1GCIA

The 0.78 angstroms structure of a serine protease-bacillus lentus subtilisin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 0.78 A structure of a serine protease: Bacillus lentus subtilisin.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Serine protease
molecule keywords SUBTILISIN
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1998-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1gciA00
1GA6A 1Q5PA 1SUCA 3EIFA 5AQEA 5JXGA 4H6WA 1P7VA 3DVQX 1SELA 1Y3BE 3AJ9A 1Y4DE 1Y48E 1GTL1 1SPBS 1BJRE 4KG7A 3T41A 4WOBA 1TO2E 4DZTA 1S2NA 2XTJA 2XRMA 2V8BA 1T1EA 3QFHA 3DDZX 4I0WB 1SIOA 3SQOA 5ARCA 4OV6B 1CSEE 1Y3CE 2P4EA 3AFGA 4J94A 3TI7A 3QTLA 4C3VA 3DYBA 5FBZA 3DE1X 1C9MA 2DQKA 2SBTA 5I9SA 4HX2A 3DVSX 4WOCA 3WIUA 3WHIA 3WQBA 3CO0S 2SNIE 2WV7A 1AVTA 1GTG1 5SICE 4HVLA 1SH7A 3VV2A 5JXIA 3CNQS 4K8RB 5JXHA 1T1IA 1Y1KE 4BWGA 1TO1E 3BGOS 4H6VA 1TM4E 4GI3A 4LVNA 1CNMA 1T1GA 2PRKA 2Z58A 3DW3X 1WSDA 1DBIA 4B5LA 1AQNA 1GA4A 3PTLA 3PRKE 1PJ8A 2WUVA 3VYVA 1WMFA 1VSBA 1V5IA 2IY9A 3EDYA 3GT4A 2PKCA 1V6CA 1SUPA 1IAVA 4YN3A 3VSBA 2Z2YA 2E1PA 1XF1A 4ZOQI 3F7OA 1TECE 1YJCA 1AV7A 1BH6A 1ZVJA 3DE3X 2PMWB 2PWBA 3DW1X 1PFGA 3SICE 3WIVA 4OMDA 3ZXXA 4DWWA 2W2NA 3F49S 5B1DA 1R0RE 4ZARA 2WUWE 1BE6A 4NMXB 1DUIA 3H42B 1SBIA 3LXUX 4KPGA 2PWAA 4CG0A 1BE8A 5AVJA 1TM1E 1SCAA 1P8JA 1SUAA 1Y9ZA 1UBNA 3A3PA 3DE0X 1TM7E 5AVKA 1TM3E 1Y34E 3DVRX 3I2YX 1SCBA 2HD4A 1C9JA 1GTJ1 4OMCA 4RYDA 5ARDA 4C3UA 3D43A 3UNXA 3Q5GA 5JMOA 2W2QA 1ST2A 2PYZA 3OSZA 1SBTA 3LPAA 1Y33E 2WWTA 3I34X 3ZXYA 3GCXA 3TI9A 1P7WA 3BPSA 1SUEA 4Z2AA 5ARBA 1MEEA 5JXJA 1SBCA 1BFUA 2W2PA 2W2OA 2ZWPA 1Y3FE 1KDZA 1EGQA 1Y4AE 1JEAA 5FAXA 3VV3A 4DJ5X 1GA1A 1ZVKA 2G4VA 3GCWA 2HPZA 1AK9A 1TK2A 4AKSA 1TM5E 2Z57A 2Z56A 3I37X 1SUBA 3EE6A 5K7SA 1SCNE 2GKOA 1NDUA 1MPTA 1WVMA 1YJAA 4H6XA 1SN7A 4NE7A 1BFKA 2ST1A 3VHQA 1PEKE 1TMGE 2Z2ZA 1A2QA 4LVOA 1LW6E 3LPDA 1SCJA 1S02A 1GNSA 1PTKA 2SICE 1EA7A 2ID8A 2X8JA 1YU6A 3BX1A 3P5BA 2ID4A 1WMEA 2PQ2A 4MZDA 2DUJA 3GT3A 1Y3DE 1THMA 2ZWOA 3DE7X 1AU9A 1GNVA 1GT91 1S01A 4FONA 1OYVA 3A3OA 3DE5X 5CW1A 3DE4X 1C3LA 1SBNE 2B6NA 2Z2XA 2Z30A 2X8JB 3DE6X 5FFNA 1SVNA 3AJ8A 1WMDA 3VTAA 3I30X 1R6VA 1AH2A 1KDYA 3Q40A 1KE2A 4CFZA 4M1ZA 2DP4E 1SBHA 1C9NA 5B1EA 1YJBA 2IXTA 3DE2X 3DWEX 3L1KA 1SCDA 3HJRA 3LPCA 2ZRQA 1NLUA 1GCIA 1R64A 2QTWB 3A3NA 1SIUA 5AMXA 4CFYA 3F7MA 3TECE 1ST3A 1OT5A 2SECE 1HT3A 4JP8A 1SUDA 2TECE 1KDVA 1KE1A 1IC6A 1AF4A 1NDQA 1OYOA 4KB5A 1SIBE 2W2MA 4NE9A 4AKTA 3D9QX 3QMPA
chains in the Genus database with same CATH superfamily
1U80A 3KTOA 2EJUA 5DP1A 1LK7A 2QM0A 3TW8B 2R60A 2PV0A 3EZGA 3NHMA 3AU9A 5K0NA 1GTL1 3KVYA 2DWOA 2JBAB 5DX8A 3BJMA 4EYEA 5EUQB 5C7OO 5KNBH 3R3WA 5CD9A 3OTOB 1OLUB 3H7AA 1WXEA 4OV6B 4NULA 5DE3A 1OU4A 4AZ0B 5DBGA 4B7XA 2FMTA 4BLUA 1CCWA 2SBTA 1K8RA 4LY3A 3DDNA 3V1LA 2ZBUA 4HWSA 4UJ3A 5CIYA 2AVNA 4BWVA 2A3RA 1ODSA 3CMMA 4TTIA 3U3ZA 5SYNA 2YNMA 2WNIA 3FHJA 4F38A 1WBBA 2GB4A 1JHYA 5ADVA 2XGSA 2LP4Y 2BE9A 1ZLYA 1YR3A 2NZUG 3IIJA 2WE7A 2LZ0A 4UXIA 1KY4A 4M21A 5KYVA 1NYLA 4UE6A 5U4XA 4BNWA 5I8WA 3V8VA 4DPKA 2I6SA 1T9HA 3A1CA 1ZXBA 3QVLA 3IC5A 3M9LA 2QD5A 4X84A 3B1WA 5DGDA 4YDSA 4A6EA 4DYDA 1I80A 4GU5A 4EKDA 1F6DA 2YFQA 4WLEA 1XVVA 3NAGA 4O2BF 4AJOA 1QTQA 5COBA 2YWFA 3WLEA 3ONVA 2Q3BA 2M6RA 2FG7C 3H9CA 4INAA 4DADA 1MG0A 4F4HA 2H4XA 3DT9A 4MDHA 4U2CA 2B9EA 3VKUA 1ESNA 5JH7A 4B7UA 1O54A 2FHPA 2GPWA 3MJSA 1XQYA 4I6JA 5KYYB 3NS7A 5FPQA 4PYOA 1YB5A 1M34B 2DWUA 2VDPB 3DVRX 3FB1A 4YRRA 5E9QA 5I4IA 5C7IO 4QDKA 4UVEA 2ECQA 2GYWA 4D0RA 5IULC 1JBKA 5JTTA 1U6JA 5JAUA 5JNRA 5BUZA 3TLBA 4BGVA 3ABOB 1P0CA 3OP1A 1Q77A 1OROA 1QRRA 3GCXA 1GHTA 2XH8A 3NBXX 4HV4A 2QL6A 1CB0A 1ECFA 2CV1A 2KQUA 2XNDD 3HI4A 5IM5A 1GLNA 2BELA 5HMMA 4Z4EA 2V7XA 2VDOB 3PQDA 1DAEA 5LYYA 2GOYA 4WLUA 2NO9A 4K6MA 4BECA 1TAGA 3GDWA 2XADA 1MOQA 2GERA 1CPYA 1UQUA 4TV9F 2OO5A 3RRXA 3DD1A 2PD6A 3MM4A 4CQNA 3CCBA 1A98A 1SCNE 3U26A 3JASB 2PH1A 3R0ZA 1VI5A 5I7RA 1QU2A 4G9GA 3OA2A 4FEGA 4BNFA 4EI7A 1ZR2A 1MX3A 4QPZA 5L7TA 5L95A 1DJMA 1TCVA 3O9ZA 2AC4A 3R5HA 4D6PA 3H83A 3SR0A 3QE9Y 4BKMA 3FPFA 5CIWA 5H81A 4NZ9A 1XLTC 1OXTA 1AS3A 1Z4IA 2QTVB 3DZ8A 2OE2A 3BFPA 1K7XB 3E9EA 4OM7A 1QK4A 5BSHA 3OZUA 2BH9A 2HLDD 3EN0A 4CUKA 3DHVA 3GGSA 3PQ2A 4B5KA 1RLTA 2FPIA 4M54A 2O05A 1TI7A 4XZ3A 2CCKA 2O2DA 2V97A 3OH8A 2GLUA 3AVVA 2A9FA 4Q21A 5F3WB 1VDZA 2Q2WA 1BMFA 2PWZA 2OTCA 3OKAA 4AO8A 1L6IA 3AHEA 2C9CA 4W1PA 2PANA 1YA4A 4CV3A 1WLYA 2VJQA 4UTXA 3SE0A 1PTJA 3R5XA 4WKBA 3L7JA 3LHKA 2EZUA 2X1HA 2J07A 5BRNA 4LGVA 3IDQA 2JCVA 3A7DA 4TLAA 4JI6B 4F2DA 4RTSA 4Y2RA 3C8HA 4Q93A 1C9YA 1U28A 3MRTA 2CNWD 3W1EA 4YQEA 2F59A 1AK2A 2EG5A 4M9UA 3GFOA 5EKXA 2I67A 3AYXB 1SU4A 2CE2X 3ED1A 3OIDA 4I5EA 5DSZA 2P9GA 4DM4A 3CW9A 4RADA 2DECA 3ZR4B 1RBQA 2C42A 4H27A 1FSPA 3UW1A 3PRHA 4LHXA 1UT5A 2CNBA 4A91A 1X1BA 3PPVA 2AS0A 3F7TA 3WQBA 1RAHA 2UVDA 4KACA 3VYRB 4BFUA 1WXGA 2QYTA 1XA4A 1XGKA 3DCIA 2W4QA 5T3UA 3CWZA 2C61A 4KVZA 2PX4A 4JT4A 1XTRA 3V48A 5BWBA 1G6KA 1DKQA 2P9BA 4G84A 1AHHA 2HAEA 2GUGA 2XE4A 4OUKX 3VXKA 1P4JA 4ASUA 4IO1A 