3EFHA

Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
314
structure length
307
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA02
4RADA 2IGBA 3KB8A 4RHTA 5IPFA 4P83A 1VSTA 2FXVA 4JITA 1UFRA 4PAWA 1L1QA 4LZNA 4RHXA 1XZNA 4LYYA 1NULA 1G2QA 1QB7A 1TC1A 1O5OA 4LZOA 3LRTA 2JKZA 5BQOA 1A4XA 1HGXA 1VDMA 2P1ZA 4P81A 4RQAA 5K51A 3GGJA 4RACA 5HIAA 1JLSA 2JKYA 4P3KA 1XTTA 4LZAA 1JLRA 1I14A 1P19A 3M3HA 4M0KA 3N2LA 1ZN8A 4TWBA 1P4AA 1TC2A 1DBRA 1XZ8A 1IBSA 1DQPA 4WMLA 3ACBA 5ESWA 4M0PA 1I5EA 1QK5A 3DAHA 4QYIB 4X45A 1A96A 2E55A 4S2UA 2EHJA 1PZMA 1NONA 3O7MA 4FYMA 3NAGA 5ESXA 5JSQA 1J7JA 1GPH1 1I0IA 1L1RA 3H83A 2GEBA 1ECCA 1STOA 4RHYA 5E38A 1ECJA 1CJBA 1A98A 1ZN9A 2YZKA 4PFQA 3GGCA 1DQNA 1YFZA 2PS1A 3DEZA 2DY0A 1OREA 4F8EA 1BZYA 1DKUA 1QK3A 1UPFA 1XTVA 4RAQA 4KN6A 4QRIA 1AO0A 1WD5A 4ZFNA 1LH0A 4OHCA 4JLSA 1P18A 1QCDA 3QW4B 3OZFA 4MB6A 4LYGA 2C4KA 1OPRA 1P17A 1I13A 3HVUA 4RV4A 4QYIA 3MBIA 1Z7GA 2PRYA 1A95A 1U9YA 1A97A 4RHUA 1HMPA 1MZVA 3OZGA 3MJDA 3LPNA 4M0UA 2H08A 2WNSA 4P86A 5HKLA 5KAMA 1ECGA 5EUCA 5JV5A 2XBUA 1OROA 5IAOA 1GRVA 1DKRA 1G2PA 1G9TA 2HCRA 1VCHA 1QCCA 4X44A 1A3CA 1Y0BA 5BRNA 4RAOA 2VFAA 1R3UA 5BSKA 1XTUA 4RQBA 1QB8A 3G6WA 4P84A 1FSGA 1ECFA 5KAPA 1BD3A 3S5JA 4WN3A 1O57A 3EFHA 4IJQA 1G9SA 3ACDA 3GEPA 3OHPA 2JI4A 1UPUA 1U9ZA 1V9SA 1BD4A 4Z1OA 1ZN7A 4RANA 2JBHA 4P80A 1W30A 2PRZA 1QK4A 2AEEA 1D6NA 3DMPA 1ECBA 2H06A 4RABA 2H07A 1I0LA 5BQPA 3ACCA 4P82A
chains in the Genus database with same CATH superfamily
2VK2A 1KEKA 2NSHA 3GAZA 3OQIB 1BGXT 2QU7A 2Y4OA 3COJA 5IDVA 4RD1A 2Q4TA 2JBWA 2FZ4A 2VBCA 3DOFA 4GNRA 4G36A 4I8XA 4C3VA 5BP7A 3BXEA 2OHVA 1A4XA 3KJNA 3RSFA 4AUKA 5F3WB 2LDBA 1P91A 1Z18A 2ZBRA 4N6GA 4UUNA 1GAEO 3SYMA 4CEJA 2OCKA 4HYQA 1OIVA 2C0PA 421PA 1M2EA 3K94A 1IYZA 2O23A 1LS1A 4OQ4A 3I39X 4F9FA 3TI9A 4NBVA 1M8FA 1V5WA 2M1XA 4GM0A 2JAOA 2ZS8A 3HNPA 1FFAA 2DEUA 4GI1A 1DRWA 3IBSA 5FQNA 1MB3A 4YMLA 5F1OA 1B6RA 3ZE8A 3NPAA 2VP3A 4BGVA 1GYPA 1OZHA 3QF7A 3H5TA 3W2TA 1R5BA 1IZ7A 3W7VA 1U28A 3GFVA 1AIPA 1FW8A 1SU4A 2DM6A 1PIWA 2QYOA 3ER6A 1CZRA 3DCJA 2IODA 5H1YA 3WO1A 4DMGA 5LP1A 2I3AA 3BXHA 4HWSA 4NU0A 4UHKA 3SHOA 2WT8A 3T7DA 1RJWA 5KJ6A 1G38A 4L0CA 3TQTA 1E4EB 1YU9A 4KWIA 4Q15A 4LJAA 1G5QA 3KELA 3T9FA 5FOWA 1QP7A 3TOZA 2WTMA 5ADWA 4L9RA 1G59A 1LF0A 3D0KA 1D2NA 1UXGA 4ALLA 1OI7A 2BFMA 1V1RA 2HCBA 2WSSA 3WMXA 3R0JA 4RIGA 1T1RA 4KMOA 5ALRA 3VVMA 4DA6A 5KNLA 4OUDA 1RQRA 3WIVA 3CX7A 3CPHA 2W8BA 1QHNA 2RGGA 1IBCA 2P2LA 4DPMA 2Q1UA 3WYGA 2OGTA 2NSDA 2IQ5A 1O94D 4PTZA 1F51E 3T0FA 4RD3A 5FWYA 3ZU5A 5EYPB 3IOCA 2BFPA 4UW9A 2VJAA 3NWEA 4YRQA 5AVQA 1CR0A 2PN1A 3AFIA 4KGDA 1NJ1A 3NO4A 5LB2A 3WGMA 2RMKA 3LBNA 5HUQA 3FTEA 2KI5A 5AW8A 1A5ZA 3L40A 2V0NA 3OY2A 5DV9A 2C5HA 3OUTA 5FPQA 3AJAA 3OPMA 3CNQS 1NVKA 2JHFA 5EKTA 2DTXA 3Q0TA 4HDRB 4OD0A 2NUAB 5KYYA 1Z35A 5KC9A 4HTFB 1QONA 1VXRA 3F9RA 4MAFA 5T3UA 2H4WA 1FYWA 3A37A 1BE8A 4RZ2A 1NQAO 1AHNA 1YB2A 1DAOA 2V5UA 5REQA 3UMFA 1BTOA 2PXCA 2Y93A 5ICEA 3GT3A 1P5FA 1PR0A 1RBZA 1VJCA 2E6UX 3KKZA 4UHJA 2QI9C 4KO4S 1G2OA 3H87A 3JYPA 1TTTA 2AFVA 2QTFA 4XD2A 4XX1A 4L5IA 5G4KB 4E1BA 1QU2A 3TNDA 3WLIA 1ZCFA 3VR6D 3MZ0A 4PX5A 1KWGA 1YDWA 1EUZA 2D5LA 1TU0A 3EQZA 1MVLA 3IALA 3N8KA 2EGUA 5ELLA 3PPIA 3RU9A 4B81A 4ISCA 4EAAA 1FUIA 3BIXA 3D4OA 1YQWA 1GFSA 3TSOA 2LKDA 2ZW9A 1XDDA 5JSHA 1H9AA 1N33B 2CHEA 5HG0A 3QMPA 4ZI7A 2JZCA 4HDNB 3NR2A 1U0LA 5BNWA 4HFNA 5EEHA 1EDDA 4PHGA 1NNUA 4YH1A 1FFXB 3QFRA 4OHWA 3W05A 3OQNA 4HRYA 3NMUF 1UFRA 2JH9A 5JVDF 1NF8A 4J7AA 3C8MA 1IM8A 3WMGA 1SPBS 1T43A 4K9OA 1J8MF 2JFHA 5M29A 1DTSA 1MB9A 2RBKA 1YIOA 2OQIA 4MW1A 3NVKI 1W46A 3IUBA 3AM4A 2JKZA 3I0MA 3OESA 2XX3A 3QV2A 1VE3A 1PEAA 2XNSA 5A3JA 5ALIA 5C9ZA 5L3QA 2W93A 4OKNA 1YC2A 5AICA 1F12A 5EIBD 5BOSA 4CF7A 1MV8A 4FZRA 5BT8A 3FNRA 5DN9A 4QLAA 2J9FA 5CT8A 4YHHB 3ICEA 1GTVA 2IUFA 2CE7A 2KBEA 1KIMA 4TWBA 4BWYA 4F5EA 2BEVA 3N8IA 1XOIA 4J2OA 4Z0PA 3A1CA 2G4CA 4TYWA 3DVSX 4LRWA 3MGAA 4P98A 1WE2A 5HXAA 1JIQA 1KS2A 5A71A 2I8CA 4KYTA 2FTKE 3ZNPA 3ETEA 3ND6A 2BR3A 4IDBA 5LP6F 4TTIA 2OG1A 1ILWA 1N5LA 3IAS1 1JB9A 3IQIX 1FFHA 4RWEA 3SC6A 4G5QA 1QQ7A 1PR5A 2BM0A 2UZIR 1HT3A 1TA4A 3KLBA 2V97A 2YVLA 2ZBDA 2OB2A 4KN9S 4UREA 5DHUA 2PWZA 3WADA 4KNWA 4Z4CA 1BE1A 2HA7A 4CTKA 1NZFA 5DI9A 3TW0A 5F7OA 2BF7A 1H2AS 3DMYA 2O2DA 3WFIA 5M34A 3ER8A 3IO3A 1Z4JA 3HN6A 1XNHA 4BNMA 2DC1A 3QVGB 2I7DA 5B55A 1XTRA 2M6SA 1W47A 3HY6A 4ND8A 2PMEA 4JOSA 3WK9A 1R18A 4ZO8A 5FTMA 1ATZA 1TCVA 4P08A 4AIIA 4R01A 4P6VF 4BVBA 5HZHA 1Y6GA 5JQGF 1PK9A 3DT8A 3FUXA 2C61A 2ZTMA 3M8KA 4PYKA 3IXLA 4PNZA 3PIRA 3CZCA 3N87A 2GPSA 3SD7A 3IP3A 3SSNA 4NATA 4EATA 1XCLA 3PQ3A 1VZ2A 1OZGA 2JI7A 4IDEA 4DL9A 1Z5VA 2ZANA 3GQBB 4KQMA 1SBZA 4O4HB 1U9CA 1R3DA 2V4ZA 4NBKA 4IHAA 1D9XA 1MVOA 1PNTA 2QL7A 1U5BA 3P2YA 4IV5A 4WRRA 3U7GA 2GPJA 4NPHA 2PQ6A 1SVKA 1NTOA 3L1VA 3DYIA 2NYUA 1X7YA 4G9BA 4AS3A 1TF2A 4M38A 3RF7A 1DJPA 3K4PA 2FG6C 3V7UA 3AG5A 3O4GA 3ENQA 1VCHA 2QKYA 4G5SA 2BGRA 1HYEA 2R2GA 4TTSA 5E95A 4GMHA 3VAZA 5D3ZA 1RABA 4QXAA 2CW5A 1JJAA 3H4MA 1U8YA 