5CRIA

Wild-type bacillus subtilis lipase a with 0% [bmim][cl]
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 64
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5criA00
4WDRA 3R3YA 1LNSA 3H2IA 4GECA 1L7QA 5C8XA 4GXNA 4X92A 2Z3ZA 5I9IA 4QWWA 3G7NA 4MYSA 4HVTA 1VOTA 4AZ3A 2OQVA 2GBCA 2WUFA 1MPXA 3MVEA 3DYIA 3DS8A 2XMRA 3ESAA 4YK7A 5ALYA 2I3DA 1OILA 2YXPX 2HIHA 2XUAA 2X8BA 3H0CA 1QONA 2OCKA 3BDVA 3FYTA 5A2GA 1ZI8A 4E15A 2HA7A 5KREA 2XMZA 4H7FA 2WU3A 3WL8A 4HTAA 4AQDA 5T4BA 2RHWA 2WIGA 3D3NA 1UFOA 1WPRA 4QWMA 4INZA 1B41A 1EI9A 1E8DA 1QLWA 4UHFA 2QJWA 5ALQA 3IUNA 1SCIA 2OAGA 1LBSA 3HYSA 4X7BA 3E1GA 1H23A 3HXKA 3F98A 1JFRA 4MYDA 3STXA 1XQYA 2XMCA 5FPPA 4EZIA 1CUXA 4MEBA 1QIDA 1ORWA 3PF9A 3VJMA 1R4ZA 4FLMA 4B9EA 4PSCA 4UBNA 4BC0A 3BDIA 1CEXA 1F8UA 3ZI7A 2GBIA 4CIBA 5CT8A 1QIKA 1XRMA 5K3BA 4KAJA 3WZMA 4TGLA 1VKHA 1HL7A 1CR6A 1E3QA 2ES4A 3H2HA 3DJYA 4Y2SA 3VKFA 4BB0A 5LLSA 5HF8A 2XLCA 1ZD4A 4FLEA 4AX4A 1UKAA 4L72A 3IB3A 2QUBA 4L9AA 3QBJA 2G4LA 4HXGA 1UK9A 4Q3LA 3AZOA 5DNWA 1XZKA 3D4LA 3WZLA 2JEYA 1HDEA 4UFNA 4GLBA 5AI0A 2DSNA 3S8YA 3EQ9A 3OPMA 2VT6A 4X97A 2WFLB 3A6ZA 1K8QA 3FYUB 5K3AA 2VAXA 4U2EA 4FWBA 2WIFA 4H7KA 2HL6A 4B7ZA 1KU0A 5AK4A 4G4JA 1G5FA 2OCGA 5AKXA 2BKLA 1XZIA 1UOPA 4CG1A 3IUJA 1GQSA 1L7AA 5AICA 4N5HX 1E8MA 4B0OA 5JAPA 2DCMA 1DX6A 4QE3A 4A5SA 1TCAA 2VT7A 3GELA 2DFPA 2VA9A 4B83A 4MEAA 3H2JA 1ZIYA 4LYEA 4RE6A 1RYYA 2ECFA 4G5XA 1IUNA 2GBGA 3WK7A 3STYA 1ZGCA 4JYPA 5CT4A 2OCLA 5AM5A 3AINA 3FCXA 1C4XA 5ALHA 4BTVA 3ILSA 1THTA 4BVKA 2PUHA 3E0XA 1QIEA 4YASA 1M33A 5CT9A 5FDFA 3A2NA 3WL6A 2VJCA 3I6MA 4U2DA 1X70A 2GYWA 1BRTA 2OPHA 3WK4A 1K63A 1Y7HA 4FNGA 3IVMA 5HFAA 1P0MA 4EY5A 1XZAA 4GWLA 1R1DA 2C7BA 2GBFA 1PJAA 3U1TA 2HA6A 3KD2A 3F67A 4X00A 5HZGA 1JJIA 3D0KA 1WB5A 4WJLA 4V2IA 2PPLA 2XLBA 3KSRA 2VEOA 6YASA 3N0TA 3BJMA 1XZDA 1JU3A 1XKLA 1XQWA 4CI9A 2RGUA 4KACA 4H7HA 2WKWA 4W1SA 5EHQA 3VVLA 2GYUA 2Q0XA 1J1IA 4MJ3A 4HRYA 3Q0TA 3ED1A 5JAHA 5LKAA 2ACEA 2WLSA 3PUHA 5AH0A 4F5ZA 2GZSA 4CG2A 1DTEA 5FUMA 5JZ9A 3R40A 1BEZA 1THGA 1YCDA 2ZYIA 4DNOA 3VJKA 3O4JA 5ALSA 1DINA 1YASA 2FJPA 1LPPA 1S8OA 2HA4A 3FWHA 4UUQA 5AOAA 3SX4A 3V1MA 5ALPA 2IX9A 1UXOA 2XQFA 2XDWA 2FX5A 3HABA 5D6OA 2Y2VA 4OB7A 1H22A 4FHZA 1QFMA 4B82A 4BCBA 5ALGA 4BP8A 5IH7A 3S2ZA 3C87A 3WKCA 2XUIA 5KBYA 2WFLA 3FYUA 2RI6A 4HXEB 1PFQA 4WCVA 2EDAA 5DWDA 4WY5A 1CQZA 2VJBA 2H9YA 3IURA 3PUIA 4C89A 4NMWA 5AM1A 5JARA 4QDOA 3VVMA 1H2WA 2HU5A 5JIBA 4Z49A 1LZKA 1BCSA 5H3HA 3WKDA 4WFIA 1UKCA 4DYHA 5JAUA 2RIPA 1E8NA 1VXRA 3I2FA 3LS2A 1ETHA 3MUNA 5EIEA 1LPMA 1Z68A 3R3XA 1XQXA 2QTBA 3AIOA 1CUZA 2OXEA 1CRLA 2JGMA 2XQKA 3H1BA 2XUPA 4HRXA 5FOQA 2R11A 3GA7A 1TRHA 2WIDA 4F21A 1TCBA 5HCUA 5FRDA 4LXGA 4TVKA 2OGZA 3FSGD 4X95A 4BVJA 1N5RA 5JAOA 4H7JA 1VLQA 1YAHA 2P8SA 4FLFA 2ZYRA 1SCQA 1VJ5A 4CCYB 4DSZA 2DHEA 3FBWA 3H04A 5JZBA 3WK9A 2PKYX 3DLTA 3G0CA 3FOBA 2WTNA 1KEZA 1JT2A 4OU5A 4AO8A 2I03A 2ROQA 4NZZA 3DD5A 4MQLA 4AN1A 5ISMA 2HHAA 2DQZA 2OGTA 5CTAA 5HFNA 3F8SA 3G9TA 5C8VA 2BCEA 3H18A 4B0PA 5AHXA 3IBTA 5EIAA 4OCZA 3LCRA 1A88A 3I1IA 2QOEA 3A2LA 3ZWQA 3FSGA 1A8SA 3WIOA 3IULA 5JD4A 5CH3A 3DL7A 3QMWA 1XZEA 3C70A 1YS2X 4M0FA 1F0PA 2Z8ZA 2XUOA 2WFZA 4OPMA 4C01A 1XRPA 4AB1A 4DMFA 3WA7A 4OSEA 2QXUA 4Y2TA 5HKBA 2PUJA 4ARAA 1LPAB 2O2HA 1P0IA 5ALTA 1EHYA 2RONA 5D3KA 4IO0A 3I6YA 2WUDA 2FJ0A 1JMKC 1K4YA 5C7YA 1UK8A 1L7RA 4X90A 3BWXA 1EK1A 1EXWA 1XZJA 2PSDA 1FJ2A 2C0QA 1UK6A 1CUYA 2XQJA 5AI5A 5AI8A 2VF2A 3B5EA 3I2KA 4I3FA 3D2AA 5JASA 1GPLA 1AKNA 1XZGA 2B61A 4DNPA 3A2MA 1SFRA 3HSSA 1QGED 4UHHA 5D7BA 4DGQA 2HRQA 1SC9A 1LBTA 2WJ3A 2XUGA 3PFBA 5FP0A 1A7UA 2VATA 5ALJA 3RLIA 1Q0ZA 4GBGA 1DWPA 3H1AA 1N8SA 4LXIA 3M83A 4ZV7A 4RGYA 3KWJA 2WFMA 4Y2QA 4KR0A 1MAHA 2BUCA 2VQ6A 5T4FA 3AIKA 2OGSA 2WILA 4K6HA 1AGYA 4BZZA 4QDUA 5LZ7A 4F60A 1CUIA 1C7IA 4W1PA 5DTIA 5A62A 2G5PA 5BWBA 5LKRA 4C4ZA 4BYMA 1WOMA 4AO7A 2X5XA 5AKJA 3LIIA 4GHWA 4OUKX 4DSAA 3QZUA 3DNMA 1QIJA 1BE0A 4QDZA 1GKLA 4WY8A 1XRQA 2PSEA 5EI5A 2OCIA 3D59A 2EEPA 2BAGA 4DLNA 4CCYA 1DWOA 4ETWA 4Y2VA 4D9JA 7YASA 4TPKA 4PSDA 1CVLA 5BOVA 3WWCA 1W52X 4IH9A 5EFZA 3QMMA 1E66A 1EVEA 3EQ7A 1YR2A 3KWFA 4GW3A 1GZ7A 2AJ8A 3O4HA 4OB6A 3QVMA 2JEZA 4OYYA 4EHBA 2OQIA 4AXBA 3AUKA 5FLKA 1ISPA 4BAUA 3F9CA 2HA0A 2AJLI 4L3WA 1DWQA 3WWOA 2WQZA 3BF7A 2Z3WA 2QT9A 1IVYA 3X3HA 1ZGBA 1ZICA 3G0GA 2I3ZA 1EB9A 2J4CA 2ZJFA 1SCKA 1CQWA 1UT6A 2H7CA 3JW8A 4G8CA 2WJ4A 1MX9A 5HF9A 1F6WA 4U2GA 1YA4A 1BN6A 1DT3A 4G8DA 4ZGBA 4EUSA 3ICVA 2PSHA 1Q83A 4LIPD 5AIAA 4UBIA 1MTZA 2PU5A 4OU4A 3WKEA 1SOMA 2O2IA 2VTVA 1HPLA 3VISA 5DNUA 3KXPA 1IZ7A 1MNAA 3ANSA 4Q1VA 5AI4A 4KRYA 4RE5A 1EDEA 1O6FA 1X2EA 2XUJA 1QIIA 3O4GA 4BP9A 4LKOA 1R3DA 4B84A 2PL5A 2YYSA 3YASA 5ALFA 4N8DA 4UHBA 4ARBA 4EY8A 5J3JA 2QKYA 3ZV7A 2QMQA 1W75A 1QO7A 5LZ4A 2BGRA 1D07A 5F4ZA 2O7VA 1CUHA 2CBGA 1U2EA 5E2IA 3IDAA 1Q0RA 2J3QA 2CZQA 2ORYA 4N8SA 2XMBA 2DHCA 1ZD5A 1JKMA 1GKKA 2Y1KA 5ALOA 5CH5A 1AZWA 4DTCA 3DCNA 1QE3A 4RNCA 4Y2UA 3G9UA 5K3DA 4K5QA 5C81A 4H0CA 4Q3OA 3UMJA 1LPBB 3WL7A 1QTIA 1FFEA 4WDQA 4X71A 