A 1EK6A 1OC2A 2WD7B 3WIDA 2GASA 2BLLA 1ZK0A 2NU6A 3TFQA 4MKXA 3ROPA 3FSRA 1EBFA 1ZK4A 4Z0PA 4YPOA 1H6BA 2WE7A 3GRKA 4DLAA 4OOFA 1HSOA 2BFMA 1DOHA 3CXRA 1JAXA 5DCWA 3RKRA 2HMVA 3U0BA 1A27A 3E9MA 1TLTA 4L74A 3DAPA 3JD4A 4KP7A 4ID9A 1WZIA 4NBWA 2O48X 2CF6A 3PQDA 1NR7A 5KJFA 4CMBA 4HV4A 3G3EA 2X5OA 4B8WA 4WE3A 4WCFB 3ZHZA 4CL3A 3QW2A 4Q3CA 3RWBA 4IINA 4B7XA 3MZ0A 1V6AA 4XYLA 2DTEA 4NK5A 4WLNA 2A4KA 1I2ZA 4R1NA 1VKNA 3WTBA 5L53A 3VDQA 4A5OA 4WOJA 1MXFA 4RLSA 1Y8RA 2VTEA 2QYTA 5HWSA 1E7SA 2W90A 5DP1A 5FEUA 4P38A 3FR8A 3TOZA 1GPDG 3FWNA 4E5MA 2D4AA 3K8ZA 4RLHA 2Z1MA 3O26A 2POQX 4O5OA 2X0IA 2D59A 1S6YA 2PZLA 2X0JA 4RV9A 3IOYA 5EIOA 5F3RA 3WGYA 3PJDA 4BS9A 4D42A 1SOVA 4DQXA 3K31A 3NTQA 4AL4A 3JCZA 3TSCA 2Y0EA 4BKUA 4Y98A 4BO0A 5IDQA 4BO9A 3ZWBA 2ZTMA 4XYMA 1LDNA 3ADPA 2VNAA 2X23A 3INRA 1DIBA 3AW9A 1NYTA 3L6EA 1TT7A 1N1EA 3NUGA 4GAEA 1VM6A 3ZNNA 4AFNA 8LDHA 1ZSYA 1HRDA 1K5HA 3HQ4O 1HKUA 4RL6A 3NEPX 3TZCA 4XYGA 1ENPA 1PR9A 3TN7A 4UULA 3DXFA 5JAQA 1F14A 4GVLA 3H65A 2IXAA 1U7HA 4HKTA 2UDPA 3KBOA 2ZTUA 4F45A 5AOVA 1DLJA 4DIOA 1BHSA 3KB6A 1GQQA 1LLQA 2DFDA 2I67A 2GERA 1GQ2A 1A9ZA 1I24A 1U9JA 3ENNA 4PZEA 5IF3A 1VSVA 5LC1A 3B20A 4WGGA 5DBGA 4M87A 1PGPA 3WSWA 4B4OA 4D41A 3H9UA 1LLDA 4CR8A 1DIAA 1H6CA 2C07A 2AEMA 5F1PA 3L6OO 3ZV6A 1V8BA 1M6HA 3GPIA 1Y8QB 1T2CA 3L4BC 3I6QA 3D64A 2V65A 2ZTVA 3ZWCA 5L7WA 1KYQA 1OBFO 1PX0A 3QLJA 5TSDA 2BMAA 3FNGA 1XQ6A 2AQIA 3IUPA 2WWRA 3E1KA 4YDRA 2UV8A 4MVJF 2BI8A 4G5HA 1UDBA 1J4AA 4Q9NA 1C1DB 3JQEA 5DBIA 1DJNA 3AM3A 4J0EA 2D1YA 1OOEA 2FSSA 3HG7A 5T64A 1J0XO 5B4UA 1PZEA 3AY3A 3VOSA 1W6UA 2GN4A 4EZBA 1JN0A 5C7IO 5I7VA 5KNLA 1ADBA 4Q3DA 1GYQA 2FHSA 4CMAA 4OQYA 1NQ5A 3R3JA 2C82A 3VKUA 4BKRA 5ITVA 4FC6A 1VLLA 2FPIA 5H83A 3UCFA 2WSBA 2AW5A 1FXSA 3G79A 4LN1A 4OQZA 1P1KA 2VZ9A 2XXJA 1NQAO 3DZIA 3I83A 4BO7A 2Q1TA 3NV9A 3OQ6A 4KZPA 3GVIA 3JTMA 4MP8A 2GZ2A 1DJQA 4Y8VA 1YE3A 3JQGB 3MCVA 3A14A 4PZDA 4GGOA 1VL8A 2OMEA 3GRPA 3IDSA 3PHIA 3V2GA 2FSVA 5B4VA 1PJSA 3Q0EA 3IC5A 3AU8A 3ZNOA 4WCFC 3G1UA 4E2WA 3QA9A 1RM0A 1JVBA 4ND1A 3QE3A 4I08A 3JQ8A 3S55A 3UCXA 5G0VA 4EJ6A 2W2KA 1K6XA 3PHGA 3HN7A 1LSUA 1P9LA 3BMQB 1LSOA 2B69A 4LW8A 1PJLA 3MJCA 1BRMA 4PLYA 2UYYA 4AJKA 1ZK2A 4CMKA 3ZU5A 1PL6A 4KUGA 1PZGA 2O7QA 3H3JA 1YKFA 2FPPA 4I8XA 4ND4A 4YQYA 2ZB8A 3DBLB 1E7WA 3CPSA 4DQVA 2HK9A 3WWZA 1GU7A 3O4RA 1Y6JA 3MJEA 5AQ1A 3ZWMA 3JD0A 1WDMA 1Q7BA 5AVOA 3GPDG 3N58A 5T6BA 4BNGA 3ONEA 1RKXA 1YJ8A 3KHUA 3TL3A 3TL2A 3KYCA 1QYCA 3WGGA 5CAEA 4BNVA 2HJSA 4BL5A 3L4BA 1I10A 2PV7A 3C7DB 3RJ9A 3AFNA 2YY7A 5CDUA 1VC2A 1EVZA 5A5FA 2DAPA 3HDHA 3PJFA 3VPGA 4DL9A 1P45A 3VTFA 4DC0A 3DZJA 3DR3A 1DHTA 5MDHA 3TDKA 1CEQA 4AJHA 1UXIA 1E1MA 1GD1O 2EXXA 2H63A 4J4BA 1NFFA 3FI9A 4BIIA 4RJTA 1MG0A 4A73A 3OJOA 2HMTA 4C7JA 1QV6A 5KVVA 1R4MA 4KWIA 5TJHA 4WLFA 1IHXA 1VL0A 4GSLA 4KQXA 1FF9A 4Q3EA 3K5PA 1EBUA 1R16A 3ST7A 1CQJA 3V1YA 1R6DA 4HBGA 1DEHA 3ONFA 5L45A 3BAZA 3GEMA 4DREA 4EBFA 3V5NA 2BD0A 1XGKA 3RUEA 1H6AA 4GWGA 4BNLA 5C37A 4E3ZA 1CETA 2Y68A 4MVJI 3ZU4A 4DGSA 4LSMA 1X7HA 5KTKA 1YOVB 4YWJA 1VJ1A 5IDXA 5EESA 2FZEA 3AI2A 4MIOA 1VE9A 5DZSA 2X9GA 1ZMOA 3GA0A 2CDCA 2FZWA 3JV7A 4CM1A 1F8FA 2DBQA 3E6AA 1SOWA 4WCFA 1DFHA 1B8PA 2VHVA 4XQ9A 3MJ4A 3JSAA 1I3MA 3IAHA 5JE8A 3PK0A 2HAEA 2NVUB 