3EFHA

Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
314
structure length
307
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efhA02
1QCDA 2WNSA 1O5OA 3G6WA 3H83A 1ECGA 1ECBA 4P80A 4RAOA 4JITA 4M0UA 4RQAA 1HGXA 4JLSA 5E38A 1UFRA 1OPRA 4F8EA 4X44A 4P82A 1VCHA 1TC2A 3MBIA 5K51A 3ACCA 2IGBA 5JSQA 1D6NA 1P18A 2EHJA 4RHXA 3HVUA 1V9SA 4RACA 4P83A 3KB8A 1BD4A 1QB7A 2H06A 1GPH1 5EUCA 3S5JA 3OHPA 4P3KA 2C4KA 1I0LA 3LPNA 1WD5A 3O7MA 1A95A 1I0IA 1DQNA 5ESWA 1U9ZA 1FSGA 1NONA 1DKUA 1QCCA 4P81A 4TWBA 1L1QA 1MZVA 5ESXA 4P86A 1YFZA 1O57A 2HCRA 3NAGA 1VDMA 2H07A 3N2LA 1ZN7A 2E55A 1ECJA 2JI4A 1XZ8A 2JBHA 3DMPA 1I13A 5BSKA 2YZKA 4LZNA 1XZNA 4RADA 4RABA 3DEZA 4RHYA 1HMPA 4ZFNA 4RHTA 1UPUA 1XTUA 1XTTA 4RANA 5HKLA 1J7JA 1GRVA 1CJBA 2P1ZA 3ACDA 1P4AA 4QYIB 4Z1OA 4M0PA 4MB6A 4LZOA 2GEBA 1QK3A 1DQPA 4M0KA 3GGJA 5IAOA 3OZGA 4KN6A 4WMLA 2JKYA 4OHCA 5IPFA 1QK4A 1BD3A 1STOA 2AEEA 4QRIA 5KAMA 1A3CA 3DAHA 4RV4A 5JV5A 3LRTA 4LYGA 5HIAA 1Z7GA 2JKZA 3M3HA 1AO0A 4P84A 2PRYA 4LZAA 1P19A 1ZN8A 1G2PA 1ZN9A 4RQBA 2DY0A 1G9TA 5BQOA 5BRNA 1QK5A 1DKRA 3OZFA 1L1RA 1XTVA 2VFAA 1I5EA 1PZMA 1IBSA 1JLRA 1W30A 4S2UA 1U9YA 1QB8A 1OREA 1G2QA 4LYYA 1NULA 1LH0A 2XBUA 3MJDA 2PRZA 4RHUA 1ECCA 1Y0BA 1A98A 1A97A 4PAWA 3ACBA 1I14A 1OROA 4PFQA 1G9SA 1ECFA 3EFHA 2PS1A 1A4XA 1UPFA 4FYMA 4QYIA 2H08A 1TC1A 1R3UA 4X45A 5KAPA 1VSTA 1BZYA 3QW4B 5BQPA 4RAQA 1A96A 4IJQA 3GGCA 4WN3A 2FXVA 1JLSA 1P17A 1DBRA 3GEPA
chains in the Genus database with same CATH superfamily
3ETHA 3SBDA 2IH2A 4R41A 5EKUA 1O54A 4BNJA 3RYIB 1GRCA 5T4FA 3M82A 3N2NA 2G09A 3I61A 3TH5A 2AR9A 1E7YA 4OUDB 2XB8A 3PTAA 1APBA 3PPWA 2GPNA 3WIVA 3QOXA 1IZ0A 2NADA 1MT0A 2V58A 1VGVA 2QM3A 3DE4X 3NETA 4M0LA 2RG1A 4AJIA 1FOEB 2V9ZA 1SCIA 3H5WA 3NHBA 1N2SA 4KMRA 3HJNA 4I6JA 2RAVA 4BO6A 1HZZC 1PGPA 4EEKA 2R751 5KI6A 5I48A 1KORA 1I4WA 1YS7A 3AUKA 3BOSA 4PSCA 1IHXA 1IK4A 2XDQB 2QZJA 3G79A 3O2QB 3TLGB 3V80A 2IYVA 3PDWA 4B4WA 2B7BA 1OGYA 1T9ZA 4FSHA 2UUOA 3LPNA 4ZZ1A 1WD5A 1C1XA 3U7QA 3HBMA 4V0LA 5IYZA 2F43B 2DQ4A 3GLTA 2I6UA 2Y05A 2Y71A 1RRMA 2VH1A 1N3IA 3DOIA 4DJFC 2YHIA 4MKGA 4R9SA 4OB7A 4CJXA 4PQRA 3BXFA 4OYRA 4QJ5A 1C1DA 4ALNA 1W4LA 1J0BA 4ENUA 2D2EA 1U0JA 3DL4A 3E8XA 3WNQA 3D4LA 3Q8KA 2P90A 2HF2A 3HYNA 3NCTA 4TN5A 4CFZA 1FUEA 1P4SA 4R4JA 4M9ZA 3ZCRA 3UWPA 3QWAA 3R7BA 4EL5A 4WWHA 1PSZA 3VAYA 2Z4TA 1PWEA 4ND6A 3V00A 3MLBA 2ADMA 4AJNA 4ZGBA 3DPSA 2J7PA 2JLXA 3C5WP 4M1MA 1XRSB 4GP6A 4N3NA 3N86A 1DDOA 2HU7A 2HNBA 5DIFA 1UUFA 1ZL2A 3OTGA 2DB3A 2GN8A 4DRYA 4NBRA 4BAZA 3NWJA 3R7LA 5LFAA 1ENZA 4K1XA 2AMLA 1RJEA 1U9IA 3EY4A 4CLOB 3BXEA 4E03A 1Z7WA 1WLYA 2J3JA 3EQ2A 3HKCB 4L50A 5JFGA 3KT8A 3S8YA 2FF7A 2GXQA 4WBXC 4N48A 3FPFA 3SYNA 3BTUA 2FSFA 1F8GA 5A06A 2VZEA 1I1NA 1L1RA 3F1LA 2FSUA 2HWYA 4H7IA 4FNGA 5ABPA 1EKXA 3VC3A 1A8UA 1RXSA 3C3EA 4J16A 2QD5A 4A6DA 4G84A 2YFYA 5CDTA 4BLVA 2I3GA 3IFSA 3HDJA 3I9MA 3T9EA 2BGKA 4LDPA 2OCBA 1AGYA 1X1BA 3ILYA 3Q3CA 2XSZA 2X1MA 3Q11A 1HI9A 1K68A 1NI4B 2OB2A 3ILVA 4WKNA 1E9VA 4Z9FA 4YRCA 2I91A 3JAKB 4II2A 3VSEA 5ELMA 3SICE 4M7WA 4ESEA 5JQGF 4MKXA 4QPJC 2RKBA 4LKRA 5KREA 3EGDB 4MO2A 4ARAA 4DS3A 2GM5A 4GYYA 2PAFA 1OLSA 3ZLTA 4ZMSA 3BFPA 3OFNA 4P35A 1OYVA 3LKZA 4WLVA 1BRMA 5GJCA 4HTAA 2QN7A 2C61A 2ODEA 1WW8A 3PX7A 3IP8A 1OBFO 4PNPA 3JARB 5JSZA 2GN2A 4P82A 2WM8A 4MEBA 1MBZA 2ILTA 1KP3A 4WOKA 2P2YA 1NDHA 4FFBA 5EWMA 3R7WB 1TIBA 4YRQA 3G5UA 3Q8LA 3MTEA 5MHTA 3RRFA 1XB2A 2Y1EA 3WB1A 2V9CA 3H65A 2NVWA 1Z2EA 2FK7A 3PJDA 4TN1A 5K99A 4BX8A 1FNSA 4LNAA 4G9BA 3WYBA 5L95A 3M4NA 1RFLA 3L8DA 4H18A 5IVHA 1W44A 1DIOB 4A0QA 3V34A 4IIYA 5LJLA 4KNYA 3CJQA 4NP6A 3VKFA 4MVCA 3LI2A 4PW0A 2B5VA 2F4VB 2OV3A 5FBVB 2BGTA 5AM4A 4HNAA 3QFSA 1GA4A 4QNMA 5FOWA 2IJGX 2PEZA 3MHTA 1JFRA 2B2NA 2PXHA 1Q7EA 1JAZA 4HS4A 4MQEA 1N8SA 2XYPA 3TGWA 1E5DA 3NANA 2WB2A 3ITEA 3N2LA 3CSDA 3L7BA 5FNZA 2E82A 1Z34A 3ZLBA 4CODB 2D6FA 3BWCA 5KTNA 4XB1A 3RG2A 1GSOA 2CFOA 4NOLA 2QPAA 3WGJA 3DFFA 2V03A 4S35A 2B69A 4GRDA 5CB4F 1QUFA 1ZCBA 3AESA 2CYAA 4XIJA 5CM9C 1RZVA 1SCUA 1FMTA 2IXGA 4ISCA 1E9AA 1P4AA 3A05A 2HTEA 2HV8A 2IXAA 4QYIB 5FR2A 2YXEA 4BBZA 5E9QA 1ZONA 2QR5A 3OX2A 2XMQA 3EVNA 1NOJA 3JVEA 2R0QC 3HJUA 3ZWXA 3MINA 3PNPA 3URMA 5KPJA 2F3RA 2B92A 4OHOA 5KX5F 4FE7A 1G7SA 2PX8A 3OF5A 4TTVA 3ETCA 4BQQA 4B6OA 3ENWA 3X1JA 2XMSA 4DAOA 4ZXPA 3CRNA 3GEMA 1GG2A 3HDQA 3AHIA 3L4EA 4PRLA 2EKPA 3H5NA 3U60B 4G1VA 5J2UF 3H6KA 3GD7A 9GPBA 1XZQA 2ASEA 2WIBA 3EBLA 5KC8A 4TKLA 1V16A 1JPNA 5I3CA 1KI1A 1MQ8B 1VPWA 1BU5A 4F7DA 2B1QA 4JP2A 2QRMA 1M34A 1XA0A 2WD9A 2XNKA 3BA1A 3AY7A 1FFSA 3NQ41 3E2PA 3NC4A 5HIIA 2L2QA 5C52B 1I6KA 1NR5A 2Q5EA 1G291 2NUAB 1KDTA 1HETA 4FDAA 2ONJA 1EVJA 1Q1NA 3AP3A 2X8JA 4CCYA 4YP0A 1BCRB 1OR8A 3I9FA 5K0SA 4H17A 5BXYA 3VPFA 3LPDA 1DZ3A 4Q66C 4A0SA 1BEEA 1K5GA 2Q3BA 2D1TA 3UAYA 2Q0XA 3ABZA 2I65A 3QW4B 1PJ2A 4LF7B 3AETB 1E9FA 2A9RA 1HK7A 2D2XA 2FXVA 3JAWA 1U94A 3IJ5A 4L76A 5GV8A 4L6AA 4QGGA 1OX4A 5A4MS 1ES9A 2V97A 3HCFA 4R3NA 4Q1FA 3GNTA 1O5OA 1UBCA 4DILA 4CF6A 3A6PC 1YRQA 4OGWA 3WIDA 3H04A 4KQMA 