5CRIA

Wild-type bacillus subtilis lipase a with 0% [bmim][cl]
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 64
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5criA00
2XQGA 3WIBA 4CCYA 1VZ3A 4KAFA 5SYNA 4MYDA 4UBKA 2HIHA 5I8PA 1XZLA 2IITA 3AIMA 1HKHA 3VDXA 5AKGA 5J3JA 3WJ1A 1KEZA 1R9NA 5AP9A 1W4LA 3QPAA 4AZ3A 3IURA 3BJMA 5CXXA 2JEYA 2VSQA 2ACEA 7YASA 1CRLA 4TPKA 5LKAA 4B7ZA 5ALMA 4QDTA 3BIXA 5FDFA 1GZ7A 5CT9A 3I6MA 3G0IA 4Y9SA 3W05A 4Y7DA 5CT6A 4OB7A 2OAEA 4ZWNA 1VZ2A 5JADA 2JBWA 4BCCA 2XUHA 2WIFA 5LZ4A 4UHCA 5HK8A 2IIVA 5LKRA 4BTVA 2WHRA 3EBLA 3FCXA 1QTRA 2XUQA 1ORWA 3HRHA 2XUDA 5IVDA 3NUZA 4B84A 4W1QA 4G9GA 5AIAA 1ISPA 2RONA 4ROTA 2XUJA 1H2XA 1YA8A 5ISMA 2XQIA 2C7BA 3T52A 2Q0XA 1LPMA 2PKYX 5HZGA 2FJ0A 5HK9A 2XUPA 4RGYA 1PV1A 5AI9A 2YYSA 2BUBA 3W9UA 1BU8A 1J1IA 1A7UA 1AC5A 4H7DA 4ITVA 1UWCA 5AOCA 2XQKA 1ZI6A 1LLFA 1F0NA 2HU7A 1G66A 3GFFA 4MWTA 3A6ZA 5AK3A 4DLNA 3FSGD 4UHFA 1G4HA 4M0FA 4IQ4A 3CCBA 2O2GA 1J2EA 4QLOA 3O9VA 1W1IA 1XRQA 2OLEA 5CH8A 5AI4A 2WIGA 4YASA 2XE4A 4F21A 4X92A 1XKTA 2GYUA 1LBSA 2PBLA 4X6XA 5ALVA 5IVHA 4GLBA 5JAOA 2WTNA 2ZJ7A 3VVMA 3G9UA 2DHCA 3WLAA 4IH1A 3K6KA 4MYSA 1IUNA 5AI6A 1CV2A 5T4FA 4MWSA 4DNQA 2Z3WA 3RM3A 3DS8A 1UFOA 1EB8A 2GBFA 2GYWA 4PSCA 3C70A 3C5VA 3R0VA 2BKLA 3DQZA 2W6CX 2OGSA 3HJUA 4KE6A 1F6WA 5A62A 2H7YA 2DHEA 3H04A 2PSDA 3H1AA 4PSUA 1IMJA 4B0PA 3EIOA 1PFQA 4KE7A 1TCCA 3MUOA 5EIAA 2CB9A 4NZZA 1XQYA 4Q05A 1N5MA 3WMRA 5CT8A 3H2JA 2V9ZA 3W2TA 2WU3A 3K9BA 1ZD5A 2RI6A 1Y7IA 5ALFA 4BE4A 4MQMA 1E8MA 5EHNA 4JNCA 3A2LA 2XMCA 4QDZA 4TGLA 3AIOA 4B9EA 1WB4A 2B9VA 3NWOA 4BRSA 4RE6A 1R9MA 1JU3A 2XDWA 3FLEA 1U4NA 2AJCA 2RHTA 4BVKA 1M33A 3IBTA 3DOHA 5KBYA 1NU8A 3HACA 1IUOA 1LPOA 5HQ3B 1L7AA 3QMMA 1CUSA 5K3DA 3G0BA 4K6HA 1CUAA 1QO7A 4OD0A 1U8EA 2WFMA 1BEEA 1JT2A 3G9ZA 3R40A 3M81A 3A2NA 4FFVA 1DINA 1ZD4A 4X91A 3A2MA 2OQIA 1MAHA 1EHYA 1A88A 5AK4A 2QOEA 2XMSA 2XLBA 1LNSA 4OU4A 4DMFA 4UPDA 2QKYA 3D4LA 3SX4A 2GBIA 4UBIA 2ES4A 3STWA 2OCKA 2X8BA 5C8XA 3D2CA 5FXMA 5CH5A 1LPBB 1XFDA 2XI4A 4HXFB 5T4HA 1ODCA 5ALIA 1VJ5A 3O4IA 2ONCA 1FJ2A 3DOIA 5DNVA 2BUCA 3OOSA 1U65A 2XB6A 1DQYA 2ZSHA 1MJ5A 3H1BA 5HF8A 1CUFA 5DYYA 1CUIA 1GPNA 5KWIA 2ROQA 3WI7A 1E3QA 4KE8A 1QJ4A 2HA5A 4FBLA 3DL4A 1KU0A 4Q3OA 4UUQA 3WWEA 4UFOA 3WYNA 1QLWA 5JD5A 2QR5A 3PUHA 1C7IA 3D3NA 2GZRA 2WUGA 4BAZA 2AJBA 2WQZA 1ZI9A 4HXEB 5CT5A 3VVLA 2FX5A 4DMHA 1QZ3A 4H7EA 1FSSA 4C87A 3O9MA 1AX9A 4W1SA 4DNPA 1CLEA 3LLCA 1CUYA 4O08A 4B0OA 4A16A 3ZLTA 3O95A 2PU5A 4JYPA 2CJPA 2HDWA 2WHPB 5ALOA 3AIKA 3G0DA 1TCBA 2RHWA 4KAJA 4WJLA 4QE3A 2ZYRA 2WG1A 1EI9A 3DD5A 4H18A 2ZJ6A 4X94A 2XMZA 2BGNA 2WJ6A 1SCIA 2DQZA 5JD6A 4RPCA 5IKXA 2VAVA 4BATA 3DCNA 3RARA 2QT9A 3V1NA 3SC2A 4J0IA 1AZWA 1R4ZA 2VT7A 1QIFA 4JYMA 1GQSA 2D0DA 3HYSA 4FLMA 4HXGA 4EB0A 3UUEA 2VAXA 2VJBA 2HA3A 5ALLA 1XLVA 1DTEA 3WA7A 3G0GA 4HS9A 3Q0TA 5DYWA 3STUA 1CUJA 2V98A 5AI5A 3IVMA 2HA6A 5ALEA 4NVRA 1WOMA 4GEGA 5ALSA 2XMQA 1VOTA 4ZGBA 3KDAA 2GBCA 2JGEA 2VA9A 5AKJA 2QS9A 4FTWA 5AKEA 1ODSA 2QZPA 2G63A 4G8DA 1FFBA 3FYUC 2J3QA 4Q3KA 2OPHA 4UHDA 3C5WP 1MO2A 5K5EA 1EXWA 3LIIA 4NS4A 2WJ3A 4OYYA 4C4XA 3V1MA 1MPXA 5AM0A 3F67A 5CT4A 3ZV7A 4J0KA 4QDOA 1WPRA 4DNOA 2I3DA 4DMKA 2WU4A 4ZXFA 3PF8A 4ZREA 1SCKA 4L0CA 4H7FA 4Z49A 2H1IA 1CPYA 2OCIA 3F9CA 2WHQA 5EHZA 5CXUA 3B12A 4NMWA 1VXRA 3IB3A 3W04A 1AUOA 2HU5A 4Y2VA 2H7XA 1XRPA 1DQZA 2XUIA 1R50A 3OC0A 4BC0A 3G02A 1YA4A 4BB0A 4CG3A 5AHXA 3JW8A 4GECA 1MX1A 3WK8A 5JARA 3VJLA 1CQWA 1HQDA 1WCYA 3FOBA 4XIIA 1BN6A 5AOAA 4ZV7A 1QONA 2HU8A 4W1PA 4ZI5A 1VLQA 3QH4A 1E5TA 3F98A 3E0XA 1MAAA 1UKBA 4HRXA 2O2HA 2VJAA 3R3WA 3PUIA 3HEAA 3LS2A 2VTVA 1CUZA 3ANTA 3C8HA 1ZOIA 3DL7A 1TAHA 2OGZA 1AMNA 5AOBA 5C7YA 1XZFA 1DT3A 4EHBA 3IUJA 1XKLA 1WHTA 1H23A 1ZIYA 1L7RA 4H7JA 4Y2PA 2I03A 3Q8WA 3L1JA 2RIPA 4F5ZA 4N8SA 5C81A 5HF9A 4QWWA 3B3QA 3WWOA 5EHQA 2JGFA 1X2BA 3QPDA 5H3HA 2WIDA 2XQFA 4KRXA 2XUKA 3I2FA 1IUPA 2P8SA 1JJIA 2QXTA 2VJDA 4DTCA 1CUUA 4C4YA 4FDMA 4BDTA 5JASA 4C01A 1F0PA 1LPPA 3BDVA 4XJVA 5JZSA 2QUAA 5IVKA 2WFZA 4EBBA 1XZJA 4P92A 4FLFA 4LKOA 3E3AA 2JGMA 1HL7A 1E89A 3DLTA 4HVTA 1CQZA 4PV7A 4AO6A 3KXPA 4U2CA 1QIMA 2EDAA 3HLKA 2WIKA 3S2ZA 4FWBA 3E4DA 2XUOA 5ALTA 2QVBA 4DGQA 1VE7A 5EHXA 1A8QA 5DNWA 5DJ5A 4Y2XA 1EDDA 1OXMA 2PSFA 3BL8A 4Y2SA 1ZJ5A 1WB6A 4J0CA 3WIOA 5AI8A 2AXEA 3WQHA 3O4GA 5ALPA 5IVIA 2XLCA 1MN6A 2WTMA 5ALKA 1DX4A 4HAIA 2XUGA 4LXIA 5ALJA 3IA2A 2CBGA 1YS2X 3PDCA 4P08A 1UKCA 1SC9A 2CKMA 3TGLA 4BBZA 5FV4A 2GBGA 4EA6A 3V48A 2R8BA 1BRTA 2G5TA 4K6GA 2CEKA 1JMYA 1H2YA 4LYEA 1B6GA 1IVYA 3FLAA 1CUEA 2JGKA 4N8EA 1BROA 1UK9A 1Q0RA 4AN1A 1WB5A 2ORYA 1AQLA 1NU6A 1JI3A 1P0QA 1TKRA 3I1YA 4JH0A 5HQ3A 1QO9A 5FRDA 4DMCA 2OQVA 4Y2RA 3IUNA 3L1HA 3WWPA 5C8ZA 3ICWA 1YB7A 1EDEA 4B6GA 1QFMA 2WSLA 3LIPA 4X00A 5D6OA 4C88A 1YS1X 3AILA 2V97A 3WL5A 3C87A 1FFEA 3QPCA 1KU6A 3A70A 3CCCA 2DHDA 4ZRDA 5ALWA 4EUSA 3GZJA 2G5PA 3RKSA 2VJCA 1RP1A 4D9JA 1LBTA 3DYVA 4F0JA 1C7JA 3I6YA 4G8BA 1DX6A 1XZCA 2HRRA 2ZYHA 4AN0A 4EY6A 3CXUA 4BE9A 1BCSA 2VEOA 3MUNA 2JGLA 2PSHA 5KWJA 