1GCIA

The 0.78 angstroms structure of a serine protease-bacillus lentus subtilisin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
b'AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN
publication title The 0.78 A structure of a serine protease: Bacillus lentus subtilisin.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Serine protease
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1998-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1gciA00
2PWBA 1PJ8A 3OSZA 3DW1X 4NE9A 3DE4X 1Y3DE 1LW6E 1AQNA 1OYVA 3TI9A 3DWEX 2PRKA 4GI3A 1P8JA 3TECE 1NLUA 2SICE 5SICE 5B1EA 1SBTA 1GNSA 1DBIA 4JP8A 4LVOA 4J94A 1UBNA 5AMXA 2WV7A 3BGOS 3A3PA 4MZDA 1SUDA 1TM5E 3SICE 1SIBE 4WOCA 1SBNE 1SBCA 4DZTA 2WWTA 1C9JA 3BPSA 3DVSX 1WMFA 1ZVKA 1KDYA 2XTJA 2Z57A 1S01A 5JMOA 4WOBA 3SQOA 1V6CA 2ST1A 3F7OA 1KE2A 2ID4A 1T1EA 1SCJA 2Z56A 1Y34E 4H6WA 1GTL1 1HT3A 2W2MA 4ZARA 4H6XA 1NDQA 5ARDA 1Y48E 1VSBA 3DDZX 3GCXA 3BX1A 1T1GA 1SUEA 4B5LA 3ZXYA 3VV2A 3LXUX 1R0RE 2XRMA 3VSBA 1TK2A 1SUAA 1Y3CE 1GTJ1 4OV6B 3CNQS 1GA1A 3QFHA 3I37X 4BWGA 1BH6A 1JEAA 3DVQX 3A3OA 5CW1A 3QMPA 1WMDA 1TM4E 1C9MA 2WUWE 1AH2A 3DE6X 2E1PA 3VTAA 1Y4AE 2WUVA 1TM3E 1SCAA 2PYZA 1BE8A 2DQKA 3WHIA 1TM7E 1Y3BE 1GCIA 3DYBA 1TMGE 4AKTA 4CFZA 2V8BA 1MEEA 1AVTA 2Z2XA 3DVRX 1R64A 1Y4DE 3AJ8A 4NE7A 1SELA 2W2OA 1GTG1 3PTLA 3WQBA 1EA7A 4KPGA 1P7VA 5JXIA 5I9SA 4YN3A 1S2NA 2W2QA 3DW3X 1KDZA 1WMEA 1KE1A 1R6VA 3VYVA 1GA4A 1BFUA 1TECE 3I2YX 1C3LA 2DUJA 1IAVA 1WSDA 1BE6A 3F49S 5FBZA 3Q40A 2IY9A 1SCNE 4C3UA 1GT91 3AFGA 5JXJA 1DUIA 1KDVA 1YJAA 3F7MA 2G4VA 5ARBA 4H6VA 1SIUA 5FFNA 1TM1E 4M1ZA 3PRKE 3UNXA 2ID8A 1EGQA 4CFYA 1PEKE 4KB5A 1THMA 1TO2E 1SN7A 2SECE 5AVJA 2TECE 1GNVA 4NMXB 1XF1A 5AVKA 4ZOQI 3EDYA 3P5BA 2Z2YA 1SBHA 3DE2X 2IXTA 1Q5PA 2GKOA 4LVNA 1IC6A 2QTWB 1AF4A 2B6NA 4OMCA 2HD4A 4RYDA 1BJRE 1S02A 5FAXA 4K8RB 4CG0A 1SPBS 1ST3A 3GT4A 1PFGA 1YU6A 2X8JA 3Q5GA 1SCBA 5ARCA 2P4EA 1ST2A 2ZRQA 1WVMA 3WIUA 1SIOA 1P7WA 1Y1KE 4OMDA 2DP4E 3H42B 2ZWOA 2Z2ZA 4DJ5X 1SUBA 3HJRA 2ZWPA 3GCWA 1Y33E 3GT3A 1CNMA 2SBTA 2SNIE 5B1DA 3L1KA 3D9QX 3DE7X 3D43A 3I34X 1YJCA 1OYOA 2PQ2A 1SCDA 2PWAA 4C3VA 2X8JB 3T41A 1MPTA 1T1IA 3VV3A 4FONA 1SBIA 1BFKA 4I0WB 5JXGA 3I30X 5JXHA 4HX2A 1SUCA 1SUPA 1OT5A 5K7SA 1AU9A 3DE1X 1AK9A 1C9NA 2W2NA 4Z2AA 2Z58A 3ZXXA 3CO0S 4HVLA 4KG7A 1ZVJA 1TO1E 1YJBA 3AJ9A 1SH7A 2Z30A 1Y9ZA 1Y3FE 1PTKA 3LPAA 1GA6A 3DE5X 4AKSA 3TI7A 1V5IA 3DE3X 1CSEE 3EIFA 3VHQA 2PMWB 3QTLA 1A2QA 3LPDA 3DE0X 4DWWA 1SVNA 2W2PA 1NDUA 2HPZA 2PKCA 3LPCA 1AV7A 3A3NA 3WIVA 5AQEA 3EE6A
chains in the Genus database with same CATH superfamily
4UM8B 1MB4A 2F3TA 2ZAYA 1LLFA 5A9SB 3S55A 3L4BC 5JS6A 4KIGA 2DLDA 3CH4B 3I45A 1EKXA 1A4UA 3UW1A 3WGUA 1TTHA 1GFZA 2I3DA 3SSOA 2X0KA 3JALA 1E63A 5CGZA 5LWQA 2OWEA 4MKFA 5CH3A 4JA0A 4G0PA 4JQZA 3VR2A 5BVGB 1UWCA 5L51A 2NZXA 1XEWY 3EGXA 3TL2A 3HM9A 3L01A 1VPDA 4HDMB 3WJ1A 1C3OA 1X0VA 3CWQA 5CLIA 1GYRA 1MAHA 1M8PA 1RMQA 2PRKA 1PYOA 3EVAA 3QA3E 5E6RA 2HJSA 3WK5A 2YY6A 4AI6A 4XYBA 3MQFA 5SICE 4R8MA 2CV2A 5BRJA 3TVYA 5KWIA 2YZMA 3GEEA 3QUTA 2XDQB 3K8OE 3BJEA 4JP8A 5CURA 4XR4A 4DJDC 4EJ0A 5K3CA 3FMFA 3NMUF 4RNCA 1R8XA 1X42A 4AZWA 2ZUVA 4OBWA 5BWCA 4J6FA 1Z34A 4Y2VA 4NYIR 4GM1A 5JIBA 1C0LA 2IYQA 3MJDA 3KJGA 4TS3A 1ZNYA 4I55A 1PS0A 2HMAA 5AM3A 3CX7A 4DC9A 2P5SA 4WESB 5H82A 4JX9A 2I6XA 2R7KA 1DNPA 3ZWDA 1Y63A 2PLFA 3W2TA 1JYSA 1BYUA 1UL1X 5K3FB 3TWOA 5ALFA 3UUWA 3U62A 4F4FA 5B7NA 2CCGA 2D0PB 1JECA 5AR1A 3GQBB 3H3XA 4ZU6X 2PMDA 2OAQ1 2DH6A 1QJ4A 4YRPA 4EFKA 3HKBA 5HTOA 2HDHA 4MDEA 4DFDA 1Z37A 3TJMA 1HQDA 2IZ1A 1I2ZA 4BFCA 2ZBEA 4FQ5A 4F45A 5B2EA 3A9UA 5KTYA 1XX6A 1N2CE 1DADA 2CHGA 2HMWA 5L7TA 4NJMA 3EODA 1QH1B 4ZCQA 2IT1A 5B7GA 4I81A 5CB4B 3HB1A 3UKOA 2Q6TA 1W85B 1GGMA 1WCV1 3CR8A 3K0BA 3QUBA 5EN4A 3UJ7A 3M6FA 4K6GA 2FW7A 4WXYB 4Z99A 3OOYA 1CX9B 3D3KA 3KLPX 3OA2A 1WCYA 2D0IA 3CPJB 2QRZA 3E9NA 4B8YA 4LZAA 1MLDA 4QUIA 4MMZB 4TL9A 2JKZA 3AF1A 3CZ5A 3DZKA 2ZB2A 3TTVA 1YFJA 3KT3A 4HO1X 1WNTA 4BV2A 4E2XA 2IXGA 2FSPA 1TAGA 1PQ4A 1J33A 2QPAA 4GVPA 2Z5FA 4JUFA 4QJ5A 2QVGA 2JCXA 2HFJA 1ZUIA 3FFWA 5H5JA 2WF7A 3VNSA 4YAUA 4LF8B 1YR2A 4ETWA 1DRJA 3KVNA 3LH5A 5LZ9A 1KWGA 3UMFA 5BSFA 5CLQA 1K4YA 3L0DA 3N2KB 4GSYA 1Z6XA 3P9CA 3WMWA 1QOQB 2J45A 3EVFA 4N3GA 4O4HA 3O47A 5TMEA 3VU3A 5K3DA 1SWWA 4O4LA 2C5EA 1TUGA 4OHVA 1GNRA 1UDBA 2X42A 3URMA 1BOOA 1PUIA 5BN1A 1X15A 1RKXA 1ECLA 1WX1A 1G4UR 1OC2A 1YUBA 3GPDG 5HE9A 5HQ3A 2CSXA 1GPDG 4Z3KA 2H1OA 1VJCA 2IPNA 1R7RA 4FGZA 4FLEA 1KI7A 4IHKA 1XU4A 1KNXA 1W9MA 4DVGA 5KNDA 5DASA 4B46A 3H0EA 1NZDA 1SKYE 2VAMA 2P4QA 2ZWIA 4QAJA 3ZTYA 4KFTA 1YDMA 1T35A 4A03A 3MMNA 4YT4A 3DVQX 1G3QA 3JYLA 4CIAA 1IJKA 1MR3F 2HMYB 5K0FA 1EUYA 2NMVA 4MKHA 1BC5A 3QHPA 3S44A 1U3UA 2ZYUX 3HHEA 4U0KA 4BKMA 1FQKA 2AI1A 4B73A 2VP3A 2GN0A 3OFVA 1EU1A 1PLKA 5G02A 3E23A 1VCOA 2O20A 4MWDA 4WCVA 5CEFA 3X1KA 1VPEA 1HE2A 4WOJA 1T9ZA 5KAPA 3M2TA 4WWHA 1MJGA 4DHEA 2AJDA 2YY7A 4PSAA 5TGZA 5JU6A 3PHCA 5C53B 4OJKA 2MSCB 4DR1B 4RGQA 1KQPA 4O3MA 3PT9A 4IDNA 4GWGA 4RFVA 2C4HA 3G49A 5EXEA 4QULA 4KJZA 1I13A 5BWOA 4Q4AA 