2JGNA 2ZRQA 1ZGJA 4WA7A 4GR9A 4ND2A 2YRFA 3HY4A 4RHEA 2G6BA 4ZOEA 2F7SA 5GQSA 3U4AA 5C80A 1O57A 4KZPA 2ONKA 2G5GX 2JAWA 4YRZA 1JJBA 4CMHA 3AHGA 3L4EA 3QGMA 1IHYA 4LI0A 1J0EA 4L4YA 3W2FA 4F21A 1I5RA 2H1RA 3IVGA 1KQNA 1IBKB 3ZYCA 4IQ8A 3V1UA 3V4FA 4JC8A 4CMGA 1C3XA 1U7TA 2UAGA 4WLOA 1SEVA 3BAZA 5C1OA 2TMYA 2IF2A 3UGTA 1WR8A 1KP9A 1YBFA 1CFJA 3PEVA 4RJKA 1XZCA 4JFRA 1WIWA 3B9PA 4XQGA 1X1CA 1YCHA 1FF9A 1QCYA 2JS7A 1ZM9A 1QFYA 3T9CA 2OM6A 1QNLA 2X1HA 4C08A 1ZCJA 1N2XA 2OKCA 4L9SA 5DLEA 1JS1X 1LRLA 1ZD4A 2BC9A 2ZOSA 3PPVA 4ZCIA 3WRYC 4D0NA 2P2GA 3VR6H 2C99A 3NRBA 4R1LA 5LUBA 4XFJA 3RVOA 3MGCA 2AJBA 2RC6A 1GZ5A 1NMSA 1V25A 1VM6A 2OBFA 3DGEC 3IUSA 4KGXA 3NG1A 3JSXA 1ULUA 4J1TA 4OUDB 1HLDA 4GP9A 4X91A 2W8BB 5K4AA 1D2RA 3WG9A 4PCUA 3UB3A 5CT9A 1U1GA 3D8TA 3WK4A 4RDCA 4PN3A 1JR2A 4H7FA 4NBRA 2ZZNA 1B1CA 2VAVA 2RGAA 3BSFA 3ITKA 4IMJB 4UEOA 5BMOA 3SQWA 4BVKA 4RVOA 3MWGA 4FFLA 3WAKA 4CW7A 2NZJA 4JBWA 3UMCA 3W2GA 4F92B 3AU8A 3T7JA 4MOWA 3D43A 1JQDA 1HZZC 2P9ZA 3CEJA 1P9OA 3TUZC 2EYQA 2WJIA 1OU0A 2BDEA 3IP9A 3IXQA 5JJ5A 1SCNE 2IZ1A 2QORA 5AO9A 4KDEA 4F5WA 2G28A 1S3FA 4IHJF 4O25A 4UFNA 5KCMA 4J3NA 2I22A 4CODB 2MT9A 2DQ4A 3LWBA 2FZGA 4KJZA 1EX9A 5K5EA 2R4QA 2GPAA 2WJGA 5DTEA 3ROXA 1T8YA 3N8DA 4S1PA 4DLKA 1M2FA 3T5CA 2NVBA 1NUHA 2R6DA 4NCBA 3RR2A 2IS4A 1DQYA 1VE7A 3E0XA 1VCIA 5HZMA 4AN4A 1HLPA 1F60A 4GPIB 3DLIA 2CLSA 3EFOA 3H5LA 4GOMD 4MYTA 2R8OA 3ZLTA 4RDXA 1YJ8A 4JCCA 1RJEA 4QXQA 3AH8A 4HS4A 1EUYA 4NV1A 4OH1A 5CFNA 4MQ5A 1DS6A 2B9VA 4DQVA 1M5RA 1HDYA 5KHAA 2XXAA 4DSOA 4RVSA 4BVHA 2GSDA 1G7TA 3O0DA 1D2EA 4MZXA 2FPUA 3OLZA 4B5KA 1CE8A 5DSXA 3SEZA 1LW6E 3R5TA 4CUJA 2HSWA 5KNBA 4D0SA 3JD4A 4GSKA 5BR7A 2OBBA 1ZAKA 2BEWB 3GCXA 4LDRA 3ZY6A 3K2EA 4UC0A 2C2BA 4LJSA 4WT7A 2O8BA 1R0BA 1JG1A 4DSNA 2BFNA 4Q66C 1PYOA 4KWEA 4ZT2A 1X7DA 4FFNA 1C4WA 2V9CA 2OFOA 1IUOA 1EE2A 2D59A 2HU2A 4TLBA 5L3QB 3CKKA 1OMOA 3TTTA 4MV3A 1EFCA 1RCUA 4RPHA 3CW9A 3A05A 3AVTA 1H85A 1HZJA 3EZ2A 4GOJA 3USCS 1XFDA 2BFAA 4RANA 2OAP1 5IH7A 5HJEA 1OFUX 4FLEA 4IQFA 2BEVB 1B16A 2ZRPA 4JT9A 4LJYA 1W30A 1RAEA 3AK4A 1E7YA 4C5BA 5FV4A 3H6GA 4I9FA 2VJKA 3TVTA 3TVDA 5JASA 2HF8A 1AGNA 2JGJA 4IDGA 2R6ZA 4CDNA 4IHQA 4Z4HA 1W5TA 1U1FA 4TN1A 3WNDA 3LZDA 3PXGA 5IC6A 1YO6A 1E6EA 3FPSA 1SUSA 3EJWA 4BN0A 4C4OA 1GPMA 3ZQUA 3KWFA 3TG8A 4URWR 1NVVR 2IHZA 2X0EA 4QJ3A 4DBLE 2ONYA 4E5PA 5BYAA 2C0CA 1YDHA 1E2LA 2WV7A 4MVCA 5U1PA 1N0HA 2XGGA 3CR8A 3EGCA 2FMHA 2FQWA 1MJNA 1BXGA 4G26A 1BJKA 3FJ1A 5DYNA 5FUYA 2IYRA 3EIQA 1UF9A 5TPWA 5PNTA 4KBGA 2HAEA 2JFXA 1XR3A 4ND8B 1PW7A 4R1NA 2RHLA 3E15A 3AJ8A 1RFLA 3IOBA 3C7DB 2VZ8A 4M0KA 4Z0TA 3RUDA 2PKRA 3MJ4A 3V9PA 3HJRA 3PYXA 1F4LA 1BXRA 3LQ4A 3Q8MA 5GZ6A 5HTOA 4WFJA 3MGGA 4HDQB 4KXNA 5I4KA 3HMQA 1DJMA 2BFEA 2CWWA 1Y3CE 2WUDA 3QPCA 1NJ8A 2UDPA 4WBNF 3U9SA 1NP6A 1QLHA 3C45A 2XUFA 2E55A 3F49S 3BGVA 3QBVA 4IGKA 4YV7A 1KDTA 2F8MA 1K27A 1RPTA 4EYOA 4ZYZA 3G7UA 1KYIA 4XUEA 1JSXA 4KFTA 4DCMA 4FJ2A 1Q1EA 2QTTA 1SA0B 4HN4B 4AMBA 1ZCAA 4KFUA 4AKTA 4IXTA 3OQOA 1NXQA 2C2HA 3O3MB 3W79A 2G80A 1LJUA 4IFBA 1JR3E 4KRYA 1Y3FE 1WQ3A 1JA9A 3CONA 1N2BA 2HJSA 4GEKA 4E2FA 5I7OA 2DQKA 1I6KA 3OTQA 4LHZA 4AX8A 2FQYA 4OB7A 3ROEA 4FYWA 4BNDA 1Q22A 4EFKA 5JD5A 3FAKA 4AG5A 5C4IA 5LIRA 4QRIA 2Z1NA 2REOA 1LFDB 3P2IA 4P31A 1Z7WA 2AOUA 2ESRA 4TTJA 4XB6B 1P45A 1TTHA 3MG9A 3RS4A 1QS0B 1DOAA 2H7YA 4BVFA 2E4AA 3OLQA 4GPEA 4Q48A 2ZUEA 1T8SA 1PG5A 1OT3A 2AOWA 1VB5A 4LNAA 2FSVC 1MUUA 2NGRA 1TIPA 1EGHA 1EM8A 4HRAA 3SU8A 4TGLA 4LV6A 4PSKA 3FUTA 1XXLA 4NBSA 2OWEA 2FPXA 5TY0A 2XLCA 3D6NB 3PEEA 2YFYA 1HL7A 4DJEC 1PZHA 3U3RA 4GOLD 2F8LA 1Y3AA 2INGX 1Z0IA 1GDHA 3KK0A 4P5PA 2Q5IA 5C8YF 1F8GA 2J0QA 3ROZA 1JNYA 1Z4LA 1M0SA 2VT2A 2Y68A 4NCHA 3B60A 3K31A 1E18A 2ZIFA 1Z0UA 2ZYDA 4JA0A 5AW5A 5IAJA 1IZ0A 4ABYA 1M1YA 2NAFA 3C3KA 1LWOA 3ON5A 4XQ0A 5HBGA 3TIGA 1E0AA 3S6JA 1QO9A 2YV4A 1G16A 3TF5A 3A1DA 1PNVA 1MEJA 1WQ4A 2ORED 4XUCA 3H8WA 2IYOA 3K09A 5HWSA 3AB7A 1DJQA 3KXDA 3R0IA 3LRPA 3QLVC 3VNRA 3Q8KA 1NNSA 2G04A 3K9HA 3O4RA 2HIAA 2OB1A 4K9PA 1NLMA 4HBGA 5JAPA 5JTUA 2XKBA 3P0JA 2PX8A 4KJXA 9LDBA 5JD4A 1CIVA 1DZ3A 3KTFA 1CBUA 4OXXA 5EPEA 3CUUA 3V4ZA 2XVXA 1NUPA 3ZZTA 3ZDFA 1ULHA 2QVYX 4NY1A 1J9EA 4TSFA 2ZJYA 1HRDA 1ZKDA 3FOZA 1VPWA 1WSWA 2VDNB 3MTGA 1HX7A 1V45E 3SFTA 1MRSA 3HWX1 4RSGA 1MC4A 1FVOA 1CNFA 2W6ID 1ZC3A 5TIIA 4XLZA 2C5SA 3IH5A 5K8IA 2ISCA 4RQAA 4RACA 2VYVD 3L6DA 4HYTA 5L40A 1GGEA 1JKIA 2B1GA 3A6GA 1OPXA 2Y27A 3B3FA 3O8LA 5E2AA 1UQTA 1Z7BA 2V96A 4P4TA 2Y2VA 1FQJA 1QG2A 8AT1A 2XWBF 1PGNA 3DKIA 4QUAA 3E22A 4JOQA 2A1TS 3WRXA 1EP2B 3IL2A 5I5EA 4PTYA 1CU1A 4D96A 1T9HA 3E81A 2J5QA 4JT4A 3ACBA 5EEGA 5K0CA 1RXCA 2CE2X 3LUJA 3O2JA 3W6UA 1I33A 1TT5A 4LYEA 5F7ZA 4OGLA 4OVKA 2CBGA 1J8QA 1O97D 4G1BA 1SB9A 2FFQA 4NFSA 4EX7A 4ZI2A 4FOTA 1MRZA 3NHLA 4BE4A 1NDHA 3AW9A 4F1KA 4JSYA 2G4VA 3GY0A 2N47A 3PVZA 3WI7A 4E4TA 1SXHA 2HHHB 1LNQA 1P9NA 3OCZA 3KE9A 1CE8B 2C7GA 2GM3A 3P2JA 5TEVA 2EZ4A 5K2OA 1IOLA 1OVGA 1KC1A 2I33A 3N7AA 4F3CA 1NRIA 2N75A 5DGIA 2X8WA 3FHCB 5EUMA 3WV5A 3EXEB 3TKYA 4MVJP 