2Y0BA

Caspase-3 in complex with an inhibitory darpin-3.4_s76r
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQARGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 51
structure length 140
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y0bA00
4EHFA 1I51A 1IBCA 4I1PA 2K7ZA 3P45A 2C2MA 4FEAA 1CP3A 4N6OA 1SC3A 2XZDA 3V4OA 3P4UA 4QUDA 4JQYA 2H4YA 4ZVOA 3NKFA 4M9RA 4JR0A 2QLFA 4NBNA 3EDQA 4QTXA 1RWNA 4QUIA 2CNOA 2CNKA 4DCOA 3V55A 3R6LA 2FP3A 2Y1LA 4JJEA 3D6MA 1PAUA 3IBFA 3DEHA 4JB8A 4JJ7A 5IBRA 3V6LA 2H4WA 4ZVSA 3V6MA 1K88A 3GJQA 3DEKA 4DCPA 3UOAB 2XYHA 4QU0A 2FUNB 4NOLA 4D3ZA 4EHLA 1SC1A 5I9TA 1RHJA 4NOKA 4N7MA 4AW9A 1NMEA 4PRYA 4ZVRA 5LUAA 3R7NA 3SIRA 2CNLA 3H13A 1GQFA 2CNNA 2P2CA 4EJFA 2J33A 3UO8B 1NMQA 2H54A 1I4OA 2CJYA 4DCJA 5IANA 1RE1A 2H65A 4EHHA 1RWPA 2QL7A 1RWXA 4N6NA 3BIJA 4NBKA 1RHUA 3S8EA 5IAJA 2XYGA 1NMSA 1RWWA 4EHNA 4QTYA 3NS7A 4QU8A 2C2OA 3IBCA 4QU9A 4FXOA 3V4LA 4HQRA 1SC4A 4JJ8A 4NOMA 3KJQA 3GJRA 4PS1A 3H0EA 4QUHA 4D3YA 4D3XA 2AR9A 5LUBA 1I4EB 4LSZA 3H11A 1K86A 1RHRA 4ZVTA 3R5JA 5IC4A 4QUJA 4QULA 4HVAA 2C2ZA 2C2KA 4I1RA 5I9BA 1KMCA 2H51A 3S70A 4ZVPA 2XZTA 2HBZA 3R6GA 4AWAA 1QDUA 2XYPA 3R5KA 3R7BA 1GFWA 2H5IA 3GJTA 4EHDA 5LU9A 1RHKA 4JQZA 3RJMA 3D6FA 4ZVQA 4EHAA 3V3KA 5LU8A 3KJNA 3R7SA 2QLBA 3PCXA 3OD5A 5IAEA 5K20A 1NW9B 2QL9A 2J32A 1M72A 2QL5A 4QUAA 2CDRA 2FQQA 4AWBA 1F9EA 2Y0BA 3H11B 1RWMA 1BMQA 3PD0A 4N5DA 3NR2A 4NOJA 2HBYA 1JXQA 4IYRA 4PRZA 4QUBA 4N7JA 4IEFB 1RWKA 1ICEA 2J30A 1PYOA 4EHKA 2HBQA 2J31A 2WDPA 5IBCA 5IASA 4FDLA 2DKOA 4N6GA 3E4CA 4FGUA 4PS0A 4QUEA 3ITNA 3PD1A 4HQ0A 3SIPA 3GJSA 1RHMA 5IAKA 1RWVA 5IBPA 2C1EA 1RWOA 2CJXA 3DEJA 2H5JA 2NN3C 1F1JA 3K7EA 2HBRA 2QLJA 1RHQA 1CVRA 3EDRA 4QUGA 2H48A 5H0IA 5IAGA 3KJFA 5JFTA 3D6HA 3DEIA 5IARA 5IABA 4NBLA 4QU5A 4JR1A 1QTNA 3H1PA 4ZVUA 5IC6A 4JR2A 1SHLA 1I3OA 1SHJA 1QX3A 3QNWA
chains in the Genus database with same CATH superfamily
2GN8A 3KQVA 1N32B 4IH9A 4BLWA 1GLVA 3ILXA 3Q8LA 3HS3A 2BI8A 2UXCB 3U7RA 4D3SA 2W90A 3RK4A 4BKRA 1GEGA 4IRUB 3BTVA 3CX8A 3IUBA 4NFSA 1XLUA 2ZSFA 1QJ4A 1SUAA 1M2KA 3F0TA 4X6UA 3R1IA 4Q9IA 5FI0B 1T9HA 1NNUA 1TAGA 4EUNA 5IJ0B 4YLYA 5FAXA 2G3YA 4JJ4A 3VR5H 2IHZA 4DRXB 4MYUA 5D8DA 1OFHA 3VSEA 1SQ6A 3K6RA 4GKBA 2CDBA 3P2IA 1JIJA 3WQBA 1AGYA 3MN1A 4EUSA 5D01A 3HXOA 1I5EA 2D0DA 3DA8A 4OK3A 1R0WA 1V6SA 4HH1A 2V4ZA 3KYIB 3U7QA 5L3SB 3DMHA 1OLXB 1JJAA 1KHHA 4EFLA 2QBYA 4B6EA 5ALWA 1CK4A 1I01A 1AK9A 2UZIR 3OPMA 5DE3A 3T3MB 3GP3A 5LUAA 2N46A 2C4TA 2D1YA 3QTLA 3SXUA 4H7HA 4MDFA 3TBKA 1BIFA 1T5IA 4QTTB 4FP9A 3PT9A 1Q7TA 1SAYA 4RTQA 3ZYZA 1F12A 4NENA 1IC6A 3FJ1A 5JCJA 3BXEA 2PQMA 3PNQA 3NWOA 2UYYA 4KFSA 1XTZA 2XVAA 4A27A 5BSRA 1K7XB 2DWQA 3S81A 5I8WA 4Z5XA 4OX9Y 3MJVA 5ITZB 4LVNA 2MSKA 1CDOA 4CPDA 4H7JA 2ZTMA 1Y5IA 3GFBA 1GSAA 3UYLA 1WSDA 2QSYA 1K5PA 1HL7A 3ZD7A 5FRDA 1ESDA 4WN9B 1TC2A 1PJCA 1OT5A 2QNBA 4K6CA 5E6SA 4X00A 1D4FA 4AX4A 1V37A 4D6PA 5A4MS 1JKFA 4Z54A 5BPHA 1N9ZA 1GUYA 2NXWA 5LKAA 4P3PA 1Z08A 3WLAA 5DBIA 3GA0A 3DFMA 1S1CA 3QLTA 1D7AA 2VF8A 1SXJA 1TM7E 3JZAA 2G0NA 1ZITA 3I8XA 2ZBDA 3ZCTA 2ZWVA 1RZ3A 2QVGA 3TUIC 4BO6A 2QM7A 2C78A 3WLKX 4COKA 4N40A 1PG0A 2K2QB 3VAAA 3NDIA 2Y99A 4ARVA 3NP7A 2XWJI 4CYMA 3WFJA 1GA4A 2XECA 2Q9UA 3IOCA 4B47A 2RIPA 4K9SA 4FSXA 3RSFA 4GG1A 2QXUA 3E22B 3FUTA 4KYVA 3NIBA 2XTMA 4FS8A 1E7MA 3UIEA 4EA6A 4IXTA 2X5OA 3E84A 3ZOZA 3KJXA 3O5AA 4WNAA 3F7OA 4CM8A 3D0RA 3N7TA 4LYDA 2GN9A 1TOAA 1QCZA 1CNEA 1YDHA 4AJ4A 4A2QA 2ZRHA 5HF9A 4TWIA 5C5IA 2J9YB 4N41A 1BHSA 3URMA 4AP5A 2DY0A 5TXGA 2N1BA 4JR1A 5BURA 1G3RA 1ACJA 1OJLA 1TO1E 2HFJA 2X0RA 3GFTA 1T25A 5EGNA 3T4UA 4AFNA 4D9FA 4G0NA 5K0FA 2O8DB 2UV8A 2Q3MA 3KU4A 2XUGA 1BFDA 2IU0A 4QD3A 3GVHA 4W82A 2UUPA 1G4HA 1IQPA 5TJHA 4R2MA 2BR4A 1USIA 3LA6A 4DANA 3UUGA 3GDWA 3A2NA 4TQGA 4OLJA 1T29A 4MCAA 4UDXX 4DUZB 4DLPA 2A7QA 3FFXA 1PT5A 2Y1WA 3QA3E 3ZWKA 5FORA 3LHSA 4FFNA 3RVDA 4O59O 4FKBA 1W5EA 4EENA 4YJDA 2LGJA 4QOSA 2V5VA 4JC8A 1H4QA 1NF3A 4UBOA 1JI3A 3NTVA 4OKSA 5FOUA 4N0EA 5KTOA 2IYAA 3COZA 3OPVA 4JVNA 1B0AA 2B1RA 2PYDA 3EEQA 2XVYA 5A5VA 5JS8A 2XPCA 3Q10A 5TY0A 1E1RA 1P2TA 3GJZA 4IFIA 1OBOA 1YR7A 2FSIA 4ILEA 5FYQA 3QU2A 5B3AA 3KUCA 4GKAA 3IB3A 2CD9A 3OMWA 4J94A 4YDSA 1UJNA 3U4HA 2V6JA 1MAWA 3AEXA 3I1YA 2QMOA 3D6NB 2OV8A 2X41A 1WZ2A 2VZ8A 4MKGA 2X2PA 3M6VA 5KBYA 5DM70 2RGDA 2R6FA 2O7VA 2YXNA 2WLSA 2EEZA 4Q34A 4K26A 3V4PB 1GGNA 4Z3KA 1OU0A 4N12A 4Q7MB 4ACAA 5B36A 2BEUA 2HD4A 2FZ4A 3REFA 2FVXA 3CG0A 1O8CA 2QGNA 1E4OA 1W88A 1NM5C 4PG4A 3F5MA 4EHNA 3ADCA 1KY4A 2X3UA 2PV0A 3ZZ1A 4FYVA 1N77A 4JP5A 3L4BA 4HFMA 2OZPA 3FI0A 1R15A 3O21A 5ALXA 4WKNA 3SGLA 4BVEA 1F1BA 2IIBA 4RD2A 1X9IA 3L04A 4K9NA 3E5RA 4PG5A 4HGQA 4QC2A 1J0AA 1DEHA 3R09A 4KK4A 4MP6A 3DOCA 1OYWA 3A3YA 1HMPA 1VSVA 2N0SA 5F64A 3WLQA 4AKGA 5SYMA 3HI6A 1SVLA 4UC0A 1QUFA 3GCWA 1JDPA 1HYGA 4IF6A 4JI0B 1WDWB 4DMMA 5KAPA 2VTDA 3TTSA 3AUJB 2C20A 4YJ2A 1CTQA 1N78A 3AHJA 2F6RA 2BFFB 2JLYA 1UC4B 3U4IA 3EPKA 4DY4A 1BU8A 1L6RA 3M89A 4BP8A 3WZMA 2R6AA 1DDIA 1U0HC 1ZI9A 3HP7A 2FW9A 4MR7B 1SCNE 4D0NA 3BA6A 