4Q34A 2V96A 1W4LA 4Y9SA 2BGNA 2WM2A 2Y2UA 2K2QB 2WHQA 1T4MA 1W1IA 1AMNA 1BROA 4C87A 2ACKA 1K6EA 4KYVA 3G8YA 3GZJA 3STVA 3O95A 4N8EA 4FBLA 2C5GA 3PDCA 5FPQA 3QPCA 2VAVA 4UBMA 2D0DA 4X85A 2O7RA 4BDSA 1HLGA 4FBMA 4CIAA 1CUEA 3E4DA 1W76A 5HK9A 1XLVA 1GT6A 2VJDA 4ZREA 4LXHA 4GEGA 4BCDA 1CUJA 2JGIA 1VE6A 2PX6A 3CCBA 4BDTA 5AIBA 1G4HA 3ICWA 3PI6A 3QYJA 1CUCA 1R50A 1WB6A 2Z5GA 4JUIA 2CUTA 2CB9A 5I7UA 3BE8A 2OAEA 2JGLA 3FAKA 1TIBA 1QIHA 2AJCA 5EHZA 1VZ2A 3GBSA 2O2GA 3C5WP 1W6RA 2HFKA 4Y2JA 1JJBA 3HRHA 5LZ9A 2AJBA 3EF3A 4W9RA 4PF1A 2HA3A 5HQ3B 2X76A 3GUUA 5DLPA 2XT0A 2ZSHA 2YASA 1ZJ5A 1XZMA 1N1MA 1QIGA 3AFIA 1CUUA 1HBJA 4DMKA 3FVTA 2W6CX 1FFAA 4WFJA 3TGLA 1QFSA 5HF5A 2QRUA 5CT6A 1WCYA 2ZYSA 3C8DA 1YB7A 1CUDA 3SWWA 1DT5A 1EH5A 1ODSA 1YS1X 1MO2A 4AO6A 4BVLA 2RHTA 1MU0A 1FFBA 2BFNA 1TQHA 2QJRA 1EK2A 3FCYA 2WUGA 5AM2A 1E5TA 1J06A 3FLEA 3I2HA 1YA8A 1NU6A 4Y2XA 5YASA 5CBKA 4J0GA 1WM1A 3VJLA 1QTRA 5A7FA 1LPSA 5ALZA 4QLAA 4U2FA 5K3FB 4HAIA 2JIDA 4IH4A 2WU4A 2B4KA 3ANTA 1CFJA 1O6GA 3CN9A 1H2XA 3DYVA 1J07A 4KE8A 2XB6A 3L1HA 4JNCA 3AIMA 3EBLA 5K3EA 3DEAA 2ONCA 2QXTA 4F0JA 3M3DA 3L1IA 4HXFB 3KDAA 3WIBA 3DL4A 1R9MA 3QITA 1EA5A 3DKRA 1JJFA 3W06A 3WI7A 3OTQA 1CUVA 3C6YA 4B81A 4QDXA 1VZ3A 3P2MA 4ZV9A 3NUZA 2XI4A 1WHSA 3JYHA 3MGAA 1ACJA 5ALKA 3IUQA 4S0XA 3WYDA 1P0PA 3F97A 4QZVA 2WTMA 2FUKA 3HLKA 1YAJA 3ZLUA 2CEKA 5LIPA 1A8QA 2HU7A 3I2IA 1NU8A 3K9BA 4MWSA 2G5TA 1BN7A 1XZFA 1UOQA 3C6BA 4X6UA 4J0IA 2GYVA 1XZHA 3OG9A 3LLCA 5A7HA 3TRDA 4KE6A 4Q82A 3QM1A 3V1KA 3QMVA 4YPVA 3DOIA 5AI9A 4FTWA 1VA5A 1CLEA 4OD0A 4J0CA 5KWJA 1Y7IA 3O9MA 1XRRA 3O4IA 2JBWA 3K2IA 4K2AA 2ZJ7A 4KE7A 5HQ3A 5JD6A 1HQDA 1YB6A 2JGKA 1JU4A 1WPXA 2QS9A 3C6ZA 4EY7A 3RKSA 4XVCA 1ODTC 1WB4A 4H77A 2QZPA 4XJVA 3OOSA 1AC5A 1UOOA 2H7YA 1HKHA 4X91A 5DNVA 3W05A 5E4TA 5LZ8A 5AOCA 5LP1A 1EVQA 4PQEA 3R0VA 5CURA 1F0NA 3H17A 1XZBA 5CT5A 3PF8A 4EB0A 5AJHA 3ZPXA 3STWA 2J3DA 5DTJA 3F96A 3WK8A 4P93A 3W04A 5CMLA 4B80A 1XKTA 1GPNA 3HC7A 4DMCA 3CN7A 2H7XA 1K5PA 1ORVA 1LPNA 4C4YA 5AKYA 5LYYA 2DR0A 3SK0A 3BIWA 5K3FA 5FXMA 3ZLVA 5AM4A 2HDWA 4E11A 1NX9A 3WJ2A 3WKBA 2JGJA 3ESDA 1WHTA 2XQIA 1XQVA 4HZGA 4OB8A 1CIJA 3W9UA 4J0KA 2QUAA 3D2BA 1ODCA 5ALXA 5DYWA 5ALMA 1EDDA 2PVSA 4UHCA 3HI4A 5A6VA 1BS9A 4KEAA 4P92A 2HADA 5ALUA 1BCRA 5E4YA 1AURA 2OG1A 4A16A 5T4HA 4DM7A 1TCCA 3U0VA 4ZI5A 1PV1A 4H18A 3UUEA 5AKIA 1CUAA 3UUFA 4H7DA 5JYCA 4J0JA 3WYNA 1MX1A 4J3JA 5IVIA 1B6GA 5EHXA 4K6KA 2B9VA 3FYUC 4X3CA 2XUQA 5ALWA 4J0DA 1TAHA 3WK5A 1OXMA 1XZCA 3SC2A 5CXUA 4ZXFA 5KWIA 4W1QA 3R3UA 1LPOA 5CXXA 1DQZA 4LHEA 3R3WA 2G63A 3OC0A 4G4IA 2XMDA 3CCCA 5ALRA 4OYLA 4C6HA 1LGYA 1CUGA 3R3VA 3D7RA 5HK8A 3TJMA 1TK3A 3I1YA 4Q05A 1MT3A 2EDCA 2J4FA 4FDMA 3EIOA 4FMPA 1GPKA 5BV7A 3ESCA 2QVBA 4DNQA 4BE9A 3G0IA 4UFOA 4C4XA 2CKMA 1UWCA 4U2CA 5EGNA 1QZ3A 5AM0A 4QDTA 1BU8A 3V1LA 5SYMA 1CUWA 3G02A 1IUOA 5JZSA 3H2GA 4KE9A 5CW2A 1DQYA 1Y37A 2WIKA 4MXDA 3WJ1A 1IUPA 4FOLA 4FKBA 2HA5A 3WWEA 5LZ5A 4BAZA 3NOXA 4X93A 1E89A 2DHDA 2HM7A 3FVRA 4XIIA 1P0QA 4CFSA 3DQZA 5T4EA 3L1JA 4NS4A 3BJRA 4J03A 5FV4A 1CPYA 5DYYA 4AMYA 4IQ4A 1XRNA 3CXUA 3QPAA 3NGMA 5AP9A 1MAAA 3QPDA 2WHPB 2AXEA 2Z8XA 2LIPA 3JWEA 3AJAA 4BTLA 2JGEA 2PSFA 4QNNA 2WG0A 4ITVA 2RAUA 4UBJA 1MJ5A 3NWOA 2XUDA 5ALVA 4Y7DA 4UBKA 4UPDA 3QH4A 4X6XA 4E46A 3VDXA 1XFDA 1MNQA 5AKEA 5AKHA 1RWQA 4BRSA 1ZI9A 1G66A 5JATA 5ALNA 4JH0A 1Q84A 2XMQA 1BEEA 4DNFA 5AK3A 4BCCA 1IMJA 4WFKA 3KOOA 2OLEA 3C5VA 4JYMA 3HZOA 5E4JA 1XZLA 3C43A 4W63A 2DQYA 2CMFA 1N5MA 3BXPA 3HJUA 2B20A 2E3JA 3EQ8A 1KU6A 4MQMA 4I4CA 4K6GA 3ESBA 3WKAA 3D2CA 4BBZA 1R9NA 2ZJ6A 4UHEA 4G8BA 1TKRA 1GQRA 3FNBA 1QJ4A 3RARA 1JMYA 3GFFA 1EX9A 4G9EA 2XUHA 3WA6A 3H19A 1ZIXA 1VXOA 3T52A 4BZWA 5IVHA 2W22A 2I78A 4KAFA 3ZLTA 3BIXA 2XUKA 4H7IA 2WUEA 3T4UA 5AM3A 1CUFA 4UBOA 4M0EA 5DYTA 2ZVDA 4PW0A 2C0PA 3WK6A 1I6WA 4Q3KA 3IUMA 4XWGA 1XLUA 3TEJA 5ALDA 1ZD3A 4XX1A 3DDUA 3WLAA 5JADA 4U2BA 4EY6A 3AZPA 1XROA 2HA2A 4GI1A 5JD5A 3LP5A 3E3AA 2H1IA 3I2GA 4UBLA 1UZAA 1ZI6A 1QO9A 2C58A 2HRRA 4ROTA 4MWTA 4ZWNA 1T2NA 5CH8A 4ZRDA 3O9VA 1C7JA 3WL5A 5DJ5A 4YX9A 4PO3X 5D3ZA 4EBBA 1GGVA 4PV7A 3K6KA 4EY4A 4IHAA 5CRIA 1ZJ4A 4CG3A 4L0CA 1XRLA 1JI3A 4I19A 2R8BA 2AJDA 3H2KA 1ZOIA 5SYNA 1XLWA 3STUA 5AKKA 1UK7A 1UKBA 3HEAA 3RK4A 3AILA 4DIUA 5A71A 1EB8A 4FNMA 2WJ6A 2VSQA 5HF6A 4FFVA 4GDMA 3BL8A 2JF0A 4DMHA 1VE7A 5AKGA 3WWPA 5IVDA 4G1FA 4BE4A 1RP1A 3R41A 2WHPA 5ALEA 1MN6A 5LZ2A 1R88A 5IVKA 1CUSA 4UHDA 4X94A 2IIVA 5AO9A 3STTA 4AMZA 2BUAA 2XMSA 5C8ZA 3G0DA 2C5FA 4P9NA 3C6XA 5K5EA 4B6GA 1AUOA 3V1NA 2WIJA 5HKAA 4W1RA 2XQGA 4P08A 4B85A 4C88A 1EDBA 3C45A 1J2EA 1QOZA 2XE4A 3LIPA 1DU4A 4B9AA 4Y2YA 5I8PA 3MUOA 4BRZA 5EHNA 1AX9A 5K3CA 3VXKA 2VJAA 2V98A 3OM8A 1LZLA 3BF8A 3Q8WA 1MX5A 2WG2A 2ZSIA 1QIMA 3A70A 3RM3A 2PBLA 3O0DA 1ACLA 5AK5A 2IITA 2PU7A 4J0HA 3IA2A 1YSCA 4BAGA 1VA4A 1FFCA 3FLAA 3M82A 4QA9A 3OURA 2GZRA 1OCEA 4G4GA 5ALLA 4G9GA 3G9XA 5AI6A 3B12A 3G9ZA 2HU8A 1IZ8A 5IKXA 3N2ZB 1FSSA 1X2BA 3C8HA 1U4NA 3AZQA 4KJXA 4BATA 2JGFA 2XMGA 4M0MA 4E14A 5EIHA 1H2YA 4Y2RA 2V97A 3FLBA 3PFCA 4HS9A 1DX4A 2BJHA 1FFDA 1EINA 3D5EA 4H35A 1A8UA 4KRXA 4CCWA 2NW6A 3R3ZA 2C4HA 4X6YA 3WWDA 4KAAA 2BUBA 5AOBA 2WG1A 5JANA 2Y6VA 2CJPA 4O08A 1GXSA 3I2JA 4A23A 4JEIA 4AZ0A 2WHRA 3GROA 5A7GA 4PNZA 2Y6UA 1CUBA 2QR5A 5BWCA 1ZD2P 3I6ZA 2UZ0A 4IH1A 4PSUA 3IIIA 2XUFA 3I28A 4H7EA 5ALIA 3DKKA 3B3QA 2ZYHA 4UFPA 2V9ZA 3W9BA 2WSLA 1USWA 2D5LA 3M81A 3PICA 5ESRA 1U8EA 4BC1A 2PM8A 3HACA 3V48A 4QEKA 4J7AA 1LLFA 4QLOA 4EA6A 3W2TA 3V9AA 3G0BA 4LYDA 2PSJA 3WMRA 4FFWA 1G42A 5AKZA 5JALA 5FKJA 2QM0A 1QIFA 4RPCA 3WQHA 2HFJA 3PE6A 4AN0A 2YH2A 4N5IX 4NVRA 4Y2PA 1CV2A 1U65A 5AKLA 1H2ZA 5AK6A 3DOHA 1AQLA