5HRAA 1IEVA 5IKEA 1JA0A 2IVZA 1E2PA 1DBSA 4MCHA 4FYYA 4URFA 5BN4B 3QNMA 2VDPB 2V97A 4RLQA 4IIJB 1M0WA 3ZWAA 1V8DA 3RWMB 3T3OA 3AXTA 3FMIA 3H1PA 2JGLA 1IZZA 1NULA 4V24A 2HH9A 4PQEA 3ETCA 4ZV9A 1C1XB 1P4RA 4PX3A 2HW8A 1XQVA 4UZFA 3CB4A 3CIOA 5EP1A 4B2LA 4AJKA 1V7PC 3CW9A 5GOTA 4F2HA 4DDWA 4MRSA 1AKNA 4JCCA 4TTTS 1NXPA 1SG6A 2OBMA 2RGNC 1NE7A 1YI8A 3ETEA 1XRRA 1W2WB 1CU1A 3KJEA 5EKXA 3STTA 1T4MA 3T7KA 4AKTA 4BZZA 1T1RA 4MV6A 1XMQB 1T2VA 4LKOA 3UZUA 1XKLA 1E1CB 1PFWA 2GM3A 3ULKA 4XD7D 1G5IA 3FJ1A 3G9TA 1ETUA 2EQ5A 4AN0A 2I9PA 1E2LA 1O8CA 4QARA 4C0JA 1DWPA 4BNIA 2NYRA 1KYYA 1NATA 3F71A 3T5MA 4BNWA 2VPYA 2GI4A 3DOCA 3TQCA 1ZHHA 4C4XA 4XH9B 4LDZA 4K9PA 1JPVA 3PX7A 4H1HA 3ZWWA 1KAQA 1NXTA 1E9RA 1Z4OA 3JY6A 4IFEA 1NTRA 1GZ7A 3K9CA 2VR1A 4MVYA 2Q1SA 1RIIA 2BMJA 3KVVA 4AZ3A 3EH1A 5CBKA 2PE5A 2O8DB 4RMHA 4M0DA 3T3NA 4QE3A 1GL7A 4FW9A 5F1KA 1UXKA 1YAHA 1ODSA 2EDCA 2C7GA 2BVNA 2M2IA 2ODEA 3AESB 1GY8A 3ID6C 3OP1A 5FULA 5C1BA 2W2QA 2HWXA 1XOIA 4CODB 3V9AA 1HQKA 4QELA 1FP2A 3BK1A 1WMEA 4AUEA 1PVOA 4MKIA 3C7CB 4RADA 5T8KC 5HKKD 5LD2C 1U0FA 2Y77A 2JKYA 4MS1A 3U9SA 4P83A 1EVZA 1XTPA 3UWOA 3W4JA 5B2FA 1FP7A 1NE2A 1KDRA 3F67A 4P7BA 1V4NA 3LUGA 1U9ZA 4M9XA 5JO9A 4HMQA 4KBYA 4HWOA 4BGEA 2AFRA 1WXQA 4F1JA 1ZGJA 1JDBC 2FZ5A 3F4KA 4L73A 4TVSA 3TLGA 1FBNA 1M1XB 1RMYA 3QOXA 3VU8A 1QIFA 1NY6A 3S0JA 2NXEA 1OA1A 1VLZA 1UZUA 5T41A 2O5CA 1LC0A 2VXCA 3GJ8A 3Q8XB 3ROZA 2QW1A 2ZT8A 1AHNA 4TL6A 2XTAA 4L6AA 1R4MA 4FDMA 5AOBA 1GGKA 3E3NA 4ZEMA 2I4OA 1JH9A 2Y4OA 4O4IA 4CM8B 2OORA 2YZ2A 4LEIA 5BVHA 2XEXA 3SIPA 4U2FA 1D6SA 4JBLA 1KC3A 4ZOCA 1F17A 3C3JA 2IYZA 4TMXA 3A1UA 4D9HA 2QR3A 3KJQA 4PZCA 1L5FA 1E9DA 1ID1A 4OREX 4G0XA 4PM4A 3BSSA 5FOXA 2R97A 2TMYA 4WZ6A 3WNQA 1XAJA 2O1SA 4UVHA 5LQRA 2ATXA 4A10A 4YGYA 3BL5A 1KIMA 1YBMA 4M1ZA 4KFRA 1M2OB 2DUMA 2UZIR 3ILHA 3N2ZB 2J0QA 3L7KA 1G20A 3IAAA 4ZQEA 2HK7A 4UQLA 1FQWA 3UMGA 2GZAA 4MP3A 4DVJA 5JMTA 1TADA 3I9FA 3M6IA 4TRRA 5I5EA 2VJLA 2ZSKA 3E1SA 5J2UF 1EPUA 3AU9A 3NLLA 4IDFA 4MKRA 4OAQA 4B43A 1TJYA 1L3CA 4A6PA 4E31A 2Z6AA 3H9CA 1LFDB 2F8TA 3LS2A 3FKSD 5E1DA 3C48A 2G09A 3I9MA 4ZOQI 5CDUA 3D64A 1Z13A 5EHGA 3D8NA 1TTPB 4LOKA 1ECCA 5DCLA 1RHUA 4IUYA 1XDBA 1HDRA 7REQA 5J23A 2X19A 1QOZA 4I3GA 3WK8A 2AC2A 2ACEA 3A9WA 3FWPA 1ABBA 1R50A 3TCNA 2AJCA 1CRLA 3UMBA 1QAOA 5H16A 1TZJA 3ZD8A 1BMFD 5G53C 2PS0A 2CFCA 4KXYA 1FMTA 4KR7A 1BKDR 4B1FA 1Q12A 1A1VA 2PV7A 3CN7A 4PCUA 4ER3A 1EIWA 3RHFA 3Q11A 3GHHA 2A0YA 3QPUA 4YP5A 4ZCPA 3D0KA 4JLMA 4FHCA 4EHNA 2EG5A 1WZNA 4G5XA 5IBQA 4I4TA 4CF5A 3QVKA 1Q0LA 2B6NA 2HHCA 1KRWA 1FSGA 3DF7A 1KZ6A 5HS4A 1ATIA 3TR6A 4CG0A 1W1UA 4F8JA 1ABFA 3QKTA 4QXAA 1P6XA 3BHNA 2JZNA 1H23A 4OI1A 4CKYA 3EPLA 4TX1A 3NV9A 3QHQA 4F85A 2FQQA 4CKBB 3M6MD 1XYYA 3OF3A 2OHJA 4BMCA 4BMPB 5HXAA 5L3QB 3KM0A 1MXHA 3NDPA 5J4KA 3C3DA 4Z0PA 1T1SA 2JGRA 2A1IA 3SE0A 5ADHA 1CY6A 5EPOA 1YKFA 4TTJA 2ZJ5A 1MHPA 3ZWQA 4W7IA 3HZRA 3U7GA 2I3ZA 1E64A 2ZYWX 4J75A 5BSTA 3W6OA 5CVCA 1MIOB 3AY7A 4JVMA 1IWOA 1V1RB 1JLMA 4XCQA 2V7EA 4N5LA 5ALSA 1V1MA 4DGQA 1P7WA 3PNOA 2PH5A 3RYCB 2WB2A 1E8NA 3KYCA 5EJIA 4HRVA 4P7GA 3W06A 3X0DA 1DIGA 3U7FB 1JXAA 2NO6A 1SIWA 4YB8A 5D3ZA 3HMQA 2XDYA 1SUBA 2XYQA 3G0GA 3GHYA 1MP0A 3AL3A 4RIHA 5DNAA 4IP0A 4ZQFA 4DWOA 3GU3A 2ZR9A 2MSWA 2OBXA 4J4BA 3BREA 3G5TA 4I99A 4QEKA 2HBRA 1ZKMA 2VLBA 3CH7A 3OJEA 1Z25A 4TKUB 4X64B 4WH0A 2DWUA 3B1VA 4KRXA 3NPAA 3ILYA 5JNUA 3DZDA 4MUGA 1BFDA 4EB0A 1MAWA 5FO0A 2JHPA 3WLOA 4IINA 4Q00A 1OTXA 4M1EA 2IP4A 3REQB 3CG0A 1ULUA 3AR8A 1OYOA 1R8SA 2HJRA 3Q87B 2PS3A 3KYJB 4KAAA 4M1YA 3FWYA 4M99A 3W5SA 4C3VA 1W4RA 3ZW8A 1MF7A 3GRUA 3TSWA 1NFFA 1E5VA 3COYA 4DPLA 1ZD9A 2Q07A 2R47A 3HGQA 3KWFA 4N7MA 4RHEA 4Y6LA 5G3ZA 4RJLA 3OAAA 3ZU6A 2HSGA 3AINA 5HZHA 3U61B 4D2IA 1OWLA 4TV8F 1P4HA 2BE7A 3PGVA 2FEOA 3X2SA 3W5UA 3O8RA 2IKSA 3PE3A 5IDVA 4BBZA 4FFSA 3QKUA 3H18A 4RZIA 4BO7A 1L5KA 4B81A 5FCDA 4E0BA 3WLPA 5A3QA 1B76A 2ICAA 4DV6B 5SZHB 3GFFA 4YV2A 3WKEA 2JZCA 2V54A 1HL3A 2HSWA 4ZPJA 4D4JA 1B15A 1E89A 3QLVA 3SPXA 3MLAA 3NDBB 4DQ0A 3ZNNA 2DFNA 4DV2B 5JS7A 4RHCA 3PDJA 1LTHR 4EG5A 5KWEA 5DGXA 4Q3KA 2RC6A 2QTCA 5A1TA 1LBIA 1HY3A 4EOGA 5FIUA 4A9AA 2HL6A 5DWDA 3G2KA 2HXSA 4Q7KA 1FUIA 5LKAA 2QQFA 4AJ2A 1LD3A 5AOAA 2PFGA 1IL0A 3LHIA 2FUKA 2D2VA 3VYRB 4YCJA 3THYA 4N0DA 1GXSA 3WP0A 3DTNA 1TOAA 4HVLA 1Q57A 3NYRA 4BVBA 3IE0A 1DJLA 4PHFA 2P0AA 2JGJA 2JLRA 2W6JA 4XLTA 4HAVA 5DM0A 2OVBA 5I9MA 2WG0A 4IDGA 1GR1A 1DO8A 2CT8A 3D1LA 3PYMA 2QNBA 1VHLA 2CD9A 3R5SA 4BVFA 1YDWA 4WQMA 3R7FA 3WLJA 3KLNA 1MX5A 2Z30A 5F9MA 2NU9A 5FNVF 1DAPA 1ZD4A 2IU0A 3TZLA 1Q0PA 2XW6A 3EIHA 1N2OA 1S8FA 1X1AA 4C4YA 3LPAA 5J5AA 4C2AA 1YFLA 2VTVA 3EY9A 3W4IA 3ZHCA 2EKBA 2GRUA 4PZDA 2G88A 1Z29A 1GCUA 3O4VA 4XUEA 4W5NA 4AKSA 4YVFA 1VDZA 4WOKA 1HX7A 3BUSA 1WMAA 1QIHA 5HM6A 1UK6A 3MN1A 1Y89A 4BQSA 2XMDA 4OHBA 2FGKA 4RZQA 5EGNA 1T9BA 2HUNA 3U4MA 1SXGA 4XFJA 4EEXA 4OPMA 1TQ4A 3ZTWA 3ZR4B 5K03A 2DHRA 1N2BA 2GZ2A 3AVQA 4WN3A 3BJZA 3DD5A 4UEKA 2ZRIA 3AJEA 4TLMB 5D86A 5DKFA 4RELA 4POAA 4EO9A 1XTTA 2E4ZA 3NETA 2JGAA 3FDZB 4KPUB 4Q39A 4U5QA 5LZ5A 2XXBA 3L4JA 2AFHA 