4NARA 3PVCA 1FFCA 1UFRA 5FYQA 1TJYA 2O7QA 2FUNB 2I1WA 1BYIA 3N87A 4WCVA 5H4GA 4MUEA 4E2FA 1WXIA 3TZEA 2BM9A 2CKMA 3SZOA 4RNDB 1N9GA 5AW1A 3BMCA 2Q5QA 1WX1A 3K9BA 4C1NA 7GPBA 3ZEIA 2P9HA 1N0VC 3COYA 1WS6A 1E3TA 2N47A 3F7TA 3FLMA 2G0TA 4E14A 4FHZA 4AKGA 5NULA 3THOA 3A2NA 1RM4A 3AEYA 5G3ZA 5BVGA 2BFCB 3ZHYA 1BKSB 2RBGA 4WE3A 1P4GA 4N5HX 5BNFA 1KYTA 2IYYA 3ZE1B 4DCOA 2C0CA 1CDOA 2V6GA 1I32A 3AT1A 3DSRA 3LNCA 5EIHA 4FDTA 3ZXIA 2BKVA 5F98A 4OSPA 4J6FA 5G4KA 3UXYA 3A9RA 4UE2A 2JFXA 1DI0A 1FJ2A 2VQSA 1QGOA 1K6XA 4DA7A 4KVAA 3LS2A 3Q7QA 4A9AA 3HBNA 3ZDYB 4N41A 1TB4A 4PYRA 4BLRA 4FGUA 4B44A 4ZODA 1NBIA 3IERA 3N58A 4EG4A 3O03A 1X1SA 1YV9A 2VL7A 1G8GA 3NH9A 3JWHA 4LNUB 1RBYA 2BDUA 4XR9A 2CV1A 1VIDA 3QTTA 4Y2PA 4L74A 1KVRA 1E2JA 3MTDA 3T5DA 3P2MA 1IBMB 3IPYA 4G0YA 1PGOA 4M1KA 1YMQA 5FL3A 2QYTA 5SV2A 1NZFA 4L4RA 2QK4A 5DMXA 1VJ1A 2HA3A 4W1RA 5IK2A 1BVRA 4FXPA 1GSAA 2GA8A 3NM5A 2WHYA 3UT0A 3TMYA 3ZLUA 1NY6A 1WR8A 1HO3A 1PP4A 3DHWC 1DEOA 4JP3A 4CCAA 3U7HB 3C8DA 3U7JA 1T9DA 3VXKA 4JT2A 1TZ2A 4Q4AA 1N0WA 2VAPA 4UNSA 5AJXA 1A2QA 3OJ0A 1XTKA 3ZW8A 3RT9A 1KEUA 4GMKA 4OK3A 4HAIA 4LWZA 4RV4A 1RJ9B 1QF9A 2JKZA 3NDBB 5IVIA 3VV3A 2N46A 3QZUA 2B2XA 3UJAA 1TKBA 4GL4A 3OQ6A 4AW9A 4EW3A 3P27A 5CK5A 5I5GA 4X5OA 3DEYX 2PBFA 2PL9A 1KPIA 2DLDA 4BFLA 1EZ4A 5EHXA 4YXFA 3T7AA 5L3QB 4YQYA 3L7CA 2VP0A 4AMGA 1IN1A 3I2YX 2AJ8A 4R3UC 2NTNA 4OL9A 4IRMA 4V38A 1DWQA 1LNSA 3GIWA 3DAOA 1G2QA 1MW8X 1PFYA 1JALA 3RKUA 5LD2C 3IAM1 1Y81A 4LHZA 5IFKA 3OY7A 1SKQA 5HF9A 3JPYA 3WGUA 4KX5A 4U8GA 3PGMA 3N53A 1UKCA 1T3TA 4GM4A 1QZUA 2ZJ7A 1CRPA 1NG9A 1DHRA 4H6XA 2BRUC 4JIMA 2BDTA 3RS5A 4F4JA 3OOEA 1LPSA 2AN4A 5K8VA 1DOHA 3G0IA 1BKDR 4MQLA 4EP1A 2V7TA 2ZT5A 4BRSA 4I1OA 5KYTA 1CZLA 2ZWPA 5HGJA 1DO8A 1RS0A 5B53A 5C18A 1FSZA 2HWXA 4AMYA 4LDZA 3V7WA 2A4MA 2EJUA 4KE7A 4LUCA 3M6WA 4CMJA 4UM5A 4KP7A 1JJAA 3W05A 2FWNA 2PLRA 3RW9A 1AHNA 1EUDB 1Q7GA 2V74B 1DJQA 3SIPA 4YMVA 2FRVA 1PHRA 3FCEA 5ENZA 3HU2A 1OILA 5THKA 3C3KA 2BGGA 4BGVA 4IOLA 2DBQA 3JYOA 2CDAA 4JELA 3U44A 5H02A 3V46A 4EW6A 4M46A 2D0PB 4Q5IA 3K0AB 2AMFA 1YL6A 3DOHA 5D5PA 5DRYA 2IF0A 4QDXA 1N7HA 1J24A 5BMVF 3STYA 4XH9B 5E95A 1TO6A 3PEUA 4DBLC 4JLOA 4MXDA 3N7UA 4Q02A 1NLZA 3U7IA 2AW3A 4OY3A 2D5IA 5AOVA 1GCGA 1EFVA 5ADWA 1H6CA 3ZDAA 2YXDA 3FTEA 4CKZA 4PZYA 2QLLA 3MT7A 3JRWA 2VSYA 3CZPA 2QXTA 1J07A 6AT1A 5ESXA 4UDXX 1E0KA 3NGLA 4F4HA 3ZD7A 5BR7A 4NTZA 4AI6A 3IUBA 3E8MA 4E7PA 2WT8A 1UFVA 5K1ZA 1ZNWA 3DZHA 5BT8A 5CVTA 5KNDH 4PLCA 1E3MA 1XPUA 5DBIA 4V0OA 4GSYA 3G82C 1I13A 4DRXA 3EXHA 3OJLA 1KNXA 1GG8A 4OJMX 2YC2C 2GO1A 2ZRPA 4PLYA 4RSRA 1Y82A 4JI7B 2PQ0A 3HM9A 3TR6A 3OT1B 2QPOA 1K7SN 1ND5A 3H2KA 3QEKA 1DKPA 2B3TA 3UFXA 5K03A 1RKQA 1WQ1R 4MLZA 1U2DA 4FOOA 4EHHA 1EH5A 3HSYA 4MUYA 4NH0A 1Y3DE 2ZYHA 3I6BA 3RS0A 1OXXK 1MPTA 4GZ3A 3H4IA 2GKSA 1O95D 4EHLA 1SOMA 1B76A 2VSQA 3L0BA 1U0GA 3O8NA 2FHSA 2PD6A 2ZPAA 4FYWA 4XOIA 3V4PB 4ARIA 1NJ8A 4I8DA 5EIBD 5A3SA 5DM60 2IYQA 2B99A 4JB8A 2BW0A 4JQZA 5BSGA 5BR4A 3SG0A 3QVJA 1ABEA 3GQVA 4O63O 4BPRA 1YRBA 2Q6OA 5DM4A 1UDBA 2ZI5A 3WYEA 3VYSB 1F9AA 2P68A 3KCNA 4MR9A 4F8JA 4CIBA 3II6X 4ZAZA 1QAMA 3SYTA 4MWOA 4O5AA 4AYXA 3G17A 3I05A 3S7TA 5HFAA 4EFNA 2IYUA 1X7ZA 1XDWA 4B8WA 1TD9A 1ODIA 1FU4A 1QFJA 2CSUA 3OKFA 1YNSA 4NX2A 5LQSA 4BLTA 1P73A 3HGTA 4PBRA 4YRDA 1GWNA 4KE8A 4LGVA 4LSWA 1TYDE 2XADA 4IEEA 1H3EA 1XXHE 2FPRA 4GWLA 2A0FA 3MCTA 5EQJB 5DNDA 3PITA 1J8MF 4TUYF 1ZNZA 3A9CA 2FJPA 2KX7A 2WJAA 3Q6IA 3ANNA 4US0R 1EM8A 5IJ0A 2D7CA 1VP3A 2W5UA 3DBHA 1MRZA 4KXWA 1PFQA 4Y0NA 4QBIA 4K03A 1TCAA 4KLRA 4LHYA 1K6JA 4H7JA 1ZSVA 1D07A 3D0KA 3KUKA 1QYIA 3PEFA 4YUXA 5IG2A 1BMQA 2IVFA 2IBTA 4BOYA 3FTFA 4KL8S 2E4AA 4W5OA 1M1UA 2RDMA 5H1YA 4ZHSA 1X0VA 4EFKA 1ABBA 5J2TF 5TMBA 1N8TA 1KBQA 1YBHA 5HZMA 4P4NA 4FMDB 3USCS 4MS1B 2OV4A 4BZPA 1W36B 4HPXB 1CR1A 3UMMA 1UIMA 4AMUA 1ODTC 3JW8A 4ESOA 3MJCA 3AUFA 3RVPA 3FWKA 4XRGA 1XCOA 5B55A 3AG5A 4GXRA 1R8JA 3WQQA 2CUKA 4DA0A 1RYFA 3OAAA 4UMDA 4KPUB 3RS2A 5JMWA 2ZJYA 4WLFA 2IDMA 3T3NA 3HYTA 3MCVA 1CUUA 2DQYA 2K87A 2QUKA 4FBMA 4N40A 5ANRB 3RGGA 3W90A 4GX2A 4RDHA 3HR4A 1V1MB 1Z4PX 4X1OA 5FOXA 1N5LA 3WZLA 4HEHA 4TSRA 3SVZA 4MULA 5H0IA 1CFZA 2OBBA 4GX0A 4RJKA 1A5SB 5FO0A 2PQ6A 2XSZD 1LBEA 3TTWA 2QTVA 4EATA 4RJ2A 3DH0A 4AP5A 4F6LA 5HNKA 3PDJA 2Q21A 3R4CA 3LQKA 3B2QA 4Y6PA 1JECA 1V35A 5EP3A 4MLCA 3BXPA 4IMPA 4O4IB 2O8BB 2SCUA 1POWA 4JBIA 1VPEA 4OHVA 3GPDG 4HLCA 5EPOA 3AUJB 1FDUA 2ZR0A 3NAGA 3AR9A 3LCUA 4LPKA 4PS1A 4UVEA 4BEBA 3WAGA 3CN7A 1MB4A 1ABFA 2RONA 3E18A 5CXXA 4IGFA 3OFND 3MZ0A 4KV9A 4FW9A 3VZDA 2FN7A 3SAJA 1GVHA 2XF2A 5LMZA 1D2MA 3I6ZA 4EO7A 1H4TA 2NQTA 5BSHA 1ZZGA 4MI9A 4TMZA 1Q91A 4FI3C 4HBGA 4BNNA 4JI0B 4JXJA 1D1QA 2XKKA 4Q3EA 2QVCA 4GOJA 4L95C 2YVAA 4KXXA 1PEAA 3WIEA 2P3SA 1YNOA 4HAOA 4Y2XA 4Q3AA 5D3KA 4IV0A 1LWNA 4MVJE 2G82A 3B5JA 4YA6A 3ZHSA 1LPPA 3U7EB 5JWOA 2J0VA 4J16C 4HP8A 4UPVA 3QOYA 1XLTA 3CB4A 4AWBA 2G71A 1OXUA 1NXWA 3CBGA 4QC2A 1J22A 2B4RO 1M9NA 1W6UA 5HFJA 4R71A 2DR0A 4K86A 2IF2A 3QU5A 4UD2A 1SG9A 4ZI3A 3IVRA 4JUAA 5BURA 3BSFA 