chains in the Genus database with same CATH superfamily
3CUUA 4QPCA 4KQWA 3GLIA 3IJPA 1N0IA 1LNSA 1XELA 1ZFNA 1L7QA 5T67A 3VYWA 4IL5A 3T35A 1NE7A 2QX9A 4KBFA 4X92A 4ON9A 1NXQA 4QWWA 3KO8A 3UT6A 1NMSA 3EY4A 4ZEVA 3IUSA 5DM60 1VOTA 3OX1A 4UZFA 2OQVA 1GPBA 2GBCA 5GPBA 4GYWA 3JS5A 4UNRA 2PUBA 5E7JA 3A9VA 1ND5A 4EKNB 3OZVA 1PT8A 1SKUA 5MGNA 3MIIA 3UTDA 3FVQA 3ZCXA 3EGIA 3RROA 3LW7A 3LA8A 3PSAA 4KP7A 1HNNA 4NYIQ 4RUKA 4XA8A 3K96A 2DJIA 2PS9A 3QKTA 4XR9A 3TS1A 3T7IA 4AMGA 1NF9A 1SHJA 3MINB 4OIFA 1O58A 2XUAA 3WRXA 4CEIA 1RACA 1T5TA 3B1VA 2W4MA 4XDGA 4I9NA 1QONA 1TYBE 1NXSA 2RHJA 5A5DA 4RTLA 1ZUNB 3VZDA 2DFNA 4NE2A 3L0IB 1BG6A 3ENZA 3DV0B 1E92A 3RTEA 3QBDA 3V2IA 3DUFA 4YRDA 4DARA 4US1R 4EARA 3FKSD 4ZTUB 2CV0A 2GN0A 1VYUA 2HXSA 2Q3BA 4D82A 1XPRA 3DB2A 1PR4A 4LDNA 3Q0EA 1GRRA 2QM3A 3RT1A 1P5RA 4FGZA 4RQTA 3U39A 1FTWA 2QW1A 5CDFE 5CYOA 4BNDA 2QVYX 1T4BA 2WU3A 4JOCA 3WL8A 2Z95A 3MM4A 1KA9H 1RT9A 3BFXA 4YMIA 3PJEA 5T4BA 2I1LA 4C0AC 2FFRA 2G9ZA 2WTXA 3HHPA 3PXBA 4L5CA 4X41A 2CL6X 4ND7A 1QV6A 5CDUA 2GWHA 2QRQA 2XB4A 1N5JA 1B41A 4I5IA 2G0NA 4BFSA 4BQOA 1Z63A 1ZM4A 4HYQA 1CB0A 3OOJA 3GVCA 5HXAA 4DB2A 2EGHA 4TMKA 1SULA 1ZRMA 2GJ4A 4C4AA 3NC0C 1R74A 3AEXA 3W8NA 5C8DA 5DEIA 1B1AA 1MA0A 1CNMA 1VQ1A 1FZTA 4RDIA 2D1SA 4GOOD 3A1DA 1JLRA 2C2WA 2YXLA 5IUNC 2QQEA 1P72A 4CMEA 3RR2A 5JH7A 1II0A 7REQB 3RVBA 2W2PA 3Q7PA 1YQTA 1A96A 3UMVA 3HYSA 2BGJA 4ZODA 5BRJA 3TVDA 2N9UA 4Q48A 4M0PA 2D2EA 5MN5A 3VI4B 3QW2A 2FZWA 4JUCA 2FMTA 1JQAA 2WIBA 1KORA 3CEAA 3HXKA 4D9FA 1JFRA 4MYDA 2GD0A 5AD1A 1QGUB 1WSDA 3HZRA 5CM9C 2NUAA 4HBZA 3IDQA 4B6RA 1E20A 3GFBA 4BMPB 5FPPA 3OO0A 1RWBA 2XW6A 4WERA 4N49A 3SC4A 5AR1A 4MEBA 3FY4A 1B3RA 4C0XA 1KVRA 5CA1A 4Z0PA 5CDHA 2QY9A 3UKOA 5DHRA 5TR9A 2D6FA 2WICA 3CZ9A 1EJ2A 3FKSA 3FCCA 4FCTA 1LSSA 2CMDA 4FLMA 2JFPA 3VJMA 1T9AA 2JHAA 2I2CA 2QRNA 2X7JA 2BMWA 1BKSB 1EBUA 2CZGA 1XPOA 2W11A 1GQFA 3JASA 4QQFA 2EKLA 4OYRA 4UBNA 2XKJE 4HQKA 2RHHA 4M38A 3ZHQA 3NPAA 4F4FA 1U04A 2V5AA 2PRYA 4OIMA 1XMXA 4OJMX 2AUNA 3BVPA 4G37A 3ZI7A 2GBIA 1QIKA 2HNKA 1AS3A 2C4WA 2R00A 5IJXA 4CQLB 2Q3HA 1SXHA 5K3BA 1JHQA 1ST3A 1EJBA 5FBRB 3OP1A 5KMGA 3GGSA 3VPAA 1U28C 3HB9A 4JI1B 1G7RA 1U9IC 1PZHA 1FS6A 4YAFA 2Z2IA 4DOMA 1Q0PA 4WBSA 2ES4A 4QHTA 4EY3A 5L3QB 1UXJA 3L77A 1P2VA 1QX3A 5SZIA 5TB5A 1P7WA 4H3KB 4EG6A 5B3JC 3MBIA 4KB5A 4F86A 3LXRA 1UPBA 1HT1E 5BSUA 2JIZD 2YDXA 2B8EA 1EFKA 1FTSA 2X0RA 3SQLA 6ABPA 3ZDCA 5IM5A 5HF8A 3H1EA 3RUFA 5B58C 2C7RA 5ERXA 2HSGA 1Z7BA 2Q2NA 4PRZA 4AUNA 5LM3A 1MBZA 3DV2A 3ILVA 4IQGA 4IXTA 2HZ7A 1QM5A 4R9UC 3QVLA 3AQ4A 1FU8A 3QBJA 4H08A 4FFBA 1UWLA 3WQSB 1OLXB 3PQCA 4A8JC 3PXUA 5BT9A 3CNEA 1NP7A 2BGKA 2H92A 3ZHCA 4HXGA 2WJYA 2GHIA 4FS3A 1RABA 2JPDA 5HGXA 3LY9A 4Q3LA 3GJTA 4QRIA 3CT6A 5DNWA 1N6PA 5ULLA 3M0EA 3O5AA 5T7BA 2Q5IA 3WLTA 4MQUA 4RPGA 3L8FA 3ROKA 5HZHA 1E1YA 3KQUA 4YUVA 1I51A 3UHPA 4GXRA 4GLBA 3PRYA 4S1NA 1VI6A 3V6LA 3VTKA 2DSNA 2YNMD 2HYIC 2OORA 5C35A 3S8YA 3QV1A 4NXNB 1MABB 4OQDA 3RGGA 4X97A 3I1JA 4M8NE 4JB0A 3V7YA 3TVYA 4V02A 3A6ZA 3L8ZA 1K8QA 1QGAA 1RWPA 1G6KA 2HSEA 3EOBI 3FZNA 3BILA 3FMVA 3HYTA 4WZAE 3UV3A 2GPBA 3WHLA 3TFOA 4MUAA 2R4UA 4KQJA 4TYMA 2JI6A 4JLDA 4CCSA 4QTUB 4E5PA 3TLGB 3A6KA 3A9UA 1MIOB 3EZGA 4L5YA 1H0SA 5CXQA 2QXYA 4N6NA 3MMXA 4IR7A 3KYCA 2HL6A 4HS4A 5EIBD 1ZXLA 2WHXA 3CNQS 1MAVA 3DF7A 3GUVA 4I1SA 3RBVA 3T4EA 1RAAA 4R8RA 3R75A 3L6BA 2FZGA 1G5FA 1XTSA 3I61A 1BVUA 1Q3KA 2IEAA 1QH0A 1ZMXA 4S24A 1MOQA 1XZIA 1WDLA 4RGVA 4YRZA 2BFBB 1FDSA 1KO8A 1ONSA 2P79A 4HZUB 1QOPB 1SCUA 1W8IA 4CG1A 4RY2A 2EV9A 1XVVA 4MUYA 2JIZA 2VF7A 2ZRKA 3LC1O 1NSYA 1YI0A 3L4KA 4OXRA 3RFVA 4PZLA 3WX0A 5CB8A 1E8MA 4Y9DA 2P6UA 4MR7B 3VO9A 4B3FX 5KQRA 3IP3A 1JDBB 4ZJYA 5C52B 5IU6A 1SD5A 1R0ZA 2PWAA 3KR2A 1V11B 2VYCA 2NSJA 4EYEA 4KVFA 3FZEA 3I34X 1D4OA 1QFXA 2FN9A 1ZCAA 1ZJZA 2ZQYA 4B2YA 3K0SA 4EQ6A 1CQIB 2HK9A 4QRHA 2DFPA 3DZGA 2WLTA 3QE0A 1PNOA 4EF6A 4HDKA 3O83A 1J25A 4LYEA 1UT8A 4LDQA 5BQ3A 4JGGA 4RVOA 4FB5A 3ZWBA 1PRYA 4N9WA 1LVHA 4O4IF 5IBCA 4YBRA 3K8ZA 1NW6A 2YNMA 1I2AA 3VKVA 3L1KA 4GX5A 2WDPA 3NOQA 4WEQA 4YI3A 1RI5A 4AROA 5TE9A 3WGJA 3ACDA 1ZGCA 3OPQA 4JYPA 1P73A 3CRRA 3A1CA 2ODQA 4LUCA 2FP4B 1FQWA 1MJGM 3TGPA 2NQ8A 1VJDA 4BB6A 3FCXA 1U0BB 3ILSA 2H1RA 5CA0F 4KITB 4P1ZA 1LI5A 3L4JA 5ED4A 1JDSA 1M33A 1QHYA 5CT9A 3WO0A 2YJ4A 5E8JA 2VJCA 1ISSA 1E61A 2AXQA 4FDUA 3GUHA 4JC0A 3I6MA 1K6IA 1HO3A 4ZVVA 4LE2A 4U2DA 3D8RA 2GYWA 3FPFA 