1IOVA 2AMVA 1XU4A 5LXTA 3NJ4A 1UUFA 3C6YA 4QREA 2LIVA 2W0MA 1Y8RA 3DLAA 3C7DB 1UPUA 3IQXA 4DSOA 2OZLB 4CQMA 1IEWA 4EL5A 1XWWA 2VK2A 1ZU5A 4Q3OA 1LV8A 3LY7A 5BQOA 5FLXA 2JJQA 3J81A 1ZM3A 1C9MA 4NV1A 1R9JA 3KPJA 1XDUA 4ER6A 2AL7A 3RANA 1QH9A 3HUUA 3UJCA 2EJUA 4JP1A 1H8ED 4QEKA 3B78A 3MRTA 3SVLA 1W4AA 4KRFA 3FPJA 1VA4A 4C5BA 3ESDA 1PG5A 2C4WA 4H0NA 5JZOA 1X7ZB 3C6ZA 3D0OA 2ET6A 4MKIA 5EMLA 3TOCA 4ZZ1A 4L2IB 4B0PA 4ZJZA 2JJYA 4Q6BA 4M0DA 2OSBA 4HSGA 1YR8A 1DOHA 3C85A 5I6DA 1X1DA 1EX7A 1LDYA 1HTBA 2RHHA 2WHEA 3AKYA 4DA4A 4LV6A 4I1PA 1AE1A 3PTZA 3BE6A 5L6MB 4RANA 2VDVE 3WK4A 3LI2A 4Y7DA 5AMXA 1KBOA 4TV9A 3C6KA 5CCXA 3GROA 4M7OA 4NBNA 5M04A 5DBHX 1RJDA 1O57A 4QXAA 4U6NA 4IUDS 4F7WA 3R20A 3R3UA 3ZK7A 1P18A 1BZYA 2OENG 2XB6A 3G5UA 3QY0A 3WLPA 4RM2A 1CUUA 5DYNA 5FXMA 5CD1A 2AI2A 2IU3A 4GVLA 4B74A 2XCIA 2O7QA 3E9NA 3UV3A 4I7EA 2J59A 4KMMA 4ZJYA 2ORWA 4FZJA 5HKOA 2SECE 1VC2A 2ORVA 3A1NA 5JZBA 5J43A 3QEMB 4IZ6A 1UKZA 3P9YA 1YKSA 3QVJA 2P2CA 1HT1E 4I0WB 3ER9A 3ABOB 2VK4A 4BBJA 4EH1A 4AG5A 3JPWA 4TLMB 4XB2A 4DNQA 1ZJ4A 3C3JA 1RYZA 2SBTA 2C2WA 2PUTA 1Z38A 2XT6A 3RK0A 1E7YA 5HS4A 4RSRA 5DBOA 3QKWA 2QRKA 1A1VA 4YJ2F 1FUIA 3I9NA 4DXHA 3SQWA 4LY6A 1N8TA 2BMDA 2WOJA 3ML1A 3VU9A 2VDNB 3K9GA 4KRYA 4LZZA 1YR3A 3JQ7B 5F5XA 5IAOA 1QS0B 4GXTA 1F38A 4LBWA 3ST7A 3LT4A 4F2PA 3C2QA 1EQ2A 1GPJA 1T6XA 1V7CA 4DWVA 4B5KA 4X45A 1PW7A 4ZQIA 4DEYA 2Q1WA 4BNWA 4WHMA 4JC0A 2WJAA 1E79A 4DJJA 3I37X 4NQZA 1ZH4A 2CMKA 5FP0A 2BFNA 1L4LA 4AJJA 1ODTC 2P75A 4ZQCB 4H9GA 4BV9A 4LI3X 3TYXA 4PE5B 2H1FA 1ATZA 1KIMA 1W5BA 4L85A 3KTAA 4WCFB 5TMDA 3V8EA 5BWNA 3KLPX 5AM5A 4G1MB 5KOJA 1EPUA 4DAOA 2I6UA 2LP4Y 2VWHA 3AUKA 4GPEA 4JJ6A 2QSZA 3BL8A 3WIDA 1KMHA 5M5BA 4IBOA 1XP8A 2YXPX 4UBIA 3WV5A 4X1KB 3DMFA 3LCRA 1V0JA 3HFJA 4K9OA 3OWXA 4S1WA 4Y0VA 3KDSE 4TRNA 2OWDA 2PGOA 3ZWYA 4LZJA 2V03A 3KTFA 3WB0A 1M10A 2VKQA 4GNRA 4HD8A 4QPDA 3AVVA 1BWPA 1HUQA 3FPCA 4BXOB 1W85B 1YB2A 5IZCC 3CS3A 1H8HD 2I3ZA 4HMOA 5TQ0A 4A8HA 2UXBB 5FIUA 2Q6IA 1VP9A 3IUSA 4WY8A 1VLLA 4HQ0A 4B6RA 1Q12A 5F2EA 4AZ3A 2D7CA 1PFVA 1EWQA 1NT2A 1RZVA 3F73A 4P5DA 2C5HA 3ZHBA 1XU7A 1M2VA 2F43B 3E7PA 1CETA 1V96A 1TZ2A 2DF8A 2DQKA 3O93A 3VR6H 4EKNB 4GL2A 2GCEA 3EMVA 2CUTA 3KEFA 3G7UA 4KVZA 2P6UA 5DOZA 1GTSA 3A2MA 3I39X 3C3WA 1NZDA 3TRDA 3IP1A 4UPDA 2ZWAA 4EDHA 3UTDA 1TM2A 1JU9A 5DU2A 2FWPA 3QNUA 2W2VA 1PNOA 2IKSA 1YB4A 1CP3A 1B42A 3GRZA 3RTBA 1NBAA 1SXGA 2QTVB 3PEEA 3QKUA 2E85A 3AFGA 4FGLA 1JZQA 2DMRA 4OQYA 1RYYA 4R41A 1VG1A 4C4YA 5C1DA 2HK6A 1TGVA 2GZ2A 2XVXA 2GFQA 3AMVA 3M1YA 4JD5A 1YRAA 3UJBA 4IIEA 1MRZA 4F85A 1LBSA 4LRQA 3G79A 1RM0A 2WG0A 3RG8A 1Y3IA 1DMSA 2ZKIA 1J97A 5FQOA 3V1TC 5LJIA 5KJ1A 1L4HA 4ZPJA 4R9VA 3EJ6A 1K66A 4JVSB 4QNMA 1JSRA 2DR3A 2XDWA 3OT1B 2HC9A 3PSHA 4D9NA 1XQXA 1GCAA 2OZKA 2RHTA 3EBPA 1YE5A 1ACMA 3A6ZA 3F3KA 4WADA 1XPOA 1PJLA 2WIBA 2HMYB 4FJ0A 4RKYA 3TOSA 7MDHA 1HR0B 1OTXA 1OZAA 2ORIA 4NOKA 4WLVA 5CA1A 1DB3A 3I01M 4BB5A 1FDSA 3SOZA 5DXFA 3Q8WA 2PS3A 4WWHA 2QN8A 3HR7A 4CMGA 1VXRA 4LMPA 1UADA 1EXVA 3EPLA 2OZEA 1QTIA 1YTUA 1XXHA 3VVMA 4D8VA 3ME5A 2ZRIA 1VCOA 4DLSA 3EXIB 2K87A 3G49A 1J8YF 4QATA 1JG7A 1CRZA 3ZUPA 3UY4A 3LDAA 2QYSA 3GRKA 2FUG6 2AW5A 4WZAA 3D5TA 4RK1A 5CGZA 3JRNA 5CFMA 5GTDA 3BMNB 4J0JA 3HB5X 1WHSA 2QZPA 1M6VB 2FDXA 3N2GA 1GGKA 1O94A 2J3KA 2OSVA 2H2HA 1NVAA 2OV3A 2ZRQA 1ODJA 3C3DA 2YBDA 4GYWA 5CVUA 1QRSA 5FWXB 1RI5A 4CGZA 2CCJA 3RTAA 2VHUA 4JXKA 2R7MA 4G0UA 4E2YA 1U2DA 4DLKA 1KC3A 4CT5A 1YDEA 1NAIA 3E7XA 1I7SB 2CL0X 4ZDKA 4PZEA 1OKKD 2V4MA 1CF4A 1SU4A 1WUKS 2XUAA 1HDIA 5JAHA 1Z0DA 4LYAA 3RVMA 2GHTA 3V8QA 2PM8A 3I6ZA 1XZAA 2CHGA 2NZWA 3O8QA 2FPMA 4I9NA 4ZEXA 3FOWA 4Z53A 5IAEA 5CVEA 1L7QA 3AO0B 5P8WA 4D45A 3O8RA 1HL3A 2F8SA 4LTMA 2QRUA 3VUFA 2ZQZA 1QMGA 2ZK7A 3H6GA 4NU6A 4OF4A 1SCBA 4D9HA 3WP1B 4KR9A 1ISHA 4MPRA 4AO8A 1XSEA 5C34B 5GIPE 1PYOA 3LT2A 3LUPA 1J5PA 2EW1A 3QENA 4G65A 2GCPA 4UXHA 4YMSA 2OXTA 1HDRA 2WZDA 2CD7A 5KCMA 1CDDA 1OV4A 3JQFA 3KYJB 3K9CA 2X0EA 4YONB 4CM9D 2QUHA 3MC1A 3NHSA 1ZOPA 3E6AA 4GDFA 3PD1A 3VSDA 1LY1A 1X86B 3GAFA 1YSCA 4YAWA 4XJSA 5IKXA 4X7MA 3I6YA 2P2YA 1P1RA 2O2XA 3F8TA 2OILA 3IE2A 4YTEA 2IOYA 4ZAYA 1OIXA 3QEJA 3FE2A 4WTOA 1MV8A 1Q7RA 2Q9CA 4N0PA 2X5KO 2Q41A 5EXEA 2J41A 3N6XA 4HPWA 1JV2B 4NFHA 1M2JA 2NUAA 2I4TA 3DF7A 4RXTA 1DVRA 3I2YX 3TLKA 3UTCA 4BLQA 5A05A 2Q3LA 1Q0SA 3WICA 3DUFB 3UKOA 4NZPA 2JD0A 4HYEA 1L3IA 2E6KA 2OGSA 1G3IA 2G08A 4IUYA 5DRTA 2CFTA 1W2HA 5EQFA 3ZDYB 3E3LA 4H77A 2G67A 1WX1A 4RSMA 1ND5A 1MQ8B 3B3AA 4QFMA 4HDNA 4YT4A 3LBNA 4EEZA 3VX4A 1KRXA 4BMVA 2ZUSA 1X13A 4B6GA 3BFXA 2JI9A 4DR3B 2ISSD 4EJ2A 2ZWMA 3AW9A 1U4OA 2GOYA 3NHUA 1PT7A 2PAFA 1HZZC 3WJ7A 3IEPA 3MQ2A 2LCQA 1H6AA 5DDIP 1TEHA 1CZHA 4NV3A 4RAQA 1ZUNA 1EP3B 2FN9A 1U9IC 4PZCA 3DLPX 1XEWX 3M9XA 3R5FA 1XDBA 3QPUA 1E32A 4FUQA 5JH7B 3PTAA 1NYTA 1H3NA 4IILA 3N75A 1H6BA 1NE2A 3UAOA 5KYYB 3NHWA 5FTMA 4PCAA 1P81A 4U7FA 3UJ3X 4D97A 3HVIA 2XD4A 2I3GA 2FF5A 4IMJB 1RAHA 1DC8A 3K09C 2IE8A 1MN6A 2CVZA 2VBGA 3KHKA 3QX8A 1KI1A 1U8XX 2YV4A 3UMCA 3VNRA 5BV2P 1YJCA 5IBQA 4TUYB 4GPD1 4BJHB 