5CRIA

Wild-type bacillus subtilis lipase a with 0% [bmim][cl]
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 64
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5criA00
1R88A 2XQFA 4X7BA 1A8SA 4Q34A 3WL6A 1CEXA 3UUFA 5FLKA 1VZ2A 4AB1A 3WWOA 1N1MA 1CUBA 1JFRA 2XUFA 3M83A 2B4KA 3C8DA 4DNPA 1K8QA 1P0MA 4DMFA 5ISMA 4QDTA 3F98A 3BIXA 1LPBB 3QMWA 3IUJA 5HK8A 3N2ZB 3IULA 3HRHA 2O2IA 4TVKA 2RGUA 3W06A 4Y2XA 1BEZA 2XQIA 4X85A 4AMYA 5CT6A 3VXKA 4KRXA 4LHEA 2WLSA 4Z49A 4N8EA 3WIOA 4EZIA 1BCRA 1MTZA 4G9EA 3V1LA 3P2MA 4AMZA 4HXFB 1AUOA 4LKOA 5AKKA 3KWJA 3B5EA 3WKCA 4G4JA 1HDEA 2HA2A 1YAJA 4UHBA 1XZKA 1LNSA 1THGA 2Z8ZA 3GELA 1ORWA 2EDCA 5A7FA 4AZ0A 1FFEA 4I19A 1EDDA 5HK9A 1ZOIA 3C43A 4B83A 1VKHA 1TCAA 2ORYA 2XMGA 4QDZA 5JD6A 1W4LA 2DHDA 2H7CA 4IQ4A 5AKXA 3HZOA 1HQDA 1AC5A 5I8PA 5JALA 3A2NA 3QPAA 1AZWA 2RI6A 4JYMA 2QXTA 1XZMA 3ZLUA 4V2IA 3RLIA 1HL7A 1EINA 5K3BA 4EY4A 3G9ZA 2Y2VA 4D9JA 1UT6A 2D5LA 5DWDA 2HU5A 5AH0A 4RGYA 1B6GA 5LZ9A 5FKJA 2QM0A 3G02A 3S2ZA 1NU6A 3BWXA 3W9BA 4KAJA 2NW6A 4B80A 1X2BA 5C81A 3DLTA 3HABA 4RE5A 4RE6A 1MAAA 3PDCA 3WL7A 3ESAA 3BF8A 1CUDA 2VQ6A 4HS9A 1XZEA 4RNCA 1XLWA 3DDUA 4FWBA 1R9MA 3IUMA 5SYMA 1G4HA 4OU4A 3QBJA 3KDAA 2C4HA 5AO9A 2XUKA 1GKKA 1EX9A 5HKBA 2R8BA 3OM8A 1XQWA 5C8XA 2Z3ZA 4QWWA 2WHQA 5I9IA 4U2DA 1M33A 3EQ9A 4FOLA 2WU3A 2ACEA 1FFDA 2AJDA 1PV1A 3R3YA 1VJ5A 1BEEA 4MWSA 4XVCA 2HRQA 2IITA 3PICA 4HVTA 3IB3A 3WJ2A 3F97A 3K2IA 3WKEA 3UMJA 5K3AA 2WQZA 5D3KA 3YASA 1PJAA 4Y9SA 2DHCA 4K6GA 3D5EA 2PM8A 3NGMA 1LPNA 1CUZA 1DINA 1XKTA 4EHBA 5DYTA 3WWDA 3VKFA 1N5RA 5JATA 3GBSA 1CRLA 3ED1A 5A6VA 2CMFA 4JEIA 2V9ZA 4U2BA 2XQJA 3DL7A 2Y6UA 1UK8A 3E3AA 5F4ZA 4DNQA 4UBMA 4GI1A 2ZYHA 4Y2VA 1CUVA 3AIMA 4F5ZA 4Y2RA 4W1SA 4PF1A 5AK3A 1Y7HA 1EI9A 2IX9A 5JASA 3WZMA 2PU5A 3O4IA 1Y37A 1IVYA 3LIPA 3FWHA 4DGQA 1Q0RA 1XZGA 4KACA 5HKAA 4MQMA 2OCGA 2R11A 1AX9A 2O2GA 2ZYSA 2YH2A 4J0KA 1GZ7A 4H7JA 3V1NA 3HC7A 2OAGA 4ROTA 2Z3WA 3H2IA 1XQVA 1ZGCA 1BU8A 3G9XA 3V48A 4QWMA 1QIIA 2OPHA 1UZAA 2G5TA 4FHZA 1GPKA 2Y2UA 3V1KA 1QJ4A 2K2QB 1R1DA 2VJAA 2ACKA 2OGTA 5HFNA 4FLFA 1XRQA 3WL5A 4ZI5A 4X00A 2FUKA 1S8OA 1WM1A 2QUBA 1CVLA 1XRLA 1O6FA 2J3DA 4KR0A 4QLOA 1GT6A 1BE0A 4HXEB 3O0DA 1ZIXA 2OLEA 4FNMA 4KYVA 5FXMA 4EY5A 3FNBA 5AIAA 1W52X 4W9RA 1QE3A 1BROA 4EY6A 4Y7DA 3DL4A 1E8MA 2WKWA 4CCWA 1ACLA 4AN0A 2ZJFA 4X92A 3O4HA 3DNMA 3H04A 3LP5A 4L72A 3I1YA 3G0DA 5C8VA 1B41A 3H1BA 4J0GA 5CURA 1USWA 2ZSIA 4BATA 1XZBA 4BVJA 1CV2A 5ESRA 3TEJA 2GBGA 2OCKA 5AHXA 2OG1A 4BC0A 1IUNA 2XUQA 5AOAA 2QKYA 4UBIA 4QEKA 3VVMA 4EUSA 5LZ4A 1ACJA 3DCNA 2VTVA 1LPAB 2V97A 1IUPA 4X93A 1XLUA 5AM1A 2RAUA 2BUBA 1MAHA 5HCUA 1OILA 2AJBA 4G9GA 1K6EA 4WFIA 3WWPA 3HSSA 1F8UA 4KEAA 3AFIA 4N8SA 4Y2TA 1DWPA 1MJ5A 2DQZA 4FKBA 4I4CA 1DX6A 2O7VA 4N5IX 1CIJA 2OGSA 1MO2A 1CUUA 3K6KA 4Y2JA 4P9NA 4FFVA 3CCBA 1XFDA 3OC0A 5A7GA 4H7DA 2PU7A 2XMCA 5T4HA 1DWQA 2GZRA 2OCLA 4W63A 1YR2A 5K3CA 2VA9A 4X95A 1P0QA 1CQZA 4BE4A 4PSUA 4DLNA 3WKDA 4WY5A 3FCYA 2QXUA 2RHWA 2OXEA 4KAAA 5LIPA 4OPMA 1UKCA 5AM5A 2BFNA 1QO9A 1DQYA 2EEPA 3ESBA 3HEAA 3PUHA 5E4JA 3WA6A 4FLMA 2CZQA 3F9CA 3QH4A 4YASA 1R50A 3C8HA 4OB8A 2H1IA 3G8YA 1J1IA 4ZV7A 4UPDA 4H35A 2WIKA 2QZPA 5AK4A 5HQ3B 4GECA 3G0GA 3E0XA 4F0JA 3JWEA 4DM7A 4P92A 1E89A 1L7AA 3FLBA 2CUTA 4B84A 2ZSHA 4DMKA 2WFMA 1XRRA 1THTA 4E15A 1BS9A 1XQXA 1ZI8A 3QYJA 4C6HA 2WHRA 4BBZA 3H1AA 4EB0A 1U65A 4MWTA 4UHEA 4AXBA 4PNZA 5CTAA 1YASA 3T4UA 4DMCA 4NZZA 1CUIA 1GPNA 2HADA 6YASA 1E8NA 3I2FA 4J0HA 4DNOA 3WYDA 1TIBA 2BAGA 4IH9A 5IKXA 5KWIA 5A7HA 3RK4A 2JGKA 4ZV9A 4NS4A 1TRHA 4LXIA 1MX5A 1JU4A 2G5PA 2H7YA 5ALUA 2WHPA 4PW0A 3PF8A 1CUSA 3W2TA 3FVRA 1UKAA 3QITA 3DD5A 1IZ7A 3S8YA 2X5XA 4B9AA 2HIHA 2GZSA 3WK8A 2JEYA 1SCIA 1XZHA 2WIJA 5JADA 1LLFA 5JAPA 1MX9A 1MT3A 3FSGD 4GXNA 1J07A 4UFNA 3I6ZA 1JT2A 2PUJA 4J7AA 2VAXA 3DYIA 2VF2A 4M0EA 2XT0A 4H0CA 3DKKA 3HXKA 5BV7A 5HQ3A 2WFLB 2XLCA 5AJHA 1Z68A 1U4NA 2AJCA 4WY8A 5E2IA 2ZVDA 4WDRA 1X2EA 3R3ZA 2HU8A 5LP1A 3C6BA 1WOMA 2HA5A 5AKEA 3MGAA 2XUHA 1F0NA 5AKLA 1CR6A 1ZD5A 1HLGA 2JGLA 3ICVA 3RARA 1LPOA 5FOQA 4KJXA 2EDAA 5ALEA 5AKYA 4Q82A 3FYUC 4Q3KA 1JMYA 2JGJA 3A70A 2PBLA 3IUNA 2XUPA 4OB7A 2OQVA 1Q83A 1HBJA 3O95A 1KU0A 2HA6A 1DQZA 4B0PA 1QTIA 5D6OA 1DWOA 2PSFA 4LXHA 3AILA 5CRIA 4YX9A 1SCQA 3EQ8A 4X6XA 2Q0XA 2RHTA 4BE9A 4AZ3A 4FDMA 1H2ZA 3OTQA 1T4MA 3HACA 1IUOA 1ISPA 2JGIA 5HF8A 3WKBA 1EB8A 5C8ZA 4K5QA 2HM7A 3SWWA 4FBLA 4L9AA 5KWJA 7YASA 1SOMA 3LIIA 3M3DA 2C0PA 3VJMA 2HA0A 3GUUA 3TRDA 3ZWQA 2WFLA 4LYDA 2LIPA 1UK9A 2P8SA 1GXSA 4B81A 5T4EA 3WIBA 4Y2UA 4C01A 4H7EA 3DEAA 4ARAA 5AI6A 4XJVA 2HA4A 1LGYA 5CT5A 4IH4A 1EHYA 5BWBA 2ONCA 1ODTC 3FSGA 4BVKA 3WI7A 2X8BA 5D7BA 1C4XA 5FPQA 4ZWNA 3N0TA 5IVIA 3ESCA 3R3VA 3OPMA 4GHWA 1TQHA 4H18A 3M82A 2XUGA 1IMJA 1UOOA 4GWLA 2CJPA 2BJHA 2WIFA 2FX5A 1DTEA 4G1FA 4AO8A 4CIBA 4FTWA 1JU3A 1YA8A 5AI4A 4BZZA 4G5XA 3PE6A 3OURA 3FVTA 1ZD4A 1TK3A 3STTA 5J3JA 2XI4A 3I6MA 1VA4A 5ALHA 4BAGA 5CT9A 4MEAA 3WLAA 4BDSA 2HHAA 1UKBA 2BCEA 4BRSA 3IDAA 2WM2A 2XUAA 2B61A 1A88A 4KRYA 5DYYA 4F60A 1EVQA 