4TWIA 4F06A 1OREA 1K63A 3L7DA 4MRVA 4TUYB 1EFTA 1JW9B 1SVUA 5HIIA 2A58A 4DQLA 5C9ZA 2E18A 3BXOA 3L0CA 1UT5A 2GPTA 5DEOA 3ADBA 4JKIA 1D1QA 3OA2A 2C7OA 2PR7A 1Z5VA 2K6GA 4G07A 4MMZB 1CIPA 1A7JA 2H9AA 2I7TA 2O52A 4FMDB 2C1ZA 2Q99A 1XZAA 4Q6WA 3KQSA 2ZBDA 3PDIA 3U1TA 2ONKA 4RHUA 5BQ5A 1ZEMA 1NMZA 1V8ZA 2IUTA 5FULA 2M32A 4TMWA 3ST7A 4WD3A 4DCUA 3FNQA 3NTLA 1PHPA 4X00A 2EHJA 2OMEA 3D0KA 3K4QA 3OZRA 4NP6A 4BNNA 3NPMA 4I50B 1WB5A 1VPTA 4LOAA 1AKYA 4EHLA 1NHGA 1RI2A 4L6CA 4IM7A 4MLZA 3TG8A 2GK3A 4WA7A 3W5JA 1R9JA 2HPAA 3R3JA 2OE2A 1XIVA 5FO1A 1Z33A 2VEOA 2OXIA 4V1CB 3HJCA 1XKXA 3WYAA 1AK2A 3N70A 1XZDA 3VHQA 1IY2A 3IIKA 1D0SA 3VOAA 1SNYA 4N47A 4CI9A 1RHRA 4RFSA 1ND6A 3ZGVA 2DGDA 1IG3A 1ZRNA 4KACA 1UBNA 2H54A 2YWCA 3KEOA 3L6UA 2DERA 5C7OO 5EHQA 3VVLA 4MPPA 2GYUA 2Q0XA 2PXCA 2X9NA 1IH8A 2QPAA 2IPMA 4OGKA 4A0QA 3F46A 1KAQA 4ES6A 4NOMA 3ZIAD 4X7PA 5F52A 2AUTA 2BBOA 2ZRQA 5JAHA 2XNCA 4R1LA 1X1AA 2QW0X 1DWUA 1T0BA 1KH2A 1U2GC 2C2YA 3QGMA 1T3LA 5HA5A 1N2BA 5FORA 4BVGA 4CG2A 1I4EB 3C3KA 1DTEA 5HKKD 5F33A 1Z6GA 5C5EA 1UBOS 1WOYA 1CB7A 1Y9AA 3DOOA 3HGTA 3DTVB 3R40A 1HA3A 4K03A 4WNAA 1ZPDA 4MCHA 2XA2A 3EIFA 1JDPA 4JOQA 1T2FA 3RSFA 3S6JA 4DNOA 2C4UA 1PV2A 1U3VA 1CWUA 3L18A 3I53A 4NOJA 3O4JA 3FPJA 5F35A 4ZD6A 1XWIA 3V4ZA 5JXWA 1ZC3A 3MT8A 2IZ5A 1YASA 2YMLA 1W25A 5LFAA 2HA4A 4GL2A 2FMFA 5F7XA 1OFGA 2IX9A 2OOSA 2BDTA 4XUCA 1A98A 1UXOA 2HQOA 2JK1A 3DQPA 4N3AA 2WJGA 4UNIA 5KOYA 2FX5A 3DZ8A 4KXNA 1B0UA 1ZBQA 3GZTB 4TWZA 4RBNA 5D6OA 2A59A 3R24A 4KX5A 4MV9A 4YAOA 5P21A 5DSXA 3RYFB 3CX6A 1H22A 3INYA 4MCAA 1WXWA 1EP3B 4RF3A 3W8DA 4YAGA 1O8CA 1LTQA 2AN1A 2LBPA 1KK3A 3GJYA 3H83A 4DQVA 4KNWA 1MXHA 3N39C 4YQFA 3BGDA 1WJGA 2SECE 4N3NA 3ZBUA 3JQDA 4FUTA 3UCEA 1C50A 1QU3A 4A8TA 3E9CA 4GU5A 3H42B 3JD1A 3HYRA 2WFLA 1DMRA 1E2EA 3H9QA 1CP2A 3WIEA 4QU9A 2NWQA 4B3XA 2BFDB 2GEFA 4LOLA 1JDZA 1JYSA 2RI6A 4A1OA 2IY7A 3LKZA 4DDTA 1E58A 2H0RA 3W3ZB 4LQDA 3D43A 4EKIA 4ZFNA 3I64A 2PMEA 1RPZA 2GH1A 4F9FA 1FNMA 2BSXA 1JH8A 3FGOA 3ZIAA 4OLHA 4EG8A 3PUYA 4DQUA 2B99A 3LQ4A 2YV1A 4LHZA 4M9UA 4AWXA 1WVIA 4XR4A 1OIWA 4S05A 2BV3A 4Q4HA 3L7MA 1AQNA 3O9ZA 2F8LA 4MQBA 1W4RA 3LGAA 4NMWA 4YQZA 5HKKA 1NN3A 1CX9B 2Z57A 4RTQA 2IS1A 3LECA 4OJNA 5BR7A 5F7ZA 2HNAA 2X40A 2CNLA 2MYPA 4PZ0A 2CVOA 4KIJA 1IY9A 1G3MA 4UEWA 5DX8A 1T8TA 2HU5A 3NIDB 3FXAA 5LOVB 1O0SA 1LZKA 1U2TA 2O23A 1VL0A 2RH8A 3DHYA 3GL9A 4GH5A 4D79A 2QMHA 4ZALA 3WKDA 3OU2A 4NNOA 4ZI7B 3DVSX 3NHKA 3IFSA 3QWHA 4WKOA 1NVVQ 2A1UB 4OK3A 1RLJA 3HUTA 2C2XA 3NC1C 5B58T 2F3SA 1VXRA 1PAUA 1ZGHA 4AM8A 3L49A 5ARBA 4EI7A 5EIEA 1QRSA 2RAFA 4P86A 1R4MA 1AHPA 2PH3A 1Z68A 2ZJ8A 2QTBA 3EVFA 1P3DA 3JTEA 3R3XA 4URYR 4RCYA 2OXEA 3IE2A 4NAUA 3S2YA 4CKYA 2GXAA 2JHCA 2BFPA 3GYBA 3QVWA 4HMOA 4MJXA 5TC4A 4UCQA 3TM4A 5GJWC 3VSDA 6LDHA 2PFGA 2J9FB 2R11A 1KOFA 2PAFA 4FCCA 1V8BA 4I99A 4Q7JB 1L5GB 4EGCB 3AWIA 5I3CA 1E94E 1YQDA 2C7GA 4WRRA 2QLLA 3A36A 1RNLA 3EGVA 2JFXA 3GNLA 2A35A 3JAWA 3KPUA 4UMEA 5JNWA 1KBQA 1KVSA 1JHUA 1W4AA 2HUPA 1JT9A 1Z38A 1QBGA 1SQGA 5AJXA 3AUFA 3GDOA 1Y1QA 4P2GA 2QLFA 3O1HB 3WNQA 1FSPA 3FR8A 3J81A 1U3CA 3DM9B 3N0XA 4TVKA 5LQKA 2OGZA 3G1WA 4Q1AA 1T6BY 5FUWA 3NBKA 1T6NA 3P9PA 2I33A 1MLDA 1UM9B 2NM0A 1OX4A 2E55A 3TJRA 3EVCA 3A9RA 3IQIX 1VLQA 1X3LA 1LI7A 2H06A 2P8SA 2JFGA 3I9V6 4HATA 5TQ2A 2ZYRA 1VJ5A 1NC1A 4CMIA 3O8CA 2AYZA 3K0CA 1NBWB 5AJTA 4OMUA 5J1SB 2J3LA 3W3AH 3UN1A 4WVFA 1E6WA 2VR1A 3UHAA 4AJNA 4F2HA 2VCHA 3TIXB 3H04A 5JZBA 3O2SB 4A9AA 2QD2A 4OXIA 4P3OA 4UNSA 1SVWA 4ILKA 4B45A 1NXVA 2YRWA 3JPYA 1FVFA 3Q11A 4PLHA 2Q0QA 1CZKA 4L8WB 3WK9A 4HH4A 2ZPUA 4KH0A 1J20A 4ARVA 1QG6A 2BVNA 4WHMA 3R5HA 3FOBA 2PX0A 4INJA 3RODA 3C41J 4BRUA 4NARA 4IOJA 3CEMA 5ESDA 3SNKA 3OY2A 2HTEA 4OQEA 2GA9A 2WF6A 4Y98A 2O0MA 3ZGZA 2ZSFA 2Q1UA 3A6DA 2H3HA 3OUZA 2QL5A 1P5JA 4MA0A 1A5SB 1GU1A 1N1DA 4AO8A 1UXHA 1TM5E 2I03A 2A0UA 2X22A 1RRGA 3A6GA 3BWVA 1T8SA 1Z13A 1TM4E 3DD5A 3M4XA 4FMBB 1GN9A 2HHAA 2OGTA 4IVRA 4RVGA 4ZAZA 1UC5B 2Q21A 2RHLA 4MAMA 2PO7A 3BK1A 3G9TA 4M1SA 4X54A 4TYYA 5T6BA 4P3PA 2XYPA 3MWJA 3W5HA 2ZBRA 3K9HA 2EBWA 3AJRA 4JMLA 2FOXA 3IBTA 4R7TA 5GY7A 4IXNA 3D54D 5EIFA 5KYXA 5B5SA 4ND4A 4YJDA 3SZLA 1OX6A 2NGRA 3I83A 4P31A 2FETA 3NIBA 4JR1A 4WZAB 2BFMA 4JVNA 4ZOAA 2OQ2A 4F5DA 3FROA 2L82A 3NT5A 5D8DA 5D5HA 2FLVA 3NNSA 3IULA 2GZAA 5CLJA 1AN0A 2ZIGA 4AJ1A 4BLWA 1GFZA 2YZ7A 4ZYXA 1UBFA 5FOXA 4EX7A 4V0LA 5HQTA 3FOZA 3AKDA 4ZCRA 4BN0A 5G41A 3TR6A 2YWDA 3WLSA 3DC2A 1GTSA 1JDVA 5FT9A 5EKUA 5GJBA 5KVSA 3A6HA 3QMWA 4H3VA 4O3MA 3MCUA 1XCJA 3BWMA 1YS2X 5M29A 1J0AA 3B48A 1QCDA 4ZIRA 1XALA 3CPSA 1YRWA 3LFHA 1Q1ZA 5BNFA 4JGBA 2FG5A 2ZUDA 3DCIA 1GSAA 1VG0B 1ZONA 3KVNA 4O3FA 4OPMA 1YL5A 2CY0A 5EVJA 4C01A 4CM4B 2WYHA 2FPGB 2V0CA 4CF3A 1ZZEA 1J8QA 4KR3A 5HZKA 1ZO8A 3L4EA 5HQJA 1ZOPA 3KU1A 3EFBA 1F20A 3NHSA 4NESA 3RUIA 3UANA 5JFTA 4OSEA 4HNUA 1NYRA 1MV8A 5CU7A 5ELXA 4WUVA 4Y2TA 2WVGA 3FGNA 3V2HA 2ZRMA 5CB4B 4TRRA 2AEMA 2OZLB 3AVTA 3HWWA 4QTYA 3MD0A 3ABZA 1O8BA 2H08A 3K0HA 3H05A 3TGWA 3ZKAA 1LPAB 2NXJA 2JFHA 2O2HA 1FYFA 4LYGA 4XSGA 1X1CA 5FBKA 