4NYMQ 3T41A 5IHPA 4BPBA 2QD4A 3E7DA 2WHEA 3BXXA 1H66A 5REQB 1U9CA 3KT6A 3P26A 4IJUA 4PHTA 4BTVA 1W5TA 4MWCA 3GJ8A 2LW7A 3K5PA 4KOEC 4OSEA 1QB8A 5THXA 1OA1A 2ZUCA 4K0KB 1MOSA 3E05A 2OCIA 3QH4A 4GE0A 1EWQA 1NQTA 5FOSA 2XUKA 4KQ2A 3HR7A 4DVGA 3H2SA 1DEXA 4S1WA 4MP8A 1DCFA 2BGNA 2O57A 2QNRA 1RVDA 4YC7A 5H82A 5ALSA 1L7QA 1Q1AA 2RI6A 4OJTA 5KSOA 1DWPA 2E49A 4J8PA 3SZGA 3Q2KA 1AKYA 1PJQA 1X80B 2Y67A 3RRMA 4A10A 4DV7B 3MJEA 4ND7A 1PR5A 2PT5A 3S0JA 4D0SA 3ZVMA 4MEJA 3KNZA 4FXOA 3EIOA 3LUJA 1FNDA 3IIEA 1RZUA 4L0CA 1G4AE 3PPIA 4PX3A 3ULKA 1PL7A 2P35A 3I45A 3GGGA 3HEBA 2C2WA 3T1OA 3WLOA 4IUYA 2WFLB 4I4IA 5ITSA 5ALQA 2DF8A 2XDWA 3ZZTA 4CM4B 5DHTA 2BMWA 3FFAA 2NOAA 4UMVA 2OLEA 1CJTC 1IN4A 1B14A 1HA3A 2CLHB 4IXNA 4B4OA 2P75A 1IQRA 1D0VA 2DX7A 4DQKA 3BIOA 5KSYA 1V9SA 2C4UA 2NZ8A 4K9MA 4UREA 1L1FA 3TUIC 2IPOA 3WDLA 3WFIA 3A32A 3LP6A 1V8ZA 2R8XA 3KPYA 4A26A 2QJOA 2WWGA 4B85A 4M87A 3RUEA 3BE6A 1R0LA 4AX8A 3CLTD 1BE0A 1OA0A 2OECA 1JDNA 3SX0A 4DDMA 5KBYA 1W581 3DP7A 2WYHA 1GPLA 2PA3A 3G1WA 3IIIA 5AXDA 3ADPA 2P7HA 1RC0A 4B4DA 1LV7A 3DLAA 3ORFA 2HCRA 3VNQA 2ZETA 5BNTA 1IJKA 3M7IA 1N7GA 4IJVA 4GMDA 5T6BA 2D06A 3OU6A 4UPEA 2ZRKA 2CVHA 1TCVA 1L7NA 5F3DA 2YRFA 1UAAA 1L4BA 2Y1KA 3PZRA 3F6PA 1FLVA 4KQCA 4UFPA 2JJMA 2R62A 4HBZA 1GZDA 3IKJA 4PSDA 1VHTA 4O1MA 1KYQA 4KSCA 3OZ7A 3Q7PA 1HDGO 2I54A 2O14A 3NHLA 3UOAB 1CE8A 2C5FA 3VC7A 1JSCA 3WL7A 2X7HA 1EJ2A 5BSEA 5C8VA 2GZ1A 4GLOA 4QASA 4S04A 2RHMA 1ATZA 4HQ0A 1UJ5A 2PUAA 1H1TA 4FINA 4B8YA 4PBSA 5IC5A 2P6NA 2WLTA 4BFYA 1QSGA 3IRUA 3E58A 3NZEA 3VR0A 3GRKA 3KB6A 2O2CA 3JVVA 5H3CA 4H7FA 1BJKA 5JH7B 3AHHA 2DHDA 5DULA 2HR1A 1P33A 3BL5A 1NJGA 4I6EA 1UPCA 1OZ0A 1P3DA 2YMPA 2JGLA 1GUDA 4MI6A 1ZN9A 3PDIA 3EVAA 3T5GA 1KJWA 1J25A 4N7RA 1NV9A 1G5PA 3ZCXA 1QQTA 1DFGA 3ABIA 3IUEA 3O74A 4HXGA 4RHFA 3E81A 1QYWA 3CLTC 3RF6A 1L3BA 3EGXA 4RK1A 3UV7A 4PHGA 2CBXA 2B8EA 4YPFA 2W6JA 3BK7A 3QJ5A 1H1LB 4II3A 4DUZB 3OSZA 4HVTA 1J7KA 3P94A 1JI0A 3PNYA 4ZQIA 2YWJA 3W5JA 3WQHA 5IM4A 4CL0A 1RQGA 2AN1A 4P0TA 3C16C 2BEWA 1GCAA 2VHEA 3EH1A 4QL3A 3TLBA 4YMLA 1J5XA 5A3RA 1OASA 1SPXA 4O0LA 4TMWA 3R24A 1GCUA 3ZH9B 4YIHA 5C53B 2HBQA 4C6TB 1UK7A 3ETDA 2PFGA 2GPAA 3STXA 5D51S 2BZ0A 5ALTA 5IK2D 1U8ZA 1XHLA 2PMFA 2QL9A 2IOYA 2VNJA 5AVSA 3CEAA 1ZH6A 3WWEA 2RG7A 2A9JA 3LDAA 4PLFA 3RYCA 1HURA 1ZX1A 3QLTA 2G67A 3BL8A 3DKRA 4ND4A 1HX7A 1GYPA 2Y3IA 5ECYA 3DWFA 3CONA 5G1PA 5FFMA 2AKAB 2OEPA 3Q9NA 2DUJA 5H8WA 1S2OA 3IO5A 2ID7A 1X92A 4KR3A 4LQDA 3BMQA 4L3OA 1C4WA 3A25A 4LXXA 4I14A 4KR9A 3BSYA 1CDDA 1N2CB 3QOWA 4C4XA 4KWIA 4DIOA 3UXMA 1QMPA 3MWFA 3IUYA 1F5SA 3UHAA 1ETUA 1UXOA 5JZOA 1D2EA 3B9RA 1JZQA 1JWAB 3CBQA 1TYZA 4MGZR 2Z6UA 3GP3A 2ZRAA 5KTKA 4Z8YA 4EUNA 1D2AA 3DFZA 1S01A 3ELBA 3JZDA 2C98A 3N5KA 3PGJA 2X13A 4N7JA 3FUXA 4X0EA 5I51A 1X70A 4PY2A 1G3UA 4PLTA 3C85A 5C1BA 4EKGA 1SQ5A 2PZGA 3O7MA 3EVZA 4C88A 4BAUA 2WFZA 4OUKX 4ITUA 3UZUA 3Q5EA 5B2ZA 4MV9A 1QX4A 5CFOA 1GKKA 4TKMA 3BXZA 3UAVA 1TLLA 3KD2A 5ADHA 1LPBB 1ZRMA 2AHRA 2I99A 3ON5A 4L8GA 3QXGA 3BBLA 4K6CA 3KZOA 2RJOA 2RGBA 3GCGA 4Z9AA 3RFVA 4PC2A 3C6MA 4OUDA 1AGPA 3OKCA 1VRCA 2ENWA 5EWJB 4AMBA 3KKZA 3M1IA 3HFJA 4J6EA 4YCJA 2WTUA 3I04A 4BJ5A 4NYIR 3WYNA 2E4VA 3HCAA 5HBGA 3EZFA 1E1CB 2PJRA 3K70D 1G5TA 2GRAA 2DSNA 1W47A 4II7A 5C32A 1F6WA 3DULA 4RIGA 3BIXA 1FZTA 4L16A 5LM3A 3CE9A 1MV5A 2YN4A 2ZUVA 2CEKA 1GZ5A 1NBEA 2H4HA 1NLYA 2JAWA 3PEVA 4UTVA 3VYVA 2AN5A 4U7TB 3U1VA 5KX5B 4EY6A 2X8BA 4DSZA 1QE5A 4AS3A 4TTAA 3PRYA 2VTBB 2F43A 2AW5A 3U61B 2BR3A 4UD6A 2F2TA 1P19A 1Y3AA 3PNMA 3QY9A 4RE6A 4RENA 3JD1A 1G4UR 4WESB 4O4HF 3VDRA 1M74A 4ZYWA 1N5JA 1G7RA 2IYFA 2VP9A 3RQIA 4AN0A 1VYHA 5J2UB 5EI5A 3L8FA 3MFQA 3WLEA 3IMFA 1UDRA 2A5YB 1ZUD1 2XZOA 3DVQX 4XGKA 4IICA 4ZZ2A 1GZSA 4DGSA 4OL0A 1Q5PA 1WO8A 4Q15A 4R8RA 1JG7A 4Q18A 2BFOA 2NGRA 2OBNA 3BUSA 3MPUA 2ZDHA 2D74A 4KH0A 4M0FA 4UHDA 1O4VA 4LZZA 1MA0A 1O58A 1XYGA 3SC6A 4Y30A 3WGHA 4E5YA 5CX4A 1RLOA 1PJRA 1OROA 2QTZA 5CIWA 2PKCA 3LUKA 4RPGA 3N3AC 3SIWA 1BHSA 4JJ8A 2JLZA 5CT4A 2VYND 2VSFA 4HUTA 2CVZA 2LDXA 3ROEA 3NYWA 1SHJA 5D3QA 4D45A 4MDHA 4OBEA 4ECAA 3OURA 3HXQA 2GWRA 1GRRA 1RSZA 3DMRA 2D3TA 3ZU5A 4CQJA 1WZCA 1K6IA 2PZMA 3HVJA 3RTCA 3HEAA 3D2CA 3N0WA 2ZAOA 3WSVA 1UXGA 5JYDA 2FLVA 1X87A 2WVHA 2YH2A 3FBGA 1KY5A 3H2JA 1WMEA 4ZQEA 2XTAA 3HKCA 3N0VA 3R3SA 5A02A 4IVNA 3IIMA 4TSFD 1T9CA 1GU0A 3F46A 1Q19A 4MWTA 2ZSJA 3W34A 3PF8A 1Z08A 2VDVE 3L5OA 3UK1A 2DEUA 2VYFA 3ZI7A 1O2DA 4CV0A 4JD5A 1Z7YA 3RWMB 4H7HA 1OXKB 5LZ7A 1D2CA 8ADHA 2OB1A 2GA9A 3G68A 2WNHA 1VHDA 5E1MA 1VSUA 2C3UA 1LPNA 3BPSA 5DCYA 4A2PA 2ATVA 4UJ3A 1P9LA 4KYIB 2REQB 5BQ3A 5I01A 1MDFA 1DHTA 1WQ4A 2O2ZA 3DZIA 4JBYA 5H3LA 1L8XA 4JVNA 3QX8A 4WZBB 3TW4A 4C7JA 3RU7A 3L7IA 3GDFA 1BWSA 2AOXA 4UXIA 3FYUB 1XVIA 1C4OA 3AVPA 1N36B 4TZ6A 3OE5A 4U5QA 1NI4A 1SKBA 1XCGB 4FDMA 1Y6GA 1OFVA 3ZHXA 3IDQA 3WYDA 1ZHFA 2FPWA 2WF7A 1EDZA 4E07A 4P81A 4P31A 3AYXB 2F1JA 3EXHC 3FUVA 2AC4A 3GOQA 3KJGA 5IAEA 4LRQA 4NAVA 4EYGA 2O8VA 5CJ2A 2CCKA 6ABPA 3E9RA 3OBIA 4D3ZA 1C5KA 2LP4Y 1A1VA 4GMHA 5BVHB 3ZKWA 