5ALGA 4PSDA 3FYTA 5IVDA 1RYYA 4U2EA 3C45A 3PF9A 2XMDA 4UUQA 4AO6A 5H3HA 5DTIA 2VJCA 3LS2A 4MQLA 3BF7A 1WHSA 2B9VA 1QIKA 1JMKC 5HZGA 1ODCA 3BL8A 1XZLA 2DSNA 2G4LA 1UK7A 4H7FA 4OSEA 3WK4A 4ZREA 5LZ2A 1JJBA 1F0PA 3F96A 3E4DA 5EGNA 2C7BA 4C89A 3CN7A 2FJ0A 5ALOA 4X90A 4JNCA 4K6HA 1G42A 4MEBA 1ZD2P 2AXEA 4IHAA 4U2FA 1VZ3A 3W05A 1QIHA 3O9VA 5CBKA 5AI5A 2RONA 1ETHA 2WG2A 4DNFA 2OQIA 2WFZA 5K5EA 2C5GA 3H2HA 5K3FB 2HDWA 3AUKA 3STYA 5ALFA 5FUMA 1P0IA 4NMWA 2C58A 1N5MA 4UBKA 4IH1A 3L1JA 1I6WA 3AZQA 4U2GA 5AOBA 4Q05A 5ALZA 4BYMA 2PL5A 4X94A 1E8DA 2FJPA 5EIHA 1XZIA 3ESDA 3JW8A 1A8UA 1FFAA 1CUEA 1TCBA 2CKMA 1O6GA 4XWGA 1WHTA 4KE8A 1C7IA 4M0FA 5FRDA 1E3QA 4W1RA 3BJRA 2WUDA 3D0KA 5LKRA 2XMZA 5IH7A 2B20A 3R0VA 3DOHA 1P0PA 2BUAA 5FP0A 2WUFA 3KXPA 4LYEA 2AJ8A 4CFSA 5CXXA 1NX9A 4O08A 5ALKA 2WUGA 2ES4A 2JIDA 3AIOA 3C70A 1D07A 3QPDA 3D2AA 1XZAA 3UUEA 1CUXA 4A5SA 1XRNA 3H19A 3KD2A 1WCYA 4Q1VA 4DYHA 5CH5A 3U0VA 1UOPA 4XIIA 1GQRA 5K3FA 1BN6A 5LKAA 2WJ3A 3QM1A 2HA3A 4DIUA 3F8SA 1VA5A 4MYDA 3ILSA 5JZSA 5AKHA 1VLQA 3C6YA 3I2KA 3H2KA 4I3FA 3Q8WA 2JEZA 2HU7A 4AQDA 3WWCA 5CH3A 1XKLA 5AIBA 2GYUA 4J0JA 2PPLA 4CIAA 3WMRA 1NU8A 1JI3A 1AQLA 2D0DA 1H2YA 4DSAA 1CLEA 3I28A 4H7HA 2WSLA 1CFJA 2QVBA 3QMMA 4CG2A 2OAEA 5ALQA 2I03A 4Y2SA 3C5WP 2XE4A 5JIBA 5ALWA 5ALVA 5CT4A 4W1QA 3PUIA 4BP9A 4QNNA 1W6RA 2WIDA 5FPPA 5JD5A 1ZI6A 3FLAA 1XRMA 2C5FA 1EDEA 5EHXA 2DCMA 4X97A 5ALSA 1UOQA 5EHNA 2XMRA 4C4XA 4UFPA 4FMPA 3WYNA 5AKJA 3NOXA 5T4FA 5LZ8A 4EY8A 4L3WA 2YASA 3C6XA 2PSHA 4UHDA 2UZ0A 1E66A 1TCCA 4Y2YA 5FV4A 5JAHA 4G8DA 5DTJA 5LZ5A 5AK6A 1XZCA 3BIWA 1UXOA 4X3CA 1W75A 2WJ6A 3BDIA 1WPRA 3I6YA 4RPCA 1BN7A 1W76A 4OUKX 1IZ8A 4INZA 4J03A 4U2CA 3ZPXA 4A16A 1UK6A 4H7IA 2JGEA 2VATA 4FFWA 3NWOA 3K9BA 2H7XA 4YK7A 4FBMA 4L0CA 2O7RA 1UWCA 4KAFA 1EDBA 1MPXA 4UHFA 1GKLA 1ZGBA 4B0OA 3WKAA 1VXRA 5A2GA 4WJLA 2DQYA 3NUZA 5BOVA 3GROA 3WQHA 4PSCA 3A2LA 3D59A 2HL6A 4J0CA 4OU5A 4BTLA 3O4GA 1GGVA 5HF9A 3H2JA 5A71A 4MJ3A 1EA5A 3AJAA 1EH5A 3DYVA 5EIAA 1ZIYA 3EQ7A 1A7UA 4G8BA 5AKIA 4BRZA 5E4TA 3T52A 2WUEA 1QIJA 5ALMA 2WU4A 5ALPA 2VT6A 3SX4A 1CUHA 5DLPA 1LZLA 5A62A 2QR5A 4DMHA 2VEOA 3R3WA 3FAKA 1LPPA 3BE8A 3VJLA 4BDTA 1DX4A 3KOOA 4BCCA 3W9UA 4BP8A 3HYSA 2PX6A 1FSSA 1ZICA 3STWA 3TJMA 1VXOA 1SC9A 3M81A 2BUCA 3PFCA 5K3EA 5EIEA 3AIKA 4KE9A 4YPVA 2PUHA 4G4GA 2XDWA 1KU6A 3ZI7A 2Y1KA 3I2IA 2W6CX 4CG3A 3IURA 1WB4A 2WG0A 2VT7A 3R40A 4A23A 4BCDA 2DHEA 3D4LA 1QFMA 5AI8A 1PFQA 3WWEA 1YCDA 3H2GA 1JJFA 1TAHA 4EBBA 3RKSA 3E1GA 5CXUA 3ANTA 4UHCA 4ARBA 4XX1A 3SC2A 2YXPX 2ECFA 5CW2A 4ZRDA 4BCBA 1DT3A 5EHZA 1EB9A 1U8EA 4JUIA 4UBLA 4ZXFA 1GQSA 2PSJA 2ROQA 2WILA 4HRXA 5JAUA 4DTCA 4Q3OA 3GZJA 1U2EA 3KWFA 1BCSA 1CUJA 4GLBA 3VJKA 3IVMA 2QOEA 1XQYA 3ZLVA 4QDUA 5CT8A 2JBWA 1C7JA 2GYWA 3C5VA 3D3NA 4P93A 5AICA 4X91A 4K6KA 1VOTA 4Q3LA 3GA7A 4FNGA 5JD4A 1DU4A 3C6ZA 3VISA 2OGZA 3B3QA 5HF6A 4CCYB 1F6WA 2XQGA 1R9NA 3CN9A 5AKZA 5HFAA 4F21A 1MU0A 2XMBA 1LPMA 4N8DA 1QZ3A 2WIGA 4J0DA 3OOSA 3WJ1A 1AGYA 4C88A 5LZ7A 4B9EA 1AURA 5EFZA 3I2HA 3WL8A 1MNAA 2XMSA 4E14A 2BGNA 1H2XA 4PO3X 2PSEA 1WB5A 3QMVA 2GBCA 4W1PA 4UBOA 4ITVA 2PSDA 5ALIA 3I2JA 3D2BA 3AINA 3G9UA 1EXWA 5SYNA 3BDVA 1OCEA 2VSQA 2XLBA 5HF5A 1CUYA 2Y6VA 2O2HA 3G0BA 1XZFA 2OCIA 1XROA 3VDXA 4ETWA 5AKGA 1G66A 1QIEA 2GBIA 2GBFA 3AZOA 4TGLA 2IIVA 1QTRA 4J0IA 5K3DA 2WTMA 2HRRA 4BAUA 3A6ZA 1EVEA 1CUGA 1CUWA 1CPYA 1CUFA 4WFJA 2HFJA 4MYSA 2I3ZA 5CMLA 1FFBA 3C87A 4E46A 5DYWA 1H22A 3F67A 4CCYA 4E11A 4UBJA 4BTVA 4DSZA 4WDQA 5JANA 3X3HA 3GFFA 4GDMA 4HRYA 3O4JA 5E4YA 3HLKA 4B85A 1EK1A 2XUDA 1N8SA 2JGFA 1TKRA 5IVHA 1RWQA 1LZKA 4GW3A 5ALJA 1QFSA 5C7YA 4OD0A 4QA9A 1ZI9A 1QO7A 2E3JA 3FOBA 3D7RA 5ALYA 2QS9A 3R41A 2J4CA 1ZD3A 3SK0A 2I3DA 2JF0A 4G4IA 4Y2QA 3G0IA 4G8CA 1YA4A 1AKNA 4GBGA 3STXA 3IA2A 1GPLA 5AK5A 1H2WA 1J2EA 3WK9A 5CH8A 1Q0ZA 4BVLA 1VE7A 4QE3A 1R4ZA 1E5TA 4AN1A 5AM4A 3LCRA 5ALNA 2I78A 5DJ5A 1A8QA 2XQKA 4OYLA 1QOZA 2QTBA 2V96A 3DOIA 3STUA 1G5FA 3PI6A 3BJMA 3OG9A 1SFRA 1MN6A 2VAVA 4KE7A 1QIGA 4OCZA 2C0QA 2J4FA 5AP9A 3VVLA 5LLSA 2Z5GA 3DJYA 2CB9A 3DKRA 1ZJ5A 4JH0A 4TPKA 4QLAA 1LPSA 1MNQA 1QLWA 5KREA 4M0MA 4QDOA 2QMQA 3STVA 1T2NA 1K5PA 1EK2A 5AM3A 1XZJA 4EA6A 3WK7A 2JGMA 1R3DA 2CBGA 1YAHA 1JKMA 1H23A 1WB6A 4C4YA 5LYYA 3O9MA 1QGED 4X71A 1YB7A 4B82A 2VJDA 2ZYIA 3LLCA 2QUAA 3MVEA 1WPXA 4P08A 4QZVA 2J3QA 3WZLA 2HFKA 1YS1X 5EHQA 4K2AA 1FFCA 1LBTA 1XRPA 1ODSA 1UFOA 4EY7A 3G0CA 4QDXA 3ICWA 5FDFA 5ALRA 2GYVA 5D3ZA 1CUCA 3G9TA 5YASA 4BB0A 3ANSA 3RM3A 5EI5A 1YB6A 2QJRA 3ZLTA 3QVMA 3U1TA 4X6YA 2WJ4A 1YSCA 1DT5A 2DR0A 1K63A 2HA7A 5JARA 5ALTA 3CXUA 3WK6A 4HZGA 1AMNA 1X70A 4PV7A 1J06A 3WA7A 4X6UA 4MXDA 5DNWA 2CEKA 1YS2X 4BAZA 4C87A 4BZWA 2WTNA 4N5HX 1QONA 3I2GA 5DNUA 5KBYA 4C4ZA 4BC1A 2QT9A 3V1MA 1Q84A 2W22A 4CG1A 1MX1A 3FYUB 1CUAA 3H17A 1HPLA 4ZGBA 2X76A 3Q0TA 1ORVA 5T4BA 3WK5A 4B6GA 5JYCA 3EIOA 2WHPB 3QPCA 4NVRA 3HJUA 1W1IA 3ZV7A 1OXMA 4GEGA 5AI9A 4OB6A 5JAOA 2ZJ6A 3QZUA 1K4YA 4HTAA 3TGLA 1LBSA 3L1HA 5ALLA 2XUJA 5AM0A 2WG1A 1RP1A 2XUIA 4H77A 2XMQA 1KEZA 2XUOA 3AZPA 1XZDA 3FBWA 4H7KA 4FLEA 4UBNA 2ZJ7A 4HAIA 1QIMA 5DNVA 3EF3A 5I7UA 5AI0A 2DFPA 3A2MA 4Y2PA 1L7QA 3D2CA 3JYHA 5JZBA 2H9YA 3DQZA 2V98A 2PKYX 4UHHA 1VE6A 2XB6A 5ALXA 4WFKA 3CCCA 5BWCA 3DS8A 5IVKA 1SCKA 3FYUA 4LXGA 2Z8XA 3H18A 3R3XA 5JZ9A 3BXPA 3PFBA 4IO0A 4CI9A 2PVSA 1ZJ4A 3IIIA 3L1IA 3HI4A 3W04A 4UFOA 1L7RA 2BGRA 2YYSA 3MUOA 4B7ZA 4J3JA 4AO7A 3I1IA 5AOCA 1BRTA 4KE6A 1CQWA 1JJIA 4AX4A 2VJBA 4OYYA 3FCXA 4HXGA 5AM2A 4S0XA 1QIDA 3EBLA 3IUQA 2AJLI 2ZYRA 2G63A 3IBTA 1XLVA 2QJWA 4PQEA 1QIFA 3R3UA 4JYPA 1Y7IA 3H0CA 1HKHA 2QRUA 1FJ2A 3V9AA 3FLEA 5ALDA 4WCVA 2RIPA 3B12A 3KSRA 4LIPD 3MUNA 3G7NA 2BKLA
