3EFHA

Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
314
structure length
307
Chain Sequence
b'NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA02
1U9YA 5KAPA 4M0UA 4RACA 1A4XA 4WN3A 2HCRA 2H07A 2XBUA 5BSKA 1J7JA 1NONA 2GEBA 3M3HA 2IGBA 1P4AA 2JI4A 1U9ZA 1Y0BA 4IJQA 1G2QA 4JLSA 5JSQA 3GGCA 1TC1A 1VDMA 5IAOA 2DY0A 1UPFA 3ACBA 1XZNA 4LYGA 1A97A 4RV4A 1DKRA 3DEZA 1AO0A 1D6NA 5BRNA 1PZMA 1BD3A 1I13A 3NAGA 4LZNA 4P81A 2AEEA 1G2PA 1OPRA 3MJDA 4JITA 1JLRA 1LH0A 2JBHA 4LZAA 4RHTA 1UPUA 4RANA 1DBRA 1NULA 4RAOA 1BD4A 3MBIA 3EFHA 4QYIA 1I14A 4RHXA 3N2LA 2WNSA 3KB8A 4PAWA 1GPH1 1BZYA 1A95A 1O5OA 1QK4A 3DAHA 1ZN8A 1JLSA 1MZVA 2H08A 1G9SA 1P19A 1VSTA 2C4KA 1I5EA 1XZ8A 1ECBA 4P80A 1QCCA 3GGJA 1I0LA 1ZN7A 3O7MA 2VFAA 2PRYA 3ACDA 4FYMA 3OHPA 2FXVA 4M0KA 1QCDA 1CJBA 1QK3A 2PS1A 1A96A 1GRVA 3LRTA 4P83A 4MB6A 2JKYA 2PRZA 4RQBA 1OROA 1UFRA 3HVUA 4X44A 4ZFNA 4RADA 4TWBA 4QYIB 4P3KA 1ECFA 1ECCA 1YFZA 4S2UA 1TC2A 1Z7GA 3H83A 5HKLA 1OREA 4LYYA 5ESXA 4P84A 1G9TA 4Z1OA 4P82A 3OZFA 3G6WA 1HMPA 1ZN9A 4X45A 4WMLA 1DQPA 1ECGA 5IPFA 4KN6A 3GEPA 4RHUA 5E38A 4RABA 1DQNA 4F8EA 3OZGA 1DKUA 1XTUA 1QB8A 1W30A 2JKZA 3ACCA 3LPNA 5KAMA 4PFQA 2H06A 4RQAA 1XTTA 1I0IA 1FSGA 1STOA 5K51A 1ECJA 1V9SA 2YZKA 1P17A 5JV5A 5BQPA 1A98A 2P1ZA 3QW4B 4M0PA 4LZOA 4P86A 4QRIA 1O57A 1QK5A 1R3UA 4RAQA 1VCHA 1P18A 5ESWA 1IBSA 4OHCA 3S5JA 2EHJA 5EUCA 1QB7A 3DMPA 1XTVA 1L1QA 2E55A 5BQOA 1L1RA 1WD5A 1HGXA 4RHYA 5HIAA 1A3CA
chains in the Genus database with same CATH superfamily
2C2HA 1FFDA 1JIKA 1L5HB 4JJAA 3OZWA 2W2KA 5K0LA 3V00A 4EG6A 4EY3A 3WXMA 4UTPA 3BSFA 3UWPA 4N41A 2DWOA 4JXZA 2CL7X 5EZYB 2AZXA 2D1TA 5CFLA 2Z04A 3TJZA 2ZQZA 3KSUA 1CUGA 1W47A 3I73A 4LY9A 5EMJA 1A77A 2EKZA 2W11A 1MLDA 1X9HA 4JJ4A 3TTXA 5D3ZA 1XEXA 2FP4A 2G5GX 2GDJA 5IBPA 3FYTA 1C5KA 1NX9A 5IAOA 1PFGA 1ZEMA 1ZVKA 1V71A 4FFBB 3HXKA 2RHTA 4NJMA 3EGEA 1U2QA 1E8MA 2BGRA 4EGQA 2IU6A 1NG9A 2I6QA 3B1KA 5FP0A 1H4QA 4J1TA 3K0BA 3O21A 4ITUA 1SB8A 4IJUA 5JXIA 4G8BA 2WUFA 5JXGA 1PWZA 4LEIA 3NAQA 3BWEA 2G40A 3UJ6A 1U2SA 2H1HA 2ZXFA 3H9BA 1RXEA 1WZEA 3HB9A 2DBVO 2Z8YA 3FAKA 3QA3E 2GM9A 3USZA 4ZMRA 3VMMA 2Q45A 5KKCA 2C99A 2GYUA 2Z9CA 3BGWA 3DL7A 1X2EA 2OAQ1 4N7JA 7MHTA 3ZDDA 3NJ4A 2WHPA 2YHUA 4J0CA 4PHTA 2BONA 4LCJA 2EJBA 1I24A 4ZVOA 4A9AA 3T41A 3UOAB 2F62A 4X6LA 1UOEA 3D43A 2ZRNA 5FTLA 1JB1A 2CFCA 3NVMB 1TKBA 5AM5A 1KGDA 3PDIA 4OX9Y 1T4MA 4E4TA 1ULBA 1S8AA 3ZDXB 1EEXB 2X42A 3AR6A 2AG5A 2VG8A 3RTDA 5A0TA 1V3QE 4R9VA 1YBVA 1GZDA 3WGJA 3PU6A 2P3LA 4ERNA 2YVUA 4MR9A 1IUOA 2RB5A 2FMFA 4TS3A 3MWEB 1PSWA 1N0WA 1FUKA 5IVPA 5K0JA 1GZSA 5I7EA 3D8HA 1E64A 2YS6A 3S8YA 3A9CA 1NXVA 3OFKA 4NULA 4C4OA 3DZ8A 2CNKA 1X70A 4QBKA 1UDWA 1A7AA 4X6UA 3U3DA 1ODFA 2M6RA 4L8VA 1IUNA 5AM0A 1XCBA 3VKGA 4N54A 4QELA 4RK5A 1AV7A 1RRVA 1LJLA 1U2DC 4ZWNA 3IKJA 3UMVA 4YP6A 4C6SA 1V2HE 1Z25A 3CNOA 3NEPX 1JALA 4FP9A 4Q7LA 2DCMA 5BXQC 1PD1A 4DDTA 4IIVA 1T6YA 1VMIA 3OP1A 4J0IA 3W3ZB 3EQ8A 4LE1A 2AFHE 3FHOA 4PRLA 2FVYA 4UHFA 3WB0A 1JHUA 3U5TA 1U04A 4DILA 4DQUA 1C9EA 1HI9A 4LQLA 2C98A 4KOEC 5CCEA 3Q0TA 1F8XA 4YJKA 3D02A 4QG7A 2XGGA 2JAUA 3DHVA 4MQFA 2EQBA 3TNJA 4AY3A 1N5OX 3H84A 1K3TA 3IAS6 4TSKA 5FQOA 4DQKA 1FVFA 3L1KA 2X2FA 1JSCA 1PG5A 3CEJA 2WV7A 4U2CA 1UXHA 5CA0F 2YV5A 2O8CB 1XVUA 3WYCA 2FN4A 1Z0KA 2HJGA 1KC3A 1MG0A 3P2YA 3GW8A 2C58A 3EQ6A 3W8NA 3CE9A 1A8PA 4CKWB 4ZI7A 4WOBA 2FSHA 3IGFA 3K20A 2R751 5E9WA 5BN5B 3BMNB 1EGVB 5C8YB 1EJ0A 1O9BA 2R9VA 2XUJA 4OU4A 4QWWA 3B82A 4YDRA 5GQSA 1CEYA 5FWXB 1H5NA 3PNOA 2GJSA 3ID6C 2C7RA 1NUTA 5H81A 1FDSA 2MSNA 3L8GA 4RF4A 2Q3JA 1A82A 3W5CA 4CEHB 2DTDA 2Q9AA 2VF4X 3TTYA 3UJAA 3K0KA 1A4XA 1N1EA 3MWDA 4R4JA 1UJBA 3CX3A 1EAYA 4UHBA 4OD0A 2JH8A 4UULA 5BUCA 4AZ3A 1E79A 4UHEA 1SQSA 4BFLA 1NBMD 1NXOA 1KDRA 5GJCA 1TLFA 3KHSA 2D59A 5JFOA 2R6AA 4RDIA 4IFEA 3CZ4A 2GOYA 3U0BA 3AILA 3PICA 3QP9A 3TGWA 3VV2A 4IH9A 1NI3A 5FR1A 2XSZA 4A26A 1DTWA 4RO0A 4EPWA 2JCVA 4TSFA 4BJHB 2PG3A 3DZIA 4HDMA 4JR2A 4Z8YA 1XTZA 3ROTA 3ZUGA 4BRUA 2H4HA 3ZIDA 1T9CA 4ITVA 4XWOA 1R88A 1VP3A 2VP5A 2PQ6A 2ZDQA 3E9MA 2CUTA 2MINA 4P3PA 2ZB3A 2ZQ5A 1LH0A 5CNKA 4YPFA 3JAKA 1Q95A 4Y1EA 3SY8A 1S6YA 5DYNA 1PJCA 1Q3KA 4FZ3A 1ZOLA 4MQ4A 5CXQA 1X9IA 4J8PA 1IMJA 1NDQA 3C8MA 3INGA 4FJ2A 1XMPA 4KDFA 4OH7A 4UMDA 5K7SA 5IM4F 3ABZA 3NOQA 3IS3A 1W36C 1SY7A 1F1BA 4H7EA 4RU1A 3IP1A 2CJFA 3QVUA 5AHRA 3U4QA 3FZNA 5JWOA 4YXFA 2AJLI 2CBXA 4FMDB 5JBQA 4TL6A 1KVSA 3QXHA 1UODA 4O1HA 3STUA 4PFJA 3PUXA 1OZFA 2HDNB 2YQZA 2Z8ZA 3HFGA 3RC7A 4B85A 4MRAA 2B4KA 1GQFA 3BFJA 1R2QA 2RH9B 3ODPA 5JI2E 4H0NA 5JCZA 4U3JA 1FYXA 1Y8RB 4MDHA 3OQIA 1QC5B 4K81B 1TD1A 1RPJA 5AKYA 2VYQA 3KQUA 1SXPA 3I04A 4Y2UA 2IGTA 4QX6A 1WMFA 1GT91 1QRRA 4AS2A 1JU3A 3RABA 1WUTA 4C4SA 2I5PO 1XRMA 3GP3A 2Q0QA 2ZCVA 4U7WA 3DT8A 4D6YA 5E0OA 5A3SA 1KS9A 2AQ8A 1A50B 4I8DA 2YJ5A 3SMVA 4X3PA 5CDFE 3OIYA 2OPHA 2QSYA 1SA0B 4Q4HB 2NAPA 4JNKA 1DUSA 2OKGA 3BIWA 2AFHA 4FC7A 1E2FA 4CUZA 5BYKA 1V1MB 1E1LA 4LOAA 3RVNA 3RHTA 5KPDA 1DRVA 1QO7A 1E6CA 3GNQA 2ZETA 3AB8A 2CFRA 1O8BA 1WVIA 3GJYA 