1B8OA 5EKDA 2X1MA 4BVEA 1EHYA 3A05A 3DE4X 2CNWD 3EZFA 5AK0A 4E1BA 1JPJA 3A14A 4V0KA 3CWZA 1T3SA 2H0AA 3OKCA 2AC2A 1QHIA 5LQRA 1FDTA 2HCFA 2DFKB 3K8YA 4GVXA 2BMVA 3GVHA 2C2MA 1T2EA 3G2PA 4FGJA 4MAFA 4EELA 3BWXA 1EK1A 1EXWA 1BVYF 2JKZA 4I1OA 4KUEA 5ADHA 1X1RA 2PWBA 1XZJA 2R6HA 4HDRA 3JWPA 2BONA 1F5NA 4C0WA 3OX2A 1G9XA 4TVSA 2DG2A 3U9SA 2YXNA 1E32A 4IYRA 2C0QA 3REFA 1XVTA 3IV6A 4ESEA 1FMLA 1ESCA 1CUYA 5AI5A 3ZVKA 4F3TA 1SHTX 5AI8A 3AESA 1GD1O 5AYVA 4DIBA 2E1PA 1EBBA 3O91A 1OFVA 3D8UA 3P45A 3C3EA 1C9KA 3RJMA 1Y33E 3THOA 4I3FA 5I45A 3D2AA 3O7MA 4IG4A 4QRDA 5JYBA 4ZYYA 3L7NA 2EU8A 1XZGA 1AKNA 2YWBA 2IYSA 3TQOA 5GAJA 3N8DA 2B61A 1Q1NA 4JK3A 2MYNA 1S7CA 3ETLA 3KKLA 4UCXA 4NOLA 4V0MA 4MPJA 3O2NA 4HQLA 2ZRGA 1NJ6A 1SFRA 4P4LA 4BECA 4IKPA 4YUZA 1E1LA 2SBTA 3T38A 1U99A 1R8XA 4RZ2A 1WDWB 2FAXA 4UHHA 2YHIA 3CIFA 5D7BA 1M2EA 2X8AA 1SC9A 1EM6A 1LBTA 3CE9A 3DKPA 4NTZA 4N3BA 1E2UA 1P2DA 2XUGA 3P9IA 4XOIA 3ZCRA 2W6ZA 2BYTA 2O5EA 3G2OA 1ZG3A 2QZ4A 4A91A 4F8JA 3NDIA 3FDXA 1P6XA 4PVCA 4TV9F 5DNEA 3OZUA 5JDCC 2IX3A 3MMSA 4OH1A 1NXOA 2B5WA 3CLUD 5LQMA 3S99A 1H4VB 2JI4A 3EGDB 4P2BA 3V4LA 1U0NA 3I42A 4F1JA 3NHPA 3BMCB 1DWPA 4ER0A 1YC5A 2N0SA 4XM1A 5H7XA 4E5MA 2FR8A 4EYOA 3U09A 4B3IA 3VU0A 2VJPA 1D9XA 1XU7A 2B8JA 3GRYA 4DEVA 4C6TB 1I1QB 2QAJA 4KR0A 1LV8A 3AIIA 2PMFA 2UYHA 4BQRA 3UH1A 1TCVA 4LTMA 5T4FA 1BNCA 1HT0A 2O7QA 3OWXA 4JDUA 3O8RA 2WILA 3OT1B 4K6HA 3CCFA 5AUNB 1BQ4A 4C08A 4Q24A 5I7WA 3ENVA 4FZVA 4F60A 2P1ZA 4LJKA 1Q22A 3TSCA 1A8PA 2ZB8A 3B3FA 1RKBA 3COVA 4I14A 2WKQA 1A95A 2RJOA 1X13A 4WADA 4JQCA 2G5PA 3K73O 1W5BA 1UIMA 3EOAI 3UGKA 5CX1A 3K9NA 1RZ3A 4C4ZA 4D8VA 4MQEA 5JSZB 1WOMA 3K1JA 3PUZA 1G1MA 3Q40A 4OQYA 1UP4A 1VIMA 4YMWA 5I8WA 1EM8B 2DX7A 3LIIA 4GHWA 1QDEA 1A9XA 2QUZA 3KVOA 1XD2B 2QMEA 5K3CA 4CVNA 1H3EA 4I5FA 1QIJA 1AB6A 1BE0A 3QBEA 4EYSA 1I30A 2GM9A 1R66A 1NWHA 1IHDA 4WY8A 3ZV3A 4TKVA 3KKZA 1XRQA 1KJ8A 1DTWB 3R9KA 3SD7A 4BNGA 5AVYA 5EI5A 4V0SA 3T06B 2RGAA 3D59A 1XP5A 4GR9A 3QIAA 4PIMA 2BAGA 5FA8A 3RSHA 1MQ8B 1J9EA 1GL7A 1KZ1A 1MH9A 1Q19A 4XUDA 4PN3A 4RK1A 3SQWA 4J0FA 1E99A 4UREA 4U39A 3ONFA 3IQXA 4Y2VA 4YCCA 1B0PA 3VOBA 1RM5A 4LOJA 7YASA 1I6KA 4H7PA 2G04A 3PC7A 3AYZB 3OJEA 1J9GA 2OWDA 1JFLA 5BOVA 1URPA 1W52X 2A3RA 3PK0A 3QBVA 3GLIE 3M6WA 5EFZA 1RJDA 3QMMA 3T1OA 2F1KA 1KDYA 3ZYZA 3MD9A 2C42A 1HGXA 3BZUA 3DWFA 3GCDA 5L40A 2YVKA 2ZIZA 1P7ZA 3NBUA 5HJ2A 5F98A 4DIDA 1MW8X 4KFTA 5B55A 4XDHA 2KHZA 2I8LA 3KWFA 1GZ7A 3FTPA 4C4RA 3DMDA 4OB6A 1WB9A 2HT1A 1BXGB 1WZCA 2WZCA 4IS3A 2OQIA 1THZA 3IKVA 4UVGA 4EVQA 4RPKA 1BIFA 4K9LA 5IAOA 3J80A 3UJDA 1XK6A 2DJ5A 4D6XA 3AUKA 1ZH4A 4WESA 5DI3B 2FPIB 1ISPA 3KD3A 5FLKA 3RUPA 4JP5A 1I10A 3VHXA 5JR3A 3AL0C 3KLNA 2HA0A 3ESZA 3EY9A 1DO2A 1Q7EA 1RYMA 3O75A 3PVCA 4WMLA 5G3ZA 1L2TA 5EZSA 4U0JA 3T3MB 2WQZA 3N2KB 5J5AA 2NTJA 1APBA 2QT9A 1FY2A 3HMQA 1IAQA 3ITEA 4U4AA 2XR1A 3PC8C 3G0GA 2O5CA 1EB9A 2EKDA 4I66A 1J8VA 4M86A 3SGLA 1KS2A 3BC1A 5EJMA 1W35A 3EJ6A 3N7TA 4AFNA 4EVIA 2H7CA 1H3NA 2DWPA 2XYQA 4G8CA 4JLKA 4L0DA 3RQSA 4GC5A 4U2GA 4ZEXA 4RHCA 5CM8B 1BN6A 1YRBA 4FZ3A 3MCVA 4PHGA 2QYHA 2P4UA 4HEQA 2VSFA 3PL1A 2AB0A 1XXLA 3ZC3A 4G8DA 4Y0VA 5KREA 4OF4A 4JV5B 4UOEA 1JQDA 2X15A 2YXBA 1YHYA 2H0QA 5DHSA 5ELLA 4ENVA 3U7EB 1Y7LA 4R0MA 3T0FA 1NASA 3ICVA 3OUUA 2PSHA 4TYNA 5DBIA 3MGBA 5CAEA 4OG2A 4QXPA 1M5RA 1SHUX 2HIGA 3EW7A 2GUGA 4LIPD 4MIEA 4O1IA 1H6BA 2O5VA 1M7HA 4GKVA 1MTZA 1ADYA 1OWMA 5GWXA 4OU4A 5I7RA 3TCNA 1SOMA 4K9MA 4G5HA 2XTAA 1HPLA 2CVQA 4CLOA 3DO6A 1CY2A 3Q8XB 3KXPA 3AL3A 3DVAB 3ZKWA 2ON6A 4OL9A 4QM7A 1MNAA 2G8LA 3JRNA 2JCSA 3NP9A 4DILA 1DEHA 3IT0A 3WMEA 2BTQB 3B9PA 2ZUCA 1U4SA 2K4MA 4KYTA 4Z0TA 3DVLA 4QKQA 5AWFC 3GGDA 3UK2A 1GDHA 4WK0B 1Z8HA 5DGTA 1ZUWA 4FHFA 4RE5A 3I01M 5IUJC 1X8LA 2QTFA 1C9MA 4EX6A 5BURA 2Z6AA 3KQTA 1Q21A 1X86B 1PUXA 2O0LA 5FLEX 3G5LA 4DCVA 1P33A 1QYDA 3B51X 1R3DA 3MCAA 4NYIR 2GTIA 1EVJA 4B84A 2VTBB 4JCCA 4AS3A 4FDTA 3YASA 2IDMA 2C84A 4GM4A 1JVSA 2RHDA 3JQRA 3EGWA 3H8VA 1BZYA 3EE6A 2J3EA 3TDKA 5J3JA 3HTXA 2DLNA 4K8RB 4BMNA 3MLBA 3EGXA 3ZV7A 4BV8A 4M8IA 3NJ8A 2JH8A 2YY5A 1W75A 3RKUA 4BKPA 3ZX5A 1BD3A 1IEVA 3EMKA 1IRIA 1A2OA 2OVFA 1PYDA 3H7IA 3CURA 1JFFA 5D86A 5JDIA 1JEYA 3U4AA 2MSLA 1TTTA 1KJZA 3CKLA 2HXGA 4N48A 5BWMA 2C2BA 4LX8A 1N2CE 4IDHA 1D4FA 3RYHA 1A2BA 1U2EA 5LMCA 4EJSB 4PPYA 2O4UX 3OETA 4QGBA 2ZTMA 3FPBA 5FA5A 3OHPA 3CUWA 5BRAA 4W99A 1GRNA 3HZZA 2CZQA 4K7JA 1F3OA 3PHLA 3KZMA 4FT4A 4L9SA 4Q4DA 1WL8A 3UFXB 3V97A 4ANFA 5AVQA 3VV3A 5T8KC 2LUOA 3SLRA 3R6TA 2WJWA 3CH7A 4FHCA 4GPD1 3CH5A 4LJSA 3ZEAA 1JKMA 5KI6A 1PWHA 4UMDA 2ETXA 1ARZA 2Y1KA 3PX2A 3IUBA 1T9GR 1MC5A 1BFDA 3BHMA 3AEKB 3BXHA 3GFPA 4X63A 1AZWA 2NYUA 4NBLA 4B6QA 2RAVA 3AEQB 5JS2A 1Q91A 3DCNA 3WLQA 5GVRA 2DBYA 2OHGA 2RHRA 3LBNA 4PTZA 1X7ZA 3G9UA 1AQYA 2VPTA 1BGXT 3BM5A 4J16C 4DMLA 4GOMD 4F72A 1P80A 3OQOA 1MP0A 2FPKA 3TAUA 3CLRD 2VPIA 1KJYA 4HB2A 1HZJA 3TNFA 2IL1A 3QJYA 3UT5A 3WL7A 3GARA 3NONA 1M6VA 4QOJA 1YTUA 3VR2D 4EDFA 1V41E 1E7MA 3BXZA 3I5MA 4JVLA 4PANA 5DT9A 3W2EA 3THYA 2QBYB 2GPWA 1CR1A 4Z9XA 