4E15A 1E8NA 1Q83A 2WLSA 1A8UA 4FKBA 4UHBA 4JUIA 3UMJA 5ALDA 4E11A 3AZQA 1I6WA 4AO8A 5K3FB 1P0MA 1L7QA 4UFPA 5JAPA 4QA9A 3BF7A 3QMVA 1XRLA 1YAHA 1UOQA 5AICA 2HFJA 1CUXA 2QRUA 2C5FA 2K2QB 1JU4A 1Z68A 1XZIA 5HFAA 3H2GA 1LPAB 2H9YA 1DWPA 5FPQA 4OYLA 4H7KA 2ZYSA 4TVKA 3HI4A 1UK8A 2J4FA 5AJHA 4W63A 1N5RA 4IHAA 3C43A 4KACA 4UBLA 3H17A 4AZ0A 1G42A 4I4CA 4J0JA 4YK7A 1EK2A 3KWJA 3OM8A 5HKAA 1UK7A 4B81A 4YPVA 5FKJA 3DKKA 1VKHA 3B5EA 2PM8A 4UHHA 3M3DA 2WHPA 3C6ZA 4L3WA 1S8OA 3EQ9A 4UHEA 4OUKX 2QMQA 5ALNA 3WJ2A 3R3ZA 1ZJ4A 2OG1A 5SYMA 2WFLB 4DM7A 2H7CA 4LIPD 3OTQA 2JGJA 1CIJA 2QXUA 1XZAA 2Y2VA 3VJKA 5IH7A 1YSCA 3WK9A 5FLKA 4M0MA 1YCDA 4AX4A 3G8YA 4L9AA 5LZ2A 3D0KA 4Q82A 3U1TA 3I2HA 1TQHA 1CEXA 2VT6A 3U0VA 5DWDA 4W9RA 4H77A 4Q3LA 4B85A 4XWGA 1LPSA 5A6VA 3IULA 3D5EA 2VATA 1GXSA 1CFJA 1HDEA 5AIBA 2JGIA 5E4JA 1ACJA 1VA4A 3WZLA 1BE0A 1P0PA 4QWMA 2QM0A 4UBMA 4BP9A 3EQ7A 4A23A 2BUAA 1XQWA 4RE5A 5D3ZA 2HA2A 4C4ZA 2GZSA 4Y2YA 4A5SA 4EY4A 1QIEA 4AB1A 1EA5A 3BDIA 4AQDA 5CBKA 2Y6VA 2PU7A 3UUFA 3FVRA 4C89A 4Y2QA 5A71A 2DCMA 2O7RA 2DSNA 1T2NA 3BIWA 1WPXA 2HHAA 3AUKA 1E8DA 2BGRA 4OU5A 2ACKA 3QZUA 5CRIA 2EDCA 4GDMA 3WWCA 4E46A 3ZPXA 1RWQA 5EIEA 3I2GA 2OCGA 3JWEA 2QJRA 4FFWA 4U2GA 3DYIA 4C6HA 5ALGA 4Y2JA 4DSZA 4AXBA 2DR0A 3G9XA 5YASA 1XRRA 1UK6A 5CTAA 3D2BA 4J0GA 1K8QA 4QDXA 3QYJA 5HF6A 2VQ6A 5EGNA 3AFIA 1LGYA 4QDUA 4IH9A 3TRDA 1BEZA 2C0QA 4AMZA 5AM1A 3N0TA 3AJAA 2JIDA 2C5GA 1EK1A 4QNNA 1ZI8A 1NX9A 1Y7HA 4DIUA 2R11A 4INZA 4KE9A 4PSDA 1LZKA 4WFIA 1BN7A 3I6ZA 3QMWA 1YR2A 2PSEA 1JMKC 6YASA 1ZGCA 4QEKA 4J03A 5A2GA 1QFSA 4Y2TA 1ACLA 5K3BA 4N8DA 1UOOA 1O6FA 2WILA 4PQEA 3OG9A 3GA7A 1JJFA 3VXKA 5A7FA 3GUUA 3HZOA 1SCQA 1QE3A 2AJ8A 4BZWA 1GPLA 5A7HA 4BCDA 3GROA 1UKAA 2WG0A 5AM2A 3K2IA 1SFRA 1MNQA 4Q1VA 2XT0A 1USWA 1QTIA 1MX5A 3STVA 4CFSA 3H2KA 2O2IA 1EVEA 1PJAA 1Y37A 2GYVA 5JALA 1EB9A 4GHWA 5ALYA 3V9AA 1HLGA 3D2AA 1AURA 5AKHA 5DYTA 4L72A 2C0PA 1HBJA 5A7GA 1ZIXA 3C8DA 4G4IA 1CUHA 4IH4A 4CI9A 4FHZA 1CUWA 4BCBA 5FP0A 1JKMA 5HKBA 2YH2A 3ESAA 4LXHA 3ESDA 3C6BA 4M0EA 2PUHA 4DNFA 3I1IA 3ANSA 3FYTA 3FYUB 3WL6A 4ZV9A 1XROA 1XQXA 5ESRA 3ED1A 5LZ8A 5AKIA 1QOZA 4GW3A 2WUDA 4F60A 4H0CA 5AKLA 4BAGA 4FMPA 1MT3A 2ZSIA 4MEAA 2FJPA 2I3ZA 3DKRA 5CH3A 1BCRA 3YASA 3WL8A 2B61A 3F96A 1DT5A 3W06A 2Z8ZA 3PE6A 1D07A 3I2JA 3ILSA 2W22A 5ALHA 5E2IA 3VKFA 3SWWA 4Q34A 3T4UA 4PF1A 1AKNA 1QGED 3ZLUA 2XMGA 3DEAA 2PVSA 5JZBA 3X3HA 1CUDA 1HPLA 2WUEA 3DNMA 1YB6A 4WDRA 4HRYA 5AI0A 2WJ4A 3H0CA 1H22A 1WM1A 4X3CA 4IO0A 4S0XA 1TCAA 3WKDA 3G9TA 5F4ZA 5K3CA 4UBOA 1YAJA 5ALRA 2BFNA 3FSGA 3ZI7A 1T4MA 4QLAA 4MJ3A 4AMYA 1QIKA 4EZIA 1UZAA 5BOVA 2JEZA 1ORVA 1ZD2P 1ZD3A 1VA5A 4WFJA 1E66A 2HRQA 4CCYB 3GBSA 4K5QA 3PF9A 1EH5A 4FBMA 4DYHA 5DNUA 3E1GA 3M82A 2QJWA 2C4HA 1XZGA 2WKWA 4LYDA 2OGTA 1X70A 1ETHA 4DSAA 4ARBA 1CUGA 4G8CA 3O4JA 4CG2A 3V1KA 1TRHA 5AM4A 5LZ5A 3STYA 4J3JA 5K3AA 1LZLA 2JF0A 3R3XA 4BDSA 1FFDA 2CZQA 4AO7A 3O0DA 3BJRA 2QUBA 2HL6A 1EVQA 5ALQA 5AO9A 3GELA 5BV7A 4BVLA 4OSEA 2HADA 3C6XA 4WY5A 2DQYA 4FOLA 3W9BA 5K3FA 2Y6UA 1W75A 2PSJA 2WIJA 2D5LA 3WYDA 2HA7A 3BWXA 4BRZA 1THGA 2OCLA 1Q0ZA 4BVJA 4LHEA 1SOMA 3NGMA 4UBJA 3R3VA 2B4KA 3WKAA 4EY8A 5K3EA 1P0IA 1UT6A 1CUCA 2CUTA 3KSRA 3D59A 1IZ8A 5I7UA 1TIBA 2Y2UA 1VXOA 1X2EA 4BP8A 2HFKA 1G5FA 1EX9A 2EEPA 1B41A 5FPPA 1J07A 2Z3ZA 2HM7A 1OCEA 4JEIA 1ZICA 4LXGA 4XVCA 1DWQA 2CMFA 3KOOA 3JYHA 3WZMA 1MTZA 4X97A 2DFPA 4PW0A 1WHSA 2V96A 2Z8XA 1R1DA 4KEAA 5EFZA 2WG2A 5AKZA 5BWCA 2IX9A 1VE6A 4OCZA 5CURA 3D7RA 3I2KA 1QIGA 3HSSA 3KWFA 3R3UA 2I78A 3BF8A 5FUMA 5AM5A 5AKXA 2NW6A 3FLBA 4MXDA 3H2HA 3H2IA 2WFLA 2OXEA 5KREA 4U2BA 3WK7A 3QM1A 2Y1KA 5LZ7A 2BJHA 2B20A 2YASA 3I2IA 4BTLA 2ECFA 4ETWA 3ZWQA 1OILA 4CIBA 4U2FA 5FOQA 3RK4A 5JAUA 4G4JA 3PI6A 4BYMA 4OB6A 3SK0A 3WWDA 4G1FA 4X71A 1GT6A 5CMLA 3G0CA 4B82A 3N2ZB 3H18A 1R88A 4X95A 4GBGA 4WDQA 1W52X 2XMBA 4X90A 3QVMA 5C8VA 1TK3A 1FFAA 4KYVA 1Q84A 3R3YA 3WKEA 5D7BA 3VISA 5HF5A 5AKKA 3G7NA 4U2EA 4H35A 1THTA 3C45A 2G4LA 4X6YA 5LIPA 5AH0A 5CW2A 5E4YA 4PO3X 4P9NA 4UFNA 4BZZA 3STTA 4KR0A 2ZYIA 3EQ8A 5LZ9A 4GXNA 3I28A 3KD2A 3PFCA 2PL5A 5HFNA 3WKCA 4BAUA 3AZPA 4EY5A 1XLWA 4MQLA 3P2MA 4K2AA 3AINA 2XQJA 1GKKA 1QIIA 1J06A 4GWLA 2XMDA 3FNBA 1QIJA 4N5HX 5DLPA 5JYCA 4EY7A 3F8SA 4K6KA 1K4YA 3ZLVA 4WCVA 4CCWA 4MEBA 3LP5A 1K5PA 4HTAA 4PNZA 5AK6A 1CR6A 1W6RA 3STXA 3R41A 2J3DA 3TJMA 4P93A 4B83A 1ZGBA 1U2EA 3TEJA 1AGYA 1XZHA 4J0DA 3OURA 2BCEA 1EDBA 4HZGA 1EINA 1GPKA 4J0HA 3HXKA 3WA6A 1MNAA 1XQVA 5AK5A 3WK5A 5JAHA 2PPLA 1CVLA 4OPMA 3C6YA 4KRYA 3WKBA 5JANA 5EIHA 5AKYA 1XZEA 5T4EA 2AJLI 5DTIA 1LPNA 3RLIA 1N1MA 4CIAA 4G5XA 1QIDA 4GI1A 3PICA 4G4GA 3ICVA 1UOPA 2YXPX 4KJXA 3BXPA 3NOXA 3CN7A 4B9AA 5LLSA 3WK6A 3VJMA 2PUJA 2HA0A 2HA4A 5HCUA 3V1LA 4H7HA 1XZDA 4OB8A 5JATA 1FFCA 2WUFA 1MU0A 2ZJFA 2Z5GA 2C58A 5I9IA 4WY8A 2FUKA 1O6GA 1XZKA 2QTBA 3F97A 2LIPA 4QZVA 1K63A 2AJDA 3MGAA 1XZBA 5D3KA 1JFRA 4X93A 4ARAA 1F8UA 2OAGA 4UBNA 5DTJA 4H7IA 5E4TA 2PX6A 2RAUA 4I19A 3FCYA 4CG1A 3OPMA 3WL7A 1ODTC 1H2ZA 1YASA 1N8SA 1H2WA 3HABA 3M83A 2O7VA 3DJYA 1BS9A 2X76A 1MX9A 4I3FA 3BE8A 3FYUA 1IZ7A 5EI5A 1CUBA 4FNMA 3ESCA 4FNGA 2XMRA 3O4HA 1GKLA 5BWBA 3HC7A 4X85A 5AM3A 4WFKA 2XUFA 1DWOA 3FBWA 5ALXA 3EF3A 1XZMA 1C4XA 1A8SA 4XX1A 2WM2A 4BC1A 3ESBA 3IUQA 2J4CA 1XRMA 1JJBA 2X5XA 3DDUA 2RGUA 4FLEA 4J7AA 4B80A 1GGVA 3QBJA 1RYYA 3FVTA 4YX9A 3CN9A 3IDAA 3QITA 5ALUA 1UXOA 3FAKA 4KAAA 1GQRA 5LYYA 4RNCA 3LCRA 3IIIA 5JIBA 1XRNA 3FWHA 3WK4A 2ZVDA 3PFBA 4U2DA 4N5IX 5LP1A 5JD4A 3AZOA 4V2IA 5JZ9A 1XLUA 3H19A 4Y2UA 2XUAA 2E3JA 1DU4A 1CUVA 2BAGA 3S8YA 1R3DA 1W76A 4X7BA 4E14A 4X6UA 2VF2A 3IUMA 1K6EA 4W1RA 2UZ0A 1QIHA 3L1IA 4G9EA 5T4BA 3MVEA 5ALZA