4YRDA 1ZK0A 5JNWA 3VXKA 2J3HA 2RGYA 2VF8A 3EBLA 4MX8A 4TMXA 3ESQA 1SUDA 4DBVO 4AJPA 4ER3A 4PFQA 3CRW1 5DGTA 4B75A 3PIIA 4WDQA 4OPMA 1T9GR 4TT8A 3L93A 1DCKA 1UKEA 1GPBA 1OLXB 3CUEF 1CVRA 3T3HA 1X77A 2EKLA 4QDOA 3YASA 3UWOA 4QHYA 1T2DA 3ZDZB 3FLAA 4FD2A 4YMSA 1E5VA 1E1YA 4OP1A 3DW1X 5EUBA 6NULA 4H15A 5EJFA 4HYTA 4KH1A 1V8OA 1ISPA 1VCMA 2BPOA 3BSWA 4TMKA 4YRBA 3DMPA 4NEHB 1QQTA 1G1MA 1PKXA 1DDIA 1YUBA 1I3NA 3DDSA 5G1NA 3HZRA 1TAQA 4OGLA 3WMRA 4DJFC 4HT3B 1G60A 2AI2A 1P1BA 4ZAWA 1Y7TA 2ABWA 4EMSA 2ZYTX 2D2FA 3MUFA 4RVDA 1N32B 2XKJE 3TD6A 1L0BA 2JJQA 3ZIAA 1RJWA 4TXLA 1E2MA 3D54D 2GJKA 2NSLA 3ASZA 3RU9A 3W4JA 4BP3A 2V54A 3JQ7A 5DPMA 3H5VA 1AGPA 3PE6A 4DV3B 3MUNA 3KEOA 3TF5A 3WFZA 2H2WA 3CKMA 3VPCA 3BGOS 3OJLA 2A5GA 4HRAA 1XVAA 3TIVA 5B58C 4NJEA 4BU1A 3Q7SA 4OCZA 2XTJA 2YBEA 4P98A 2VK1A 4D9JA 4US1R 2XXAB 2WEKA 3QTLA 2ZUCA 4NAUA 4FGKA 3TX2A 1LTHR 2QVYX 1H2WA 1NUPA 2VTBA 3RTEA 2BAGA 1U28C 3LHKA 3UAGA 2O3SA 2P8JA 3UO8B 4QJBA 5ADUS 4AXBA 3BD9A 3L8HA 2ZSHA 4PYKA 2WICA 2ZTMA 2WSLA 5AI0A 3P19A 1GIAA 4G6ZA 1KO1A 4JMLA 2W6NA 2X3UA 4URVR 3LTNC 3A58B 2QPOA 4DR1B 2YHIB 2NACA 2VLIA 1ONBA 2OXFA 1ZO8A 2WWWA 4OH1A 1JDBB 5BNTA 5C8DA 3LA8A 1EFVA 2QL9A 2FFJA 2C82A 3M6FA 4RZ3A 4X71A 2PVCA 4HGZA 2E4XA 4GLFA 1TRHA 2BLLA 1JJAA 2G9UA 4HGYA 4TV9B 4WZZA 3WIUA 1ODJA 3GVCA 4ZRDA 4Z7NB 2WBLC 3MYRA 4HQLA 4LRYA 2FUG6 1VCOA 2BTOA 5DCWA 1KARA 3B2NA 1Q12A 1VIVA 4YCSA 3DVAB 1KI3A 2C8JA 3QXXA 2H0QA 4HF7A 4NYIQ 4LJKA 1CD5A 3BEOA 1WNFA 4RF2A 1YRBA 1JHVA 3ZWQA 4KIJA 2GQ0A 1BE8A 1ZUNB 5JATA 2CNWD 4XUDA 2GEVA 5KDOA 2XA1A 1RC8A 2JRCA 4BLVA 4FILA 4MS1A 3NBAA 1MB9A 5CDFA 3RYTC 4GLBA 4EY7A 2CJWA 3OHMA 1TCBA 4MW7A 4J3FA 4I3HA 4XRGA 4F4DA 4RTSA 3WGHA 1E3IA 4YP1A 3MJHA 2FPOA 1QX4A 4KXWA 3S2UA 2PMEA 4EHHA 1RLOA 1BW9A 1V5FA 2QRZA 3GGGA 3QKTA 4CZ2A 4CT4B 3VU8A 4YQYA 3H9JA 2FRDC 3CU5A 5KU1A 2AFIA 2C61A 1Y8ZA 2YWDA 5T4HA 3W8EA 1R8YA 4GQIA 2WU3A 3ORFA 2X40A 5IAEA 1IHXA 2H29A 1VKRA 5FTKA 3WDSA 8GPBA 4LF9B 2JLRA 3O3CA 3FR7A 3P9KA 5IABA 4CQMB 1GFZA 3FROA 4RTPA 1U9IC 4UZSA 3O9MA 5LLDA 4PG4A 1DOZA 4RZUA 4YAGA 1V6CA 5FWNA 3B51X 1YQEA 5A7GA 3ZVKA 2GT1A 4Y7DA 1YVDA 5HM6A 2BZ0A 4MCHA 3HC7A 4CM6A 4AROA 4ND3A 5HK8A 1OXKB 1HL7A 4DRZA 1Y98A 2PT7A 3NVDA 4GQBA 4PX5A 5F5NA 4REQA 3OIFA 5CFQA 1O8CA 3VDNB 5FI0B 2F9LA 2AR0A 4WLNA 1JAXA 3G79A 1XFAA 1VL6A 3PSHA 5EIBC 4JI3B 3PEWA 3P9IA 1RRCA 1AS2A 5B1HA 2YMMA 2FKNA 2VAVA 2ZAOA 2QX6A 3PGMA 2CBZA 1TPZA 3IEKA 4N3NA 2P1RA 2HHCA 3LW8A 1R0RE 2YZGA 4D4JA 4RDXA 3OM9A 4PG5A 5FTWA 3RM3A 4FXOA 4CKBB 2H0RA 5IARA 3KLPX 3RAPR 3VBEA 1RI4A 1O6GA 1C0EA 1HOTA 1M2GA 4N8DA 1WXHA 3A6JA 1YCHA 1JQ5A 4GR4A 4MVCA 3NC4A 1N5RA 1N2BA 5LQDA 1IY8A 2CLCX 3DXYA 3O1HB 2IHTA 3DBRB 1ZM2A 4OHZA 1SBZA 3RTAA 1M66A 3IKVA 3JV7A 4MRVA 3F3YA 1PI3A 4E30A 1EMDA 3WLEA 3RG8A 3DVLA 3WQRA 4GGPA 4W1SA 4ESOA 2C5BA 1AQJA 3O8NA 4Q01A 3HB4X 1JG2A 4RELA 3GUZA 2V6MA 3D3JA 2YY5A 2A59A 1ZOSA 2V9ZA 3D7MA 2ZBVA 2PUGA 1PT5A 2JI7A 3KQKA 1HDXA 4OHXA 2AQIA 1E4EA 1KBOA 1PE0A 3ZGLA 3WGMA 2JAXA 4K2HA 3WGUA 3ED5A 5L6MB 2J4DA 2A5YB 2GCOA 2QPTA 4M0MA 2I54A 4HLUA 5EY5B 1E7MA 1FLAA 3HADA 4H17A 3RYFA 2F9MA 4CG2A 3KDPA 3VOBA 2XE7A 2OBXA 3V7NA 1TEXA 2E85A 4DWOA 2FPIB 3EWAA 3OEWA 2Y0EA 2YVKA 4NBRA 3R6DA 4GLOA 5FPPA 3UKOA 2J6IA 3IERA 2OVBA 2H4XA 2WHYA 4NYMR 1YJCA 4JLKA 4O2BF 4XRRA 1ZL2A 1Z8NA 3MD9A 4D9CA 1D0IA 4FZ5A 1E6UA 2AUMA 1E7WA 1KEEB 2BBSA 2BEUB 2XJ4A 3Q3EA 5AM1A 1HF3A 1GNSA 4I1RA 1KOFA 3TI7A 4TKMA 1TZBA 3IALA 4OIMA 4Y2PA 3CCCA 4GGMX 2PIAA 5BSFA 1I32A 3PZBA 4U9HS 3NEJA 2IYUA 1PJTA 1KY2A 1PK9A 5CYOA 5K3DA 2ZT5A 1L7MA 3X43A 3WLJA 3E35A 3ZCRA 4D4LA 2IP2A 2Q1YA 5AHWA 3LUPA 1SUFA 3ZV5A 2JGEA 1E1RD 2LIPA 3EPLA 4EI8A 1ZZGA 3PVSA 4IYRA 4P93A 5KQRA 5JZOA 1WQ4A 2CD9A 3EE6A 4QNNA 1TYEB 5HVNA 4UM8B 3C3WA 2OHXA 3C1OA 3K1JA 3PXAA 4DLPA 1RS0A 2H48A 5KQPA 2GF9A 2HA4A 2PO5A 1WABA 2C4MA 2Z5VA 4TTQA 4FGWA 2RKWA 4LTDA 5SYNA 4XWWA 2ZS8A 3RIHA 3ZY2A 1G18A 1NY6A 2EGUA 1E9SA 1VYUA 1AZLA 2IKSA 3BREA 4JBYA 1RIFA 3M4YA 4FN5A 4HOYA 4V3CA 3WL6A 4BO2A 3W5BA 3HXMA 1P9NA 3LRXA 4MW9A 4RC9A 1CS0B 5DRYA 4HQ0A 1PZFA 2QEQA 3KOXA 3K9WA 1HMYA 2J3QA 4RMGA 3ROFA 2R8RA 5ITZB 1DNPA 3RODA 1JAIA 5F2EA 3HY6A 3K5IA 1DXOA 1O5TA 3RYIA 3DZBA 2HDWA 1UOOA 1ZHFA 5FOVA 4DC9A 1JHAA 4X91A 4BNYA 4M86A 3NETA 1Z6XA 3KR2A 4L4XA 4Q3OA 2JLXA 5AJWA 5EZ6B 2LCFA 3KLMX 3C8DA 2VATA 4MV3A 1JXOA 1N2XA 2JAQA 2WWGA 2XNKA 1JI0A 4EMTA 1MB4A 3HP4A 2Q29A 5EIXA 2R7NA 1NTOA 1UT6A 1WG8A 1A97A 2QX7A 2C7QA 1E94E 1S01A 3V2IA 2HSDA 5B30A 2YWCA 2YN4A 3B52X 4M89A 5TGZA 4B9AA 3H0EA 1XXLA 5AJVB 2FDXA 3QE0A 5P8WA 3VDXA 5FPKA 2QV7A 1T36A 5ECYA 3SLRA 1E4OA 4A0GA 3ETLA 4ARZB 3GLRA 1W36D 2BMVA 1U90A 3PF8A 4L0MA 5E7QA 3ZWNA 4O3MA 3AETB 3IV9A 4RV5A 1IXYA 3I37X 4OI1A 1I4DD 3AUAA 3ZGZA 2PZEA 1ZL0A 3TFQA 2BRUC 5I8WA 5SY4A 5J59A 3K9NA 5AIAA 3AM3A 4O5AA 1MO6A 1QS0A 3HCEA 3RWBA 3AZQA 1EUDB 1XCOA 3IDZA 2VA8A 2A0FA 1W6UA 2JI6A 2O2DA 1PP4A 4NH0A 3M4XA 2J87A 3JQ9C 2CBGA 2VPPA 3JVVA 3QYJA 4W63A 5EFZA 5IHXA 1HY3A 1QGZA 4I3GA 4WJZA 1NJSA 4JUDX 3WGNA 2HADA 3F5FA 5TT0A 2CVOA 4RPIA 