3U3JA 4LXYA 3ADBA 4UE2A 5A71A 4L4XA 3EGEA 2J07A 2X6RA 3AUJB 3ENNA 3OLCX 4AYTA 2VQDA 3O91A 2D5AA 2FQYA 2Z3ZA 1JU3A 2UYQA 4P4SA 3BFJA 5BXQC 4TL7A 1OKKA 2Q6LA 2BY4A 2FG7C 2OGZA 2QGZA 3AFHA 1EFRD 4GICA 4C2UA 1Z88A 3NC0C 5TEVA 1GQFA 2DERA 1XDGA 5LMUB 5LOVB 3MFYA 5DM60 1EP3B 1Z12A 4MROA 4CEIA 3KETA 5FRDA 3W5BA 1PWYE 1LJUA 2D59A 3K1AA 1J70A 4ZGGA 3DR5A 4B17A 4CM1A 2C8LA 2B99A 3FNFA 5F35A 3SXUA 3R7WB 4WBNA 4L3WA 1KO1A 1ZNXA 1I10A 3GEIA 4H3VA 4ZCMA 4MLDA 3WGMA 5A5FA 5MN4A 1Y6FA 5J43A 1ZSNA 3LC7O 2PKWA 4HDSB 4MAFA 1USIA 2BELA 3BHMA 1NI4A 1R74A 1W4AA 4LYAA 3QUQA 3HVIA 4JJ7A 3T8YA 1D2CA 3ZHYA 2RONA 3V4RA 2GD1O 2YIVX 3ROKA 4IIVA 3E3AA 3KPYA 2EFJA 2D06A 3JWPA 2W8ZA 4MSUA 3D6AA 3ECAA 4QUAA 3T4XA 4UE3S 3WYCA 1YQ9A 3PFKA 3KJNA 1Z6PA 2E6KA 1HQYE 2VCYA 3IE2A 4U6QA 3R7WA 2QX4A 4UHFA 3R8FA 1TC2A 4NS1A 5COBA 1DUSA 2CK3D 2WE8A 2J48A 1Z0IA 4Q5IA 2P27A 1O0BA 3I6MA 3SHVA 5JCXA 1WHTB 3M4XA 3NBXX 5C8DA 5JNWA 2X58A 2ZBFA 1YT5A 3VBCA 4BXOA 5GONB 1WO8A 2FWNA 1SHJA 4W5HA 4CEJB 2JFZA 2OZPA 4MYRA 2OOKA 3PD7A 4JX8A 5JALA 1P6UA 2BGIA 3IILA 3KZVA 4I6GA 4UEOA 3ZVRA 2XLCA 5M29A 1E2IA 4F4IA 3L1VA 3GP8A 2OYRA 5ADVA 2OP0A 2GXSA 2B78A 2B37A 3RBAA 5DNYB 1R18A 1CQJB 2ZTSA 3E2MA 3E18A 3EGXB 5AUQA 1KDYA 1DMSA 3EZLA 3SEFA 1FW6A 4WJLA 1PV1A 4R84A 1EBFA 3K6JA 5COAA 2FSGA 1W2GA 2B2CA 5E6RB 4RF2A 1X94A 1RE1A 1T6YA 1XKXA 1JQKA 2IQ5A 1ZRSA 2VIIA 4BY9E 2V45A 4S1WA 4B7UA 2J08A 4PG8A 5SY4A 2GT1A 1NUAA 5HF8A 4HAYA 2WA1A 3O1HB 1P1HA 3HCPA 2GK7A 3ZE6A 2RI1A 2A7XA 2VJCA 3NR2A 4WACA 4JC0A 3UK2A 1RCUA 1U28A 3EUWA 1T1EA 4AJHA 5JAMA 1TYZA 2DLNA 1JHVA 1RQNA 2GVNA 2HHAA 2UVDA 4ID9A 1QHEA 1YL6A 3QBEA 4I55B 5DYIA 1P4SA 3V7UA 4YPVA 3FGPA 5LLDA 1I7DA 4NI5A 5HIMA 3A31A 2P2ZA 2ZR8A 4H6XA 4R1LA 1MNQA 3KCQA 2GZHA 2PZ8A 4KFCA 2OGTA 5AJHA 5GAJA 2IV3A 3C3CA 4G65A 3B2QA 1VSQA 4IZ6A 3FVVA 1HEUA 1JAXA 1NXOA 1TPYA 3OZCA 4J3JA 2PD3A 3M4ZA 3R7SA 5L53A 3FOFC 4EG3A 4R1QA 3QLEA 4RPIA 2X0IA 2KSQA 1IU9A 3IBTA 4PE5B 4ZJUA 5D00A 3ZJ5A 2H1IA 2Z95A 1NRJB 2NZ8A 4M1MA 1BX3A 1HTWA 5SYAA 4XR9A 4YGXB 4YQFA 3QIVA 3M70A 2C1EA 1Z62A 2GBIA 5DSZA 4KHPB 1E62A 2CLEB 4KO2S 2RHDA 1KU0A 1QCZA 1DJMA 4CUZA 2YWDA 2IYWA 4Q1BA 3GJRA 3TQRA 1BHJA 521PA 4KYIB 3K5PA 3QFHA 4WL0A 5FOWA 3GY0A 4OKIA 4R2IA 4HVCA 3I37X 1VE5A 1VE3A 2H1FA 1B43A 3I72A 3QUAA 1CERA 3C3EA 1QTIA 2HNKA 1YZHA 1KVSA 2XX3A 4D25A 3BB3A 1LA2A 2GAFA 3WLSA 1ZIDA 5EIAA 1GPUA 1N5DA 2H92A 1UCFA 3AIIA 4GYWA 2ZIEA 3E61A 4KH0A 5BWLA 4Q9KA 5CYGA 1FS6A 4BMOB 3ORQA 2WU1A 5AM2A 2WBLC 1L4HA 3EWAA 3VKWA 2QTVA 2RJOA 3PRYA 2P90A 3KQQA 3SY8A 1IBSA 2FJ0A 3GFVA 3GN1A 3K09A 3K96A 2OC4A 3T34A 3F74A 1XTUA 1JE1A 1O5OA 3T3EA 4BCCA 1O7JA 3HKCA 1YOVA 3TZCA 3MTAA 1M1ZA 4UOQA 4BMZA 4FINA 4CMEA 4F72A 2QVLA 2LWIA 1BRMA 3S2IA 4B3IA 5JSFA 4HJRA 3WI7A 4ZT2A 2C4TA 1HTTA 1U2SA 1XCBA 1N9KA 1GKLA 1WXGA 4FOSA 4HB0A 2O06A 4O4HB 3OQIA 3NB0A 2M98A 4OGLA 2AZMA 2M1XA 4O4LB 1DRVA 2XUJA 1TEZA 1MOSA 4HYTA 1DC4A 2A9FA 5JOQA 3RVOA 4D81A 4JJEA 1X14A 4MOWA 4LXGA 1NBMA 3SZUA 2H11A 2WJPA 4R41A 4X41A 2VYVA 2O1EA 3WR5A 1SD1A 2AYXA 5B3LA 1FX1A 4BVEA 4I6JA 4R7ZA 1MG0A 3I39X 2GZSA 3PEUA 1DWUA 1LLDA 2H16A 2AG0A 4TMZA 1KO5A 4V3CA 5EC8A 4CV3A 3TLAA 1DKMA 1S1CA 3QQPA 1NNEA 4RLSA 2BEWB 2F1HA 3GMIA 2WOOA 1U7TA 3NKFA 3STVA 2GKSA 4BNFA 3ZLTA 4RW0A 2ID9A 3KSUA 3RKUA 4TS1A 4EKYA 2H2FA 5H0IA 5K0SA 1E69A 1G8PA 4DR5B 3JV7A 3O74A 4B40A 4GZ6A 1EWRA 4XYLA 3DVRX 1KPHA 1HDYA 1PTJC 1TNDA 1Y4DE 2I55A 3LIPA 3ZGOA 4A8TA 4M1KA 2Q29A 4BNKA 3E3MA 1V43A 4HN2A 1H94A 1UPTA 2PJDA 1M34A 1CUFA 2HSZA 3WRYC 1YBFA 3IUJA 4PZUA 2JLVA 2WR8A 3RC3A 2Z6UA 2PPVA 3F9RA 4XJVA 2H1HA 1WB4A 4KPGA 1PYGA 3KV3O 4BKRA 1B93A 4E4YA 3BGSA 4NR0A 4EPWA 1J09A 3TSOA 4BRZA 2C7PA 1ZICA 2WTNA 1J4AA 2RGGA 3QEMA 4QOEA 4YMTA 3O7WA 3I61A 2G72A 3KYDA 2YXEA 1Q7CA 1THTA 4RIEA 4M0UA 5EWLA 4C0KA 3PUZA 3RSHA 2RHGB 2Z1NA 3CHYA 1O8BA 2NUAB 1P4JA 1QKIA 1E1QD 1QHXA 1KZ1A 4Q4JA 5EHNA 1F9EA 2EZ4A 5AJYA 3FHCB 5TDHA 1LSSA 4QYIB 3HDGA 3LF2A 3LT5A 4ON9A 2P5TB 4M9CA 2BFDA 3HA2A 3HVHA 4MV5A 4O33A 2DM6A 2OCPA 3GD5A 5I7OA 3GVXA 4QODA 4WKBA 2SCUA 3NKLA 4I5FA 4JL6A 1D2AA 5KQLA 4PZ0A 5F9FA 3Q3HA 4G2TA 4XJXA 5EOVA 1ADFA 3EZYA 2GN2A 2N3ZA 3O7MA 1V5FA 2OQRA 1A5TA 3IXQA 4HMPA 4OMFG 1C7JA 5F1PA 2DBYA 3F1KA 1RBQA 3NT2A 2YOHA 3T7CA 1U04A 1N0VC 5G0TA 4WKOA 5JTUA 2AG5A 4EUFA 1R9MA 4N8EA 1DKLA 1KDVA 4D42A 1JXQA 4CG2A 1RXCA 4WVLA 2CLSA 1PDOA 2XHEA 3DO5A 5FXMA 3USCS 3VR4H 1YA6A 1O97C 3SQNA 1UBUS 5KQMA 5JNSA 1ULBA 4DBLE 4YP0A 3DZIA 1P45A 4WAUA 3KZXA 4QYTA 1NHGA 3R8XA 6Q21A 3EG9B 1XMPA 1EUDA 2I2BA 1MU0A 2Q3LA 3LPMA 4C05A 5SYMA 3BRCA 4Z1MA 1NLMA 3ZWOA 5DM1A 1M76A 2I78A 4MS1B 4R1OA 1N6LA 4ZU3A 2TECE 2QM8A 3IUBA 4NBSA 4DIFA 2O5EA 1V11B 1XLTA 5AKYA 2XMBA 4FHZA 2C88A 3LT2A 2WYHA 4FJ2A 4ZQIA 4LSWA 3ZZMA 5DMXA 2PT7A 4M87A 2VPZA 1FLAA 3PEWA 3UHJA 1M6VA 1YZUA 5EQTA 3HQ4O 4MEAA 1YZVA 2XUAA 1R4MB 1TGYA 4OQPA 4ZZ2A 5B30A 1PV2A 4ZI7F 5D6NA 4O4IB 4NHEA 5KPJA 1Y7IA 4JGBA 1H9AA 5IBPA 3FWNA 4WDQA 3Q8KA 2RC5A 3EIOA 1HOXA 1RHMA 2B2XA 1ZI8A 4G24A 4QPJC 5C8YF 1N8SA 2NADA 2WNIA 4ZVSA 3WIEA 1BXGA 4CIYA 3VR6H 4JODA 1X0XA 3BA6A 3EBLA 3Q6NA 3S40A 2VT6A 