2Y0BA

Caspase-3 in complex with an inhibitory darpin-3.4_s76r
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
140
Chain Sequence
b'DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQARGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
molecule tags Hydrolase/protein binding
source organism Homo sapiens
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
total genus 51
structure length 140
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y0bA00
3NR2A 3H1PA 1SHJA 1SHLA 1CP3A 4JQYA 4JJEA 4QUJA 3R7NA 5IABA 3D6MA 1SC1A 3DEHA 5H0IA 5K20A 3DEKA 1PAUA 2XZTA 1KMCA 2QLBA 3BIJA 4EHFA 3V4LA 1RWVA 2QLJA 3H13A 5IAGA 3EDRA 3R6GA 4JJ8A 2Y1LA 3RJMA 4DCJA 3GJRA 2WDPA 4QUBA 3V4OA 2J30A 5IC6A 4NOJA 4N6OA 5IBPA 2HBRA 2QL9A 4N5DA 3V55A 4DCOA 1ICEA 1M72A 4EHNA 2H5IA 4JR0A 4N6GA 1F9EA 1JXQA 1RWNA 4HQRA 2H51A 2CDRA 2J33A 2FUNB 1K88A 1I4EB 4IYRA 4NOMA 4EHDA 3GJSA 2HBYA 3S8EA 4NOLA 2XZDA 2FQQA 1RHMA 3H11B 4I1RA 4AWBA 2CNKA 4QUAA 1RHRA 2QL7A 4QUHA 3V3KA 4EHKA 1I4OA 1NMSA 3IBFA 2H54A 1RWWA 4D3XA 3R7SA 4FDLA 4IEFB 1RWOA 4D3ZA 2H4YA 3GJQA 3IBCA 4QU9A 4QUGA 1RWPA 3V6MA 3E4CA 4QUDA 5I9TA 4JR2A 2XYPA 4QULA 4I1PA 4QU0A 3DEJA 4DCPA 2H5JA 1RWMA 4NBLA 4AWAA 2HBQA 2HBZA 1F1JA 1NMQA 3P4UA 4PS1A 3UO8B 2J31A 1RHUA 4ZVQA 3R5JA 4AW9A 1GFWA 4QUEA 2CJYA 3PCXA 4EJFA 1I3OA 3K7EA 3QNWA 4NBKA 5IAJA 3PD0A 4D3YA 4ZVUA 4JJ7A 2C1EA 3EDQA 5LU9A 4JB8A 2QL5A 1NMEA 3NS7A 3D6FA 2H65A 4NBNA 4EHLA 2J32A 4QU8A 1SC3A 2H4WA 3S70A 5IBCA 2Y0BA 1GQFA 5LUBA 5IBRA 5IAEA 1RHJA 1RWKA 3KJQA 2FP3A 1QX3A 4EHHA 3R5KA 4PS0A 4N7MA 2XYHA 4QTXA 4PRZA 4M9RA 4ZVPA 3D6HA 4FGUA 3SIRA 2P2CA 5LU8A 5IC4A 4N7JA 2CNLA 2H48A 3P45A 1I51A 3R6LA 2C2OA 5IARA 2C2MA 3KJFA 2XYGA 3H11A 4ZVOA 3OD5A 1IBCA 3KJNA 1NW9B 4HVAA 2CJXA 4ZVSA 1RHQA 4LSZA 4HQ0A 5IAKA 3GJTA 2AR9A 1QDUA 2C2KA 2QLFA 1RE1A 4FEAA 2C2ZA 1BMQA 4FXOA 4N6NA 4ZVRA 5JFTA 2CNNA 4QUIA 3DEIA 3R7BA 1CVRA 3ITNA 4JR1A 1K86A 2NN3C 4JQZA 3V6LA 5LUAA 3NKFA 3SIPA 5IASA 1PYOA 4QTYA 1SC4A 3UOAB 1RHKA 4EHAA 5I9BA 1QTNA 4PRYA 2CNOA 4QU5A 3PD1A 4NOKA 4ZVTA 2K7ZA 1RWXA 2DKOA 3H0EA 5IANA
chains in the Genus database with same CATH superfamily
3RSGA 5I9NA 1GCGA 4P3OA 3B48A 5AVRA 3M1AA 4US2R 1MX1A 4H3KB 1YVDA 4QG7A 3CJRA 3PRHA 3W9YA 4Q7JB 1ND5A 3NWJA 3EVAA 4IHJA 1K3UB 5KTYA 4G86A 4HBZA 2XXAA 3ZD6A 3GH1A 2VO1A 3GLHB 2RE8A 4JFRA 4LRSB 3E1GA 4H7JA 4FEGA 5FBWB 4WEOA 2IOHA 1QUEA 3QZUA 2GAFA 2PGLA 3FPJA 1H0RA 5CX1B 5JYCA 4AKIA 4BCBA 1QHXA 3AOGA 3OPYA 1U90A 3KVNA 3DQZA 2GYVA 1M72A 3MCZA 3PIRA 5IDYA 3UMJA 1H8EA 3WGLA 4GEGA 3ZWYA 4AP5A 4BX2A 2V03A 4PXAA 2IUFA 5TNXA 2ERCA 2HSGA 2HA6A 2XNJA 1L3BA 3PF8A 4HRXA 4B9AA 1IHDA 3ORFA 4ZHSA 1FIUA 2DKNA 3GGDA 2HBYA 1ZD1A 2NXWA 5G53C 1S5PA 2NSYA 6ABPA 1OOEA 1G7TA 1YS9A 1H93A 2CC2A 4I08A 4EK9A 4MUIA 1YZFA 5CFMA 2B98A 2JAUA 5ABPA 1T6ZA 2V7XA 3E9MA 2PEYA 5CXSA 5E38A 2YRWA 1LK5A 4WOPA 4P53A 3UH1A 3H3XA 1JBEA 4U2BA 5JU6A 2FJUA 3F71A 1PEAA 2QE7D 621PA 3W2EA 4Z3DA 1OASA 3OU2A 3Q4GA 1EUZA 4KHZA 3WGQA 5FUBA 1JJFA 2XKJE 3BRCA 5FTJA 1U2DA 3D5TA 4FIDA 4OIFA 2HREA 2CZGA 3EDYA 5E6UB 4XSHA 4YAIA 1JR3E 4Z4GA 4AW9A 2WQ6A 3IP5A 3MW8A 4DDKA 1P7ZA 3DLCA 1OBFO 3NHJA 2GEJA 5CVCA 5HCIA 5TB5A 3REOA 4F86A 3CG0A 3M9WA 4HOYA 3OTOB 1O6CA 5JCZA 1U2GC 4GUDA 4Y2GA 4D80A 3OQMA 2GF9A 3AW8A 1X1RA 2ISSD 3VDMA 1E2HA 4AUMA 1WOMA 5K1ZA 2GOYA 3NS7A 3EG9A 2BN4A 3H1BA 4F4HA 2JGDB 5KSYA 3BXOA 2L17A 3TKYA 4HT3B 1U2EA 3D43A 4ZPJA 4B79A 1AVTA 2BGLA 2ISCA 4J4BA 2VHWA 3NT5A 4JYBA 3MILA 4UEOA 1ULTA 4AKTA 1K4YA 3ZW9A 4B4KA 2G88A 2P9ZA 1QR6A 5KYUB 1PLJA 4BNZA 1XKQA 4XR4A 1E9VA 5FTMA 4JBXA 2GA8A 3HB9A 1R6AA 3T3GA 2N1BA 1QQAA 2ZG6A 1U2GA 2C78A 4AUKA 2V54A 4LE2A 4TKUA 2CMHA 2PS3A 1ISIA 2WF6A 2AI3A 1Z38A 1JIKA 4LSWA 1YR1A 3GLHA 1QZZA 1CQJA 1PSWA 4Q4JB 2HA0A 4V0ME 4OQFA 4OXQA 3UJAA 3W5HA 3B85A 4IOKA 5BSMA 3DAYA 1RXUA 3X2SA 5EXSA 2IYEA 4B2LA 3ISTA 2HUNA 3CZAA 4MQUA 5BN1A 3WY9A 1NQAO 1XELA 2SCUA 2G76A 2YQ5A 2XBLA 1SKAA 1GEGA 1RJEA 4PQFA 3CLRC 1E8NA 4MWDA 4M54A 4QBFA 1OQAA 4J0GA 3V9AA 2IS2A 1E5LA 1GU7A 2ZZMA 3FPSA 2VYCA 2QY9A 5JDCC 4DRZA 3QJYA 2YRXA 3PD1A 1TC2A 3H4TA 4O3MA 4BB6A 3J81k 1OX5A 3WXBA 2O3QA 3T9AA 2FPOA 2J41A 5CURA 2I33A 3DEHA 2JDIA 2EP5A 4BKPA 3RKSA 3OX3A 4KYVA 3JWJA 3UW3A 3CMCO 1X7YA 4I4TA 1O95D 2AJBA 2J6CA 3ZDEA 2QDKA 1XCLA 1YE8A 3D4IA 3U2QA 3V4LA 1ONSA 2EJVA 3D8RA 1UP7A 2W8BA 4WN9B 4YDRA 2VK4A 2YV1A 2OD9A 3HDTA 2DH5A 4YQYA 5CEEA 3FCAA 2Y1OA 4AP6A 3AXSA 4IGEA 4O4HA 1TJPB 1QXSA 1JN0A 3GFRA 3HJNA 4YLEA 4FDAA 5D6OA 3V8RA 2IYLD 5I3ZA 4WACA 2VPWA 3ETGA 3HBMA 3L46A 1UWVA 1V25A 2HLNA 5HTOA 2WJ4A 4IJKA 1W2GA 1P2TA 3EZLA 1W36D 4Z9FA 3HCOA 1G21B 4EX6A 1Y80A 4JI1B 2ZS8A 2XZDA 3RC2A 1ULAA 2ID9A 3LCVB 4PIMA 1ONOA 2LNDA 3F96A 4BP1A 1KEPA 5NULA 1TMGE 2Q4EA 2W0SA 4B0OA 2XIQA 4G9EA 1C0EA 3RF7A 1GCAA 4CQMB 2ZUEA 2V7GA 2B3DA 4UC0A 3RIHA 3PGMA 1EFPA 4M9ZA 1OTHA 1I9CA 2AK3A 1NUHA 2D2IA 4LC9A 2IE8A 3U60B 3SAJA 5HIAA 3IBCA 3IJEB 3K4PA 5DBGA 3SZ3A 3NDRA 5BQOA 1Z35A 5F5XA 2A35A 4JU9A 3UGTA 8OHMA 1KU0A 5BSFA 3U4QB 1WXHA 4FXPA 3B3AA 1FMJA 4E88A 2IBSA 2BZSA 4QATA 2Z2KA 3UO8B 2QD3A 2QD5A 3N39C 