2GYVA 4KR0A 4N6OA 2QIPA 2FU5C 3LPAA 1QFXA 4GPAA 4QFBA 3DEAA 3TE6A 1IAQA 5DM60 1XNGA 3LQ1A 4MGHA 1QQBA 4DR6B 4O4IA 1E96A 1YFZA 1RBYA 4XB1A 1IJEA 4EHNA 2ZVPX 4WOPA 4C0SA 4W8HA 3D5QA 4R84A 3I05A 2JBAA 4RMJA 2CK3D 4XVCA 3HRIA 4GSYA 1I6MA 3CVYA 1RZ3A 1TW2A 3FPSA 2XWSA 1NRJB 2FPPA 5LXTB 1DTSA 2YYYA 4BVFA 2XUGA 3REQB 2PZLA 2XRFA 3NC1C 3ONWA 4FUQA 4PYOA 3SDBA 1Y8AA 1ZIXA 2WD7B 3WAGA 4D9KA 1LLFA 3PQ6A 3V2GA 2PUCA 2D06A 2H1IA 1YHNA 4Y2XA 4AJ1A 2QD3A 1GCUA 3L4BA 3ZE2B 4O4JA 1FYVA 4S0XA 1NUSA 2RK4A 2WNHA 2NXJA 4MITA 4QO7A 1KY4A 4U6QA 3TRKA 2X23A 4TYYA 4MWZA 1XBTA 1KDOA 3VYWA 2Q3MA 3C3PA 3OLXA 4X8HA 1LS1A 5TQ0B 1X7HA 2XYGA 5LIRA 3CVXA 1QWOA 2FEPA 1ZNWA 1Q83A 2HPHA 2BM1A 1Z47A 2Q4BA 4P3OA 4MYDA 2B30A 5FAKA 1WBBA 2JDIA 5J63A 2QUAA 3NBQA 3LWBA 1YO6A 2IA5A 1C80A 4OGKA 3C6XA 1SQGA 3V1NA 2HCTA 3JASA 2I78A 1NVTA 4ZJZA 3H5NA 5A3RA 1S2DA 2ALJA 5AOCA 5JNSA 1XK7A 3RJZA 3TFWA 3L4JA 3BORA 4JI5B 2O2JA 1XZAA 5E3IA 2IEBA 2VNAA 4DOMA 4WN9B 3U19A 2B8JA 4X6XA 2NSDA 2O8FB 4HNGA 1GNLA 4OHUA 3NW9A 1SCAA 5KNCH 1FNCA 2FPKA 3DONA 4R05A 5KAPA 2BV3A 4YAWA 2P3SA 1BS2A 2V59A 4MV4A 3U9TA 1EVQA 4MUNA 1BFKA 3PCRB 4R2KA 4R98A 2QD2A 1G21A 4BBPA 1V1RA 1D4ZA 4BU0A 1U7PA 1E9FA 4J0JA 4N18A 4DEXA 1A71A 3H5RA 2R1VA 2D6FA 3QOXA 1JEOA 2D7JA 2GNPA 3HUFA 1N77A 3G9XA 1TF2A 1ZYUA 5D01A 4KK4A 2Y1CA 1JHMA 4RV4A 4ZZ2A 3TPFA 4ZGGA 3JATB 4DL9A 3PFKA 1UK7A 2YFQA 3KHUA 2VT6A 1ZH6A 2PEYA 3MJSA 3ME5A 4WASA 3R7LA 3PEUA 1YJBA 2Z58A 3W3AA 3URMA 1TVCA 4BNIA 4G8DA 2WAOA 3BFPA 3HU5A 2AN4A 3T38A 1JLRA 3KUXA 3KOOA 2NU9B 1ENZA 1WMEA 4L8LA 3I83A 5AVVA 4DQ0A 3ZHXA 2EW2A 2SNIE 1ZGAA 1KSJA 2FPRA 1E7YA 3KDAA 5EXSA 1BCSB 1D07A 4PAWA 3SFVA 4A10A 1ULAA 2YCLA 3ZWBA 2XCSB 1NRWA 2YJZA 3DZDA 2XOKA 1L8XA 1QIHA 4Y2SA 3NCHA 3OT1A 4K9NA 4XVQA 3T5DA 4AKHA 1DHRA 5CDGA 5BSVA 2JAWA 3C41J 2MSKA 1YQGA 1OFUX 1YZLA 3NVAA 5ALRA 2XLCA 2GPJA 4AJLA 1PV4A 4GIBA 2FW1A 3LECA 1L7RA 5A3JA 5CR9A 1VPTA 4HLCA 4PS0A 3JZMA 1YZQA 4DXHA 4EG5A 3NBKA 5KYVA 1OFIA 2ZZMA 2WC1A 1JECA 4OHYA 4YAEA 2E6UX 3M6IA 4MGKR 4UBIA 1SIOA 4ZCTA 5BMOA 3FKSD 3LX6A 1BEEA 4N5DA 3EEQA 2DB3A 1G7CA 2ROQA 3QNUA 5F64A 3TLXA 3FOBA 2B2CA 4QUHA 4C7OA 4Q4JA 1N7IA 4XIGS 1T5LA 2ZE7A 3SHOA 4C4RA 5K8VA 1EZZA 3HH8A 3ZWWA 2JEOA 1AUXA 3Q3IA 4BV9A 1Z38A 3HKDA 2HT6A 3C8HA 1G8PA 3KFLA 1YB6A 4U00A 1YZNA 1H2BA 2ONCA 2P6PA 3UWSA 5CA1F 5CIYA 1OYWA 4BO0A 4E7OA 5L95A 1PJ8A 2XE6A 1QGOA 1R6XA 3CONA 2CNBA 2ZVQX 4B4DA 2RCNA 1JE1A 4PHGA 1N6HA 4FE7A 4CU2A 4C3VA 5KSOA 2ANCA 4NNJA 5CB0A 2CXPA 2X77A 1BKSB 4FNGA 3TLAA 4MAAA 5CJ2A 4ZHSA 4UMEA 2WD9A 4KRYA 2ES4A 3GELA 3Q8WA 4Q9IA 1SVUA 4BECA 2JHFA 5LWHA 4ABTA 2IV7A 4Z9FA 3V3TA 2O48X 4Q4AA 4LMBA 4CR7A 2CXNA 1UBKS 2OM2A 3LUBA 4PSKA 4R0MA 4HXYA 5C1OA 1FJXA 1BIFA 4IUCS 1R00A 1IM5A 2IHZA 3IJEB 5ADVA 2YUIA 1SXJB 4BO5A 5EIBD 5E95A 3EULA 1WO8A 4NTZA 2IVZA 2A14A 5BN4B 4U2EA 1SU4A 2OQRA 4HX2A 3V1YA 1FNSA 4TKVA 2JW5A 1TLLA 1YUMA 3P0HA 2MHCA 3KTOA 4ONEA 1E99A 1L5GB 3TTVA 3FNEA 1QX3A 3QJGA 2QRGA 3HKBB 1LRJA 5LQJA 2IE0A 4Y9RA 3GLQA 4OYHA 1GNVA 2EV9A 4KNVA 1DTEA 5DEOA 1I7SB 3AVYA 1Q1EA 1EE2A 3MT7A 3TSAA 3LCMA 2XNCA 4YP7A 5B3LA 4FBLA 4RMHA 3N6VA 3ICPA 3RUIA 4MO2A 4AKEA 3SFZA 2KPOA 4IJQA 1E66A 5E7IA 3ENVA 4KQMA 3O38A 3ACBA 4GZ3A 4BVAA 2Z56A 5CNJA 1CHDA 1ZCZA 2Z4TA 4QHTA 3NALA 2BSQA 1E3JA 3PHHA 1NI4B 5SZIA 2C7VA 4BNMA 3DHYA 5E1MA 2IYOA 2AEEA 5LBUA 4QT0A 3STHA 3U56A 4YVFA 5EOVA 4BRZA 2H2IA 3SF8B 4F2GA 3ADKA 5DLQC 1BD4A 3QPVA 2K4MA 4GSKA 5JU6A 2BMJA 2FWMX 3CLRD 2A88A 2AXEA 3PUHA 4I4TB 3V46A 4GXRA 4BO6A 2EWMA 4QYWA 1VE1A 2GXSA 1QZXA 4GECA 2FEMA 3FCEA 4D56A 3U4MA 3AM5A 2Q6OA 3O95A 1NVBA 3D8UA 4N01A 3CKLA 3QFFA 4QU9A 2ID8A 3ZKWA 3OCWA 3GLGE 1FRQA 1E69A 2RG1A 5TPZD 3WGZA 1Z2PX 5CXSA 3TAUA 1Y1TA 2BFEB 3AP1A 1EIZA 3DQZA 4MUFA 3UKJA 2RIPA 3M81A 5JEEA 1R0SA 1V5WA 6GPBA 5KWVA 3HP7A 4D80A 4ZOLB 1YA6A 1NJFA 5FNVF 2X0KA 2WM3A 3G5LA 3QVSA 4J75A 4JLMA 1W87A 3EK2A 3K72B 3HVHA 2CSUA 4PQEA 2WE7A 1LLUA 2C9YA 3FYSA 4ZFNA 1WMBA 4PCAA 2FJPA 4V0LA 3R0IA 4H08A 3DF9A 4P1ZA 3RRBA 4JP8A 1E89A 1XNRB 2FYTA 2ZWMA 2YIDA 5ALSA 2GXAA 1MO5A 1Z0ZA 3A27A 1IG0A 4WZBB 1RI2A 3A14A 4MEJA 4C1NA 4C7BA 4Z4FA 1QHSA 1ZN9A 2QM3A 1DQZA 3D3WB 1FP4A 2G9ZA 2ZJFA 3B2QA 3EC1A 3AESB 3LFUA 4FZJA 5AI8A 5DN6A 5ES3A 2JK1A 5K0EA 4PBSA 4I99A 1L3CA 3MRTA 4AMVA 4U0KA 4YACA 2IYLD 2WG1A 2YS7A 5G4KA 2V03A 4IEIA 4GPIB 4F3CA 4NCIA 2HWYA 4PS1A 3IVGA 4E08A 3G9UA 4CKZA 2JHPA 3KYDB 1FL9A 4KE8A 5J2TF 4NENB 2AG1A 4J0FA 4Q0MA 4ARAA 4UTRA 4QHSA 4EGFA 2JIPA 3PPXA 1PWYE 1RLMA 2J3EA 3IR6A 4KMSA 4GMDA 3SZLA 3CZQA 3ROGA 4PPGA 1S3IA 1PFVA 2ENWA 3PKZA 4MSUA 2ZE8A 2EX4A 4B3FX 1KPIA 1W85A 2FPSA 3DE5X 2OOKA 2I76A 2HLDA 4J1SA 2VZ9A 2HF2A 2Y92A 2IEDA 1LI4A 2ZROA 3GFOA 3K2BA 4DC1A 2NGRA 2M6LA 2BR3A 2HWKA 2ZJ3A 1TCCA 3H4TA 1B0UA 2XDQA 1D2AA 1L1RA 2BCGY 1J25A 3EIXA 1Z5GA 3I23A 4E70A 4I5IA 2P4EA 2OFXA 3OESA 1PBNA 3T9CA 3B3GA 3VO8A 1YZVA 3G8YA 4TOIA 4AQDA 4ZN6A 1E0AA 3Q7PA 4M8LA 1TB4A 1MJNA 2R8XA 5HF6A 5ENVA 4BJ1A 1OAAA 1P9OA 3A3YA 2QVCA 1JFLA 5FL7D 3VYSB 3ZGOA 1QRUA 3K2EA 5JBNA 1Q7BA 2XUFA 1ORVA 2FSGA 2D13A 2JAOA 