1GCIA

The 0.78 angstroms structure of a serine protease-bacillus lentus subtilisin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN
publication title The 0.78 A structure of a serine protease: Bacillus lentus subtilisin.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Serine protease
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1998-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1gciA00
1WVMA 5AMXA 1TO2E 1AV7A 1NDUA 1P7VA 3BX1A 3QFHA 2PWBA 3SQOA 4KPGA 1KDZA 3DVQX 3F7MA 1TK2A 4C3VA 1BJRE 2IY9A 1KE2A 1DBIA 4LVOA 3F7OA 1PFGA 2B6NA 4KG7A 4ZARA 1SBCA 1Y4DE 1AH2A 1SCJA 3AJ9A 1SUBA 5AVKA 4OMCA 1WMFA 3EDYA 3PRKE 3DVRX 2W2QA 2WWTA 3D9QX 1SUPA 2X8JB 1Y33E 1OYOA 3T41A 1ZVJA 1THMA 1BFUA 3F49S 3TI7A 1HT3A 3DW3X 3GCWA 3OSZA 2W2OA 4JP8A 4ZOQI 2W2MA 4H6WA 1S2NA 1YU6A 2G4VA 3QMPA 1BFKA 1CSEE 4NMXB 3I37X 1OT5A 5JMOA 1SBTA 2Z2XA 2IXTA 1TO1E 1IC6A 4BWGA 3PTLA 2Z2YA 5FBZA 1C9MA 1BE6A 1OYVA 1SIBE 4NE9A 1AVTA 1KDYA 2PKCA 5JXJA 4HX2A 1R6VA 1R0RE 3EE6A 3AFGA 1MPTA 1KDVA 4LVNA 1C9NA 4DJ5X 3WIVA 3VTAA 1A2QA 3D43A 4K8RB 3GT4A 3VHQA 3GT3A 2XRMA 5ARBA 3DE5X 2W2NA 1TMGE 5FAXA 4OV6B 3DE3X 1IAVA 2ZWPA 1SVNA 4B5LA 1MEEA 1EGQA 4YN3A 2PQ2A 1SIOA 1TM1E 1CNMA 2ID8A 2Z2ZA 3P5BA 1TM4E 1T1EA 1Y34E 1C3LA 3LPAA 1P8JA 1BE8A 1GCIA 5JXHA 1V6CA 3SICE 5AQEA 2SBTA 1NLUA 2DUJA 4HVLA 1V5IA 1Y48E 3QTLA 1KE1A 3LPDA 3VV3A 1LW6E 1P7WA 1UBNA 1SCNE 3AJ8A 1YJAA 3ZXYA 3DVSX 1TM5E 4AKSA 3Q40A 1Y3BE 1BH6A 5K7SA 4H6XA 3VSBA 1Y1KE 4FONA 2E1PA 1PJ8A 1ZVKA 1AK9A 4GI3A 3Q5GA 4CG0A 1SELA 2V8BA 4AKTA 2DQKA 5ARCA 1VSBA 4OMDA 1GA1A 2P4EA 4WOBA 4WOCA 1S02A 1Y3FE 3WIUA 5AVJA 1SBNE 4DZTA 3DYBA 2XTJA 3DE1X 1NDQA 3DW1X 4DWWA 5JXIA 1AQNA 4KB5A 1GA6A 2PYZA 3DE2X 3DE6X 1GNSA 1WMDA 1YJCA 1SPBS 1SUEA 3BPSA 1EA7A 1TM7E 2WUWE 1DUIA 3A3NA 3H42B 1GTL1 1SBHA 1PEKE 1PTKA 5I9SA 2ZWOA 3I2YX 5FFNA 4H6VA 3I30X 3CNQS 2TECE 4Z2AA 1Q5PA 1YJBA 3DDZX 2QTWB 1SCAA 1Y3DE 1WSDA 1ST3A 2WUVA 3LXUX 3A3PA 1XF1A 3I34X 2GKOA 2Z30A 2W2PA 1SBIA 1R64A 4RYDA 1GT91 1Y3CE 3DWEX 2PWAA 2WV7A 2ID4A 1T1IA 4CFZA 4NE7A 2ZRQA 4I0WB 3DE4X 1GNVA 1SUAA 3EIFA 3VYVA 3DE0X 2HD4A 1T1GA 1JEAA 4MZDA 2ST1A 4CFYA 3ZXXA 2Z58A 3WHIA 5CW1A 1SCBA 1SUDA 5SICE 3WQBA 1SUCA 2SICE 1ST2A 1SCDA 1S01A 1AF4A 1Y4AE 3CO0S 5B1DA 1C9JA 5JXGA 3TECE 3LPCA 2Z56A 5B1EA 2SNIE 2Z57A 1GA4A 4M1ZA 3UNXA 2SECE 1SH7A 1AU9A 5ARDA 4C3UA 1TM3E 1GTJ1 4J94A 1SIUA 2DP4E 2PMWB 3A3OA 3DE7X 1GTG1 2X8JA 3L1KA 3VV2A 1Y9ZA 1TECE 1WMEA 1SN7A 3TI9A 3GCXA 2HPZA 3BGOS 2PRKA 3HJRA
chains in the Genus database with same CATH superfamily
1I1HA 1PT6A 3FI0A 4FHDA 3JYQA 5JNSA 521PA 2AF4C 3WDKA 4D8XA 2IUEA 2UZ1B 4U00A 1IHXA 1YULA 3VHXA 5JCXA 2C2MA 4P53A 5KWVA 2DLCX 3ABSB 1VLQA 4IR7A 3TYXA 3FTEA 3A06A 2WJVA 1WUKS 1N0VC 4NU5A 4E6PA 1F6WA 3TW6A 3NIFB 3GDFA 4X62B 3Q88A 3N76A 3PC3A 2WTAA 4U2FA 3QVUA 2R7MA 1CEYA 3D3JA 4L8VA 8GPBA 3M4JA 4D0RA 4LOKA 5K6RA 3NC4A 1GGNA 1NYQA 2XMBA 2R8XA 2YVUA 1MUUA 4FMCF 3TVTA 3ZYCA 3OHSX 2WMNB 1ZD1A 3CX8A 3M5WA 2XMSA 3OJLA 4G5XA 4LF5B 3I0MA 2IY9A 4MCJA 2DFNA 3QELA 2YMQA 3QUBA 3GVPA 4LBVA 3CF6R 2GPYA 1H2BA 1GITA 4TWRA 4TS9A 3AZOA 1ZY2A 5IARA 5K45A 1M1YA 1UP7A 1SC6A 2R8EA 1CUWA 4Z0TA 5G4KB 4KXXA 4B6SA 4FWTA 3L92A 5B1IA 1FX0A 1H5UA 3BAFA 5KVQA 2JHAA 1IRIA 4II3A 4XSGA 3VNAA 4BNDA 1VMEA 1H0KA 3WYNA 2B4YA 3RT9A 4NAVA 1N5KA 4BTVA 1IXZA 4R9SA 4MR7B 2B8WA 1SUBA 1V7QA 2EEPA 3JVDA 5F9MA 2AQIA 1KMHB 3HN2A 3AF2A 4LS3A 1ESNA 1KS2A 4X90A 1WDTA 3DAOA 5CHYA 3QQ5A 3BUSA 1II0A 3FZQA 4PBRA 1E9VA 1T1SA 2BSAA 3ETNA 4MV5A 4M1WA 2NO1A 1KJJA 2YS7A 5K01A 3D9QX 2JEYA 3DFMA 1MTZA 3P5SA 2G5PA 3BILA 2O3SA 3FMGA 4YT2A 2VJMA 3MUNA 3IAHA 1WXFA 3NT4A 2JZOA 2PMDA 5K0BA 3PWKA 2PZBA 2QYHA 3L84A 1LNZA 3M6VA 1KKLA 1WZUA 4MUIA 2HNAA 1H2XA 4U63A 1JEJA 4K6GA 5IC5A 3P4UA 4D56A 3I64A 4OB6A 1P29A 4YVFA 5DF1A 2PVSA 3RYIA 4X45A 3EF3A 4F93B 2HJVA 1J39A 4A27A 3OVMA 5KCZA 1DP4A 1MO4A 3UBTA 3EIQA 4IG4A 2AE2A 3SZGA 4ZOQI 2BGUA 1MFPA 4TSFD 3S68A 5FNVB 4B2PA 1RWPA 2W2MA 4BUJA 2QVXX 5JCOC 4OI0A 2XUQA 1RAGA 3FHOA 4KNVA 1H94A 2FPIA 3NNDA 2ZR9A 1YU6A 3GCGA 3LBNA 3ZHCA 2WWYA 1X7XA 4IBOA 4PX5A 3K6SA 4GGMX 3U60B 2X1HA 3U44A 2VRCA 4NFHA 1QK3A 3CTPA 5COQA 1OT5A 3UMBA 5CDGA 1RRGA 2VJNA 4NBKA 3DTVA 1CS4C 1LY1A 1SZDA 2XVZA 3W2EA 2J41A 1W85A 4YDHB 4IG9A 3INYA 4U7TB 5EYPB 3E1GA 1ZK3A 3PICA 2OHXA 1QG0A 1I4WA 4B17A 3EQ9A 5ELLA 3UFBA 3VR6D 2FJPA 5LNK1 3LI2A 3S1AA 3CZ9A 4JT4A 5B7NA 3DOOA 2YJ4A 3ZH2A 1M76A 4OH1A 4DBVO 3SHTA 4EAQA 3FKJA 5IWCA 4J3NA 2DKNA 1XZMA 2BKVA 3ZHSA 2YTZA 2ZWMA 4HFJA 1XNJA 5GV7A 1TI7A 2XMDA 3GVHA 4JEIA 3LIPA 4G5OA 3WL3A 3WP1B 4DW8A 4EMTA 2BBSA 1IY0A 4QECA 1Z0DA 4PGMA 1J0DA 4LVNA 3RQSA 4YRIA 2EP8A 3THYA 1XKQA 5NULA 2HWUA 3CFYA 1RCTE 5E3HA 2EJUA 3H2JA 1JG3A 1ZRNA 4MPPA 4G2NA 5JPCA 1KWGA 3D3NA 1YL7A 2QLFA 2QLJA 1K92A 1R6AA 2ECQA 2Q3EA 3FFWA 4WJLA 4GBGA 8OHMA 5LXTB 2B2NA 4F2PA 1QFXA 1X38A 5E2BA 1AQYA 4R2IA 4RSGA 1M1ZA 4HGNA 1TPZA 4KO3S 3QKTA 5K8CA 1IEQA 1YHZA 3KUCA 5JE8A 1BWPA 1JNXX 5G4LA 1BXGB 1W8IA 3A6LA 5FTNA 5K3FB 3HDGA 1UOQA 2HB6A 2OTCA 3RTGA 4LISA 1WB6A 4V0ME 1K1EA 3PQFA 3LWDA 3DZGA 2WJZB 