5K3FA 1GV1A 2X8AA 4HB0A 5AM2A 1I01A 2HCBA 5IM5A 1DC4A 2IHKA 1U0EA 4GXTA 2H9AA 4MNTA 1IZ8A 5AVKA 4Y2YA 3WGMA 1H6DA 4P7KA 3T5BA 1XZIA 3U0VA 1Q0HA 2VUSA 1CK4A 3DB2A 4KE7A 4MK4A 4V0MA 3JVDA 3UIEA 5LZ4A 2G1PA 3PC2A 4QOJA 1PSZA 3SC6A 5WRFA 3BMNB 3ZCQA 3I53A 3RS5A 5FTLA 5HJ2A 3I5XA 3QPWA 2EF0A 1W0KD 4LF9B 1KARA 5G40A 1KEEB 1P7CA 3PRKE 4K05A 1U0RA 4LPKA 4C6TA 2JLVA 1OBHA 1I2CA 4N5NA 3RC3A 3VPBA 1D5CA 2I6SA 2XIJA 3FMVA 3NEJA 4PR0A 1MAHA 4TMYA 4IIUA 4YJGA 1CTQA 5LWQA 5DBOA 1XFDA 2RBGA 1IPHA 1A9SA 1JMYA 3A9TA 2QP4A 2WVGA 3KFLA 2Z2IA 1YB4A 3JPYA 3TIIA 4DBZA 2XNDA 1NW9B 1PGOA 1T9KA 4AZTA 2EX0A 3MQ4A 5JISA 3VNBA 4TZ6A 1BGXT 1E62A 2E18A 3EXG2 2OY0A 3GLIA 3CR8A 1J39A 3UUFA 2OHXA 5BWLA 3SU8A 1RQXA 2GCOA 3O7WA 4JNCA 3DEIA 1NLZA 4XQEA 2BGKA 5CT5A 4H16A 1ULSA 4OUDA 4B33A 1PE0A 1VKNA 2QU7A 1XXHA 3O3OB 3WTCA 3AKYA 4G0NA 1X77A 4Q9JA 1PFYA 3KJHA 1S6YA 1WRBA 3ZUGA 3GYGA 1MO3A 3F4LA 2WF8A 4OJMX 3VR5A 3AHDA 4F9TA 5CAEB 4HNUA 3HR8A 5JRZA 2AEMA 4GP6A 4PAMA 4LF6B 4INOA 4LV6A 4OTZA 5FAXA 4RQAA 3VYRB 4EP1A 1YS1X 3L0BA 1FBNA 5FORA 2B2NA 4WLEA 5JWRA 2V1XA 3DL0A 3JR7A 1C4KA 2OFXA 3MM4A 2OWEA 1I7PA 4TV9F 2B1QA 3EEYA 2J59A 3FRIA 3G23A 4LCJA 1NJFA 1W73A 3SLRA 7AT1A 1U99A 1P0PA 2QNRA 3OBIA 1W2WB 4MPDA 5B4UA 3ZWCA 5C34B 3KAKA 4OD0A 1HDCA 3EFOA 4W9NA 3NHUA 3N5KA 2D1QA 2IYWA 3FR8A 4KQ2A 5TARA 5AVSA 4JYZA 1ITZA 1JXQA 3HJCA 1G63A 3Q2OA 5U4QA 4RTQA 4BEVA 4XOIA 2YR0A 4Z6KA 4UE2A 1THGA 3TDNA 1A9XA 2HSWA 1SUCA 3LY9A 4IIJF 2CNKA 3RRZA 3WHPA 2OO3A 1CKEA 4NYMQ 4U7GA 4OLJA 4YJHA 2JK1A 3DHWC 4NJMA 4TTSA 4AKHA 2Q1WA 1X13A 5MN6A 5KYKA 3QYFA 3LT5A 2O05A 4CMBA 1Z6AA 1U0LA 3IURA 3JAWB 4QUGA 3QU4A 1UAYA 1T36B 1TAHA 4GP9A 2OESA 1N2SA 1EDBA 3PITA 3CZQA 3RHSA 1IIRA 5CB0A 3MT8A 4B6FA 3WDLA 1TXGA 3UF0A 3LY8A 3G2PA 1V9LA 2I2XB 1N2ZA 3O4JA 1J90A 3UNXA 4DJEC 3M4YA 4N8DA 4QUEA 5F3RA 2ZDGA 4YAWA 4TS3A 3PL5A 4TTRA 1ZGAA 3FNQA 4QZVA 4NU8X 4OJKA 3AR5A 1JR2A 3I2IA 2B9EA 3ZZNA 1ZK1A 2QL5A 3E53A 4X3CA 4P3XA 4Q7EA 2IBMA 4EIWA 4X8LA 5F1YA 2YJTD 3N07A 4OUDB 2EFYA 5FOXA 4BX9A 2R47A 3LRXA 4ND3A 2Q2OA 3G49A 3T3PB 4GLOA 2B35A 4OAQA 3NRBA 1K6EA 1Y8RB 1SHUX 2B6HA 1XCBA 3CUKA 4G07A 1G3MA 5L3VA 5CA0A 5C5EA 3TK1A 1H0HA 4GBED 4M1ZA 4YT5A 5D00A 4EATA 3DL4A 2Q5OA 1GGKA 2CK3A 2PBFA 4MVYA 4P6VF 5BW6B 1ZH6A 2LKCA 2F1IA 2ZVQX 3IQXA 5EFZA 4G2NA 5D3MA 4EEKA 1U9ZA 3QVOA 4TRJA 4RDHA 2Q5JA 3DF7A 4MGIR 3KJNA 1JWBB 2AYZA 1YBFA 1XNQB 3A0UA 1VLMA 1BU8A 4HDRB 2M6LA 3L40A 2PZGA 4TLLB 4O25A 3AEQA 2JLSA 1XDZA 2J6BA 2VBIA 4L73A 5H80A 5D6NA 2GCPA 2AV6A 3ETJA 4N3GA 5DPMA 5IZCA 2QMEA 2NP6A 3P2YA 1J0DA 2Q0QA 3CRMA 2BHTA 2A92A 3PQ4A 1Z2EA 3KG2A 5ALGA 3D4LA 5EUMA 5LB4A 1C5KA 1SZDA 3MPOA 4DJDC 1SUIA 2ZANA 5FWDA 3P9CA 2CVFA 3D8SA 5AFSA 5FLEX 1FOEB 1D9XA 1W9HA 1EEXB 2GCGA 2ZB3A 4GZ6A 4JYMA 4J6EA 4TXMA 1PTJA 3ORHA 3PUXA 4YJHB 5AMXA 4D1YA 3FOFC 2ZQZA 4I5FA 3T3IA 3DAPA 1P2DA 2PE5A 3SBEA 5C4GB 3R44A 2WJHA 3N2KB 4S1NA 1OH7A 3WFZA 4ENRA 2WA2A 4PRLA 5F9MA 4OY3A 1VE1A 4JV5B 4PYNA 4PFJA 1NP6A 4CV0A 1GQRA 3HJBA 4TYPA 3AETB 4BATA 2W6MA 1ZCZA 3Q1LA 4MX8A 4CR6A 3Q7PA 1JEJA 2F00A 4NJMB 3U13A 3MS7A 3ZBQA 1NNSA 1HOTA 2GZ2A 3BD8A 4G9GA 1T34A 1S0UA 5TDHA 1XVAA 3INGA 2R8OA 1M2WA 2E4YA 1J8FA 5CRIA 5C4IA 1NULA 2X4GA 3BX1A 1DNPA 2CCGA 1XRMA 3DYBA 4WY2A 3CF2A 1BX0A 4I4IA 1GM5A 1YDGA 2OVFA 4MR9A 4UD2A 4XUEA 2H4ZA 1CUJA 4QELA 3JSAA 5THKA 2O7VA 1NIJA 2C1ZA 3C6KA 2QRUA 3KB6A 2Y0CA 5CW1A 1Z29A 4QYSA 2J08A 3GPIA 3U7QB 4BO6A 1TECE 3VYTB 1ZK2A 5DTMA 2ZE5A 4L8GA 1SXQA 5EGNA 3TW8A 4BU1A 4MI3A 3AY7A 5ES3A 4Z0HO 1E1KA 3P52A 4OHVA 5CDHA 1JFFA 1HBJA 4DCTA 4KI7A 1HMPA 3W5DA 4BFSA 4NV0A 3K5WA 5K0ZA 2EL7A 1TKAA 1PUIA 2UVQA 3IO5A 5LDDC 4FFSA 1IXRC 4X93A 1T8TA 2AX4A 1UBUS 2ZUCA 3LVQE 4R51A 3BL8A 5AI4A 1L5HB 1W25A 4YT4A 2GD6A 2V3CC 4PINA 1QB8A 4IGAA 1N2OA 1XA4A 1KE2A 1TQ2A 5JAUA 2VCYA 3NW9A 2E4ZA 4HQOA 1AKTA 1JZTA 4IBOA 4IHKA 3W8NA 1WL8A 2AC2A 1ZK0A 3RLIA 1OT5A 3ND5A 4KXMA 3OJXA 4V3BA 3SQNA 3H4IA 3S1LA 2FKNA 4MIYA 3H17A 1Y82A 1NASA 1F17A 4MWGA 1UPUA 4RIGA 1M8KA 4FLFA 4MARA 4ND8A 3VKUA 4V02A 1SWVA 3AP2A 2CXXA 3H2HA 3QU7A 4NEGA 3KV3O 3R0ZA 3TSOA 2Z1MA 3DFMA 1S4MA 4GFDA 1GO2A 4JLNA 4NDAA 3UXEA 4CEJA 1FSSA 3I12A 1YMVA 1N6NA 3A6FA 4N4AA 4LOLA 4NESA 4BMNA 3H2BA 3TZQA 1GPWB 2JLZA 1T29A 1P1KA 3SYKA 3L6EA 3EF0A 4Y2VA 1G6HA 3AEXA 3M5CA 4LYGA 2C82A 4YJ2A 3PPWA 4DLPA 1B14A 1PGQA 2GPNA 3BVPA 3BG5A 3HU3A 1FJGB 3SQXA 5JFTA 1JJVA 4UUOA 5LBIA 2X7HA 4AL4A 3DKKA 1DKRA 5DBFA 1Z5PA 2A1UB 2HJRA 3GUUA 3LVBA 4GRIA 2CHQA 4JY7A 4M0DA 4Q24A 1PR0A 3LWNA 5CB8A 5JS6A 4MQEB 3GLIB 1ZKMA 2P8SA 4BV2A 1NF3A 1UKCA 1UPXA 2B36A 1P4GA 3P9RA 4WXPA 5K05A 3W4IA 4MR9B 4B71A 1M5RA 2VPTA 3AR9A 1XK6A 3H8JA 1QU2A 2W37A 2RHGB 3CPJB 1ZONA 5DGTA 3RFUA 1CJKC 3GLUA 2ZYDA 1CUSA 5EMJA 5FOQA 1TTPB 3PPIA 4ERNA 2ZQ5A 2YN2A 2JFPA 1EVLA 2G9ZA 2BCJQ 5KCZA 2J3EA 1BE1A 2L19A 5DHQA 1JPNA 3TTWA 2X58A 1QIIA 4GPZA 1P0CA 3ZZTA 2I1QA 2RAFA 4ME6A 3NDPA 3RUCA 1J56A 1WEKA 1DLJA 4I1VA 1IN8A 4BEBA 4LPSA 4YPVA 4GOMD 4RXUA 4D57A 4X66B 2O20A 1VLZA 2QPAA 5K6AC 4ENTA 4GF5A 4RGVA 1GSOA 3FKSD 1E5QA 3ZE1B 4FMCB 2J33A 3RSZA 4ENQA 4XFKA 3I76A 5AUOB 1HFJA 4GLBA 