1GCIA

The 0.78 angstroms structure of a serine protease-bacillus lentus subtilisin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords SUBTILISIN
publication title The 0.78 A structure of a serine protease: Bacillus lentus subtilisin.
pubmed doi rcsb
source organism Bacillus lentus
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1998-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1gciA00
1BE8A 4M1ZA 1KE2A 1UBNA 2G4VA 2Z2XA 1TO1E 4I0WB 5JXHA 1WMDA 3VV3A 5FBZA 2ID8A 4H6WA 3GT4A 1BH6A 3T41A 1T1GA 1GA6A 2Z57A 2PKCA 3I37X 2SICE 3H42B 5ARCA 1YJBA 3PTLA 3DE0X 1DUIA 1TM3E 1ST3A 4NE7A 1C3LA 1C9JA 3BPSA 3DYBA 1NDQA 4NMXB 1GNVA 5ARBA 5JMOA 1GT91 4ZOQI 2W2QA 2PWAA 3OSZA 4KG7A 5K7SA 1KE1A 4H6VA 1Y3CE 1P7VA 3LPDA 1AH2A 1WSDA 3WHIA 2E1PA 1A2QA 1EA7A 2IY9A 1XF1A 3LPAA 5SICE 1CNMA 2DP4E 1WVMA 3F7OA 1TM5E 3I30X 2ZWOA 1Y1KE 3D43A 3WQBA 2X8JA 2V8BA 1KDVA 3QMPA 1WMFA 3DDZX 1R64A 1Y3DE 1R0RE 1GCIA 1Y33E 3BX1A 1SCNE 2PQ2A 3EE6A 3TECE 5JXIA 1YJAA 4DZTA 1GTG1 2WUWE 4AKTA 1AK9A 5AMXA 3LPCA 1SBTA 1Y9ZA 4OMCA 4C3UA 3L1KA 4HVLA 1MEEA 4Z2AA 1SCDA 2W2PA 1TK2A 2Z2YA 4AKSA 2X8JB 1T1EA 1GA1A 1ST2A 4GI3A 3HJRA 1KDZA 2TECE 1P7WA 5B1DA 2B6NA 4WOBA 1SUBA 1T1IA 2W2MA 3BGOS 4RYDA 3GCWA 3EIFA 4OMDA 1AVTA 1OYVA 2ZRQA 1BFKA 3CO0S 4CFYA 2HD4A 1TECE 1SCAA 4CFZA 3P5BA 3SQOA 3ZXXA 1TM4E 3WIVA 2XTJA 1R6VA 2Z2ZA 1OYOA 1SBCA 5JXGA 1WMEA 2SBTA 1GA4A 4HX2A 1NLUA 2DUJA 1V5IA 1Y3BE 2DQKA 2ID4A 3PRKE 1Y4AE 1DBIA 2ZWPA 4ZARA 2W2OA 3DW1X 1SCBA 3TI9A 1CSEE 3VTAA 1TMGE 5AVJA 2PWBA 1S01A 4LVOA 4H6XA 3DVRX 1P8JA 3DE4X 1PFGA 1BE6A 3DE2X 4KPGA 1AU9A 1Y4DE 2Z56A 3DW3X 3QTLA 3I2YX 1HT3A 1SUCA 2PRKA 3DVQX 4K8RB 1S2NA 4FONA 4JP8A 1AV7A 1ZVJA 2IXTA 2SNIE 1ZVKA 1GTL1 1BJRE 1IAVA 3WIUA 3F49S 1IC6A 1SH7A 1Q5PA 1YJCA 2ST1A 3A3PA 3DE5X 3F7MA 3CNQS 1SUDA 1C9MA 4YN3A 1Y34E 1TM1E 3VV2A 2WUVA 1PTKA 1SBHA 1SBIA 3QFHA 5B1EA 1Y3FE 1VSBA 1V6CA 3TI7A 2SECE 3I34X 4NE9A 3DE6X 3DE1X 1JEAA 4OV6B 1SBNE 5AQEA 4WOCA 2XRMA 1SIBE 3A3OA 4DJ5X 3VHQA 3DE3X 3D9QX 3GCXA 3DVSX 1GNSA 4DWWA 4C3VA 1THMA 1OT5A 3VSBA 3DE7X 2QTWB 5CW1A 3DWEX 1TO2E 3ZXYA 3GT3A 2P4EA 3AJ8A 5JXJA 1TM7E 3Q40A 1AQNA 2Z58A 3UNXA 5FAXA 2WWTA 4MZDA 4KB5A 1SN7A 2PMWB 1EGQA 4J94A 1SPBS 1S02A 1SVNA 3AJ9A 3SICE 2Z30A 4BWGA 1SUAA 1BFUA 1AF4A 1C9NA 1SELA 4B5LA 2GKOA 2WV7A 5ARDA 5I9SA 3AFGA 4CG0A 1Y48E 1MPTA 2HPZA 1SUEA 1SIOA 1LW6E 5AVKA 1SIUA 1SCJA 3EDYA 1NDUA 1SUPA 1PJ8A 3A3NA 5FFNA 1YU6A 3Q5GA 4LVNA 1KDYA 3LXUX 2PYZA 1PEKE 2W2NA 3VYVA 1GTJ1
chains in the Genus database with same CATH superfamily
5EG5A 3QEMA 4X95A 1JMYA 1PFKA 5HE9A 4LOIA 3FOCA 5HFAA 5LKAA 1P1RA 2G4VA 4FMCB 1Z6TA 1DAKA 2GDZA 3HCEA 5I51A 5LYJF 2V74B 1RZRA 4RHUA 3P5SA 2HV8A 2C4UA 1H8EA 4Q4JB 4QJ4A 1EQ2A 1X9HA 2P69A 1KMMA 4PG6A 2WE8A 1H65A 3UJDA 4KACA 4EYSA 2WJAA 2PSJA 3T41A 3OFND 4G5GA 4J2TA 4JYBA 3I1IA 3K9CA 4DG8A 1ENOA 4I1OA 1ZK2A 4M8IA 3O0TA 2RKWA 4OAPA 1GKYA 2XZDA 1I0IA 1W85B 2W4MA 4IHQA 5FKJA 3GGGA 1THTA 2CB0A 1M67A 2G88A 5H4HA 2OXTA 5L3VA 1P3DA 1P72A 4C03A 1NQUA 4ARBA 1UT8A 1ZESA 3EVBA 4MI3A 3VJRA 3ILSA 4WOKA 1RYZA 3I9JA 4KLZA 3TSWA 4KLNA 3W5HA 1EK0A 2BGUA 4XQ0A 3TRIA 2H1OA 3EPHA 1QSGA 3P9PA 1K88A 1NTOA 2X58A 3LL7A 1DUIA 5IP5A 2EKZA 4KUGA 4QPCA 2O20A 1QHFA 1N2BA 2L82A 1RT9A 1UC8A 2CDCA 2JLQA 2OBLA 3A3YA 3CPEA 3DF7A 1GJRA 3H9BA 3IQIX 1UKBA 4XW2A 4ALIA 4K3VA 1WCYA 3KEGA 4MRAA 4WLFA 5E9WA 1D6JA 1T35A 1M2KA 3ZU2A 1U7WA 1W8DA 2QJRA 2IODA 1OYWA 2YVUA 3IEKA 3M6XA 3A1WA 3QEMB 4AZ0B 1AMUA 2QNIA 2D2VA 3AF3A 4OHZA 3HJAA 1ZCBA 4FHZA 1P4HA 1KVSA 3QX8A 3VUFA 2YOHA 4DN6A 2B92A 5EIXA 3AF5A 1ZMTA 4BFZA 1QH1A 4RYLA 1XVAA 3ND5A 1K7XB 1YCHA 2NZXA 4EI9A 3DDSA 4YDSA 1WXIA 5BOVA 5LMZA 1ZOIA 4Y2TA 4Q9JA 4BBJA 3NZEA 3ILYA 3ADDA 5JC8A 1OAOA 1XXHA 1NLZA 4RDCA 4R1QA 4I4TF 5CIYA 1BS9A 1PHRA 5EHNA 2M98A 4O1HA 5K8TA 1IQRA 4KWEA 5AW3A 4PC2A 1VRWA 2PS1A 3GEBA 3TTWA 1SZDA 3A6DA 1GZSA 4IR7A 3K71B 2MSEB 4BEVA 1R18A 4B4OA 1ZY2A 2FK7A 4DL9A 1WQ3A 1A9SA 2Q0QA 2Z04A 5DLPA 3BJZA 3L8CA 4M0UA 2PZLA 3BKWA 1ECJA 4MR8A 1ZNZA 1FB5A 1N5OX 5CVVA 1IG0A 2JLBA 1ORVA 3BDIA 3MTDA 4F9EA 4J0DA 2XR1A 5DP2A 2CBZA 2Q4OA 4PZ9A 5J1TB 2DP4E 2OV6A 1A95A 1RM0A 2WVAA 3N0TA 3MS4A 4Q9NA 2H2DA 1CUBA 1ZRMA 3I30X 4D2IA 1PL8A 1DBPA 1X8XA 5IFKA 2PWZA 5HNKA 2Y1OA 1OU0A 3C7TA 4MIOA 3ZHCA 3KSAC 4FQ5A 2JLVA 5JCOA 1VRCA 4CT4B 1GCGA 1Z2EA 1DOHA 4AU1A 1FX0A 3WB9A 1HLFA 1XR3A 2E1RA 1U0JA 2OCLA 3AHJA 3F47A 5SZHB 4C07A 5A5EA 3P96A 4KPYA 1S8OA 1E62A 5JAPA 4C30A 6ADHA 2WWYA 1JG7A 3M6WA 4F4DA 1T6NA 3I5XA 2NO4A 5CHEA 3PEEA 4F9GA 1TW2A 2B36A 3KKPA 4WAUA 3LRXA 4F6RA 2EP8A 2ZRIA 2QROA 1TXGA 5CAEA 3NBZC 3ZD9A 3EE6A 4BMYA 5IZ4A 3VZBA 1XXHB 2GEFA 3KEFA 2ID7A 4KQ9A 3ROTA 1PR9A 4MITA 1QOZA 5FWAA 5CU7A 3FPSA 3IPAA 4Q3OA 1G7SA 3G9UA 3G5UA 4AMBA 2WQ7A 1IL0A 3L7NA 4NAUA 1QTIA 4KODA 3WNBA 1GTRA 1ZHOA 3DGFC 4FN4A 5D01A 1WSBA 1HX7A 4IVNA 4DR3B 4OMCA 3I6IA 3FPBA 3IQGX 3OPYI 1XPJA 1M8GA 4MR8B 1FU8A 3E2PA 2YOGA 3DEFA 5AJHA 4L8FA 4A7PA 1JYSA 3B6ZA 4IG9A 4X8HA 5JD6A 4DHEA 4NH4A 9MHTA 4HAWA 3T38A 1DUSA 3OFKA 5BRNA 3JASA 3HXMA 1MJFA 1SCDA 5DHSA 1UJ4A 3OPYA 2B0JA 