3DDOA 1AF4A 3PRJA 4X92A 5EPEA 5A06A 2IHUA 1XRMA 3IODA 5A4IS 1PJCA 3UK7A 4BRUA 4A4DA 4DB2A 4YUXA 2VYQA 4II7A 1L6RA 1VIDA 5ECWA 3RWOA 3BE5A 1P5ZB 3FSGA 4ENVA 3EWIA 1U7XA 4QPCA 4UVDA 1ULHA 3KUCA 2I2CA 1XRJA 3PXUA 1CCWA 1UFOA 2ZU6A 3QJYA 3EBPA 3AU8A 4ZWNA 3SJZA 1TMOA 5BRAA 1L8QA 1FFWA 2I3AA 5IN4A 4OU4A 4QKQA 4RUKA 3NEJA 1SEPA 1WUYA 3K2IA 4GI5A 2LD4A 2ZJ7A 3ANLA 4OFXA 2B7BA 1VGQA 2I66A 3I2GA 3KKOA 3N58A 3H3JA 1ES9A 1T4DA 2JDID 4B6OA 3GNTA 1Z4MA 3ISJA 2BKAA 4WNYA 3S3TA 3IO3A 3QY9A 4ZC8A 1E1KA 1G0OA 3HR7A 4KRGA 5AVYA 1WCXA 3DKVA 4KUEA 1QFXA 1X13A 2V7PA 1XAGA 2NVUA 2J7KA 5E9AA 1OA0A 1DB3A 4NCJA 3RHZA 4Y1EA 1Y5NA 2OUKA 3IIKA 3W5VA 2GFHA 2A92A 5F7ZA 1FDVA 2QE7A 2Q50A 4L0QA 3HA3A 3L8MA 2H07A 2ZWPA 5LMZA 1I51A 2X7JA 1F2UB 4I4TB 4U8GA 1XBTA 3LUAA 4LI3X 4PYRA 1CNMA 1NOKA 2SNIE 4Y67A 4ZAFA 3ZWVA 5FFFA 1WSBA 3ZVMA 1A9ZA 3DT8A 4BFTA 1V16B 2WSSD 4FLFA 2WWWA 4Q03A 5BSUA 4RANA 3B1WA 3DE7X 2OXTA 3RC2A 3SKVA 4U7HA 3LZ6A 5J3JA 1Z0JA 2VYNA 4O2RA 4RQAA 3ETHA 3MXTA 1XNRB 1R6AA 1BVUA 1YJCA 2XZLA 3AF0A 3LYHA 4TT8A 2EQBA 2CVQA 3C0KA 3H8JA 3VBEA 3OE1A 5IZCA 2OV8A 3U5ZB 2ZLBA 4JK3A 4KC0A 3ELYA 5FO1A 1Z45A 4MVJG 1E2NA 2V6GA 5HRCA 2C9CA 1HEIA 3B9QA 3ZZNA 3U40A 3KOWA 3K73O 5BURA 1MRSA 1SBIA 5JFTA 2A5GA 5AVVA 3EFOB 4HPWA 3TXYA 2XIQA 3UBTA 1MFPA 5JMPA 5G1PA 5JXHA 1YIOA 4HX2A 4U6NA 4CXMA 2BGTA 1PWZA 2CDRA 1AJEA 3KYCB 1CIPA 2BZ0A 4LQCA 3CX4A 3S68A 1YB2A 1JTVA 2EWMA 2LRHA 1KR2A 1RABA 4O4JF 5K51A 3TSAA 4GPZA 3LE8A 3D3NA 3I28A 4V0LA 1E0SA 3UWKA 3SFVA 1ZZGA 1JB9A 3DUFA 4RGYA 4GOLD 4OJTA 1RFLA 3ASVA 1NN5A 3LHSA 4JJAA 5FADA 2QZ9A 4NICA 2ES4A 3CO5A 2WJVA 3HUEA 2BMVA 1CQZA 4RDCA 4YCDA 4B31A 4Y9TA 4F4UA 1XDUA 3HYRA 2E37A 2UVPA 4GPEA 3SFZA 4GDMA 4CTOA 4KG7A 5T4BA 3RYFB 2QN6A 2AZXA 4U9HS 1TO1E 1U7HA 4IIHA 3ZJYA 4YHHB 4CG1A 2L69A 1UADA 1FDSA 1UR5A 3MRTA 4KSBA 5HTKA 1CG6A 3CMMA 1N57A 1N7GA 3BH6A 3QFCA 1U5CA 4IUCS 5E2AA 3Q0EA 3DHYA 4IOKA 3ND7A 1O97D 1LRLA 4S1NA 4CF7A 1GNPA 3W2IA 3W5DA 3B3QA 3LP6A 1WTCA 1IBLB 1QRTA 3KR2A 1NC1A 5K01A 3JQ9C 3DMPA 5CT8A 1E96A 4L50A 2ZCUA 4P3NA 2FKAA 3BIXA 5CB8A 4BDSA 1M5RA 4B6RA 2FETA 2GAJA 2O52A 2PXHA 5DGHA 1YVPA 4RAQA 1N0UA 2Y1OA 4QTYA 1E20A 2AOXA 3DNPA 1UMBA 1OI7A 1QQ7A 2JIPA 4NK5A 1Q11A 3VTKA 2WI8A 5BT9A 4LFBB 1VSUA 3OPQA 4G23A 3LAWA 2OXEA 3IPXA 2BFMA 3HUDA 3U4QB 1R0LA 4BQRA 1OBCA 5J47A 2QP9X 4RZSA 5IJZA 1RXYA 3F8WA 4JBGA 3JWIA 1D07A 4J6EA 4BN4A 5AJZA 1P0CA 1GXSB 3QV2A 2UUBB 4GXNA 3U7JA 4IH1A 4TVKA 3TD6A 1KDTA 4I8DA 5K8IA 3HNRA 4FYVA 1NVKA 4IHAA 1PJLA 2C4UA 2QAGA 3VGPA 4ZDWA 2E49A 1Y42X 4JU9A 3VO8A 2VQEB 2HT1A 1Q20A 3WIVA 4NBLA 1GIAA 1ECBA 1M1NB 5GOZA 4BGUA 3PVCA 5EIOA 3BD6A 4UQPA 2YN2A 1FNBA 5CLFA 4Z9XA 2ZEJA 2PNFA 2CJFA 1AG9A 1OHHA 4WCDA 2Q2OA 4LA4A 2R96A 5ALVA 3EUEA 5HDQA 5EJ4A 2FQWA 1XXHB 1K3FA 3HVRA 3MRVA 2OBLA 1LRJA 4NE9A 2WWGA 1QGYA 2X9LA 1VL8A 3OUUA 3VR4A 4IX1A 3ZV3A 2EJTA 2FEAA 1HR0B 2IXAA 4YRRA 1RZRA 1N32B 4EB3A 1FL9A 1BXKA 1DRUA 2JNWA 3ENVA 2WZBA 2BGLA 3D3WA 3UPDA 2XUFA 3TO5A 2R7MA 3BMCB 1KETA 3FCEA 1HL7A 4WRRA 2R5WA 1JAZA 3DWEX 4L72A 3W2FA 3GEPA 5ICEA 2CXUA 1W6RA 4CQMD 4DDVA 2GRJA 2XNCA 5CDFE 5DZSA 5L3SA 4QVKA 4REQA 5AI8A 1NX9A 5HBGA 1QVAA 3AR4A 2WSBA 1CUGA 1GNSA 3I05A 1NUSA 4RAOA 1L7EA 4JXXA 1RBYA 3GARA 5JFGA 2IDJA 4GWLA 5HQJA 2QENA 3A1NA 4KRFA 3EJ6A 1ZH0A 3BXGA 1GOTA 3QJ5A 3TOCA 5KBYA 3A1EA 1C8BA 1Z26A 5D1HA 1L5NA 1P2DA 3DTYA 2J6BA 2DG2A 1ZY2A 2H3EA 3C3AA 3EGWA 4KLRA 4P4SB 1PS9A 2P79A 4N49A 2IUFA 4G8JA 3CSDA 4XYEA 1WV0A 1MVNA 1ONNA 1UZLA 1SD2A 1WRBA 2RKOA 1EHIA 3P9ZA 3H2YA 1ESDA 2PCLA 1YBHA 2W58A 4MUNA 3REFA 3ZIUA 4YA6A 2W4IA 3VR6A 1Y1QA 4JB3A 7AT1A 5AUPB 3VPFA 4AG5A 4F5YA 4LC9A 4ZODA 3KAJA 1MO6A 2A9RA 1FY2A 2YHUA 3K1AB 1N3YA 2LNDA 3DVSX 1QIJA 4P4TA 4LPSA 1BDMA 3KQTA 4WBNB 1C4XA 1LFAA 1RADA 1VL1A 3EFHA 2TMDA 2FSSA 2JLSA 2XTJA 4AO6A 5LQCA 5HKLA 3I9JA 3RBVA 2G1PA 1VRWA 1O6GA 1F5SA 3K0FA 1P18A 3BBLA 4NZ9A 3ITDA 2YWJA 2OMEA 2WDPA 3O84A 4Y6GB 4WOBA 4AQ7A 2QBYA 4YDSA 4I2VA 2FEKA 5FUVA 1NI4B 2Q5CA 3CZQA 3RTDA 4Q37A 3RBZA 1DARA 3ZDFA 3PP8A 1W4CA 3EK2A 4TYNA 1T2NA 2IX9A 4M8KA 5T4FA 1GG8A 4JYCA 3LX6A 1T5HX 2BFPA 4WZBE 4LMAA 5E9QA 3VOAA 1NSYA 2FEPA 3N8GA 3WLIA 2VTEA 4FYHA 4HF7A 4ZVTA 3BWVA 4HS4A 4GC9A 4PFKA 3R75A 1HZZC 4FFBB 4KV9A 3ZHOA 1Z5VA 1JA9A 3QYFA 1P9WA 1OIVA 4AROA 1ZOLA 1R10A 2W2MA 4L5JA 4GKJB 3SCZA 4QG7A 2ONYA 2GN8A 4KO8A 1IK6A 1RZUA 2Q6KA 3D2LA 5E3IA 5GZ6A 4DLZA 4DSTA 5JJCA 2P2SA 1ESEA 2XUDA 1I7PA 1LSUA 2FQ1A 4TWIA 4C7JA 4FZ5A 4U2GA 3W7BA 1VPVA 5KNLA 4OHRA 2Q45A 3W5CA 1BHQ1 1L7PA 2JHGA 3OT4A 5BRNA 4TKVB 3M83A 1E5TA 2YMQA 2MYUA 5K4AA 3PA8A 1OTYA 4BFYA 3N7TA 4LHXA 3WADA 2C3OA 4AD8A 2GRAA 4J1NA 4BP8A 3WLAA 5LP6F 2D1FA 1F20A 3ESQA 4O6VA 1MW8X 3UT5B 3WMXA 1XMXA 3B1YA 2WRZA 3ED5A 3GUVA 3MUOA 4XSVA 4N8DA 4UXHA 4C2TA 2DFKB 5FPHA 4FWTA 1ISSA 3UTCA 1NQ5A 1PZHA 3VVBA 4DIBA 4E30A 3U81A 3QXHA 1Q95A 1C3XA 2PBZA 2X4GA 2FOIA 3T3HA 1WVIA 2YBEA 1K8QA 1Y82A 3D7MA 5AKZA 3SM9A 3TOXA 2ZUSA 2GJ4A 2SKEA 3GMSA 4MXDA 3VO1A 1AX9A 4C76A 4CN9A 2J3MA 3DDCA 3II6X 1NQWA 2HCJB 3OCUA 3A6JA 1FYEA 2HJHA 4IVNA 2VHUA 4XSHA 3UICA 2I0FA 2ZAGA 3P9QA 1SG0A 1JG3A 