2GBGA 1USVA 2VZ8A 5DASA 4QYWA 4BX0A 1ODLA 3B5IA 4CT0A 4BQPA 3N0XA 4R2LA 1MJGA 4GQIA 2O2YA 4MQMA 1DEKA 2AYXA 4H7HA 3TM4A 4A4DA 3A1CA 1Y8QA 4JBXA 4MEAA 3WLNA 3Q3IA 3RYCB 2ODAA 3UAGA 1ZUHA 4J0GA 4EF4A 1X7ZA 4ENTA 6GPBA 1OBFO 3DEKA 1V3QE 1FDUA 3R7LA 3A27A 4Z7OB 2IXEA 1NNI1 2NXNA 3AJRA 3VR6H 3DFKA 5M5BA 1RTKA 2VKQA 1XCMA 2FUG6 2X86A 2YWXA 3ZOKA 3E9QA 4PQFA 4OHZA 1ZXBA 1QHHA 2O14A 4KAFA 3S7TA 4EATA 1JKJA 2HSJA 4P5EA 4UHDA 2VK8A 3TGLA 1UKEA 3IE2A 4BP1A 5GJBA 5T8KC 4BMPB 3C1OA 1XYVA 2BVNA 5AUPB 3UO8B 3CINA 5AUOB 5A6SB 3V6LA 1M6EX 1H4QA 5FKJA 4BQFA 5JFTA 3AR6A 4UDYX 3U13A 1JU3A 4OD0A 4MGKR 1YDHA 4Q1AA 3HRHA 2VLIA 4C76A 3PNSA 4WWHA 3KQVA 1D7OA 2OHVA 4MRMA 5F3DA 1TQ6A 3CZ5A 4E5MA 2GXSA 2XDAA 2JFUA 2Q2NA 3SPXA 2H7YA 2YIJA 4FNGA 2OM6A 4HBZA 3BIFA 1VLZA 3FDZB 5FBLB 3U3ZA 2J46A 4XD7D 1A72A 3V48A 1UOEA 4NKRA 4GSKA 3LPDA 3PA8A 3OM1A 4GMDA 1B6GA 5JWHA 3Q0EA 3E48A 5L95A 3NT2A 4UVDA 3V4FA 1M10A 1LTQA 1X1SA 1Y9EA 1XV5A 1OX5A 4M36A 3NWJA 3W6NA 4C21A 3OKCA 4MA4A 3AV3A 5FLYA 3JQBA 4Z6KA 4EG5A 1QJ4A 3IH5A 3DOHA 4Z8YA 1IN1A 2AEFA 3KEOA 3S2FA 1IUOA 1U04A 3KAQA 2XLCA 4L8YA 2UDPA 1NU6A 1XAIA 1T3SA 2VYQA 3TL6A 3W34A 3T5AA 3ZI0A 3FPAA 1H4TA 4PU0A 1BMTA 4N1AA 2CHQA 2X22A 3CN7A 4IF6A 4L6AA 2GCIA 2FDRA 4ZI7B 3FOFC 2VWHA 4R2XA 3SS9X 3BSFA 4Z9AA 4KFRA 3UA4A 4MPRA 3EQ8A 3X1JA 2BISA 2E1PA 3FM9A 2F59A 1JSRA 1M6VA 3Q72A 5HIMA 5BORA 4URHA 1BHJA 3EVDA 5CT4A 2XDQA 3UCXA 4NXMB 2II6A 4C20A 2FXVA 4FP9A 3EWSA 1ZAYA 3THOA 4DA7A 1MV8A 1EU1A 2I65A 3H3FA 3QKRA 1J0BA 2X9GA 2BV3A 3EMKA 3WS7A 4B87A 2ZYAA 3HI6A 4KR2A 2M2IA 4DYDA 1SKAA 2QIOA 4O1MA 1OAOC 3CLKA 4BLSA 1J7JA 2ZIUB 3UPDA 1NBOA 1VSBA 4JL8A 4TMYA 4FW8A 2DBZA 4RA9B 2VJDA 4UEJA 1V26A 1W0JA 5EUCA 5HXAA 5B58C 4XLTA 3R8CA 1FP4A 3AXSA 1DQPA 4E2WA 5J63A 1JQDA 4EI9A 2B7LA 1A71A 1C14A 2F4NA 2HV8A 3N2IA 5KWEA 1J8YF 4TLAA 2Y1DA 2IH4A 4U0KA 1XLVA 2J9YB 2YINC 1ACJA 3HEMA 3JTEA 4FFVA 5SZIA 4DY4A 1QHYA 2P6PA 4YCJA 3B3QA 4OXNA 2FPKA 2IHVA 1PUXA 4D9IA 3UMMA 4F3CA 1NJGA 3AI2A 2GZDA 1GEEA 3UMYA 5A0TA 3CR7A 3KOOA 3LK7A 2XTJA 3OF3A 4Q9JA 3M1IA 1T4CB 2AR9A 1J49A 1IY1A 2FQYA 4EI7A 4JJKA 5AW2A 5HBRA 2EKZA 1FP1D 5DN6D 2WHEA 3GI1A 1AO0A 1OB2A 1KAOA 5C5EA 3I1IA 1NN0A 4KB5A 1T0BA 4URUR 1D2HA 5DNWA 1CRPA 3TMKA 5CDHA 3Q7QA 4U7HA 3C5HA 3SJ7A 4B46A 2V7TA 4Z7NB 5INTA 4IGIA 3NVKI 2I6QA 5DISB 4C0SA 2YXNA 2W98A 1O57A 2FRVA 3UWKA 1SUEA 5DPMA 5L9AA 2OKCA 2ZYDA 1P3Y1 2L18A 1Z12A 2R8ZA 4UAVA 4XGQA 4XE5A 3OEYA 3GVCA 3L9WA 1WVIA 1RWMA 4NZZA 1UMDB 1T5SA 3ROXA 2OR3A 3SJAA 3AF4A 5GY7A 4EJFA 1N25A 1TNDA 2Q4OA 4P4LA 5FWYA 2Z95A 1EUDA 2JHFA 2QZJA 1OROA 3UTCA 2AN9A 4BMNA 4BNUA 2WIGA 1PEKE 4KWCA 3HZRA 1T25A 4MV4A 3V4SA 4ALIA 4N12A 3UK0A 5K0TA 3L7OA 2GHQA 4E5SA 2Z6UA 2G9QA 1E94E 2Q9UA 4KMRA 4ZT6A 3RIYA 3L7DA 4QOGA 1MVOA 4ND6A 2ZT8A 4X65B 2Q6TA 1E1RD 1XN1A 3A1DA 1YAJA 4ALJA 3LHDA 3ZVKA 2YXDA 1YFKA 2HCBA 3WQHA 1A8IA 4ED9A 5J4LA 1Y1RA 2CL0X 2QX9A 3C5EA 3SQWA 3UMSA 2YQ4A 3F1KA 5J4KA 5T64A 3CX6A 1QKJA 3ZPXA 2B8NA 2O20A 2HK7A 2JEOA 2QOEA 2ZSFA 3C98A 1IEVA 5FR2A 1O4VA 5JEDA 3M9LA 3OEHA 4L73A 4MYSA 4YJFB 4ZRDA 1H2ZA 2P3OA 3OKPA 3UMJA 1HDXA 2WTMA 3IOEA 3MJCA 4EB0A 5HW0A 4DV4B 3H9GA 4P3KA 3KEMA 1NG1A 1GRVA 4X0EA 2GS9A 2QTMA 2FSIA 4GKKB 2FSFA 3ONVA 2OAGA 3I9KA 6REQB 3I9LA 4LJLA 3BZBA 2OFPA 4GL4A 1BFDA 4X1IB 4V0QA 1PD0A 1G20B 2BUCA 2QQ0A 1KZHA 4ZCPA 3ICCA 1RLIA 5K8VA 2WM2A 3QFCA 1AF7A 4RYDA 4BNNA 3LD9A 1GQYA 1PSWA 1J09A 2V03A 3OU2A 3OZFA 2PKYX 4N6OA 4BMYA 1UC9A 4JWKA 4CV0A 1C1DB 2WE8A 3AQIA 3DMYA 2B83A 1XALA 1KDOA 2A0UA 3G9XA 1OXMA 3Q7SA 2VXYA 4LYJA 4O2AF 3TK1A 4KYTA 1U8TA 4M9QA 3TQCA 1NKTA 2UVPA 1RT9A 5P8WA 3U4HA 3V1NA 1F2TA 4KIGA 3P0IA 4NE2A 3QPUA 1BVHA 4CYMA 1P9OA 2Y0CA 4RJTA 1N5LA 2D4HA 1EPUA 3K9CA 4AG6A 2G6BA 1YO6A 2K2QB 3QFTA 1PVOA 1WWKA 3UC5A 3VU9B 3SIPA 2XZDA 1UODA 1UJ6A 2J3LA 2ZYHA 4EUFA 1P9LA 4A10A 1J21A 5LZ4A 5MFPA 5EWLB 5JMWA 1DFGA 1VFPA 2YY5A 2N3ZA 3BTOA 4GC5A 4KHZA 5ED0A 5GPBA 3WYDA 5LOVB 4LI0A 3BE8A 3HB5X 3EGDA 3LT0A 1NV9A 3P9KA 4YCAA 4UBIA 3TW8B 3DHVA 1W4RA 2HU8A 5F9FA 3HO1A 1ST2A 2JJ1A 4FFSA 4JJ4A 1QORA 2FR8C 3HYTA 3GLGB 1RABA 3K4QA 3EXEA 2NP7A 3R3ZA 2XXBA 3U7HB 1YNOA 2FEOA 5JCOA 2Z3WA 2G07A 3EVZA 4HGOA 4DLWA 3KQPA 2PSDA 5HMMA 2O5RA 5JNVA 1BQ3A 4QDZA 4MLZA 4AXXA 2H59A 4LAFA 5FUWA 3ASZA 2F3UA 2RHBA 3WB0A 1Q7EA 1W5BA 1DC8A 1EZ1A 1Z5OA 2B98A 4LFAB 5JCJA 3JAMA 4DWJA 3DR5A 4O4JA 4WUVA 5EFOA 1WAMA 3F5DA 3UKOA 1AXGA 2OV6A 4G5RA 3HYRA 4P7KA 2IYUA 3AI3A 2LCFA 3I09A 1E62A 3KZMA 3OT1B 4YJ3B 2VK2A 1NQAO 1ODJA 4UMEA 1IULA 4B35A 1SUFA 1CWUA 1I3MA 3OT4A 1A9XA 4KFTA 2PSEA 1M0WA 1MU0A 1T8TA 3LY9A 4GH5A 4NY1A 4CE6A 3B2QA 5I47A 4Q03A 2XCUA 4GRAA 1ZONA 4DGSA 1BDIA 1QVAA 1E18A 3ZD8A 3T3NA 2AB0A 1O96B 1UMKA 1QCYA 2JAPA 4ECEA 1SG0A 2JLSA 1A7AA 1Y4ZA 4EO9A 3OFND 4F7WA 1D4ZA 5LP6F 4QX6A 4ZK2A 5KTSA 1Z6GA 3KLBA 3HCCA 1WLSA 1D1PA 2WP0A 4XWKA 2DEUA 2PV0A 4HDKA 4NEHB 5ENDA 4BNZA 5C80A 2IYYA 2V5AA 1CJVC 1DKOA 2GCNA 2VDPB 4G0MA 5M7EA 5AW8A 1R9MA 1GYQA 3PNQA 4BCCA 3IQDB 3E3LA 5ECWA 1JEYB 3MAJA 2C77A 3UKJA 1FZQA 4EFNA 2XXJA 2B34A 2NGRA 4W5JA 1U6KA 4ETNA 4TRNA 5L3VA 4Q48A 1N9GA 2C0CA 