2LP4Y 2JHPA 2IIQA 3IQFA 4Q3NA 3A6LA 1MAAA 3OJ0A 3DCNA 3I0NA 3ONVA 2O8BB 2YV5A 3DBOB 4GWLA 2OGUA 2WJ6A 1IG0A 4R3UC 1R1DA 4U7PB 5MFPA 3N6XA 1SHKA 3UMBA 4LRSB 3SBEA 4ENWA 5AVRA 1GUFA 2UKDA 5AESA 121PA 3LC2O 2HQ1A 3DHEA 1VA5A 1HUQA 2IT1A 2VCEA 3KEFA 3U1TA 2VNKA 3NIDB 3ZNNA 1UXKA 1LPAB 1U98A 2FSIA 1D1QA 1YBHA 3BREA 3LY7A 3UH0A 2OE2A 1DEXA 1RYNA 1W49A 2W6QA 2BGJA 1AA9A 4ZRNA 4ZU1X 1Q91A 2HMWA 3D2LA 4HNVA 1KYZA 1PGJA 4Y0AA 3KQTA 1CZOA 5DBOA 4R0NA 3QU9A 4ZVRA 1L8AA 1ONSA 4KMMA 2GEFA 3D6TB 1C3JA 2ZJ2A 3KL2A 3VR5A 1GILA 1DX4A 2HLDA 4Q3OA 2A5JA 2VEDA 2JFGA 4UHHA 3A26A 4WXRA 5ESRA 1SIBE 2DFPA 1AK2A 4OFZA 1TEVA 4TS3A 3OO1A 4U2CA 1X2EA 1YK0A 2DYKA 1A4UA 1QQ5A 4J1SA 3RU7A 4D8TA 3HFJA 4O2LA 4DJAA 1T0UA 1U4OA 1PG2A 3BWVA 2Q8QA 5BRNA 5BWMA 3E9QA 5L45A 3K96A 1FUUA 1DEAA 1BXGB 4PRYA 4PYQA 2RI6A 1ECFA 5EP4A 2XYHA 3GVIA 1BD3A 1KK0A 4MQFA 5AM5A 1J20A 1E6LA 3DMHA 3ONDA 5CXXA 4DAOA 5HQTA 1XCOA 4HAIA 3V4PB 4NFYA 1ONNA 2IOQA 1AH2A 1O0SA 2XH8A 3CZMA 3WFJA 2J3JA 3O2SB 3EJ6A 4P80A 1EFRD 1SAYA 5J2TF 4EA7A 1TEHA 1AA6A 4QFDA 3BE8A 4B3HA 3B20A 4G9EA 4CDMA 5KWEA 1IN5A 4RK6A 2H9IA 5KPJA 5JLAA 5CDFA 4N5NA 3NVAA 1XKLA 2PBRA 1Y3BE 2Q6VA 2B30A 3HH8A 4JROA 4RK0A 4C3OB 3QYAA 3OE4A 5DSTA 1K4KA 4PHHA 3TLJA 5F9FA 2Q41A 1N8TA 4GNKA 2GUGA 2NZWA 1BW9B 1A4IA 4YTEA 4I1VA 5GV7A 1V8DA 2YJGA 3PEUA 4D44A 4MUAA 5KNCA 1PR2A 1AB5A 3PNQA 5KX5A 3G8BA 1J00A 4ZREA 4EO4A 5JXWA 3H4IA 1GNVA 2YV1A 3VU0A 2C5LA 1PWYE 3IQZA 1EUCA 3ZBUA 1RBQA 2GDJA 5K3OA 1AK1A 1RTTA 3CX8A 1MORA 3QKTA 2GPNA 2MMCA 4W1QA 3WIEA 4BRWA 4Y3UA 1GTRA 1G5RA 1Z6GA 3UK1A 3RTEA 3ZE1B 4D8UA 4MRVA 1U63A 3LCMA 2PGLA 1SZDA 2AOUB 3JQPA 3GDWA 1RKUA 4EUHA 1MEEA 1NBMD 3K0SA 5KJ1A 2RGUA 4PN7A 4ATNA 4V2UA 1G3RA 3FXAA 2ZE6A 4TKVA 1B23P 3JARA 4TMXA 2ZR8A 3AB8A 1HKHA 1I7NA 3K0CA 3H5AA 1JYEA 3DDSA 3ZKAA 2QJRA 4IEFB 3MTEA 5CJJA 5CLGA 1CUXA 2BZGA 2C1ZA 1QX4A 2IZ6A 2XJ4A 3UO8B 1FRQA 5F9MA 2VAMA 1AZTA 1X7GA 3H1GA 4AMYA 3SBDA 4W6ZA 5CP8A 3HRHA 4BFUA 3GHHA 4PONA 1E69A 1SXJD 1QWOA 3KYCA 2O8DB 1XNGA 5DX0A 4UXJA 5CDYA 3SWWA 4Z7OB 4M49A 1HDXA 2FPRA 2ONCA 3G1UA 3L6EA 4YDHB 5ES4B 1WCYA 1X1QA 3PC6A 1TADA 4GPTA 4M88A 3VGPA 1Z4OA 3WYNA 3BQNB 1M1YB 4MV1A 5C7YA 5JNLA 1BDIA 3STYA 4WXYB 1EZZA 1BRMA 2FP3A 3KYDB 4UXHA 1VL2A 1RJFA 1U0EA 2ZE8A 3LBIA 5SYAA 5ILOA 1G5IA 2GTIA 3G2HA 1XVTA 5F78A 1OIXA 3HUUA 3NM6B 1MDBA 3RG8A 5EIHA 4ROSA 1T1SA 3ILXA 1XDUA 2XOXA 1OAOC 3BX1A 3EVNA 3FMPB 1EFAA 2FAXA 1UOPA 2AN5A 3G2MA 2F17A 1Z56C 3I64A 3OE7A 4PSAA 2OHIA 3DEHA 5ELMA 1E9AA 1GVNB 1W2WB 2OQRA 1JJVA 1PVDA 5D86A 3UGKA 1JH9A 1A9OA 1ZI8A 1FUEA 3U3XA 2P75A 5DNCA 6ABPA 4Z4QA 3NBYC 3OD1A 1SQFA 3HDGA 4GAEA 4RQTA 3TPFA 3P32A 3UM9A 1OWOA 1QHSA 3GWGA 3ZE7A 4AZ3A 2G9RA 2IS1A 1W8DA 5IKEA 2RGCA 4CM6A 5IT5A 4R9SA 5IVPA 2PWYA 4TRRA 4E5KA 4JU9A 3I53A 1EXVA 2O48X 2HXSA 2VPZA 1XRPA 4TV9B 5K20A 3IT0A 4TWAA 2DSTA 4JI0B 1JPUA 1LTHR 2AS0A 1AGYA 2IFTA 2X9LA 3DV0A 1H9BA 4A10A 2HNKA 2DUUA 1R27A 3N2GA 4WERA 2YL2A 4W6QA 1TCCA 2IPMA 3KTDA 4R1UA 5F1YA 4EG3A 1XQWA 2Z2JA 2NXNA 2ZUTA 3E22B 1EWQA 4ENSA 5K0ZA 5GZ3A 4QVGA 4B4DA 5AUPB 1T3GA 1Q0SA 2HRDA 6YASA 2EBUA 3HZOA 4LBYA 4R6WA 1FU7A 1DAEA 1MABA 2EQ5A 2IOHA 3PB3A 4Q9IA 5DNEA 5CLJA 4ZAYA 3SN6A 2YH2A 3U4HA 3WE7A 1N2CB 2LXNA 4OKSA 1ZH2A 3TPZA 4C0QC 4UM8B 4HX9A 1UDBA 4O2BB 3DXYA 1FYXA 1QH8A 3VNUA 1WSDA 3AEYA 1YZLA 4BO2A 4ZARA 3KWMA 2R1TA 2WWXA 1AZSC 3LT4A 2QN1A 2ZT8A 4L3OA 1W4BA 2OV2A 1U8CB 4FK8A 5C81A 4FIZA 5FH9A 2WHPA 3A4TA 1IMOA 4JI8B 5COBA 4UNPA 1KJ9A 4FCWA 5KQRA 2VOEA 3X1YA 1DMRA 2ZJFA 3EMVA 3ESCA 5IVIA 1R9JA 1LRKA 4HB4A 3R9IA 5KC8A 4DUYB 3U7IA 3T15A 4X8MA 1W4AA 2P7HA 2X15A 3NHSA 4RMIA 3VC1A 4XYBA 4DR3B 4YONB 3UB2A 1Z4MA 2QD2A 1P62B 3L0BA 4N6NA 3HRIA 4JC4A 1KO1A 1EI9A 4KE8A 4CMIB 4KPUA 3ZGLA 2C7VA 5KYNA 3F98A 1H65A 2YRXA 1XTKA 2EERA 3ZLUA 1N32B 4L95C 3ORFA 4TVBA 2XXAB 4QQFA 1ZU5A 2LZ0A 4KWHA 3VYTB 1E1QA 4DLPA 4FYMA 4D45A 5JVDA 4BUJA 3VSDA 3PVCA 4L75A 5JSQA 3PHLA 1RADA 5DXJA 1P2BA 1E79D 3NDRA 1O3YA 1TQ2A 5IHXA 5ADUS 4HHEA 1E2PA 2FZEA 5CH3A 4ERXA 4CGZA 1M7BA 3TGPA 1XTZA 4B48A 4Y2TA 1ZS9A 3ADKA 4GR5A 2FWBA 1UBTS 2QZPA 3F67A 1G8AA 1LA2A 4I4CA 4M0LA 2X77A 4IM7A 1ZISA 4TVKA 1CEEA 1GPWB 3AVQA 1P1RA 1I3KA 2DHDA 3IAM1 4DMMA 1R8QA 5AR1A 2JFNA 4M2LA 1JU9A 2V6GA 2WSBA 2XDWA 4MQFB 4OXIA 5A2QA 4P38A 1AV6A 4Z7QB 3O90A 1Y6JA 5DP2A 2B0CA 3EXHA 3OZFA 3UN1A 1W59A 5EHNA 4RVUA 1T8WA 1NPDA 2G25A 3ANTA 3GA0A 4FEAA 4HKTA 3L6OO 5DP1A 5LZ8A 4EHKA 5LP6A 2HFKA 2J3QA 4KAAA 2I6GA 5J5VA 3L0CA 3FSGD 1JAIA 4BFCA 1B00A 1MZVA 3L8MA 1IUNA 4PBSA 3ILYA 2J7PA 3KEGA 1FIUA 1GEEA 2V55B 4IEIA 2EARA 2IYTA 3DM9B 4FC6A 4OF4A 1SC4A 3ICOA 4EI2A 4DLRA 4PANA 2AXNA 5I4BA 4N0MA 4MPTA 5THKA 2JJ8A 1ODJA 4IKPA 5CDUA 1CUBA 4QNRA 2P6UA 4B40A 4C4YA 2VSXA 3KVNA 3G9XA 1E1KA 3HMKA 3PSHA 5JQGA 3CVWA 4FYIA 2WZDA 4PZLA 4OHPA 2DUJA 4JHLA 1GQQA 1DBQA 1R50A 1VIYA 3ASVA 3U4GA 2ZQ5A 2VDLB 3OOSA 3DJYA 3H2SA 1FRFS 2G72A 1HYQA 1R9NA 1UMCB 2VSOA 4GLJA 4HX2A 4I14A 3QV1A 4ZPXA 5F76A 3EISA 4L2IA 3TD6A 4G4IA 3V00A 3WYAA 3TZEA 2B3TA 3D5TA 1E8MA 1ZUD1 2BSAA 3N2IA 3NVDA 3RYFA 