3UHAA 4Y6RA 5L51A 3C7AA 3WJAA 1U7TA 1RM4A 1Y81A 4ALLA 2EHDA 4FOSA 2CVOA 3B1KA 1E1NA 3GZNB 3UXYA 4NIMA 3WGZA 2CVZA 5JDCC 3MEQA 3NX4A 3TZ6A 5I9NA 4CMIA 1V0JA 4FIZA 1ZW1A 2PZMA 1SNYA 3ZHYA 1FDVA 3X2EA 4XYEA 3KM0A 4PZCA 3HDYA 4FSHA 1EVIA 1R4NA 2PH5A 4ILKA 2VTDA 1QLJA 2C20A 4J90A 2EGHA 2GYYA 5DP2A 3WWYA 3I3OA 3GFBA 5JLAA 4FQ8A 4E32A 1DAPA 4PLGA 1AHIA 3DMTC 2YHUA 2BI7A 3O9ZA 4MP3A 5U1PA 1MLDA 4FBGA 4PLCA 4XX0A 8ADHA 1DHRA 1PEDA 1GV0A 3U4IA 4PLFA 3KOUA 4B4UA 2O3UA 3BMCB 1PR3A 4J49A 4L4RA 1FK8A 4QO8A 2A92A 4FS3A 1M6WA 1SEVA 2A35A 3E48A 3PQFA 1Y1PA 3VAZA 3D4NA 3ZCXA 3EW7A 1BW9A 2P4QA 2Q2QA 3OFSA 1U5CA 4N5LA 1LNQA 4CMCA 1X14A 4ZQFA 3DZFA 3TQHA 4QSMA 2Y93A 3AU9A 3AOEC 1SCUA 1P1HA 4N54A 1P0FA 3EVTA 2H6EA 4FJ1A 4HUJA 2WYVA 3AUUA 2Y0DA 1N92A 2FPGA 1U3WA 5F1OA 1Y8RB 4GQAA 4CQMA 1U3VA 3PYLA 4DYDA 5I7SA 3WGQA 1KERA 5HS6A 4BNWA 3S2IA 1OI7A 1T2AA 3P2YA 3PZRA 2YJZA 4DBZA 1CWUA 1XA0A 4GWKA 4XWYA 4LVCA 3JQAA 3EGOA 2E48A 4B7UA 1YGYA 4GLLA 3JQ9A 2B4RO 4W99A 5DULA 2JHFA 1UAYA 1MUUA 4BVAA 4YRAA 1DC6A 1OAAA 2J5RA 3DZGA 3Q9UA 3ZH2A 5JYDA 1ZCJA 4XJSA 5K9ZA 2JL1A 1VKOA 1E7RA 2VYVD 4IGFA 2VZ8A 3KSUA 5TC4A 4E2ZA 1D1TA 3JYOA 1PQUA 3K73O 1CYDA 1MXHA 1ZK1A 1CIVA 2NVBA 3A1NA 4FR5A 1RWBA 4N5NA 3D1LA 4YB8A 4PLTA 3INTA 3WTCA 1C0KA 2Q4EA 3KZVA 4O0LA 4DPLA 1BVUA 2I5PO 4CM3A 2Y1FA 1X0XA 3WX0A 3VZPA 5BNTA 3WQSB 1RYDA 3M2TA 1EK5A 1EVJA 4ND3A 1PL8A 3AI3A 4BKOA 4OIMA 2AE1A 2EV9A 4LRTB 2DUUA 3RUFA 1NXQA 3FD8A 4BB5A 1LC0A 3UH1A 1W4ZA 2OXIA 4BNKA 3NDJA 1KEWA 5JDCA 1WDLA 3H8VA 2PWZA 4TZTA 3GMSA 4PLPA 1XSEA 2AA3A 2HSDA 5GMOA 3ZW9A 1NPTO 4IBOA 2AE2A 4I5EA 3C1TA 2NNLD 1YRLA 1MC5A 4ZQHA 1HEUA 2Q46A 3OIGA 3FPLA 3I9LA 3GAFA 4G65A 4J9UE 3OM9A 4FC7A 2J3HA 4D43A 3JQGA 4ZQEA 3F6YA 5L40A 5ENDA 3DMTA 4Z3DA 5CEEA 4GX2A 3T4EA 1IY8A 2HUNA 4MDHA 4L75A 2P4HX 1PWZA 5FF9A 4GX5A 1HYHA 4ALKA 4YACA 4GKVA 4Z0HO 5G0SA 1IHYA 3FHLA 3AUSA 1XLTA 1ZK3A 1F06A 3BXXA 4R9SA 3SLKA 3TRIA 5IZ4A 4E30A 5CPFA 3GGOA 4Y6SA 2D5CA 1H94A 3I6IA 4XKJA 1J49A 1KVSA 5TGDA 1GZ6A 5ES3A 3OJEA 2PK3A 3DWFA 4R1TA 1HDGO 4QUKA 3KSZO 3AOEA 5IN4A 1HE4A 3SEFA 1PJ4A 2ZYDA 3W8FA 4RPHA 4G81A 1ENYA 4K9DA 3ROQA 3ZHXA 5A02A 1DC5A 4RVSA 5IZCC 4YT4A 1X0VA 4QXMA 1NHGA 3FBTA 3PI7A 3JYNA 5L3ZA 2NTJA 3ICPA 3L9XA 4XA8A 4AJJA 4Q3AA 2O2YA 4Y6PA 1ZZEA 4D3SA 3WGIA 1NAIA 4GH5A 3GG2A 3H5AA 2IEDA 2BGKA 2VZ0A 2WJPA 3BTSA 3EC7A 1GUYA 3GF4A 3GFGA 1NVGA 4I5DA 2UAGA 3E18A 5KJ6A 4CMEC 2XOXA 2X5KO 3PQEA 1H2HA 4R54A 3C85A 2B0JA 4PCVA 1OC4A 1LLUA 1XWFA 2Q1WA 4OSOA 4D45A 4RVFA 1G0NA 1YONA 1NASA 2EKPA 4PG5A 3VVBA 1DIGA 4WJZA 1LXCA 1MFZA 1SBYA 1Z82A 3CIFA 4IZIA 2W2KB 4R1SA 2VCYA 2VRBA 3NKLA 3WGOA 4CLRB 4KDEA 2B36A 1ZSNA 1PJTA 3DBHA 4RF4A 4HFJA 5I8WA 1AHHA 1WNTA 1E3IA 3U4HA 3WICA 5A9SB 4EITA 4B3HA 1XKQA 3COSA 3ZWXA 5JAIA 1B0AA 5JC8A 4ZN6A 4P4GA 1G0OA 2X5JO 1EDOA 5KCZA 3ROKA 3TZHA 4U0JA 4NU6A 3PP8A 2O3JA 4EUEA 4YT8A 3PGJA 4XQGA 1DIRA 1MA0A 4K6CA 2PZJA 4NG5A 5K0ZA 4PG6A 3QVTA 5ITWA 1XG5A 2GO1A 1HF3A 3ORFA 2VRCA 1E7YA 1YB4A 1YOVA 1XU9A 1LSJA 1T26A 3BMOA 4CMHA 3AWDA 3KYCB 1IUKA 1K6IA 3NDIA 4FFMA 5F5NA 4JX8A 3DTTA 1L7DA 3PVZA 1LDYA 3OIDA 4EGFA 5CFZA 4BNUA 4YAGA 3ZU3A 1JVSA 1O8CA 5HA5A 2PNFA 2Q4BA 3L6DA 3T7CA 3ROMA 2XPCA 4ONEA 4Z9XA 1PJ2A 3PFWO 2EF1A 1ID1A 4BGEA 1OMOA 3H5RA 4LMRA 2GR9A 4PLWA 2ZATA 4MINA 2B4QA 2CD9A 4MO2A 2PA3A 2Q50A 3WYEA 1YB1A 3GN1A 4M49A 2G0TA 3F47A 1SMKA 1PWXA 5EL0A 3U49A 1WMBA 5C3MA 1IPEA 3JQFC 4GMFA 3TNLA 3I9JA 1GADO 4BQRA 4CV1A 1NFQA 4RPGA 4U6QA 3W1VA 1R4MB 4E13A 3MWDB 5LDHA 3GQVA 1N2SA 4PLHA