chains in the Genus database with same CATH superfamily
4MLPA 4RHTA 1U0FA 4ZT7A 4CCSA 4LXQA 5MHTA 2XQGA 1CT9A 3BOSA 3IV6A 3W2EA 5LFAA 3WIBA 1GFIA 1MDFA 1VZ3A 3V2IA 3JSAA 5SYNA 3DAOA 2ZITA 4UUNA 4D4LA 3JTMA 4MYDA 2FR0A 2HIHA 3C97A 4B71A 5D1NA 3TL2A 3LOUA 1OVGA 1VHDA 3D5TA 1KEKA 4JBIA 1EFKA 4ZN6A 1WNTA 1T26A 2VN8A 3P52A 3C3EA 2F8LA 2RG1A 1P5HA 3F1LA 3SKVA 1R4MB 3Q5DA 3VV2A 1KEZA 1Z4NA 2ONYA 5CLIA 2CXTA 2AVNA 3LXRA 3QPAA 4XQ0A 4DR4B 1EPUA 1AZLA 1XTSA 3LYHA 2X5KO 3MJTA 2D8AA 2G4CA 3CR7A 3BJMA 1UMKA 4XSVA 5CXXA 3OPXA 1G9TA 5KZMB 3U48A 4MKHA 1AK9A 1I2MA 1SBTA 1D7OA 2P4UA 1H85A 1VIAA 1CRLA 4Q4AB 1ZMXA 1M0TA 1SUDA 4IDEA 5LKAA 3PUYA 2P9EA 1SZCA 3O8QB 2D2VA 2NLOA 4G23A 1GPMA 5BSRA 3PQ7A 1FNSA 2KMLA 4UTRA 5ALMA 1W7AA 4QDTA 1XMSA 1U0OC 4BGIA 5JNTA 4LJKA 4S24A 3B53X 4IXNA 5CT9A 5LLDA 3KAJA 2O20A 1PQPA 3GZNB 4KDEA 3MWKA 4R1MA 4CEIB 1TZBA 3MCAA 3W05A 2W2LD 4DDHA 1FMFA 3AEQA 1CDOA 2QUJA 1CR4A 1P80A 1ZGHA 3QWHA 5DYIA 2VHCA 5BW5A 1T6BY 4DY4A 1L7XA 1NYQA 2JBWA 5JADA 4E1AA 3ITKA 3BTOA 2VDJA 3KQQA 2J0EA 1T6YA 1YZYA 1TVEA 3I6QA 1RYHA 1UM9B 3LO5A 4IOLA 1ZXLA 2O8NA 3BE4A 3SLGA 2CVOA 4HGZA 4XQEA 5J5CA 5LQAA 5LKRA 2WHRA 4F6RB 2JI8A 2BM1A 2DWCA 4WW0A 1GN9A 2W37A 3JQ6A 3EGXA 2WWRA 1ORWA 3PFKA 4ER6A 3IEVA 2BFAA 3GY0A 4LI3X 2XUDA 3ND6A 2BEVB 4ESOA 2ZU6A 2IYAA 3NUZA 4YR9A 5LSAA 1JHXA 4R6XA 2FSSA 2ZDQA 5DNEA 4DXAA 3KK0A 2ZRQA 2IDZA 3BMQA 2P2GA 3JSXA 3JWIA 2P91A 3KFXA 5BWLA 1XD2B 2YBEA 4G9GA 1OI3A 4WQMA 3JWHA 5AIAA 4BRWA 2XUJA 4D8VA 4KP7A 2FPPA 2QD1A 3N2NA 3T52A 3TZBA 4JCCA 2PBRA 3FXAA 3OHSX 5FD8A 3VC1A 1B42A 4AJ4A 1U9ZA 2IH4A 9LDTA 4RGYA 5JNUA 4BUZA 1E3WA 2FEXA 3GPIA 4J2HA 5AI9A 3FNRA 3W9UA 1GVHA 1UMDB 1DC4A 1PGNA 1CY0A 1HLFA 3D4IA 1UDXA 1XAJA 1XYYA 4EGAA 1KP9A 5C5IA 5GP1A 3KKMA 3AVWA 2XZOA 1H3EA 1GO2A 3ZNQA 1WKBA 4M89A 4JXKA 1SXHA 3RC3A 1RWVA 4H7DA 4ITVA 2XQKA 1T4GA 4OQMA 5DX0A 1W8DA 4I99A 4A27A 2HTEA 4REQA 9GPBA 2Z9DA 4KUHA 1F4LA 1UBLS 2BZ1A 3FSGD 4G5RA 1R2QA 4OQNA 4QIHA 3BB3A 3D3EA 4M0KA 3CCBA 2CUKA 2Y1OA 2VZ0A 5E8JA 3SHTA 2EZUA 3HCNA 2V7GA 1GA4A 3L8DA 3BRWA 1FX0B 1JYSA 3M1YA 4JKOA 4LJ4A 4B6FA 5LQKA 2PUBA 2C61A 2Y0EA 1OOEA 1Z5ZA 5TEWA 2J7KA 2UYGA 3GEEA 5INTA 3D1JA 1CY4A 3TLAA 4KREA 4Q4DA 3WGMA 2WIGA 2N0SA 4YP5A 5DM60 4O4IF 2OP0A 1N2HA 3LP6A 3RJ9A 1RJEA 2XE4A 1H9AA 2VO1A 4M7RA 4FKZA 1JWLA 1YR1A 2J45A 1R6UA 2AZMA 4EG7A 2A4KA 2GYUA 3SEFA 2HQ1A 1P1KA 2PBLA 3UG6A 4RA9B 3L82B 4X6XA 4O5AA 3RTEA 1QWSA 4QTXA 4BGUA 3GLGA 2I1LA 3MWDA 3T0GA 2VPPA 1WZ2A 4GKKB 3N2YA 2XYGA 4F5EA 1UPAA 3VSAA 4WN9A 2OBXA 1OT3A 2RFLA 4G84A 2ZWVA 1O5TA 2DHCA 1ZW1A 2X4IA 4MGYR 1P77A 4NZNA 5KOYA 1USUA 4ZZ0A 1M7BA 3R8XA 2JJYA 4PNHA 3WLAA 1MXHA 4IH1A 1RWKA 1MJHA 2O52A 1VL5A 3BIFA 1JHDA 1ZR2A 3EVNA 4EMTA 3M6MD 5AI6A 1JNYA 1QHYA 2GJ9A 4J0FA 1CV2A 5T4FA 2EP5A 2YWXA 4GRIA 4NFHA 1L5FA 2EJBA 2Z3WA 7MHTA 1ITZA 1V6SA 3RM3A 1DAMA 3GT0A 5HVNA 1UQTA 1KPGA 1UFOA 2ORWA 3NFRA 2AC7A 4V1CI 4NYIQ 1IEWA 1T9KA 3OZFA 3G2JA 2EX1A 3C5VA 1U2DA 3R0VA 3DQZA 3T7RA 3NHYA 4HQRA 1LSSA 4MS4B 2W6CX 3CPHA 2OGSA 1U5CA 1HOTA 1PR6A 1F6WA 1DO8A 4BFZA 1XXHE 1J7JA 2V9PA 4ODIA 3RHZA 1IMJA 3H99A 5E8RA 1NL3A 3JYNA 2RGWA 3KQSA 1RAAA 3PVSA 2X1MA 1PFQA 2E37A 4KE7A 1DDGA 4PAQA 2C84A 2EX4A 4R8KA 3TSWA 2FPGA 1PJLA 3MUOA 5F64A 2QRKA 5AVZA 2OT3B 2PCLA 3GZTB 4OFBA 5EIAA 1SUCA 4LBYA 3P9NA 3SFZA 5CDSA 4S1OA 2WTXA 1XQYA 4GZLA 1RPNA 4NZZA 4ACBA 5ITZA 3MJDA 2MINA 3Q0IA 5JVDA 1EZZA 1N5MA 3PNBA 4KV7A 3NTQA 4A1FA 1ZISA 4B3IA 5CT8A 3W2TA 1KETA 1N75A 3SZRA 4H17A 4CWAA 1IHYA 1IOZA 3DEHA 2PWBA 1ZD5A 5K01A 1Z4MA 1ES9A 3PC8A 2A8YA 3HXLA 1P1JA 3WOVA 4BB9A 3LTEA 3OE5A 2KM1A 2E1RA 4LJLA 3M6LA 5C5EA 4G0VA 1E8MA 1KR2A 2C2KA 4P32A 3TJRA 3O26A 3A2LA 1QVZA 2XMCA 3TW8B 2QJTA 5H68A 1C1DB 1OXSC 1Q12A 2YMPA 1WLYA 3A1VA 2BFOA 3A4NA 3CTMA 1WB4A 2MYPA 4LVCA 2V74B 3U31A 1O6CA 1E9EA 3HKCB 3TD9A 4DR7B 2EL9A 3E7WA 1DEKA 3QU2A 3UEOA 4HC4A 2J32A 2W2OA 5K3OA 2V3VA 4XQGA 1U99A 1C2TA 4J6FA 1FSGA 2XDWA 4NJEA 1ZH2A 2AG6A 3HWX1 2JLAA 4PN7A 1E1MA 3IBTA 5THQA 3OOWA 5KBYA 1NU8A 2YS7A 4ETMA 1LPOA 4FJ0A 1ZWLA 1Z2EA 1FTSA 1GA1A 4OK6A 4A91A 4JFRA 5HQ3B 3HJRA 2Z6UA 1XCOA 4E4TA 1TJ4A 4UVIA 3G0BA 4QX6A 1Z82A 1ZY2A 1Q0HA 3ONFA 5TX7A 2FETA 1Y4ZA 4PLGA 4L78A 3RFTA 1EUDB 3IBCA 4QASA 2P35A 1U4OA 2JH8A 1BA2A 1MFZA 1JBQA 5HJ5A 1GCOA 2AYZA 1TOAA 3TSOA 3R40A 3F3YA 3FGZA 1KOLA 5IMSA 4HWOA 4L73A 2FEKA 4NL4H 4BUCA 3L6EA 9ATCA 2FUNB 1NVXQ 3A2MA 4IJVA 1PDWA 2BRUA 1M67A 1J0DA 1MO4A 