1B0ZA 1V48A 4FR0A 1YGPA 3U4DA 3A8TA 4EI7A 2X5JO 1YS2X 3P8ZA 4Y1RA 1G8FA 1TKCA 3M4NA 4RD0A 4WCFC 1KO8A 3ZH2A 3ZZNA 4EM6A 1MDFA 3EHEA 4IF4A 3VDNB 3QV2A 1P4AA 4FCWA 5CAEB 3GJRA 3I4FA 1I0IA 1V2GA 1Y3DE 3OF2A 3TLXA 3X1XA 5JRJA 2UYCA 4KCGA 3UOGA 5CG2A 3FOFC 2GEVA 2W6ZA 1H8EA 4CLOA 2BCGY 1ZMRA 4BGVA 1FIUA 1L7BA 2G9VA 4D9EA 1X15A 1GNRA 5DEIA 2HQBA 2E1RA 4LZWA 1DC5A 1R6DA 3HKEB 2IC5A 3S70A 2FJUA 1IG0A 1JAZA 2FOLA 5FADA 2FE4A 4LEIA 4M0MA 5LU9A 1R9GA 3CR7A 2BBOA 1B15A 4X1OA 1Z15A 4GR9A 4X7BA 1V4VA 1D4OA 2RB5A 3DOFA 4GPIB 2WP8J 1MHPA 4BQSA 1OZ0A 1ML4A 2XF8A 4LS3A 7ABPA 4Q9HA 3R0JA 4OYHA 3EGWA 4ZOLA 3HSKA 3MJSA 4JU8A 4PHHA 5JFGA 3NALA 3THWB 4GSYA 1XEAA 1YZTA 4PRZA 1PN3A 4FR2A 2ZIFA 2C8KA 3Q88A 1A2BA 4ZCTA 2AZDA 3VVBA 2O8FA 2A92A 2BIFA 1J42A 5KNBD 1RBYA 3GGCA 4JGBA 3K73O 5C1PA 2WB2A 2PKEA 3HYLA 2ZRMA 1EVZA 2UZ1A 1C3OB 4HQ6A 1FTGA 1Z6AA 3B5JA 1IVSA 2D1SA 4RETA 1EFUA 5AESA 2QKYA 1H2BA 4EB0A 2Z8ZA 4K6HA 1BE8A 4A5OA 2HJWA 1JEYB 3EDRA 4XLTA 5DX1A 1B6GA 4K2AA 3KOZA 4YCSA 1NL3A 3O0DA 3V8NA 2ZSDA 4X5OA 5I7HA 3D81A 4CTNA 4GBED 5BVHA 5KIAA 1QUEA 2F4VB 3D7LA 1P1FA 4MROA 5F33A 5T6BA 3VYWA 3ZE9A 2ECPA 4C88A 3VPDA 2BFWA 3LL7A 5HM8A 2YNMA 1QO9A 2VXOA 1QAQA 1M2HA 3DOHA 1NXXA 3JTMA 1PIWA 2G76A 2BYTA 4PAMA 2RHCA 1UBEA 4W6QA 4XIIA 1I0LA 1VIVA 1GL9B 4GX5A 4XWKA 1G9SA 3DE3X 5ARDA 4O4HF 2P9QA 2MDTA 1RWNA 3TZ6A 5DULA 4U2KA 5CFRA 1G8JA 3NIDB 4TLLB 1B14A 1NIJA 4WVFA 4IJUA 1N3IA 3DEHA 5JCOA 1GRNA 2HJSA 2PS9A 5DTQA 1CW2B 1Z47A 3H17A 3P9XA 1X87A 1X1EA 5AI0A 5HA5A 4AUNA 5CDTA 2GM4A 3QKSB 4ZAZA 3FRHA 1MW9X 1VMAA 1NV8A 1QG0A 3FNQA 1XJWA 4EHLA 1R9NA 4BFXA 2JGJA 2FUCA 3IHTA 5IVDA 3Q12A 3UZUA 3X1YA 3KETA 5GOZA 1XF9A 1V8DA 2CUNA 2H63A 2OP0A 2GK3A 4KLZA 721PA 1LA2A 1TLTA 2YIMA 2VWPA 3DO8A 1FSZA 2BZ0A 4YAFA 3OQVA 3D1JA 3PCRB 2YWFA 3I2KA 3B1VA 4HP8A 2H54A 2PMEA 1VL1A 2BGUA 2J4FA 4WQMA 4PRLA 2PBLA 2VXCA 4X3OA 1V25A 3AB3A 3NWBA 1T4GA 3C3KA 3COVA 2JKZA 4XCXA 5FPTA 4IX9A 2NU9B 3RC1A 4BBAA 3HVHA 2JAOA 1KVSA 1B26A 2C5LA 2Y67A 1DWOA 1T5BA 1E8DA 3G1TA 4M9QA 1G21E 1E89A 1OLUB 2O57A 1H8HA 5F77A 2NQ2C 3ZE6A 2Q62A 4ND8B 1HLDA 1O08A 1V2HE 4QUHA 4ME6A 1IN5A 1K2VN 5HFNA 4AM8A 4F93B 2QAGA 1LLFA 1EESA 1LGYA 1ZGAA 5CVDA 1O97D 1C2YA 4BYGA 2QTNA 4OXYA 4Q93A 4GXRA 1KYQA 3AR4A 2EKBA 1Y3BE 3KSZO 3HPRA 3F6BX 1XRSB 4N3CA 1GPMA 1G6OA 2PWPA 1SWWA 3FCCA 2ATVA 3FLEA 3NEPX 4AYTA 3RYCB 2E9SA 4I4CA 1TKRA 2FZVA 1YR9A 1ENOA 4MW1A 3F5QA 5K3OA 1O8BA 1PJQA 3W0LB 2G25A 1B0PA 3N8KA 1G20B 5J2UA 5JNRA 2AFHB 4YC7A 1Q95A 1QH0A 2R68A 3KZNA 3PD0A 2G36A 3R3YA 3D3KA 4R1SA 2QYHA 2I3DA 2BTOA 3FKSD 4M98A 2HCBA 4RUKA 5AKHA 4D79A 1KI8A 2DH6A 1KO7A 4FOOA 3NHYA 1V16B 2DWPA 4NCIA 2ZCVA 4Q3DA 2QQ0A 5KDOA 1T0PA 3RT1A 1LI5A 2O0KA 2H5JA 3O47A 3GY0A 4LYEA 4DQDA 1JQKA 5FKJA 5E95A 1CVRA 2FEAA 4PEVA 2GRAA 3RYFB 4ZEMA 3I73A 3GT0A 3GZNA 1U0GA 3PQEA 3ZV7A 1J8DA 3TLYA 3MPUA 4G81A 1WUYA 5DTEA 2VZ0A 4W4TA 3Q2OA 4QG3A 3BHNA 3GLIE 2AK3A 2HYDA 2NO0A 3WYEA 1YQUA 1WP4A 3AW8A 1XYVA 3P20A 1XGKA 5ALDA 1G9TA 5HDQA 1MH1A 2PKWA 3OJFA 3RUIA 4YRSA 1FP6A 5HHTA 1VMEA 4R81A 2VNHA 4C2AA 4CLEA 4R2HA 1U7WA 2AMLA 3I5AA 4HNSA 3RFTA 3W2GA 5E1MA 4GI3A 4EYQA 4ZHQB 5KNCD 1MAUA 3C3XA 4WPGA 4XSVA 4ZVOA 2AC2A 3BHIA 1G8HA 2J6HA 3QBVA 2Z08A 1FRZA 1PW5A 3P27A 2BMFA 3LGSA 2F1JA 3EPPA 3TD9A 2JGNA 4KQXA 3I4LA 2R00C 2I1VB 3EZNA 4PX3A 3ITEA 2ZATA 1ZC3A 2C9OA 4JGGA 2QRPA 3QE2A 4JLNA 3ZV6A 3D59A 4FHGA 4TWBA 1JR2A 1YAJA 1X38A 2ZAGA 5DTMA 3RJZA 2P91A 2WU4A 4RVUA 2IH4A 3L4EA 2AQKA 5DSXA 5FOQA 4L6IA 3DMYA 4EY5A 1Y80A 1XAHA 4FBGA 4HTFB 1U28C 4D3DA 4YAGA 1VL6A 1R0RE 4K3UA 1X2BA 2NXNA 3BJIC 4NBWA 4QUKA 2HRCA 5FB3A 2QSUA 1I4WA 3ZCQA 1JJ7A 1YNSA 3C6MA 3BSFA 3ULKA 4KO1S 3HBLA 3AVTA 3MB8A 1JG2A 1FOEB 1RVDA 1BVRA 1VSTA 1B7GO 2VPXA 1IAQA 4L28A 1H2EA 1UMBB 4RKWA 4ZCLA 3BQNB 1EK0A 4LOHA 2CHVA 1RRGA 1L5QA 4G0YA 3PE3A 4D4LA 5KJFA 5CYPA 3C3EA 4AWXA 1MW8X 1M0SA 5E7MA 3UWDA 5HRCA 2OFWA 2NXJA 5FEMA 3S5UA 1RXVA 2BFBB 1CS0B 4AY6A 1CF9A 4LXQA 3QITA 5CLIA 1KI3A 2AOWA 5FHRA 1BDIA 4YWJA 1QANA 2XE7A 3LHKA 4MKFA 2PRSA 2ZSBA 2HBZA 3KC2A 1QYWA 4M1SA 4NU8X 4Q24A 2IHNA 1GG2A 4X3CA 5AI8A 4XPIA 1T5LA 2WJ4A 2WJHA 4YMLA 3OO1A 3L7MA 4GW3A 2ZRDA 4NDZA 5CHEA 1EWKA 5C35A 2O05A 2D3TA 1VJDA 2BGLA 4ZU6X 2PU5A 3WQHA 4ZQHA 4X6YA 3FUCA 1TO2E 4PCUA 1KOFA 3NC0C 4WZBA 3K53A 2O1XA 5EJ9A 1OF1A 5AKEA 2ZZNA 4OLFA 4QZVA 2BBSA 2UUBB 2EX1A 3G7SA 1WOYA 3WAGA 4DC9A 3UA4A 3IVAA 5ESWA 4JN6B 1FC0A 1WSWA 4M7WA 1ZOIA 1M6NA 4XOIA 1CNFA 1OB2A 1QQTA 4IFTA 2XWPA 4NYIQ 4CQLB 4DVJA 4X7RA 1SZPA 4G8DA 1I36A 4O1HA 4S2UA 1XTVA 3JD3A 3PD7A 4QKQA 3E3OA 4ZU1X 2P6MA 1EXNA 2RG7A 3I72A 4FUTA 5AOAA 3SR0A 2J3JA 3BWVA 2VP2A 4RY9A 3AUFA 3LV8A 3MYRA 2C0QA 4FOSA 2FMXA 4H17A 4CKWA 4KPUA 4AY2A 3VJMA 3U7GA 3UB2A 1JBQA 4O4JF 7ADHA 4DV7B 2A9FA 4HH4A 3GJXC 2K4MA 4UUBA 2PAAA 1B74A 2AOVA 4QOHA 1FTQA 4ARBA 5FV7A 4Z8XA 4HDAA 2ILVA 1BFKA 4M8NE 4ZCSA 1QF9A 5LYJB 4AKHA 2EKQA 4I4IA 4YRNA 4M1OA 5IHPA 1S3FA 3KSDO 4GUAA 5K8TA 2P27A 1NJSA 3ZDBA 2AG5A 4ZVVA 2BI7A 4KV7A 1J1UA 2I7DA 1UFOA 2NYRA 4JEMA 1AQYA 3BD8A 2XMSA 4ZRDA 3TM4A 5HUQA 4OO3A 3T5MA 1IN8A 2CYBA 