3PBKA 1WDTA 2BKXA 1Y6QA 2B5OA 2Q3LA 5I45A 1U2DC 3JVDA 5IMSA 2PU5A 1Z15A 5H9WA 3K9HA 3C98A 1E96A 4LZNA 3JARA 4X8OA 3ZG6A 1IWPB 4IMRA 4TYWA 2W0MA 5H68A 4BMSA 1QP7A 4V0QA 4IKEA 3PDUA 4D9IA 4BBAA 4R1NA 1SCAA 5CTAA 3T6KA 3TLYA 4L0QA 2B98A 3KM0A 1WF3A 4G01B 1TDJA 3CTPA 2XVMA 3CRQA 2QRQA 4DQVA 2QTFA 1Q95A 2K5UA 4FU0A 3KD3A 2OYSA 4JSTA 1LQUA 1TZBA 2C97A 2XUFA 4N54A 5BQFA 1UKZA 4LRWA 4D0NA 4NMWA 2C42A 3FF4A 4R8KA 3C8HA 3ROXA 5DX1A 1DX9A 2CB9A 1RABA 4KWTA 1GGJA 2C31A 4ZMRA 5DO9A 1Q0LA 1HYBA 1LPOA 3A58B 4IRXA 1II9A 4UTOA 1ADFA 2H65A 3IQXA 1R0SA 3M6XA 3F2VA 2WF6A 3QITA 3WRXA 3TFQA 3KJXA 4A4DA 4WJLA 2N1MA 3HR8A 4QBFA 2ZSKA 1F8XA 2FUEA 4RF3A 5KYUA 4HF7A 2JCSA 3DD1A 1JLRA 3G0BA 1XJQA 2IODA 4Q6WA 5I8PA 1QGAA 4ZTZB 1L8LA 1CNFA 2WTMA 1BIFA 4G5GA 1RYZA 5GIPE 1XK7A 3KLBA 1MG0A 1FW6A 2ZRBA 1M76A 4XM0A 3FXAA 4G26A 1XT6A 3IAXA 5GM1A 3WTCA 2WINI 4QOEA 3T99A 3VO8A 1VB5A 1QIFA 3PJGA 3PPYA 1J20A 3QKRB 5AK4A 4N01A 4QYIA 1KAQA 3IS3A 1JT2A 1IPFA 2YWFA 3EULA 4KE6A 1N6RA 1U80A 2Y76A 3HB5X 4NFLA 4B73A 1A2OA 5D87A 1M2OB 1L4UA 2AR7A 3CW2A 4IHKA 2PJDA 4C7OB 4BE4A 5KPDA 1RWVA 4RVHA 4TYQA 5BSTA 3RSSA 1CS0A 3W5UA 1E0AA 1P8AA 2WG2A 4OD0A 2R9VA 2WM9B 3U3OA 3KVOA 4ILKA 3F67A 2IUYA 3FG9A 4KQFA 3FGNA 1QKJA 4AS1A 3VZSA 3MLEA 4LX0A 4C03A 3I6IA 3ICCA 3LOQA 1C7IA 2AUTA 4N0PA 5DTRA 4YP9A 3SP1A 3L4JA 4XVUA 1E3WB 4W6ZA 1VMEA 1NXVA 2A5GA 3Q3JB 1GZ6A 1OYWA 2ZI4A 3ZE0B 3RRXA 5C37A 3T5BA 3SI7A 4YH1A 2AE2A 1LVUA 1EGHA 1PWHA 2CMFA 2EJVA 2VAWA 3GNLA 1ZD3A 2C9YA 4E5SA 4BGDA 2QUZA 1UIRA 1XMJA 2NUAA 3L6RA 3DYBA 2ID8A 2CXSA 2OK8A 3OIYA 4LJ5A 4YLGA 4B4KA 4G5OA 1BCRA 1SVUA 1J2YA 4MDYA 4RV9A 1OKKD 3HO6A 3OP1A 2ZQZA 2NVBA 4HGOA 4LA4A 4F11A 4BFTA 2VP3A 1AGXA 3DQZA 1A0OA 4RLQA 1BMTA 3KCQA 2HZBA 3FLAA 3PC4A 3BXHA 3IBFA 4JLDA 4N3BA 4UAUA 3AETA 2BSXA 3H5LA 4Q7EA 1II0A 1WMDA 2IHVA 2ZE8A 4NAUA 4C4AA 1F1BA 1RADA 5KTPA 5INTA 2DPLA 2OM6A 3U1BA 3U7GA 2W6ZA 2NLOA 3EIFA 5AKHA 3RVQA 3TAXA 4L9RA 5D3ZA 2F7SA 4FFPA 4ABTA 3NW9A 3KR2A 3KT0A 1JTEA 4OAQA 4I66A 3AUAA 3T15A 3J7AC 1GGNA 2R7AA 3ASYA 4CDGA 2OHFA 4EG1A 1MQSA 2AQ8A 2JK0A 5FNVA 4P5PA 1DGQA 4MI3A 4ZU3A 3K1YA 4D6XA 2W2NA 1G1AA 2GBGA 2ATIA 2H17A 4B3GA 2Q1WA 3M6FA 4A6PA 1U2SA 1M66A 1WDKA 4E1AA 4MMZB 1LDYA 4YV2A 1CRZA 2JKYA 2P62A 4EENA 1E3LA 4BNKA 2B36A 1YJ5A 3N3BC 3WLIA 4WFJA 2VDQB 4ZXFA 5BSFA 2EC5A 2Q1XA 2YL2A 4G0ZA 3FOWA 3GNSA 2DFKB 4JOCA 3D6HA 3W3AA 3IURA 4GE3A 4DIUA 1MXHA 4HAUA 2HJVA 1JI3A 1QS0B 4LHSA 5BYBA 2DFTA 1UPTA 1PS9A 1XTVA 4X95A 2EJWA 4MQFA 4ZAFA 4LNUA 3L3BA 1QQ5A 4FUTA 2JFNA 3DJYA 3U4QB 4CTJA 1CR6A 3CVJA 4IHJA 4ZVRA 2JNWA 2Q4OA 5EJIA 5TMEA 2ZJZA 1XALA 4C3UA 5FWAA 3OQPA 3TRIA 2CNNA 4HFMA 1NULA 3W04A 2ZVQX 4JUIA 2Z9DA 1YIDA 2H0RA 2QUJA 3FZYA 1RTKA 4LSGA 4W1PA 4E1BA 2NXCA 5K01A 3DWGA 2PS9A 3KTDA 2JIQA 1K5DA 4TUYB 1HG0A 3AIKA 1S5PA 4PGGA 1SUWA 2J4CA 3GDGA 4R1SA 1V0JA 3PLAE 1MOZA 1TC1A 1FFBA 2H9YA 2ZUUA 4AIIA 1B0ZA 4N3CA 4FEYA 3WNDA 4G37A 4LE2A 5DNYB 3RSGA 5TS3A 4L4SA 4MKIA 5JAOA 1T8WA 2V98A 1DCMA 1HV8A 3AUYA 4REMA 2EFDB 1CNMA 1Q0HA 2ZQYA 1UOPA 1X39A 2NXNA 2XRYA 4M1TA 4DBZA 5J2TB 4G24A 4KK4A 2VA8A 5AJWA 1FIUA 2VF5X 1CXZA 3AP1A 1DKQA 3LCMA 1EXWA 4MGEA 1NP3A 1FDRA 1F48A 4Y6GB 5FLKA 3VU1A 4O6VA 2FPIA 1DLIA 2I4TA 4CUJA 3I6MA 4EJFA 2YW2A 2FDRA 3H4TA 4NICA 1QRTA 5K8CA 5LUAA 4MARA 1MN6A 1RWPA 1E61A 3B89A 1Z0DA 2FOIA 3WGTA 2YYAA 2OD2A 3HSSA 5HF5A 2QRVA 2W6JD 4Q4CA 4QTXA 2FZVA 1OXMA 2J85A 1L6RA 3LOPA 3K9GA 3GH1A 2JAUA 1OD6A 3HUUA 3A6ZA 3I9V1 5GONA 2X2EA 4KGVA 4F1JA 4GLFA 3UM9A 2AOUA 2IYEA 2KJQA 4BLWA 4Z49A 4ZRDA 3T3EA 4BNGA 5E4FA 1IXKA 3GAAA 4G4JA 2ODAA 2W48A 3A1CA 4MV8A 3SIRA 3OTOB 1K5HA 4IX1A 3C4QA 1LC0A 3DTVA 3NKVA 3AFMA 2PCJA 1U0FA 1DQRA 5DTMA 1CS4C 5JANA 4OQZA 4Z5XA 3ZCPA 2FSPA 5BSKA 1EUDA 1DINA 2RHRA 4UUMA 5FA5A 1ZGHA 3GLRA 2FW1A 3QSGA 3EHDA 2PMCA 1AXRA 5D1HA 2QX9A 1NQAO 3M6LA 4I4TF 4ER0A 2B9EA 1NVTA 3KZXA 1IULA 4HB4A 4ROSA 2G70A 4FDLA 1F14A 2PUWA 2FSGA 1OVGA 3K0AA 4WH0A 2AXNA 4C08A 2AKEA 1YKFA 5LWQA 1A9XB 2E48A 3DMFA 2O06A 3K0FB 4FIZA 4QOFA 5CW1A 1FW8A 2W2XA 4KQHA 3HA5A 2P9GA 1WMFA 1P7VA 1YS4A 2RGDA 2VJAA 4D4MA 2F90A 5AUOB 4OI4A 3WDSA 1Y4DE 4ENRA 4G0PA 1HNNA 2I8LA 4KIGA 2RHJA 5J4HA 1IN5A 4XUGB 4WI1A 4O02B 1SIUA 4GNRA 4EJ6A 4IY1A 1E1DA 4RQBA 1ZR4A 1FTYA 1G9TA 4NDAA 3NAQA 1D2NA 1C0PA 4RZIA 4ZAGA 3B1YA 4F9FA 3R8FA 1S3IA 2GD1O 4LOHA 4EDHA 2M9MA 3P5BA 1LBHA 2G76A 3RSZA 1RWOA 1BWRA 4W9NA 4YUYA 3RJ5A 5F5NA 1GNQA 5HM6A 4P7GA 1BN6A 2FFJA 4M76B 2PZJA 2XNHA 4NQZA 3NEAA 2V7UA 3KHKA 4LMBA 3ZCQA 5T4BA 1E66A 2MMGA 4LI0A 4AUMA 1J21A 3F5FA 1GFIA 3KWJA 3LA6A 4K0RA 4LDRA 4OV6B 3IE0A 5IC4A 3NHSA 5GZ6A 1N4DA 1KC3A 2AZTA 1VDZA 4H35A 4UVHA 3DM9B 2L18A 1JG4A 2P3OA 2ZEJA 3B1FA 5MF6A 3MTBA 2EQBA 4KREA 3F8SA 1NUHA 1V71A 1BQ4A 1JA9A 4LJ4A 4G5XA 4WLNA 3X2FA 4MLDA 1U1EA 3JR3A 2OL4A 3LE8A 2HRDA 5DBEX 1FVOA 3U9TA 3D6FA 3ONNA 2BUCA 1P5HA 2OD7A 3C4JA 3LT2A 2RHOA 4C89A 3U19A 4URHA 1U8FO 3DAPA 4H1TA 4KUHA 1V5EA 3WQRA 5IRCD 1L7XA 3ZHUA 5AW5A 1EVQA 2R6JA 1FTQA 5DLYA 1I3OA 1E3QA 3ED5A 4AZTA 1SUDA 1YMVA 3MJRA 3QEMB 4RORA 5IANA 1E6LA 1W0CA 