chains in the Genus database with same CATH superfamily
2RAVA 3G23A 2CNBA 1SAYA 4MK4A 4EYSA 5BV0A 1BE1A 1U2RA 1XZGA 4BMPB 3HCFA 4E1VA 2G25A 2UUAB 2N75A 2RB4A 2CUTA 3UMYA 2JCBA 1RLJA 3PEVA 3ZXXA 3UUWA 1CNFA 4DWJA 1U2DA 4K3UA 4EUSA 1JT2A 4G86A 3GVHA 3UG6A 1R50A 4BNDA 1QGOA 2GBFA 3WRXC 2B2XA 3VU0A 2V7GA 2ID9A 1S8OA 2F3PA 5JD3A 2C9DA 1C9NA 1JZTA 5EWJB 3EMKA 3WFIA 5I7WA 2AFHB 2GF9A 5B4TA 2V6GA 1KARA 2LTAA 2CJFA 2AXQA 1BJRE 4YCAA 5HBGA 4HWSA 4I5GA 1U94A 1UPAA 4HN2A 1FW6A 2A0KA 1BWQA 3PCRB 1EDEA 1E60A 1L9XA 5KKNB 4OYLA 1ZH2A 3HM2A 3RVOA 1D2RA 3WGJA 1JB9A 5C7LO 3F8TA 4ZMSA 3DCJA 1E62A 1G8YA 1HBJA 1GLGA 2GYWA 3EOZA 3PPWA 4ZT2A 3N6VA 4KOEC 3GN2A 1QO9A 3H99A 4I4TB 3SF0A 2EG9A 4RVDA 2ZXFA 3VHRA 5I6DA 2WABA 2QG9A 4BGIA 5HF6A 3AYXB 3CG4A 3EX7C 3E5HA 1PT7A 4FGWA 1A7JA 3LY5A 3H8WA 4QQRA 5C3UA 4OQPA 2WVJA 3EQZA 4KN9S 4UUPA 2PRYA 5H3LA 4IIEA 4QDJA 5ALVA 5FJIA 5IKPA 2WPDD 4BLTA 3SHOA 4QDOA 5E6RA 3WQBA 1B15A 4B83A 4WINA 1GDDA 1Z2OX 3EAQA 3MNFA 3QF4B 4UEJA 2FPXA 1CLEA 2CHVA 4AWXA 4CMGA 1KZGB 2F1IA 1FCJA 3IUNA 4MVJM 2BOVA 4JNCA 2VPQA 5A6SA 1HEYA 2Z2JA 4OA5A 5DM1A 3R9WA 1THZA 4HNAA 3THRA 4A8HA 2WTAA 1EHIA 3DTYA 2HO4A 2Z9BA 3HPQA 1R4NB 4GI3A 4IF6A 1VE5A 4LGVA 4R2KA 5TE9A 4DANA 4YR9A 2C77A 4IHQA 3I2GA 5BY2A 2EGUA 3OOHA 1OWPA 1W96A 3MQFA 3WGHA 1R1DA 1QZZA 3B1JA 3EG9B 1O87A 5EAIA 1C1XA 1P77A 4FMCF 5EERA 2XT9A 1JHZA 3VR6H 3I2FA 3V4LA 4DXAA 3W5AA 3E3LA 4OLBA 1EVKA 2CB0A 2QT0A 3PVSA 4ZCPA 4ETWA 3ROFA 4TKVA 4AC9A 3BJEA 5H9VA 5ILOA 1VTKA 1BU5A 3A11A 4QDUA 2ZR0A 1I2BA 1B23P 5EA2A 2XGSA 1VCIA 1HLGA 1P1JA 2ZSDA 2EJWA 3D6TB 4ID3A 4FX5A 4NR0A 5B1DA 3T9FA 2PEYA 3OZSA 3DJYA 1JYSA 2HCFA 3S7ZA 4JJAA 1Q1NA 4Q37A 3IV6A 3U3OA 3GLIB 2CJWA 1U7XA 4Y2SA 3ZEIA 1AKYA 4OLHA 3UAZA 3LF1A 5HG0A 4HWRA 1TZJA 3IOEA 4GXQA 4V0ME 5KHOC 3AVVA 2WHEA 4TL6A 2JEYA 3S1SA 2WFLA 1K8QA 1QE3A 4AM8A 4OO3A 1TA9A 3UT6A 1HLPA 4FHGA 2V96A 4PQEA 1JQ5A 5LU8A 3IL2A 1NTOA 1QGYA 1Y7HA 5C4GB 3OICA 3M9WA 4K9SA 1YULA 4W1RA 4YV0A 4FVTA 2YMMA 4P36A 2YFYA 1N5JA 2QUJA 4CKBA 5CFNA 1M1YA 1MVLA 1OXVA 5JFGA 2FDCA 2B94A 1KZHA 2G04A 3CRQA 5AW5A 2A1TS 3FI0A 3U7JA 2WF5A 2IHKA 1WSBA 3NVDA 1FLNA 1QH8A 3HGQA 1MGOA 2YOGA 1YK0A 3P2KA 3F6CA 3OBBA 3QVOA 4QDXA 3T41A 2VXOA 3V4PB 2FWMX 1UP4A 3M82A 2VP2A 1ADCA 4O6VA 4Y2RA 2MYUA 1MVOA 3T1OA 5AVRA 1EHYA 1KJIA 2QHXA 4AULA 5AKYA 3B52X 3C6KA 1VI2A 3AETB 2IIBA 1H0HA 1N6KA 4IIYA 5AOCA 4FB5A 3OQNA 1TJ5A 4DUYB 1N7GA 1MTOA 2MINB 4IQGA 4KXFB 5IVIA 1KSHA 4ZQBA 3T5DA 3ZHQA 3TBKA 3ZHUA 4G1FA 1QJ4A 2NXEA 2R5FA 4EJMA 4RTKA 3AR5A 3WLJA 1JLKA 1VE6A 1ZNWA 4QOEA 4LRWA 4Z8XA 4G0VA 1TVMA 2G5PA 3AILA 3A3YA 4PE5B 2XCTB 1SA0B 1QYIA 3AJ9A 3I9V1 4JYMA 5EZ5A 3GK3A 4K0RA 4WNAA 1MKYA 3U3RA 1I3LA 3RUIA 4G9GA 4AXXA 4D3FA 3SK0A 3T3OA 4J07A 4QT0A 1IN5A 2EWWA 2RH8A 1NVDA 3U9SA 1EEHA 4DSOA 2Y99A 1J07A 4I3FA 4WMLA 5LLTA 5A2QA 1MO5A 5JSFA 5FOWA 3U3DA 2Y1LA 4NABA 2NLOA 5AHKA 4EI8A 1R0RE 2W2VA 4WBNA 1II9A 4TWBA 2OFXA 2ZYSA 3PTLA 1CERA 5D5QA 1FMLA 3AG6A 4DMGA 3AGQA 3LA8A 4C0LA 1YL6A 3Q6NA 