2PH7A

Crystal structure of af2093 from archaeoglobus fulgidus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
227
structure length
220
Chain Sequence
GMDVEIVEELSKMLAGRKAVTEEEIRRKAIRCALKIMGARLVGIDAELIEDVTCSLIDLHFSEKVKIGDVLFYHPHVIKPEKEDFEQAYFEYKQSKKFLDAFDIMREVTDRFFEGYEAEGRYMRKYTKDGRNYYAFFSTIDDTFEDVDIHLRMVDEVDGDYVVIVPTENELNPFLKFFKQYSEDAKRAGLKIWVVNPDEKTIDPFIGYPKDFRLLKGFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein AF_2093
publication title Crystal structure of AF2093 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
total genus 54
structure length 220
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3400.10 Mainly Alpha Orthogonal Bundle af_2093 domain like fold af_2093 domain like 2ph7A01
3.40.50.10670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold af2093 domain 2ph7A02
2PH7A
chains in the Genus database with same CATH superfamily
2VDVE 2MINA 4B3DA 4TKUA 5EE9A 1ZHOA 1SKYE 1SU6A 4G6ZA 2GFQA 1X2EA 2R6DA 3BFJA 3CLHA 4WK0B 1DV1A 4QUDA 1DXQA 1RWOA 2Q3BA 3RWOA 3STVA 2C0CA 3QNMA 3TBFA 1LQUA 2VFAA 3DLCA 3QXGA 3DFUA 1I6MA 1MFPA 1FQOA 4JP5A 4F3RA 5DYGA 3FHJA 4D0LB 1B76A 1AKQA 2ZBQA 5KCZA 1WF3A 2I78A 3P2MA 3QLVC 2RHRA 3LUBA 1RWBA 5LZ4A 2WTXA 1OXUA 4P22A 2A33A 3PUHA 3OC0A 2ZJBA 2G28A 5IBRA 4D2IA 4R1NA 3RHSA 4B84A 4NXMB 3G0CA 2FFRA 2WIJA 3AERA 2WQ7A 1GAXA 2GJSA 3BIWA 4U0KA 4GOXA 4KQGA 5FUXA 4MR7B 5BN4A 3RTAA 2PGOA 1Q14A 3ICPA 4C0BA 1YVRA 4MV6A 4PO3X 3A1SA 4A6EA 4D9KA 5IS2A 3EUEA 2DFNA 1NWCA 3KPVA 4RH0A 3SNKA 1Y37A 5TPWA 1EGMB 5EEHA 1Q11A 2J32A 5HDBB 3RW9A 3ZWBA 4DQUA 5JNWA 3GEGA 4C4YA 5CFNA 5A2GA 5LJLA 2YOFA 3RYHB 4LGVA 1S8FA 1WPQA 2R1UA 3GFVA 3PIRA 2ASEA 1AV7A 1L4BA 3N3BC 3C3MA 3QWBA 4OQZA 1SELA 5ALEA 4AJ1A 4EQZA 5LOVA 3OE5A 1NSFA 5ALHA 4DSTA 3LWZA 3MTJA 1QIKA 3HL4A 5TJHA 1G8AA 2B1RA 3PRKE 3JQGB 3PJDA 3RYIB 5LXTA 3JQBC 3H86A 4GKKB 5IT9A 2EG5A 3HABA 1A27A 4HDKB 5EJMA 1DIBA 2HRDA 2RHWA 1BZYA 4NOJA 3ZW9A 4H1TA 2HL6A 1B0UA 1FRZA 2B7CA 2A88A 4PGFA 2IS6A 4X1YB 2WVAA 3GDFA 3VR4A 1PJ8A 2WV7A 2NPOA 4Q1AA 1LW6E 1K8YB 2MSKA 2D3TA 3FNRA 3O26A 1Z39A 2FZKA 4S3MA 4XQGA 4D1YA 1YZYA 5DRTA 1OFTA 3S2ZA 4QO7A 4ZAZA 3VR6H 3GG2A 2A67A 3PNKA 4MUHA 4NVRA 1QO0D 5EUMA 1MX3A 1NW3A 2YWHA 3UBMA 4UUAA 1JLSA 2VL7A 2XRMA 3MQ4A 4XB2A 3RODA 4EVQA 1ARZA 1POXA 2QV0A 4LOLA 4WNAB 4DJAA 2FX3A 3K9QO 1G3RA 2ALJA 2G88A 2YNMD 1E0SA 3DWFA 2LRHA 3MGGA 2H9AA 3V80A 4DMLA 1W88B 3GEHA 1QVAA 2PT9A 4NCNA 4PYRA 4PLGA 1PJQA 1FFYA 1X80B 4EY4A 2ATXA 4TYMA 2NADA 3VOBA 3ZN2A 4LHZA 3SD7A 4LS3A 5B1HA 1Z6YA 