1JHOA 1VLQA 4XFKA 4BP1A 3Q8LA 5KMGB 1G9SA 1K2VN 1HE5A 2P9HA 1ZR4A 2XTMA 1R0BA 3C41J 4IJ5A 2ECFA 1W8DA 4WERA 1CZUA 3A37A 3UATA 1BGVA 2CFSA 3GN2A 4LJYA 5B53A 4JKOA 5T6MA 1PVDA 1RS0A 2QX8A 1JVSA 4LF6B 4AY2A 1ZIXA 1JFSA 2EBFX 4F3TA 3A9VA 3I6QA 4PG4A 3NJ4A 4E21A 4QDOA 1VJ5A 3BGWA 3E81A 2FPIA 3IURA 4YJ3F 3QWFA 3GLFB 2WOJA 3NBQA 2XHZA 2I76A 3EBOA 3C45A 4R2XA 5JDCC 2J0SA 4W5TA 1B14A 3RV4A 2YRFA 4OYHA 1YZNA 4YAGA 4N48A 1E60A 4HDAA 4J0FA 4HRXA 3E4DA 5G2OA 4Z2YA 1GDHA 4ZREA 2IVFA 4PYIA 1IZ9A 4C5BA 5B12A 4MPPA 1XVTA 3H5OA 2VT2A 3QM1A 4IVQA 1UEXC 4ZHQB 1FFXB 1DIBA 2XD9A 2A1UB 2VHXA 5E7QA 4JQCA 1WETA 3FN4A 2EIXA 2FWBA 3KTOA 4EMSA 4DEVA 2POCA 3JQQA 3EPPA 3DOIA 4WK6A 4E14A 2R1TB 4QUJA 4GOMD 1YVUA 4JUDX 3PNSA 2FPGA 1M5UA 2NZUG 4G84A 1YR3A 2O05A 3LCCA 1G18A 4YAWA 1KH1A 1HKHA 3PPWA 5G0SA 1FK8A 2IXFA 2PA0A 2RGAA 3V1YA 4RY0A 3GLKA 1I4EB 2Y9PB 1ZUNB 1R64A 2YR0A 3ROMA 3BTSA 3UOAB 2QX7A 4Q3NA 4B83A 1QIDA 2JLWA 2J9XB 4PWZA 3L1IA 2PZLA 5E7IA 2QMYA 3DBHA 3RC7A 2PFSA 4H7FA 1VCHA 2W0SA 3OQIB 4LWQA 3D8HA 3OEEA 1CNEA 3ES9A 2H0RA 2HGZA 5CXUA 1QCDA 2W70A 3MB8A 3VZDA 3E70C 3FNRA 5H3LA 5HE8A 3UENA 4UBNA 1E66A 3BRWA 4UCXA 13PKA 2DECA 4Q82A 4ZYTA 3UFXB 1GCOA 4ENUA 1KFBB 1Z2EA 2R8RA 2YS7A 4FBMA 4IV8A 4AL4A 3DW3X 4HDRB 1NPTO 4FZ3A 4DG8A 2JGIA 4EB8A 1J7JA 1O77A 2RCYA 4WY8A 3P4XA 1EE1A 1TZBA 1V5GA 2Q8QA 1O6CA 1OLXB 2IEIA 4TTVA 4DNFA 3AVVA 3CKMA 1V25A 3WRXC 1NSFA 4LF9B 2UYOA 2OECA 2WHPA 1RAHA 4KQ9A 3BFPA 3E8XA 5DNVA 3G7UA 4TV8B 5IP5A 3CW2A 4QGGA 3CRNA 1TECE 2YMMA 1B8NA 4UNIA 5JAOA 2EKDA 2DUJA 1Q15A 3GROA 5DB4A 3KQKA 2O0KA 3F90A 2YWXA 4CT4B 2ZBPA 5INTA 2P9JA 4LJKA 1W47A 3NEYA 5IMBA 3D0RA 1J2JA 1VPTA 4GMGA 4ZRNA 2UXDB 1B2LA 2R6CA 2W43A 3SZGA 2HZ7A 2PJUA 2JFNA 3EOZA 3N3AC 3QFFA 5ELXA 1NVVQ 2XOEA 1BA2A 3W5JA 1M34B 3L5KA 1R4NA 4GH5A 3VPXA 3D5TA 3P26A 3QVMA 4QT4A 3TZKA 3HACA 4OHYA 1EINA 3FYTA 4MUFA 2N46A 1Q7TA 1AB5A 2PUJA 3FLEA 4QREA 4GLLA 4P4NA 4C08A 3VNUA 1A0OA 1MJ5A 4UU7A 3F7MA 4AP5A 5BOSB 4QGFA 4UW9A 1FP4A 3E27A 3EQ8A 4JASB 4YMIA 2BBTA 2NQTA 2CFOA 2PMKA 2PXXA 3PJDA 2P0YA 5AP9A 2V8OA 2BT4A 3CF2A 4M21A 5JZOA 2V0GA 4RSRA 1PR1A 1T15A 1AQIA 3KYDB 4M38A 3ZVKA 1G6Q1 1JR4A 3QH4A 1MTOA 4K86A 4RMJA 1CUCA 2A0KA 2EF0A 3EVBA 6ABPA 3J81A 3HXQA 4KB5A 1BSVA 2XXAA 5DCWA 3BM5A 1JEEA 1SN7A 2XKAA 5AVJA 1RE0A 2AQIA 1T4GA 1R12A 3FRHA 4G0ZA 4MW0A 4WNCA 1DO0A 1FJGB 3DGFC 4L2IA 3DLAA 4BFZA 2YV2A 4AP9A 2DPHA 1GRQA 5K6AC 2QKYA 3TNFA 3EXIA 3QENA 3UYLA 2P30A 2V4UA 3DT9A 3WIBA 1EP1B 1G16A 4IKOA 3K30A 1OZHA 5E38A 3ANNA 3CF4G 4DILA 4B3RB 4BLPA 2FDXA 2X7XA 5HVNA 1ZK3A 1OXXK 2VDJA 3E58A 3JD1A 2ZSFA 1NQTA 1JUDA 3P96A 3VU9B 3ZDRA 1A3CA 4DMHA 4EJ6A 3MG9A 4EO4A 1Z6QA 4F8EA 4IVRA 4D43A 4U7FA 4D80A 4UUOA 2E3JA 3QWBA 1CB7A 3DKRA 3R3SA 4GOOD 2WKWA 2JA1A 5KI6A 5ED4A 3KVRA 3BWXA 821PA 1OQAA 3UC5A 1IY2A 1CIJA 3WJ2A 1YF3A 2CEAA 1D6JA 2Q0QA 4RQBA 5CG2A 1EUDB 4LYHA 1PSDA 4AUNA 3W9YA 1SU6A 3I3SR 3OIFA 2P6NA 5G4KB 4BWFB 4Y9UA 1ILEA 3SR0A 3SJ7A 2WF6A 3EPKA 1ZMBA 2J4FA 5JG7A 4D4MA 2BF4A 3LP5A 4LRQA 2WUEA 2ZXFA 1U8XX 3IP9A 3FFXA 2AKAB 4HDNB 4EGCB 3TTYA 4E07A 4OA8A 2OOSA 3EXAA 1KEUA 1P1CA 1V6SA 3H1BA 3EXFA 1EDDA 4DAOA 1WVMA 4Y0NA 4KVGA 5BQ3A 1QGZA 3SF8A 2AJTA 2EG9A 4DA0A 4Y2GA 2Q21A 1QDLB 3HO8A 1ODFA 4KIWA 5JMWA 2ZCJA 1OFIA 4P3KA 1XYGA 1L3IA 1ORIA 4NDNE 3QPCA 4PV7A 2OESA 4UUNA 5HCIA 4DA7A 4YRCA 3OICA 4H3SA 4EY8A 1KFCB 5BNTA 3H42B 1TK9A 2O8CA 1WZEA 5A1JA 3NFYA 1U2EA 4XWYA 1XEWX 4XWTA 3K6RA 4F84A 4KO4S 4RTLA 2PIDA 1FVFA 3H5RA 5WRFA 3L6DA 2IE0A 4FE4A 4YIHA 1P0MA 3E2IA 2YC4C 5IT9A 3GB9A 1BHSA 3A1CA 1K88A 2W71A 4G5HA 1UPAA 1VL0A 2EJVA 3ABRB 4ZGWA 5KYUB 1G64A 1MX3A 2YJZA 4G67A 1GP2A 1A82A 1HKUA 4GXRA 3VR3A 4QPPA 1VMDA 3HRKA 1OMOA 2O8NA 3GFRA 1CZNA 4RPHA 4EEZA 2AK3A 3NKVA 2OO5A 2HMTA 2X9GA 1F14A 3T3PB 4JGGA 2POQX 2VDQB 3CLTC 3D7SA 1YR7A 3A14A 4FMDF 5AUNB 3UMMA 1Y3IA 3H6HA 3VV3A 1SZJG 4R0NA 2B5WA 2PO7A 1P2TA 2I62A 5F12A 1BMDA 1HZJA 1VG0B 1M6YA 3SFTA 2WHQA 4R51A 4JYPA 5LXTA 3TRIA 3WYBA 3B8EA 5DJ5A 5K0CA 2HV9A 2ZE8A 1Z0SA 1U98A 2PT5A 4O5AA 3HR8A 3ZV6A 3MS2A 5IK2A 1OGYA 1T2CA 1Q22A 4GLFA 1M10A 2Q46A 3FMGA 4RQUA 4I3HA 4BYGA 2E6UX 1M6EX 2BRUC 1EIZA 3IOBA 3MMPA 4V02A 2A5JA 2G83A 3I01A 3OQVA 4RPGA 1GU7A 3E7FA 5TGDA 2AVDA 3U37A 4RC9A 2Z58A 5BSGA 4X8HA 3KEGA 1OFVA 4JMLA 3QX9A 2W6OA 3MC1A 1AQJA 4D98A 5IABA 1OIWA 5K0LA 3TZEA 2XBLA 2HMSA 1E1YA 1ZVJA 3S28A 4G0UA 5FTNA 2VYFA 5JS2A 3V4ZA 1IN5A 4YXFA 2EGHA 3LQ4A 4M46A 1SXIA 2XDAA 1NT4A 3NVAA 4ZDJA 1AZSC 5ENVA 2GB4A 1IN4A 4ZALA 3PQFA 3V1MA 4DKJA 2AEEA 1SH7A 2AMYA 2YWGA 4XYMA 4DARA 5EMKA 1WUHS 2OCDA 3DOHA 4IJUA 4LIPD 3R4VA 4M6WB 4DCCA 3BE8A 1J2TA 4GS5A 4XQEA 1QV7A 5A2GA 4OSEA 5FOSA 3AHDA 3F6PA 2XE6A 1RAFA 1CQXA 2B4TO 1XTQA 3GO4A 4DSAA 3IPRA 3VPHA 4Z0NA 4X63A 5FOTA 1MOZA 5EVJA 1MHTA 2ZRAA 1VCNA 3RUFA 3BVPA 3O21A 2ZJ2A 1XQXA 2YHAA 4QRHA 3KSDO 4KMSA 4W82A 4Q7EA 3KX2A 5E1MA 5DNUA 5I4KA 1IY8A 1I1HA 4ASUD 5ADWA 3DUFB 2YDXA 4HGQA 4WSOA 3FYHA 4KDCA 3FCSB 2JGDA 1SFRA 3F2VA 3WDKA 3RIHA 5CDHA 1YAJA 4J9UE 4E32A 1B2RA 4EY3A 1CDZA 4OI0A 2W2PA 1TJ3A 2UVPB 3D4IA 1S7GA 1UJ4A 5EJ9A 2O0JA 2QT9A 2HA2A 2AFVA 2VKTA 