1HOXA 2P2GA 1ONNA 2VPTA 3GLVA 4Y3UA 3S68A 1Y82A 2H9AA 4MYHA 1O94A 1LLCA 5AP9A 1LEHA 3RI3A 1B73A 2RGWA 5K3BA 421PA 4M98A 4HDAA 1IM2A 2AC7A 4MWSA 2X19A 4QOJA 1E89A 3UMFA 4BJ1A 4YQZA 3HKEB 2N1BA 1RZVA 5HF5A 4UXIA 4N76A 3HH8A 3W77A 4M0MA 5IDYA 2A0XA 4E08A 2EARA 5E4FA 3SR4A 1TCBA 2JGAA 3RC7A 4HRYA 3I01A 3JVDA 1L6IA 1YVEI 2PGJA 2GN1A 2V4MA 1I36A 3VKWA 3WNDA 3I32A 4LJKA 7YASA 1OX4A 2LPMA 4PQRA 4FDAA 2Z57A 3FTCA 4QLAA 6ABPA 2RARA 4WPGA 2YIJA 2VF8A 3EEQA 3GFPA 3PGXA 3MAGA 4FFDA 1X92A 4BNMA 3PGA1 4HXYA 5A2GA 5A4KA 3NBQA 4X20B 5JNVA 4XWKA 4M9XA 4TKZA 4D02A 1Y3FE 1T4BA 3KTOA 3BK2A 4ZRNA 3T3GA 4RK1A 1NT4A 2IU3A 4RHCA 4XW2A 1RWPA 3EHEA 1NP7A 4HI0E 3CZQA 4H16A 4IYJA 4X6XA 5DH9A 4UTRA 2QYHA 3L8GA 2FZ5A 5CB6A 3D4PA 4H7DA 3BXOA 3L4JA 1YKSA 2BISA 3TW8A 2OECA 1P9RA 3GC6A 1JTEA 5T57A 5TX7A 3BUSA 1R12A 2ZT5A 3KRTA 1TA4A 3OQIB 4KVFA 3SFZA 4ZHSA 1EZ1A 3L1UA 1PF7E 4PHTA 5SZHB 5A9SA 1KQGA 1GZVA 4QFCA 4KXQA 2QE6A 4KQJA 3T1HB 1EJBA 3ID6C 1OYWA 1EAYA 2EP5A 1XZQA 1SCIA 4IDFA 5KAPA 3BIJA 2ZW9A 4R40A 5T67A 5CB0A 5JADA 4G5SA 5AKKA 1J97A 4OXIA 4EELA 1YMUA 4J0FA 3FLBA 4G4IA 3BCRA 3DOJA 4ZOLB 1RE1A 2ODWA 4MMXB 5IT0A 2VQFB 1F48A 3I9NA 3USES 3CH4B 3OQMA 2RGDA 3ZX4A 2R6AA 3JARA 2WTXA 3R6TA 5CEJA 1XDZA 1NJ6A 1DKMA 1F2UB 2WBLC 4II7A 5JO0A 3HA7A 4D0SA 1PEKE 2Z43A 3BZUA 3EUWA 2IXDA 4JUFA 1SXJA 5CYGA 4MV7A 1ETUA 1NBWB 4HLNA 1M8GA 5REQA 1Q1QA 4TS4A 4CQJA 3QVXA 1N6NA 2PZBA 2VP0A 3GWZA 3OQHA 4R8LA 3NTOA 1CPYA 4QREA 5LNK6 3KDPA 3BHMA 5EHXA 2J5XA 2O23A 3IQHX 4LSWA 4XYLA 1DWOA 1LK7A 1E5LA 2WM9B 3PYXA 1HE1C 2J59A 2XEDA 3DHVA 3K0AA 5G4KA 4RA9B 3MTDA 4QGFA 2W6ZA 3GVPA 3WJ7A 1D5CA 2VJAA 4OHXA 4UEKA 5IDVA 2ZSAA 5EZ6B 5DPMA 4LHWA 4MUMA 4BUJA 2PUBA 1B3RA 1CUVA 1IPFA 1K2WA 3EZFA 4IJVA 3BHIA 4MRMA 3U7RA 4DCNA 4J0DA 4M86A 3LCCA 4JDUA 3G5TA 1KJNA 4TSFA 1R5NA 1PT9A 4P8RA 4YRPA 3EAGA 1XFAA 3W5IA 2IZOA 2WQZA 1MB4A 1NW7A 1Y3HA 3OEWA 2YMLA 3GOQA 3ULKA 2GTPA 4IDOA 4HAXA 4C3ZA 1RZRA 4WN3A 4WZAB 1C3JA 3EXEB 4XDGA 5CNIA 3A4LA 5CDGA 5T4EA 1MAAA 3JQ9C 1VJ0A 2NM0A 4TUYB 2GF2A 2OFPA 1LWNA 1WOMA 1GXSA 2AD5A 4PC7A 2AXPA 4OF4A 1H65A 3R8XA 1L3BA 3VU9A 1R8YA 2GUGA 3DXZA 5EWJA 3VYTB 3B12A 2VJNA 2AFHA 1W0KA 3BH7A 4QUHA 1TQ6A 2YQ4A 3SVLA 4IHJF 4X7BA 2J07A 5JJKA 2VUHB 4U9HS 1GQRA 1RYEA 3I72A 5AKJA 2GS9A 4CF6A 2OGUA 2R86A 2XCRB 1INLA 1GZ4A 3JQBA 5KIAA 4ZEXA 2R68A 1JUDA 1V35A 4JVMA 4BATA 3KQNA 2C0PA 1SIUA 2W2NA 3NOXA 1HDCA 2P9EA 2CV0A 3ZJVA 1WL8A 4Y1EA 1P8AA 2ST1A 1QORA 1AKTA 3RVBA 1FNMA 2RHRA 1USWA 1NR1A 1V1MA 3H1TA 2C3UA 1KAQA 1EUQA 2ZULA 2HV9A 3JAWB 1J1IA 2FLKA 2A5FA 3ZDYB 1Q3HA 4GPBA 2E6KA 1DDIA 1WZNA 2ODTX 3PLRA 2ASVA 2XCOA 5TQ2A 2GCGA 2H1CA 2HTEA 3I0ZA 4M9ZA 3EA4A 4YASA 1KYVA 1SD5A 3Q7TA 3GCGA 1YBMA 3DVAA 5DF1A 1RXYA 1SIOA 1Z0FA 4X54A 1AXEA 2W8ZA 3QV1A 5JOQA 1I51A 2IYOA 3DAYA 1A8HA 3QFCA 5FOVA 1YWGO 3BSSA 1S7GA 2HT6A 2QMQA 1ZQ9A 2ZQYA 4YMTA 2BHLA 4IKOA 2ISCA 4G5XA 2ZR7A 3IEUA 4X24A 5EVCA 2IOYA 4GT1A 3WAGA 1ADYA 2XTMA 4MB0A 3JRNA 1SZDA 1N3IA 1OIVA 2G9QA 3C1OA 4J2TA 3SDZA 1C4XA 3PHLA 4BO3A 2XDQB 1J0EA 1SXGA 2QXUA 3C6XA 4MVJA 4X91A 3IA7A 3ZN2A 2PMWB 3ABZA 3KLOA 2VCEA 2EU8A 3UT5B 3OQPA 4FYHA 5TRTA 1QTIA 1SZCA 3IS3A 2EFJA 5E3HA 1G8HA 3PYMA 4I1YA 2C4MA 4NCKA 4WZBB 3ONDA 4UAVA 4QAQA 4OREX 1TEHA 2ES4A 2GLUA 3OO0A 1HT3A 