The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
54
|
sequence length |
227
|
structure length |
220
|
Chain Sequence |
GMDVEIVEELSKMLAGRKAVTEEEIRRKAIRCALKIMGARLVGIDAELIEDVTCSLIDLHFSEKVKIGDVLFYHPHVIKPEKEDFEQAYFEYKQSKKFLDAFDIMREVTDRFFEGYEAEGRYMRKYTKDGRNYYAFFSTIDDTFEDVDIHLRMVDEVDGDYVVIVPTENELNPFLKFFKQYSEDAKRAGLKIWVVNPDEKTIDPFIGYPKDFRLLKGFKN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Uncharacterized protein AF_2093
|
| publication title |
Crystal structure of AF2093 from Archaeoglobus fulgidus.
rcsb |
| source organism |
Archaeoglobus fulgidus dsm 4304
|
| molecule tags |
Structural genomics, unknown function
|
| total genus |
54
|
| structure length |
220
|
| sequence length |
227
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2007-04-10 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | af_2093 domain like fold | af_2093 domain like | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | af2093 domain |
