3EFHA

Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
314
structure length
307
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase 1
total genus 94
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA02
3LPNA 5JV5A 4IJQA 4KN6A 1VDMA 4P80A 2JKYA 4RQAA 5IPFA 3LRTA 4JITA 4RHYA 1A97A 1BZYA 3ACCA 1LH0A 1PZMA 2H08A 1P18A 2WNSA 1ZN8A 1O5OA 4RQBA 5BRNA 1CJBA 1G9TA 4LZOA 4FYMA 4PFQA 4OHCA 1DQNA 1A96A 2IGBA 1G9SA 1AO0A 2PRYA 1ZN9A 1I0LA 1Y0BA 1DKUA 3ACBA 1ECCA 3DMPA 3OZFA 1VSTA 4QRIA 4LZNA 3MBIA 5BQOA 5JSQA 3N2LA 1I14A 1VCHA 1JLSA 1D6NA 1U9YA 4P83A 4RV4A 3H83A 4M0KA 1JLRA 1UPUA 5BQPA 1UFRA 1ECJA 1HMPA 1W30A 4ZFNA 1ZN7A 1QCDA 4M0UA 5BSKA 1L1QA 1R3UA 1O57A 4LZAA 4LYYA 1OROA 1I0IA 1QB7A 1OPRA 1XZ8A 3GGJA 1Z7GA 2JBHA 4LYGA 4RAOA 3GGCA 4QYIB 4WN3A 1G2PA 1G2QA 1IBSA 5ESWA 5HIAA 1U9ZA 1I5EA 1STOA 3MJDA 1GPH1 4RABA 1XTUA 4PAWA 1A95A 4P86A 1NONA 1P4AA 1ECFA 4P81A 1P17A 4P84A 3NAGA 3OZGA 4TWBA 1GRVA 1OREA 1UPFA 2GEBA 4MB6A 4RADA 2JI4A 1QB8A 1QCCA 3OHPA 1ECBA 1WD5A 3EFHA 2E55A 1L1RA 4WMLA 1A3CA 3G6WA 5IAOA 2PS1A 4Z1OA 1BD4A 2XBUA 2HCRA 1A98A 4RANA 4RHUA 2PRZA 2DY0A 1XZNA 1ECGA 4QYIA 4P82A 2P1ZA 2H06A 1A4XA 1QK3A 3GEPA 4JLSA 4RHTA 1XTVA 1DKRA 5EUCA 2JKZA 2H07A 4X44A 2EHJA 1TC1A 2YZKA 1DBRA 4RHXA 1V9SA 3M3HA 5KAMA 5K51A 2VFAA 3HVUA 1P19A 4S2UA 5ESXA 4RAQA 5E38A 1NULA 3S5JA 2AEEA 1MZVA 3QW4B 4RACA 3DEZA 1XTTA 3O7MA 5HKLA 1J7JA 1YFZA 1BD3A 1TC2A 5KAPA 4P3KA 3ACDA 1I13A 4F8EA 1QK4A 2C4KA 4X45A 1FSGA 2FXVA 3DAHA 3KB8A 1HGXA 1DQPA 1QK5A 4M0PA
chains in the Genus database with same CATH superfamily
2VHCA 3FCOA 3PGLA 1MO5A 1SQ6A 3IQWA 3HLTA 1AK1A 2HC9A 2WFMA 4S1PA 1HORA 1NXPA 2ZP1A 3H8WA 3S2FA 2F2TA 3AERA 1QIHA 4PO3X 2HU2A 5E3JA 3CYFA 1KMQA 4OHRA 2J0EA 4PBSA 1DKNA 4CMJA 4F5WA 1R37A 3AETB 3H42B 4XVCA 1L5GB 4AKGA 1ZN8A 1UP7A 5IT9A 3AM3A 1Y98A 1BQEA 1SHKA 2I67A 1OXKB 2Z83A 1P1JA 3JW8A 4INJA 4NNJA 2OG1A 2Q7OE 1GSOA 2GM3A 4MUGA 5KYXB 3BMQB 1KJNA 1W88B 1Y1PA 1JNYA 1ZL2A 4YHHB 2AWNA 2VSFA 2B1RA 5GIPE 4MW4A 3QWIA 4WBXC 2QXTA 2XA2A 3SHWA 3AW9A 3IJEB 2YXLA 2OFOA 1ATIA 2G9ZA 5EZ5A 2XRZA 3DKPA 1EX1A 1Z28A 1M34B 2DH5A 2CY0A 4PHHA 3KWJA 4BLSA 1R15A 4F3KA 3AUUA 2WUVA 4JK3A 1V8ZA 5ES4B 1NI3A 1T0JB 3UW3A 1X8LA 1N1DA 4MI9A 3JASA 4RHEA 4QODA 1RRMA 3EGWA 1NQ5A 2F7SA 2XTAA 5KNBA 2K5UA 2FDCA 4YXWA 5KX5F 4V0LA 3HWSA 5JMWA 1UOQA 1EP2B 2CDCA 4XPIA 2PWAA 3ULKA 5JRZA 3IKTA 3U39A 1UMCB 4BFZA 1ZH2A 4K6CA 3JVUA 5A06A 4MR9A 3WJ1A 2OEPA 5JFOA 1IG0A 2G8LA 1X1CA 4II3A 4UM8B 3URMA 4I6JA 4KIWA 3ZHBA 1E5LA 4N0EA 2CHUA 5HIAA 5ICSA 3DE3X 2HV8A 2QVLA 1HDZA 3H5OA 3HPRA 4L4RA 1YRWA 1LDBA 4PAWA 1WZ2A 4DUPA 5B3JA 5KYYB 4TZTA 4O4HA 4QSMA 1BKYA 5JSKA 2RKBA 3KJZA 4Y2XA 4RBNA 4ZOLA 3NTLA 3D54D 3WLHA 1MLDA 4FNGA 1A9XB 2BUCA 2DWQA 5DN6A 3IT3A 3U9LA 2E9SA 3VC2A 4JT9A 1YCFA 2VNIA 1SU8A 3P71T 2RHBA 3VOBA 4TYYA 2H4HA 3ETHA 1BWRA 5HF8A 1ZD3A 2V1XA 3FSRA 1HE3A 1V1RB 1M54A 4PPQA 2ZM5A 4GW3A 1F20A 4R1MA 2CBGA 1YUMA 2GUWA 3AJRA 3MS7A 1M7BA 4ETMA 2CDNA 4K9RA 4RKWA 2CFTA 5H9VA 3L0IB 3QVMA 2TMYA 3ZJYA 4DYVA 2DPXA 4IDNA 1CY0A 1KSJA 2IYOA 1R4MA 3O8OB 5EJ2A 4BJHB 4L4YA 3TDMA 2IEDA 4ZV7A 3MTBA 2EBWA 4EA9A 2WTXA 1PFYA 5C31A 4K7JA 5HZMA 4ZVMA 3WKCA 2J30A 4M55A 5AJYA 4AJNA 4X65B 5KNCA 4MXDA 2JH3A 1C4WA 3F6BX 3PQDA 5KYXA 2QTCA 3IXLA 2BTQB 4CMEA 4ERNA 4WOKA 1SCNE 2G5TA 4BGIA 1KL7A 1RI2A 3GFOA 5AHOA 2POCA 4YH1A 4M21A 4LUCA 3RU3A 1PCXA 2Y4NA 2GKGA 5ICFA 2PMBA 1E2PA 1J2RA 1SBQA 3H99A 1FFCA 3K6SB 1Y5MA 5CNJA 2DUJA 3I72A 1DBSA 4ZZ1A 3CZQA 5H4HA 1A8SA 1RE0A 1E32A 2ISCA 4R8VA 5BSMA 3W6PA 4EATA 1AKRA 1T8RA 4LFCB 3UC9A 3QY0A 3HBMA 1CB7A 1RLOA 1IM8A 3NHUA 4JP5A 2I2WA 4KGXA 4RQAA 2O7RA 2VDRB 4J29A 1UKAA 1D04A 2BMFA 3UVEA 1WWKA 1G9XA 5EIHA 4DGSA 1U7UA 4D4KA 1CU1A 4PAQA 4BTEA 1MJFA 3IUQA 3KZCA 3O4IA 1VL5A 3ENZA 4V2UA 2HLHA 3ZZUA 3WLLA 3TW6A 4DR5B 1LQTA 3PT9A 3BZBA 4BFYA 1ECCA 2EFJA 1BRMA 5ADWA 1ZCAA 3NHKA 1VPWA 5KNCD 1SQFA 2QE7D 2J3LA 2Y3IA 4HAOA 1MJHA 2GF0A 2OQRA 4IZOA 4XZ3A 1BS2A 3DC7A 2VRBA 3U4AA 3WTCA 3KTAA 3PL1A 4C4OA 1DC7A 4D0LB 5JRDS 4OIMA 2QJFA 2CJYA 2QOEA 4I9FA 1CUBA 1VSVA 3S2YA 4AJPA 3AVOA 1ZICA 1X86B 1OOEA 1Z7EA 3PUJA 4J1TC 4QXOA 5JSYA 2GASA 4DTIA 3IV9A 3OOEA 4C4RA 5JOQA 1ULAA 2IBSA 1AIPA 2V7VA 1RJWA 2OZEA 2A1UA 4RFLA 3L40A 5B12A 5ADVA 2F9LA 2CGEA 1E3TA 4ZI7A 3GDOA 4NYIR 5K0NA 1RHJA 1XTQA 4QJ5A 4COKA 3RK4A 4F2HA 3K09A 1KJ9A 1IPFA 1TMKA 3EXHA 1W1WA 3GRCA 3QMWA 3AWIA 4KVZA 4QO8A 3AR8A 4ZJUA 5FWXB 5D2CA 3JQFC 5D8DA 3T4XA 3I76A 8AT1A 2VNJA 1YA6A 3SHOA 1GY8A 1TQ2A 3EY9A 3HGQA 4BTVA 5SY6A 1FDOA 1AN0A 2YJTD 3A6JA 3X1DA 4KUGA 1QYDA 3G17A 3L5OA 4ZJPA 2EIXA 1L8XA 1U3WA 3AIIA 3GFQA 3MTEA 3S29A 1IN8A 5U9CA 4CM9A 2I2DA 1SVLA 2B83A 1JV2B 3VVMA 4P4TA 4B7ZA 3U3RA 4DNXA 1XDWA 3OD5A 4UVIA 4ZQEA 4F12A 3L7NA 2ON6A 4D4GA 3WGHA 2DT5A 5ICMA 1MG5A 2A9VA 3F98A 4MINA 4HDNA 5K8LA 4GG1A 3DBVO 4QLBA 3EIQA 4DV4B 4HQKA 5AH0A 4FOPA 1SC1A 1YS7A 1LC3A 4Q7QA 3CRQA 4MYHA 4RTKA 1DPFA 4JOBA 4WDRA 2IJGX 4AWAA 1T43A 2PX2A 5EIEA 4X7MA 1TGVA 4FYYA 2Q1SA 2HSGA 1CY6A 4GPTA 3BIWA 5DX8A 4E22A 3U5TA 4JI5B 2WSSD 2GLUA 