3UATA 3BZBA 4UZEA 3BE4A 2QG9A 3FPEA 4BVBA 4JN6B 2CSUA 1EA7A 4OHCA 4ZQHA 5BSTA 4QGSA 2PLWA 3HKCA 5BVHA 2X5KO 3VYRB 3SHWA 4P5DA 1T6ZA 2QN1A 3BB1A 4EO9A 3FZQA 2V96A 1JKFA 1W4LA 2ZB4A 1DKRA 4Y9SA 3SX0A 3O7WA 3BMQB 4QOSA 4L1KA 1HRKA 1QMPA 3HM9A 5FTLA 1MFPA 1OLSA 2Y2UA 2WHQA 3F6PA 4ND2A 1D6MA 3QWBA 4H4EA 2XB8A 1YJBA 5JFGA 4OBBA 1QTQA 2IIPA 4FHEA 2DUWA 3FAZA 4EUEA 1WKBA 1U9ZA 1CG6A 3KT6A 3PUVA 4ID3A 4IGIA 2ZZNA 3GJSA 4PRKA 1UBCA 2FOIA 2REBA 3AVWA 5ITZB 3IAXA 2ZJ1A 4I55F 3T5BA 3QA3E 3D81A 4CNQA 4G0VA 1BROA 4C87A 1WHSB 2QTCA 3IL2A 3RVKA 3G8YA 4I7EA 3HCDA 4OX9B 5ECWA 2HOQA 4UD6A 3NEYA 4JS0A 4LY3A 2GO1A 2JCYA 1RC1A 2HQRA 3GNQA 2QTRA 3OKFA 2VWQA 3KUUA 4X6LA 3AI3A 3W5VA 1UR5A 5DBFA 1GAEO 2OY0A 4BX3A 3AUAA 4Q4CA 5HTOA 3FDJA 1ADCA 1P8JA 3PDCA 1LRKA 4GYYA 4HH1A 3QPCA 4XPIA 4COKA 2CWDA 4QBTA 1U0OC 4X85A 1O96B 2E4XA 2PBZA 2CDRA 4JWKA 5BUCA 3DE0X 2XWBF 3QXHA 8AT1A 2I8CA 4GEKA 1L8QA 1YVUA 2W7TA 1UADA 2BDUA 3C5EA 3N5KA 4K9QA 4LTNA 3BSSA 4US2R 1WQ4A 3PBKA 4K26A 4CFYA 5JFOA 4NE7A 2HDHA 1ECCA 1YS6A 5HK9A 1FQKA 1PN3A 1XLVA 2O8CA 4B73A 2JFFA 4TL8A 4MJ7A 1ZWLA 4LXHA 5AMXA 3RFCA 3FZYA 3IEKA 4BCDA 3R0JA 3WYEA 2VHCA 3CRQA 5BV2P 3RIXA 1Q77A 1KMHA 2GF9A 3L84A 3VR2A 1X1DA 3CCBA 3WB9A 4F6RA 2R7NA 5KJFA 2WYIA 3E15A 4C4SA 3AF5A 4BDTA 1TVKA 3QVXA 1G4HA 1CUCA 4IRXA 2EW1A 4JUDX 2JH9A 8ADHA 1Q7RA 5ILGA 3WL3A 1NW8A 1QBKC 2J30A 2JJ2D 3GRRA 3H5VA 3AI7A 1TAGA 3BCSA 3H8JA 2B2CA 4M1ZA 5F3RA 4MJLA 2CB9A 5LSAA 1KOGA 3PQ4A 3AR9A 5KYGA 3I4CA 2EJUA 1KAGA 1G8JA 2QDXA 4PO1A 3BA1A 4PFSA 1W2HA 5EVCA 5FUXA 1EFLA 2XF8A 3FAKA 5J5VA 4JLMA 4RPIA 2BOVA 2VDWB 2IK8A 4TLAA 4EG1A 5KCMA 3QLUC 2BHRA 4G63A 6ADHA 3C5WP 2EZ4A 2Z2YA 2VDOB 3JVVA 1EK6A 2HFKA 2JLRA 3LG2A 5NLLA 2IHKA 3BTVA 4Y1RA 2C4TA 3HFJA 1IXSB 3T9BA 3H5AA 2C96A 3EF3A 3ZHUA 1Y98A 2MT9A 3O2QB 2X76A 2AI2A 3P9KA 4WKCA 3AV3A 4MYUA 1R8QA 2ZSHA 4RAOA 1N6IA 3FG9A 1KFBB 4OJYA 3OD5A 1JA1A 2AT1A 3DG9A 1F38A 1YF3A 1OQAA 2IQIA 1BRMA 3MNFA 2FKAA 1ADFA 5FYDA 3UXHA 1Z2DA 3JD2A 1PHRA 3RRJA 1P7CA 3FVTA 1DUVG 1MO4A 3VNQA 4DR1B 3IDZA 1KHHA 1NY5A 4YUWA 1MORA 2FF5A 1YWGO 3NTXA 3PGMA 4IP0A 5KOJB 3WYGA 3L5OA 1FFAA 3E82A 5JSHA 2A7QA 4HY3A 2Q8PA 2FI1A 5HF5A 2PJUA 3HB0A 3A4VA 4CV2A 2FWMX 3C8DA 1EWYA 3Q3CA 3B7GA 2VS1A 4ID9A 3RFUA 3E9DA 1WEHA 2B4RO 2CDNA 1G21A 3MTQA 1NOIA 1U02A 2KWIA 2AMLA 1GARA 1YS1X 5FA6A 8OHMA 1A5ZA 4BQPA 5I7HA 2WAMA 1E79D 3FNIA 1FTNA 1IOWA 2Z5VA 3N86A 4DUGA 1QG2A 4E5UA 1FFBA 2CC2A 3GLRA 4HN9A 3ZK7A 4N3GA 4UARA 2BFNA 5FOSA 4EB3A 5LDHA 1JIUA 1Y3CE 1EK2A 2QJRA 4HC4A 5CJJA 2WZDA 3G8AA 2D3TA 4RF5A 4GOKA 4OAOA 3VAZA 1K7CA 4AKTA 1LRLA 4OKNA 4BKMA 4YHHB 1J06A 1PEAA 4JLOA 1Z36A 1N3IA 4WBNA 1OZGA 2QRMA 4HDOB 3PPVA 4RFLA 3R4CA 4K0KB 1Q50A 1QF7A 3RBXA 4NULA 4M0CA 3PNSA 1U98A 4WXPA 2P4QA 4K81B 4WCFB 3VJLA 2C5HA 2CNBA 4QT0A 4R0NA 5CB0A 5GIOE 3IRVA 4IJQA 3R6WA 1RCTE 5HJ7A 2QI9C 4OI4A 1F5SA 4PBSA 2XV1A 3KKKA 4KH1A 4QLAA 3TDMA 5KVAA 5DXAA 1XTJA 3HDVA 4MVJD 4YNBA 5DCYA 4YIHA 1CK4A 5A5EA 5K3FB 1H2EA 4IMPA 4ZJUA 3SJAA 5F1OA 1J42A 1R5BA 2Y77A 3ZY2A 4ZZ2A 1QYCA 1UBGA 2R00C 1SUEA 4P7JA 1DDIA 4M1MA 3F2VA 3Q88A 3E3LA 3BMXA 3ORFA 4GZ6A 1KF0A 1XEXB 3DBLA 1H94A 1P2SA 2HLNA 2V58A 2VPWA 2WU4A 1DDGA 1UCFA 4IDEA 5CFZA 1S1MA 2E4UA 4I4TF 5HMLA 5FAXA 2ZRAA 2A5FA 1CFJA 1YCHA 2JNWA 1P7YA 4M1EA 4F7WA 3JQBC 3TZLA 4L22A 2G1PA 4HQRA 4KE8A 5A3JA 2P1RA 1S2MA 5AVKA 1USIA 3EDQA 5I9NA 3FFBA 1JBEA 1JB1A 2JAWA 4PNEA 4S1OA 4YWHA 3K1AA 3L1HA 2PNFA 4WLEA 1E79A 2H4XA 5EQDA 2XWJI 1ULSA 1DCFA 3H4VA 3VZCA 2WRZA 1H5QA 1NRJB 3MHPA 5K3EA 4MRAA 4PE5B 5TMPA 5EMHA 2QPLA 2ABWA 3PQ5A 4AK9A 4HRAA 1V5EA 2AXNA 4HXFB 3SJ7A 2NU9A 3RADC 4B75A 1PU2A 4OBWA 2G8NA 4RMJA 1CJSA 2JGDA 2P3OA 3QITA 4NH4A 4G97A 1RC8A 1JQLB 4Z54A 2XKBA 1AVTA 2P62A 3GEIA 3G3EA 3O74A 1YQUA 1CUVA 2FKNA 4A4DA 2AW3A 3IQEA 3P2MA 1GLGA 3NM5A 5I4BA 4AP5A 1HE3A 3ZY6A 5HOQA 1AO0A 4GICA 4MPDA 3RANA 4JBNA 1TVEA 4DE5A 2IXEA 2JLVA 1L5SA 4LGMA 3R6LA 3F3KA 4TQUS 2EATA 5FI0B 3ZWOA 4MVJA 5C2JB 3QKRB 3VAAA 4JJ7A 3LBFA 4CKXA 1DADA 2VJOA 3EIHA 3L6CA 4M76B 3PPXA 2AWNA 5JJ5A 1OTXA 5ALKA 2GX6A 3IOEA 3HPRA 1WPGA 3KSDO 4WIAA 5A4AA 3SC2B 1KBZA 1M2JA 2YWRA 2PG3A 1UKEA 2YVUA 1T10A 3IMEA 1NVUQ 3SG0A 3QQ5A 2BHLA 1P0PA 3DLCA 4ENUA 1SCNE 5GTDA 3S27A 3DDCA 1P4JA 5THKA 3SS9X 4GRIA 3X2SA 4I55A 4FU0A 3HLKA 3SVLA 4CLHA 5K0GA 5JMWA 1K8XB 4HCJA 5CVCA 3QFFA 3H75A 2J0EA 3R7WA 3U3RA 4C7XA 5LIPA 4A36A 1PJLA 4CTJA 4Q02A 4Y6LA 2PNJA 3KLPX 4R2IA 3QP9A 3D6FA 1V4BA 4AZTA 4CM5A 1XNQB 4W8GA 4UHKA 4PLVA 2R62A 4QUDA 3EPRA 5EZYF 4ZV4A 1K89A 4J0IA 1OR8A 3VR5D 1GQ2A 4MP8A 3IVXA 3I12A 4WXRA 3JX9A 5FB3A 1R15A 2IHBA 4TOIA 2IP2A 3I58A 5A7HA 1US8B 3U7QA 3TRDA 3EXFB 2W6MA 4IHKA 1VIAA 3NASA 1RLTA 3ZDXB 3UWOA 3OICA 1C1XA 3UQYS 1ZGGA 5D87A 1N2CB 2FRVA 3HDHA 1DIHA 1QK3A 3TAHA 4DQ0A 4F4HA 3MS2A 2JANA 3HN7A 4D5EA 1XCGB 2GZMA 1OWOA 5EE3A 3CZAA 3OE5A 2YNMC 4TVBA 3BGOS 3GLSA 4G0QA 4RJJA 4ZHQF 3QYAA 4CMGA 2EHDA 2RGGA 3KFXA 3M6FA 4QG7A 3B1FA 3GWZA 1WXIA 3R9WA 1GUAA 4UDOA 2UZ3A 3QKWA 1XRRA 2QV0A 3GFGA 3TW0A 3FKQA 2F62A 4LV5B 1E4EB 1PZMA 1P5HA 2GCPA 2R1VB 1JSRA 