3AP3A 5KTOA 3DBOB 2Z43A 4B2IA 3FMPB 1EHIA 1A88A 4RK0A 4TTJA 1HLDA 5FUVA 2IOYA 3RTDA 3OM9A 1DUVG 3IDSA 1RWOA 5KJFA 5E3HA 1OXKB 2C5SA 2XD9A 4OU4A 4MB2A 3KZOA 4YPFA 1XU9A 2R68A 3D4LA 1QYVA 1Z12A 3AK4A 4L02A 4MAFA 1FQKA 1TJ5A 3LX6A 2FW1A 4TV8B 2J46A 3OLCX 1U7WA 1PWEA 4RSGA 5JRDS 2FMXA 2FSVC 4J1TA 5EMNA 1KJYA 3IOMA 1NUSA 1QR6A 1BU5A 3QXHA 4DG9A 3D2CA 3FTCA 3SAJA 4E03A 3JYLA 3TUZC 5CH5A 1XFDA 4NWIA 4U2KA 3K9QO 1P45A 1H2EA 5AVVA 5KNCA 1XA3A 1A5BB 1OXBB 1L3IA 4F93B 4QU9A 2AOVA 5J1TB 1UBCA 3ZW9A 4F04A 3O4IA 4QXQA 5GZ1A 1MA0A 2VP6A 3I83A 4UUAA 2YHIA 3ZHTA 4IFTA 1NP7A 2QWXA 5DE3A 1FLAA 2DRIA 2Q4OA 4XCQA 2GZ1A 4Q3CA 1Y1LA 1GCAA 3NIWA 3R9KA 2OEPA 2QDKA 2Q4RA 4I4NA 5CAEB 2C57A 2VQ3A 1MRZA 3N7UA 2AS0A 3W8RA 4YT4A 4EMUA 4HLNA 3JQAB 4HLQB 4JHXA 4EPVA 1LBHA 5C53B 1E9AA 2F3SA 3PYLA 4ZU3A 3CPEA 2HSZA 1ARZA 1SBQA 4R1NA 4E5KA 1PJSA 4PHHA 4GVLA 5ETJA 1QHXA 3D3KA 4QUJA 4CIYA 2Y68A 1NTOA 3BICA 3EGOA 5KWIA 2R1VB 3A9CA 3GRZA 2G5CA 4OX9B 2CFTA 3GVXA 4QBIA 4Z51A 1KJZA 1OROA 2HHJA 1E3QA 3E15A 3EA0A 4LW8A 4FMDF 4PZDA 1FIUA 4EI8A 1QJ4A 4WNAA 2EKBA 3GBVA 2PV7A 3LUBA 3WMXA 4CM6A 5CA1F 4Q3OA 3ZU6A 5ED0A 2OKGA 2GNPA 2X1HA 1QLWA 2O1EA 2HREA 5JD5A 2B7BA 1VYTA 1F38A 3HU1A 1E1YA 1FNCA 1FJHA 1SURA 3WGLA 1Z7YA 13PKA 1P0CA 5DHAA 5EHGA 2G8NA 5IEJA 3VKUA 4F9TA 1Z5VA 3R5XA 2GZRA 2QMEA 5GADl 4PX5A 5D51S 3CVYA 9MHTA 5CFZA 2XRFA 4KDCA 5FTWA 3FTFA 4B33A 1L5VA 3E48A 2G0AA 2P0AA 4IHJF 1C2YA 5H4HA 1ESNA 4HSGA 2Q2WA 3D3JA 3OT5A 4B2LA 3D0OA 2JCGA 3U62A 4X64B 5K09A 3GJXC 1Z5NA 1F2VA 3HNRA 5DTMA 1JLRA 4PVDA 2EQAA 5K0NA 5C1DA 3O9MA 3DPSA 3C8MA 5KNCD 2HLPA 2R85A 5LJLA 1TM2A 1XQ9A 2VDWA 2ZYAA 3K1AB 4RVSA 4DNPA 5A3QA 3LLCA 2REBA 1CUYA 2IYNA 3HBMA 1U0LA 4FHEA 5EXEA 4YV1A 1NBOA 1AVTA 3N3BC 4C6SA 5B64A 2X15A 4HT3B 2FWAA 3JVVA 1DRWA 5DRYA 4MTCA 4YWJA 3RRZA 4RMGA 4M7WA 4XOUA 5E7QA 2PMKA 5AXAA 4HNAA 4JYPA 1NKTA 2I7CA 3FB4A 3NM6B 4MKRA 2CHFA 4BLWA 2F3RA 4R83A 2O2JA 2QA5A 3DNFA 4FDAA 2O2XA 4MSUA 4BZQA 4WJLA 5AESA 3AIIA 2CLKB 4OXQA 3SVZA 4E1VA 5KYTA 4I5GA 2AKEA 3QBDA 2ZETA 3MCVA 2ZYRA 1ZVQA 3D6FA 1SBHA 3FZEA 2GHIA 1CRZA 4BQSA 4EW1A 3ER8A 1NBHA 3RK1A 1E20A 3Q41A 4F12A 1BGVA 1QPGA 2A6PA 3Q12A 1EI9A 4J3NA 1J1ZA 4JV5B 4H18A 1AT1A 1NZDA 1O8BA 1WF6A 2A35A 1S8FA 4LZPA 4PLWA 1JHVA 1JLLB 2BGNA 2CXUA 2GERA 2YNMC 3A9WA 1XC7A 2QL5A 4IGIA 3CF6R 3OBBA 3SEQA 1K4MA 3FCCA 4AECA 2XCOA 3SFTA 1GGJA 2REQA 2H1WA 1L8OA 2MSDB 2PXAA 1GQ2A 1TTQB 2O50A 3G82C 5M3BA 4DWVA 3WNDA 2ZIGA 1BE8A 4INAA 4LRWA 3VAAA 3DCNA 1I1QB 1SO8A 3H3XA 3OPYA 4JYCA 4KO4S 3RARA 2XZLA 1XMQB 1CB7A 2HMVA 3V1NA 2O8BA 3SC2A 4TUYB 4BO8A 3F8WA 4NS1A 2X42A 4PAGA 4NOLA 4D46A 4X7MA 3QHPA 4ENVA 5A6SB 4YRPA 2FP4B 4M9RA 4TT3D 4DQ0A 2V8BA 5HA5A 5EJ4A 2IV2X 4EB0A 4XPIB 3UUEA 2VVTA 4RFSB 2WM9B 4LMPA 1BWRA 4DNXA 4PG8A 1GITA 3G79A 3R9IA 4JR2A 1YS6A 1Z7GA 2QMZA 5EJEA 2QTNA 2WUVA 5ALLA 2R1TA 1XLVA 3UWMA 1T6XA 1M75A 1R37A 4G1VA 3SIPA 1VPTA 4PRKA 2PGDA 1KOFA 3CA8A 2FU5C 3Q0TA 1LK5A 2A0XA 1CUJA 2HMAA 4GOMD 1J9EA 1KRHA 3HMKA 3O74A 1PX0A 2IP1A 3ETLA 1E2LA 2VNAA 3QX9A 4EG5A 4X60A 5AI5A 1Z5WA 2GF0A 1ZVVA 3WL3A 2BM0A 3LY7A 4R1TA 4DIKA 4BVBA 2Q5HA 4CKBA 2HA6A 5ALEA 2WQ7A 4NVRA 1WOMA 1K4KA 4NXMB 4AP9A 3CX6A 4GEGA 1MVLA 1VYVA 2J3HA 5ALSA 2ATVA 1L8QA 3OIVA 1QMGA 1U8YA 1I1HA 2I54A 4QJIA 1H1LB 3I01M 1JE1A 5HKLA 1TU4A 4PG6A 3KDAA 4WCFB 4ZO6A 4ZGBA 4TQUS 2M6KA 1V1RB 1UXKA 4A0SA 2GBCA 2JGEA 4NK4A 2QTTA 2VA9A 3FNEA 4ISBA 4DCTA 4PYLA 4N6NA 5AKEA 2W00A 5D84A 2I9PA 3LVBA 4WIAA 5DZSA 5KHAA 2O5CA 3LW7A 5LP6A 2ZUWA 1IBLB 2VYVA 3G5TA 1Y6FA 3LE8A 1RWBA 3O38A 4XWAA 5JFGA 1FFBA 3FYUC 2J3QA 5KMGA 4Z99A 3N59A 4S04A 4UNSA 2OPHA 1GKUB 2WWIA 3GEBA 3ZE0B 4D97A 4EECA 1XFAA 2NVOA 4KL8S 1ESEA 5HE9A 3C5WP 1QG0A 3FOAA 3M2PA 4ARSA 3CLVA 3MS4A 4KVGA 1I01A 1EXWA 3VOBA 5J4KA 3LIIA 4HAUA 2FZEA 4L6CA 4BKMA 4DT1B 2D2FA 2QW0X 2V55B 4FW9A 4OYYA 1ILWA 4Z4FA 2FHPA 5FUBA 4KVFA 3DMGA 1UMBB 4BMXA 3KWLA 1DO0A 4WLUA 5J63A 2A57A 3UQZA 3FJYA 3JZMA 3MWGA 5E6UB 5LNK6 1H65A 3ZV7A 1RQ2A 5FH9A 4AS1A 4DMKA 3UJ3X 3G0HA 1QFXA 3VYTB 1OGJA 2IZOA 4BXOB 3VKHA 4URZR 4UCFA 4JK3A 5MF6A 4L0CA 4AZWA 1FSZA 4D4GA 3A6PC 2DFVA 1H3NA 3W5UA 5EJFA 3K9FC 4I66A 2RBEA 3K2BA 3NEAA 2L18A 3K1ZA 1H05A 5DNCA 3EEFA 3KR0A 1EXVA 1U8FO 1ZIDA 1N4AA 3VPXA 2DKNA 3JD3A 3THSA 4NONA 5JMWA 1Y9ZA 1L7DA 3PGXA 3QOWA 4PGHA 3SXJA 5CXUA 4QFBA 1K06A 4KFRA 1HE1C 2WJJA 4U3JB 1AUOA 2H3EA 2HU5A 1WIWA 3URMA 5JXGA 3UV7A 4I55F 3VVBA 4M1SA 3K20A 1MENA 2WSBA 1B7GO 3EGDB 4LSWA 4OLHA 5DXFA 3RAFC 3ZWVA 3F78A 1DQZA 5G0TA 1NGSA 4R8RA 1F5SA 1YULA 1ZQ1A 3LBNA 1R50A 1FRZA 2N46A 3RC2A 2FG6C 5JSUA 4CGZA 1ZVJA 3ACCA 3W1VA 5BSEA 2ZSKA 4HMOA 2NVUB 1R4MA 4WE3A 1CEYA 3LCUA 3KPVA 2P67A 3UPDA 2AUMA 3FZGA 3L8EA 1G21E 2VYVD 2BHSA 3E7XA 3LPMA 3DM9B 4WK0B 1SIOA 1DADA 2CLDX 2Q9BA 3EDYA 1OV6A 4FQ8A 4CG3A 1E1KA 1RWNA 1EKXA 4G85A 4JU9A 5HYVA 1YZTA 4XIGS 5FBZA 4EJ6A 3PFIA 3W2HA 4OQEA 3WQQA 3GX1A 2BH2A 2XV1A 4QXAA 1ATIA 2LE0A 3KZNA 3NANA 4Q4AA 3ZGOA 1WCYA 3S2SA 4OO3A 3HUDA 1X9GA 3FUVA 1RIFA 2VLBA 1XNQB 5AOAA 4Z9BA 3T3NA 4GP9A 3QTBA 3ND9A 1T5OA 2FR1A 2PAAA 4RZHA 3RAEC 