3MGAA 3RTGA 2F3QA 3QOXA 2JFVA 1Z6YA 4R5MA 3P2JA 3UJ8A 4CNQA 1XROA 5IXYA 2YICA 4HPXB 1PZXA 2PRKA 3CRRA 2P69A 2O2JA 1ESDA 2FB9A 1YR8A 2CNWA 1XTTA 2PKWA 3G2OA 4XJTA 3B3AA 1OHHD 1RRPA 5HFNA 3ZE2B 4F46A 2YYZA 4F97A 1WU8A 1EINA 2Q5CA 3KTDA 2QPLA 2QP3A 2HF2A 3RVDA 3IAM1 1RIFA 5DGIA 2IGTA 1RHKA 3IAXA 4DEVA 4CPDA 3WAKA 4PX5A 3A6GA 3E61A 1UC9A 1YL5A 4WRRA 3L7IA 5JANA 3ELWA 4JXXA 3HSSA 2WTEA 4CFYA 3PD0A 4Q4AA 4XCQA 3Q7EA 1D8AA 3RLFA 4QX6A 3BFVA 1JLMA 1HQKA 3GZ4A 5KYGA 2F62A 1QTRA 2HQBA 1K8RA 1JJ7A 2ORWA 4P4LA 1S3IA 5C80A 4BZQA 4QAJA 2VSQA 2XQKA 3LC1O 4HNRA 3TLMA 4PLVA 2HEIA 4FGZA 2P0YA 3WP0A 2G4VA 2IUFA 2P7HA 4W7IA 1JDZA 4F3RA 4BNXA 3BIFA 1D6SA 3PC8C 4ZU1X 5AYVA 4V1CA 3I2YX 3ANMA 2C98A 3C70A 5CYFA 4ZYVA 1E9DA 2UZ4A 1IZYA 5KWJA 1P31A 2ZRKA 1MDBA 3NGMA 3SZMA 1WXWA 3JAMA 3NBXX 2AJBA 2B6HA 4N3GA 1MW8X 4KTVE 2FR8C 3FRJA 2DWPA 1PWYE 1PJBA 2P2LA 3LS2A 1EXDA 1STOA 1O2DA 1H2ZA 1ZM3A 5EJFA 4ZJYA 3OPXA 5FUMA 3D43A 4EDFA 1ZGGA 1GCIA 1PEYA 3OZCA 4CCAA 3THOA 5IJ0A 2NAPA 3OPYA 4LOKA 3D7NA 2B21A 1ETHA 3SFVA 4NZYA 2QU7A 4KITB 1R2QA 4D74A 3FN4A 2ZU6A 4JZYA 4L5CA 3T7JA 2FWRA 5F2EA 1Y9ZA 4MI1A 1ZD2P 3FYCA 4R9VA 2B20A 3C3PA 4JKOA 4MAAA 2BMDA 4YCNA 4FPXA 3JTEA 1RLIA 1Q0QA 1RW4A 3M2PA 1G5HA 1O57A 3RAFC 1CXZA 5E9AA 4ZOBA 1JKXA 2I6QA 3BKWA 3NIFB 3U81A 3RS4A 5JVDA 3IUJA 4L8YA 1VIDA 4PAWA 4CUKA 2OHFA 3SSNA 4JELA 1PX2A 3LA6A 4TTPA 5IAJA 4C4OA 4Q4CA 2XODA 3E82A 4XGIA 4OX9B 5DO9A 3PR3A 4BGVA 4P58A 1CZKA 1E3MA 4RD3A 4ZYWA 1K3UB 3JALA 5CJPA 3O83A 2WYUA 4XFDA 4EJFA 1L5ZA 1YZTA 3E5MA 4F7WA 3ODPA 1BVHA 4TZ0A 1G98A 4IYRA 4R3NA 1V71A 4NK4A 5BOSA 1DRJA 1XZBA 2FK8A 1JBKA 2Q4RA 4AVYA 3K1TA 1VLHA 4JA0A 4GKKB 4Q3LA 5LMNB 4MPDA 3AHEA 4WDRA 5EC8A 5JSZB 5FNZA 1NF3A 2QXTA 5EE3A 2NTNA 4WKGA 2ZSHA 3W5SA 2AXEA 1COWA 1HG1A 3VPSA 1Q74A 2DHRA 4BNJA 1EGAA 2VBGA 4FGLA 4N6OA 4TQ9A 2YWEA 3NT5A 2V7QD 4Q39A 5E1MA 4IXTA 3ZU6A 3DP7A 2ZB7A 3QG1A 3OX3A 2NO0A 5TF4A 5HF9A 1SJ9A 4TL7A 4LPSA 4ZT3A 3ZU2A 1ZLYA 4QPCA 2O8CB 1ORIA 2BFDB 2E82A 4AMGA 5H1YA 1IHPA 1TYDE 2FH5B 2C1EA 3LSYA 1T10A 4OK5A 1TK2A 4MJLA 3SSMA 4UCXA 2Z8XA 3KEOA 4FCCA 2H5LA 4R16A 3ZX5A 2QSJA 2BM9A 2CCJA 3K20A 2KYRA 3N70A 1L4GA 3LRXA 4JI4B 1KVTA 1TUGA 1SUFA 2GRJA 2IZ0A 2BGMA 2W70A 2PLAA 1GNVA 3KKLA 1XEWX 2P9FA 3RT9A 4C20A 2O8FA 5CRIA 4TV8A 4FILA 1EGVB 4I66A 2WWHA 2BHTA 3LKBA 1EUCA 2VCHA 4O8ZA 5TT1A 2NPFA 4LDQA 3VI4B 1ZPDA 1XKXA 2P90A 4JBHA 2GO7A 1WUIS 2WHXA 3JASA 4MRNA 1FIUA 3DW1X 2Q3HA 4HBZA 5E6SB 5I4BA 1U8CB 1FDWA 3NTRA 5IMBA 5BW4A 1VL2A 1X7ZA 4G84A 4F4IA 4LF8B 2OD2A 3NAMA 4KR9A 4BQFA 3HVHA 1XE3A 1UXJA 3IEIA 1GNPA 2GZRA 4HAYA 1KOGA 3FPJA 1GA6A 4MJ7A 3A2MA 1KEPA 2IV2X 4E5PA 5JCJA 1QP7A 2A94A 1EX7A 3DCIA 2IEGA 3KK0A 1SPXA 1FQJA 2YDYA 2PGNA 3HSKA 4MB6A 1ABFA 4QXOA 2EJUA 3O94A 3U7IA 3RC8A 3N2NA 2XUHA 4G0ZA 3VHXA 1GZ7A 3FTEA 2EBFX 1SWVA 3OLYA 4KFSA 3O90A 2GPNA 4J0JA 1VECA 4OQXA 2ZWOA 1NF8A 3O8NA 3WFJA 4XLLA 1JKFA 3VUFA 3MT9A 4WL0A 4X95A 3UICA 4LEIA 4M1OA 1DEXA 2EFGA 3WXBA 5MGNA 2WJIA 1DKOA 3VPDA 2XYRA 4WZAA 2H8GA 4BEJA 4ZODA 3SPXA 3X1DA 1F0KA 1P0PA 1T24A 3MBOA 4UE2A 2H65A 4MS3A 3RBXA 2ZUDA 4DCUA 2WZBA 1V45E 1ZH6A 2VL7A 3SICE 2W9XA 1U1EA 3R3SA 2OAQ1 1HYQA 1CT9A 1X94A 5TIIA 1FNDA 2PKQO 2XMPA 1U7OA 5K20A 1LI4A 4YP5A 1HX7A 2W4IA 1KP2A 4RCYA 3Q41A 5IEBA 