1WTAA 3BMQA 1X3SA 4PV7A 1CDZA 5HE8A 4K6FA 1Z36A 2IYYA 3N8GA 4DIDA 2UUAB 1L5RA 4KHPB 1UOOA 2R6AA 3VO2A 1IUPA 2CBZA 3MHPA 4RQUA 1IPFA 2FRXA 2QW8A 5EG5A 3T12A 4TKVB 5KPDA 2I1VB 2EZUA 3JARB 1HEIA 1WBJB 1WDMA 1YS7A 4FD2A 2W8ZA 4P35A 1Z3CA 2OLKA 3ZD8A 1SXPA 5DHPA 1TTPB 4U2EA 4BTLA 1S02A 5BUSA 2FXVA 3DMGA 4OATA 1IAQA 1KEEB 1KYQA 1DDOA 2ZBEA 4MKXA 4Q01A 3KT0A 4L50A 4L9WA 3KHSA 3OJXA 2QAJA 1A9ZA 3TNYA 2BBWA 3SYRA 1LCIA 4TQAA 1P3DA 4F3YA 5JHHB 4DKJA 1JLSA 2G67A 2ZCVA 3LPMA 3ZQJA 1JIVA 1GGNA 4D4LA 1QKJA 4E21A 3E84A 1SD5A 3C8UA 2NQTA 3U26A 3F7NA 3JQ9C 5LMUB 1TE2A 1SKAA 4LNUA 3PF8A 1QZTA 1FS5A 1O7JA 2FUNB 3AHIA 3DPSA 4RGYA 5EKXA 4DNXA 5BNIA 1BHJA 1NKVA 2F1RA 4IUDS 3ZIUA 1B8PA 4A8HA 2WT9A 3CKYA 4Z0HO 1KU0A 1NVFA 1FDUA 3E9ZA 4NYMQ 3H9CA 3LQYA 3A3YA 2IV3A 1UKBA 2FPKA 4MO2A 3DLTA 4EFNA 4B3GA 4W82A 2VQDA 2Y1LA 1K8RA 3TLBA 4YXFA 2VHWA 2XCIA 1FXUA 3ZC3A 3D3JA 1U1EA 1Y48E 5IM4F 3LLVA 3O4VA 2JLAA 3RFFA 5FO0A 1KNXA 1U9IC 2QR2A 1I01A 1POXA 3VDMA 1N0WA 3VXKA 1II0A 1NVEA 5B1YA 1ETHA 4HPWA 1DQNA 2HLPA 2VYFA 3HY3A 4L73A 1E9SA 4Q7KA 5JEDA 5JC1A 3PK0A 5C1IA 4FYHA 5JR3A 3GHYA 4OLBA 1NHGA 1L5FA 2VHZA 4MWTA 3Q3GE 4O2RA 3RUPA 4L28A 2HCFA 1XTVA 1E2GA 1VPTA 3EY4A 4DWOA 4BVAA 5EQDA 1G4AE 3BWEA 4UUPA 1VBFA 2ZIUB 1SWWA 3GIDA 3L7BA 3VZQA 2IX3A 3O3CA 4ZKDA 4K6CA 1WVGA 1B7GO 4YLGA 4Q3BA 3SYTA 2HU7A 4U7FA 3MBIA 4L72A 3ZV6A 2NSYA 4JZYA 4PGFA 5AM0A 1GFZA 3BIWA 4YIHA 4JOCA 3VA7A 4QDTA 1RHUA 3ND5A 2OD2A 3WX0A 1YOVB 1MABB 2Z5LA 4H3VA 2UUOA 2EQBA 1I2CA 4IHJA 4NMHA 1T3TA 3VMMA 4AY5A 4MI1A 3M9LA 4ZDWA 2H4HA 3AR3A 1QH8B 3NAZA 3WWOA 4REMA 1Q0PA 1Y4AE 2R1TB 2OR3A 3QFFA 1UBHS 3HWSA 2NT4A 4LRYA 5ALZA 3IJ5A 2Q2VA 3BWYA 3VPHA 1N36B 1JXAA 3BB1A 5HOEA 5D3MA 3FTCA 1WULS 3MERA 5AW6A 1TQDA 1VLHA 3OEHD 5ALTA 3C6MA 3MUNA 4OXKA 4PRZA 5AH0A 4BVEA 4Z7NB 1CCWA 4MIEA 4PCLA 4UZEA 5EZ6B 1H8EA 3F8SA 1U2DA 2CXSA 4GHWA 4HLQB 4LCEA 2XRZA 2O20A 2EDAA 3KLOA 3C87A 4NENA 5MN5A 1K9VF 4RYLA 3OTWA 3D54D 3EZNA 4HNAB 5EZSA 4DIBA 3AOEC 5IYZB 1TKBA 4ZC1A 5J59A 2A9QA 1W2GA 5JPIA 1DXYA 1QGED 3KUKA 3KBOA 3T1OA 5JAUA 3K9BA 5T41A 3ONFA 5GGYA 1OFIA 5JVDB 4YRCA 2EBWA 1IE3A 2NACA 2PVCA 3H13A 4FLFA 3NFRA 3IOYA 2BGTA 1YBAA 2ZI3A 3N3AC 4RXTA 4B85A 3II6X 1FMFA 5EE0A 2ZREA 2XCOA 1E0JA 1IOWA 1T5SA 2NNLD 3PIIA 3KEMA 3BVPA 3H9EO 4I55B 1CF2O 1WUYA 1NNEA 1V8BA 1Z26A 4M9QA 2Q0XA 1XPRA 2P5SA 4MW5A 1XNJA 5EMHA 3L0OA 5DBHX 3RTCA 1N6OA 3FDIA 2CUTA 1O6FA 3P4YA 4IJVA 4V3BA 2GLXA 2OCLA 4JQZA 4BMPB 2A92A 2IVFA 4CM8A 1G2IA 4WZAE 2JDID 1N4AA 1U0OC 1PJZA 4LRXA 3TSWA 4HR7A 4UULA 5JRJA 2C31A 1RXVA 3TZQA 4PYOA 5EJ2A 1Y8ZA 2LE0A 3M6AA 1NVXQ 5D1NA 2ZIWB 3NBQA 3EVFA 1OH5A 1L7EA 1TAHA 2WILA 4GRAA 1QZUA 2DSNA 2WWTA 1Z6PA 2C5AA 2F90A 1RI4A 4J0CA 3OPXA 2EKBA 3H42B 1W0KD 3Q2OA 3QPUA 2JJ2A 4GBGA 4H1HA 1GCIA 1C7IA 3RYCA 5JCOA 3ZYZA 4AY3A 3OURA 4E3ZA 1ML4A 1I4TD 4WOKA 5IX8A 3ZJVA 3EIFA 2BTQA 1FZQA 2AI3A 4I5IA 4RHYA 4YASA 5EZQA 3X1KA 1PLKA 3TW6A 2JLVA 1U6IA 3LF1A 2D2XA 1ZXXA 3SF8A 4A0HA 2HSEA 1GPAA 1XTIA 4WBXC 5JQGB 3MCZA 3OT5A 3LY8A 5JYBA 1CETA 3M6LA 2UZ0A 3P9QA 4EJ6A 4ZYUA 2PUAA 2WM2A 2HU8A 3NT5A 4U8GA 4QA9A 3CNLA 2WM8A 4WBNA 4C87A 3U7JA 5DF1A 3TQCA 4MV5A 3BF8A 4ZZ1A 1DG9A 5CLHA 5CB6A 1XMPA 5EJFA 3RYFB 1OI3A 1Y1RA 5AVOA 4QYIA 2HWKA 5GM2A 3FG9A 4BLQA 4S04A 2O9JA 1O9GA 5DASA 3RU2A 2WKQA 4RMJA 3T38A 1NIJA 3VPSA 5GGXA 1OI4A 3IBTA 2H7XA 3OZWA 3LSTA 3WNBA 4MSUA 3H0CA 4Q9AA 4DMHA 5JO9A 1QQBA 1YZVA 1QSGA 4NCXA 1Z2EA 3ZBPA 1NSYA 3AGPA 5JXIA 5D84A 2X7HA 1GGFA 1QUFA 2PZKA 3OLYA 4U7TB 5A6VA 1Y98A 1P2GA 3DFKA 1KZ6A 1XRRA 3BFJA 5BSEA 2NAPA 1GRQA 2BSXA 4CE6A 5KOJB 3ANSA 4RJTA 3PA6A 1H2BA 1KI2A 3Q0IA 4CN9A 5LMCA 4RVFA 4RJ2A 3ZUGA 3IQEA 4LHWA 2VJQA 5AHWA 4H16A 2XB4A 3ASUA 2XTNA 3PTZA 1T2NA 2H18A 4UTXA 5FUXA 4F3NA 1BCSA 4M0FA 4GOND 2NX2A 1A76A 3JZFA 5INTA 1RI5A 4IJUA 4N9QA 4QSHA 2HMYB 2ZGVA 1BFKA 1FQKA 5IK2A 3V1YA 5CFMA 1P1KA 4B34A 5JSKA 3A4MA 4IP0A 4QT0A 3D6FA 2GR9A 4INZA 5EMMA 1WW2A 3NXSA 5C8YA 3H5OA 1LDEA 1NM5A 1P39A 1TO1E 2GA8A 4TVSA 4KACA 2VF7A 3GRUA 2R8RA 1CUZA 1FQOA 3EDMA 3T7RA 3CR7A 1FDVA 3QVWA 3TLKA 3DVRX 4RHFA 1Y6ZA 3SHQA 1DIHA 1G4UR 1EWKA 1QZXA 1YQGA 4KAJA 3WNVA 1NYLA 5T4EA 3WB0A 3H1TA 3QPWA 2YKGA 3SMVA 4DLLA 2CJPA 1T0JB 2FW1A 3TTXA 2Q8PA 3CH4B 2B92A 3DV2A 1ZINA 2KPOA 4C2BA 4CKBA 1EXWA 5BQ5A 3HB7A 1PV1A 3S44A 2XMGA 1P7ZA 4RPIA 2B37A 2GK7A 1HLGA 3BGSA 4IKOA 3RGGA 3H2GA 4OBWA 4C9BA 1NG9A 1MAHA 3IAXA 2A14A 1U9JA 1HPLA 2ZWMA 5AMXA 3TZLA 4EDFA 2ZCUA 4X85A 1SQSA 5JAIA 4LV8B 3FKSA 5EWJA 2Q3MA 1WG8A 4DSZA 2VUTA 1QO7A 3CSUA 3R3JA 5DM0A 3UK7A 1UJBA 1TPZA 1CEQA 2PKEA 4JWKA 3I9V1 2FOLA 2OORA 2R68A 3FHJA 1JSRA 5AJYA 2JARA 4EUKA 4DWVA 4IHJB 2OBXA 1S2NA 1XVUA 2E4UA 1W6UA 3N3BC 4P7JA 3E8SA 1IIBA 3HVIA 1G9XA 3TZHA 5TQ0B 5I5GA 3N39C 1XA0A 3GG2A 3JPWA 2WMNB 3Q9SA 2X5NA 4HPXB 4K40A 5E1DA 4YYEA 2FJPA 3RFXA 3GLIE 5D3MB 1HK7A 4PBTA 1E1LA 1BFDA 1GVHA 4Q9DA 4BTEA 1WRBA 4R8KA 1GPYA 1XZKA 3PLNA 1QKKA 3UB4A 3L8GA 4NX2A 1B1AA 1HDIA 2ZETA 1JTFA 1RRCA 4KQ6A 3DKRA 2CHVA 2OCIA 4BNIA 1W48A 2CSUA 2P2CA 4BMSA 4Z9YA 1GN9A 4CMJA 1LXCA 2G1PA 4LQCA 