1NQUA 5C9ZA 4ZI5A 4DCMA 1PT7A 3GZNA 3R0JA 1E5TA 2BMWA 4IVPA 4CEIA 4BMCA 5LA6F 4ZEOA 4HRXA 7MDHA 3SICE 4ZI2A 2GBLA 5TQ0B 4D9NA 1Z07A 3COSA 1NZFA 1NVEA 1VHJA 1CUZA 2WHYA 1RI1A 5CGQB 5TVKA 4TXMA 1UM9A 2XYRA 3DEJA 1J8VA 3CMMA 3RF6A 4EUKA 1ZM3A 2GASA 4WKPA 1ZOIA 3TL6A 1L4FA 3NAMA 4F6RA 4K28A 1AMNA 4RMHA 3PQ6A 4OGKA 5LQSA 1XD9A 4AG5A 4XJSA 3GNTA 4I5EA 4D0SA 1YJAA 1BDBA 4JODA 2VNHA 2PPVA 1XZFA 2PUVA 4Q93A 2LGJA 4UZEA 2BBWA 1DT3A 4BNIA 3HEMA 4DOMA 4EHBA 2BEVA 3ORSA 1UWVA 1V1JA 1NUAA 2HI0A 3CINA 3DZJA 4NE2A 3UYKA 2G5GX 2NXNA 3DZHA 2FSFA 4FFBB 4UEOA 3TCXB 4HJRA 3S2FA 5GVSA 1G3QA 3GV0A 1RYDA 3KZKA 4G86A 3SX2A 1DARA 1XD2A 3E9ZA 2Z1DA 1OH6A 2H63A 4OM7A 1D4OA 4RKYA 1KDOA 3VR6A 1EHCA 3RYTC 4EW2A 1R15A 4D45A 5IM4F 4KQFA 1I9GA 3OIYA 4FHFA 2IEYA 4GVPA 4OMCA 3RS8A 3FNHA 1HWYA 1KK2A 2VRNA 3GP3A 3EQZA 4CF3A 4N5DA 5DGCA 5CVEA 1WCIB 1NG1A 3P5SA 1X2BA 5H3HA 3USZA 2WIDA 4A0QA 3B48A 2VG8A 1ENPA 3DPUA 4CR8A 4K05A 3MTBA 2Z5FA 1Z2NX 3TI9A 1S3SA 1UMDA 4RJ2A 5B37A 4ES6A 2JVJA 1IUPA 2HAEA 1W6UA 2P3QA 3CS3A 3OMLA 3J81A 4JR1A 4BJHB 1JJIA 3UT5B 3CNQS 2H1LA 2Q9UA 1CZNA 2ICAA 2Y1WA 2VJDA 4MI1A 4DTCA 1QFYA 1JWAB 1DOHA 3P27A 4L9WA 2B8TA 4DC1A 1G8FA 1FP1D 2IELA 5K0ZA 2IZZA 4C01A 4Q66C 3HFJA 3I1JA 4D0RA 1A2BA 4MR7B 2JKYA 2P30A 1TJNA 1GU7A 3STHA 4XJVA 5JZSA 5IVKA 3DXXA 3ZK9A 2VKTA 1VM6A 3STUA 1FX0A 1DAKA 1CB0A 2HPAA 1NE7A 2HY7A 1WXIA 4KFCA 3TD2A 3P8ZA 3HN2A 2XYVA 4ZJYA 4JOQA 4GZ6A 3L06A 1KO7A 3MM4A 3JAMA 5EHIA 3W6ZA 4IINA 4DJAA 3DOFA 1H2RS 1CULC 3PHIA 5CK4A 3ZY4A 5LQUA 1AA9A 1RQRA 1D9XA 2W4MA 5FBQB 1Z34A 4Q9AA 4ZQEA 4HL6A 2IV3A 1C3XA 4RA9A 3QXXA 4E09A 4WADA 2I91A 4NZOA 3IODA 1JQ3A 4DJJA 4Y0AA 2OXTA 3IPCA 4NU0A 1GWNA 1FJXA 2Q0HA 2WIKA 2ZSDA 3A32A 2VJNA 3EWNA 4JCOA 3S2ZA 1HYGA 2C04A 1ZUWA 2AW3A 2XUOA 4H2DA 4LV5B 4X94A 2O3UA 3FYSA 3RFFA 1KWKA 2QVBA 1NM5A 4CR6A 4IFIA 3KNZA 3VR6D 1EFDN 4H31A 3O92A 3EG9B 4WNYA 1BC5A 1VE7A 2OO3A 5FL7A 2GEFA 1A8QA 2YFYA 3KQVA 5G40A 4ZVUA 1TZCA 3LGSA 1Q21A 2FUG1 1EDDA 1EFPB 4QBFA 4Y2XA 3TOSA 4BKRA 3Q3IA 3W77A 1J25A 2RGAA 1XNHA 3REOA 3E61A 2FPXA 1VHTA 1PFGA 3VSCA 1N34B 1O97C 4PYMA 1IOWA 1PNQA 2MMGA 3AV3A 4RSRA 4DZRA 5KYGA 1V11B 4BO7A 3LC7O 4MS4A 1CNFA 1JIXA 1NDHA 1RXYA 2RJNA 3DCJA 1JG2A 3QP9A 1E1DA 4N40A 4Q48A 3SOPA 1MJGM 1KWGA 3LDGA 2EJTA 5K4GA 2HQBA 5IVIA 1X1QA 4MROA 1B0PA 5TQJA 1OREA 1QG6A 1Z2CA 1GZ3A 2RGCA 3P45A 5ALKA 1DX4A 4PBSA 3U40A 4CLDA 1V71A 2XUGA 1TQ6A 3K70C 3BRSA 1CJVC 2QTHA 2QR3A 2JK0A 5CNIA 2GXSA 3DZKA 4QFDA 4P0TA 1IATA 1RQ7A 4A0RA 2CBGA 4P08A 4TSRA 1SC9A 2X0RA 3QWAA 4MA4A 1QCZA 2CKMA 3B1YA 1Z08A 4OYHA 1ZQ9A 2AOWA 1DV1A 3H1TA 4QREA 2BVNA 1QH0A 3NNNA 3LGXA 3FUCA 1U2TA 3Q9SA 2X5JO 4K6GA 2X9NA 2Q8QA 1XU4A 3P7MA 4PX2A 5EMHA 1NJ1A 2EFYA 2O0MA 4Z0NA 1TZ2A 1N1GA 5GV8A 3ADOA 3D6JA 3TNLA 4XYGA 4FR2A 1G3UA 3O2JA 3WGNA 3L9WA 5FAXA 4DVGA 1GPH1 1YCGA 4ND5A 4JT4A 1B6GA 2YV4A 1DXHA 1XEWX 1O54A 1A1SA 1IVYA 2FX3A 3PGMA 2C82A 2CMHA 3FLAA 4HO1X 4NX2A 2A59A 3V8NA 1C1DA 2TRSB 3ZOKA 5KYWA 1W5SA 2X6TA 1I7SB 1ISIA 3HKCA 3HJGA 4MJXA 4XPZA 4W6ZA 1MQ8B 2W7TA 4XLTA 4BNXA 4AY6A 3JRNA 2CMDA 3FMIA 2ZI7A 1D03A 2JGNA 4W5RA 4B34A 3KQLA 1M3SA 5FL7D 2ORYA 4HX9A 3VPGA 3ZHVA 3C7DB 1ZR4A 1WBBA 1KEVA 2FFJA 5DTRA 4V0RA 4IY1A 2PWZA 3W4KA 3JWPA 3PL5A 3L8CA 4JH0A 5HQ3A 2IXFA 3H4IA 3KJFA 2W8ZA 4MWDA 2EKPA 4K9NA 5AXCA 5FRDA 2YFHA 2KW5A 2WPNA 4Y2RA 2CHGA 5BRNA 3L1HA 3RVJA 1I4TD 2QQFA 1EUDA 2IDKA 3CNOA 2YWCA 3D6VA 2IPXA 3F9RA 3KFVA 1U80A 1DFIA 2NTYC 3N5CA 2XA2A 4JC5A 3V8BA 4LXYA 1N5LA 1KO1A 1B8UA 2H5LA 2WSLA 4NCXA 1HE4A 4HH4A 4C14A 2C7PA 1GU1A 1FYVA 5DTEA 4R8SA 5I7HA 1ULHA 5KJEA 1NG9A 3WL5A 3WHPA 3C87A 4J0QA 3QPCA 3SVLA 1Y5MA 2LP4Y 1KU6A 3A70A 3H5AA 2DJ5A 3AUSA 3G5MA 2DHDA 3HDVA 2XKBA 1L1RA 4EUSA 4KO2S 2WI8A 3UMMA 1P7WA 2EV9A 5JZOA 1U0HC 4WOCA 2O2ZA 4DLBA 4AKSA 4WVFA 5B2FA 2Q29A 4ZOBA 2VF4X 5CK5A 5F3WB 4TV8A 3NCTA 4F0JA 4W8OA 1IWBB 3D3WB 4NABA 5B36A 4P83A 1LDEA 3VDNB 3GWGA 1YJ8A 3R9WA 2X19A 1RU3A 2LWIA 1V26A 3MBIA 4NENB 1MV5A 1GGFA 2JGLA 4IIGA 5A5VA 5JBQA 5FTKA 3E9YA 4E15A 3KTOA 1ZNQO 5DGDA 1FK8A 2OZLB 4BO2A 4W5QA 2WLSA 1EGAA 1R0LA 3BQMB 1G4UR 3CE6A 8ABPA 3SR3A 5DNYB 3VR2A 1EBFA 3M6WA 4FKBA 4UHBA 4JUIA 2BGIA 5ALDA 4NULA 1QE5A 4ZT2A 1I6WA 4YCBA 1MCZA 2GKGA 5FIUA 1X9HA 3HVKA 4IQ0A 4OHFA 3OZAA 2WDZA 1P0MA 3WNZA 5CAEA 1AGNA 1VI6A 1CSEE 1N5OX 4KODA 3VSBA 5IULC 5JAPA 1BOOA 3BF7A 3V4PB 1E2EA 1ZSYA 3JQAA 4K3UA 1XRLA 4N0PA 3CO5A 4D3FA 3X2SA 2F9MA 2P27A 1IPHA 1NPDA 4YV7A 4DARA 1JHOA 5KNCH 5DM4A 2R1VA 4OBXA 1MAUA 1TQ2A 1CG6A 4M8KA 5B1YA 1DBVO 4QQ8A 2V4MA 2UYHA 4RF5A 4TM8A 3ZZ0A 3NHFA 3RQIA 3B51X 3NS7A 4HOYA 3HUUA 2GSWA 3KU1A 3ZS9A 4AF7A 5CCEA 4F4DA 4GUDA 4YXWA 1IAQA 1AQJA 5F77A 1Z68A 4F38A 2FWPA 4R51A 4TKVB 2D5AA 2WINI 3IDFA 3OIWA 4FONA 2HGSA 3E1SA 3T4EA 2ZAMA 3NTVA 4MAMA 2GVDC 2OLJA 3MLAA 4NRDA 1IXSB 1LUAA 4AW9A 3N39C 4IS2A 8LDHA 4YHHB 1Y1PA 2IQ5A 1A7JA 5GONA 2P79A 4RTNA 3BM5A 3RFVA 3AJ8A 3AV0B 4LZOA 1EJ6A 2V54A 4DIDA 4H9GA 1LW6E 4OGGA 1JEYB 3U5ZB 5IKOA 1DEHA 1HTWA 3NDJA 2ZYSA 1OXVA 3M4XA 3HI4A 1YR6A 2J4FA 3O3MB 3UHJA 3ZTYA 1H6DA 1FYXA 2ZT6A 