1GCIA

The 0.78 angstroms structure of a serine protease-bacillus lentus subtilisin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 0.78 A structure of a serine protease: Bacillus lentus subtilisin.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Serine protease
molecule keywords SUBTILISIN
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1998-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1gciA00
1GTG1 2V8BA 3TI9A 1GTJ1 1TMGE 4YN3A 5I9SA 3GT4A 1SUCA 5AMXA 1NDQA 5FAXA 4ZOQI 1Y3FE 1AVTA 2DUJA 1SBCA 1TM1E 5FBZA 1AQNA 3OSZA 1P7VA 1MPTA 1T1IA 1TO1E 2IXTA 2ZWPA 3L1KA 3Q40A 1V5IA 1Y3BE 1BJRE 2Z2ZA 2Z2XA 3CNQS 1YU6A 5JXJA 1WMDA 1PFGA 1EGQA 2SECE 4DWWA 4OMDA 3LPDA 5AQEA 1SBIA 2W2NA 1WVMA 3I30X 3VTAA 4OV6B 1TM3E 3BPSA 3DE5X 2WWTA 1GTL1 1C3LA 1SUEA 1NDUA 3DE6X 4GI3A 4H6XA 4NMXB 1IC6A 2PRKA 3UNXA 3A3OA 3DVSX 4C3UA 1T1EA 2PWAA 1KDYA 3EE6A 2ZRQA 3F49S 2W2OA 3GT3A 2PMWB 5AVJA 3PTLA 3AJ9A 1C9JA 1THMA 2SICE 1Y34E 2DQKA 3VSBA 2XTJA 1GA4A 1AU9A 1ST3A 1YJAA 4FONA 2GKOA 3DYBA 5JXHA 4NE7A 3F7OA 5ARBA 3CO0S 3WIVA 3AFGA 1AH2A 1BH6A 3DE7X 2X8JA 3F7MA 4BWGA 1EA7A 1YJCA 2WUWE 1BE6A 1WSDA 1Y3DE 5SICE 4ZARA 1R64A 1GA6A 4KB5A 4CG0A 1A2QA 1C9MA 1SBTA 1SPBS 2B6NA 1P7WA 4B5LA 2XRMA 1AK9A 4J94A 3HJRA 3LXUX 3BX1A 1MEEA 1ZVKA 2W2QA 5ARDA 1KDZA 1WMFA 3PRKE 1SIBE 1LW6E 1NLUA 4Z2AA 2SNIE 4WOCA 1GNVA 1PTKA 3T41A 1SIUA 2W2MA 3GCXA 3WQBA 1Y33E 1Y4DE 2Z56A 1SCNE 3WHIA 1R0RE 2ID4A 1IAVA 1Q5PA 3P5BA 1Y4AE 1AF4A 4LVOA 3QMPA 5K7SA 3D43A 1ZVJA 1TM4E 2PQ2A 3GCWA 3TI7A 2HD4A 2QTWB 2SBTA 1C9NA 1JEAA 3DDZX 1GA1A 1SIOA 1YJBA 3DVRX 3WIUA 5B1DA 4RYDA 1GNSA 1BE8A 3D9QX 4H6WA 3VV2A 2DP4E 3DE4X 3I2YX 3I34X 1R6VA 4I0WB 2IY9A 1GCIA 1S02A 1SBNE 2G4VA 3DW3X 3SQOA 1T1GA 1SCBA 1Y3CE 3DE0X 1SBHA 3QFHA 4AKTA 1TK2A 5CW1A 1KE1A 2WUVA 2Z30A 1TECE 1OYOA 4M1ZA 1PEKE 1WMEA 4LVNA 5FFNA 2X8JB 1ST2A 1HT3A 5B1EA 1SUAA 3LPAA 4KG7A 5JXGA 3ZXYA 1S01A 5JXIA 1GT91 2PKCA 1SELA 2WV7A 4OMCA 1CNMA 1TM7E 3VYVA 3EDYA 1KDVA 4HVLA 1KE2A 1PJ8A 3Q5GA 3SICE 3DWEX 1SH7A 3A3NA 1SCJA 3BGOS 4CFZA 1SUPA 1SUDA 3ZXXA 1SUBA 1Y1KE 2TECE 3DE3X 1Y9ZA 4KPGA 5JMOA 2ZWOA 3AJ8A 3LPCA 3DE1X 2W2PA 3DVQX 3EIFA 4H6VA 3I37X 4K8RB 4DZTA 3VV3A 5ARCA 4CFYA 3TECE 1SN7A 2PWBA 1BFUA 1P8JA 5AVKA 4WOBA 1BFKA 2Z57A 3DE2X 2Z2YA 1DBIA 1DUIA 1VSBA 1XF1A 3H42B 4HX2A 4JP8A 3VHQA 4C3VA 1S2NA 4AKSA 2Z58A 1OYVA 2PYZA 1TO2E 2E1PA 2ST1A 1SVNA 2P4EA 1OT5A 2HPZA 4NE9A 3A3PA 3DW1X 4MZDA 1AV7A 1SCDA 1TM5E 1UBNA 2ID8A 1SCAA 3QTLA 1CSEE 4DJ5X 1Y48E 1V6CA
chains in the Genus database with same CATH superfamily
4RFSA 3E27A 4BQSA 4KAAA 1V96A 2XZDA 4JJ7A 3HJCA 5EHIA 4PWZA 5D7BA 4EG8A 3UUWA 4AIRA 4MA0A 4JCCA 3ICCA 2JAHA 3RBAA 4PYRA 4OY3A 4GZLA 3PFHA 5ALIA 5EI5A 3V2GA 1WMDA 5L9AA 4LYDA 1TCUA 4FMPA 1Y37A 2JLYA 3T7JA 1U4OA 5P8WA 2MSDB 4GD3Q 5GM1A 4WINA 3JYQA 5CJJA 1IB0A 5EKSA 5F9MA 5K6RA 3A4VA 4P0QB 2CB9A 3SJCA 2QAGA 3PCRB 3G6KA 3R41A 2NTJA 2QI9F 3D8TA 5K3FA 1OYWA 4TWIA 3EH1A 1QZZA 4BNWA 2HIHA 3BORA 5T67A 5MHTA 1MJGM 3DFFA 3K73O 3N59A 1Q7EA 3ACCA 4XVHA 2QROA 1GPBA 1IBCA 1PDVA 2JAXA 4PLGA 4YPOA 5TMEA 4ZDIA 1TU3A 1DX4A 1NF2A 1OJ7A 4Q3OA 4Q4CA 3C16C 3GRRA 1JTVA 3QJYA 3LFHA 5GONF 3KTDA 4ALIA 2ZIEA 4GGMX 4DLYA 1TMYA 5CM8B 1F12A 1GFIA 1PKEA 2W2QA 1S2IA 1SKBA 2GRJA 3RYHA 3EDRA 1DAMA 3LC7O 4TLLB 5E6RB 5K3SA 2PPLA 1SXGA 1B1CA 1BRTA 2CLOB 1Z28A 1V3QE 1R0ZA 2XUIA 3BN3A 2GZAA 3LA8A 1UC4B 5CVEA 3VR0A 4AKIA 2CDCA 2BKLA 1UT8A 2CLCX 3DMPA 4K9NA 1RHMA 5CFOA 1F3LA 4M89A 5A71A 2FG6C 2JBAA 5K8IA 2FUKA 4TYPA 2H2FA 2GDJA 3MNFA 3PA6A 2P5SA 4QYTA 3GDOA 4ZFNA 1HDGO 1C29B 5BNZA 2HBYA 5DK4A 2PJZA 3ADPA 3ZBTA 1G8YA 1GAJA 5B7NA 1Y7LA 2HTFA 3GG2A 5A0VA 2CBGA 2CLHB 2WBLC 3TJRA 5JBNA 4CV0A 2B3DA 4GLOA 3ES9A 1PUIA 3FSJX 4G1UC 1E2EA 4M86A 3THOA 4MS4B 3MWDA 3VR4H 5FBWB 1WB4A 3P52A 1OU4A 1E99A 1NURA 1W30A 4FHCA 3TIXB 3VDNB 4TT8A 1Z35A 2I1VB 1X3LA 3TZBA 3DUWA 5FFNA 4FC6A 2XUFA 3GA5A 2CLEB 1IHUA 4UTPA 3ER8A 1P73A 5ICCA 5DNVA 3E4CA 5J5AA 4CQMA 3OE7A 5CTJA 2WSIA 4F4IA 1BVYF 2WQZA 3SICE 4NDNE 3JQ7B 1U0GA 2BFFA 4MWZA 1VSQA 5CFLA 4AF8A 3GH3A 4DQKA 3T52A 4YMVA 2DHRA 1NLYA 2D7CA 2ISQA 2CYAA 3A04A 3DE1X 2OK7A 4JWKA 1TTPB 4RPJA 2CEAA 1X1AA 4MS1A 3AY7A 4KIWA 2B37A 1KL7A 1Q11A 1ZXLA 2Q3EA 5EVJA 1KOLA 4I3HA 4NE2A 3T5DA 3UOWA 3ZY2A 2DT5A 5K05A 2E4AA 2Z57A 4BX2A 5HHTA 2BRUA 3AY6A 1QLJA 2HJWA 5L7YA 4PAQA 3CPEA 3GL9A 1FRVA 8LDHA 1GQFA 1A71A 1N6KA 3G1UA 3G7NA 3NOOA 4FMDF 4YUZA 4CEHB 1F8XA 4A6PA 1G6OA 2VHEA 4ND8A 4RIFA 2G4CA 2OXEA 1OH5A 1T0JB 4S04A 2HL6A 4J2TA 1GFWA 1FNMA 5L3SB 3E9DA 1F3OA 2O4UX 1KGDA 4DQ0A 3NAMA 3PTZA 3R7LA 2IEAA 3M6FA 4P32A 2JLUA 1AKQA 2OV1A 5K03A 1V5IA 1DO2A 1EXWA 1L5YA 3O4IA 3VOBA 3ZNOA 1EFLA 5FLXA 4C04A 4RHXA 1PDWA 1RKXA 3Q10A 3RK1A 4KU4A 4BFXA 1R6TA 3WS7A 4JI1B 1E1QD 2IZ7A 3DKKA 5AHRA 1K5GA 5LWHA 3K71B 1WDWB 3WIBA 3EISA 2ERYA 1KVRA 3IKVA 3K8YA 3G0BA 2Z2KA 5AXDA 2DRIA 4ZQCB 1JYSA 5DEOA 3W90A 1KK3A 3F49S 1JKXA 3L79A 4W5WA 3UFBA 4JYBA 1C7ZA 4CMHA 1THMA 4KK3A 4ZVPA 4WEQA 2ZSUA 4JHLA 3FVQA 2WU4A 2B83A 4QUIA 2W71A 4OXIA 1BOFA 4F4FA 3C7TA 3W7BA 2ZU0C 4MW1A 3T4XA 4DGSA 4BWGA 