chains in the Genus database with same CATH superfamily
5JRZA 1VECA 3ANMA 3DZIA 5JNUA 3SHQA 3HTXA 1QQBA 1EBFA 2IYVA 2Q1YA 4LDNA 4ALJA 4HNVA 3UUFA 1TOAA 3BJZA 3HJCA 4FE4A 1C9EA 5AJTA 2HKIA 2WIAA 1LNQA 4R7GA 1JZSA 1NWHA 3GEMA 3E9NA 3W5IA 2JK0A 4IDNA 4X24A 5FBRB 1E7YA 2ZITA 3CLHA 2QYHA 3GT4A 3HVIA 5LB4A 1MCZA 5FPHA 4INPA 1LWNA 1T0UA 3C8DA 4LGYA 4LV5B 4MVJM 3U7RA 4ZOLA 4DNPA 5JHGB 3OLQA 2EIHA 4RK6A 5ISMA 4CIXA 1LPBB 3SZRA 1RTKA 3WYAA 1NYQA 5HK8A 3U7QA 3B20A 3MYYA 3HRHA 2V4UA 3MAAC 4PFSA 4CN8A 1H9CA 1YHNA 4ZCLA 1T0BA 5KQSA 5DNDA 3D8SA 3RNOA 3RSSA 3W06A 1OU4A 3VTZA 2AC7A 4ZEMA 1BEZA 4CMCA 1K08A 2ZBRA 2AT1A 2CYCA 4X85A 2GSWA 2JGDB 1ESMA 1GZSA 2FEOA 3VNSA 2W7TA 5JMOA 3FNHA 2V7VA 2Z2YA 4X44A 3PQ8A 2HJSA 2P5UA 5I3ZA 1RJ9A 2X22A 3WIOA 1O58A 4PYOA 4Q9KA 4CKZA 1DC6A 1I3CA 1B2LA 2W8ZA 3ANLA 3MWGA 1K8ZB 4V0NA 1APBA 2IYPA 1VB5A 3HCDA 3HCNA 1KZ7B 4IDQA 2ZJ5A 4R2HA 4ZAVA 4ZVRA 3I61A 1EQUA 1OYVA 3U40A 3HUDA 1YZUA 1XU9A 3HGQA 1NSYA 4HXFB 1Z0ZA 4C7BA 2CNDA 3UOWA 5FT9A 1L4KA 2BELA 3G2OA 4FEAA 5FBWB 2WD7A 3HV2A 3A14A 3O83A 3FYHA 2PQ0A 3T4XA 4AP5A 2B4QA 4BWVA 3KOUA 4NRDA 1XAGA 1Q92A 1MDBA 3WKCA 1F8FA 1W30A 1DO8A 2ZXUA 2OQRA 2V7QA 4KQCA 3DZJA 1DMRA 2CL0X 2IA5A 2VHTA 4CM6A 4JEHA 4HYEA 1YDHA 1LNSA 3BPSA 3N6XA 3NIGB 1D6MA 4HDRA 4PG7A 5ESWA 5JR3A 3P45A 3VR3D 2J9FA 2AF3C 2WE7A 2VHUA 2EDCA 3ILHA 2BPOA 4L0MA 2HBZA 4OJMX 3K6SB 4YRPA 4AZ0A 5AMXA 2QVLA 3TW8A 4XDHA 1RMYA 1JQJC 2JCVA 2QT1A 2Q8NA 3AEUB 3ND8A 5WRFA 5HYVA 2UKDA 2ORWA 3B2EA 4L4YA 1M5RA 4RMNA 4NZPA 5J4HA 3GJ4A 2RGBA 3LDFA 2JFHA 2P9TA 4BLOA 1PEYA 4P8RA 5HK9A 2IP4A 3DE0X 1Z3CA 1ZOIA 2XWJI 4MLPA 5C46F 4LF6B 3FTCA 4DLVA 3LV8A 2ACWA 5CFQA 4HN4B 1WKVA 4QXMA 4FKZA 4DCMA 3W4KA 2FZVA 1XA0A 1O97C 4KTVE 2AXNA 1JA0A 4AAYA 4JL6A 4US1R 1TCAA 4MR9A 3SX2A 2AOUB 2XMGA 2ZR8A 3CLSC 3CLVA 1JIQA 1KSJA 2H7CA 1I51A 2I55A 2R6JA 4IQ4A 2VJMB 1EQAA 3I9LA 2REOA 1HQDA 1RLUA 5D84A 4BO4A 1ULSA 1X9GA 5EESA 5JALA 1RQRA 1N2CB 2Y1GA 3QPAA 4G81A 4YJFA 1C9NA 2RI6A 2J31A 4CM3A 4Q1AA 2HWKA 2Y1FA 5FBLB 1XZMA 1IDN1 1L3CA 1ZUWA 5IKOA 5I51A 5TMPA 4DY4A 4V2IA 2QLLA 3ORFA 3VNBA 3AF5A 4TS4A 2CFOA 2J48A 3LWDA 3N05A 5CK5A 4BV9A 2XHZA 3PXCX 1EINA 4FEGA 5IG2A 2JJ2A 3DFIA 3ZXXA 2PKCA 5CA0F 3TIVA 1NBHA 1YZTA 3L5KA 3MELA 3PRJA 2EKQA 2DU8A 3MMPA 1ABBA 3PLRA 3TCXB 3WB9A 3FOEC 1UT6A 4WFQA 1Q7GA 3IDSA 1CS4C 5KJEA 4YT2A 2HWYA 4MVJF 4BU1A 5EWJA 1HTTA 3BG5A 1SQGA 3CKKA 4EA8A 1L6IA 2OD9A 2RC6A 3GYGA 4Z9AA 3VNQA 4D9NA 3KQLA 3AM1A 4XGNA 2I1VB 4TKLA 2BDTA 1ZW6A 2ODBA 3OMWA 2EBFX 3KEOA 4HEA1 3WBJA 3C7CB 3IQWA 3LQKA 1XD2B 1C29B 4FE7A 3T7SA 3ETJA 3L9WA 3PUVA 1X2BA 3LNCA 2NPFA 2RGCA 5C81A 5FTLA 1P75A 4YI3A 1V35A 3HDHA 4IX9A 3CUEF 3OO1A 3DLTA 3SF0A 4GGMX 4CUZA 3RAEC 1YJBA 3GJ3A 4II7A 3WNZA 4CMIA 2POQX 2QL7A 1MAAA 3PDCA 3ESAA 1SB8A 1I3NA 3HYLA 5I4IA 3VAZA 3W5HA 2CV2A 2BEUA 2W6OA 3LRPA 3TZ6A 2GB4A 2VQ6A 3OZUA 2V7GA 4DDHA 2WJYA 4DMMA 5LQDA 4C29A 1N9ZA 4C21A 1YZNA 2ZBGA 3TQRA 1R9MA 2ISQA 1BE8A 1A8IA 1YZFA 1P29A 4F97A 3GJ7A 1PR1A 2OHHA 2Y66A 4Y6GB 1G4HA 5GGYA 4OU4A 4FX2A 3ZKWA 2QUIA 2E4UA 1TEHA 2WU0A 2DTEA 2VWGA 2Y4NA 1LTQA 2Z4RA 2ZBQA 3QOWA 4IUDS 2ZI3A 1ADCA 3RUIA 3UAOA 2C4HA 1K75A 2X23A 4I4TA 4YQEA 5JISA 2ZE6A 3WLIA 1WTCA 5TQJA 3VI3B 3PYLA 1GKKA 2QZ9A 2R6CA 3OHPA 4UREA 4U6QA 1XQWA 4X7MA 3X43A 5C8XA 2C7OA 2EJTA 2J3EA 2O57A 3BGOS 2WHQA 3AR4A 4FJ2A 4QWWA 2OFFA 1M33A 1O95D 2HF7A 1OFTA 3EQ9A 3NKLA 4K9MA 3RR2A 5A5GA 5CDFA 5FWDA 3JD4A 1FFDA 4TWBA 2B1IA 3GVXA 4IFTA 2WQ7A 2A58A 2JLYA 4W5NA 4LHXA 1PV1A 2AYXA 1GCAA 1VJ5A 1BEEA 1U5AA 1YT5A 3KPYA 3D7NA 4LV8B 4Z53A 4XFDA 3RVMA 4CQLA 1YB5A 1LQ2A 3IB3A 4HDSA 4F7WA 3D8RA 1ILWA 5BOSA 1XQ9A 2BC9A 2IU6A 4S1TA 3ZE6A 3C3EA 2GAIA 4C9BA 1ZWLA 2A4MA 5KJFA 4UM8B 1TUBB 1FYVA 2FMFA 3UMJA 4BNXA 5IJ9B 2WQZA 4R81A 5DKFA 2H29A 1V8DA 3KJIA 1PJAA 2NIPA 4FCVA 4LE1A 4W8OA 1KVUA 2B5OA 3W2IA 4EF5A 2E6KA 4D98A 2EX1A 5AW7A 3Q5DA 1H6AA 1LPNA 3A1DA 1DINA 1E9SA 3TZKA 2CJFA 1U8UA 3WLFA 3VU0A 1A9ZA 3DKVA 4NH0A 2V4MA 2Q5LA 4E2FA 2VHJA 1C7FA 1I3LA 3TIGA 3NHSA 1LY1A 4IHJF 1QAQA 1BX3A 2KJQA 2HB6A 4KFTA 4BNLA 5EJEA 3KCNA 4DC9A 3B53X 5C3MA 3T3DA 2CMFA 2JI4A 3Q40A 3R5XA 5JNRA 2HWUA 2V9ZA 2DWPA 3T0GA 4C0SA 5LDHA 2YMLA 1RU3A 1FFXB 3DWFA 2FF7A 4WWHA 1LDMA 2ZT7A 1LKZA 3ADKA 3DL7A 4L22A 3I0ZA 4AXXA 1SVKA 4BLPA 1EWQA 4TQGA 2V03A 4DNQA 4UBMA 1KY4A 5FHRA 1JHVA 3ETCA 4TTVA 4Y2VA 3SC3A 5KU7A 1DC7A 4FYVA 2JZOA 2VSFA 2IHKA 2XXBA 3H8SA 2V7BA 2SECE 1Z08A 2E49A 