2KW5A 2KBFA 1YMQA 4KFUA 2IJGX 2IYZA 5JO0A 4Q01A 3A8TA 1CQZA 3JCZA 5EE3A 3ZHSA 4R3NA 4C03A 5KQMA 4KR6A 1KQOA 5CYFA 3HCBA 1T0JB 5EJ7A 3CVVA 3MINA 3QE0A 3QOYA 4GIBA 4J2OA 4R2JA 4ETMA 3KEQA 4JP2A 4ZCMA 7ADHA 5K0CA 4GZLA 1Z2PX 4H0FA 3MJTA 4M38A 2C54A 5A05A 3U5TA 4QDXA 4QU9A 4CQJA 3BGVA 3Q7IA 4ALMA 2FN4A 3DLTA 3B3FA 3GPBA 4KKVA 2LWIA 1IXKA 1ZKDA 3WMFA 1YIAA 1B00A 4JOQA 4MHSA 4E32A 5KOHB 2XBMA 3DDZX 1R6BX 3SGLA 4U3JA 1HDYA 1Z07A 3T7IA 4OJTA 4WECA 4D81A 5KNBH 5TQVA 1Q6ZA 4U2EA 3WR5A 4ZYUA 4G81A 1XMPA 1S2MA 4DLLA 3R0XA 1VLLA 2BLNA 4K6HA 1YTUA 3OQPA 2WAOA 4GMXA 3B36A 1YJ8A 1PD0A 2AZMA 4JCOA 2WZCA 2PGNA 1KMMA 2WFLA 4DGQA 1NOKA 4JLAA 3ZGLA 4CL0A 3QP9A 3JWIA 1M73E 2JFBA 3HJHA 3ZLBA 1FX1A 1X2EA 1B8OA 1XZLA 2PMWB 3OWOA 3HU1A 3SQDA 1BX1A 4EQZA 4ZVMA 1PT9A 1SBNE 1WW3A 4NNJA 4KLZA 3SDBA 4D44A 1VKJA 3ZE9A 4HQNA 2ZSBA 2CMFA 2GYYA 4UNPA 1E77A 1H6AA 4NBTA 1L8LA 1TQ8A 3L18A 3OPQA 3UK2A 1BX3A 3EZFA 3VISA 4YDQA 4IDAA 1KYXA 4KN6A 4JI7B 1TKCA 2NT3A 2XRFA 1QRDA 4BJ6A 3OTHA 1QTRA 3QPDA 4FDMA 3IUQA 3WS7A 2DY1A 4C7MA 4IIYA 2AD1A 4UVGA 1DIOB 2XYQA 1NDUA 4IWXA 3LYHA 1YD7A 5FQOA 5CD1A 4HJRA 2W4MA 3KK0A 2FF5A 5FH9A 3B1VA 1GNTA 3FPBA 1ZR4A 2BFCB 3G79A 4UNNA 2CMDA 1Y1LA 3QNUA 5HBRA 2BY4A 4G6ZA 5CT4A 1A95A 1AX9A 3LPAA 1Z0ZA 2IY8A 3DUFA 3GARA 4FW9A 1CQJB 2Q1TA 3QX8A 1QKKA 2PSJA 4Q4JA 2B1RA 4RFSA 1L5WA 2NXCA 4WESB 2O8FA 3WLSA 2XMGA 2G4CA 2NZ8A 2O07A 3EC1A 2MU1A 3JQ9A 4Z5XA 4EH1A 2E48A 3KXLA 3VZPA 4DG9A 1AO3A 4QYTA 2YFQA 3A37A 4ZVVA 4R8RA 3KNZA 1K7EB 1QDLB 2YTZA 4GOXA 4OBEA 1BHQ1 2GZMA 3I05A 1UMBA 3IAHA 5DCWA 3RG8A 3DBHB 3IEKA 1CYEA 5THQA 2YV2A 2WHPB 1GPLA 1GUFA 1NPDA 4RJKA 2GQ0A 1RI2A 3UPTA 3A6LA 3SM3A 2BD0A 4F8EA 4NFSA 2P90A 5A6VA 1YJAA 1EVZA 1FDIA 1MGPA 1JW9B 1Q6YA 2FPXA 4N5DA 1SH7A 5AK5A 5BQ3A 3T4UA 1UXGA 3FPHA 4DB2A 3QV1A 4RY9A 3MTIA 3I9LA 4HQRA 3WBJA 2CDRA 4H7FA 1EK2A 3KT0A 3FHCB 3F5QA 5AM3A 2BFNA 1ZXXA 3PCTA 1ULZA 1BCSB 2VYNA 5A9SA 1WTCA 3I6YA 1G59A 1NBME 1VSQA 2JJ2D 1Y42X 3DVAB 1I4OA 5AJUA 3ZHBA 4CF5A 4E13A 1TEZA 2J4CA 5KJ1A 2JCBA 4NWIA 4NZZA 4C0LA 1W87A 1T0IA 4BPRA 4ZOBA 5AVOA 4Z2AA 2Z5GA 2RAVA 1EJ2A 1LW6E 1L7PA 1ZCJA 2I87A 3AF0A 3CV3A 4HXYA 1FFBA 3WK8A 4RPHA 3D64A 1WAMA 4ZOLF 2UZ4A 2HM7A 1TD1A 3SHWA 2ADFA 3BJEA 3H75A 4CDMA 4NYJQ 4RF4A 1NYLA 1YB7A 3FI9A 4OI0A 4DMGA 3HL4A 2I99A 4O2AA 1I3OA 3PIIA 2UUPA 3BWVA 4N76A 4E5SA 1UCFA 2ZAYA 3KPWA 5DNEA 5CA1F 3QE3A 4P7GA 2ZTVA 1HORA 1AHHA 1IM2A 1IZYA 1MJ5A 3HB7A 2YXPX 3N8HA 5K0FA 3L84A 3S68A 1L2TA 4R68A 4FCCA 5LFAA 1TPZA 4NBNA 5E9AA 2PS9A 1SXGA 3OOWA 3SJZA 3EW7A 3M3PA 2F1RA 5KHOC 2Y8EA 2XDQB 1JQ3A 2Z4TA 4Q7LA 1QRSA 1VHTA 1IYZA 2P4QA 2VWQA 3B1FA 4X1IA 2R2GA 3PQ8A 3CPHA 1W34A 1FFYA 3RSHA 3NUGA 3OECA 1N9KA 2Q28A 4LZOA 3IQWA 3VKGA 4PLZA 4QRHA 5FA6A 2PUEA 1OKKA 4BVJA 2VT6A 3WAGA 2TSYB 2H1VA 1MH9A 4A9AA 5JH7B 4FYPA 5A7GA 4QUKA 2K7FA 4IPTA 5E2BA 2Z6QA 4KREA 2OECA 1RJ9A 1XVTA 4C29A 2XMPA 1R3DA 2N47A 3LM8A 1HEYA 3LT1A 2C3PA 3EWSA 1ZINA 4D4KA 3B8EA 3U37A 5HWSA 3H99A 4CCYA 3JYQA 2MSCB 3QKTA 4IVRA 2GHTA 4PGFA 3VV3A 2PX0A 1KVTA 2B8JA 5T3YA 2VJQA 2LV8A 2WQZA 3B6EA 2DWCA 2WT8A 3CNOA 1YS7A 4G0OA 1AV7A 3VU3A 3OQNA 3MMPA 1KPHA 2QP3A 4FYHA 1AB6A 1HO3A 4MR7B 5AJTA 3RC7A 5JXWA 3LA6A 4M87A 5JJLA 1HC7A 3KKQA 3OCCA 1RHKA 4WK4B 1GYRA 1J0EA 1VE9A 1SCNE 3DBRA 1KY4A 2QQGA 3WQBA 4Z7JA 4MLPA 1RXEA 1NT2A 3KSRA 3PNMA 5B3LA 5B2FA 1OHHD 2V5AA 1BKYA 2BFAA 2XOXA 3N75A 2AUNA 1IUPA 2IHTA 2IYTA 1OX4B 1XDUA 5B4VA 2FW6A 4QUJA 1O94D 4OK5A 3UPUA 4QIHA 2QNIA 3ANLA 1KJYA 5H0IA 4WCVA 2UYCA 2D7DA 1KMCA 4WADA 1ATIA 4EHFA 4IJUA 4RA9B 3BAZA 4DE5A 4ADSG 4Y9SA 3CH6A 3E61A 4JJ8A 2EYUA 1XDSA 4XLTA 3Q3JB 4F3TA 3AC0A 2QMZA 4HAWA 2AE1A 1XF9A 4BJ3A 5E1OA 1U11A 4E07A 3L8EA 3NHLA 1FTNA 3UWDA 4LYDA 5L3ZA 4LWZA 3STUA 2PRZA 1O8CA 4CIAA 3Q10A 3FN4A 4J1TC 3MLBA 2VJBA 1USKA 1YZTA 2XNCA 4JOBA 5IN5A 1ZGBA 3HY3A 4BGVA 4X71A 3QLVC 2AQ8A 1VE7A 1ZSNA 2DFLA 1ADJA 1IOVA 3AVYA 1N9ZA 3K96A 5JE8A 3G8CA 1YWGO 4KH0A 1IEWA 3M49A 5DVZA 1PV4A 3FMIA 3ZBPA 1U9YA 3BGSA 2VJDA 4X1OA 4B8WA 4HAUA 4NEHB 3ZDZB 2O1EA 4FOSA 4D5GA 4PVDA 1E2BA 2FUCA 3TXAA 4EW6A 3Q8MA 2WWGA 3FPEA 2IIQA 4BUZA 3K15A 1I1OA 3TTYA 1PT5A 3ZIAA 5BMVB 4PM4A 4CE6A 3BZBA 1OFGA 1GZ3A 2E85A 1BN7A 3MB5A 3L7IA 2K2WA 2OLEA 3OLYA 3BYZA 3DCIA 1ESEA 3E9DA 2R7AA 1NQOA 2PV0A 4PLFA 4TSFD 1WKVA 4EVRA 4KV9A 4BZQA 1G8SA 1U0HC 2D8AA 1Z08A 3MZ0A 1X1SA 2NVWA 3HVIA 5LD2B 2VI5A 1WCYA 2X8WA 5FLXA 4X1KB 1CCWA 2A5GA 2BP7B 4JEHA 4XYBA 1XZFA 4ZGGA 3N86A 1ZBDA 2VP0A 1R0XA 2IA5A 1X7ZA 4CDGA 1LBIA 1AUXA 3NGLA 4ZAVA 3ROEA 3WVNA 1W5FA 4LK2A 5IBRA 4G5FA 4YRSA 2L69A 2SICE 5EC8A 3X43A 3GC6A 2V7QD 3LQ4A 5IWAB 1E5XA 2ILTA 3OCYA 1TD9A 2JJYA 3II6X 5IEBA 1KPGA 1Z33A 1ZGHA 2IELA 2YL2A 3AWDA 3CNQS 3K0FA 1QJ4A 4DSZA 3OU7A 2J3HA 4Q7MB 4ZYWA 1WHTB 1QE3A 2QW8A 2H2FA 4KVZA 2J0UA 4DRYA 5JIBA 2DTDA 4Y2QA 4ZVSA 5HM6A 2FEOA 4H7KA 3KELA 2OMKA 4W9MC 1I6WA 2I7XA 4Y9RA 5JNRA 4G0UA 4NYIR 2XB8A 3LMKA 4NJEB 1X8LA 3GAZA 1IRXA 1U2DC 3KCQA 4OA5A 5IM4F 5AKZA 2GDJA 4M8NE 4Q47A 3PK0A 5DTQA 1DADA 1CB7A 4MROA 3SBOA 1I13A 2ZJ2A 5CB6A 4ESOA 1QO9A 2J0EA 3RQSA 1O6GA 2X5XA 3WBFA 3KSZO 4B48A 2BGGA 2DF8A 