3EFHA

Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
314
structure length
307
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
rcsb
source organism Homo sapiens
total genus 94
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA02
1P19A 1QCDA 1JLSA 1VDMA 1OROA 4RHYA 4QRIA 1BZYA 4M0UA 1ECBA 1WD5A 4LZAA 2IGBA 2PRYA 1BD4A 4RANA 1J7JA 4JITA 4ZFNA 4RHXA 1LH0A 3DMPA 2JKZA 5BRNA 4Z1OA 1JLRA 3G6WA 1GPH1 3NAGA 3GGJA 4RV4A 2WNSA 1HGXA 1L1QA 4WN3A 4P83A 4WMLA 1DKUA 4RAQA 1QK3A 3MBIA 1TC1A 1ZN9A 4PFQA 5KAMA 3DEZA 1DQNA 2PRZA 2PS1A 1A3CA 2HCRA 2YZKA 3KB8A 1NONA 1ECFA 1DKRA 5JV5A 1OREA 1G2QA 3GGCA 2E55A 4QYIB 3QW4B 4IJQA 1P18A 4S2UA 4P80A 3GEPA 1XZNA 1A95A 1L1RA 1DQPA 4TWBA 1D6NA 2VFAA 3ACCA 3OZFA 1XZ8A 1Z7GA 4MB6A 4RQAA 1I5EA 3S5JA 2P1ZA 3O7MA 1A98A 1UPFA 2H08A 4RHUA 1STOA 5BSKA 1YFZA 1O57A 3ACDA 1A96A 3OHPA 4OHCA 1G9SA 1UFRA 1V9SA 5ESWA 5BQOA 1ECCA 1QB8A 2H07A 3H83A 2EHJA 4LZOA 5IAOA 1OPRA 1IBSA 1XTVA 4P86A 1ZN7A 1A4XA 4LZNA 3EFHA 1VCHA 4X45A 4RADA 4RQBA 4PAWA 5EUCA 1QK4A 4LYYA 2FXVA 4RACA 5KAPA 1I0IA 1HMPA 4RAOA 3LPNA 2C4KA 1PZMA 1R3UA 5K51A 1MZVA 3OZGA 3MJDA 1W30A 5BQPA 1ECGA 3LRTA 3ACBA 1NULA 4M0PA 4P82A 1Y0BA 3N2LA 1I13A 1G2PA 4LYGA 5E38A 3M3HA 5HKLA 2JKYA 1AO0A 4RHTA 4F8EA 4JLSA 1U9YA 3HVUA 2JI4A 4FYMA 1FSGA 1QCCA 2H06A 5JSQA 4QYIA 1P4AA 1XTUA 2AEEA 2GEBA 1I0LA 1P17A 4KN6A 4RABA 4X44A 2DY0A 1TC2A 5ESXA 1I14A 1QB7A 1XTTA 1UPUA 4M0KA 1CJBA 2XBUA 4P3KA 1DBRA 4P84A 1O5OA 4P81A 1BD3A 3DAHA 1GRVA 1QK5A 1U9ZA 1ECJA 1VSTA 1ZN8A 5IPFA 5HIAA 1G9TA 2JBHA 1A97A
chains in the Genus database with same CATH superfamily
3SF8B 1RS0A 5HJ7A 3U9SA 2O7SA 1U7XA 4QATA 4AICA 2YJ5A 1P1RA 3WYBA 2VZ0A 4TS9A 3KV3O 2XD9A 4H17A 1B7GO 4KAJA 1SRQA 3B82A 3IVXA 1SXQA 1UBKS 4OIMA 1EGQA 3WMGA 4E70A 4EPTA 2JEYA 4YAKA 5HM8A 1K6EA 3ZBQA 1FNMA 1S3GA 3EEIA 1EHCA 3CT4A 2H8KA 3IMGA 1E32A 1FTWA 3AF1A 1VL1A 3IUMA 3CW9A 4KH1A 2HA7A 4V0ME 2XGOA 3WSVA 1T24A 1ODIA 3EA4A 3ESXA 2WA1A 2XCUA 3W7AA 1BFUA 1XPRA 6PFKA 2QG6A 4URHA 3U7GA 3VMFA 2JH9A 3KL4A 3KQMA 3RUEA 4L08A 5AJTA 1UK7A 3L02A 4F0JA 4B0PA 2GBPA 3FVQA 1PSDA 4XB2A 2BEUA 3SU8A 3HNRA 1E1QD 2H2FA 2NVUA 1WUHS 3HKDB 4PO8A 2HWWA 4C2AA 4OB7A 4BLVA 1NVDA 1FNBA 5BNZA 4N5NA 1CUYA 3PD7A 3V4RA 1RABA 1BDMA 5JV5A 1W5BA 3F4BA 2H17A 1NBEA 4CCWA 2V1XA 4F04A 1PT7A 3OLYA 3U6KA 2Y1WA 1REQA 4KYIB 4B3BA 1RZRA 4ZEWA 1MENA 1OLUA 1GRCA 3S7ZA 1EIZA 3D1LA 2C00A 3FMFA 4NZPA 1GDTA 3HWX1 4MUMA 3UPTA 2CGEA 5I8PA 2VDMB 1BKDR 1XDBA 4UUMA 2OC9A 1NVVR 1PDVA 3QOYA 3DE5X 3EXIB 1QRRA 4JC0A 5ESRA 4GKKB 4PCVA 1U7WA 1YQWA 2EX1A 1JKJB 3I45A 1XRNA 3CN7A 3RAJA 1GGMA 3L7LA 3UAOA 3KTAA 2XQJA 2I2CA 4S2EA 1JHAA 4YV7A 5LXTA 5B6JA 4LX8A 3WLQA 3BK1A 2P90A 3OMLA 2HWUA 4AW9A 4N6GA 3VYUB 5DI9A 1DSSG 2Y4NA 2GWRA 3CLTD 4QPPA 1BHJA 1U3GA 3WZMA 1PX0A 1L5GB 4G5OA 1Y8QB 4YS6A 1CE8B 1E4YA 4UM9D 3UO8B 4K1XA 3T34A 4IAOA 1TO1E 1GTG1 3IULA 3G1UA 4IS2A 5AMXA 3TQIA 2H4HA 3U7QA 1IZ7A 1WW2A 4E09A 1FSFA 3U4DA 1AF7A 1FDSA 1BQEA 2AG5A 2XKBA 1GYPA 2P2SA 3BFXA 5AT1A 3LRTA 3BD8A 2P69A 4JEMA 3ZG6A 4AJEA 1X77A 1XV5A 2QNRA 2ZRDA 3FR8A 1N4DA 1JBEA 1XZEA 2C2MA 3I6IA 5F4BA 4D0SA 1YZNA 3DAYA 3I53A 1GVNB 3I04A 3WLEA 3KWJA 3EN0A 3ROPA 3F47A 1WTCA 4AIIA 1FSGA 3EGVA 1VKJA 3DE4X 1L5YA 1ZG3A 4M2LA 4WNCA 3D7MA 1K8ZB 5CVTA 1I80A 1RM0A 1TCVA 4Q19A 1UKCA 2E5FA 3E3MA 3NTUA 4FE4A 8AT1A 2ZANA 4CN8A 3G79A 1ZL0A 5AVUA 1XMOB 5LBTA 2AKEA 1RYEA 4AO8A 3V7YA 1NATA 3I2KA 3PB3A 4WVFA 1D6SA 1O5TA 2C8JA 1T2AA 3VOTA 1CT9A 1ZWLA 4G0VA 3OY7A 2C78A 5GM1A 4LJ6A 2BFDA 4OHWA 3UT5A 1U0OC 5FJIA 1UOQA 3B20A 4YREA 1NMXA 3EIWA 1O2DA 2J0UB 4QX6A 2FEKA 1PAUA 3GVIA 1MP0A 4HGNA 2C7QA 1S3IA 4MQMA 4CKCB 5DM70 3HZOA 1NE7A 1BCRB 1VJGA 1X39A 2WG1A 3IAXA 3B1WA 4Z7OB 2BGLA 5ALDA 4ZK6A 1TA4A 1M2KA 5JPDA 4HMQA 5CIWA 1HETA 1O7JA 2BGUA 2VOJA 3MELA 5B2ZA 2WZBA 2XCOA 2RI1A 1GR1A 2XLBA 2SCUB 3D2CA 1A9SA 5BMVA 1U1IA 1UFVA 3BL6A 4E30A 1XJCA 1RQRA 1HDEA 2KBFA 1NXTA 1B74A 2ZWOA 1J0EA 5FT9A 4RKQA 1A8SA 3C3YA 5HCIA 2ZW9A 5C1IA 1CDOA 4BB9A 4BKOA 3UG7A 3IB3A 1I4LD 3Q41A 3DDHA 1JAHA 2VT3A 4ZI5A 1RYNA 1DHRA 4JB3A 3T5GA 1X7GA 4DJ5X 4EY6A 4F45A 5KOJA 2GEFA 1ID8A 3OLWA 3LT1A 4DLKA 4ROSA 4ZO8A 3TW4A 2R6ZA 3W9SA 2ZM5A 4Z9BA 3FCSB 3RCBA 5K8UA 2ZSKA 4RHEA 3T1YB 1PUJA 3GA7A 3HLYA 2ZITA 4LJ7A 5JXJA 1M2OA 1MB4A 4IDBA 1R0XA 5E1BA 1IPEA 2WJYA 4XAQA 3C5HA 5BQXA 3AEXA 2CDBA 1YVRA 3NNSA 4HH4A 5L3QB 1KEEA 1G9SA 1V9SA 4CQMD 2CYCA 2NO6A 1U4SA 3TTUA 2O59A 2FSVA 1H8ED 2YV2A 1U2DC 4P4LA 1U0FA 1GAXA 4CJXA 1T5BA 2SNIE 2XUOA 3LWBA 5F52A 3WK6A 4FBGA 5F23A 4BGIA 5FPHA 1BMFA 4RENA 4HN9A 3ERCA 2D13A 3BZBA 3P9IA 4FT4A 4ILKA 1SCKA 1E0AA 2AD5A 3MEQA 2J41A 2X14A 3HB5X 2Z2ZA 3IS3A 4I1RA 3N2GB 3IEPA 1PZMA 2R1ZA 3D6VA 3V1KA 1EYZA 1XL0A 7ABPA 1AU9A 3TQSA 2EHDA 5J5AA 1LRJA 5JSYA 4AZWA 5TARA 3U7EB 5K0TA 1D6JA 4P82A 1R6VA 4URWR 4EUHA 4Q48A 3OE5A 2DFKB 5EZ6B 4DCGA 3BWCA 1JVNA 4XJSA 5BN3A 1VC2A 3DEKA 4KRYA 2WPDA 1YB7A 1I6WA 1KY3A 2CXXA 1VSQA 3S44A 1C3VA 3HNOA 4TKUA 3ZOZA 4EA6A 4YMVA 5BSEA 3AL0C 1TL7C 1ZJZA 2V58A 3MJ4A 2RHLA 4Y9DA 3RRBA 1B2RA 4E13A 1LV8A 4NC9A 