3A06A 4GLJA 1KMNA 4K2AA 4RSGA 4KE7A 3X1JA 4A10A 4B7AA 3MJEA 3P4XA 5A3RA 5JD6A 3MBKA 4TWRA 1JHZA 1T1SA 2FQWA 2JLAA 3OCVA 1YB6A 5J4VA 2I4MA 4HGNA 5KTTA 3VPFA 5EIBC 3NM4A 3SYMA 3A4IA 4EY7A 4BNKA 3EVZA 1PL8A 1A4IA 4E09A 2C31A 1B43A 1T4DA 4YJHA 5TXGA 3H3FA 3NR2A 4DDMA 1WB4A 3GZ4A 3W8RA 1D4ZA 2IODA 2FW9A 2J09A 2TMDA 1G60A 2MR6A 2PXXA 2H7YA 1S4QA 1UMBA 2YUIA 3LOPA 5DNVA 2VDJA 4Z4GA 4ICIA 3P9XA 4LRXA 1NN5A 4RU1A 3MMPA 5JHHB 5LP1A 5JJLA 1PJ3A 1RLIA 4IJ6A 5B3KA 1E3SA 4X8MA 1ZUD1 3VDQA 5K0JA 2XE8A 3CRVA 3LYAA 3VR5A 4CGYA 1R12A 1SXJE 2VK1A 1XZBA 2GPYA 5E6RA 2OYRA 2QAGB 2AFHA 2A94A 3D2LA 4YP0A 1Z47A 5FOUA 2OT3B 3BKXA 3PF8A 3N6VA 2OXCA 4D8YA 4GS5A 3U3MA 2XIJA 1NLFA 3PGA1 2BZGA 2H59A 4OYHA 1O1YA 4XASA 5KTOA 1G5HA 5FTMA 4CTKA 1Y82A 3O31A 3RDPA 4CM1A 1X9HA 4M54A 3O4RA 4ZCPA 2JASA 1E9AA 1H0KA 2HH9A 4QJ4A 3REGA 2HK8A 3VDNB 2AZXA 5H0IA 4L2IA 5ERGB 4UUNA 1B74A 4CEHA 4NCNA 4CJXA 3MRSA 1XPJA 4I1VA 3CN7A 1D6SA 1ONPA 1XJQA 5FPYA 1KZ4A 2C4VA 4NECA 3RO7A 2SNIE 2JA2A 3HWX1 3CKKA 1C7FA 1P5ZB 5J4HA 1ORVA 4HFJA 4U7JA 1HDIA 2DR0A 2HMSA 4MV4A 1MFZA 4M8LA 1H9AA 3BIWA 3T3DA 4JNKA 3BN3A 3ZLVA 1UZLA 4Q9LA 1E6EA 3EW9A 4Y0NA 1KP3A 2HBQA 4N7BA 4R1NA 3T9AA 2QORA 4EO4A 2AQKA 4JLAA 1LTKA 3OHMA 4MGEA 2JGJA 2K87A 1XF1A 2VI5A 1NNLA 2XQIA 2G6TA 2ZQZA 3ESDA 2Z4SA 1CIJA 2UVPB 3ET4A 3EZ2A 3GRKA 4KBGA 4OB8A 4PBTA 5CTJA 3QEKA 5PGMA 3RG2A 1PNTA 2YTZA 2JI9A 2PUTA 3IAFA 4IXMA 2E82A 5F5NA 4YP9A 4YLYA 4Z7QB 5LYJB 4B43A 4KAXA 2A3NA 3JZMA 2H1VA 4G65A 1ODCA 1XEFA 4NJOA 1O6BA 1HYHA 1SEVA 1VLMA 1W5FA 2P9TA 4FFPA 4QO7A 2YX1A 4UHCA 4M9CA 4YDSA 3T5DA 2IPLA 2YWEA 4JBYA 1MH1A 4NCBA 1SM4A 1ESMA 2V0NA 1EAMA 1RPJA 1H1LB 3PDUA 1B7GO 2VJKA 4LOKA 5ALUA 5FLYA 1AURA 1JIVA 5LXTB 4LDAA 5T4HA 4A6DA 3OWHA 4R69A 1PT5A 1S9DA 4IIBA 5IEBA 4DM7A 1Z8DA 5LB4A 1TCCA 2X0KA 1PV1A 1Y42X 1NYLA 2A6PA 3BFKA 3EOZA 2EC5A 4GRAA 4I4TA 2O59A 3K0FB 4JJEA 1JKJA 2XNSA 4HEA1 1A9TA 2QGZA 2XT6A 5BP7A 4M4SA 4ZO6A 2EW2A 4PYOA 3PFGA 2LDXA 1H4TA 3IX7A 1YVPA 1QO0D 4IIJA 3M1AA 4RVUA 2O50A 3RVLA 4BUJA 3E23A 3F9RA 2M6KA 2NZ2A 1YUMA 2YQ4A 1Y8RB 5E1BA 2IYYA 4PZDA 3U7JA 3PD0A 4HLUA 5CFOA 5AVRA 5LMUB 3QRWA 3M49A 2XXAA 4D99A 2D1YA 2Q6KA 4HDMB 4GMHA 4KN9S 3FNGA 1CERA 1YS7A 1O9GA 4J3JA 4RS4A 1BVHA 1B6GA 4BASA 1YQQA 5DKFA 3E81A 3ZZUA 4UM5A 3N2LA 1DSSG 2R86A 2ZYGA 4RMIA 4RA9B 1PR3A 5DFAA 4OH7A 4R2KA 1Q6ZA 3CUYA 2B9VA 3H11A 2W2TA 4X3CA 2YIJA 3CVWA 1ZOLA 1RI3A 4Q18A 4JI4B 2FEOA 2NNWB 3I72A 4J0DA 5KAPA 3KLBA 3UENA 2EP7A 5A4KA 1E7QA 1WEKA 3OZSA 1E5VA 1DC8A 1TT5B 2FXIA 3JQQA 1E1CB 3KEGA 4LVNA 4ZXFA 4A82A 4W1QA 5CLQA 1OI4A 3GAMA 1LPOA 4I4NA 4R9RA 5CXXA 1VLJA 1JB9A 1ZWKA 1NLMA 1T4CA 2JARA 2V5VA 4QU5A 2FZEA 4U6QA 2WFAA 5FR2A 1T2AA 1V1RA 4F04A 4PCLA 4X66B 2OZEA 2ZSJA 4QNRA 1S02A 4RYDA 1UBLS 3EVNA 1VMEA 3EYWA 3L4SO 4A0HA 5ALRA 4ARCA 3JQFA 3TKAA 2V7GA 4OYLA 3ZW7A 1CJCA 1L7XA 2NZ8A 4XLTA 4E07A 1IPFA 2DFTA 2O1SA 3R3VA 5J2TB 1J39A 1Z0IA 1ZISA 3F6CA 4WQMA 1DEOA 1GVHA 1RPTA 2VDPB 1ZJJA 3BB4A 4J2HA 4US0R 4M7RA 3VH1A 4J8PA 4P5PA 3W5BA 5G40A 5KTYA 1N5OX 3F7TA 5ELMA 3TDNA 4O1MA 2TMKA 1B6TA 3LV8A 3SEZA 3NATA 4BZXA 1XTZA 3OQPA 4GR5A 1YVDA 1MT3A 2J4FA 4MEJA 4R1OA 2EJWA 1XYVA 4FDMA 5HM6A 4LF9B 4PYNA 4RZUA 4KQKA 621PA 2NVUA 1AG9A 1DOZA 4QUBA 1Y5IA 3PLNA 3KTAA 4XCVA 1G55A 5U4XA 1EUQA 2Z6UA 1SUBA 3KVRA 4G86A 2FW0A 1UWCA 1ZYUA 2IF2A 1X1TA 3GJ4A 3OZXA 4BL5A 1KRWA 4LWOA 4E88A 2F9FA 3WGIA 3VR6H 1UC9A 4C6TA 2JI7A 3EDRA 4RTOA 3LYUA 2COEA 2W6NA 3I2YX 4LQLA 3AVOA 4KDFA 4Q7KA 5EZYA 3A04A 4C2AA 1PVDA 3IBFA 3RU7A 4E5KA 1G7SA 5CVJA 3WHPA 3G02A 3KJNA 1PTJA 3CF2A 3WZ2A 3Q1LA 4EGSA 4IGAA 4DSTA 5JZSA 5L51A 2D2FA 1PJRA 2YC4C 3HL4A 3KPJA 5DOVA 1KE1A 1KYVA 1V9LA 4ND8B 1Y37A 4BO4A 1BE1A 1TD1A 3WTBA 2WIKA 2IVZA 3I30X 4MXDA 3GI1A 4QAQA 1TKCA 1FX0A 1IUPA 3KVYA 3QENA 3TXYA 3WGOA 4UDNA 1E2QA 2H8GA 5LA6B 2OD2A 4C4OA 5LZ5A 4ZKEA 4K6CA 3EBOA 4MMXB 4EB6B 1Q14A 1E89A 4ZHQA 1N9ZA 1Z17A 1LK0A 1RAGA 2B0JA 4XIIA 4M83A 4R2HA 1PYGA 3OOWA 2P68A 1UWKA 5EJ6A 2H63A 3L1JA 1PQYA 2Y66A 4TXLA 3A1VA 2A9JA 1PG2A 3ABRB 1RWMA 5K0LA 1OXXK 3EVEA 4J03A 4DA7A 2I2BA 2PHZA 5SYAA 1QRTA 4XLZA 2ZI6A 4DLXA 3NUGA 4TROA 3A4YA 1XRNA 4Y7CA 1PR5A 3SSOA 4M9ZA 1S2DA 4YAUA 3NGMA 3I01A 4TTPA 5B64A 4J3NA 1H93A 4MWOA 4OHPA 2JLXA 4C4TA 1DAPA 2IUUA 3FJ1A 2QU7A 5EZ5A 1CRWG 4IJVA 5CA1F 3AJAA 2GM4A 1Z7YA 3F4LA 1UZNA 4ITVA 4QNNA 3IKJA 3SYTA 3VO8A 2WB2A 4QVKA 5K9ZA 4NNPA 1YGYA 4W5WA 2C54A 2MINB 2PX5A 2P11A 2RDMA 2XGGA 3HLYA 3KB1A 1MJ5A 4IVNA 4N54A 4YMSA 2WD9A 3B6JA 3ND9A 3H1TA 1YR7A 5ITVA 3ZDAA 1FVXA 4UBKA 3EG5A 4UPDA 4G56A 4OUDA 3NIFB 1QHNA 3JVIA 3RS8A 2HHHB 2XYVA 1W30A 5CVTA 4UULA 3Q9NA 3X1WA 1TE2A 4QFMA 1N8TA 4YXWD 4LRSB 3IXLA 2FXVA 3OPXA 3OEHD 2Q3LA 2ZEJA 4FKMA 4HDAA 1RWQA 1VCOA 2K7ZA 2W5UA 2ZS8A 1KSJA 4RH1A 3VDRA 3L07A 2H4WA 2GTHA 2LNDA 3PHJA 4HQOA 3UW1A 1TEZA 2I3AA 3T7RA 4ZEWA 1P1CA 1M1ZA 2V8BA 3VM6A 3W4KA 1EMDA 3BORA 3TTYA 4JH0A 1Q84A 2XMQA 4J07A 4MLCA 4MR8B 2D13A 5BXQC 4KHZA 4Z9BA 8GPBA 1SXPA 3ZQ6A 4BCCA 5DBHX 1HDOA 2B1JA 4NEGA 4YACA 1A9RA 1VI2A 3A1SA 4MW5A 4U9HS 2I6FA 3C5VA 3RHFA 2XWSA 2HMUA 