3GP8A 4OQLA 4JGIA 4QC2A 3WYBA 2RI0A 1RXIA 1SVMA 4IOLA 4MB2A 2DG2A 4CL3A 5AW3A 4JXKA 4XARA 1O2DA 1U0BB 1KQGA 4P86A 3GJ0A 3U62A 4BQSA 3GBPA 2C7OA 4W7IA 5SY4A 4LOIA 3I1IA 3RUHA 3WK6A 3LAWA 1SY7A 4OQYA 3DV9A 4MKFA 1UR5A 5HUJA 3DAYA 2ZIZA 3DBHB 5EY5B 3PL1A 2P7IA 4AJOA 3AT1A 4D46A 1KTVA 1T9AA 3FTQA 3NBFA 4LYFA 1OV4A 3KNZA 3ZQ6A 3BRQA 2VZ9A 1CW2B 2GD2A 2SCUB 1FTGA 2BEUA 1VSQA 1WD7A 2CXOA 4CT4B 1GITA 1OH7A 2PH3A 2Z5FA 2J48A 1M8KA 1WEKA 2MSEB 4NBTA 4XW2A 4D92A 1TKAA 4GZ3A 5IUNC 5EJAA 5B3KA 3V1LA 4BNTA 2HMAA 1R6DA 3RPEA 5JJIA 1HTBA 5KNDH 4JFAA 1GTJ1 2VPQA 5KB3A 1RYHA 1PZGA 4UTOA 1YI8A 2AIRA 1N5RA 1XKXA 3OETA 1OSNA 1E5TA 4G1MB 2M1ZA 4K03A 4RFSA 4XASA 2GZRA 4M8LA 3L93A 4DLVA 1GUBA 3K92A 4UPDA 3RC1A 4BNVA 4D4IA 3KCQA 3LVRE 3HB4X 3L07A 4UUBA 2B20A 1G60A 2IP4A 2ZK7A 2KHZA 2ZJ4A 3G0BA 4FPXA 3URKA 1KH2A 1E20A 4INJA 1U6KA 3SF8B 1ADJA 2YWGA 1BXZA 2H7VA 4KQXA 2KBFA 2I7TA 4P81A 4ZO6A 2AT1A 4GO1A 2NO6A 1G20E 10MHA 2GXUA 2OOKA 4LE1A 5LJLA 5J2TA 2WSLA 5JXGA 1EXMA 2PFKA 2RE8A 2Y2UA 4EM6A 4IOKA 3A6JA 1H1LA 3AF5A 3MQFA 3P9SA 2WWIA 2P4SA 5ALPA 3DXZA 4W99A 3ZU2A 1TZJA 1RP1A 1KF0A 4ZO9A 4TLDA 1OH8A 3KV1A 1MXHA 3O84A 4FBLA 4MVJE 4CETA 3ODPA 3UJ3X 3IMGA 2G08A 2P4QA 1CZHA 2UZAA 2FPIA 3F7MA 4QYIB 3ZE2B 1T0HB 3OD5A 5LZ4A 2C83A 2VC2B 3RSHA 3GUYA 4DB4A 3X2EA 4UBMA 1QRUA 2BD0A 2IHKA 2HSZA 1TFRA 4WGGA 3PA8A 2DFTA 3WGJA 3G88A 3RSCA 1K9SA 3T95A 3Q3VA 3AEQB 2EX0A 1CJTC 4TM8A 1TUEA 3I12A 3DEZA 3OLXA 1KEUA 1SOAA 4AZSA 4N7JA 3SIPA 2GAJA 3NIFB 2Q6KA 3I0ZA 3A7EA 3CV3A 3QNMA 3JVEA 1VCMA 1RP7A 1Z62A 3A32A 5C8ZA 2C8VA 2H57A 2IEIA 1WW3A 3KQNA 2NVWA 1A9RA 3QW4B 2GCNA 4KU4A 2PE5A 2QX8A 1BCSB 2CEKA 4P7GA 3VKWA 3EPKA 3S7ZA 3VR3D 2FG7C 4XCXA 5HA5A 3S8MA 2I4NA 4TQUS 1CC1S 1IHXA 4V38A 4FT4A 4ZAZA 3WLLA 4DCTA 2G06A 2V7TA 3HN2A 3UV7A 2X9NA 5ENVA 3RTDA 1YRWA 3CG0A 3ZWBA 2L82A 3K09C 1U0RA 4XPIA 3WWCA 2XCQA 2CUZA 4DYVA 4XA8A 5B4UA 4MUIA 1HH4A 3DZFA 3I6IA 3MOIA 1YQQA 4EJSA 5B30A 4L8GA 1DKRA 1T35A 4X0EA 2YN2A 3FFBA 1YHYA 1QPZA 1IATA 2CLEB 4ZXPA 4ALMA 4D26A 5DHTA 5TQJA 3HZHA 1EE9A 5IJ0A 1OWPA 1QORA 1BDJA 2F48A 3G2JA 5CH5A 2N42A 4JT8A 5B3JA 4CKXA 5CNJA 1TAUA 2X0FA 1P7YA 2CMGA 3D1VA 2UXDB 3GEGA 3DLBA 1NXOA 2EIXA 5I9BA 5KU1A 1RLOA 3W6PA 4CKBB 1UPUA 1D03A 4EDHA 2QRVA 4U3JB 1U94A 3FFWA 2CLFB 3FYTA 4TM7A 2ASEA 1SVUA 4M55A 2JBAA 1R0RE 2W2QA 3K9LA 3IP7A 4JKIA 1Z88A 4WNCA 4Z1MA 2LKCA 2Z6UA 1B0ZA 4QQRA 2YZGA 2R48A 4R83A 3IV9A 5EWJB 2XGJA 2MMGA 2ODAA 4RMGA 5JE8A 5BRJA 4C29A 4JB8A 2ID8A 1GTSA 4LDZA 4ZD6A 1D6SA 3ZGXA 2IYWA 4EUEA 1XB2A 3DMTC 3CWQA 5LQSA 5JSZA 1TIBA 5MDHA 1DIGA 3WRXC 1VHLA 2J5BA 1L8LA 2O2HA 4LDJA 5HJ2A 3RJZA 4A73A 2XQIA 1Y82A 3HDHA 3G8CA 2QSZA 4L0DA 4WGFA 3QVKA 2JZNA 2HLHA 1W2HA 2E1RA 4Q9HA 5HDQA 4ACAA 3T3NA 2YHBA 5DMXA 3ZGOA 5DCWA 1SC3A 2PJUA 2VUIB 4N7BA 5FFMA 3OAAA 5KKNB 2EKZA 2I54A 3L4BA 4HDOB 4EHNA 1LPSA 3ODGA 2ZJ0A 4XGRA 2FPPB 1IHOA 3QLEA 1C4XA 2ZKLA 3MFQA 2FZVA 3EZ7A 4JMLA 4WKGA 5F35A 3VBCA 5JZMA 1JLRA 1Z2CA 4B4UA 2H1OA 2ZJBA 3H04A 4HBZA 4QASA 2LCIA 1K86A 2WG0A 3C3CA 4I4NA 2C97A 3C39A 4UAUA 2PQ0A 4TTAA 4CQLB 4DDUA 1ENZA 2IEZA 5MN6A 3R6GA 3D9QX 4WMLA 4YUZA 4F4CA 4W5OA 4PNEA 3UXHA 2R9VA 4UEQA 4FWBA 2HR1A 5G1NA 4FSXA 5DM2A 4N03A 1QUEA 1NR7A 4XIFA 2Q3DA 3L1IA 3T61A 3LPDA 5I7HA 5HIKA 5KJCA 3F6BX 4OI1A 3PFFA 3OZEA 1Z28A 1H23A 1U2PA 2GCOA 4EVIA 2OBMA 2AC2A 1H0HA 4TX1A 5UKDA 3CJQA 2GEBA 4MDFA 5T8KC 2G17A 6PFKA 4UHCA 3T1TA 2MINA 3BSWA 1WW8A 4LRQA 2RB4A 1PJBA 2EFGA 2WIJA 3SR3A 2RHBA 4B0PA 1K6XA 3CMCO 4MB0A 4BFLA 3W2HA 4DDVA 4HDSB 2QQGA 4WV3A 3U7EB 5EE5B 1D1TA 3IA7A 2N9UA 1BZYA 3CHYA 3PNPA 2AI1A 3MS4A 1IY2A 3WGTA 3ZG6A 4EOGA 5DE3A 4CG1A 2I29A 3KUXA 4CHGA 2BEUB 1LD3A 2ZSKA 2J45A 3K32A 2C82A 1KK2A 1RWKA 2Q21A 3B1JA 4BQPA 4JJIA 2BKAA 1RSZA 4JEUA 4DCGA 4ZQGA 5AI6A 2O3TA 5DWDA 2OXFA 4KQWA 4E31A 3OQPA 3OC6A 3WL8A 1YZQA 4R3NA 4OBEA 4QOIA 5A4AA 2VDWB 2VHEA 1AKMA 1RPAA 2CMKA 2DFKB 4JQCA 4OHRA 2VQ3A 4Q39A 3H4TA 3UJBA 3OM0A 1REQB 1WM1A 4MMZB 2YC4C 5EXXA 1RWBA 1T9ZA 3BKXA 3T5AA 4FCTA 5K1ZA 3LGXA 1XXHA 2DQSA 3OCJA 3UMRA 1UBNA 3SVLA 4ND6A 2OD9A 2R7AA 2FFHA 1NFFA 1E2QA 4RS3A 3SIRA 4ZZ3A 3PPXA 4RGBA 3RVSA 1JBEA 4LCBA 1H5QA 3NM4A 1NNI1 2CVQA 3NHYA 4TTPA 5AOBA 3DM5A 2GT1A 4BECA 5BN1A 4JB0A 1EX7A 3QE3A 4K1XA 4UUMA 1Z6QA 3L5KA 3D81A 4B79A 2O2YA 3DEFA 2PV7A 2XGOA 3JWPA 4GMGA 1H66A 1NLUA 2AK2A 4JIMA 6REQA 1YXMA 1VYVA 4DMLA 3K70B 2XQFA 2O8EB 4AJLA 1D7AA 1I1OA 2FW9A 1SULA 2RHGB 3BFKA 3OTHA 2C94A 4QYTA 4UNQA 4ER0A 2HGZA 3LCCA 2OECA 4PO8A 2YWDA 1S6YA 3DD1A 4ABTA 1OXSC 4G0VA 3B6KA 3PJGA 1P77A 3C4JA 3SR4A 2FPIB 3IT1A 2CDBA 1GO2A 2B4KA 1P1FA 4Y30A 2WIDA 3AERB 4QTTB 4CTOA 1AQYA 2IUTA 5KKCA 1G8SA 1I4OA 1L1QA 2B4QA 5HRCA 1ZPDA 3SEFA 1OLUA 1ISPA 1Z0ZA 2X0JA 3KB1A 1X92A 1QV6A 4N8EA 1GYRA 4OB8A 3FF4A 1LK0A 1W4CA 1Z4QA 3HCEA 1XMVA 4TWZA 2ZJ5A 4F91B 3LMKA 1YFJA 4XEHA 2MHCA 2G1KA 4X65B 3R8FA 1PJQA 4JGBA 5JJCA 4IXNA 1UFKA 3A4YA 3DFZA 2CFIA 3N2LA 3SK0A 2VWPA 2YFQA 4D41A 3AVPA 1QIIA 1BS2A 1DTEA 3FR8A 3PRYA 5FOXA 5HIMA 3TOVA 3AI3A 1U7OA 2QPTA 3JAKB 1Y1SA 1Y33E 1KKMA 3ZH9B 4Z4IA 1GNSA 