4HV4A 5C32A 2Q45A 2XT9A 4JASB 1XD2A 5AKZA 3P2KA 1W75A 5B58C 4E1VA 2YNMD 1KJIA 1MAUA 4S3MA 4EHHA 1KDVA 3B48A 3BMOB 1C4XA 5EQJB 1VJ5A 5B7QA 4FB4A 4DCMA 2P7IA 1LI7A 2BI8A 2VLIA 3NEYA 3DEKA 4OYHA 3A6ZA 1BX3A 2C2BA 4DV7B 2H5IA 3QSYA 3TSAA 1DJMA 5A5DA 3LT5A 5CXUA 1DXQA 1QNFA 2P6PA 3EMDA 4CM8A 1BWQA 1L0BA 2PKXA 1IM2A 3FCXA 1T2AA 1W5EA 4NICA 4URHA 1T10A 3EWSA 2OCIA 1RKBA 3QW2A 1ENZA 3TOSA 3H16A 1FBNA 4Q1VA 4EYOA 2AKYA 1XF9A 4DV6B 3L9WA 2Q5HA 3QKSB 1GEGA 2FXIA 3R5FA 4ZI7B 1BA2A 4ND3A 5J4HA 2GNOA 3AQ4A 3CSDA 4LXTA 5AHRA 5JFGA 1SU7A 3KYDA 4MZDA 1ZI9A 4OATA 1NUAA 3HRKA 3C41J 3FUWA 3OPYA 1KFKB 3QKUA 2R5NA 4Y2GA 1TJ5A 2ZT7A 3MT7A 4WXHA 1T8TA 1FP2A 4XJTA 1GPYA 2APJA 3AF4A 5ALRA 3TRJA 1SKUA 1U0BB 3VKUA 4C4AA 2M9MA 3G8CA 3D7MA 1NW8A 4X64B 3TLKA 4P4GA 4DLWA 3N0WA 2PWYA 4TT3A 2EZ8A 2A57A 1DEHA 1NLMA 3AM5A 4JMPA 5EKDA 4EB6B 1YMUA 4PLZA 4F7DA 2Q6OA 1TL7C 4HNUA 4TZ0A 2FRDC 4CKEB 1G8HA 3O6VA 1AK2A 4JGGA 2ZANA 1GTRA 2XODA 4MGHA 4EHJA 1JVBA 4I6EA 5KS2A 3DUFB 1XRPA 3E5RA 4O5OA 1TYEB 1EBBA 3AEUA 4NARA 5CU7A 4M22A 3WK7A 4B0PA 5K6AA 4JI7B 4KAAA 5AOBA 1Z35A 1HEYA 4YRBA 1F9EA 2IE8A 2M2IA 2W90A 3OA0A 4H08A 3MJDA 2PXXA 1QORA 2M32A 1E4EA 3EZGA 3EXEB 1GTJ1 3HFSA 4O2LA 1CUSA 4ZT7A 2GESA 3BA1A 4W4TA 1AM4D 1SBZA 2Q1TA 1TYZA 1U0SY 2BN4A 2DMRA 4PICA 5L9AA 5G1PA 1GCAA 3RRFA 3D6HA 1BOOA 1CIJA 4E5PA 4GYKA 3DHEA 1US8B 1CSEE 2ZSJA 3BC1A 1JR3D 1M2KA 3FKJA 3FLAA 3SYLA 3NNDA 4OLFA 1QZ3A 3ZVLA 3D3QA 1YAHA 3BICA 3VC3A 1NE2A 3K2QA 3O8RA 4OBXA 4LJRA 3UUEA 2E6KA 3HVHA 1BE1A 4M0MA 5DNDA 3FCEA 1POWA 4KYIB 1V5GA 2WWFA 1ZPDA 1YZTA 4MQFB 1TC1A 1XZQA 3D64A 3NRBA 3KETA 2C59A 1PHRA 1CUEA 2GJKA 4LX8A 3K0AA 4XARA 1GCOA 4PQGA 3EFEA 4D5EA 3JS5A 2VYQA 1P1FA 2GMWA 1X7ZA 3GLFB 1SAYA 4JBXA 5EVCA 1O5IA 1TT7A 2GN2A 4KAJA 4YRLA 1P2VA 2IV3A 2OPBA 1OH5A 2HX1A 5T6BA 4I1VA 1UC8A 4N47A 4C0KA 5FL7A 5D7BA 4HBZA 3KZMA 4HWPA 3EFOA 4NENB 2X5XA 5GZ3A 1FSZA 4WY5A 3SF8B 4DE5A 2KW5A 3SVLA 2FXVA 1GPLA 2JLCA 2HSDA 4ZYLA 1SUSA 3R7AA 4LXUA 5HK8A 3T5PA 5T4HA 3LPNA 3KTOA 4UE3S 3VBCA 1HSZA 4HGYA 4JOSA 4LWPA 3RYHA 1S8FA 2A33A 1WZUA 4KQ6A 5ER9A 4BC1A 5CT5A 2I78A 4PIPA 3U3XA 3ZLUA 4EI8A 5A6VA 2OCYC 2YS7A 4Q4HB 3UGTA 2HA6A 2J4CA 1FQKA 3V7FA 5KCZA 3D8RA 1D2EA 5EWLB 4HXYA 4YAFA 5G40A 4BNWA 5HIJA 4AS2A 1XCOA 2NQTA 4YVFA 4G2NA 2I76A 3G49A 3TBFA 4PC6A 3ABRB 4A0GA 1HRKA 2DR0A 1IOVA 4X92A 1W25A 3CLTC 3NVDA 4HGPA 2YV5A 2DEUA 1CR1A 3ZI0A 4ZHSA 2FWNA 1M2VB 1ZK1A 4B79A 5LDGA 2IOFK 4RQTA 1Y1KE 4AZ0B 4CFZA 5KWEA 3U7RA 2PJUA 4A6DA 3ZIDA 3DLTA 3M9WA 4DMGA 4Q39A 4U6QA 1W87A 4YP0A 3BRCA 2ZUDA 3D7NA 3GDGA 4JH0A 1I7SB 2ZYTX 4M2LA 4BKQA 1ORIA 1NOKA 5DOZA 1NJ1A 3GEGA 1HT3A 3BFXA 4C1BA 3L8GA 4EHKA 2DH6A 1WA5A 2PR7A 1QCZA 3H1EA 3K9GA 4D8YA 2IH2A 4GLLA 5C3MA 1WKCA 5IMBA 2P4QA 3KTDA 1Q7EA 3HUEA 4OI2A 4D6YA 1H4VB 1P6UA 1E6WA 1SM4A 2QRHA 1PS8A 2VAPA 2ZIWB 1I32A 1GZUA 1YDFA 4I36A 2QUIA 1MORA 4XWGA 1YXMA 1OKKD 3VHXA 1T4GA 2LR0A 3P2YA 1ADFA 2ZE6A 3D0OA 1QHSA 2BONA 5IKXA 3HSKA 3SM9A 3K05A 8MHTA 1NDHA 5EERA 4BNMA 1P2BA 1NXWA 1C8LA 1QDEA 2XB4A 3PUXA 3TB6A 1WQ4A 4M36A 4K0KB 4DCNA 4Z7JA 1MEJA 3N7UA 5AKJA 3Q9LA 4M8SA 1N34B 1H65A 2JI6A 4C4PA 2OCPA 4ALLA 1GNSA 1FY2A 1XTJA 3GNSA 4L1KA 1J5XA 3HK2A 1UXIA 1OCEA 5LVAA 2WAYA 3C6YA 4I50A 5C4GB 3GJ0A 1R0CA 1FNNA 1M33A 1F6BA 1HQKA 1E9BA 1Y9EA 3FHLA 1UDAA 2XMQA 1P7VA 4WN9B 1Y1LA 2FJPA 3U19A 4Z4FA 4OKIA 5JC8A 3IAS6 1OAOA 3BJRA 3LRXA 1G8GA 4E5SA 3GYBA 1N5KA 4PC2A 3U48A 2HQRA 2OD7A 3CG0A 3VKVA 3G2PA 3QH4A 3GLGE 4JZKA 3QKIA 5JZ9A 2QRGA 3NUGA 1E69A 3W7BA 4EITA 5J1TB 3IMEA 2PH1A 2VYCA 1KYYA 1R74A 2QRQA 2JFFA 4AMVA 1ODCA 2G63A 4YP7A 4A91A 4I50F 5DTRA 1NC1A 2RBEA 4S1VA 2WDZA 5GINE 2VDWA 1XAJA 3C3JA 3HA3A 3JD3A 1TA4A 3NC0C 1BXGA 1E1DA 4MRRA 1U0EA 2VH5R 3CLSC 1XRLA 5JYCA 1GXSB 3V1LA 5BN1A 4QATA 1U0HC 4O2BF 4ZO6A 5DM0A 5E8RA 5C53B 2XOKA 4CYMA 1XELA 3DE0X 2A9FA 3DAHA 1ULZA 4WKBA 4EI7A 2Q9AA 4MIYA 3SKYA 1UR5A 3C1UA 4WT7A 2ROQA 4N8SA 4BMSA 3TOZA 2A88A 1O97C 2PY6A 3C87A 3OTIA 4RM2A 1M6YA 3WMEA 3X2EA 4F86A 1UKBA 4PXSA 4S24A 4X0EA 4BVEA 1IE3A 2GZHA 1KOGA 4FEYA 4Q3NA 3ZVMA 1MQAA 1U8AA 2IUTA 4WCDA 1P44A 4DCGA 2QL6A 4XA8A 3EPJA 3LCUA 1X3SA 1JHQA 2QSJA 4QLAA 3WVNA 4MIOA 3B6JA 4X6LA 2UXDB 1U1CA 4F2DA 3E7WA 1OU0A 4YJ3B 7MDHA 2CXNA 3SQMA 1RJ9B 2EHDA 4GR9A 4HNHA 2XQFA 3LLUA 1L1FA 3FWPA 4R9VA 2BE7A 2PRIA 1AB6A 3AFGA 5FPQA 3TNLA 1X9GA 4AFNA 3BDVA 3ZPXA 1T9ZA 2NYUA 5REQB 4ZYXA 2CCJA 2R1VB 4W5TA 1HEUA 1O0SA 1FA9A 1TZJA 3N05A 3L4KA 1ZWLA 2XOKD 3X0DA 4OSEA 1VCIA 5DTEA 4DLYA 2QM7A 5C80A 2VXCA 2H0QA 4YUXA 2AMYA 2R8YA 4IIYA 4WGFA 5E0KB 1Z7YA 1XE3A 1E2GA 2HB6A 1ZXBA 2Q3CA 2VPZA 3H6KA 3N74A 3OIFA 4FOTA 4WEQA 2X5KO 3GN2A 3FZQA 3CGGA 3JQAD 4EARA 1XJ5A 3QE0A 2JIPA 3EEBA 1XJCA 2H9AA 5FV7A 3FFXA 3DV9A 2HZBA 4MUIA 1DRKA 4BVGA 2V7QD 3K6SA 1C5KA 2J48A 3ZN2A 2SKCA 4HRVA 4NYIQ 2YN0A 3I73A 4EHFA 3M1IA 4PLCA 2AE2A 2G9VA 4B6RA 5H4GA 1R6XA 3EXAA 3QVTA 4LWQA 2P8JA 3TLYA 4B33A 3PT5A 3ILVA 3L6CA 3KQKA 2NU6A 5JAQA 4CF6A 3KWMA 1J8FA 4O4IB 3WI7A 1Z9BA 3UAWA 3LT4A 3S0JA 3H9GA 2E7ZA 5IKOA 4UU7A 3F7NA 4IG9A 4MKIA 4YP9A 3SQNA 3ZDAA 3PHCA 