4IJUA 1Y1SA 1KA9H 4TLEA 1DUVG 2D2XA 3RARA 4MJ7A 1YIAA 3RUHA 1RI3A 1TAGA 4TKZA 1K8RA 3HYNA 4WK0B 3H5VA 1P60A 2XUOA 2HWKA 3U3OA 2VCHA 1E2EA 4DQ0A 2O5CA 4MS1B 1ZOPA 1AUVA 3W77A 4Y6SA 4L78A 4KPGA 1XTVA 4CTOA 2BFFA 1TM2A 5T4FA 3PDIB 1P4AA 2RHTA 4HH3C 1GZHB 4AKGA 5THKA 1NPYA 3BORA 5IK2A 2RCNA 4BS9A 2P3SA 3LBYA 1EEXB 4WIAA 1X2BA 4H16A 5GADl 4RY9A 3DMDA 4I1YA 4I55B 1FPMA 3FOCA 1G2QA 4UVGA 4KR6A 1A97A 1MOPA 3BEOA 1MG5A 2Q4RA 2BZ1A 3KXDA 5AM2A 3K8OE 2C9ZA 2XQIA 4FIZA 1JJBA 3BMNA 4L8GA 4PYIA 2VSXA 1WMBA 1G38A 1FQWA 3TINA 4R5MA 1Q17A 4LVOA 3RVQA 5IYZA 5TQ0B 3P9QA 4LRWA 4AYWA 1FFXA 3GZTB 3YASA 5CVTA 4M37A 1YF3A 3NMUF 2GXUA 2W4MA 2BGIA 4CQLA 1X80A 4TOIA 5T8KA 1K27A 2FDCA 1FC0A 1GPKA 1BQ4A 3D3WA 2PA3A 3AEZA 2WUEA 4L4XA 4PV7A 5M3BA 1CE8B 1ZN8A 1RU3A 3JALB 1K4YA 4WADA 1N7GA 5DX8A 3WJ1A 4EYSA 3K15A 5JQGF 1DKLA 4R1PA 2ZR8A 2ES4A 3DDUA 2V5UA 2O0KA 2APJA 1W87A 4BB9A 3IBSA 2RD2A 2XWPA 3D1VA 4IUBS 1K9SA 1TCCA 1TQ2A 1I5EA 2FW9A 3BF7A 4RGBA 4U39A 1PLKA 2I0FA 2QM7A 5EQDA 1VHLA 3EJ6A 4CEIB 5EEGA 1VLHA 1YDWA 2GAIA 2VL7A 2HMVA 3L1VA 3MFYA 4KO8A 1H2YA 4BIMA 5BPHA 4KLNA 1Y9DA 3O95A 1U2GC 3RABA 3RHFA 1T36A 3H2YA 2B2CA 1TVEA 1J5XA 5CJ2A 2P6OA 5C1DA 2X8JB 4JN6B 4KYVA 3OCVA 5LVAA 2BELA 3M2TA 4B5KA 1NN5A 2B8JA 2GILA 1YB6A 2ADFA 4RPKA 2B35A 2XTZA 1XGKA 3DV2A 3QVGB 3R6GA 3UHPA 4F3RA 1C9DB 1XZEA 3IVAA 2AWNA 4E08A 1HT3A 1MORA 5F78A 2R6HA 4MKFA 1QRSA 3RFVA 3OPVA 5A3QA 4PNPA 2P35A 2P68A 1QV9A 1AJEA 3PHGA 2H4JA 4PTZA 1IY9A 4EW2A 2W70A 3R6LA 2ZIXB 5JS8A 1VG0B 1X8LA 5CGZA 2M1XA 2QUHA 4WGGA 5DM4A 2X8LA 2NPFA 3T99A 5CX1B 3DEYX 3O83A 1L7EA 1Z6ZA 1W8DA 2A67A 2G1UA 5BMVF 1DPGA 5IKXA 3C3CA 3UVEA 2D5CA 4QUJA 2GF2A 3J80A 2B61A 2VUHB 2DRIA 1F9AA 2GZ2A 1ULTA 4YRSA 3TLAA 1V1JA 1GDHA 1OAOA 3FUVA 3WNDA 4MINA 4ALMA 4PFJA 4KE9A 4BKUA 4ZEVA 2O9JA 1QZZA 5J59A 4OL9A 3LYLA 3VGPA 3V4VB 1EWTA 5CYGA 1T10A 2H29A 821PA 1LS1A 2W8BB 4GX5A 1VLJA 1E4YA 3JS5A 5E38A 4YJ2B 5J5CA 1TUBB 1EA5A 1SIBE 1CPYA 1SY7A 1EDZA 1KSHA 1V16B 4OL0A 1Z2EA 1L5HA 3WLEA 2QLLA 5CBPA 4KMOA 2XCIA 2B37A 1KK0A 2PQMA 1WU8A 4CQMD 1YB1A 4IS3A 4XW2A 1KI3A 2X4LA 4YV0A 3U4QA 3GD5A 3IX7A 4M7RA 3HR8A 3ZGVA 1B6RA 3GUHA 1U0GA 3SF0A 4DGQA 3V1KA 1KEUA 4EAAA 4EG4A 2R79A 4L8LA 3HJUA 3CVYA 3KQOA 4ZVSA 4NBWA 2J6IA 1ZN7A 2P11A 3T3GA 1X9HA 2H16A 4KQIA 1NBIA 1T26A 3Q8MA 5DFAA 3WNQA 1U7XA 3JD0A 4RK7A 3CSSA 4CL3A 1UBUS 4EUSA 4U2CA 3Q10A 2BBTA 2WTXA 3PJDA 3DE5X 4UFPA 4WLNA 1YACA 2FEWB 4UJ3A 2C00A 3DF7A 1FMLA 1LPMA 3IHLA 4NF2A 1GVHA 1PZXA 2HI0A 2QVCA 1P91A 3Q8WA 1K75A 4XARA 1E5QA 3RHTA 2F4VB 1U5CA 4RL6A 5BR1A 2O2SA 5DOVA 3IT3A 2B6HA 3KB1A 3NHSA 4DSZA 2R7NA 2XUIA 2GA9A 3RDPA 3VNBA 1GVNB 2OC9A 1P7YA 4F5YA 2IQIA 1DT3A 2IDMA 2YWBA 4ZVLA 3L7JA 3AP2A 1KO1A 3KT6A 3WLSA 3P4XA 5IH7A 3Q2KA 2I54A 1QLWA 1WPGA 2PUAA 1N2XA 1VDMA 1N0WA 2CK3A 4HDAA 4XQCA 5TV2A 3BSWA 4Y6GB 4S05A 4INJA 5IX8A 3D3KA 3RC9A 4AN1A 2I3AA 2ZRMA 3WMGA 1TU3A 3AESB 3N1UA 3QBDA 1CIJA 2Q8PA 5CXXA 3EEOA 3KQLA 4LXGA 1DMRA 4ZI2A 1QF6A 4OXXA 2QB5A 1NBWB 2WPDA 1YQTA 2MMGA 2V9PA 1ZNZA 5EHZA 2HK9A 4NU8X 4DANA 2Q0SA 1E3MA 1B73A 4GYJA 3U7EB 3ML1A 1KH2A 3GG9A 2GPNA 3GFTA 2FJ0A 4OHWA 4I1VA 3HH8A 1U3VA 3TTVA 4Z49A 1QE5A 2FPLA 4MPJA 4F8JA 1WETA 2J08A 7REQA 3EFEA 1KXZA 2PH3A 4I9UA 4L07A 1AKQA 2P0EA 1Z63A 5DTEA 1U6JA 1ZVQA 2RBEA 3CTMA 1K3TA 3JD3A 4RULA 3ORRA 5EJ2A 3V9PA 1AKYA 2WSMA 1LQTA 4S04A 2JI8A 4QG7A 1MO3A 5HKLA 2VHVA 4XGRA 2PBZA 3KR2A 4FR5A 2ZVPX 1V4VA 2AD5A 4HZIA 4PLZA 2BZ0A 2H2DA 1MC8A 4FJ0A 1P7WA 4ODIA 4GMKA 2B2XA 3MMNA 3UJDA 3V4PB 4D3FA 3B1YA 5TJ9A 4QUHA 1M0EA 4IIYA 1Y3IA 1VJGA 1GSOA 1BKSB 4WZAE 3D7LA 3OO0A 2KPOA 4M0EA 1VYVA 2AJTA 4HAUA 4NV3A 4RVNA 1OH5A 3H1FA 3VKHA 4DOMA 3L2OB 1RBZA 1L5QA 1BMFA 1TXGA 3CNHA 4MGEA 4BBZA 4LF6B 4INPA 5D7BA 4A23A 4ZRMA 3OHPA 2K2WA 3ZY4A 3L4SO 2CJWA 1PWXA 4LE2A 3FOWA 2IGBA 1DIHA 1OUMA 1P62B 3LWZA 4QJIA 5FBWB 2VQ6A 1YOVA 3G02A 1NGSA 1HI9A 4P83A 4REMA 3RYHB 2FFQA 2H54A 4FOOA 3M82A 4J07A 3GLFE 4NBTA 1ZHOA 1TMKA 4HB4A 5GVRA 2QBYB 2O8DA 1CUDA 2XB2A 4MUBA 3IE1A 1G7TA 2QPLA 5DGXA 3L3BA 4HEHA 4Q4JA 2FR8A 1E2KA 3HJHA 4E32A 1MQ8B 1UC8A 3B6EA 2PZAA 3OCZA 5BR4A 1W2HA 5DTRA 3WGJA 5C1IA 4HI0E 3EPPA 2WUDA 2WIFA 3ZWDA 5C4MA 1NQOA 2A9RA 3KXLA 4UZSA 3TLYA 1XJWA 3TBHA 1DAHA 3W6OA 4ARZA 2E6KA 4CKEB 4D4KA 4XVUA 2J7PD 4QQ8A 1O0SA 3GGDA 5T41A 3JQ6A 4D9NA 5ALVA 2VDOB 4YCSA 2SCUB 3NHAA 4EG6A 4IHQA 3PLAE 2XTMA 4Q4HA 1XJ0A 1HRDA 1Z8DA 2QMZA 4FYKA 4MKHA 3KTAB 3D81A 4P98A 3KHKA 3WDMA 1QU2A 3UY4A 3ET4A 2E5WA 1QYDA 1J9ZA 4L27A 4N3BA 1XPRA 2NPIA 2J31A 3DYBA 2PH1A 1BA3A 2WIBA 3K0KA 2PM8A 3NHFA 1YJXA 3QU4A 1QS0A 1J2RA 3E15A 2DLDA 3SQMA 1LNSA 3LQQA 4E13A 1NU8A 1JJFA 4DQXA 2CCKA 5IVIA 2GM9A 2OLJA 3ABZA 5EVCA 4UNRA 4C3OB 2F7SA 4F6RA 4QGFA 4PCUA 4UTZA 5A4IS 4ENRA 2WV9A 3MA0A 3ZWOA 2CZQA 4BEVA 2G83A 1DJPA 5B2EA 1G9SA 2FETA 5JI3E 3VO1A 2W6ZA 4Q9DA 1XMVA 1FYXA 2ZE8A 5ALDA 4AT1A 4DSUA 5AESA 1QHGA 2QLMA 3FNGA 4KRGA 1GTMA 2WUWE 4IJ6A 1SXGA 2ZJFA 2FJUA 1G21E 1YI0A 2GDZA 3SX2A 3SNKA 1PV2A 2X23A 3SZOA 4UCFA 1XD8A 2R25B 3B82A 3ZBUA 2FF7A 1QH1B 4C89A 3LX8A 3LCJA 5B6PA 2CNNA 3S8MA 2ZSBA 4OY3A 3DFUA 4GR9A 2HT6A 