2LCFA 1R0SA 1M1ZA 1UL1X 3ACDA 3C1OA 3OIVA 5FPYA 4L4UA 4A2PA 4IS3A 1T9AA 4YBZA 3UMRA 5H9WA 3GT4A 1W4CA 2P65A 3A2MA 4YRCA 3L4BC 1JTFA 3IE1A 1J23A 1KJJA 2F1RA 1KAEA 3HXKA 1GAWA 4HAYA 3TAXA 1B2LA 1W93A 3WSTA 3HSYA 5AHOA 1IDN1 4OCZA 3UWDA 2LDBA 3VR2A 5CXUA 1QG2A 4J0JA 3TQCA 1MC5A 1S8AA 1SQ0A 1SXJC 2YJ3A 4GZMA 4L8VA 3KTFA 2ZUSA 1H2AS 3OY7A 4MKGA 2H3HA 2X3UA 3JQ7B 3WLSA 4CMIA 5I7HA 1EXWA 3QY0A 1RM0A 3NUQA 1J2EA 3AT1A 4HR7A 3HA2A 3D43A 3W6UA 5LU8A 1X7WA 3ADDA 1HFKA 3VPGA 4YRMA 3PJEA 2DFNA 2V7QA 4S3MA 3W7BA 5J5VA 5IKMA 3WXMA 5E2AA 2C4WA 1ZIDA 1D0SA 2GZ3A 4P93A 1WCXA 3EAQA 2JLCA 3CCFA 3GLGB 1ACJA 2XDAA 5LUBA 1Z2EA 2E4VA 4KQIA 4YP7A 2IHBA 3FNBA 3UXMA 2ZTLA 5K3FA 2ZDGA 1JEQB 3WLRA 1KA9H 3AIMA 1QZUA 1N2CE 4O4LB 3MPUA 1E96A 1T4CB 5D7BA 3GLFB 1N32B 4CF7A 4V02A 2HU8A 1COWA 1JIVA 3MT9A 2IIQA 2PSEA 3GLUA 1Y4ZA 1TDJA 1U6KA 1DUVG 1L8XA 4LVOA 5FI5A 1GDDA 3LFUA 3QXJA 3VDNB 4A8TA 1TJPB 1NFQA 5ARBA 3DBHA 5TQ2A 2BGTA 1QNLA 4FI3C 4L57A 3HR4A 3RV4A 3V32A 2QP4A 5CPFA 2DHEA 3ZZUA 2DCUA 1JVSA 5U9CA 2B1QA 1V5FA 3P4YA 4EYSA 5D3MB 3F6PA 1G17A 5BSUA 3N5CA 2QMEA 3UAWA 2JLUA 1RCUA 2OK8A 4J07A 2IZ6A 3F78A 2C3UA 3A1TA 3I62A 1ORVA 3TNDA 1J2RA 1H1LB 2JGAA 1LWNA 3O9VA 5D5QA 3UV3A 1JP7A 1UEXC 2I2FA 1NDHA 2GZHA 2O0JA 4LTDA 5KYKA 4EZIA 3EQ8A 1RZVA 2Y68A 4IWYA 3VU9B 4K86A 4R71A 2NOAA 3I1JA 3LXRA 2XGMA 4N6GA 3TIIA 4C88A 1J5XA 1IM2A 1O7JA 2YFYA 4FQ5A 2FY8A 5I3CA 2JAPA 2SHKA 1D9ZA 3KLPX 3NEYA 3CF2A 5DGXA 1ZP6A 4BZZA 3ZVKA 4U2EA 3COVA 2JIZA 3G02A 2WWHA 3HDGA 1DLJA 5JSUA 3PLNA 4PLFA 2FG6C 1A7JA 1E2UA 1XWFA 2PTGA 4JDUA 4BNDB 3B7PA 2HH9A 3TTVA 1A9TA 2B34A 4ITRC 2VZ0A 3V8RA 5BW5A 1QK5A 1C2TA 5KNDH 2C4MA 5BVHA 1WNTA 3UMBA 4IRUB 4NZOA 4B8YA 1F8FA 3I5AA 3RR2A 1THZA 1K7FB 1UC5B 2C5EA 1YO6A 3BMXA 4NOKA 4DV4B 2WVHA 2BZSA 2J3IA 3GUHA 4YXWA 3VVLA 5GV8A 4ECAA 2YXPX 4HQ0A 1NG9A 1MMFB 1IJFA 5E3JA 3PFHA 3QPBA 4C43A 2HTFA 2EX1A 3FYUC 3UAXA 4D43A 1P2BA 4HCJA 4CMJA 5IKXA 2E5WA 4WZBA 5ICGA 4MVXA 1QRSA 1UK8A 2WPDA 1HWYA 1ULBA 2NN3C 3P94A 8ATCA 1W4BA 5C1DA 1PO7A 2X2PA 3MGKA 4RVGA 5HIJA 2AIRA 1FL9A 2VK8A 2PJUA 4JLNA 4NOJA 2FWMX 4UUAA 1YL5A 4M8LA 2XECA 4L0CA 5IJXA 1HXHA 3AUTA 3QEMB 3MWEA 3HVRA 3GJSA 4L1KA 3K70B 3JARB 1LQUA 1ADBA 1LRKA 1X8KA 5AM5A 5TB5A 1UBJS 2FWJA 3INTA 4DPLA 4QG3A 3H42B 4MPPA 5FADA 3BMOA 1UKAA 3OUZA 3WZMA 2CMHA 3UAYA 2HMVA 3AK4A 3CH4B 3K0FA 4LOIA 3I5UA 1SCBA 1WO8A 1P5HA 3VMFA 2X40A 2QVZX 5MFZA 1B0UA 3DZJA 3R0JA 4V0RA 5AVOA 2ZI7A 2OXRA 2FXIA 4GSYA 5JZOA 3QKIA 1J0DA 4Z4GA 1C0KA 3MCAA 3W9SA 2NP7A 3CEMA 3I3SR 5LA6B 4C3OB 3S2GA 4EB6A 4LZPA 2P6OA 3GCWA 1CS0B 4HNUA 1IY1A 3K3PA 4OSOA 1J9GA 4KN5A 4EAAA 3VNRA 3OE1A 1DU4A 5EP1A 2Q4EA 3LIPA 2NM0A 2WJIA 1G38A 4EB8A 3MCTA 3Q9LA 2R6FA 1XAGA 2ST1A 2PO5A 5CW2A 2O57A 3TE6A 1MNQA 4DM7A 5A62A 1Z63A 2CXOA 2FW6A 4GOXA 1DKOA 1FQOA 3G59A 4UBMA 2FSHA 2K6GA 4OYYA 4HPJB 4A16A 4F8EA 1BDJA 1V48A 4PWYA 2QQ5A 2Z30A 4UKDA 1MZVA 5EIBD 1CERA 4FW9A 2BEUB 5CDGA 2XOXA 2PKYX 4ZCQA 5JCJD 1XSEA 3R44A 3QF4B 4JJGA 3NIWA 2WTBA 1WZNA 3JPWA 5FOUA 3ROQA 4EGCB 3IELA 1ITZA 3AP2A 4OVKA 5REQA 2NZYA 3NHZA 5CT4A 2A5FA 1SCDA 2MYTA 4TTSA 2DXIA 3IS3A 3SS9X 1GFIA 5ISMA 2W2LA 4L72A 4E31A 3SYNA 1MUUA 3QKWA 3D6VA 3GAMA 3QGMA 2IUFA 4GLOA 1YS9A 2PS0A 1I13A 3KDPA 1H6AA 3CUSA 1Z47A 1JG4A 4N0EA 2ZTMA 5F1OA 1VTKA 4CN8A 1SAYA 1XYGA 1E63A 2AW3A 4PC1A 5F9MA 1LVHA 3N05A 2RJOA 4DMHA 3HXOA 3RUPA 1OWNA 4B3SB 1OFIA 1V0JA 4EAQA 3SQOA 4U2FA 3T1TA 3BE4A 2EFEB 4J0EA 3SY8A 2VSNA 4Q3DA 2C0QA 3SF8A 2J0SA 3J81A 2QLBA 4Q18A 3OVMA 3QXSA 2NO1A 2FQYA 2PLAA 2VLBA 4L7VA 2LKCA 3UYLA 3V2HA 2F1KA 4QULA 4AY4A 1JIIA 2HK6A 3ZK7A 4BNZA 4RW0A 4U2KA 3I39X 3EAGA 3KOUA 1KMQA 4ZD6A 4GBMA 2EIHA 3A26A 5A2GA 1FFWA 2GMWA 2H1RA 2CXPA 4IDQA 1PR2A 1YI8A 3VH1A 4AZ0A 2O8CA 1M2WA 3M49A 4LTMA 5I9NA 3VR3D 3ODPA 1P0IA 4UUBA 1U4SA 2WJVA 4FMPA 2R6CA 1P3JA 3FIUA 1U0LA 3VR4A 3ZCUA 1QFYA 1XTJA 1L7XA 1JG2A 4YMLA 1NMQA 3OC6A 1F1JA 2BJHA 3O38A 1KVUA 2CVPA 5LXTA 3KQNA 3OCJA 3PC3A 4AYXA 3DKKA 3RLIA 1CX9B 1EQAA 3L8YA 1XZBA 1N7HA 4HB4A 1XU9A 4KDFA 5I7AA 4HEA6 3EDRA 4MA4A 3N1UA 5I8PA 4KXXA 4DCNA 5JCOC 3NJ4A 1PHPA 2QRNA 2WM9B 2XOKA 2GAAA 3M3HA 1VIDA 1JAHA 2C3OA 1R50A 4BVHA 5DNYB 4PZYA 4BRZA 1FA9A 2BFNA 1TT5A 2DUNA 3DMDA 4C7VA 4RS3A 1E1QD 1EFUA 3VHXB 1PNQA 2QNBA 2YMPA 4PZUA 2M6LA 3AGPA 4I1RA 4BRSA 4DNOA 1I0IA 3UFXA 4QDUA 2WSSD 4HO1X 3HCPA 1CC1S 3FMPB 5L3QA 2GM3A 4F5EA 3IVGA 1QIGA 3GR6A 4OOEA 2MYPA 3M8KA 2W8ZA 3PA6A 2Z57A 4KAJA 5EWMA 4A0FA 2XRFA 4FFPA 1RR6A 1CR4A 1Y63A 2FWAA 3KKMA 1I1QB 3H2SA 4QGAA 2YZKA 4YJ3A 2XCSB 3CB2A 3LO8A 1JEDA 2DQSA 2JFWA 2PIAA 4RJKA 4UEJA 3RS3A 3UJ9A 1EMDA 5AFSA 2P5SA 1R16A 1LBHA 4X7RA 2MT9A 2OHOA 5C1BA 1D6MA 3OLZA 4NNOA 1S4MA 2XMRA 3R0VA 4NENA 5CW1A 1ZM9A 2BR3A 2NQ2C 1XZEA 3SZMA 1G2QA 2O1EA 2P67A 2ZCVA 4DLLA 5SYAA 4L4YA 4F11A 2YXEA 2WSMA 4MA5A 2IYUA 2H4WA 4IY1A 1G1AA 4GR5A 2DLCX 1OBFO 1PGOA 1X1RA 5A2QA 4GYKA 4UFNA 4J49A 4CMAA 3NHSA 4TWAA 5BYAA 5JS7A 3I28A 1W47A 2H29A 4EY8A 1SHZA 1UJMA 4KO2S 1UPTA 3JV7A 3GJ6A 1Z38A 1OUMA 5LBUA 2MMGA 4E51A 4J3FA 2ZSEA 2W43A 3B5EA 4PZ9A 1RXYA 1SVLA 1O6BA 3SHWA 1UXGA 4FYXA 4HKTA 4DWOA 3RREA 