1GGNA 1HO3A 5BVHA 4RKFA 4CEJA 1Q95A 1EG2A 3H17A 3S2SA 3HUFA 1TK3A 3OPMA 5JMPA 1E18A 2I1WA 4OGGA 3V3KA 4UBNA 5DTQA 3NUZA 3N8NA 5FBKA 1PZEA 1LDNA 2I62A 3ZWMA 1KY3A 3F6PA 3G8AA 4I9NA 1J42A 3KR2A 3W2EA 2GK7A 4DM4A 4ZHQF 3BRWD 1E2MA 1OILA 1I7QB 3I1JA 3NJ4A 4BN0A 4EB6A 3Q3CA 5BWCA 4PANA 5B12A 2D8AA 4TX1A 1G9XA 4YS6A 1F5SA 1ODSA 1WCV1 3KUCA 3L4EA 4FBLA 3U4MA 4LG1A 1F7UA 3MFQA 1GL3A 2BI4A 3P2KA 2WHPA 5IAEA 4B82A 5EXSA 1XLWA 2QRQA 4K9RA 3VTFA 4E2FA 1U2DC 2D1SA 1OXBB 5DCUA 5D2CA 2F3PA 1AQIA 3L06A 4YR9A 1RS0A 1Z5GA 3M6LA 1BOOA 1MV5A 1YD7A 2BI8A 3IURA 4EUEA 3WAGA 1HEUA 1RJEA 4B76A 5FOQA 4YEDA 2IV2X 2VP6A 2X3UA 3ADOA 1JXMA 1LBEA 1XZMA 4WTOA 2JEOA 3G5UA 1JLRA 3V80A 1XNRB 1TF7A 3P9RA 4ZQHA 5EPOA 1GCAA 2X1MA 3CF4G 3FPHA 1J1ZA 1RI5A 2C99A 2WG0A 4P93A 4YPVA 5KSYA 3IIEA 2D0IA 1UKAA 4FGZA 3LPCA 1GCUA 4C0WA 1XFAA 3AYZB 1S3IA 2P77A 1GAXA 3V1KA 1STOA 4MVJE 3TSZA 5I7SA 4I9FA 1WZIA 2E82A 221PA 3AV0B 3LUBA 4XWKA 1C1HA 3KWFA 2IDZA 1XGKA 3C2QA 1OSNA 3UGKA 4EEXA 1E5XA 3FWPA 2AF4C 4UMEA 2R8BA 2UUBB 1OVGA 1W34A 4E1BA 2P4EA 4W82A 2ZIWB 2GN9A 2YZKA 4KHPB 3R20A 3SBEA 2Y1OA 4RH3A 5BN1A 4DKJA 1WO8A 1UWVA 5BR7A 1XZIA 1RAGA 4RX1A 3TQCA 1WTCA 2D3WA 4UCXA 4ND3A 5FBZA 4EUHA 4AKGA 4OI2A 1D2GA 1LBIA 3DT9A 4PO1A 3BF8A 3WP0A 2HRQA 3IOEA 3DT8A 2I1LA 3DTVB 4JQSA 3B5JA 3JVVA 3NWPA 4PZEA 3AHCA 5KNDH 2AUNA 3DDWA 5E95A 4EPVA 3GP5A 2D2FA 3PQEA 3LDFA 3MXOA 4XPIB 1FJHA 4EVSA 2LIPA 4C4RA 5EKTA 2N42A 4ZOLA 1GTL1 4A6EA 3Q98A 4Z1MA 2IBMA 2G82A 1D2CA 2A8YA 4RD1A 3V55A 2D62A 4C0JA 3V9AA 1QO7A 1QJCA 1FU8A 2C20A 4R40A 2GPBA 2NZ2A 4LCJA 4NNOA 4QFDA 5H1YA 2YY5A 4CKEB 4UTXA 4LWZA 1CYEA 1RWBA 4NFYA 1G8KA 2HXYA 5H0IA 2ZIXA 4AG5A 5IZ4A 3HXQA 1MXHA 2NU8A 3QA3E 1X9IA 1NUSA 4M7OA 3AY0A 2YMQA 2OGWA 2PAFA 3EF3A 3QU5A 2QI9C 3T1OA 1S3SA 2PX4A 4TVKA 1OA0A 2OFOA 3FFTA 4C4OA 3QVXA 1HI9A 4JSYA 3OEEA 4D02A 4WKGA 3FZGA 3OFSA 1RWKA 4QXRA 5J4KA 2CYCA 2QUIA 1Z56C 1N2XA 2EP5A 3S2YA 2IXEA 3SD7A 3GRFA 3KCQA 4FWIB 2Q5FA 4NECA 4EB3A 2FQXA 3EVTA 2JIPA 2R9VA 3I2KA 4HNHA 1YHZA 3EVAA 1QB8A 1QHFA 3RRNA 1D0VA 1V8FA 1W0KD 3FTNA 4F1KA 2Z95A 1RCTE 2FEPA 2AG1A 2I2DA 4TYMA 2Z6AA 1OIWA 1ULUA 3GPDG 1BN7A 2HFJA 4MR9B 1OHHD 1W4AA 2OV3A 3ZD8A 2OHFA 4WQMA 2VWGA 2XMBA 4FSHA 1S8FA 3LD9A 1KYTA 3DMYA 5GGYA 1WY7A 4OI0A 4GOLD 4YAUA 4MQ4A 1C4XA 2LE0A 1XQVA 3DZBA 2QN3A 4A8PA 5EIBD 4FJ1A 3VSCA 1XQYA 1VHLA 4QODA 2PX0A 3W0LB 2PFSA 4TQUS 3TZEA 1T2AA 1N9GA 1GG8A 5FBHA 4COKA 4V03A 2ZYDA 1TZMA 1SCBA 1QG6A 1T2VA 4Q9NA 3ZOKA 2FFJA 4B6GA 4ID9A 1GDDA 5I9BA 3BWMA 1JHRA 1D1TA 3GLFE 1OGIA 2G1AA 2ZRNA 2VUUA 3EMDA 3M9WA 1HH4A 1ZUHA 5KYXB 5K2OA 1XN4A 1XSEA 2FG5A 4MKIA 1TLLA 4H1UA 4IBOA 2GM5A 3NPMA 3VR2A 2FTKE 2YDXA 4CEIB 4E3ZA 2PQMA 4MV9A 3VR3A 3W8NA 4B3GA 3GRVA 3IMFA 2V4UA 2X77A 4HDOB 4PGHA 3KK0A 1AKUA 4KVZA 1B8UA 1J2YA 1G63A 2M6SA 2ZULA 3F8WA 4LZWA 4J76A 4XSHA 1P39A 2V6FA 1U1CA 4RMJA 3O73A 3VPGA 1M9NA 1BRMA 2JL1A 2IW1A 2WNSA 4OFXA 4TN1A 3QBVA 3VV3A 4OF4A 1JR2A 3W9YA 1BFKA 1EVLA 1KMHA 1M1XB 3UHAA 4BN5A 4EQ6A 1N36B 2O8NA 1U2GC 4X1YB 1G5IA 2Y2VA 5IPFA 4HATA 4WH0A 1VJ1A 3EUAA 2G04A 2IA5A 2YMMA 2DKFA 3DUFB 3T5GA 1JECA 5EMJA 3UH0A 2QK4A 4IZIA 4OKSA 4BLSA 1GAEO 2VDUE 4EATA 3G0DA 3HS3A 2I8CA 4LRWA 4LZOA 5FI1B 1OXSC 4R6XA 4TV9F 5FAXA 3DZIA 5THKA 1TMGE 2BOVA 3ECSA 5KTKA 3PX7A 2WSMA 2AOWA 3FPEA 4YJ3F 3PNOA 5BNWA 1CIJA 1QCDA 1YI1A 3MRTA 3OSZA 2ZWPA 2O07A 4A8JC 4L5JA 1EWKA 5IEBA 1N6OA 2GZMA 4G5QA 3SLRA 3TOVA 5KDDA 1XEWX 2V1XA 1V5FA 3H3XA 1F6WA 4BMYA 3GARA 1XLTC 3IPAA 1RYHA 3FDZB 4QFMA 4CUKA 4M87A 2HMAA 2OLKA 4DLRA 3TM5A 4AAYA 2I65A 2DPMA 1YRAA 1PP4A 3WDKA 4EY5A 3DWGA 2RCYA 3NVAA 1XRPA 3I83A 1QAOA 3L6CA 3PC7A 4IIFA 4EEZA 5LN1A 3HLTA 2XB9A 4RY2A 4FVTA 4MS4A 2V03A 2XX3A 3EXG2 1KVTA 1ZM4A 2P7HA 4QQNA 1I1NA 1NQWA 1KVUA 2V6JA 3ANXA 3EIXA 3IR7A 4ICIA 4OLHA 3ZC3A 3C3YA 2RKWA 1A69A 1SC3A 2O8CB 2PHZA 4XOIA 3HSYA 3D4BA 3QF4B 4Y1RA 3KYJB 3K20A 4JSTA 2HJSA 2XDYA 4Y9UA 3INRA 1KPGA 5TGZA 4M0UA 1YZ3A 4ILKA 1GV0A 1O5IA 1TX4B 4LQLA 2QTTA 2K5UA 2JIOA 4KFUA 3H75A 3ZDQA 4E5NA 4B74A 1X7ZB 4BP3A 1RPNA 1Z15A 4CM5A 4UNRA 3SEFA 3JALA 2BFMA 3BH7A 2UV8A 1PEDA 2R79A 3ZS8A 1OYYA 3AI3A 2WJJA 3KAQA 1CD5A 1ZNQO 4C7OB 4EA7A 4EZEA 3KZOA 3FBWA 3IUQA 5KKAA 4UM8B 2VHQA 1FYFA 3NEYA 2GCEA 4DMRA 1FLAA 3CHYA 5DGCA 1N6NA 5JAOA 1OIXA 1CP3A 1E0SA 2I4MA 3AUXA 4G41A 1Y98A 4S24A 4RSMA 1ZM2A 5DBHX 4BQPA 1YV9A 2OQRA 4LN1A 1N2CA 3PUHA 4CM4A 1FNSA 5A4AA 4RSRA 2NGRA 3R3ZA 1ZL0A 2XMZA 1E2JA 3ZHQA 3OCYA 2XR1A 2DUWA 2B99A 1QRSA 3H8WA 4KEAA 1ULSA 2EDCA 2AOTA 4QBFA 4CLHA 4KHZA 4TKVA 5JAHA 3WO0A 4WZAA 1VHDA 4Z9AA 3TJZA 1TEZA 5IUJC 1JX6A 1ST2A 3OE7D 5TEVA 4TUYB 5E4FA 3P97A 4KO3S 3FDFA 1XTVA 1VLMA 4KQJA 1SUWA 2BGMA 5K6TA 3WLNA 1N2EA 4ZHQA 3B85A 1GM5A 5E4TA 3ADKA 3AY3A 3LRTA 4MMXB 4WCFC 2CHFA 1VG1A 5LA6A 3ZIAA 3ZWWA 5BRAA 3GV0A 2QQ0A 4MZXA 4Q0MA 4QXAA 1LUAA 1SUIA 1GARA 2H4WA 4EO7A 3KOYA 3ZHBA 4DZTA 1MQ9A 4LV8B 3SVTA 4G9GA 5C7YA 4LHSA 1VBKA 2YWFA 4ZT6A 1VFPA 5CB0A 2RJOA 4RAOA 3W34A 4Q24A 4H1WA 3TCNA 2PSHA 3LCVB 5T3YA 1NY6A 4L4RA 1Y6JA 1VKNA 4K88A 4Y3UA 3RKUA 3VR6D 1UXKA 1Y5RA 1Z7BA 3A31A 3X2EA 1K2VN 2C31A 2YXPX 2MTBA 