4RFSA 3CQ9A 4LJYA 1XMIA 4RJIA 5AJHA 4R8VA 4AECA 3HVKA 4R1SA 3A36A 3ZGOA 2JLZA 1ZM7A 5DBEX 1COZA 2Q3JA 5LP1A 4GE3A 1C7QA 1XC7A 3E53A 5HDBB 4QJBA 3SBOA 3AIMA 1WMSA 2B1RA 3EOBI 2P8JA 1E58A 4QEDA 2QD2A 1Q12A 5BV7A 2ENWA 2CXTA 4H15A 3DD1A 2BP7B 1JG7A 4JLOA 1DKQA 4MW1A 4Z0PA 5KSPA 5K5EA 2FPPB 4DR2B 5TQJA 2XZLA 5E4FA 2J67A 1EGHA 1U0JA 2C82A 1W4CA 3FIJA 1V9CA 3K09C 4JELA 4MQBA 4PY2A 4FLMA 4WVLA 1KQFA 1FFBA 1MJHA 1RFGE 4YAFA 2HGSA 2AOVA 5H16A 3DBOB 4XQGA 4JI6B 5CH3A 4JGGA 2FPRA 1S5PA 3JVIA 1WXQA 5T6BA 2XT9A 3TVDA 5FA8A 4V1CA 2DWQA 3WLHA 2OEPA 2BHTA 4AVYA 721PA 2JCBA 3T9EA 2FMTA 2B30A 2QI9C 3WGOA 2PUWA 3MZ0A 1TU0A 2D00A 5EZ6B 3I8OA 5TPWB 3LFHA 2R7AA 2C4TA 2FG6C 2OA0A 3M6IA 3CH5A 1LCIA 4HNUA 4BKOA 2ZRQA 5FTKA 3QJ5A 3A9WA 4GPBA 1S2DA 1BS9A 1GNVA 1W0KA 4QO7A 3IIMA 4F91B 4D25A 4HAIA 5CLFA 1ISRA 1IWPB 2JL1A 1U8FO 5DNAA 4QPCA 2P1RA 5ALEA 3E9EA 4U8HA 1MB2A 3EQ6A 4HOYA 4M9UA 3SR0A 1U2GA 2W2VA 3W2FA 2O3TA 4B32A 2A35A 2OFOA 3KC2A 4I1PA 2F1OA 1LK5A 1L8XA 2XB8A 1NMQA 1X9GA 2ANBA 2PLFA 3MJHA 3NUGA 5IJ9B 3TX2A 3E82A 4WLVA 3HLYA 5DRYA 3EEIA 4L5JA 1K98A 4MV9A 3ZXXA 1JLRA 4RNCA 3C3MA 5HFNA 2PXHA 4E3WA 3I5AA 2XUJA 3BRCA 2HIMA 3ZLBA 3TNDA 1C4OA 2R6AA 1SUDA 3O9MA 1NR7A 1AKEA 1QH8B 1YR7A 1ZGCA 1Z13A 5EE0A 1K88A 3A4IA 2OXTA 1NBME 4RF2A 1ZUNA 1KRXA 4WTOA 2JD2A 4EHAA 3M4XA 1TMOA 2H00A 2JGKA 3K1JA 5L7WA 3W3ZB 4PYLA 1FUKA 1M34B 1VJTA 2A86A 5EQJB 2BGGA 2Q4TA 4PIVA 1G291 2AA3A 4ZAYA 3QI7A 4KP7A 1XKTA 3TD9A 4DIMA 3TNFA 4IDNA 2HCJB 4ASUD 1W5AA 3RIXA 2FGKA 3H4MA 2ATEA 1W44A 2XWBF 1K7SN 1YB5A 2P3QA 2H6EA 2QD4A 3IDZA 3JV7A 3U5ZB 2PX3A 3DNMA 5HE8A 1MJFA 1K6IA 4Q1FA 3L1JA 2VDQB 4FI3C 3RFXA 2FSVC 1JT2A 3EGXB 4POAA 4OXIA 1DX4A 3A37A 5KNDA 4FYYA 2C07A 4HB0A 3I2IA 2C2GA 3BN3A 4YGYA 5C8YF 3CM0A 2ONKA 4IH1A 5C81A 5K0GA 4MUHA 3JQ7B 2PMWB 3HGQA 3UXEA 3RG8A 2PT6A 3BERA 3O8QB 4HTFA 1FFGA 2HBZA 1D3AA 3IJRA 3E27A 3KBOA 1LKZA 1HYHA 1YD7A 2RC6A 3WVNA 1MIOA 4HSEA 5L40A 1UFVA 1ZNQO 4DV1B 4I8IA 1J97A 1XWIA 1KERA 3BGOS 4WY8A 3VJKA 4LFBB 5E4JA 3ADPA 3WGHA 3BCRA 3D0OA 5IHXA 2HKIA 3I9JA 4QODA 2QWXA 4HQ0A 4B4OA 2R4UA 2XE7A 4ZP1A 4E5VA 3RU2A 3WWOA 1XA0A 2FEAA 3EZ6A 4JLDA 4QBFA 5T4EA 5ESRA 4UEOA 3SBEA 1SU8A 1O2DA 1EUCB 1V6SA 1NW9B 1GYPA 2QNIA 1OB5A 5H3CA 4PANA 5L3RA 4QQRA 4RTRA 2JDID 4EA7A 3O93A 1A77A 2PWBA 3P9CA 4PG4A 1PJ4A 4FXOA 2QV7A 3AETA 3WB9A 4CM4B 2DR0A 1HORA 2Z6AA 3WK4A 3UOAB 4HPXB 5YASA 3A2KA 2A78A 4WBNA 3NR2A 3I9FA 1QRUA 2QMOA 3Q0TA 3U7JA 2DXIA 4BPBA 2ZTSA 5C7YA 1XNRB 3LUJA 3PI6A 3GLKA 1H5QA 2L69A 3H16A 4TVKA 3PGJA 4YQYA 3UYKA 2GFIA 2VOJA 2CUNA 3AY0A 4HB3A 5K09A 2H07A 1GZVA 2VNAA 5DHPA 3GJ4A 3AR4A 3STVA 4B76A 1FXSA 2NOAA 2XEDA 4RDIA 4DBLC 1X1EA 2QM0A 4EPRA 2FPGA 4QU9A 2EC5A 2Q3LA 4G1FA 4UTVA 1T5OA 1USWA 1Z08A 4DDHA 1F2UA 5I5EA 4YRDA 3OEEA 3PXEA 1AXRA 4ZO7A 2XD4A 1XCOA 3F3KA 2WQZA 2VJQA 5IAEA 3N6VA 2DECA 1U0FA 2G67A 4ND2A 3AFIA 2BM9A 3L46A 2W6QA 1FQJA 4QGAA 5JBQA 3LCUA 1DJQA 2PRIA 3OH8A 3TLMA 1DKRA 5E9WA 1JUDA 1UJ4A 4V2IA 4RQBA 3ZLVA 1A7KA 2I2WA 4ZC1A 5B1HA 2OQRA 4C2AA 3NBKA 4YMLA 5HQ3A 1U7WA 1KZ1A 3R77A 1J25A 4TV8A 4E21A 1E0AA 1M8KA 3FKSA 4A8HA 4J2TA 1E3WA 1K6EA 1TK3A 3GB9A 1JFRA 1QX3A 2AJLI 1DO2A 4ZCIA 1AM4D 1DWUA 4EECA 1W34A 3L43A 4K86A 4OHRA 3CONA 2HPHA 4ZYUA 1G3MA 1DAFA 2GSDA 4L1KA 3BCHA 3WSVA 1N3YA 3CCBA 3CW8X 5HFJA 1YZ3A 3ANXA 4BFTA 4C78A 4D3YA 3DNFA 5FV4A 2H4FA 5HOQA 3BWEA 4H3HB 5F3RA 3DG9A 3DAYA 1HMYA 5DZSA 1IEXA 1IN4A 2W2QA 3REGA 5CEJA 4YTEA 5TQ0A 2M6LA 3JRWA 2VYVA 3GJYA 4F6LA 5CB4A 3MBOA 1UFKA 3EVGA 3PDJA 4FFLA 4RD4A 4JC4A 3S2ZA 4S2UA 5JYDA 4ZYZA 4I19A 3R8FA 2E4XA 4YMTA 1DGQA 1PEAA 4X3PA 3DKKA 4BKRA 1QKKA 3A6JA 4L5IA 4ROSA 3TZEA 4CEHA 4U2DA 1MEJA 4Q6BA 2J9FA 2W2OA 3BOSA 3D6JA 1BDJA 2FW6A 4Y2HA 4BV3A 1XN4A 1I7SB 3Q7TA 1K4MA 1LXCA 4E1VA 5KYNA 4KR3A 4UFNA 5KYUA 1O8BA 1RJ9B 3GT0A 1XZFA 4E2YA 3THWA 1I32A 2QUZA 3MOGA 1BD3A 4HH1A 2I4RA 5CA1B 3IEUA 1ZITA 1XVAA 1Z0FA 4RYLA 5LP6B 3KQNA 3HCRA 3S40A 2ECOA 3UUFA 3ZE6A 1OI2A 5HJ5A 4MR9B 4MVJP 4DAOA 5IAAA 3AY3A 3K6KA 1FQKA 1ZK1A 4R9RA 3HSSA 4YO7A 3AVUA 2AOUB 3QU7A 2P27A 3H18A 4ISBA 3EFOA 3X1DA 4YPOA 4JLPA 3NRBA 2EQBA 5A9SB 1R12A 4C5AA 4NG4A 2GAOA 1M2FA 1Z6PA 5EKDA 3AL3A 2WHXA 4AJEA 2H9IA 3U9SA 1Z36A 3AK4A 4DUGA 4L4YA 5BN3A 4F9GA 4U9UA 5T6MA 1FK8A 1EWQA 3UJNA 2GXAA 3AHIA 3AFNA 3NJRA 5GZ6A 2I1VB 3U2QA 4C7BA 1YZYA 3EE6A 1E59A 4AI6A 1KHHA 2IEYA 1NXOA 4N0MA 1CZHA 3ST7A 4US1R 1EVQA 1EHYA 4HXEB 5L3QB 4KIWA 2BJWA 3FDFA 5GWXA 4A1OA 2WEKA 4NMWA 4DMKA 2JKYA 2RGAA 4OQYA 4MJXA 5AVRA 1R0WA 2PT5A 2VDMB 2DJ5A 1PZFA 2ILTA 4JXZA 1P61B 3FNIA 3W9SA 1QYRA 3COSA 3KXKA 1UK9A 1L8QA 4F06A 1R9NA 4N41A 3PUIA 5EOVA 2RKOA 4YREA 3DEFA 2YY7A 3BXOA 1SK8A 1I0LA 4Q6WA 3UOGA 1F1JA 1ADGA 1HM5A 2DGDA 2ET6A 2FPSA 3AR9A 3CHYA 4V3BA 4AJJA 1I4LD 3A9VA 1XDWA 2AS0A 1CYDA 1NF3A 1VGQA 2C98A 1OWNA 3FTCA 5CVDA 5D1NA 5KSYA 3GWGA 4LWPA 1OPRA 2NUAA 5I7HA 1UOOA 2V3CC 3JARB 4L9SA 5T57A 4EUNA 2QR2A 5BRNA 2G4LA 2VHQA 2X0EA 4KL8S 3IP9A 1SVNA 2EBHX 2KBEA 1KIFA 3R5HA 4FYMA 2XCTB 3KQTA 4DS3A 4Q7KA 3ZZ0A 3VMMA 1RFLA 2VP4A 3N2NA 1I4DD 3WGQA 5L4NA 4DM3A 2OQIA 1Z47A 2NW6A 4QZVA 1XCPA 