5F3DA 1SWVA 3P96A 4CDGA 3HBAA 4Z9YA 4EABA 5JQGB 1NAIA 3CLRD 5EJ9A 1G42A 4YK7A 2TMDA 1D9ZA 2RI0A 2QTFA 2W98A 3MJVA 3WGOA 2J0VA 1WHSB 1USKA 2R6DA 3TNDA 3P4XA 4Y1GA 3NO4A 3U3JA 3HXMA 4IIJF 3VR2D 1CFZA 1MB9A 1RYNA 1TUGA 3K1AA 3C41J 2GA8A 3Q7RA 3JQFC 4QYWA 1V16B 4BN0A 1U11A 3I73A 3QSYA 1BVYF 5KYWB 3Q8XB 5FKJA 5LLTA 3DKKA 4RCVA 6PFKA 4CV3A 2J3IA 4GWGA 2G67A 4KNYA 4CN8A 1XK6A 3B5EA 3M3DA 1GGEA 4UHHA 4D41A 3JQAD 3LYLA 2OKCA 3RTBA 1YQUA 3NT5A 4Z7JA 3AHJA 1M2GA 1E96A 2E82A 3IP6A 3TYXA 2QMQA 3R3ZA 4ZOQI 3ZQJA 5MN5A 3LUDA 1R0RE 1FRNA 1KRWA 3BKWA 3N8HA 1L7NA 2CNDA 4ZAXA 4F2WA 5BW4A 4DM7A 2ZR9A 3CJRA 3LUPA 4LIPD 2QG6A 4N3GA 4G5HA 5HDQA 2QENA 3ENQA 5ARDA 3I62A 3G2NA 3MZ0A 1CIJA 2J9GA 1JLLA 1N5JA 4L57A 4YXWD 5BQXA 2G25A 3RVRA 3MUFA 5D85A 3PNSA 1ECPA 3HO6A 4XX0B 4V0MA 4I9FA 5BWMA 4PEVA 2RKOA 3WK9A 1Z9BA 3N87A 1EUCB 5BXQC 3AVOA 2Y05A 4YMLA 1SKYE 4PFJA 1HE8B 1OHHA 3USES 4KITB 4L9AA 1LX7A 5GV7A 4ZEVA 2ERYA 2NO6A 1OBHA 3BA6A 4HDSB 4MCAA 3U1TA 4Q6BA 4JVNA 2G0TA 3FGOA 5A6SA 2BEKA 1CK4A 2FP4A 2HIAA 2VT2A 1KDZA 3U0VA 5DWDA 2NU6B 4B6PA 1T91A 4XPIA 1T5IA 1WMSA 4RFSA 4C04A 5CFQA 1JDPA 4LJ5A 4XWGA 2EXXA 1LPSA 1KFKB 2VPXA 2Z6VA 3WHKA 4B4UA 1X0XA 3V4LA 3IULA 4Y67A 1P4HA 4E5DA 4ZT5A 1N7JA 4PXAA 1J6UA 3EZXA 2AN3A 2YMQA 3NGXA 4YALA 1CFJA 2POCA 3GRUA 1HDEA 1JLKA 2IXAA 4FX2A 1REQB 1Y9DA 3N07A 2C2ZA 1X1CA 8ATCA 1KGSA 2EQBA 4BEBA 1ACJA 3ZWBA 4UU7A 2X0EA 1VA4A 1H93A 4KXFB 2UUAB 3ABIA 1X3LA 1PUJA 1VFPA 2ZZKA 3K09A 2IKQA 2HIGA 4EATA 1R6DA 1RKUA 3F3SA 1P31A 1SAYA 3GJYA 4G8JA 4US1R 4QWMA 3KR9A 5BUZA 4DADA 1OA1A 2FWMX 1JDJA 1OXUA 3GEMA 4ZOAA 3BJIC 1OYYA 1C1YA 3ZKAA 4DMMA 2NO1A 3RVLA 4IXWA 1QPBA 1WSBA 1H1LA 2OL4A 4WCFA 1LBQA 1P3JA 1V1RA 2OM6A 3AONB 3MTJA 4UAJA 2OMKA 5GVRA 3UH1A 4Z7OB 1EWYA 4BNZA 4C4ZA 3K1TA 2HK8A 4JQSA 1M7HA 3D7NA 3PWTA 1QIEA 1O94C 4JEHA 5FORA 4AUKA 4EY4A 3H3FA 4AQDA 5CBKA 4HADA 2VXYA 3DE1X 3UUFA 1G7TA 2WP8J 3FVRA 1MEJA 1EVLA 1JE0A 3TFOA 4BY9E 5A4DA 3GLUA 1TU3A 4L4SA 2YVKA 2F43B 3KZCA 4KIGA 3BHIA 4M1KA 1SD5A 3PCTA 2ZT7A 3WGTA 2O7RA 3IOYA 4CL2A 4EJSB 2JGAA 4I50B 4JLJA 3NW9A 1G5QA 3C3YA 2Q3FA 1H8HD 1T2NA 2DSNA 2GJKA 3PU6A 3R5HA 4G3XA 4QXRA 2ZR0A 3D4PA 3FPEA 3UMVA 4DT1A 1QZUA 4JLWA 4J07A 2OFPA 4JI2B 3RRJA 4PYIA 1N6PA 2GAOA 1UMBA 5ILGA 3EEIA 4M0UA 4YAOA 2OY0A 4IX1A 3W5CA 5CFMA 3KDPA 5E6UA 3RHFA 1R64A 1B15A 1Y3HA 3MRXA 5CRIA 4YAIA 3OCXA 1MZPA 4GDMA 2RAFA 5K0LA 5DT9A 2EG9A 2E2WA 3LZCA 2G77B 3DAGA 2WICA 2OCGA 4BXOA 2FGKA 4AULA 4FFWA 3ZXUB 3HB9A 4Z4CA 1Z56C 4FYWA 1OWOA 4RKWA 3L41A 2CL6X 1A9TA 2QN7A 2O5RA 3QK7A 4C0AC 4Q1AA 1B3BA 4C6HA 4EG4A 3FIUA 3F5MA 5ALGA 4BNNA 1YRHA 3Q1KA 1FS6A 4W5WA 3IVRA 3B6KA 4DSZA 1LVHA 4ENPA 3T3IA 3KKLA 1E2UA 2DT8A 4IS3A 2Y92A 4Q7KA 5FLEX 3R8CA 3NATA 4RETA 4HH0A 4PZ0A 5YASA 2WMDA 4U3JA 4YC7A 4IVRA 4PU0A 2PS1A 1C7FA 3F8TA 4C4RA 1CR2A 1UK6A 5L4NA 5AJVB 4LF7B 2JFWA 2IRWA 1KAMA 3QYJA 5HF6A 5EGNA 3EGDA 3MCUA 4B3MB 4TKUB 1JFVA 2QRVB 2WB2A 2FRVA 2W2NA 3EEQA 3ZH9B 2W8BB 4AJ2A 2C1ZA 3UJAA 1TQ8A 4ZMBA 2NVUA 1TC1A 3A36A 2VEDA 3GGJA 3LT4A 3NIBA 1UQUA 1MQAA 1FPMA 3OIUA 4YQZA 5EIBD 2DOKA 1A8IA 2XR1A 4NJOA 2ZZMA 2JHGA 2R11A 3ZQKA 2HX1A 4QM7A 4INZA 3KUXA 1M8GA 2NUPB 3ECCA 3MJEA 3NU1A 4PSDA 3UMYA 1YU9A 3QUTA 1NNI1 4IEIA 4LV6A 1L4EA 2COEA 2H4HA 2RH8A 4X84A 4KQ9A 2C96A 4KMMA 4HLUA 4QEKA 3H5WA 1JU9A 3IVGA 4N47A 2X2OA 3KKPA 5A2GA 4AY2A 1C1HA 3GLKA 4EQZA 3ID6C 4Y2TA 1WLSA 1JG1A 5DBFA 3FROA 3CEAA 4N8DA 3REFA 2D59A 3U81A 3PNYA 5AHKA 2EC5A 2B1JA 2LTAA 5COAA 3ZBQA 1O6FA 2VHUA 3I05A 5BORA 3FHTA 1ZKMA 3V8PA 2WILA 1YQXA 3IKVA 3ZV3A 3S1AB 1KO5A 5TQ0A 4B8WA 1B76A 2OR3A 2BKUA 4BMNA 5LB4A 3VXKA 3HVHA 2Y9PB 3H1FA 5H7XA 1HYHA 1Q57A 1H66A 4HMPA 1KY2A 3CF0A 5EJ2A 3RSOA 1Q91A 3GUUA 5KQSA 1CRPA 2WPDA 4CM3A 3W5SA 4DUGA 4Q1EA 5EZ5A 3GROA 1PFYA 2OHJA 4MS1B 1JDTA 4XEUA 1PR0A 2O5EA 3UJHA 3F7NA 4ZCTA 1CY2A 1SVOA 2XTJA 2XZDA 2GZHA 2ZVQX 3AM4A 4HZIA 4XUGB 4XEHA 1PFKA 3OJCA 4K3VA 1K6MA 4LYJA 1MGOA 1YUNA 3ETGA 2ZI9A 2PLFA 3IVAA 4IRUB 3SX0A 4M38A 5K8VA 2G80A 4PC2A 2XT0A 3TH5A 1U5AA 3I5MA 2XF8A 1TAUA 1USWA 4JSYA 4BN5A 3BGWA 4KOAA 1MX5A 2J9FB 2WJVA 3NONA 4FFBA 2BGKA 3STVA 4DQVA 2C9CA 3DDOA 3H4TA 4JLSA 1FB5A 1VRVA 2BGMA 3G2PA 2IUEA 2WZCA 3AEZA 1GSOA 4XM1A 2GYVA 5FTJA 1EB9A 3I8SA 5TARA 5JCPA 2BGGA 4I6GA 1HLGA 3MMZA 1FFGA 4IPTA 3A04A 4MV6A 3D31A 3MCTA 5T67A 2R6CA 5DYTA 3CSDA 2AZXA 1WCIA 1AO3A 4LCBA 2YWHA 4UM9B 1TTTA 2C0PA 2A9KA 1I2AA 2Y76A 4K88A 4Q7QA 1ZIXA 5BOSB 1WMEA 3INYA 1FS5A 4PLYA 5KVCA 1B43A 1YC5A 2RGNA 3FNIA 3RR2A 3OFNA 4IH4A 1NJ5A 2TMGA 2YV3A 5DLYA 3UT5A 2YZ7A 3LKZA 4DM4A 1LKZA 2DPHA 3AFGA 1I3OA 3WLEA 4BCBA 2R62A 3EVCA 3JQBC 3NZEA 1FCJA 3VR6H 4WXMA 1SJ9A 2PDAA 2ATXA 3QUSA 3C39A 4LXHA 4X8OA 2YR0A 4LBVA 3TW4A 4MR7A 4NFLA 1F2TB 5FBLB 4PRZA 1JP7A 2Z57A 1P3DA 3EODA 4O2RA 1NWHA 3HYNA 1ZNWA 3S6JA 5BNFA 4LGYA 3WGYA 3CLTD 4PO8A 1GRCA 3IAS6 4KR6A 3CX7A 1OVMA 2Q3EA 3I1IA 3IQIX 1XU7A 1F0KA 4EJ2A 3FYUB 4KQ1A 4PFSA 3H11B 3UTDA 5LMUB 5DXAA 1EAYA 3U19A 1OH7A 4V0NA 4DUGD 4FB4A 5EZYF 1YMVA 3N2LA 4EUNA 3QUCA 1PJ3A 1YI1A 4WXEA 2R7KA 3PDHA 3RLFA 1OBOA 3KQTA 