4MWBA 4YMIA 5AXBA 2OPHA 2XA2A 3I5AA 3RYCB 1CIVA 2DFPA 5BVHB 4BNVA 1CJBA 3DKVA 2B34A 3UJ6A 1U9ZA 1M1UA 1SOVA 3E1SA 3EVEA 3IELA 4I4IA 4O33A 1N3YA 3DC7A 3KB8A 4BUZA 5ICGA 3D8SA 3A7DA 3EZFA 1K8YB 4FDAA 3NBZC 3SZMA 1N5JA 4F9FA 3FAZA 2PS0A 1F0KA 4PHCA 4G24A 4WNAA 3ZY4A 4CT0A 5THQA 2DBZA 2Q0XA 4X6YA 5LLTA 1TQHA 4DV3B 1OB5A 4MW5A 2AJBA 1L4MA 1G7SA 2VH5R 1FTNA 3BYZA 1DBWA 5HKBA 4NCAA 3W7VA 4P7BA 1LD3A 2EJTA 4NJOA 5EKXA 3KEGA 1KQNA 1QYIA 2AUTA 5JFOA 1OLOA 3L8DA 3Q0IA 4FLFA 5JDCC 4MVJH 5D8DA 1VE5A 1WL8A 2I22A 4RADA 4ZQEA 4LMPA 3LBNA 4HL6A 4N3AA 5AM0A 4Y2GA 3BTUA 5K0ZA 4ABTA 1NVAA 2VWHA 2DFTA 4K9PA 3H7IA 3NOVA 4XW2A 2GKOA 4NENA 3SM9A 3HUUA 1E69A 1F4VA 1NV9A 1ZVQA 4H31A 4U9UA 1JHDA 5CT5A 2GBCA 3O03A 4B4VA 1NUPA 2ZUEA 3IC5A 4Y9DA 1LLUA 4INPA 5JH7F 2V1UA 4FS8A 4J94A 4X7BA 5L7WA 2VK8A 3BIJA 3LNTA 5EUBA 4WCFA 3RJMA 3RKSA 3TW6A 3WGNA 3WJ7A 3I4FA 3IKTA 4QUBA 2IXFA 3LCMA 4OSOA 5DN6A 5JSYA 1OLUB 1K5HA 2PJUA 1RMTA 4CV2A 2X22A 3BJEA 2J4FA 4ETIA 1SBQA 5TF0A 3DO6A 2G36A 4CKWB 3I4CA 4DCCA 3QMPA 5A3RA 4HWOA 3W5AA 1A2OA 3EEBA 2V55B 3H16A 1E4OA 4DWOA 1UMBA 1G3RA 2J9FB 4N12A 3EXG1 1XL1A 4DA8A 4J43A 4EG1A 1ZD2P 1WUKS 4NBSA 3EEYA 3PFWO 4BC1A 4YHBA 3T38A 4ZALA 1Q1NA 5CG1A 5EJ7A 4OHPA 1R0YA 4YRJA 4QXOA 5NULA 2AEJA 4ROTA 1CJMA 4U4AA 1KBQA 2XCRB 3NT5A 1FRZA 4AKTA 1G21E 4V0MA 2RHDA 2VCHA 4WXMA 2XVMA 3NHLA 3N2IA 2IS4A 3EZGA 1JI0A 3PE3A 4UU7A 2ODNA 2PS1A 3OWOA 4GBJA 3U81A 4MVJG 3C8DA 4HVLA 3DYIA 4W5OA 1BEEA 1NLFA 2F55A 5L8VA 2FLKA 1X1QA 2NAFA 4IOJA 4BV3A 2GEFA 1PN3A 1DRVA 1JU4A 2TECE 3DE3X 3JR3A 1KDRA 2BBTA 2VP0A 4QOFA 3CJTA 2QUBA 1HLDA 2N47A 3F67A 4JFRA 2A94A 2HC9A 4BZXA 4F60A 2JVKA 1DWPA 2NUPA 3PQ5A 1DC8A 2EJUA 4QGSA 3IIKA 3N70A 2QPTA 5DF1A 5BMVB 2ZIXB 2FPWA 1JG2A 3QWIA 2DLNA 1IUNA 2PFGA 2Z9DA 5EUQB 4IDPA 4BWFB 1LXCA 3LX8A 3F6CA 2GFHA 5I7OA 2PH1A 1AN0A 1KI3A 1VRVA 1YVUA 1XU9A 4CDRA 2HO4A 3OX2A 3DLIA 1G4HA 1GRCA 3EBPA 3O90A 1MIOB 1ZGBA 2AMFA 3AUUA 4YVFA 4I8DA 4P84A 1K3UB 5DX8A 1KI2A 3HC7A 2XE7A 1M2OB 2QF7A 3M5CA 4L0DA 3JYLA 4GC9A 3KBOA 2I7VA 2YQ4A 4HLNA 4N5MA 3GT4A 1YCDA 2R60A 4RE5A 3G2IA 4QE3A 4FFOA 3ISVA 4TTRA 1Z6YA 3ROMA 4DIDA 3BRSA 3GJTA 1R15A 3N07A 2EOAA 1CS0A 1YZTA 3D6MA 1D6SA 1L5VA 1TXGA 4K6OA 4F3YA 1GPAA 3MCUA 2HF8A 2ZIGA 2D5BA 2ODWA 3EGXA 1NJGA 2AQKA 4R8KA 1G38A 2FK7A 3RS9A 2DYKA 1LBQA 3LT5A 3Q15C 3OZXA 4ZVLA 2GUWA 4O5AA 3DULA 5LXTB 1ZJJA 4ACBA 2P6PA 2VPYA 3ELWA 3DBRB 3NANA 3TLXA 5KU7A 2BGKA 2XADA 4NBNA 1FNNA 3QX3A 2H1LA 2W2OA 3KRTA 2KWIA 3PTLA 3OOWA 3SR3A 3DHNA 3ML1A 4LZLA 1YJ5A 5EGNA 4A0QA 4R0VA 1C2TA 1EE9A 4B4OA 1FP2A 1OIVA 3HM9A 2EERA 3GFBA 2IOQA 3FPSA 4IGFA 4M0LA 4DLKA 4CIAA 1YJCA 1FYDA 1KNQA 3VPHA 1X92A 4TLCA 2VJLA 1ACJA 1VMDA 3IP1A 3HPQA 5C4GB 5SY6A 3FZEA 3V1MA 1EBBA 1OFUX 4NCIA 4C7MA 1HGXA 3R24A 3P2MA 1VG8A 2VOEA 3MUNA 4D3XA 3DEYX 1C41A 1E2GA 5LMNB 3HXOA 5FIUA 4FYYA 1B42A 4J2HA 1TDJA 1YZQA 5LIRA 1WHSB 1GEEA 3A25A 4DPKA 3EIHA 2C3YA 4IDNA 5J4VA 1QNLA 4JYCA 1KZYC 3LW7A 4YCSA 1TIPA 2HK8A 1V3VA 3IUNA 5F3WB 1XTPA 3ZHCA 1FL9A 2VPZA 1C1DA 3FPJA 4P0TA 1YMVA 4YMUA 1GAQA 2X0NA 4NY1A 3RVJA 3T9DA 2IF0A 3IJPA 3ZCQA 4BO4A 3TFOA 2RI0A 5D1NA 1SIOA 2ZRLA 2QLBA 4F38A 1O6ZA 5GAJA 2ES4A 1XRLA 5BT9A 5TQ2A 5B3KA 2P69A 4MULA 4CR6A 2CFRA 4GOXA 3LVBA 1ZFNA 5KQLA 4LFAB 2H65A 3QHPA 4KJXA 3E70C 2HQRA 2ECFA 2HHLA 4LGCA 1R16A 1DTWB 3ER6A 3OX3A 2KX7A 5F7XA 4C5CA 3Q7PA 1RRGA 4CDMA 1DFHA 1MAHA 2BFEB 3CJRA 3NUGA 2UYGA 3C3AA 4CL8A 3MMSA 1RE1A 1XHLA 4ZC1A 1UJ2A 3ZBPA 4U8GA 3KQMA 3MMPA 1GITA 4WHMA 4RTMA 2YRXA 2OFPA 2H0QA 2WOOA 5DYGA 4YAJA 2R751 3RAGA 4GPTA 1IBLB 1XKQA 3CG0A 2R6ZA 5G4KB 3HU5A 3ROXA 2ASVA 4MPJA 1KEEA 3WIOA 4REQB 4UVGA 3QMVA 4AY3A 4C07A 3V3TA 4DPMA 3GRUA 3LK7A 1VCIA 2ZU6A 4N6GA 4EITA 4BKUA 2O23A 3GLVA 4WK6A 4ZQIA 2H1OA 4FGLA 5C8YF 4IM7A 5KSWB 3VZPA 3IAS1 4HBZA 3G8CA 4E5VA 1EGAA 4IXWA 1TEHA 2AOTB 3FIJA 3RS3A 3MMNA 1D5WA 1G0NA 4QGAA 1XZQA 4WZAB 1D5CA 1MFPA 4BLWA 4JC0A 1U3DA 1NVVQ 2QMZA 3DOEA 4R8VA 4RVCA 5EUMA 3H97A 1G2OA 4H27A 5B3JA 3Q7EA 4V0QA 2CDAA 3QI2A 4ZO6A 2FHSA 3ADDA 1DIOB 1LCIA 1UK8A 1VQ1A 1YVDA 1TZKA 2J9YB 3PGXA 1NXVA 3H9JA 1YCFA 4G26A 3QLTA 3PJDA 4D26A 1P0FA 3QLUA 3JQ8A 2C42A 4O4JF 1NUTA 2Y0DA 2GUGA 4YT5A 5JMTA 3QLUC 4K28A 4TPKA 4JFAA 4RELA 5DHAA 1TLFA 2E6UX 3V4PB 4HH1A 2AN1A 4DV7B 3AIIA 3AQIA 1O96B 2O8BA 3WL8A 2H0RA 3LS2A 4FMDB 1SG0A 1T0IA 5A9SB 2RGXA 2C9YA 3KZ1E 3K0FA 3N2KB 1C1YA 4JY7A 2WAOA 4IJKA 3I61A 5F23A 1E8NA 1QIMA 2UAGA 2MU1A 5BWOA 1T91A 3KQHA 1IN5A 2YUIA 1US8A 1EPUA 3U37A 3T34A 3ZEAA 3DDCA 2B69A 3RYCA 1Q0PA 1ZCAA 2JFWA 2Q9UA 1X6VA 3Q9SA 2XE6A 5DGTA 1MX3A 1JW9B 5EIBC 2IQIA 2FMIA 2WWGA 4NS1A 1U28A 3BCRA 2PUHA 3CLTD 2YTZA 3HR4A 4F84A 2WA2A 5K01A 1PRYA 4B0PA 4DYDA 2XGMA 2CNWD 2H92A 2KYRA 4XAQA 2UXBB 4PIPA 5K4GA 1TQ8A 3GLHA 2M6KA 5CD1A 4Y6LA 2OD9A 3EQ2A 3ZCUA 5LA6B 4H0FA 4HWSA 3U1TA 5I7VA 1CUJA 4J75A 4Z6KA 4R1SA 1JL3A 1UBJS 4AJPA 3OT1B 3I1IA 5KJFA 2R1VB 1POXA 3AWDA 3F90A 1HNZB 2FWJA 2JIQA 4L5AA 4YBZA 3BAFA 1IOZA 1DC6A 2J3EA 4H7HA 4S0ZA 3VX4A 5IMSA 1CT9A 5TVGA 4Z51A 1T0PA 1T4CB 3OLZA 5IMBA 1DAOA 1XZLA 3GO4A 2MYUA 2Q3FA 1J8YF 1VA5A 2L19A 2CWDA 