4IGKA 3HA2A 4CL3A 1R4ZA 2Y27A 5BNWA 2NPIA 4M98A 5LZ4A 4BFVA 4N12A 3RFXA 4S1PA 3CQ9A 5KOYA 5GVRA 3W5DA 2IDMA 5AJHA 1QO0D 4WKBA 3AL2A 4TMYA 4OMFG 5TVKA 1TQDA 4P4SA 4BMNA 2FF5A 3RK1A 3SSNA 2O7NA 2DFKB 2BR5A 3AY6A 4EM6A 5JG7A 3HR7A 2HHJA 4XM1A 4IWYA 3EFOB 4N8SA 3RCBA 1RVDA 5C53B 1UZAA 4CV0A 3V4RA 1FS5A 1ENOA 1W2GA 4M37A 5AOAA 5DHFA 1NSYA 1Z06A 4FCWA 4R2WA 3HO6A 4OMDA 4CMEA 3JTMA 4RZXA 3O9VA 4P2BA 3L6RA 5HKAA 4LYJA 4TV8F 3BL8A 3FDIA 2CLDX 1QHNA 4OQYA 2VAWA 4XASA 1KJQA 4FNMA 3SI7A 2OENG 5BN3A 1FTQA 3CXRA 3KP1A 1G41A 1JDZA 3GLGA 1M2OA 3QIVA 2W5UA 3E9ZA 4R5MA 4W8OA 4WKCA 2P9YA 3A6KA 1GPKA 3MJCA 4PHHA 4WERA 5HE9A 3D6JA 3ZHRA 4TTSA 3V4PB 2QRLA 3IP5A 4N48A 3K9LA 1DAGA 2N1MA 5A3QA 4CTOA 5BXYA 5JJCA 4KYIB 1KI2A 1QAOA 5DM1A 3IP6A 1T2CA 2ZT6A 2YJTD 1T9BA 1BFDA 1Y7HA 1MIHA 1W4CA 2VNSA 4HMOA 5BY2A 2DP4E 2EEPA 3AT1A 4I46A 3R5SA 4TTRA 4C6TA 4URXR 1A0OA 5SYAA 3I2JA 3JD3A 5DBHX 3OQVA 1TECE 2O1SA 3AF0A 3L07A 5E7MA 3AR3A 5D7NA 5IF3A 4QVIA 2HA5A 3JQPA 3R3XA 5L9AA 4MKXA 1HETA 2GN8A 4YWJA 2WIBA 2NNLD 2Y9MB 3QJ5A 3DOHA 3FPFA 1RHRA 1FFBA 3ZBPA 5HXAA 1XYYA 4R1OA 4CMCA 1KMNA 3QOYA 4ARCA 1L4GA 4ID3A 4QEDA 3F67A 1FP6A 1NX6A 4N6GA 4KE6A 1ZJJA 3DFMA 1UC4B 3I2GA 2FZGA 4QDKA 3EW7A 2DR2A 4GX2A 2B94A 3IQWA 3DTNA 4NFSA 4NVRA 4V1CA 1Q6YA 1GDTA 3ZE6A 2ST1A 4F60A 4NHEA 1WF6A 2JRLA 3ZWMA 1IPFA 1M2EA 2QR3A 1CXZA 3FDZA 2W93A 3O8OA 5U9CA 2BGJA 3VZDA 2EVWX 1IRXA 1L4NA 1L2TA 3NJRA 4MV7A 4P5PA 3EMDA 2H1RA 4DRYA 3CKKA 5K2OA 2D1FA 3HDYA 1ZIPA 3DFZA 3TQIA 3AVTA 1CY8A 4YRTA 4ZICA 4B84A 2QR5A 3TL3A 3ROEA 4CKEA 4F9TA 3QSYA 4OQQA 3LZ6A 2EIXA 1Y5IA 2MSEB 3ECSA 4R16A 4MCJA 2O14A 1JP7A 3PPVA 4HH0A 5J43A 2JBWA 2W6ID 1BJRE 1PEDA 3BG5A 3C14C 4JEIA 1FUUA 5C8ZA 1NMXA 4GE3A 2SBTA 1MOQA 4E2ZA 1VSUA 2JCYA 4GBJA 4E14A 4G0QA 1MJ5A 1XTKA 2OY0A 1IY1A 1G5PA 1XDSA 2BKXA 4JBHA 4NS4A 4DEVA 4CIAA 3WSVA 2WR8A 2QTZA 5T57A 1PJZA 3DTVD 3MT9A 1S8FA 1YZKA 3AR7A 2B5WA 2OV2A 2YN0A 2IIBA 3E7WA 3IQXA 4B48A 2X7XA 5A1JA 3GJ8A 5LYJB 1C1YA 1B1AA 3SOZA 2JNWA 3KZVA 3SZUA 4BNNA 5AVUA 5DLPA 3VNRA 3UJ9A 4J49A 4ZZ3A 3H1EA 2AJTA 3OZIA 4MYTA 3UNXA 3O82A 2C7OA 4HEHA 2EGHA 2DFVA 1KMCA 2W90A 3I01A 5FPQA 3H1FA 3OA2A 4CF5A 1JYEA 1D2MA 3VH4A 4ZDJA 4QUIA 4D81A 1RAFA 2YYAA 4L73A 2UVPA 5FAXA 3JXEA 5KYWA 4ZI2A 3HM9A 4MRRA 1Y1SA 3UWKA 2DPGA 2FMKA 2XYRA 1TO1E 4MVJM 2XRMA 3N0WA 4O2AB 3VZCA 2RJ3A 3GJ6A 3LBFA 2RGAA 1XMIA 1AKTA 1OUMA 4NBNA 4N7RA 4Q7MB 3WHPA 3P9XA 3HVJA 2ORED 1QQ5A 1H8HD 1I0ZA 1QGAA 2WFLB 4LF6B 3ND5A 5K3FB 2RHGB 3D0RA 1PQWA 3DAHA 4XWAA 3AFNA 2QUJA 3E22A 3W7AA 4D0RA 4J4HA 3M6AA 2NVUA 2CFIA 3Q9SA 1NJGA 4FE4A 2Q5CA 3DE1X 1GUYA 3PR2B 3TLYA 2WZCA 1P7VA 1G20B 3DZKA 5AW9A 3WL5A 2BD0A 4W5WA 2GF0A 4ZAYA 1ABFA 2VJPA 3LCCA 4I1PA 4BQNA 3GZ4A 3CJQA 1C7QA 3V6MA 3D3QA 4R8MA 4YDHB 5H3CA 3ZUPA 3KR0A 1AOXA 1PEAA 3GUVA 5AXAA 1EB9A 2X9NA 1W49A 2C4UA 2PUWA 4M38A 5G0WA 4JI4B 3WA7A 3OIUA 1X7XA 3FUCA 4OXNA 1JEDA 5EINA 4DLWA 4GXNA 4K9DA 5E4YA 4NLLA 4YR9A 1SK8A 5EUMA 2J67A 4Q3KA 1QUFA 1CRLA 1FYEA 3JQBC 3K53A 3Q7TA 4PLFA 3U62A 4XYLA 4XWYA 1ISGA 1T0BA 3SQLA 1YR9A 2R0QC 3RS8A 2Z2JA 2XMDA 4M1QA 4AX8A 1DJLA 2NXCA 3GEPA 4Q1FA 1EVIA 4RA9B 3WLRA 3AEQA 3R5TA 4CKCA 4XIJA 4DQXA 3B9PA 4CG1A 1Z6PA 4P0TA 1TNDA 1HZZC 3GD7A 1JXMA 3VR4D 1VPEA 2I7VA 3K6RA 3I45A 3L6BA 1GITA 3ZE9A 3MNFA 4HZIA 1UAYA 1SVSA 3I6YA 1Z7EA 3L43A 4WXMA 1QB8A 4DUGA 2YW9A 4BO7A 3NBZC 3EZNA 3E9QA 4LJYA 2VWQA 4ZU6X 3WLKX 4UM9B 5B4TA 5JWRA 1H6DA 4NZYA 1YULA 5LP6B 1B0ZA 3RFTA 4ZMSA 5F7OA 5IDQA 1JDTA 3KJEA 5AUQA 3COVA 1WBJB 4Z4CA 3C8ZA 1X9GA 5IFLA 1W4BA 3SU8A 1RQPA 1M74A 3AB3A 3EZFA 2Y1GA 3EVEA 3ONVA 4JIGA 5ALEA 1AQYA 1G9XA 4UXIA 4JJZA 5G1OA 4E5SA 2QM0A 3H2BA 5GIPE 5FA6A 2FZ4A 1XZGA 1KJIA 4Y67A 1ZR4A 2Y1OA 3QI2A 5AH0A 1LF0A 1T8WA 3H97A 4IGEA 3MWGA 1RYZA 4EITA 1FNMA 5F2NA 3UW1A 3D7SA 1P2FA 1L5VA 1O95A 1P2DA 1T5OA 3G7UA 3HCBA 4LXGA 1XD9A 1JMYA 1W35A 4DCVA 3VU9A 1ODLA 3T7SA 5F7XA 2RE8A 1FLDA 4CKXA 4RD4A 2C2KA 2JI4A 3BB1A 1G3RA 3G5MA 3MBKA 1N1GA 5PGMA 4HRXA 4JP1A 4YAKA 4R8RA 1R4NB 4KLCA 4KQ6A 5EE1A 3FTFA 4TVKA 3U4CA 3C45A 2AHRA 1H2AS 1KJ8A 5P21A 2Z30A 1IM8A 3N8NA 5LL6P 3BOSA 3EAFA 4LDJA 4A3SA 3PRYA 4CL8A 4QBHA 3OPYA 1YGYA 4G0OA 4KK3A 4TVBA 4I7EA 3V8EA 1RYMA 3I6BA 1QP8A 3KVYA 2XMBA 2QTAA 3TGLA 4JBLA 2I62A 4ND1A 3R41A 4WD3A 3DE6X 1GGJA 2GBIA 1E0KA 1OPXA 1ZG3A 2FZVA 2CLFB 3DM5A 1IK4A 3FIJA 3GL9A 4IIJB 4QSHA 2V74B 3U6KA 2ZRGA 3IXQA 1OX6A 2O5RA 4QPZA 4AMBA 1LW7A 2FFAA 4PZEA 2I2AA 4PZUA 1UFKA 3BQNB 4IINA 1RYFA 4ACBA 4EY6A 2XVMA 2G9VA 4DAEA 4JLJA 4QG3A 2WOOA 1R0BA 3DO8A 2BGNA 3LKVA 1H6AA 2B83A 4BLPA 3HYCA 4KGXA 1H5UA 4WKGA 2ZCJA 3V34A 4FEGA 4AG6A 2O2SA 2WDZA 3KETA 1ESCA 4Q7EA 2H1LA 1D7AA 1GAEO 3HHEA 3CLTC 3PJFA 1WP4A 3BIOA 1U31A 4L8GA 3R7DA 3DLHA 1LCIA 1JQBA 4NCAA 3S4YA 2NO1A 1T6ZA 3K9GA 4D42A 4ZAVA 5A4AA 3PJDA 1ZCFA 1A9ZA 4LC9A 1HKHA 5EFOA 4EZBA 4FDMA 3T4XA 4OLJA 1R6UA 1TK9A 4PEVA 1EXDA 2FG5A 3PXXA 4LQ4A 4J3JA 5FWAA 3EVBA 4XE5A 2I9KA 4RZHA 2RJOA 3ZU4A 3DQQA 4WNAA 5DYIA 4D2IA 5I9IA 3MERA 1B8NA 2YZ2A 3OU7A 1FNBA 3GCXA 5EP3A 3VTFA 2YFKA 5HUHA 1KTVA 2Q07A 2TYSB 