3CRQA 4UJ3A 1A2KC 5IBQA 5BMVA 1Y7HA 5HBRA 4BJ6A 5BNIA 4MQBA 2LCFA 2AN3A 4N5NA 5J2TF 1FRFS 5GOTA 3GV0A 1HRKA 3E7DA 5TGDA 4HB3A 5B58T 4E5PA 4XQCA 3FWHA 1RJEA 2GUWA 2QQ5A 3EOZA 3G13A 2YWBA 2V5VA 4BX9A 4C1BA 4B43A 1XX6A 1ETUA 1Q0RA 1U0EA 1XZGA 2D7JA 2AL7A 4KACA 4RKEA 2R6DA 3NATA 5IKEA 4KZKA 1AX9A 1C0PA 2XRFA 2VTEA 4DJ5X 3WGIA 5JY6A 1B7GO 4QYMA 3ET4A 2L69A 4OTZA 4H1HA 1K1EA 4EI8A 4F4UA 3FTFA 3MWYW 3MTAA 5EZ5A 2QRHA 3LP8A 3DXFA 1GZ7A 3HBAA 4L5BA 3L07A 2RGGA 3HC7A 3K0FA 2OAGA 3V1NA 3P9NA 4CKBB 3H9BA 3WLHA 2GZMA 3UAZA 3D6FA 2EWVA 5E6RB 1MP0A 1T8UA 1ZWKA 2IELA 3H2IA 4LMRA 4DN6A 4J3NA 1QKKA 1TZCA 2GPWA 2LXNA 3B48A 1LD3A 3WY9A 3ZWXA 3I32A 1D6JA 1FLNA 3G9XA 3PGKA 1WZIA 3BWBA 3SFZA 3V48A 3GGJA 2YZMA 2PA0A 2Q5IA 4QWMA 4PFJA 2M32A 4W9NC 4N7BA 2BBWA 1UZAA 2OPHA 4C76A 4YAKA 1DLIA 3U4MA 1GPKA 2G1UA 3LP6A 3M5PA 5HFNA 3IJPA 5IEJA 1C1HA 4BNJA 3VBEA 4RKFA 2V4ZA 1KZ4A 5TXGA 3DOFA 4M1EA 4GUAA 3QE3A 5IAKA 3WYEA 1WMAA 3H75A 2ALJA 4DIBA 1H66A 3GXOA 5A4KA 5JXGA 4JI8B 1BXGB 3BH7A 3HYTA 4MQ5A 2NU7B 3DTNA 3X1WA 1E4VA 3OU2A 3P0EA 4ZI7F 3FDZB 2W6QA 5KYVA 4QLOA 3LFHA 4JT4A 1I01A 4PPNA 1JYSA 2GXUA 2WMDA 1ZNXA 4HXEB 5EJ5A 3HP4A 2B35A 1LX7A 3JWHA 3O0DA 1E4OA 2OLEA 4LJAA 4LSGA 4RESA 4ZTBA 4BJ1A 4HLUA 1G21B 4EY5A 1KFCB 1F60A 1QNLA 1IBKB 1SXJA 3FNBA 5AIAA 2F3RA 1BXRB 4EAAA 1CG6A 3H11A 3ODPA 1QE3A 4WINA 4JYBA 1E5DA 4W82A 2EJUA 4EY6A 2IHUA 2NSHA 3DEFA 4Q3BA 3DL4A 3D3EA 1E8MA 3IVGA 2WKWA 3BCUA 1T36A 4HDKA 1N0HA 13PKA 4QYTA 4TV9F 3VKUA 4CCWA 1ACLA 4C7KA 4Z4IA 2ZJFA 4BLSA 1NVWQ 4U7HA 1W5BA 4RADA 1YQXA 2ZBUA 3R3HA 3TO5A 4D97A 3H04A 3B89A 3BWCA 2VDNB 5HMMA 2J46A 1OH7A 5GJVC 2ZCVA 1QE5A 4REMA 2CVOA 1G41A 1NBEA 4L9WA 1B41A 4B4DA 3BSYA 4MUJA 1JR3A 4GM4A 7REQA 1FNMA 2PX0A 2H57A 2QTAA 5A5EA 1CV2A 1JEAA 3HCOA 3RYTC 4B4VA 1NUQA 5CYPA 5BN3A 1NF2A 2OB1A 2QN9A 5ESRA 3TEJA 4EUHA 3CZMA 4PAOA 2R62A 3FGPA 4PRLA 4WKCA 3V5NA 4A8JA 2XW6A 1UODA 1XP8A 2E37A 2Q8PA 4RL6A 3MXOA 2RK4A 4QTZA 3WGTA 2QD2A 4BC0A 4E31A 2ADMA 1A0OA 2H63A 5SY4A 4W5OA 4ATNA 3EJWA 1TUGA 4RMHA 2KW5A 3OA0A 1G18A 2EERA 4F2GA 2FZGA 1PJBA 4XJSA 1G8YA 4JQZA 1YZHA 2R68A 4LRUA 2V3WA 3HKEB 3VKHA 4HI0E 1O4VA 3O1HB 1N2JA 3VPFA 1CP3A 3U26A 5IT5A 2RK6A 3OZCA 3N2KB 4U4AA 5ICGA 1WVMA 3WJAA 3DCNA 2VTVA 2P9CA 4B5KA 4WXYB 4OF4A 4JLOA 3ZE8A 4KB5A 4X93A 1XLUA 4BO5A 2BZ1A 3B9BA 1U0OC 2CLDX 3VU1A 2X6TA 4M0CA 1JZTA 1D1QA 2QIPA 3INRA 3CUVA 2W2LA 2CLKB 2GPJA 3DVSX 4NBLA 1LLQA 2AJBA 1ZVQA 1P1KA 3WWPA 2WUWE 3M34A 3AVXA 1PR6A 2JARA 4KEAA 5GZ3A 4R5HA 1M8FA 4JL5A 1PL7A 3HM2A 4LCBA 4MR8A 3A7EA 4CM5A 4D4LA 3OFNA 1E2IA 2VBCA 2A1IA 3BWVA 4WVFA 2KHZA 3ZHOA 3QVKA 3IP8A 2IDJA 3AG5A 2FSFA 3AL2A 4KHPB 1MIHA 3CRNA 4J94A 2UU9B 4DF3A 3PX7A 1DX6A 4RJLA 1NC1A 2ERYA 2O7VA 4KQIA 2G9RA 3L79A 1ZY2A 1R6DA 5CCBA 1FP6A 2A0YA 2BH9A 3ZYCA 2OBXA 3TTWA 1MO2A 1NPTO 4ZARA 3RRBA 3NR2A 3BILA 4P9NA 3PHIA 1KI4A 1RRCA 4QASA 4ZVVA 5IMSA 4L3VA 3QV2A 1P4GA 4RENA 1UJNA 5IX8A 3L7KA 1VHLA 2GI4A 1UDAA 1VPTA 2V6FA 2OCLA 3FKSA 4IY1A 4W63A 2IYYA 2G0AA 3ONFA 1RADA 4BEBA 1CU1A 3VQTA 4NFHA 1RC1A 1NVUQ 1BHJA 2JFPA 4L4XA 4PSUA 3SBOA 1U3UA 3X1MA 4CRWB 4DLNA 3QVVA 4WY5A 3RHZA 1AOXA 4IV8A 4KCGA 1LK0A 4D3XA 1P3DA 1HDOA 2QXUA 2RHWA 1A5TA 1R74A 3CCFA 3EMVA 1FVOA 2ID4A 1GHTA 1OF1A 4X6LA 3P0JA 3SN6A 1WNTA 3RK1A 4AY5A 1PHRA 5DDIP 3U81A 4BLQA 3T9FA 2YWDA 4HZIA 1E4YA 1KQNA 1CDOA 4G26A 2UVDA 4XCVA 2O59A 1UKCA 4RFSB 4I36A 2GYYA 3IELA 1RRFA 1M0SA 4RS3A 2EEPA 4UXHA 2QSJA 4JCCA 3V6LA 4LYGA 2FPWA 3RC9A 2R79A 3E03A 3LL7A 1QDEA 4OMFG 1JHPA 2AEFA 1KOFA 3FH0A 1TZJA 2Q9CA 5K4GA 2FEPA 1PQUA 3WA6A 1UEIA 2A5LA 3Q1KA 2J3MA 1U7WA 4N1AA 4FZVA 1UPCA 2QD5A 3EVDA 3QH4A 2FSVC 3C8HA 3IMGA 3NOVA 4RVHA 3N58A 1F4LA 4EUFA 2YWCA 2D5AA 4JP3A 1PG2A 2WIKA 1CERA 2IPAB 1JHOA 5SYAA 2V0NA 1YJCA 1YFZA 4I66A 1QU3A 4YRZA 5FORA 4LISA 1E94E 1I4LD 1GTMA 2XEDA 2EFGA 2GTHA 3G0GA 3LHFA 4F0JA 4DM7A 4XQ9A 3GLIB 1AKRA 3P0RA 2Z2KA 4YYZA 2CUTA 5U1PA 3O4VA 1V1RB 4RA6B 4B84A 4ZYTA 1M8PA 2HN9A 4DMKA 1GPBA 1S1CA 1SG0A 1XRRA 5KYGA 1THTA 1NJ1A 4E15A 4EBFA 5K8VA 3TXYA 1QFYA 4DB4A 2FMTA 1V45E 1Z0DA 1MRZA 3JYPA 4YO8A 1XD9A 2YV3A 2XNDD 1ZI8A 3ZCXA 4BPRA 3M1LA 4BKQA 5M04A 1QG4A 1KNQA 2WK1A 3M4JA 3QYJA 5CLQA 1MRSA 4JLJA 3PPXA 3FKQA 2VF5X 1IY1A 1E69A 4HZUA 5CLHA 4QG3A 1C1XA 1XL1A 4C6HA 2WHRA 4BNFA 1X1DA 5FH9A 5G0UA 1N6LA 1DS6A 2GZ2A 1JB1A 2GPSA 4D0NA 1NN1A 2G67A 4AG6A 4Z5XA 1VBMA 2GN2A 2FOIA 4MWTA 4CL0A 3JVUA 4UHEA 3GLFB 5G0SA 5EKDA 3H6GA 4M87A 2HMWA 5CTAA 3GB9A 4Q39A 4QPCA 3RI3A 3H3JA 2A7XA 4DMCA 2HADA 1VPWA 3IRUA 5LUBA 1PP4A 3RODA 4G37A 1TVMA 4J0HA 2PRIA 1RVV1 1UXHA 2LRHA 1E9VA 1GUFA 2I9PA 4PHHA 1RS0A 1TIBA 4Z9BA 1GPAA 3H9JA 3RV4A 4XD2A 3PRHA 1VE3A 2R5NA 2Z5FA 2NZJA 2BGJA 4PHCA 2Z4TA 5EIBD 5FBHA 2LUOA 3HHPA 4NS4A 1SK8A 1XHEA 4ZQCB 2BHLA 4FFLA 4OSPA 4R05A 3VZQA 3AQ4A 1W2WB 2G3YA 2G5PA 4O4JB 3COYA 1K88A 5K3SA 3KQPA 3DHYA 3HEMA 5ALUA 1ZCBA 4JUAA 5JOQA 4UEWA 3LC7O 5LP6B 5KB3A 1KQPA 3PF8A 3BQNB 3RYIB 3EC7A 2VWHA 1VJRA 2PDAA 3KJEA 2O7SA 4OP1A 3RS7A 4C08A 2G83A 3DDOA 2C54A 3EOBI 5SZJA 5JSFA 4WLEA 1A4IA 4EX6A 5HA5A 2QDXA 5BUQA 1XHFA 