4LGVA 4TROA 3WLSA 5DMHA 2UXBB 4L07A 3ZZMA 3FTEA 1NT4A 2BCJQ 2RIRA 1L8QA 2ZJ4A 3U4IA 4R9SA 5FPTA 1NYLA 4DMCA 1DAFA 3L1IA 5A9SA 1EU1A 3DLBA 1JBQA 4RU1A 1Q0ZA 5JPCA 1NUSA 3GLIE 4A2WA 1N5MA 2BFFB 2YDXA 3G7SA 4M1WA 2O52A 4RJIA 1MNAA 2H07A 1O94A 1V4BA 1W35A 1E79D 2J87A 3C15C 1XTZA 1GR1A 2OO3A 3FUVA 3R3WA 1ULTA 2FE4A 3IAFA 4H1HA 3R74A 3VPSA 4CIBA 5FCDA 1K4KA 3QTTA 1IK4A 1M8JA 2QUBA 3HR7A 4G24A 2ZRIA 1KO4A 4AULA 2A9OA 5ICGA 3FW1A 3LVRE 3ND8A 2ZIXB 3WLIA 4DG9A 1G8YA 3UMYA 2WWWA 4KDCA 4Q03A 3RTAA 4RLSA 4YJ3A 1EXNA 4NCNA 4V02A 4LHVA 4A36A 2WW8A 3RAGA 3R75A 2VHVA 3VR6D 4CMEC 1NF3A 2X7XA 3R5TA 4O2AA 2LW7A 2PX3A 2KQUA 3SQOA 2A58A 1QX3A 3VDRA 2GA8A 2VF5X 2OZKA 3A9CA 4AZTA 2ET6A 1IZYA 4Q7MB 1MB4A 1XLTA 3M7IA 3O8DA 1JIIA 4XRRA 1OU4A 1NBAA 1OZFA 1WHTB 2V96A 4CETA 1CT9A 2HO5A 2WTMA 5EIXA 1R27A 2WAAA 4ZVPA 2W42A 2UV8A 4D3YA 4Z4GA 1X94A 1JL3A 4BMNA 3G2IA 4M1ZA 4GXQA 4XVRA 4ENPA 3GIDA 5T57A 7GPBA 5I9NA 1Z0UA 2DU8A 3RRXA 1UBLS 3ZNPA 4NBWA 1CYEA 2XY4A 5G2OA 4ABTA 4JWKA 4R9UC 1A96A 3EA5A 1V8OA 4Z4IA 2R6JA 3W6OA 2JFYA 4X1KA 3NTXA 2J9YB 4YWJA 1CDDA 1KKUA 1RKQA 3I37X 2XUHA 1XZGA 2VDOB 5FOVA 1JKJA 5AW5A 1EJ0A 5K4GA 4PXYA 2R66A 1VSTA 4MUFA 2YWRA 4M1TA 3HCWA 4NWIA 3MCVA 1AQLA 1Z15A 4L8GA 1SD1A 2VDVE 3M1YA 1KI1A 1QJ4A 2F43A 2QQ5A 2YMPA 3D0KA 4WZBE 1RP1A 1GFZA 2K4MA 3DE6X 4FXOA 1PLJA 1THTA 2EKPA 3ZWQA 3ZE9A 4RV4A 2PEYA 2BBOA 1UC5B 4JBLA 3UT5B 3L0BA 2X0DA 3Q7IA 1DFGA 2ZUFA 5ARBA 3UHJA 3QPAA 3UV7A 2C7RA 3VTAA 4J1QA 4TKUB 4YRRA 2IYZA 2GH1A 3AL3A 1ISFA 1MOPA 3ELYA 4PLPA 4AWXA 1WR8A 3ZCQA 4LJ5A 3EDQA 2J5QA 3QK7A 5FLYA 1P4GA 2AZ4A 2H2GA 2R1UA 1AURA 5ENVA 3IDAA 3CF2A 3D31A 2OSBA 4RKYA 2JDID 4R8SA 4ZTBA 4AP9A 2RD2A 1U7TA 1D9ZA 2ACKA 3QNUA 1A8QA 1NLFA 2LP4Y 2EW2A 1CEXA 2LIPA 2P2YA 2X41A 3D6MA 2C3OA 2V6IA 4HDSB 2RGDA 4ND7A 5LPNA 4C7OB 3G82C 1GV0A 2VP0A 1OBHA 2Y4OA 4B84A 3IOEA 2FOLA 2V7TA 3QWHA 4LA4A 5L40A 1QFMA 2C8LA 4ZJZA 1P33A 4HEJA 2R6FA 4CLHA 3RBVA 2NZVG 2J8ZA 4A6EA 4C76A 1SXIA 2GEUA 4R7TA 3ELWA 3MT9A 4M8NE 4RPKA 3ABQB 4DA7A 3ROFA 2C7PA 3IHKA 1XZDA 2Y77A 1GSAA 2ZYHA 1E8DA 1WUTA 4FZJA 4G5XA 3GPDG 1AV6A 3L41A 3GMIA 4O4HF 4LF4B 2PS1A 4EYGA 5BR4A 2HCBA 3MGCA 2M6RA 2WF9A 4F2GA 4DKJA 2PL1A 4NEHB 5CVVA 4KJZA 2Q6LA 3NG1A 2YCBA 4N48A 2EU8A 5JD5A 2PXAA 2VBCA 3GP8A 4W7HA 3V8EA 2ZAMA 3VPFA 3JYHA 4IF4A 3PWTA 1QG4A 1E1QA 4ZYVA 4MW6A 2J0SA 3KT3A 1H2WA 4HDKA 4PYIA 1U1EA 2ADOA 1QAOA 2JW5A 5TQ2B 3AB3A 5FTLA 3QLEA 2CMKA 4P98A 3DH0A 4ZTZB 1QP7A 5TMDA 3SKVA 2QTGA 2XMRA 5SYAA 5CXQA 1IONA 1W0KA 1ZM4A 2PSSA 3FZGA 4K88A 4PPGA 3PR2B 3PRKE 1E0DA 1I2DA 3H86A 5KTNA 4Q3KA 4GOOD 5BVGB 2E85A 2IYUA 2QLBA 4CCWA 3KSMA 3NH6A 1D07A 3D81A 1XI2A 5AVWA 2DSTA 1Z34A 3GVCA 2HDHA 4G86A 4NBUA 5JVDA 3L6UA 3N2EA 4BLRA 2EKDA 7YASA 2ACVA 1BAPA 3UB2A 3HCDA 4S2EA 2WK1A 2YYYA 2FUCA 4UMEA 3V9AA 4URWR 2F3TA 1MVOA 3T1NA 3V7UA 3DJFA 1TCUA 4MPTA 1UADA 1XGKA 4JLJA 4RVCA 5T4FA 3M4JA 3U1BA 3AB8A 2EDAA 1CLEA 1SUDA 2QK4A 2VJMA 4YP1A 5CFOA 4YJ2A 3KLNA 1H8EA 4WV3A 2PV0A 2AOTB 3IMCA 3NTRA 4ZVSA 2Y0PA 4BAGA 4I1IA 3MJEA 4NQZA 1UQUA 3THYB 2B9VA 4EDFA 5CDFE 1S6YA 5J4LA 3UHFA 1NVWQ 2GGSA 3GU3A 3OJCA 4XCXA 5TPWB 2XCRB 4MCAA 4LYAA 1Z6ZA 2VNKA 4F97A 4QDXA 5ALJA 1EM8B 1UOOA 2R8XA 2RB4A 3IXQA 3P2OA 1W34A 5ALTA 1YMQA 4FD2A 3VNSA 3N28A 4YLEA 2P2NA 1K6XA 3KHUA 4HR7A 5DGTA 3GEEA 1KEZA 4MKZA 2WJ6A 5LXTA 1N8KA 1YA4A 3I58A 3T3PB 2I7VA 2Z09A 2Y1DA 2Y05A 2Z1NA 3DMNA 4KGDA 1YO6A 2IY7A 3G79A 4MR7B 4QQNA 3T41A 5IEJA 4OJYA 2IHTA 1A9XA 1ZCBA 1EDEA 2ZJAA 1W30A 5FBVB 1QGOA 4FYIA 4J2HA 1GR0A 2D3WA 4JLDA 4OU4A 1O57A 1JKFA 4U5QA 5CB6A 4AL4A 3MRSA 1EIZA 3S4YA 4JYCA 4Z4EA 3RIXA 1FFHA 4JUBA 4HADA 3UTCA 4ITVA 3SJAA 3AKCA 1B6RA 5FDFA 4RTMA 4ODIA 1YRHA 1J1UA 3GJ6A 2GCNA 3K9WA 1SG0A 4KWEA 4J43A 1RRGA 2IH5A 1FJ2A 1UOEA 2MMCA 4P86A 1G5PA 4E5NA 3FCUB 3WGIA 2CDRA 1YQDA 5SZKB 5LQRA 5AJHA 2DBYA 2Z5LA 1DJPA 3LHSA 4P84A 1L7XA 3RLFA 4AMGA 4JHLA 5CX4A 3RBXA 1A8HA 2ZI7A 4EZEA 3WGMA 5JI2E 2ECPA 5BN3A 4YRJA 4OHMA 3E70C 3TIFA 3WV4A 3E82A 5DNWA 3WBBA 5K5EA 5SZJA 1JQ5A 4KE6A 2WM2A 2R8RA 4HL6A 3K9FC 1L7NA 1LWNA 2XZPA 4ENVA 1L4FA 2G6BA 1P1RA 4BDTA 4EL5A 2HW8A 4J7CA 3IMFA 5FBRB 5EGNA 4UHKA 1T9CA 3FMFA 4L5BA 3TQQA 3BMNA 2WMDA 3AM4A 2XYQA 3IILA 1EE9A 2C1ZA 3IQIX 3TOXA 3V8RA 4XIFA 1IWOA 1QPGA 3I9FA 3RS4A 4CHTA 3BREA 4ARBA 1WB4A 2QTBA 2ZCUA 3NQ41 3T95A 4RF2A 3BL8A 2ZB3A 4NF2A 4QLOA 3DDUA 3LQRA 1G8PA 1PWXA 2C0CA 3NETA 5KQSA 3L7OA 4QPNA 4NEQA 4UBKA 2QP4A 3V8PA 3R5XA 3ZZ1A 5LD2C 4MQEA 1Y4AE 2WTBA 4KREA 3R4CA 2JC3A 5FR2A 4ARVA 2QAGB 2O8BA 2H00A 3DE1X 3SMVA 2R44A 2H2IA 3IYLW 1E2FA 5FEMA 4L7VA 5L6LB 2VYVA 4OF4A 4PRKA 1DC4A 2B5OA 3PC4A 3LC1O 1YT5A 1Z6XA 4WBNB 5JZBA 2PWPA 3R0ZA 5FOSA 2A1UB 1XUOA 1DB3A 4PO9A 3AVWA 3A1TA 1CHDA 4P9NA 4HGOA 3M2TA 2O4CA 3O7WA 4MI3A 3RF6A 3AOEA 3FUUA 3KJNA 2GX6A 3RRBA 4FFPA 1HYHA 3QA3E 4BLQA 3I1JA 2BEUA 2FR0A 4EHLA 4EUEA 5J4KA 2ZE8A 3TFOA 5G3YA 4I9NA 5KOYA 5H1YA 1O9HA 1MX9A 3DUWA 5JNRA 1J5EB 1B74A 2G70A 2HWYA 2OO5C 3HH8A 4YCJA 4DM7A 3W4JA 4Y2YA 2NXNA 4RH1A 2ZAOA 4GNRA 2BYTA 1T8SA 1U2QA 1QQBA 4PLGA 1M0WA 4MTCA 4EGSA 1W6RA 