3BQMB 4BV2A 1QFYA 1EJ2A 4QYIB 2QLBA 3O2NA 5TT0A 1XMXA 4B0PA 2CB0A 1A9YA 1FDTA 1ORHA 2DWPA 3GGJA 2REBA 1Z29A 2BEUB 2QS9A 3RFFA 1ISGA 1W2WB 1WCIA 3A4YA 4CEJA 1GZ5A 3AZQA 2C7PA 3ON5A 4EK9A 5GINE 4GGPA 1SXPA 3AWIA 4JLMA 3E9RA 1G59A 2P2ZA 2J5KA 3K09A 4ZOEA 4B40A 2YKGA 4F4UA 3PENA 2IIBA 4BQRA 4OP3A 1C9KA 3HBMA 3BKXA 2JK0A 2X0RA 5AXAA 2DT5A 5FPTA 3DZIA 5E4YA 5F7XA 5LN1A 1P8JA 1ZRHA 1TIPA 5A0FA 2V65A 4JX8A 5JSUA 2VP3A 1HNXB 3CLTD 4ARSA 2QD3A 1JBEA 1S3FA 5KVVA 2FW0A 5K3FA 3FMVA 2IXAA 2WAOA 2Q5EA 5AJVB 3KSRA 3EIEA 5ES3A 1RYMA 3ER6A 3FR7A 4GZ6A 4I08A 4WZBB 3QTLA 5KQRA 3BE5A 3DD5A 4X20A 4ZFNA 4Z5XA 1FMTA 1O6FA 5IP5A 4EGJA 3VH3A 3MERA 2A5JA 1JVNA 3KOWA 4R69A 2KLBA 3L6CA 4KDCA 4WQMA 2CLSA 4EB8A 2OAEA 5DHAA 1JPJA 4ZCRA 3SBXA 3JYLA 1G41A 3F3YA 3PKZA 4KPEC 2JIZD 4Y9DA 2IE8A 2JAWA 1NJ5A 3TUZC 4F3TA 3EA5A 2HMTA 4A6EA 4HNVA 3V6MA 4C0KA 4YIHA 1L1RA 3T5GA 1F8YA 2ZTVA 4EA8A 4GEGA 4HAZA 4ZAGA 3ZTWA 2XXAB 1GSAA 1JYEA 4HVTA 4A91A 3IFSA 1C4KA 3E35A 3TSAA 3IIKA 1EDEA 2C95A 2PR7A 4MVJD 5LIRA 3DCJA 4Y2TA 3DBHA 4PC2A 3T0IA 4BX9A 1ZR2A 4GX2A 5EE3A 1Z0AA 4HLQB 2D5IA 5FWXA 4NBVA 3DL0A 3FZYA 4NSNA 3M9WA 5JO9A 2FPOA 4C0BA 1XYGA 1WPXA 3NB0A 4BRSA 4YT5A 3OT5A 5ARCA 3FPGA 1B1CA 1YH3A 3MWDB 2J09A 1B0PA 2Y76A 4PFSA 1A2OA 1PF7E 4EHLA 3T7JA 3C6QA 1XZJA 2C42A 4WOBA 4WCDA 5KYVA 4WEOA 1VL8A 3SF8B 4Z4IA 3ETLA 1QAMA 2YFQA 4BEBA 4D2IA 1TTHA 1QTQA 3Q2OA 4KQGA 3NETA 2VRBA 3H97A 4II2A 1MO6A 3MRXA 1VJ0A 2G9UA 4AZ3A 5ICSA 2HA3A 1X15A 2VNSA 3DAFA 4RXUA 4WXEA 4TQGA 4EEXA 1JFSA 2QLNA 2TRSB 2RHGB 4DABA 3AX6A 3PNVA 4RCZA 2Z2JA 3IUNA 3G0BA 1FRQA 2FSVA 4MV0A 5AXBA 4BIIA 1KYZA 5GOZA 3TL2A 3IBCA 5EMHA 4DWWA 1AQ6A 1G8PA 4L7QA 2HLDA 4QPNA 3TJMA 3X2EA 2FF5A 2PYZA 2OESA 1G1MA 3IUBA 2H1IA 5AVTA 2B0CA 3DE6X 1Q7RA 2C54A 2WF5A 3L0SA 5IH3A 3WJAA 1N5JA 3EZLA 3F4KA 1TFUA 1Q2XA 3HXPA 4CMEC 1W1UA 3K1TA 2IPLA 2VF5X 2BFBB 2XGJA 2HA2A 3TQOA 3QW2A 1F3OA 1CR2A 1R6BX 1U4OA 4JYPA 3V34A 1IDOA 4YXWA 1W49A 1NE7A 1UJ2A 1YZTA 2PZGA 2V0GA 2EX1A 2IXFA 1PT7A 5B58T 3RS2A 2H2HA 1HR0B 4BRUA 4GYKA 2HN9A 4MVJH 4XYGA 1EM6A 1GPMA 3RYIB 1T43A 3M8KA 5LUBA 1SHUX 2JVJA 3PEUA 3KEGA 3BGVA 4OI4A 4LZNA 4ER3A 2QLTA 2C4KA 4LE1A 3V32A 5BQFA 2UZ4A 2QW1A 3O6VA 4AZVA 3OQOA 1WQ4A 4ZPJA 1SC4A 4HVCA 1IJEA 1IK6A 5KWJA 4PSCA 1LBHA 3BB1A 1G8JA 1PJQA 2TECE 4TZ6A 4ZQHA 2GPBA 3C7CB 4MRPA 3PQ3A 2D5AA 1DOZA 2XADA 1YKFA 1JHZA 1U9JA 3S3TA 4EQ6B 4FINA 1LVHA 3MRVA 1HTBA 1P72A 2QRZA 2KHZA 1QDEA 1XIVA 2FUKA 3I2GA 1Y5MA 5DXFA 4KLZA 1I51A 5CDFE 5DP1A 2IS2A 2ZPTX 3FNBA 4X1YA 5LA6B 4YJHB 1ZD3A 2QL5A 3V8NA 2R85A 3LOQA 4PC3A 3HKBA 4IQ8A 4GZLA 5LLDA 1Y6ZA 3H8VA 4PHCA 4JZKA 4WNCA 3NWPA 2P4HX 1L7NA 4MCHA 1IJFA 3I61A 2Z30A 3K2BA 5IUJC 4DQUA 1Z07A 2Q5IA 1UMBA 4WN9A 1F4PA 3ZLJA 1D6NA 1YDGA 1YZFA 4O29A 1B8OA 4R3WA 2V55B 2UYCA 3TSOA 3ESRA 1N7HA 2P7HA 3D5QA 2GEVA 5LKAA 3N74A 3RVBA 5JRDS 2WV7A 2CLHB 2O50A 4ZEMA 3VKWA 3QBTA 2WMDA 1IJKA 1BVYF 1T2FA 3QFFA 1MW8X 4CFZA 4KQEA 3CLUD 1B42A 4B0OA 2H1RA 5ESXA 2QYSA 1QP7A 5FL3A 4M22A 3T7RA 3A6HA 4QBGB 3TR0A 3V1MA 2VXOA 3MJDA 3AIIA 3PXCX 2GZ3A 3K05A 1B8PA 4IJVA 5JAPA 1M6HA 2ROQA 3VYVA 2IODA 2O5VA 2WU4A 4OK6A 2PJRA 1T1GA 2C4UA 2H4ZA 1H23A 4O4HB 5BOSA 1DTWA 1YGPA 4PVCA 1XCJA 4YMWA 4A6DA 1HL3A 4FB4A 5FUMA 1AMNA 4F5EA 4B7ZA 5M04A 1OF1A 1W36D 1CZNA 4R01A 1JKXA 1KR2A 3A7DA 1YKGA 1G1AA 1LV7A 4CN9A 5JLAA 1VYTA 3SYLA 3T0GA 5B1YA 3UJ7A 3I9V6 5KVCA 1C81A 3OFVA 2HF7A 3GUUA 5BNWA 3MMXA 1CUUA 1IG0A 3Q6IA 4WA7A 1M5UA 2WC1A 1ZH4A 1V9LA 2R4QA 4IAOA 4E11A 3VOTA 4KOAA 3L6RA 1B26A 1NBMD 5C32A 1SVUA 1QM5A 2C3MA 5A5FA 4OKSA 4CXMA 1KFJB 2D0OB 4JYCA 2HHHB 3WZLA 3G6KA 1KP3A 1XAHA 5E1DA 3WKAA 1U8CB 3PLRA 4MWEA 1QGUA 2JBAA 1K0FA 4ZYXA 1EP9A 3ZYZA 4X8MA 5LWQA 4G63A 1FLDA 2HDNB 4DVJA 2ZIFA 1X94A 5KSWB 2NWQA 5AHWA 1KBOA 1M1YE 1KK3A 3QUAA 1ZISA 2H1SA 4HQNA 4WDQA 2ARKA 2HRQA 2SNIE 5I4BA 4BWYA 1JIVA 4XJTA 2I9KA 3VVMA 2WWXA 3D1JA 4JLBA 1GA4A 3LL7A 3MJFA 1SAYA 2JJ8A 2RDMA 4DUZB 1KJ8A 2G9ZA 2J3KA 1Z4QA 1JDJA 2V4MA 4XASA 1U90A 1JLHA 3IULA 5FP0A 4N0DA 5CJPA 3EZGA 3KR9A 4B8ZA 4BXOA 3ZHUA 3QXSA 2O0JA 1EWKA 2GJSA 4KQ6A 4LK2A 1OVGA 1OZHA 3JQRA 1II8B 4LY0A 4HDOB 2XOKD 2PUHA 1VXOA 1E99A 1HFWA 1TD9A 1TJ5A 2QD5A 2FP4A 2Y2UA 3AT1A 3FUWA 3H3XA 3QJYA 3TLBA 2O2CA 2DP4E 3ZCRA 2C4NA 4CT4B 3A04A 3PZRA 5LQJA 3O84A 1FB5A 4B75A 2PEZA 5IS2A 1VCIA 2KQUA 2J0QA 2VQ3A 1MO5A 1U31A 3O4VA 3SKXA 1QP4A 4UDOA 3L1KA 2NIPA 4NH4A 4DIEA 2GHRA 2DUUA 4TMFA 1NSFA 1U0EA 4PYJA 2ZETA 1ZA2A 2POCA 4QREA 5CEEA 1PGQA 3CF0A 2O8BA 3PQEA 5DBFA 5KJ6A 2NQTA 3PRJA 5FIUA 4MYUA 2H52A 4PN3A 2I7XA 4CFSA 2O0MA 2Q29A 1X0XA 2Z4RA 3L8EA 1BH2A 2CFIA 1MQ9A 1OFUA 2PXXA 2F1IA 4M89A 5FUXA 3ZHBA 5IJ0B 1FFSA 2BAGA 2G63A 4L2IA 1LJ8A 1TZMA 1YDEA 2Q99A 1NR1A 3VTFA 2CJXA 1R6UA 1L4MA 2JKZA 4LNUA 4NZOA 3W4KA 1ZI9A 4YRPA 4DL9A 4KIFA 2OVFA 3TZHA 2A9FA 4MVJM 3LC1O 1SVOA 3CS3A 3OAAA 2FXIA 2YV5A 1KBQA 4IHJF 5JROA 2JGLA 1YZKA 2QROA 1K97A 3UIEA 4MCIA 4JUFA 4FIDA 3WKBA 1ZK2A 4F7DA 5JVDA 2QMQA 1OLXA 4P32A 2HFKA 3BXFA 1Z4NA 2QRQA 2KMLA 5HJ2A 2J3QA 2OV3A 1RWWA 3D0KA 3KAJA 4IUDS 4TSFA 4UXJA 4JYMA 3I6MA 4MR8A 1PLLA 1U2PA 2J4CA 4IFBA 1KVQA 