5DEOA 4MVYA 4YUYA 1PIWA 2IELA 5GM1A 2RE8A 3O38A 4RKEA 2O7SA 3U0VA 4PO8A 2QG6A 5I7FA 3DNPA 1J9ZA 1KI1A 1JQEA 1E61A 2RGDA 1JQ3A 3I6YA 1LSUA 1U3UA 1WXEA 4HQKA 4LCBA 3WFIA 1FX0B 1PL0A 5CA0F 1O5OA 4WZAB 3STTA 3TUZC 1ZIPA 4URUR 4KAJA 2QRKA 2YXEA 3D3NA 1I1OA 2V3VA 2TYSB 2G8LA 2YXDA 4B8WA 4KVZA 2ROQA 4F6RB 4UAUA 1SUBA 4CMEA 3HXKA 1HL7A 4BN5A 2Z9DA 3EXHC 3T5MA 3AXSA 3TBFA 3AL0C 5A5VA 1J0BA 5EJ5A 1IUKA 2F90A 3UANA 4WVFA 4K3UA 2YXPX 3F1LA 1APBA 3KPWA 5BRAA 1EUYA 2J4DA 1UOPA 1E3DA 2YXNA 5CCEA 2ECKA 4JLPA 3U1BA 2X1MA 4XM2A 3MEQA 5JRJA 4L50A 5EOVA 3HNOA 4HWPA 4J8PA 1Z7GA 2Q3EA 3KJFA 1NXPA 4OJTA 5JWHA 3U0BA 2FFQA 2DRIA 3E7XA 1N3LA 3VO9A 1ZQ1A 5EN4A 3S28A 3BT7A 5L4LA 3MGCA 2VZLA 5HHTA 5J4HA 4Y2SA 2FVXA 4JKOA 4Z7OB 2Q2VA 2VP5A 4LYAA 3RU2A 5AJWA 1XNQB 3JASB 3VR0A 3OPYB 1HE5A 4BNUA 4MW4A 1J0DA 1TJ5A 1Y1QA 3I0NA 1CY6A 1OILA 2WW8A 3RS8A 4KQCA 2OR3A 3MA0A 1UJ5A 4J9UE 2AEEA 5EZ6B 2QRZA 4HGYA 5FNVF 4MUIA 5D3MA 2XUJA 3L79A 5F3DA 2Q6OA 1NP3A 1GZHB 1PGJA 2GA9A 3DOFA 4NU5A 5C1OA 2V5UA 1XCBA 5HUQA 2WOOA 3F4LA 2FEAA 3U5ZB 1WDKA 4Q3NA 5HZMA 3OEHA 4DPKA 2WA2A 3E8SA 4DT1A 3IKTA 4F3KA 3RBZA 1J2YA 1KZ1A 1Q0SA 1SQSA 4P58A 5F2NA 4G85A 4Q03A 3L06A 3CGWA 3WWCA 2JKYA 3A6LA 4BN4A 4ZCRA 2X15A 3ROGA 1QP0A 3Q9NA 1DBRA 3SYMA 1Y3IA 3SEZA 2DETA 4U2GA 3JAMA 1J6UA 1FP7A 2WIFA 4ALJA 4BGVA 2W71A 5HKKD 1JDVA 1L4UA 2V1XA 4CMHA 3CLTD 4EGQA 5HM6A 4P7FA 1NNSA 4GHWA 1G66A 3F97A 1N1GA 2VT7A 3I8OA 4HUJA 4LQLA 1RRCA 3O83A 3AYZB 3FCYA 4TSFA 1GRVA 1YGPA 5F1PA 1V2GA 4MKZA 3WWZA 1PE0A 4ZXFA 3REOA 4CQJA 1S01A 1ZJJA 1K2WA 2PUJA 4Y7DA 2MSCB 5TS2A 4R9SA 1LBEA 1OTYA 3ELBA 1HDIA 1WQ4A 4MVJF 2AOUA 4GZLA 4FMDF 2YNMC 3PNOA 1RADA 2EEZA 3HBFA 2XTMA 4G09A 5IXSA 1F6BA 3BORA 3CLRC 1KPHA 3KXLA 1IMJA 3MWJA 5D3MB 1T2VA 1Z7EA 2Y6VA 4BNWA 5JMPA 3HFGA 2PKEA 3H9GA 1MQSA 2C03A 1M6VA 3R9KA 2R60A 4E88A 1Z4IA 4KPGA 5TQ2A 4ZKEA 5IABA 3ORSA 3RIMA 4MHOA 4DT1B 6NULA 4KIFA 4JX9A 5FP0A 2BRUC 4NFSA 3E4DA 2CCKA 1Z15A 2H1RA 2X19A 1W36D 2FR0A 3EBOA 2PRYA 4YHBA 3T7SA 1KKLA 1LBIA 2IOFK 3G0CA 4PS0A 5FADA 2CVQA 1MJGA 2G1UA 4ND8A 2ZLBA 3RT9A 2RI6A 3U37A 2IS2A 1DAIA 3IEVA 5AKHA 2VH2A 3VAZA 1BKSB 3MQ4A 3MOIA 4K8RB 3RE1A 3ET4A 4OJMX 4ZWNA 1JSXA 2EC5A 1FFWA 4PW0A 3FPJA 1TX4B 1SBZA 3ZWOA 4PQFA 4F71A 4DCJA 2ENWA 1NL3A 1JWBB 3Q7IA 3O3CA 3L8YA 2AN3A 4F5ZA 3LQ4A 4MS4A 3G7UA 4C4AA 1J0CA 5DWVA 3KEQA 1BW9A 3EF0A 1ZVMA 2OVFA 2AOUB 2DR0A 4FVTA 1JEYA 2QOEA 3NHYA 3AEXA 3H2GA 1E5DA 4RZIA 2O2JA 5LVAA 4ICIA 5K0JA 2YBEA 1OBOA 2I71A 2G07A 3FPCA 5LMUB 3SP1A 2V45A 1ML4A 2BLLA 4TMTA 2WMYA 3TRJA 2B8TA 4PYIA 3VU0A 2HA6A 1M6VB 1DCKA 4H1VA 1LK0A 1W19A 5A0TA 2H4HA 3EPPA 5TQ2B 3FI9A 1UC5B 3IPYA 1KRHA 4HQNA 4CZ2A 4ZU3A 4WFKA 4XCQA 2XDAA 2XH8A 4N6OA 2Y4OA 4XSHA 1YB4A 1LPBB 2XHEA 1UAAA 2M6SA 4WZZA 3REQA 3VPAA 2AB0A 3G8DA 3Q1KA 4GWKA 3SN6A 4DAOA 3K6RA 3BJRA 1FK8A 3JQFA 3K8ZA 3NRCA 2JJ1D 1I14A 2CJFA 3ZZNA 4DLBA 2DBQA 2YS6A 4ND8B 2PRJA 3GPBA 5AHKA 1TTTA 4MV0A 4TWIA 3VHRA 2DT5A 3HUUA 1IWBB 1TEVA 1VA4A 3ZE7A 3PUKA 2GILA 5DMXA 3MMNA 3HP1A 2GSWA 1ADCA 3NAQA 2VFAA 1E0JA 3MCVA 3Q3VA 4XCXA 4RMJA 3RC1A 1VSBA 1HT2E 1XEXA 2BF4A 3JD0A 4MS4B 5F2OA 1O6BA 1S9DA 3BOSA 1V26A 4IM7A 5MFZA 4JU8A 3IDQA 5BSHA 1V43A 2C9YA 4EIWA 1BAPA 3X1MA 1ZH6A 5BNTA 4GOND 1U0LA 4JLUA 3AVYA 4CQMA 1L5FA 3W8NA 1P9LA 4YACA 3MUOA 1TIBA 1K8RA 3NAGA 2QM0A 1P9OA 2WIKA 2WUDA 5LDDC 2ZM6B 3DDWA 3DVLA 1GPUA 2QAIA 4BO2A 4E21A 1DEAA 1DJMA 3AJDA 2I2CA 2C2BA 3I23A 1TYEB 1KDOA 3I9V6 1L7NA 1PZGA 4K6MA 2RIRA 3FGOA 3DDOA 3KUKA 2LNDA 4WWHA 2P77A 3AUJB 4YUAA 5A2QA 4ZCPA 4B6FA 5B12A 2PAAA 4TTVA 3FLMA 3REQB 4EO7A 5HKLA 3O90A 1KAEA 1LJ8A 1FTGA 3DZ8A 4P92A 2PMFA 3K0CC 1FYFA 2SKDA 4B3JA 1Q2UA 2IXFA 4DSTA 2E4UA 4EI7A 2C7BA 1A8HA 2Y99A 4U5QA 3HSYA 3ZGXA 2DBRA 3VC1A 1W5AA 3MYYA 2QNBA 1UIRA 1C1YA 1N2CE 2XT6A 3H3FA 3OCCA 4IJMA 5E9JA 4LJRA 2W6QA 4WKPA 2J0UB 4K28A 4U5XA 2VSYA 3AVVA 2E5LB 4ENPA 1XEXB 4JWKA 1N0UA 1PRYA 3C14C 4MINA 3ELUA 2YOFA 4XB2A 4ETNA 4QZVA 1ZUNA 2XDYA 3FHCB 3N2YA 2HZBA 4JP2A 5I47A 5KTPA 1QE5A 1UDCA 2CFIA 4CQMB 4I6EA 4WDRA 1FRVA 2X6QA 4X90A 2QVLA 4RVFA 1QZXA 1TJNA 1VHJA 3EC1A 4R83A 5FBRB 3DT6A 5E3JA 2YWXA 4LSZA 4Z4GA 3KQVA 2Q5IA 5E0KB 4C0XA 4J0GA 2C5HA 3A1EA 1DJPA 5AK6A 5KQMA 2D7DA 2O59A 3G0BA 1WCWA 3DO6A 3PXAA 3SIXA 4CTNA 2BGNA 4F84A 5EJFA 5AI4A 4D0NA 1RAIA 2J9FA 4HNRA 3U81A 2FB9A 2PIDA 3NBQA 3ZTYA 3U61B 4BVBA 3QELA 1FU4A 1JIXA 5TY0A 3TBKA 1E64A 1UXJA 3UPTA 1N32B 3OURA 4EUFA 1NN0A 3PRYA 2DU8A 1C81A 1X13A 4KJZA 2BMJA 4WADA 3SJAA 2LZ0A 3GBSA 4JUBA 4A9AA 3AM4A 1NW5A 1BEZA 4WEOA 3HABA 1NVFA 5DNVA 1W2WB 4B5LA 3W0LB 4AYTA 1RXUA 3VMFA 3GUVA 2P2YA 3AR4A 4HN4B 2GKOA 5D85A 3ZWCA 1ZA2A 2CXPA 2XNCA 1WLSA 2ZTSA 2W6ID 4QXQA 1CIVA 1QB7A 4JN6B 4HXYA 4RV9A 4TLBA 5FHRA 4ZVQA 4YV0A 1YB1A 2BGLA 4INZA 2BW0A 4QXOA 4YAEA 1KYQA 2E49A 1I2CA 2RK6A 2QXTA 3O8LA 4KNVA 2OC9A 3IELA 3EGCA 2B7LA 5KYYA 1ECGA 4XRRA 3LHSA 2MTBA 2BL4A 1RRKA 3BF7A 4WCVA 3KJXA 3L8ZA 1SG6A 3A2MA 3VR4A 5KZMB 5F1OA 4O2LA 2CZCA 3Q3CA 3NFRA 5FNZA 5KCMA 1NXSA 2ZJ1A 3H5RA 3JVVA 3LQFA 4JDPA 2EBHX 3LKZA 5LP1A 2XCRB 1LBHA 1SA0A 1OB5A 1O7JA 4IH4A 4MW7A 3ZEIA 4C1NA 