3RVJA 2Z6UA 2VT7A 3I9OA 3WL3A 4FYVA 3TLEA 4Q93A 5E2AA 5CB4A 3CG4A 3BWYA 1WV0A 3V7UA 5KVVA 3KPYA 3PFHA 3VMFA 4M83A 4JVLA 4IR7A 4L4SA 3DOCA 1T8UA 2ZBFA 1WCWA 3FKQA 4LV5B 9LDBA 3UXYA 2O8BB 4P36A 4F4UA 1U99A 2UYYA 3KXIA 4Q16A 5JO9A 5CHYA 3AEUA 1RXVA 4HH3C 2RIRA 1CRQA 1CQXA 4M1SA 2PGDA 3L7IA 4ZHQB 1SWWA 4JT9A 2ZK7A 1HORA 2QI9C 4MVJF 4ZEVA 4ZJPA 5BT8A 4PLZA 5CD1A 4YCCA 1INLA 4W5OA 2F3PA 3WLOA 3PK0A 4EABA 1K89A 3BVPA 4X90A 5DVZA 2X8JA 3V7WA 2DXIA 2YV1A 4I9UA 4Y2VA 1LLQA 2PS0A 3E6AA 4DV6B 5AXDA 4JA2A 2Q41A 1RJEA 5AKIA 4L50A 2O2XA 5DV9A 2FSUA 1X42A 5CLFA 3EYAA 1TUEA 2HU5A 3MINA 1PJ2A 2B35A 3PQ4A 1XEAA 3Q6IA 3EIQA 1WUKS 2NW6A 1CZUA 2QKYA 2AR9A 2R6R1 4KV7A 1IHUA 2OXEA 3WDMA 2XXJA 5KIAA 2BMAA 1E1MA 3BFXA 5TR9A 2WWIA 1ZRSA 1Z37A 2CLKB 2QN2A 2XOEA 3HL0A 4FU0A 1QKJA 4H4CA 5DIZA 1U6IA 2IUFA 2QD4A 2O2CA 4RPKA 1K9SA 3VOAA 2GD6A 3R7WB 1L8OA 2IUEA 4GRIA 4E31A 1Q19A 2MMGA 2JGFA 3NXKA 4FBMA 3ZXUB 1YBMA 3QU5A 4D3SA 2TMYA 1YDHA 3OZTA 2Q1TA 1U0OC 2IOFA 4Z86A 2WY2D 1TL7C 2OM6A 2CDCA 2QN8A 2WAMA 2BI7A 2HN9A 2WTNA 3HABA 4QJIA 4DC0A 3U09A 4AI6A 3DFUA 5BV8A 2NU8B 4R1TA 3GCZA 1X7WA 4B2PA 2ZJZA 3OIGA 2W2VA 3GLKA 4OQEA 3AL0C 1JDUA 1H23A 3R44A 4R5HA 3V8MA 2C54A 4AFNA 5IH7A 4YRGA 4CW7A 1A9YA 1AE1A 3F5MA 1F2TA 1SOUA 3UMMA 4YGXB 2IHBA 2R4UA 3PFIA 2G1PA 4OQ4A 3VPAA 1QIJA 5TMDA 2W6CX 2P9GA 2PX8A 1DDGA 4MVJD 1JKJA 2X13A 2CJXA 3VJLA 4C7VA 3M2PA 3RANA 2BKLA 3VC2A 3M6XA 3ZDEA 1LDYA 1M1YE 2PA3A 4TRRA 1KFJB 1LZLA 1QOQB 3IDSA 3MCUA 2HWUA 3DL2A 3EXHC 1W93A 4EG0A 4Q02A 1QKKA 1DOHA 3H6HA 1ZOOA 4NPAA 4CMHA 1ZIOA 3G0BA 1SIBE 4RGVA 4RF3A 5JD3A 1YS7A 1WA5A 2L18A 4F38A 1E3LA 1NSTA 2AEFA 3TW6A 4GU5A 1U9JA 2Q8NA 3DV0B 4KZPA 2WSSD 1E1QA 1IQPA 2HF8A 3GBVA 2DPMA 4QTZA 4DZTA 1GPAA 3GOQA 4RK6A 5F78A 3JRWA 1N0VC 2W43A 3H5WA 1PR3A 3CLSC 4JEMA 3HDGA 3B8EA 5JMTA 1G8AA 4QPPA 4MAMA 3HVRA 2G9QA 3W1VA 3DH0A 3QZUA 1SUCA 2ASEA 1OYYA 4JAVC 2JHGA 1IB0A 3ZJTA 2HIAA 4JCOA 1NQWA 1L3BA 3I6ZA 4BQSA 3R7BA 3HV0A 1P0QA 3TJRA 4IO0A 4R1SA 1NMSA 2XDWA 3L06A 4LJ7A 4OI4A 1QV6A 5DHAA 4WOCA 5F7ZA 5CJJA 2Q7OE 3GLFE 3IPLA 3LBHA 4MW0A 3RT7A 4GC5A 2V98A 2C3YA 5BQPA 3L0CA 1UMDA 1USVA 3MTJA 2ZJAA 1RAEA 4IDOA 4KX3A 3F6RA 2NYAA 4QBIA 3OZVA 1VPVA 1MRSA 2OWDA 2PCLA 3RSGA 3SBEA 4UU0A 4BFUA 4RENA 1N2JA 2GZAA 1VPDA 3OD1A 3TTTA 1C29B 1GGMA 2W37A 5BSWA 2QQEA 3C4JA 2WKSA 4HNQA 4QPDA 3U80A 4AO8A 1H2ZA 2UV8A 4MI3A 2E18A 3SQMA 4AP5A 4BNDB 3K32A 3K6SA 4X6YA 1GZUA 1L5MA 2F48A 3F5QA 5FPYA 4IFTA 4M0DA 5IYZF 4AZWA 3OF3A 1CY7A 3B3AA 4MKZA 3V4SA 3V97A 2PKYX 3DOFA 3OEHA 4I1IA 4TN1A 2LDXA 3TQTA 3ZU3A 5L4NA 5HZKA 3A04A 1FX0A 3PL5A 1AURA 3OSZA 3R3HA 4HGRA 1U9ZA 5G53C 3X1MA 3HJBA 1YHZA 3VVBA 3QEAZ 1GFSA 4HAIA 1V48A 1UANA 1PHRA 2AG8A 3H2GA 1QWSA 3ZCXA 4XDZA 2UU9B 2W0MA 5FTJA 1QHIA 3B6EA 2TECE 3FW1A 4WXEA 1RZUA 1P91A 3DT6A 4RKWA 2XODA 3AVXA 4JVMA 3PFWO 4CUKA 1DC7A 2WA2A 3PHJA 4PYQA 5EIWA 3A1UA 1E0SA 1D9ZA 1JV2B 1Z7WA 4WLOA 1PX2A 3T1QA 2W2KB 1GQRA 4MUHA 4I50F 1E6KA 2HGZA 1O08A 4LHXA 4UW9A 1YGPA 3IAEA 4HY3A 3TZQA 2AQKA 3IMGA 5AVXA 4RBNA 1LTKA 1J0BA 2QP4A 3KPVA 5ALMA 1XEXB 2FP4B 1BZYA 2FTKE 4Z0TA 4MUKA 5F3WB 3K0EA 1PQPA 1U3WA 3P9RA 4QATA 4MMXB 2VZ8A 3MS7A 4JB8A 2QM8A 4NJMB 1CTQA 3AVUA 4O1IA 2OXCA 1OA1A 1G66A 1ONPA 1AS0A 1GD1O 1YA8A 1KDVA 4K0RA 4IDAA 1UBOS 2KX7A 4M0EA 2HRRA 1OGYA 4TS9A 4WGGA 1ND5A 3WMWA 4KUHA 3OETA 2VHQA 4DNOA 2OD2A 1A9OA 3I61A 2PL1A 2QZSA 1Z2NX 3UT5A 1RYDA 4ZYLA 5CIWA 4GL4A 1WUHS 2PH7A 3Q98A 4J4BA 4DIUA 1U80A 3LU1A 1IVYA 4Q7JB 1G64A 3UKDA 5LMUB 1YVPA 4NE7A 5U4QA 3VRHA 1N5IA 3BHMA 1N92A 4WUTA 3KUKA 4BNUA 4NZPA 4EY4A 3PDIB 3N2ZB 1VL5A 4YROA 2OLKA 3PGKA 4S04A 5DXJA 5T6BA 1OVMA 3K8ZA 2JLBA 1TE2A 4TUYF 1LQUA 2O23A 1RAAA 3ND6A 3R76A 3HPRA 1T25A 4UHJA 2E4AA 2HJSA 4KQEA 4B82A 4JT8A 2AC7A 4MR9B 3W5SA 4BZQA 3EASA 3OAAD 5IN5A 1OFTA 4HAOA 4EHIA 4PSDA 4U5XA 1M73E 2C4HA 1PTKA 4D9FA 1MB2A 4JOBA 5MF6A 3KKQA 4HJRA 1TX4B 4ZODA 5HRCA 3GLFA 4G5GA 5HFAA 4AU1A 3QA9A 3BXXA 5F21A 3R23A 1YR1A 3KJFA 1ETUA 1B6RA 3CINA 1LD3A 4D82A 4IDGA 5CLLA 4KR9A 1U1CA 1YACA 1U2PA 3ZQJA 3UFBA 3KD3A 1Y82A 1QDLB 3O75A 3EGIA 5I7AA 4KMOA 1ZJZA 3NTOA 1G7RA 1GQQA 1PT8A 3KOYA 1H6CA 5MFPA 1RWXA 1JEYA 1ZI6A 1RQGA 4FFVA 4KWEA 1WSAA 2INGX 3K0CA 2H3HA 3KSMA 1QSGA 3MTBA 2V6BA 3OTQA 3H5IA 4IWNA 3H5AA 3Q87B 4JEHA 4F3YA 4YCNA 5I9BA 1XROA 3K9CA 1D4FA 1N2HA 2VI5A 2YNMA 4JUAA 4KE7A 4MWDA 4NONA 5AOVA 4YQZA 4ZVTA 3GPDG 4MQFB 3HCDA 1B74A 3THRA 4CWAA 1QU2A 2MU1A 2PJZA 3TCXB 4DDVA 1V35A 2VXCA 3EZ9A 4CI0B 1GTL1 1TM2A 5C4MA 2XBUA 3CLVA 1H0RA 3TSCA 4DZZA 2GK6A 3P71T 1XQ1A 2WUVA 2IL1A 2QTCA 3GAAA 2PTHA 4YECA 2EKDA 3L3BA 2IPOA 1A27A 5LOVA 3KB1A 3LQRA 3KE9A 2ZLBA 1ETHA 2RBEA 3N2IA 3LRPA 4ZI7B 3ZHTA 1HYBA 1PRYA 1ZUWA 2PT6A 5EXDA 4B7AA 3DWFA 1YJXA 4PTYA 3NRJA 5CDTA 1QONA 2FQQA 1UPTA 2RK6A 3LVBA 3QWIA 5I4IA 3A0UA 5BVHA 3KSBC 4XSHA 2GEFA 1MX9A 1HA3A 3G89A 1WXGA 3MWDB 3QTBA 4YMHA 3A4NA 4JI0B 4AZ3B 4RKYA 1QHFA 3SG0A 3UK0A 5BSHA 1KAMA 3E1GA 5AHXA 4CETA 3OQBA 1OF1A 1USUA 3E9NA 2WZQA 3FDJA 4ZVSA 3UWDA 1GNPA 1BQ4A 1RDFA 5CURA 3D0OA 2O9JA 4YRAA 3U44A 2PNFA 3G23A 