1MENA 1USUA 3NWEA 5U1PA 1WU7A 1XXLA 4GBGA 4Q00A 1TMYA 2UZAA 4ZJPA 3OHSX 1SXPA 1Z5OA 2V98A 2WNHA 2Y4OA 5FV7A 2ODPA 5BT8A 5FADA 1W0KA 4A16A 4D2IA 2CXTA 4K9SA 4DHEA 2H6EA 3NYWA 4ICIA 1KYQA 4IXMA 4OSOA 1M1NB 3SF0A 3C14C 4L5AA 3H0CA 2I6GA 1B8NA 5KYNA 2QRGA 1TYZA 1B6TA 1SUAA 1YQQA 1AUQA 2A67A 2WUVA 1C9MA 3KYJB 1PAUA 3PVZA 1T6NA 2IW1A 4R54A 4FWBA 1JYFA 2G9UA 2PZ8A 2A14A 5IF9A 1ZUNB 2C9OA 2UXBB 3C3BA 3CVOA 3K5HA 3AEKA 5MN4A 2JJMA 1SPXA 5CJPA 2WDPA 4HVTA 1G9SA 1DWUA 3DXZA 3KHSA 4M76B 3T9FA 1BQEA 1I80A 2ICAA 4TLEA 4CMAA 4ZO6A 2Z98A 1FZTA 4INZA 4EECA 1EQUA 1WUIS 3AM3A 5LOVF 3T7DA 4J43A 2J3LA 2XYRA 2XH8A 3C3EA 3ZX4A 3GVIA 2D4HA 3OOYA 2XTZA 2XXAB 2IOYA 2IU3A 2SECE 2X2FA 2Z6VA 1X74A 3H5WA 4KO1S 1J22A 3OJWA 4JKOA 2QT9A 3D3WB 4I1OA 1BHJA 4PTZA 2CZCA 3LHKA 4WEQA 1H85A 4HLUC 1G4HA 2LUOA 1E69A 3OKAA 4B43A 5KPJA 3RBVA 5I7HA 5CB4B 1JSRA 1UWLA 4RV4A 1QIGA 4GOND 4TXJA 3WKAA 5DLDA 3EH1A 3ZWQA 2PLAA 3GPCA 2P69A 2IS1A 3D3JA 4BTEA 1DC8A 2BOVA 1JG3A 1AKRA 4P3YA 4ZDJA 2Z30A 2ZIXB 1FYWA 2BF7A 2AJDA 3LCUA 4Y2UA 2FWBA 2CWDA 3RRJA 4E1AA 1IIBA 1OIWA 1SAYA 3KHTA 4PO3X 2F9MA 3T1TA 1YJXA 3EHEA 1A9RA 4XVHA 2XAUA 4PSVA 4TMKA 4DAEA 3EEOA 3HM2A 1XN4A 4E12A 3C6YA 5E2IA 1P5ZB 3RU7A 2HO5A 4Y6SA 4D82A 2PH1A 1YA4A 4UHCA 1SKYB 3WGJA 4EFKA 2W22A 2VH2A 2R8XA 4OLAA 3PNBA 5IC5A 5JZBA 4I5GA 3G9QA 3VO8A 1TIKA 4RZSA 4H1TA 5EMHA 4D9HA 2GETA 3C8DA 1Z2OX 1KWGA 3FNHA 5K9ZA 1BA2A 2GUGA 4DWVA 2CDBA 1MFZA 4TRRA 4U6NA 2O7QA 1N8KA 2QMQA 4PS0A 1ZW1A 1CFZA 1DG3A 4A0HA 3IUMA 2P2LA 3G0BA 2VP9A 1B74A 3RROA 2OK7A 4BVEA 1AV6A 3GFOA 3NPAA 3GA0A 4EAAA 3KKLA 1XAGA 4BMVA 1IMJA 4YO7A 5C81A 3ANSA 5FI1B 4E33A 1UFVA 4BIMA 1BAPA 1IXZA 4M89A 4MAMA 5EL0A 3G6WA 3G89A 1V5FA 2V9ZA 2Z2YA 1UIMA 3E2MA 2B99A 1KFCB 2C3OA 4HJXA 3EYAA 3N2ZB 1MO2A 3HHEA 1Q57A 4YVFA 5DO9A 3RU3A 4ECAA 5JVDA 1QVVA 2JDID 3RASA 3WP0A 1UFQA 3SDZA 2BKVA 3HXPA 1HZZC 3AEQB 1QAMA 4L9WA 4QPJC 4FFLA 3HEBA 3NASA 1P9RA 2KPOA 2QYOA 1ZJJA 2QN6A 1SO8A 3GRUA 3NONA 3ETCA 1L6RA 1XQ6A 2P9CA 5JPCA 4PGAA 2C4TA 1WVMA 1Z6GA 2FR1A 4WVFA 4DC0A 4ROSA 1QDEA 3WNQA 5EZ6B 1JU4A 2XZOA 3OM0A 1SQ5A 3MJRA 3EFEA 5CDYA 3V97A 3HEMA 2ZCJA 1I24A 3GRYA 3I32A 3EGEA 2WB2A 3TBFA 3FBGA 3I6BA 3RFCA 4URHA 1EGHA 2EL9A 5CMLA 4L9AA 5HQ3B 4MUMA 1SBCA 4HEJA 4L4UA 5GONF 1ZL2A 4Q1CA 2P30A 2C99A 1L4YA 2P6NA 2X76A 4RMIA 1QK4A 1G4AE 1OE0A 3E22A 3EGDB 4S0ZA 4GC9A 4BO4A 5HIIA 4PC2A 2AG5A 2V7WA 3V8QA 1LF5A 2JLAA 4DCOA 5DW3A 1IONA 3L79A 4C22A 2ZI6A 3BRWD 1LU9A 2DPLA 1MGOA 1GT91 2FQ1A 2HD4A 4MLZA 1FW8A 1R9NA 3T5TA 2JGIA 4Y1RB 1PR6A 3BJZA 4WBNF 2XUOA 3KD2A 4JHXA 4E7PA 2B20A 5EE0A 1E9AA 3UQYS 3H6HA 1N32B 1GL6A 2P11A 2PZMA 2Y1CA 2XWJI 2W2VA 4H3HB 4TTAA 5TMDA 3CX8A 3DTYA 3MA0A 1OROA 2OBFA 3MPUA 4P08A 1JKXA 2N0SA 1BVUA 5F64A 2RAUA 4LV8B 2BTQB 1D4ZA 3I9NA 4DMFA 4F1KA 2GXSA 3RT7A 3C8MA 3BMOB 5IXJA 1G20E 2Q21A 3UAWA 3U61B 3QUCA 2DLNA 4FI3F 4Q9AA 1YDFA 3QU2A 1FTSA 3CM0A 3AOEA 2A86A 3IULA 4FNOA 5TMPA 2DUNA 1JR6A 1GG5A 2YJGA 2IS6A 2UVPB 4FBLA 1E3DA 3MT9A 3UN1A 4FZRA 4KNVA 3CG4A 5CM9C 3CS3A 4FFPA 1PJ8A 4TT3A 1MAVA 4LJKA 2IV2X 2PRKA 2Q8PA 4ISBA 4ZT7A 1KC3A 1AS2A 5FV4A 1EM6A 1U4NA 2F17A 1KI8A 4J0IA 3TZ6A 4MA5A 4A27A 5G41A 3GRRA 3Q2KA 4EUFA 4AO7A 2H1LA 3PQDA 1F7VA 2Z5LA 4Q37A 4CTKA 3KDPA 1DDGA 4JXZA 3BK2A 3KYIB 4A82A 3TG8A 3J7TA 1L1FA 1ZDMA 1R8SA 3M2TA 1OWOA 4OHXA 1JIVA 4MWBA 4ZO8A 1TKRA 1MW8X 4AY2A 5COAA 2GKOA 2ZIVB 4JB2A 3L92A 1QZTA 1RMYA 2KI5A 3NP7A 5BVGA 1MFPA 3CONA 1DRVA 1JB9A 2AI2A 1DEHA 1YBHA 3UHJA 1DQSA 4OXNA 5J2UF 1QTQA 1R0SA 2PPLA 1I6MA 1TK3A 3K20A 1WB9A 2AW3A 3IS3A 3OCJA 1DTWA 4PV7A 1QDUA 4BFCA 3IEXA 3PPXA 3FR7A 2QRLA 3NHMA 1JKIA 4H6PA 4O2LA 1UAGA 1R0CA 2R96A 3CYFA 4O02B 1T3TA 4S35A 4XFJA 3PTZA 5FO1A 1A9TA 4K2HA 1WQ4A 3TFWA 4JVOA 5CLFA 4H60A 5JV5A 1T8YA 2JL1A 1GTMA 1CRLA 1THMA 1V4BA 4Y1RA 5DXAA 1AJEA 2FOIA 2NGRA 4Q16A 5AM5A 4JI2B 3IT0A 3IT3A 3ZKWB 4CR7A 1DUIA 4URVR 4YPOA 2OKGA 2P5TB 1J1IA 2HDWA 3D2CA 3GPLA 3NOOA 4QGAA 5C3MA 2EBHX 2QRNA 3C2QA 5ISMA 3K0FB 4B2PA 4QYXA 5BSHA 4JL8A 3H05A 1CZOA 1RKUA 5DHUA 3ZHOA 3BXPA 4BYMA 5BUCA 4GGOA 3NIGB 4N0PA 1NUUA 2ZVPX 1E7YA 3H5OA 1O2DA 4HX2A 4NICA 2XQJA 2ZETA 3W7VA 4MH0R 3ILSA 4BU0A 2BFEA 4XM0A 1ZRNA 3BMQA 4BUJA 1H5UA 1O97D 2VXBA 3B5IA 3DLPX 4GS5A 5CB4F 2BHSA 3VSCA 4EUNA 1I9GA 1OIXA 2PX6A 2XECA 3O1IC 3Q9UA 4LOHA 2QT1A 3FKQA 4PZDA 3BB3A 1FVFA 4NFYA 3N70A 4P3NA 5AK0A 1QUFA 3WK5A 5BN5A 5FWYA 1V3UA 1KKMA 1QHHA 3I5AA 2FUNB 4X6UA 3DMGA 4IXNA 4OP1A 4D25A 1W36C 1FB5A 1NBHA 2Z3ZA 4PHHA 3VU9B 4NMMA 1ONNA 4KO2S 4C5CA 4G84A 1YZYA 3LUCA 3HJRA 1W59A 3ZQKA 1YB2A 1K2VN 4ER3A 2W98A 3Q3GE 4ZAFA 3E6AA 1SXJC 5BO5A 4XCQA 1XCMA 4EX7A 1Q0RA 3NTLA 1UKYA 3M4XA 2ZB8A 7MHTA 4IX1A 4QNMA 4EQ6A 1V1MA 4IDNA 3GHHA 1R88A 4DDHA 3PJEA 4LHYA 2FFBA 4DT1B 5AVTA 3KL2A 3PLNA 3NIFB 3KKNA 4GBMA 3T41A 4A8JB 5K5EA 2R4QA 5EJ9A 2QN9A 3N7TA 2C1XA 5C7OO 1GUZA 1MABB 2QN3A 3JZDA 2PGIA 3C45A 1KY2A 3EDMA 3L7AA 1CUUA 1ZK3A 2WJPA 3I72A 1E6UA 3QNWA 3G2NA 4LDRA 2IYRA 3HNPA 4Q3OA 1CNFA 4Q82A 5KHAA 1W47A 2YV3A 1BVHA 1JH8A 1GQOA 1FY2A 3KEMA 4PN7A 4YCJA 3LBHA 4X9XA 2MINB 1H2RS 2FSIA 5LZ5A 2WF7A 2WWIA 5GJVC 4DLAA 1UDXA 