2IEGA 3DZCA 2ZIXB 1GNSA 3KWMA 4TLDA 3WNCA 4LF5B 3BMNA 4YV1A 1U0HC 3FCUB 3K1AB 3V4VB 3HYSA 1MPXA 5FX2A 1AKRA 1SCKA 2VCYA 5HK8A 1EQ2A 5DSXA 5THQA 1M0TA 2AYZA 3QV1A 5CLQA 4AN4A 3AUSA 1EAYA 2IU4A 3CZMA 4DDVA 3HVHA 3LY7A 4JL5A 4HD8A 1NNEA 4G0VA 3MCZA 1W4CA 4UEKA 4HB3A 4DNFA 1H22A 4ETIA 5I4CA 4WY5A 1XTQA 1KI7A 2J3LA 1I0LA 1NIPA 2XWSA 4K3VA 3AR2A 2IXDA 4ZJPA 3KJIA 3ELWA 3PVSA 1GO2A 1M6EX 1KFJB 3DQPA 1YJAA 1S2DA 5MDHA 2J09A 2QT9A 3MC1A 3NHMA 4D9FA 3IMEA 4WCDA 2ISQA 1GG9A 1S6YA 3NHUA 3GLHB 3UG7A 1RXEA 1OBOA 4W7HA 1SO8A 3PEEA 2P1RA 1QLWA 2EP8A 2W9XA 2BHLA 3ICEA 3BFJA 4HPJB 4MS1A 3SKVA 4B32A 4PTZA 1UANA 4FONA 3LHKA 2RJNA 2FWAA 5G41A 1BOOA 4L4UA 2GT1A 4NEHB 5DOVA 3WMRA 4MMXB 4MW5A 2Q3DA 4KPGA 3UGJA 5JYCA 1Z5ZA 4J1SA 2G5GX 2C3OA 3X1YA 1WZIA 4KPUA 1P1RA 5F2KA 1A7AA 1SQSA 1L9XA 1EVZA 1G3RA 2OUIA 5JI3E 4CM6A 3AFIA 2Z8XA 2YDYA 3GOHA 3R7FA 4OQXA 4M0PA 1XPRA 3UUFA 3I2FA 3O9MA 1EFUA 2BI4A 2LNDA 1DQPA 1H0RA 2G77B 3QYAA 1QQ6A 2AFRA 4UBNA 1Y7HA 4XX0B 1V1MA 4Z9XA 1Q44A 4GVXA 1Y37A 2BISA 4MQBA 3O94A 4D2IA 2Y68A 2VUUA 1MVNA 4XRRA 4ZOBA 3OIFA 1A5BB 1IOWA 5K09A 4J0HA 4B3SB 4QQ8A 3LPLA 2PUEA 1VLZA 2FUG6 3GELA 4O4IA 2O8BA 3VC2A 3UB4A 1H6AA 3OZFA 2FFBA 3FZNA 1IXSB 1SIBE 3CWCA 1WZUA 4FCTA 2KMLA 2VPYA 3LFTA 5EE0A 1D7OA 3E82A 4HMPA 1UBOS 2PQMA 4N5MA 3OLXA 4RKYA 3NPAA 4OHWA 5AHOA 1THMA 5CVDA 4DM4A 3G89A 2JGKA 1AK9A 3CFYA 3VPGA 1T1JA 2DR3A 5JO9A 5JSFA 3OIVA 1GFZA 4Q39A 3BD8A 1GN9A 1TECE 3FCCA 3RBXA 4JLBA 4AO6A 4DLLA 3ROZA 2R87A 5JNUA 5JD4A 1RJGA 3ADKA 5JS8A 3Q4GA 1WM1A 5J9FA 4MUAA 1VKRA 1NTRA 1UWCA 1QYDA 1E2IA 1VYUA 3GFFA 1RCFA 3O8OB 5B30A 1WZ2A 3EW7A 4I1VA 1N2EA 1YE8A 5LYYA 4GH5A 2ISSD 4D9EA 5A4KA 3B9BA 3R40A 3O1LA 4INAA 4UVGA 1QP8A 2WAXA 3K73O 4M0CA 3I83A 2BPOA 1V1RB 3GFOA 3ENZA 3U9SA 4JEUA 2GTHA 4N0MA 5HUJA 1P1JA 4IW3B 2EGUA 2PNJA 3MWYW 4YT2A 4GPD1 5CVUA 2OCGA 2BZGA 3L06A 2R1VB 5TGTA 3SEAA 2IIBA 3KHUA 4UKDA 3DCYA 5G0SA 1E9RA 4K46A 4RZ3A 3PXXA 2BY4A 2IYTA 5AM1A 2AK2A 3LTNC 1N32B 1XJ0A 1QG4A 3ZWPA 1E9BA 5EXSA 2ZCJA 4NATA 4G9GA 1HY3A 1W1WA 1HM5A 1O9GA 1ZA2A 1KKUA 2E21A 1Q11A 3EJ6A 2GRUA 1HDOA 4FC6A 4G8DA 5CVEA 5J4LA 4BFSA 5COAA 5TY0A 5ARBA 3DT6A 4TLAA 4YGXB 2XMRA 4WV3A 1CDZA 1OZAA 1UINA 3G88A 1KZ1A 3H8WA 3OHPA 4CTKA 2WMDA 1W2WB 3RHZA 3PHGA 1JV2B 4JBWA 4AC9A 1M33A 4LBYA 3BZUA 1YSCA 2W58A 4Q7KA 1GRQA 4QNRA 1WAMA 2YR0A 1ZD5A 4M3NA 3CH4B 1YAJA 2O1WA 4M55A 3CNEA 5BYKA 4KBFA 3WAKA 1AS2A 2W4IA 2XUZA 2CLFB 4L3WA 4P54A 4X8MA 2NT3A 2FX5A 3R5JA 1SBTA 2YJ5A 3KSAC 2DHCA 4MA0A 3BTOA 2R7NA 3VR2A 1U3UA 3QLVA 3FFBA 1TCCA 4IMJB 4CM4A 4Y7DA 3BJZA 2QYHA 3M89A 4LNHA 4F5YA 1I3NA 3MM4A 4HNVA 4F6CA 4HVLA 2XKAA 2QF7A 2WVGA 5T3YA 4IDHA 4YBRA 3DNPA 3DFIA 1LZLA 2BH2A 3RIYA 3HH8A 3TX6A 4ACBA 1I94B 4MW0A 1XR3A 3WRXC 4UTPA 4YCSA 2A8YA 4JC8A 4KODA 4QLOA 2XUHA 1TQDA 3A36A 2TMKA 3NEJA 3V4OA 3AKEA 3LPAA 2OP0A 3REQB 4DMFA 5BY2A 4KAXA 3D3KA 3OO1A 4DADA 5B57C 2OCYC 3IO3A 4P3OA 1QIEA 1C30B 5IKXA 2GARA 4O4HB 1GR0A 3ZXUB 3HA3A 5F9FA 3L8CA 4NRDA 1TMOA 5C4MA 1E0JA 2AWOA 2ZT6A 4PYMA 1NHWA 3BERA 5AIAA 4DE5A 5L4LA 2HGSA 5C35A 1MTZA 2R4QA 4UTRA 4NBUA 3FMOB 2Q49A 1VBMA 3DXYA 1Q21A 3PC6A 3O4GA 1K3TA 5DCUA 1T1GA 4CHGA 1ECCA 3FHCB 3B82A 1R9NA 4GEGA 3X1XA 2FA9A 2ZB8A 2O05A 1KYZA 2QU7A 2XTMA 3UWOA 4FEAA 4MQUA 3F90A 4OJNA 1JHUA 1UBRS 1XHEA 4OG2A 1ZOIA 1YC5A 4WZAE 1SY7A 4DIFA 2GTIA 2IY8A 2ZB2A 4URZR 4E0BA 4ZI7A 1E94E 3HDYA 3PCTA 4F86A 1ZY2A 2WKWA 1VL6A 3PSHA 1RBZA 4C0BA 2X8AA 4DPLA 2QLNA 4EABA 3CUEF 1JDSA 1GITA 3C6BA 2VAMA 4PS0A 5TQVA 3A1FA 4HNRA 1V8FA 5JH7A 1XFAA 4C7BA 3CKLA 5EJGA 4IILA 1IM2A 1JR3A 3A8TA 1EK5A 4QTTB 4WA8A 1SC6A 2CFRA 1P0CA 3C39A 3GLGE 5JZVA 1DARA 3OD1A 4CFSA 3W3AD 4BN0A 3DPIA 3R44A 4BRZA 5DNUA 4K6FA 2FJ0A 3D6VA 5IULC 2HQBA 2XITA 3N9IA 2BHTA 1ZM2A 1H1LA 3HV2A 4M36A 5TF4A 3G0OA 4I5FA 2DCUA 3GRYA 1JSRA 2WK1A 3QE0A 3VZQA 4RK6A 4Y1RB 3LP5A 1JDPA 4G4GA 4XCQA 5E2IA 1KWKA 5L9AA 1YTUA 3HJFA 1IXZA 4LVNA 1TM5E 4RZHA 2YKGA 1KQNA 1I2BA 4O4LB 4ZVPA 4D3DA 3ONDA 2OFXA 2PLWA 3CGWA 1UZUA 3C1TA 5JO0A 1DRJA 4I08A 3L7KA 3DVAB 4IIJF 1V6AA 2HRCA 1ZESA 1JB1A 2PMKA 2YOGA 3I6YA 1TUEA 2ZE6A 5EUQB 2WW8A 4R7TA 2P4HX 2WV9A 3PQ5A 4UOEA 3F5DA 2I3AA 1QHNA 2HQSA 4WVFA 2QOEA 1C0IA 3LQFA 1RRPA 4PIVA 1T9GR 2WIFA 2YIMA 1G3QA 3FMFA 3GCDA 3VDMA 1HDEA 1U99A 1G5HA 3DC2A 4MITA 2GF2A 1UADA 3IQZA 1N2CA 4EFDA 2DFNA 1KJQA 1JVNA 4KQ9A 5KHAA 1QOPB 2ABWA 4GQAA 4RU1A 3RAGA 3TYXA 3V3KA 1GARA 2XNJA 3G2MA 3E7FA 4EL0A 1M2EA 5B64A 2GCGA 2QD3A 2QL5A 1S7CA 4Q9DA 4F60A 4N5IX 5FOUA 4UC0A 1N6IA 1QRDA 3DR3A 1AUXA 2ECKA 3WL6A 2GUGA 4TMTA 2FPLA 2R6DA 4QFBA 4E31A 5KNCA 3E5RA 1YE3A 1RLUA 3X1WA 2QN6A 3C41J 3QKSA 3R3HA 3RLFA 5JISA 3I32A 4J03A 1BGVA 4WZ6A 4QJBA 1CWUA 3EZ2A 1R4MA 3QEJA 4JCOA 4LWPA 3D7KA 2NU8B 2PL1A 4D57A 2GYYA 2NW6A 3LL7A 2ON6A 4QYMA 3PTLA 3WMFA 2IFTA 5FDFA 4AO7A 1I4LD 2BD0A 3G7UA 3LDFA 4N03A 3WLQA 1PJ8A 2P2NA 5LBIA 3CXUA 4XAQA 2C9ZA 3TJMA 1P4HA 1T9KA 4A1OA 1P2UA 2IA5A 3G5MA 4H4CA 4U2CA 5FO1A 3DTVD 1S9DA 5FPPA 4YPOA 2XAUA 4QM7A 3KZCA 2AG6A 2VH2A 2VHUA 1YBVA 3QY0A 1W8DA 4EHNA 1EIWA 5EWJA 2XBUA 4ED9A 