2Y68A 3BXEA 4YMUA 1NXXA 3C8UA 3JZIA 1J2TA 4M1ZA 1X9GA 4GUDA 3SGLA 5L3SA 5EFOA 3WKAA 2HJRA 2HBZA 2J9FB 3MSXA 1TO1E 4I0WB 4PINA 1KZ6A 2J9XB 1MQ8B 4WI1A 3NGXA 4Z8XA 3QELB 4JLJA 4BCDA 5AW9A 5IASA 3AEYA 3G9QA 4JV5B 4MIKA 2DEUA 2OV1A 3WKBA 4JQSA 1O8BA 2G5PA 1Z17A 4J91A 3JRNA 1LY1A 1N25A 4CDGA 1H1DA 4DLLA 4E31A 5B30A 4BZZA 2II6A 1T1GA 1G9TA 2VWHA 2PSFA 2WLTA 3HRKA 3ZEAA 2PKCA 1ACMA 2EBUA 4OU5A 1CS0A 1NQTA 3U7JA 4Z49A 2R79A 1LJLA 4C4ZA 2BR5A 1B1AA 3NOOA 1N9KA 3BCUA 1SG0A 2Z2IA 3A4VA 4P33A 4ZO7A 1YB7A 1AQJA 1VLQA 1WCV1 3EXHA 3GIWA 3KQSA 3OZ7A 4GM4A 5B6PA 4ZEOA 4QUGA 5KYYB 3U1TA 4GLJA 3C7DB 1O94C 2ZEJA 3WFJA 2EGGA 2NLOA 3V4RA 1E4EA 4YCAA 1AURA 4TLLB 3U62A 5C9ZA 3C5WP 3RABA 1U90A 2QTNA 3HFSA 1G63A 1X14A 1XELA 3M49A 1WUJS 2RHGB 3LP8A 4L9SA 4Q7MB 4DV1B 4KQMA 1EIWA 1ZMXA 1PGPA 2VCHA 3B20A 2JVIA 1SA0B 1GWNA 1KAHA 1YR2A 2YMMA 4KL8S 1GN9A 1B0PA 3FR8A 2IPOA 2BYTA 4ZOQI 1V8DA 3LC0A 3PX2A 3MAJA 3QVSA 3WV4A 4C0KA 4F5DA 5I4BA 5L3SB 1DBVO 2WYOA 3AVTA 2CVZA 3DHWC 1U0RA 3OSUA 4R6XA 1VYUA 1RM4A 3EZYA 4NESA 4WHMA 4IZIA 1ZGHA 4AXXA 2GM9A 3JYOA 3N2IA 3R1IA 1USIA 3U3KA 5JRZA 4UMDA 4AMYA 3BL5A 2J08A 5H8WA 5AW0A 1WBBA 3BICA 3AW9A 3KFXA 3EXG2 3OI7A 2BSXA 4BO6A 2CVHA 4R2HA 1DWOA 4H59A 4HVAA 3U31A 4FJ0A 4C21A 4LX8A 1CS0B 3IAEA 3OM0A 1Z36A 3C6MA 1A4UA 1G42A 3PGMA 4JCOA 1PCXA 4LNHA 4RMHA 1KMIY 2QL9A 2VL7A 1GOTA 1OWLA 3AETB 3EIHA 4H35A 4TUYF 4AKEA 3LLSA 4C4RA 1UIMA 1V71A 3E5NA 4OF4A 1VJ1A 3AIOA 3WHIA 4QG7A 5AOBA 5GZ1A 1R4AA 1YS1X 3EXHB 3R6GA 1E89A 1JG6A 1RCUA 1YO6A 2FN4A 3R77A 3PX3A 2H85A 3IUBA 4M1YA 4M54A 3SYTA 1A5TA 3IP6A 1Z37A 4FN5A 2HJGA 1I24A 1E9AA 3FUUA 3GRFA 3IMKA 1E4EB 4I1YA 5E2IA 1BVYF 1YR8A 2C88A 5FEUA 1I3MA 3EW7A 2PD3A 4NU8X 2H65A 2ZIWB 3PNLA 3O8QA 4QLAA 4UBKA 3DZBA 4WDQA 4RSGA 3O47A 4IIBA 4V0SA 4B47A 4QBFA 5JJLA 3H5OA 1JEOA 2KX7A 4QIHA 1JJ7A 4X3CA 2GLUA 4YNBA 2YWCA 1QHNA 3AB7A 4PO1A 4PWZA 2GS9A 1Q19A 2D4AA 2GXQA 2I4IA 2P75A 2ZRFA 2ZYIA 1T8YA 3AR5A 3IOEA 3OHSX 4GNKA 3LBHA 4ID3A 4M0EA 4Y7CA 5I7AA 4EDFA 1SXIA 1QTRA 2DLDA 2YNMA 3EAGA 4BTVA 2V4ZA 4LYGA 5DK4A 4MKXA 1RHUA 1OV4A 1U2SA 3PZBA 2DPLA 2ZJ6A 3CEAA 3BK2A 4PLZA 2W4QA 3SOZA 1Y4UA 1ONPA 5TNXA 5HZKA 3MILA 4NRDA 1M2GA 2HH9A 1N7GA 1JUDA 5E95A 4BMDA 1KMHA 2XVAA 1VFPA 1AS2A 1L5YA 2PS9A 3QUAA 4GR9A 3O92A 1TYAE 2XUGA 4OGGA 5E2BA 4KR9A 3D54D 2JLCA 2B8NA 2Y1KA 3LPCA 2QB5A 2OXEA 3D5TA 5A04A 4ZOBA 1GR0A 1IQ0A 1Z2AA 2BRUA 1A7KA 3MLEA 3AM5A 1NIJA 1M1ZA 1XZBA 2AEFA 4RQTA 1QUEA 3BWVA 2L17A 4LY0A 3NV7A 4EMTA 2H5IA 3LT4A 1CR2A 2HLDA 1QE3A 5ALYA 1CUDA 2ZZMA 3EIXA 2JGFA 2PUVA 4QASA 2XB2A 3V1TC 2NV6A 4KDEA 3OQNA 1BH2A 1D2GA 3OIWA 4MP6A 4E03A 3ZCSA 1QMPA 1TK2A 4MX8A 1T2AA 3O8QB 2F4NA 4YV7A 3ESZA 1PO7A 2OZPA 4XX1A 3GFVA 3L1IA 1JLLA 1USVA 2CFOA 4MW0A 3STXA 4CBVA 3HDVA 4WL0A 1HBJA 3N0WA 4GI3A 4JZYA 1XF9A 2XMRA 4NVRA 2TECE 3C3DA 1NVWQ 1DXOA 1G21B 3GYBA 3NT2A 3DKPA 5ED0A 2MT9A 4UAVA 3I3OA 4DSAA 1LPOA 3OMWA 1T0PA 2B99A 4U7FA 3UF0A 4DM7A 1F9AA 1DWUA 1NC3A 3S44A 2PG3A 4ZI2A 1BNCA 6LDHA 5IN4A 1H6BA 2VWPA 3BGOS 3H97A 1L6IA 3IVCA 3KV3O 3LV8A 1EBUA 3N8HA 3NHSA 1QZTA 2CL0X 4HNHA 1KMHB 3A6FA 3CNHA 4RZSA 2MJLA 4LZWA 1NI3A 1Z28A 5K8CA 2IX9A 3KPYA 4MQBA 4HKTA 4B33A 1FP4A 1LSSA 2H48A 4ZO6A 4EZEA 1IZ9A 3VH4A 4F2HA 1F2TA 4MI6A 3KVYA 3SQOA 1TU4A 4CKXA 3NJRA 4DLAA 4FC6A 5HUHA 1W0CA 3WGZA 3MT7A 4RESA 1ADGA 3HC7A 1GU1A 2Y9MB 2A3NA 2YY7A 3LPNA 2C9BA 1I5EA 1W4ZA 2CVOA 2FVYA 1AUVA 3D7RA 3FCAA 3IRUA 2E4XA 4N49A 4UHCA 2N1BA 2G9NA 4FWTA 3H19A 1H4TA 3VUEA 3P9KA 1TQ8A 2ZSDA 2LIPA 5KAMA 4OQ4A 3JR7A 4A2QA 2O2SA 3LDAA 4M7WA 3DOUA 4PNPA 1EP3B 2G9QA 1J8YF 1C8KA 4H4DA 2A9KA 1M7BA 1XZKA 3CGGA 1A9PA 1Z82A 3GJ4A 4HH1A 2W6OA 3WRXC 4O4IA 4LRWA 5AVVA 1XTQA 2Z1NA 5L3ZA 4UEQA 1XP5A 2BBWA 2HA0A 3MGAA 3OVMA 3RQSA 4AS3A 4AP9A 3RJ5A 1KFJB 1WW3A 1VPWA 4KYIB 3T3MB 3NXKA 4MMXB 3UB2A 4GMKA 3OTIA 3EPKA 3U60B 3OAAA 4QEDA 1YR1A 1NF9A 2NQTA 3KC2A 2YL2A 4NDAA 2DBZA 1LLFA 2C3OA 4L5BA 1PG0A 3IR7A 3C4QA 3MTIA 1SOUA 2VXYA 4GZMA 1H93A 4PG4A 3IPRA 4W1PA 4YRDA 5ITWA 4FZJA 3WVNA 1EGVB 1C1XA 4B79A 1B0UA 2BFWA 3WIOA 4C87A 3LTEA 3WLKX 1SC3A 2WYWA 5CD1A 1G18A 1RYBA 2KPOA 2QJFA 1PS9A 2EX1A 1GG8A 2H9IA 1EK1A 5KIAA 1FP4B 4PTYA 3SQWA 3TDKA 5JS6A 2PGOA 4HTFA 1SURA 2FSGA 2ZSUA 3U6KA 3PQDA 3RBAA 1VPDA 1DADA 3AB8A 3K0CA 1H5QA 3OFJA 4KE6A 4RZ3A 1OGYA 3WHKA 1Q16A 2AYYA 3PT9A 3E53A 5A1JA 4AJIA 4NCJA 3K2EA 3OESA 3UUFA 2JAHA 3V55A 2RBGA 5FPYA 2FLKA 3EXFB 3LZDA 4MUGA 4I55A 4O2RA 3SXUA 4WECA 2JCYA 4OM7A 1VG1A 4MRSA 1JG3A 1I2ZA 1XI2A 1OI7A 1WUTA 2GPTA 2HJHA 5KSZA 1L4HA 1ZK0A 4O4IB 5SZJA 1T26A 2E9SA 5CM8B 5CDTA 4LRQA 3CW8X 3KSUA 3QHAA 2J6CA 4XD2A 1BE6A 1EFDN 2JH8A 3QYAA 2ZAOA 3DE2X 4UNQA 1M1YB 1KO7A 2OYSA 5A4DA 5KBYA 2FY8A 4HLQB 5A4JA 1PFUA 3BH6A 3QVXA 4A6EA 2A30A 4C89A 2Y2UA 2AK3A 3KJIA 4PBTA 5FTMA 3FUWA 4HB4A 1YDFA 1KAMA 3UHPA 1N0VC 2N46A 3DO8A 4EITA 1FPQA 1C1XB 2A9JA 121PA 4CI9A 1TTQB 5DWQA 2OBBA 3E9ZA 2PRKA 4I99A 2A0XA 2DFDA 4OBXA 2E82A 2G8NA 3LUCA 3KWMA 4YRPA 1F2VA 1QFXA 3KS9A 3LUJA 3FG9A 4HTFB 1D2RA 3D02A 3ASUA 1DC6A 1USKA 3V2GA 1L1QA 2DR2A 4G2TA 4HGPA 3B89A 2BELA 4MR7B 3IAHA 4Z4QA 3I0ZA 