1QPBA 3GBPA 2BMJA 3L05A 3QBTA 5AKJA 4DA9A 2HZBA 5JARA 3L8CA 2ZTUA 3WJ1A 1E3WA 4U2KA 2XKBA 4BBAA 4X62B 1Q22A 4ARCA 2WFLB 3LVFO 4EZEA 3QE4A 1K3TA 2IZ7A 4OB8A 1K7FB 3AI7A 3OIVA 1KP2A 3OSUA 3FAKA 3MWEB 4YCAA 4EW2A 4G9BA 3V8MA 2FQWA 1LVUA 1T13A 3CEPB 2D0IA 1XF1A 2QXTA 3U39A 2H1CA 2QM0A 3CUEF 3FUWA 3JRXA 4EO4A 2N42A 5HJ5A 4KFTA 3K1ZA 3EZ6A 2WJGA 1NC1A 2A30A 4CIXA 3EGIA 3DDUA 1RAEA 2DKFA 2YZNA 3KXDA 1FEZA 3WFIA 2W6CX 2QLFA 3NFRA 3B9RA 2HY7A 2B1GA 5GV7A 1F6WA 2Q3DA 2RHJA 4IWNA 2EX4A 2EKZA 1H69A 1SIOA 1SC9A 1UIRA 1R7RA 2YY6A 3QGMA 4J4TA 1YK0A 4PSUA 4XIIA 1PS8A 4HDKB 2PKXA 3ON5A 2PR2A 3HJUA 4GXNA 3S2UA 4FKMA 3IA7A 4KI0A 1JDBB 1V4NA 1RXSA 1AKNA 3F5MA 4OXKA 2NU8A 2FN9A 4L5CA 1ZEMA 1L7XA 2NXNA 4UULA 2B5WA 2I3AA 3GCDA 2JIDA 3JAKA 3SEAA 4GLLA 5KB3A 2JS7A 4R83A 1X9HA 1RAAA 3JQCA 1YR2A 2NV6A 2RBKA 5DBEX 3X1DA 5DMXA 3TB6A 4EI2A 2IKQA 4H7PA 2VUUA 4LHXA 4B7UA 1TGVA 1ZIPA 2I3DA 4G63A 2BCEA 2FMKA 3STXA 2YZ2A 5K3FB 2YHSA 4JQYA 3KE9A 1IHXA 3K1TA 4G67A 1KSGA 2M32A 3N0RA 5IH3A 1Z5GA 1LLCA 1Q7TA 3MJCA 4HHEA 3TM4A 2D0DA 2JJ1A 5FOSA 2C0PA 3QVLA 3O4IA 3BWDD 3IJRA 2FSHA 5HMMA 1Z2CA 1KZHA 5JSZB 1A69A 1BD4A 3GQBA 2ZJ6A 3HDVA 2CVPA 4FOLA 4HEHA 2GPWA 2C2XA 3RODA 2H1WA 5C1IA 5FTKA 1IJFA 4DQVA 1THTA 3R6DA 1SCAA 1DLIA 2HZ7A 1P73A 3ROMA 3I5MA 1CB0A 1P4JA 1P1IA 1J00A 3LQFA 4R1PA 3HBLA 3OLCX 3ESCA 4IDBA 2VXCA 1H1LB 1I3LA 5IRCD 2G28A 3M9XA 1U9CA 3KOMA 3DT6A 4ACBA 2XWPA 2CT8A 1V7QA 5ADUS 3UA3A 1RFLA 4BFXA 4EJSC 2FQQA 3KXKA 1NF9A 4KQIA 2FETA 3LCJA 4MVXA 1U0BB 4AWBA 3U26A 1U0NA 4TMTA 4ZU6X 2H2HA 2WM2A 3CEAA 2XNSA 3AFGA 5BVHB 2A9JA 1Z6PA 1ESMA 2V7TA 4LXQA 2A59A 1EUYA 5A9SB 4ASUD 4W7SA 1H65A 4D9BA 1LQUA 1XWFA 3R40A 3SDSA 4B6PA 4GI1A 1NUQA 1V26A 1CVIA 4YAUA 3ASVA 3R5TA 4QULA 1M2NA 3AM4A 3KDAA 3KYDB 3W3AA 4FNMA 4ZODA 3VKFA 4ZJZA 2IPXA 5BP7A 2GPSA 1JEDA 1HE4A 1V6SA 5EQFA 1O4WA 4CYMA 1JWAB 3IELA 4PW0A 1KJQA 2WU8A 4ODIA 1HNXB 4DVGA 3TE7A 4H1HA 1KJNA 2IHJA 1RVDA 2IY7A 4NBKA 5AHXA 4HDQB 2PA0A 5LKAA 2JH9A 1T36A 221PA 3BE5A 3KJEA 2BEUB 3LQQA 2Q3MA 1NZFA 1LSOA 3TRIA 4PHFA 1KEVA 4YYZA 1YK1A 3ENNA 2X9QA 1C30A 1RSZA 3KLBA 4MIKA 4TV8A 4EFDA 2BSQA 5PNTA 1RI4A 3QKWA 4OQLA 1DRJA 1P80A 1OW3B 1ZM2A 2ZU6A 5C53B 4RVDA 5AXBA 4FUQA 2O0MA 1HQKA 4LEIA 2B4QA 1E6MA 2D1YA 3A70A 3C3AA 4L7QA 4WHMA 5CNKA 5IARA 5KCMA 2CHFA 1WXDA 4HGQA 2AFIA 3S2IA 4MDHA 3Q85A 1RLJA 5FNVB 3OD1A 2R6CA 1DKLA 3ECCA 1EFKA 4RHCA 1ENPA 4GLFA 1EINA 1CETA 3C3DA 2I80A 5JCJD 4ER6A 2ODNA 3QEMA 3MB8A 3I8XA 2PT5A 1H42A 1C0PA 5BYBA 2TMKA 2VHCA 3V1LA 2D2FA 2HHLA 3QSGA 3ONEA 2X7JA 1R8YA 4KU4A 1QCYA 1RWBA 5KNLA 4AIIA 4HQFA 2I54A 2HJGA 2QRZA 4LXUA 5B5SA 3VAYA 1P33A 1OFUA 5AI9A 1DJQA 1G8AA 1KH1A 1FLAA 1MQ8B 3QITA 3K3PA 4CG1A 2O8CB 1ZH2A 5BURA 1UBKS 2HTEA 3WHLA 3WWZA 3A6JA 1MJHA 1XU4A 4FYVA 3VR1A 1TM4E 4ZMBA 5F4ZA 3RVLA 3G2OA 4DA0A 2QAGB 1NV9A 4YBZA 1NY6A 5CYOA 3GGPA 2PSHA 1B2RA 2HCTA 1VGRA 4LY0A 4WK6A 4ZOLB 1QB7A 1F14A 2AMJA 3L7BA 1V1RA 1VPVA 3IJ5A 4IY1A 3RO7A 4XQGA 3T5AA 4RTPA 1FXUA 1RMTA 3EGXA 1A5AB 5HG0A 4WNIA 4TV8B 1PJ3A 1PNOA 4WI1A 3RJMA 4CGYA 2REQA 2VPYA 3H5TA 4LXTA 5G1OA 3TYXA 3KZXA 4F2WA 3MXTA 1W88B 3M81A 1UXHA 5P8WA 1KZYC 4PXYA 1AXGA 3AHIA 1SVOA 3QVTA 1E64A 4L8LA 4E94A 5KKAA 4JI3B 3AKEA 3DFUA 4GI7A 5T6BA 5HIMA 1BEZA 3N2KA 1GNLA 4CM5A 4M8SA 4LZNA 4YLYA 3WAKA 2JD2A 1A7UA 2O1XA 2K87A 1XB2A 1OX6A 3CMMA 1KK3A 3V33A 5KWJA 3PXUA 1E58A 1TO6A 2A9QA 2ONZA 3HZRA 3IAXA 3LUBA 1GL7A 5CU7A 1QQTA 2IPMA 2GK7A 3RS3A 2AVDA 5GM2A 4KDEA 1PJQA 1CDZA 3DOHA 1W4CA 4M36A 1XKTA 1OHHA 1IHPA 2B83A 2NQTA 4B35A 4NG5A 4TGLA 3BA1A 4B75A 4N47A 3RANA 4C9BA 2GLTA 1NOJA 1YTLA 1I32A 4OHYA 1FJ2A 5IYZB 2JFHA 4IO0A 5J1SB 5BV0A 1RPAA 5H9VA 4ATNA 3ZVMA 3F5FA 2QAGC 2AHOA 3O93A 3C70A 4JBLA 5DM1A 1A2OA 2QN7A 3B3QA 4JS0A 3RHZA 4RJJA 4A8JA 1Z5ZA 3JQGB 2J07A 4UEJA 1C9JA 1K3FA 3IBSA 4F7DA 3ZCRA 3FLBA 2W2OA 4IIGA 4DYHA 4M1MA 4ALNA 3VH1A 4KWHA 3NMUF 2ZFUA 3F2VA 3K2EA 2ODQA 2O2HA 1RBQA 2VHYA 3KZOA 2BMAA 4CCSA 5IXYA 3MGCA 2V7UA 4XE5A 4JP8A 4C4XA 1FTQA 4BWYA 3OC0A 3QE2A 5AI8A 2PS1A 1KFEB 1LDEA 1CY2A 3EVTA 3UUEA 4BGIA 3KZ1E 4NCIA 4GAEA 4QHTA 3NC0C 6REQB 4K9MA 1ZYUA 3P9KA 2FX3A 3HGMA 2FEWB 4KVGA 4ZXFA 3G2MA 5LXTB 1IZZA 3DQPA 3QY9A 4P84A 3S5UA 2G80A 1CUDA 2NUTA 3EIQA 1W96A 3PJGA 4TZTA 3RRNA 5JJBA 2X1HA 3OZSA 1LEHA 4RWZA 1GFSA 3TGWA 5LM3A 2JGJA 2XRMA 4H9GA 4NQZA 3I0MA 2PWPA 2PZFA 2C2GA 2G1UA 2CZQA 1QV9A 1ZOSA 2C58A 3U62A 1OA0A 1ZGGA 2B78A 2FXVA 3DFKA 3JAKB 4P4SB 3H6KA 3TAUA 3UJHA 5JYDA 4MQ4A 3SR0A 1P74A 3IXMA 1SUWA 4AX4A 3SIPA 3KWMA 3TW8B 1U7OA 2Z3VA 4H08A 1EB9A 2CXQA 4RVNA 4AULA 1KWKA 4MIOA 4E03A 5KU1A 1ZXLA 1N2IA 3QKSA 4MSUA 4AF6A 4KYTA 1ZM4A 5B4TA 2OGUA 4YAGA 1NMYA 1NN3A 3VC7A 3HUUA 2LW7A 4YRQA 1MTOA 2DR0A 2VTVA 3P2EA 4MWTA 4R98A 1AG9A 1NPTO 1RCTE 2AL7A 2QQ0A 4HC4A 1G5HA 2I4TA 1W93A 4HLCA 4HTFA 4S2UA 5I4IA 4EF6A 4WFIA 4Q4LA 3I04A 2VF7A 3B82A 2GK3A 3I64A 3Q7SA 2O8NA 2A6PA 1ILWA 1E96A 2DQSA 3NDIA 3OM8A 3P0RA 4OMUA 4OYYA 4BVKA 2WT4A 3O5AA 3GOQA 3H16A 3HFJA 1BDHA 5FI0B 1AT1A 1XU7A 1YI1A 2DQYA 3G8AA 5IBPA 4EI7A 3T3HA 3NAQA 4GO1A 4V1CA 5CDFA 3OE7D 3TMAA 1IC6A 3JR3A 1X7YB 1HLGA 3WLHA 