4B3IA 1LW6E 4BLVA 2KQUA 5AHXA 4RZQA 2C54A 4TRMA 4AO7A 3PRYA 3HADA 2E4UA 3T7EA 3SYNA 1LPSA 1NE7A 3D7RA 2W48A 3DO5A 4Z3OA 3K0CC 2VSFA 4UVIA 1HDXA 1MAHA 4G0UA 3OESA 1DT5A 2X3YA 3FR7A 1W93A 1J8YF 2H7CA 4PANA 1J70A 2P3QA 4WA7A 3TW4A 4ER5A 3WL6A 3W5CA 5JS1A 2CVQA 3PHCA 3HJCA 4YYZA 2HO5A 1G8SA 2BEWB 1A4XA 2YHSA 3G2QA 4FUTA 1A71A 1E5VA 1KDVA 2LCQA 4ENVA 1MQ9A 2ZB4A 1DBRA 2QN9A 4P84A 4YCBA 1KJWA 1NYLA 1YR3A 1TMKA 2FOLA 1Z75A 2QYOA 5CDHA 2OXFA 2WM2A 1TKRA 2C4WA 3AYZB 5DLEA 4F1KA 2EYUA 2PBLA 1Q19A 2JCYA 4KO3S 3QKSA 3IVGA 2XRFA 2HZ7A 3E8SA 3ET4A 2J1LA 5CA0F 4QNRA 1CY8A 3ITNA 2D1QA 2I99A 3DMRA 4P33A 2Z3WA 1IJKA 4DLBA 2IHYA 5GGXA 2RB5A 1H23A 1ZICA 4IOKA 3U4AA 4D25A 3LDHA 2XDQA 2DERA 3GX1A 3A6EA 1C80A 2C31A 2OV4A 5LIRA 3QELB 1ACMA 5K8IA 1XRJA 4OHWA 4KR6A 2QP4A 2B83A 4W7HA 1CBUA 4H15A 4GMGA 2N9UA 4A27A 4BQSA 2C94A 1RKUA 3RC2A 3TJZA 3DULA 5KSOA 2HMWA 1ZIDA 1E1QA 1F4PA 2D0IA 5LQRA 2HRBA 2VYNA 4WJLA 4GR5A 3A6LA 3E9YA 1BIFA 3EFEA 2YDXA 3FDFA 3GGDA 1FRVA 2NYRA 4Q24A 1OIXA 1NNUA 3RVSA 1XL1A 4UARA 1CS0A 4A6PA 2KHZA 2XGMA 3B51X 3N8KA 3NJ4A 1JHYA 1ZM9A 2QUZA 2BSQA 1XCPA 2HA5A 2JCSA 4MRPA 3LXRA 1DT3A 2Z04A 4DSUA 3V1UA 1UC8A 5F3WB 4CKCA 9LDTA 2VZEA 2ZIFA 4NAVA 5FX2A 1USGA 4H4CA 1SQ6A 1HE5A 4URUR 4QUGA 1VHTA 3WLMA 5AD1A 3LY8A 1M34A 5JJIA 3FA2A 4JLPA 4B17A 1YS4A 3NT2A 1YIDA 1ULTA 3FSEA 1QDUA 2P79A 5LB2A 3BSFA 3BXGA 4LZWA 5K4HA 1ZD5A 1I13A 3V7YA 1M0EA 3W78A 2WYWA 3C8MA 3I05A 1IZ9A 3ZXIA 1JQLB 3S1AB 2WUFA 2VF2A 2Q41A 4RZHA 1YUBA 3MW8A 5IXJA 4OH7A 3D4OA 5DX1A 1DAIA 4GX0A 4NH0A 4OHMA 1JQ3A 4K03A 1JZQA 1QK5A 3QTLA 1T5OA 4M88A 1ZN7A 2CLSA 2NU9B 4EHBA 3OE7D 5ADWA 1YNOA 1VA5A 3V7FA 3FGZA 4ZYYA 5BYAA 1D4FA 3LLSA 3HNPA 1OA0A 5JCPA 5EUMA 5JQGF 1VPTA 4YUXA 2BM8A 3DOCA 4MB2A 5EMJA 1TMGE 2BAGA 9MHTA 1CF9A 2AOWA 1UBCA 1NV9A 2JATA 2XKAA 4DIMA 1E0DA 2H1FA 2JC3A 4ZV9A 1SHLA 5JS7A 4CIAA 5JFTA 2IDJA 4Z5XA 2F3TA 3KR1A 1QRUA 4WKBA 3D0RA 1MMFB 4PBTA 1T2FA 3TRHA 4S2UA 1KMHB 4BVFA 3U40A 5A4DA 1TCCA 4P82A 2G9RA 4RKEA 5BNFA 1CCWA 2CZCA 3O6VA 1IQUA 2HHHB 1WOYA 1PNQA 3PR1A 1PR1A 1BS2A 4G01B 1JWBB 4IXWA 1BOFA 2BRUA 1CY6A 3DT8A 2BFOA 1JLHA 4GBED 4MWCA 4MYRA 4TSKA 4KIGA 5IXSA 1QGUA 4GC9A 2GZAA 2Z30A 1M8PA 1TF2A 2AR7A 4A36A 2LIPA 3WL3A 3RQSA 3MOSA 5CLGA 3QKIA 1IZ8A 3CQ9A 4QXAA 4TGLA 3R7DA 2O5VA 4CNBA 3T0IA 3MBIA 2YY5A 1PQWA 4WWHA 1QZUA 3V3KA 5LVAA 1OPRA 4CKWA 5IHXA 1ORWA 1YA4A 3OSUA 3FNFA 4TQUS 5KQMA 1ZEMA 4E2YA 4C05A 2JLRA 4XARA 3T3EA 2Z5VA 3RT7A 3CSDA 5J3JA 4LY6A 1B6RA 1I2MA 1QE0A 1QAQA 5ERXA 4F3NA 2IX3A 4IH4A 1UFRA 4I4NA 3FJ1A 4MS4B 6ADHA 4U0KA 4O08A 3RYFB 4FYKA 5DCYA 4OUDA 5LZ4A 3M5PA 5ES4B 3LZ6A 2X15A 3H1BA 4MUYA 4U7TB 2GN6A 1DAOA 3KKZA 2QW8A 3TF5A 3GBSA 2Y0CA 1CF4A 4G07A 3DYIA 1XCJA 2ISSD 1AKMA 1AM4D 2BMWA 3N39C 2P91A 2JFGA 2XD4A 4KG7A 5CIQA 1GA4A 1FFWA 1U7ZA 1OJLA 3FYUB 1HR0B 4NL4H 1OCEA 3HJTA 2FF5A 1DTSA 5B55A 5KNDH 3LDGA 4HQKA 3DO8A 3NFRA 4CM9D 3ENVA 2YRXA 3SM3A 1THMA 2IYQA 3CVUA 3KZKA 1E2QA 4TXMA 1KO4A 2XOKD 4HUQA 5E4TA 4YJHB 4HEA6 2P41A 4OHYA 4FLFA 5I4CA 4N01A 4EVSA 4QLBA 1E6EA 2IKSA 2PRZA 2P2CA 3OTQA 4WD3A 2P2NA 2C2YA 2NXJA 4PAOA 2OOSA 4OBBA 4IGAA 2YWXA 3HR4A 3LWNA 2HRQA 4R69A 3U3JA 3VR1A 5KJCA 2NYAA 1SUDA 3TE7A 4YDHB 1GQOA 1L5VA 4CM8B 2BUAA 4KFCA 5GOZA 4AJ2A 1IAVA 2VHWA 4KYIB 4JEMA 