4MA0A 2HPHA 3BJRA 2B4TO 2X2OA 4BIMA 2QX6A 4E09A 1XG5A 2LBPA 2QT9A 4P4SB 3GNLA 2FKAA 3PCTA 1GGVA 4L76A 1XIVA 4F5DA 4XPIB 4OHYA 2BY4A 2XNKA 4JY7A 4EVSA 3ZD6A 4YYZA 2VK8A 4C30A 4MCHA 2ORWA 1NUUA 5ITZA 4HI0E 1XL0A 2BFCA 4O4IF 2FF7A 3PR1A 2X5OA 1RJGA 3U13A 2FY8A 3VZDA 5JH7F 4H3SA 5IJ0B 2VKTA 3NHMA 3WRVA 1PT9A 2AX4A 4HB2A 4FVTA 5ICFA 4B3RB 5IKPA 2C4MA 3HACA 3Q8XB 3JQRA 3OHMA 3IV7A 5BV7A 7REQB 4PM4A 3CRMA 4ZCQA 1JG4A 4DSTA 2EU8A 4PCVA 5GP1A 5T57A 2ECFA 3ZE9A 3DE3X 3RYIB 1RXUA 4H6XA 3OKFA 4DXDA 1P5HA 3A3KA 4E5DA 1N9GB 3WHLA 1V7CA 2SNIE 4PX3A 1UBSB 3ZZUA 1CYEA 3QVOA 1ZC4A 2PUGA 5IM4A 3C6YA 1A9TA 2OV4A 1TUGA 1ST2A 3D3WB 3WGGA 3WAGA 1R0YA 2IW1A 2PUTA 1ADBA 1ODCA 3L4SO 5F1KA 3UJDA 1XRLA 3O2QB 2CK3D 3HG7A 3LUCA 4HFJA 2I2AA 3PUHA 5J9FA 1X9GA 1BQ4A 3KV3O 4ZRMA 4DE5A 3UMMA 1K97A 4CCSA 3MC1A 3KM0A 4LMRA 4ARUA 1M34E 1BH2A 3NTLA 4AN1A 5IAAA 2QJOA 3ZIAD 3AKDA 2VDVE 4X97A 5GY7A 4F6CA 5DGDA 2X1LA 4BMNA 5E3JA 1KE1A 3WGVA 1K5GA 4HXEB 5BSTA 4HQ6A 1UWCA 3U1VA 3YASA 4CYMA 1E98A 3CZ5A 3GCWA 1WMDA 4GVLA 4MITA 1QHHA 4EUFA 3W77A 3TTUA 4Z4FA 3BS4A 4UEKA 3KBBA 2FJUA 3UA3A 4OQPA 4PU0A 3ZKWB 4U7DA 4GMDA 1P4RA 3G2PA 1BSVA 1CB0A 1Y1LA 4YFVA 1GU7A 2NYVA 2ZEJA 4U4AA 5CNKA 1ONBA 1Y5IA 4E33A 1QH1A 4IH4A 5A6SA 2ZJ8A 4HDCA 4JGGA 2VAWA 4XSGA 1BA2A 1DBVO 2J3MA 1DG1G 1LDYA 4HNSA 3UT6A 3QXGA 4XQ9A 4F96A 2XTAA 4L8LA 4UBIA 4LJ7A 5H68A 3WOVA 4OXYA 4JLJA 4QOHA 1VCOA 5AJUA 4ARZB 4QDOA 5DGTA 5LR6A 1X87A 4OV6B 3QF4A 4DCOA 1P7PA 1FSFA 2Q4OA 2W6PA 3KLMX 4ADSG 3E3AA 3ZW8A 5BQ3A 2Q1SA 1QU3A 2YXLA 2MINB 4XPZA 2EOAA 3B5IA 4MRPA 2C3YA 2KB0A 3RIHA 3VTAA 4TMVA 2ZTVA 4JLAA 2UYHA 2Z95A 1JSLA 3SBOA 3OCYA 2EZ8A 2PCJA 1OFHA 5DGXA 3SQNA 5TPZD 2JFZA 3VV2A 1W0JA 1O4VA 1SRQA 4CV3A 1DO0A 4NE9A 1AK9A 3EUEA 2X8BA 2R6GA 4A2PA 1RLUA 3CSSA 3E5NA 1RWWA 1KAQA 4GRIA 4ER3A 3D3KA 2ZJAA 3W9SA 1ORWA 2I8LA 1NUAA 4F8YA 3UHPA 4LTDA 2QD5A 3OEYA 2PA3A 1JFVA 1IXKA 2XZLA 3WGIA 1NBAA 2IDMA 2WHRA 3KVVA 5FHQA 3UPDA 5FBVB 1ZOPA 1ECLA 4JD5A 1PL7A 4CIYA 3KD3A 3LX4A 4PPQA 1AHIA 5JWHA 4D98A 4B6JA 3FSEA 3RVBA 5BY2A 4Q4JA 2SECE 3RAPR 2EGGA 2CZCA 3C8HA 1EQAA 3LLSA 3QOYA 1XXHB 3D8UA 1YNSA 3UV6A 2LD4A 4MCJA 2OXEA 1LC0A 1CDEA 3SHWA 1MG5A 2AE1A 3E3OA 3RS9A 2PZAA 2ZB7A 4ZK6A 4LECA 1L9XA 2O07A 2R1VB 3OPYI 4GKAA 5DI3A 5LBTA 5HNKA 1PSDA 3JWGA 3FE2A 3U48A 4J90A 1DG3A 3L01A 5I9TA 4C7VA 1VCNA 2P9TA 4GOOD 2DR2A 1OUMA 6REQB 2P4EA 1EX6A 1DCFA 1PLJA 3OJEA 3RUIA 2AR0A 4LXHA 4MULA 2H1SA 3OZRA 4LX8A 1FU8A 1HURA 1N3BA 3BYZA 3IODA 1YE8A 3OTIA 3UK2A 4XEUA 1AMUA 3ECSA 1TUBA 2OCXA 3PC3A 4QXPA 3TPCA 1I4EB 3AY3A 5KSOA 1R4NA 4FM9A 2QVLA 1AXEA 1L8QA 3G6KA 2QSJA 4CLOA 2AOVA 3N86A 2Q4RA 4KE6A 3VOAA 1UP6A 4DLZA 3JZDA 3ZGZA 1XYVA 5KCZA 4IGFA 1KJZA 1NX9A 4MPDA 3SJCA 2QE7A 5E4TA 2G63A 3L6UA 2OZPA 3GDOA 4LF9B 1GDDA 1WXWA 2FMUA 1YH3A 1SU7A 3V8EA 4UEJA 1OLUB 4NXNB 1B8NA 4F72A 3ZGVA 5AVTA 5JISA 1U1DA 1LQTA 3RRMA 3T3GA 1XJCA 3MLEA 2A58A 2WKSA 2XNDA 4FFBA 3QXXA 3IHTA 3Q7RA 1S4MA 4C0LA 3FDJA 5AKLA 3ZXSA 4ZMSA 1KIAA 1NAIA 3R3VA 3CF4A 3NEYA 2ATCA 1GWNA 3PJRA 4YROA 5DN6A 5LQRA 1ECPA 4HADA 4RTPA 3QWAA 1PEDA 2YXNA 4COKA 4JLVA 4ZN6A 1D7OA 3AMVA 5CUQA 4ZT6A 4LWQA 4G1CA 1JDPA 3MQ4A 4LTNA 3MRTA 1OI2A 3QWHA 4O8ZA 3ZHBA 2YICA 5A3RA 5DNUA 2OVBA 1I2BA 5H81A 2GN4A 4LY6A 4C4SA 5KVSA 2HA4A 2YYSA 3RVMA 1PR3A 2R85A 3D3QA 1ZU4A 4ZZ2A 2QTZA 4H7EA 4ER5A 4PC3A 3WVNA 5JZOA 1SVOA 5D5PA 5T4FA 1Z9BA 1J8VA 4EGAA 4HNTA 1F5SA 1PDWA 1TYDE 2FRDA 2J08A 3BUSA 1BDBA 3LX8A 4WTOA 3VPFA 3ZZ0A 1V37A 3A2LA 4NTZA 4RH0A 1RKXA 1N1MA 2BFCB 2NZVG 1LK7A 1Z82A 1CUDA 3N76A 3LK6A 4M1KA 3VISA 5LOVF 3BZWA 2NV2B 3I01M 1YTUA 4OYYA 2FWIA 4EF4A 3AW8A 1WLSA 4F85A 2XKKA 4A8JA 5KVAA 2Q3CA 1CUEA 3SYLA 1VSBA 3V8NA 5AK3A 2HK9A 4YUXA 4I1RA 4LJRA 3S0JA 1MC1A 1P3Y1 2R00A 4U39A 5ALDA 5HZKA 1D4OA 2RG1A 3ZHYA 1G3MA 2VH1A 3K0EA 3R44A 1P80A 1CLEA 1K68A 2RHHA 3HLKA 4L08A 5JG7A 1N6NA 1MOZA 2ZJZA 3DH0A 2RC5A 1MQSA 3M1LA 4JOBA 4JR1A 4RZIA 4DR2B 2FPWA 4R3WA 4WQMA 5J5CA 3CPSA 1YHZA 1A82A 2IHTA 1TMGE 5TGTA 5B7GA 2Q45A 4KXLA 3ICCA 4HXYA 4NFHA 1ZMXA 4BPBA 2NLOA 3PXBA 4HGNA 2YYZA 4H6VA 4U2GA 1WWKA 1PJCA 4FW9A 3VFDA 2RHMA 2Q9CA 3FN4A 3VTFA 1M1XB 1AE1A 4ASUA 2C98A 4FS8A 4LKRA 4N0DA 4BC0A 4A8PA 2A1UA 3BWXA 3HCRA 1MJHA 2ZIEA 3HDTA 4JEHA 3CEMA 4YB8A 3JQAD 1YA4A 5K0NA 4JVSB 3VAYA 1PQ4A 2O14A 3KWLA 2F4NA 1QG0A 2CYAA 1QC5B 1GLGA 3QUAA 5GONB 3G3EA 5F2OA 4P3YA 4UHEA 1T4MA 3ANLA 3GRZA 4AKIA 4EW6A 3FR7A 3N0VA 2WV9A 3H19A 4R8SA 4N48A 2Q3BA 2I6QA 3Q7PA 3FYDA 4NABA 3L7LA 3B1VA 5A6SB 5IEBA 1S8AA 4FGSA 5CFPA 1GM5A 1BOFA 2RGWA 1Y80A 2IV7A 2ZLBA 2B7CA 2PLFA 2NZUG 2F3RA 2ZYUX 2EYUA 4BWVA 2F3QA 1E2FA 1GKLA 4Z8XA 2VA9A 2W2TA 2IWRA 1XL1A 3EC7A 2WABA 3Q6MA 3QXJA 1WKCA 4O6VA 1ZUIA 3VPXA 5A2GA 2QD1A 5CURA 4CCYB 3RI3A 3BQMB 5AJXA 1GV0A 3IEKA 1U2GA 3MTBA 3F6PA 3GGSA 1IC6A 3G85A 3P26A 1DC6A 2H5EA 2JCGA 4YJKA 2HK7A 5T6BA 4IFTA 1FJ2A 3LQ1A 3TDMA 1OASA 1PFWA 4NKRA 1J2YA 2I0FA 3RNLA 4C21A 1C9NA 1ONPA 2PPLA 3UENA 2J5KA 4FDAA 1KA9H 2QJTA 2P77A 4KLRA 4EITA 5JBNA 4JBYA 1NPTO 1J1IA 1WMSA 3GBSA 1YF3A 1H2YA 2HN9A 1KJIA 3AM3A 2I6UA 