1UANA 2ZJ4A 3NAGA 4UCXA 4BRUA 2D5LA 4D41A 1QFZA 3BCUA 4Z1MD 3EN0A 2IPLA 5CCXA 1QQBA 1IDN1 1K5GA 2WSSD 1PG0A 1KQNA 1V8ZA 4GBJA 4EL0A 5BMVF 2YFYA 2BR5A 4QKQA 1X39A 1QH8B 3AJEA 4IF4A 4OK3A 2CW5A 3EIXA 3KB1A 1ZAYA 2JGKA 2LCFA 3E82A 4JQCA 4AJKA 1C7IA 4BO3A 5LLSA 1K4MA 4Z9YA 2R8RA 5IUNC 4XGRA 3U0BA 1YCGA 4U02A 1SVNA 3L77A 4IOLA 5B1DA 4A3SA 4B6SA 1E2LA 3BB1A 4O59O 4BBZA 2SCUB 2FSFA 4O2AB 4BO8A 1N3BA 1KQPA 1C8LA 2W2TA 2NUPB 3B9PA 3JW8A 1P0QA 3BKXA 2I4LA 1G8KA 2HBQA 1KO7A 4IIXA 4XA8A 5AXCA 2C98A 4M0EA 4RW0A 2QVLA 4DJAA 1GFWA 1GSIA 4KBYA 4ZHQA 3GMDA 5BRNA 3EG5A 1Z0KA 3K7EA 4EAQA 4PVCA 1Z8DA 2PXXA 5AICA 2RHOA 1NW3A 1RADA 3L1HA 1P8AA 1YS4A 4HYQA 4UDYX 4DDVA 3WICA 4RSRA 2ES4A 2OHJA 2WWRA 3I9JA 1YQ9A 3VPGA 1CY0A 3OPXA 4C1BA 2R6HA 2Q5FA 1Q92A 2RJ3A 2Y0BA 4JMPA 4PLPA 5U4XA 4AY5A 5A5DA 2BMVA 2EEZA 3GRCA 2XADA 3MFYA 4N7BA 3RUDA 3PX3A 1KKLA 3ACCA 1E20A 2CN1A 2BFFB 1Y8ZA 4RLQA 4FMCF 2P9BA 2XDYA 4FKZA 1ISMA 4U1RA 1Z22A 4DPLA 1SR8A 1EH5A 5CTJA 4I66A 5JNLA 1YGPA 3QRWA 3QUQA 3AL3A 3OCXA 4I1UA 5UKDA 4LHWA 4CT5A 5BORA 5C4MA 2XVYA 1ODIA 2PFSA 2JBAA 2I2AA 2BUBA 4IXTA 4LSZA 4BB5A 4HVCA 1JSLA 3KQHA 3MSCA 5T57A 5D3MB 3UGKA 4F4CA 3HRIA 3OQ1A 2PVSA 5HK9A 2CBZA 2A9PA 4YBRA 4R71A 5I47A 4JVLA 4KNWA 4QUIA 3ZY2A 1NY5A 1PR4A 3DULA 3IPYA 3N59A 3OEHD 4M7OA 1P75A 2BHRA 2GLXA 2F8SA 3C98A 1NVUQ 3EGOA 4PU0A 2OUKA 2EAUA 1DKMA 1KJZA 4IFIA 3I9V6 3QWHA 4NOKA 2XUQA 2VJYA 4R2KA 5B36A 5AWFC 5K3DA 5BR1A 2VWHA 4DKJA 3ESDA 3SBDA 1PL6A 5BN3B 2G82A 4RE5A 5LPNA 1QRUA 2R68A 1UQUA 2FAXA 1MHPA 2OWDA 1FK8A 1XTSA 3HA3A 3UAZA 3ZGVA 3ZQ4A 3RVDA 1HPLA 3PJDA 3W1WA 1INLA 4B44A 1TVKA 4R8MA 2AZTA 3DCJA 1NW5A 2HK9A 2H0RA 4IQ4A 1D2HA 2HDHA 4Y18A 4QPNA 4YQEA 1E2PA 1QV6A 3ED1A 1U3VA 1I3KA 2O6LA 3P0EA 3S55A 4NOJA 4MWSA 1JE0A 4J75A 1JHPA 4HKTA 4UW9A 2FLWA 1O5IA 3LX4A 4WJKB 2R65A 1NW6A 1NV8A 1UKVY 2ERXA 5EZ5A 4XVQA 4BQQA 3ADCA 2WM8A 4Q34A 3O1LA 1O1YA 2XTMA 2D3WA 2E7ZA 2VNSA 3Q3VA 4H2DA 3OOJA 1IK4A 4F84A 3CVUA 3T1YB 4N54A 3H2JA 1YL7A 3FMPB 1M34E 1UT5A 2EIHA 3CXUA 4OLHA 3U80A 1GZ5A 3GBSA 1K8YB 1VHJA 3BDIA 2BMEA 1IH8A 2ETXA 4LJAA 1VDZA 5EHNA 821PA 4V0OA 2WIDA 4W6QA 1TQ4A 4G4GA 2QX8A 1VKOA 3MWDA 2KHZA 2YMLA 2ZJBA 4DLYA 5KYGA 1TF2A 4JI0B 2CF6A 4HR7A 3T12A 4NULA 3KQKA 3EQZA 2OYSA 1ZMXA 3QVGA 1V5GA 1K4KA 1VB5A 1D8TA 1A4RA 3KQVA 5KREA 1OBCA 2ZQYA 1QK5A 1Y5LA 4I4TF 2I66A 3PNYA 4Q3BA 1QH1B 4DLKA 5DGHA 1YZQA 3T3OA 3U3KA 4AIRA 1AQUA 3DOIA 2QTVA 5F4BA 4WK2B 4YV0A 3O21A 2ZYRA 4NH0A 4DR3B 1GPUA 1KDPA 2C7OA 1FMTA 3ZCTA 1T9GS 2BC9A 1HLDA 1M2GA 1ZVKA 3AIOA 4Q1BA 4X44A 4YJ3A 5FJIA 2HA3A 1ABBA 3FVQA 2ECKA 3WK6A 4G1BA 1EX9A 1PJLA 3GEPA 5D51S 4WINA 4XX0B 3RT1A 2G67A 5AD1A 4W6ZA 2CJPA 4HLDA 1RRVA 2OV8A 3KCNA 2C8VA 4LECA 1NAIA 1XU9A 2ZRAA 3CWCA 1H9AA 1IJEA 2JA2A 1M2OA 2OBMA 2XD4A 2RHBA 4N7MA 4YWHA 5JNUA 4C01A 5JXHA 3S44A 5CGQB 4OGWA 1HE5A 2LCIA 4L50A 1P6QA 1F9AA 2NZJA 3WIUA 4HEA1 4L8YA 3S27A 3U7RA 4N3CA 3UMYA 3VX4A 4Z8XA 2YOFA 2DHRA 3SFZA 3GVPA 4DPMA 5JQGF 1DC3A 2PXCA 4UREA 2FZ5A 3L8FA 2G83A 4K9OA 3SYTA 4FEAA 2FEKA 2Q4DA 3E2IA 3B70A 2ZUTA 2VZEA 2CXHA 2QT0A 4HDCA 5A9RA 3L0IB 1DJNA 1T5TA 2Q99A 4H1VA 4BQEA 4B3MB 1B43A 1U2TA 4CETA 3AY3A 3PS9A 4GMGA 3CN7A 1SC4A 1NRWA 4FS3A 2E0IA 1BTOA 2I6UA 2MR5A 2W6ZA 3ANMA 4ER7A 2FFJA 2C0QA 3EUWA 4EFNA 5JSZA 3WSTA 4B6EA 2MYUA 4ZRMA 4G01B 5F1PA 4EMTA 4S1OA 1BOOA 2ZPUA 4HWSA 1DBRA 2JFQA 4E14A 1C9KA 4WZ6A 5CYGA 3EZGA 4YTEA 4POOA 1TZJA 3GOHA 2IHBA 1D07A 4KL8S 1FP4B 1U0SY 1H2HA 5DGXA 5E7IA 1FFCA 3WC4A 2J9GA 3PXBA 5T8KC 3L1VA 4BGEA 4EEXA 2F43B 2PX3A 2X19A 1A9OA 1ZG3A 3RUHA 1A27A 5BR4A 3CW2A 2BFWA 3IRUA 2OTCA 1JXAA 3OUTA 2Q6OA 3N05A 4GSLA 5EVJA 3UCXA 2QTHA 3RU9A 3ZOKA 4KE9A 3G68A 3QXJA 3TPZA 1B8UA 3FKSA 3TFOA 1CF4A 2H5EA 3UMSA 5IKXA 1MIOB 2QRVB 3C4VA 1HTTA 4HLNA 4B6QA 3E1KA 3RYCB 4L78A 3HWRA 1HKHA 3K72B 4W1RA 1JECA 1IE3A 4MPJA 4KBFA 1YCHA 3VR6H 1IN7A 4NOLA 2GJ4A 5JI3E 3IDFA 3H3JA 2XWBF 4MYHA 4KQGA 4B3IA 1GD1O 1QF9A 4ZQHA 4LMRA 2Q2WA 4A7PA 2HLDA 1RRPA 1MO4A 3FBTA 3Q8XB 2R84A 4U7HA 1YRYE 4WWHA 4HAXA 4R69A 4BAGA 4JGBA 4N5MA 1KP9A 5JR3A 1E3QA 3V6MA 1OREA 3GVXA 2ZAOA 1XWIA 4L5IA 2NZVG 2FW7A 1G55A 5EJMA 4DIEA 4Q3LA 5AW4A 3ZK9A 4DA7A 2OV2A 3G7SA 5D5QA 1MQ9A 1JTFA 3LLVA 3EHDA 3X1YA 5JBNA 3EIOA 3MAGA 2DRIA 1ZNZA 4IDQA 1ATZA 2PPVA 4GQIA 2XT0A 1CHDA 1WHSA 4UU8A 3RS4A 3A6PC 3JVEA 2XEDA 3KP1A 5IAJA 2ZUSA 4D7AA 4D3FA 2I2FA 4X7RA 4TWAA 3X1ZA 4OVKA 3V7FA 3F73A 3A10A 4MS3B 1R3UA 1XMVA 2VP6A 4MUYA 5KSZA 3C7TA 1J8VA 3FB1A 1KTVA 6Q21A 4F5YA 1ML4A 2YYYA 1IFXA 3IILA 5IKEA 1C4XA 2X22A 2VR1A 1RKBA 3MTQA 4M1WA 4UBMA 5E9WA 2FEXA 1T8SA 1Q1AA 4AMGA 1JDTA 4CIYA 2CKDA 5LQJA 4RJTA 4GM0A 1N5KA 1NJ1A 2WPDA 4FGUA 2C8JA 4LF8B 1YXMA 3HBJA 1Q0PA 4N7JA 1N7GA 1C7JA 5FIUA 4EG8A 5F73A 3N2IA 3CLUC 3DZHA 3MRXA 3P9SA 1RVV1 1U5BB 4KAFA 2P27A 4QGBA 2O3RA 3U1TA 2EYQA 3Q8KA 5DEOA 2YNMC 5E2AA 5KOIA 3FTPA 4GX5A 2CUNA 1BE6A 3L06A 4E4RA 1C3JA 5KKCA 3CJQA 4DDWA 1TCCA 4BQFA 2KWIA 4A2QA 4NCBA 1WLYA 4QEZA 2D4AA 2NPOA 1VRVA 4DLVA 1BXKA 4AJIA 1UM9B 3WWYA 4LK3A 1FXWF 1LPAB 3J81A 4DR2B 3UOWA 3O95A 1L5RA 1X9GA 2AC7A 2GZDA 4RJIA 5KYUA 5TLSA 2CNOA 3HLTA 3JYLA 