4GYYA 4JA0A 2VPZA 2IPXA 3B6ZA 3WWZA 5KINB 1DTWB 4HUJA 4QQKA 2EJUA 2OA0A 2A0UA 3WAJA 5IKXA 3THYA 1Z4JA 3O0DA 2RK3A 4HDMB 4LXQA 3GLUA 3HG7A 4MYRA 4IIUA 4C29A 2AKYA 4G1BA 2IHNA 3R6LA 4WCFC 4DYDA 1SUEA 2MINB 1TM3E 3CLTD 3JAKB 1S4QA 3K1AA 4A5SA 4HPJB 1O0SA 4M7PA 3RF7A 4X94A 2PH5A 1F3OA 3TL6A 5DHPA 3HMKA 2OSVA 3IMCA 3U4QB 2W6OA 4Z54A 1N3IA 2I6SA 1N5LA 2ZI3A 1UF9A 2IJGX 1B3RA 1E7QA 2PMDA 3CUUA 1SZCA 4NECA 1AKVA 2GA9A 1JKXA 2QN6A 4QSMA 3VNQA 2VHXA 3RARA 4AZ0A 3PBKA 2RSLA 2MTBA 5EHQA 4X64B 1UADA 3FXAA 4BLTA 2BLNA 1ISHA 3U7EB 4HNUA 3Q3JB 1J33A 3HU1A 5LD2B 4X63A 2XT0A 4U3JB 4D8WA 4QO8A 2ANBA 3OQIB 1QZTA 2FSPA 2ZRQA 3T12A 2E21A 4QRHA 3FMVA 5G40A 4OAOA 1XTRA 1UJMA 4DKXA 4F93B 3TNDA 4AK9A 1Y9EA 3ZD6A 1W34A 3GJ3A 4JZKA 3PQ7A 4RQAA 2P75A 4P38A 2R6CA 3LJKA 1JG6A 1UKZA 5C1PA 2W6QA 3K2QA 2QTBA 4D98A 2QJTA 1WNTA 1S5PA 1E2HA 1FDUA 1B8UA 3INTA 4EFNA 1NGSA 1D1TA 2PZMA 5F51A 5CP8A 2OB2A 5JADA 3KVNA 5LZ5A 2Y3IA 3C87A 5DFAA 2AFHB 3LNCA 3OLYA 4RESA 1FMJA 4KP7A 4Y2GA 3TDMA 5ICSA 2R5FA 2VXOA 1BH6A 1ULSA 3I9V6 1J8MF 1RM4A 4RJLA 4B3XA 3AR8A 2ZYDA 2XIJA 4Q18A 4Q3AA 3CW9A 3LCRA 1LK0A 1Z6YA 4EA7A 3U7RA 2JLVA 1L4FA 2GVNA 1IBRA 1KVQA 3WHIA 1UXGA 5AUOB 1Z2OX 1G8HA 5DNVA 2GD0A 1DCTA 1RAHA 2YFHA 4YA6A 3SE0A 3TX6A 2OFWA 2HNBA 4PSCA 4WINA 3VJKA 5MN6A 4TTVA 3ANLA 4FFMA 3DOOA 1J2JA 2YTZA 3RUHA 4P53A 5DMXA 5TIIA 1N7HA 1NOKA 1NBMA 3C7CB 3MS4A 1V8FA 1XMSA 1O54A 3GJSA 5H80A 1U7TA 3FNHA 3TXYA 4BDSA 4E13A 1M33A 4YLEA 4BVJA 4BVKA 2Z6AA 2VA9A 2NO6A 4XX1A 3FZGA 3PTZA 3P0EA 2W6JA 4ZQFA 4I6JA 1FW6A 4HEA6 4LNAA 1KY5A 1MP0A 3AUSA 2HGSA 2M1ZA 4AUNA 2CFTA 4UVEA 1CUJA 3I4CA 4BMPB 4OF4A 4Q4CA 2EFYA 2K7FA 4HADA 3CF6R 5CAEA 2TRSB 3CRVA 2OILA 3ZDCA 3GVIA 3L7JA 4V02A 4B73A 4M0CA 4E3WA 5HX7A 3OZRA 3S55A 2QMEA 2F8SA 3FPBA 2FR0A 1LLDA 1WX1A 1X1QA 1ZI9A 3JQ7B 5JC1A 5FA8A 2QVGA 1XXHA 2OO7A 2Q4OA 4WT7A 4YAIA 1KK1A 3UYLA 1P8JA 2ZT8A 1LQTA 1QJCA 1ZITA 2HPVA 4J90A 3CMCO 4NJEB 3PB3A 4JLNA 4B09A 4R2LA 2VTBB 4UD2A 1RJDA 3TIXB 3D6FA 3CRQA 4L16A 3WGKA 4BFSA 4DE5A 5KYTA 5CA0A 4OJYA 1JSLA 4CIYA 1V45E 4QU0A 3KQVA 2ZIZA 4O0MA 4BFCA 5A5FA 2PZJA 4J6FA 1NF8A 3HN6A 3R9IA 4BLOA 1YZGA 3BYZA 3E9EA 1P44A 2XTNA 1M8PA 4JL8A 5G0TA 4IOLA 2CLIB 1Q74A 5ESXA 3RVPA 1JAHA 5KO2A 1JDSA 1EFVB 4JC5A 5MGBA 3SXPA 1T3ZA 5L4LA 4BY9E 5BT9A 3BWBA 3PNVA 4W5QA 4OJTA 3ZS9A 4YRLA 4EPRA 5EN4A 4IS3A 4F0JA 1YR3A 5JAIA 2B4QA 3KSZO 2C2OA 4PXYA 1FRNA 2PX4A 1VSQA 4CV1A 2PJRA 2XA9A 2NG1A 3V1TC 1TUIA 3NKLA 1FFSA 1GRQA 5JT1A 2RGNA 3IX7A 1CDOA 1B2RA 5CVVA 5CB8A 4P54A 4F85A 5JRJA 1GG5A 4CLHA 3RRYA 1WB4A 4L8FA 2XEDA 4JYMA 3ENWA 4MS1B 3N8IA 3QLUC 3O4IA 2CJWB 2I6TA 3VR4H 2BKAA 1JHDA 1OSNA 1U8CB 1ISRA 3KZXA 3MB8A 1RMQA 3IR5A 4QXQA 3RKUA 3I0MA 3SBXA 3SDSA 1WS6A 2XCUA 3UW3A 2NXWA 1P1HA 4UBLA 5IM4A 2QA5A 3RVSA 3U31A 1BW9B 5HOQA 4G1MB 1H85A 1TT5A 3AI2A 4RUKA 4LXHA 2OZPA 5ABPA 2AFIB 1XTVA 5HMMA 4YN3A 1KK2A 1JG7A 5K2MA 3FPEA 3PQ8A 4WLUA 1EK6A 1I4EB 5DTIA 5IAJA 1E5DA 2I7CA 1SCKA 4I0WB 3WTBA 1M0EA 5JXJA 3F3MA 3EIEA 3GNSA 4BAUA 3LD9A 5CNIA 3UQZA 5CBKA 2QX8A 5CTAA 3N76A 2NTJA 4M9ZA 1U5CA 5FUXA 4R3UC 4YCJA 4ND7A 4YONB 3S2IA 1PV1A 3VHLB 3IAS1 4GZMA 3G2HA 1V11A 4H7FA 4MYHA 3ZK8A 4HWKA 4O4LF 5IAGA 1J0CA 4RLFA 1NW6A 4JZYA 1NT4A 2GHTA 3AQ4A 4IHKA 4WIAA 3FSJX 3V33A 4JL6A 4GOXA 4MP6A 2A5DA 4YRFA 1AKMA 1J6UA 3GPIA 2IY9A 5LUBA 4G4SO 5HK9A 3QHPA 4FR0A 2J7PD 4D0SA 1IHDA 2E4WA 4REQB 4ZCIA 5IUNC 2PPLA 4AJ9A 3WMEA 4LG1A 3GFVA 4YUZA 3JWEA 3HO8A 4GWKA 1XA4A 2O50A 1LDMA 4HLNA 2K6GA 4LE2A 1HE8B 4RHTA 3FBTA 3PZRA 2VNKA 2PWZA 4CL0A 2ZB8A 1U3GA 4FHFA 4RHEA 4P6VF 3CW8X 1W75A 3VAYA 1QIIA 3BDVA 3N2LA 4OSPA 1QLJA 5UKDA 4QOGA 3VNUA 2QRUA 1ZWLA 4N3BA 1ZCJA 3PX3A 4RVCA 1KOLA 3DLCA 1GWNA 2QZ4A 4GQAA 2O7QA 4BKOA 1N0UA 2HK7A 4Q7KA 3O84A 4ENRA 3Q11A 1N9KA 3RQIA 3ZDBA 4RE6A 1YB4A 1QHXA 1COWD 5BYBA 3E5HA 1R5NA 4B2YA 3E7DA 4LV8B 1F2VA 4MQBA 2CNLA 1GU7A 4N47A 4FHDA 4ZQIA 4HGPA 3LRTA 4KXMA 3TWOA 2G5PA 5TEVA 3NORA 1JQKA 2B0JA 2XAAA 2QP3A 3M6UA 3L8DA 1HDGO 3DS8A 4H18A 1WU7A 4LK2A 4NPCA 3RVOA 5D5HA 1M3SA 3B3JA 3IQHX 1X1RA 3H4VA 5DNCA 3CNBA 1L5ZA 1T9GS 2N42A 2Q1UA 3ANSA 1LKZA 3CZ5A 3H83A 3II6X 3MRXA 2VL7A 2X86A 3NAMA 2CNWA 3VR6D 4CEIA 4JLUA 5EJ4A 4ZT6A 4D74A 2XWBF 5IEJA 2AZDA 1P7WA 3GR6A 4FKZA 5AVSA 1E4EB 5JOQA 1OLOA 3NHLA 2WDPA 2HMUA 4CIXA 4DFDA 2F8TA 3MWYW 5E6SA 3F6YA 1RFGE 1EDZA 2GCOB 3U4GA 4ZU1X 4B6JA 3I1YA 3NOOA 1B15A 3STWA 2B4AA 2PXAA 3RYFB 3EN0A 4DMUB 1O6FA 1VIMA 2VUTA 3ZZ0A 1EB8A 1KETA 3CZ9A 1G8GA 1YQUA 5L45A 1QNFA 1AMUA 3RSQA 2YIJA 1J2TA 4M6WA 3CF4G 3RO7A 1RHMA 4Q3LA 1SCJA 3ROQA 3K4QA 1U0GA 2KB0A 4G2NA 4E22A 1Z0UA 1WQ3A 1BX0A 3PRHA 3QLJA 4G5OA 1XTJA 5AUPB 1OV4A 1NNSA 1A9QA 3QVXA 4R41A 1B4DA 5JR3A 3KOUA 1EK1A 1PQUA 1Q0HA 4MUBA 3AIMA 3NPMA 4PC2A 4LI3X 2WYHA 4FIZA 5JV5A 1J5EB 2W6PA 4E46A 1ZH0A 3O8QA 2IT1A 2PAFA 4KPFC 4XGRA 3I9JA 2PTGA 2Q7XA 3LXXA 3VU0A 4BQRA 2JJ8A 1YNOA 4F3RA 5IXJA 1YB5A 1E9RA 1SU6A 3SZMA 1VJTA 3I9FA 5IS2A 2KHZA 2A67A 2ZI4A 1E92A 2DSNA 3O73A 3QXCA 4H6WA 4ZU3A 4EB6A 2AR7A 3ABQB 1PNVA 3M9LA 4MR7A 1FSPA 3FUXA 4K1XA 4NFYA 2BN4A 1GEEA 