3HP4A 4IQGA 4L07A 4Q4AA 3KZCA 1QYXA 4RY0A 3T3DA 2SICE 3TZCA 3UAOA 3AONB 5HQ3B 2ON6A 5JWRA 3EZ6A 1ODSA 3PGA1 4W8GA 5LVAA 1I0ZA 2I62A 2NG1A 4HWOA 4RV9A 4BU0A 1HI9A 4RIIA 1JVBA 1SXJE 3PG5A 1Z2PX 3T5DA 3KUDA 1VPVA 3MMNA 4HH0A 5HIIA 2F1OA 3PC8C 3LPLA 5KNCH 4LFAB 1XV5A 3UWDA 2CB9A 3D1JA 1GKKA 3K6KA 5CG1A 2H63A 4B8YA 1RWNA 2JNWA 3GJQA 1RHMA 4BLUA 3WS7A 2BV3A 4NNJA 4LTMA 4BFTA 3AIIA 2W6JD 5E0KB 2C8LA 3MYYA 4EVQA 3ASZA 2ARKA 1P7WA 1EAYA 2GAIA 3E27A 4EI8A 1HGXA 1UBEA 5TV2A 4F3TA 4PO1A 4JI7B 3TX6A 2IY9A 1VJGA 5IJ9A 3SM9A 1NI5A 1V16A 5DX1A 2PUFA 1AN9A 3D8BA 2V74B 2VJYA 3FNHA 2YS7A 4RXMA 4GX2A 3CLHA 1UMDB 3JD0A 4MR7A 4TLCA 5LPNA 3MTAA 1I3LA 2IELA 1XU7A 3L7JA 3ORQA 5EJ9A 3UJ7A 2IXEA 1J2JA 2JLYA 4R2XA 4U63A 2PMDA 1EUDA 4G4SP 4YT8A 1NPYA 4RTMA 3MEQA 1O58A 3HM2A 1Q7BA 3NQ41 1GRCA 1S3GA 3SNKA 2Y71A 5EJMA 4CLOB 5I9NA 3ZQKA 3UPUA 2WQZA 1SFRA 4KEAA 1Z7EA 2QRZA 3N6VA 4PVCA 1Z2AA 2L2QA 2VLIA 3RSOA 1S3IA 1JMYA 1L7AA 2HLNA 1OFTA 2I6SA 3GMIA 1T36B 2I2CA 1JKFA 4QGBA 2JPDA 3IXMA 1INLA 4JLBA 4RVCA 1XLVA 4WLFA 5G0WA 3V8BA 4LS3A 4Y1RA 3K1YA 4PF1A 4I1YA 3HLTA 3WLRA 4L8FA 2J09A 5E6SA 2OK7A 3CC8A 5JI3E 3EVBA 2CBXA 3KQPA 4AZVA 2QVBA 2FWNA 4LOJA 5CFRA 3PUWA 2RH8A 3ZY2A 4EG1A 3PQFA 3FVWA 1IWBB 5CFOA 1YZHA 2BLNA 3L7DA 5I7FA 2R6HA 5LYJF 3W90A 5BT9A 3Q10A 3LUGA 4KQFA 3JQGB 1E7WA 1WUJS 3TLMA 3AVVA 3OCVA 5SY6A 4JXXA 4LJ5A 3GIWA 4BU1A 1CVIA 5JS2A 4HVLA 1XWIA 3C1UA 1DRKA 1SUBA 3OZTA 4RCVA 4CLRA 1D2MA 5EIWA 3OC0A 1ZVJA 1C8KA 2PLRA 5B5SA 1L5NA 2YZMA 3VSEA 2C1EA 1VYTA 4GLOA 2HTEA 3F9CA 2PUBA 2AHOA 1O6BA 3WQSB 1XDZA 3SKXA 2QXTA 5DCUA 1LBEA 1ISMA 1JEYA 1GRVA 2E4YA 3QU4A 5J1SB 5LD2C 3WB9A 3QLUA 3QBDA 1OLSA 1U3UA 3WXBA 1OFVA 5I7EA 5AKIA 5EVCA 2FWJA 3TD2A 4B4OA 1SG6A 4R6XA 4B9AA 1FYEA 1P44A 2BFDA 3QQ5A 2N3ZA 3KZVA 4G8DA 1Q2XA 2AZTA 1CNMA 4TTQA 2FQ1A 1G9SA 2FE1A 1J24A 2FEPA 2KJQA 2YC2C 3DEKA 3FD8A 4DM3A 4JDPA 4HQ0A 4M86A 4TT8A 1NBEA 4J4BA 4IVPA 3ZY4A 1HDRA 3BK1A 4WLUA 1MO2A 2HDOA 2XMSA 1ATIA 3E9CA 5G1OA 4AFNA 4XWOA 4NG5A 4DOMA 3SZLA 1Z45A 2Z5VA 4FR0A 3SZRA 3U09A 3AFGA 3LXXA 3CW8X 4X66B 4B2PA 4BMYA 1E66A 4JLUA 4L27A 4A9AA 3SE7A 1E32A 4FHDA 1TZKA 3GFSA 4EPRA 3NTOA 4RHTA 1AZLA 1NXPA 3L7YA 3HB0A 1L5MA 4RA6B 4GBMA 1CZKA 4N3NA 1VLLA 3ZN2A 2Q6TA 4RELA 4TL8A 2XODA 4JJ7A 2Q28A 5ECYA 4Y9UA 2WUGA 2CNWA 3I2JA 4MEAA 2P9GA 4JJFA 3W5UA 2YJZA 2ZSUA 4BBJA 1WJGA 2CEAA 2W4IA 3GDGA 4NYIQ 2B99A 4P3XA 4B6EA 1EVLA 1IU9A 2YJTD 4U7JA 3Q88A 2A2ZA 1YA8A 4HLCA 3OKPA 3X1MA 2FPLA 2R8PA 3C1TA 4PNPA 5J63A 2G83A 1AKYA 1MW9X 3DTVA 4LSZA 4CLXA 4I1PA 2O5EA 4NESA 1QIGA 4NF2A 5C34B 3T94A 3UC9A 1AS2A 1JX6A 4ZQBA 4X8HA 4S2UA 2OAGA 4CUZA 4ZAWA 2XB9A 1BYUA 4DYDA 4RUKA 3HPQA 1XX6A 3R0VA 4C7OA 1RJ9A 2CHUA 3PR3A 2QUBA 3H9GA 4FYKA 1YB7A 1WSBA 3FLBA 3ZI4A 3VHXA 2XY4A 2WWVD 4D4HA 4E07A 4HH1A 4QXMA 5LIPA 2Z6AA 1SBTA 4YGYA 1U3WA 3F5DA 4WI1A 2X19A 2Z2XA 3H8JA 2XHZA 5AW4A 2YWBA 4QVIA 3W5CA 2XE6A 4JR0A 4GVPA 5MGBA 3NBAA 4ILEA 1IZ8A 1N6KA 4XFDA 4F84A 3C7CB 5DU2A 4LDNA 1ELOA 3K05A 4F04A 5A4IS 4JK3A 3L1KA 4RMNA 4KVGA 1WZIA 4JYZA 2VDRB 3LXUX 3ZXYA 1H3NA 3FNEA 4CG0A 1DWPA 1XWFA 4RZ3A 4IUYA 4PG6A 2IEGA 1M2OA 5FTKA 3B51X 4E5MA 5TLSA 3E7XA 2RAUA 1K2VN 2YWEA 3BMNB 3BG5A 2WAAA 2VNHA 3QVJA 3F5MA 5K99A 5LNK1 4O4JB 5B1SA 2REBA 5JALA 2YMLA 5FNVB 4FHGA 1RBMA 5AHRA 2PZGA 3RVDA 1YTLA 3CZ4A 3A6DA 4EPVA 4WZAA 1L1EA 2IXBA 3RVKA 5EFZA 5A3VA 4B7XA 4EFDA 2VT7A 1B3RA 3TZBA 2YHAA 2Z2ZA 1E9BA 4NEGA 2A4MA 4YRLA 3GEDA 5ALMA 4UU7A 1ZG3A 4DUGD 4NH0A 5KTSA 4QPZA 1OZFA 3CUVA 3KJEA 4RYDA 3A2KA 2O2IA 2QM7A 2PX3A 2WVGA 1C5KA 3ZI0A 1HDOA 1GNPA 1R3UA 2Q5FA 4MCIA 2CLOB 5TGDA 4IW3B 4FNGA 4EL5A 1IPHA 1VQ1A 2Q3FA 3T7SA 1XK6A 2XMZA 2C4WA 2DKNA 2EFEB 3DNMA 4G0WA 1C2TA 2IU4A 1E77A 2EQAA 1I9CA 4V39A 2V6IA 1F2UB 4P0TA 1VP9A 4LHXA 1CD5A 2CB0A 2UYYA 3CUYA 4OSEA 4UVHA 5KTPA 3I61A 3TX2A 4H3HB 3SSAA 4FMDB 4E14A 1X70A 2C95A 1NOKA 2YWJA 4MR7B 4Y2PA 5IBRA 2FA9A 3EEYA 2H06A 3O83A 3W4JA 5A4DA 1HDCA 2ACVA 1EGQA 1GZDA 2GO7A 2PH1A 3K70C 1N77A 3FOAA 4J0QA 4LVCA 4D8YA 5AJVB 5TMBA 2B82A 3D8SA 3M3DA 2I4MA 3OFNA 1A2KC 4U6SA 3RRFA 2PT6A 5KS2A 1C7EA 1QG4A 3DJFA 4AX4A 4MVJM 5EMNA 5LA6F 3RADC 5IRCD 1GDTA 2MYUA 3GLGA 3NT4A 2OGZA 5ES3A 4JU8A 1ZRSA 4ZVKA 2NU7A 1M2KA 1GXSA 3VDNB 3INGA 1AKWA 2FPOA 2CNBA 2HW8A 3QUSA 1PE0A 1QVRA 1T5HX 2QT1A 2BKXA 4FNAA 5I9SA 3KT8A 5AM1A 2FV8A 4FDUA 3SPXA 1DDIA 2ZDQA 3LLMA 3THWA 5BV2P 1L7MA 1UMBB 1PQUA 3A28A 2EATA 4LRUA 2VTDA 3P20A 3PFWO 1CDDA 4EHIA 5C1DA 5AXAA 1N2ZA 2A0FA 2FXIA 2PL3A 3AR4A 4OSPA 3S7TA 4DLAA 5LLDA 3RT7A 3FZEA 3BULA 4DWWA 4B4VA 3ER9A 4MV0A 3O7WA 2PGXA 4AY4A 3C3DA 4YAKA 2Y1XA 3A9TA 3FPAA 3CTMA 4FOPA 4O02B 5IDXA 3UKJA 2PU5A 4TYQA 4CF4A 1X9HA 1QF6A 1D1SA 3FA2A 9ATCA 1NXWA 2ADMA 1L4KA 1L5QA 4UARA 2VXBA 2DTEA 2C5FA 1VSUA 3PQ7A 2B4RO 2AW3A 4PWYA 1VA4A 4AMZA 1YHNA 3KHKA 1Z37A 1A5TA 1DIOB 1NV9A 2WUVA 4XVHA 4ERNA 2CHQA 5FPKA 1RZRD 4FYPA 3EPLA 1FEZA 4ED9A 1JQAA 3OM9A 4HSEA 4RE5A 4V1CA 4XJSA 5B3JC 2ZVPX 3I4CA 2MSDB 3PFGA 5K3AA 2HUNA 2POQX 4BC1A 5DM4A 1KRWA 1RVV1 2J9GA 3SIWA 2PRYA 2AV6A 1XKQA 3AIKA 4M0EA 3HKEA 3ZGYA 