5AKGA 1M0EA 2QTMA 1XTQA 4B3FX 4MUKA 2QEQA 3QUBA 1CJBA 2LRHA 3JD3A 3TCNA 2XUFA 1GVHA 3CH7A 2YJ4A 2B8JA 2I33A 2OD9A 1QUEA 3K8OE 3GROA 1C3XA 3GJXC 3CNLA 5AW4A 1PLJA 1ZN8A 3C7AA 1PQ4A 3VPDA 5KVAA 2DUNA 1MX3A 2DULA 2Y1XA 5LZ9A 3HUTA 2P41A 3BB1A 4HZIA 2C98A 2XWBF 2GJ4A 2YFKA 1HL3A 3KLNA 1U0SY 1PL8A 2IXAA 4K9KA 4YCJA 3NBXX 4AY3A 4EGQA 5CLHA 5MN5A 3WK9A 1KI4A 2O3RA 4BJ6A 4MROA 4ZU6X 4MPDA 3NR2A 2BZ0A 3R3JA 5KYNA 4NYJR 4CODB 1LDYA 4QZVA 3R2JA 4KVFA 2XNKA 2ZKIA 2H1IA 3FTEA 2YMLA 3OF3A 3V42A 3Q4GA 3THXA 2ZBEA 3TLMA 1A4IA 1HE4A 3V34A 2OO5A 2P8SA 4NU8X 4BUZA 1TPZA 2QSYA 5KNDH 1G5TA 2GILA 2OK8A 4NU0A 4QRDA 4FR0A 3ZHVA 3N8NA 4P34A 4OVKA 3IJEB 4FYXA 5AI8A 1EXDA 1EQUA 3NVMB 2C8LA 1EX6A 2QM8A 2R11A 3HB7A 3O6VA 1PD1A 4B73A 1H0KA 2XX3A 4F2HA 1OB5A 4KDEA 4INJA 5FOTA 4K86A 1CUXA 3RUIA 2WTBA 3G7UA 4M60A 3M6AA 4Q1EA 2CCJA 3DKIA 5LMZA 1NKSA 1QQTA 2PRJA 3NHMA 1MAUA 2HXYA 4ZOLB 1CUHA 1P31A 2X9QA 4G81A 1IN5A 2HPHA 5FWYB 1DFGA 3GBSA 3Q2IA 2D5BA 4YPOA 1QUFA 4TZTA 5A4DA 5CD9A 4RZ2A 4WOJA 3UQZA 4WTOA 3C3PA 5A7HA 3G5TA 5KKCA 4BNUA 5KVVA 4Q4HB 2FMFA 1G2IA 2C8VA 3PRHA 4S35A 3I5AA 2DBVO 1EVZA 4IVRA 4FOPA 3OM0A 4QQRA 1A96A 3FMIA 3O4JA 4HZUB 1U3FA 1KQ3A 1GKLA 2DHQA 2E4YA 2VSYA 3B9BA 3KKLA 4OO3A 4CIXA 5J4KA 2WAOA 3VR3A 4EFDA 4CMJA 4JYZA 2BJVA 4DIFA 1L4KA 1UDCA 1OTYA 5T3YA 4CM4B 2QR3A 3G89A 3P1JA 4EY8A 3L2OB 1UBMS 2E82A 5KQPA 2XCTB 1JEDA 4M7PA 4E5PA 4N3AA 1K66A 1RW4A 3HDVA 3P52A 1QH1B 4CDNA 3VDNB 1ARZA 3HYLA 1N2IA 1UOEA 3TGWA 2P9ZA 1GZDA 3ZCVA 3DHNA 2H9AA 1HDZA 1H4SA 1PP4A 4OYRA 5B1DA 4RTLA 1MU0A 1DO2A 3H1AA 3QTTA 4J0GA 4AMBA 1YE3A 1M5RA 3K0EA 3MG9A 3EPLA 5JDCC 5FOQA 1MW8X 2X42A 4KPFC 1VJRA 3A1VA 3KJQA 4IUCS 3CF2A 3N76A 2OOSA 2WTMA 2EIHA 5JQWA 4PZCA 4EGSA 2JHAA 4HWPA 7REQA 5LQRA 1CUCA 3DD1A 2AOTB 3ZWYA 3HVUA 5FBKA 1D8AA 4XQEA 2YNMC 2VH1A 1CDEA 3OJCA 5D5QA 3UC9A 3UTDA 1NOIA 4S12A 1HT3A 2WZDA 1XROA 1GQRA 3D0QA 4RA6B 5F78A 2PX4A 2PS9A 2YXDA 2DXIA 1CS4C 2A9PA 4ALMA 5AM1A 1A2BA 2WT4A 2WSIA 5C32A 4XGKA 1NW4A 2C92A 2VF5X 2YTZA 4PLVA 5LQCA 2Q41A 2BKVA 1ONSA 1K0UA 4MUXA 5FNVB 2Z95A 1XVAA 1LSJA 1H8EA 4DLXA 4FGSA 2J9YB 4MIEA 4CVNA 3ZXUB 1U3WA 3PNVA 4V1CA 4WCFC 4JB8A 1NVGA 3HV2A 1BC5A 4MMZB 3CH6A 1O1YA 4ETIA 2C2HA 3FBGA 2VYCA 1RQNA 3AIIA 3FUVA 1OAAA 1TNDA 3D59A 3DBRA 1HY3A 3GAZA 3ENVA 3LCJA 4KQMA 1BGXT 4KC0A 4ONEA 1MAAA 1RMYA 4R31A 4WASA 3ZK7A 2O7VA 4ZAYA 4CEHA 1RHUA 4MS4B 4QICA 4EH1A 4E5VA 3L1IA 2ONJA 4IIGA 5HQJA 4P5DA 1BDIA 3TLBA 1DFHA 2HREA 1JG7A 3SJBA 1K5HA 4CQJA 1L3IA 3PI7A 5FTJA 1N2HA 2BR3A 1DIRA 2OBYA 3ONNA 3TQCA 1IN4A 2XNHA 1CDZA 1XLTA 1KE1A 2BEWA 1FTQA 2DWUA 1SUBA 3PJGA 1QK3A 3TL2A 1PT5A 1E8DA 2IIQA 1UOPA 1X38A 3DEZA 3QRWA 4G0WA 2YJTD 2CVHA 2QXYA 3PXUA 2F59A 1J2TA 1XZAA 4AQ7A 3WI7A 2FMTA 3L9XA 1IJBA 1PJTA 3EY4A 4AZSA 3H19A 4HFJA 1E2LA 4Q0MA 3WB0A 4DS3A 3FWHA 3NX4A 1RJWA 1FW6A 2GARA 3NDRA 1Z4MA 2FDXA 4LXTA 3LUPA 2NTVA 3OUUA 4JXKA 5IH7A 2GXSA 3JQEA 3H2SA 4G8BA 1ZJWA 4YRFA 4N7JA 3LQ2A 1E59A 3R09A 3G7SA 1XVTA 4A16A 5H8WA 1P2BA 3KR9A 2CJWB 2CXTA 4KSBA 1C1YA 4W5TA 1NUSA 1A5SB 3RRNA 3JAKB 1Z2OX 4RL4A 4G1UC 3DLHA 5CA1F 2YCLA 2QMHA 2IV3A 4LXGA 3AHFA 4D0NA 5CT9A 3TG2A 3LX5A 2M6KA 4KR7A 4J9VA 3NM5A 3BTOA 4WD3A 1ZH6A 5HIIA 4HI0E 5TS2A 4MPPA 3KAQA 5D3MA 2EEZA 4ZAFA 3ZK9A 2MR6A 4RY9A 4WXMA 1HZZA 3CR7A 3WL8A 4EATA 3OTOB 2ZUFA 3C41J 3IXMA 4MR8A 1IBCA 1QDEA 1ZD3A 2ZR7A 3JWJA 4GM1A 4ZARA 1GEEA 2AL7A 2NNLD 4ESHA 4URXR 1X3SA 1V4NA 1G21A 1L4HA 1AVTA 2J7PA 2VYVD 4HVLA 1ODFA 4RVGA 1BE6A 4RTSA 1GD1O 4HRYA 3VXKA 2ORYA 5D3QA 2GO1A 2PCJA 4MPJA 4O4JF 3OP4A 4YJHA 5FDFA 3KOZA 3M4JA 3NCTA 1PS0A 4X1IA 4O2AF 1ULBA 4NS4A 2G82A 2HLDD 1IQ0A 4RLSA 5DEIA 3BS4A 4YJFA 4BHTA 2GH1A 2WM8A 2W37A 3PICA 4OV6B 3LPCA 2PG3A 2YQ4A 2ZI3A 3LPAA 3NGLA 1KNQA 4Z4GA 2ZTHA 2CNBA 3E9NA 5LVAA 2ZJBA 4MTCA 2VJDA 3QZUA 1RXYA 1T5DX 1PLKA 1Z0SA 2P75A 3HA5A 1FXSA 3AFMA 1YONA 3H1EA 2ZLBA 3HFRA 4IIXA 1L7OA 1OLUB 3W9BA 1YS1X 3C6ZA 2FXIA 3HCDA 3U7RA 4DMCA 3LX8A 1UAYA 1E1NA 3EEFA 3QBEA 2OCBA 2Y9PB 4FLEA 2YJ3A 5FBRB 4DDTA 1MIOA 3M4YA 3IOYA 5JNUA 3INNA 2WVAA 1HDRA 4UU7A 3A6ZA 1Y81A 3CUTA 4MI6A 2O1SA 5WRFA 4M1TA 3KRTA 5AVTA 2GDZA 2UVPB 2CUKA 2QRPA 4MB2A 1L7XA 2IITA 4R8KA 2NXNA 3KYDA 5BNTA 3VR2D 3U1VA 1LXCA 4M0UA 2O07A 4OMUA 5DHUA 3BXOA 1KBQA 2QYTA 3FBWA 1GPYA 6GPBA 5K9ZA 2Y1LA 3PWZA 4LPSA 1U4NA 3CZ5A 1Z63A 1XJQA 1Z34A 4MLCA 5C1BA 4OXQA 5AKKA 3ISJA 1D4OA 3C6BA 1P1KA 3GQVA 1DV2A 1KWGA 3LVBA 5JYBA 4Y1EA 2IEDA 2EZ8A 5JYDA 1RWKA 2F8LA 4JL6A 5ERYA 1II9A 2ZRBA 4NBTA 3ESDA 4WI1A 3TNJA 3BIFA 1DIBA 1H2WA 4XTCS 2GN8A 3IFSA 5K8IA 1JIKA 3TIVA 4IRXA 4UFOA 4ARAA 4U0KA 3AF0A 1CQPA 1ZP6A 1JDPA 4HVCA 3BXFA 1AGNA 4V1CI 3TIXB 2PJZA 3V55A 3RJTA 4ZQIA 3NBKA 1K63A 1H9CA 4BAGA 4YMUA 1NXPA 2QVLA 1ECFA 4NK5A 4TYNA 4HLUC 3DKKA 1CJTC 4LVCA 3WP0A 1ICIA 1BWRA 3IIEA 3AT1A 4K0RA 8ATCA 1IXRC 3ZX5A 1C41A 4BTVA 4MUJA 2F8TA 1TAQA 3CXRA 1YJ8A 4PXSA 4ARZA 3C6YA 3CWCA 3OD1A 4Q7MB 2BI8A 5ALMA 1NNEA 2D4AA 4QYWA 3JVIA 1IHOA 5AOCA 1UC9A 4IX1A 3RFFA 3GNQA 4UBKA 1IB6A 4QQ8A 1QHIA 1Z08A 1QLJA 2EOAA 3PFKA 1YQDA 2OPHA 1F12A 4ID3A 1P4JA 4LDJA 1SXJD 