3HJCA 4B6SA 4Z1MA 1TJNA 3WA6A 4DGQA 1CY8A 5JNVA 4WFIA 5KI6A 4ZC8A 5C8YB 1EUQA 2QN1A 2WUFA 5C35A 1B2RA 1SVKA 2POQX 1M0WA 2XCUA 3F1KA 4R84A 2CBZA 5EOVA 1OH8A 1ODLA 3FB4A 3AZPA 1U3VA 1RHKA 1WTAA 2C96A 3KM0A 3EGDB 3SS8A 1A88A 1DC4A 2J31A 1P9RA 3BB4A 1IEXA 1CLUA 1C9EA 4ZGGA 5HUHA 1ATIA 3CJQA 4FOPA 5K3BA 1KDRA 2R6JA 2IV7A 3ZCXA 721PA 3NH6A 3OD1A 5EXPA 3RVJA 3A2KA 3AGQA 1SZDA 3CUWA 1YGPA 2OCXA 1AM4D 1GCAA 4EKNB 5K0SA 3OZBA 4KFTA 2ERYA 4QNMA 1SU6A 4H15A 3S1SA 3SC3A 3EQ6A 3NBZC 4WJLA 4LGYA 4HQFA 3QTTA 4NQRA 2O0KA 4YJ3F 5H3LA 5A1TA 1RCTE 2JLYA 2IA5A 1YIAA 2J7KA 3TOSA 4ZPJA 1JWLA 4TQUS 3SLKA 2QX7A 1XTQA 3MJHA 2IELA 1WRBA 1GCGA 3QFRA 3ZWPA 1XLWA 3WK7A 4CG0A 1EFVB 1A69A 4ARZA 1DI0A 2JDID 5KHLB 3H4IA 1E5VA 1JEYB 3BHMA 3KQWA 3OPYA 4RSGA 3ROMA 4W7IA 5J1SB 4YMVA 5E4YA 5FHRA 5IUNC 2KI5A 1W4LA 3BTUA 2YJNA 1B93A 1MF7A 2FPSA 2J0EA 3ZGOA 4NZZA 3HBAA 2WWTA 1J06A 3Q85A 2HRDA 5DM1A 2FEWB 3H2ZA 3UJDA 4AL4A 3K5HA 1GQYA 1YONA 1IZYA 2XVXA 2W2PA 2YOGA 1DB3A 1NUAA 1LS1A 4B8ZA 2CWDA 4XB6B 4BBJA 1EPUA 3KZVA 5FXMA 1YHZA 4MWSA 1XCGB 3TQRA 2R751 4PYQA 2OLEA 2C83A 5BV7A 1UANA 3IAM1 4MSUA 4Y2PA 2HF8A 3FFAA 4XOUA 5GZ3A 1C1XB 1T8UA 1TTPB 4NF2A 4Q9JA 3RDPA 3A36A 2YMMA 2ZR0A 1SFRA 4K9PA 4I9GA 4E14A 3ZD8A 1S2MA 4JX9A 3DEIA 4HGZA 2NTNA 5I7SA 2JEZA 2JCXA 2ZAGA 3C3YA 1AKVA 2BEVA 4NHOA 1KP9A 1QGDA 2HHLA 4INPA 4MS3B 4P31A 3AKYA 3ZU6A 3THXA 4GOLD 2ZRKA 2CEKA 2YHAA 1PJLA 2XQGA 4ND8B 3K6JA 4MVJE 2IQIA 4CUJA 3BH7A 1XFDA 1IN8A 1ISFA 4CEJA 4CKWA 4AJNA 2AFIB 1MX9A 2XQKA 2A30A 4XD2A 5FL7A 1FYFA 4GPBA 1OFHA 3RS9A 4LK2A 3BXPA 4RWEA 4QOJA 3P9RA 4I1YA 1GUDA 5ALYA 6GPBA 3SN6A 1AGPA 2QN8A 3LDAA 1YBFA 3DFKA 3NEPX 4X85A 3W04A 4IMIB 2H48A 4IMPA 3V4LA 4QTYA 4GO1A 5C5IA 2IOYA 3LCMA 5HUQA 2KSQA 2HMTA 3I92A 3ZDXB 5JEEA 3M3PA 5JRDS 4DA4A 4OHYA 4L6AA 5EIXA 3FLMA 2I8AA 4IJUA 4IIXA 3TIFA 2AZXA 1DP4A 2RC5A 2FFBA 2HK8A 1ZAKA 1N1EA 2GN8A 3ND8A 4KQGA 5HKLA 4C4YA 4PZEA 3S7TA 4DDTA 5L4SA 2V0NA 3WYEA 1XP8A 4X00A 2X4DA 2W0MA 1PAUA 4TV8B 1NSFA 2VH5R 2Y6VA 3UPDA 2XLBA 2HA6A 3FFBA 2NO7A 1XRSB 1ZH4A 2A0FA 3PD7A 1RWKA 4ZGBA 1M8PA 2AQHA 3WLHA 3WV5A 1E9RA 4HEHA 1RWXA 1XRNA 3JVIA 2QZPA 1MHPA 3FPCA 3NPMA 1KO5A 1U0OC 3TTYA 4MYCA 5KYWB 2I91A 1KEZA 1F0YA 2NYAA 1WHTA 4K6HA 4DG8A 3ELUA 4PYRA 1KVQA 4QE3A 4MICA 2WINI 4ROTA 3NVKI 1WG8A 2CXUA 2R8BA 4INJA 4Q1FA 2ZPAA 3G88A 4DMCA 2OZEA 4KOEC 2XE6A 4JXXA 2ADOA 3AI3A 4S1OA 4E2WA 1WR8A 3NTUA 4WLNA 4HDRA 2DLNA 3CWQA 3QOFA 4MITA 1QTRA 2JS7A 4NBKA 4IQ0A 2LV8A 2EHJA 3ZC3A 4Q4HB 5KPJA 3KZ1E 2BFOA 2ZXEA 3D0OA 4Y67A 4DLPA 5IXYA 1P9NA 3LQ4A 2QTNA 3AEQA 1Z56C 3CX6A 2BP7A 2IKQA 3OX2A 1W0CA 1AUPA 4EJ6A 4PHHA 2HPHA 4A2WA 1P8JA 1QFXA 1PKXA 1JILA 2Q7OE 3OA0A 3TLMA 5HOQA 4TVBA 4XVRA 5BRAA 1C41A 1PRYA 3ZGVA 1MO5A 4FC7A 2CHUA 4MWDA 1AK1A 1CY6A 4KXFB 5KBYA 2YUTA 4YK7A 4F2WA 2YY6A 3NHPA 2QT9A 2I2DA 4NBTA 4QPJC 2A1UA 4CKCB 3D8HA 1W52X 4ZQBA 3DXZA 3OZCA 4CF4A 1QO7A 2D7JA 1T4MA 3D4NA 1P2UA 3QXHA 4PAOA 1JAIA 1KZ1A 2HHCA 1H1LA 4D3DA 4E12A 4EVQA 3MK31 4B3TB 4Z4FA 1KQOA 1NW8A 3THYB 4LMBA 9MHTA 3GJYA 1NJGA 3T3GA 2NSLA 4RESA 5C4GB 1UAYA 2QTAA 3DCNA 1L4HA 1RBYA 2HA4A 3AF3A 3KU4A 3N7UA 5K1ZA 3ZWDA 3FKSD 3C3DA 4N5MA 4EK9A 2HSDA 1URPA 4LYEA 2FN7A 4DV2B 1EFLA 2HF7A 3LPDA 1SCJA 3NB0A 4I46A 5DU2A 4XSHA 4IDOA 4H1WA 5HDBB 4FWBA 2QRPA 4LS3A 3WBFA 3Q7EA 3RO7A 4Z7QB 1KZGB 4AKHA 3SAJA 3A3OA 5HJ7A 2I3DA 1UKCA 3L6CA 3W2EA 4JA0A 5EE3A 1NLMA 1FQJA 1XEFA 2G5PA 3D6HA 4CEHB 3ZBPA 4NK4A 3RC1A 3W5AA 4UZSA 1UAGA 3PC2A 4EPWA 1KE2A 1OBVA 4F1WA 1GKYA 1MABB 1OFTA 3MINB 2VSOA 3B9RA 3L1KA 1Q83A 4Q9LA 4IGFA 4YCBA 1ZOPA 4J9VA 4B8WA 1Z75A 4HAOA 1GCOA 4ZK2A 1VE7A 3E9MA 1KSHA 1LW7A 1M2VB 2R2GA 4TS3A 4MLPA 1NVMB 4ZMSA 1OV6A 3RBXA 4IHJA 4OHCA 2QZ9A 3CCCA 3KKZA 4EJSA 2GCGA 2FHSA 1QH1B 1AUVA 2H4FA 4IIFA 3JYLA 4QJ5A 1QDLB 2K87A 2RB4A 4RCVA 1UCFA 1H5QA 4Z86A 5BSEA 3C45A 4IHAA 4KPUA 1K63A 1NQWA 3NZEA 2D4HA 2CJYA 2D6FA 1S3IA 4D9EA 3B6MA 1IE3A 3H9JA 5EUBA 1T1EA 5FT9A 5LNK1 1KPGA 2Z8YA 3FZGA 2C58A 2MU1A 2HBYA 1UBKS 2A9PA 4GC9A 3RVDA 5H3CA 2ZGVA 5FTKA 3RGGA 3M4ZA 5E7QA 2V54A 5HJEA 2JATA 4IDFA 1JR3A 1GFSA 4LHWA 3AIIA 4NMMA 3HJNA 3F6YA 4XQCA 3NFRA 1NA5A 4I5DA 2Q2VA 3IBCA 5FV7A 4JLUA 2JVKA 2FUNB 4TVKA 5CGQB 4NMLA 3QE3A 4FDLA 2PWPA 5BN4B 1SR8A 1N4AA 3DV0A 1ISGA 5CB4F 1G5QA 1JSRA 1TVKA 1FRZA 1Q11A 2F6RA 3DC2A 4AROA 3CVJA 4PYJA 4U00A 2JCYA 5B1SA 3WKCA 2YV4A 1H1DA 5JD4A 2A88A 1NQ5A 4J16C 2B6HA 3AERB 3AUKA 4KH0A 1RDFA 1QYDA 5KZMB 1IDOA 1F2TB 2HTEA 4RZ3A 3D1JA 5BQ3A 3BTOA 4Y2UA 2CBXA 3WQHA 3ZTWA 4YRZA 1H3FA 2HRQA 3FHCB 4G5QA 3QELB 1RQNA 1SZCA 3GDHA 1LJLA 2BR4A 3ESXA 4GMHA 3WDSA 4FILA 5A04A 5C7LO 2V65A 3KT0A 2ZUWA 2AV6A 3AF4A 4RDIA 5HJ2A 5IAKA 3UV6A 1KP2A 4N4AA 3LC0A 2BMWA 5CFPA 1BKYA 1EFPB 3KKNA 2ZW9A 1NUUA 2BKXA 4XYGA 2UDPA 3IUBA 5E7JA 3WNCA 3QHAA 3QY9A 3IGFA 1I0ZA 1LF0A 1S0UA 2OAP1 4XSGA 3QYPA 1Y5NA 4YJKA 2ZOSA 2VHEA 3PV0A 1MXFA 1EJ6A 2RBKA 4G5GA 3QK7A 1J0EA 4L27A 3WK5A 4D3YA 3KLNA 5H16A 4L28A 2Z2IA 3FI9A 4XLTA 4C6RA 3EVGA 1GR0A 3FDIA 1Q91A 1Z34A 1G8JA 4MV8A 5CXQA 5GPBA 2F1HA 1Z7EA 3QKSB 2IL1A 2P9CA 1UJ5A 3AHDA 1E0KA 5M29A 2C5GA 2H0QA 2Q4TA 