4GZMA 2HU7A 4QUGA 4DR7B 5I7RA 3A2LA 4M0KA 3NC4A 1TVMA 4R3NA 2GPWA 1Y3DE 3ZE0B 4UEJA 4CFSA 2FMIA 5BN3B 2GCOB 2AF3C 2VYVD 2QYHA 3OEHA 1DJLA 1DIOB 4FX2A 3E5MA 4AY4A 1CIPA 3OA2A 5C1PA 1NSFA 3AF0A 4FFBA 3VJMA 3OLVA 1MU0A 4LBYA 3UJ8A 4LG1A 1A9YA 1AZSC 1Q95A 4WLFA 4ZZ3A 5L3VA 1J23A 5FUBA 3SZ3A 4DA6A 1JN0A 1W0JD 3EOZA 3TK1A 1OI3A 1ZOPA 3KZVA 1O95D 2XWSA 3WWEA 1XHLA 1V7CA 2ZT6A 3U4DA 3S70A 1CXZA 4JXXA 1PJ2A 1G8MA 1OXBB 3MW8A 9MHTA 2GTPA 4YRAA 4ZYWA 2CK3D 2HMSA 3DDSA 5CR9A 5LBIA 2XHZA 1UQTA 2RC5A 1YVUA 3GLHA 2VJCA 4NYJR 4D9BA 2XX3A 1QO0D 3ASZA 3DBIA 3RIMA 1ZOLA 4V0SA 1R6AA 4PQYA 1XCJA 3ZTYA 5MN6A 1Z2NX 2YOFA 4L2IA 3K2IA 4B4DA 1YL7A 2VZ9A 5AKKA 3NXKA 1DL5A 2ZAIA 4HWGA 4PR3A 1LLQA 3BVPA 1BXRB 4RLFA 3LWDA 2DPGA 2BFCA 1Q44A 3L93A 1MMFB 1WKBA 4DVGA 2CF5A 4N8DA 2QSYA 4N3NA 5EIBD 2HNBA 3GLUA 5CK4A 3QUCA 4RA6A 1L5YA 1NUUA 1HYQA 1PWHA 2JHFA 3WWDA 4D7AA 2P9JA 5JD6A 1OC4A 1U3DA 1S0UA 3G0CA 2MDTA 3COWA 2GXUA 5FP0A 4KFUA 5B1SA 1P91A 1ESCA 3K32A 4M9RA 1Q50A 3KO8A 1F1JA 2O05A 2Q3LA 2RDMA 1K8RA 1IJKA 1LX6A 4A9AA 3CVOA 4TXMA 1B6SA 3TW0A 1JVSA 4L7QA 4FXPA 1U6JA 1FU7A 2QEQA 2PDAA 3EGXA 5A04A 4TKMA 1UBCA 1YHZA 3KUXA 4DANA 4LHZA 2W7TA 2HZ7A 2B21A 3KB6A 4FYKA 2AGVA 1G2OA 2ISSD 3C3WA 3QPWA 1QO0A 4EEKA 3ZCXA 1IQPA 1JUDA 1HLFA 2QRKA 3MFQA 5TX7A 3WL5A 5CB0A 4Z3OA 4URFA 2JANA 3OFJA 4GRIA 5FI0B 2H92A 4IBOA 2QD3A 4AUKA 2R8ZA 4R8MA 4UCXA 5IF3A 4I9HA 1ACLA 2ZIZA 3T0GA 2RARA 5KU1A 1O7JA 3ETGA 3W2EA 4AF6A 3GHHA 4UBMA 3SZGA 4ROTA 4BIIA 5KTYA 1GPWB 3SQLA 5I7OA 2UYHA 3B85A 2QU7A 4CDMA 1IY8A 5TQ0B 3WYFA 4IPTA 4O4LB 1NI4A 5TF0A 2FQQA 2V03A 1IK6A 2XJ9A 1M73E 2JRLA 2YC2C 1EWRA 4OHUA 5E1DA 5ELXA 3SEZA 5JDCA 3MN1A 3ROEA 1ZVQA 2LVBA 4IXDA 4QRIA 1FYWA 5GY7A 4B82A 4YRSA 4AQYB 1F3OA 5KZMB 1I14A 2GVDC 1UMBB 1WKVA 4OQDA 5AM3A 1XLTC 1Y9JA 2OZLB 3PTZA 4FINA 4Q9NA 4R8RA 4WESA 1JEAA 5KSYA 4BXOB 2B4QA 2OV1A 2JJ8A 1D0VA 3QYAA 1GUAA 1JLRA 3HCRA 4QTXA 4WZZA 5IJXA 4UPEA 3GCXA 3Q0IA 1DG3A 3BWXA 3AY3A 5M29A 1XTSA 4I14A 3F8TA 3KE8A 1FFEA 1AQ6A 1OD6A 3OCVA 5BYAA 2QR2A 2D00A 2X0KA 1VFNA 1ZMTA 3NCTA 2R9VA 2HJVA 3LQFA 2JJ2D 1KP3A 2N46A 3KD2A 3OJLA 4I81A 3WLAA 2HDWA 5I7EA 1K75A 2IWRA 5MGNA 3EWAA 3K1ZA 3FSGA 3OFNA 5D6NA 2ZJ2A 2F8SA 2DUNA 3JZAA 4ZTUB 1UKVY 1T34A 2OQIA 3N8GA 3TTYA 4JLAA 1JQBA 4EFNA 3MPUA 1G66A 4LRQA 3T1YB 1IB6A 5C8YA 3ZDBA 4UHBA 4WBSA 1X19A 4HUQB 1LD3A 1BCSB 5TE9A 4I19A 1JBEA 1I2ZA 1KZ6A 4DVJA 4JI2B 5ECDA 5MDHA 1RXVA 4P38A 1KPHA 3KEGA 1XJQA 3BMQA 4UQPA 3W9UA 4HT3B 4DMHA 3DQPA 3H2SA 3OT5A 2O8NA 4DMLA 2AT1A 1I8TA 1LUAA 1H6DA 3HABA 4MGYR 4PWZA 2CW5A 4CQMB 4EQ6B 5JANA 2WKSA 2NZJA 1R5JA 3OE7D 2IUUA 2O59A 1B4DA 2GPNA 1OLXA 1OJLA 1SVIA 5DDIP 3UMSA 4IGEA 1M34A 4OD0A 5EP3A 4DJTA 3UT6A 1MVLA 1YHYA 1N2SA 4TV8B 3HXKA 3VHRA 3MGBA 3FPCA 1EVYA 2FPOA 4RMIA 3RVKA 2XGGA 2AS0A 1I9CA 2ZTHA 3CFYA 1N77A 1KZGB 1XL0A 4IDDA 3ZXXA 2PX4A 3ADKA 4YQEA 1ADJA 4MK4A 3UMVA 3N5KA 2O8FB 1EVZA 4LY0A 4M7RA 5LDDC 1C30B 1S01A 2QMHA 3GA0A 2BWJA 3K8YA 1NI4B 1Z2CA 3VR0A 4X9XA 3PNBA 3SVZA 1JFLA 1ZUHA 1DHTA 3F9RA 3BA6A 3G13A 4W1RA 4C06A 1OI4A 3FPLA 4OKNA 1GPDG 2Q5QA 1Y6FA 4HRYA 4HB4A 4L57A 4XAQA 3VDNB 3ZDRA 3RAFC 1VJDA 1EZ4A 1FLVA 3SJUA 5K0EA 2OZLA 4BY9E 2B0JA 4CR8A 2I8LA 2OYCA 4BE7B 5BORA 4Q9AA 2Q3DA 4UZFA 1P61B 4UOZA 2ZRKA 1Y8CA 4D8TA 2Z0MA 4OB6A 2I4TA 1AKNA 2YL2A 4UUPA 1E1MA 4PYQA 2VOJA 3ZWWA 1XN4A 2DPMA 1ZNWA 2I3ZA 3FBTA 1FP1D 4YJDA 1QPZA 4OI4A 2W4MA 2A4MA 1BC5A 4H7DA 4HCJA 4L9WA 4RL4A 1REQA 4IO1A 5G53C 4MEAA 3ZK8A 2P68A 3OY2A 2AL7A 3IA7A 1OQAA 4MUKA 4EEXA 4GBGA 1PV1A 4CF7A 1M1ZA 1DTSA 4U2CA 2O14A 3WLKX 1LSSA 1Z25A 2AFVA 3KQSA 3OWXA 3QU2A 1DWQA 4IWNA 4Q6BA 2QVGA 4OQZA 4TKZA 5EOVA 5CA0B 4ZHQB 2JKVA 4OA8A 4UXJA 1J8QA 3RIYA 3WGTA 3EVBA 3DYIA 2J3MA 2H4FA 4M3NA 4BZWA 4Y6LA 1ISSA 2F4VB 2NSLA 4R0NA 5K7SA 2YVLA 1QGUA 1LBEA 3Q11A 1X7GA 4WKNA 5LSAA 1ZJ5A 4FKZA 1L1QA 2G09A 1H05A 4JQSA 4QUJA 4JS0A 6REQB 5CH8A 5KSPA 2IDJA 4CQMA 4UHHA 1ILEA 2IW3A 3E9CA 1LXCA 2QD2A 4WVLA 4GSKA 5AM4A 1H2HA 3T9BA 2QAJA 1JDPA 2CHFA 4OJTA 3V8NA 4D79A 5K01A 4MV5A 3L6BA 2QPAA 4J16C 5TEVA 2XUDA 1VLHA 4IIXA 2X9GA 1GZ3A 1QQ6A 4EFLA 2PE5A 1P81A 2OBXA 1KKLA 3JRXA 3TUZC 1TCCA 2D5LA 2ZQ5A 3V4VB 4EG7A 4J2TA 3SBOA 4I4TA 3BTUA 3PU6A 1RKXA 2VDMB 3M33A 1XNQB 4OHBA 4KPEC 2HJGA 4HYQA 4ZVKA 2V6BA 3BWDD 4QOIA 3K70D 2I6SA 2PX6A 2AE1A 3WL4A 3ANLA 1FVXA 3GRPA 3WKAA 4AY3A 4BJ1A 3SEAA 1DV2A 2XMGA 4ZAVA 2XD9A 5BWOA 2QRJA 1PL0A 2IXGA 3LBFA 4Q4CA 5JU6A 1GQQA 4V3BA 2E2WA 5CT6A 4YRQA 3WGZA 2W00A 2YKGA 1E8NA 2VPXA 1FRNA 1QO7A 1KI6B 2HJHA 4OM8A 2OTCA 3LUHA 3U17A 2PS9A 5ALMA 1LLDA 3GGDA 3OLWA 3ISVA 5MN4A 1O6BA 4RAQA 2XE4A 2P3QA 4FIZA 4Z0PA 3PNYA 4PTZA 3LUDA 4Q01A 4BNGA 2Y2UA 3I04M 4TLMB 1VMIA 3F7OA 3B6EA 3FY4A 3LQ4A 1N7GA 2P4EA 4ICIA 4ZOBA 5EIFA 5F4BA 5EJIA 2XNHA 1ZNYA 1TTQB 1CNMA 2N9UA 3AVPA 3OZDA 4ADSG 1H66A 1AX9A 3BL5A 5A7HA 3RRJA 3DL2A 4YN3A 5J3JA 2A67A 1O77A 1Y8RB 2CN1A 3LNCA 1KJYA 4FHCA 3O9VA 4PG6A 2VA8A 3BORA 3TQSA 3L4BC 3JRWA 3VZCA 3W1VA 2EP5A 2ZRAA 1S8NA 1N3LA 3BL6A 3CRVA 1JX6A 2YN4A 2BGWA 5T3UA 2XB9A 1QP8A 3OZVA 3P9SA 4OHFA 3TLZA 3DLIA 2OHOA 