4JI8B 1CQJA 2QZSA 3I45A 2CNDA 3KT3A 2WY2D 4ZICA 5TRTA 1Z37A 4DWWA 1DLJA 2EG5A 4Y6RA 1ZD4A 2PWAA 4DG8A 5I45A 4Z4GA 3GT7A 4AUMA 3EXG2 1UC5B 1ZH8A 4MUJA 2LWIA 4H59A 5F5LA 3FNEA 1RXYA 2DUJA 3AM5A 1QV9A 1T5SA 1XYGA 1U6IA 3MMZA 3RU7A 1GEEA 3NH6A 3W8EA 2HSGA 3N7UA 4DQKA 2EZ9A 1I33A 2XUOA 4G1EB 3S8EA 3ZGYA 5LZ9A 1A95A 1E3TA 4JUDX 4BO9A 5KQRA 1NM5A 4LECA 3U1VA 1ZJWA 4REQB 3BJZA 2CC2A 3NASA 5ALRA 1JUDA 2QT0A 5KNBA 1C0PA 1UBFA 1CX9B 3GLQA 2F3UA 1O3YA 4U1RA 4NCHA 4A8TA 3GF4A 1V4NA 3KG2A 4X63A 5LLTA 5I7EA 3WLSA 1REQB 3CEJA 4YEDA 3N2NA 1TU3A 3QXSA 4LZAA 4NHEA 2C0PA 3FPHA 4DFDA 4IV0A 4RLHA 3OCVA 3T99A 5AVZA 1F0PA 1D2NA 1KRHA 2DUUA 3IP5A 2NNLD 2Q1YA 4KKVA 4RMGA 3W2IA 4BFVA 1UR5A 3KHTA 1PD0A 5FR2A 1PYDA 3OOYA 2QROA 3R75A 3V8VA 1C9JA 4G8JA 4EVQA 5KNLA 2XRZA 3R5KA 1IJKA 2NSHA 2BGNA 3DL0A 3DM9B 1O03A 3FHJA 2J1LA 1F2UB 4QYMA 3T7TA 1ZVKA 3DKRA 1ORWA 2X4DA 4H7EA 3TAXA 2FUKA 2WHPA 1UH5A 4EPTA 1CRQA 1AKRA 2IQ5A 3JATA 4JB0A 3AF5A 5BNTA 1EB8A 3RYHB 2H8GA 3AGQA 4KWHA 2GESA 2R751 4L8GA 3DFZA 4E09A 1JHOA 1UBMS 3QF4B 1CJBA 1T2VA 1O6FA 1G291 1CY4A 1X1TA 1QGOA 3N0VA 2E1PA 5G02A 4PLPA 1PUXA 2K7FA 2B3TA 3QWAA 4UTVA 3D3JA 3X3HA 3HCFA 1XG5A 3UN1A 3EIXA 1V11B 5E9QA 5CXUA 1KBQA 2AN9A 2JGDB 2WV9A 1VPVA 1ZL2A 4RIFA 5EXDA 3ZTYA 1ZHFA 4O5OA 4JI5B 1Q2UA 3AJDA 2GILA 1DCMA 3D2BA 4NSNA 4E1BA 1L7DA 1TMYA 1D07A 1IM2A 1F2TB 2WQZA 3DB1A 2B99A 2C5FA 5JI2E 4YCLA 1JG3A 1N2SA 3LFHA 5DH9A 4MQFB 1PQYA 4PBRA 3N05A 3MEQA 5DFAA 4ZXFA 1V26A 4Y2UA 4ALNA 2R8ZA 3DEIA 2CXHA 3BD9A 2KBEA 1KQGA 2XX3A 1L7XA 3PQ6A 5KDDA 1KY3A 1EHYA 2YV2A 4TROA 5HFJA 4NYIR 2IYXA 1SIUA 2VUSA 4KZPA 5EXTA 4EO7A 2VAVA 5L3SA 2HOQA 1OLXA 4OYRA 2H1HA 1S2GA 1QM5A 3MS2A 3P45A 4JHXA 3T3NA 3NBZC 4MWSA 4TTAA 4XQ0A 1AKUA 3QE9Y 2I3BA 4F9EA 2ZSHA 3AL2A 5KC9A 4DR2B 4INAA 4F9TA 2A9PA 2JGMA 5TT1A 1C0IA 1J0XO 2EERA 1DC7A 2WF7A 4GPTA 3RTCA 3V8RA 1Z2OX 2Q50A 2X4IA 5BW5A 1GFIA 4FT2A 4M9SA 5EP1A 3F2IA 2V54A 1E5LA 3NHAA 1PO7A 2I6FA 3NWEA 1UT5A 2WE7A 2YWRA 8ABPA 1DKLA 5ITZA 1ZVVA 3ELWA 4A0QA 4URXR 4EARA 5C5EA 1UC8A 1ZK3A 4D7AA 1SVOA 4XKJA 1V5FA 5ALUA 1LRJA 1ISMA 2ZP1A 4NXMB 2NNWB 4I50B 2JIPA 4WN9A 1XWFA 2R5WA 4E3ZA 1MB3A 3PEFA 3ANSA 1O6CA 3FKSA 3O4IA 4KN8A 2CXTA 4BV2A 2BKEA 4CLDA 1L9XA 1HGXA 5REQB 3TPZA 1FDOA 4O29A 3WHIA 5EHXA 3AXSA 3TZKA 5AQ1A 5EPUA 3ODPA 3HJCA 4MWEA 1FTNA 5DHQA 3TNDA 4P3NA 4Y6LA 3R74A 1QJCA 4WN3A 5T64A 4HH3C 5IDQA 4TXLA 1GCGA 1F2VA 2HHCA 2JCVA 4KIJA 1R8YA 1NWHA 3O91A 1OYYA 3G2NA 5CM2Z 3LWNA 5K4AA 1HNWB 4JLUA 1H42A 1FJHA 4C87A 1N1EA 3R5SA 1LBHA 5AFSA 3IQGX 3G17A 3EARA 3FW1A 3F1LA 4TKVB 1QWOA 4S05A 2N3ZA 2XCQA 5EP4A 1NG1A 3HP4A 3MWFA 4W7HA 3RS3A 2WFZA 5CP8A 5DNDA 4A15A 1A9ZA 2YFQA 5B57C 3RS0A 3V3KA 1RU3A 1RXIA 1R00A 1R0XA 4LISA 1NFRA 1FNSA 2JS7A 2CJWB 2JK0A 4GDMA 2XE4A 2J32A 3DZDA 5LQAA 5K2OA 1DG9A 3WLEA 5LD2B 3ZHXA 2GM5A 2E49A 1MDBA 3X2FA 1I7QB 3WIEA 5B55A 4JHLA 2ZSAA 3EQ9A 3W5SA 5DXAA 1DAMA 3H2GA 1JLLB 5A2GA 1ESZA 2IY9A 3F5FA 1A76A 3DE6X 1MOPA 2QD3A 5IZCA 3NG1A 4X20A 5IJAA 3TB6A 3TLCA 2F4NA 4UM7A 1U0JA 2ZAIA 2X2FA 1KO1A 1C7QA 3VPSA 4QUEA 1G59A 3ZZTA 3BL6A 5FBZA 4G84A 4YUYA 1YZUA 2FF7A 1O89A 4F1JA 1F1JA 3ZIAD 3HDTA 1X0VA 3DQZA 1PS9A 2Z5LA 3PC6A 4QJ3A 5LQCA 2V9ZA 3ILVA 3UC9A 4KLAA 3EDMA 3FNGA 4FNOA 1BYUA 3K6SA 2J46A 1FTYA 1XZIA 3ZHVA 1MOSA 3AY0A 4EHFA 2LR0A 3G1WA 3V7NA 3HBFA 4QDXA 1WKBA 3SF0A 1ZEMA 1XEWY 1GZ3A 1UQUA 4I6GA 5AW2A 1GZUA 3HJBA 3O4VA 4EKDA 1EZ1A 3H2HA 2J5RA 3O3NB 4GKKB 3ER6A 1XOIA 5GJBA 4HB4A 2G40A 4PAQA 2GHRA 3G2LA 5LNK1 2RCYA 2HTEA 1G1MA 4KXMA 1U8AA 1U2TA 2R7KA 3A3OA 1G4UR 3N3BC 3R3HA 3SYTA 5LSAA 1O96A 1J99A 1QHGA 3A06A 1FS5A 2NLOA 3DZBA 3JYHA 4Z4CA 5ERYA 4P1ZA 2OCAA 2R6JA 1DIHA 2OO7A 2CY0A 1XWIA 4L8YA 4LGMA 4PXYA 3S4YA 3ZN2A 5JAPA 1A9TA 4E5MA 4DBVO 2GLUA 5H83A 3EXHB 3PFCA 4L8FA 5L4NA 1LEHA 3R7NA 1JHDA 1BH2A 2QT1A 3PHJA 4MVJD 1CBUA 3HB7A 1TCAA 3TE7A 2CXQA 4JLKA 3E4DA 3TTUA 4YFVA 3IE1A 3D0QA 3VKVA 4I1VA 3H9GA 4FNGA 3ZJ5A 2P68A 4ADSG 4C0XA 2ZJOA 4LC1A 4GGPA 1EK1A 4F0JA 3F4LA 1Z8NA 2J6IA 2R8OA 2WVGA 5H1YA 1KI6A 1AKMA 1MJGA 1UBRS 4IJVA 2NX2A 5CX1B 5KYGA 4D99A 1NQUA 2B1IA 4G26A 3KOYA 4BNZA 2BFAA 3WHLA 1FFDA 1WEHA 5HPYB 1W96A 1SN7A 3ROTA 4GVXA 1F8XA 3BE8A 1H69A 1SVWA 421PA 1E6KA 3UGJA 3TZCA 2XGSA 4CLRA 3G89A 2IZ0A 4N9QA 4MR7A 4URWR 5JATA 1SBHA 1ESEA 2QRNA 4PBTA 2QORA 3S2UA 3SX4A 4BFCA 4DA9A 2ZM5A 4B43A 3EIFA 1PJAA 3HEAA 1XPRA 1HKHA 3VA7A 1WF3A 2HUNA 1C7JA 2OZLA 3CW8X 4ZFNA 2QD2A 4WBNA 1O4WA 3IO5A 2QTAA 3HKDB 2Z0MA 4Q9NA 4MQUA 3CZAA 4CEIB 3DWFA 4ZVQA 2M1ZA 3OOWA 3SZRA 4EP1A 4PM4A 1H0KA 3NM4A 4INZA 2VDWA 4JJFA 1UFRA 1Z7GA 3I3SR 1G8AA 1X7ZA 3KB6A 5BR7A 1AXGA 4XW2A 4L2IA 4IYRA 5TQ2A 4OFBA 4GYYA 2B8NA 4ID9A 4KNYA 1RBQA 4J29A 5DI3B 4URVR 4OLAA 3KKMA 3L6CA 3QSYA 1XTQA 3A6EA 2FKAA 1XXLA 3GBSA 4IJ6A 5IASA 4DIKA 5DM0A 3STVA 2NTVA 2HIHA 2V6BA 3L5KA 4DV4B 4LWQA 4MDYA 3SHVA 3OECA 3DPSA 3QVOA 3ROZA 3Q98A 5FO0A 1J2UA 4JI4B 2MWMA 2VOJA 1YA8A 4BGIA 3CJQA 2IBSA 1UPFA 1V1JA 2Y66A 2W4IA 3EGCA 2DX7A 2QLJA 3BORA 3MQFA 4GWGA 3WRYC 2J48A 4RDIA 4YJHB 4C0QC 4AJHA 2XRYA 1FW6A 4PG8A 4ZMSA 1JIXA 5BN1A 2JLZA 