2FKNA 5K6TA 1R6DA 5ALFA 3OZWA 3JPWA 4FYHA 4UBOA 4MDHA 1L4FA 2EWVA 3JATA 3PNBA 5HS6A 3ZVRA 4GKBA 4QTUB 1SMKA 5A5DA 3TQFA 3LMKA 3D2LA 3ZXUB 1RXUA 1YR6A 4BO3A 3NI2A 2IHTA 2HA4A 1V7ZA 4Q3NA 4AROA 3G17A 1LTHR 1DO8A 1WE2A 4JX9A 5I5GA 4HV4A 2H18A 4IEFB 5CAEA 2P4SA 4K6OA 1RRPA 4JR0A 1GTSA 4DZRA 4N6NA 3QEKA 3T3EA 1XWWA 3H04A 3VR6A 1JU9A 4QYSA 3S2YA 4BQQA 2UYYA 3MWKA 1NLFA 4KEAA 4LJ7A 4CNQA 1Z3IX 1SZJG 1WCXA 1JHAA 2YY6A 5BR8B 3CV3A 3U3JA 2ZDGA 1J2YA 3U7IA 2ZW9A 2E4VA 2HF9A 4R3NA 2P5UA 2VAPA 4U2BA 3SR3A 4H7DA 3VC3A 4CM8B 4JYAB 3LG2A 3LXRA 1UBLS 1FP7A 3O74A 5A2QA 3AEKB 2XV1A 2XSZD 3KLMX 3DVRX 4I50A 3VYSB 1NJ2A 2VBGA 1L7RA 2VK1A 2B5WA 2FG7C 2X3UA 4PSVA 2HU2A 2R8OA 4LYFA 2CHEA 3S2GA 1L8AA 3CH4B 3GUVA 1KNXA 3SDBA 2AEEA 2E87A 5J3JA 1TKRA 1YGYA 4HHEA 3PZBA 4HMOA 2WK1A 4NQRA 4ZQGA 1LDBA 3SE0A 1L9XA 2XCRB 4MUFA 3WK9A 2PMBA 4NCXA 3IEIA 5LMZA 4G1EB 2NXWA 3CSUA 4D3DA 1TW2A 1OIWA 1THZA 1JE0A 1V9SA 1IZ0A 1JHUA 3X1ZA 2FUEA 4F2GA 1A82A 4ZK6A 2HCTA 2JFXA 1M6YA 2C8JA 1KFKB 2M9MA 4YECA 2O1EA 4PBTA 1XT6A 1U2EA 4C03A 1AXEA 2PGXA 1BHQ1 4HGZA 3TKYA 1NUUA 4J1SA 1IHDA 5KCMA 4YMUA 2VDNB 1L9KA 2ZBGA 3GJQA 3GPIA 3E5RA 4OSEA 1HDOA 1Y1TA 3CBGA 4QDXA 4RD0A 5DV9A 1TZ2A 3MINA 2VHXA 2PGDA 1QO0D 3BMCA 4M0PA 3L0DA 4DB4A 1KEPA 2JGDA 4ER0A 2JFVA 3WLRA 3T1VA 1V5FA 5KU7A 5CYPA 2BRUC 4P86A 5FX2A 2Z2XA 3AL2A 4GECA 4RZHA 3TQQA 2Z4TA 4XQ0A 4H7PA 2A33A 2V4ZA 5JADA 5EZQA 3U7QB 1DBRA 4NFLA 2VJAA 4KQXA 5AXDA 1JA0A 3NYIA 1KJNA 5LQSA 2J0VA 3CMCO 2WFLB 4DNQA 5IDVA 3BJEA 2HFJA 1VLMA 4U7PB 2AFIB 2PSSA 3WLAA 1W88A 1YL6A 3T4EA 1MR3F 2WD7A 4WNIA 1B0ZA 1KDTA 2Y68A 3EXAA 4MJ3A 2AZTA 1FNNA 3OIUA 2AK2A 4NE9A 3WMRA 3OZIA 5BRAA 4LGVA 2ZSIA 4XOIA 3AFGA 4ZWNA 3RNOA 2FAXA 4G5SA 1OI7A 1NFQA 4MMZB 13PKA 5I4KA 5IWAB 2RIRA 4BNKA 4BTLA 2VJYA 5TF0A 5HILA 1E1QD 4BVEA 1QONA 4KYIB 1F12A 4RA6A 2DYKA 4RD3A 1RADA 1QCCA 4H3SA 3E81A 3DDOA 4PZZA 5HK9A 1G6KA 2QW8A 3OMWA 1I1QB 3Q3VA 3TZCA 1NKSA 3TLXA 1UQRA 1ZBQA 2HPAA 4FMDF 5GAJA 3ZU2A 5E95A 1S7CA 4IDOA 4CIDA 4R4JA 1ISIA 4I5FA 4B6RA 3VHLB 4CMEA 1A9PA 3FTQA 1FYDA 1QPGA 3PGMA 3DLBA 4QAQA 5HIIA 3ZIUA 5KSZA 4OV6B 3WYEA 1RLJA 5KYGA 1Z73A 1C9YA 4XVHA 1R4AA 4E12A 5AT1A 4HH0A 4FGZA 5K51A 2VSOA 3UBMA 1BKDR 2ZBDA 2PGAA 1PGNA 5EJ5A 3M1YA 1WUJS 5DYGA 4D9EA 1EFAA 1WU7A 3U31A 3PV0A 4TVBA 5FAKA 1N1DA 2JIDA 4O2AA 1CQPA 2GTIA 4EKGA 3GEBA 4HQLA 3AUFA 4WNAA 4ZODA 2R8BA 4KGXA 4ND7A 5SZKB 3DDHA 1WNTA 1CR4A 4C07A 4E5NA 5DNCA 1KETA 1X1BA 1LDEA 1F8XA 1ODIA 1AZWA 4RS3A 1XO1A 2DBVO 5AW5A 4J90A 5KI6A 2JCXA 5B37A 3TTYA 1T1EA 1FYVA 4HS4A 4LDPA 5B36A 1F8GA 2JIMA 2JLRA 3T1OA 1ULAA 4AG3A 5JASA 2XQJA 1AKVA 1G5FA 2I67A 5IAGA 1PJTA 4XIGS 2R87A 4GR5A 3U80A 4RAQA 1G5TA 1D6JA 5J43A 3ENKA 5EXEA 4QDOA 3WFJA 4RADA 5BSMA 5GGYA 4HFNA 2WM9B 4KO4S 5EXDA 5ESWA 5GVSA 1CTQA 5BP7A 4JY7A 3VZBA 2GO1A 2PRJA 4LX0A 1PSDA 5A4KA 2E9SA 1QIGA 1TO6A 2VCYA 3LWBA 4P4GA 4FFNA 4R05A 4E70A 2IDJA 5DK6A 2HMAA 2VPWA 3PP8A 3W2GA 5I9IA 3RS4A 1DC5A 1NLUA 2F43B 2XYPA 1M0SA 1ZX1A 1S9HA 2ZUUA 3OLYA 1Y48E 3TDNA 1XBTA 3RC3A 1CRWG 3DMFA 5FBQB 4D80A 4BQSA 4EW6A 2HBYA 1WS6A 3I3OA 1CJKC 1LBSA 3IQWA 4AJPA 1XROA 4R1OA 1A7JA 1Z39A 1KOFA 2UU9B 1PZGA 2H7XA 3EHDA 4IJMA 4KLAA 4UM9D 5DN6A 3OU7A 4P2BA 1ACLA 1ZN2A 4EGCB 5JRZA 5BQ5A 5LOVA 3PUWA 2AN3A 1GOTA 5DU2A 1XQYA 3T8YA 2B69A 4I4IA 4EW3A 5KYWA 5TE9A 2NZJA 4RJJA 5IVHA 3VJLA 3BRQA 1EJ6A 3L7NA 1T6YA 4NESA 3GPCA 5BWNA 2XMPA 3F6PA 2GJ8A 3V1TC 3KT8A 4URVR 1N8KA 2JH9A 1E5XA 3BMOA 1Z68A 4N49A 5LDGA 5F1KA 1Z8HA 1Y1KE 5TEVA 1BW9A 4OGWA 5FUVA 4BFVA 2HU7A 3L0BA 1GGEA 5DE3A 5KYXA 3PGVA 1PG0A 1CD5A 3DQPA 3EXHC 5AUQA 3ORHA 2HX1A 3ZV4A 3WIDA 1EFPA 1R4MB 1CNEA 2B25A 4GQBA 4M83A 4ABTA 4UE6A 5HQJA 4CHGA 2FH5B 3U26A 2WVJA 1K66A 1P33A 4F1WA 2WYUA 4O4IB 3HO8A 4O0LA 4HUQA 4KLRA 5CEFA 1HT1E 2HC9A 2V8BA 2IUFA 2A6PA 1L7AA 1U3FA 2PV7A 2Z8XA 3BCSA 3K6JA 1PQPA 1E1RA 1LZKA 3FGZA 4RAOA 4KDFA 4BX2A 4F71A 1V8DA 3IP5A 4BVLA 3C3JA 3ZWPA 2GEFA 2QT9A 2DHEA 1LGYA 1GFZA 1XPJA 1CJUC 5IXSA 2WHYA 1JFVA 4EHJA 1S8FA 2X7XA 4MB2A 5F2OA 3AEUB 4IRUB 1OX4B 3KT3A 1EFRD 1L8OA 3DQQA 5I3ZA 3ZKWB 3JTMA 1POWA 3DLHA 2OPHA 4IIHA 1D2CA 1J7KA 4WPGA 3W7AA 4YACA 2YHSA 2OO5C 2CE7A 4FMBB 1Z7WA 4F4DA 1FZTA 3QXJA 1G63A 2QSYA 4HNGA 1G8GA 1XSEA 4KXYA 4UHJA 4EGSA 1JI3A 1JWAB 4ARVA 1DRUA 1A9RA 2ZB8A 5K3EA 3G1UA 1QB7A 4WINA 3FNRA 3WMWA 4TRRA 5A5EA 3TVYA 2PO5A 9GPBA 3SM9A 4UQLA 1JV2B 4YR7A 2OBLA 1S4QA 1XG5A 5DBOA 3CH7A 5TJHA 4C9BA 2DETA 4P0QB 1JJVA 1T36B 3ZHYA 2Q1UA 1MNAA 1HV8A 4W1RA 3WRXC 3CBQA 1NWCA 1U4NA 2ZUCA 1OBCA 1JB1A 1VCNA 2GERA 2JANA 2CNBA 1J2TA 3QENA 5LZ2A 2JRCA 4FZVA 1FW8A 5EHIA 1B8VA 3HJCA 1E0DA 3T7CA 4RNDB 3LVBA 4YAIA 3GFGA 3QIAA 3QOXA 3E84A 3KDSE 1R88A 4S1TA 5KQMA 5JQGA 1BU5A 4ZYVA 4CL2A 1GADO 2YMLA 1U4SA 3HB0A 3DV9A 3WIBA 5KTTA 1KEEB 3PFIA 1P4RA 4A2PA 5JSZA 1WUTA 1QU3A 4LYDA 4R1QA 2OBNA 2GASA 1XZDA 1XXHA 1U0NA 1CDZA 2X5KO 3HKEA 1V8BA 4GNKA 4GWGA 1Q5PA 2RAPA 4TTAA 1BVRA 4CQJA 2FR1A 3H05A 5B3LA 3EIHA 4OHVA 3RTEA 4FZ3A 2HYIC 1U94A 2QTWB 1FRVA 5EWJA 4TT8A 3PGA1 3IOCA 4X85A 4XSVA 3VZSA 2A57A 3CG0A 3LWNA 5AM4A 5UKDA 1CQJA 1LC0A 4V39A 4C6TA 4AU1A 