1MO6A 4RKQA 1LLUA 2CFIA 4S1PA 1LS1A 3IOMA 1IY8A 3EQ7A 4FP9A 1SCBA 3JASB 4D6PA 3DMYA 2JFYA 3E3LA 3HJAA 2QLTA 1C14A 3QI7A 1E1CA 4KQGA 2FPKA 4LBWA 4R9UC 1BS2A 5C3UA 1PCXA 2Z98A 1NW7A 1YQEA 2IZ5A 1PVVA 3CINA 3WZMA 5ALWA 4ZVQA 5FBKA 1A96A 1KAGA 1KETA 3DWEX 3VPHA 5KX5A 5CYFA 2PGOA 1L4KA 2BFNA 3P2IA 8GPBA 3D6JA 3HNPA 4CZ2A 3HYLA 4G81A 1PR1A 3WGYA 1VOTA 2XMPA 4FZVA 4EY3A 2CDNA 4QXQA 4WESA 3PNLA 4GX5A 2HQ1A 2PXCA 4TL8A 5AM3A 3C5EA 3EDOA 2FLKA 1UXHA 3B12A 4L8FA 4EHKA 4G5QA 2H29A 1VM6A 2PJZA 1ISSA 3KXPA 4HGZA 4IS2A 3BTVA 1T2VA 1I7NA 5DP1A 3LMKA 2CVOA 3AJAA 4V0MA 4P3NA 5ITZB 1E6CA 3B1WA 1GQRA 4XPZA 1P5JA 1GGMA 1NSYA 1WV0A 4XLTA 1L5FA 4MUBA 3WI7A 5JBIA 1VMIA 2HLDA 4R8LA 4EOGA 2VYVA 3IMKA 3M34A 3I2GA 4C06A 1TTHA 4BP3A 4DPKA 4D26A 1GP2A 3CZAA 3ABSB 5HDBB 3GP8A 1BNCA 4YAIA 4JI8B 5DBHX 3WADA 3SYLA 2CKDA 3DNFA 1WUHS 2X5KO 2EX0A 1XVAA 1ZGBA 3ENKA 5SY9A 1GPAA 1MJFA 1TO2E 1O57A 2CMHA 3GU3A 1X8JA 3MOIA 1SUFA 2ZJ6A 3EIWA 3QU7A 4FFMA 1JNYA 4WBSA 3PUYA 1N2OA 5DJ5A 4Y6SA 4R2LA 4UU1A 5EMLA 3UMJA 2YJ6A 4F3TA 1V2GA 4KQ1A 1IBLB 2RC5A 2XE7A 4UQOA 4DAEA 1MTOA 2IVZA 4P2GA 3QMVA 4ZVVA 3OPYB 2P0AA 1RE1A 2ZTUA 4OBWA 1XD2A 1AKTA 1YQXA 2Q41A 1TVEA 5D3MB 5TQ2A 3CF2A 1VIMA 2POQX 1KAHA 1NIJA 3PV0A 4LJ7A 1CQIA 4IF6A 3TQOA 1IOLA 4YJKA 2IV2X 2GCOA 2C5AA 4HQLA 2Y66A 1Q74A 5DP2A 4QTUB 5AR1A 4K9DA 2V0NA 2J9YB 2REQA 3RFCA 3TBKA 3TIGA 4AZVA 4Z1OA 2P5TB 4MV6A 2A3NA 1NMQA 1QLHA 5UKDA 4CEHB 2IOFA 2FOLA 3CZRA 4NV0A 1P61B 4QHYA 2B1IA 2XOXA 3RREA 4EECA 4LECA 2J9XB 3IQDB 3FYUA 1U8UA 1YOVB 2AX4A 3Q5DA 4Z7NB 2W6PA 1SCJA 5DGHA 4QQFA 5KYGA 1GQQA 2LRHA 1QUEA 3BGWA 1NHGA 4GP7A 1TQ8A 3KSZO 4MIKA 3HZOA 3M3HA 1GNLA 5LQKA 3HGMA 4XE5A 3TOSA 4EKNB 2IXFA 1T43A 4X1KB 3J80A 3QX7A 4W9NC 2Z4RA 3NHAA 4A23A 2B4QA 2AL7A 3RFFA 3BKWA 5H7XA 1L2TA 4B46A 2O3JA 3E15A 2FMXA 4Z99A 3F74A 1VQ1A 1W25A 1ZEJA 2FN8A 2OV1A 4R6XA 3R76A 1BXKA 3BWDD 4O2RA 1AQYA 3WNZA 1FFYA 2WTNA 2CVPA 4RVFA 1IBSA 1Z17A 2XJ4A 5TGZA 4BU1A 3T5PA 4LOIA 3JQFA 4ZVUA 3L5KA 5AXCA 2YHAA 3I4CA 2J6BA 3ZLJA 3INTA 1GR1A 3DOEA 3WMXA 5BYAA 2XGJA 8MHTA 4OXNA 1V9LA 2NVUA 2WJ4A 4KQIA 3TVTA 1UBEA 2VP5A 2FWJA 4GZLA 2W4QA 4PRKA 3QRWA 1V7QA 3MEQA 4OGLA 5I7EA 5TXGA 1FQOA 4KG7A 5AM0A 2HK8A 4K26A 1ZIXA 4MJ3A 5SZKB 4FK8A 1HOXA 1NSTA 5AVJA 4CKWA 3VHRA 4Y6RA 4TMVA 3K6RA 1AKEA 4CL8A 4DR2B 2W4MA 3OA2A 2ROQA 3CF4A 4EQZA 2AIRA 1AKNA 3NC1C 3HV0A 3T7DA 2QR2A 3LUHA 2J6CA 1S7GA 3FI0A 1TA0A 3U6KA 1U6JA 1UBKS 4CM3A 2F1KA 2QHXA 2HO4A 3QFHA 4WUTA 4WD3A 1NW5A 5JU6A 3DGEC 3JQAB 1KMNA 3CZ9A 1W96A 3EPJA 1E5VA 3EDQA 4BECA 1BDJA 2F59A 1XELA 3Q10A 4NH4A 1EUCB 5D1NA 1WU8A 3EC2A 3WKDA 4WGGA 4BLPA 2WA2A 4AX4A 2YMMA 3IE1A 1D04A 1DV1A 1FRNA 1C9EA 1G8AA 2JIBA 3DMDA 2KQUA 5D7NA 3TXAA 5JZSA 3PWSA 3CPJB 2XQJA 1UEJA 4EGQA 3KQSA 5C1OA 4FGWA 3H5IA 3VU9A 5JCPA 3GFVA 3I5AA 3PQEA 1U3VA 1ZA1A 4DDUA 4M1SA 3RNOA 1TD1A 2IP2A 3WP1B 2D00A 4M8KA 1V1JA 1WD7A 1DKUA 4XTCS 1M2OA 4CMGA 4YYZA 1HORA 1PT8A 4ITRC 4K05A 5CMLA 5ESDA 3T0GA 4C7OA 3GEBA 1CZRA 2VDOB 4KBYA 5J4VA 4M9SA 2GS9A 5EA2A 1Z6GA 1ZICA 3K7EA 1BDIA 1ZWLA 2Q5JA 1JYSA 2P9YA 3KXDA 3MCWA 4AU1A 1L5VA 1PU2A 1GA1A 4PPGA 3PDHA 1ONSA 5EHNA 3QIAA 3A70A 3RYIA 2FSSA 1XC7A 4Q7MB 3SC3A 3K2IA 1L9KA 5DMHA 2O3SA 2FJUA 1H3NA 1RHKA 2VK1A 1ST3A 4P4SB 5A9RA 1E3WA 1PAUA 4H1UA 4I4TB 3KV1A 1KP2A 4P38A 1NUUA 2C92A 4C04A 3ZDBA 4CETA 2ZB3A 1LV8A 3G8YA 1OWLA 3H2ZA 2J07A 3IB3A 3PWZA 2X0EA 1E64A 4PXSA 4C7MA 3QVSA 1JKJA 4NJMB 1ZIOA 2XTJA 2FZEA 3FSRA 1XZBA 3OMWA 1R0KA 5K0NA 4U6QA 1YK0A 3TBFA 3C7AA 4PZCA 4DL9A 1G0OA 2CMKA 3H84A 4JWTA 1RWXA 4OHMA 1KZHA 4NCIA 1P9RA 2V8BA 3FUWA 4BZXA 4AMVA 3NRBA 4KR6A 2OORA 5KTTA 4RGVA 3ZY5A 3IBYA 1ZCJA 4KDCA 4ESVA 4DV2B 4URWR 1CJMA 1GTL1 3RQSA 1BG6A 1Z0UA 4BNWA 3RJTA 3F6YA 3DTNA 3NHYA 4C07A 5IWCA 3G6KA 5EZSA 3KHSA 4TQ9A 4BKMA 2Q62A 4A16A 4ENPA 1CYEA 1JFTA 4FX5A 1X7GA 4OP2A 2NZWA 1Z3IX 1H5QA 1QVAA 3O83A 3U3ZA 4DDHA 4EA8A 4Z7OB 2YXBA 3IIJA 3ZQUA 2DETA 8OHMA 3WZ2A 2VAVA 4OMFG 4UAJA 4R84A 4D3YA 2UAGA 1LRLA 1FSSA 2Z04A 2ZS7A 4PCLA 4R8SA 5CW2A 4U7GA 2AB0A 4MGHA 3JQGB 5F1YA 4A0FA 3EK2A 3PGKA 1A97A 1HF3A 1XZEA 2BBTA 2QRZA 1K9SA 2WE8A 3KP1A 2B20A 4IOJA 1XN4A 3VR2D 1RXIA 3RLIA 3O1IC 5KVAA 1QP0A 3MWEA 1VSQA 4D74A 2OCAA 1DFIA 1CQJA 2FG5A 1JFFB 5CNIA 4KN5A 4X93A 2G4LA 4D25A 2X58A 3FPLA 3NYRA 3KE8A 5CAEB 3ZW7A 1PL8A 2OHXA 4NYIQ 4EGFA 1PS0A 1VFPA 2FH5B 2FW7A 2OCXA 2Y1XA 3L0ZA 4LI3X 4YLYA 4AJ1A 3GLVA 4R69A 5JHHB 2GWHA 2XDYA 4FOLA 4QGHA 3SX4A 4DUPA 4CKEB 3BB1A 1VKJA 1XZHA 3H19A 3K1ZA 2V0GA 4YRPA 2CC2A 4ZICA 3I2HA 4YV7A 2Q3EA 5IFLA 2YJTD 1QS0A 3M6VA 1IPHA 1WUJS 3G2QA 5EZQA 3RIXA 4EYSA 2O1SA 4IYRA 4HYTA 1Z2PX 4JENA 4B35A 2H59A 2ONKA 3MJHA 1JLLB 2HUPA 2FGKA 2V0CA 3AEKB 4LTMA 3PUVA 5K6RA 2LVBA 3U4QA 3U56A 3Q1KA 5HZKA 1FJXA 2A1UB 3U4AA 5DV9A 16PKA 4X00A 4TM7A 1ZHHA 1W87A 2BLNA 4H77A 3KVRA 2PTGA 3HY3A 3QA3E 3L1JA 3MT8A 1PLKA 3JTEA 5I7UA 4YONB 5K3CA 1VGRA 5EJ9A 4Y6QA 1JFLA 1W49A 2QY9A 4FWTA 4JJ6A 2QY6A 4TUYA 4GLLA 5LXTA 1N78A 1BQ3A 3ZK7A 2YRWA 4WX2B 3WLPA 1SXJB 4MRRA 2JDIA 4JI6B 2I7DA 3K8ZA 5ESWA 5LNK1 1CR2A 4J49A 1QCYA 