3HHEA 3OLCX 5PGMA 4ZA2A 3HO8A 2Q4EA 4RTSA 1U2SA 2IP4A 4MV3A 5D1HA 2I2WA 4CMAA 4R6WA 2WWHA 1T1IA 3BDVA 1FFGA 1GD1O 3C45A 2P4QA 3UMMA 3QEMA 3ENVA 4LHYA 4X54A 1R16A 4B7ZA 2G9QA 4JQYA 2PJDA 2CMHA 1ZR2A 4HFNA 4ND3A 1E9CA 1P7WA 3A32A 1YIOA 2QUZA 3OIUA 5F9MA 4BWFB 3VUEA 4HT3B 1ZUWA 4LXHA 4E51A 5LL6P 3DZCA 1U9IA 3BE4A 2HHHB 2WINI 1W49A 3BERA 4ZEOA 1ABBA 2ZFUA 3HV0A 4UU8A 5HK9A 4ZDIA 5DMXA 2JBHA 1U02A 2B98A 2MTBA 2P9EA 2Z2IA 2ZRBA 1UMKA 1JT2A 3AUAA 1QS0A 2KQUA 3JQ7A 5F52A 2NMVA 4O2LA 1EDZA 4YO8A 2W6ID 2ZIZA 3LLCA 1CCWA 3HEBA 3K09A 1DLIA 1HQCA 4BO2A 4V1CB 3ZBTA 4MCIA 1EJ0A 1NXPA 2O3QA 2I4OA 2Q3FA 3OESA 4FEEA 4L5JA 4PC3A 4R8RA 2OBFA 4O3MA 4UATA 1ZSNA 3MTQA 3PK0A 4G4JA 1MNAA 4KWCA 1CUYA 3RSQA 2O54A 4WCFA 2F9LA 5H3LA 2GB4A 5H70A 1YFJA 4GMXA 5ED4A 3PFWO 4CTKA 1YH3A 4QGSA 5JJLA 5EZSA 3OF5A 2C0CA 1IEQA 3EUEA 3A4LA 3TIGA 3IT1A 4BGEA 5LD2C 5ICCA 3IUPA 4PZLA 2QQFA 1TYBE 2XE6A 3UEOA 2I65A 1XO1A 2AQIA 1M8KA 3GEPA 1S8FA 4FZVA 4U2EA 4DKJA 5LOVA 2QENA 3DBLB 3F78A 3NEAA 3L3BA 4HAZA 4IZOA 4KDRA 8MHTA 3IDOA 4BXOA 2R1UA 3BT7A 4DBLC 3MD0A 5H68A 16PKA 4UE3S 4HXGA 4Y9DA 5AVRA 4HS9A 5JQGB 4FYWA 1EI9A 3LKZA 1XCPA 3D2LA 5CVVA 5LQSA 3EVAA 1G60A 3V5NA 5C9ZA 4XYLA 5L95A 1DQSA 2XE8A 1LPPA 2FRDC 2F43A 2VRNA 3ZWNA 4S04A 5JTUA 3I9OA 1JH9A 3BOSA 3H8WA 3LBYA 1P3DA 4U5XA 1A8IA 4YNBA 3IYLW 1A27A 2WJIA 5AUQA 1UM9B 5AXCA 4W5QA 1PJ8A 2YHIB 4XGNA 4LJ6A 5IM4A 2WWXA 1U98A 4HJRA 4XUEA 3LCVB 3V3TA 2BP7B 4EF4A 5JYBA 3NV7A 4CLHA 4ALLA 2R8BA 3DEJA 1SMKA 4MUEA 2H0QA 2OCGA 1YB7A 1LLDA 1QLWA 1WWKA 4OP1A 4QHSA 2PJZA 3RRXA 1CB0A 3QE4A 4EW3A 2ZUFA 4D25A 4UOEA 2Z8YA 4TLCA 3T1NA 4D9BA 4RTLA 3RQIA 3KQOA 4TTRA 4LJ8A 3H1TA 1NXWA 5JBIA 4UVEA 3AQ4A 2X8WA 4JIMA 2P9FA 3ZWDA 2IOQA 3EY4A 5CXQA 2A0KA 2NSDA 2DC1A 3VHQA 3BRCA 2YW9A 3GP8A 3CSDA 2G09A 2FWNA 3PGXA 1QFMA 1BMFD 2C2MA 4DS3A 3TK1A 4GQIA 1JNXX 3U4AA 1QPGA 2O8NA 4OA8A 3ZNPA 1U1EA 3EXHC 1E2EA 1HH4A 2ASEA 2J4DA 1O5IA 4IWNA 5KQGA 5K4HA 1IJBA 2QYOA 4PF1A 5IW8A 4IV8A 4RZ2A 3RV4A 3S2IA 3ANNA 1ZD1A 1KEEB 4U9IS 3O95A 3IDFA 3U49A 1FB5A 2XEDA 3GXOA 4FLFA 5C8ZA 2NPFA 3WOHA 4P81A 4JBYA 4YGYA 1ZHOA 1H2XA 2JBAA 4G5XA 5BNFA 2G06A 2JFHA 3BMNA 1RI4A 1E4EB 4EMUA 2IYVA 4CL2A 1M6VA 2Z5GA 3UXMA 5TIIA 2D5AA 3MTEA 1RLJA 4QL3A 1XK6A 2FGKA 3PC2A 3KRTA 3EZYA 2V7BA 2YDYA 4B0OA 4D1YA 4E1VA 4R83A 1YB6A 2DY1A 3PJDA 3IC5A 2JFUA 5ES4B 4P7GA 1TYDE 4K0KB 3HC7A 2ZXFA 1TUBB 3DEAA 1KS2A 4D82A 3DQQA 3WXBA 4KJZA 2VSOA 4TTIA 3V1LA 4RPLA 3L7JA 5F1OA 2HEIA 1PFWA 1D2HA 2IA5A 1CYEA 2H7VA 5J23A 3SMVA 4NCXA 2JIDA 1Q0RA 1CY2A 3SXJA 2D3WA 4KQMA 5B1DA 3C43A 1HNXB 4YCNA 2DB3A 2IPAB 2JCGA 1NMXA 4ZC8A 3G85A 3R0IA 2PXAA 2NAPA 2NVWA 4RD1A 3IJRA 2VSXA 2P8SA 4W9NC 3ADBA 4XASA 1ZM2A 3ZIAA 2CVFA 1IBLB 4KHPB 3CRNA 2GN6A 3M6FA 3P1JA 1QO0A 4MXDA 1XQVA 3UHPA 4AJNA 1ZA2A 3ENNA 1IL0A 4X1IB 1JHYA 1QCDA 1G3QA 4HADA 3ZD9A 2GF2A 3AG5A 2GBPA 4UTOA 3B3GA 3O92A 1M2GA 3WAJA 2G0TA 5DV9A 1SQ0A 4ESOA 5FNZA 4A1FA 1NQXA 3U19A 4QDTA 1T9AA 1TZMA 2FRVA 1YQTA 2VBFA 4EVIA 1IM8A 2RGCA 1II8B 4MUAA 5KYXB 3RI3A 3S1AB 4G1BA 4OJNA 1VDZA 3HFSA 1Y7LA 2GZSA 1INLA 1QH8A 5JJ5A 1WXFA 1JEQB 1U0EA 1XNJA 1ZIYA 1G5FA 3GW8A 5H3HA 1VIYA 2VF5X 5BNIA 3ZJ4A 3EIEA 2EHJA 2FMKA 4DREA 2LE0A 3TW8A 2POCA 3WKDA 2H0RA 3FWPA 1GAEO 4OHBA 2EBFX 3ZG6A 3FTEA 3ZQ6A 3IRUA 1I32A 5DNYB 3CM0A 5JADA 4FC6A 4UUPA 1WZNA 1RKVA 1XRQA 2OMKA 2RHDA 1G42A 3BXPA 5CT6A 2QTCA 5FF9A 3TNJA 3B38A 5EL0A 3QTBA 4BX8A 3HJAA 2A1TS 2E2WA 4ZTUB 2C7BA 1DJPA 2CCKA 3CBGA 1U7DA 3OQIB 4IR7A 3OJ0A 4MVJA 3TTWA 4PCVA 5F73A 5EJ2A 2PUCA 2ZE6A 3GLFB 1BXRB 1N9KA 2AOTB 2GAIA 4KXXA 4RZQA 1NQTA 2OHVA 3IPCA 4KQ2A 5K8LA 3DE1X 5DWQA 3VR1A 5KX5A 1QTQA 1A4RA 4LHVA 4AULA 3LSTA 1GCOA 2OCXA 3UHFA 1Q1NA 1Q11A 3RS7A 3GMSA 5HUHA 2JH3A 2ZS8A 4R8LA 3IXLA 2P77A 3CH6A 1G16A 2F55A 1YVDA 2B9EA 2F3QA 2X58A 4YUZA 4QOFA 4QA9A 2H2IA 2DJ5A 3DE0X 2QLFA 1V3TA 3H3FA 2LW7A 4PXSA 4CL0A 2R00A 2DUWA 4KU4A 4D6YA 1I9GA 3ZU6A 1DQZA 2QRVA 2RE8A 4URHA 3OKAA 1FRNA 4JJ7A 4BNDA 3WDSA 5DK4A 3H83A 3Q8XB 1NZJA 1LH0A 1HDOA 2ERYA 2J67A 2P0AA 3DJYA 3FNIA 4LKOA 1UJ5A 4MWBA 4V0NA 2H1OA 5EC8A 3A14A 1L5GB 2QU8A 1T2CA 3IAM6 1TVMA 3W5VA 2I87A 4YR7A 3B6JA 1X7DA 3C97A 1U28A 4MO2A 2DLNA 3ACBA 3IRVA 3TD2A 4ENUA 3IKTA 3B8HA 4HWRA 3W6OA 2FPXA 2FPPB 1E62A 3AKCA 3EUWA 4R31A 1RI1A 2QLTA 3FUXA 2NV6A 2HDNB 1L8LA 1LFAA 2LV8A 2X42A 2Z09A 4HJXA 4IMRA 4TLAA 4WGGA 2CXRA 3HKEA 3WLTA 2C8VA 3HG7A 1LW7A 1U8UA 1EIZA 1OFVA 2NTNA 2QI9C 1KGSA 4RJJA 1KHTA 4R1MA 2XUPA 5IDYA 3DP7A 1DHRA 1LI4A 4Y6PA 3WX0A 1F7VA 1MTZA 3T7KA 3GAZA 1V5EA 3W8NA 1NPDA 3HU1A 1R4AA 1WVIA 3PPVA 4LK2A 4CI9A 2PUDA 3FHTA 1JT9A 1NBME 4HRXA 3F6YA 4AMVA 5JRDS 4GR5A 4MW0A 5F78A 3NAZA 1IUKA 4IDDA 4EY3A 2AF3C 2FR0A 2RGAA 2PVCA 4UULA 3D3NA 1QGED 3CBQA 3O75A 3WZ2A 4YYEA 9GPBA 3UHJA 2I6QA 4IQ8A 4NK4A 3TD6A 1YDWA 3FWYA 3T34A 2EGUA 5ESRA 5HXAA 1UJBA 1M7BA 3SHTA 4E22A 4D4HA 1TYEB 3A27A 4LC0A 2QMYA 1C3OA 4GEKA 2YZGA 1XQWA 1X14A 1RE0A 3GQBB 4Y9UA 4Q7EA 2VP9A 1JIVA 1DKMA 1NVMB 1QHXA 2WHYA 1MMFB 4FOLA 1JEYA 3F9IA 1WAMA 1WMEA 2PMFA 1C9DB 4Q05A 3G3EA 3NW9A 2W58A 3NHZA 3IQZA 5GV8A 2DHQA 4R40A 