1GGFA 2G04A 1NMZA 3L5OA 3UHFA 4A8PA 4MKIA 3OFVA 1CR1A 2AG0A 3BL5A 3M5DA 3EPPA 5EYPB 4BTVA 5L3SB 2OFOA 1PRYA 3GN2A 3U7JA 2GJ9A 2CGEA 4IDDA 3IQZA 1S2LA 1U3CA 3OJOA 4RSHA 1M0TA 3ZHXA 4CUKA 4NPHA 4ENWA 1KYTA 1XJ0A 1CS0A 3N74A 1FYVA 3EDRA 3QQPA 4BVHA 3I39X 4OGFA 3ZVLA 5DK4A 4UZEA 5TVKA 1LJUA 3PQFA 3V7WA 4H7DA 1NA5A 2XE8A 1L5OA 4FR0A 1SCBA 1QGDA 2DP4E 3F8TA 5EFOA 4TTTS 3ESYA 3EWIA 3QFCA 2ZTSA 4F3NA 1CQIB 1TRKA 1FFWA 1K9SA 1YBVA 1ZFNA 3B9QA 5C1BA 2CEAA 1J2EA 1O58A 5CXUA 1QIFA 1KSHA 5FA5A 3LDUA 5LA6F 1SG9A 5BSRA 1NRIA 4C6SA 4I1SA 5ITZA 2GSWA 4TVOA 2J3DA 4QD3A 4NF2A 5G4LA 3AHJA 2G4VA 4R2WA 3LD9A 4PZ0A 2AF3C 5BQ5A 3R7WB 4DZTA 1MX9A 4A6EA 4DWJA 4GXRA 5DX8A 5JHHB 1DRKA 1SURA 3LAWA 1ZOIA 1PJZA 3P32A 2QLTA 4MAFA 1XYVA 4UEQA 4Z8YA 3EXIA 1N9GA 3PENA 4FHFA 4UEWA 4J3FA 5ELLA 4RETA 1RQ7A 1T9ZA 3BEOA 3JZIA 5AKKA 2ZJYA 5I9TA 3UB4A 3NM6B 4HUJA 4QSMA 4F5ZA 3G0CA 4TX1A 5AHRA 1OH8A 4JVMA 3EFHA 4EB6A 1C3LA 1O9GA 2CEKA 1ULBA 1XNHA 1Q3KA 1U7XA 3T99A 3R9WA 2VTBA 3GJYA 1VSTA 3IBTA 3M83A 4X61A 4P34A 2PXHA 1P3DA 3BE6A 4YP0A 4CKWB 1X19A 4NEQA 2OQ2A 1BD3A 4C4YA 4UARA 1W8DA 4V24A 2A5YB 4OM7A 2ZYTX 2CFCA 2AOWA 4R9SA 2YQZA 3EZ7A 4O2BA 1TK9A 5EIXA 4IVNA 3VZDA 3K70C 1E1QD 2WG2A 3PKIA 4OQDA 2X8JB 3EY9A 1CY6A 1EIZA 4L4ZA 4BAUA 1GSAA 4Z4QA 3TLKA 4WL0A 3U3XA 4YAEA 2EQBA 5JPIA 5K8VA 2JB9A 3N76A 5TQ2A 2UYYA 1D1TA 1G1MA 1QHYA 1RTKA 2H11A 3ZXSA 4F1JA 3ROTA 4OHWA 3GPDG 4A73A 1WPQA 2QORA 1CDDA 1JA0A 3PHLA 4LNUB 3REGA 4B7AA 1STOA 8AT1A 1TI7A 2F8LA 3MUOA 3OIYA 4R2LA 4RZHA 4FCWA 3SKXA 3TOZA 1RBZA 4GL4A 1IG0A 5SZJA 3U81A 3J80A 2GDZA 2ZWVA 4J2TA 3JQPA 2ATEA 3QI7A 3TUJC 1V9SA 3EPJA 2BRUC 3VC1A 2P62A 1NE7A 3UK0A 4ZQFA 1XI2A 2DM6A 2WU0A 5AW9A 5IU6A 2ZOSA 2GI4A 1QBGA 4AZVA 4IZHA 3KWFA 3AINA 1E2DA 2YW2A 2WAXA 1COZA 1S2OA 2P4EA 4QDZA 4CN8A 1QSGA 5K3BA 5K8JB 2OA0A 2VQ6A 1MZVA 2CLIB 3U40A 2H00A 4D3SA 3NYRA 5ALHA 3NHYA 4P4SA 2HMYB 5DV9A 3ZY6A 3IKTA 2OV1A 2BMWA 4LYEA 3R24A 4PYQA 4YEDA 5L4SA 5JTUA 3A6KA 2X42A 3KD3A 5ALZA 4RL6A 5A06A 4OG2A 5G0TA 3W90A 3T1VA 2OPBA 2WJVA 4L15A 4Z9AA 3KSMA 4CLRB 1WS6A 5AT1A 3TECE 1ORDA 2BKLA 1NU8A 1FP4A 1G5RA 1UH5A 3UV7A 3CY6A 3GAMA 4AO8A 1C0IA 4RA6B 1SBYA 3IE1A 5GMOA 3ZD7A 1XTTA 3ONWA 4ZT2A 4GKAA 1E63A 3BMCA 1W0JA 4IILA 4QODA 4XPIA 3W6OA 1OY1A 1OXXK 3HDQA 2YBEA 4C4OA 1QYWA 3NYQA 1CUBA 2EBWA 3L0ZA 4FJ2A 4RCZA 3K09C 4M88A 1YJQA 3O8OB 1YAJA 5EKUA 5SYMA 3UA4A 5ILGA 2I7TA 5BMVA 2COKA 1JEQB 4K7JA 2RH5A 3GCZA 4MGKR 4AJLA 2ZYIA 3AR6A 5JJKA 1S3FA 3FDZA 1MP0A 4IG9A 1C3OB 5C7YA 5H9WA 4PLYA 4DADA 4LOAA 2IH5A 3DG9A 2BEWA 4GT1A 1L3CA 1SQGA 5AVXA 1OAKA 3RVQA 5KUTA 1YDHA 2ENWA 1DX6A 2C42A 3A1WA 4G1UC 1T0UA 1U3WA 1AO0A 4URXR 1N2CE 1RBMA 1SVWA 2W83A 5DOZA 3WZ2A 1L7VC 1PL0A 3I2GA 4PPQA 3KPYA 4OXIA 1XA0A 2F2TA 2Q6VA 2B82A 1D2RA 4J7AA 4DG5A 3TLMA 5DNWA 3LNCA 4WW0A 2VP4A 4CM3A 4U7TB 4YCCA 4JJ7A 4DS3A 3PDIB 1KH3A 4RNCA 1P0FA 5EE1A 5JJIA 3CCCA 4GZMA 4L74A 1VRCA 2QGFA 3GZTB 3FNEA 3Q15C 2HB6A 3ZDFA 4C0XA 1Z39A 1K92A 3PNVA 4IV8A 3OA0A 3UGJA 5IAEA 1P7YA 3TAHA 1LXCA 3OZ7A 1L0BA 1C80A 4AICA 1QONA 1Y9JA 1J8MF 3HYNA 3I2JA 5AOVA 3JTMA 5JCPA 5HNKA 1AGXA 2PR7A 1SRRA 4D0LB 1GUYA 2EXXA 1T24A 4REQA 1QFSA 3C6ZA 1S2IA 1ST3A 1DWOA 1MPTA 2C9BA 3BBPA 1KEUA 1GJRA 4X5OA 4EEZA 2ZWMA 5FWXB 4R3WA 5IHPA 2HQBA 5KYXA 3FTFA 4BLRA 3I1IA 3GZNB 3A1FA 1X7GA 3PHJA 4PNZA 5F2OA 4B3HA 1D4FA 3RHTA 4C2UA 1N25A 4DM4A 3VHRA 3JWGA 3DZFA 1NR5A 3IMFA 3ZWXA 1P7VA 1WKBA 1JXMA 1A7KA 1EHCA 2QPTA 2YC2C 3WK9A 3Q6IA 4OJNA 1U98A 1E7RA 3ZTWA 2JRLA 1LBSA 4I2VA 1XNGA 1R5BA 2HJ9A 3LQYA 4KVAA 4P4GA 5FBZA 4AG6A 4BNNA 5LMNB 1WXQA 3DE6X 5KSOA 3I2KA 4DUPA 1R8JA 1EAMA 2MTBA 1JE1A 4YQZA 1N92A 5FUQA 1F0KA 3RAPR 2FZ4A 1APBA 4RPGA 1ESNA 1IXSB 1AQYA 1KEWA 1EUQA 1J99A 2B69A 3HSYA 3UOGA 4RTKA 4QQKA 4CJXA 3EPKA 1NKTA 1BJTA 2IRWA 5BQPA 5LR6A 2FMXA 3PGXA 5E3JA 2NLOA 1TTHA 4IG4A 1G3UA 3IT1A 5ALYA 2CL6X 1PQWA 3M1LA 2GO1A 3FYUB 3MWFA 1JLRA 2HFJA 3HZZA 3W4JA 4ZMSA 1E1DA 5KNBD 2YWHA 4OMFG 2QD2A 1OKKD 2VXYA 1NXVA 4YMHA 5DLQC 2R8BA 1TCAA 4QOIA 3A4IA 4D96A 1JAIA 3W9UA 3RTAA 4DMHA 3FJ1A 1B1AA 3E0XA 1W4BA 2X2OA 3A1VA 4FONA 4R6WA 5AK4A 1KA9H 2XUDA 5KVQA 1X92A 2ATIA 2WFAA 3QOWA 3WWCA 1RZRA 4N6GA 2QENA 2HSEA 2NOAA 4F46A 3L0SA 5F7XA 4NXMB 5B37A 3U19A 5CXQA 2MSNA 1DP4A 2B30A 2FPRA 2IZOA 2WP0A 5D1NA 4L4RA 1P61B 4FYKA 1S4QA 2VDQB 2DETA 4N03A 5I7FA 4UBKA 1TLTA 2IPNA 4B4DA 2GZSA 1RHRA 1ZJYA 3WBKA 3CX6A 4NIMA 4HNSA 3GLHE 4GUAA 1I2BA 1FFHA 2ODBA 3BDVA 1KK1A 1ZESA 3ITEA 3ZC3A 1QGAA 2L82A 1J5XA 3TZCA 4B5LA 1MVLA 1XDGA 1X7WA 4I99A 5CPFA 1VYUA 3TZKA 2WE7A 4QG3A 4EJMA 2QRHA 3AUKA 1GXSB 2LCQA 4RF3A 4YJKA 1NVKA 4UBOA 3EBPA 3L49A 3M5PA 5CX4A 3X1KA 1NQWA 4JMLA 1SEPA 4JC5A 2ZAGA 3EE6A 3KB2A 3PLRA 1BS1A 4MI9A 1N8NA 1W85B 3DZIA 3NATA 4LJLA 4EJFA 2IH2A 5JANA 1BKSB 1XMSA 2DFKB 2WSBA 5AI0A 3U9SA 4O2BB 3RYFA 2E4AA 2XXJA 2XNHA 5EPUA 5KSPA 3GMIA 4BQSA 5IT4A 4L95C 4CM4A 1T25A 1MUUA 3AR3A 1A2KC 3U6KA 1QGUA 4R81A 5J2TF 1UAAA 1TYBE 3S2ZA 1D2MA 2P9TA 1P0IA 3GZNA 3OZUA 2O0LA 4ZTZB 1HDEA 2KSQA 5KOJA 1EQ2A 4QT0A 4R9NA 4PLHA 1DDOA 1N2CB 1PW7A 1DAIA 3G6KA 3WNDA 4MUFA 1YVRA 4B8YA 4OB7A 2WF5A 1DKPA 