3K8QA 4R6WA 1QUFA 2SNIE 4ZKDA 2XQIA 3AKCA 3OEEA 4QOGA 2ZVQX 1ECPA 1RPNA 1Z0KA 5JRDS 3GA5A 4Z99A 3X2FA 4QQFA 3SXUB 3T5BA 4MWZA 2XVZA 1VPLA 3CZAA 3E03A 4AJEA 2UXCB 3NWPA 3FTPA 4P3XA 5D1NA 4AWAA 3DTYA 3ED1A 4CMKA 2D0PB 4KJXA 2RG1A 4NENA 5JZVA 3IBTA 3DDCA 2R751 5IT5A 2ZYTX 5HVNA 4HYEA 3UMJA 6YASA 4JR0A 1ULHA 2CNLA 5F1YA 3RIXA 4DSOA 4Q05A 1X8JA 1JLRA 5K0TA 2FKAA 2UYYA 3K0HA 3CR7A 1CC1S 3KEOA 3GJRA 1JR3E 2XOKD 1J1UA 3PKIA 5TV2A 5A9RA 2B2XA 1SVMA 2WWIA 2ZI9A 3D1VA 1THGA 2HBYA 3FKSA 4JS0A 4M83A 5JEEA 4DLVA 4I50F 4IIFA 4RVCA 2GCEA 2HKIA 2QW0X 3VR3A 4QG3A 4H7PA 3NIWA 4MVJH 1RP7A 1ZGJA 5DASA 3VOSA 3M5WA 3NHJA 1SBIA 1T9KA 1F4VA 1P33A 4PYNA 4X93A 4N8DA 1E99A 1QGAA 2I9PA 4G0ZA 1U9JA 3Q7TA 4TTQA 1NQWA 4CTKA 5M29A 2EFJA 5A62A 1TEHA 3NALA 1GLGA 4DNQA 5CT5A 3TI7A 3V4VB 1AKMA 3W1EA 3HLTA 3K2BA 4XGNA 4X6LA 3TLCA 2EZUA 3WADA 3QMMA 1NG1A 3RAFC 3A6KA 2R00C 4GWLA 4A2WA 2XKBA 4OV6B 5SY4A 3OE4A 4NQZA 1GPBA 5BOSA 1GZDA 1SBQA 2D5LA 1C3OA 2NUAA 2OGZA 3HSKA 4LXYA 4MB6A 2CLLB 4NENB 4P2BA 2E6UX 1QF6A 1O94A 3EMKA 4V0MA 3W5DA 3J81A 1FDSA 3QMWA 1OGJA 1W4CA 1X15A 2M6KA 2ODTX 2FOXA 3E1GA 2XECA 1AG9A 3M83A 2OXCA 3P2OA 2A33A 3LFHA 1XTKA 2LIVA 3AH8A 4RZ2A 3WLEA 2QPLA 5MHTA 1ISHA 1KYWA 4US2R 5KVVA 3ENVA 3GCXA 2O7VA 4O2BF 2KYRA 1GNSA 2OD7A 2DSNA 3FIUA 2HXYA 4KN9S 3QUBA 4OXQA 4R7TA 3EVGA 4ER7A 1T10A 3ZS9A 2AVNA 1WZ2A 1HEYA 1YIAA 2ZCUA 1PD0A 3A32A 3BE5A 3RSSA 2ZRHA 3GRCA 1IDOA 1OAAA 3P9YA 2AFHE 3V9AA 1ZJ5A 1E2LA 1XZJA 2PMKA 4ES6A 1SKQA 4Z0TA 4IMPA 1YZLA 1F8UA 3PTAA 4W1QA 1L9XA 2C2HA 2R68A 1U3VA 1ZL0A 2GN9A 1UDXA 1S4MA 3T7EA 4N39A 2CE7A 1GP2A 3ZYZA 4Y8VA 2VTKA 4Z0HO 4P54A 5K0BA 3GAFA 3F96A 3K9LA 3QNUA 2JFNA 2JZCA 1F0NA 1I3OA 1V37A 1WETA 1ZM2A 4H2DA 1EEXB 2WIJA 3BQNB 3WJAA 4KFCA 3UJ7A 4CHGA 2EYQA 2PD4A 2Z58A 2EKDA 3IAM6 8MHTA 5KJEA 4BP8A 5BOSB 1WP4A 2APJA 1C3OB 1QP4A 3K9QO 1ECLA 1T34A 3HVUA 4KWTA 3ESDA 3IJPA 5KX5A 1DBQA 4MGHA 3GJ6A 3K0FA 1A72A 2C4WA 4P31A 4AJ9A 4LWOA 4BRUA 5KKCA 2RCYA 2P6PA 4HAXA 5C7LO 2PMCA 2XYPA 4PLCA 1U9ZA 1NBME 4HEA6 4TZ0A 3W2FA 1A2BA 1L7BA 3FOFC 2IEYA 2XNHA 3AVOA 3DOHA 1W46A 1HZZC 4ARVA 2PNJA 4LE0A 2OYCA 2OE2A 1DEXA 2QMZA 3U7HB 2O2EA 1C2YA 4P3PA 2O8BA 1QHIA 4LV8B 4PXSA 2R1TA 4UTVA 5JADA 3R9XA 2VDKB 5CJPA 3SG0A 3ZJVA 1RE0A 3PC2A 2H5JA 4R31A 1M0TA 1Z7YA 1AUOA 2HJ9A 3B51X 3MELA 3DMNA 4IJKA 2CFRA 4JELA 4Y6RA 1KO8A 4HYTA 3IXMA 2ZUTA 1XHEA 3OPVA 4LXHA 4QUEA 4M8SA 4IDNA 3EGEA 2PLWA 3L18A 5AI5A 3EDYA 1UP4A 2OQVA 4OYYA 1VE6A 3MB8A 3NHMA 3V3KA 4NY1A 5IWAB 3KWFA 1O4VA 2ZRGA 1YS7A 1FS5A 1G9XA 3OD5A 2FYTA 2HO4A 1GNTA 3OTQA 3Q5GA 4IXWA 4L5CA 4XUDA 3WNCA 1YFJA 3QA3E 2VQSA 3V9PA 3EYWA 4M0MA 3D8UA 1GLVA 1GTJ1 1N6RA 2JANA 3OQIA 5K05A 2XIQA 4IPTA 5KX5B 3ZIAD 3K0FB 7GPBA 3IQZA 2HF7A 2QPTA 1RSZA 2J3IA 2Y0EA 4NV3A 3ETLA 5A4KA 1G8AA 3HSSA 4BXOA 1WMDA 2PS3A 3H1EA 3BFPA 3ICWA 2QP9X 4HLNA 1KI6A 5DMHA 3EF1A 3FWNA 1EXNA 1B6TA 1S7GA 3VV3A 1ZNWA 1ENZA 2ID8A 4LEIA 4ENSA 5T3UA 3S1AA 3EZNA 4OKSA 4QRDA 4MUHA 3I72A 4HJXA 2B9VA 1OXSC 4JVLA 1CFZA 2DPYA 5SV2A 2P9FA 2GOYA 3R9IA 1XDZA 2ADMA 1JEJA 4TVOA 3ME5A 1KOLA 4BB5A 1ZWLA 5TDHA 4GL2A 4K6OA 4DIOA 3U40A 1N5KA 2R1TB 3OM9A 3PA6A 4WBNA 3R9XB 2R4QA 1PR0A 1CR6A 4DBLC 2DQYA 1FLNA 4AN1A 1IN7A 2XVMA 3I09A 1DKNA 2MSLA 3K4HA 1A2OA 1RWPA 3RFXA 1BU8A 2ZXEA 4TKLA 5F21A 1OPRA 4LF9B 3GJYA 1W4BA 2P65A 4CG1A 1EFKA 4X94A 1R16A 1XAIA 4KQEA 4M8NE 4NE7A 2X3UA 1DMSA 5EPEA 1ZGBA 3RH0A 2NYAA 3SR3A 4S04A 3U48A 5EHZA 5AJTA 3AY7A 3ZIDA 1Y4SA 1HDYA 1NA5A 2IHUA 3NWJA 4GU5A 3PT5A 1Z6ZA 2W9XA 2C96A 3GEEA 3LM8A 3MRXA 4PHTA 3TSAA 4ANFA 3NMUF 2V6JA 3AESA 3FMPB 1EXMA 1BRTA 1C7QA 1DTEA 4UVGA 4FGJA 1K68A 1ISPA 3DL4A 1YMQA 1G8FA 3SE7A 5LLDA 3NT4A 2H4YA 1J70A 1MC1A 1W2HA 2O5VA 3CEMA 4FHCA 4RLQA 3C1AA 1HEUA 1W581 4D9JA 2UKDA 4BXOB 2EIHA 2JGJA 1KI6B 2R3SA 2PJUA 4D42A 3HXPA 3ZE2B 5AXDA 1JJFA 4ZC1A 2BEVA 3S1AB 2NO5A 2NADA 3NAMA 1WXGA 4OXYA 3WRXA 5IHPA 3NGMA 2NTEA 3CEJA 3SXJA 2P41A 5K8LA 4RGQA 3CVVA 3OKAA 3UKDA 1MIHA 2VQ6A 2EFEB 4F85A 3LO5A 2REXB 1TUGA 3JD2A 4WBNB 1PZHA 4PR3A 2ZDQA 2W6ZA 3GFTA 2UUCB 2IXGA 3UYLA 2WI8A 4KBYA 1T9HA 1WSDA 3BSYA 4XDYA 4DS3A 3IMEA 2JEZA 3KQKA 3QPDA 3WLSA 3F71A 4YRIA 1UFKA 2ZTVA 1QGDA 4RAOA 4KGZA 2OFFA 621PA 1QQAA 3C5CA 3LBNA 4TWJA 1WNTA 3FZNA 5JAQA 2WFAA 5L3RA 2HQBA 5K3CA 4RCZA 1XTTA 1Q3KA 2VP0A 4RO0A 5ENZA 1D8AA 4LA4A 5HIMA 2NXWA 4DWJA 2XXBA 4F5YA 4MWGA 1E5LA 4IX9A 1KEZA 4P83A 1OLUA 2VOJA 4ZQCB 2IHBA 4QL3A 4NYMQ 1ZIXA 1QX4A 2HW8A 3EHEA 5FLXA 4CG2A 1CDEA 3THYA 1ZIOA 3AESB 1F14A 4BNYA 1ACJA 1OX5A 4J2OA 1EJ0A 1LCIA 1HYQA 3H65A 1YDGA 4NU0A 3TLGA 1UL1X 5DM60 5IYZB 1Z3CA 1OWNA 1R0RE 2QZSA 4PNHA 2BCGY 4ZDIA 5F9HA 1I32A 2QKYA 1I7NA 1VB3A 4G4JA 1KETA 3ZWPA 2BEVB 4FI3C 4FYHA 4HGRA 5FQOA 1YJQA 5KU1A 2W2LD 1CPYA 3IMGA 1R00A 4G89A 4NDZA 3U6BA 1QZUA 3CH5A 2ZI4A 5BUCA 1A7AA 1R27A 3L0DA 3AEZA 2IHYA 4J1TC 5ALFA 5FXMA 1RPAA 3GPDG 2D1RA 2OKGA 4I5FA 1ZD2P 3ICOA 4IIJF 5LYJA 4Q7QA 1XRSB 4ZV4A 4J0JA 2Z6AA 5G40A 3N1UA 2B35A 2AZMA 2H59A 1RWVA 2GKGA 1Y9ZA 2FWPA 3JPYA 3OPQA 5JSKA 4DA9A 3UJCA 2GN1A 3FBGA 1RMYA 1NY5A 3LYAA 4DYHA 4IY1A 5F51A 5DM4A 1YOVA 3WOHA 4ONEA 1OMOA 