2WOOA 1BXKA 1T24A 1KSGA 1P74A 2Z43A 4RFVA 5KHAA 3CX7A 3BOSA 3K9CA 5HZHA 3LBYA 2JEYA 3GNTA 4JODA 2OTCA 4A3SA 4AZ3B 3W3AH 1GR1A 2OYSA 5JADA 2PIAA 4OHZA 5IP5A 4IIJA 2CNLA 2NUPB 4XWOA 2FWNA 3HZZA 2XYRA 4IQ0A 3E6AA 4BZQA 4S1PA 2P4SA 4DY6A 1C50A 3QSGA 4ZA2A 4J7AA 4F4FA 1MH1A 2A9VA 4M36A 5LQCA 1I8TA 3PDIA 3TD6A 4DCCA 2IXBA 2JLXA 4H0CA 3DKKA 4P2GA 3SSAA 1H85A 2PZJA 2RAFA 2A0FA 3H0KA 3U7GA 4PXSA 2XTJA 4XD7D 4Z0HO 2QTMA 1RACA 1P81A 2NZWA 3SQNA 3QUBA 2QLMA 3EWAA 1JXMA 3IVCA 1VJ0A 1Y6ZA 5ITZA 1AK9A 5F78A 5TR9A 1GXSB 2AJCA 5BNWA 4KGDA 1GEEA 3RG8A 5CYGA 4LDPA 1VG9B 4WDRA 4UAVA 1X2EA 1PX2A 4WERA 3UCFA 3WGNA 5HCIA 3DPSA 5DK4A 3M49A 2Z6UA 5LP1A 1S02A 4BMVA 3PPIA 1E2PA 3R9KA 3WE7A 1FPQA 2CVZA 3B60A 1QGZA 1C1DB 1V1MB 1XQ6A 2J6BA 3OZGA 4B4KA 1ZIPA 4E03A 2EC5A 5AKEA 5FPKA 3EQZA 3FOAA 3JAWA 4LZJA 5G0TA 1DXOA 3P19A 2P9YA 1FXWF 1IATA 1SNYA 2JAOA 2QW0X 3N8IA 4IDEA 4QYSA 2C5HA 3TLZA 5M34A 4P7JA 5BSMA 4TROA 5EKXA 4NCJA 1Y4ZA 4MV5A 2I34A 2RBGA 3F1LA 1K6IA 5TS3A 3D7KA 3ZK7A 1Y6QA 1YOVB 1KRWA 3V2GA 3SM9A 2IZ5A 3CJQA 2CXXA 2JGLA 2PRSA 4HDQB 2PH1A 4FR0A 3B6MA 4EHLA 3DBHA 2I2XB 5T41A 5JWHA 3T5AA 1BVRA 3AGQA 4BVAA 2MINA 3ML1A 4LVCA 4P7GA 3AM4A 2BFDA 1ONNA 4QNRA 4GSYA 1OFHA 4QXQA 5F7OA 1SRQA 3MT8A 2BEKA 3KXDA 3OQ6A 3SSOA 1KTVA 4AMGA 4AS2A 1EUCA 3OKPA 4IGEA 3JQEA 4O4IB 4BFLA 3IAM1 4QFCA 3IS3A 3HBFA 4R2WA 5KNDA 3GT0A 4LXUA 1B3RA 3WVNA 2V6GA 4QULA 3ZI4A 1BJRE 4BHTA 4DSTA 1BSVA 2C2BA 5LQKA 1OAOA 4CUJA 2ARKA 1XMPA 2UV8A 2ZUSA 5IBRA 2HJHA 5C8YB 1R15A 2RGDA 3SYMA 1GQOA 2A3NA 3MJEA 3O2NA 4WRRA 1HBJA 3WMGA 3O95A 4JBGA 3CWCA 4XJTA 1EJ0A 3MAJA 1LK7A 3UY4A 4OQPA 2YMQA 4ODIA 5IFKA 1TYDE 5FWAA 3NDIA 4YRNA 5BV8A 1HYHA 4DLUA 1GUDA 4LXHA 1E3JA 1FTYA 1IHUA 1RXUA 1T29A 5CRIA 3X1YA 1NMZA 2DFLA 2VXCA 2QA5A 3EFBA 4NJOA 1WZ2A 3RS0A 3OU7A 4HAVA 2HNAA 4FOSA 4BE9A 1AD2A 1DARA 3LHIA 4JROA 5JEEA 1GN8A 1GLVA 1IQRA 1MD9A 2WVGA 4OL0A 4LGVA 3UFXB 4CEHA 1PNVA 3OTQA 3FVVA 1P1FA 1U7XA 2F1JA 2JIZD 3ELBA 4CEIB 1IUOA 3LXRA 1GVNB 2FSGA 4BMZA 1U3CA 4BLTA 1L5HA 4HNUA 1MO6A 3SAJA 2AX4A 1ZJWA 1BDJA 3DUWA 3GDHA 3AH8A 3VNUA 3BAFA 4G5HA 4N3BA 5BQOA 2DPYA 3EQ6A 4C43A 5K4AA 5KWJA 2FMKA 1QU2A 4NDZA 3BWYA 2A5JA 5B3AA 3WIEA 3TIIA 2HA0A 1YZGA 4DCGA 3L04A 3VR5A 3TRDA 4P0PB 1KY5A 1VG1A 3H13A 4O4LA 3ZWQA 4NY1A 4LYDA 4QLBA 2LIPA 1WHSB 2Z57A 3UIEA 2DUWA 5CA1F 2DOKA 2YJGA 4NCIA 2A1UB 3FCEA 4Q4DA 1CW2B 3S2UA 1R4NA 2HAEA 4YMLA 2O2DA 1UBTS 3MBOA 4F06A 2PT6A 1JEEA 3GW8A 2HK7A 3HY6A 3DR5A 1GAEO 4FN4A 5J9FA 4CPDA 1DZIA 3NC4A 4XJVA 2W0SA 1HQCA 4AZSA 4YUXA 2YDXA 1IOVA 4LNHA 3EVTA 3E18A 4QXAA 4UNSA 4RTMA 2DFNA 3OAAD 5BWBA 3K8OE 1ODTC 3RE1A 1PWEA 3FSGA 4QPZA 4D3SA 4YAFA 3AHHA 2JDIA 1RRMA 4V39A 4ZV4A 3UAYA 2J0UB 1U0RA 4F12A 2GZAA 3EQ2A 3K15A 3NNNA 5IVIA 3SIWA 3R3VA 1TGVA 2Y99A 2H16A 3FUUA 1IMJA 1M6HA 4GWLA 5CB4F 4URFA 3IIKA 4R2XA 5CTJA 3UK6A 3HU5A 4O8ZA 3GT7A 2QVCA 3DDHA 4YJ2F 4J2OA 4IFBA 2Q7XA 2O48X 4II2A 4LGMA 1DTEA 3G3EA 3QUQA 4FTWA 4JBLA 2DE0X 4F8JA 3F3YA 2NQ8A 5AI4A 3UMRA 2IPOA 5FWNA 3HKDB 5F1KA 5A2QA 2YIMA 2VFAA 5I7AA 2PYZA 1P9RA 5P21A 3PE6A 4Z51A 1IPFA 3OURA 3OZDA 4G2NA 1MFPA 4G1MB 4LZLA 1NW4A 3V4ZA 3VV2A 2GD2A 4FEYA 3X2EA 4ENUA 5C18A 5J3JA 2QSUA 4AG3A 1E0AA 1JGTA 3EDMA 1WW3A 4R7TA 5IW8A 5TMDA 1NZFA 2ZS8A 3TAXA 5K05A 4KUEA 4YBZA 3DULA 1KORA 3ADOA 1KBOA 2QLFA 1VA4A 2YRWA 3PWSA 5CB8A 3EZ9A 4D8TA 4P7KA 3SDBA 1OVGA 1P2DA 2H11A 2VHYA 1MB9A 1YA6A 3QFHA 1GYPA 1GPYA 3AVVA 5CJJA 5I9SA 5BO5A 5DHQA 1CRPA 3N2YA 1TUEA 3E9QA 4BRSA 1CJMA 3FNIA 1PNTA 3IKLA 1VYHA 1NDQA 4DLRA 5KSZA 1W48A 2B61A 1CETA 4KRYA 4Z7OB 3L4KA 3A1EA 3GH3A 4F60A 1GFZA 3BFXA 1FMCA 1NXXA 2V65A 4HMQA 2ZT8A 4PSDA 1I1QB 5ALGA 1C30A 5HIAA 1RQPA 2ZYAA 4TSKA 2F3SA 4XRGA 3EDQA 3VC7A 1MB0A 1ZSVA 4AD8A 3H4MA 3UXHA 1CNEA 4UUQA 2RGXA 3ZE7A 2FU5C 1QGDA 4TXNA 3S55A 5H3HA 2B82A 5EUCA 2M6RA 1YNSA 1X7YB 1EX7A 1PN3A 3LS2A 2FPGA 2Y68A 3K9QO 4BNNA 4K9RA 2PMCA 4DUGD 3L3BA 1OGJA 1QIKA 4H6PA 1WHTB 5HZGA 4MVJP 1ODCA 3VU9A 1GPMA 1IZZA 3U4IA 1RWVA 4RIIA 3BL8A 1KZYC 3UO8B 2BMVA 5FUQA 4LQLA 3KC2A 4RZIA 4C30A 2WHXA 5BSVA 4GRIA 4RETA 2HCFA 3DE7X 5A3QA 3QW4B 4OBWA 3H9CA 2FLWA 2VQEB 6REQA 3ECSA 2XHEA 5L7TA 3JQDA 3GGGA 2PRJA 3THWB 1LRKA 2XDQB 3FFWA 4OSEA 5DHFA 3WK4A 5GJCA 1G2IA 1X9HA 1T5LA 1N5DA 3ESRA 3PVCA 5CVTA 5GINE 1U9IC 3E4DA 1C2YA 1BRMA 1N8NA 2F3TA 2B3DA 3JAKB 2D6FA 2BL4A 5EGNA 4H6WA 5D1HA 4NZNA 3KTFA 1AMOA 3C39A 4FMCB 1XXLA 5EE9A 3EGWA 1EGAA 4U7DA 5ALOA 1P3Y1 2HEIA 3MA0A 3U7FB 1SXJE 2G71A 3OBBA 2GR9A 3UXYA 1VFNA 1OROA 5H81A 3V1UA 2C4UA 3COSA 3QKTA 1NQWA 4R69A 1GKIA 2E7ZA 3ZV3A 2IHZA 4IJWA 2PAAA 3F5QA 3LWZA 1ZD2P 4MEBA 3O3NB 1SD2A 2W6MA 4OV6B 2Y93A 3V7YA 3SJAA 3NRCA 3RSOA 3AHCA 3VNVA 4IHAA 5EJMA 2I22A 7MHTA 4BYGA 1QIHA 4DTIA 1JFFB 3D7LA 5A02A 1E96A 1ZLYA 5G1PA 2P0AA 3W2FA 3WLJA 5LXTB 2XJ9A 3PX3A 2FP4B 2XRYA 3AQIA 3MN1A 2ZG6A 3QVLA 2JHFA 4Y6RA 3UBTA 2FOXA 3KHKA 4OHRA 4C07A 3VZBA 1LSSA 2WG2A 3MBIA 4MV9A 1IBLB 1BQ4A 1W8IA 4TL8A 2I2DA 1HL3A 4EYGA 3RBAA 3PZBA 1RPTA 3AUKA 1PGQA 1JR3E 3GCGA 5ALFA 4B8WA 1ZGAA 2VDRB 1BMFA 1R0SA 4NMWA 2O8CB 3ECCA 1H5QA 1P4AA 