3G0CA 3R6DA 4QL3A 4AP6A 3S8EA 2BFFA 1QRAA 1VE9A 2E55A 3AEXA 5KTPA 1QORA 2IOQA 2FPUA 3OBIA 1IBMB 4HBZA 2PZKA 3CT6A 1C1DA 5DHUA 5KQPA 2Y05A 4UM9D 3I0ZA 4GXTA 1NRXA 2QTRA 1RLIA 3I52A 3CXUA 1YTLA 2EJWA 4HYQA 1ZWKA 4XB2A 4JN6B 4LXXA 3CN9A 3BXOA 3FYDA 2I1VB 4YDQA 2B2NA 3I5UA 3QE3A 1J8YF 1U7OA 3U48A 5HSGA 5JVDA 5IHXA 3DTVD 2IPOA 3CPEA 3DO8A 3H75A 4NYMQ 4PG6A 2CKMA 3NYQA 4XFDA 4DBVO 1JJBA 1E2FA 1G19A 3MYRA 4C21A 5TY0A 5C2JB 1SMKA 1OXBB 1IWPB 1UKAA 1PF7E 1N75A 4UVGA 4AJOA 4EGJA 3RK0A 1G7CA 1GVHA 3RSFA 2WWHA 4GMHA 4F6RA 5IEBA 4HMOA 3H5TA 1OYVA 1TW3A 1RWXA 4N9QA 4OHPA 4H0CA 1K8RA 2BMFA 4D56A 1XD2A 3KAQA 5E3JA 1UANA 1CYDA 2ZRKA 4W6QA 5U4XA 4BV9A 4BO5A 4BVHA 5LL6P 5MGBA 2B7CA 2AS0A 2OKGA 3FDXA 2SICE 3UPTA 1KZYC 1M2KA 2FB9A 3QFTA 1Y8QA 1N6PA 1YB6A 1Z22A 5CK4A 3MA0A 3GZNA 5CTAA 4KE8A 5HJEA 3TTUA 2R7AA 4GQIA 4IIBA 1U1CA 2V6MA 2VXYA 4C6TB 3OZVA 4L5BA 1TIPA 2QAGB 3VI4B 4O2BF 1M0SA 5FX2A 2BFOA 5DCYA 3A3PA 4MRMA 2NZVG 2YRXA 4MV9A 3SVZA 3Q9SA 1HPLA 2RE8A 1PSZA 1YD7A 2PH1A 2WTMA 3QMWA 3TNJA 3H7AA 3G0HA 5ETJA 3DCIA 5K4GA 3TBKA 4DBLC 3CZ4A 2IHTA 3EMVA 5F3RA 1XTJA 1PFYA 1NBME 1QLHA 1AUPA 4R1PA 4X6YA 4KV7A 3NRCA 7MHTA 3GJ0A 4R6XA 3IUEA 2CBZA 1KAOA 3UHFA 2F1IA 3VTFA 1NF3A 4HI0E 3UT0A 5JJBA 3CLTD 3BN3A 1PX2A 1Y9DA 3C4QA 1JSLA 1K0FA 2NVOA 3V4PB 2JPDA 3B6EA 4CGZA 5JISA 3WNZA 2A1TS 3I5AA 1FLDA 4HFMA 4TROA 4Q9HA 5DYYA 3TR5A 4A8JC 3L84A 1V6CA 4IMIB 1F3OA 4J4TA 4REQB 2QNRA 4NNJA 3SOPA 5G0VA 3FNEA 2PL9A 3IQFA 4QRDA 5ICGA 1TF7A 1CQWA 1A71A 3MB5A 4BNLA 3MRXA 1A98A 2I7CA 2O6LA 5D3QA 1DEOA 2FZWA 1FDRA 1QQ5A 4OM7A 3T3MB 4CIVA 1PJ4A 1B00A 1T0HB 1U7UA 2O3SA 1CIVA 4EL5A 4MA0A 5JR3A 2JK1A 5DTJA 3RC9A 2Y1FA 4FYIA 1PFUA 4RV5A 4CLEA 1N5MA 2MCFA 4ESEA 4ACBA 4Z6KA 4GQAA 1I9CA 3AMVA 3MBIA 1N2ZA 3OI7A 1AS3A 4HNHA 4OGGA 4D57A 4E5YA 1J1UA 1QO7A 4MQUA 1DCTA 3OOSA 3OO1A 3R40A 3OETA 3IBGA 3H4MA 4OQNA 4JNKA 1K7FB 1T9HA 1TU4A 3OT1A 2QQEA 4OJYA 3TQFA 1J07A 1FVXA 1H4TA 2BF7A 2C3MA 4K03A 2JFYA 2WG2A 3FCYA 3SR3A 3WRWA 3BKWA 2BH2A 2R66A 3U44A 1F7UA 4UHHA 3CW8X 2CE7A 3RVQA 3CUWA 4ZCRA 3GFOA 4CCAA 1QYCA 3KLMX 5IYZB 5IANA 2I29A 3AHFA 4WA8A 3T4UA 2GEJA 3H4TA 2QBYB 3SXPA 3CEAA 3HCWA 1G8YA 3FI9A 4G81A 1FRVA 1RWOA 4PAGA 4Z3OA 1K97A 4ROTA 2IYPA 4GPAA 5DTEA 1VBMA 5F4ZA 4YRMA 1TCCA 1XPJA 4JY7A 1KGSA 2DFPA 3OX1A 2IW1A 1EJ0A 1U0OC 2Y4NA 3DXXA 4UBKA 1N7IA 1ORHA 2Q28A 3PC2A 4CV2A 1GG9A 4F97A 5ICSA 3PTAA 5BMVB 2Q3CA 3JX9A 4X20B 5HMLA 3E03A 4DYVA 1CJUC 3FKJA 1NF2A 2O14A 1RBMA 3IALA 4CV1A 3UMVA 3CKKA 3IDAA 2YTZA 4B33A 1LSOA 2FMFA 1SULA 1Z8FA 4MW7A 3F9CA 2REQB 5KOIA 5AVSA 1VMKA 1BO6A 1YMQA 2Q41A 3M1IA 4B44A 1X87A 4W5WA 4C30A 4ZDKA 3LDUA 2GN9A 2VQ6A 4KWTA 1XHLA 2PUHA 2XMRA 4LPKA 1RPZA 1JI0A 2YDYA 3L92A 4BO6A 1MMFB 5AKJA 3SGLA 5EHIA 1DQNA 4NC9A 1T36B 1QKKA 3GYBA 1GSHA 5C8YB 5FUWA 3KIPA 3PT5A 3CONA 1AHPA 4C1BA 4Y1RB 3IUNA 1HI9A 1NNI1 3ZEIA 5KHOC 4GZLA 1T0IA 2B94A 1DQZA 2P9EA 4KXWA 1N6IA 3R0XA 2JLYA 3EEIA 4MS3B 1X7WA 3OJ0A 4WDRA 4FZJA 1GR0A 4RLFA 1JI3A 2QTAA 3ZJVA 1RW4A 3EDRA 1B0ZA 1H0SA 4ZICA 1PZNA 2O2HA 2H48A 1J97A 3IV7A 4N0QA 1SOVA 3O0DA 1E3QA 1GWNA 3WQRA 4PEVA 3VJLA 2R68A 1PFVA 3UPUA 2VZ8A 4O8ZA 4AF6A 5IBCA 1LI4A 3O2SB 1U65A 1L5MA 1VL6A 2D2FA 2IL1A 3EGOA 5HDBB 4EYGA 4G41A 5BORA 1G41A 1TAHA 3GQVA 1ZDMA 2I2XB 3G8DA 3O8OA 3UMSA 4YAIA 1AOXA 4UVEA 3V33A 1J0DA 3FPKA 3LC0A 1E3JA 1VI6A 4LDAA 4MWCA 3WP1B 1QMPA 4BNVA 3WKAA 1JXOA 4U39A 5DBEX 1RRCA 4IZIA 4GX0A 5F7XA 3HSSA 5A6SA 1DEXA 1JBKA 3HWRA 3Q12A 3CZPA 5KVCA 2FSFA 3HBAA 4LK2A 5EJEA 4MYUA 1YR8A 1E6LA 4KYUA 5HG0A 2P78A 1I2DA 2R6JA 3WL8A 5LB4A 5HGJA 3U39A 3ADPA 1ZN9A 2YVLA 1YRQA 4BNGA 1G5QA 4R6WA 2CEKA 2DBRA 3KOUA 4G4JA 4RVNA 1HE3A 4EW3A 1OLSA 1R0XA 4EAQA 3FOBA 4QA9A 1BX1A 3EYAA 3EC1A 4XD7A 4IQFA 3MTGA 1G6HA 5KSPA 2AOTB 2XE4A 1F5NA 5C1PA 4JSYA 4DV3B 1NVXQ 3FCUB 1SC9A 1UOQA 5DGIA 3PUWA 3HY4A 3W3AD 3ZCUA 3HS3A 4UUMA 5FOVA 1RXSA 3AKZA 4J76A 2P5UA 4MQFA 5ECYA 5CXXA 1RXVA 3WSTA 3O4IA 4PLWA 4N01A 4NV3A 2E4AA 2JEYA 3HCAA 1BFUA 4ME6A 1JEQA 4ZN6A 2AR0A 1STOA 2FPGB 2ACWA 2PAFA 3HUFA 1ZH6A 4QTUB 2PLAA 1QF7A 2JEOA 3BH7A 3DCYA 1BRTA 3DEHA 3H8WA 3PSAA 4RXTA 4NPHA 1E9SA 5E4TA 1TA9A 3E53A 3KXKA 4OEHA 3EGCA 1EGHA 4RFSA 2EDAA 4WK2B 3D4PA 3EEQA 3EZNA 3PX3A 1OTHA 1Z5GA 3NBZC 4JLBA 4ONEA 3QFSA 2H1SA 4O4JB 5E0KB 5TQ0A 3R7DA 3SIWA 2ZI5A 3OQOA 3LKBA 1OXKB 4IO1A 1LTKA 1O58A 2XA2A 2AR9A 2VSOA 1Z3CA 4K1LA 4C3UA 2PX3A 4BLSA 2QUIA 2LW7A 2WU3A 3DBHB 3HN7A 4LZLA 1HETA 2JFHA 4N76A 2F9FA 3DB1A 2DT8A 4FW8A 5HKKA 1UJBA 3SYKA 1YZGA 4C20A 1EP9A 4LTDA 1LBQA 1OROA 3BIFA 3FPAA 2PBFA 3P2OA 3AR6A 5DBGA 4RJIA 5L4NA 4PW0A 1XQ1A 2J0EA 3LQRA 1PZMA 4I08A 5HIJA 5AK5A 1R00A 2LBPA 2OCIA 3UKJA 1ODTC 1VRVA 2AQKA 1IXSB 3NONA 3W4KA 2BV3A 1R1DA 1ZESA 1WLSA 1GKYA 2DWQA 4FJ0A 4CFYA 1N8KA 2PGDA 1BAPA 2B98A 3CNHA 3LY9A 3WYAA 1LDGA 4F5DA 3NHAA 3SDZA 4N5NA 1QYRA 1XHFA 4FX2A 4NBUA 4CQLA 5JROA 5FWYA 1ETHA 4N5DA 5JAQA 3WL6A 3KALA 4NMXB 2XUKA 4Y2TA 4ZAYA 1J7KA 3ZPXA 2FOLA 4XW2A 4EARA 5E3HA 4Z5XA 4X54A 4LBZA 2BFCB 4KQ1A 4D0RA 3SZ3A 1CUUA 1T3GA 4D6XA 5D1NA 1XQ9A 3MGGA 3TUZC 5K1ZA 4CTJA 4I9GA 2G5CA 4QQRA 2OGWA 3CEPB 3FFTA 4UUQA 