3TSOA 4FB4A 5LMCA 4KXMA 4KMSA 1V4BA 1PJAA 4O3MA 5BPHA 1W4LA 4I5GA 2RGEA 1XWFA 2IZ7A 2JJ2A 4IGFA 1AXRA 2I76A 5E7MA 3QA9A 1ZC3A 1N1EA 1OLUB 1AKQA 1U5BB 2Z2YA 4Q00A 4PIVA 2OCBA 1FXSA 1J8QA 4GT1A 4HVCA 2UU9B 3HO1A 2R65A 3RFTA 3ZNPA 1EVLA 1RWQA 1T8WA 2VJDA 2WQZA 2CB9A 3THYB 4Q6WA 2OT3B 3BE8A 2HREA 3DV9A 3HVHA 3WLQA 5CDHA 2JI7A 1CWUA 1EX1A 2BDUA 3FCCA 5ALTA 3TLGB 4MVWA 3WGTA 2Z83A 5KJ6A 1A4XA 2ZROA 1JW9B 4FZ5A 4D5GA 4ZI3A 5BWBA 3T8YA 4RF5A 4JJAA 2HA7A 1A4IA 1B2RA 2NO1A 2X9NA 1Y3HA 3LKDA 4DABA 5BP7A 4JUFA 1XCPA 1J8FA 1T1IA 4GEKA 2JIBA 4J3NA 1W25A 1FUKA 2POCA 3HCCA 2GERA 4F4FA 1L3BA 5GJBA 1TNDA 3PHGA 5K3FA 3TOCA 1PW7A 2PR7A 5LYJB 2OCAA 3HYSA 3C3EA 2XUOA 1GADO 3CO0S 3O1HB 1QO0D 3JRXA 1EI9A 2O14A 3V8BA 4GPD1 5JECA 3EWAA 5DLEA 3VH1A 1Q0PA 2CSUA 1OY1A 5AJUA 1TM4E 3KB2A 1DJLA 3GLHA 1HSZA 1X19A 1AGPA 1YOVB 4ZRNA 1F8GA 1R50A 3SQNA 3FB1A 3KFLA 4JBWA 4IO0A 3L1HA 4UNIA 1KKUA 2XT9A 2J48A 1HNWB 2BGKA 4UZSA 3GJXC 1DKRA 5IAKA 1ETUA 4UU8A 4L78A 4CHTA 2A5GA 4MHTA 1D1PA 3K94A 4OCZA 3AMVA 2HAEA 2Z9BA 4OJYA 2VXBA 4JI6B 1WEKA 4FBLA 1Y7TA 1W88A 1M2JA 1XWWA 1H2FA 2AD1A 2BMAA 4Z3OA 1NJFA 2IH4A 5LPNA 2OHVA 3RAGA 2FEMA 2ZT8A 3I9KA 1IN8A 3WMEA 4MKFA 2YMLA 3TMAA 1YRYE 2QW8A 1LV7A 2WMOB 3FF1A 4JUIA 2EVWX 1U8CB 1ZFNA 2NTYC 3P0EA 4KQFA 3OQBA 1SOMA 4LY9A 3M33A 3SJ7A 2EGUA 2HF2A 2XF8A 3GWZA 5FPTA 2ID9A 2R5FA 3UUWA 5IKXA 2IC5A 5KTSA 5I9TA 5DX1A 2JRLA 2NXEA 1BVHA 3IE2A 1K66A 4C14A 4MVJG 3WL3A 1U0HC 3DYVA 2IYZA 1Y4AE 4FLEA 3UFBA 2ZWPA 3PC4A 5L6MB 2QSUA 1V16B 2IE0A 4KUHA 4X00A 5LOVF 1KBQA 4N3NA 1PVOA 3H6GA 2WKWA 3N59A 1KJ8A 4MPRA 2GM5A 2Z8ZA 3UG6A 2EXXA 4X0EA 2OYRA 1T3GA 3G68A 1QGZA 2C8VA 3KV1A 2PGJA 1NXOA 2L0XA 1EDDA 3EDMA 5IBRA 5REQA 3GLHB 5FULA 4Y1RA 1COWD 2R6JA 3DMDA 2XLCA 2EDCA 5C81A 4DDHA 1PT7A 3S5JA 5I4CA 4W4TA 4OB7A 4EB0A 4BUZA 4N7JA 2J7KA 4PQYA 1JG2A 2AJCA 3G9XA 1L5RA 4DEYA 4PX2A 1SB9A 3VNUA 3NQ41 3UAWA 4KK4A 1W88B 4XYEA 3TW8A 3D2LA 3BFJA 5CR9A 3SKXA 4EPXA 2V65A 4INPA 4RZHA 2F43A 3RC9A 4NS1A 1EM8A 1MO3A 3D7LA 7AT1A 2NN3C 3WSTA 3KQNA 2VN8A 2FPPA 3UA3A 4CL3A 3NWBA 4QFBA 2YHUA 2VNKA 3FYDA 2FU5C 4PBSA 3THWA 4NOLA 3UK0A 4PTZA 4TMVA 2OA0A 1U9IC 2ZS9A 4GM1A 3DW3X 1P1FA 4X84A 5ETJA 3WAJA 4AM8A 3EGDA 2IXAA 2QL6A 1ZC4A 3VYUB 4YLEA 2SKCA 5IH3A 4KI7A 4OLJA 4N48A 3DO5A 4YLGA 2Y1GA 1C0IA 2R85A 4UE2A 4RK4A 2BY4A 3GLUA 3VBCA 3B9QA 2QJTA 1CS4C 4XGIA 4I3FA 5J9FA 4TYNA 3D7SA 4H0FA 1F5NA 3C1UA 4K8OA 5NLLA 2QP3A 5REQB 4I5IA 1UBLS 4F4HA 1HZZA 3HA7A 4Y1RB 4EFKA 1QJ4A 3VZQA 3UCEA 1HFJA 1YFLA 3U13A 4OBEA 1YRWA 3L82B 2DKOA 5A7FA 1M74A 3EASA 5BV0A 2QM8A 5AKZA 4OHFA 4EBBA 4AJ1A 5AI8A 5HCNA 1IAVA 2R7KA 4RJLA 2DY1A 3VDXA 3TW8B 3LC7O 1VB5A 3T1OA 3KM0A 2FWIA 3VX3A 3EWSA 4HRVA 2XJ4A 4EW2A 2F43B 2XA2A 4QSHA 1FUIA 5HQJA 5ILGA 1EM8B 4KU4A 4D8XA 2ST1A 1TD9A 3A3PA 3NAZA 4BFCA 4MWCA 4R41A 3KQQA 3ADCA 2NP7A 2O2GA 2FPPB 3BEDA 1BQ4A 4D3DA 3HRIA 4F4UA 4TM8A 4RTRA 5ICEA 3ZXUB 1K6EA 3TM5A 3CH7A 1CUHA 1M33A 3IQHX 3QYFA 4MV1A 5FNVA 2C2MA 4QGAA 4XD7A 4Y2UA 3DOJA 2PXAA 3C5VA 3GXOA 2VF2A 3MK31 4IS3A 2WTXA 3EGDB 4HNUA 1WUYA 1F3LA 2P9JA 3OPMA 2OSBA 4S1PA 3HA5A 2HLHA 3N74A 3VO2A 3W5IA 2BM1A 3CIFA 3MQ2A 5GJWC 2P5SA 1YAHA 2ZVDA 3UMCA 1CDOA 3QEJA 4TMZA 5JZMA 4B6PA 2LVBA 1G8HA 4RL4A 2PYIA 1AGXA 1CZLA 2CFSA 3MTAA 4NYJQ 2E55A 3C3PA 4JGGA 4QXRA 3O2NA 4Z2YA 1IB6A 2FEOA 3G9TA 3R7FA 1QU2A 2X5XA 1BKYA 3LG2A 3P4UA 3G3EA 4PXAA 3K1YA 1VLMA 2W6MA 4LV6A 3EW9A 1TD1A 3PGA1 1W49A 3Q8MA 2CVFA 1MB3A 1KGDA 1QKJA 2FSSA 2J5BA 1TZCA 2BEUA 2R5WA 1DC8A 4MVJI 4ZP1A 1LUAA 1X0XA 2WC1A 4NCIA 4NONA 5FQNA 1H5UA 4HEJA 4DW8A 5C1PA 4I4NA 5LU9A 2DT8A 2Q5CA 1YZQA 2N47A 3BKXA 3DD5A 3GBVA 3N7AA 5IAAA 1H0KA 4IDGA 1AZLA 3HXLA 1TMOA 4JUAA 5ITVA 2AIRA 4PGMA 1RLMA 2HDOA 2OP0A 4J6FA 1Z6QA 1FFAA 3I2HA 3E81A 1O5TA 5FNVB 3UM9A 5AVOA 4N5DA 1ZSYA 2XE4A 3H99A 4IDCA 5ILQA 2VNAA 2CEKA 3L7KA 4NJOA 4ZJPA 1XZGA 1HPLA 3B2NA 3P0IA 2ZBVA 3PENA 1IU9A 3A3KA 1E0KA 1PWEA 3WLNA 4P98A 1PJQA 1T0UA 4QOFA 1UZMA 3RHZA 1NULA 1VKNA 4GZ6A 1IRXA 4KKXB 1PDVA 3NUGA 4ZT2A 1TCCA 1KK3A 3NM5A 4D3FA 4QM6A 2GCPA 2NVUA 4ZEMA 2MR6A 5HK9A 5JZSA 3CNEA 3UJNA 3UMBA 1VMEA 1HORA 4KR3A 3K0AA 1B6GA 3FXAA 3QLVC 3VU9A 4CIXA 1ICIA 4L5YA 4NV0A 1DLIA 2BZ0A 4P4SA 4D9GA 7REQA 3KLBA 2JIOA 4U2CA 2H63A 4NCXA 3WMFA 5KTYA 1JGTA 2ZK7A 4RNCA 3ABZA 5E4YA 1IEVA 4LVCA 2BUBA 2BEUB 4QBKA 5DNEA 1ZVQA 5GGXA 1G3MA 4BO0A 2HUNA 2I1VB 3B1VA 4PU0A 4F56A 1QIKA 3DNMA 2BBOA 2HPVA 4UBMA 4NECA 4P8RA 1FDTA 1AKYA 1WO8A 4EY4A 2EV9A 2JAQA 2EJCA 2EJWA 3QG5A 2OFOA 5HCIA 2XUQA 1MC5A 4E3WA 1MB2A 2V7PA 1K2VN 1NWCA 1E6EA 1U0OC 4JJ8A 3ZV7A 5AKLA 4NS4A 4YUXA 4JC5A 1F1JA 2ZB3A 4JUDX 5ECGC 4QO7A 2GNAA 4DLXA 1C4XA 3IT3A 1YVEI 2ALJA 1GGEA 1AH2A 4U7HA 3D2BA 5B6JA 4LF8B 2FPSA 4HDNA 5DO9A 4HDRB 3ID6C 1HOXA 5E38A 3GOHA 3M1IA 4KO1S 5T4BA 4CE6A 1KK0A 3E4CA 3TVDA 5IBCA 3EEQA 4BO3A 1Q7EA 3F3SA 1U0TA 4FZRA 4R2JA 3GP8A 2Q6TA 3L04A 4GQBA 3AC0A 4PZDA 5CEEA 5ARDA 2EL7A 4YJGA 4FW8A 3P71T 2A57A 2NVUB 1SRQA 2CLOB 2QQFA 3A37A 1ODKA 3LVQE 2FE1A 4DPMA 1DXQA 1U2QA 1UPFA 4QLOA 3R7LA 1LW6E 2PVCA 2LGJA 4BFXA 3VU9B 2O1SA 3BC1A 3P32A 2HMAA 4LGYA 3I42A 1ZDMA 