3HJFA 2RHMA 1XRMA 5A5FA 3PUXA 1RWKA 1B4DA 1ICEA 4J2OA 2J30A 4MLDA 2VIIA 5JD3A 3W9UA 1IJFA 1NNEA 4EITA 1XTUA 2AQ8A 2XUDA 4FCVA 5BXYA 5EMHA 1UWLA 3F4KA 3KQPA 5KHOC 4H7PA 1BGVA 4MJ3A 3WKCA 1ZGGA 1GTZA 4M83A 3VR3D 2FZCA 2PKXA 4TM8A 3CWZA 4MA5A 4WUTA 5EVCA 1Q17A 3T3OA 1O6ZA 2IPNA 3C7TA 3TQOA 1JKJB 4UEKA 2WU3A 3L8CA 4LDQA 3S68A 2X23A 2H48A 2W6IA 4Y2XA 5EJ5A 1QF6A 1PBNA 3T0IA 1OAKA 3SQXA 2YYSA 4KNVA 3GD7A 1HRDA 1UJ4A 2V7TA 3JU3A 3JYQA 1MQ9A 1Z0SA 4O2AF 3EWNA 3HDYA 1U0TA 1OYOA 1NMYA 3V1KA 2IXEA 2QIOA 1XZGA 1NUSA 5CR9A 2JLRA 2WRZA 5A3QA 2HH9A 1LBEA 3AJ8A 4WINA 4GS5A 3GCZA 4A9AA 1N36B 2FXIA 2ZJ6A 4AKSA 5NULA 1NJ2A 1SOAA 1M5TA 2AFHE 3CA8A 4B79A 3ZH9B 2AEMA 1RLOA 1FFAA 3DTVD 3PXDA 4JC5A 4BQFA 3QVTA 1CR1A 3M8KA 4OQNA 2NU9A 4RHYA 5KTMA 3UK2A 3FPKA 4DUPA 2OUKA 2R85A 1GKIA 2BM1A 4HWTA 3SU8A 5CT9A 4EFMA 5DM60 2H2DA 1AQLA 3FZGA 3I9JA 2YWJA 2HWKA 2WMDA 1U9ZA 2FN3A 4AIIA 4ND8A 1SC1A 1AX9A 4NVRA 3F3SA 5JO0A 5G53C 3RW9A 1FZQA 1E1KA 4ZTBA 1QE0A 2BTQB 3CWQA 2HFKA 4UHJA 4XIFA 5ALVA 3MZ0A 3R7FA 4AZTA 3NO4A 4PX2A 4TVKA 2NXCA 4TRMA 4RY2A 2YXLA 2YWHA 2JHAA 3KE9A 5GP1A 3U39A 3VFDA 3J7TA 1TT5B 3FNRA 3EZXA 1HRKA 1S02A 1TE2A 2JJ1A 3FDZA 5GVRA 3OTHA 4ECAA 3M7IA 4WBXC 3RYCA 1K4MA 4XE5A 3TGPA 5EJ8A 4F3TA 4NECA 3Q3GE 1TUGA 3V4LA 2PMBA 1EJ2A 4AZ0A 3CVYA 1CIVA 5I47A 3K35A 3CF6R 3MTIA 1P45A 2NV2B 4FSHA 1Z2DA 3AG6A 3Q0TA 4O1IA 4Q47A 1IXRC 4EX7A 2X3YA 4F4FA 4QRHA 3R8XA 1KVRA 5G1NA 3UJDA 2VQDA 1AHIA 1USVA 2JGAA 3E9DA 4J9UE 5DBEX 3OFKA 5SZKB 3CX3A 1A4XA 4LXUA 1UFQA 1KXJA 1T2NA 6AT1A 3ZD6A 4CIVA 3OKCA 1NVKA 1NFFA 1V16A 3ICOA 1IN1A 3LOUA 1NP6A 4JS0A 5JY6A 1ZRMA 4JYAB 1PP4A 1R18A 3IJ5A 2LDBA 3QG1A 1TQDA 4NE2A 3ZHQA 5IDXA 3H3XA 2WYUA 3ZVNA 5HCUA 4HLUC 1WXIA 1A9PA 4MMYB 5AW5A 2GLXA 3E27A 3MUFA 4E7PA 1KFKB 1WXDA 2FWJA 4I1OA 4I5GA 4L4ZA 4WW0A 1II9A 1EVLA 1ZAKA 3JQ8B 4MHSA 3RYFA 1DAHA 1SIWA 4E4TA 2BGWA 1SHZA 3A9WA 3GA7A 3GUUA 1GT6A 3OPQA 2JD2A 2D5LA 4I4TB 5B4UA 2JPDA 3JRXA 1ND6A 2XOXA 5LQNA 1QP7A 2F1IA 1XEFA 1JDNA 1NGSA 1X7GA 1ZK0A 4C4ZA 2RC6A 4GXNA 3PHHA 2WF6A 4MWDA 1JVNA 3TKYA 4EHBA 1TYZA 2HF2A 3KM0A 5AH0A 2DQYA 3SIPA 3FXAA 5LNK6 2V7UA 4ZHQA 5T5QA 1SCAA 4NK5A 3BQMB 1WTCA 5EE5B 1PI3A 1JA0A 4G5HA 4RVOA 2YMPA 3RIEA 2GR9A 4QYXA 1X39A 4ZP1A 4A1OA 3L84A 1RQLA 4DT1B 1R6XA 3AUYA 5HTKA 5TT0A 1VRVA 1E1NA 1I4DD 1KQ3A 2OLEA 1PR1A 4ZVUA 4UM9B 2B4AA 1E96A 4RPKA 3CLUD 1BQ3A 1A88A 1T9ZA 5F5NA 1UKAA 2XD9A 5BYKA 1ONNA 3G0OA 1G18A 1IOLA 1DAFA 2MYUA 4LY9A 1P5ZB 4L22A 4MZXA 3SFZA 5IC5A 1E2PA 2CFRA 3DZFA 3GNLA 4WLUA 1P75A 4B80A 5ADVA 1E20A 1FUEA 2HT6A 3F71A 3JYLA 4MUMA 1LVGA 2XQVA 3R0VA 4OJKA 3CUKA 3L0OA 4YALA 3LMKA 4IWYA 5ALJA 3STUA 2C9YA 3QHPA 3LCCA 5D7NA 3TJRA 3WGHA 2AXQA 1TCCA 4U3JA 1G63A 1NQWA 1U0LA 3GVCA 5JSYA 1XZNA 2P3SA 1IG3A 1UMBA 4O5AA 3W2HA 2ZKLA 4LX0A 4UBMA 4XD7A 4B6QA 4TMXA 1VE9A 3EGOA 5I8PA 1YVUA 4Q3KA 4ITUA 5B64A 1ICIA 3BH6A 4V38A 1LZLA 2PX4A 3S1SA 4PGGA 3BH0A 2FFQA 3GGPA 5A6SB 2OA0A 5HIAA 3B9QA 5K3DA 1QTRA 4UU1A 4CLXA 1MRNA 2C42A 4QRDA 3C3BA 1Z22A 2N47A 2AFIE 2GBGA 4KDCA 3W1EA 2JLUA 3RS8A 2DWOA 5AVUA 2BGRA 5AW8A 1VZ2A 3W7BA 4Q6WA 3SDZA 5HF6A 3PRYA 3QM1A 4BMZA 3LQ4A 4YV7A 3U13A 3CLTC 4JAVC 4P4NA 2OMEA 3JWIA 4M60A 2FPLA 4A0HA 4CV1A 2GK7A 2Y9MB 3OBBA 4D4MA 3IBYA 3PQCA 1EVQA 4UEQA 3LDGA 4ZVMA 2PNJA 3RS5A 4BVKA 3E9ZA 3SCZA 1JQAA 2VA9A 1IONA 1KNQA 3MW8A 3UK0A 4DARA 1THZA 3JW8A 4LJYA 5JNVA 3LX4A 3CKKA 4K03A 3CKMA 1PV2A 3GYBA 4QHYA 4MWTA 3E05A 4L4UA 5FOXA 1IN4A 3U7HB 3T3DA 2GHIA 4R3WA 5CXXA 3ZGZA 4R2WA 3I4CA 1Y9ZA 4U2DA 4WKOA 5CGQB 2AX4A 3WQRA 3R0QA 4QG7A 4UTXA 5EJEA 5EP3A 5BW8A 2CMFA 3CE9A 2XWBF 4CQLA 4QRIA 3KVNA 1ADGA 1VCIA 5DO9A 5KOIA 4WI1A 1U2ZA 4LIPD 4PZUA 4EHAA 3BFJA 1RC1A 3C3AA 2AN4A 4MQEB 1EHCA 4WX2B 4KQKA 3I83A 1QVAA 1THTA 1XKLA 3CSSA 3OQPA 3UJ8A 2QVCA 3KS9A 4K9DA 4PN7A 4PR0A 3E2PA 1X74A 3Q3EA 4IPTA 4UBJA 4B2YA 4ZJUA 4R4JA 5F12A 2CFSA 3FOCA 1E3WB 3FVRA 4WLFA 5KQSA 3HY6A 1LF5A 4D9MA 3VDRA 3OE7A 4LA4A 4P8RA 1F0KA 4ZK2A 1YFKA 5G3ZA 1AU9A 1G8SA 4FQ8A 3VH1A 3H9QA 4L50A 5AK3A 5BN3B 1QQBA 5AVKA 4J3NA 2XZOA 2PX3A 4YQZA 3EY9A 2YRXA 3AVOA 1SKBA 2FSVC 2HCRA 4QBKA 1NZFA 1B6SA 2JB9A 3LPNA 3MXOA 3T5AA 1DRUA 3FGNA 5LA6A 1WCIA 3LHIA 3TIFA 4K05A 4P4GA 3A6DA 5F7ZA 5HF8A 1OXUA 4CR8A 3K6KA 4BQOA 5C37A 3O8LA 2C5GA 4LMRA 1SD1A 1SO8A 1Z0JA 3RC9A 5AHXA 2DLCX 2NZJA 4P7KA 5B37A 4R9UC 1BHO1 3ZCSA 2X9VA 2ONCA 5FPHA 4HWKA 3SAJA 5J4LA 4Y2YA 4FDUA 4W1SA 1Y6QA 4ILKA 1Y1RA 2COUA 4TWJA 1D6NA 1YC2A 2HK8A 2X14A 1I4LD 2AQHA 1S01A 5EXSA 3UOWA 2BKXA 1D6MA 2Z58A 1XDGA 3MGKA 4FOTA 1FJ2A 1BDHA 4YQFA 3I5MA 4CMIA 1TEXA 1U31A 3P94A 5BMVB 5H81A 4B4KA 4ESEA 4LSWA 3M6LA 3QE3A 3QWFA 4WXHA 1KERA 4REQA 4RA6B 4BMOB 4D0SA 1J9ZA 1QAOA 1V95A 1SH7A 1RNLA 4OI4A 1AQJA 3RSHA 1ZS9A 1TJ5A 4DLVA 5HQ3B 3NYWA 3IP7A 1JKIA 1KXZA 1ULHA 3O1HB 1H2YA 1REQA 2ADMA 1QOZA 4FSDA 2JIQA 3ZI4A 1PGPA 3H2JA 3RF7A 2Y1FA 1Z56C 2L2QA 3L49A 4R9RA 2FWIA 5IH7A 5BR8B 4RJLA 3FSGD 1OC2A 1LK7A 1MAHA 4PO1A 2ZJZA 2OECA 2ZUVA 3QYFA 4FHZA 5G0WA 3VC7A 5U1PA 2NZYA 3WHKA 3WGGA 1VLZA 4BKQA 2R1TB 2R3SA 2WZCA 2ZJ5A 1SR8A 2F59A 4KOEC 3WV4A 4G36A 