2GUWA 4Q21A 1XDGA 1OI4A 1X0XA 2X5JO 2YL2A 4FPXA 4N49A 4CIVA 4EB0A 3O74A 1N2EA 2QTVA 1GTVA 3SEZA 1V7ZA 2D1SA 3T5BA 3JD0A 3ETJA 4B83A 1YVRA 4RJJA 2RHRA 4C4PA 2O0KA 6ABPA 2E37A 1BDJA 5BN1A 3V3KA 2CUNA 4A91A 3L0DA 4XDHA 4QRDA 1JIQA 1PU2A 3E1KA 1P72A 2CLSA 3G49A 4M1MA 4YDQA 1SVNA 3H16A 4XLLA 5IDWA 1NI5A 5MGNA 1SU7A 2QLJA 3MGKA 4D8XA 4O3FA 3A6HA 3HUDA 4DM7A 1CUAA 3RYIB 4MLPA 2WF7A 2GN9A 4HEJA 5HKKA 4RAOA 4XEHA 1Q44A 3HYLA 3JZFA 4JB0A 5ICFA 4X85A 4D5GA 4ZT4A 2YJ4A 2H1OA 3LKBA 1Z8FA 4YMGA 5CX1A 2V5UA 2IZ6A 1JVSA 1Z82A 5B1SA 3FI0A 5KS2A 4JQYA 2P9TA 3QFHA 5BR1A 4Q19A 3KJNA 3C5EA 4WQMA 4JASB 2GS9A 2OFPA 4TS4A 5KNCD 1MABA 5DGHA 2CJYA 1GGFA 4LN1A 1O0CA 4ZZIA 1H94A 4NS1A 5EIFA 1G8JA 1I0LA 3OU2A 1FZQA 1LFDB 1SCUA 2EW8A 4EVRA 2GNAA 3EGOA 1T36B 4QYXA 4L3WA 4ZYVA 4DAOA 4ZYWA 3JAMA 4KQ1A 3JQAD 5DNAA 5IC6A 2BJHA 4M7WA 1II8A 1KDZA 5FPTA 3VNVA 2CNOA 4CLOA 2EX1A 2K2WA 1MC4A 4NG5A 4N39A 1XMOB 1JJVA 1SCIA 1QS0B 2HBQA 3A4VA 4MVJH 4HS9A 3CNNA 1HUQA 1U2DA 4P3YA 1KE1A 5KWSA 2HAEA 2J3IA 2R66A 4IDQA 1J7KA 1Z4MA 3R5JA 4Q1AA 3UICA 2FUG1 3AVVA 1T1JA 2PN1A 3HJNA 1U2ZA 1NVEA 3ABIA 3SKVA 2EFGA 4YRNA 1YCGA 3TRIA 4D8UA 1LX7A 1N1DA 3WG9A 4DV1B 4AS1A 4IM7A 1RRGA 2DPXA 4MW4A 1YZHA 3SDZA 1ZVVA 3R3VA 1RQRA 5EJAA 1I3LA 5DGDA 1V96A 1E1RA 4MUJA 4O4IB 3WRWA 4F2WA 3HLKA 4H1UA 3ZZMA 1UBFA 2E48A 2RKBA 4HHEA 4QXPA 1I6WA 4K6GA 1CUHA 2H2FA 3P20A 4RVFA 1GL6A 3LY7A 1VLVA 2Q7DA 4EKYA 1I1NA 2JBAB 4JLOA 5H82A 3SCZA 4PQYA 4R1PA 4C87A 4TMVA 4I2VA 3L8CA 4TV9F 5FNZA 1E4YA 4NE2A 5IC5A 2FPPB 4B3JA 2PSHA 1B41A 2Z2ZA 4U0JA 3RS0A 4U5QA 3FRHA 4G5QA 4WZAE 1M7HA 4LJ5A 4EKIA 3ETEA 1G4AE 2VH1A 2YZ7A 4DIEA 4YCLA 1SUSA 4AJEA 1GGKA 4O4JB 4UMFA 5GGYA 1UFQA 2FEWB 2RAUA 3TAHA 1WLSA 3WR5A 3IUNA 2O06A 4FNOA 1VGRA 1JLKA 2HQBA 2MYUA 2FLVA 4PU0A 4U2GA 3ZY5A 5HIAA 4C01A 4MUYA 4ZRMA 1GPDG 2GM3A 3AG5A 4JKOA 4NABA 4CI9A 1XWWA 3IBTA 2OMEA 2ZUBA 3HKCA 1UBLS 4OLHA 3PXBA 3QNMA 5DGXA 4BNJA 5EMHA 1Y6FA 1AT1A 2GEBA 1T0IA 3RSZA 2OCDA 4NXNB 1GLNA 1DBIA 3TVDA 3JASB 5DJ5A 4QWMA 5I9TA 4E0BA 3RU3A 4O2BA 2P0EA 3LGAA 1T35A 2ODBA 1UPFA 2OQVA 3LFTA 3AUKA 3ITKA 4ZDIA 3X2EA 1XZCA 3OTGA 3QNWA 5FV7A 3HUUA 4U02A 2PNJA 3SZ3A 2YDYA 2DBRA 3G9ZA 3L0OA 5IN4A 1SIWA 4PG7A 3RROA 2BFBA 2IUSA 1EJBA 1GUZA 2JPDA 2QMOA 3MJDA 1S3FA 5AQEA 4L08A 5ILQA 3T99A 3X1WA 2IYQA 3DMFA 3WOHA 5A2QA 3HYRA 1H0SA 1QTIA 3LC7O 3CPJB 1E1CA 4ZVLA 4RANA 4BLWA 4DTIA 1IONA 3GA5A 1P1FA 3IR7A 4JFRA 2H7CA 3ZCSA 2PFSA 4IDFA 4DJ5X 1G21B 1USGA 1V1RB 1W48A 1XAJA 2OK7A 4EG3A 3QKWA 4HXFB 3K3PA 2OLJA 2GRJA 2R1VB 2A9OA 3DEFA 5LA6A 1JLSA 5EIOA 5B7NA 2IEGA 3GGSA 4YH1A 1T1IA 3AJAA 3ELDA 3L7DA 1J5PA 4MZDA 4UM5A 1T10A 5F2OA 2G9NA 4Y18A 5CW1A 3SLKA 4JYAB 4G3XA 4EATA 3SPXA 4Q9JA 4ZOAA 4ARVA 2VPXA 1BN6A 2GBFA 4RFSA 1OYOA 1J70A 4IJ5A 4WSOA 3DZFA 5B2FA 3H9EO 3ROPA 4EO7A 5E1DA 4KMRA 4BYGA 3X2FA 5K5EA 2I9PA 3EVDA 4GI3A 1P7YA 2GILA 4HVCA 3LYUA 2BT4A 1FPMA 1ODIA 1R6TA 3LT5A 2PFKA 3M5PA 5D84A 1H3FA 3S99A 1ABEA 1PTJC 1YS2X 4A6EA 3TTUA 3VZBA 2AK2A 3GRCA 2EZ8A 2YC2C 1EGAA 3OT1B 4EHKA 5A7FA 2J41A 3ABRB 4BQPA 2PKEA 3OCXA 3STTA 1U7OA 2FOLA 3HCWA 4AMUA 2R6DA 4EHJA 2CK3A 1ZM7A 4AX4A 1P1JA 3NFYA 3T1YB 4YBRA 1DFGA 1T29A 3WKCA 3UB3A 1DKPA 4JWTA 3GWGA 4G8JA 1MC8A 1MVOA 3TRJA 1WVMA 4A0RA 3AJDA 4DLBA 4D1YA 5AHOA 5LQCA 3P5SA 1YDGA 2W2TA 2WM8A 2CXSA 2VSQA 3FB4A 4IDCA 3KKPA 5HM8A 1V26A 4JY7A 3D7KA 4C7OB 4Q4JB 3IV7A 4M8IA 4I66A 3NHAA 5L3RA 3TZCA 4B33A 3D31A 1S8OA 5K05A 4JLWA 3L5OA 1M2NA 3HKDB 1RABA 1NVWQ 5K0CA 3Q2IA 4GKKB 2WKQA 4HDAA 4WZAA 2PMFA 1D2HA 1NG1A 1FSSA 4RAQA 4WK4B 3BXZA 3EC7A 4MKRA 2ZBEA 1AU9A 3H99A 2P9EA 1GY8A 1WKCA 2W2LD 1BQEA 3EFEA 5AO9A 3V55A 4AG3A 1SXJC 2P4QA 1U0FA 1I7QB 3N28A 1NQTA 2QRJA 2PSJA 4PTLA 4C1BA 4GG1A 4QEKA 4MR8A 3H3XA 1ZGHA 1IZ0A 2QN9A 4FE3A 4NAHA 2EBUA 3ZDYB 4NPHA 4MARA 3CVVA 2DHQA 3V2HA 2I1VB 2A9JA 4QUEA 3WK5A 2PZBA 2XB8A 1THGA 2F1IA 4Q4AB 5EJ2A 4O63O 1QIEA 2PSSA 3S2FA 9LDTA 5L53A 4OYYA 5BSKA 3CR7A 1ZD3A 2WT4A 2W70A 1DEXA 4E51A 1OU0A 3G8AA 1KS2A 3TM4A 5B6IA 3LZDA 3T94A 1UPCA 3R6TA 2YKGA 4YRKA 13PKA 4RPGA 5B7PA 3L01A 3D4PA 1ODCA 3MHPA 2AMJA 4RPCA 2OMKA 1XCGB 3CUSA 3B85A 1B8PA 3EMKA 4TKVB 5JMWA 1AUVA 1U28A 2D1RA 2ON6A 1BNCA 1YB2A 1F7UA 3B38A 3SZGA 4WXYB 4FYJA 4YAUA 1RWPA 3KLNA 4N3CA 5KWEA 1P5FA 2ID4A 2J9YB 2PX2A 2HCJB 3E4CA 3TGPA 1XRPA 3A6DA 2Q99A 1ZNZA 3BX1A 3CX6A 5ECWA 4Z0PA 1ZISA 2C4VA 3T1VA 3U7IA 3CYFA 3SSAA 4TVSA 4H7IA 5YASA 4HC4A 1XPUA 3D81A 4EB8A 4FLEA 3DYBA 1FA9A 4DS3A 1V39A 3QQ5A 2EP8A 4FSHA 3S27A 3AU8A 5F98A 1CIVA 3LCVB 1HYHA 3IULA 3K0FA 5C5EA 1O7JA 2WVJA 4RH3A 4BO8A 5KVCA 3RC1A 4EYOA 1IDN1 1WW8A 2A3NA 2G8NA 1P2UA 2O3RA 3MIZA 3NZEA 2PS1A 4B31A 4MWGA 2OYSA 3I09A 1Q3TA 3PPIA 3UJ8A 1BE6A 3TG2A 5CPBA 2FVXA 1US8A 2B69A 2OG1A 3H86A 3HZZA 4LXIA 2ESRA 1SVMA 2P9HA 1ZRHA 4HGOA 4IMIB 4RZSA 5KOJA 4KMMA 1E9VA 2P7HA 4QJ5A 3WFJA 3FKSA 3DR5A 1K5PA 1LF5A 1RCFA 3KUUA 2VJOA 1S1MA 4XGKA 3VKFA 4JGIA 4COOA 5CCXA 5DNUA 3RIEA 4PGMA 1QYCA 4KLAA 4G4SP 2RGRA 3DBLA 1ZOIA 3INYA 4LXTA 1AF4A 4IP0A 3RUPA 3LP5A 1SOAA 1PSZA 4PVCA 3KSAC 3C6MA 2FRDA 4FMCB 4C05A 2Y2VA 