4ZQGA 4ZZIA 3D8RA 1ZD1A 3TB6A 4E5UA 3R5FA 3PFKA 5C8YA 1U2RA 1UK6A 3NTOA 4FEAA 1IMOA 3W6PA 3U7RA 1I7DA 5IVHA 1BWSA 1G8HA 3GMTA 3HKCB 2OGTA 3K4HA 2YOHA 5FADA 3UMFA 3H1AA 1RQLA 3E8SA 1RRVA 3PLRA 4M60A 4Q1FA 4IV0A 3SBXA 2GXUA 1YA6A 3SMVA 3UJ8A 2QD2A 3GGOA 4NBVA 1GD1O 2QW0X 3QLVC 4P33A 1ODJA 2UXCB 2QN8A 2C7RA 1C3VA 2O6HA 3KWLA 4F97A 4GNRA 2PUAA 1SKUA 5P21A 3WLRA 3OP1A 4TMVA 3OURA 1U28C 4E4RA 2QR2A 4RY8A 5HCNA 5IAOA 2B4QA 4O4JA 3U62A 4KNVA 3WHLA 3RBVA 1U1FA 1YE8A 3G2PA 3F47A 4KYIB 3SP1A 4HMQA 4Q3CA 3AKDA 1WCIB 4YJHA 1QLHA 4OGLA 4GI7A 4P54A 1T9GR 3P9CA 4WDQA 1T0UA 3L8ZA 1Z3IX 3JD2A 2VEOA 3ABIA 3CN7A 5EGSA 1UMBB 5HQ3B 1TYDE 4YJFA 2VC2B 4QX6A 1S8OA 1WZEA 3HBNA 1UT5A 4H3SA 4E1VA 3M1AA 5FV7A 3OKAA 5BR1A 4YONB 3R75A 4JOSA 4DSZA 3ROGA 4COOA 3LHFA 3GAZA 4DMLA 3TXYA 2CL6X 2VNHA 3NETA 4MRVA 1RMYA 2LVBA 2B4YA 3E7PA 3QFRA 4LPSA 1KTIA 3VKGA 2UDPA 2W2NA 3A1UA 3PHHA 2XEDA 2VNKA 2UYCA 4G25A 1GTG1 4X24A 4MV6A 1N6LA 4U63A 1JT9A 4C2BA 2XYVA 4YJGB 2Q2QA 4IV5A 2VH2A 1T2NA 1HDIA 1VLLA 4UTOA 3UJAA 1ZN2A 3AJDA 1B0UA 3RD5A 4FSXA 3GVIA 3EMBA 3L8CA 4LF9B 2P8SA 1P2TA 4UHHA 5EXPA 3L6DA 2C3OA 5EE5B 2VXYA 3TTXA 2X0KA 2J46A 3QXSA 1SFRA 1R9GA 3VR4D 3FPAA 3EZXA 5K8UA 1G8SA 1H05A 3BGSA 3VYWA 2TRSB 1AM4D 3O4JA 1FS6A 821PA 3ERCA 4OUDA 4ZVVA 4IJMA 2K87A 2JIMA 3IR5A 2WHYA 1SXJA 3ZU2A 2EXXA 3DP9A 3U16A 2JLVA 2UUPA 2FWMX 2IEYA 1VCHA 3HHPA 4NRDA 4PNEA 5AVZA 3NCHA 5GINE 3C6ZA 3UT0A 1SU4A 1C4KA 2DTDA 5ULLA 2H4XA 1C7QA 2WTXA 2WZBA 4QBKA 6REQA 5CEEA 4FONA 1K8RA 3B1YA 4WZAE 4JENA 3JATA 1AB5A 3C6KA 3OVMA 4PC2A 1X0VA 3L0BA 3NOXA 2ESRA 2PZEA 1U8EA 4EFDA 4G4SP 4P7KA 2B6NA 2DHEA 5EE1A 2YYYA 5FPPA 4EYGA 3VYTB 5AKIA 1QO0D 3BB4A 3PHJA 4EY7A 1U3FA 5HF6A 4WWHA 5IG2A 4NKRA 3V8VA 4MWCA 4QRDA 1DCFA 1OBOA 1PF7E 3OICA 2B8EA 1UK9A 5ERGB 3BHIA 3LLCA 1FBNA 5KHLB 2CLSA 2RIPA 2E3JA 3PP8A 4J1NA 4L5CA 1IQ0A 2H8KA 2VAXA 4QDOA 2W7TA 1WOMA 3I04M 1USUA 1SVOA 5F4BA 2WM8A 3ANYB 1IG0A 1ZU5A 4QRHA 5FEUA 4E03A 2WJVA 4LHXA 16PKA 1W29A 2JRLA 5FD8A 1WU8A 1DKMA 4DV4B 4IHAA 2OK8A 3DLHA 5JROA 3UG7A 3BRWA 5HS6A 3T5AA 4ER7A 3CEPB 2CF5A 1OXUA 2M1ZA 2W22A 4X3CA 4YJ3B 4ZICA 5T8KA 5E3JA 2FFHA 2Q0HA 4UVDA 1SU8A 2FMHA 3HP1A 3A6KA 2JZOA 3T3MB 2MIIA 3C5CA 1O58A 1CQWA 4DUYB 3AR5A 5FFMA 5F3RA 3QSGA 4I4NA 3HZHA 4AB1A 2XD4A 3DMHA 4OH1A 2Q4OA 3NH9A 5DYNA 3LUJA 3UHPA 1I2ZA 4IVQA 1VCOA 2YW2A 5IN5A 5KTMA 5KVSA 5A5VA 3QFSA 2NZYA 3EA0A 1RU3A 5KYUB 3RVBA 1CY4A 2YUTA 3IEVA 5BR4A 1ZJ4A 1HK7A 2G77B 4PLYA 4ONEA 4J1TA 1M6WA 3T5TA 2B8TA 2BV3A 3DZKA 3F96A 3LYHA 5FTKA 5H4HA 1P3DA 1YB4A 3IRUA 4H0NA 4NFHA 1WZCA 4TLMB 1PT6A 6ADHA 2ZVDA 3QFTA 3MA0A 4M54A 3RRMA 4II2A 1E2KA 2JGIA 3OFNA 3TQQA 4HC4A 2VDJA 5HK9A 2VF5X 4DRXB 2XOKA 3OQNA 2J7KA 1RRMA 1EGHA 1XTSA 3LVRE 3NNNA 4PBTA 1KSJA 3FZNA 4L78A 3VYUB 4HUJA 4TOIA 4J4BA 4UM9D 4JL8A 3FA2A 2JBHA 5DBIA 3SWWA 2FZEA 1N2BA 3SJUA 3JQ7A 4RVSA 5HA5A 4B8WA 3FNFA 1BEUB 1JDZA 1ODCA 2C0PA 4IZHA 5HF5A 1X8KA 5DRTA 1G17A 4L0CA 3KFXA 1NE2A 1T29A 1ADGA 1MV8A 2I71A 2WILA 2WABA 3ANSA 4PCUA 5LP6A 1BXRA 4UXHA 1LNZA 1ZK1A 2WAAA 3CXRA 1F9EA 2CNKA 3ZJ5A 4HN9A 4J0EA 3MQ2A 3CR3C 2DBYA 1Q6ZA 4AS3A 1NPDA 1AK1A 1RXYA 5CT8A 4WFJA 5KPJA 2C2XA 1NDUA 4PAMA 2RHMA 3PR3A 3A6JA 1J20A 4MVJD 1OASA 2OD7A 1RIFA 1HYHA 2COKA 3AKEA 3DVAB 3EZNA 3GZJA 1DKRA 4KWIA 1V8DA 2JGNA 3AETA 1U11A 2BGNA 2NZJA 5ABPA 4J7UA 2ZJYA 4JBNA 1M0EA 4XB6B 4ZTUB 1JQAA 2EL9A 4Q66C 3DPIA 3BK7A 3SKYA 1YL6A 1CKEA 2D4AA 4KLRA 1EFKA 3T7RA 1XHFA 1RI2A 2C59A 1L4YA 1BGXT 1SC6A 4KB5A 5CX4A 5B1IA 3GXBA 3EX7C 2W9XA 1KAMA 3IUSA 4AYWA 1VPWA 3C3KA 5DYTA 3TNJA 4D8WA 3Q7TA 2ZYHA 1SIBE 4QELA 4DEXA 1Z0IA 4WOCA 3BKXA 2PZKA 5B7GA 2Q5CA 5IUNC 1AXEA 3QLJA 3WLAA 1X14A 4BVHA 3SJAA 4CKYA 1YL5A 2G5CA 2ZJFA 4PYNA 2P4SA 4M7RA 5JNUA 1WBBA 4KC0A 3K30A 1ATIA 3ONVA 4I5GA 3ZWCA 4DREA 4F0JA 1A8UA 1XTJA 3OIYA 4I4CA 4RM3A 2D5AA 2JI4A 5JI2E 3EFBA 3BGIA 3H5NA 1QTQA 3G2NA 4QOGA 1W0KA 1J2JA 1DAIA 1K7XB 2G70A 3E23A 4KXFB 4P82A 4URZR 4Z9BA 2BZ1A 4OJYA 4YV7A 1WR8A 1KR2A 3IAS6 5FOTA 1IM2A 5KTTA 2I29A 2XCQA 4JIGA 4DG8A 1FMLA 3T3GA 5K8LA 5E8JA 4IDGA 3H8JA 1EAYA 4OHOA 2F67A 4FFLA 4RK1A 1VL6A 4CMBA 1H94A 3Q7SA 4G5XA 1FVFA 1DAPA 2Y77A 3O8CA 2O1SA 4XSGA 4QQ8A 1QH0A 3S2FA 2FPSA 1IIRA 4MPRA 3I1YA 4QYMA 5LD2C 4Y6PA 3FLEA 4Q39A 4MP3A 1KJNA 4W8HA 1K92A 4AUKA 2O0HA 2LD4A 5SYNA 5B3LA 2Q7XA 5L53A 1EVQA 5CHYA 2WC1A 4GVLA 2ADOA 4JJEA 4NV0A 3AEUB 1OGJA 4LZAA 5JMOA 1XDGA 4J49A 3ND8A 1YGYA 3QVGB 1YA8A 4F5YA 3PC6A 2QJRA 4BO6A 4U6QA 4DTIA 2NO9A 3LQ2A 1CW2B 3D1JA 4E46A 4KRXA 1SHLA 3WKCA 1GZ4A 4FDVA 1ZUNA 2PUCA 2RBEA 5H3LA 4MAAA 3U56A 3ZDAA 1JQ3A 3TR6A 4R0NA 4EGFA 1E92A 4KE9A 1NNSA 3T1QA 1SVNA 1J5PA 3WRXA 3LWZA 1EUDA 3PNPA 1D2RA 1DKNA 1LSSA 3GOHA 1CEXA 2XAUA 1S3FA 3HEMA 4G81A 2BW0A 1BMTA 2HRZA 3MJCA 1OLSA 2EC5A 4KGZA 3FNEA 3K31A 5IF9A 5AHXA 4EB6B 5CEFA 4Z0NA 3W3AD 3DOIA 3Q88A 4HDSB 4WZZA 5FJJA 1RJ9B 1N34B 1FMJA 1G20A 2XOKD 3CLSC 4LPKA 3QPVA 4EKYA 4LMRA 4HUTA 2G5PA 1SQ0A 1ZXXA 2R5WA 4NQZA 1OAOA 4JVMA 4ERNA 4QT4A 4EAQA 1J0DA 5LDDC 1DO8A 2FPGB 2OZEA 1TYZA 3IE2A 1Q2UA 2KS6A 4UUBA 3T7DA 4Z4GA 1H2AS 2H6EA 1D7OA 1XP8A 4RJJA 2OVBA 4AO8A 