4MROA 4Z53A 3BWYA 4EW3A 3IXLA 1X1TA 2N46A 1C7ZA 3ZNNA 4XWOA 4AS3A 1PJCA 5FLKA 2Y71A 3I6IA 4XCXA 2MYUA 4OBWA 4E11A 2W4MA 3MS7A 3ESZA 1M74A 1D8TA 2WF9A 3AJ8A 3C14C 1DZ3A 3IESA 3IQDB 3ID6C 5JLAA 1NRJB 3IVAA 3ANMA 3CY6A 5DYNA 5F5XA 4UVHA 4WY8A 4A8HA 1QLJA 3TN7A 3C5CA 2XUIA 4CI9A 2R7LA 4YRKA 2ZXFA 1FP4A 3P9ZA 2Y3IA 2QTWB 2GD1O 2GJAA 1RKXA 1HETA 1CG6A 4GMDA 4H31A 3CIFA 3G8BA 2V7WA 4DY4A 1L4KA 3LP5A 3WK9A 3RT7A 1HNWB 3C74A 1KK3A 5CB0A 3IPYA 2QPAA 2P2YA 3KQMA 1MIOA 1BOFA 1AXGA 1SELA 3RK1A 3HJFA 1LEHA 3KQHA 1EJBA 4XJVA 3CX7A 5KYXA 5FI0B 1BCSA 3VAYA 3KJFA 1RJWA 1QANA 1RMYA 1CY4A 1Z0KA 2ZIXB 3LKBA 1BCRA 3PC6A 4PX9A 1VBKA 1ZBDA 4P5PA 2VHXA 4YLGA 2PZBA 3T7IA 1E2QA 1Q7RA 1UZLA 2DMRA 5AKHA 2F2TA 2XMQA 3ZV5A 4JEIA 3EXFB 2RHMA 3LUHA 1D2EA 4R2JA 4ZQEA 4BNUA 1QP8A 4FNGA 4KNVA 1A7UA 3HY3A 1ZCFA 3PYMA 5JHGB 4E4TA 1Y8AA 4B9EA 4GMXA 4OLJA 1O97C 2AFIA 3IYLW 2B1JA 3FPJA 3L92A 4YV1A 3G0HA 1NFFA 2YVUA 3K0BA 5T4BA 2ZIUB 3RYHB 1DRKA 3PICA 1GZ6A 1FZQA 5LQSA 3S27A 3A1NA 4GHWA 4KOAA 3AX6A 2WF5A 5EZYB 2WT9A 2AQIA 2FJ0A 2QVXX 4MS1A 4W8OA 1OCEA 3ZCRA 4HYTA 2HO5A 1N0VC 2OKGA 2WFAA 2XYGA 3VX4A 2C2BA 4R7TA 3HTXA 4N03A 3CC8A 4D9IA 4YYZA 4Z1OA 1SQGA 2G40A 1IAQA 1NR7A 2NTVA 1NNEA 4B6JA 3LXUX 1CZOA 1M6WA 2VPYA 2OMKA 1YZNA 2C2HA 3D64A 4P53A 5LYJB 2HQSA 3I2KA 1GZDA 5JIBA 3DDOA 1EHIA 4ZVVA 4KE8A 4LHYA 1PVOA 3C2QA 2QU7A 2QP3A 3LYUA 5BNTA 3LDUA 2DFDA 2ODQA 4MHSA 1ONBA 2ICAA 5G0WA 5J5AA 1UXJA 2V45A 3KJZA 2DPXA 4F9EA 1FVHA 1XLTA 4CMIB 1QKKA 3PUKA 2CSUA 4MARA 1XCOA 5AHWA 1W2GA 4JX8A 1GKUB 1E89A 2Z1MA 1DWUA 4OI0A 1I2AA 3ZZTA 3ZDAA 1O89A 3ESYA 3VH2A 3PE3A 1QC5B 3K0CA 3RHZA 4E13A 5A3QA 5KSZA 3RVKA 2GM5A 1QORA 2GN0A 2PBFA 2H9YA 1GDTA 1Q2UA 1N2JA 3IAS1 3BXOA 1SZJG 2J7PA 1XVTA 1FFXB 3P4UA 1T8WA 4BNKA 2WQ7A 4E3WA 4JHLA 5AKKA 5A0TA 2IHJA 2X8LA 2ZRPA 3BIFA 1P2TA 1DAHA 1ZN2A 4BGIA 4RUKA 1JRLA 1YF3A 3KJXA 1MRNA 4HXGA 4KC0A 4C7BA 2Y0BA 3BZBA 3TMYA 2VPWA 5C32A 4IKOA 1GYRA 1FJHA 2PSDA 4TRRA 5ICCA 3EF3A 4N9WA 2J9FB 3ZQUA 1U5BB 1A4RA 3GUZA 3PSHA 4FNOA 3EY4A 4HZUA 2B36A 2CUKA 2ZI4A 3D8BA 3K09C 2IE0A 1OH6A 1UT6A 1EXDA 3QUAA 4TMYA 3MUEA 4M1ZA 4U7TB 4EW1A 4UHFA 1VE1A 5AVTA 2DERA 3U4QB 1CK4A 4BFSA 2W0SA 4FBLA 5HK9A 2Q46A 5JQGF 2DBVO 5DSXA 3H9UA 1Z33A 4JWTA 1H2RS 1SIBE 4PG5A 5J59A 4Y2TA 1KETA 4XA8A 5BSTA 2I76A 2P0YA 5FOQA 1K8ZB 1TKAA 1XAJA 4UC0A 3ND9A 1SPBS 1JKIA 3FYCA 1E18A 2FR1A 4DZTA 2G0AA 3ND6A 1C50A 2GR9A 3UKOA 3QU5A 2Q6KA 4W5OA 1PZHA 4OQYA 4ZT4A 1ZJWA 2XYPA 2H8GA 1BDBA 4KQMA 2JLXA 3P0IA 3X2FA 1GXSA 3FBWA 3LGSA 3MGCA 3HJHA 1WPQA 4HZGA 4TKLA 2JGLA 3PHHA 4FT2A 5ENDA 3UGTA 4BNIA 2D1RA 1VL8A 4UNIA 3ZH9B 3WGNA 4L3WA 3BE8A 2JZOA 1G55A 2QQGA 4RTJA 2AFHB 3F5FA 4JODA 5K0LA 5K8UA 3JASA 1Z3CA 2AJCA 1OIXA 3HG7A 1BW9A 3GBPA 1OXMA 1JFFA 1KFBB 1RJGA 1U1DA 1JYFA 2R66A 3F5QA 3T61A 5HFJA 4J4TA 3CIOA 5J63A 1R5OA 2EU8A 2W8BB 1JE1A 2I7DA 3VR1A 5FPSA 3WB0A 1X87A 3I9V6 2FPWA 3F6SA 4J90A 4UE2A 1I6MA 4M37A 3CW8X 5CNMA 3K6SA 2J7PD 2ZUVA 1EFRD 3G2QA 4TRNA 3B2EA 1APBA 1X7YA 1IEWA 1GKLA 1U02A 4MS4A 1U0HC 5GONB 3SHOA 4RVCA 3T9EA 3WRYA 2WUWE 5KVQA 4CTJA 3OQOA 1KP3A 2Q5FA 3ACBA 4HEA1 4KODA 5LZ8A 4LSWA 1AQIA 2XR1A 5AJXA 1R4MB 2NQ8A 4Y2HA 2YBDA 1SOVA 3KZKA 3NC0C 4DJTA 1GAJA 2IX3A 1FP7A 3JZDA 4GPD1 3KSUA 4X94A 4BFVA 4BOYA 3MMSA 2A5LA 2H1IA 4XQEA 3T5MA 3OICA 2PVPA 1D1TA 3O2SB 3R9WA 1VZ3A 4FOTA 4EUNA 1U7XA 2R5FA 3VR6A 2VN8A 3QLTA 1HLPA 1T5BA 2Z08A 4IAOA 4ZVUA 7YASA 1CUGA 2QMOA 1TUEA 2GF9A 3DZBA 2WZQA 3EYWA 3K1TA 4KUEA 5EKDA 3ZUGA 3IEKA 3MRSA 4G1FA 1KMCA 2QYSA 3EFOA 4C21A 2UVQA 2JA2A 4CV1A 4JJZA 5GP1A 4KRYA 1NY6A 1P0MA 1JZQA 1NJ6A 3D0RA 1WY5A 3G2OA 4FLMA 4P7BA 3VKFA 5EMMA 3ICEA 1O4VA 5ALQA 3C15C 2FX2A 2G7ZA 5T4FA 4BRWA 1WUKS 3N6VA 3HE3A 1AC5A 1RYMA 1LW6E 2FFRA 1U1GA 3E2MA 3SC4A 4C4ZA 1E1KA 1JJVA 1HDZA 1RLIA 2WJ6A 2ZFUA 2ZJ0A 1PX0A 1RXEA 5CCDA 1TYAE 1IUOA 4TKUA 3FGPA 2OG2A 1PR0A 1ZFNA 4PQFA 1PUIA 4QXPA 1PDVA 5G3ZA 4F96A 5D2CA 5JYCA 3SVLA 1PFKA 2V8OA 2PKQP 1NPYA 4EL0A 3GT7A 4XFJA 4YUVA 1R37A 3CZPA 1XRRA 2OAGA 1T6ZA 3MELA 4MAFA 3TR6A 5JPDA 5ER9A 3AYZB 2GO1A 2VP4A 2PGOA 3MJCA 2OCYC 4DCPA 4QNNA 5FBKA 1VSUA 2WDZA 1CUEA 1NDQA 3SF0A 3ZI4A 5LDHA 3R5TA 4Y2XA 2D8AA 2C9DA 2DPGA 1Z5OA 1X1DA 3CLSC 3H5TA 1E2LA 3WK8A 2DE0X 3TB4A 4A2QA 4Z7JA 2QYHA 2WA2A 4LC9A 2EP7A 1A4UA 1JYEA 2PHZA 4D8UA 5B4VA 4KG7A 4MULA 1OPRA 4XI9A 3WGJA 3D4BA 2H5IA 2Y1DA 3W5HA 1VBNA 2CXNA 2JIZD 3JPYA 1B43A 4ZVTA 4G56A 1PV2A 3UHFA 5FBZA 1ESCA 1H6CA 5AW6A 3ZWYA 2PY6A 1MZPA 3QVVA 4LJ5A 4P4SA 2EBHX 2HCBA 2AR9A 4J9UE 1R00A 4XTRA 4BMVA 2JD2A 5EJ2A 2W00A 3JYOA 3SFTA 4MB6A 3RHSA 3E6AA 4ALMA 4DANA 3BZWA 4I6EA 4OQMA 1BXRA 3IPCA 2Q1SA 4WV3A 1G19A 1NOJA 2YS6A 5TNXA 3L05A 3DZGA 3EC7A 3FZEA 4KE9A 2C20A 4UPDA 2HCFA 1DS6A 1N3YA 1Z08A 3QEMA 4BO2A 2EEZA 2ZSUA 3ANYB 3G0IA 3OIYA 1O58A 1HRDA 5IZCA 3LUPA 4BYGA 2Z3WA 1C7IA 2ZZNA 2YWCA 3ONEA 2AX4A 3RIMA 4IJVA 3A6ZA 2GWRA 1L5LA 3SFZA 1ZRNA 4HD8A 3S7ZA 3WYBA 4LW8A 2Q29A 5EIHA 4X8OA 4NBUA 3A0UA 3WY9A 4G8JA 3GRFA 1TM3E 1K8QA 4GIBA 4MRAA 4I1UA 2PT9A 2VYNA 4QO7A 3F2VA 1F6BA 1GDHA 2NU6B 1E4OA 3EMDA 4NSNA 1QMPA 4XGQA 2K7FA 3NP9A 4O2BB 5DYTA 2AE2A 