4YR7A 3W1EA 1Q0QA 1W2GA 1WUJS 1XZPA 3JR3A 4LTNA 5AM4A 2FETA 1W59A 2FGJA 4ABTA 1PBNA 1QHSA 3QMPA 5B3AA 4BQRA 4X84A 4EK9A 5CEEA 4OK3A 3E8SA 5AJZA 1ML3A 4C4OA 2EFEB 3RIHA 4MGYR 1ACJA 2B5OA 2HSDA 3BC1A 2H0AA 4NG4A 5ECGC 3S2IA 2AA3A 1BFDA 4QTXA 3LPDA 2C1ZA 1G7CA 2FFAA 1SQFA 2BGMA 1IOZA 2OD7A 3NWJA 4QAQA 4YV1A 2G8NA 2A1IA 4UU8A 1L1EA 2O1EA 3MMXA 2JZNA 2PN1A 1WEHA 2OHIA 4U7HA 2WU8A 4R1LA 1ECLA 3HB9A 2B7LA 5D00A 4DSOA 1OPXA 5FP0A 1L5NA 5BMVB 1DADA 1NJSA 3C7DB 3L4BC 3SYRA 1NQUA 3JVEA 4FFNA 5EMNA 2O1WA 1WXDA 3THYB 3FIJA 3JY6A 4BEJA 3G5MA 5HGXA 4LFAB 1FJHA 1OZHA 2FQWA 3B1ZA 1RXVA 2J9RA 1UKEA 3GVCA 4MSUA 5C5DA 3MNFA 1JI0A 2ON6A 3A7EA 2H7XA 2DHRA 4QQFA 5FFMA 3DFKA 4B81A 3IO5A 3OH8A 5BW4A 5LQAA 1AO0A 4FCTA 1WW8A 3RSOA 4JT4A 5KOJB 4BKRA 2NTYC 5BOSB 5KOHA 1Y6GA 2WAYA 3EW9A 2JJ1A 3GFBA 3RE1A 4ASUD 3ONFA 1KS2A 1BKSB 2GN6A 2YYYA 4JELA 1ZVVA 1QU3A 3Q72A 3FUXA 3WKAA 3ZCXA 5ALPA 4U3JA 4JLKA 4P4TA 1UM9A 3HA2A 1VL5A 4NCJA 5A0FA 1M2OB 1MW9X 4DM3A 1J8MF 4KB5A 3GJ4A 4QVIA 2QTLA 3ADBA 1ACLA 4HB2A 3L6CA 5AXAA 1KEEB 3HFSA 1I1HA 1ZUIA 3C5EA 3UCFA 2ZQZA 4YMHA 1UDBA 5FBWB 3B38A 2J9FA 1ND5A 2HRDA 1TKAA 1EI9A 5CNKA 3HJHA 3Q87B 4UQPA 4AJ1A 1T1EA 2RAPA 3DAGA 3KZKA 1SOMA 4Q01A 1H2FA 2ZBGA 4HWGA 4HPWA 4WFIA 4CKXA 5D51S 1G5HA 2CEKA 1FVXA 5JAPA 5DYGA 2OB2A 3R5SA 4MRMB 1BX0A 1RKQA 1WLSA 5CURA 1U94A 4J7AA 4EWLA 1SC4A 3EUAA 5D3ZA 5KDLA 3RG8A 1Y3FE 4ZZIA 3MCVA 2CNNA 2R00C 4FN5A 1J8YF 4Y9UA 1PSZA 3CX6A 3SEQA 2JKVA 2ZS9A 3K4HA 1O95A 3MTGA 2HLDA 5FX2A 2PAFA 3IAAA 1NRXA 3HR4A 1DKUA 1V25A 4B83A 2R4UA 1C1XB 1F60A 1GA4A 4FC7A 2FKAA 5ANRB 4G0PA 4KNVA 5JSZA 4PFSA 1Z8HA 2AHRA 2FSSA 1N2SA 4PG6A 1VBNA 3QI2A 5A5VA 1QVZA 3VKHA 4B46A 2HADA 1BYUA 2O2IA 4OGKA 2DFNA 3T9FA 1HOTA 1AGXA 2UYCA 1H2AS 1T3HA 2C3YA 2VAPA 4TKUB 5COQA 4TXLA 4YP9A 3KYCA 3A6FA 4GPEA 1GG9A 1DBIA 3GFRA 3DQPA 1O0CA 1ZMBA 3SC2A 5KTMA 4Y2SA 1F2DA 3V6LA 4JU9A 3GEPA 3P9ZA 3O38A 1FRVA 4LRUA 4WWHA 1N0WA 2DBYA 5C18A 5IM4A 1CVLA 1FYEA 3PKJA 1BJKA 4V0SA 3HU5A 4QIHA 2AN5A 3RUDA 4RYLA 1TT5B 2ECOA 3BJIC 4RIHA 4WZZA 1N8TA 3A1SA 4JLJA 3TSOA 5JJ5A 4B6FA 1DG9A 3GVXA 2XGJA 4X6LA 4LOJA 3IALA 4JJ8A 1MEEA 4NABA 4XGRA 3WYCA 2I1LA 1SU8A 1MEOA 1D2RA 1YVDA 3C16C 2P9TA 4FFMA 1CEQA 4PGGA 1RDFA 4CMHA 1KQGA 1L5RA 4ND8A 3WAKA 1N5DA 2I0FA 1UBUS 4TOIA 1EGMB 2I4RA 4Z7JA 2HIGA 3FCCA 4G1CA 2E1PA 4Y6RA 4DIOA 3KQUA 4KGXA 3THXB 3FJOA 3F8WA 1AKVA 1HSOA 3RSGA 2PZMA 4OAOA 4WFQA 4RVFA 5EUCA 5IDWA 4BYGA 2GTPA 2CEAA 1LTQA 2QORA 3DMGA 2C4MA 2I87A 1AJEA 4D46A 4QECA 4Y2PA 3JZFA 2R1TA 3DEFA 3JATA 2COEA 2YDXA 2HMYB 2GF9A 4NFLA 5EYPB 2X9GA 1B2LA 3FJYA 4B4DA 3KNZA 3EG9A 3PGA1 3TINA 5I4CA 2FJ0A 3T8YA 3FROA 1Z25A 5EQFA 2JHGA 521PA 2YXPX 2YUIA 2JFFA 1V8BA 3GH1A 5IAGA 2JCVA 1E2NA 5A9TA 1A1SA 1YBHA 3PR2B 4KQCA 1NRJB 5B64A 5FOUA 5JWRA 1TLTA 5ITZA 2YJ6A 3MB5A 1U7HA 1VCIA 1G8KA 4EB6A 5FA5A 3I37X 1I0LA 5FA6A 2UZ1A 3I01M 1VE6A 4MYRA 4D9NA 3QF4B 1DAHA 2OCPA 3P2MA 3WNBA 4DUGD 2XMPA 3OE7D 5F7XA 3QWBA 3RRZA 4X85A 5JD6A 1YFJA 4J29A 1QYIA 1WUKS 2IF2A 3EGXB 3U09A 2WD8A 2X0DA 3ZCRA 1EK1A 2FP3A 2QRHA 2ZT5A 1QCYA 3DZKA 1YGPA 3CWQA 4Q1DA 621PA 4CL2A 4WDQA 2XW6A 1RC8A 1QQ7A 4CL3A 1RM3A 2A5DA 1G4UR 1G8SA 3LDHA 2OA0A 1OFUA 2Z3WA 2GA9A 1U8XX 2ANBA 2RFLA 3CW8X 3WGOA 4F3RA 2G9VA 3BCHA 4MGEA 2Q5EA 2JGFA 5JBQA 3R7DA 3CU5A 2MINB 2F1RA 5BWOA 1UWCA 1NX9A 2YRWA 5DV9A 3RVMA 2V0CA 4LZPA 1D2GA 4PNPA 4EY3A 3C3EA 1BH6A 2GEVA 1UEXC 3G8CA 5B58C 1XALA 3I76A 5EUQB 2QDXA 4FJ0A 2RH9B 4ZVSA 4R2MA 2FN8A 3IDAA 4D4KA 3R7NA 1N7JA 2BVNA 2B1JA 4WN9A 1E9CA 1TZKA 4H0CA 4WBNF 2PKEA 1UBHS 5HJ5A 2DCMA 4EOGA 2WLTA 3U3RA 1GL9B 4O08A 4QOHA 4XGIA 3UKJA 4OA8A 2X3FA 4H1WA 1IC6A 1Y7IA 2J09A 2GN4A 3MM4A 2XSZD 3DXFA 3MT0A 3OX2A 5FWDA 2ZJ1A 3SHFA 3UMMA 4MRPA 3G5LA 1SVSA 1TI7A 3SE0A 5DRYA 2D1FA 2RHCA 1IAVA 4XSGA 4OX9Y 1TT7A 2FG5A 4LNAA 3ZGLA 1CYDA 3U2QA 4FQ8A 2BHTA 2QL9A 4B8ZA 3KUUA 4HDKA 2FW7A 1S2DA 4Q9AA 2WU4A 2JLXA 1M6VB 1LTKA 2OM2A 3DTVB 3O7MA 2PVSA 3I5YA 1ID1A 4K6FA 1HK7A 4B0OA 1KO5A 1JG6A 2X0KA 1N2CE 1X1DA 1SHKA 4HGOA 1XYVA 2NVOA 4JSTA 4P3OA 4RXUA 1BVRA 3RDPA 3L4KA 3PHIA 2GYVA 1NVVQ 1JNXX 1QHYA 2CDNA 4DUPA 4FGUA 2PSSA 5KYVA 3Q11A 2IEYA 4GOND 1M5TA 5SYAA 5CYFA 2RHTA 3TKAA 4X6YA 3E2IA 4RJJA 2GXAA 4P3YA 5DVZA 3KSMA 2E4VA 4UDNA 3OURA 3QPBA 1QFYA 1G20A 4RACA 2G1UA 1OR8A 1GQYA 3H4MA 2QRMA 2OENG 3R3XA 1XCLA 4BO1A 3C5WP 1ZRNA 3A2NA 2OO7A 4DM4A 3WA6A 1YD7A 1GGHA 1IM8A 2HNBA 4LHVA 4CUZA 1VHJA 4G4SO 2EFDB 2QLJA 3UMGA 4G4IA 4W5RA 3FZEA 4U2EA 3JAMA 5G0SA 2X1MA 2EGGA 1OZAA 3ZOKA 4RF5A 3N0TA 1VLQA 5E6SA 1J09A 1GQ2A 4QULA 1YDGA 1Z4JA 3ZWDA 2Z8XA 1C0PA 3A6PC 2PU7A 3L40A 3FOBA 2F9FA 4HADA 1XLVA 2WJJA 4YNBA 3F8TA 4QJBA 1J2EA 1OMOA 4QTYA 3S8YA 3R76A 1D0VA 1IM5A 1RYHA 4OLFA 2I5PO 5CYOA 3O3CA 3S2SA 4ER5A 1N33B 2R84A 3E1KA 3IEXA 3I34X 3B5JA 3EWAA 2RARA 1AE1A 2ZRLA 3DZBA 2Y1DA 3G6WA 4UBOA 4BNTA 4EG7A 3EGIA 2HXGA 1BHQ1 4B9AA 5IJ0A 1MXFA 2YWGA 5AOBA 4CLHA 4MWBA 3KPYA 1QHHA 5I8ZA 3WXMA 3ZN2A 4B43A 4HUTA 3ZV7A 2C3UA 4HVTA 4MR8B 4UEWA 1AKEA 1U90A 1E18A 2QT0A 2WTNA 3LP5A 1G21B 2I7XA 3UT6A 1PJBA 1Q3TA 1CV2A 4LQDA 4ZT3A 