1AHHA 3IBYA 4J1TA 4P4SB 3T3EA 4R84A 7REQB 3FUXA 1JIQA 1ZZGA 3JQBC 3VYRB 4FR5A 5FL7A 1Z88A 5AICA 4GKKB 1JR4A 5G1PA 3CR3C 1T8UA 1GRNA 2C5GA 3UGTA 1DE0A 4NBLA 3CZCA 2AA3A 4YP7A 1QP7A 3L2OB 3IDSA 4EHBA 2WZCA 4UNNA 4LVNA 2GM3A 4Y9UA 2GLXA 1KDYA 4AJNA 4DCTA 5ICSA 2HCBA 4KSCA 2VH1A 3N70A 2F48A 1T29A 3LT1A 5K3SA 3K72B 5I6DA 5C1DA 5BSRA 4HAIA 5MN6A 5HK8A 3RHFA 3T9FA 1G60A 4L76A 3DMGA 3RT1A 2HMVA 5JNWA 3EDCA 2AC2A 3LF2A 3MB5A 2IDKA 5HTOA 5FBZA 2QQEA 1X94A 1XWIA 2LTAA 3V7NA 3OCXA 4B81A 4QM7A 1UFQA 1YI0A 3GD7A 9GPBA 4HDNB 1E3JA 1T2CA 3Q15C 2I4RA 3A9UA 1ZKDA 2QLNA 3DEHA 5KWJA 5EXEA 1NUQA 3ZDQA 2DVMA 5GVRA 5C4IA 2C5LA 3ZDCA 1EVEA 2PX0A 1WZIA 3GLTA 1KIAA 5EE5B 2Q2OA 4MP3A 2J07A 1XJ5A 4YJGB 4EYEA 3DDNA 2BGRA 1DAFA 3H42B 1DLJA 2R2GA 3JAWA 3GLFA 2CV2A 1PNQA 2J0EA 3FWHA 3PNKA 4BWFB 3WDKA 2PNFA 1ELOA 4B45A 4UVEA 4G36A 2CV1A 2RHRA 4QEZA 1W35A 2QTBA 3RSLA 5FV7A 1ZN8A 2WAYA 3IPCA 5FI3A 1C3LA 1NRXA 1V95A 2ATXA 2M6RA 5L7WA 4KPEC 2O1WA 3O26A 2ZDHA 1ESZA 3WNVA 2C3YA 4CCSA 4B0OA 1KZHA 5KI6A 2RAFA 4OAOA 4YPOA 1AMOA 3WAGA 1V1JA 1NF2A 2GVDC 2VDUE 3ZZMA 5C8XA 3GHYA 4AFNA 5H9WA 1HZJA 1L4FA 2GVNA 3PP8A 5JCJA 4YUZA 3TG8A 2PUFA 1H1LA 1TJPB 3KPVA 1TVEA 2EKPA 1NE2A 2R8ZA 2HCFA 4W9RA 2AKYA 5E6RA 4QT0A 4DCUA 3HDQA 4F6LA 1TYBE 1M75A 5U4QA 2DUWA 2LD4A 4PZEA 1T6ZA 3RUEA 1U3DA 4G0MA 3OQ6A 1O95C 3SYRA 3QY0A 2HQOA 2ZIZA 4RMIA 1V4VA 4Q1CA 3GUCA 3V42A 4A15A 1HE1C 5ADWA 4DQLA 4LS3A 1Q0LA 1YI8A 1U8UA 2LV8A 1K06A 4W99A 5TE9A 5FOVA 1LI5A 2R6AA 1CQJA 3LY7A 5BNIA 1D0SA 3CV3A 5FOQA 2HPAA 3A31A 2BMFA 4FFDA 2JAOA 5T4HA 3W05A 2R2AA 5EESA 2P4QA 1KH3A 2QMOA 3B7GA 3C8DA 3JAWB 4GZ3A 5DHFA 1NJ1A 3LVFO 5EWLB 4RHYA 2GPBA 4BMVA 1M8FA 3HCNA 5AK5A 2DHQA 1LDEA 5IN5A 4F45A 4KRFA 1T5DX 1XMQB 3PQ8A 2CHEA 1ADFA 1JDPA 3U7RA 4KK3A 5TRTA 5CDFA 4BL5A 5JY6A 2PMEA 5A5FA 1W76A 4KXUA 2XRYA 4GVXA 2VYCA 4M1QA 4XWYA 3F7OA 2OL4A 3KAPA 3PSHA 1V8BA 3I2KA 3WWEA 3GFBA 3ML1A 1PD1A 3CCFA 4WPGA 2HCRA 5BWNA 4ZAXA 4CKEA 1PYOA 3AEKA 2BJVA 4TWZA 1JZQA 3QMPA 1SVIA 1KQFA 1CBUA 2A14A 1H1LB 4X7RA 4BQFA 2JIDA 4NEHB 4WNAA 3R5XA 5E6RB 2ZTMA 5FR1A 5GJVC 1XZHA 1ES9A 2X22A 5HF9A 3TWOA 3DZGA 4QJ3A 5BN1A 4GDFA 4NX2A 3FMIA 3JATB 4QRIA 4ZYWA 1UXOA 1UMDA 1R6UA 2IP4A 1M5UA 4AO7A 1HL3A 2VZ8A 4DC9A 1HYEA 2PZ8A 3I1YA 3V6LA 1K6XA 1VJTA 5KVSA 3CJRA 2K5UA 1E8NA 3KUDA 2A1IA 2H57A 2IGTA 1Z0UA 4ZOAA 4GGOA 4ZJZA 2I4LA 1CQJB 2D13A 1A2KC 2Z4TA 4Q3AA 4EYOA 5ENDA 1X38A 3SM3A 3ZH9B 1EAYA 4JLOA 1C30B 1U9IA 2B98A 3GWGA 4YRJA 1H3NA 1CJMA 1SC6A 2PGNA 5LM3A 1PI3A 1R6DA 3L93A 1N2OA 1VKHA 4ZVUA 3Q8KA 3C3BA 1ZIDA 2AI3A 2XRFA 3X1KA 3ED5A 4J1SA 3H05A 4K9DA 1I7SB 5C8ZA 2QN8A 3A4IA 2C54A 3WGYA 4NULA 1BU5A 4E4TA 1NJ5A 1T0BA 1XB2A 4FOOA 1EVJA 4O5OA 4RCVA 2GA8A 1IY2A 1AQLA 4GSKA 4HZUB 1Y5LA 3VPDA 1G64A 1RKBA 4XVCA 4EMSA 5F4ZA 3HM9A 4A10A 1OU4A 1T0IA 1QDEA 1Q6ZA 3PXUA 2YZGA 1KVTA 3GVHA 4YJHA 5DIZA 3SZ3A 1HTBA 3DG9A 3AFNA 2P62A 3ETDA 4TMWA 3TOXA 3G5AA 4CKEB 5A9TA 3AEKB 5ERYA 3HB9A 5EJAA 2RGGA 4F8YA 1YE5A 4YONB 2IUUA 2OLEA 5KYVA 1P1IA 3MLBA 4Q3DA 4E6EA 1WPXA 4LHSA 3DAPA 4UHFA 4UUMA 2PX4A 3ADKA 1Z2PX 3F5QA 1UMDB 4Y30A 3IAM1 1LLDA 4IXNA 1T2FA 2A0KA 2B6NA 2QUIA 5KNDA 1S3SA 3Q3HA 4IEFB 4Z0PA 3VR2D 2ZQYA 1DCFA 5CDUA 4X54A 3UJ3X 3ROKA 2JF0A 2W8BA 1FU7A 3QZUA 3AYXB 4H77A 5CK5A 4HEA1 4CIBA 1DAPA 2GAFA 4E11A 5KVAA 4BS9A 5KYXA 3NTRA 4EI8A 6AT1A 2EU8A 3TE6A 4KZPA 4B44A 1KBZA 3ECAA 1XG5A 2P9EA 3AUFA 2QVXX 3L6DA 3OKPA 3RC2A 4C4SA 4DR6B 1LA2A 3HU2A 4Q93A 5CT9A 4CMGA 2PLRA 3FOAA 4LWQA 1GCUA 1V11B 2VDQB 4EUNA 3B85A 1WBDA 4JXZA 4GXTA 4G4SP 1WV1A 4DEVA 4Q5IA 4YJHB 1KZYC 4BFUA 5JQGF 4NWIA 5CCBA 2HK7A 3PPYA 3R4CA 4BNZA 1X8KA 2GKSA 4CKWB 3WGLA 4D82A 4UJ3A 4Z4FA 1OOEA 1SKUA 3FH0A 3H8VA 3JD3A 4YS6A 2IDJA 4RTSA 2JGMA 1XKLA 3BVPA 5JBQA 3J7AC 1LBTA 1KJZA 2G77B 3N76A 1UJBA 2P9ZA 4PZ0A 5EIHA 5K4GA 2B34A 1CCWA 2NT4A 2PL3A 2P7IA 2Y4NA 1WVIA 3CUUA 3HI4A 4KRYA 5EKTA 3VNSA 3AR7A 3SHFA 5B57C 4XYGA 3OE5A 1SXJE 3HGTA 4HD8A 2DUMA 1C7RA 3OQ1A 1E8DA 2YC4C 1ESCA 1AHNA 4Q3BA 3FD8A 4TLCA 1OKKA 2WHPA 4P0PB 2ID4A 4FC7A 1NQ5A 1F4LA 3E9QA 4B6RA 5EQFA 2CK3A 1U2RA 2W8BB 2PCLA 3U44A 1NFQA 1DQYA 1SU4A 5AUOB 3E7PA 4Q66C 1QH8A 2XGOA 4KIJA 1XIVA 2QP4A 3SIPA 4BHTA 3DV0A 1FRQA 3CVJA 3JSXA 2UYQA 1JJAA 2OXRA 4P32A 2QU7A 3IIEA 2FSPA 2D7CA 1M1NA 4LX0A 4OQXA 4Z3KA 1NUSA 3U4IA 2G1JA 4DADA 2X1VA 5KNBA 1L4BA 3CF4A 1MRNA 1G4AE 4Q4LA 3K73O 3TQSA 5DOZA 1PEYA 3EFEA 1OH7A 1KMQA 5JYCA 2WRZA 5K09A 4G8CA 4RGVA 1RWMA 1KY3A 3NUZA 2ARKA 1B26A 4JKIA 5M7EA 1RXWA 3D0KA 4CF3A 1OFUA 4WOJA 1RCFA 4D9IA 4LFCB 2P30A 1SOAA 3MUFA 4JP3A 4MS3A 4X20A 3V4ZA 3QLVA 3H4MA 4TRJA 5C3MA 1MRSA 1XZMA 2WT9A 1ABBA 1QS0A 2BTQA 3EIEA 3PNBA 3HZOA 4OP1A 2Q9BA 1W44A 3K8OE 4UBNA 3RARA 5KYGA 4Q7JB 4OXRA 3U17A 3DEAA 2Q4BA 4P2GA 1DG9A 2BEJA 4IDBA 4QELA 4IVQA 1NG9A 5F1KA 2NTVA 4N01A 1WZUA 1KWGA 1TJ4A 2WHPB 1Z34A 2BKXA 1XZQA 3JRWA 4NNOA 1TIPA 3U44B 1HE2A 3C8MA 4PC7A 5FBKA 2WYHA 5FA6A 2CJWA 1C3VA 2JH9A 3HWWA 2ERXA 4YRZA 1QH8B 2G82A 3DVQX 5ALZA 3OUTA 5EXXA 5DP1A 2Q5JA 1YC5A 1ZX1A 1U3GA 1U3FA 2ANBA 2EZ4A 1N0IA 3DV0B 3F5MA 4WUVA 2X0EA 5KTNA 1QQ7A 2WYUA 4JP8A 4F9FA 