2J0UB 1E9DA 2OGTA 1DXQA 3UH1A 1X8XA 2QTWB 1B8VA 1T25A 3SXUB 1BX1A 3QLVC 5FULA 4CKCA 1Y1TA 3FW1A 3WWPA 1SBHA 4QD3A 4QE3A 3OZDA 3BH7A 4F6RB 4ZIRB 3TOZA 4DB4A 2VPIA 2V9PA 5KQSA 2G4VA 4ZDIA 4P32A 3MJFA 4WKPA 2CF6A 4L7QA 4XI9A 1F7UA 1ST2A 2F8TA 1O5TA 2NU9B 1JR3D 3WGOA 4CR6A 2XAAA 2NPFA 1E77A 2P9JA 3U48A 3VI3B 2HSJA 1ISJA 2VF2A 4ISBA 5IJ9B 4IM7A 4TWJA 4CQMA 2ZSDA 3NDPA 1K08A 4R7GA 5PNTA 5BXQC 5TQ0B 2UDPA 5EESA 4DIEA 1SMKA 3F97A 4Q21A 4FYXA 1DP4A 1ZRNA 3CX3A 3PP8A 4RJIA 3SZRA 1R8YA 4DR7B 4J76A 5EGNA 5TC4A 2YS6A 3KAPA 4BNLA 3VNSA 2D8MA 3Q3IA 4GYWA 4JU9A 4HNTA 2A57A 3BIJA 2H4JA 4C3ZA 5LU8A 4LWQA 4EARA 1M6YA 2Z2KA 2L0XA 3DEHA 4TTRA 3JZFA 4Y8VA 3QQPA 4BASA 4M7RA 4INPA 1ISFA 2XRMA 4CG1A 1M7GA 3TO5A 2C58A 3M6UA 4L5IA 3ICWA 4EITA 3AUUA 3AVTA 1N2JA 3PWTA 5KNLA 1H9AA 1CK4A 1P1HA 4ZO8A 2E4UA 4R31A 4UFNA 4E5UA 4ACAA 4L72A 1NVVR 5CG1A 2Z2ZA 3QVUA 4LRTB 4XJVA 1CQWA 4YRFA 4CTOA 2IIVA 4WY2A 4YAUA 1ZR2A 4E7OA 2HT1A 2QZZA 1GLVA 3T4UA 3WLFA 5LQAA 1Q2UA 3HGQA 3KLPX 4GR9A 1CQXA 3C1OA 3K31A 4J7UA 2P30A 1E20A 5SZHB 5LZ2A 3CRVA 2ORED 4EKYA 3T0IA 5GM2A 3I5XA 3OT4A 4Q1DA 2A9VA 3G3EA 4P33A 4DJTA 3RAFC 3HVIA 3G5TA 1N1DA 4HGNA 4IJKA 4L9SA 4DM3A 1ECPA 3P9KA 2QLMA 2VHWA 1RLIA 1WXFA 1FTWA 1Y4ZA 1WVIA 3BB3A 5AOCA 1K4MA 1E1YA 5BSRA 4J91A 3NPMA 3HCNA 3K0FA 5JAQA 5AESA 2J3DA 1RQNA 3CW9A 3ZV4A 1LJ8A 2AJCA 5LP6F 1T5LA 3CUTA 3L0YA 2FZWA 1KI6A 2XY4A 4HYEA 3ZUGA 5KNCD 2QXYA 4DV4B 2WIDA 5EP2A 4AG6A 1EDDA 1ECBA 1TCUA 2GFHA 3KALA 3VPBA 3PC2A 1OF1A 1VG8A 3HA7A 4QO8A 4RA9B 4AQDA 4ZKDA 2I9PA 1V39A 1YS9A 2A5FA 3LUPA 2M2IA 4Q9IA 4WXPA 2CGEA 2C2HA 3A6FA 2W2LA 5DGCA 3H0EA 5AI6A 4KXQA 2JFHA 3QGMA 1MAHA 4DSUA 3K8YA 3MELA 2O48X 4GI5A 5KSWB 4L1KA 1GQFA 3IUPA 4XW2A 1R0ZA 1NNI1 4GVPA 2FB9A 1NE2A 2FEWB 1S4MA 3MXOA 4HAVA 4KTVE 4D6YA 4AUNA 5K4AA 4B48A 1BHQ1 2WICA 4Y9DA 4ZCMA 2YY7A 4GAEA 1LDGA 2VBIA 1F2TB 1MJNA 1XOIA 5AP9A 1HFEL 1RXWA 4Q4JB 2C9DA 2P2GA 4AKSA 1Z5OA 1GGHA 2C4TA 1EP1B 2ZCUA 3EFOB 3LLMA 4FMCF 3A37A 3LJKA 4OIFA 4JSRA 5ALUA 4TOIA 5FBZA 3WK5A 4MCHA 4ZYUA 4E2WA 4YCNA 1LX6A 4CI9A 3LPCA 5BW8A 4NLLA 1NUTA 2R6ZA 1IQPA 1V8OA 1VJDA 5J1TB 3V8RA 4BGEA 3IH5A 5JD5A 2OV2A 4GBGA 4F9TA 2AS0A 1Z0FA 2QPLA 3L6DA 1CYDA 2W42A 4A36A 4IP0A 5JLAA 2ADFA 3IEUA 2HHAA 3FTNA 1P72A 1GUFA 1DMSA 3KDAA 1MX3A 4X8LA 3BG5A 4YAOA 4BNYA 4DDWA 4TL6A 1FFXA 2QJWA 1HL3A 1YAHA 3OD5A 2R1UA 2RGNA 4B7XA 4TV8F 1BW9B 1TF2A 2IE0A 5CTJA 3VNAA 1A77A 4R1MA 1IMJA 3QEMA 2A14A 2BMVA 3NMUF 4FYPA 4NZMA 2R25B 1X0XA 3DT9A 1VBFA 2C82A 3ONFA 2H8KA 1VECA 1DIBA 1XKTA 2CBZA 2O3TA 3HG7A 3K1AA 3L8EA 3D9QX 4PICA 2F67A 4X6UA 2JCXA 5ICSA 3T0FA 3ZK9A 2JBWA 3R6DA 4PF1A 1RXCA 4MV5A 2M6KA 1FRQA 2YV3A 2LTAA 3G9XA 3OZGA 3JX9A 4LOLA 2WIJA 2PGJA 4YMWA 3VJMA 4C1BA 5KKNB 5CXSA 4OVKA 1QK4A 3EE6A 4YJ2F 5FB3A 2EKBA 2NACA 1C3JA 1J8DA 2HLDD 2JHCA 3IAEA 4AQ7A 1J6UA 3UENA 2JIZA 2VYVD 2AG1A 2ZSAA 3IAUA 4URUR 2BKUA 5EJAA 5A3QA 1OIXA 1EGQA 1P4JA 1N4AA 3L8GA 5K8UA 3LP8A 2GILA 4QDKA 4XWTA 2K6GA 2I9KA 5JCXA 1RYEA 4D98A 3BF7A 3DOFA 5L8VA 1S8AA 2PX6A 3FB4A 4B6QA 2AZ4A 3O1HB 2QZPA 3MUNA 4NFHA 2ZI6A 2CYBA 3UPTA 4XYBA 4CM5A 3QVWA 1MB0A 1PT9A 2Q3MA 1VPLA 3G9UA 4QT0A 4CLRB 1ZJZA 3FFTA 2ZFUA 2DWCA 4AY4A 1U0EA 2FY8A 4RHUA 5DWQA 2F1OA 5JCOC 1U3CA 1V7CA 4IDQA 5DHPA 5F2OA 4RHEA 1Z25A 2E4XA 5AICA 2GETA 4EB0A 3CS3A 4I7EA 3PEYA 2H1SA 3DBRB 1J0CA 2GESA 2WTAA 4TWRA 1MQAA 4TXLA 3VO2A 1SD5A 4E22A 4TMFA 4UCXA 4XJSA 5BPHA 3IT0A 3GLSA 1P1CA 3DVLA 3KVNA 5AVOA 3VO9A 3VR3D 5HQ3B 2Q5OA 2X9GA 1PSWA 3HMQA 2X0FA 4PZAA 2FF5A 2PE5A 3ZHOA 3FB1A 1M1XB 3BX1A 1EYZA 1GTRA 1U2QA 2ZJ2A 3RWOA 1Q7CA 4JX9A 3SHVA 1L7BA 1SUBA 1XL1A 2JIMA 3A4VA 4DZZA 1JBQA 3GBSA 4PGMA 3KZNA 1YDFA 2I6XA 3K2BA 4JGGA 2QTCA 4IDEA 1F2UB 2IITA 4M54A 4RTSA 1E2KA 2B7LA 4PZUA 5JXHA 1DRUA 3IP9A 1U2EA 2XD4A 4B45A 5K0JA 1SZDA 4KRXA 4YDRA 5CDFE 2WD8A 2WC1A 4E11A 2DUNA 4OQLA 4WK2B 1PK8A 2IKSA 4LF8B 2E5LB 3HADA 3IQHX 3AIOA 5DDIP 4MAAA 4W8GA 2REOA 2L82A 3AHDA 2GH1A 2R3SA 3WMWA 1T8SA 1FU8A 1W6RA 5DI3B 5JBQA 1QOQB 2O2JA 4BVKA 4GMFA 4JR0A 4PO1A 2FSVC 2PSSA 1U8CB 3G8BA 4RYLA 1Q3HA 1BVUA 1VHJA 4IINA 3SJZA 1BKYA 2NO4A 4IIJB 821PA 4YUVA 3RWBA 5A5DA 1U0OC 2BTEA 2RCYA 3Q2OA 4FPXA 5B1DA 1I51A 1TRKA 2EFGA 2F1IA 3KSRA 1V3UA 2DKOA 3AG6A 1F4LA 1NVGA 1KVTA 4KSBA 2Y1GA 1K9VF 3AHEA 3DHVA 3FDXA 3MNFA 3QA9A 3UW3A 2XEDA 1X9GA 1V1RA 5LOVF 3R9XA 2O50A 3GMIA 5JYEA 2DMRA 5K4GA 4AL4A 1PG2A 3KYDB 3W5VA 2R1VA 1USKA 2OOSA 3R3XA 5FI3A 4PO9A 3FYUC 4ZAYA 1UT6A 2JLQA 3VR6A 4IH4A 1Q22A 1AMUA 3EPHA 1Y3IA 4XWAA 1AN9A 4CIYA 1Q1EA 1H2BA 2EERA 1NMZA 4UW9A 1YVDA 4PYQA 1UKVY 1XZMA 4HXEB 1FE8A 3OU2A 1YWGO 3BQMB 1CQZA 2O1XA 4N39A 1Q14A 3HFSA 4QWWA 1XQ1A 3Q2IA 4GMXA 5JS2A 4DMHA 2GN9A 1EFAA 3H1GA 3TQIA 1H9CA 2NU6B 4YCAA 1R6DA 4GOKA 5KVCA 1WBBA 3NOXA 3JQFC 5AI9A 4ITVA 3VYTB 3UWKA 1IYZA 1KU6A 1SM4A 4NNPA 5J47A 2VPTA 5CJPA 4N0QA 3V2GA 2FFRA 3CUVA 4ECEA 4DR6B 3KFLA 3OUUA 1ADBA 2WTEA 5M7EA 4WY8A 3AI1A 4YMGA 2JG3A 2I76A 2DJIA 1U0RA 4D4JA 3IP6A 4PYJA 1CPYA 1OU0A 3EGVA 3U9LA 4C4RA 1Z47A 4EUEA 2GPSA 3CUSA 3DXFA 5TSDA 4EG0A 3TGPA 2PPLA 5HIMA 1AXGA 