1GPJA 1GL9B 1OTXA 1Z8NA 3IEPA 5IT5A 2BGJA 2P9QA 4G1EB 4EELA 1TADA 1EFVB 3MTIA 1JG4A 2HA0A 1A9ZA 3NNNA 2DQZA 1ANKA 2EX4A 2XCLA 3ZGZA 3IPRA 2MYTA 1PTKA 1RXCA 2VDLB 5CHYA 3WGKA 3IR5A 2FUNB 1Z0IA 2H7XA 3K16A 5EQDA 3S3TA 1AV7A 4DCCA 4OK3A 3I2JA 3FWNA 4U2KA 2VDQB 2CXTA 1HBJA 4RA9A 4C7JA 3C85A 2HM7A 1XCLA 4HYEA 2P75A 3ENQA 5JBNA 3I52A 2FETA 4DJEC 1JQLB 3K72B 3T7SA 5HFAA 2I5PO 5HUQA 5JQWA 2JHGA 1KSHA 1TJYA 1KBZA 4IDFA 3E7PA 3AP3A 2NW6A 2WIJA 2R751 4LYFA 4MPDA 3G0DA 5AI8A 1S4MA 5CDGA 2A1IA 4TSRA 1LEHA 1FDWA 1YQQA 4MTLA 4N3AA 1UMCA 3GAAA 4JQZA 4A8PA 4QQRA 1Q7BA 2XYHA 4PSKA 4BFCA 3NMUF 1PK7A 5B30A 3RQSA 1ZR2A 1JPJA 1FC0A 1ZWKA 3AEQA 2YIVX 3F4LA 3FUCA 1E3LA 3RVQA 4B9EA 2EBFX 3H87A 3NYRA 3RVSA 3DNFA 1ODJA 4UNIA 3KNZA 4ZVRA 4OXNA 3ZIAA 2VPQA 1QHHA 2Q3FA 3LI2A 2V3CC 1VIDA 5IW8A 5C9ZA 3D0RA 4W5NA 1KI6A 1SVUA 2ODQA 2V7BA 2D2FA 1A95A 2PNFA 4JJ6A 3HUFA 3I6YA 2J5BA 2JA1A 3MRXA 4PLVA 3UWSA 3W3AH 3SE7A 3BYZA 3FHOA 2X40A 4CTJA 4OH7A 1Q15A 4G2TA 3A9SA 3OSZA 2ONJA 2PMWB 2ZLBA 3EQ9A 3LY8A 5F23A 1WSBA 1J1IA 1J8VA 5GQSA 3VTFA 1BU8A 5I4KA 3L4JA 2RGAA 2V5AA 4LQCA 4PRLA 4X8MA 2W2PA 2PG3A 1II0A 4UULA 4RTRA 2AZTA 2KX7A 2ONCA 5JAHA 3VUEA 4OGGA 2FRDA 3A05A 3LUGA 4M8IA 5DP2A 3VPAA 4DLAA 2I3GA 2EP7A 4XJSA 5KOHB 3AV3A 3KS9A 1B1AA 4Y0VA 3EZ7A 1VE1A 4QM6A 3FDXA 3PA6A 5EUCA 1C7FA 2W2LA 2OL4A 4YMSA 3SBXA 3UGQA 3OJFA 1NRWA 4EGJA 3CV3A 1NVUQ 4MVJA 3P4UA 2A0WA 3L8CA 3ETLA 3CS3A 4I46A 4TMXA 1QG6A 1JKIA 1V41E 4B43A 4DNQA 5SY9A 4Z2YA 5TF4A 4GC5A 4NP6A 2EJTA 3VVLA 1CUUA 3GRUA 1FSSA 2WWXA 2C7VA 1CFZA 2PU5A 3G8AA 2Q5LA 1YS2X 1G0NA 1KAHA 5E9QA 3WRYC 1F2UB 4MO2A 4NMHA 4ZQFA 4FWTA 4BNNA 1CQJB 2AXQA 5TGDA 2I6QA 3D2CA 1BCRB 2FWJA 1LTHR 3NAZA 2OOKA 4GPBA 1TZMA 4JJEA 4RS3A 4YP5A 3TBKA 5K3FB 3SEFA 2KS6A 1YNOA 2YHIB 3QHAA 4XQCA 2C7QA 1BROA 3IELA 3TMKA 4MIEA 1GL6A 1XKXA 2AC4A 2P2LA 4HDQB 3HUUA 4ID3A 3ZBUA 2PKQP 1RPTA 2NVWA 3LO5A 3FDZB 2Q5OA 2R8PA 5KNDA 1HO3A 3RV3A 1QO9A 2CLOB 4HH0A 4MJLA 3D4BA 4C21A 5F2EA 2V7XA 1FUKA 4FYMA 4LZOA 1E9CA 1YWGO 4DMFA 1FQWA 2DFLA 4CQJA 4EPVA 2C83A 4QUDA 3HXOA 1XCPA 3IEIA 2JIZA 3NVKI 1KEPA 4WD3A 4C6TB 4Q4LA 3E9YA 1IOLA 3ZKWA 1UC9A 3B7GA 3DOOA 5FWAA 3IGFA 3KLMX 2D62A 3I9V1 4GE3A 2RHJA 2G1KA 2WVGA 3A06A 3R6LA 4BVAA 1GZDA 1D7AA 3MUFA 3OCZA 4DSNA 3A2NA 1IG3A 3W78A 4D8XA 2VP5A 2LUOA 2JZCA 4GP9A 3ZK9A 1TTHA 1XWWA 5MF6A 3H4IA 1QF7A 4B3IA 1GAWA 2Z3VA 1PT7A 4O8CA 4GQIA 5IWCA 4DLLA 4C4ZA 1P80A 3LQ1A 2GZMA 1M2FA 4FD3A 4NAVA 3UYLA 4WLVA 5AI9A 4UNQA 3G88A 3SU8A 3EA0A 5BQPA 4G09A 5L4SA 3FCCA 1H5UA 3UMFA 3EXG2 5LLDA 3GUHA 1KFJB 4YREA 4B6QA 4ESEA 3L49A 1THMA 2N47A 5F7ZA 3V7WA 1XU9A 4OP1A 1QS0A 2VVTA 4LVOA 3FN4A 3CTPA 2GZDA 2FQXA 1YS1X 1E1YA 1NDQA 4HSEA 1UK8A 1LPBB 3TUIC 2DERA 3QMMA 2PGDA 2EZTA 4FGKA 4MLZA 4FLMA 1E1QD 3H04A 2JBWA 4UZSA 1U8XX 5FQOA 4QBTA 1EP9A 2LGJA 4OHZA 3UQZA 3OKPA 5DVZA 1X80B 4IS3A 2FUEA 2WF7A 3DVSX 3QI2A 3RARA 5AESA 5BV1A 3OFVA 4M9CA 4EJ6A 5IM4F 1CWUA 1M72A 1N9KA 2G72A 3Q85A 3W3ZB 3ZY4A 4B7AA 1FB5A 3HB9A 3EGCA 2FMKA 4QD3A 4DT1A 1E5DA 1RBQA 4QEZA 3FF4A 2A14A 1A7KA 1R9MA 3TSOA 1F8XA 4MVJE 5LQMA 1TEZA 4DLNA 3Q0TA 4ZGWA 5HQ3B 1F8GA 4UAVA 3N2IA 1CP2A 3EXIA 2FPIA 2GF2A 1ZAKA 4LJAA 4ND8A 1DELA 4J7UA 4PZYA 3VZQA 3RFFA 1PJZA 4BX3A 2C07A 2JEZA 3NIWA 1KVUA 3PC6A 4K8RB 2J46A 3DW3X 2HGSA 4RZUA 5CXXA 5EMNA 521PA 1HTTA 3SJZA 4HF7A 3WOHA 4E21A 5A4IS 3SDSA 2IBTA 1KI9A 1VYVA 1N2EA 3V1YA 1VJ1A 3U7GA 2AYYA 2X2FA 1FX1A 2QVCA 3R6DA 4YRNA 3RVOA 3ZXSA 1HK7A 5FRDA 4WNCA 2GWHA 3SKXA 4BV3A 4I9GA 2OHHA 3IBFA 2DTXA 2Q7XA 4G0VA 1AQYA 1DS6A 2EERA 1PNVA 2B0CA 2HV9A 4MW5A 3MA0A 4QTZA 3OIUA 3NDIA 5BQFA 5FA8A 3BJZA 1AOXA 5ALXA 3WGYA 2G0NA 4DLTA 3SXJA 3P5SA 2HADA 4WZAB 5BRAA 1NPTO 5EHNA 3B3QA 1F4PA 2AIRA 4GVLA 4TTQA 5FBKA 2RAPA 3T1QA 1OAOC 1TKRA 4OHVA 4FU0A 2Q6VA 4TYNA 2RHHA 4HDMA 1UDBA 2ZYRA 3AYZB 1QXSA 3TNDA 4X62B 2FN3A 4OYYA 1VGRA 1NBMA 3Q98A 4YAUA 3OCWA 5HPYB 4YPFA 1TIKA 3OHSX 2C8JA 2OFXA 4YRCA 2IOHA 5FQNA 2YYZA 2G25A 3WHIA 1U9CA 2CJWA 3ZDEA 1HI9A 2FSUA 2FFRA 4RD2A 3DR5A 1THZA 1Y3FE 1NGSA 2QVBA 4UXHA 3IUMA 3N6VA 3ZY3A 2A7XA 4L50A 2QTFA 2QRVA 3HJUA 5GJVC 1ZQ9A 4PRYA 1Y6ZA 1RPZA 2ZUBA 3WQHA 2OP1A 2ZR0A 1GLNA 5T6MA 2HHAA 2YHBA 4C7VA 4IHQA 3OPYB 5BY2A 2HLNA 1N5LA 3GWGA 4ESOA 5KJEA 1UFQA 3B53X 3MJHA 3MYRA 3FOZA 2OVBA 3QLVC 4DY4A 4JB8A 4LOJA 1M1XB 4H0NA 5CVUA 4MKXA 1K2VN 1XMSA 3IAS1 3AJ8A 4GP7A 2XUKA 1P2DA 2HH9A 4JMLA 5JALA 1GL7A 2RAFA 1S3FA 3PR1A 4PWYA 2PUVA 1IEXA 4B81A 4UAGA 2C5GA 4OXKA 3ZJUA 1SCDA 3ILXA 3PTAA 4XGKA 5KTSA 5DHSA 4C5CA 1T0BA 1Z75A 4ZPJA 5IH7A 5KDDA 4F4FA 2PPVA 1ECJA 1PVVA 1RI1A 1XEWX 2HF2A 4OBEA 2ZBEA 2DBZA 3DOFA 1Z07A 5JQGF 2H1CA 1P7CA 2JLAA 2YJZA 4HD8A 1S3IA 5EIAA 3DV2A 1WY7A 1TEXA 1HKUA 3E5NA 2PUBA 4W9NA 2IQ5A 2B4YA 4MW2A 3WLMA 4PQEA 1RAAA 4NKRA 4R54A 2IS6A 1Q1AA 3KQYA 4Q9LA 4H16A 1QJCA 1Z6GA 2IZ0A 4KNVA 4X84A 2PL9A 1I7DA 4JLBA 1GD1O 2OB2A 5AW8A 1E1RD 3OT4A 3EH1A 2ZUEA 1Z8HA 2O5RA 2R6R1 2Z6VA 5FO1A 4FS8A 1I10A 1A5BB 1H0RA 2HXYA 2YY6A 3EXFB 3L8DA 4CL8A 4YV2A 2QRMA 1M83A 4K2HA 2FMUA 1EWYA 3C16C 1G59A 1USIA 5AVOA 4ZU6X 4TKLA 2IOYA 