4S1PA 3WA7A 1GPH1 5K8UA 1HK7A 1MC4A 4Z2YA 3F5FA 1UMBB 1WS6A 1GPWB 1WHTA 1OQAA 3PFIA 4HX9A 2AJDA 4KUHA 3RHZA 2Y1DA 3QG5A 1OZFA 4ACBA 3VNSA 1FS4A 1VDMA 1E3DA 1X7XA 1NVVQ 1DAFA 3BRCA 4PTLA 3AXSA 3ESCA 1I6MA 4RKYA 3V1MA 5I51A 3PNQA 4W5TA 4BMZA 5A5EA 1YFLA 4KL8S 3TWOA 4BJ6A 3P45A 5BMOA 4BXOA 1EQ2A 4DIKA 1JZSA 1ODLA 1T8YA 1MD9A 2YHIA 3SM9A 3GDFA 3KO8A 3TVTA 3I42A 1OSNA 2J3KA 4OAPA 4R6WA 2NPOA 1KAGA 1SWWA 3FZEA 1ZUD1 2HRRA 3ACDA 1BDMA 5DB4A 4IO1A 3DT6A 1L0BA 3LQFA 4WN9A 1YKGA 4L4UA 5JXHA 4F5ZA 5LLSA 5A5DA 3DM5A 1UC5B 3U2QA 5B57C 1AZWA 3DFZA 3ZPXA 4J0HA 2WQ6A 5JBNA 1ECBA 3DMNA 4I0WB 3GLHA 1Z6ZA 1XMVA 2RI1A 1XJWA 3GMIA 3VR5A 4NFHA 3QKUA 2C83A 1PFKA 1PYGA 4ZVMA 4UU1A 3VHQA 4KDCA 3LXMA 4HH1A 1QPGA 2RC6A 5A5GA 2WHYA 3G0OA 3OSZA 4X8MA 1MQ8B 1V3UA 4IDCA 1M74A 4OXXA 2BBSA 2KJQA 2TMDA 3LP5A 4IWXA 1YQDA 3G8BA 4O4LB 2O8DB 4HRXA 1EUDB 2X8WA 2PQ6A 5F4ZA 2ZI6A 3GEPA 1IEQA 4Q1AA 3VH1A 5KQLA 4IJ5A 1AA9A 2RAUA 3BAFA 3D3KA 3M6IA 4E51A 4FDLA 4F96A 4UOZA 1SULA 2PSSA 2V6BA 3PC6A 1SO8A 3NAQA 4U5QA 2QD2A 5CURA 4BV9A 1PV2A 3HDGA 3HP1A 4FD3A 1VJGA 4J7UA 5DNUA 4N0MA 1AMNA 2GHIA 3OCVA 3KAKA 3DBVO 3KHKA 4G1VA 2O8NA 4EWLA 1M1NB 5FO0A 1MZPA 1AGNA 2Z0MA 5L3SA 2X1VA 3LYHA 1Z22A 4QZVA 4NARA 5AJHA 5ALQA 4Y9TA 2KMLA 3OPVA 4CBVA 2NADA 5L7TA 1GNTA 1GPAA 1QF6A 1L4HA 3K9GA 1JA1A 3DLIA 1L4KA 4JLAA 5LXTF 3VSDA 4ESHA 2QU8A 2QRJA 4TLAA 3LY9A 4IMPA 4J91A 2DFVA 2FK7A 1RFLA 2B61A 1U8UA 1MX5A 4YDQA 1C3LA 3MS7A 1R9MA 3T61A 5EIFA 5M7EA 2VPIA 2CVFA 2ZSUA 1NWHA 4IEEA 2IHVA 2O2EA 1H2XA 4PU0A 4REMA 4V0LA 2WG1A 3JQCA 1P3Y1 2W5UA 2XMZA 4DQ0A 5FUQA 1QB7A 3PDJA 3EQ6A 4Q4HB 4Z6KA 5LJLA 2CL7X 4ND2A 4O2BF 5K0CA 4PR0A 1NZJA 3B13B 2ZYAA 4TMXA 2GB4A 1DDOA 5TPZA 1KMQA 1OW3B 1POXA 3LVRE 3V7UA 1M7GA 5K1ZA 2C42A 4ENUA 1PD0A 4BZPA 4JT2A 3I5YA 1D2NA 4XIJA 1Z08A 4YMIA 3ETHA 1T1RA 2HU7A 4GPD1 2I2XB 2ZIWB 1R9GA 3BIOA 4ITUA 3Q6MA 3MGCA 1Y6FA 2X5NA 3HA5A 4OBWA 2ZT6A 4MVCA 4UM9B 5ALPA 3GNLA 3FUWA 2TMGA 2HQRA 3OZRA 3CLTC 2D8MA 2QMHA 1I14A 1XOIA 3ANSA 2ZI3A 3ONVA 5EMKA 2QGZA 3PENA 4ZC1A 4OK6A 1PAUA 3BTVA 3TJMA 2ILVA 2D13A 2PBRA 3ERCA 5EXXA 3B1WA 1UBTS 2FWNA 2NPIA 3K5IA 2MWMA 1A96A 1ZRHA 3DQPA 5D87A 4RV4A 2IXBA 1U2EA 4UATA 3WBBA 3ER8A 4FQ5A 1YASA 4XCXA 5D7BA 5HBRA 1XU7A 3DEFA 1NM5A 3WBFA 3LO5A 3T5AA 2VDWA 4ZANA 3L0CA 3N87A 4WK6A 3WNVA 2H7XA 1T0IA 3NNNA 5D3MB 1JKIA 1KDZA 3WK6A 3AQ4A 3HEBA 1NJ5A 5HGXA 3PJRA 1WDKA 2HSEA 3RUDA 2WJ4A 1A5BB 1L3IA 4Y2GA 1DAGA 4AX4A 3X43A 3FFWA 4J2OA 4ABYA 2BR4A 2XNDD 1U8YA 1NXTA 3PXXA 1M2JA 2G06A 3HWRA 4BVBA 4R01A 4DCTA 1LDEA 2WP8J 3K0FA 2ATCA 3L2OB 5LZ8A 4U7DA 2NU9A 4JN6B 1YB6A 4IZHA 4TVSA 3N7TA 4PINA 2HK8A 1FSFA 2FCAA 2HBYA 1KIMA 2RGXA 4RY9A 3FKSA 4U00A 4YJDA 4JD5A 5KVSA 3AP2A 4TXNA 4R71A 2XNSA 2JD2A 2YX1A 3H2ZA 4GOLD 4DBLC 4K86A 4KFTA 4G1CA 1G3MA 1PN3A 2A0FA 3ZGNA 1PJ3A 4TYQA 2QW1A 2DGDA 1F4LA 1MQAA 3OEHA 2RCYA 1Y9AA 3VH2A 3E03A 2Y05A 2N46A 2O0MA 4D99A 1F4VA 3QX7A 1FRFS 2IYUA 3D4IA 3JWHA 1VJRA 2BP7B 4Z53A 2FFHA 1KMHA 4NMXB 3DO6A 4PPNA 4C14A 1UL1X 3FNEA 4C4TA 2YXNA 3BA1A 1DC8A 2HK6A 2X76A 4DEXA 4NI5A 2ZPUA 1Y4AE 2D5AA 2GGSA 1F7UA 4JBNA 3KQTA 3GRUA 4NBLA 1JKMA 1TL7C 2FG7C 1P2GA 4MP6A 4YHBA 5LQUA 1ZN8A 4QEDA 2C2XA 1VE1A 2GPJA 4JLVA 2WJGA 4MYSA 4Y6OA 2V9CA 2IYLD 1L6RA 4CCYB 4I7EA 5BPHA 5JEDA 