2H16A 4TTSA 1PSWA 3PJRA 1NMZA 4FEEA 4B6PA 4D97A 3BTVA 1Y4SA 5BV8A 1TOAA 2NU6B 4ZZ0A 3FNFA 3FWNA 4X1IB 3SLGA 3NXKA 4PRZA 1MG5A 3K6JA 4EABA 2GKSA 5CK4A 5KVCA 3KQNA 1IPFA 1XNHA 2QM7A 3KFLA 3GJ5A 3C70A 4MCHA 5MHTA 1WVGA 1Q3HA 1J07A 5HQTA 4P5PA 1W47A 1U7PA 3K9GA 2JVIA 2HPAA 2FPOA 1A9XB 1XZMA 4JHXA 1Z68A 1X7YA 2DLDA 4CI0B 3QW4B 4JX8A 5JZMA 1GNSA 2CFRA 2Q3BA 3HU3A 2QYOA 2A94A 4A91A 1A95A 1JIXA 2PKXA 3G5UA 2BMEA 1UUFA 5IC5A 5A4FS 5I9NA 1LDGA 1T3LA 4J4TA 4X5OA 1JX6A 2F3TA 1H5QA 1CUZA 2B7BA 2DKFA 1SH7A 2PPLA 1XD2A 3NB0A 1WW3A 4RU1A 4B7XA 3ROZA 1XLWA 4NG5A 2BYTA 2GF2A 3IIMA 4O3MA 2QUAA 2GJSA 3LA8A 1MNAA 1PDWA 3NHZA 2CF5A 3IDFA 3K31A 4Y98A 4C4YA 3L0PA 5IFKA 3LHKA 4EUNA 3NEJA 2H5IA 2G80A 5K0NA 3UK6A 1WG8A 2CXSA 2HI0A 4O25A 2J3MA 2O2EA 1LV7A 1T9GR 2ZRHA 3FYDA 2FLWA 3FR7A 4KYVA 4NVRA 2QBYA 1KZGB 1NPYA 4ZEOA 5ILGA 4Y2VA 2W6MA 3NALA 3ZHOA 4M83A 4RAOA 3GNLA 3P2YA 2ZJZA 1VKNA 4O1IA 1A9YA 1E3QA 3G9TA 3L7KA 4FHZA 1GSIA 1KP3A 3WG9A 1OD6A 3KHSA 2XSZA 1LEHA 1R66A 2H1LA 3CJQA 4CCSA 1KZ7B 1NNUA 2PGNA 4QC2A 4WEOA 3V00A 4IDDA 1N3YA 4BE7B 1GYQA 2IBTA 4UVGA 2KWIA 3ZVRA 1RP1A 2YHSA 3UUEA 5IX8A 2VN8A 5JNTA 4NCAA 5AICA 1CY6A 3JCZA 4NCNA 4O6VA 5DT9A 5F21A 3W5UA 4NBSA 3KB2A 1V9LA 2EFHB 2YWJA 2PGXA 5G0WA 4D4JA 5TVKA 4G5QA 1KK1A 5FCDA 4RJ2A 2IYLD 4PQYA 3HKEA 3AINA 1SRRA 1ZVMA 3D7SA 4H3KB 2AFVA 1RBZA 3WP1B 5AQ1A 1N6RA 1IFXA 1VE7A 2EYQA 2CV2A 1WB4A 3HCOA 4KV7A 1UWVA 3K0CC 4KE8A 5EINA 1KDYA 2F62A 2XMGA 1ULUA 4DJFC 4EKIA 1PD0A 4G9GA 3EVEA 1MH1A 1YMQA 1I3OA 4WADA 1IXYA 3SZ3A 2ZR8A 2RHBA 1JN0A 1ZZGA 3ZD7A 4A10A 4FFSA 3UJHA 1UBGA 2LE0A 3D6TB 2C9DA 2CNOA 2WWHA 2KM1A 3ZZTA 5BRJA 4KR3A 4Y1GA 1FP4A 2CV0A 1E2BA 1QMGA 3KZCA 4J1QA 2QMEA 4ZT7A 4EG0A 4YAUA 2HYIC 1U0HC 1Y1TA 3F6RA 3Q5EA 1NW5A 2AMLA 3TLEA 3FPJA 2R4QA 4PZPA 1PU2A 1SKYB 5A3RA 3CUVA 4KQXA 1W1WA 2AXEA 2XYVA 4NYJQ 2C9ZA 3TFQA 3O4HA 4MP8A 4HEJA 4YT5A 4C0WA 1W73A 2ZJFA 3SSAA 5DNYB 2PWAA 1ODKA 1N7IA 2BMVA 4NECA 4UUNA 5HP4A 2NIPA 2B21A 1MUUA 2TMDA 3DT9A 2I78A 2Q1TA 3G2IA 2M6RA 3JASB 3ZE7A 1QP7A 3K32A 1OIVA 2GAOA 3CRMA 3K5IA 4DJAA 1SCAA 4J8PA 1FCJA 2OY0A 4MKIA 1CRWG 2GGSA 2N0SA 3KUDA 5ALGA 3TR6A 1U3VA 3G23A 3B9QA 4EBFA 4UJ3A 3LT2A 3SS9X 2H31A 2FP4B 3UH1A 1SUDA 1Z7GA 4BVJA 3T41A 2I3ZA 2XGMA 3DTNA 3GPDG 1KFCB 2O0HA 2WIGA 3KXPA 3ZZ0A 3EHDA 3R44A 3ANSA 3H75A 1YB4A 2FPIA 2ACKA 1ZOOA 5LP6A 2O4CA 3DB2A 3FDXA 4UCWA 1K6MA 2J4DA 3DKPA 4I66A 1E4EA 2P62A 2JGNA 2CJYA 1OX4B 4BNDA 4GX1A 3PR1A 1NR5A 5THKA 5IRCD 3H11B 3BKWA 1QU2A 4POAA 5HCNA 2CFIA 2Q3HA 3QLJA 1MC4A 2C5FA 3FYUA 1VRWA 1JQBA 2D1SA 2HSEA 3LYLA 4IQ0A 4JLWA 2A5LA 5D85A 1E2GA 1CK4A 2V8OA 3IXQA 4YAOA 3BK2A 3JVUA 1EIWA 1R8XA 1NI4A 1FQKA 4KRGA 3U19A 4HCJA 5KAPA 9LDTA 1C3JA 2HUNA 4NBUA 2YXEA 1QE0A 1MR3F 4UUPA 2RCNA 1E4VA 3OSZA 4OHMA 4EL5A 3DDWA 5H5JA 5BQPA 1YCFA 3MYRA 1SC6A 3I4CA 2IP1A 1OXUA 3AI7A 1B6GA 4R8RA 3E53A 1KI9A 1E3EA 5HSGA 1Z9BA 4E94A 3QE2A 4U39A 1QCZA 5KYWB 4M87A 1LNQA 1ZM3A 3TVTA 3ROXA 2GJAA 2W00A 3JYHA 4A2CA 1NHWA 4C05A 1JHMA 2KSQA 1OI4A 2R6R1 3JQDA 3F3YA 1W2WB 4H1HA 3L8YA 1VIVA 1YKSA 1H05A 4I46A 3P0HA 4LJKA 4DMUB 4BX0A 3AR3A 1QFXA 4F4HA 1OCEA 4PGAA 4DC9A 1UOOA 1YHZA 1Z33A 3BMNA 3DHVA 4LA4A 2EZTA 4BC1A 3MFYA 3PDWA 5JSHA 3MK31 1T2VA 3WBFA 2A57A 3BXEA 3BJEA 1ZESA 1DIGA 3UY4A 2V55B 3PDIB 1W4ZA 3FNHA 2X6RA 5JZVA 3FJ1A 1LQUA 4REMA 4LF5B 3RBVA 5FWXB 1TYBE 3VU0A 2FGKA 2POCA 1Y1QA 3D2LA 3M6UA 1H1DA 3G8AA 4LY9A 1F1JA 4RLFA 4ZOCA 4QDKA 3DUWA 1BD4A 4UQLA 3MQ2A 5IWCA 4NCIA 4KFRA 2E4WA 4RDIA 5KBYA 2GFQA 1QZ3A 2P91A 3R4CA 4RY0A 2EJWA 4KXLA 1HOXA 2QYSA 5FO0A 1SZPA 2G1PA 3DE7X 2JFXA 3OOSA 1A8IA 1N57A 1FP6A 2R1TB 3JATB 4L8GA 3ZJVA 1QO0A 4CF5A 4AO6A 4K9OA 3KWFA 3NIBA 1Z6QA 2R8OA 1SD5A 1C3OB 2YMPA 1OBHA 1H23A 2QIOA 1QZUA 1EBFA 4OK6A 5LOVA 3CZMA 4I08A 1ML4A 2CLCX 2WZQA 4GYJA 4EB3A 3K2BA 1J8FA 1ZICA 2H65A 3HN7A 4WOBA 421PA 1W0KA 2H2IA 1KI7A 2QRVA 3I1FA 4UHFA 3WLSA 4EMUA 1IG3A 3E9QA 2ZYHA 4MKRA 5EPOA 1MBZA 5L7YA 4OI2A 3USZA 1CYEA 3W2TA 1MX5A 1Y6QA 3C6QA 4HFMA 4XE5A 4C0XA 3TW8A 1XRSB 3QP9A 1V96A 4C0JA 1E2DA 3CEPB 4HGQA 4KQIA 4FEYA 4LXQA 2DJ5A 3LC2O 1LLFA 3QBDA 4FD3A 1GCUA 1QYWA 5GZ3A 1OILA 4JI4B 4G0ZA 4QPJC 2NYRA 1N2GA 3NI2A 1A7KA 3SNKA 1JSXA 2OXEA 4OQPA 4C22A 3NZEA 1VL6A 2FUCA 4IICA 4KBYA 1HSZA 4HNSA 4PG7A 5J1SB 4JKOA 2ODEA 3HM2A 4QD3A 5JHGB 2Z1MA 3USES 4B7ZA 5C80A 2G7ZA 4E5UA 1GPDG 3EXHA 5CFMA 1BVYF 5JC8A 3EZ7A 3FYTA 5ALRA 1VIMA 4IHJF 3VH4A 5A6VA 1Y1RA 4Y2GA 4LZWA 3T7AA 4KMOA 5I9MA 3DA8A 4ZYWA 4I0WB 3TRIA 1N3LA 5JS2A 1DARA 2CHVA 4DOMA 1EAMA 1HG0A 4JWKA 2NOAA 3PQ4A 3P2JA 4U1RA 3HUDA 5HS4A 3TQQA 1JKIA 1X92A 1FDRA 3EUFA 3FDZA 3OFJA 4GRAA 4X24A 5DX8A 3S0JA 4QREA 2MSNA 1MFPA 5KYUB 4ARSA 3SJAA 3B6IA 2GBLA 1FFCA 2YCBA 3MGGA 1W96A 3BHIA 5ENZA 1M34A 2PT5A 1GPNA 3A3PA 4ZDIA 1X7XB 2AZ4A 4GLOA 3MMSA 4DYDA 3D6FA 3CLSC 4KJZA 4ENTA 4MUGA 5H3HA 3UGJA 3O3NB 4CT0A 4UFNA 1RQXA 1YMUA 2MOKA 2Z56A 3H2JA 1ZH2A 5JCXA 2IZ1A 4HLDA 4URZR 2ZAMA 3DQQA 4YRRA 1VBFA 2WIAA 2GERA 3DD5A 4HQOA 1ODJA 3TJRA 1QIGA 2QGZA 2ZJ3A 4BX9A 5LWQA 1UMBB 2GEBA 2LZ0A 5I47A 2GJ9A 1FDOA 1NQVA 4XVUA 1U99A 