4BO7A 3NKLA 3AF0A 1DBQA 1KP9A 3GZJA 4FB5A 1SUDA 5F7XA 3AERB 5AJTA 5T4FA 3LVBA 1I3NA 2IUTA 1Z6GA 3O4JA 2WI8A 3QZUA 1T9BA 4PZDA 2AN3A 3Q72A 4ZRNA 3VNQA 3OMLA 2AUMA 3MJEA 3KQQA 3RYHA 1JXOA 3FB1A 5LUBA 3NBXX 4B3DA 3QF4A 3B2QA 2QJRA 3HXPA 4CODB 1OXVA 3KZOA 4WOKA 2VJQA 4N8EA 4DF3A 3GD5A 1LI7A 3E23A 4CEJB 2WVJA 3HB1A 4QULA 3KZXA 4I1RA 4WBSA 2IOFA 2PUAA 3NHLA 5DLYA 4YQYA 5EKUA 2JGDA 5LQDA 2G72A 4RENA 3EGIA 4BRUA 3O2SB 3OE5A 3LHFA 1NLYA 2SCUB 3GLVA 1ADCA 4GO1A 1TCBA 1ONSA 3PR1A 4HLNA 5DASA 1MB9A 2YRFA 3H75A 2GAJA 3N8NA 1P5RA 5FUBA 3SYKA 1YO6A 3TVDA 2PHZA 3K0CC 2I03A 4FPXA 4YAIA 3T12A 1Z7WA 1JEJA 1NJGA 3VOBA 5B30A 2BEWA 4BJ6A 1E6MA 1DZ3A 3PDJA 3AINA 2EBHX 1T35A 4M36A 4RVFA 4RPIA 2XB8A 4YA6A 1JMVA 3O4GA 4RK4A 4CMCA 2W4MA 4G37A 4AS1A 2H6EA 4OHKA 1DTWA 3JR3A 3DTVA 3NANA 2KI5A 3NOXA 4QGBA 5GM2A 2OPBA 4JOQA 1EFRA 4MV5A 4OGLA 2PBFA 3GOQA 1L7VC 2X86A 2ZREA 4TRRA 3IIEA 1OGIA 1E18A 1E2LA 3ONWA 1K6EA 2Q0SA 1K3FA 1JTFA 6ABPA 3IODA 1W36B 2A9VA 3CEMA 1JF8A 2D0IA 3OUTA 3TIVA 4C21A 2HDHA 3K9BA 1YHYA 1HE4A 1HURA 1XZCA 4Y6OA 1JQ3A 5DP1A 3IEXA 4QUGA 2C9DA 3HY3A 1E9AA 1P7PA 1LB1B 4WOJA 1P7YA 2O9JA 2Z3ZA 3OETA 4EPWA 5JSUA 1TX4B 1RCTE 2REQA 1HSOA 2QGZA 4R69A 1Y7TA 1SQFA 2HIAA 4AF7A 4BNYA 2ZVDA 3EIWA 3DAOA 1Z73A 2JLVA 3U3XA 4D56A 1L7MA 4KQIA 1F4PA 3PGLA 1AOXA 3AM4A 4YASA 4F84A 3T5PA 1N0WA 3SPXA 1CJVC 5BV1A 3NIWA 3K2IA 3AT1A 2GCOB 2JATA 3LAWA 4KGXA 4TWZA 2JI6A 3L40A 1USGA 4M0EA 5CT4A 4EFDA 1T5DX 3P2EA 4M9RA 4QVGA 4BNGA 3E1SA 3CZRA 3L0CA 3ZS9A 4I50A 1PJTA 3L92A 1QKIA 5HWSA 5SY4A 4S24A 1E3MA 3ZY6A 2V0CA 1EDDA 2GN2A 3UT0A 5BOSA 3OZIA 3A4IA 1X8JA 2GZHA 4UTPA 5REQA 4E4RA 3U1BA 2JFGA 4EAQA 1RI2A 4X65B 1XRNA 2OORC 2Y2VA 3HCPA 1R0YA 3LPAA 4Y2PA 5CCDA 3IAAA 3JX9A 3U2QA 3UOAB 1DQRA 3UMFA 1UINA 2LIPA 3ROXA 2EKLA 5MN6A 1NRJB 2RHJA 3R6TA 2CB0A 4G86A 2JVJA 3ZXSA 5FUXA 4FJ2A 1UCFA 4UW9A 1YB1A 2JLSA 4R1QA 3BB3A 3IXQA 1OYVA 4BNLA 1QQ5A 1VHJA 5U4QA 1IQRA 4AICA 5J5CA 5JU6A 3IULA 4OXKA 1FNDA 2CNWD 4NL4H 5A4KA 1Y6FA 2FDRA 3FZNA 3IUNA 1AUOA 4MWOA 2X4LA 4KO3S 3ZPXA 3SN6A 1JXAA 4H0CA 1XRLA 4WOCA 2I91A 1RWXA 2IUSA 3MQ4A 4GL4A 4LZOA 4OM8A 2HCTA 2ID8A 3CH7A 3H42B 4PYIA 1A5SB 5K0LA 5TF4A 4EI2A 3WMXA 3COWA 3U6BA 1EU1A 5KNCH 3AJRA 2IVFA 3M6IA 2D1QA 4QYWA 3G13A 2EL9A 2H4ZA 4DJFC 2ZSUA 1CEQA 1CY0A 1JZTA 3CCCA 5D7BA 3W5HA 5ALKA 3C74A 4BLPA 3N0WA 4DSTA 1R1DA 4QVIA 4DG9A 4KTTE 4YMGA 1WMAA 1KETA 4E5NA 3HDGA 4FCTA 3B7WA 1M7GA 1SHTX 4LPKA 1KJIA 2HPVA 3OQJA 4RKQA 4F96A 3KUKA 3VR5D 4ZAGA 1NLZA 5ABPA 5A9SB 1N2CB 2MHCA 2VTVA 1NJ8A 3NOOA 2YR0A 2YL2A 4QODA 3PC3A 4QQNA 1EFLA 2GN1A 3G2OA 1WPGA 3EMBA 4EHDA 2P4UA 3EG5A 4COOA 4PQYA 1LS1A 4ZT3A 3IBTA 2CHEA 4OGWA 3ZV5A 4DMFA 1Z7EA 2QAIA 2VYVA 2XKBA 3KPWA 1R74A 4G6ZA 1QPBA 2FRDA 1QF7A 4HYQA 4MUNA 3TZLA 4ACBA 3DAPA 4S0ZA 5JNWA 3K5HA 2ODPA 3L0PA 4G5FA 4RU1A 4JLPA 1AA9A 1RP7A 1BU5A 1UK6A 2W2LA 3JXEA 1AO3A 3KOUA 1FDVA 3LD9A 4MIKA 2RH9B 5ECYA 4DPMA 2X5NA 3Q6IA 1T8UA 2XBLA 2E0IA 2Z5VA 1EIWA 1Y6JA 5IH3A 2XKKA 2WWIA 5JDIC 1I24A 3I2GA 3KP1A 4R51A 4D9IA 3SR3A 1EDBA 1GZSA 1MIOB 3QYJA 4URUR 1KFEB 3W4IA 3WBFA 1F6BA 2XXJA 2ETXA 1XMOB 5JS2A 2EW8A 5IBPA 1BS2A 3WWDA 3GLIA 1DFIA 1T91A 3F5SA 4LOJA 3O8DA 3HA5A 3VV2A 1Z36A 1E7QA 2MT9A 5FPPA 4CWAA 5K0SA 5K8UA 3M1LA 7MHTA 1WPXA 1DOZA 2ID4A 4M0KA 3T5BA 1ZGCA 1HFKA 2M98A 3LDFA 3QA9A 2FZ5A 2PLFA 3O83A 4XYGA 1XDZA 4DNPA 4F60A 3OY7A 1NR5A 3D3EA 2AHOA 2O7NA 1XV5A 1ZQ9A 3SYNA 3ZDCA 4CF6A 3KLNA 4DL9A 1VYTA 2FRXA 4Y9RA 5F1KA 5JXWA 4QOJA 3ENZA 2ZTVA 2Q49A 3Q7QA 4K0RA 2P9TA 2DRIA 2BGKA 4E33A 3AGPA 3EXHA 3KV3O 1NASA 1AH2A 1OBFO 3R3SA 3AL3A 1VPLA 4NULA 3SIWA 5KTSA 4O4IB 3QLUC 3QFFA 3SHFA 4YAUA 4IJQA 2J5XA 4C7VA 5KYWB 5HYVA 1A50B 3RYIB 3OQNA 4JA2A 5HJ2A 2Z6VA 3KIPA 3QVVA 4TZKA 2PXCA 4XX1A 5ALTA 4DLTA 4BQRA 3WAKA 3VNAA 2WTAA 3WJAA 4FDAA 2ZJ4A 5I3CA 1C9KA 4RS3A 2VUUA 3GU3A 4CM6A 3NKVA 4KR6A 4HG2A 3GDFA 4QU0A 5CVCA 4BRSA 3UBTA 1Z12A 4BN4A 4NEHB 2YIDA 1JI0A 1I1QB 2RBGA 5ENZA 1UT8A 1F4LA 1Q83A 1NI5A 3WL4A 3HPQA 4S12A 4E11A 5G1PA 3C5CA 3A6PC 5JWHA 4QXPA 3L7LA 1AUQA 3FTQA 3SEAA 1J1IA 1KK0A 1V8PA 5TVKA 3VGJA 2VJDA 1VPDA 4CRWB 3GBVA 3DAYA 4LRUA 1KEZA 1UWKA 1Z6QA 3ABZA 4IGAA 4EFKA 1D03A 5BUCA 3L7AA 3WK5A 4NESA 3HKDA 1TKBA 2C2OA 3NHBA 4IH1A 4GX0A 4UHFA 1Y8CA 1DRVA 3GEMA 1ZZGA 3LZ6A 4JLMA 1FJXA 4CEIA 4P31A 3MK31 4EGJA 1TRHA 2JLAA 4W9NA 3ZJTA 1DO0A 2M2IA 3U7EB 4LZPA 4MWGA 5I4IA 5HKAA 1HC7A 3KKOA 4Y6GB 3VYSB 3IQIX 1TJNA 3PFFA 2WQ6A 3O9VA 1QFXA 4NABA 1Q6YA 5EHNA 3RSSA 4D81A 5HZKA 2OD7A 4AN4A 2H51A 4UPEA 1FUYB 5K5EA 3FM9A 4QJBA 3H18A 3OCWA 4F4CA 1Z88A 3DHEA 1H1LA 1I4TD 1NHGA 4TWAA 4BTLA 1D0VA 4IKPA 4X7PA 1W6UA 2R1VB 2X22A 1JHVA 2ID7A 1F2DA 4JQZA 3AB7A 2BAGA 4W5HA 1CULC 1W5AA 2V55B 3EGDB 5ECDA 1WUJS 4I4NA 2RD2A 2QRGA 2Q0QA 4ON9A 1NNI1 5CFLA 2GETA 4V39A 4YJHA 1CU1A 1YU6A 3NHJA 4QOEA 1N2HA 2ETVA 1B8PA 4UNSA 4RM3A 1K89A 4J6FA 3IELA 4YDRA 4V0QA 1ESCA 3A9SA 3CLTD 3RVJA 2F48A 2A0YA 2OUIA 2PIDA 3EE6A 4UMDA 4DEVA 4ER7A 1JAHA 2D2FA 3K71B 1DX6A 4IIYA 4OY3A 5EWMA 4EW6A 2G9ZA 2XLCA 1TU0A 2I6XA 5JOQA 3V4FA 3OP4A 3PCTA 4MVWA 1N57A 5E9AA 1CFJA 