3ZV4A 2GARA 2V5AA 2ZKIA 4RX1A 1WSAA 3GELA 4XX0A 4JJ8A 2PEZA 5EIFA 4BN5A 4K6OA 4CM4B 4I5GA 2N75A 1CZHA 3DAHA 4DBZA 3LSYA 1ZIPA 2FFJA 1KI1A 3C5VA 2GYYA 1U3FA 4NCHA 1BDIA 4HZUA 2VWHA 3L8ZA 2E5WA 2AUNA 4OIFA 3GLVA 1Z2OX 4BIIA 2HYIC 2QPOA 5F9HA 1X19A 3IT3A 5EUCA 3AL2A 2X41A 4M1SA 1V8FA 3QF7A 1T8WA 3H1TA 1SB8A 2IYRA 2BHRA 3HU1A 2BZ1A 3FKSA 3QKSB 3U7QA 4BFVA 5BR7A 2IX3A 3EA0A 3H1FA 3I83A 1VHWA 2F17A 2JFPA 3CGGA 5DTMA 2BKLA 4CHGA 2I2DA 1H65A 1SPBS 3KB2A 1NVWQ 4AIRA 1X7XA 5D5HA 4UHJA 1PWEA 1KXZA 1REQA 1B1AA 2NO5A 2VN8A 1CT9A 4NIMA 4RA9A 1OBFO 2CE2X 2NWQA 1U5BA 1BNCA 2ZJOA 4LV6A 3TPFA 4A0RA 1KJZA 1TA0A 1BMFA 2RHHA 3DEYX 4HAIA 1RWQA 3HJBA 4ZCTA 5C8XA 1DJNA 4YXWD 2WIFA 1WSWA 4L2IB 2P4EA 3DV9A 1FXWF 5PNTA 5FWXB 4GR5A 3T52A 5JZBA 2GASA 2F4VB 3EXIB 4HGPA 1DEHA 1RI2A 4DIDA 2P0EA 3OMWA 1SY7A 4ED9A 2AH5A 3UCEA 1EJBA 4YJHA 3T1OA 4K9KA 1UJ2A 3R5FA 2RG1A 1Q19A 3DOFA 5HF6A 2XNHA 3ZDAA 3RS7A 2AEJA 2EU8A 1RXUA 2P4SA 2Q4RA 4Q6BA 3TLBA 3HBJA 3OFJA 4CM6A 3STHA 3JWGA 3W34A 1T3LA 4QFMA 2YYZA 2Y2UA 2BJHA 1DAFA 4W99A 2Q8PA 1NRWA 2A33A 3MWLA 5AKXA 3L1KA 4J0HA 5C52B 4KP7A 1DHRA 2PR7A 4ZEXA 1NKVA 1UF9A 4BNMA 1Q7RA 4CKWB 4I4LA 1NPDA 1QG2A 2IWHA 3SEQA 3D43A 5IAEA 4QUKA 4RZ3A 3ONVA 3I5YA 3ZZUA 1EB8A 2RGNA 3MEQA 2PFKA 4RZUA 2R1ZA 4TKZA 1U7PA 4AS2A 2AI3A 1AQLA 1CUWA 2C0PA 1CK4A 5H81A 4ALLA 5C34B 5AW1A 2QR2A 2FNAA 4MUIA 2QYTA 1IQ0A 1LJLA 2YNMC 3A1TA 3AFIA 3JW8A 3U49A 3EXFB 2X0FA 3RREA 2O7VA 1A9PA 2E4UA 4UOEA 1HURA 1OFUA 1L8AA 3EISA 1VI2A 2CVOA 2VT7A 4RK4A 3EHEA 4Q3DA 3R9IA 3O93A 4AWBA 4WA7A 5PGMA 1SK9A 2K7ZA 5DEIA 1XF9A 1OT5A 5DXAA 3T5TA 5FTLA 1JHAA 1LK5A 4EY6A 1AK9A 1XZGA 3EZ7A 2WKRA 3HI6A 2IU6A 3MT0A 3D8BA 1OASA 3B1JA 1GV0A 3D6UA 4EKIA 5K0ZA 2PZEA 3VXKA 2ILTA 1ZMTA 1IXKA 2OHXA 2VT3A 4QGHA 4RVDA 1D4ZA 3JARB 3WKCA 1LQTA 3L8DA 4GPBA 3VC7A 4Y2SA 1CQIA 1J8FA 1YQEA 1NJ5A 2DHEA 2PR2A 4J0IA 2YXDA 2BIFA 3R7AA 2H4HA 2VBCA 4ILEA 4QATA 5IAGA 1IRIA 2DZDA 5AESA 5F64A 2BBOA 1JAYA 5T8KA 4XX1A 1WY5A 4I1RA 4XGQA 4D8XA 1G21B 1KYQA 1KJWA 1TD1A 4HGNA 1W73A 2VJMA 3GXOA 2G9VA 2CHEA 3BBPA 1MQ8B 2BJVA 1JJAA 2QD3A 5C4GB 1N0HA 2R7NA 1ORDA 3ME5A 3DLTA 3M4YA 1GL9B 1EDEA 3C6XA 1EFHA 3TQHA 5TQJA 1IOWA 4M36A 2PLNA 1ZL0A 2Y93A 3NOQA 4YCBA 5J4YA 1LCIA 3PVSA 1I01A 4DF3A 5LXTB 1ULAA 4ZO8A 5DH9A 1UFVA 2ISSD 3QPWA 3O82A 2FK8A 1G8GA 5ALWA 3RIEA 1Y1LA 3EIFA 3PKZA 4FN4A 1VSVA 1WQ1R 4BZWA 2MTBA 5JSKA 3BQNB 1U3DA 1QU3A 1THZA 1ZK0A 3HPRA 1BW9B 3NUQA 4YJFA 3H11B 3A6GA 3JPWA 4RHYA 3FG9A 1BXRA 3RNLA 1U0SY 2CXSA 1UT8A 1F8FA 3ACCA 5KYTA 4ZTBA 3EVDA 5KSYA 4ZVVA 3BGIA 2CMKA 3QEBZ 3JVDA 5KVSA 1AKVA 1JLHA 4LY6A 5BW6B 2P6UA 2Q5OA 2XB8A 4PX9A 3U60B 1J23A 5ITWA 1L5GB 3NGMA 2JIZA 1T0PA 2R6FA 2IPLA 2Y0CA 5IF3A 5AHWA 4V38A 1JHRA 3DW1X 2M9MA 3OBBA 4HUJA 4LOLA 5IDYA 5ADUS 4NQZA 5CEEA 5IJ0B 3UG6A 3KJFA 1V48A 2PH7A 4WVFA 4PGFA 3DMGA 3GRFA 3U7RA 1ZR2A 2ZRDA 5CT6A 1ZWLA 2L42A 3AOEC 4RA6A 3UJCA 1LW6E 3ZWPA 2Q7DA 3PF9A 4YO8A 4OK3A 3WXMA 3L7IA 5DP2A 4X61A 3EVTA 1TU0A 3JASA 7YASA 2C9BA 4GM0A 4A16A 5BN5A 2GCPA 4M54A 2YFQA 3QLUC 1OT3A 3Q7TA 4M1WA 1JFVA 4EX6A 5KU1A 4FOTA 4NX2A 4PFJA 1RPTA 2XD4A 2FZEA 3GV0A 3EWSA 4K9MA 5D51S 2WIJA 2KHZA 4YJGA 3WLLA 1VSTA 4GGMX 3KRTA 1SCQA 5DSXA 1KMIY 3W6UA 1ZD2P 1QH0A 3WYNA 1D8TA 4JEIA 3TYXA 4Q1FA 4B7AA 1OWPA 3IHWA 2CZCA 1VFNA 3I6ZA 4INZA 2ZS8A 3GLIE 3TEMA 4P93A 3COVA 1E4OA 1JVNA 1U3TA 5A3RA 3SLGA 1XZIA 4F71A 3O4GA 4BMXA 4OQEA 1B8PA 3NWOA 5ALNA 2YWBA 5TQ2A 4B3XA 1OI2A 2RIPA 2VBIA 4X1IA 3W9BA 3LLVA 1SBCA 3CVVA 4PZEA 2PX5A 3L4SO 5EEGA 1Z17A 1LK0A 4D9EA 2FWPA 4IGFA 3BPSA 4FFLA 1DAEA 4JVOA 1FLVA 3PUIA 1SR8A 3IPYA 3R6WA 1NG1A 3ILSA 1Z8NA 5CA0B 4CIBA 1JWAB 2Q3JA 4XGRA 1QHNA 4NAHA 3OQPA 2H3HA 2YNMD 2A3NA 4RKWA 1Q0TA 2V7QD 1XD2B 1N5JA 2HRQA 3M6UA 5B3KA 4HEHA 2P2DA 2YV4A 2ST1A 3EHDA 3AK4A 1A88A 1KXJA 1KE2A 2ZTHA 4L0MA 3V2HA 4E6PA 2W22A 5IJ9B 1OFTA 4YWJA 3HL4A 3GZNB 3HABA 3GLSA 3MWFA 4RVOA 5CHYA 1M0TA 1EFCA 1S5PA 4HAWA 4RVCA 2VJQA 3DPIA 1QP7A 1X1DA 3U9LA 3W2HA 5EMLA 1KTVA 4P38A 2R11A 2DF8A 2BEVB 3LDFA 4Q3BA 5HNKA 2Y76A 1BOFA 3CZAA 4IRUB 4MRMB 2AFIB 1IUKA 4KDRA 3LO5A 5G0UA 1JEYA 3EXHC 1IM8A 1XVIA 4ZARA 1K08A 3ZY3A 2CL6X 1OXSC 2R5FA 1CDEA 3N0WA 1Q7BA 1CR6A 2VXBA 1W25A 1A1SA 5SZKB 2CNKA 1VSBA 4NBWA 4GDFA 4ZYWA 1EX9A 2C5AA 1DXHA 4KRYA 4D46A 3KQLA 1Y6GA 4MVJF 3HR4A 4FQ8A 1CTQA 3ZXYA 2ZIAA 1M33A 3GLUA 4OQYA 3PZBA 4WGFA 2BR4A 5J4LA 4JP1A 2A86A 4QOSA 1LPBB 2Z1DA 5HA5A 4WOPA 1E5QA 3PIIA 2JIMA 4UJ3A 3TW8A 3WK9A 3TGLA 4D74A 3TAUA 5EZYF 1Y6QA 3OCVA 3VDNB 4II3A 2FSIA 2CXOA 3AM5A 4HTFA 5MHTA 5DK4A 3EMBA 3EN0A 4OHZA 4LNUA 4NOLA 3K70C 4IWYA 1XFDA 3CNQS 3E5HA 3WLNA 4ESHA 1XZEA 2WSLA 4K9OA 2RHMA 1H9BA 3NDRA 1SCUB 4BNTA 221PA 3CLVA 1L5YA 1HE4A 4LHYA 4ZTUB 3WJ7A 2F8SA 1DBQA 1Z5UA 2O8VA 1UQTA 2Q49A 3PX2A 4L7VA 3W90A 4F9FA 1CZKA 2C77A 2JVIA 2LTAA 1NONA 4YAOA 4ZEWA 3ZBTA 2BDUA 2R00C 2V9PA 1F0KA 1EH5A 1KR5A 2FSUA 4IGEA 2CB0A 1MB9A 1P9LA 3LHFA 1D8AA 4EATA 1LJ8A 1CD5A 4XUGB 4Y1GA 4YRIA 2DQZA 1WXHA 2KS6A 2WLTA 2WUWE 1J6UA 3EEYA 5LVAA 1AH2A 1FP6A 4CLRA 4F5ZA 3M2PA 3OT1B 3DE6X 3TVTA 2DUWA 5CJ2A 3TMKA 3OPNA 5I3CA 1APBA 4GECA 2JH3A 