3PZRA 4LF9B 1JZTA 4S3MA 2QK4A 3CISA 3GLFE 3NBFA 1LPMA 5BV0A 2X7XA 3T5CA 3RTGA 2QN6A 3TSCA 5TF4A 4Y0NA 4LYHA 4D41A 4ETWA 3PXXA 5IYZA 5JUWA 4PHFA 2GA8A 3EIUA 3VV3A 1TQ8A 3NHSA 4R1UA 2GASA 4LZJA 3UHFA 1C5KA 3S28A 3I9MA 3KPUA 2PLWA 4DF3A 4JI6B 3LW7A 1JHZA 4HNQA 3OF2A 3OT1A 4W5JA 3T9CA 2PNFA 4Z0HO 3ZJTA 4W7SA 3HN2A 3CMMA 5HOEA 2IODA 4L75A 3V2GA 2X8WA 1A4RA 3RVLA 4A8TA 4MQBA 1GXSA 1AKTA 1G20B 5DBFA 2ACEA 1GZ5A 5AKLA 2PM8A 4PLPA 2QA5A 1K0FA 4W8GA 5FBQB 1THGA 3FNBA 2Y2VA 3M49A 2BF4A 1PV4A 4OXIA 2PWYA 3PGKA 3RH0A 2C8KA 2PX0A 3BMCA 3ODPA 1NVTA 1SFRA 3PCXA 4O1HA 1K7YA 5FUWA 5GIPE 3AUFA 1THMA 2OWEA 5CEJA 4DDHA 1C9MA 4YACA 4U7DA 2V9CA 3VU1A 5CA0A 3N6VA 5H81A 3TLAA 1C4WA 3BB4A 4KXQA 4IFBA 4CMAA 3IAUA 4W82A 3Q85A 3RBAA 3B8HA 3RR2A 5EHQA 5ELMA 1JT9A 1YZHA 3MTBA 3O83A 5L3SA 4JJZA 1K92A 1U1GA 4M4SA 4MHSA 3Q8KA 3N2IA 2QU8A 4JT8A 2B5VA 5AVJA 3A11A 2UUAB 2ZWMA 1YS7A 3CUEF 3EXAA 1GSOA 3OZFA 4WH0A 1ZK0A 1G6OA 5HRCA 3MRVA 2X5JO 3MJVA 1U0TA 2XKJE 4RD6A 5IXSA 3JQGA 2B99A 3H8VA 4NEQA 4P4NA 1T4CB 1P0IA 1USVA 4GBMA 4QTZA 1R0RE 3E3LA 5DK6A 3G85A 5IJ0B 3PRJA 4OJYA 1SBHA 1TO2E 2FMHA 4L27A 1VP9A 3LBHA 4LSMA 2O48X 5J59A 5SZIA 1WOYA 1GL6A 3VJKA 1UL1X 2FEXA 2FMXA 3MILA 3L05A 1I36A 3OFND 1ZH8A 4JODA 1X0XA 1ESDA 3RFVA 3RWOA 1I4WA 5DX0A 3JYOA 3KJNA 3G1TA 2P4UA 2FK7A 4JOBA 4NPAA 3TOZA 3T12A 2Q21A 3GJYA 2B3TA 1ZOIA 4FXOA 3MD9A 2CJXA 3T7TA 4UOZA 4IDHA 3STXA 1UEIA 1IK4A 1LWOA 1DJOA 4DCCA 1EUDA 3KUXA 2O3TA 3NBQA 1E98A 3PGXA 1EVEA 1DEKA 3COPA 5DOVA 3RS4A 3OY2A 4PG5A 4X94A 3QU5A 3W3AA 2JGIA 4RGYA 4DLLA 2OCIA 5HKLA 3JZMA 2GO7A 1PJLA 1XDZA 4N54A 4BCCA 4TYYA 1UXKA 2O2GA 4JVNA 3JTMA 3BD9A 3HCBA 1QCCA 4R1OA 3FYHA 4M37A 4TV9A 4EB8A 1A5TA 4DSUA 2BDUA 3IP7A 3OAAD 4GNRA 5D8DA 5BSMA 4K0KB 4FEAA 1PNRA 2R6AA 2CL6X 2ENWA 3FVRA 1VPWA 1A76A 2BOVA 1DRWA 4I1IA 1IBRA 1WHTA 2OL4A 3GOQA 2Y1KA 4NL4H 2JIOA 5ELXA 4C0QC 1HQCA 1UBTS 3S27A 3OZUA 3T3IA 3CVJA 4NQRA 3Q3IA 2JDID 2VSOA 3OZVA 3KCNA 1UT6A 3TOSA 4QOGA 4BNXA 2HT6A 2ZIXA 1XZFA 2V7VA 1F9AA 3K8QA 1THTA 2W6IA 5EMKA 3SDBA 4A8PA 1X8XA 2XB2A 2FOXA 3N05A 4BKUA 4NF2A 2HRCA 5I5GA 2QBYB 5AO9A 4RF2A 1JAIA 1W36D 4B4VA 1IK6A 2ID7A 3A1EA 2A0FA 3O8QA 4L9RA 5B4UA 1LU9A 4DV6B 2PSFA 4HAUA 3H5NA 2NYVA 4CIVA 3NAGA 3R3HA 1RR6A 4Q6BA 3IERA 3AM3A 1W75A 2VAMA 3MWEA 1M54A 2AG0A 3L7BA 5AR1A 3W77A 2VHVA 1FU8A 5LZ7A 1G8JA 3WLJA 5L95A 1ZXLA 2XF2A 4LN1A 4Q9IA 1CZNA 3IR7A 2Y2UA 3AY3A 3COSA 4Q9LA 1M6EX 2IY9A 3E4DA 3V8BA 1UZUA 1RACA 4YI3A 2PX5A 3RC8A 1YRBA 2D2FA 2ZVPX 2F9LA 3WLIA 1QG6A 5JADA 3LHSA 3KVYA 3KQKA 3Q8MA 3FWZA 1F0YA 1LZKA 3GFGA 5GJBA 3LFHA 2YN4A 1P9LA 1LDMA 1EP3B 3B8EA 4FMDB 2VP9A 5EJFA 1G2QA 2VUSA 3IMCA 4DQLA 1G8GA 1XOIA 1KYTA 2XT0A 1P0QA 4YQYA 1P0FA 5GVRA 3ROFA 2Z3VA 1PR5A 1HNWB 1POXA 2DHEA 3B3AA 1GHTA 3RQIA 3U3MA 3PLAE 2J67A 4JROA 4EHBA 2XQIA 4KSYA 2B8EA 3IC5A 4US0R 1WVMA 4M9ZA 1NP3A 2CB9A 3T9BA 5H70A 4BEBA 5HKOA 5AW9A 5LP1A 1K75A 4EHKA 3UQYS 4ZVRA 1X7ZB 3IPRA 1B14A 2QF7A 4AECA 1TTPB 1J4AA 3N28A 3MWDB 4XD2A 4GLFA 4MWZA 3O8NA 3ZDEA 5SZHB 1RCFA 1A0OA 3GCXA 2IC5A 3DZCA 3V7FA 1G7TA 1HT2E 2B1IA 1KJWA 1F8YA 1NAHA 1KL7A 3LCUA 2OYCA 1T4GA 1PX2A 3R8CA 4TT3D 2REOA 1INLA 3K05A 4JGBA 4LZNA 3ICQB 2M9MA 5BWCA 4WKGA 1XI2A 2J6CA 4F4IA 2CDAA 3PGJA 4FZ3A 2R60A 5FFNA 3N0RA 4F5ZA 4MA4A 3AHIA 3W4IA 2DVMA 3T99A 4PYJA 1EFVA 3K1AA 1WDKA 4MI9A 4KHZA 3SQNA 2FH5B 3GRUA 1U28A 1PJZA 1T9KA 3QE4A 1IJFA 4H2DA 4IMJB 4BX2A 1KO1A 3QUTA 2P0EA 5DULA 5TQVA 1N0IA 4GF5A 3KSRA 2R87A 3NOQA 3HUFA 1SUPA 4F9EA 2YX1A 1N78A 4OXRA 1JMVA 2C7GA 1L5QA 1TAUA 4LMRA 4M9QA 4GOMD 3IODA 3DLIA 1EZ1A 3E9RA 2M2IA 5G3YA 3G02A 2JGLA 4IIDA 4MI3A 1C7QA 1AGYA 3NNNA 1T8RA 3ORYA 4YRGA 5SYNA 5JW6A 2VDNB 3EIFA 1XTJA 3UJ9A 2AE2A 2QMZA 3FSRA 5CDTA 2A58A 3IMEA 1LJLA 3QVTA 2OVBA 3ZNQA 3GT3A 2XBUA 1ONBA 1H8HD 4TSKA 5DASA 1FTSA 2NSYA 2NQ2C 4MOWA 2WI8A 1QRSA 2NN3C 1RM4A 1VL2A 1BVUA 2JRLA 3RS9A 1F14A 4NNJA 2FPIB 2NO0A 3R6WA 1T9GS 1TAHA 1MB0A 1NUAA 4RVHA 4F46A 4LBWA 2BI4A 5LP6B 4Q3NA 4YDQA 3LU1A 1E4EB 3PX3A 3OFNA 1VBKA 4M1KA 4AT1A 2ERCA 3FOAA 3B2QA 1XPOA 3WTCA 1RTTA 3L18A 2ZIGA 5B7QA 4FGJA 4JB2A 4WZBB 5DM1A 2XZOA 3O26A 4PU0A 1ZCJA 1ZMTA 3P9PA 1G6Q1 1MQSA 4K3VA 3U9LA 2FI1A 5GVSA 2PAAA 5DGCA 4PHGA 4E7PA 5FEUA 4TPKA 3RTEA 3ZCSA 3IBSA 1OVMA 4BVFA 3ZY6A 3H5AA 1PNVA 2GHQA 1DC6A 1U9JA 1ZUHA 1UIMA 1DL5A 1Q17A 2P2CA 5EKTA 3KQLA 4HPXB 3PNOA 3Q8WA 4KX5A 1TU0A 3DV9A 1L5ZA 5E0OA 3R9XA 1JR6A 5KTKA 5KU7A 5ICFA 3GRYA 2V7WA 5GMOA 4HK4A 1TK3A 2BMAA 1CS0A 1BS9A 3FWKA 2PGDA 2OFWA 4P33A 3TR0A 1NI5A 1RCTE 2JIZD 5CT6A 3L6EA 3QLUA 1OWPA 3SGLA 2COUA 3FIUA 2VHWA 4MUHA 2Q45A 4IIJF 1Z3IX 4MVJP 2FZ4A 1NA5A 1TYCA 3FNQA 3WWOA 1WDWB 1FMLA 1Z7EA 3OICA 1K7FB 2PMKA 2IE8A 2QVGA 4WRRA 1J7KA 1PJ3A 2WJ4A 1B3BA 1XB2A 5EUBA 4QGAA 4FKZA 3UKOA 4DSNA 1EUCA 4KO4S 2HA5A 1G5IA 1QH8B 3VV2A 5T6BA 4GKAA 1UZNA 1USWA 3LX4A 4LKRA 5IULC 1JILA 5TEWA 3BQ9A 1N32B 3FDJA 3ESZA 1EDZA 3T06B 1P3JA 5LU8A 3MIZA 2PMBA 3H04A 3NETA 4OGLA 3DAFA 4HDAA 4AJ4A 1BH2A 3EVTA 3K4PA 4F3YA 2EC5A 3UOAB 3UAZA 3HSYA 6Q21A 1CUSA 2YMMA 4GI3A 5BUCA 2R6GA 2FRDA 3PCTA 4KXNA 1EUZA 