2VDLB 4EI8A 2HPVA 3LGSA 2QZPA 2WM3A 5BV0A 4NYIQ 1DKUA 3OC6A 4R3UC 3H4IA 1PGJA 2GKOA 4ZYWA 3AM1A 2AUMA 2D3WA 3N58A 4C08A 1N3BA 2YCLA 3UWSA 1E2MA 4CLRB 2R65A 4IDBA 4PXSA 5B12A 1JFFB 2ZATA 1TF2A 4O1HA 2YWEA 4G23A 1NYTA 4A6XA 3QITA 4LW8A 4IDCA 2COEA 4ZANA 4BQNA 3C6ZA 4HATA 2WJPA 3G2JA 5BMVA 4ZO4A 2ZJOA 4GF5A 3MGAA 4L5YA 3TLGA 1FFCA 3K9FC 3THXA 2IYRA 3UJBA 3IDOA 3R5KA 2UKDA 1CUCA 3GJ7A 2V45A 4C1BA 4D3XA 4Q05A 4RKWA 1BG6A 2AT1A 5LQMA 5BO5A 1U1EA 3IAAA 3FNFA 4LJ5A 4WK4B 3SY8A 1SUAA 1NT4A 2QX8A 3KOXA 1O0CA 3HVRA 1NM5C 2V7BA 4UMFA 1GR0A 1R9JA 2WFAA 1KH3A 1GL6A 2QDKA 2ST1A 3QBEA 3SLRA 1USIA 2JA1A 2GX6A 3PD7A 2X9VA 1IN7A 1XTIA 4D97A 5HOEA 3I62A 4OB8A 2H5EA 4RTLA 1BOFA 1OXXK 1ADJA 2GK3A 3N3BC 4YUVA 5JW6A 2D0PB 2GAFA 1LLCA 3PFNA 2CZCA 3ZK7A 3KJGA 4QEKA 4B3HA 3T4PA 4IO1A 1KMCA 2RHRA 3MCTA 5BSEA 1NW8A 4Q66C 5FLEX 4CN8A 1B74A 2PIDA 3B78A 3I6ZA 3UOWA 4XM0A 3V7UA 1UPXA 5CXQA 3R6WA 4MLCA 3RVRA 3PRYA 4Y1RA 2FP3A 3QXCA 3SVZA 2CEKA 1JSXA 3N2YA 1E3IA 1SD1A 1T2AA 1Z7BA 2IOFK 1AC5A 5GM2A 3S55A 4BYMA 1G16A 2O1SA 3LSTA 1C30B 5IMBA 4DRXB 3ISTA 3EVAA 1JSLA 2W2LA 1VPEA 3PA6A 5DLQC 5J2UF 2IS1A 1UK6A 2BRUA 2Z57A 4XIYA 3GP5A 5DDIP 3T12A 5KEIA 4JROA 3R9XA 2AG6A 2W11A 3ND9A 4FC6A 3WHLA 1R8YA 2JBWA 3V8EA 1T9CA 3E5MA 4GNRA 4DCMA 1Z75A 1XA4A 4I1SA 2PD3A 5LJIA 2AMJA 3Q15C 2YWFA 1KRHA 2VPIA 2IF0A 3I42A 4UTXA 3VPHA 3KOYA 1MVLA 4HRXA 2CUTA 1H8HD 3KVYA 5JY1A 4OI1A 3H6KA 1ULSA 3LF2A 1EI9A 3A4NA 1QQ7A 5KTRA 4M1EA 2V58A 3KALA 4PX9A 4ZCQA 2KB0A 3RRYA 3AEQB 4PAWA 1IOZA 1VG8A 1Z74A 4OUDB 4PWZA 3K7EA 4PXAA 4TM8A 3TJZA 4AD8A 4GM4A 1CDDA 3ROZA 1LLUA 1TECE 1O5TA 5KX5F 5B2FA 1GJRA 1PT8A 2V7QD 2RE8A 1LX7A 3E22B 1GU7A 3EB9A 2ZUFA 1LBIA 2FWAA 1ISPA 4I4TA 2ZYSA 4JUIA 4OHOA 1L8LA 2VF7A 2W0MA 4XM1A 3KYCA 4YJDA 1XA3A 5ERGB 4EY4A 1RI2A 1ZC3A 5CCDA 1ISSA 1OZAA 2AGVA 4UAGA 5IHPA 1O6ZA 4BFUA 3VZCA 3NAQA 4LZZA 1DTEA 2WDPA 1TLFA 1KZYC 4M9CA 3PYLA 3DDNA 4RESA 2PBLA 5IZCC 5HUJA 1IZ9A 1NDUA 1ND6A 5AKZA 1P7VA 4C29A 4J16C 2CHUA 2F3RA 2BSXA 5KYYA 5CFNA 4J75A 1P75A 1LPOA 1SURA 3T54A 3KYBA 4AJ4A 5HKBA 2OCAA 5CH5A 2OHHA 4HYQA 4ZQBA 2O6LA 4G01B 3A9SA 1HE2A 2P65A 3W7BA 2GNAA 2VRCD 3ZS8A 2REQB 3W6ZA 4AJNA 3PPWA 1P3DA 3ECAA 1BU8A 1ZL0A 3BFJA 4BJ5A 4YRLA 1VE9A 4HLUC 4BO8A 1NDHA 4DIBA 2IP1A 3UMVA 1AK2A 4NHOA 3AHEA 4FBMA 1ISFA 1TJ4A 1OI3A 1SOWA 2BFEB 2FMIA 2MINA 2A5DA 3NAMA 4ZV7A 3QPDA 4DCVA 1IEWA 1U3TA 2QUIA 4X1KB 1FTYA 1WA5A 4V0RA 3NCHA 2RIPA 5GJCA 5ALZA 3U09A 4LEIA 1JDUA 3JQFC 1WD5A 4BO7A 1QBGA 2XA2A 1T29A 3UZUA 1FYWA 1U2SA 2ORWA 4ERXA 4Q4HB 2RJNA 1X0VA 1SXJB 4RHFA 4RL4A 4NZYA 4YS6A 3WGLA 4EVQA 5FDFA 1GFWA 1GZ3A 1QG6A 3R3SA 4O8CA 1ML3A 2OCXA 3D2CA 4HEQA 3AKZA 3UT5A 1FIUA 3AR5A 1G4UR 3OCWA 1U3GA 2H1LA 4K9LA 1L4UA 3L5OA 2JFGA 3ITEA 4KPUB 4PRYA 5DNDA 3VJRA 3QUSA 4R9VA 1A7UA 5IANA 1D03A 3OJ0A 4HFRA 3WAKA 4C0JA 4RCYA 2AQHA 4E88A 2R00C 1VCOA 1X7DA 2XCOA 1XI2A 3CKYA 3ROPA 2ZSEA 4AMGA 4FFRA 4MUNA 1LV8A 2FFAA 2ZBFA 4G1MB 3RANA 3WICA 5FHRA 5CMLA 3SEFA 3WSWA 4YRTA 2C2KA 3NH6A 3ZU6A 1R7RA 3IVGA 3NANA 4MTLA 1F60A 1QBKC 2XGSA 3DCNA 3LC2O 4NZNA 4UBKA 1NF9A 1D0VA 2XRYA 3O1HB 2QENA 5LZ8A 2V97A 3N8GA 3SZLA 4UM5A 5DLPA 2ATVA 1ORDA 1SUPA 2EHDA 1QXSA 1L4GA 4XD2A 2CD7A 2EF1A 4Z3KA 1GN8A 2R7KA 2HR1A 3ORSA 2W43A 1O77A 1HT0A 2VUUA 4ON9A 4TTSA 3DCIA 3URMA 2K7FA 1X70A 3L4BC 3HA7A 3HMKA 2A9PA 3KLPX 2XGGA 4QAJA 1YA8A 3GYBA 4E15A 1OLOA 1WHTA 3GOQA 3BIXA 2PL3A 3CEPB 4EY3A 5E3JA 4NARA 1VE7A 2BM8A 2DULA 1RQLA 1GNLA 2JGRA 1HEIA 4JLVA 5ENZA 2GD1O 1UIRA 4QVKA 1XEFA 4KO1S 3GJXC 2WINI 4JJAA 2IHZA 4J2OA 4EY8A 1P17A 3VI3B 1H1LB 2FPMA 1R0SA 3ND5A 1DWOA 3EXHA 1VMIA 3COWA 5JTTA 2G4VA 3C43A 4ZA2A 3STUA 1IBLB 1BFKA 4YMSA 1Q7BA 2VKTA 1QAOA 3HJTA 1E2PA 2C2XA 2R84A 4HPWA 4CTJA 2BMEA 2A0YA 4X84A 1BCSB 5ADUS 1SO8A 4DPLA 2AKAB 1RIFA 4HDNB 1TO1E 1HETA 3SYMA 1E4OA 5IAKA 4BLRA 2F6RA 2EJCA 5I8ZA 1X8KA 3F47A 2M98A 4B3RB 3LZDA 3T7SA 1VIYA 1L5SA 1C8VB 1NASA 2VAVA 3G59A 4CTKA 3U17A 4CIWA 2WJAA 4KGVA 4QWWA 3CUYA 3CW2A 1OOEA 5B53A 2DQ4A 3H7IA 4ND8A 3OHMA 2NAPA 3PR1A 4OJNA 5A02A 3A9UA 2ENUA 1DLIA 5FT9A 4IZ6A 5J4YA 1XU4A 4GAEA 3HKCA 4V1CB 5JXJA 1MABB 4M86A 3F5FA 3LOUA 2W5UA 3AM3A 4FOSA 4JP5A 2G1KA 2XBLA 1SPXA 4R68A 5D3MA 4RVFA 2GR9A 3USZA 2HEIA 2CXNA 1QHSA 5L7YA 4PCLA 4J0EA 4LUCA 2H4WA 3SHQA 3IBFA 3ZDEA 1MA0A 1PFWA 1TT5B 2FA9A 2OO5A 3ODPA 2GM4A 3ERCA 2X1MA 1EWRA 4L8FA 4WMLA 3UUEA 4Y30A 4Z4QA 3OOYA 3NHWA 3GJ0A 4UKDA 4Y9SA 1RC0A 2FZ5A 4C4SA 2BF4A 2CLEB 2Y92A 2ZP1A 3PGLA 3REQA 3OY7A 1JAXA 3NTQA 4N0EA 1X3LA 2Y2VA 1QYVA 3H9QA 1GZUA 3ICPA 1UEJA 2A5LA 4GLLA 1MNQA 4JNKA 1WZCA 1L4BA 2ZJ8A 2WKRA 1HQDA 4RPJA 3GLSA 4YRQA 4YRGA 3QEOA 3LX5A 3NTOA 3L0YA 5KPJA 1P1IA 2EFJA 1AS2A 4L8WB 1T2EA 2DERA 2JJYA 4X44A 2A1IA 2DKOA 2RHMA 3IV7A 4MUJA 4EG3A 2Q3BA 4WX2B 3WNZA 3WRXA 3KPYA 1ECFA 4JGBA 5I7WA 2YC2C 3LUCA 1E1LA 1R15A 4N54A 1RC8A 5G40A 2CV0A 5CK4A 3T5PA 3V8RA 1OREA 1GGKA 1XB2A 1XCGB 2J6CA 5ENVA 1NQUA 2JI4A 1AHIA 2HF8A 3WAGA 4PSDA 2EFEB 1WVGA 5EG5A 1ORIA 4LMBA 2EKPA 1WHSA 2JLYA 2PQ2A 1LSOA 4KTTE 2I6SA 4QNNA 5HX7A 1TM1E 1PW7A 1UJ5A 1MAVA 2BFOA 4WXYB 3ZWQA 1HOTA 4DM4A 3ASUA 