1NW7A 3IT1A 2DZDA 5DNYB 1R12A 3SMQA 3FVRA 1HQDA 2G9ZA 3HEAA 2CDNA 3TGLA 1NNUA 2NWQA 4S1WA 1ZVKA 1Q1EA 3EVEA 4QBTA 1PGQA 4QARA 3VR1A 5EP2A 4B9AA 1PLJA 2P5UA 1X1SA 2TRSB 2G7ZA 5L95A 3PK0A 4FNOA 1GGVA 5FF9A 1UBHS 4MS3B 3LU1A 3CSDA 3EB9A 1KEUA 4A8HA 1T8SA 3QUTA 2OHFA 1FIUA 1QS0B 2BTQB 2H06A 4H16A 2G72A 3JQBA 5J40A 2F9FA 521PA 2G08A 3WYAA 2W6JD 4GF5A 5LKRA 3TCKA 1WZCA 2ZSKA 3GARA 4HMOA 3KHUA 4JJ7A 4U8GA 3LNTA 3S99A 1VG0B 1X3SA 2H1FA 5K03A 1X7WA 4I08A 2V3WA 2CJYA 2D2XA 4K9LA 2WPDD 3UWKA 2V0NA 3VDMA 5JPCA 2CJWB 2QVGA 2BHRA 4A2CA 1W47A 2XQKA 1WMBA 1MQAA 1V4NA 4DV7B 1PJRA 5G4LA 2FX2A 4DJAA 3RYCA 4Q12A 3RUDA 1HGXA 1FTSA 4Y2XA 4AZTA 2VRWA 1YCDA 3TUIC 4R16A 4GBGA 4ZICA 1V3UA 1QORA 2HRQA 3UC9A 3IE0A 3IB3A 4CV2A 3AL2A 4I7EA 2GPSA 4C43A 3GG9A 4AD8A 3T7TA 3RRZA 1XRPA 1S0UA 2YWFA 2ZR8A 4FEGA 4DLYA 2P3SA 1U1EA 1J5PA 2R7MA 4IW3B 4G1MB 1H8HD 1LBQA 3CG0A 4QGGA 3WNQA 4GECA 1IVYA 5KU7A 1JIUA 1FNBA 4ILKA 1YVRA 1EFRD 2JB9A 2WD9A 1LC3A 4OKIA 5DCWA 2O6HA 1SKYB 2WLSA 3OE1A 4E70A 2XIJA 1DDGA 1S89A 3VKVA 4Y67A 2D6FA 2HK9A 3RVPA 1QO9A 1OCEA 1RHRA 2W8ZA 4F2DA 821PA 2ZQZA 3PICA 5AI9A 3RNLA 1Z16A 3L41A 3ZWXA 4C22A 1L7XA 1XFAA 1F8FA 3H8WA 3IO5A 4XIFA 2AZXA 1X2EA 3A2LA 2GJKA 1MTZA 3TXYA 1XMIA 3CUWA 4KAAA 1AS0A 1SCIA 1X7YA 3E82A 1X7WB 5TMEA 1MV5A 1TLLA 1IK4A 3KQTA 4EPWA 4FYVA 1FC0A 4MUAA 4WLOA 5DNWA 5KOJA 1PSDA 1FFYA 2V7WA 3IQWA 3FMOB 2ZI3A 5J3JA 3VVBA 1SEVA 1R66A 3MIZA 3RYCB 3QNWA 1LWNA 5ALPA 4WV3A 4ARUA 1JIJA 4XVUA 2XAAA 1GCOA 3V4FA 5DW3A 3SD7A 4BLQA 5LP6F 4RTLA 5BW6B 1L5HA 6GPBA 3DWEX 4HXGA 1Q7GA 4RTQA 1MKYA 5BV8A 3LOPA 4UHEA 1O95A 2R1UA 2X77A 3UXHA 4KYTA 4PQGA 4U63A 4KRXA 4PLYA 2AEJA 2IK8A 1EBBA 4PS1A 1E9EA 1GUDA 3AWIA 1UPBA 4JC8A 2Y3IA 4NC9A 4GI1A 5D6NA 3U3JA 3D2AA 2I1WA 1VMAA 3KSBC 1B00A 2VTEA 5GONF 1C1DA 5JS1A 2FFAA 2YRXA 3C41J 3P9SA 4AQYB 4QNNA 4NMWA 4JC4A 2JBHA 4MZDA 4B17A 1PU2A 4JA0A 2EIXA 1R9JA 4G1UC 4HX9A 1KK1A 3E9MA 3HO6A 4XVRA 5C34B 3UJAA 1M2NA 5DX8A 2AZTA 3IKLA 1HI9A 4DYVA 1E2KA 3OE7A 1F6DA 1GKUB 2OUIA 4MK4A 3AKZA 1D6NA 3R3ZA 3BDVA 3I5AA 2GVZC 4Q18A 1NSTA 4ABYA 2O8DA 2GQ0A 4GI7A 3ZZ0A 1X7YB 1NWHA 1VPTA 2C9DA 3QXCA 1KDTA 4W7IA 3PX7A 3R0ZA 2DHDA 2HRBA 2HQRA 3SHWA 1XQXA 4IDFA 4C6TA 4YK7A 5KOJB 1PJCA 2IHKA 1BFUA 4TXJA 5LJLA 1KHHA 2P1DA 1RI2A 5LQUA 2B4TO 2RK3A 5IS2A 5A4FS 2D1SA 5JNTA 5JSFA 1BCRA 5B1HA 2DFNA 1N4AA 2FPOA 2WJJA 1XXHE 4DB4A 4HK4A 3NFYA 4L28A 4NF2A 1V25A 1NDHA 2IFTA 2OFXA 4Z3DA 1RE1A 2F3QA 4TTPA 4YALA 4JB3A 3SE0A 1L5HB 2IKQA 4O08A 1D5CA 1WX1A 4DNFA 3OJCA 4ASUA 5I45A 4B4WA 4UASA 3L0ZA 3K16A 4I50A 5H3HA 1ZN7A 2ZIFA 3ZK8A 1G38A 4RANA 4RVUA 1DX6A 3NR2A 2XNKA 4IIEA 2OD9A 3LW8A 3ZGLA 1P29A 1QHSA 4B34A 5GZ3A 2P2GA 2D5CA 1E2HA 3MJTA 1JMVA 1PSZA 5K3BA 4ZHQF 1C1DB 1UFRA 3OTOB 5HRAA 1NN1A 1FSFA 2C1ZA 3NIGB 1ND6A 4MVJD 3WQQA 2VUUA 2F17A 2AWOA 4CJXA 1TJ3A 4CEIA 2IZ6A 1TLTA 2WHQA 4Z8YA 2AC7A 4MUKA 3SIWA 5CFRA 3H7IA 1SKBA 1KE2A 4CFSA 3CUYA 1JQLB 2B0CA 5KNLA 2C7QA 2GPYA 3NEJA 1TUIA 1UZLA 4WINA 1ZIYA 5CYOA 2IUSA 1CUGA 2O8DB 1Q44A 2PX3A 4BIMA 1U0NA 2WJWA 3REFA 4DEXA 4ZN6A 2N9UA 4IDAA 4UUPA 3T06B 1PFWA 2HHAA 3D59A 2R48A 2AVDA 3TLYA 2QI9F 1O97C 4M1OA 3KZCA 1L8OA 1GG9A 3HKEB 1H1TA 4ZT7A 2KBFA 3KOYA 4BKPA 2H0AA 5G41A 1NUPA 4WQMA 2DOKA 5T57A 5TARA 3S70A 4G41A 4OI0A 4GOLD 1JLKA 4JFAA 2XNJA 4R9VA 2VF8A 4Q39A 2UYCA 5JBNA 1TU0A 1NYLA 5ES3A 1GUZA 1T5BA 1DAHA 2AXNA 3M6LA 1CUEA 3PTLA 3NNSA 4M7RA 5T5QA 3VQTA 3AM1A 3IESA 1HTTA 1VJ0A 2J41A 2J8ZA 3IODA 4I50B 1VYHA 3KR2A 1U2ZA 3RVLA 2LXNA 5F35A 1K5PA 3OETA 3RFUA 2YRWA 3SS7X 5IAJA 1TZMA 1VE3A 1YH3A 3DEYX 4R2KA 1M6EX 2MSKA 3GCDA 3RU9A 3V8RA 3WMWA 3JD1A 1GPMA 1NOIA 2H1IA 3C7AA 1NXVA 4NMXB 4RIGA 1TF5A 4M21A 4FKMA 3OJEA 2QAGC 2FMFA 1EWTA 4CEIB 2C3MA 2A1TS 1Z74A 2BI8A 5ARBA 3M3HA 4MW2A 1I1NA 2IU3A 3TIFA 1JI0A 2Q28A 3IUNA 5CH3A 3SEQA 4E5MA 3PEFA 4AZVA 5DTRA 1AO3A 2ZWIA 5DNUA 5IVPA 2PWAA 1J22A 2V6IA 1CEQA 2GEUA 3GJ3A 1SHTX 1UKCA 3NYRA 3PHLA 4NOKA 2OQRA 1DRWA 1NMQA 3D3EA 3OIDA 4OM8A 4OFBA 5F98A 3AGPA 1P1KA 3QRWA 3UKOA 1ULZA 1GTSA 4AKHA 3KJNA 1GSHA 5IDWA 3KR1A 3EK2A 1T4MA 3U16A 1H9CA 3GRUA 1X1EA 4RE6A 1LZLA 1Q77A 4ZAVA 3KRTA 3A4MA 4B3GA 1E2BA 2REQA 4IWNA 3WLLA 1PZMA 1BIFA 1R1DA 4UM8B 3LPDA 1E9SA 3K9NA 5CFNA 1TPZA 1JQ5A 2IWRA 4PSVA 4J4HA 3ZGOA 3LQKA 2EF1A 2Q7OE 2H18A 1EBFA 2JJQA 3JWGA 3ROXA 1ZITA 1PL7A 3MRTA 5H3LA 3UTDA 1OC4A 4EY3A 5TEVA 3EQ7A 3FYTA 3LHKA 1NKSA 4L15A 1PR6A 1TAQA 2R6R1 4EW6A 1QHEA 3L7AA 4W5QA 1CNMA 5AUQA 5C46F 4ZU1X 1KOGA 2YTZA 1JS1X 1FNNA 1R3UA 1TZKA 4RHTA 3OF3A 2WTEA 3AOEC 4U7DA 4IH9A 4H3VA 2FXVA 3BREA 1E9DA 1JLHA 2C5BA 1S3IA 4HPXB 3DZDA 4JLSA 4K6KA 1E59A 3GRRA 4V0RA 3WQBA 3DHYA 3H11A 4OGWA 3V2HA 4CCYA 4UOEA 3IDFA 1YIOA 1LX6A 3AZPA 3TSZA 1N3IA 1H6CA 2HC9A 2FUCA 3SVTA 2CDBA 3DPIA 2GETA 1W36C 5CG1A 1EAMA 1UXIA 3Q7SA 3K1JA 4BNFA 8ATCA 4A0FA 4M9CA 3O4RA 1SCNE 3KB6A 3PJFA 8OHMA 1P7PA 3B48A 3BN3A 1MA0A 5CTAA 3QXXA 2H2WA 2ZYAA 1UMKA 4ZDKA 4AP5A 3R3JA 3INTA 5JXIA 3EXEA 1W5TA 3B6KA 3OG9A 4R1UA 4PV7A 4EY8A 2REQB 3GA7A 1TB4A 3ZZTA 1F2DA 1GTG1 4RVDA 4ZT5A 4W7HA 1IN4A 1PUJA 2YV2A 3F5SA 4UNPA 4F2WA 4X7BA 5IX8A 2FHSA 2QD3A 