5IFLA 1A2KC 2BD0A 1K4YA 2O7QA 1TTPB 3FNFA 1FP4A 1M34E 3P0EA 4QHSA 3RE1A 4Q15A 4NK5A 5YASA 3A36A 1L5ZA 1X74A 2QLMA 3HACA 1B0AA 2R7KA 3UV3A 3CUTA 4R41A 1NIJA 1KOJA 1Z0FA 3DOJA 3EGEA 2O6LA 1N36B 5KQLA 1WD7A 1M7GA 4MGZR 4DRZA 4CKCB 4R1PA 4A5OA 4AYTA 4FGJA 2V97A 3HZOA 3RS8A 2CHGA 4XWYA 1E7RA 1P0CA 3GPCA 3VI4B 3UJNA 4YT4A 3HDHA 1CR6A 1W2WB 1XTVA 2WF8A 2OECA 3KV3O 3RRMA 4A23A 4RULA 5UKDA 4LDAA 4D9FA 3GVHA 3VISA 3M6MD 1WDMA 5HRCA 2QPLA 3L0DA 5IJ0A 1SPBS 5P21A 4B2YA 2PX0A 4ZT4A 2PZBA 2H6EA 2Q6TA 2FFHA 2OC9A 3RVLA 4AX8A 3WNZA 3M6XA 1AMOA 4S0ZA 5LB2A 2QGFA 2QRVB 3OM8A 4NOKA 1DAKA 3CGWA 3DO6A 1XTTA 2BEUB 3LYLA 3IOMA 3M6WA 3ZE1B 1XMIA 1ZD4A 4JQCA 1SOWA 3U49A 4IOJA 5C3UA 4FGSA 4BVFA 4R1UA 3A3YA 4BB0A 3TF5A 2PH5A 3IERA 1DFHA 2CVQA 3P0FA 1DIGA 5AM0A 2PUGA 3IV6A 4CI9A 1YC2A 3FNIA 4V0NA 3RWMB 2RC6A 1DCMA 2CV2A 1IMJA 4N3GA 4UHCA 1RBZA 4R8LA 1GRCA 2HBQA 5TMEA 1JYFA 2BH2A 2B8WA 2W48A 1UT8A 1G8AA 1JDVA 2YDYA 5EQTA 5CB4A 1P7YA 4AJHA 3WXMA 1HH4A 1L5HB 3RRYA 3JWGA 4KWCA 1J8DA 4I8XA 2X8BA 1JJAA 4BZZA 3HFGA 3ZE8A 2AQHA 3FTFA 4FFBB 1ZSVA 1MGPA 4NV0A 1I6KA 2P4UA 2B36A 3BXOA 4Q9JA 1JHUA 1Y8QA 2QW1A 4K28A 3EF3A 4PC7A 1QKJA 4RSGA 3QLJA 1T2DA 3FPEA 2YH2A 4CBVA 2BGGA 2IVZA 5FLEX 1YZGA 2CK3A 4EO4A 4MQLA 3UN1A 3WIOA 1DEOA 3C3CA 3PFCA 4V0OA 3T7EA 1R4NB 3CLSD 4W63A 1E9VA 3Q7RA 4EIWA 4D4HA 3ICEA 3FHJA 5E4YA 1Y82A 3G0IA 1KRXA 2JGRA 3DE2X 4DA8A 3P96A 2C4TA 1RYBA 3BQ9A 4FUQA 4X8LA 5EE9A 1FPMA 1J42A 2C2HA 5CT4A 4QULA 1UZAA 4ZEWA 3WSVA 1TRHA 4D0GA 2RE8A 1WVIA 1C3VA 4RTNA 3U7IA 2ZYAA 3RFVA 5A03A 4NCJA 1JH8A 1Y4ZA 3E18A 1ZN7A 2KSQA 4YV7A 2J4FA 5KJFA 2FAXA 3EODA 3RHSA 3SR4A 1D1PA 2YWCA 2O0KA 3PHLA 2ERCA 4JUCA 4TTPA 4NOMA 5THKA 1XAGA 2CXPA 3JVDA 1PR5A 2PTHA 3MINA 2I6XA 1IULA 4H2DA 3VU9B 1SKMA 4IJ6A 1T5HX 1EE2A 4Y30A 1RWXA 4L08A 4RV9A 3AJAA 1P62B 2FWMX 5JY1A 3QXXA 2HSZA 3NGXA 2IP1A 1JAYA 2AUMA 4W8OA 4F21A 9GPBA 2XTMA 3LDFA 5EJAA 3UWOA 3THXB 4HXFB 1R0ZA 1HFWA 2GEDA 3B36A 4OKSA 3AUSA 3A3KA 1N2GA 3PFBA 4LISA 4D3XA 1KGDA 2H3EA 4HGNA 4ZPXA 5FKJA 3IVCA 1KJQA 5HGJA 4N40A 4R1OA 3AKZA 3T3HA 3SEQA 1G6OA 1AG9A 3RKUA 4HAZA 4HWSA 3OC6A 3RTGA 5JROA 1EJBA 3DE7X 2CMFA 4YP6A 1WL8A 2RHWA 4N7BA 4BNJA 4DSTA 5JSHA 4KR6A 2YFYA 2R4UA 3PPXA 4FYWA 4KLRA 5K99A 4OFXA 1T1RA 1WHSB 3I8XA 1K3UB 2B9EA 4X6XA 3A1VA 1QVZA 2IUYA 1IBRA 3FTCA 4JEIA 1BE8A 2PH7A 3IB3A 1W49A 2ODWA 2ZEJA 4FSHA 2JAXA 2X0RA 3IA2A 3A3NA 3BWEA 4OL9A 1CZKA 1G20A 5EIWA 1PWEA 1MZVA 2JRCA 3CB2A 2N42A 2QV7A 1FUYB 2YWHA 3H19A 4E2ZA 2UUOA 3A6LA 2MTBA 1YI8A 2IP4A 3N2YA 1U8EA 4P3KA 2FG6C 3J7TA 3OICA 4LX0A 5DFAA 4F8EA 1QIJA 3VRHA 4KE8A 4TWRA 1ZGHA 3QPVA 4PNEA 2NZXA 1ESZA 2E1PA 3B38A 4M38A 4JYZA 4KRYA 4LAFA 1CC1S 1WAMA 1VIVA 1R0WA 3AGPA 4X1YB 1QHHB 5AW3A 3AY6A 4HVLA 3NOQA 3EYAA 3H5TA 2O54A 5DYYA 1E7YA 4JNKA 5D5PA 1YJ5A 3VO2A 1VA4A 5GONA 1FMFA 1GTG1 4G6ZA 3GY0A 3L7JA 1YB2A 1Q1ZA 1KF0A 5IKMA 1OXTA 3DAFA 3CX3A 1DV1A 5JS7A 3KR1A 1NN5A 4AW9A 1A77A 1ZEJA 2OV6A 5E6SB 1W36B 4BO1A 2IYVA 1XAIA 2R1TA 2Z9BA 5E0OA 5BSGA 5DNUA 3QSGA 4EJ0A 5AIAA 5JS6A 1UAGA 1W29A 1Y0BA 2A86A 3F97A 4I8IA 5EVJA 3AKEA 4IRXA 1JAIA 3KAPA 2JCXA 1UBJS 3DV0B 2GPTA 3U61B 2ODAA 2A84A 2XT6A 1TOAA 2JI7A 5FWXA 4BGVA 3KYCB 1U9IC 2GBGA 3AVYA 1TAUA 3PHBE 4IH9A 2QU8A 2SKDA 2FG5A 2V8BA 3MWLA 4MWEA 1IEQA 4KACA 3DNPA 1OT3A 4B32A 4LDJA 1PFUA 4E3ZA 4QPPA 3CZ9A 3WLJA 4GXRA 3H8VA 3T34A 1M76A 3FOWA 1FMLA 2RGGA 4AICA 2GOYA 3E35A 3HXLA 3M82A 1FBTA 5CGQB 4YB8A 3GUYA 2HDOA 3AVXA 1PNOA 4GOJA 2BHSA 1CP3A 3PC2A 4P3OA 4ZOEA 4ID9A 2C99A 4J0KA 4P7BA 3W8DA 1MVNA 3B89A 5LP6A 2CC2A 3ORRA 1MC4A 3Q2KA 5BVGA 3DONA 3ZE6A 5F5LA 4D4LA 3STUA 2PT6A 5EG5A 4EG4A 2QD4A 3RW9A 1NL3A 2BOVA 2Q5IA 3BCRA 1X39A 5CYGA 3RRZA 2RG7A 3GJZA 2AKAB 1H6AA 2VIIA 1L7DA 3N76A 1KVQA 2YHIA 4GNKA 5ETJA 5IK2A 3W2GA 4E2XA 4KXWA 1LBQA 4N6OA 5BYBA 4EKYA 1PJ3A 2NV0A 4FJ2A 5HUHA 5F78A 3U4QA 2XUZA 4I4LA 1DIAA 4IQFA 2PS0A 4JKOA 5EXEA 1R00A 5U4QA 3HJNA 2WUDA 4FWBA 1M5RA 2EOAA 3W5DA 1W4LA 3LAWA 1FW6A 1VJ0A 3PQ8A 1PD1A 5ALKA 1AF7A 5A9SB 1A4RA 1SR8A 2P9GA 3CLVA 2FPLA 2VKTA 1J7KA 1X1QA 3FAZA 3LP5A 5F9HA 4ZXPA 3X44A 3PPYA 1MB3A 1T9GR 4BN4A 1YC5A 4L2IB 4EZBA 3CEHA 2PKCA 2P2DA 4ILEA 1XBTA 1GNTA 1OWOA 2NXJA 3HDYA 3GH1A 3WK4A 4CM8B 5IRCD 3GJ4A 2OUIA 2PVPA 5G0SA 1SKYE 3H2BA 4KXXA 1BHSA 1JHXA 4YT8A 3FKSA 1OLOA 3HGTA 3L43A 4LDNA 3F4BA 1QONA 3CIOA 3ZCPA 2BKLA 3KJIA 2GKSA 5L7YA 4YGXB 4B35A 1A5TA 3R6TA 4HMOA 2XQJA 3TE7A 4BL5A 4JI4B 4WBNF 4AT1A 1XU7A 2EGGA 3D6UA 2GXAA 3VR5H 1OIVA 3NGMA 3IUJA 4PV7A 5FB3A 4KDEA 1FX0A 2PSFA 2C2XA 3IIJA 4YCBA 3V2GA 4OTZA 4ZAWA 4P08A 4B7UA 2QUHA 4DHEA 4FZVA 4HDCA 4DSUA 4R01A 3A9RA 4DJJA 5K0JA 3NJ4A 3B1WA 1KDPA 2VPWA 1VP3A 2WD7A 4CV3A 1HDYA 4I55B 4G0WA 1R6UA 3Q3EA 1N5OX 3P2IA 3M81A 4CMBA 4Y7DA 4JU8A 1L9XA 1HDEA 3GRFA 1H8HD 1S9HA 4PTYA 4CE6A 2IELA 1MV8A 3FNHA 4G89A 2V74B 1LTQA 1MC5A 3KJGA 2YFHA 2F1RA 1D4OA 3CNNA 4N82A 4OJNA 5KUTA 1ZJJA 3FMPB 1RNLA 2FFBA 4ONEA 4X1KB 2C61A 1MF7A 4JVMA 4QYSA 2PL3A 3PLRA 3O8QA 2MWMA 1JKJB 4HNAB 3LLMA 4RY0A 2Y1FA 1L4BA 4AX4A 4KAXA 3HP4A 5LQSA 1KZ4A 4QG7A 4YAIA 1N92A 1IRXA 3SN6A 