4CCYA 3ONNA 1NMQA 4L9SA 4RK6A 2P6OA 2BUBA 4K03A 4U2CA 1D4ZA 4WD3A 4DBLC 5I4IA 2V9ZA 3GJ7A 4PSDA 5IU6A 2WSLA 4C3UA 4A6XA 4M22A 1W8IA 2GHIA 1LLFA 2V6MA 3BMOB 3ZN2A 1GSAA 3D31A 4GVXA 3GAMA 5IC4A 2O20A 3ZZMA 4LXYA 3ZDXB 3R8FA 1V9LA 5FYQA 5TPZD 3GVXA 4BQOA 2C5AA 2YZ7A 4ZAXA 2XTZA 4TXHA 1G6Q1 1KVSA 1PJCA 1IBSA 3MUOA 4YWJA 2XZTA 2NTYC 5IYZA 3ETLA 2C4VA 3B9QA 4BO3A 4FIDA 3GPIA 1ICEA 5FKJA 2Q3MA 1NVFA 4Q1DA 4PAOA 2HJRA 2J31A 1UANA 4GPAA 2CVHA 4RCVA 1L5FA 5IM5A 3IJ5A 3UK2A 1MG0A 4QG3A 5I48A 4XEUA 1SKMA 4NH0A 4YRTA 5TMPA 1GT6A 1EQ2A 4GM4A 1IL0A 1TT5A 1ADYA 1PYDA 1O54A 3B52X 3TE6A 3MWFA 2PGLA 3HCBA 4DCUA 4EGCB 2FZLA 3RS5A 3TTSA 3RIMA 3W2HA 3DAHA 5GPBA 4AZ3B 2NUBA 3OZUA 4FIZA 2IH2A 3IERA 1CR2A 5AHKA 3D8UA 3QV1A 1GUZA 4ETMA 2OZLA 1IZ0A 2I1QA 3EYWA 3NNDA 5MGBA 5DP2A 3RR2A 1EXMA 3QFHA 5CT6A 1YS9A 4D5GA 4X92A 2G6TA 5B3JC 4GRIA 4KQEA 2YZNA 1NG1A 1MN6A 3NDRA 1OAOC 1VE6A 4G8JA 2O57A 3HCFA 1XCMA 3NUQA 2RK6A 2B9VA 4W4TA 2Z8XA 4UM7A 3LTEA 3Q2KA 3DA8A 3E22B 2JW5A 4YCNA 3EXEB 4H4CA 1HYQA 2BY4A 4UFOA 1KYQA 2FFQA 3BDAA 1M1NB 4FCWA 4MOWA 4L22A 3OZSA 1ATZA 2JGFA 4UDXX 1NXXA 3QG5A 4P7FA 2HLDA 3ZK8A 5BW5A 1H9AA 1OCEA 1LQ2A 2Q1SA 3RC9A 4JR2A 4O0LA 2Q9AA 4M9RA 5K99A 1SVLA 1NPTO 4LQCA 4Q7LA 3ZWOA 3NW9A 2I34A 4K6KA 2Q46A 1XF1A 1MW9X 1NNUA 3VPBA 5I7UA 1KRHA 2FOLA 4I9HA 4BXOA 4JGIA 4I3GA 1SXHA 3UMJA 3PNKA 4KDCA 2XVZA 2ZI7A 4UZEA 1YE5A 1B6GA 1MC8A 3DOJA 1KVQA 2QD3A 1FEZA 4R2XA 3UFXA 2V7PA 1KYZA 2IIQA 2GN8A 4GQIA 1KAEA 1ZK4A 1Q7CA 1LKZA 1PD0A 2MSEB 2PMCA 2RAFA 3UMCA 1TKRA 5CB8A 3UMGA 3UUGA 5JNRA 3WE7A 1NF8A 1U9JA 3QVTA 4XUCA 1C7JA 4FYIA 5F5XA 3OIWA 3R3UA 1N4AA 4YRBA 5KYUA 3RUEA 2VYVA 3CF4A 2ZXEA 3N74A 4HYEA 1GPMA 1DCMA 2AG5A 4Q9LA 1VDZA 5CPBA 4DV6B 2WUEA 4KKVA 1CRPA 2XCUA 2DHCA 4URWR 9LDBA 4LJ9A 4N0EA 1RKVA 1E6UA 2VDVE 3MERA 2CZQA 4I6EA 2C5LA 5KI6A 2A59A 2R6FA 3VTAA 3QOWA 1IIBA 5BUCA 1K4KA 4UAUA 1NNEA 4D74A 4DRXA 2A9KA 4O1MA 4ZMRA 1UZNA 2WTMA 4GR9A 4I55A 5AQ1A 3G0CA 2NO6A 1NUAA 2YICA 3ME5A 4YJ3A 3FNBA 4FKMA 4XI9A 1UZAA 1BS2A 2XWBF 1L5KA 4GOMD 1KSHA 3QF4A 1T8SA 3PRHA 4Y1RB 2H1IA 1HPLA 4CCAA 1IXKA 4TMKA 4EM6A 4Q12A 1K68A 1FFHA 1AGXA 2JFZA 4BNJA 4TSFD 4BZPA 1VYUA 3E9RA 1EQAA 1JBKA 4QATA 4NYMR 5KCMA 4NHEA 1B8OA 1KU0A 2W42A 1ZM3A 3IPRA 2AC4A 5BN5A 3LFTA 4Y6QA 5ICEA 1BMQA 1FNCA 2CMKA 4JHXA 3CG4A 1YZFA 2I33A 1S7GA 3OQBA 4B40A 2YNMD 1UC5B 5I3ZA 3I09A 4PC6A 4YBRA 1J1UA 5KNBA 2XF8A 3JYOA 3IAFA 3ABSB 1JQKA 3FR8A 4UPDA 4YUAA 1KEPA 2IU4A 4LYFA 1WXWA 2Q1WA 2PUEA 3C6QA 4P83A 1XIVA 4HO1X 4IMIB 1V4NA 1XD9A 1NZDA 1H2BA 2PQ0A 3QJGA 4WK2B 1E63A 2YJ6A 2O8CA 5A9TA 4LDJA 3REFA 3AR3A 4P4NA 3A2KA 4OHKA 5A6SB 2DB3A 1R4NB 3GLFB 1ZCZA 2OP0A 1RTKA 1K3TA 1L6IA 5AVQA 1Z2EA 1QHXA 1IUPA 1E1NA 5ESWA 4Y30A 1Y3CE 4DUPA 4DCPA 3MJVA 5G4LA 3KLMX 3W5SA 3IX7A 1BD4A 1H0RA 4RDHA 4MDFA 3FYCA 4FHZA 2BMAA 5KQMA 1MIOA 2XZLA 4IH4A 3FGNA 5HFAA 3HYRA 4RZXA 2EF1A 2NXEA 3IDZA 3RYHB 3SBDA 1Q3KA 3WMGA 3EK2A 1N0UA 3W79A 2IS6A 3L6UA 2JFFA 2HWKA 1BYIA 3AF4A 2DTEA 4N0QA 1PFVA 4J0JA 3H0CA 1G16A 3DDUA 1VLZA 2E4WA 2Y76A 4II7A 3X1WA 1NJ5A 2HU8A 1A2BA 5BN4B 4JI7B 1LK0A 1M75A 4RGYA 3MT0A 3C0KA 2W6IA 3EA5A 4LTDA 4OQDA 3LKZA 4OQPA 3RASA 2UXDB 3OZDA 2AFRA 3QVKA 4UUAA 1W85A 3K1AA 4AS1A 1AXRA 2IYOA 1C9DB 1RYBA 3H5IA 3PDJA 3BREA 1QFYA 5JE8A 3RC2A 3VZSA 2C57A 2ZRBA 3F46A 4PTLA 2W6MA 4S35A 3LSTA 4FE3A 1WWKA 2EW1A 4WOJA 4ND1A 2A9VA 1RHRA 2ZUSA 3V8BA 3T1HB 3BCHA 1MX1A 2HMWA 3GMSA 4HPJB 4MQMA 4Q6BA 1XTRA 2J30A 2FXVA 1KEVA 1MUUA 2C94A 2DVMA 3OC0A 1JPUA 1Z6QA 1K7EB 1M10A 3A26A 1KAQA 3ILYA 4GYKA 5KMGA 1AIPA 2ZREA 3B5EA 1UPCA 3TF5A 3ZGZA 2FPKA 1AUPA 4AMVA 3NTVA 4N03A 3WMFA 5K45A 3ETHA 2B8WA 5GMOA 3VJRA 3EDOA 3FPKA 4RF5A 1N2CB 2ZS9A 3M3HA 3A70A 5E1OA 5EJ4A 2OQVA 1Q83A 2C98A 1UR5A 2QE7D 2R4TA 2H1SA 1DEHA 1U6KA 2GSDA 2WD8A 3JTEA 2MSKA 4CMEA 1CY1A 1F8YA 1EHCA 4U39A 1BHO1 2XQGA 2WIBA 4BBZA 4IHKA 4MV3A 2BYTA 2QPOA 2RGNC 4MP6A 1IOWA 4AU1A 5TQVA 4L27A 4M46A 5IDVA 4EA6A 3T61A 2BRUC 4W5QA 2Z43A 3LF1A 2H9AA 4F2PA 4B31A 2N9UA 1KC3A 4ZCLA 1KI6A 1R5BA 1JHPA 3ND5A 3A1DA 1Y4SA 4CM8A 4V0SA 3STYA 5KYVA 3A27A 1DAEA 1W5TA 4GI2A 4CQMB 1DO0A 3MSCA 2BLNA 1DMSA 4JQOA 1MIHA 5JWOA 1CJSA 3SX0A 4ZCQA 3U17A 2FV8A 4CMJA 4DF3A 4X91A 1HE8B 3IUBA 3ZW8A 5FNVA 2FLVA 2A9JA 2Z1NA 3JD1A 1W5EA 4RQAA 3VJMA 2IH4A 4MDHA 2CVQA 4NAVA 4JASB 5A5DA 4KR3A 2QP4A 3E5RA 3IOYA 4JC8A 3JAKA 5EJAA 5JNLA 4HDRA 2FQQA 2Q5LA 3CLRD 3P2YA 1PWYE 1RDFA 1L3IA 5HIMA 1QQ7A 3ZX4A 1QRUA 3P9ZA 5L6MB 3CVOA 1XL0A 1HZZA 2BKAA 4RGQA 5ISMA 1I2BA 2VPXA 4G2TA 1VPDA 1E6KA 5TT1A 2NO5A 4Q34A 5BUZA 4OP2A 2WIKA 3VNQA 5F33A 2HJ9A 4J0FA 4RAQA 2CW5A 2PRJA 5HCUA 3C6MA 2ZUCA 1VJ5A 2OB2A 5AHWA 5DI3B 1KORA 4L6CA 2ISCA 1JUDA 2O5VA 5G40A 4MQ5A 1NVBA 3PNMA 1XVIA 1SELA 4ENQA 3MN1A 4GT1A 1M2VB 3ZGNA 1KDVA 5HOQA 3N87A 2ZM5A 3O9ZA 3SLGA 1W6RA 1H5NA 1RZ3A 1THZA 4XWOA 3RS8A 5LQMA 2XVXA 3A10A 2GQ0A 4B43A 4EFLA 1SUBA 1P7CA 1R7RA 3I5MA 4FGKA 1HQCA 4RNDB 4RGBA 1EFCA 5K3CA 4UBOA 4BX3A 4POOA 4PTYA 1Z12A 4PG6A 1GQYA 4OCZA 3TUIC 4E11A 1OMOA 5EHNA 1HT1E 3C3BA 4ATNA 4F04A 3A2MA 5EUCA 3JPWA 1YR3A 3GGDA 3X1XA 1HMPA 5KYYA 2VK4A 1L7AA 