4XCQA 5D2CA 3PQ6A 1XJ0A 4G3XA 4MJ7A 5CIWA 3X1XA 1H4QA 2W71A 1NT4A 2J5XA 4DG5A 3K71B 3BIFA 1ESDA 5CMLA 621PA 5DVZA 3ABSB 4O4IA 4IEEA 3BPSA 5JH7A 5LJIA 1KK1A 1D3AA 3B48A 3RYHA 4UHBA 1Z5PA 1SXGA 2AZDA 3JZMA 1IBLB 4P0PB 2JK0A 1ENPA 1L7VC 1SCQA 2ZJ3A 2C2KA 3BIOA 1Y0BA 3P5BA 4MMYB 4PQGA 4X94A 4H60A 1M67A 2X0KA 1KVUA 2ZSDA 2XMCA 2O7SA 4D3DA 2D2EA 1ZRMA 3VDRA 4DHEA 2QG6A 3HVRA 3DEYX 1E1CA 1AS3A 3OZCA 3USZA 4AYWA 3OQMA 1Q15A 3P2KA 2ZI5A 2VHCA 2F59A 3AM1A 3I9KA 3A9SA 1MO5A 1S2LA 5FP0A 4JB3A 4OQFA 1FNDA 3GEHA 2VT3A 4Z1OA 1BVRA 3TBFA 3R5XA 2BT4A 2XOKA 3K1AA 2BBOA 3UJNA 3K16A 2Q5OA 3DTVB 2AW5A 4JHXA 3TB4A 1U3CA 3ORRA 1Q7RA 3FWZA 1U2RA 2PYDA 3TOCA 5HF8A 1MGPA 4X3PA 1AOXA 3QU5A 4LMBA 1YGPA 3L1HA 2BMAA 4Z4EA 2J4CA 3D6AA 1WX1A 2QPLA 2EW8A 4CM3A 1UBKS 1NVMB 3W6NA 5ITVA 1CHDA 3HBMA 3SOZA 1JU4A 4RULA 2EG5A 4EFMA 5THQA 3C4QA 4Q93A 4BNNA 2VZLA 1Z0SA 1Q1ZA 2X4DA 1JLHA 4QTZA 4RBNA 4AULA 1PTKA 1MENA 3OQ6A 5A5VA 1W4LA 3NORA 4C07A 4CMKA 3NCHA 4L5CA 3IB6A 3GPCA 3OMWA 2O0LA 5FRDA 5I51A 2ZJ1A 2E5LB 4HJXA 1M2OB 4WHMA 3Q40A 2TECE 1HYHA 3UFBA 1LRJA 4E2ZA 3KCNA 5JNTA 5F52A 2QWXA 3X1DA 3MCVA 3KQKA 1UJMA 5GMOA 1FXSA 1U1IA 1OB5A 1DEKA 2JIQA 3RLIA 2O2GA 1Q7EA 1WP9A 4DBLC 4D4MA 1PDOA 1J1UA 3GJYA 4OP2A 2WHEA 4WZAB 1JKJB 4IIJB 1VJTA 1DX6A 4URFA 2YJ5A 3B6JA 5CB0A 2QN9A 3IPXA 1YBMA 2WC1A 4GM4A 1T2VA 1N2SA 2ZUBA 4H6PA 1RYBA 4NMWA 2WQ6A 4BNZA 5AJHA 2RGNA 1BWPA 4OQZA 4DQKA 3MCAA 3DZDA 4IVNA 2O3SA 4KX3A 4DV1B 3E3NA 1SU6A 3IIJA 1ZAYA 1GEGA 5C8DA 4RTOA 3A70A 1BAPA 5B4TA 1EUQA 1NE2A 2JRCA 3OZBA 1XSEA 4BO3A 4KOAA 1RMQA 1YR1A 1N5IA 1WMAA 1XU9A 2DWCA 4NJEA 3VJKA 3NYQA 1YT5A 3NBKA 4UJ5A 5H82A 5BXYA 2RAVA 3KZNA 1VHTA 1VGQA 3R77A 4V0LA 3CG4A 4MXDA 4WKPA 5E3IA 3ZCUA 4CI0B 2ASVA 1VG1A 1CY2A 5F1PA 4BO7A 1WPQA 3H2BA 3HADA 5FTWA 3X3HA 1TJYA 1OFUA 2B4YA 4LJ9A 2XRFA 3A2NA 2GK4A 4CCAA 4BLPA 4H7KA 1HQDA 3EVZA 3O4IA 2F9FA 4LUCA 1ZYUA 5BMVB 1M6WA 2PNJA 4UBLA 3VX3A 5BUZA 3A1SA 3UTDA 1C3OB 2G09A 1T8PA 1XQVA 1PR9A 1X19A 2EJCA 3C3PA 4W8HA 1KOLA 3TL6A 4BEJA 1AMOA 1TZCA 3NNNA 3Q9LA 5EXPA 2WFZA 3J81A 1EJBA 1AKTA 2DVMA 5IF9A 4M9UA 4C7MA 1J33A 2AG5A 2IHBA 3L0YA 1JF8A 3R5HA 1ZEJA 1NSFA 3JAWB 4NYJQ 4HQFA 1GXSB 4OREX 3RLFA 5JY6A 3QUCA 1MLDA 3VBEA 3HGTA 1F6DA 3H18A 5KTMA 3IEXA 2R97A 3B3GA 2FDXA 4Q4HA 1WU7A 1QHGA 1P31A 2C59A 5B1EA 5JOQA 3H1EA 1UBLS 1Y3IA 1E3QA 3RUEA 3KB2A 1PD1A 1HXHA 4G8CA 2V7QD 2VWGA 3H5RA 1PX0A 3KC2A 3VR6A 3LHSA 2HJVA 1CQJA 1X7XB 3KJZA 5KYXB 1X7ZA 4IXDA 2BFBA 4FP9A 2AWOA 3L9XA 5IAKA 3DB2A 4AZWA 4TKZA 1UXJA 1I0LA 3SQDA 4DQ0A 1F06A 1DBPA 4CR7A 1YB5A 1XEAA 1X80B 3SS7X 1P1BA 2VR1A 2CL0X 2P9JA 2B3DA 1B41A 3IPLA 2Z8YA 3BHMA 1JLMA 2BUAA 1KAOA 3EVCA 3HPRA 3MFYA 4DZTA 4PYJA 2P3LA 2Q1TA 4FX5A 4CLEA 3C5HA 5U4XA 3F8WA 1KBOA 1VHDA 1UZUA 3PJEA 4MHSA 4S1OA 2OYSA 1NASA 2HX1A 3CUWA 4FLMA 4H17A 5TXGA 4DRYA 1F2VA 5F98A 4CXMA 5BN5B 2IIBA 2WU0A 3H86A 4QPNA 3ESQA 3HXOA 1E0KA 1XTTA 1JBQA 1I14A 3RFTA 1X1AA 4CQMA 1QE0A 2OXIA 2PIAA 2ZI4A 2EJUA 1T5IA 4NSNA 1DV2A 1RIIA 3R9XB 2P9CA 3AYZB 2O8NA 2LVBA 2WIGA 4RFLA 1BU8A 4Y2HA 4ZAFA 4B75A 1I1HA 4V1CB 3ROFA 3UGJA 4LSWA 3R1IA 3HB9A 2FW7A 3UMVA 3EC2A 1XNRB 3EIHA 1UDXA 4HAUA 3G5MA 4IX9A 3HKEB 4BIIA 3JCZA 1W4ZA 1XAGA 1R6XA 1X8JA 5AIAA 1VYUA 3PGJA 1U5AA 5EIFA 1M74A 2R6JA 3KSZO 5BNTA 2AUMA 1VKOA 2KLBA 3M4JA 4O4IB 2EKLA 5JH7B 2YY7A 3G8DA 2ZYGA 5LOVA 1WUHS 1VL5A 2WYOA 2I87A 1CUCA 5HJ7A 3LOPA 3K0HA 1BX0A 2P79A 5C18A 1KFBB 2VATA 4GZ6A 3R20A 3WGYA 4CTMA 3K0AA 2IKQA 3R09A 1OV6A 3BD6A 1YVEI 1FSZA 4A3SA 4CDGA 2DY0A 1I4WA 2IU0A 1JKMA 4LXXA 3UUGA 1VJ0A 3G49A 4PZDA 4MW9A 2E48A 4YJ2F 2B34A 1NRJB 3SLGA 3HO6A 1LFAA 4X61A 1T0BA 1Q0QA 1DELA 1FBTA 1NI4A 5DNAA 2QY9A 3C3MA 1DCKA 1X15A 4LYGA 5BRAA 1EX1A 2W2KA 2GZHA 3LUKA 3G5TA 1HYGA 1FX1A 1T1GA 3GLIB 2O1SA 1EVZA 2Y99A 4BKPA 3GMSA 4X93A 2FUEA 5BWBA 4IH1A 5LXTF 1JFFA 3MJDA 4R0VA 3THYB 1F7VA 5CM8B 3U37A 2W5UA 4FOSA 3PPYA 5BN3A 4AF8A 1EYZA 3A27A 4FWIB 1AX9A 2OK8A 4UUAA 1A0OA 5DTJA 2DJ5A 2XTMA 4KKXB 4F12A 1ZLYA 1W9MA 2C84A 3LZCA 1W93A 4HV4A 2FN7A 4LWOA 4U5XA 1U3GA 1YR8A 3ITEA 3ZWKA 3QX3A 3BA1A 6LDHA 5AHOA 5LU8A 1NN5A 4ZHQF 4A1FA 5JNWA 4UKDA 4DRZA 3HZRA 1CSEE 4ZCTA 1Z2OX 4UBKA 1BVUA 1A7UA 1R5OA 1G3IA 3EFEA 1XTBA 4JBLA 3U7QB 4MA5A 4A0FA 4AO6A 1MQAA 4G0UA 2PO5A 4QYSA 3IUJA 4MKHA 4QJ4A 1F2DA 2YIJA 3AXSA 3LKDA 4KIJA 1L7PA 1PN3A 2GK3A 1TLFA 2A5GA 3WKDA 4WW0A 4ZJYA 5J40A 4I6GA 4UBJA 1CUIA 2JHCA 3IMCA 5BQPA 4YGXB 4WACA 2I3DA 2DF8A 4LXIA 3RVNA 2CXNA 3LZ6A 3DTNA 3I1YA 4NCNA 5F3RA 2YZNA 1E3DA 4DGQA 3DOHA 3DQZA 16PKA 1QYVA 3OX4A 1PV2A 1JDTA 1RQ7A 3JQ6A 1NULA 3LWDA 4XLLA 3KR0A 5T7BA 4XWWA 3TLGB 3VHRA 3HK2A 1OR8A 1QBGA 2OCYC 1OBCA 2GKGA 3AWDA 1JXMA 3F3SA 3X43A 4AKSA 2JAHA 1JWBB 2X8JB 2ZCJA 3ZDBA 3G9TA 3ENNA 1XEFA 3AZQA 1FNSA 2GFQA 3DE6X 3OICA 4E7PA 2C7BA 1NJ6A 4FR5A 2OO3A 3A1WA 3RVPA 4XGQA 3KEOA 5AUQA 3RUAA 4B74A 1IY0A 2FGJA 1HT2E 3CFYA 4P9NA 1DQPA 2CDNA 3GF4A 2FFJA 4A7PA 2PUWA 5TF0A 2VDUE 3RABA 4LI3X 1WB9A 2QR3A 2E9SA 1B93A 1VI2A 2BMJA 4OKIA 4Y6PA 1PTJC 1G20B 1N5JA 1A96A 1PJ8A 4V0ME 5DKFA 2W7TA 1X7HA 4B7UA 4DLWA