3TQOA 3UV7A 2C83A 3NV9A 4IXNA 5ICSA 4HDMA 3NGLA 2UYQA 4K9SA 5E38A 1U8YA 2OGUA 3A04A 5H3CA 4Y6SA 3RF6A 3ZY5A 2RHMA 3H84A 4XWWA 2H1OA 3G5UA 2MSKA 2O3SA 1G9XA 4Q05A 4BQPA 3JWJA 4EGFA 5TMBA 3DTVA 4H27A 2NUTA 2EHJA 1HFEL 3B3GA 1ZXLA 4IZHA 4YRBA 5KVVA 4ILEA 4CT0A 3CC8A 2YN0A 4KI7A 4U5XA 1J8QA 2YV4A 4DLYA 1DG3A 1Y3DE 2TSYB 3C7KA 1NRIA 3IT3A 4BMDA 5DP2A 4FR5A 1Z35A 2QAIA 5I8WA 1OPXA 2LVBA 3WBKA 2J6HA 1P45A 1KE2A 3JW8A 1A8UA 4H0NA 2OHOA 4F6RB 3KTOA 1CUEA 1H42A 3GK3A 1EM6A 1OR8A 5C32A 1XZPA 3M6XA 1R6TA 5C4IA 5LR6A 1QHSA 4WOJA 1HDCA 4XEHA 4OI0A 1T25A 3HY4A 4CMEC 2IQ5A 5KQLA 4BEVA 1OPRA 2WUDA 1SHKA 1TJ3A 5LKRA 2XMZA 3S2IA 3F49S 4JL8A 1ZKDA 3DOHA 1F2DA 2QEQA 1FYEA 2BUAA 1I4WA 1H3FA 4QUEA 2FUG1 4PC2A 4BN4A 4YT5A 5FP0A 4CV0A 4FMBB 3K73O 4MIKA 4LV6A 1SULA 2HMUA 4D74A 3A10A 3E1KA 5JXIA 5B6PA 1L9XA 2GEJA 3CEMA 4BRUA 5K8UA 1KMMA 1NX9A 3GP8A 4EYEA 4OP3A 3W79A 2B4AA 4PG5A 1GEGA 4L27A 2XR1A 3WP0A 4EAQA 1ADBA 1AKQA 2BFFB 2CYAA 2EZTA 4JUFA 2ES4A 2R6GA 4QBIA 1MV8A 3G2PA 2FUCA 3HO8A 4IF4A 3S44A 3TWOA 4M8IA 1S8NA 1FX1A 3JR3A 3AKCA 2VF7A 3Q72A 4ID3A 3AVUA 3GJ5A 1W25A 2F43A 3OQJA 1CUXA 3EUFA 4GOXA 1XDSA 4YJHB 3GPLA 1MJHA 1UM8A 1FQOA 3LJKA 1XRNA 1R0XA 2AZMA 1W85A 3V32A 1IY2A 5TMEA 5F3DA 5CBPA 1JBQA 2B69A 2HPAA 2XCTB 1HKUA 3L6EA 2PLWA 2WDZA 4J16A 1RYHA 2O8VA 4W9MC 4LJRA 1B8VA 1OVMA 2HO5A 4HLQB 2VPXA 4TKVA 5EYPA 2ZJBA 3TLXA 3M6FA 4IOJA 4CKEA 3EY9A 1JFSA 1A9OA 1KVRA 5LKAA 2JCXA 2M9MA 1K86A 1A95A 2WJ3A 4E6EA 3EVFA 4G5SA 3N7UA 1N2SA 5JECA 1NDUA 2QN1A 4LVOA 3LSYA 1QP4A 1AQJA 1G59A 1M34A 2BM1A 2W6IA 2PCLA 4R1OA 3I8OA 1QX3A 4CU5A 3Q2OA 5CLLA 5JZMA 2WB2A 3BE4A 3F8SA 3HXLA 1SG9A 2Y1CA 4MYDA 1H2BA 3WIDA 2JJQA 4U8GA 5BMOA 4Z4GA 2XKJE 4NAUA 3RYFA 3LMKA 2BSAA 4FFPA 4M7WA 1AA6A 2LE0A 5KYXA 2ZJ1A 1ISHA 3BEOA 1BA3A 3C6YA 1T1SA 2GXQA 1TMOA 2JI6A 1D7AA 3GGCA 3K4QA 1NVVR 3THRA 4DEXA 3RAPR 5EA2A 1COWA 3L8CA 4MKXA 4V1CA 5JRDS 3AB8A 2F55A 2EU8A 2FQXA 2QYTA 1RZRA 3NPMA 3BE6A 4DV0B 2EARA 3DAYA 3F78A 1HE1C 3W6ZA 1XNGA 1UJ4A 4PQFA 1E9EA 2R60A 5B1YA 3KFLA 4N01A 1H2YA 1OFVA 3AJEA 3K92A 4DZTA 4I55A 4BFTA 4BEJA 3VX3A 4P4GA 4DSAA 3HN6A 3E2MA 2YY5A 3IV9A 1X94A 4JLUA 4H7HA 1CFJA 3PGLA 3T61A 1WUJS 3E5NA 3DBIA 2FOLA 2FPPA 4ML3A 1L5NA 1IK6A 1AK1A 2OAEA 4W99A 4E5UA 2FQWA 3EDCA 5B5SA 2I03A 1UBMS 1YI1A 3R0XA 4BECA 5TS2A 2YXEA 3UJCA 1ZGZA 4R2KA 1Z7EA 1V37A 3AF4A 3I3SR 1DEKA 2XE4A 4R9UC 2OXCA 4UEKA 4RZXA 5B1EA 3PC4A 2PZ8A 3HE3A 4HDNA 4IOLA 1QH1A 3EVBA 1Q0QA 2C4MA 2J9RA 2V7XA 4IL5A 4ISBA 3HQ4O 1Q3KA 1IH8A 5AJUA 4D42A 1KJZA 5CVCA 2NZYA 4DNXA 4QNNA 4BGVA 4TMXA 4MHSA 1Z62A 4OM8A 2PZFA 1WOYA 2BKVA 4UUPA 4MP6A 2C9MA 1ZOLA 5EQJB 1TEZA 1MA0A 1TLLA 4EUNA 3EXG2 4PQGA 5KWVA 4GEKA 3TAUA 1GO2A 1L8QA 2GAFA 2F90A 3BMXA 3FMPB 5DCWA 4IRXA 3C4QA 4RV4A 1NMEA 2QENA 1ZI6A 3SD7A 2ZQZA 2C00A 3DFZA 2HPHA 4LE2A 1EDEA 2JIMA 3V4PB 3U4HA 1RKQA 5JYEA 3RFUA 5EHXA 2DCMA 4NH4A 5C0OE 1LLDA 1YQQA 3QHPA 3EY4A 2NPIA 1HYBA 4JWTA 5F9HA 1TM5E 1K89A 4FMPA 4ALLA 3B36A 1WZUA 4ZAXA 2IV2X 3E7PA 1S2GA 2ZAYA 3HBLA 4PICA 1ZRHA 5LZ8A 4BQSA 2DH5A 4AECA 1NJFA 2YVAA 1TTHA 2PSHA 5D00A 1LSOA 2UZ0A 1F0KA 4UTNA 4ALMA 1P0CA 1Y1RA 2FW8A 2JAPA 4G8DA 4QHYA 1W35A 2GEDA 1BOOA 1FMJA 1G5HA 2NZ2A 5FI1B 3GFTA 5FNZA 1QRTA 4GC9A 3RBVA 3DZCA 3L40A 3GGOA 2HSGA 4TLEA 1TYZA 2VJKA 4OATA 1V16A 4IGIA 4X3CA 4ACAA 4C4TA 1HV8A 3VSAA 5BV1A 2WJ6A 5IANA 5J4YA 3TL6A 1KK2A 3W5BA 1N5KA 2CSXA 1TLFA 1SBQA 4G0PA 5C52B 2ZVJA 4Q5IA 3JD3A 2FKAA 5LA6A 3H5VA 5L3VA 5LDGA 4PX3A 4EPVA 4MB2A 3KSDO 4RPCA 1JLLB 4MS4B 4OUKX 4EG0A 2I4TA 1BJTA 1CJUC 1SG6A 1V2GA 1V3UA 3NHWA 3K0AB 1BE1A 4INZA 4D4HA 3RS9A 3EPHA 2GFHA 1V8ZA 4AI6A 4J03A 2R9VA 3BRWD 4TS9A 4A0GA 1MGOA 3O3OB 2VHEA 4PINA 5DB4A 4QYIA 3R9IA 3KZXA 1YWGO 1CLUA 1JEQA 1QP7A 3RS8A 1KI2A 1COZA 3IBSA 1PW5A 2ANCA 2EAUA 1QH9A 3NWOA 4KQXA 3VR6D 3K32A 3ORHA 3HU2A 3SE0A 2B37A 2XVMA 1GAWA 3SZUA 2CJYA 3G2HA 5ES3A 3REQA 2GF2A 1GL7A 4B75A 2Y27A 2XOKA 3QBDA 4TRJA 4DJAA 1UAAA 4YGYA 4G1EB 3A1CA 4EL0A 7ADHA 1WDKA 1IN5A 1EDBA 4Y98A 2AG0A 1NATA 2HO4A 1R0KA 4MW2A 1RWXA 2O50A 4I1VA 2HX1A 1AS3A 1OXBB 2F1IA 4OHYA 2EZ8A 4FYMA 4YMTA 4EO4A 4Z2YA 3RG2A 3LYUA 5JJLA 4D9FA 4PVDA 4N0QA 4MVJG 4Y2HA 5GTDA 5TX7A 4PSCA 3A2LA 2B0CA 2YZGA 4RHCA 5K45A 1WLYA 3DBLA 4YN3A 2BY4A 3SIRA 3EGDB 2ZUCA 4ESHA 1C8KA 5EE1A 4QBFA 2NU6B 4BMOB 2JK1A 3B2NA 3G2IA 4IJQA 2YV5A 1GG9A 1K6XA 1KGDA 2BFOA 3H99A 3NHLA 1MW8X 1XVIA 4IIXA 4DARA 3PQ7A 1GU0A 2OHXA 4L8YA 3UA4A 4EVRA 3OX3A 4R68A 3JCZA 5EZYF 2YW2A 3AW9A 4B3DA 4HR7A 1Q1NA 2WV9A 3IUYA 5CITA 5F35A 3L7NA 4H6XA 4ER3A 1FUYB 4G1UC 2WZCA 4Q02A 2JFOA 2M1ZA 1T1RA 1PGNA 4ZU1X 5JJCA 4CLEA 3NH9A 4AUMA 5KWEA 1KQGA 3AJAA 1EH5A 2FQYA 1PL8A 2C88A 1YB4A 1U8XX 1JWAB 5EXXA 4BO0A 2CMDA 4Q19A 4G1VA 3UICA 4CI0B 2VUIB 2C9ZA 2ZFUA 1E6LA 4UEJA 4FWTA 2FX3A 1A98A 4G8BA 1WKCA 4ARZB 3R0IA 3PEWA 4WA8A 5E4TA 4KWIA 1LW7A 4JJ6A 3DP9A 1RHJA 3T52A 1PNRA 1YCHA 3WLQA 4PTLA 1IULA 4EMBA 2HDHA 5AK0A 4NJMB 1F6DA 2VI5A 1DV2A 3PXEA 2W4MA 4XE5A 5F7JA 1O5IA 1KJJA 5ALMA 3K1TA 4JC4A 4CM1A 1HDGO 4TV8A 4G8JA 1I0ZA 3JVEA 1L7NA 2VT6A 4C0XA 1CUHA 1N3BA 