3N28A 3OFVA 1MG5A 4FT2A 2OV1A 1XZLA 4S1VA 3C43A 5J2UB 3TRFA 4W63A 3O2JA 1KO7A 1KSFX 3HJUA 4M7PA 1NAHA 4MUMA 4PZZA 2CXQA 1TO1E 1KZ7B 5GINE 3OF2A 2B4TO 3PCRB 2WJHA 2XWPA 3A6EA 2GN2A 4PHHA 5BSMA 3RSOA 1IU9A 1K86A 1NVXQ 1VFPA 3HWRA 3V1TC 1I4OA 2WUWE 2NN3C 4GMFA 4CEJB 1E3EA 1GV1A 1V7PC 2IEBA 2JFQA 1JAHA 1HI9A 3D2CA 2Q4RA 1E2JA 1EVZA 2R66A 2GOYA 2Q3MA 3GBVA 4MITA 1IIRA 1OY1A 5AW4A 5K6RA 2VBCA 3ZGYA 2QYSA 4G8BA 4U5XA 3BCHA 4CGZA 4JJZA 1TKRA 2P9BA 3FNBA 1IM2A 5ILOA 4QREA 4MUBA 1GRVA 2ODPA 4HWOA 1M2FA 4A8JB 1QZZA 3CVVA 4QECA 4B3RB 2NTYC 4OAQA 3CW8X 2PT5A 4JJ6A 4PC3A 1BO6A 1U6KA 2CZCA 2Q29A 3BJZA 4H6WA 3WA6A 5LLDA 4OY3A 3I32A 3MERA 3NFRA 4Z4EA 3C5CA 3HKEA 4G0XA 2ZWMA 3CHYA 3GIDA 2YS6A 3DDSA 4O4IB 1QVRA 4D7AA 3B70A 5JYDA 4RTNA 1HLPA 2ERCA 4KMOA 4YXWA 3T52A 1G2QA 2B21A 3OEHA 4NF2A 3ZWVA 2I67A 3PXXA 5JJIA 1ZVVA 1JTFA 2DT8A 2WM3A 3CUTA 4YRNA 2BDEA 4JD5A 3LGXA 4OI1A 1PE0A 2I9PA 3BIXA 4NIMA 4PPNA 4QOFA 3LLVA 1JZTA 4WAUA 3ZE1B 2FWAA 3EH1A 4HX5A 4MYRA 4Q1BA 5IX8A 1KEUA 3V6MA 5B4VA 2QTHA 5CA0B 1XDWA 5IM4A 3OZAA 2RAPA 4NCJA 1U7UA 1GCUA 5AM3A 4DVGA 4EKDA 4IDCA 3GLKA 1BEUB 2VZLA 5B1HA 3TMAA 1Q12A 4A5OA 4PW0A 4RTSA 2C0PA 2NAPA 2R8OA 1I6WA 4Q3KA 1Y4UA 1H1DA 4ODIA 1PD0A 3EGCA 4MRPA 1V0JA 3WQBA 1SZPA 3DWEX 3CRMA 2HO5A 1YS4A 1SXJB 2IWRA 1H8HD 2HN9A 1C3OB 3MMZA 2N3ZA 1OLUA 1WCIA 4IYJA 2BFAA 4TTJA 2OM6A 4CTOA 4ETIA 1Y1PA 1FDUA 4YGYA 1VBMA 3TKLA 3D5TA 4B5KA 3U44B 4H1TA 3CWCA 1QNLA 4Q00A 1GPDG 3K94A 1GQQA 4XGNA 3P1JA 4EDHA 2FQXA 1VL5A 3E3AA 3ZHXA 2XB9A 4BLSA 1HZZA 4INAA 3EQ2A 4KR6A 1BDBA 1T2UA 4G36A 1UZAA 4C7OB 1RTKA 2CDBA 4UU1A 2G1KA 2YZGA 1X7GA 1B8PA 1QO9A 1DJNA 1KP9A 1JA9A 1HM5A 1DI0A 1EUCA 5M3BA 1NVGA 1L4BA 2GHQA 3UMYA 1IWBB 3Q9UA 3AUUA 4TS1A 5CBPA 4DIOA 2YHBA 3WAGA 3X44A 1XQ6A 3V8BA 2GKSA 2VWPA 1RI1A 2XY4A 3Q6MA 3BXEA 2ZPAA 2I5PO 2ZDQA 3JQPA 4JP8A 2G70A 5CH8A 2ZUSA 4D0RA 2I9KA 1FDRA 2QLTA 2QMZA 1A9SA 3CFYA 4Q4JB 3GYGA 3SHVA 2VHXA 2Q2QA 5D3ZA 1D0VA 3EXEB 2KI5A 4XX0A 3OWOA 3U13A 1GGVA 4PV7A 3RVOA 3KZKA 4BLTA 4F7DA 2RKWA 5GQSA 4ZYZA 4Y6GB 3GNTA 2AK3A 4J7XA 4L0CA 3T9EA 1RJEA 1OAKA 1DXQA 1DBQA 4MX8A 2ADMA 4X1IB 3E1SA 1REQB 3FHLA 3OJFA 5IHXA 1ZOIA 5C3UA 5E6SA 2G9UA 1XLWA 3CTMA 4ETMA 1F2UB 3QOFA 5AKKA 5DMXA 3ZW8A 4BUZA 1P2UA 2ZTSA 1ZITA 2ATXA 3TEMA 2BFCB 4BLVA 4D9MA 4DMGA 3WGLA 2GQ0A 3HCOA 4AURA 4C05A 2CXPA 1BDMA 4NYMQ 1EB8A 4FNMA 5EWLB 4ZVRA 3SBDA 1P6QA 1RBQA 2WWGA 1CY1A 2WZBA 4KGZA 1IK6A 2ZBEA 4DJDC 1H8HA 2A9OA 3CLUC 5H5JA 5HF6A 4RK5A 1Z6YA 3BL8A 2JF0A 4B35A 3GNSA 4ZZ0A 1X7XA 3SCZA 2C3UA 1C7QA 5C1BA 4B33A 3OF3A 3OCJA 1NQWA 1N1GA 2Z08A 3C0KA 1Y8QA 3G2QA 3EZYA 3K0AB 3KIPA 1RP1A 1W96A 3LM8A 4G1FA 4KFUA 5EJAA 1OYWA 2WHPA 2PGOA 4EAQA 2RMKA 3VV2A 2ZUEA 4OHVA 2WU0A 5EQJB 3VTFA 4TXNA 1X8XA 4IJWA 2G9QA 4ZC1A 1G5QA 4GBED 3BBPA 1TKAA 3STTA 2KSQA 3CNBA 3W4JA 4ZK2A 3C39A 4CKBA 2NZYA 3OZ7A 1TCUA 5C34B 3BX1A 2QTVA 4CR7A 2I1QA 3T7KA 4FEEA 2E87A 3G0DA 4MS4B 2FUG1 3TNDA 2CHUA 1JGTA 1E6UA 3LBHA 1RRMA 3PUKA 4WJZA 3V1NA 4DUPA 3S40A 3C3AA 3AM1A 3A1UA 1QYVA 4M0KA 5E9WA 4L78A 4ZGGA 5HKAA 2BMDA 2GEKA 4RTMA 2ZITA 5JPIA 4P08A 2J3HA 4LSGA 1JQ5A 3GEEA 3A37A 3WB1A 3FNRA 3ZE6A 5A0FA 3OZGA 4F9TA 4MGYR 5KNBH 1ST2A 4YJ3A 3V55A 4C88A 4CIYA 2KLBA 2C9OA 2XWQA 4R1PA 2WQ6A 1ZNQO 3GWGA 4IIGA 4M1YA 1I7SB 2GFHA 1J2EA 4R1SA 3EC2A 3KJQA 1IJBA 1LLDA 3AFNA 4P4NA 5AQEA 1UDCA 3WRYA 4YMVA 5BN5B 3EEOA 1CE8B 3GRFA 2Y99A 3K9WA 4WKBA 4Y2YA 3NOVA 3VO1A 2V65A 3DE7X 1G41A 1KI6A 2C98A 2XEXA 3MUOA 4FGUA 1HQCA 3UAVA 1AUXA 1K2VN 4NBKA 5EHNA 3AVYA 3KKMA 5B36A 2WPNA 1WUHS 2D5CA 2J87A 1G21E 2YFHA 5JNRA 3A1NA 4FWIB 1W94A 3DBRA 2QRGA 1ZBDA 3N6RA 4FK8A 2AOTB 4C3VA 4D42A 2Z9DA 1DKNA 1ESEA 2GEBA 1KL7A 2VJAA 2B35A 3MF4A 1Z4MA 3JQ7B 4UVEA 5F4BA 3TNYA 5L6MB 1ULUA 1Z62A 2CHQA 3N87A 5JZMA 1LZLA 4P35A 3ZJTA 3TPCA 4DLUA 1NNUA 2Z58A 3N7AA 5BQPA 4FDAA 4TLBA 3G5AA 3PXGA 3N3BC 3TNJA 1GGEA 4A2QA 2ZSIA 4DUGD 1QIMA 2FRDA 3RM3A 3DYBA 3GU3A 3NFYA 3QJ5A 1Y4AE 1UZMA 1K3UB 1QANA 2Q6IA 2PBLA 5CNKA 1ECFA 2NU8B 4HYYA 3KWLA 3ER6A 3I4LA 3H1GA 1FVOA 2P1DA 1ACLA 4DWWA 4ESOA 3CG4A 3NDRA 5IXYA 3W0LB 4J0EA 5AK5A 1UBSB 4RIEA 4Q39A 2QTWB 3WADA 4DAOA 5IP5A 4PN7A 4J0HA 1LBIA 1Q5PA 2PSSA 3DBHA 4RIFA 4CTMA 6REQB 5I7OA 1AGRA 1YSCA 4WINA 3UOWA 1FTQA 2IEIA 4HNHA 5JDIC 4XYBA 2IYVA 2G7MC 4GVLA 5E0OA 4HYTA 4ZDIA 1AS2A 1GADO 1KFEB 1P7PA 3KM0A 1DZIA 1KAOA 1OCEA 2AK2A 3AKYA 4KU4A 4NCAA 2PQ2A 3JY6A 5IMBA 4M98A 3ZK9A 4MW7A 5ALLA 4E70A 3Q2OA 4DCNA 2VDMB 3OM0A 5CCBA 1K0FA 4LN1A 4AN4A 3DZIA 4JXXA 1PFYA 3FE2A 3UICA 1VE9A 4HO1X 2QENA 5IKXA 4GYJA 3CH4B 1DC4A 5A9SB 2V6BA 4PRLA 1U4NA 4KJXA 4BTEA 2OC4A 2JGFA 4YMLA 1M72A 3MJRA 5CHEA 3TECE 1PEYA 3K9CA 4M0MA 4E14A 2IHTA 1C4OA 3NUQA 4Y2RA 3FLBA 3KC2A 1WU8A 2LPMA 1U2DC 2ZE7A 2FWBA 3BXFA 2OFOA 3LP8A 4PFKA 4CCWA 2EWWA 4TWJA 2X2EA 3KCQA 3I8XA 2FRXA 1J0XO 1YRQA 5JYEA 1AQ6A 2P9JA 3I9JA 3R3ZA 4R9NA 3GVPA 2J0UB 1EGVB 4DY4A 4MGHA 3B1YA 1G17A 1I2ZA 2F3UA 3U6KA 4JP1A 4GNRA 1N75A 5IYZA 2CJXA 1L5ZA 1RCFA 1K5GA 3EWIA 3PRHA 2FWJA 4R8SA 3T3GA 3WWDA 4JSYA 3B13B 2DR3A 5AOBA 4LSMA 2A78A 2WG1A 3QX7A 4I81A 2C8J