3GR6A 3D43A 4XR4A 4PHGA 5K3CA 4J8PA 1N6HA 1X14A 2I1WA 2HPHA 3PIIA 3TRIA 3RF7A 4QGGA 2I03A 5TSDA 3DDZX 3H1GA 5IJ9B 5KWVA 5HNKA 1XAHA 4KYTA 4B75A 4DC9A 5C52B 3T1HB 5EJ9A 1PAUA 1WMAA 1QR6A 2XUJA 4KHZA 2FR1A 3V5NA 2RHLA 5DIZA 2PLRA 1FYXA 1NTOA 1U8FO 5KWJA 4IEFB 1JILA 4K9MA 4PIVA 2FFAA 2FN8A 2BEVA 2VC2B 5IYZA 1EGQA 1VZ2A 3K5PA 1G3UA 1XVTA 2R8EA 3ERCA 2DFNA 2CNOA 2I29A 1IXRC 3KAJA 3PEFA 1XZ8A 2YV1A 3MXOA 3RKSA 3RVMA 2AA3A 1DEKA 2X86A 3FKQA 3DZFA 2VYND 2WU4A 3GC6A 5DASA 3T3DA 1NP3A 1VPTA 3NBXX 3HKCB 1Z5WA 4HLDA 3AYXB 4DY6A 1XDUA 2QRZA 3QEKA 2H57A 4YMLA 5ITWA 1OX5A 3RS9A 3OKFA 1ZGGA 3FMIA 4YCCA 3CRMA 1WUYA 3WWPA 1UJMA 2RI0A 4CIYA 221PA 3K0AB 4FUTA 3IAUA 3VOAA 2H3HA 2H52A 3BZWA 3BSSA 4KP7A 3DC2A 3RKRA 4RH0A 2OC4A 3EAGA 4D45A 4KCGA 3VOTA 1E1CA 3VPXA 3EVCA 1J2TA 2COEA 1RJFA 4M9SA 4MP8A 4D81A 1EVLA 3ANNA 1UDWA 4U7TB 3VNBA 1IVSA 1WOMA 2R6HA 5E6RB 3PHGA 3UB3A 3F7MA 1T3TA 2B2CA 2XAAA 3Q2IA 2O20A 4PO8A 1YRLA 3E8XA 3KCNA 4E31A 3ECSA 2ID9A 1WTCA 4A0FA 5B3KA 1NVFA 2LWIA 1VCMA 3KHTA 5E4TA 1HE2A 1P4SA 3HNPA 5GV8A 2HL6A 2FN7A 2CMGA 4FMDF 1MRNA 3V2IA 1FFXB 1UODA 2YICA 4KQIA 4TS3A 1B8PA 4F9TA 3CPHA 1J2JA 1QE0A 2VYNA 4C43A 4GX1A 4FEAA 2XBMA 4WAUA 1LTKA 2QJRA 3QWAA 3SICE 2XWQA 1Y5LA 3PUHA 5JJKA 1Y33E 4IHJA 4Z4HA 2A2ZA 4RUKA 1QHFA 1HNWB 1SG9A 3A4IA 3IHWA 1FOEB 1P72A 1RTTA 3GP3A 4I1RA 3GUZA 4IIJA 5F21A 5IXJA 1T3SA 3NGLA 5JXWA 2IHUA 1IXKA 3KXPA 4RD1A 3RFXA 4A92A 1V6AA 4G4GA 1NXQA 1I9GA 3DL4A 2VT3A 4OMDA 5HQJA 3G68A 3H6HA 5K0GA 1YRYE 2VP2A 3KZOA 4Y2UA 3HBAA 3K9BA 3W2IA 1DQPA 1PG5A 2JCGA 3DJYA 4O4LF 4AG3A 1DUSA 1RP7A 1U2SA 1J99A 1OWMA 5H5JA 4CKYA 5LWHA 4NFYA 4PNZA 3HKBA 2VJQA 2Z08A 4KBYA 3VJKA 1OGJA 4XSHA 1ZD5A 3T5GA 3P9ZA 3A4NA 1C8KA 4B3SB 5CW2A 5C7IO 1RXYA 3P2JA 1S7CA 4MWOA 2PMEA 1YACA 2E82A 3K0HA 4RKRA 1PZHA 1WZEA 3NIBA 2FX2A 3L0OA 1KQOA 5DYGA 2FF7A 3IKJA 2V7QA 4R9NA 1F0PA 3LXUX 5DULA 1J56A 3A04A 4JSRA 1RXIA 2D5BA 4ME6A 5IBCA 4CEJA 1OV6A 3CNEA 1UKYA 4A0RA 1CBUA 4JJIA 2F4NA 2BFOA 3LFHA 1V37A 1WB9A 3VYSB 4QARA 4YJFA 1U4OA 2LTAA 1HOTA 3HKCA 3SX0A 2BFDA 1H1LA 2IYYA 4M98A 1QU2A 4KVGA 4RYDA 1NJSA 3WWYA 2CHQA 4JP2A 5JCJD 3C97A 2QXYA 3K9NA 1NQVA 2NNLD 1D9XA 1QGAA 1YRBA 2IITA 2W6ZA 2GAOA 3TMYA 4BVHA 1VL0A 4EPRA 5B4VA 4UEQA 2IIQA 5J43A 2AZXA 4E30A 4ERXA 1PZGA 3KJFA 5BXQC 3SFVA 1Z0ZA 3W2TA 1QF6A 2CNWA 2AJTA 3SC4A 4QUAA 1W9HA 3TCNA 4CMAA 1T91A 4M9XA 3KT0A 1KH2A 2JBAB 3CVXA 2O5CA 2VHWA 3KELA 5CFRA 1O96B 4MRVA 4WFIA 5FIUA 4WN9A 2DJIA 3FFBA 1XYVA 3EMKA 3MCUA 4G63A 4PE5B 3TCKA 3AVVA 3EG9B 3Q8MA 2NO1A 2HRBA 3ETNA 4L51A 4D2IA 3IE0A 2WD9A 2WJ4A 4H4CA 4RJKA 1E6EA 3NR2A 1NP7A 4RF4A 5EMLA 2J08A 2W22A 2JJQA 3GJ5A 3INNA 2HMVA 4IQ8A 3RO7A 1GNVA 1Q1BA 3B1ZA 4PVCA 4AJEA 4AECA 5LUAA 3P26A 1ZGBA 4IMIB 4YY3B 1X9HA 3FWYA 2UYCA 2DWPA 3ESQA 3QLTA 4D9CA 1IC6A 4MW0A 1S9DA 4YRZA 1NT2A 4EVIA 1AQIA 5EJMA 2O2EA 4CTNA 3D6VA 3AM1A 1XDDA 4BKRA 5LNK1 1Y7TA 3RJTA 1L8AA 1Z62A 2VEDA 1F9AA 4C30A 3VZRA 1V25A 3JALA 1GXSA 2COKA 2W37A 3IPCA 1SUWA 5DTMA 2I55A 3QNMA 1K7XB 1SVWA 1CEEA 3CUYA 2DY0A 1OF1A 2VEOA 4LBWA 4MMZB 4TRRA 3TL3A 3C6ZA 4NJMB 5KCMA 1VJGA 5EL0A 4EPYA 2P5YA 4J0QA 1PL7A 2BZGA 4LHYA 2EKZA 3SE0A 5B1EA 5KQGA 4KK3A 1GGJA 2F8LA 4H3KB 2QZZA 2JIZD 2BFWA 2Y6VA 3GGPA 4UW9A 3CWQA 5J23A 4LNUA 4KXMA 4P4SB 4WI1A 3G0HA 3FHTA 1KY5A 4MQUA 3DL7A 3FGPA 3GFFA 4AUEA 1EJ2A 1FFDA 1U1GA 2OV2A 3KVRA 3ETDA 3X1MA 4IFEA 4ON9A 1LVHA 3ELBA 4AIIA 2RHRA 3GB9A 3OCCA 1KZ9A 1E2MA 1BVRA 4DG8A 2QTMA 2B37A 4XGIA 5JXHA 2IS4A 4BQPA 1C2TA 1Z0AA 2FP4B 1GUBA 2QYSA 1PUJA 3BPSA 3AHJA 2E4VA 3R8CA 3AL2A 2HCFA 2UYQA 3SR3A 4KQMA 1FZQA 2I8CA 3PWSA 1XEFA 3SIRA 4A73A 4BQQA 1KORA 1JYSA 1R64A 1Y1QA 4HS4A 2HPVA 4Q9KA 1NF9A 1N32B 1GQ2A 2WICA 1NJ5A 2A9PA 4IUDS 4EY8A 2NPOA 2R65A 3F1KA 4HWOA 3EDMA 3BZUA 4B73A 1JXMA 2NYVA 1UWKA 3HN2A 1Z22A 3F5MA 3PGXA 1D09A 4FGUA 2EYUA 4C05A 1EFVA 5LJLA 1DKUA 3IHLA 5DI3A 4X6UA 5ESDA 3DBHA 4JEUA 5ABPA 3WIVA 4GYWA 5TC4A 2EDCA 5C18A 2J3HA 3W9YA 1ZL0A 2XMBA 4HBGA 1SCBA 4M1YA 1SUCA 5ALGA 1FXWF 1LNQA 2GJSA 4JJ8A 2G9NA 4IXNA 3SLGA 3Q0EA 4DG5A 1RWPA 1TYAE 1P0IA 2CLFB 1QLWA 3TLMA 2BHTA 3MERA 1KK3A 1JJFA 1HRDA 1NUQA 2AG5A 3H3JA 4X60A 2JCSA 2KB0A 2WZDA 3FD8A 1IB0A 3EUWA 1B93A 3ZHUA 2GS9A 3LWBA 4BUZA 1G20B 3O94A 5HYVA 2IEBA 3RS5A 4ZFNA 2WPDD 1U7ZA 3NT5A 4J2OA 4BNHA 3T94A 4DUGD 1GQFA 2AI3A 1R50A 2C4WA 2X15A 4EX6A 3Q5GA 1CR0A 1C9EA 2R60A 4LJLA 2GCPA 3UICA 1Y8AA 2H5EA 3ICCA 3P9NA 3KDAA 4Y9UA 3ABOB 2ZETA 3UUWA 4DCJA 2AOUA 4R16A 4U0JA 1DC6A 4GKKB 1LDMA 4ANFA 1I4OA 5DWDA 1TJNA 5DYWA 3DEIA 4C29A 4PG8A 1WCIB 5BMVB 1AY0A 3KJHA 4R1SA 1Z63A 4DWOA 1U65A 5G1OA 3UJCA 1W0KD 2ZBRA 4C0XA 4LJYA 2H31A 4LNUB 1NJ2A 3OUZA 5KBYA 2QENA 1SIOA 3LP8A 4R1LA 1QLJA 3WQRA 3B7PA 1OREA 4W5HA 4O25A 1GA4A 3K0FA 1SC4A 1SUEA 3DW1X 2NV2B 3EF0A 4Y6QA 1D1TA 5EHIA 1JHRA 3HDTA 2WJAA 2WP8J 1G5RA 4WMLA 3L1KA 4ENRA 3GJXC 4EAQA 3RI3A 1PBNA 3OTGA 1TGYA 2UUBB 5JSFA 1VLMA 1Q6ZA 2PGIA 3DTTA 2GJ4A 3HMQA 3R44A 3RVRA 3ZI4A 4ZCRA 4D26A 1S3GA 1YDHA 1MP0A 2RAUA 2ZQYA 2C1EA 4FGWA 3GPLA 4Y2VA 2Z2JA 2P4HX 3LL7A 4GQBA 5DM60 3E6AA 5KAMA 4EYSA 