3IP8A 1G9SA 1JHVA 3IPRA 4HDKA 5DM60 4Z4QA 1OTHA 1SNYA 3CUKA 5E1OA 5J47A 4QDJA 2HU7A 2RHCA 3V7NA 3AEKB 4QWMA 1V35A 4R1PA 4RZ2A 3ZZ1A 2VDRB 2VPZA 1PFWA 3B7WA 3HJBA 5CHEA 5CVUA 1XZAA 3EPRA 3S8MA 5JARA 2FGJA 3MS4A 1U7TA 4Y2YA 2H9AA 1OI7A 2OPBA 4GI7A 3G49A 4YCJA 1H8HA 1G9TA 2R11A 2HV9A 1O0SA 2UUAB 3FRHA 1K6EA 4XFDA 2FCAA 1QOQB 3Q7RA 1CZRA 1E60A 1YR8A 4JBGA 4B48A 2YC2C 4IF6A 2HQOA 3ANTA 1FK8A 3V2UA 2XT0A 3KLOA 4Z51A 2C5FA 2Z8ZA 3RF7A 5FFNA 4P92A 4YPFA 4NDAA 2YQZA 2YYAA 1V8FA 1JDBC 5EERA 1NI3A 2PH5A 3EGXA 2FPGB 4QOHA 4BC0A 1T3TA 3DT8A 5BWLA 4E5KA 2V6BA 4X93A 2OO7A 1SIUA 3AEUA 3ICCA 3L7BA 3PEVA 2BFBA 2QZSA 5KDLA 4JI3B 4U1RA 2JGMA 1LX7A 4U7FA 2ZKIA 5F1KA 3PB3A 2ZBPA 4JT2A 3PRKE 4TWRA 3VI3B 4YT5A 5A4KA 1Y1TA 2IXDA 3B1VA 3HA5A 5B37A 4JUFA 4JENA 2JANA 2FZKA 5CNKA 3CT4A 1E3LA 3CYFA 2GNOA 3N2KB 2P6MA 2IBMA 1UODA 1YS1X 2F1JA 4MV7A 3SJ7A 1JE0A 2WWWA 2EX4A 2XHEA 3WLIA 2WIBA 2NNWB 2ATIA 3C3JA 2C4VA 1WSAA 2DT5A 2Y77A 4IM7A 4ML3A 3LVQE 5I9SA 2IIBA 1OLSA 3FDZB 4WT7A 3SK0A 1D2GA 1DQNA 3P7MA 3ZWOA 4ZTZB 2IYXA 2FZWA 5DIZA 3SX0A 1S5PA 4GXQA 5AK4A 1QG6A 2OZPA 4XYBA 4GE3A 2QW1A 4AZSA 5JSKA 4CHGA 1D4FA 3HJTA 4N18A 3GRRA 2KMLA 1AGXA 2RKWA 5FWYA 1QIKA 3OPMA 1IWBB 5FLEX 2MCFA 3TPFA 4C7XA 4RZHA 4DRXB 4DV1B 1ODJA 2YIDA 3T15A 3EDYA 3PD1A 3RADC 3TQSA 1PR1A 3EZYA 4YMSA 2MIIA 5FOSA 5J2TA 3U56A 1B16A 2WK1A 3N75A 3OEEA 4GRAA 5BMOA 1VRWA 2JBWA 5LCXA 3I1YA 3BIOA 4Y6GB 2ZSDA 3ZWXA 3FAKA 2YVKA 3C3KA 3JTMA 4TMKA 5EQFA 2XD9A 1FB5A 1H2WA 3NAZA 1L7MA 1G0NA 1K3TA 2DQYA 1E3SA 1FYXA 1JVNA 1NMSA 4FDMA 2EERA 5FUXA 3K0AB 3O3MB 3OCCA 3WO1A 5L3ZA 3GJ5A 1T3HA 2VP0A 4Q4CA 4TV9A 4I4TA 4L16A 1BMDA 1GT6A 4G24A 4II7A 4B73A 5CAEB 4HQNA 1GTMA 4X97A 3ZJVA 2RHHA 3K71B 2GTHA 4EZBA 3DFIA 1O8CA 5A9TA 5K4GA 4P22A 4WUTA 4JI0B 2P27A 2JCSA 2O8DA 5DX0A 1E66A 1ZISA 2PL5A 4D02A 1JIUA 1KAGA 3H3XA 3LZDA 2ZJ7A 4JNKA 4KVFA 1N5MA 1NP6A 5BQOA 2J32A 3K9LA 2C82A 3VPCA 2QL9A 1NW9B 1BROA 2WVJA 3FYDA 1XALA 1ZVKA 3O95A 1XTKA 5E6RB 4ENUA 3MUOA 4XIFA 1L7AA 4KLRA 1K4YA 2XBMA 1TJ4A 4RETA 3U9LA 1BHJA 1O03A 1PZEA 1PNOA 5ERXA 3UWKA 2WTEA 2P8SA 3G2KA 3FF4A 3WRYC 5B6PA 2LR0A 3WHLA 1M2KA 1NVXQ 3EODA 3OJCA 1C4KA 4JHXA 3HKEB 4IICA 1C81A 3K94A 4AS2A 4HG2A 3D2AA 2AG0A 4D4IA 5KO2A 1KJIA 4JCOA 2O52A 1EI9A 4GXTA 4IMRA 4ZQIA 4PZAA 4YAFA 4D4HA 2CYAA 1MC8A 4MO2A 1R88A 2WJHA 3C3WA 1HV8A 2X8JB 3N2NA 3O1HB 1Q19A 4XIYA 4X60A 4YJGB 1NW5A 1HX7A 2GM4A 3KVVA 1GQSA 5G4KB 1YULA 4Y30A 2VJPA 3Q10A 3C6KA 1R0ZA 3OE5A 1K27A 1II8B 3GEDA 3ODGA 3SSAA 5HIMA 5F3RA 3TZEA 1NJ8A 2ERCA 4Q3BA 2WHPB 2HSWA 2OCGA 3HNRA 3FHLA 2HK7A 2I2XB 4YRDA 5HS4A 2XCOA 3I2HA 3N8IA 2Y67A 1KOLA 5FOXA 4M4SA 5F1PA 1E99A 2J9RA 3RFUA 1ESDA 4G81A 2BSXA 2O8NA 3TQQA 3CRMA 4H6WA 4B87A 3PRYA 3VJRA 1OXKB 2DY0A 4Z7NB 5CVCA 4B32A 2QNIA 4UFOA 3SZGA 5AXAA 1L7BA 1UPBA 1C3XA 1QF7A 2IHYA 2JFGA 3CKLA 4U3JA 4M49A 3ZWBA 4E4RA 3JQRA 3TW6A 3GI1A 2UZ0A 2ZB7A 4CQLB 4ATNA 1MENA 2XUDA 2O5EA 2N75A 1G4AE 4MHOA 2GN6A 3L82B 5TT0A 3TMAA 3V1UA 4E1BA 2VQEB 1WF3A 2IH5A 1GKIA 1OX6A 1R0CA 3GJ4A 5KTYA 4PRYA 1I6KA 3HN7A 4RTQA 4YUXA 3N8DA 1Z9BA 3ND5A 1X39A 4MQMA 4N1AA 4A5OA 2PJZA 3A27A 2YZGA 1Q1EA 3GB9A 3UJ3X 4BWGA 1IOVA 3HJGA 2IU6A 3RYFA 2A7XA 5SV2A 4C0AC 2C31A 1LLCA 3AY0A 3C3MA 1LI7A 3FROA 2BM1A 3R6DA 1ZMBA 1ZINA 3W4IA 2PL3A 3AESB 1FFGA 3D5QA 4C0KA 3MWDB 1TF2A 4B45A 1VYVA 5K6RA 3EBPA 3IKJA 1BS2A 3CLRC 3DPUA 3VQTA 4ENQA 4J0CA 1V5IA 4FM9A 1ZUD1 2FKNA 3A9UA 3C4JA 1VCNA 3M6LA 3G9ZA 2C97A 3PEEA 2I55A 4HDSB 1Z5VA 2EFCB 1PQUA 4L0QA 4CLOB 1QUEA 2VVTA 5C1OA 3PEFA 5IYZA 1P4RA 2FQ1A 5LZ4A 3GU3A 3QV1A 1QX4A 4ERXA 3A9CA 4LZZA 1LI5A 1HSOA 1FNSA 3ESRA 3ETDA 4FLFA 1Z0DA 2G70A 1JFFB 2BFEA 2J0VA 3HYSA 1BGWA 3QMWA 4O08A 2O3TA 4H17A 1YVDA 4JP2A 5DLQC 4CLOA 2JD0A 4ETIA 5IYZB 4IIDA 5MHTA 1ACLA 4NJEB 2ZI3A 4BUJA 1B0AA 1MX5A 1WX1A 4OD0A 3E5HA 1X7ZB 2Z6UA 4Z4IA 2Q5QA 2XNCA 4PLPA 4BTEA 2D7CA 1U3FA 3AM4A 1PYOA 4BWFB 1K6XA 4N82A 4RIIA 3T7CA 2OWEA 2Y27A 1OYWA 1RSZA 4ARCA 4OI4A 1OTYA 4HN4B 4I50A 3AWDA 4MUFA 4ZREA 1E7WA 3RWBA 5C51B 2BFFA 2EF0A 2EKZA 1BQEA 5DVZA 3V8EA 1NI5A 3E70C 4ZJUA 1B76A 2GCOA 3L4SO 3LF1A 4D4KA 4ESHA 4YACA 4ZVPA 5JY1A 1Z35A 3DLPX 2IF0A 3M9XA 4MVCA 2O2IA 1QE3A 4AJ1A 1D03A 2WUGA 1K66A 1PG5A 4DC1A 4MINA 4Q4JA 3RHTA 4BUZA 1V3VA 2H00A 1YQWA 4N0PA 3QF4A 4LCEA 3PEYA 1T3GA 1AD2A 2B92A 1O1YA 1S8OA 3JAWB 1C7QA 1Q44A 1QHSA 2WEKA 4D8XA 1M2FA 3PG5A 4R8LA 1ZY2A 3ZD9A 3G2MA 3NUGA 5U1PA 2V6JA 3AR4A 3I9NA 2JBHA 4ZO9A 3ZWVA 2E82A 4WNAB 4YT4A 5L6MB 5IHXA 2WQZA 5IJZA 2I4TA 4URHA 2XYVA 1MAWA 1J00A 1RRKA 2O1SA 4IO0A 5A4IS 4PQEA 3W5IA 1JDTA 3OE7D 3ZTYA 2DJ5A 1XCJA 3E8MA 4FGWA 3MZ0A 1MPXA 1RLOA 2A1TS 4F2GA 2OY0A 3JSXA 1M34E 4P5DA 1S3SA 2OP1A 2Q5IA 1PR6A 4OHBA 1XPUA 3P1JA 4TTQA 4FFMA 4YAKA 1JLLB 3A4NA 3ABZA 4WH0A 1U5CA 4NFYA 5A4DA 2QMUA 5B2FA 1O94D 1ZK4A 1BKSB 3EA0A 2XODA 4TTJA 4C6HA 4DA6A 4HUQB 2X76A 3VA7A 1U4OA 3QMMA 2QTRA 5THKA 3RC2A 4J4HA 3V2GA 1SKQA 2H1SA 1QRAA 4DMGA 1KRWA 2DKNA 3H2YA 3ZIDA 1XDWA 1V25A 4IUYA 4PG4A 2ECOA 3UB2A 3VMMA 2FZ4A 2H2AA 1XD8A 1IU9A 1Q0SA 3ZQ4A 4F7DA 1U1FA 2BM9A 1C4XA 3OT1B 5A9RA 5T57A 4C76A 2NLOA 2REOA 