5BQ3A 2EX0A 2XEXA 4OQDA 3Q9UA 1X7GA 3DGEC 1JQKA 1W52X 2Q4BA 4FOTA 1ZM3A 3I9NA 1NXPA 3O8CA 3H4VA 4XXHA 3BYZA 3H84A 3PPVA 4WKGA 5E6RB 1GRCA 2RK3A 3N2GA 3BGWA 3DHEA 3Q3JB 1U0OC 3GIDA 1JF8A 2BHRA 4DDUA 3FAKA 3WDSA 1KZ4A 2O2DA 4KE7A 3FAZA 2DZDA 4JLJA 3VBEA 2C2WA 4G5QA 3ZDBA 3LPAA 4ZRNA 3HUFA 3W8RA 5LQAA 3AF6A 5FNVF 4DSOA 1WXEA 3I32A 4RZSA 4NWIA 5DK4A 1KO8A 1ND5A 2HRZA 2YWDA 1ARZA 3EG5A 3K1ZA 3PNKA 5DJ5A 1OFUX 3S4YA 3LQ2A 1MGPA 2WOJA 4YJGA 5AQEA 3ROGA 1SC9A 3EBLA 2ZJ2A 3JR3A 2W58A 4N9WA 3CPSA 3OIGA 2ECPA 3V5NA 4XCQA 3W2HA 2YNMD 3JZDA 2ZSKA 1KVTA 2MIIA 4AURA 4E22A 3CRW1 2D6FA 1OBHA 5DM2A 1H2EA 3TR6A 2PFSA 1M3SA 3F9CA 3MSCA 4R8MA 4X8OA 2BEVB 4JBIA 5ALOA 3TH5A 5B30A 1R0LA 4KLCA 5EINA 3OQNA 3BQ9A 4XZ3A 4Q02A 2G8NA 3TKAA 4YUXA 4OKNA 3X2FA 5A3JA 3CF4A 4TM7A 2CDCA 3HE3A 4I9GA 4LWOA 4YA6A 3ZZMA 4BTEA 1MO2A 3UENA 4WERA 1Q19A 3IAFA 4D3SA 1JPUA 1OXVA 1TQHA 4AKSA 4AJHA 1NM5A 4RQAA 1PDVA 1ADFA 2UUOA 2XTAA 4H0NA 4P9NA 4U02A 1RRVA 3V2UA 1T2DA 5ICGA 4PZ0A 1EAYA 1QMGA 3QF4A 4MOWA 2EP7A 3C0KA 5TQ2A 1PKEA 4AIRA 2ZR7A 3I92A 4O2BB 2ZIZA 1GAWA 5CM8B 1J9GA 3WK7A 3H5NA 4MYTA 3K20A 4HNSA 1LF0A 1AQLA 5KJ1A 4TLCA 4RF4A 5CNMA 1FS5A 4OQZA 2HXYA 4Q4LA 1AOXA 3GGSA 5BN4B 2HIGA 5BV8A 4AQDA 1DOHA 3G2QA 1L5GB 4TKUB 3EC2A 1CRQA 4WL0A 2O4CA 3X2SA 2QP4A 1JFTA 1HYGA 1O89A 1YVDA 1T2CA 1PVDA 2NTJA 2PJUA 4WKBA 3HXMA 1Y6GA 1XX6A 1TAHA 1ZHFA 1DAEA 1JQAA 2R2GA 4OQLA 4P6VF 5AKKA 2LXNA 1U7UA 3TSWA 3QX7A 4JC8A 5SY6A 1NOJA 4ABYA 1QUFA 1VRVA 3EZFA 2NTEA 2Z8YM 3BXHA 3B6JA 5DB4A 3OP1A 3E3NA 2FMUA 2RH5A 1GFSA 2RK6A 1Z22A 4WOCA 2OGUA 3AONB 3S5UA 3A10A 4E7PA 1VKJA 4KFCA 2QUKA 4BMXA 1ZOOA 3SP1A 3PFBA 5CIQA 3KKPA 3ETDA 3OPYB 4HQKA 4BNVA 4RIHA 1ONSA 1G8SA 2ZYGA 1DC6A 4I4NA 5JS7A 1LZLA 4CMJA 1N2CA 4RV9A 5B1SA 4DARA 1JG4A 1PJBA 3O03A 3X3HA 2OCDA 1PYGA 3VYTB 4PLVA 3GHHA 4Y67A 4EDHA 4IUYA 4RFLA 2GT1A 1U8AA 3TWOA 3A1UA 4BBJA 1JIKA 3MTEA 4LRTB 3SLKA 2VP9A 3WV4A 2DCUA 1X74A 2L19A 1Y5LA 2ETVA 3PD1A 4NS1A 4EVSA 1NHWA 1RXYA 2ZE5A 3VZPA 1RACA 2NU8A 1GUFA 1ZJ6A 2C9BA 1TRHA 2B7CA 2W22A 3BXXA 3GG2A 3ZU3A 3U48A 4KNYA 1QP8A 1YA4A 1JDBC 1OLUB 3D4NA 1XU7A 3I8SA 3OSUA 4P31A 5AK6A 4ITRC 3AUYA 5ALJA 4QM7A 1G7SA 4MW5A 4UU7A 2IH2A 4Z4CA 3G9TA 2QNBA 2XAAA 4LZWA 3V55A 1OC4A 4MDFA 4J4BA 3U39A 1CJBA 5A04A 3KVRA 1IATA 1RZ3A 2RHHA 2OMKA 2GBLA 2WHPB 2ZTLA 3G5MA 4LDQA 4U5QA 3WXMA 5JNTA 1SBHA 1C7IA 3F71A 3ILSA 4AL4A 1N34B 2H3HA 4NDAA 2IBSA 3H9BA 4QOFA 4Q4CA 5L53A 4MHTA 3O5AA 3LCVB 5IZCA 1XZIA 2C5LA 1DDIA 2XDYA 3NDPA 1YT5A 2EFYA 3PB3A 4RVGA 5E0OA 2WTNA 4J16A 3FD8A 2WDZA 5AM3A 5HS4A 3EMVA 2JCGA 3RYFA 3T5MA 2QGFA 3AC0A 3RT7A 3I30X 4AY2A 5KOYA 1THTA 3OLZA 3DJFA 3FPKA 4OJTA 3CNQS 3KUKA 5EQFA 4BMSA 1UJCA 2VYNA 5KC8A 4MV3A 3F7NA 1MFZA 1TQ4A 4O08A 4RHYA 4ZN6A 3V2IA 2WJIA 1E2BA 1DFHA 1X7WA 4O6VA 2PN1A 4PCAA 2P9JA 3PHHA 2I8AA 4XTRA 4F4IA 2C92A 4HLUA 2UXBB 4FZ5A 5DTIA 4ZU3A 2QNRA 2PKWA 3IQHX 1A8HA 5EERA 3ZBQA 4B4DA 3OA2A 4LPSA 4G0WA 5E2IA 2VR1A 2Q27A 4Z9XA 4BBAA 5JAUA 2PS1A 1LPAB 4ZI7F 3MPOA 5FJIA 4PLGA 1JTVA 1PG5A 3LHIA 5CGQB 1SQ5A 1AGXA 1YQXA 3OCYA 3ZE7A 1XEWX 1PJ2A 3PCRB 4FX5A 4DRYA 5A4JA 1MHPA 2AOXA 1P1FA 2BOVA 2AL7A 4YRCA 1YKSA 4J43A 4ASUA 3JQFA 5AVUA 1EK6A 5BN3B 2C9MA 1C3XA 1TCVA 1WXXA 2P2DA 3CUSA 2X2PA 3EHEA 1UK7A 3DWEX 4RVSA 1JG6A 5BYBA 4QG3A 1G6HA 3MWEA 3H1TA 2BCGY 2RMKA 3CB2A 1OXKB 5KVSA 4G56A 2XJ4A 1Z83A 3IS3A 1FFAA 1MKYA 2R00A 3T38A 2GAAA 1IZYA 3EGWA 4M6WB 3GQBB 1E7QA 1PZNA 3A1SA 4DLUA 3KHUA 4HNHA 4TQ9A 4BL5A 4LECA 3H2GA 4JCOA 4NL4H 2FPWA 1D6MA 2OV8A 1WP9A 2LW7A 2Y71A 3GLVA 3LUPA 1L4KA 2X8AA 3G2NA 3KPUA 4RCVA 5EE1A 2I4OA 1NRJB 3V8QA 3WWCA 3ZWNA 3IUYA 2DE0X 4C22A 5JYBA 3NV9A 2WICA 1LDMA 1VE3A 3DB1A 3MBKA 4PGHA 1CY6A 1DQYA 2P30A 1XZBA 2VRWA 4MS3B 2DU8A 2ZT7A 3RJ5A 3T9FA 1TMYA 3OQJA 4DEVA 2BHNA 1WEKA 2CDBA 3GF4A 4HMPA 4B6GA 3EXIB 1I0IA 1V5WA 1S3IA 3LUFA 3OIDA 4NCJA 3RIMA 3H86A 3TRFA 3L4BA 1L3IA 2I3BA 4JAVC 4XCVA 5ALPA 5SZHB 2CXHA 1YJ8A 1NMXA 4E6EA 1CY7A 3NGXA 2LCQA 3MF4A 4XVQA 5HVNA 2VC2B 4LZJA 3EWAA 5HQTA 1CQXA 1QFJA 2V54A 4FSDA 3A7EA 5B2ZA 2Y0EA 1A1VA 2Y67A 1YZLA 2QIPA 2PBFA 4QJ3A 3CLSD 2ZREA 4E2XA 2HF2A 2BJHA 3ORYA 4RK0A 2JDIA 3L04A 5KNCD 3KYIB 3R0JA 4S1WA 5DHFA 3FSRA 3NPAA 2A9JA 1OYWA 5I9BA 2DQSA 2YDYA 4WRRA 1C9JA 2AOTA 3C3EA 3NOOA 4BMDA 1WF6A 2EBUA 1KYQA 2PKEA 2FY8A 3IAEA 3GNQA 4FDMA 4JU8A 1QB8A 3E3MA 1WCIB 1P77A 4QFCA 4WN3A 4G0UA 4C05A 1E0JA 2AI2A 1NUTA 1XZPA 4BFCA 4BNWA 1WCYA 2O3UA 1WY7A 3GEEA 3TBKA 4US2R 2I76A 4FZJA 4N5NA 2B9VA 3CF4G 1DC3A 3BL6A 3B12A 3HS3A 4CIXA 3UW3A 3UW1A 4QM6A 3BJMA 4KAAA 3AXTA 1UQUA 5CXUA 1GQRA 1P7ZA 4GFDA 4RVOA 5KOIA 2LD4A 3BZUA 5TXGA 5HE9A 1PGPA 2Q5HA 1DADA 1QAQA 4ZO9A 5WRFA 1HO3A 4K40A 1SBYA 1WM1A 4LHYA 3TZBA 5H82A 2XBMA 2ZZNA 4GKJB 5J2TB 3PFGA 4LSWA 2XKJE 1G7RA 3NHRA 1UJBA 4WT7A 4MICA 1T8YA 2B0JA 2JI6A 3HC7A 3IKMB 1E7YA 2ON6A 1WMEA 1Y63A 3EAGA 4XVRA 4L5AA 3VC7A 1REQB 3WGVA 1LBTA 2RH9B 3CLUC 2OXEA 4NAHA 1KAHA 1NNEA 2QORA 4D8TA 3GUYA 4FOLA 4MDEA 4EG1A 2W93A 3HUEA 3VPBA 1L7BA 1PR4A 4RDXA 1BDBA 2PX5A 5LL6P 1T2UA 3ZEIA 2IXDA 3REFA 1FP6A 2J3IA 4K9NA 2INGX 3ZE8A 3L8DA 3HWRA 4BO2A 2VNJA