4F56A 1WD7A 1QOZA 1A5AB 1B3RA 1E7MA 2RH4A 4JVLA 4F5DA 5K6AC 2B2NA 4PSCA 1LSOA 2R3SA 3PQDA 2ZRQA 4G09A 4NATA 1CUFA 4NKRA 1J2YA 1C7IA 4O4IA 4PXYA 5AKJA 1SWVA 2X58A 3I9JA 3QJYA 4EARA 3FKJA 1YZ3A 4XUGB 1POWA 1Z2DA 2ZCJA 2H2HA 2J07A 1TM3E 3NATA 4DEYA 3WZ2A 3WGHA 5LOVB 3HYTA 4RS3A 3U17A 3VBEA 2DPYA 3NJRA 1VGQA 3AB3A 2B6HA 5FPPA 3DV0A 3MJFA 4XB6B 4PC3A 1E3WB 3LXMA 1R4MB 4JJKA 1RIFA 5CPFA 3FTFA 3OQOA 1TK9A 3OIGA 4EJMA 2IT1A 4BY9E 3LBFA 1HYQA 3BL5A 5IH3A 1MF7A 1VJTA 3TW8B 2JLZA 2DPMA 2QJOA 3QVVA 2IS1A 2HRQA 4JZYA 3X1DA 4ARIA 4KN8A 3BREA 2DY0A 5AHKA 3FMOB 3N86A 4CN9A 4C08A 4HX5A 2RC6A 2XGGA 4FMCF 1QAMA 4X6UA 2UXDB 3A1NA 5IZCC 3L82B 3EWSA 4XM2A 1Y7TA 3RIYA 2QDKA 1CFJA 1TW2A 2XCLA 3N8IA 4KO8A 1Q7TA 2WWXA 4FYWA 4RK7A 4TMYA 5FNZA 3EXHB 4B80A 3ZCUA 3AEKB 2BFFB 3RGGA 2XZTA 5BWMA 4BDTA 1L8LA 3T15A 3EPKA 3LYUA 1EK0A 3PNQA 4OKSA 3CTPA 4GZ6A 4Y8VA 5E1OA 1Z13A 4UBIA 4M9CA 2JLBA 3LHIA 3W6NA 2JCBA 1US8A 3ROQA 3C3XA 3AWDA 3UWSA 3IKMB 1FLAA 1RQ2A 2VHYA 4BP9A 1X9GA 1PZGA 3EDCA 3EHEA 5TF0A 5B30A 3K35A 3EFBA 4EHJA 1RE1A 4Z3DA 5A3QA 5AXCA 1KEWA 1UC8A 1M34B 3IH5A 3OJ0A 1E7RA 3GRCA 5ELLA 2HK8A 1NZDA 2ROQA 2H59A 1TC1A 2XB9A 4J4BA 4PLCA 5AKIA 1SK8A 2AB0A 3OU7A 3UMVA 3NEYA 1WAMA 4FWBA 3IVAA 3RUPA 2UZ4A 1NQXA 4ZHQA 4X62B 4S1VA 3KAKA 3C2QA 5E1DA 4EAQA 5KJ6A 4RFSA 3HACA 4JEIA 4L0DA 1Z5NA 1QE3A 3GJ8A 3JD1A 4CZ2A 2G76A 3LQRA 3U13A 4AC9A 4B48A 1H65A 1N9ZA 1XQ9A 1LX7A 1S9HA 2O2DA 4V3CA 4CM9D 4QYTA 4RTQA 4TZ0A 3BH6A 4F2GA 3LS2A 4U2DA 2JIDA 4GMKA 3UFXA 1BGVA 1PF7E 3P9YA 1DWPA 4EDHA 5IVDA 3MGKA 5B1YA 4M1EA 1CEEA 1EM8B 1HEYA 1KDOA 2G77B 2IZ0A 4I36A 4JI0B 3QWHA 3Q9SA 1SCBA 4B3IA 3WA7A 1NJ6A 4YCNA 4GVPA 3SC6A 5EL0A 4MWDA 1PJCA 5TDHA 2CXNA 1EFRA 2V6FA 3L04A 1JQ3A 4JR0A 4UULA 3NV9A 5CM2Z 4Z99A 1MABA 1PR2A 4Y6GB 2FWIA 5KNBD 3M1LA 1JKFA 4OPMA 4D98A 3ECSA 5A02A 5BWLA 5I01A 3HJCA 4CG0A 1NQTA 2V7QA 4QXMA 1NX6A 4HB4A 4PPQA 4R98A 5CB4B 4RDXA 2XE8A 4RIGA 5BYJA 1Z38A 2CXRA 3MXOA 5JLAA 1UKBA 2ZSFA 4EPVA 2RKWA 2O4UX 1G21E 1TM5E 2DUWA 1OFTA 2YWHA 5LLSA 4HT3B 4RKEA 5GWXA 3K0SA 4IV5A 4NZOA 1WMSA 2GYWA 2WOJA 3E9DA 1ZW1A 1ZFNA 4E46A 1DQRA 2A5YB 1H2ZA 5TGTA 3IAHA 1KAHA 1MN6A 2AZMA 2LR0A 2OAQ1 1QVVA 2VUHB 3AR8A 3Q6NA 2AEMA 2NTJA 3DDSA 3K5HA 2GF0A 4IOKA 4QPDA 5EP1A 2C5SA 3BCSA 4LJAA 1Z18A 3WHIA 5JU6A 3QY0A 4INZA 4QUGA 3ZI4A 2HMUA 2QN2A 4Y3UA 2IEGA 3TIIA 4J3NA 4MVJE 2CZQA 1HE5A 1QG4A 2BTQA 3KLPX 1WO8A 4DZZA 4COKA 1X87A 4Y2XA 2J9XB 5FRDA 1E3SA 1EFTA 1KR2A 8MHTA 3PUYA 2WHRA 3DBIA 3H4VA 3FZQA 3JQ9C 3JQGB 2RHWA 3MINB 5TV2A 1OHHD 4J0JA 4UPEA 5DXFA 2QD4A 1OBOA 2P3SA 1RYFA 1LPOA 2EW1A 5DIFA 4FGLA 3OQMA 2NMVA 3HSKA 1KEUA 1FJXA 1P2VA 3V8EA 3WL4A 2VRNA 5L8VA 1J24A 3GCGA 4G86A 4ARUA 5ED4A 3BWMA 1P62B 1V0JA 3PFBA 4MEAA 3UA3A 1MJGA 3AKYA 4PM4A 1IE3A 2C61A 1UPBA 2ID4A 2ZYTX 5B37A 4Z3OA 4TRNA 2QD2A 5BRNA 2CBZA 4AL4A 5B3LA 5IABA 3HJUA 4S1NA 1WZ2A 1K3TA 1GPH1 1GGEA 1KYQA 3WQQA 4LHXA 5A5GA 5LQUA 4GX2A 4FU0A 4BAZA 5FHQA 1LPBB 3C6KA 4L6CA 3DOJA 5JANA 3FDIA 3GC6A 4ETNA 3M33A 1ZN9A 3NT5A 2Q3LA 3F6EX 3PXGA 1DQNA 2VXOA 1G0OA 4JBGA 5KTOA 1Z4KA 5FLYA 2HJSA 2OFOA 3F6CA 4ZJYA 4CQNA 3FLMA 2H4JA 1GL3A 3DYBA 4WZAB 5E9AA 2VRCD 4ZI3A 5KTYA 4L5CA 4TV9B 1SC9A 1ZJJA 3JAWA 2DUUA 1XEFA 1E5LA 3STTA 4WAUA 2BM8A 4UTVA 2TECE 1IH8A 2GK3A 3CGGA 5H4HA 1KWKA 3QWAA 4C2UA 5AW8A 1WU8A 2Y66A 1IHYA 1JTVA 1XZKA 4AUEA 2WTXA 4GOJA 2LW7A 1GILA 4U9IS 1NBHA 2GPNA 2X8JB 1XZIA 2WK1A 3LLVA 4HGZA 1V1RB 2IYRA 4JOSA 4C01A 2F4NA 4RIFA 2D5IA 4HAWA 5BQOA 3O75A 4H6VA 5KNCA 3OF5A 2ZIXB 3K09C 4GGPA 1L8OA 1HDXA 4OFZA 4F6LA 5A5FA 1O6BA 1C14A 1SG0A 2IUTA 4IMPA 6REQB 3F5FA 5A0TA 4KLAA 4GI1A 4X45A 1ODLA 5FHRA 4EG8A 5GOTA 2Z4TA 1YZYA 2XTNA 5CTJA 2OAGA 2AOVA 1SULA 2E49A 4HTFB 3DYIA 2ETVA 1KVTA 2I6QA 5KYYB 3Q15C 2D3TA 5DHAA 3TE6A 4F2DA 3G8YA 1G3IA 1IZZA 3WNVA 3ZCQA 4A8JB 1SKYE 2X7JA 3BRWD 2NVWA 2XVZA 4D0LB 4RL6A 4YRCA 3OFVA 1RYMA 1G2PA 3TD2A 3A25A 4EVQA 2HSZA 1N25A 2IPAB 4N7MA 4CM9A 1H2RS 5DEOA 3IQHX 4BE4A 4WUTA 2A59A 3JQ7B 3KZOA 2H52A 2V98A 5TJ9A 2VPQA 3EXFB 2FZKA 2ZQ5A 4X97A 5LBUA 3OJWA 5FEMA 1G41A 7MDHA 4O4HA 2GAIA 2PT6A 4HQ6A 4DNOA 1G63A 3K6RA 5A62A 2VHJA 1EWQA 4LDPA 1ITZA 1RJ9A 1V95A 2AN3A 2XBMA 4F1WA 1PWHA 5AM2A 4EPWA 5L7TA 1OGIA 4IGKA 1Q2UA 2DT5A 2VSXA 4I3FA 1XDGA 3GVHA 2JBAA 3RVNA 2BBSA 4TLEA 2EGUA 4C7OB 2IYWA 3K70B 1DOAA 5DBHX 4LXXA 4OXKA 1ELOA 3DL2A 3D4BA 4KR6A 3UT0A 3A1UA 5K6TA 1Y1PA 4XRGA 5LU9A 4R2LA 3R7WA 4RTRA 3O5AA 4EI9A 1KMCA 1XA3A 4GEGA 4LYAA 3VO8A 4AJLA 3H3XA 1AH2A 1NYRA 2VDUE 1IIBA 2C5HA 3WQRA 1C3LA 3N8KA 4JVOA 3VPHA 5JI2E 3FSJX 1EFVB 3K1AB 1WXQA 2PSJA 3UPUA 2IS2A 3O82A 3BILA 3C1AA 2BH9A 2DG2A 2UZ3A 4GM0A 4PZDA 4YRSA 1OH6A 2MU1A 2OESA 2OTCA 1TJ5A 2IU6A 3NHUA 3TTXA 3MRSA 2DM6A 3ENKA 4Z8XA 1PFYA 3H05A 5AJXA 5U1PA 3VH3A 1B1AA 5EZYA 4KLNA 1NI3A 3D4NA 1DEOA 4GZ3A 3MCZA 1J5EB 2P9FA 2VXYA 3SWWA 2FQ1A 4RW0A 2DSTA 3NDPA 4PF1A 4ZIRA 1OVGA 1UBOS 4WY2A 4B6SA 4PYIA 2ZXEA 3WYNA 2XADA 2RGNA 3I4FA 2QX4A 1ZI9A 2QXUA 3WAJA 4FI3F 2RCYA 4OB8A 4Z1MD 1SHLA 3HFGA 1KU0A 3NC0C 2IGTA 1OHHA 5K4AA 2NVUB 4BNHA 4GO1A 3TGLA 3SPXA 3H13A 3AHDA 