1WKCA 3DL2A 3P9IA 3D6MA 3FVQA 1V2HE 5FIUA 3FNQA 1QU2A 3MJDA 3T5TA 4RCVA 2OHJA 5L7YA 3AW9A 2IYNA 3OX3A 4G25A 4DC9A 5LZ9A 3GEHA 1GYQA 2RB5A 1CKEA 3VAAA 1AZSC 5EQDA 3AQIA 3HSKA 4G23A 3IRVA 3WNBA 2Y2VA 2NUPB 4DJ5X 5DVZA 3H11B 4A8PA 5J5VA 3U2QA 4BWFB 4RJLA 2C2YA 5B2EA 1C3VA 4BIIA 4DLZA 3GGCA 4JODA 1MNAA 2GEKA 5A9SB 4IXMA 4WIAA 4X8HA 4KFCA 2BJHA 1QCDA 3MOSA 5JAMA 4A15A 3GJSA 3FOZA 5EQTA 1TU0A 1DRWA 4O4HA 3P1JA 3AFOA 3EIHA 4MUJA 1X2BA 4W82A 4XQCA 5E7IA 3CVWA 1QIDA 3OI7A 3DDWA 2C3MA 2YJ3A 3PQCA 1AIPA 2Z95A 3TZKA 4U7FA 1UBHS 1XLVA 4QRHA 3AF3A 1IU9A 3AM5A 1RXVA 1N5IA 2QRNA 4RPIA 4ER3A 1V95A 2A86A 3IMCA 3AM4A 3TRFA 5KWIA 5JDIA 4LYJA 3KTAB 3OZUA 2D8AA 1KI2A 1FQKA 2OUKA 4P83A 1QO9A 4MUMA 3CIFA 3UCFA 3JD3A 1OV6A 3U26A 3R5FA 4IWNA 3UK2A 5CHEA 3AU8A 1NP6A 3D8RA 3MBKA 1QGYA 3HKDB 2FMHA 1KIMA 4I3FA 2BFBB 4EI8A 4HOYA 1Q84A 3LGXA 2GEJA 1H94A 3UA3A 2MSDB 2ZULA 5SZIA 3SXPA 1T0JB 2PYDA 4AZSA 1VLQA 3EQ8A 2WSBA 3USZA 4NR0A 3FM9A 3W7AA 4CV3A 3QUTA 3PD1A 2FQXA 3KQKA 1ZGGA 2DJ5A 3BGSA 3E27A 3O2SB 3UEOA 1KHTA 2QXUA 3BZBA 2NUBA 1RYNA 3SCZA 2M1XA 2H7VA 3OZRA 4CKXA 2IYOA 3UT5B 1BMFA 1UBNA 4K9RA 2UZ3A 3CX6A 3ER6A 4FSDA 3S2YA 1VCIA 1M2KA 1TKAA 2I03A 1H0HA 1JHVA 3C7KA 3D3EA 3ITKA 3NIGB 5HKLA 2FFHA 4WBNA 5SY6A 3UJ7A 1L5WA 4DMKA 3AI7A 4NDNE 4EGJA 3GJ7A 1PJZA 4EPTA 2X9LA 3BD7A 1Z7EA 2CLMB 1UEIA 1O0CA 6YASA 1UP7A 4O4LA 1C3EA 3ORSA 3VR4A 1YZYA 3LCJA 2VHZA 1ZJYA 5HW0A 3DVAA 3ZY4A 1FF9A 2Q5FA 1GAXA 5EP1A 3IILA 1C1YA 5IVDA 3GVXA 3N74A 2JDID 5FOQA 4QJ4A 5LIRA 2CJXA 4YR9A 2YDXA 2UZ0A 3T3MB 4H6VA 4ZGGA 2V1UA 2R97A 5F78A 4R81A 2N42A 2O9JA 2G08A 5HF8A 3SE7A 3GEGA 3SHOA 3ZD9A 3RCBA 2WOJA 5AQEA 2DPMA 5KWJA 3CPHA 2ODPA 3DV9A 4Q1VA 3HPRA 3GT0A 1MJ5A 1N5MA 2GDZA 3IEPA 4FBLA 5DOZA 4DXDA 3UAOA 3FYDA 1EUQA 3HBJA 2WZQA 1EGAA 1JJ7A 1EB8A 1O8CA 1UWKA 4X90A 3FNFA 2ZBFA 3GLIB 3LWBA 2AG0A 3OZTA 4WNYA 4YVFA 5F3RA 2JJ1A 3HLYA 1K66A 2C5HA 4PQEA 4CQMD 5I7HA 1QWSA 3P9QA 4GBJA 4IWXA 4B6EA 4NJOA 2NXJA 3O3CA 4OKIA 1CB7A 2XGMA 1URPA 4OQ4A 2FW6A 3DEJA 2F4NA 1T3GA 1DKLA 2HNAA 1P2SA 3ZHQA 2ZYIA 2UUCB 2PSHA 5L3SB 5F2EA 2TMGA 2ZWIA 2ZDQA 1UXJA 2ZUFA 3QKUA 2V55B 1E4VA 5J5AA 2FWRA 1RBMA 3C4VA 3TPCA 4HDNA 3R9KA 4PZPA 4G1FA 1TJ4A 4E2ZA 5IKMA 4LBVA 3NHFA 2GF9A 4ZKEA 2MIIA 1J1UA 4FHDA 1ZK3A 1H4QA 3T3GA 3AQ4A 4HEQA 2DBRA 2WF9A 1DIRA 3OEHA 4ZGWA 2UXCB 3STVA 2JAHA 4DEYA 1P91A 3D8BA 4JR2A 1LSOA 2QWXA 4K81B 4Z3DA 2OHHA 2WYOA 4YUWA 1MU0A 3T61A 3JASA 3ZWQA 4YP5A 5JZMA 2W2KB 1W59A 4MO9A 2P9TA 4XYGA 5EKTA 1A4IA 1EVLA 5FWYB 1G5QA 1KE1A 3U3KA 3B20A 5BP7A 2AJDA 4MW9A 2CHFA 2UXDB 4EA7A 4G0NA 1XNQB 1Z12A 2C96A 1WHSA 2XMGA 4ND8B 3KQLA 3IV9A 2BR5A 3B6MA 1ZVKA 3CT4A 4RZSA 3DMGA 1VL2A 3C6YA 1N6LA 1GTZA 2ERCA 2IHKA 3GDOA 5LP1A 1VZ3A 1CG6A 2VATA 1Z5UA 4F3KA 3E23A 3R7NA 2HI0A 1DC4A 4D02A 4DZTA 1Z45A 4WA7A 1XZNA 3LZCA 1M0SA 4Q9AA 2Y93A 3G2LA 4JNCA 2OGWA 3P0IA 1U4OA 2C88A 2JLRA 3G8AA 4WJZA 4Z54A 3V1KA 1CJUC 1IG3A 3UJPA 4RK7A 4EKIA 5ITZA 1QRAA 2PZAA 5ALJA 2HMSA 3SSNA 3EA5A 1VRVA 4QJ3A 1XXHA 1VHWA 2QE7A 4OHYA 3JQCA 1GUYA 1J97A 3EZ7A 4OHBA 4K6GA 1T5SA 4ZCQA 5C46F 4BJ3A 3DLHA 4KKXB 1JIQA 1NN1A 2WTBA 3IAAA 2C8VA 3VKUA 3QLEA 1E2HA 3KTFA 4Q3BA 2ZUWA 4PXYA 2D7DA 1M1YB 4GMGA 4INJA 1ZU5A 1CERA 1R9GA 3ISVA 4OHZA 1C7RA 1XA3A 5CA1F 4L8WB 4OU4A 5H59A 2PT7A 3KAKA 2XA9A 3R4VA 4AROA 3M4JA 2QRPA 4GI1A 3OWXA 4EG5A 2WWYA 2DRIA 3GZJA 4QHSA 1UPAA 4RFSB 5BN3B 3P5SA 4PZ9A 1BA2A 3ENNA 2FKAA 1ZRHA 4BQRA 4HH4A 4REOA 2QT1A 1MVLA 1V47A 1DTSA 3R23A 1QAOA 4CWAA 1TA4A 2OHIA 4H59A 2ZI3A 5FOVA 4GKAA 4KRYA 3HXMA 1UXKA 1Z2CA 4JEMA 3INGA 4LF9B 3EH2A 3L1UA 4TXHA 1V5GA 1DTWB 1F0YA 1MIOB 2D2VA 1SK9A 3PGLA 4GZ6A 5IM5A 1CUDA 4BUCA 4Q05A 2BM0A 2EVWX 2CHEA 4CEHA 3FOEC 3MWDB 3GIDA 3LQ2A 5BYJA 4X45A 1KMMA 1BMDA 3B36A 2XUDA 5IZ4A 3A04A 1LUAA 4GR5A 4HL6A 3NOOA 1YOVA 3NRJA 4D9KA 2OPHA 4K9KA 3OMXA 2V7PA 2CZGA 1LC3A 1USIA 2UYYA 2ZCVA 2B83A 2YWEA 3A9TA 2FXIA 1IBKB 2IGTA 3DDCA 5CCXA 1T4DA 1YMUA 3PUKA 3H2HA 2I1LA 2XVYA 3LVFO 4JP5A 5G4LA 4DC0A 3V48A 4TKVB 2JIZD 3RYHB 3LUGA 3ZJUA 1EX1A 2WHXA 2YQ4A 4PONA 5I7RA 1C8VB 1HDIA 3ZQKA 2IYSA 2ZKLA 4LYFA 2J9ZB 3IXLA 1E3IA 1D2HA 1VYVA 1ZMOA 2BI7A 4J0KA 5FA8A 4LXIA 8LDHA 2JBAB 3F3SA 5EPEA 5TX7A 4ZARA 3NHRA 3D3WB 4N65A 3ZCUA 3QX9A 1DC3A 3I0MA 1X77A 3QF7A 2VP4A 4JEHA 4RSMA 5AMXA 3KB8A 1GZHB 4V2UA 3GROA 2H06A 2FZGA 2PVCA 2VJBA 2XKJE 2HHHB 3AKZA 5CDYA 1A4UA 2EYUA 3WRYA 4DR1B 3G59A 3U3MA 4BJHB 5KOIA 1NVKA 2ZBEA 1N2GA 2BEVA 2XXBA 2GERA 3N59A 4MVJA 5JNSA 3O2NA 1VKOA 2RGNC 4N12A 2FMFA 3OQIA 1KQ3A 2ZTSA 5C1PA 2AJBA 2Q2WA 2F3QA 3NWBA 3VI4B 3HCEA 1OXSC 2V1XA 4C0SA 1LCIA 1NU6A 4IJ6A 4MW1A 1OH7A 2SECE 1FJGB 4NZOA 1PKXA 3DZ8A 1IHDA 3MGAA 1VDMA 4OJKA 3EMBA 5EERA 4QEKA 2HU5A 2HDWA 4IHAA 1HPLA 4NU5A 5KMGA 2XMBA 3KKQA 2X5OA 3TAHA 1YRLA 1H2WA 3VPSA 2PT9A 4HAWA 4Q3KA 1Q6YA 1G20E 3C3MA 3D02A 1RFGE 2LV8A 4UHKA 5COQA 1FQWA 1P5RA 1KPGA 1CR0A 1N2XA 2PYZA 4Q3OA 3UKOA 1EUCA 2BTQA 1YQGA 3OJOA 1YBAA 2COUA 5KYWB 1I7SB 5JG7A 4JJ4A 2OGUA 3N6RA 4N5NA 2OKGA 1KOJA 3PI6A 4JXKA 4LZJA 1U9JA 3AZOA 3QJYA 5EP4A 1M5UA 1NDQA 1QK3A 1WXGA