3MJFA 4F5ZA 4WNYA 1RM4A 3IRVA 2WSSA 2Q3JA 3D8RA 3BMOB 3RUIA 2EJCA 1DC5A 2QTBA 1JQ5A 4O4IF 3NO4A 1VLVA 4Q4AB 4MV3A 5JZBA 4PLHA 1GV0A 4QHSA 1U8EA 1KS9A 3P20A 2PUEA 4ITVA 2ZJZA 2MSWA 1ML3A 4KSYA 5KOJB 4Q3LA 2YZ2A 1PW7A 3H18A 4LHVA 1B8OA 1Z4PX 3B1ZA 1UBLS 4IIJB 2C95A 2Q49A 4FQ7A 2DCMA 4Y6QA 4ENVA 4RSRA 4HDRB 2JG3A 3PNBA 5IC6A 3WGMA 1USKA 2CMKA 1TTQB 4WD3A 1A77A 5G0TA 1ESEA 3TSWA 2D3WA 7ABPA 2GK3A 3LYHA 3G2PA 3W2FA 2WVAA 4GP9A 4FCCA 4JS0A 3MW8A 4R8VA 3T06B 4KYVA 1HT0A 1VJTA 2QLTA 2V7VA 4Z4HA 1DLIA 2GETA 5K6AC 3ASUA 3GZ4A 4DOMA 1C3JA 2IIVA 1YL7A 1Q74A 3UAVA 2CUNA 5JAMA 1HOTA 1W76A 3L8CA 1Q3HA 2PZGA 2DKOA 4YRGA 3IR6A 1FZTA 1BAPA 4ACAA 3CNBA 1GQRA 5JAIA 3NVMB 4MQLA 1CZUA 3AQ4A 2P5TB 4V3BA 5ALNA 5BN1A 4YDQA 4C3ZA 5FUVA 5FRDA 1N75A 4OY3A 3QLEA 4S24A 5TS2A 3HKBB 3S1AA 5E3HA 2ZCUA 4FD3A 1BWQA 4MGKR 1Q0PA 2HCTA 3E7XA 1YBVA 2ZS8A 1FSFA 4CMHA 1XZFA 4M0PA 1ORWA 1SB8A 1T0HB 1ZH0A 5AXDA 4MV4A 2AC7A 4EF6A 5DTEA 2FSIA 3MSCA 4HTFB 3DQQA 4K9MA 5CIQA 3PGXA 1WKBA 1M76A 4WK0B 5EXDA 2D62A 2P1ZA 3AW8A 4F3NA 3LY8A 1PT7A 1UKYA 2VF4X 2P9ZA 2YW2A 2ZSFA 4C4OA 3VR6H 3TXXA 2FDCA 2FPLA 3AR8A 4OHUA 3BQNB 3WAKA 4DJFC 2WYVA 1NGSA 3ITEA 4AMGA 2WB2A 3T5CA 3EOAI 3EC2A 3ISJA 2YUIA 3Q6IA 1PG2A 3GFPA 1GVHA 2VFAA 3FUTA 3R76A 3G8AA 2G83A 4X8MA 1ZD4A 2QHXA 3NWOA 1ACMA 1G4HA 3HCOA 5M3BA 3UMSA 2QPOA 1KH3A 3T0IA 4RPCA 1CJUC 1C9DB 1VG0B 3MPOA 5HBGA 5ILOA 2F1OA 2HT1A 1AH2A 3I6QA 4GT1A 4I4LA 4Q1CA 5JCJA 1C9NA 2O6HA 3DFZA 3DLTA 3OMLA 2UXDB 1CNEA 3GJ0A 4CXMA 3O8RA 1CJCA 1N6RA 2ODWA 5I5EA 2DX7A 4RCYA 3HB9A 3H86A 3OOEA 1M2HA 4MMYB 3QYAA 3NM5A 5AKJA 2II6A 2BCJQ 2Q7XA 3ORSA 5IVIA 3KTAB 2WHQA 9LDTA 5LQMA 3O90A 4OYHA 4KMRA 4M2LA 4PLGA 3TEFA 3TVDA 1OGJA 1CD5A 1Y1RA 1KRHA 1TU3A 4N3BA 4XSVA 2TMKA 3G9XA 5E8JA 5AW8A 5AW5A 1AA6A 3T9DA 4DR1B 1C1DB 1NRXA 4DVJA 3LKDA 1SWWA 2BHTA 4IH9A 4EFMA 1JFSA 1SO8A 2JFUA 4E15A 4BO9A 4O2LA 1WMSA 1P45A 2I65A 3L77A 5FBVB 3U4GA 5FQNA 5JSZA 3P52A 5JS1A 3WLMA 2EKPA 3ZHTA 4C6TB 4PRZA 2B69A 2X58A 1NBMA 4JGBA 4KUGA 3QUBA 1FUEA 2P2GA 3I8SA 3HDHA 3R9KA 5JXHA 5A0FA 5KNDD 5B7NA 4RK5A 2JK0A 2IS6A 4UU7A 3RFXA 8MHTA 3TOVA 3Q5DA 3B9BA 2GXQA 1F2VA 3GPIA 3COWA 4YROA 5ECWA 4A8JB 1NONA 3BB3A 4CQMD 3OECA 3T9BA 3E7DA 5FH9A 2RHDA 4JI7B 1DBIA 1P1KA 1R8SA 1P7YA 3L6EA 3M5PA 3EFEA 4BAUA 3HRKA 4V0SA 1VSBA 3UQYS 3V46A 1X77A 3AI2A 1NTRA 4FOOA 1FJGB 3QXCA 4R3WA 2CXSA 5DO9A 3S2IA 3BD7A 1N5JA 1XCBA 2ONZA 4KVAA 2UYGA 8OHMA 1UXKA 4TYWA 4CLXA 2INGX 3DEFA 1FFXA 1SRQA 3DMNA 4OQQA 5D84A 3IBYA 5DF1A 4PC3A 1F9AA 3WK6A 1NE2A 2OFWA 4D74A 2X9LA 5KYYA 4B3MB 3NQ41 3R7LA 4OHMA 3X1MA 5HZGA 3RTGA 2EHDA 1XUOA 4UOEA 3Q0IA 2GBIA 4JI5B 3NAQA 2XB9A 3OLYA 1Y34E 1VPDA 2CK3D 2XX3A 5L51A 1DKUA 3ZDYB 2ZAIA 2G72A 4YR9A 4BKOA 4JOCA 4RIHA 5JVDA 3BAFA 1NW3A 4M9XA 4MR8A 2Z9DA 4X1YA 2P9EA 1UBOS 4C0XA 2G1PA 1JHZA 2G28A 4OK3A 3VO1A 1MEEA 2Q6VA 3JCZA 3EEQA 4KQ6A 4NYIQ 3LG2A 1JHRA 5JVDF 4JUDX 3FAZA 3C6BA 5JS6A 2VDKB 3VM6A 1IHOA 4GI2A 3JALB 2IDZA 4IL5A 4YGYA 5DHTA 5GQSA 3VR0A 4O2AF 4K2AA 5ICEA 4RL6A 3K8QA 2NXJA 2C3MA 3AESA 1PGQA 4RGQA 1J24A 2EJBA 2CL0X 5B58T 3L40A 3VTZA 4RF5A 2HX1A 1PHRA 2XBUA 3DJYA 1TTHA 3GFRA 4GMKA 2XDQA 2OGZA 4QDOA 4J4BA 4PRLA 3O8BA 4QPNA 2ZXUA 1WDMA 2QW8A 2Z04A 2BFPA 5SY6A 1J22A 1PN3A 1QBKC 1KAQA 4WK2B 4TSFA 1CTQA 2VDUE 1HDOA 3SZ3A 1J8FA 2VHVA 1XRPA 1VPEA 1FYWA 5AHXA 3UT0A 3D7LA 2XMPA 3KK0A 4JBXA 4MDEA 1YDMA 2BZ0A 3E5NA 4I55A 1C30A 3W6ZA 3Q87B 2GDZA 3FI0A 4F4CA 1ZI9A 3ETHA 1YFKA 3EIQA 3W4JA 3JTEA 1IBRA 4RAQA 3RJTA 4ZZIA 2FQWA 5C3MA 1KYZA 1Q0UA 1TIKA 1TD9A 2P2CA 4REQB 1A8IA 1WPXA 4V0ME 4F1KA 3VZDA 1GRCA 4LBZA 3GLIA 4ZCLA 4M6WA 1IN6A 3BH0A 3KT6A 1SUDA 2WJ4A 3FOEC 2YWXA 2H6EA 3GFFA 4O4IB 2R8EA 3FNFA 3IDAA 4XD7A 4PGMA 1VA4A 4FNAA 1E3MA 3ZCSA 4BFXA 3Q3HA 4IILA 1SXJA 1II8A 2DFKB 3P2KA 5DBIA 3CUVA 4YP6A 3CNHA 3HYCA 3CR7A 1COWD 1G21A 2ZBFA 1XVUA 2BFDA 2NVWA 4MKHA 3UVEA 3R6WA 3WQRA 1SBQA 4WBNF 1VGRA 2ZRGA 3K8YA 4Q66C 4QIHA 2Z09A 5EXEA 4BNMA 2ENWA 3ON5A 3K0SA 1FC0A 2G0TA 1S9HA 3A14A 3V7FA 5JYDA 3J7AC 4QUHA 1LSUA 3QEKA 5K05A 4CU2A 1PJSA 5SICE 3HDVA 1XQXA 1Y5RA 5TDHA 1VIVA 3QFTA 3V7UA 3EVDA 2BEUA 2CZGA 3JVVA 1OZHA 1NXQA 2IZOA 4Q39A 2VOJA 5BO5A 4HWPA 4TOIA 4Q3EA 4K9QA 2BFEB 3FKJA 3IOYA 5J9FA 5IABA 2OSBA 1AKUA 2B21A 3VC1A 2OZLB 2FEAA 5IKEA 1IUPA 2C2WA 1JBQA 2ATEA 4RE5A 5H80A 4PWZA 3FFWA 2QLFA 2CDNA 3ITDA 1YD7A 1ILEA 4GQBA 1TM2A 2O0MA 4AURA 1M0EA 3TLYA 2NPIA 3WISA 3Q2OA 5LYJA 3T1NA 5CXSA 2DKFA 3MWDA 3WB1A 1HL3A 3FVRA 5JBNA 3NI2A 3RYCB 4L78A 4QARA 2XVMA 3ZV3A 1G21E 2X5JO 4LMPA 5KX5B 5IT9A 3K0KA 4PQYA 5DHQA 5A3RA 1IMJA 2WIAA 1QTIA 3BOSA 1GILA 4N5LA 4REOA 4HDCA 1AN9A 5A5VA 2ID9A 3UUFA 3IJPA 1LB1B 1A97A 3B1FA 4LZLA 1P4HA 1N5RA 2GNAA 2Q3CA 3HCCA 1VHLA 2JL1A 2P40A 3TLXA 1KC3A 2MSLA 1O6ZA 2O2EA 2WWYA 1TK9A 2CF6A 1YQDA 3U7EB 1WM1A 3HKCB 3HKDA 2HPVA 2MYNA 4R2IA 5DOZA 2UUBB 4MQ6A 1U7OA 5AKXA 3ZU3A 1PQPA 3H1TA 5AK0A 1JMVA 1VMEA 2CHQA 4GP6A 4TQ9A 3DWFA 4DIUA 2RHBA 3X1DA 1CJMA 2GILA 1KIMA 2Q3DA 5FNVB 2XE8A 5AESA 2O8EA 3H3JA 2ZZKA 3Q5EA 2VNKA 5DWQA 1VFNA 2RB5A 5ESWA 5EJ4A 4LY0A 1BIFA 2H9IA 4JJAA 3THYA 3F9CA 1S01A 4YRIA 1E5QA 