3SBDA 1M66A 1TK9A 4K9QA 2A94A 2ZSBA 5HIIA 3WLNA 4S1TA 3FTPA 4J49A 4EFDA 3I92A 4BYMA 5BW5A 4RIGA 4JROA 4MPJA 3G89A 3LDGA 4ZOLB 2P6RA 2P9BA 4MVJF 1O54A 2VZEA 3GT4A 4O1IA 1Q22A 5CLGA 4KKVA 2YJGA 3B6ZA 1Z18A 5AI0A 3TVYA 1VRWA 5DGCA 5KTMA 4TZKA 1XCMA 3JQBA 1HLGA 1JHZA 3C3BA 3I6IA 3NBFA 3L6OO 1P7WA 2PAFA 1EXDA 5ALQA 2DB3A 1EEXB 2H18A 3I09A 3AF1A 3FHCB 4RLQA 1UPAA 3L5KA 1JP7A 2EF1A 4QKQA 1NBIA 3GRVA 5KNBD 3KQNA 4B17A 3WGGA 5KI6A 4A8TA 4C7XA 3GD5A 5BV7A 1BVHA 1O94C 1DRJA 4F60A 2O2YA 3DO5A 4EH1A 3OX2A 3WK8A 1Y6QA 4K6MA 2AG1A 3UGKA 2VBFA 5KJCA 4X7PA 1P9RA 4JB3A 5U4XA 4EJ2A 5C1BA 4N76A 2ZG6A 1JA9A 4KXLA 1G38A 2FHSA 2VKQA 2REQA 3B8HA 3LDHA 4J91A 1E1RA 3TL2A 3PBKA 1G9SA 4RDCA 3DMFA 2BHLA 2J3IA 3MK31 4WACA 4MR9B 4P53A 2X1VA 4HB3A 4ECAA 1I0ZA 3OUUA 4JLPA 4ZHQF 3GJ3A 3EX7C 2ZRPA 1RHQA 4ZU1X 3PDJA 4L8FA 5A4JA 3N8KA 2VK2A 3AXSA 3QYPA 4P0PB 2B20A 4PHFA 2PANA 3LQKA 1SOMA 3OOYA 3STXA 4QUIA 2P30A 2PRKA 4OQQA 1GU7A 1B8VA 3B7WA 1H4QA 1TYDE 3A1WA 5B4UA 4AKSA 5JNLA 3V7YA 1UM9A 4IM7A 3ITEA 1DWOA 2O8CA 3HUTA 5CVDA 4OU5A 4LC9A 1FE8A 2DG2A 1V16A 2J9RA 3BXHA 3H18A 3EASA 2YWGA 1LPOA 3R0IA 5DBHX 3ZGYA 4A15A 5SYMA 5BSKA 1MOZA 1T9GS 1CDZA 1YFLA 1MB9A 3CBGA 3G3EA 4M7OA 3D6AA 3O83A 2FPSA 2NZ8A 5BVHB 5A3JA 2XCUA 1PFQA 2XOEA 4M83A 3KTFA 3VPGA 5DSXA 5IN4A 1P29A 3TG8A 1CLUA 3J7AC 2R2AA 4G5GA 3ZTWA 3STHA 4PZDA 1N75A 2BR5A 3NZEA 1M1YE 1TCBA 4BFXA 2FZ4A 2VWGA 2XNKA 1GGEA 3B6MA 1ESEA 2Q0SA 1KYIA 3E2IA 4K2AA 4ZMRA 2QGNA 1PU2A 5FXMA 4B4VA 3JATA 3K8OE 4U7DA 3DAOA 3BK1A 2YVUA 5KX5B 1E9RA 4ETNA 2XWJI 4LDQA 1J0AA 5EWJB 5K2OA 2I2XB 3A6KA 1U0JA 3AF5A 3O73A 6Q21A 1H9BA 4K9PA 4CZ2A 1U7HA 4DMRA 3DEHA 1UXOA 4ZCSA 5ICEA 5HJ5A 4CTOA 5AVVA 1YJAA 1U8UA 2BDEA 2CZQA 1JT9A 2QTAA 3NYQA 4EW6A 2I1VB 4HLCA 4N1AA 3VU3A 3O84A 2JKZA 1YVEI 2C9OA 3USZA 1WRBA 1JECA 4Q05A 2GEJA 2MT9A 2XNDA 4RHXA 3RBZA 5B2FA 2Z3ZA 3A4MA 3ZWYA 2WUEA 3KU1A 1EESA 3AY7A 2FWBA 5EQFA 4X41A 2LKDA 1JKMA 3B1VA 2CD9A 1RI4A 4E2YA 3R5HA 4E94A 1E77A 4C03A 3VPCA 1Z4NA 3HL4A 1ZH4A 5B2ZA 1N7IA 2Y1LA 1SNYA 1YQGA 2EZ9A 1YFJA 3GHYA 3I2FA 4ZT3A 1YI0A 5F51A 1ETUA 5K4AA 1IHDA 3EAFA 5I47A 3IMGA 1T6NA 2JFBA 5EZYB 1LSUA 3SS7X 4EEZA 5LJIA 3LWNA 1FS6A 4L0QA 3K09C 1E3JA 2OGUA 3V8MA 2LNDA 3LVQE 3F6SA 1M3SA 3JQFA 1RFLA 1XF1A 4U6SA 3D6JA 2I7CA 1CJTC 2FPMA 2GBFA 1TD9A 2GK7A 2IYEA 2JD0A 2Q3EA 2H2FA 3LF2A 3N0RA 3QIAA 5CFQA 3FAKA 3YASA 3R9WA 3KALA 1SKQA 1TUEA 4H0CA 4CEHA 2QN9A 4N8EA 2P9CA 4HZIA 2E1RA 1CUYA 4G8CA 5DYIA 5FUYA 3KQMA 3MFYA 3L7YA 1NRIA 2H8KA 3R3HA 2GBLA 3HWX1 4HB0A 5BSFA 5BVHA 2Q4EA 4LCEA 5AKXA 1A4UA 3M8KA 3EXG1 3NEJA 4Z2AA 5CBPA 4DTCA 3GMSA 1D1QA 1VL1A 2NTEA 2LXNA 3VUFA 1HNZB 1F60A 1LRJA 4JXKA 5TVKA 4CM9D 4HVCA 4IDGA 1G7RA 3PG5A 4X71A 3F5QA 4NCHA 2D1YA 5IKEA 2Y8EA 1XMQB 3M5DA 2J3JA 4MAFA 1A5ZA 1NF2A 1F2DA 4QU0A 3PXAA 3N53A 4WSOA 3T8YA 3JATB 3GJ8A 3VPDA 2EBUA 2PTGA 1GO2A 1GLVA 1XJWA 3EIFA 2YZ7A 3GFSA 2DLDA 2VP9A 3I9JA 5C0OE 4FEEA 2R68A 2XCOA 2V4UA 3HJRA 4C0WA 4MYUA 4EKNB 4RJTA 2YXEA 4MCJA 1J2YA 1NR7A 5DGDA 4WLNA 3C6BA 3WO0A 3K71B 1KVTA 3CE9A 3EEYA 1NNEA 3QU4A 3BG5A 1AKUA 2Q3MA 3QXHA 1E6CA 1G2PA 4L28A 4LJ4A 5EYPA 4GMHA 5IBRA 4JCOA 1E9FA 4RTJA 1JR4A 3Q10A 3MM4A 4B4WA 2ZBDA 4YTEA 2P6MA 2GRJA 2C42A 1GQOA 2B1IA 3UJHA 4JDUA 1ZM2A 4LV5B 3ROXA 5DV9A 1YR6A 1BKSB 4BFSA 4KZKA 3L1UA 1P17A 1KNQA 5B55A 1RXEA 4FT4A 1MXHA 3KWFA 1M0SA 1SVKA 2NU7A 2NGRA 3I4CA 3I9MA 4KQHA 4ZVQA 3S2UA 1NMEA 3ZDFA 1CZHA 3LYUA 5DXFA 5LP6B 4MDEA 1KZ1A 1YBHA 1U90A 1NATA 1SC6A 5JAZA 1OAKA 4AKTA 1VIAA 1CX9B 2CNLA 3PDWA 4LXYA 4KE9A 4DLXA 4DRYA 3OM9A 5AD1A 3K31A 3VR1A 1UZUA 2QGZA 3BWBA 2XWPA 2P3SA 4IRMA 5HJEA 1XVVA 3PD1A 4O02B 1T5SA 5DEOA 5EC8A 1T3ZA 2YWXA 1H2YA 3PJRA 1B3RA 2BJVA 3GBSA 4JGBA 4QTUB 4ZVNA 1EX6A 1FDVA 1N2HA 2ATXA 2WEKA 1ODLA 5AK0A 4UQLA 1VG1A 1YULA 2P3OA 1M8GA 3ZZNA 3LX8A 2IZ7A 1K1EA 1LF5A 1ORWA 2E4ZA 3MWKA 3W6UA 4Y1RA 2HQ1A 4L5JA 1EP3B 2IHKA 2VBGA 1PNTA 1KYXA 1X3LA 4I50B 4UDYX 5DN6D 2Q2NA 2Q99A 3IO3A 1KGSA 3NKFA 3FG9A 4J03A 1XP8A 4HB2A 1T1GA 4RZ3A 5HCIA 3IKMB 3TEJA 1GG9A 1KK1A 3GA7A 4Z49A 4H60A 4BGDA 3TLAA 2OV4A 2P11A 5K6AC 1GHTA 5BSHA 3X1ZA 4GE0A 5FOTA 4Q12A 4K05A 3CF0A 2AFHE 5CVJA 4TLAA 3NDRA 5B4TA 4C5AA 8LDHA 3KUKA 3NC1C 3OM1A 3U4MA 4E1BA 4EHIA 1R0SA 1DO0A 1GVHA 3PITA 4XWOA 1UDXA 1K89A 4AO6A 3DM9B 4OGLA 3ZWDA 2H4ZA 3RGWS 2Z6AA 5FOUA 1E64A 1QFZA 1U11A 4F85A 2QX4A 4LW8A 2PBZA 1EZZA 3M0EA 1YIDA 3OBBA 4QUEA 1YE3A 5M7EA 1ZXLA 1ZK4A 2NTYC 2IT1A 4N18A 1JIQA 3OETA 3DFKA 4GPAA 5D5QA 4H6PA 1MTOA 2AN5A 5FLKA 4EBFA 3DEJA 3VH4A 3IODA 3R3VA 3TPFA 4RKEA 3DT8A 1EWQA 2OCLA 3D4PA 5T67A 1W73A 4H27A 2YCLA 3KDPA 3OO0A 2HRCA 4X61A 3VR6H 2GQ0A 2CFSA 5EESA 1V8DA 3UQYS 3FUTA 2I7XA 5AWFC 5IF9A 1E7MA 4BNTA 2YFKA 2WY2D 4P3PA 1FFYA 1TQDA 2CXXA 4DBLE 2CXHA 5GTDA 4RVSA 1W85B 1DFIA 2FSSA 1GKKA 5C8XA 3QBTA 3O31A 1YAJA 4CV0A 1SIBE 1CB0A 2PXHA 2YWBA 3PK0A 1M75A 4UEOA 2OLKA 4W5JA 1A04A 2ZI9A 4I4IA 4OMFG 2Q4DA 3JAWA 3GGJA 3IVMA 1C0KA 3ANMA 4YGYA 4FCTA 4JDPA 1I7PA 3ADCA 2J9FB 4KQKA 3MJ4A 3AF6A 4LKOA 3FUXA 4WERA 5I9SA 1G2QA 4P35A 2WJGA 1BJKA 3KOMA 1T1SA 4KRGA 2FP4