4YRNA 2JCVA 4X1IA 3I6IA 1TMOA 4O2AA 2J9GA 1C3EA 3SFVA 1M6EX 1YZNA 3VR6A 3K0CA 4D92A 2Q07A 3GDFA 3AR9A 2HWUA 2V8BA 3WYDA 5E38A 4XD7A 3WJAA 4BNIA 1EFAA 2C82A 1HEYA 2RAPA 2GZHA 2C9ZA 4TVSA 1CUXA 1FYEA 1K89A 2FE1A 1CERA 3Q87B 1D8TA 2FRXA 1BKSB 2NYAA 4M1QA 1E66A 1HZZC 2JPDA 2DFNA 3KR9A 4DWWA 3P32A 2M98A 1A04A 1UJBA 1LLDA 1WVMA 3QYJA 3EXHC 4F3TA 3OC6A 4HDNA 1J00A 4I1IA 4KIUA 1W1IA 3PXUA 3A1CA 3BG5A 4BIIA 4JEUA 4GR5A 1I3MA 4F1WA 3MYYA 3BL8A 4DGQA 4KH0A 1EUCA 2CLKB 1M2OA 1KDYA 4DR2B 4GSKA 1RPTA 1A9RA 3I2GA 3ZE7A 3R9WA 1I80A 3EN0A 1N77A 2FPIB 3OE5A 2E4YA 3RRYA 3TLGA 3WMEA 5A62A 3B1ZA 1E79D 4PLPA 3W3AH 2CB0A 1C4OA 3EPKA 3O93A 2P30A 1V3TA 1MVLA 2IIPA 1WSWA 2V7EA 3KQVA 4YV1A 5AW1A 4L8VA 2O2HA 3RTCA 1EBFA 2WNHA 2AW3A 4OXYA 4QJ3A 3VHLB 2P7IA 4HEA1 1M6VB 2GJ8A 3FKSA 3OCXA 1YUNA 1DP4A 1Q1AA 4F6RA 3KHTA 2P67A 4BNDB 1VJTA 3WQBA 1H66A 4RA6B 4KNYA 1N78A 3CCCA 2EW8A 4F2DA 1QYWA 3G2LA 4ZVSA 2D7JA 1HC7A 5HK8A 4FQ5A 4NATA 3KEFA 1WPXA 2ZYRA 2IE8A 3B9BA 4LXIA 4RK7A 5GONA 2IZ0A 3V8EA 1OH8A 3R3VA 4P5PA 2C7QA 3PWKA 2QV0A 4WOPA 4KQWA 1K7YA 3QKRA 4OU5A 2VDNB 2FEKA 4H4EA 1BDJA 5TIIA 2W2LD 3EXHA 4N9QA 1ZC3A 1WHTA 4N3CA 3VUFA 2XPCA 2QD5A 3BM5A 4NJMB 4WLOA 3DV2A 3FPBA 4TTPA 1Z34A 3CSSA 3ORQA 1QIIA 4Z4IA 3OFKA 4N3NA 3OE4A 3CC8A 1TPZA 1UL1X 1N75A 1WXEA 2BKEA 3DHVA 2XNKA 3GFPA 3K9HA 4WBXC 3T5BA 5AM2A 1IK6A 3B8EA 4LXQA 1VIAA 4LCEA 5E3HA 1QGAA 1LZLA 4ZJZA 5DLQC 3QE0A 2JJ1A 2HU2A 4Q1BA 4R1NA 4EHJA 1PJ8A 1J5EB 3O9MA 4ETNA 1UEIA 4FWTA 4KWTA 1P6QA 3P0FA 5AI8A 4PN3A 2B3TA 2K6GA 3PT9A 5IBQA 5CA1F 2GZDA 4XRRA 1K9SA 2Y93A 1QOZA 3VZDA 4F8EA 1KFJB 2JAQA 5JPDA 1GTSA 4C6RA 1FSSA 2BSXA 1PFQA 2P9HA 3WK4A 5AI4A 3M4ZA 4OA8A 4A16A 2D74A 4XR9A 5JS2A 1A9PA 4A0SA 1AO3A 2ZIFA 4RZUA 4GGPA 4F2WA 3CNBA 1R4NA 3ABRB 5K9ZA 3GLFA 3K70B 5F2OA 1F2VA 4J0QA 2ST1A 4BAZA 1IRIA 4D6YA 2VI5A 4Z49A 4BQNA 4KTTE 1EA5A 4IDCA 4P8RA 2ISSD 4RK0A 1EU1A 2Q27A 4YFYA 3L6RA 2ZWVA 3Q2IA 3BHJA 1GSIA 1KRXA 1WQ3A 1FW6A 1T1IA 3PQ4A 5ICSA 2ZIAA 2HWYA 1IY1A 1NZFA 3NMUF 1TUGA 1TZ2A 2D2EA 3FGZA 1KFCB 3ORHA 4LZJA 4AW9A 1JQDA 1VKHA 4H2DA 4EOGA 1I0ZA 2SECE 4UAVA 5AM3A 3DQPA 5C1PA 5BSRA 1SU6A 4H0CA 1LRLA 4GVPA 1YBHA 1IM8A 4LYEA 2HWWA 4Q01A 5AXCA 3AGPA 1FW8A 1WSAA 3AR6A 4H1HA 5EIOA 4JB8A 3TGPA 3GLGE 1Z4LA 2CUTA 3A11A 4J7XA 3ZQ6A 1RTTA 3GQBB 3K94A 2OCPA 2IPOA 5HGJA 1QRDA 5JS1A 5AIAA 3D64A 3P9NA 2Z4TA 3OZWA 1CQIA 3LYLA 4IP0A 4YROA 4FJ0A 4TXJA 1IY8A 4V3BA 3KYDA 5E7IA 4YRDA 4LFBB 1X1EA 4ALKA 1BVHA 3CLSD 5T4BA 2BMFA 4BB0A 2PSSA 1YWGO 2DJ5A 1UFVA 1QK4A 3KPUA 5JSZB 1QHEA 2BGTA 1ZO8A 1ZD5A 1QC5B 2FH5B 3LWDA 3O8DA 1T1JA 4XX0B 3MINB 5F3DA 5JSQA 2EG9A 1DAHA 3AVPA 2IDKA 2ZJ0A 3E2IA 4GH5A 1L4EA 3PX2A 2WZDA 4GBMA 1IU9A 3M6MD 4CF4A 3ETDA 5B6PA 1A27A 3UQZA 1RWOA 4AP6A 1KMQA 1H69A 1HG1A 3PK0A 2I7XA 4KDFA 1ZDMA 3UG6A 3ZU4A 4C29A 1W85B 3ZDDA 2BM9A 2H1VA 2POCA 1OC2A 3F98A 3TZCA 1DWOA 2BMJA 3EQZA 4C6HA 4DSNA 3WAKA 5JS8A 1QIEA 3UO8B 2HCFA 2OL4A 3AMVA 1ML4A 1UEXC 3HBFA 4DRYA 4JBXA 4KACA 2XNDA 1G291 1K9VF 1SXJE 2BISA 2DQZA 4D3FA 4QOJA 4EUNA 5LZ5A 1R6VA 1DQZA 3MOIA 4M36A 1FLDA 3AM3A 4M9QA 5EHQA 1C8VB 4X3OA 3NTXA 4DE5A 3U60B 1L7RA 2DFVA 4XFKA 4TKUA 3I8SA 1S3GA 3GJRA 4O2BB 2XE4A 3NZEA 4PTZA 4R68A 3ZBUA 5JVDF 4M8IA 5JH7A 3KZMA 4CM8B 1GILA 4CQNA 1JQBA 5BYAA 4PLWA 4X63A 2HSDA 4DLWA 2QL7A 3C3CA 1KDOA 2QT0A 3AEQB 3S70A 4G0WA 1YOVA 3NHJA 2G83A 3TIFA 1JFRA 1Q0TA 2V7BA 2VLIA 3VH4A 1VBNA 2YYAA 1GPH1 4ER3A 2AI2A 5DM1A 2ZRMA 2Z8YM 3D8NA 1YVEI 3MJDA 4QULA 1B15A 4HB3A 4RF3A 3SZLA 4YMTA 2C7OA 3F9IA 2ZI4A 5JD6A 3TRIA 3SSNA 3HJFA 5CDYA 1K98A 1RT9A 5CIWA 5HPYB 2I78A 3LWBA 4GOND 4YAOA 2WWWA 1VL1A 1YQDA 4E6EA 3TW8A 5K4HA 2O7VA 3VZBA 3DLBA 4DB2A 4H18A 4I2VA 4WKCA 2AE1A 1KF0A 2D5CA 4ZT4A 4MCIA 4TWAA 3TR5A 4I1PA 2WSYB 1GGHA 1XZGA 4LJLA 5CLJA 3L7IA 1DEKA 4DA6A 3EWAA 2O0KA 1S7CA 5DSXA 1HE2A 4YJGA 4LTNA 3VI4B 1KH3A 1Q6YA 2OCGA 3L7OA 5ERYA 4DQVA 2ZS8A 4JLPA 3VPSA 4BAUA 3EBLA 2WD9A 3TEFA 1FMFA 3GUUA 4HNRA 2VTDA 3U3JA 2QQGA 1A98A 2BFBB 1M8GA 3ITDA 2OKGA 3GJZA 3GD7A 2GK4A 2QVYX 3H2HA 3LUAA 3JALB 2JNWA 5F1PA 4ZAYA 2YH2A 5K5EA 4JI8B 1IJFA 1EFUA 3VO8A 3AP2A 3I9V1 3PITA 2X5KO 2WZQA 4X95A 3WK5A 3P8ZA 3ZE9A 1JV2B 2ZI5A 2CXUA 1WD7A 1BEZA 2QGFA 1GL7A 1TA9A 3NHSA 2F8TA 1D1SA 1PNTA 3ZGLA 2TYSB 4KH1A 1EUQA 1FX1A 4HZUB 4WNYA 5JECA 1LPMA 4WXRA 5D1HA 4DBZA 1XCLA 1CUEA 1ZU4A 4OH7A 6REQB 1W0JA 1RYMA 5B7QA 2BHNA 2IEGA 3N7UA 2PBLA 4R83A 4UU1A 4GEGA 4Y18A 4PF1A 3QFFA 3I5UA 4EW6A 4XUEA 3RLIA 2NG1A 2NYRA 1IZ7A 1EM8B 1OXVA 1V16A 2RGUA 2ZK7A 2WJYA 3GJSA 3H04A 3NBXX 3NT2A 2WY2D 3UW1A 4N3GA 1QF6A 2BF7A 4K9LA 4CM6A 3PC8A 2H08A 3VMMA 4CUJA 5JCZA 2YJ5A 1SB9A 3MLAA 2C7GA 1GG2A 1T9DA 3E9NA 4P3NA 3NKFA 2D00A 4EHDA 3PWTA 4LRXA 4Q3EA 4OGKA 1LI5A 5T7BA 3M9LA 2EQAA 1EK6A 3IAUA 1T6BY 3R6WA 2P9GA 4FW8A 4KPUA 3ZGVA 3ZK7A 1BGVA 1K6XA 3HO8A 5J23A 3I3OA 4J29A 3EPHA 1GY8A 1FFCA 3ZY5A 2Y1LA 5KWSA 5LLDA 3UT5B 4B8ZA 4RKQA 5FA5A 2W6QA 1YB5A 3D5EA 4ZXFA 5DP1A 4DEVA 2JJYA 2Q5OA 4EYOA 5FI3A 1G98A 2HSJA 4UNNA 3ZQJA 3FPFA 2FPPA 2FJPA 3EEFA 3JQCA 1MGPA 1QBGA 4RV4A 2ZYGA 4U00A 2VXOA 3W2GA 3BL5A 3KOUA 4MGHA 4KXMA 3TL6A 5BVGA 