1GGMA 5SZKB 2L0XA 2ZUFA 1X74A 3DO6A 1AKEA 2B6NA 1RZUA 2W2KA 1I7DA 1Z6AA 2CMGA 2C2YA 2F8SA 1W5SA 1BA2A 5KTTA 4CMEA 1E2BA 3EHDA 3GARA 2IOFK 4DQKA 1RZRD 3DAOA 3W9UA 4B2LA 1AOXA 5HK8A 3L3BA 1W36B 3HRHA 1IN1A 1AIPA 1E1DA 1R18A 2HLDA 3ZVRA 5JQGB 1VRVA 2A0KA 2JFPA 3ER8A 2YIJA 5ITWA 1YWGO 1O77A 2P6UA 3E3NA 3IILA 3W8RA 5K0BA 1HEIA 4IWNA 2CCJA 3PC8A 1KBZA 2BDTA 3MA0A 4LCBA 3WYCA 4HGYA 4B4DA 4OGWA 3JRWA 4RIFA 4DHEA 3H2GA 4O4JA 3T41A 3JQ9C 4N8EA 1T36B 3A6EA 3OAAD 3UUEA 5IF9A 4JR1A 2BI4A 1CDOA 2PAAA 2WYHA 3QHQA 5I47A 4HLQB 2H2IA 4LEIA 4ESVA 1E1RA 2WHEA 3LIIA 3M5DA 3RSQA 4QQRA 4DT1A 1OVMA 3E23A 3U3MA 5ALGA 3FCAA 5DNAA 1I94B 3QWFA 4TKZA 3TLKA 5DMHA 2GKSA 1LU9A 1LLFA 1VECA 2GRUA 2PPLA 4EOGA 3FTEA 4AX4A 4WHMA 3ZWCA 2JAQA 3BICA 1EKXA 5H4GA 5J4LA 2XUQA 1RADA 1TQ2A 3IVRA 1DJQA 2NAPA 4K9LA 5FEMA 3WL7A 4YAIA 1XWIA 1MLDA 1RVDA 1IXKA 2WP8J 3KLMX 3DTTA 3MTDA 5E3IA 3U19A 2WY2D 2CNNA 1WD5A 3VYVA 1KWGA 3QVOA 2WV9A 1IVSA 1JJ7A 1Z8HA 3FYUB 1I5EA 3QVGA 5CDHA 1MFZA 2IOQA 1QIFA 2AOWA 4XB1A 3RYIA 2CHGA 4BX0A 3H1FA 4K88A 4EI2A 3DNPA 1XG5A 3IO5A 3FGNA 3LU1A 2Y0EA 1JMYA 1P2DA 1W8IA 1YGYA 4GGMX 1E8DA 3F49S 4NH4A 1YC2A 1OX4B 5EP2A 4ZARA 5F76A 4EA8A 1C1HA 1DC6A 1S1MA 2NSHA 2JIRA 2ZUCA 5IAAA 3L02A 3JD0A 2AD1A 5LQNA 3GEGA 3QLJA 4GNKA 1FJXA 2FB9A 3BCUA 4KJXA 2EJTA 4Q3KA 4QBTA 4E6PA 1EFDN 4YRLA 2X9GA 5HZKA 3OZDA 2V4UA 1XN1A 4BBZA 2VTEA 4LN1A 3IIMA 4E5PA 1GAXA 3IHWA 3DOIA 4XGIA 4D0SA 4G5RA 3TTXA 1X0XA 4DA8A 1VLLA 4DGSA 5TPWA 4ZA2A 2VRBA 4B33A 3VV3A 3UB4A 1ONSA 1Z88A 4CMEC 1Z26A 3K5WA 2I3ZA 1A9SA 3GVIA 1YR2A 3L6RA 5KWJA 3ZDDA 5CFOA 4BNHA 1RLJA 1SMKA 1GTSA 3N8GA 3VZRA 3ZDBA 1U9IA 5C8YF 5KS2A 5DW3A 2V6MA 2A67A 3ZU2A 1PEKE 2AN1A 3HKBA 4I4TF 3S1AB 2VTBB 2J5BA 4MGIR 1OC4A 1KSFX 1D5CA 3GH3A 3O8LA 2B4TO 2ZIZA 1EWRA 1IIBA 3LHDA 3LUDA 3NIFB 4KR6A 2AZMA 5CURA 2NX2A 3ZX4A 1XD2A 1QLHA 1KF0A 5BUSA 4CMGA 1CJVC 1SCIA 2O9JA 3LT2A 1N2XA 1NJFA 3OSUA 2WSYB 3ZYCA 1P2GA 4URWR 4HAVA 4FN5A 2HV8A 1ICIA 1ZHFA 1QHIA 2PPVA 2NU7A 4KK4A 3BMQB 1QFSA 1EE9A 3C3EA 4DLYA 3DUFB 4GW3A 3VOBA 2D3TA 3SIRA 5CB4A 1D4AA 5HRAA 2Y1XA 1HT3A 3LUKA 1KOGA 4R2KA 1UOEA 5GGXA 3IPLA 1Y81A 1B3RA 1SK9A 2WSBA 3HWX1 5F77A 2P3LA 1CEXA 3FPAA 4HWKA 4NE2A 5JE8A 1Q12A 4NU8X 3WHKA 3D8SA 1PP4A 2GZ1A 3DVLA 3NHWA 3ROXA 1VI6A 3FNGA 4KAFA 4PGFA 1RQGA 1UC9A 2JIBA 1V7PC 4IOLA 1RQPA 1A9OA 2QGZA 4KKVA 4NXNB 2DUMA 3B8EA 5F98A 4DM3A 3GVHA 2VK2A 2WSLA 3ZLUA 2Y4NA 4KN6A 5JPIA 2GXSA 2ONCA 1KXZA 1AZLA 4NY1A 4X1KB 4HNSA 3T4UA 3DEKA 1K4MA 4BLRA 1RW4A 3FFXA 4KTTE 3GEBA 4K8RB 5TF4A 2IYLD 3DAGA 4QVKA 2NTEA 1LD3A 4BDSA 1WDLA 4IFTA 2VF2A 2OA0A 4BAZA 3S8YA 3ZDZB 1U0JA 3P2OA 1EP9A 3RD5A 1KR5A 2NQTA 5LD2B 2WYWA 1ULUA 4G0MA 1GU0A 3HUUA 1FRNA 4X45A 5LMNB 4O59O 1JDUA 3HMKA 1JX6A 3HB7A 1B0ZA 5JRZA 1ISRA 4B82A 4MAAA 5IKOA 4C7KA 4RVFA 4OX9Y 2VP9A 4Y1RB 2UZ1B 1RRMA 3TQHA 3W78A 2RHGB 1T0PA 1Q1NA 3GGDA 3HDTA 3GMSA 4IIBA 4MVJA 5C8YA 1WBJB 2DJIA 3AUFA 1J8DA 3JZMA 2HWYA 2IPOA 1F12A 1P9LA 2C7BA 4MIEA 5C31A 3VKGA 2VBIA 4OMDA 4TKUB 1VCIA 4DR4B 1BXGA 4AZVA 1J90A 2VQ6A 3M9WA 5T67A 1BE6A 2OV2A 3K2BA 1FDSA 4EKEA 3EPLA 2BEWA 2O1XA 3EULA 3TLZA 3W6NA 2OGWA 5ALZA 2C1ZA 5AVWA 3FJ1A 1UM9A 2F62A 4XYEA 4RYDA 3I1FA 4HGOA 4GUAA 4EUKA 4FBGA 4PCAA 4FMDB 1POXA 3H5VA 5LZ2A 2X22A 4KX3A 4RV4A 3NHKA 3UTCA 3UENA 1X9IA 3BJZA 3QKUA 4XB2A 4TMTA 4E1VA 1M7BA 3H0EA 4FYIA 4WFQA 1L5KA 1F6WA 1E59A 5IEJA 2ZWPA 4UNPA 4AJ9A 1X80B 4MUAA 1XJ0A 2EBFX 4BVAA 4GLLA 1XCLA 3M83A 4MW7A 1NXVA 1US8A 4CDRA 4W7SA 3HEMA 3CKYA 1X7YB 1T9DA 2G71A 4MS4B 5GONA 5ILGA 1PGPA 3LCCA 1Y5MA 2H4JA 3IE2A 2CKMA 5ESDA 1H5UA 3O0DA 3QW2A 2AOUB 1WSBA 4DEYA 1RWVA 1ZGGA 1JNYA 2REQA 5COQA 4KGZA 1XI2A 3DBLA 1QFMA 4OATA 3DMTA 2OZVA 2OENG 3SX2A 4AO7A 3BX1A 2Z6VA 4EJSB 2O7RA 1Q20A 5A5FA 4OF4A 1QYCA 4FDUA 1YFJA 2PT7A 2KWIA 1GQQA 1U2GC 3R7AA 4I8XA 5ALPA 2VJKA 4A82A 5B7GA 1I01A 3PFNA 1QRTA 5FCDA 3RU3A 1OFUX 2GBPA 1I2DA 3SHTA 4DUGA 5A6VA 5K0EA 4R9VA 1M8JA 1HDCA 4Q47A 3L0PA 4EF5A 5TX7A 1DX6A 4AUEA 2HXYA 4IXTA 4MV6A 4PFJA 1GKKA 1MB4A 2FMKA 5GZ6A 4YXWD 3E15A 4KIGA 4W99A 3QPVA 3S5UA 5I8ZA 3QU2A 4DY6A 3ZI7A 5L6LB 2GYYA 1XVLA 4ZEXA 4HDSA 4AKTA 3TD2A 2CNOA 1EESA 1KEEA 3V4ZA 2IXAA 2XYRA 3GZNA 2AG1A 2YCBA 4KITB 4DQDA 4DV0B 5DRTA 3T1HB 4QUIA 1QQ5A 5F7XA 2C84A 1IK4A 1CS0A 2VNSA 4G5HA 3RRBA 3QEAZ 3N28A 2CXXA 2FSGA 1B7GO 5F35A 2X5XA 5KNLA 1E1QA 5AKZA 1XAIA 3IRUA 5CJPA 4YWHA 4P82A 3SSNA 4MUYA 3WFZA 1YZTA 2HHJA 3FH0A 3S99A 2OBFA 1EDEA 3WNDA 3KRTA 4HC4A 4IKPA 2ZU0C 1CUIA 3D1LA 3IUJA 4BFTA 2BN4A 3FPEA 5DI3A 2XT9A 4JLSA 4WACA 4P36A 3S6JA 4OHXA 4NC9A 3E1SA 1S6YA 3ZHCA 5BR4A 2V1XA 1E7MA 1Z5UA 3PJFA 4B3GA 4U7GA 3STUA 3U3DA 1OGYA 2WWIA 6ADHA 4EBFA 4GPEA 3CT6A 3NIBA 2AWNA 2ZYUX 4GD3Q 4H7HA 3W77A 1YV9A 2ZYHA 1TGVA 3NBQA 4J75A 3AUJB 4JVNA 3MGBA 4I55F 4QXRA 2P7IA 3QPDA 2JEYA 1O94A 1ORDA 2L42A 2YX1A 2VXBA 1I5RA 2CCGA 3U48A 2VDQB 4XE5A 3O91A 4YTEA 3TUIC 2G04A 2WAOA 3D0QA 3O4FA 3QYFA 1GPKA 2HA3A 3IQFA 3K5IA 5H59A 1DX4A 2JGFA 1AQLA 4P3KA 1UR5A 4JL8A 5B4UA 3EGEA 4EY3A 3KSDO 3RVNA 4H3VA 3VGJA 5A7FA 4FUTA 4IV5A 1BJTA 1CZKA 2HNAA 3KYDA 4HFRA 1NURA 2WC1A 1AUXA 2FUCA 