1GIAA 4PR3A 3DAGA 3RTDA 2CMKA 4IH9A 1VPVA 3BWMA 4DNXA 3VC1A 3MS2A 3DKVA 1BGWA 5CIWA 1DI0A 4HT3B 4AD8A 1USKA 2OORA 2A59A 5EFZA 3REGA 3HJAA 1O6BA 4MV8A 5AQEA 4M60A 1RRCA 3VGPA 3DF9A 2XI4A 1NF9A 1QIHA 3PZBA 2QOEA 3Q3HA 2FXVA 4W9NA 1HNNA 3ZJUA 1E5DA 4YJ3F 1NR5A 3GJZA 4M55A 5K4GA 4TWJA 4D3DA 3RYFA 4NJEB 3WHIA 1Y5IA 4RF3A 1W73A 4JJEA 2BCGY 1Y7PA 2HWYA 4ALNA 3FMOB 3O8CA 2Q9CA 1UAGA 1U7WA 2B4YA 4I9HA 2X8JB 4KH1A 3GB9A 5BR4A 3VNQA 2OSBA 2V55B 5CHYA 3WI7A 4KQ6A 2WINI 1T15A 2YVAA 1ST3A 1B16A 4GNRA 4ISCA 5CP8A 4IGIA 3ROTA 3FYUA 2IGBA 2H92A 3GGGA 3FZGA 5BN4B 5A9TA 3ZQ4A 4ETNA 2F3UA 1ZC4A 3KXIA 5EWMB 4RZXA 1FZTA 5LQKA 4GBGA 3NW9A 4W5RA 2W42A 2B9EA 1LW7A 2XQIA 3BXFA 4UHJA 4AS1A 2BI4A 5KVAA 1C9DB 3HCPA 4D9BA 3RC3A 3LHDA 3C1UA 1N5IA 2FZLA 4HFRA 4U9UA 3KUUA 5I9SA 3WLEA 1NHWA 2A67A 2ZRNA 1P6UA 3FCUB 1G60A 1Y7IA 4JX9A 4RIFA 4OXNA 4XQEA 2VDPB 5LB4A 5LOVF 3UMBA 4AKHA 3W7VA 3K92A 2JHAA 1T0UA 4F04A 2DC1A 1XYGA 1P75A 4QBTA 1LNZA 1FJHA 1N6RA 4LOIA 4NBUA 1KI6B 4R2JA 3PC3A 5FBHA 4CM8A 3P27A 4MA5A 3L4SO 1R8XA 2FE1A 4TVOA 1R8JA 5JFOA 5LQDA 5KTSA 1I2DA 2PSFA 1YZLA 5KYUB 3R3UA 4IIGA 1UMBA 1LU9A 2ZT7A 2VAWA 3KOXA 4L4XA 1IUPA 3QLUC 1BMDA 1E8NA 5EQDA 1MJNA 1HYEA 3QU2A 5J23A 3K9NA 4CUZA 3GVXA 4H35A 2JANA 4I2NA 3RE1A 3KUDA 3G2JA 1N3BA 3C3BA 3HC7A 5K3AA 4NXNB 2CHQA 2C7QA 3RSHA 1BMFD 1JDBC 1GLNA 1U3UA 2XB9A 3RF7A 2D5BA 3WSTA 1YJCA 2HJ9A 2F43B 5FA5A 3FSJX 5H4HA 3PNSA 2YWGA 2BEUA 3C6MA 5DGDA 3WOHA 3OU6A 2CLDX 1ZZGA 4CEIB 4N47A 2GHRA 3LUJA 2IA5A 4RTNA 2OO3A 3P9QA 2WIBA 4IOMA 3PXGA 2HWXA 1UXOA 5FBLB 1BKYA 1KSJA 1KY4A 2AN5A 2FMHA 2PIAA 3CN9A 1H2WA 3GEDA 3Q3CA 3RIMA 3RREA 4ZZ0A 5I5EA 3H6HA 3CRW1 1E32A 3NIDB 3KE8A 1K7EB 2OHHA 3OG9A 5D2CA 2DHDA 5B1YA 3QXHA 2I7DA 3K2BA 3NCHA 3NGLA 3U16A 3HVRA 1PIWA 3W6UA 4WVLA 4KH0A 3ZWDA 4E21A 1ND5A 3I5UA 1XMJA 4ATNA 3BCUA 5IU6A 2OV3A 2J0VA 4B8ZA 1KO7A 5DTQA 1PDVA 1FFSA 1NW3A 2CDNA 4Z8YA 1XX6A 2F1OA 3OU2A 4ZMBA 1Y34E 3NC1C 1RDFA 4KWEA 4GZ3A 4W8OA 4BE7B 2Q2WA 3K9CA 3WGTA 3BCSA 5JC1A 4CM4B 5D01A 1Z8NA 2XTZA 3FIUA 4L6CA 1S89A 5GJCA 2JIBA 3BMQA 4B3CA 5K4AA 2HD4A 4OJQA 3IXMA 1FSGA 4NCNA 5HRCA 1RMYA 4GF5A 1U9IC 4A5SA 3EPJA 2W7TA 4LOHA 2VFAA 4K9KA 3DCNA 4JLDA 1ADJA 3SZ3A 4PAQA 2JJQA 2PJDA 1J2EA 4H7PA 3JX9A 2Q6OA 1GUAA 3C3XA 4GYWA 4WCDA 5AFSA 2FUNB 4HYYA 2HH9A 2VTKA 3VV2A 5BN1A 2I66A 2JVJA 3BWVA 4K9MA 5LBUA 2Q6LA 2LNDA 2NSHA 2ODQA 2C7PA 5M5BA 1EZ4A 4ZVLA 4PGAA 1QKIA 2NACA 5B3JC 1ABBA 2FX5A 1M1NA 1QFSA 2O9JA 5DW0A 4DCMA 1S2MA 3E5RA 4YR7A 3QWAA 3M81A 4S24A 4ZDJA 8OHMA 4RTSA 3MWFA 4P22A 4Q9JA 4H2DA 1CY4A 3BJMA 1VIYA 1IH8A 1G8FA 1XZMA 1ZVKA 2OGTA 1WMDA 4XYBA 4DILA 1T9KA 3ANYB 3U09A 3FZQA 3LC7O 3CTMA 1KQFA 3LHIA 1L7PA 3WR5A 3G5LA 4L3VA 3ZE6A 2JGLA 2ZAOA 1BSVA 3IP7A 3QY9A 1CUEA 2YJGA 1K4MA 3IT1A 4AYWA 2OC4A 4FHEA 3A04A 4NU5A 3UJHA 3ZD9A 4IRMA 2O2CA 5FDFA 2OD7A 4GYKA 2JA2A 2VHQA 4BLWA 4HFMA 3VV3A 1EXWA 1NSYA 1HY3A 2DR3A 2H08A 4G26A 3TD9A 4N3NA 1TT5B 2D06A 1WHSB 1XVTA 1MTZA 2V9PA 4HH4A 5KZMB 1ILEA 2EFYA 2FSUA 2XZTA 3BEOA 4GGPA 1XQ1A 1QS0B 3IE1A 1P7PA 3HCAA 1I4EB 2O5EA 2IEYA 2X0DA 3WIEA 1U7PA 4D3ZA 4MS1A 1AUOA 2E85A 5JW6A 3GLKA 4KPUA 4EEXA 1PS8A 2JLUA 1HDIA 4DT1A 1Q7GA 1XZCA 1M1ZA 2M32A 1U5AA 2OAP1 1MRSA 2QRHA 3H2HA 3AVXA 1Y9EA 2DVMA 3AFHA 2D2EA 1M7BA 2P8JA 2VK2A