2Z4SA 1B6GA 1G8PA 2FUKA 1Z56C 4C4ZA 1MC5A 3H9EO 4X84A 3FPKA 5FHQA 3FTCA 4KXQA 5DHSA 1O8BA 2C9ZA 3UJ6A 3I6ZA 4UZSA 5ADVA 2WLTA 2Z8YA 1YCFA 2A0YA 2C5HA 5CNJA 1H05A 2W00A 4XIGS 4HGZA 3DV0B 1FRVA 2QMOA 3L9XA 4CR8A 1R50A 4AKEA 4NI5A 5TGTA 3NM5A 5TT1A 3RGGA 2HL6A 4LTDA 3KR2A 3L3BA 2BM8A 3D4BA 4IGKA 4MV9A 4BNYA 2WIFA 1R6VA 2H0AA 1LV7A 3P27A 3M82A 2GPJA 4H7EA 4N9WA 3VJMA 4BO0A 4BX0A 1NOIA 2AFHA 1UL1X 2BBOA 1QVZA 1RYYA 2QWXA 3GRVA 4E3WA 2QE6A 1Z2AA 2NO6A 3EC7A 5BWNA 1VJDA 4XQ0A 2YJNA 1GV0A 3ZU6A 2XKAA 3MMSA 3PXXA 1DC7A 4PE5B 4KRGA 1RQ2A 4UQOA 1A8PA 4N3BA 1JHYA 3BD6A 3QMPA 4B4WA 5DM60 1BA3A 5FPSA 1CIJA 1VMAA 1ZIXA 2WJAA 1EBUA 4JODA 4LBWA 1XYYA 4PTLA 5CTAA 4IIJA 1EFRD 4L5JA 3R6GA 4CQLB 2BISA 4PFKA 2VOEA 1OXVA 2QZPA 2YXEA 5C37A 4BIIA 2C9YA 3OMXA 3NIDB 2VQEB 2JIRA 4LWPA 1BJRE 4X65B 1PGJA 5FFFA 5DYTA 2HU5A 4ZU1X 2GBGA 4OPMA 3L04A 2Y67A 4GEKA 1RD4A 1AGYA 2FZWA 3AF3A 2QD4A 4AQ7A 4D8TA 3ZY5A 1QQ5A 2PKYX 1ZD4A 2PMKA 2REXB 1QO0D 1II8A 3Q40A 4TZ0A 2YJ4A 1L1EA 2VLIA 2RONA 4M2LA 3KAQA 5AVJA 4HGOA 1G8FA 3G2LA 1QP8A 4YCSA 4PQEA 3ONVA 1U2RA 3CF4G 4CKXA 1B0ZA 4JELA 4MZDA 1KI9A 1T4CB 4JL5A 1XVIA 2W4QA 4PG8A 1OAOC 1GRQA 3I52A 2FPSA 1LVHA 4A6PA 3W9SA 5JRDS 1ACJA 2GCOB 1KZ4A 4JLPA 4UMVA 3MWLA 5T4EA 1KYVA 4BGDA 4LXGA 2OFFA 1UODA 3LC1O 1M5TA 3IVAA 4L8FA 4WZBA 5KNDA 3LH5A 4KACA 2C3UA 4OH1A 1I7QB 4P32A 3FFTA 3KQMA 3SQLA 1Y5NA 5IZCC 4EVQA 3SQOA 1CEYA 2H17A 3BJMA 5IMSA 1EUDB 2ZROA 3NNDA 4GPBA 3T3MB 3HHPA 5H1YA 4X54A 1T5DX 1TNDA 3LXUX 3TG2A 1ORIA 1PS0A 3BJIC 1V41E 1V8DA 3TNDA 1QOPB 4LJ6A 1Y7LA 3FCYA 2E4XA 2ZUVA 3NEPX 1P1FA 4LJSA 2W0MA 1MD9A 2ZUWA 2G7ZA 2H9IA 1FYDA 4GR5A 1WMBA 2IITA 1AF7A 3EAQA 1HYBA 3HP1A 2PWBA 4ZAXA 1BE0A 3EGCA 2Q2QA 3OZGA 3JASB 3E18A 3CGGA 2XUGA 1OFUX 4IZIA 4PLGA 2WWWA 1A4XA 1Q50A 3LGAA 1OZHA 1NVAA 1SVKA 2C2OA 1GZ7A 3A2NA 2P68A 3IIIA 4L0DA 4AX8A 5FPHA 2VF4X 3EUAA 4I2NA 4V39A 5DSXA 4O4LA 5E9QA 1N2GA 4V0RA 1H8HA 1G8GA 1QAQA 1WPGA 3JS5A 3ROGA 3RVSA 2YZ7A 5JZMA 4PBSA 1RE1A 4KQCA 3DVQX 4MB0A 2QX6A 4RDIA 5C1PA 1VLHA 5E4FA 1DTEA 2C5FA 5L3SA 2CFIA 2OCKA 3PR3A 2P4UA 4CN9A 2D13A 1GG8A 3AKCA 4MV0A 5TMBA 3JAWA 4KGDA 1B0AA 1H9BA 1F8YA 5HKAA 3MT0A 1L5SA 2RCNA 4HDRA 5A5VA 4FM9A 3LZDA 1RYEA 1PR1A 4AECA 1U0JA 4A8TA 4W4TA 4H17A 1SXHA 5TVGA 3UK7A 3BQ9A 2FCAA 3JQ8A 1W5EA 1EFDN 4RLHA 4V0LA 5ALWA 2YYAA 2KS6A 3E5MA 4N5LA 3WGHA 3PWTA 3IAFA 1NR1A 1OLSB 2ZRNA 4MV1A 1ADYA 4RFLA 4NHOA 3IV9A 1JPVA 2DECA 2IZZA 2DUJA 5FQNA 5JYEA 2Y1KA 5M34A 1FP7A 1PJ4A 4B3XA 5JADA 3NBZC 2HNAA 2GN9A 1PBTA 4LYYA 3TQIA 4N65A 1DL5A 2L42A 2ZS7A 2CCJA 3IIKA 4LBZA 5D3KA 1T2AA 3CUTA 4PRKA 1V1RB 4HNAA 2IDMA 2GAAA 1A4IA 1ODSA 4XEHA 3K0SA 1T15A 4X94A 4YECA 3SMQA 2AC4A 3D54D 3BWXA 1C81A 3IUSA 5EHQA 4YRRA 3G17A 4RDCA 4OQZA 1N4AA 4ARZB 1D6JA 2OV4A 1JFSA 2H4FA 4AY6A 5I7RA 3EA5A 1X0XA 2ILVA 4G0MA 3WMEA 4CLDA 1DOHA 1HX7A 5HKBA 5HMLA 1GAWA 3OLQA 2CYBA 4TKMA 1HA3A 4H1WA 1EA5A 2H63A 3AI3A 1XV5A 1VIYA 4L22A 2J0SA 3D2LA 3RS8A 1JIQA 1FNSA 2QZ9A 1SU4A 1OZAA 2WG1A 4PZPA 4FQ7A 3TD9A 4OXYA 3T9CA 2PUGA 3EBLA 4PAWA 4EB0A 3QUTA 3V4PB 3RAGA 1QH0A 2FRDA 4PSCA 5F3DA 3TLEA 4MQ6A 2C97A 2CFRA 5IJ9A 3OA2A 2M2IA 1S8OA 3GFBA 4FC7A 4KR9A 4LMAA 2Q1YA 2FHPA 1ZO8A 2I6QA 2PBLA 2E4VA 1T6YA 3R5FA 3JZAA 3KKZA 2TS1A 3A32A 4ZZ1A 2P6MA 1TPYA 1YJ5A 1CWUA 1CUEA 3KEFA 2ABWA 1WABA 2VPIA 3FJYA 3AY6A 3L4BA 3O83A 3W4KA 1JG4A 4NAVA 5JQGA 5LLTA 5LYJA 4AVYA 2POQX 3G85A 4B6JA 1UDBA 2A58A 1EG7A 3WIEA 4Y8VA 5KC9A 4E3ZA 1XSEA 2CD9A 2J9ZB 1CP2A 1SIWA 4M6WB 4MVJE 3SN6A 1KS2A 4BNUA 2FG5A 5EJEA 1JXOA 1MPXA 1Y5IA 3K09A 2EJUA 3PNLA 1AZTA 3QPUA 1CNEA 2I2BA 1I7NA 5B7GA 2JLBA 1NP3A 4IUYA 3OZTA 3AF6A 5CAEA 5CNMA 4BQOA 5H70A 4ARZA 4KWIA 2FPGB 1BFKA 4KSCA 5FXMA 1W35A 4IGIA 2OORC 5DWDA 1SWWA 1G0OA 4RH1A 4YH1A 3TIVA 4C0WA 4Z53A 3P1JA 2O2ZA 2XI4A 3I8OA 4JAVC 4CT0A 5EHZA 3GJXC 3BFVA 1N2JA 2TRSB 3JQFC 4I3FA 4J1QA 4UD6A 2HQ1A 1XP8A 1QIMA 1N8SA 3L02A 4LW8A 5CCDA 5E4YA 4RFVA 2VYND 1OJ7A 4OI4A 3LHFA 4O1HA 2QNBA 1W4ZA 1YMUA 2R8YA 4BB9A 1ZM9A 4GKBA 3GCGA 3CBGA 4HNAB 3QW4B 3H9JA 1Y7HA 3P0JA 5GJCA 5B6IA 4Y6GB 2BIFA 3E9YA 3C3KA 4E46A 3V4SA 4KR7A 3PHIA 4DNOA 2JIMA 3R7FA 2RHHA 3GUHA 2Q3LA 3E9ZA 4QBTA 1FVOA 1JNXX 1BZYA 1XCPA 1XEXA 1EVEA 1ZW6A 3FHJA 3L7JA 4GW3A 5JSFA 1P4AA 1GADO 2HRDA 1NP7A 2WTUA 3RB8A 2PJDA 4WZAB 3S1AB 2DEUA 4Q39A 3D6MA 4RA6A 2OSVA 3P4XA 3AZQA 2GF0A 3HKBA 4G8CA 2QM3A 3TO5A 1R0ZA 3H13A 1YA6A 1KC1A 1J06A 1Y6RA 5F7JA 3B20A 2WU3A 3IESA 1JDJA 1DQNA 1R10A 4Y2JA 4D9MA 2JD1A 4DBLE 1BCRA 1FUIA 5HEKA 2XZLA 2X6QA 3HKDA 1N0UA 2IHUA 2IU6A 3WJAA 4B76A 3E58A 5HSGA 4LI0A 4M83A 1T5SA 5CK5A 5KYVA 2Q9UA 2F62A 2ALJA 1J0XO 4P9NA 1IUNA 4IYRA 5CT8A 2GTIA 4C6RA 2W6JD 1TUBA 1T4MA 1OU0A 4LFCB 1CUHA 1RHMA 721PA 1M66A 1VCNA 4RVHA 3TOVA 4RPCA 2PVCA 1IZ7A 2W7TA 1LSUA 1B4DA 1IN4A 2ERYA 3LCMA 3QEKA 4V2IA 4DCVA 3H04A 4LJYA 1KSFX 2C88A 2RGWA 2I22A 5B1YA 1ZVJA 2VWPA 1XCJA 5BT9A 1ARZA 3HJTA 4YCNA 4OKSA 1UBJS 3UJ3X 4MGZR 1U0OC 2P78A 2PTHA 4OP2A 1E0DA 3WLEA 2MSKA 1XZKA 2WJYA 2GAJA 4KO3S 4BBPA 4MUNA 3PTAA 3E3MA 1QKJA 5LYJB 2MHCA 2Z6AA 3GFSA 1T5BA 2WMNB 3KJIA 3KVVA 4CQMA 5B64A 5B58C 4WMLA 5KEIA 4HNHA