4JB2A 4IMPA 1OC4A 4JIMA 3UC5A 1AO0A 2RIRA 2X3FA 1UJ4A 2HD4A 4PXSA 4BAGA 3PXAA 1G17A 3UHAA 2ZSIA 4MEAA 2QSUA 3ORFA 1BMTA 2A88A 2D4AA 2E6UX 2I3ZA 2P3LA 2JBHA 1B0AA 1NY6A 3NTXA 3ZGZA 2IXEA 4LYFA 3DKRA 4ZQIA 3MAAC 3FTNA 3HY3A 1J5EB 1VMIA 2XQVA 4IOJA 5EIWA 4BNDA 3GH3A 1TTHA 2BBSA 3DC7A 4N12A 4WZAE 2HQRA 3EG9A 1A3CA 3AKZA 3UUWA 1P72A 4HNQA 4S2EA 4RC9A 2GI4A 1N7HA 5IUNC 2Z83A 1RC8A 4UQOA 3NEYA 3UV3A 1EFPA 1Y8AA 3G49A 2Z6QA 3ZX4A 3TZCA 4N3AA 2ZRCA 1AKQA 1JHYA 3QW2A 4AYWA 3O2SB 3VNVA 5AUPB 4UC0A 1PL7A 5LWHA 2HMUA 1U3DA 3M49A 1YRWA 4OL0A 1V11A 3GJ6A 4ABYA 2I66A 1F17A 1T35A 2Q2NA 3CGGA 3JQ8B 4D42A 2I7DA 5JWRA 1RI5A 1QDEA 3OFND 1VLLA 2MWMA 2YZMA 1TUIA 1Z63A 1Z6XA 4CLHA 5E2IA 4ZOLF 1RQLA 5BYAA 3KHTA 4HAYA 1NDUA 1ECLA 1JAIA 1BRMA 7AT1A 1UJNA 3W3AA 2GPWA 1VBKA 3T4UA 1IY2A 3VZSA 2EF1A 4LPKA 5A4AA 4PF1A 5DCUA 2YQ4A 3EDQA 5EUBA 3RT7A 2ZCJA 2LDBA 6CHYA 1DG3A 3R5TA 2DLCX 4JYAB 4R3UC 3DEAA 5AW5A 1MHTA 1PG2A 2PVSA 2QG4A 3P9SA 4KNVA 4IIHA 5KJ1A 5KJ6A 5KSOA 1XMXA 3IAUA 4NH4A 2WNHA 2GESA 1HPLA 4LJAA 5I6DA 1R00A 2QG9A 3DNMA 4OQFA 5B1IA 3V46A 4ZT6A 4DZZA 3GRRA 5IASA 1OT5A 3OQHA 4IXTA 2XCSB 1MB4A 3H0CA 4N7JA 1FNDA 4FS3A 3B8EA 3V80A 3VO9A 1Z5OA 5B3LA 5CEFA 3EISA 3IEUA 4P5EA 1B6SA 2FEOA 3S3TA 1IRIA 4BHTA 3QI7A 3RYFB 4AG6A 4XVUA 1CXZA 4N18A 7ABPA 2QR2A 4YRJA 1E4VA 1JDVA 4Y18A 1YAJA 3L7BA 2DFDA 3TZKA 4N5NA 3S81A 3JALB 2E4WA 4N6GA 3ZI0A 4EGJA 2O23A 2P1DA 3QVGB 2O57A 2UXCB 1NXOA 1JEDA 3BMXA 4KQJA 4PCUA 4UU8A 1AQNA 4RXTA 1LV8A 4TLEA 4JELA 4XB6B 5EWJB 2ZRGA 3VOSA 2I3BA 2WF6A 5AD1A 1II9A 4EJ0A 3IMEA 1QNLA 4G8BA 3ZEIA 2AGVA 1QRRA 5ENZA 3UOGA 4AF8A 1QIKA 3MGKA 1X14A 3TKAA 5IX8A 1IOVA 2EBUA 3RIMA 1WOYA 2FSIA 3ZNOA 3IS3A 1K3FA 2IZ0A 3SMVA 3AHEA 4DJTA 1FX1A 2AVDA 4Z8YA 5DOZA 5TDHA 5BUQA 3RU7A 2CK3A 4N6OA 1ADYA 3ZH2A 1TAGA 1VA5A 3CH7A 4WFJA 5G3ZA 1QX4A 4IJKA 4B4DA 1H94A 3SE7A 3TRJA 4D96A 3RSLA 3I42A 1KMMA 1JDBC 2VPYA 2I6UA 3FI9A 3IQEA 2WP0A 2PWAA 1IWPB 4DQKA 3L01A 4LSMA 1K3UB 5FV7A 4DYHA 4XB2A 5I7SA 3ZWMA 3PQ8A 1CCWA 3BAZA 2CXOA 1Z83A 3W3AD 5D01A 1CTQA 1Q0QA 1BYIA 4W5NA 1IB0A 1EVZA 1ZK0A 1QGDA 1SG9A 1CY1A 1Y6QA 3KVRA 2IGTA 3M1IA 4MVJF 5AVUA 1X39A 3PKIA 1LRJA 2QYSA 1KVRA 3MMNA 4MIOA 3E27A 5KWVA 3H9JA 2OGTA 1X70A 5BW8A 1K5DA 3FGPA 4YCSA 1HEYA 4DSAA 4L5IA 1TADA 4WUVA 1OW3B 1VL8A 1EVYA 1Y6RA 3WQRA 1ONOA 3R4CA 2KB0A 4JC4A 1TRHA 5DF1A 4JBYA 3DEZA 4UEWA 4ZCMA 2PLNA 2UDPA 5H02A 2VF5X 2RARA 3LKDA 3U7RA 3D3WA 4DJ5X 3EFBA 4XZ3A 4CF5A 2WC1A 1JV2B 4JR0A 2JF0A 1M1NB 4LHXA 4P82A 1Z28A 3BSFA 2O6LA 3P20A 1G6KA 1NP3A 1PL6A 3HN7A 2K5UA 2A5LA 2CZQA 4BDSA 4NENA 2P78A 4FEEA 4AO7A 3GUYA 1UF9A 2RD2A 2OZLA 3CJQA 3ONWA 5EUMA 1WUHS 4N65A 4R2IA 2QUBA 2HL6A 3EVBA 1R6TA 3EZ7A 1EVQA 2V7WA 4JP8A 3GELA 4ILKA 5BV7A 4A36A 3E03A 1BDJA 1VJDA 1NT4A 2G7ZA 3GJ8A 5PNTA 4WA7A 4BVLA 3WAJA 4ER7A 4ED9A 4BYGA 5ITVA 3W9BA 1DAHA 1ENZA 3ZWXA 4CMEC 3PD7A 3CTPA 1ZHOA 4AM8A 3IBSA 2Y6UA 3E2MA 4BB5A 1LK7A 1SKBA 2CK3D 3OSUA 1HZZC 4EIWA 4KR7A 3LZ6A 1QRTA 2PSJA 4LDNA 4IJQA 2YHSA 5I7VA 2D5LA 3K6JA 3VX4A 2H1HA 3OZDA 3WYDA 4F2PA 2XUZA 4EM6A 1NMXA 3FDJA 3GN1A 4CNBA 1B14A 4YRAA 2NO4A 4PO1A 4ZZ2A 4EHJA 1M6NA 1ZLYA 3T06B 2DUWA 2RBGA 1Y3FE 4G4SP 4XGQA 5B1HA 4MIEA 1RDFA 1THGA 4JITA 3JATB 4JGIA 4Z54A 4KMOA 4JQCA 4BVJA 3SKYA 5E6RB 2GUWA 3CQ9A 4DREA 4UMEA 2ZIEA 1I94B 1G2OA 4M1TA 2AI2A 3I6IA 2JD1A 1S7CA 1ZCAA 3WKAA 1CY7A 1JSZA 2QTRA 3G88A 4UNQA 4EY8A 4TKVA 2R1UA 5ICSA 1CUCA 4P84A 2CUTA 1U0GA 4DCVA 3PR1A 1MH1A 3D59A 5IP5A 1EQ2A 2B1GA 2YHBA 3E18A 1DRUA 4NATA 4CM8B 3BZWA 2N3ZA 5IDQA 3HCEA 4QQFA 3KIPA 1E3LA 3HNOA 4LYGA 1EU1A 2IODA 4P33A 1G5FA 1EX9A 1RJGA 4XKJA 4PLZA 2O8CB 1DO2A 1SD2A 5FPPA 1XCMA 3C3WA 3JD1A 4YJ3B 5D5HA 4QUBA 3L8HA 3NT2A 2YZ2A 1QP8A 4JEIA 1ZICA 3I3SR 2DU8A 1IXYA 1I8TA 1N9ZA 3RRBA 2F3UA 3PC2A 3PBKA 3I30X 5JQGA 2C3OA 3KOOA 4OSPA 4CZ2A 3GD7A 3CGWA 4ZO7A 1JHAA 2EKDA 3OAAA 4UULA 4X97A 3AU8A 3B2EA 4DV3B 3GJRA 2IY8A 3PKZA 4YDSA 1TKCA 3ZXIA 1YQ9A 4G0WA 1BG6A 2IYOA 1WHSA 3FDZB 5DX1A 5DYGA 1Q3KA 3HGTA 4G0NA 5BT9A 1QX3A 2JJ1A 3MRSA 3HPRA 4W99A 5JHGB 1S5PA 2GPNA 1FP4B 2VDQB 2C83A 2X7JA 1V4NA 5C3UA 1XTKA 4HFMA 4X65B 1V16A 2GZDA 3GFTA 2UVDA 4ZVMA 3VBEA 1R5OA 4F3TA 5GGYA 1YKGA 1TD1A 3M5WA 5CM9C 1R1DA 4Y0VA 3A7EA 4B3DA 2G1AA 2JAHA 3EZYA 4YI5A 1CZHA 1W4CA 1XVIA 3UC9A 5B1DA 4MI9A 3TW0A 1NPTO 4EF5A 3OQOA 1VE6A 2R84A 1HYEA 3EXG1 3JQ7B 1LDGA 1TM5E 4C2AA 3KLMX 3I2KA 3PHLA 4LFAB 1PWXA 4EPTA 1PGPA 2ZB8A 2FW8A 4OXRA 3D2LA 2IYRA 4YMTA 4F92B 3JPYA 1IN1A 1YHNA 1Q7EA 3RK0A 5F1OA 4OREX 4J9VA 2OCBA 1CQIB 3H2IA 2ZIAA 1DBWA 3OT1B 4HD8A 4M1EA 4PHTA 3A1WA 4NOKA 2F62A 2Z4TA 4TL6A 2Z2JA 4ZTZB 1GGKA 3ACDA 3IJEB 4P4UA 4HFJA 3V4ZA 3T1TA 1NPYA 1RLJA 5LL6P 1NQAO 1THZA 2AQHA 3HDTA 4N5LA 5LUAA 4XX0A 5LZ7A 1PR1A 4O0MA 4O4IB 2B20A 4HDOB 4L08A 4JLDA 2YASA 1EUCA 3GD5A 3TNFA 2ECFA 3ZHCA 4ETWA 1VHWA 4BKPA 3ZWQA 4TV9B 5DMXA 4G26A 4CTJA 1EG2A 4I8DA 1G8MA 4HDSA 1RVV1 4L6IA 2ISSD 2WWHA 2K6GA 3RVBA 1DXOA 1MFPA 2I7XA 1C14A 1ZIPA 2H4WA 3LWBA 5AUQA 5FOUA 4TQGA 5FOQA 2NU6A 4G4JA 2IUFA 3NTOA 3OEED 3OMWA 1JH8A 1U8CB 4JS0A 1XDUA 2UZAA 4ZVOA 5CDUA 