2X0RA 3QEJA 4NFHA 5FR1A 2HJGA 3HPRA 3Q5GA 1JJFA 2BKVA 4RFSB 4LDAA 4PW0A 3ZHXA 4UAGA 4P8RA 5E7MA 2OEPA 3M6AA 3ZOKA 4ZXFA 1A04A 1N77A 5IBQA 1IBKB 5GONF 1XEXA 1NW6A 3Q3IA 1GUBA 1WWKA 2IUTA 2VNJA 3BBPA 3HRIA 3V1MA 5A03A 4CQMB 4B3DA 1NJ2A 1P0QA 4BLTA 1CY2A 1EP1B 4M88A 1U9YA 3SX4A 1CUSA 4GMFA 2KLHA 2BRUA 3RVOA 2XKBA 2QQEA 4RTRA 3DS8A 1E7SA 2FCRA 2H5EA 2I1WA 2P78A 3F5SA 4TQAA 4DBLE 5LJIA 4OU5A 3EIUA 4O4LA 3AFNA 4BQIA 4YP0A 1ODKA 3Q7IA 1QGOA 2PUAA 3T9AA 1ECJA 1M8GA 2ZIWB 2B8NA 1E1MA 1L7OA 4TZ0A 3P9SA 4OAOA 3DE7X 5CYFA 5BYJA 1NP3A 1OV4A 4TKMA 1JIKA 2BGUA 1N7JA 3I4FA 4L07A 1HNXB 1OX4A 1HL7A 1E3EA 2PVCA 2OMEA 4UHEA 2LUOA 4KW7A 4LMRA 1Q0ZA 1BCSB 4K6CA 4UAJA 3O74A 2PA0A 3CZMA 4GBJA 4MK4A 1MU0A 4JEHA 4ZAFA 2GX6A 2OGUA 5AXCA 3HO8A 3HCDA 2H7XA 1PJBA 3RIHA 4EUHA 1YJBA 3HFJA 4M1SA 1VJRA 2QM3A 4R8KA 2V6IA 4K9NA 1QRDA 2JGDA 5HCNA 2OECA 1B1CA 4BQEA 1JQAA 3SBOA 1KY5A 1ZEJA 3KV3O 2JB9A 2PAFA 1LVGA 2HZBA 1EG7A 4NE9A 3TG8A 1HQDA 5LMCA 2I4NA 4RVOA 1UDAA 1LDNA 2A6PA 2G9QA 1FW6A 2TRSB 3BD9A 4MQFB 1P7VA 5DHFA 5F78A 2HMSA 4BKQA 1M6NA 1Z7BA 4DDHA 4X8LA 2B0CA 1YS7A 3NHBA 1JLSA 3GLKA 4G85A 4BQPA 3OLCX 3I09A 1BXRB 4YJ3B 1Z2AA 4CR7A 1WCWA 3UT5A 3H4MA 3I9JA 3DZCA 2GRAA 3RCBA 1U8UA 1JH8A 1Z29A 2PT5A 1LV7A 2ZJ3A 4F4JA 1D9XA 4P7FA 3OM1A 1Z0SA 3HFGA 4MGZR 1MAVA 3ADPA 3VAAA 3C7AA 4CL3A 2RBEA 3EVFA 2WYIA 3EQ9A 3N7AA 5HTKA 4B17A 2WG1A 3SIPA 4X7PA 4AT1A 3CVUA 4K0KB 3SYMA 1LDBA 1ZRSA 5BVGA 1E32A 2N9UA 3JR3A 4D3FA 1GM5A 4N48A 1Z4MA 3ETGA 3JYQA 5AW4A 1PJ8A 2BPOA 1XNRB 5KOHA 3OT4A 3TWOA 2G4LA 3IA7A 1QU3A 3IOEA 3BM5A 1TAUA 2WD7B 4EG0A 3L0CA 3KETA 4CTNA 1W48A 4ZEWA 2VP2A 3HY6A 4DR5B 2R8RA 1G18A 1K88A 4HLCA 4JJ7A 2I6QA 3FPGA 5DK6A 3RU9A 5CEFA 3SYLA 1G5RA 2QT1A 3FSEA 1T6BY 2A5YB 1W581 4XWAA 1QHNA 3QKRB 1FTNA 4OL9A 4ZCMA 1H6BA 3H1BA 1SCAA 3DKRA 3NAMA 1EBBA 2AD5A 3QPUA 4O29A 3AVPA 3H5NA 4AFNA 3AKEA 4CCWA 5ITSA 4MUGA 3MMZA 3HH8A 5JCXA 3HCRA 1QIJA 2GQ0A 3HYRA 1RI1A 5KWEA 1JGTA 2QIOA 4Q7JB 5CVJA 4QUDA 3HVJA 3AR9A 2PD3A 2MOKA 1SOMA 1V5EA 2GHRA 4WY5A 4C0SA 3R3XA 3NW9A 4GH5A 2G8NA 4RQUA 5BSFA 3L7IA 5I9LA 5DPMA 1FP6A 2G9UA 5JSQA 1I2BA 1H2BA 1G8AA 3O26A 5E0KB 1NQTA 4QOEA 1P29A 2PUBA 2RMKA 2VYCA 5EHNA 1Y1PA 5H70A 4RTKA 1KI1A 4A03A 1IWPB 1QHFA 2JAHA 1W75A 2ECPA 2IYEA 2P4UA 3NKVA 3QFSA 1G8PA 3LRXA 3NNSA 4P35A 1Z5ZA 4XVHA 6CHYA 2E4ZA 1O0CA 1GGKA 2HW8A 2YDXA 3KO8A 4F71A 4XR4A 1IFXA 1EM8A 2IPXA 3DLIA 3H8SA 4EHDA 3PEWA 2ZT5A 3HMQA 3KJEA 1GNSA 4I9FA 2X6RA 2IP1A 1HRKA 1KPHA 5A5EA 3LH5A 2GK6A 4KRGA 1N78A 2H08A 1M73E 1FDTA 5AKIA 4YONB 1XX6A 4D8YA 5A6SB 3SE7A 1SOWA 1XDGA 2PO7A 1N5IA 5CM9C 3R7DA 4D3XA 1B00A 4BASA 5C81A 4W1QA 4DLWA 2R65A 3AB8A 1B6RA 2QTVA 2ZSKA 1T5LA 3KR1A 2R1VB 4BN4A 1XU7A 3DMFA 5TLSA 1KTIA 2G09A 3I61A 5HILA 1EUZA 3KSZO 4G5FA 3RSHA 3EVAA 4FR2A 2GFIA 4CFYA 4DUPA 4DR2B 4N8SA 4B79A 4D1YA 1HZZC 1XVIA 2B8WA 3ZGXA 2NU9B 3V34A 2J5XA 5LLDA 4QHYA 2JIDA 3S2ZA 5MN6A 1E2JA 1C4OA 2E21A 3G9UA 1IPFA 2C2OA 1US8B 3NV9A 2GXAA 3FMVA 2RGAA 4JK3A 4KKXB 4EBBA 4D5EA 5FBLB 4IVPA 2XTJA 3AETA 4WZAA 1BX0A 1F0NA 3JRXA 3LLUA 4XJSA 1YJQA 2B30A 4KPEC 3RROA 3QW4B 1MJGM 5JJKA 2CLKB 5FF9A 5BSRA 3F4KA 3PQ3A 3VR6D 3WLPA 4Y9SA 1JAXA 4CUZA 4EQ6B 5JXIA 1ENZA 4H7DA 2H63A 1NMEA 2BM0A 5ECDA 4C0QC 2H59A 5AO9A 1MCZA 4L6IA 4V0MA 1RTTA 2OYRA 1YIOA 3PJDA 4X95A 3KVOA 4XDGA 3K6RA 4QGSA 4ISBA 2E5LB 3OPYI 1CXZA 2BKLA 4CTOA 1OI3A 2ADMA 4IBOA 2EV9A 4DSUA 5I9BA 1JFRA 1NOIA 4L15A 5J2UA 2ZM5A 3Q3GE 4AN0A 3MOSA 4B74A 2YICA 2C8KA 1F9EA 2X15A 2EZ8A 3D4PA 4RZXA 2ZYSA 1U2SA 3V7WA 4BX8A 4QTUB 4LYAA 3BF8A 1VJCA 4MW4A 3A4IA 3KBOA 3C16C 4TVOA 4UQLA 1YFLA 3OFKA 2PXCA 4EATA 3U7IA 1KEPA 4K6GA 1OWLA 4XWYA 1N7GA 4JYCA 1L5QA 1RYHA 1XRLA 2PUCA 2WM8A 2C2ZA 3CSUA 2K2QB 5JI2E 4JVSB 2NU7B 4DLTA 2UYQA 4R8RA 2XNSA 3RSGA 1K4KA 1T8PA 4MP3A 4GL4A 2O4CA 1GUYA 2YRFA 2ZJ2A 4LE0A 1NF2A 1SVSA 4Y9DA 1MT3A 1SEVA 1ZBQA 2Y4OA 4M36A 4D9FA 1FDWA 1MA3A 3ANXA 3O7WA 4OHWA 1P19A 3URMA 2R6HA 3GJRA 2ZSAA 3ESQA 5AIBA 1DG9A 1KY2A 1W85B 1YZHA 3JQ8A 3HVUA 3NT4A 4GLFA 1QWOA 3F67A 3V8BA 4EY7A 2JBAA 4I5FA 5GV7A 2OV1A 3NATA 1LDGA 3R77A 3T5DA 4BO7A 2BFMA 1JG3A 1QGUA 3ABIA 4H6PA 4BV8A 3S8EA 2VBFA 3WIBA 1Z73A 3DXXA 3L6BA 2H57A 1GZSA 1JHQA 4PX2A 3EXG2 2Z2JA 3NCHA 3AUXA 4NE7A 2AEJA 1LXCA 1MOZA 2VHZA 2A94A 3HJAA 3J80A 1X92A 4CIDA 5LC1A 1ZU4A 3KKEA 1Y7PA 2DPMA 4XUCA 3Q7PA 1I9GA 1U2GA 1G2PA 1DJOA 1WTCA 1RAAA 1BX3A 3ET4A 3CUEF 1NYTA 3EZ9A 3HU3A 3NX4A 3RTAA 1MVNA 1Z4NA 2XUFA 2ZITA 3PDCA 3D54D 3WR5A 3LNTA 3BH6A 5KIAA 2NZVG 2YVAA 3UWOA 3GNSA 2AOTB 2GO7A 3VTAA 1VHWA 5CB8A 4QPDA 4L9WA 1Z0JA 2OORA 1I3CA 1H8HD 1RYYA 4IIUA 1ZK3A 2PEZA 1D0VA 3JQBC 2XGOA 4EO4A 1KO1A 4BMXA 5J40A 4Q4LA 5CFRA 4HLUA 4B71A 3P2YA 1WE2A 4WZBE 1YVRA 4H08A 2RKBA 4N3CA 4C03A 3IQWA 1QQ6A 4BGUA 5KHOC 2JAWA 5ALIA 1G20B 3WDMA 2V7GA 4DL9A 1UJ2A 2FWIA 4M6WB 1EDOA 2X0NA 3KQLA 2IYNA 2X3YA 1WXQA 2AGVA 4RHXA 4R1MA 3C3BA 4H0CA 4WZZA 2UXBB 1F8UA 3VRHA 4A73A 2XW6A 5HF8A 3PDIA 1L4UA 2ZJYA 2VYND 2IC5A 3E9DA 4G3XA 3ZK8A 4A0RA 1WVGA 3KPUA 1WP9A 4DDMA 2QUZA 4LJYA 1AQYA 4ED9A 4LYHA 2FW1A 5EIBC 3LWBA 5KTMA 2VRCD 3M4JA 4JITA 4KNYA 1HMYA 4Q00A