2JAPA 1U3GA 3HJBA 3NTUA 4B3JA 5JDCA 2QMYA 3C39A 4JLOA 4MW9A 5HEKA 1QUEA 3SC4A 3S8EA 1M2KA 3F97A 4KAFA 4DNOA 1SOWA 3B6KA 1U0SY 3HCPA 4HXFB 2R6HA 5AM1A 1N9KA 4RK4A 4UCWA 2PR2A 2NQ2C 1J6UA 3MBOA 2WWIA 3W9BA 4EUSA 1XMOB 3AVUA 2BJHA 4O5OA 3NV7A 3RH0A 5CK5A 4ZVUA 2QTLA 3N2GB 4ZDJA 3FVRA 1I9GA 3FYHA 4LOAA 5CM2Z 3NTRA 4ARZA 4HV4A 4ZDKA 4KO4S 5EWLA 2WEKA 4HCJA 4ZD6A 1BDMA 1UM9A 2XMDA 4QU0A 1P0PA 2NSHA 3QU4A 1UDBA 1M1ZA 4MYTA 4QYSA 3T7KA 4F2GA 3QKIA 2B5WA 5LBIA 3FSGA 2M1XA 3IDQA 1X1TA 3KB1A 3KVYA 3LV8A 3TIIA 2WPNA 4BL5A 4W99A 2F59A 1L1EA 2XDAA 4TTJA 4LEIA 2P2ZA 3HDVA 3PJEA 4LJ6A 2HCTA 3IVXA 5CJ2A 1RCFA 3FUWA 1VSBA 1AS2A 1MA3A 1IDOA 4DZZA 3WYAA 1HE3A 2ZRPA 2AR7A 1U2PA 1V2HE 2OSBA 3FMVA 4G89A 4LHWA 4X00A 3UJ9A 5UKDA 3ZLUA 4WBSA 2IT1A 3DBHB 2QW1A 2ZPAA 3DTNA 4KBFA 5FTNA 3EASA 2I6UA 4GAEA 4B3TB 1YZUA 3TFWA 1QFXA 1XR3A 4D4KA 1IN1A 3EMVA 5DM60 5EWMB 4LQ4A 1EFHA 3VZRA 1VG0B 1ZMBA 4B3SB 2V4MA 3Q9NA 2R68A 1I6MA 4M0KA 4ZZ3A 4KTVE 3IA2A 4HLQB 4LJ4A 4FD2A 3U39A 3TNYA 2JAOA 4MCJA 1WW3A 1XZCA 4KV7A 3LF2A 1H9CA 4R81A 1WD5A 1PYGA 2JGDA 2X8BA 4JI3B 4AMZA 3EJ6A 5K3FB 4QTUB 4QEZA 2NUTA 4MQEB 2HYIC 1U7HA 3IQWA 2BUCA 2XBLA 3O0TA 1XALA 2AMVA 1M34B 2L2QA 1CVRA 1FP4A 1ICIA 5GV8A 2YINC 2PKQO 4JB3A 2OXTA 4LF4B 1MB4A 3DL2A 3HB9A 4F93B 2HQSA 3K9CA 4LX8A 4YMGA 1GA4A 3E15A 1MW8X 4N6NA 3CEJA 1PR0A 3OH8A 3QBDA 3NP7A 2QT9A 5FT9A 3WIVA 5CMLA 3DAOA 1R9NA 4IG9A 2W37A 4MCAA 4UFNA 4IXTA 1WSDA 4HS9A 4XWAA 5LYJA 4CG0A 5AW2A 1PQ4A 4V02A 5KHAA 4EO4A 3I2FA 4QPZA 3QWHA 1ZVKA 4JMLA 2RGDA 4ZOCA 5LP6F 5JSUA 2NN3C 4GL2A 5THXA 4C08A 2QLNA 4IUCS 1WP9A 1XXLA 4WA8A 3ZJUA 2RE8A 3COPA 4TLDA 1F06A 4TZKA 5JPIA 2I7TA 1DG9A 1Y8AA 4GLLA 1YQWA 3KT6A 4MS3A 5HYVA 3ASYA 3D6UA 3AF5A 1JEQB 5LB2A 4H60A 2FX5A 1JLLA 1L4GA 5E4YA 3TL3A 5BSGA 1KS2A 1N3BA 2PZLA 1GHTA 3Q8WA 3HUEA 4X85A 3WLFA 3MYRA 1ADCA 3VSDA 1BKYA 4X64B 2C4WA 4QTYA 1U6IA 1P18A 2J32A 1U8AA 1U8ZA 4EFNA 1RYDA 3VDMA 3T7SA 2AK3A 4U8HA 4NYJR 1A76A 2VJOA 3ZZUA 3ND6A 1ABFA 3MWDB 4CUZA 1R0XA 3O92A 4PCAA 3LL7A 2VP2A 2W90A 1N3IA 1B41A 2VJKA 3HCAA 4KO1S 2HNBA 4KUEA 3IPCA 3ENZA 3WB1A 1XMSA 3ZYCA 3HG7A 1JTFA 2ODBA 4MMYB 4P3KA 5IFLA 1O97C 1D8AA 4TMFA 2P1DA 4HRXA 3U4DA 3WMWA 4GZ3A 3S29A 5EJ8A 3I12A 4C22A 3IUMA 4BGVA 1RJFA 1C8BA 3CJQA 2O2JA 3BXGA 1MU0A 3STUA 1G20E 3IO5A 5CA0A 3OQIB 4BNMA 4P5EA 4HY3A 4QASA 4UMDA 1NX6A 3MJEA 4B46A 5K09A 4QTXA 3H9EO 4N40A 4C0KA 4LDNA 4MI3A 3TMAA 1KJJA 1ULTA 1ZUNB 4H1VA 5T57A 4FZRA 5J1TB 5AKGA 4OK6A 1X7ZA 3TLYA 1AV6A 1AY0A 3OQ6A 4WJZA 2FVXA 4AY5A 2OV2A 4HPXB 5HJEA 2WF9A 2X2OA 5TR9A 5HZHA 3WLOA 1D07A 4I55B 3WNZA 4EGQA 4Z7NB 4ITUA 2ZTSA 2GEDA 4MKXA 3IVAA 3T5MA 3IIJA 5ALJA 1LDBA 1AV7A 1TM2A 1Z6GA 4J0CA 2XCTB 4ILEA 4B2YA 4US0R 4RHFA 4RWEA 4JXJA 3UB2A 4K3UA 2PX2A 5TC4A 3OPYI 1FFBA 9GPBA 4ARIA 1HOXA 1QPBA 2VHJA 2VHZA 2NXCA 2YL2A 4QBIA 4R7TA 5B5SA 5ITZB 1BC5A 5ENVA 4Q19A 2X2FA 4FOPA 2IFTA 3OA0A 3MTQA 1J2UA 2H1RA 3BXHA 2Z08A 2G0AA 5LPNA 5FUYA 2XYRA 4DAOA 3PB3A 1HXHA 1M66A 4CCYB 1W44A 1KZGB 1KBZA 1X7WB 3Q3IA 2H16A 1SBIA 4ZTZB 4D8XA 4Z0PA 5I45A 1EESA 1MABA 1Q12A 3GN1A 4CHGA 1QTRA 4JBWA 4HFNA 1G8GA 3P9KA 4H7KA 5D3QA 2FGJA 4KSCA 5LCXA 4WBNA 4DV0B 3OOEA 1JHUA 5HS4A 2W2XA 2J3HA 1Z5NA 3OE1A 1N2OA 3CPSA 3WL5A 3UKJA 4DWVA 2C5SA 2I6SA 3LLSA 4IX1A 3AJ9A 3FLBA 4NI5A 4YUVA 3VR2D 4YRCA 3GZTB 1DJMA 5G0VA 2VZ0A 1QV6A 3BICA 2J85A 3QXXA 4IFBA 3WWDA 5KB3A 1TW3A 1DAFA 2E1RA 3V32A 4ZVQA 4NZYA 5CXXA 5SICE 1ORWA 4N6OA 2HDOA 3VBCA 1XK7A 5CDHA 3COYA 4YP7A 3P7MA 2NPIA 3HNRA 1R0KA 1BHSA 4MVYA 1NQAO 1PV2A 3P2IA 2IXAA 4W8OA 3H9QA 5DIZA 5A4FS 3V8QA 3DLPX 2ETVA 2J33A 3VKUA 3ANNA 3NAGA 1FZQA 2Z3VA 3RYIA 2GF9A 2NZVG 2F00A 2RBKA 4BNKA 3VKHA 3ZHZA 2EFYA 3L4BA 5JWHA 2AZMA 2VTEA 4YYZA 1W25A 2ORYA 4BWVA 1S5PA 4HZUA 1QSGA 2RI6A 5KNBD 3D7KA 1PJLA 1DHRA 2BP7B 2QZJA 3KLBA 5EAIA 3GDWA 5E6UB 4YXWA 1ZAKA 5AW4A 1A9YA 5BSMA 3D6HA 1OY1A 2OXIA 5ELXA 5LOVA 1XCGB 1EWTA 1KK1A 2C7PA 1BNCA 5DM70 1CZLA 1MC4A 3AP3A 4D97A 3DONA 3PFNA 3TR0A 2D2VA 1W8DA 3KHUA 5AKLA 5CFPA 5HRAA 2K7FA 2IS2A 3SC2B 3MGGA 1KQ3A 2WUFA 4PEVA 1SM4A 2XVYA 3AUTA 4C0HA 1PEKE 1E61A 3OX1A 4D9KA 2PX8A 1MPXA 2COEA 2AXNA 4P38A 3KJNA 1KE2A 4FLEA 2I5PO 3HNPA 2QJFA 1R0LA 3H9GA 1EX9A 2DH6A 1XQWA 2AT1A 3PGA1 4XWWA 5FUVA 5JR3A 1OV6A 1M8PA 4R71A 1ISHA 3ZU6A 2RJNA 1W49A 3UMRA 1J9EA 5IN4A 4IO1A 1ILEA 1DBQA 5FEMA 1EX1A 2GCPA 3DYVA 3EUFA 1DC3A 1LBTA 1FRNA 3CZRA 1E64A 3FKJA 1S2NA 2DY1A 4QRIA 3AKYA 4D9GA 3WGQA 1GLNA 3ROKA 3LW8A 5A1JA 2W2VA 4GQAA 1Q17A 4HYQA 3OLVA 5CB4F 4W63A 1HWYA 1W36C 1EWVA 4ZYWA 4GR4A 3R0JA 3JTMA 3O4FA 3U5TA 3DXYA 2QTGA 4AZSA 1DIAA 3AL2A 3L1JA 4GDFA 4MPTA 2QVLA 3WL4A 3JAWB 1NIPA 2ILTA 4JB0A 4WCVA 1FSGA 2Z2ZA 1TZJA 3ETJA 3LC2O 4MP8A 1NW6A 3T0IA 2P9QA 5JFGA 4OYLA 3VOAA 3BK1A 1A4RA 1HG0A 1E77A 3DPUA 1TF5A 1UEJA 3KJGA 1G5HA 5LLSA 3UM9A 3TEMA 4A0RA 5KO2A 4PGMA 4OSEA 3GLUA 4MJ3A 4ZI7F 4I1OA 1RYEA 4AX8A 1C9EA 4TS3A 2AG0A 2OTCA 3KR1A 3DBLB 4FE4A 1W94A 1V3UA 4ZEOA 1E5LA 3K6JA 4M1SA 1E1QA 1REQA 5JVDB 4ZO7A 5EKUA 3AV3A 2JCYA 2Y8EA 4ZEXA 3W8DA 4WAUA 1UAAA 1U3VA 4RDCA 3W7AA 4DLPA 2XTNA 3RUIA 1LPNA 5HWSA 4IGEA 3NDPA 