1LZLA 4YC7A 2GEBA 3SHFA 1QPGA 1WQ1R 5LQUA 4XR9A 5A62A 2QR5A 3DFKA 4KO4S 2CNOA 4BKUA 1UINA 1T2FA 3BTUA 4EATA 4DWJA 4MCHA 4KXLA 2YDYA 1XYGA 1ZUNA 2IJGX 4ZJYA 3AGPA 3THXA 3BE8A 2F64A 1H2AS 3JYLA 4NYIQ 4FOOA 4KQ6A 4Z86A 4BIMA 1D8TA 2BBSA 1PUXA 2WBLC 2ZIZA 4PX5A 3A3PA 1SVWA 1CZNA 4QOIA 4UVGA 4BBPA 4IILA 3STWA 4JGGA 4DILA 4Q00A 4EMSA 5EJFA 5CCDA 4DVJA 3MK31 1HDIA 2Q3MA 1DTWA 3L7DA 1Q1AA 3DOOA 1I2DA 4M0DA 2VUHB 4MR9B 5HE8A 5B1SA 3G8AA 2DP4E 4FYPA 4QJ3A 2B1RA 2NVBA 2GLUA 1HE5A 1PZEA 3CG0A 3GFRA 3SFTA 5EIEA 5K3EA 4HY3A 3P94A 8ADHA 2TMYA 3NHJA 4M6WA 3X0DA 1T2CA 2KWIA 3FYSA 1RFGE 4UMDA 3I2IA 4K9KA 4EZEA 4D57A 1AG9A 3TOSA 1UBCA 2P1RA 3K1AA 1WB4A 3AI1A 1FUIA 3UWOA 8MHTA 1P62B 3DLBA 2HK6A 1SUPA 2OLJA 2YHUA 4P4UA 4Q16A 4EMUA 3ODGA 3QBEA 2WJGA 1N78A 1J2UA 2VA8A 2DLCX 3DLIA 4PXYA 1G8AA 2O8DB 2DHEA 1FFSA 2YIJA 3WWEA 2NXJA 2EF1A 1RLTA 3JARB 5CNJA 1FSZA 3KEMA 3BB3A 5HKLA 4RTSA 3H2GA 1E9CA 4M9QA 1JJFA 3CW8X 4RQAA 3OU6A 1TAHA 1QQ7A 3P71T 2J3KA 4LJ5A 2PWZA 4LTNA 3ZWAA 4M46A 3OZWA 4RA9A 5A6SA 1EXVA 1HETA 1MGPA 1N6NA 2ORED 4P33A 3T34A 3CO5A 3ZVMA 1HNWB 2XWSA 2GAAA 1VJDA 3EVNA 4M21A 5TT1A 3CRVA 1I4EB 4Q1CA 4Q4JA 4EBBA 1MG0A 2M6LA 3RKSA 3S1SA 3MAGA 3ZNPA 2BFPA 3AEKA 3SLKA 3KPWA 3TL3A 5FPYA 1SKYE 1HNNA 3NTVA 4ARBA 3LNTA 3B7WA 4A1FA 3TX6A 4PHFA 3GCDA 3SC2A 2YXPX 3PC8C 4CTOA 4ON9A 2GHIA 5HKOA 5CW2A 1MJGA 1FVXA 2BN4A 5C5CA 4QVIA 2COEA 4O6VA 1A50B 4UZFA 4IDPA 5AVZA 2EHDA 1Z45A 2QROA 2CE2X 2ROQA 4HRXA 1EMDA 4KSCA 4XM2A 4CMIB 3CIOA 2CXQA 3K8QA 4L4SA 5C3UA 1JFVA 4KUHA 1CVIA 1IHPA 2WVHA 4GPIB 3BZBA 1W93A 3QMPA 4LW8A 3CQ9A 3VJKA 1JP7A 1E79A 4MKIA 3C3JA 2QOEA 5FUXA 5FYQA 1YNOA 1HDZA 3NTRA 4OXRA 3NAQA 5KWSA 1XQYA 1S7CA 3PHCA 3ZLVA 2O0JA 1U6KA 1ZAYA 3PJEA 1CEYA 1KXJA 2OVFA 4L8WB 4RLQA 5ADWA 2YIDA 4YO7A 2VDOB 3O84A 4YALA 1EWYA 1P8AA 3UJ3X 1OAKA 2BEJA 3MOSA 3D0RA 2OKCA 4E5SA 4FW9A 5JCJA 4W8GA 2GYWA 1E1QA 3D3NA 4M7RA 4P93A 4X8OA 1OB2A 2IZ0A 1HZZC 1Z2NX 5CLGA 3NC1C 4EG3A 2CJXA 3FPHA 4QGSA 1UZUA 2CVFA 2EGUA 1VHWA 1GSAA 2O2XA 2QX7A 4WK2B 4JOQA 2XY4A 3SF8A 2C78A 3R24A 2PGLA 1GU7A 4GM1A 2EQAA 4MLZA 3UB3A 1JDBB 1PR0A 1SO8A 4FNGA 3FAZA 2QGNA 5BYAA 4I81A 1Q7CA 2I6GA 2JI7A 4QT0A 4WD3A 3AWDA 3TKYA 3ZU5A 4G4SO 3ACCA 1ZGGA 2OGZA 3D3WB 3CWZA 3LTEA 1MJFA 1SD1A 4LWQA 4RVUA 3QEMA 2YKGA 3N9IA 2XQGA 4RGVA 1H2RS 1HX7A 1R9NA 5BNTA 5AKZA 3JU3A 1MKYA 3IJ5A 4FFSA 5HFAA 5T3YA 3NONA 4A4DA 1ISRA 5BN5B 2JCYA 1SU7A 3OLWA 5KMGB 1QZ3A 2ISSD 1QCDA 2CBZA 1LF5A 2WIGA 3PC6A 4O4JF 1JUDA 4MUHA 1R0BA 3KRTA 3OOSA 4NYMQ 1N32B 1C9DB 3QJYA 4JDUA 1N8KA 5LP6F 2F9MA 3OFVA 3L1VA 2QG6A 3GFPA 2O8CA 1G8KA 4C7OA 4C88A 3UA3A 3AUYA 5LU9A 1JAHA 4KWHA 2OHJA 3PP8A 1LXCA 3W3AA 3D4OA 1FW8A 5AUNB 4ZIRB 3PGMA 3ZW7A 3I2HA 2HMVA 3E58A 1KPHA 3BTSA 5D8DA 5B2EA 2YUIA 1MNAA 3GAMA 4ZJZA 3U1BA 3Q41A 4QGHA 5MHTA 5KTOA 1P7YA 5BPFA 4X60A 1I5OA 3TOCA 4EY3A 1ZN2A 3R8CA 4DBZA 3HGMA 4F11A 5I5GA 4DLSA 4Y9DA 3KLBA 4G1CA 4ITVA 1Z73A 4PX9A 4HADA 2B3TA 2OP1A 2ZRFA 3OZVA 5ALIA 3TDNA 3W8RA 3H8WA 1KC3A 1QHGA 2XIQA 4PLGA 1NXTA 2GJ9A 2QVGA 3EXHB 1LH0A 1T26A 1EFAA 1KQ3A 1CEQA 2ZYTX 3AINA 2PWBA 4UU0A 2ZU0C 3USZA 1ESNA 1CIVA 4H3SA 1T8YA 1WV1A 2A9RA 4DA0A 3BK2A 2G80A 4H3KB 4QYWA 1DIHA 1ECJA 3FDJA 3O38A 1R8XA 4CCAA 2ZTLA 4YDSA 5AVUA 1HFKA 2GZHA 3A7DA 5IVDA 5LP6C 3NHKA 2C98A 2OL4A 4XGQA 3DE2X 3GMTA 4PZAA 5KAPA 3U56A 5BMVB 1J00A 2VTKA 3WTBA 1XZNA 4UUBA 4HS4A 1EP9A 5AKGA 5AFSA 2VBFA 2VP6A 3D0OA 3DUFB 3N8HA 4BO7A 3K9GA 5DWQA 4AJNA 2GBIA 1SHJA 1JYFA 5C53B 1PR4A 2CE7A 5HEKA 1YZKA 2ENWA 2QR2A 4TL9A 3IV6A 1SBYA 2FB9A 3OE7A 5DBFA 1V5WA 3V4LA 4JP1A 4IUBS 3K96A 2BGLA 2VPQA 1M7BA 1NP7A 1K68A 1BMQA 2NYAA 3AONB 4NONA 3URMA 4LK2A 3KOWA 1XUOA 1CUWA 1RWWA 2P2GA 1NQXA 3L6RA 4RGQA 5AW6A 2Q1UA 3ZGOA 3K5WA 4MIEA 2G8LA 4EHAA 1L6RA 5ENDA 4EYQA 2QBYA 3JQ8A 5A9TA 1K8YB 3WSTA 2HFJA 2P3OA 3GUZA 4OXKA 3OWOA 5IFLA 3B78A 1SCDA 3EARA 3LYAA 1FFBA 3OTHA 3S2SA 4JGIA 5F2OA 4E46A 3P20A 4Q18A 1RJWA 2BMAA 2XA9A 5LL6P 1G8MA 3QTLA 1FXSA 5EWLB 5JXHA 2N47A 4W9NA 2Q2VA 3AHJA 3QF4B 3PU6A 4ZZIA 4NNOA 1QZUA 4BJ3A 5HFJA 3DAFA 3MCTA 3A9RA 3NHRA 4DSZA 4KG7A 1OXKB 2KB0A 4X20B 4WDQA 4G85A 1NBMD 4TMZA 4AJJA 1RBQA 2HUPA 3GFFA 4R8VA 1TF7A 3LUKA 4AY4A 5F98A 4HFJA 1N5JA 3FOWA 4GDMA 4HRYA 3ZZTA 4IIYA 3HLKA 4B85A 3U4QB 3VNRA 2GBPA 5D87A 1YUBA 2AS0A 1ONPA 2XUDA 4D9GA 2D1QA 4OLBA 1Y4AE 3G8DA 1NL3A 1KOJA 3L8EA 3FUXA 1N8SA 1VKOA 2GN8A 3GH1A 4Q21A 2VCEA 1TKRA 3HJGA 2FFHA 4X7PA 5TQ2B 3W8NA 5CEJA 4N3NA 2O8BA 3FCSB 5D3QA 1QFSA 4JB8A 1OSNA 2C84A 2NQTA 1QRAA 3ME5A 2Z9DA 1WXDA 1PGJA 3NIWA 1D4FA 2OAQ1 1ZI9A 5F4BA 5FCDA 4NCAA 2E3JA 2FK8A 1I7PA 3FOBA 5DCLA 3D0QA 4TQAA 1WXXA 2BE7A 4RTPA 3ZBPA 3RTAA 1Z12A 2H85A 4LDRA 3KT8A 5JTUA 1XAHA 4ENWA 5IS2A 1ZVKA 1OC2A 1JR2A 4FFBB 4NCKA 4W7HA 1MOQA 3SLGA 2OYRA 1YHZA 1T35A 1ZD3A 3QW2A 1A77A 4X61A 3SK0A 2GXSA 5EJIA 3K0CC 2D2XA 4MUNA 1G5IA 2I3DA 3WLEA 1E5VA 2W2TA 3HA3A 3P9CA 2P2LA 4G8CA 3F4KA 4LQDA 2FQQA 2W11A 2WZDA 4M1OA 3THOA 1RXSA 3B9PA 2ATVA 4J7XA 5KTMA 3E2IA 1NV8A 2VL7A 2P4QA 4WQMA 2PLAA 3WNDA 3HU3A 1C5KA 5DTEA 5M5BA 1KP2A 2VXOA 1EE2A 1J2TA 2JB9A 