1Z15A 1NF8A 3AX6A 4G01B 3T7SA 3ZBUA 3OAAD 5A3RA 1WP9A 2PRKA 5KOJB 2IHJA 5LD2C 1T8PA 4NQRA 4C06A 1VMKA 3LUKA 1RYEA 3IHTA 4ZCRA 4TLBA 2OFFA 5BVHB 4GP7A 2JJ1D 3PIRA 2X0KA 1Q2UA 4XR9A 4HAOA 3GCXA 3B9BA 4DLWA 4ZD6A 1FFXB 1REQA 1TW2A 2QLTA 3GRCA 4NARA 3AG6A 3M34A 5GOZA 3X2FA 5C8VA 1N92A 4UVGA 3RFCA 5FOXA 3TO5A 2ECOA 1FFAA 4KYVA 4M9SA 5BYKA 1HDYA 1CERA 2YWRA 4M22A 4WJZA 4C0LA 5C8YB 2DKFA 3K6SB 1UDWA 2A30A 1JR2A 2NPIA 1BYUA 5AKKA 5FOTA 1BWSA 1KF0A 2Y27A 4ZHQB 3VH1A 2DB3A 5EMKA 3G7NA 1AQYA 3LUCA 4W7HA 1KDTA 2GDJA 1XMIA 3MTDA 4U2EA 3RSSA 3P4UA 4WTOA 1H0HA 3DOJA 3LK6A 2HMWA 4X6YA 3JQGB 4DLZA 5JFTA 5LIPA 1I3MA 3FWKA 4YAEA 5EA2A 2OCYC 5CW2A 5E4YA 1BFDA 2FE1A 3CW8X 3DT9A 2ZBUA 4LV8B 4UFNA 1V39A 4D8UA 3MQFA 4Z9AA 2FFAA 3ZDDA 1H42A 1YXMA 2PX3A 2W4QA 4B4OA 2VJKA 1ZSNA 4V0OA 5BQFA 4Z0PA 3EARA 1IY9A 4C6TB 4DILA 5BSWA 2F43A 4WT7A 5M2QA 4F4FA 1V3QE 3I28A 2GN4A 4I50A 4G07A 5I5EA 5F5XA 3WP1B 2G28A 3OO0A 3WKCA 4MVJE 1OSNA 1H2HA 3AFMA 5JT1A 4RYLA 3KHSA 3UK7A 4J2OA 4OAPA 4P3XA 5A5FA 3VSEA 1XLWA 5JH7A 4C2UA 2B2XA 4WEQA 4B2YA 2A0KA 1IPEA 2NADA 2MSLA 3HCOA 4YAFA 2PX8A 4BO6A 1FDUA 3CRRA 2OC4A 3BJEA 4M0PA 2XMDA 5D2CA 5CA0F 5A3SA 3SYRA 2ONKA 3OLZA 1KEEB 1OWMA 1ZCBA 3FWNA 4R40A 1JA0A 5DLPA 5JXHA 1RKXA 4MEJA 5JXIA 3KXKA 5JYCA 2GD0A 4FT2A 3LBAA 3BXFA 1VIMA 3C8ZA 5AVOA 3TTYA 4Q1DA 4RF4A 1Z37A 4YEDA 3MJRA 4OHWA 1VG9B 1W35A 3I76A 1RT9A 1Y6GA 1W96A 2YIVX 4N03A 3W0LB 1EK5A 3PLNA 3OOYA 1UBFA 2FOLA 1DRJA 1M5UA 1L5SA 1NYLA 2UYQA 2Y9MB 3ABQB 3BG5A 2I29A 3H83A 1POWA 4MEBA 4W5HA 3TKYA 4HSEA 2C8KA 4HTAA 2FEWB 3PXEA 4GI5A 5AK6A 4ZEWA 4BV3A 4YMGA 2P2CA 3DLHA 2PMDA 5FBWB 1YJXA 2ODTX 4P3YA 3WO0A 1AB5A 4MPTA 1COZA 4GOND 4TKUA 3HBLA 2QX8A 2VLIA 2QRVA 4XRGA 2KHZA 1IHDA 1R5JA 1KXZA 2EU8A 3OKPA 3D02A 4P7FA 4AJIA 1U63A 2IHBA 2W8BA 5DIFA 4KQCA 4P93A 3TXAA 3RIYA 2R97A 1YDFA 1KYWA 4JIGA 3WDSA 4B83A 2Q1YA 4F86A 4ZIRB 3HV0A 4GLFA 4MW4A 3IR5A 1SMKA 4GBMA 4CUJA 1TK9A 4TLDA 4D44A 3QLEA 2C4UA 1FZTA 2ID7A 4II2A 4HVCA 3RC9A 1EDBA 3ZGVA 1OH5A 1CRQA 1EINA 2HLNA 2NUPA 4NV0A 5B6PA 3GUZA 3DV9A 2FXIA 2FG5A 4IV8A 3QE9Y 5K0JA 2QAGC 1Q22A 2D0IA 3CW2A 1GNLA 5HSGA 4L3OA 4A0FA 4LE1A 2XCIA 4ND8B 1VQ1A 4C43A 1XL0A 5FLXA 2ZRJA 2XWJI 1Z2DA 2A1TR 3KP1A 4RM3A 1A04A 5AK5A 3W1WA 5L3VA 3NOVA 3V4RA 1CJTC 4ER3A 1Y80A 4ENWA 5GIOE 2PS0A 1WD5A 2PH7A 4GOJA 5FNVB 3OQNA 3AR7A 2BM9A 3OM0A 1CVLA 2P40A 1CEQA 4R05A 3WNQA 1ZRNA 1SUSA 4DV6B 3MXTA 1M2VB 4K86A 1K5HA 1SVLA 5F7ZA 2JLVA 4GNKA 5A9RA 4L22A 1E60A 5EXSA 3S1AA 4RDXA 1NW6A 1CP2A 1GZ5A 1JQDA 2B82A 2JD0A 2X5NA 3MYYA 1P5JA 4G5XA 2Q7OE 4Z4QA 1X7HA 5G0VA 4GI1A 4GIBA 3UK0A 4H0NA 1QGZA 1J9ZA 3ICVA 3WIDA 2G08A 2X4DA 4YRBA 1B0ZA 3H5OA 4MS1A 4DLRA 2YXPX 4CUZA 1XN1A 2ZIFA 3ZQUA 2QLJA 1D0IA 1XDBA 4IF4A 4MWZA 2ZAOA 4EF6A 4HZUB 2GAIA 2FOIA 1K9SA 4MB6A 2ZJOA 3NOXA 3PCXA 3UKJA 5FO1A 1GFZA 2Q4EA 3X1MA 1V45E 2DPMA 1VJTA 4G5QA 5EERA 1PL0A 2I33A 1P6XA 3L84A 4I1SA 2CLHB 3HGMA 3WK6A 2O8FB 2HA4A 4P5PA 1LBIA 2O6HA 1KORA 2ZUSA 3AXTA 2WF9A 3OEHA 1JFLA 4H7HA 1AQUA 4HGYA 4PLPA 4OB8A 4AS3A 2UUPA 1FY2A 2Q07A 3ENKA 4YRTA 5JATA 3JZFA 1MU0A 2F64A 2ZJFA 3IQFA 2HWKA 3PQDA 2M6LA 4R0VA 4D4IA 2ODEA 3A4TA 5H0IA 3ICCA 5FTNA 3QJYA 4KGXA 5I9IA 2WYIA 2ECKA 5EXTA 4G97A 3UGJA 2WDPA 5B3AA 1O6GA 2WT8A 3INNA 3F97A 1AKRA 1IOLA 3NBQA 3VGJA 4C4AA 1P9RA 1K63A 2WJWA 3M33A 3DLAA 3MGAA 5I3CA 5BMOA 4X1KB 5BOSA 2VAPA 2BSQA 3CYFA 2ZI6A 1K7EB 1GSHA 3E9DA 4P4SB 1F8UA 4DIEA 4IHJB 4DWOA 3TPCA 1YDHA 1J9GA 1IHPA 1Q1QA 3VPSA 3GRPA 2DR3A 4MRAA 5DTJA 1E2GA 2ZE8A 4H7IA 3TZLA 1SCUB 4IIVA 4FGUA 2IYSA 1RWWA 3GEGA 2BDUA 2PX6A 4Q37A 5SICE 4MQLA 1RQPA 4H16A 4BMVA 3RYCB 2ZU0C 3PNKA 5IUKC 4AYXA 1EEXB 1XPJA 3FCYA 1W8IA 4HF7A 2FWRA 3OPMA 4AUNA 1F2TA 5JC1A 1QKJA 1I30A 1YASA 1ISJA 3COWA 3T15A 3TLXA 4V0QA 2R1ZA 3MPOA 4XLZA 3H8VA 1B93A 4Y2HA 3VH3A 4E6PA 3A6LA 3FYUA 1KAOA 2WRZA 3H11A 4DAOA 2DMRA 3THWB 1PTJC 4KHPB 5TGDA 3ESCA 4KR9A 4J7CA 1X77A 5LMZA 1N6HA 3HE3A 1N2SA 2NTVA 4KB5A 5CPFA 2DAPA 3RRFA 4YCNA 1P2UA 1GKLA 1N2JA 2ACVA 3LDUA 3H5RA 1U7PA 1H9BA 2RBKA 4YPOA 4O3MA 4P4TA 3RS7A 4CM9A 5AM3A 1WABA 1ZAYA 3A7DA 1Q7GA 1ZHFA 2P4SA 3GMDA 2ZJZA 1GL7A 3OEHD 3I23A 5L3ZA 3OECA 4ADSG 1T4CB 2XGGA 1YVRA 4NBTA 4JSRA 3MT9A 3Q2OA 5A02A 2D2IA 3NM5A 4MWGA 3LY5A 2VDLB 2GT1A 4W6QA 4LZJA 1EVKA 2JAWA 1Q1EA 3L1KA 4ZODA 5DCLA 3DVRX 5TSDA 2J4CA 2ZBEA 4RY9A 5IABA 4YXFA 2YHUA 1RBYA 1E1RA 1JJBA 5JJ5A 2X5XA 1QG4A 3VJRA 3EZ9A 2AFIB 4UM9D 1RYFA 4FINA 3VGPA 2XTNA 4B6QA 2PYDA 3A9RA 3BMOB 1Q7RA 2FN3A 1G0OA 5TPWB 2JL1A 4QYTA 3VNRA 1RLUA 4BNWA 2DH5A 5CCXA 4B80A 3E5NA 2C3UA 1FJGB 4YJ2B 1M1YE 1RYYA 3JQ8A 2Q28A 2PWYA 4KO8A 1EDOA 5SZIA 4MQUA 1A9OA 4IDCA 4ITRC 3EOAI 5JZMA 4YX9A 2EYUA 3QF7A 1UKEA 2A3RA 3SBDA 2E4AA 3QA3E 4DA7A 3IDAA 3FPAA 5EQDA 1FTYA 1DZIA 4P2BA 3OE1A 2Y99A 3FAZA 4CGYA 2FUG6 1NXVA 4RPIA 1TM3E 2PR7A 5G1OA 5TEVA 3WGQA 3C1OA 2PGJA 1CYEA 1S8NA 4HEQA 1U2GA 3ZZ1A 5GIPE 1C9YA 1P7CA 4E31A 4YLYA 3GT4A 2JFOA 3M8KA 3AZOA 1WXHA 5IBRA 3ICEA 1A5TA 5JY1A 3WR5A 1Q74A 2OE2A 2AMFA 3I3OA 2I1WA 3QELB 1NP6A 1U3TA 2ZRIA 4RAOA 4YRNA 3N6RA 1CUVA 2PZBA 1T2UA