3LK6A 4CL0A 4EPXA 1V1MB 3ANTA 3FYDA 1WZNA 4AO7A 4F7DA 1XU7A 3OIDA 3HADA 3IXLA 4Q4HA 2CHEA 2Q9CA 1FRQA 3IOCA 4H3KB 1BXGA 1VE7A 4HB2A 1XYYA 2CJFA 4PM4A 3LT4A 4NFSA 3ROPA 3D3EA 4KPEC 4KL8S 2WF8A 1X80A 1DQPA 4REQA 2ZETA 5IBPA 1M8FA 1ZNYA 2G72A 5BPHA 3AVWA 4RJKA 1VXOA 3O2NA 1B8VA 1N25A 1FA9A 1GSOA 1SHKA 1QKJA 3MRXA 3CYFA 1DG3A 4MQEA 3RVRA 3VZCA 4GUDA 2V0CA 1PT5A 3UB3A 1Z62A 3FSRA 4C3ZA 5CXQA 1O94C 4C6SA 5I47A 2R8OA 3KXPA 1P60A 2TMGA 3Q3GE 5JS6A 7MHTA 1M2EA 4OHRA 4TV8B 3WWEA 2QN9A 5K7SA 3OY2A 2QN1A 2NZXA 3D43A 3JZFA 1U2QA 3QQPA 4HYTA 4JITA 4X93A 2YQZA 1QFZA 2RH8A 3RTDA 5HZMA 1R8YA 1H8HD 4JP1A 2HJGA 2QTBA 3GFOA 4I2NA 1EIWA 2BH2A 1SOAA 3QHAA 4D4MA 4YAWA 2G76A 1NAHA 3I2YX 2WYUA 3AXTA 4ESOA 3T12A 4U2GA 1GCIA 1Q7RA 1V95A 3OEYA 1ABEA 1DX6A 2NVWA 3UB4A 2Z09A 3WGYA 4B3MB 2XUZA 1KIAA 4AMUA 2HU7A 2KSQA 2IPMA 1KOFA 2JDID 2R96A 2RHCA 3GI1A 2E87A 3NU1A 5JLAA 3TH5A 4A0HA 4EZIA 1D6MA 1UJ6A 1O96A 1NFQA 1WUIS 2GCIA 3QI7A 1MENA 3IAM6 3WMXA 5JEEA 2HGSA 1E0DA 4G5GA 2UZ4A 2TMKA 2QVZX 4BKQA 1D09A 4YA6A 1KI4A 1MT3A 5BMOA 1WDMA 5JSHA 2ZT5A 4ZTBA 5HG0A 3UXHA 1QF7A 1MB2A 4J0GA 2HT1A 1YQUA 2ZCJA 1JVBA 1F2DA 2W6PA 2Y0CA 1NBMD 2ZR7A 2Q6TA 1SVSA 4HGYA 5ADVA 1AKMA 2CLIB 1EK5A 1USIA 3A2NA 4JLNA 2IYLD 2VO1A 3OU2A 5E7MA 3QUBA 1Z8NA 5IHPA 1IWOA 5BOSA 4B81A 2WU8A 4MLDA 1DRJA 1M34E 2RK3A 2WVGA 4QIHA 4LE0A 1CB0A 1EVJA 2WJWA 1JR4A 1Q0QA 2GN2A 1IPFA 3A9CA 1G1AA 2JFYA 2CJPA 2QTNA 1V6CA 3CX3A 2CL7X 3Q0EA 1ZGZA 2IYEA 1NXPA 3KOWA 5DTMA 2F3QA 3T7AA 4A7PA 3IP7A 2GK6A 1LPPA 4EBFA 4TMXA 3A4MA 5I9TA 5IAKA 3KJEA 3MAJA 3LIPA 3GLIB 2HWXA 4DDTA 4EO9A 1XA0A 3ZUPA 1AMOA 1M2JA 1RXCA 2GCOA 4TT3A 1DIBA 5DXFA 4JLSA 1DRUA 4IO0A 1KQOA 3TZ6A 3DDSA 3L7CA 3KALA 1XAIA 4BLVA 2O48X 4XX1A 2PX6A 2M2IA 3EQ9A 2QNIA 1VECA 2D59A 2OAGA 3EGOA 1RLOA 4HLDA 4ZCSA 1FQOA 5TVKA 4DA9A 5HTOA 2VQDA 1T1EA 4Q82A 2D06A 4R2MA 3BCUA 3T7EA 3P9SA 3E4DA 4YFVA 3WWPA 1V9CA 2P9YA 5DNUA 1R5OA 3R6GA 3OJWA 4U6NA 4BQIA 4Z1MD 5H8WA 4G56A 4JKYA 4DARA 2KI5A 4EY6A 3NNSA 2WLSA 1JPJA 4A92A 1ZMRA 3ORRA 1K86A 1GIAA 1MX5A 4WX2B 3CISA 1AURA 1QVVA 1PV1A 1TU0A 2WHPB 4CWAA 4ZQFA 3JS5A 3PVZA 4C14A 3D7NA 3GUHA 2V3CC 2O1XA 3U7JA 3GC6A 5AUQA 3H6KA 4JUAA 4CM3A 1GUFA 1WDLA 1AS3A 3PHLA 3ZTWA 3DZFA 5JDIA 1NXWA 2SKEA 1B3RA 2OBFA 2CKMA 3H4IA 1SQGA 4IS3A 3HCEA 2AH5A 3ID6C 1D4FA 4R9NA 4RXTA 4RXMA 5J2TA 1DBSA 2H2IA 2Y1CA 5BORA 2H7CA 2ID4A 3GWZA 1FFXA 1MB0A 2GBLA 4HP8A 3PNQA 4OB6A 1WJGA 2JEYA 3BQMB 3ZWDA 5E8RA 1U81A 4PR0A 2FZGA 4INAA 3IQHX 3A8TA 3CX4A 2WTNA 3EWIA 3B2EA 2VDRB 1JWBB 1S8NA 1MJHA 3A9WA 3H1TA 3R0QA 3MWLA 2FF7A 4H6WA 4CKZA 4OQZA 1QRRA 4FQ8A 4DLVA 4QOSA 2QAGC 3A9TA 2PYIA 3BH6A 3CLVA 4UHEA 3HA3A 2QX6A 1E1LA 1IWPB 1ZRHA 2NV0A 1T9CA 1TAGA 2JHFA 1I0LA 2X58A 2HTEA 4J91A 4QEKA 3O2SB 5EYPA 4CR7A 5CFZA 3OJEA 3HKBB 3A6ZA 1T9ZA 4D4LA 4YQYA 2YXNA 2C8JA 1GZ5A 3VSAA 5LQRA 2QLLA 1PSDA 5AD1A 1NP6A 1YBMA 3FTCA 4AXXA 1KXJA 2ICAA 3M4NA 2W8ZA 2IYZA 2NU8B 5KKNB 2FPLA 5H7XA 2YN2A 3VU3A 3N1UA 2DULA 2Q4TA 3GGJA 1XVTA 3N53A 1Y9ZA 3HWSA 3I52A 3FB4A 1NVMB 2XB8A 1VL5A 1VRCA 5KYYB 3VBEA 1UBCA 1IVYA 3CO5A 1JPNA 5GJBA 3A28A 2VPTA 4KBYA 5AVKA 4MDYA 1UBMS 1B0ZA 3V1LA 3TBKA 5FL3A 2V6BA 3VR6H 1Q0ZA 4D43A 3KTOA 2N75A 5EWJB 1E9BA 2FW8A 4F6LA 4QDXA 4UU8A 3OLYA 1QZXA 3QOFA 4O4HB 4FHEA 3UHFA 5FX2A 5JSFA 3U19A 2WW8A 3R6DA 2NYVA 2ZRDA 1V8ZA 3P4UA 3AHFA 1Q1ZA 1FMTA 2LR0A 3DKRA 4Q18A 4QUAA 2VK1A 3O2QB 3QA9A 5CVDA 3TI9A 1XEAA 4I50B 5HF9A 2BIFA 2BONA 4KE7A 3V5NA 3WGZA 1A97A 1WMSA 4UTNA 2ZTHA 1Z6ZA 4ITVA 5C7LO 1SCKA 4DJDC 3UV6A 1R6AA 1P77A 3IFSA 1LNQA 4HH4A 1Z45A 4NICA 4RWZA 1RBYA 3H8SA 1IQPA 3SCZA 1XLVA 1XCBA 3DWIA 4G1CA 1LTQA 4O4IF 2A0KA 2VXCA 5JAQA 3W2FA 3F2VA 5REQA 4F8YA 5IWAB 1Q21A 3GUYA 3K8OE 3LCCA 4CYMA 2IX9A 5COAA 5D3MB 2KLHA 4CMKA 3ZCSA 1T9GS 1WF6A 4F3CA 3A4TA 5I8PA 3Q6MA 3AHIA 5DSTA 2PGJA 1EK0A 1OREA 5CH3A 3S27A 4Q3BA 1F51E 4JDUA 2UZ1A 1M2VA 1TIKA 3RG8A 3ZK9A 2D1YA 4IS2A 3JAMA 1L1RA 2JLCA 4Y6GB 1KO1A 3MTIA 3BE4A 5A02A 2GERA 3PLAE 3MSXA 2CBXA 3FB1A 5CU7A 4BBJA 4EK9A 2WMYA 4FMBB 4Z2YA 5JS7A 1FYWA 1WXGA 3KLNA 8ADHA 1MH9A 1H6DA 3D54D 4N54A 3WLPA 1G7CA 4C43A 2JARA 1VIDA 2ZQ5A 5CXSA 2W8BA 3CZPA 5KOJA 4RTRA 3SZOA 1USKA 4XXHA 2GXQA 2GYVA 2WOJA 1VSTA 3AG6A 5GONB 3X2FA 2Y6UA 1RYZA 1ACMA 4Q9IA 1GRNA 3DXZA 4BV8A 2I66A 3QUSA 4E07A 5LYJF 3KKPA 4FYWA 1P1KA 3T95A 1KO7A 1RM5A 2FPOA 2SHKA 1OWNA 3S55A 2RHGB 3SXUB 1S4QA 1PJZA 3FOWA 1LWOA 3LUDA 4MWEA 2K2QB 2XSZA 5HUQA 3TSAA 3COWA 2FX2A 3VOSA 2HEIA 4M1KA 1URPA 2Z4SA 2PDAA 3DMTC 3OKPA 1QV9A 2QYHA 4WI1A 5SZJA 1MAUA 2C88A 1L5NA 3SEZA 3U3MA 1E6MA 4RACA 2VPWA 5GOZA 3PUKA 5HX7A 1AA6A 5IKEA 4K40A 4QFBA 3WQRA 1QX3A 3AHHA 3L18A 2J3JA 5F98A 5JXGA 2HH9A 2X7JA 1O9BA 1XHEA 1FYVA 4CMAA 1SVKA 3EODA 1NL3A 2A7XA 1NMZA 2FA9A 2JGMA 5KIAA 2XXBA 1R9JA 2GR9A 3KQSA 1TQ4A 3VVCA 1RHUA 5FUXA 1W93A 4RY0A 1CUHA 4DRZA 4I81A 1RZUA 1FTYA 5KAMA 4CQLB 1Y3IA 1P2VA 2PS9A 4TL9A 3QE9Y 1GZSA 1BFUA 4HFRA 2QX9A 1ZMOA 4B44A 1NBEA 3CNOA 4PSAA 4Z4EA 5DGIA 8OHMA 1J2RA 3WGIA 1JEOA 3FG9A 5CEJA 2A78A 1PR9A 5CP8A 3R9XB 3TLEA 4B5KA 4MW7A 4KKXB 1N7HA 2AVDA 2OQIA 5C53B 1JR3D 3ZZTA 2OXRA 4B4UA