1F6WA 4KPFC 1Z0KA 1Y98A 2FX5A 2VPPA 5JE8A 3T41A 4BO0A 2V45A 3HUDA 3TUZC 2QUIA 2JLXA 1C3LA 1B8NA 2I62A 2JLBA 2X0FA 1E5DA 2FPSA 4OVKA 2VXBA 3T7CA 1YVRA 1MAVA 2OGWA 3FSGA 3QUTA 1SFRA 3G9ZA 4NBLA 4HWOA 4UAGA 1NKVA 1QTNA 1Z3CA 3AHGA 4J1TC 3HZHA 4F2GA 3MTBA 1G3MA 1Z5ZA 4OGFA 3HACA 4KOAA 3NI2A 2ATIA 4NS1A 3GBPA 4X84A 5CLFA 2VJLA 3M2TA 4TTVA 5CITA 1ZQ1A 2HMAA 2O0JA 5THKA 3VX3A 4B76A 2CSUA 2XTAA 1ZRSA 3MA0A 3UVEA 1OREA 3KWMA 1GU7A 3PS9A 5DZSA 1MOZA 1MVLA 1WCV1 4S1TA 2R8YA 3FBWA 4I55B 1MVNA 2J3HA 4NS4A 1IHXA 1SY7A 1Z8DA 1LK0A 2RBEA 3E5MA 4K9QA 4OQPA 4CM4B 4XR9A 2ZSEA 2GN4A 3KB8A 2WC1A 3LO5A 1VKJA 2QE7A 5HBRA 3NYRA 3M3DA 2JAWA 2Y1LA 4DIMA 4GM4A 2ZWOA 1V1MB 1FCJA 2G8NA 1M2WA 2QE6A 3NOVA 4RHXA 4JXXA 1NYQA 3GJQA 3PPWA 3VDXA 1SVIA 1KARA 2Q3EA 3LQKA 1MORA 3JRWA 1MC8A 2HK7A 2Q2OA 4BLVA 2VRWA 3U5TA 2OFOA 2Q2NA 1NONA 3VKGA 5IF3A 2B4RO 3D4IA 2CNNA 2GA8A 3K0FA 3K4HA 3LOPA 3CUEF 1NE7A 1RXCA 4IZIA 1X9GA 2FQ1A 2R65A 4B35A 5J3JA 4DLAA 4KIWA 3T7RA 1E1DA 3USES 5A03A 5CDSA 2IXAA 1L1EA 2IVZA 5L4LA 4UUAA 4OHCA 4BRZA 4EHJA 5KQPA 5JQGA 1EH5A 4XFDA 2GKGA 1U90A 2PNFA 4HQRA 4V0MA 1JFTA 4MRPA 1KIAA 3H16A 3H4IA 1B16A 2AUTA 3M4YA 1KC1A 4BB0A 3W8RA 3ZY2A 1FY2A 4PONA 3UFXB 2I2FA 4NHOA 4ALJA 3MHTA 5HOEA 5IG2A 2L42A 2C2ZA 1ITZA 2WFAA 3N28A 2LXNA 2NQTA 3SYMA 4KNWA 1OV6A 1NP7A 2X7XA 2YHIA 1DAOA 3C98A 3K4QA 3Q1LA 4QSMA 4CG0A 4CKYA 5I9NA 2BONA 5C1OA 1NVBA 5FA5A 3Q5GA 1X1AA 1QDUA 2ESRA 2I5PO 1M34B 3R7BA 3FMGA 4RFVA 5CB6A 2BP7A 5IAAA 2QP3A 1YCHA 3EPJA 3MCUA 3G8DA 4YP6A 5CEFA 1KYVA 4KFCA 2QN2A 1T2DA 2HA7A 3DE5X 4IDCA 4JQCA 1BH6A 3FMPB 4LYJA 4QE3A 1W0JD 5LU8A 1R0ZA 1ID8A 3PNKA 4U63A 2FZWA 2I4RA 4C1BA 5JC8A 1NUUA 1YBVA 2PZFA 2DGDA 5IPFA 1JZSA 2ZE5A 1A5TA 3D1LA 1WIWA 1GVHA 4QECA 1AUVA 4DWOA 1QR2A 3NVAA 1NHWA 3AV0B 4GR4A 5H8WA 4LJ4A 3K70B 5DHFA 5EZYF 2CDAA 1TYCA 5HIIA 3U3JA 1X1BA 1Y89A 4UEJA 4FDLA 4IRXA 3EEIA 3PNVA 4CF4A 3CZ4A 5AICA 3UKDA 2B4QA 1CF2O 3N2LA 3GFSA 2Q99A 1HEYA 2K6GA 4P34A 2IHKA 1SPBS 1YE8A 4WXEA 5E6RB 1U65A 4N82A 1KDOA 4XEUA 3TPCA 3ZXUB 1ODIA 3OPXA 4GOLD 1GZHB 2C3OA 1B0UA 2WKPA 3HU3A 4UNNA 7REQB 4IHAA 2J3EA 1J24A 1KEEA 1DIAA 1TAQA 1P17A 1SQSA 4G5YA 2VH1A 3LLSA 4ITVA 4WGFA 2RGGA 2WILA 2JKVA 1ELOA 1Z0UA 1ZGZA 1HFEL 3H5TA 5FUMA 3FDIA 3LW7A 1NNSA 1E4EA 3PUIA 3WIOA 1Q1ZA 4WIAA 2IYSA 5U9CA 1J21A 1SD5A 5AI9A 5DPMA 2FYTA 4BNMA 5DLQC 2C84A 1S3GA 1JSXA 3HWX1 3IPXA 3CCFA 5FCDA 2IZ1A 4J7UA 2X77A 1M74A 1JMYA 1EX1A 2AJDA 1PTJC 2FFBA 2FPKA 1O6GA 2X1HA 4DIBA 1GA6A 1P3JA 1TUBA 3AEYA 4PANA 4PSAA 2HA4A 4J03A 2V0NA 4BJ5A 3KXPA 3VR5A 4OA5A 1Q50A 2GEUA 3U7QB 4L5BA 2V74B 1I13A 3PZRA 4UNQA 5IMBA 3GRVA 3DD5A 4UD6A 3VYRB 3PV0A 4H1WA 2GTPA 5K8VA 1XJQA 1JDBB 4Z9AA 5A4DA 4M8LA 2HO5A 4DW8A 1K63A 4MRVA 1AGXA 3MWKA 4B2IA 1CSEE 1OWOA 4OSEA 3JAWB 1RBMA 5JNLA 3LPDA 3V4RA 3M3HA 1KFBB 1DNPA 1TD1A 2DUMA 2J33A 3FHLA 3OX1A 3V7WA 4FW9A 1U1CA 4X1IA 1JEDA 4E2FA 3NMUF 3WL7A 1V43A 4W7IA 1C4XA 3VR6D 2VJOA 1GUZA 1K27A 2JBWA 1SULA 3OOSA 3ROEA 4A0RA 3I0MA 3IILA 4EAAA 1FXWF 5DYTA 5FJJA 2VN8A 3WWZA 3ZS8A 1P72A 3FWKA 2BKVA 2ASVA 5ES3A 4D74A 1AB5A 1QP8A 1RQ7A 2WIDA 3LRTA 3AM3A 4BUCA 3U9LA 3STXA 4CW7A 4PS1A 3I9FA 3I30X 4L0MA 3TXXA 1I4EB 2DWUA 1D2MA 3FTNA 4G2TA 3LQ1A 3PL1A 2KLHA 4OM7A 4XZ3A 2PE5A 3D9QX 2PX5A 2W8BB 3R5JA 3OIYA 1KYYA 4RQUA 4US2R 4Q1DA 1OWLA 1EZZA 3BMQB 4RDXA 1JWAB 5F23A 4UOQA 1VJ1A 2XZTA 1GPUA 3CMMA 3SS7X 1L5RA 1YZLA 4RDHA 2I0FA 4O25A 3RRNA 4CEHA 1QZ3A 2VS1A 3E58A 4H60A 1SXJB 1RHKA 2XUFA 1W9MA 2RSLA 3PHLA 4HLUA 5BN5A 4N03A 3ND5A 1BGXT 1Z5WA 3I23A 3LLMA 5EA2A 3WNCA 2C4HA 2YFKA 3GVXA 1ZCFA 2BLLA 4LSGA 3OQIA 4GMGA 4ONEA 3QUQA 3LU1A 4PTYA 2FKNA 2V8OA 2FCAA 4ALMA 1YUNA 1Y4DE 1W93A 2GXUA 3DR3A 1C0LA 3LW8A 4KXYA 3GLFA 1BXRA 4IJWA 5HKBA 2GCIA 1N92A 1PK7A 2PSDA 2OKCA 3OURA 3ORSA 4IOKA 3E9YA 4S35A 3QJGA 2EBUA 1J8MF 1IHDA 1K7FB 2JCSA 4MS1A 4OHZA 3GG9A 4E88A 3SR4A 1SVSA 5EWLA 3N74A 2DEUA 4WNAB 2PWBA 3SDBA 3T1OA 3WLIA 1Z2CA 3AR6A 2H85A 4AY5A 3ZZUA 2FEKA 4OQFA 2GXAA 4ZQFA 4YUXA 4DJEC 4YJGB 5K8JB 1NVVR 1EAYA 1R0KA 4ZC1A 3K94A 4BFUA 3SS9X 3GLSA 4WACA 3DYVA 1N1DA 5CVTA 2R6DA 1PUJA 1SHLA 4J0DA 5KS2A 2OM2A 2WUVA 1F8GA 3NEYA 3TM5A 2QD1A 4DSUA 4E12A 1DEAA 3DLIA 4HGYA 3PHIA 1CJCA 1N3YA 3D0KA 4RO0A 1U0SY 3TXYA 3ZHTA 2Q29A 4KYIB 2C3MA 1H23A 2GSWA 2Y1GA 3EBLA 1RRFA 2N9UA 2O5EA 1E9SA 4RD3A 3U5ZB 2FPWA 4RIHA 4KR2A 3DPIA 4GT1A 4AMGA 4QT0A 4F4IA 2X19A 2FPPA 1WG8A 3ZU3A 1Y9EA 4L9RA 5AW3A 4EX6A 4G1CA 4OAPA 4U7HA 1ZH0A 3AF1A 1SU7A 4GFDA 1DO8A 4DCOA 4L3OA 3FPBA 1Q1QA 1KZHA 1UDRA 1YJQA 3EIQA 4E2XA 3BB1A 2Q9AA 3AEZA 4US0R 2GZ1A 4P7BA 3CPJB 3PQ3A 5G0VA 1JQBA 2OYCA 2OHJA 3BEOA 1N6HA 1M66A 1BD4A 3FR7A 4PFJA 2BT4A 1UJ6A 4MGHA 1QFSA 2G1AA 1MB0A 3G2HA 2QPAA 3GLGA 3AKZA 1T2AA 3P9KA 1SUPA 4K9PA 3CYFA 5BOVA 4UHBA 4D6XA 1T3LA 2BEUB 2EGGA 2LCIA 3EHDA 1U0NA 1UK7A 1QDEA 1QHSA 3MT8A 3NVMB 1QBKC 3PDIB 3DNMA 1W88B 2DCMA 3IP9A 4FK8A 5BYBA 5KOHA 2XNHA 5EJFA 5HOQA 1GQYA 4RHFA 3A0RB 3C3CA 3DF9A 5SZHB 3PVSA 4NQRA 3QVXA 4BB9A 4CMBA 4NXNB 5KB3A 2REXB 4RZHA 3ZE1B 3O1LA 2BHLA 2GASA 2P65A 4L0DA 2DFDA 3PXGA 1Y6GA 5JEDA 4K9LA 4MV8A 3DHVA