5K09A 2CJFA 3I9NA 3TL6A 5CVCA 2IUUA 1JSRA 3U4QA 2QLBA 2WHXA 3PA8A 1IZ9A 3G9XA 4FP9A 2FV8A 3RS5A 2XOXA 2DFPA 3GMTA 3LY5A 4L1KA 1S96A 5ALNA 4BL5A 1XBTA 2EL7A 3SP1A 2I7DA 3HMQA 2HO4A 1DJLA 2FPGB 3DMRA 3FOEC 1MO5A 1SVNA 1QS0B 4D5EA 3MWJA 3N7TA 1GITA 3H2GA 3NTXA 1ISFA 3JALA 3E9ZA 5K99A 4L3VA 2JEZA 4G5RA 4F6CA 1EG2A 3G2MA 3PUWA 1HFEL 3V8MA 3D3EA 3VYSB 1NVXQ 2X3UA 4MWSA 4A0RA 2C96A 1JB9A 3UOWA 1RM5A 1T9DA 3LVFO 4NZYA 2X5XA 3T35A 5AD1A 1ESMA 5HKKA 4JHLA 2K4MA 3H1PA 3MJDA 4JP1A 3TS1A 1EFKA 2NUAA 1FJ2A 1TUBA 3AR5A 3ZY2A 2MSDB 3CSUA 1HDCA 1H4VB 1GV0A 1WOMA 2IPNA 3HGQA 4TL7A 5CFZA 4W5QA 1RVDA 2QZ9A 1BOOA 2VRCA 3FCUB 4TXHA 1Y8CA 4WJZA 3L0ZA 3E58A 1U63A 3I83A 3M3HA 2VTDA 1YASA 2GLTA 3DG9A 3MD0A 3OPYB 2IYXA 3B1VA 3RSSA 3ZE1B 5DTEA 4B7CA 3OI7A 1RLMA 4GGOA 3ZHSA 2XE7A 1G5RA 4URYR 5DHSA 1VJ1A 4H7JA 1DDIA 1MO3A 2I99A 4Q82A 3V4LA 1OFIA 3PXDA 4R1NA 5AJHA 1GAEO 1UPCA 1DDOA 3VDMA 3V2IA 4BQSA 4ED9A 1COWA 4MVYA 5C3MA 4F93B 1EZZA 4MEJA 3MLEA 2C1XA 1U8FO 2VNSA 3NLLA 5K6RA 4RNDB 3W3AH 3FH0A 1JG1A 4DIBA 1Y6JA 4PN7A 3GJ7A 4P0TA 4YMIA 5JD3A 1K3FA 1X1AA 3GZTB 1GUFA 3KEQA 4IDEA 1GSAA 3RSZA 2UZ0A 4AULA 2I76A 5JAHA 3VUFA 4Q15A 1FX0B 1BHO1 1JV2B 2ODTX 1YACA 3NHLA 4GR4A 5DLEA 3VNQA 5JJKA 1WCIB 4KDRA 4YT4A 1R4NB 2LUOA 2NAPA 4DCTA 1VB5A 3F7NA 3OZEA 3UHPA 3VMMA 3DLTA 2D3WA 1SUCA 1ENZA 1TIKA 2P2ZA 4TKMA 4YJ3A 4LMBA 3MAAC 1YUMA 4NFSA 2N42A 4PYOA 4QNMA 4RPKA 4R7GA 2O0KA 5I4KA 2QE7D 4EEKA 4RWZA 1U0GA 2AN4A 2CYBA 1VFNA 2WT8A 4TYPA 3PBKA 3DM9B 3EVFA 1JEYB 1HYBA 4EX7A 1FP1D 3GWZA 3R40A 4OXYA 1IOLA 4R71A 1QTIA 2Y71A 1UPAA 3CEHA 3GN2A 2Q9UA 1E58A 3HXPA 4NOKA 4XJXA 3TQTA 4KIFA 1HG1A 4QPZA 5DFAA 5FNVF 3VPAA 4ZMBA 1GUZA 4HVAA 4I8DA 4KQJA 3BQMB 5KSPA 5D5PA 3MGCA 4C6TB 4CU2A 2OCXA 3R9KA 1UKYA 3KPJA 4BE9A 2NT3A 4UEKA 4RIEA 3ADKA 5CIQA 1FBNA 1V7ZA 2J48A 1GCGA 1SBTA 4II7A 4PYRA 5EG5A 3WGZA 3U49A 1B23P 1T91A 1M2FA 1XZCA 1ZVQA 3GUVA 3X3HA 1UMKA 4L57A 4DLWA 1I2CA 2BHLA 2ZAGA 3L93A 3WL5A 1H2HA 1I3KA 4R0NA 4YRZA 2BJWA 5GZ1A 1I4TD 1QFZA 1TD1A 1VYUA 1G19A 1SG6A 2NU7A 2NX2A 5EIOA 2BGTA 2KYRA 2H08A 3GAFA 4DUZB 1MD9A 1LBQA 1EXVA 4ZMRA 2BFWA 1HNXB 4R9VA 2Y05A 4JUIA 2M6SA 1XDDA 4MW6A 1YB2A 1Q0TA 2C84A 1NQ5A 5CEFA 5ICMA 1I8TA 2WSSD 3VJMA 3WDKA 1E6LA 5BYKA 5F2KA 4G6ZA 2AV6A 4YTEA 1SCUA 1R18A 3C3DA 3ZJ5A 1OTXA 2Q6LA 3AUAA 2VJPA 1E5DA 5J5VA 5MN6A 2JEOA 3A1TA 2PHZA 3HPRA 1JWAB 1IMJA 1KYWA 3TRKA 4B8YA 5C81A 5KU1A 3PIDA 5BN5B 2HNAA 2G9RA 5MN4A 1ZM2A 2PKWA 1DT3A 5TRTA 3NMUF 2QL5A 3NNDA 3W6PA 1G20E 2ZYSA 2WFZA 4L22A 3NIGB 4G0MA 5AJYA 5M04A 1AMUA 1WUYA 4MK4A 1J8DA 3I6QA 4ZVQA 3EA0A 1XN4A 2NTNA 5B58T 2P11A 5TX7A 1ORDA 4IP0A 1BAPA 4HXGA 5CLQA 4AF8A 4ZHQB 3NWBA 2RGWA 4KK4A 4V3BA 1WE2A 1V26A 2FJPA 1NURA 3NTLA 3OX4A 4MQLA 1HF3A 4MRVA 4PGHA 1LC3A 1THZA 1EFLA 2B2XA 2C9MA 4Z1MA 5SV2A 2DQ4A 3ZW8A 4AU1A 2GBFA 3NASA 4H6XA 4M98A 3KX2A 2ZT7A 2BAGA 2EX4A 2GEKA 3R5KA 3HJBA 4KIWA 3LY9A 5G0UA 4ZC8A 3VNUA 4MQ6A 4YP0A 2AI2A 2PZ8A 1TGYA 2Z1DA 1UCFA 3Q0IA 2PL5A 4UATA 3ABRB 3CXUA 4UE3S 5B1HA 1GLGA 1R00A 3BGOS 1V3UA 4O1MA 3ZY5A 2I1QA 3NP7A 1J6UA 2QPOA 4ITRC 2FDCA 1U2GA 4ZT5A 2G5GX 3BGWA 3LK7A 4PAGA 2JG3A 2NWQA 5EE5B 2CZGA 1T43A 2VC2B 5FPKA 4QBFA 2AMFA 3W79A 2FPRA 1FFAA 2FE4A 2V7EA 4AJPA 3ZBTA 1TLFA 3EXG2 3WBJA 1KRWA 1R74A 2M6LA 3WY9A 4J16A 3IJRA 3NGMA 3M82A 1YL5A 3DC7A 4PRYA 4X1YA 1BGWA 3NHBA 4NDZA 3OEWA 4CG1A 1OH8A 1IEXA 1FDIA 3PUJA 1NBIA 1RBMA 2L19A 4OMCA 1YQ9A 3DBLB 3PHJA 2OILA 4DBZA 4D3FA 4ZJUA 1JP7A 3DE3X 2UYQA 1EHYA 1E8MA 4LOAA 1X3LA 4WN3A 3R0QA 3STYA 1P74A 1FBTA 2A0WA 2GJKA 3ZI0A 1LBHA 2XDWA 2AI3A 3OE1A 2O8CB 5TMDA 3HDHA 4L9WA 4C03A 5T6MA 5B2FA 4KVZA 4ZVNA 4K2AA 1Q91A 4J0FA 1DTWB 2GPYA 3AHGA 4P7JA 1JVSA 3GF4A 4NXMB 4HQRA 3PRKE 5LLDA 2P2DA 4ER6A 3T5AA 5IN5A 1KF0A 1PL7A 1WY7A 1HLGA 1QV6A 2QZPA 3U3OA 3NC1C 1SVUA 1I1QB 1VHDA 4G9EA 4E1BA 2EGHA 3ABQB 2LNDA 3WL6A 2B94A 2BTQB 1YCHA 3E5RA 4DY4A 1CF2O 5A03A 2AMVA 5IMBA 1P4RA 3GEMA 3N2ZB 1ZA2A 2IHYA 2V6GA 2IUYA 4W63A 1UK6A 1D0IA 2XDQB 1J5XA 3ADOA 3MLBA 4YAWA 5DH9A 3TMYA 5BR4A 3ZHXA 1KY5A 5ALLA 4EGJA 2BHRA 1Q0PA 2WM2A 5EJ5A 3FGNA 2PVPA 2ZVQX 4L4XA 2JCSA 4R9NA 4BMXA 1ESCA 4EG4A 2Y67A 4JBIA 3VZBA 4JD5A 2DQSA 1E9BA 3NRJA 4Z4HA 1FS4A 4NARA 3ZVKA 1P4HA 5B7GA 3LUDA 2ZB3A 3I64A 4LZOA 1W5FA 4WNAB 3F5SA 1IZ0A 1PGQA 4K9DA 4TX1A 5ADVA 3W9UA 4M6WA 3E03A 5AHWA 1QG0A 1DXYA 1FFGA 3V4SA 4FOSA 5FULA 4JP2A 4AIRA 3KZNA 2KS6A 3IT2A 2R65A 3A6JA 3E0QA 4EZEA 3HCWA 2UXBB 2X5KO 1TF5A 4ZGWA 4A03A 1Z2EA 3DFFA 3LHFA 4KAFA 4PIPA 3AP3A 3UB4A 2QV0A 3GMIA 4KO3S 4UTXA 3VA7A 1AN0A 1D2NA 5M29A 4DE5A 1ZGCA 5JH7B 1GPMA 1AUOA 2NV6A 1UFOA 3ND7A 3W8EA 4B34A 4BECA 1C0LA 1Q11A 4M0PA 4Q1AA 3VYRB 1PT9A 1WMDA 4U7WA 2XYRA 3T3GA 2EARA 4EYQA 3KSAC 2G8LA 2G1KA 1NF9A 2D2IA 1NVBA 4Z4EA 1Z12A 2FN4A 5ALUA 2L69A 3JAWB 2HFKA 1XRLA 3D6MA 3LKDA 4PSAA 5F64A 3R0IA 1XRPA 1C7ZA 1AK2A 3O8BA 3QF7A 2BISA 2DX7A 1XLUA 1AF4A 2D59A 1T6BY 1FFSA 1I14A 3KL2A 4TRRA 3BGSA 3WIBA 5KX5F 4KQHA 3K4QA 4DC0A 2GSDA 4TLDA 3LZDA 2ZBFA 3PUVA 4IFTA 1DUIA 1HMYA 2GHTA 4G97A 1M75A 4L5AA 5T64A 3QU2A 2PUEA 1AKMA 3FWPA 4TLLB 5BNIA 