4TLDA 1ZCJA 1XN4A 2JASA 4BLWA 3KYCA 3PIRA 3CFYA 3H83A 3HTXA 4ZVSA 4MUYA 4G0XA 1CRPA 1I5RA 3DTVD 1UKEA 1I8TA 1YAJA 1EX7A 3CLVA 2ANCA 3VSAA 1K7EB 2O4UX 3EA5A 4IJUA 3VYWA 3QJ5A 4LFAB 3CX3A 3FWKA 3OD1A 4N9WA 5FTNA 1IXKA 2IYWA 2HTFA 1UZNA 3QVUA 1BMQA 2ZYDA 1SXQA 3CZPA 1HRKA 2X0FA 3X3HA 3H6KA 4D9BA 5JNVA 1NP6A 3T52A 1MZVA 4Y1GA 3O0DA 4FYWA 3CLUC 4Q37A 4CCYB 4A0GA 3CH6A 1CYEA 3EF3A 4QHSA 1BA3A 1EE2A 1NI4A 1NGSA 2COKA 1T8RA 3B60A 5CCXA 1XPRA 1SULA 4UTNA 2IITA 3D5QA 1MZPA 4NK5A 3RSFA 4WSOA 1C41A 1DV2A 2FUEA 2JGEA 2XADA 4OBWA 4ZA2A 5DN6A 2VA9A 1KXJA 3GW8A 3OPXA 1KY5A 2XCLA 5FPKA 1VLLA 3GJZA 3W2GA 4CMAA 4G6ZA 1X0VA 2RFLA 1JB9A 4MMYB 13PKA 4IHAA 4UUBA 3OZBA 3LQ1A 1KQGA 1PNRA 3SKVA 1DKUA 5ESDA 4KI0A 5A3RA 1HEIA 2GX6A 3EXEB 3KHTA 3D8SA 4HB2A 4WT7A 2C5SA 1GKLA 4QREA 4NYIQ 2A58A 1GZVA 1QHGA 4RENA 3RRNA 2HMSA 3JWIA 2Q50A 3F90A 5D8DA 3WLOA 2UXBB 5GINE 1E1RD 2H00A 5G2OA 4C76A 3KYCB 4YB8A 3DCIA 4ALLA 1PZNA 1DC3A 4ZRMA 1D6SA 3WAKA 3REGA 2HIAA 1NASA 1KEKA 1G5RA 1DIOB 2WYVA 4I1IA 5BUSA 2X1HA 2IQIA 2QTVA 1QRAA 3EAFA 1L3CA 1EDZA 1VRVA 1J8DA 3JVEA 3CVYA 5KYUA 4DWVA 1SQGA 2C9ZA 2QU8A 3LT2A 3V8EA 4LC0A 4Y2HA 2X7JA 2CE2X 1NVAA 1OYOA 3OOHA 3DR5A 4W1RA 5FI0B 2XA1A 3RS4A 2V0GA 1NX9A 1RYEA 4KWHA 1WMEA 4IOKA 3B6MA 3KNZA 2RBEA 3UAVA 4ZCLA 1W1IA 4FYJA 2WB2A 1TAUA 3VMMA 3ZG6A 1NI4B 1V8PA 1E2IA 1E69A 4RIHA 1SVLA 1V3QE 1YACA 2ZBGA 3AOGA 1VMDA 4R51A 3X2SA 4G0UA 2CNDA 4MQ5A 3E15A 2G5TA 2ZJZA 4KMRA 4OAQA 2B1IA 1E3SA 2BHLA 1V5IA 3R23A 1Z0DA 4B3FX 4EUKA 1KEEA 2JLSA 3U80A 4HGZA 1UPTA 4ZU6X 3RI3A 4BKQA 1LNQA 1JHPA 3GA0A 3VI3B 1UDBA 1KP2A 1U0BB 4GYJA 2QMQA 1C8BA 1U3TA 1R0LA 2IZ5A 2ISCA 5EHQA 5KNCA 2HF9A 5HYVA 1OXTA 3W79A 4LDNA 1RHJA 2XUZA 3NX4A 3CT6A 1TMGE 2ZUWA 1N78A 4OEHA 1BO6A 4HL6A 4QPJC 2J9ZB 3CKYA 3F6RA 2AKEA 2QTVB 4IIJA 3LHDA 1EFAA 5KYUB 2AOWA 3KOMA 1MO5A 1NE7A 3KD2A 3QX3A 2R9VA 4EKNB 2IPMA 4HB3A 3ZWKA 2NV2B 4OA5A 1YRLA 4NDNE 2H2AA 4RFLA 2QQGA 1ZBDA 3D4PA 4L4UA 5DM1A 5EXDA 3VU3A 4FGKA 4BVLA 4R0VA 3IFSA 4QNRA 5IEJA 2Q21A 3F67A 4KNWA 3IO3A 4C01A 3T12A 1C80A 3R6LA 1UDRA 4JLVA 5TS3A 4AY5A 4DYDA 4Q4CA 3KPUA 3S2IA 4MO9A 5CITA 2D5BA 4PRKA 5DU2A 4OP2A 4IQGA 3SHOA 3W5SA 5ADUS 1K7SN 1OF1A 1Q0UA 1TA9A 3HB7A 4JSTA 1KEEB 2E21A 3ET5A 2WAMA 5BWOA 2Q1UA 4J2HA 4NBTA 5H83A 2WF8A 3B82A 4IZHA 3QTLA 3DF9A 3A2KA 2WF9A 2HWKA 2YS7A 4O33A 1CZKA 4X91A 1JE0A 3ESBA 4L5IA 1ZO8A 4LYYA 3SZOA 2CF6A 3H9QA 1CRWG 1KEPA 1XEAA 1P39A 3ZCQA 4GG1A 4BLVA 3IAS6 1G59A 2R44A 1ZJWA 1H9BA 4CM9A 3IC5A 1IMOA 4W6ZA 1XTPA 3KYJB 3AG6A 4HYQA 4IIJB 1X2BA 4RPLA 4B6OA 4MTLA 3LP5A 4O8CA 1ESMA 2GD0A 3IIJA 3HO8A 4HCJA 3WGVA 1A27A 1NURA 4E51A 2IEDA 4YFVA 1EHIA 3FROA 4YJKA 2OORC 2ZJBA 1QGOA 3E9NA 2AEMA 4BBZA 3O8DA 5BVGA 3PHCA 1UEXC 2D8MA 2ZUDA 1SH7A 3FDIA 1K98A 3IP1A 4RVSA 5AT1A 3MJSA 2JI8A 2EHDA 2YHIA 3F4BA 3C6BA 5D3ZA 4CV3A 3I53A 1RPZA 3EULA 1HMYA 1FPMA 1LB1B 3MBOA 4HPJB 2VJLA 3ZS8A 1XL0A 2VP4A 2O57A 3UXMA 2HYDA 3UT0A 1JPNA 2JCXA 2WMNB 1CUZA 2IEZA 2O8FA 1V3VA 2VDLB 4D5EA 5EP1A 2AWNA 3MAGA 3VPGA 1MAWA 3E7FA 4UUQA 5CLFA 2QX4A 4GBMA 4O1IA 1Y34E 1NBAA 1U7HA 4N40A 4QBGB 4REOA 3TMYA 5I7HA 2ICAA 4LOHA 1TUEA 1VSTA 5CLHA 1DKOA 1N7IA 3ODPA 2X7HA 3N86A 1ZOSA 1TYDE 2X0IA 2GPJA 4AECA 2JDID 5MN5A 2H4WA 4OUDA 2I6UA 2RG7A 1X70A 4IGEA 2P9TA 4IRMA 4HRXA 1G4HA 1YIDA 2EFGA 1YRAA 4FEEA 4B85A 4ISBA 3AIMA 2AK2A 2JVKA 4URYR 5JAHA 4K05A 2HPHA 3LF1A 3MSCA 4RY9A 3PD7A 2R96A 5LOVA 4GLFA 1HF3A 4OHVA 3I34X 4BQQA 1M73E 3BZWA 1EUCA 1Y89A 3QG1A 4G2NA 4CGYA 5BVGB 4R9RA 2I7TA 3D0QA 4LK2A 1IXSB 3IV6A 4NZMA 4URHA 4P82A 4IX1A 4ZO4A 2C2WA 4Y3UA 3LO8A 3LUKA 5EERA 3LQ2A 1E4VA 3GFSA 4GKVA 4ZDJA 3O9MA 4R3UC 2OK8A 5AK4A 2YFYA 1ZEMA 3B9BA 2VP2A 3HUEA 3PIIA 1MFPA 3AI2A 3OCJA 5AQEA 1CB7A 2O8FB 4KMMA 2ZZKA 3SF8B 4TTAA 1CLUA 4F06A 1G8KA 3W6PA 2Q1XA 5K0LA 4O1MA 3I9MA 2NV0A 1U02A 3K20A 3PA8A 3GLGB 2G9VA 3DE3X 2HHJA 3EGVA 4XR9A 3D9QX 1H69A 3KTDA 5BQOA 3SJCA 4BYMA 2QZ9A 4V1CB 3B8HA 4IP0A 4YP0A 1QIFA 1FZTA 1ODSA 1RJGA 1KMNA 1DG1G 1L8LA 2Q3FA 4WE3A 4XB1A 3RUCA 5HF8A 5AUPB 3ZE1B 5HBGA 2CNKA 1THMA 3KQLA 1GARA 3NC0C 3PZRA 3UBMA 1UBTS 1G5FA 1FS6A 1B4DA 2P9YA 2Z43A 4OBBA 2W00A 3AJRA 3AHIA 4OUDB 3SJUA 2F55A 4GKBA 2B1JA 3CVOA 1PK9A 2GAJA 4QEKA 2C07A 2JGRA 2ZVJA 1XZEA 3E27A 3NEPX 2CLSA 4I46A 1OFTA 3WL7A 4NOJA 5CH5A 1NVXQ 1RWBA 4JBLA 2G7MC 4QPNA 1TO2E 1ZSNA 2HSEA 3TL3A 5LOVB 1PNTA 4HFJA 1N34B 5JO9A 1YKSA 3FVTA 3QOWA 2P6RA 2OM2A 1YL7A 1QVAA 1Z4OA 5ALIA 3L7IA 4CLHA 4FUTA 2ACWA 1EUCB 3KQUA 3RIYA 5IXYA 1ONNA 2RKBA 1TM7E 3FMFA 4G0VA 3UKJA 4TQGA 1QU3A 4RKRA 5KC8A 3BERA 4KOAA 1EM6A 5EE3A 1U7XA 2SKEA 2Y77A 2G1PA 1XROA 1YRBA 2QEQA 2FMUA 1XVTA 2QTMA 2QRHA 2V5VA 4QXAA 5DBGA 1HYHA 3A27A 4D8TA 4FB5A 3ZD6A 4D26A 4F91B 5CDGA 1KOJA 1FVOA 3IDOA 3QV2A 3WGHA 1PJTA 2O3TA 4KHZA 5CG2A 3AOEA 4RK0A 5F9MA 4IV0A 2YWHA 3MMSA 1RFLA 4BC1A 4BVJA 2PH1A 2GI4A 5A3VA 2IS4A 3R3WA 2WM2A 3OA0A 3BIXA 4ZQEA 3TDMA 2FPUA 3NETA 4TQAA 3IQFA 4MW6A 1QYCA 5DHUA 3DHEA 5DNDA 3WWYA 3HB4X 4LDJA 5AVZA 3UIEA 1JILA 3IP7A 1QKKA 3SSMA 3RG8A 3GP5A 2ZYGA 3RUFA 3SHQA 4JI8B 2BN4A 2J5KA 2O2HA 4G84A 3ANMA 4P34A 4ZAWA 4Q1VA 3EXG1