1H2WA 2PEYA 1PEAA 3H97A 3OIYA 3KQSA 3PUZA 2JGAA 1E2GA 3C3DA 5IAEA 3IMCA 2OK7A 3ZXYA 4F6CA 3WK9A 5CH8A 3BS4A 1LV8A 3O03A 1UJ5A 2DETA 1RAFA 3KJFA 4EG1A 5BSEA 2P6MA 4P22A 1H3EA 5ECYA 4LDJA 3KLMX 4LXQA 1DKMA 4NWIA 4QE3A 3F4LA 4QXPA 7REQB 2CN1A 5IT4A 4ZFNA 1B0PA 3FPSA 4OQXA 4IRUB 4Z3DA 5BQ3A 1N6OA 4PAGA 3VZDA 1FNBA 2AOVA 3KYDB 2FN8A 5HIIA 2XXAA 2EGHA 4UUOA 4JBIA 2QTBA 4ESVA 1RRPA 4EQ6A 3QA9A 1FJHA 1TF5A 2HI0A 3CLTD 2VTBB 3LVBA 4YI5A 4B6SA 5JBNA 4TUYB 5IM4F 5AXBA 1JVSA 5I7VA 2RMKA 3BJMA 5K8IA 4HEA6 4J6EA 1Y3HA 1CF2O 1JQKA 1ZSYA 1TMYA 1RWBA 1SFRA 2YVKA 3N8DA 3OG9A 3Q6NA 4KX3A 3HR7A 4TN5A 5D3MB 3O8CA 2RSLA 2R1VB 1FTWA 4ZCQA 1QIGA 2WZQA 4HUJA 1F51E 1T43A 2ZUDA 3RIHA 3OY2A 3PCRB 2C0QA 2J4FA 2PO7A 1Y3BE 5HDQA 1VJCA 1WETA 1MAWA 1REQB 3WGQA 4AFNA 3OJCA 4NZOA 1J6UA 3F6YA 1UC8A 1T9KA 4JI0B 1GPUA 3V4FA 1G1AA 2BFAA 1S2DA 4J4BA 2D59A 1KXZA 4TPKA 3IPLA 2ZR0A 4Q9HA 3TTSA 1ZIOA 3CPJB 1P1BA 4QLAA 4OO3A 3HCBA 5IABA 4PO1A 4YP9A 3BQ9A 1RYZA 1A2BA 1QLWA 2PAFA 2PYIA 1SUCA 4QARA 5HJ2A 4RYLA 1T8SA 1DTSA 3UG7A 1VCIA 4ER5A 3FIUA 3GIDA 1HG0A 3PFIA 2WNHA 1EK2A 4MR8B 5BNFA 4E12A 1E2BA 3QX3A 3Q8XB 4IBOA 2JGMA 5KX5A 2C9DA 4QJ5A 1YMVA 4D9BA 4D7AA 4MWEA 3ZTWA 1R7RA 3DONA 2GRUA 4PNPA 5KYWA 2QP3A 4OI4A 3KSMA 2EL9A 2Q2QA 2QRVB 1XJ5A 2WDPA 3CSSA 3O21A 5KNBA 2BMFA 2VP2A 2GM9A 1A9PA 4HH3C 1N9KA 3WB0A 1OLSB 5F2KA 3ELWA 4WLVA 3F46A 1WSDA 1Y3FE 2G9UA 3S5UA 4MMXB 3K09A 4MGYR 5IJ0A 2Q3LA 1KZGB 4TYNA 5JQGB 2I4NA 1H23A 3CY6A 1SZPA 1U2TA 2Q5CA 3JQCA 5H0IA 2EJWA 1YL5A 1K2VN 1CR1A 3QFFA 3EE6A 2VVTA 1A9QA 3ADCA 2DKOA 2F3PA 3V8RA 4B82A 1T1GA 4WZBB 1IPEA 1RAEA 3P9YA 3TL2A 2PX8A 4MA4A 3EPRA 3RS5A 1RCUA 4A2CA 3FG9A 3NYRA 3QBTA 3UAWA 1WPXA 1XMOB 1OI7A 1U7UA 2Q21A 3ZX5A 1H6DA 1JW9B 3FWPA 1P61B 1UFKA 1GPWB 3GF4A 4YRAA 3FVQA 2FHPA 1D7OA 3J81k 1QOPB 4QYXA 1E2HA 3O90A 4UM9D 2F8MA 2CL6X 1VL8A 1FFCA 1LBTA 3N7AA 3TUZC 3C0KA 3CISA 1DGQA 3T38A 2C04A 1J33A 3G0CA 4MUIA 4QDXA 2R25B 4L8FA 3ZUGA 1SVNA 1KYIA 4E5NA 1NVXQ 4CIDA 3WC4A 3HBJA 2AA3A 4IIDA 5HR5A 4WXPA 5DOVA 5FB3A 3NYWA 1Z6PA 4WK0B 5D3ZA 2PGDA 5JMPA 1W4CA 1H4TA 3RYHA 1JIIA 1RLOA 5LBUA 2ZJ8A 4QFBA 5GVRA 2B1GA 2P5YA 5KYNA 2I9KA 2A92A 5DHPA 5GY7A 3WO1A 4DM3A 1DRKA 2MTBA 1UAGA 4YRDA 2IHBA 4WADA 3G9QA 1JHYA 1Y81A 3T1NA 1XL0A 3NBQA 3RM3A 4LRSB 5F2EA 3ZLTA 3LLUA 2H06A 4Y1RB 4CVNA 3W5DA 3O26A 1B74A 4NDAA 4DJEC 4GXTA 4LOKA 3FBGA 3FOCA 621PA 1SXPA 1HE3A 2WWRA 1S1MA 4YAIA 1UJCA 2HA7A 2QT0A 1SURA 1GGJA 3IHWA 3OP1A 5F3WB 3B6KA 4TYWA 4WLNA 4MR7A 3F7MA 4HDAA 4M8NE 4UM9B 5JNTA 4IIEA 2V59A 1ZK4A 3OHSX 1XMQB 2OBFA 2ZSDA 4HZGA 3LGXA 1S2OA 1AIPA 2NM0A 1OXVA 1C1XB 2FPLA 2QX6A 2W2KA 4M1MA 4XLZA 4C6SA 1LF0A 2PJZA 3EXEB 4GKKB 4ZN6A 1XXHA 3WA7A 1PJ4A 2X5JO 2GOYA 1NW5A 4X6UA 4MXDA 3TOVA 3QX9A 3Q88A 1YONA 2TMDA 4BKPA 3I5UA 1QRUA 2GNOA 2G0TA 3RRYA 2QN2A 2CEKA 1LRLA 1TMGE 4P83A 3RC1A 1IRXA 3UMSA 2ZI5A 1Z17A 3DBVO 4C6RA 2D8MA 4BZWA 1E1RA 3A4MA 3I2GA 5JS2A 2KBFA 3B6IA 3CFYA 4KLZA 1FSGA 1UEJA 2AMLA 2NXNA 2RHGB 2GEVA 5DNUA 3H5OA 4QU0A 3TIXB 1EA7A 2NUAB 3IMKA 1Q84A 5EE3A 2W22A 4HAWA 2W2QA 1U3TA 1MX1A 1FLDA 2FG6C 1CUAA 2P4HX 1D5WA 2B8NA 2P9GA 1JG7A 1HPLA 2Q3CA 3C74A 4MS1A 4AZWA 3T5CA 5FLXA 2XYVA 1TTQB 4NCNA 5AYVA 5CLJA 2HGZA 5K0CA 1K6MA 3E82A 4H6VA 4I50A 3Q0TA 4KPUA 4MRMA 2DAPA 2XDYA 4YP0A 1ORVA 4KPFC 5HW0A 1TIPA 1HM5A 3ZV5A 3AXTA 1ZRMA 2B99A 2J41A 2PZEA 3WK5A 3CF2A 2G08A 1UF9A 1O8BA 4BX8A 4B6GA 4P7FA 5TJ9A 1E7MA 4N54A 3VPXA 2LKDA 2EFHB 4IEIA 1HURA 2XCSB 3JYOA 3VYSB 3WLTA 3NFYA 2AGVA 3H5AA 4EGJA 4MI3A 1V0JA 3H8VA 4MP8A 5HKKA 3R6LA 2XAUA 1UDCA 1EX1A 2Q3FA 4WMLA 4C3OB 2VXBA 4ND8A 5FWYB 1GQ2A 3ABZA 4JVNA 1NW7A 3CT6A 3H4TA 2KSQA 4GEGA 3EBPA 5BVHB 1J0AA 3O8RA 4OGWA 5JAOA 2MYUA 4RIFA 2GPTA 4ZC8A 1N57A 3QZUA 1VSBA 4MQEB 1Z5VA 5TARA 3VO2A 2X3UA 2H3HA 3RO7A 2H4ZA 3MMSA 3UB4A 4A8TA 4CMKA 1RW4A 2CWWA 2MYPA 1BKYA 2IYRA 3QVJA 3ZGLA 1M73E 5JZSA 2ENUA 4OQMA 1LBSA 2YFKA 1QTNA 1V11B 2XUJA 3NHAA 3U4AA 3A28A 4QRDA 5IUJC 4H1WA 4TRNA 2I2AA 4Q4AA 3HB0A 2IU3A 3OQIB 1Z82A 3PDIB 3QVTA 3COWA 2A30A 2LPMA 1LBHA 5I3CA 3QPUA 1UMKA 2RI0A 1NXVA 4XQGA 5K0TA 3DCIA 2JLVA 2B8JA 2XEXA 1CRQA 4HVLA 1ZM7A 2AZDA 1CF4A 3FPLA 2NTYC 3BXXA 5TQ0A 4U3JA 2ZJ7A 2WM9B 2R7KA 3O92A 4X3OA 3SJZA 3AR2A 4FMDF 4MVJH 3ZLBA 2YMPA 2B2CA 1DJOA 1BDBA 1TK2A 2JJ1D 2IDMA 5DBOA 3CUTA 4TTTS 5GOZA 4RHFA 1P33A 2XGGA 2G82A 3IUSA 5C1OA 1RLJA 1H4QA 4L2IB 2HQ1A 2O4UX 1GYQA 1UPAA 1XNRB 3OIUA 5AI0A 4Z3KA 5JCOC 3BMCA 3VUFA 3U3KA 4DGSA 2FZEA 2VQ3A 1FSFA 3PNSA 5DOZA 2W2PA 3A2MA 3QU2A 4Y2PA 4KNYA 3AJRA 2QVYX 4V0SA 1ZPDA 4TWIA 5BRNA 5JZBA 2WAMA 1Z6AA 1TA0A 2Q2OA 2V98A 4LY9A 1VE6A 4CG1A 5CLIA 4IXWA 1X7HA 1KEEA 4XR4A 2HLDD 2GHQA 4NBVA 5I8ZA 3DS8A 1CD5A 4J2TA 3JTEA 2PMEA 1HT1E 3QKRB 2AXQA 2OLKA 5A4MS 3EGVA 2OGWA 3WLMA 3ZJTA 5KPJA 2EKPA 5IC4A 4CCSA 2RKOA 1G5TA 3A58B 3B1KA 4EI2A 3E3OA 1O6BA 4A6XA 3H18A 3C3AA 4TMTA 5CGQB 3M9WA 4V0MA 4V24A 1O96B 4FYKA 3IOEA 1EUCB 4IO0A 2M1XA 2NYVA 3W04A 1Z5NA 2VPYA 1X8KA 4TMKA 4GP9A 4M88A 2BV3A 3GXBA 4Q24A 1YC5A 3S1AB 1VI2A 2HHJA 3MUOA 2V8BA 3LW7A 3U7EB 1SRRA 2Q6OA 2I2BA 1T1JA 2VOEA