2DOKA 4CF7A 2XB9A 3RJMA 5ILOA 1OTHA 3SEQA 5I01A 2OCKA 1IOVA 2DRIA 6LDHA 1E5QA 4H0CA 3ANNA 5HJ7A 3NCTA 2JIRA 4CTJA 1JYFA 2DHCA 2HMAA 2C5EA 4ZA2A 1ST2A 2C57A 1U9IA 3HFRA 2O8DA 2XCIA 3I2KA 2Z0MA 1VGQA 4GVPA 4NMXB 4RWEA 2H4ZA 2CFOA 4GUDA 2E1RA 4V0OA 4XQ9A 2AS0A 4CDNA 1QYXA 2B4RO 4XOIA 4DVJA 2CHVA 1QPZA 4LCEA 5JS1A 5JS6A 4QOJA 3CSUA 2ZRFA 2I6GA 3KKKA 1FP4B 2EL7A 4X84A 4C2BA 1BG6A 1U7UA 2ZWOA 1IYZA 4O8CA 1KZ7B 5C80A 2HSJA 3FTNA 4CYMA 3ZH2A 4FLFA 4JJKA 4MJLA 1UJ5A 2BDTA 4R01A 5G4KB 3K94A 4DIFA 1O96A 2E55A 2ZI9A 1E5TA 2CLEB 2IEAA 2JS7A 2GBPA 3LT4A 2OXTA 2P65A 3KJIA 1YQDA 3DXXA 4Q48A 4QTUB 4F04A 4PZPA 1LVHA 3EAQA 3I1FA 2BFOA 4DR5B 3LY8A 1J0DA 4NFHA 5JVDF 3U1BA 3LBAA 4OFWA 4EI2A 2UXDB 4P0QB 1YU6A 1W85B 2C42A 3OUTA 3QE3A 3UV3A 3UCEA 1Y0BA 4ESHA 3O8CA 2PL9A 1NMEA 4QREA 2QUBA 5I9MA 2BSAA 2XCTB 2D2IA 3PJEA 2FA9A 4A6PA 3EUFA 2XDQB 1WR8A 4DDUA 3WBKA 3OM1A 4FDVA 4YUWA 1Z4IA 5C2JB 4UCFA 5L6LB 3E9CA 1GPNA 2OHHA 4NEGA 5TARA 1H66A 1OT3A 5TE9A 4OXXA 4BNWA 1Y34E 4BPRA 3C6KA 4ERXA 5CA1A 4MEAA 4F45A 3AWDA 3HBAA 3B53X 4MQMA 1CY0A 4UD6A 1LU9A 5KQSA 2O3TA 5JFTA 1Z4OA 4TLAA 3NANA 4MI6A 1KH1A 3D1JA 2RHOA 1CV2A 3PCXA 1X1SA 4Y1GA 3AR2A 5I6DA 3ZZ1A 3PF9A 2RHDA 2H85A 1QXSA 1GL7A 1UINA 5D3MA 3D2CA 1L5NA 2V0GA 1WY5A 2QGZA 3L6CA 4RD0A 2B1JA 5GINE 1HXHA 1LV7A 2RKOA 4P4SB 5JHHB 4HDRA 2IU0A 9ATCA 1KF0A 2HCFA 3IB6A 1G3MA 2HU2A 2OG2A 5TPZA 1L7DA 1LVUA 1IN8A 1HWYA 2HLNA 4EG7A 4M1TA 3UMCA 5F7JA 5BWCA 4EGAA 5L3SA 1DAPA 4CODB 3X1DA 2AQHA 2NXEA 3M89A 3ZDQA 1UH5A 2FPMA 4IXWA 1QTQA 5DHQA 2ZRBA 5C7OO 3VM6A 4B3BA 2IYNA 4TLDA 1LC0A 1M8GA 2I3ZA 1P4SA 3QLVC 5BN3B 3N5KA 4WBXC 2D5IA 3GLGB 2RAFA 4JD5A 1M2OB 1PS8A 3UJDA 3KL2A 1KMHA 3ZQ6A 2B98A 3ZQKA 3IUMA 2QY9A 1IUKA 2CB0A 5HEKA 4ZVUA 2AUTA 3WO0A 5M7EA 3ELYA 1MG5A 2EU8A 5KQMA 1EVLA 1RZVA 1CP3A 2W4IA 4KXLA 3G2NA 4BMSA 2NU6A 3BRCA 1DKNA 1OXMA 4DWJA 3CLKA 1RLJA 1UPBA 5DBIA 1PAUA 3W06A 4C6TB 5JMOA 2FEOA 3TUIC 3THXA 4GMGA 5F5XA 4YAFA 4A2PA 2OGSA 3JR3A 2DUWA 1RJGA 4IY1A 5JMPA 3JWIA 2I29A 2B0CA 1BMFD 2I87A 4A8JC 4C88A 2PS3A 1TZJA 1KQ3A 3AHHA 4HUQA 4L0DA 5BWNA 1P17A 1YE5A 4PPQA 4RH1A 3TRHA 2ASVA 2GN4A 1YASA 5AXBA 4DMRA 1CZHA 4ZOQI 1KYVA 3FOAA 2EKQA 5A4KA 4KRXA 3BAZA 3GN1A 4W99A 4XKJA 1JVBA 3GDFA 3FVTA 1ES9A 2EG5A 3ELBA 3V8PA 3RADC 1CJCA 2GZDA 1Q0ZA 2C0PA 2WVGA 4RJKA 4WVFA 5AOBA 4AWXA 4HI0E 1P4HA 1RWVA 1XKXA 5E2IA 4V1CB 2HV8A 5I3ZA 1NZDA 2GSWA 4LCBA 1JKIA 4RHYA 1D6JA 4GW3A 1FSFA 3IJ5A 1XPOA 1MH9A 1VHWA 1ADGA 3KALA 3ADDA 1FXUA 2I99A 2QUHA 4HB0A 4MW6A 1CVIA 4KU4A 5EMNA 3FDZB 2EYQA 3O8OB 3PXUA 4NNPA 1KZ1A 3IT2A 3IKLA 1GYQA 1T34A 3AI7A 4U6NA 5IKMA 5FNVA 2BGGA 5EVJA 3C43A 4BV2A 5FL7A 4D57A 1P4JA 3C1AA 2LBPA 2J3JA 1JLLA 1UDRA 2OK8A 1W4ZA 1H2HA 3KBBA 3LO8A 4FKMA 3ZX5A 5GMOA 4CM4A 5B3JC 4CKEB 2VUHB 2PY6A 3QX9A 3ZY3A 4ND8A 1DUIA 1X86B 3E70C 2F90A 4K6KA 4R1QA 2WMNB 3DLBA 4JC0A 4R8VA 2WSYB 1DRUA 1KEPA 1QIFA 4B9EA 1Z4PX 1KI9A 1UC8A 5A4DA 5CFRA 1HOXA 2GHRA 2QRKA 1QO0A 3I1IA 4HPXB 4KKXB 3WK7A 3ZTYA 2QV0A 1ADFA 3QPCA 3ZI4A 2A86A 2R48A 1L4YA 3O1IC 2PYZA 4FYXA 4NATA 3L6EA 4B74A 1IBMB 1VMAA 2CEAA 4M4SA 1UPUA 2A94A 4Q05A 5EJGA 3FM9A 4ODIA 3MN1A 5TGTA 3ZGVA 4D4KA 3PTAA 3OQOA 4M1OA 2BRUA 2EDCA 4J43A 1II9A 1Y4UA 2NUTA 2PXCA 1Q0PA 4MB2A 1W6RA 3PL1A 4HKTA 3CWZA 2A4MA 3QHAA 3KU1A 5J2TA 1R0WA 3C70A 1BTOA 1R0KA 3LPLA 4FR2A 4G86A 1TA0A 2COUA 1K2WA 4JFAA 3WQQA 3EXG1 3JQ9A 3W05A 5TB5A 3OZDA 3T5MA 2UVQA 5JBIA 1NDUA 3R7FA 1DKQA 5CDHA 4QOSA 1D1QA 2C00A 2UVPB 1EUZA 4UAGA 4Y9UA 1N7GA 2AL7A 2GGSA 5CB6A 2CMFA 2IZ7A 3AJ8A 4LMPA 2RGBA 5KYWB 2DGDA 5AVYA 1P1KA 4BAGA 4NWIA 2V7EA 1ZNYA 4N6NA 2JA1A 4ZKEA 3WNCA 1H1TA 1C8VB 1U6KA 2VP2A 2XQIA 3FPGA 4ZPXA 4YRIA 1X15A 2L17A 1W46A 3AVOA 1DC3A 3E9DA 3OPNA 3OZXA 1EWKA 2HJRA 1MXHA 1SMKA 1W7AA 4CT5A 1E6MA 4COKA 4P9NA 3E22B 1YC2A 1K3UB 3MTEA 1MMFB 5IH3A 5T6MA 2NVUB 2DY1A 3OWOA 4QGAA 1K0UA 2PV7A 3WIBA 1VJ5A 3VR6H 3U4IA 4ICIA 2J5BA 4L27A 4OHMA 4DJTA 4CT0A 1U65A 2LXNA 2PZ8A 2QJWA 4F11A 3C74A 3BXFA 3BGDA 5LDHA 4PGFA 4RCYA 4I4TF 1AF7A 2Y4NA 4ZI3A 3AUJB 1GP2A 1X7XB 1TW3A 1ISIA 2YHAA 1Q15A 1J8VA 3EG5A 1LDEA 4KXUA 1CZRA 3BXOA 2BISA 3JQDA 1EZ1A 2NQTA 2JD0A 2FMIA 4WY5A 3P0FA 2P6NA 2R8ZA 4K7JA 1UK6A 5ERYA 4AJIA 3NIBA 4A8HA 1DMSA 1WXXA 1ZNXA 3ETGA 4AXXA 4B6RA 4BCCA 5CEEA 1SXJD 1WOYA 1XKTA 3NWEA 3AEQB 3TB4A 1UWKA 3FDXA 4FZRA 4TV8A 4KZKA 1IJKA 3UBMA 2P9JA 1WQ1R 1ACLA 1YRAA 4JQOA 3H1BA 3Q1LA 1MOZA 1W4AA 4L1KA 3ER9A 5F76A 1UP4A 2Q6KA 4MKIA 4PN3A 2CV0A 4POOA 9ABPA 4UCXA 2IBSA 2BKUA 2W6IA 4ETWA 3RKRA 3SC6A 1BH2A 5HA5A 1RR6A 1EFAA 4CHGA 4XA8A 2WU1A 1YMVA 3UWMA 4ZTZB 4ENPA 3N74A 3KELA 4AM8A 2DBQA 3BZUA 3LT2A 3DTVA 4INZA 1OYVA 4Z5XA 3ESCA 3KXLA 4B4VA 4QXMA 4U7HA 3T1OA 1KAGA 3ODGA 3AZOA 1KORA 4S12A 1AX9A 2Q21A 1Z4QA 2FX5A 5AHKA 1PFYA 1R3DA 2Q3CA 2VEDA 2YHSA 5K3SA 3RVLA 3P2OA 1PWXA 5JECA 5JQGF 4B2IA 1E2QA 3RU2A 4BMVA 1YFJA 2AW5A 3A6EA 2ZIWB 221PA 1GKYA 2UYOA 2CZQA 3KKOA 4MKHA 4ALMA 1S4MA 1MDBA 4O4HA 3U4HA 2LUOA 4KLNA 1DJNA 2PT5A 2WWTA 4ZIRA 2QTRA 1AKRA 2D4AA 2HF9A 2OHJA 2LCIA 3TTSA 3VU9B 1ACMA 1PF7E 4L8WB 3M1AA 1XJ0A