3KB1A 3CEHA 5DLDA 5F51A 5A4JA 3U44B 1SXQA 1XLWA 2GCGA 2AJBA 1RPJA 4G1CA 1X7DA 4LNAA 3T6KA 4OLBA 1P0QA 5L95A 2HO4A 4G1BA 4OUDB 1X2BA 5AJVB 4NXNB 4EHJA 1ECFA 4RD2A 3JYHA 3Q2IA 5GIOE 3N2NA 3PF8A 1QH9A 2XY4A 4BIMA 3OX2A 4Y9SA 3FPJA 4YLEA 4QUDA 1KK0A 3ET5A 4K3UA 4EHAA 1O9HA 4D7AA 2E4VA 1JE0A 5KHAA 4DPMA 5ICCA 2HU8A 4EWLA 3CZRA 4G1EB 1YRHA 1FTSA 3CZ9A 2RH8A 4YRJA 2HU2A 2W6CX 3GUYA 1ZVVA 1IXRC 1XP8A 1ZOSA 2MINA 2PK3A 4MQMA 2AI2A 3EPJA 2J9GA 3PG5A 3ZE1B 4G5OA 5TVKA 1BJKA 3PQ5A 5ALQA 1P77A 2OQIA 3AEUB 1XSEA 2PKXA 1GCIA 1L7QA 2ET6A 2G4LA 4WXEA 2ZI4A 4BASA 3ECSA 3E4CA 3NX4A 4LBYA 3ZE9A 1FDTA 1JP7A 4O2AF 2QRKA 3AFMA 4L4ZA 1RAGA 2G07A 1QRRA 2WJIA 4PRLA 5AW8A 3OPVA 4L5IA 3ZCRA 3HXPA 5AD1A 1SD5A 3A9SA 4RCYA 1F8UA 1Z4IA 3C43A 3IAM1 2YMPA 1W9HA 1Y8ZA 1D2NA 2W2OA 4JR1A 1E6KA 1E0JA 3Q9NA 4IIFA 4PSCA 3MCVA 2IUEA 3PTLA 4EJ2A 1T9KA 2VFAA 3ACDA 4M53A 3WGTA 3NIWA 1GSIA 2J5RA 5HF9A 4ZAZA 3IDZA 2PEYA 1R8YA 2VF8A 1WXXA 2WABA 3JSXA 2P9YA 3HRHA 2MOKA 5F2KA 1G38A 1JF8A 4B3FX 1USUA 3KJXA 1EK6A 1V5EA 1GG5A 3ELUA 3L93A 4JFRA 4BNNA 1E3MA 2D1TA 3OPXA 1V35A 1Z82A 4IHJF 4LS3A 4CGYA 3JAKB 1AXEA 4G63A 1RXIA 4Q9LA 2ORWA 5ALZA 2BHLA 1R6VA 2COUA 4QGSA 2PKYX 1X8LA 5JPCA 4RJTA 5MFZA 3WK7A 1BCSA 1J56A 2YUIA 1G60A 5IKPA 4Z54A 2FP3A 3I0NA 2VRWA 1SOAA 1U8EA 2B35A 2OMKA 4RULA 1R9JA 4X6UA 3ZHUA 1T5IA 3VAAA 1YDEA 3CZCA 3TCXB 3VU1A 4E46A 3JSAA 3T9CA 1HBJA 1JNXX 1YJ8A 4MWOA 3GX1A 5GQSA 4H7KA 1MGOA 5IDWA 3MOGA 1QIMA 3V42A 4QU8A 3JVUA 5GTDA 1EUCB 5JQGA 1FMJA 3M5CA 4UUPA 4G37A 1FUYB 3O2NA 1VKHA 5HKOA 4FKMA 2WKSA 1ZI9A 1L4NA 3HGMA 1BN7A 3KKLA 1X7YA 2Y1DA 3UKDA 1Q44A 3U17A 4AX8A 1E1QA 2P1RA 4DL9A 1U0BB 3O9ZA 5KTNA 2PKQO 1RLJA 5A5EA 1QH8A 4NEHB 2FX2A 4DMLA 1SIUA 4GZMA 2W90A 3OE4A 3JTMA 4XIJA 1YS7A 4BNXA 2P9BA 5I7UA 3S81A 1SVOA 5BMOA 1P1IA 1VBKA 3UF0A 2K5UA 2YUTA 3IA7A 2A6PA 4MQFB 3V34A 3LWZA 4FIZA 3UIEA 3W0LB 2I65A 3ZV5A 1TTQB 2OK8A 2WWYA 1CEEA 3O4RA 3K70D 1O3YA 3NHKA 3QYAA 1Z0KA 1QG4A 4DIEA 1DOAA 4JBIA 1UWKA 1X7ZB 1GV1A 3JD4A 3P2EA 5EIBC 4DOMA 2QLBA 3HFRA 3KE8A 4LQ4A 1QRSA 4RFSB 1MCZA 1GPWB 2QT1A 3JVIA 3KNZA 2DCMA 5TQ0B 4P4UA 2V03A 1XLVA 4QLAA 3E5RA 1EGMB 3V00A 2ISCA 3E9DA 3GUCA 1V4BA 3PDIB 4X90A 3ESXA 4B6GA 3GF4A 1KJQA 3AKCA 1L3BA 1OB5A 4LK3A 2X22A 2ASVA 3C1AA 3INGA 4KTVE 2QOEA 1DDGA 1ODIA 3M7IA 4WHMA 3BWYA 1D4FA 4XPIA 4HQ6A 5DULA 2VKQA 4D9MA 2C1XA 2GJ9A 3HDHA 3HLTA 3BEDA 1TLFA 2J9FA 2QRVA 3CB2A 4R9RA 2CYAA 4RORA 2FFQA 3K71B 2FPKA 1BJRE 4NVRA 2EERA 4DMUB 1NGSA 2Z2IA 4H7IA 3WDSA 5I9IA 4I46A 4L9RA 5JEEA 1GQOA 4I9NA 4OB6A 3AGQA 2G04A 4L15A 2OHVA 5GV7A 2A9JA 1JSXA 3GPLA 5KYVA 4CQLB 1Y8RB 4GGPA 5FWYB 2WT8A 2ONZA 3C2QA 5DOZA 4AUMA 1DINA 2AOUA 3TTTA 4ILKA 3VZSA 4D82A 1T5DX 4TRJA 4FBLA 1PUJA 1FP1D 2WWIA 3NJRA 3NNNA 2FVYA 1TYBE 1TCUA 2ZRQA 1ZRMA 3GGPA 4HPXB 3VC3A 4BVGA 4BE4A 3H9UA 4YR7A 4R3WA 3L02A 4JSRA 3GAFA 1WMBA 1IG0A 1VZ2A 1BMQA 1OWOA 1B6RA 4XX0B 5JD3A 4MLZA 3OJLA 2OLEA 2BTQB 4FFVA 2G3YA 3TNYA 4A1OA 2BTOA 2QQGA 3EGDA 4AMUA 1F7VA 5KQRA 5CHEA 3A6KA 4HZUB 1TVMA 4RD3A 4ML3A 1M2HA 1UJCA 4KN5A 2VRNA 1G5HA 4FDLA 4I36A 3HJRA 4AT1A 3NIFB 1PIWA 2QTHA 3SQWA 3T1QA 3GCWA 2DJ5A 2ETVA 2F1RA 3JQAD 4NEGA 1OZ0A 4X84A 4YH1A 1AS2A 1HDCA 1Z2NX 1NI3A 1WABA 1WF3A 5TE9A 4L6CA 3OU6A 4G2NA 3E3LA 2JDIA 3WNVA 3HJAA 2QE6A 3VNRA 1A77A 3HP4A 1X7XB 2JAOA 2WHXA 1N6HA 1F2TB 3WBFA 2JAPA 2EGUA 4AB1A 3NH6A 1REQB 1YB4A 4RSHA 1IG3A 4X44A 2B4AA 3EUAA 3P0EA 3QPVA 3UV7A 1EVEA 3FNGA 3RODA 1S4MA 5BV1A 1ZNQO 2YWHA 4W6ZA 1HDOA 4GBED 5AHOA 2V9CA 3JVVA 5B55A 4IYRA 2ZIZA 5JCZA 4KXLA 1T1IA 1WL8A 3I1YA 1KAGA 2E2WA 3JWJA 1J0CA 2X40A 3STWA 1RYNA 2KBEA 3PI6A 2G9QA 3L7JA 5H59A 3A58B 4DB4A 3SC6A 4IDQA 1NW3A 1BU5A 4ZP1A 2AV6A 2JGEA 2QTFA 2XB4A 1AMOA 3UJ8A 4MO2A 4X94A 2WY2D 2KYRA 2WSSA 4YJHB 2PWZA 3WRYA 4FLMA 1OVMA 1XTSA 5EWJA 3R3XA 4G5RA 2JGFA 1HA3A 4PFSA 1JMVA 1QMGA 3QP9A 1ODKA 2V96A 4EA6A 5AIBA 1P33A 1AKRA 2EHJA 3CNEA 2CWDA 4J3FA 1POWA 1XZHA 4V1CA 1KO4A 1QTRA 4MEBA 4HVAA 1WM1A 2PPLA 5F73A 1EE2A 4N18A 3UOWA 4MULA 4Y3UA 3BSFA 2EBUA 1O4VA 2WIAA 2WB4A 2X2FA 3K8QA 1Y1TA 2CYBA 3TL3A 3A06A 3HBNA 2HJ9A 1R2QA 2WM9B 3ADKA 2OLKA 1AKYA 5JE8A 3T9EA 2YX1A 4F0JA 1TUIA 2XVXA 3J7AC 4KZKA 2DPGA 3M1LA 3T0GA 1QG6A 1C8LA 2JJ1A 4KR0A 3HK2A 1GU1A 3GGJA 3IBYA 1R5JA 3NTVA 3H16A 1OPXA 4CKEA 1K7SN 2I3BA 2L18A 2Z6VA 5IC5A 1XD9A 3KWMA 4II2A 5DV9A 2QTBA 2A57A 4JD5A 4TWAA 3IUQA 4HOYA 4CMHA 3THOA 3FZNA 4GI7A 4Q7JB 1W5AA 2ZWVA 1ACJA 3ISTA 1G6KA 4WI1A 3A4YA 3UJBA 3VHQA 4LJ7A 4EG0A 1Y1RA 4DLTA 3ZU5A 1UBJS 3EZGA 2LZ0A 5FWNA 4UQOA 5LB2A 3DHNA 4Z8YA 1WD5A 3FUTA 3UN1A 3V4VB 2FLKA 1CQIB 4INOA 2TRSB 4LHEA 3WYDA 4KXMA 4EG7A 4TUYA 4JLVA 1U9CA 1ZONA 3RVRA 2CJPA 3FAZA 1VJDA 4UTRA 5E6UA 3PDHA 3UTDA 5DE3A 1MX1A 1N2SA 4EQ6B 5LD2B 6NULA 1UMDA 3IAM6 5AQEA 3ZJTA 1P7CA 5JARA 1HT2E 1M7HA 2EW2A 3FH0A 1COWD 2EZUA 4PC6A 4XIYA 2FRXA 4HS9A 1PJTA 1G8HA 1JDBB 1KPGA 2M32A 2OV2A 1VYVA 2DE0X 3ICCA 3KXIA 4PICA 3UAXA 3UGJA 3OQ6A 3FWZA 4TYWA 2XVZA 2XUQA 4L57A 4L85A 1NUPA 3UB2A 3WWDA 2BM0A 4PNHA 4L78A 1RM0A 1H8HD 4X7MA 2RGDA 3FSRA 4ZYZA 2P9CA 1GQQA 3JS5A 2D2EA 2CUZA 3W8FA 3I8XA 2QMHA 3HZZA 3HYLA 4U3JB