3RK1A 2WSSA 3RVKA 3SCZA 3KZXA 1RWPA 3BJZA 4DMFA 1O4VA 1BHSA 1P3Y1 1MAVA 2AEFA 2QMOA 1NC3A 5BMVF 1NJ1A 1OROA 3BG5A 4GRDA 1W87A 4I2NA 3KJEA 5DWDA 1E77A 4R54A 5HA5A 5HYVA 1AV6A 3L8FA 5KYKA 2VP6A 2PQ6A 2XF8A 4PHTA 4RD0A 1YBMA 1XUOA 2VIIA 2C7BA 2XMBA 3AM5A 3L1HA 4PCAA 2VTKA 4OHUA 4HP8A 1G17A 3E22A 5DLYA 4AG6A 3TPFA 2WHQA 4E08A 1GG8A 2QY9A 2YV4A 2AYYA 2F3QA 1M74A 2BIFA 2ZI9A 2B1QA 3MMZA 3DBHB 4FI3C 3N6XA 4HAVA 3TRFA 3FKSA 3P9QA 4LRXA 3BWYA 3DS8A 1J49A 4PNZA 2PMEA 1L0BA 4AUKA 4C7XA 4RJIA 3EC1A 1QYRA 4YWHA 2O5EA 1GCOA 1ZIPA 1Y4UA 5A7GA 2ZUVA 1K5PA 2FR8A 1RKXA 3MJSA 3D8HA 3RGWS 4MYSA 2VP0A 5KQRA 1Q7BA 4A6PA 4K6CA 2A92A 4A0FA 4YRDA 1UKVY 3OTHA 1KKMA 2ZYIA 3D6AA 1G8MA 4ZCSA 1XP5A 4YYZA 3WLAA 3KOUA 2G1JA 4O4HB 4QXPA 1PEYA 4ND6A 4CEIA 3AV3A 4DIUA 4UM7A 3MJEA 2DFTA 4JT2A 4R1TA 4RD2A 3U1BA 4KO1S 1N5MA 5E7IA 4TXMA 1URPA 4I1UA 3PDUA 1J99A 1R1DA 2DWPA 4O4LA 5ALKA 1VHQA 2JBAB 2A78A 3REFA 1NR7A 3N58A 1GKIA 2JLUA 1E2HA 5I6DA 1UT5A 2W42A 4HDNB 2ZIEA 4TTAA 2WYWA 3R7WB 1TVEA 2FF7A 3CRZA 1MMFB 2AMJA 2LPMA 3NJ4A 4YVFA 1VCHA 2ETXA 3CO5A 3MQFA 1KMQA 1EFAA 3VNAA 4OP2A 5EXTA 1JAXA 2Y1EA 1ZUD1 3B7GA 3GRZA 2JFUA 1XZQA 2BFPA 2YXNA 3G7NA 2BONA 3OJEA 4GXRA 4N6NA 4NFHA 2XUJA 3RD5A 3ZNPA 5KSZA 3W2IA 3Q3EA 2C4VA 2KE5A 5IG2A 1UT8A 1Z3CA 4OIFA 2CSUA 4BRSA 1GFSA 3EAFA 3S70A 4R0MA 1PFWA 4D9KA 5BWNA 3V8RA 4KI7A 1FSPA 5J5CA 1DT5A 3R3ZA 2CLLB 5KZMB 3UMYA 4JYCA 2X2OA 1G5QA 5B57C 3QH4A 2GRAA 4KLZA 3OCVA 3RODA 4AZVA 2Q0QA 5I7UA 1G4HA 1XTIA 4C7BA 2O7RA 4MVCA 1GTZA 3S7TA 1TDJA 5FYDA 4ZIRB 4PY2A 4D9GA 4KIJA 4RPHA 5DBIA 4E7OA 3DYVA 5FUXA 4HGYA 2JI4A 5JQGA 3PF9A 1XNGA 2RHGB 1Y3DE 1WKCA 1YVUA 1CUVA 2R0QC 1M33A 4RABA 1S2GA 2O0MA 1S01A 5KKNB 3LF1A 4AS2A 4J76A 2VT6A 1I30A 1UBFA 1VP3A 4MNTA 3VRHA 1LJUA 5FLXA 3U4QB 1FMTA 1D03A 2VP2A 3VI4B 1Z39A 3LT5A 1GRVA 2TMKA 3SXJA 1Q22A 2Z43A 4MAMA 3GJ0A 4FLFA 4U8GA 4UXJA 2EKPA 1JIQA 1AN9A 3IB6A 5KQGA 1U7TA 3RRYA 2R7KA 2JCYA 2G0TA 2PU5A 2Y27A 2ASVA 4X66B 1UQRA 1MTOA 2YNMD 2YS7A 2HRBA 2Z09A 3JALB 3REOA 2L2QA 5LMCA 4WY8A 1E60A 1IUPA 2CLIB 3EMBA 3ILYA 2A3RA 4M0CA 5FWNA 3AMVA 3GG2A 2QV7A 5FO1A 4KSCA 2AYZA 3ZIAD 1B0UA 4E15A 3U0BA 5FF9A 4Q1BA 2QX7A 3DONA 3UJNA 3JW8A 1U8UA 1DBWA 1QYXA 4FFBA 4Z9AA 4ZD6A 2B1GA 3ZYZA 1Z4OA 1ULSA 1U2DA 3ELWA 1J9EA 1QIHA 3NKFA 5H59A 1L6RA 2XUHA 2YHBA 5J40A 2NUAB 3UAXA 2OM6A 2C7OA 4HFNA 1E1CA 3PWKA 1ZUNA 1CEYA 1I5RA 1FFXA 3UK1A 2YDYA 1RRKA 4O3FA 5BW6B 1ZR4A 4R7ZA 3X2FA 4BLQA 2ATIA 5K0EA 4JT9A 4N5HX 2HBYA 4BLUA 1TU3A 5JPCA 4DA7A 1MDBA 1ZUWA 1JDVA 3IHKA 1JEEA 1OFHA 1CVRA 2QLTA 4TV8A 5AXDA 4QKQA 1N2XA 1QP8A 4XM1A 1P39A 1K6IA 2CDRA 4MARA 4CHTA 1WNFA 4BRUA 2HT1A 4JLNA 1A2QA 4XD7D 4N49A 1BWPA 2Q4BA 2RI0A 1D5WA 2ID9A 3A6HA 2WC1A 3VR5A 3ZU3A 2IXBA 5KDDA 1F38A 2BR4A 3D31A 5G1NA 2V54A 5J4VA 1XK6A 1QIFA 1RZUA 2VZ9A 3PQEA 4BB0A 3BOSA 4L9AA 4ZJPA 1OI7A 2E5WA 4BJHB 1ABFA 4D80A 3SYTA 2QB5A 1NY6A 4UFPA 3PGLA 1NPTO 4OU5A 5ALQA 3I01A 3KCQA 2OP1A 4U7TB 1AB5A 2HSGA 2C4NA 4H4EA 4YUWA 4Q9HA 2FLVA 1TIPA 4Y7CA 3I1IA 4YIHA 3F9IA 2VLIA 1ZGZA 3BICA 4GU5A 1WCXA 3O91A 1TKBA 5FA8A 1AUPA 2FXVA 1AO3A 1KR5A 5HILA 3SAJA 3WMRA 2R6FA 5AK4A 1YDWA 4EGCB 4RF3A 1Z2CA 2CCKA 4ZRNA 3WWZA 2HWYA 3TE7A 1SUSA 1XVUA 3OTGA 2AOXA 4LHZA 4PSUA 1VM6A 1W5EA 5EKDA 4F92B 2YFQA 3ASZA 1HWYA 1Z0ZA 2Q62A 2PYZA 3HI6A 3ZWVA 5KNCH 1GU1A 1S2OA 3A4LA 2JFQA 4N4AA 2C3OA 5SZKB 2Y3IA 2JK1A 4IXMA 2X5NA 4B3MB 2VKTA 3ETHA 1MG0A 2JKYA 1J1UA 3JR7A 4L7QA 3G49A 1IJKA 3BMXA 3JZIA 1OU0A 2AG1A 3PPXA 4LV5B 1DXHA 2R5NA 3B70A 5JNWA 1VXRA 3PQ5A 1A2OA 2Q8PA 3S2GA 3AUXA 2GYUA 5EEHA 3W5CA 3A3NA 1B0AA 3ZY4A 4EFMA 2GZRA 3QG1A 3HCPA 1T29A 1JYEA 2BCEA 4KMRA 4LE2A 1EDEA 5CRIA 4M0KA 3OQIB 4FUQA 4P3KA 5EIFA 2NU7B 1EFPB 2ZIZA 4YHBA 4NBWA 3RV4A 1NW6A 3PKIA 4ANFA 3KSUA 4YECA 5EE1A 2G72A 5IPFA 4JMLA 1ZITA 5B4VA 3EDQA 3GEIA 3LXUX 2UYYA 1QR2A 3R5FA 1T0JB 3TZKA 4H7FA 3D7KA 3NQ41 5H3CA 5E6UB 5FUYA 4M7OA 2VOEA 5LB4A 3GFQA 4ZO7A 2OFPA 10MHA 3I72A 4LRWA 2X9NA 1XQWA 3QFFA 4QFMA 1UK9A 3EFEA 2WJ6A 4EQ6A 3IHWA 4A1OA 2UU9B 4U63A 4HEA1 3M81A 1DO0A 1WBBA 3G68A 1EPUA 2VT2A 3P4UA 3AJ8A 1KRXA 4G85A 2AOUA 2PZJA 3OPMA 4E32A 2O2CA 1G9XA 2VUUA 3HY4A 4TSFD 3G8DA 3EWIA 4AF7A 2JA2A 2QRQA 1JZSA 1PJ8A 5M2QA 3E8MA 4QDXA 2J85A 2WOOA 1QF6A 3DAPA 3IOCA 5TNXA 3FSGA 3EX7C 3HJTA 1QAOA 3C24A 3UK2A 4JYPA 3AP1A 5DN9A 4Z0TA 1NSYA 1IONA 3VAAA 3TGPA 1CUBA 2HPVA 3WNQA 2J45A 2XTZA 3S8MA 2BBOA 1KFBB 3FETA 4WSOA 1TA0A 2FZLA 2JH3A 2Z4SA 3HE3A 3THSA 5JDCA 1BX3A 1MJNA 4QDOA 4RM3A 1NSFA 4Z4FA 4BZXA 4GI5A 4EPXA 3KEFA 1I5EA 2JD0A 2BEVB 1YU9A 2R85A 3JQRA 2BSXA 3BWDD 3RFCA 1ZO8A 2VK1A 2ZSIA 1STOA 2YNMA 1YFZA 3TX6A 4OHXA 2BTOA 3GHHA 4O02B 1UKAA 2RGEA 3D1JA 3CM0A 3DVAA 3GRFA 4GLLA 1JQAA 2I66A 3OC6A 1WZNA 2I6SA 4XI9A 5DTRA 3U0VA 1KHHA 1IBSA 2FUEA 4S1PA 3HN6A 3KQYA 1I2BA 4X1YB 1NJ2A 2NTEA 3U4CA 4ER3A 3MFQA 3TL3A 2PH1A 4Y2UA 3K70D 4DR7B 3CB2A 4C29A 1WY5A 1ZVKA 2DTDA 1RI1A 4PSDA 1FVOA 4MVJF 5FOXA 2QTZA 3R7AA 3NHAA 3OM9A 1A9PA 3UJCA 4BO6A 4H59A 1N34B 3NUGA 2ZR9A 3DFUA 3IPYA 4NTZA 4PIMA 4Z7NB 1XZHA 3UJ6A 2P27A 1T9ZA 2IIVA 2B4AA 5F73A 1KS9A