1T29A 3ANLA 3DCIA 4E11A 1OZGA 1AS3A 3QMWA 4HDMA 5J2TA 2RGXA 3CNHA 3BDIA 5IJ9B 3G59A 4YH1A 5JHGB 4FOTA 2Z2IA 3ZJ4A 5TGTA 3P0EA 2VNKA 2EARA 2QZSA 1O9HA 4PWYA 5DM60 1PNRA 1FFSA 3HCWA 4MQEB 3V8QA 1QHXA 2X8LA 3FZNA 3T9FA 4Q3CA 1AH2A 3EEBA 3FYDA 4YEDA 4F5DA 2BW0A 3FFWA 4MIEA 5DTRA 5KO2A 3CTPA 3ZJVA 4DCJA 1ANKA 4TKMA 4JYAB 4JITA 5H0IA 3OFJA 1XMIA 3QE3A 1JI0A 1PSZA 2ZRMA 5HUQA 2WIAA 3H5TA 3P2KA 3GP5A 3D7SA 1HG0A 3QLJA 4M1EA 4NU8X 1YHZA 2I6XA 1EINA 1NLMA 1TZCA 5ANRB 3WRXC 4B2LA 2Y27A 4H6WA 4BNFA 4E5UA 5IVPA 1IPFA 4TXLA 3L3BA 3UPUA 2CB9A 3HUTA 3I52A 2OBFA 2PZKA 3UWSA 3TYXA 2W48A 3BQNB 1BQEA 1W1WA 4CMHA 4BP1A 4L6CA 4JL6A 2DLCX 2ORIA 2FUNB 1KJZA 4K7JA 4Z4GA 5CEEA 5EQDA 4RNDB 3LFUA 3LYLA 2B0JA 4JLWA 2KW5A 2OD7A 4U7JA 5GTDA 4K03A 3KDSE 1LNSA 2Q5QA 2AOUA 4KXQA 4KKVA 4RORA 1OR8A 3ZQ4A 1YVPA 4MV5A 1M7HA 2RGYA 4IIUA 3QQPA 4PX3A 3RPEA 5K6AA 3ZLUA 3OLWA 3LUFA 1OAOC 1G2PA 4P4SA 3EZ9A 1T2CA 2F8MA 3ZWOA 1GDHA 3DQZA 2F6RA 1KO4A 5ALUA 1JPJA 2YFQA 1F2VA 5DW3A 3KU4A 1AXEA 2PM8A 3AV0B 2YBDA 5JNSA 1CT9A 4EKIA 2B3TA 2QGNA 4LXHA 4NZ9A 3O0DA 2X41A 4C88A 5A4MS 1T6NA 1NG1A 2DULA 1Z73A 4I0WB 3UVEA 4QNNA 3VV3A 3AESB 2CFTA 3ILSA 3RYFA 3GH1A 5J4YA 3IQEA 3OH8A 2WINI 4YS6A 3QBJA 3VFDA 5BYBA 1RWNA 3I1IA 4X1IA 3QOFA 3IESA 1ECCA 2PFSA 3BSSA 3BDAA 2XOXA 4MLCA 4RYLA 5DVZA 3KOWA 1ZN8A 5K8UA 5KQLA 1R27A 3WSTA 1QU3A 1GR0A 3CKLA 2M6KA 4ZZIA 1ZHFA 4DN6A 1NQOA 3L6EA 3WGNA 5HSGA 1AUXA 1XNGA 3EZXA 2D2FA 4J8PA 3DVAB 5E7QA 2J0SA 5I8PA 4ZI7B 3V4OA 3K1YA 3PE3A 3DZHA 4G67A 2Q1WA 3B2QA 3A9WA 2J07A 1AE1A 3I30X 4JEMA 2IFTA 5FYDA 4EPTA 5LQUA 1U8TA 4I8XA 2C4WA 1TECE 5JRZA 3DZJA 1CEYA 1BXRB 3B6KA 4PBSA 2DZDA 3MTIA 5F2EA 3EC2A 1P74A 1SFRA 1SWVA 1T43A 4PGGA 4ALJA 1G41A 2I7XA 3E35A 4MAAA 4AKIA 1H6AA 5AUQA 3CRMA 4ZVTA 1T5IA 3UMYA 4YJFB 2JD1A 3NWOA 4J6FA 2EU8A 2F67A 1MV5A 2I66A 2IU6A 2J67A 2JANA 1QGYA 3LBFA 3SZGA 3UA3A 3ZHOA 5BMVF 4D9JA 1N8TA 2RHBA 1Q0TA 4U0JA 2C1XA 3RR2A 5D85A 4C3OB 1KAHA 1U1EA 4OK5A 3U4GA 4PGAA 4J16C 4A82A 1HNZB 1DAKA 4KRGA 3FYCA 4GF5A 1T24A 4R7ZA 3TTXA 3KVNA 3OIYA 1WMEA 4WZAE 1V5WA 2BCEA 2IF2A 1QDUA 1CE8A 1P5RA 1LY1A 1WUIS 2H2WA 2D06A 2WYHA 3EDOA 4MLZA 4RHUA 5EXTA 4CT4B 1AURA 1X9HA 3S5JA 3W8DA 1R37A 1A7AA 3F3MA 3K9CA 3WRYA 4IL5A 4RELA 2XI4A 1ZU4A 4MVJF 5AVZA 3ONNA 3IAHA 5EPEA 3A05A 2VT6A 3VPBA 2VWQA 1FFGA 3DYBA 4MWOA 3FHTA 2D5CA 3A6JA 3AUSA 3ELBA 3ZY2A 1NAHA 1XAJA 5AESA 1F7UA 2O2ZA 4OHFA 2O59A 1YL7A 2WSYB 3EVNA 1Z6XA 2XOKA 4TLAA 4V3CA 3E3MA 3THYB 1GN8A 2PKWA 4WWHA 1IOWA 2VQ3A 3IAEA 4G5QA 2VP5A 1G3QA 1CNFA 2NQ2C 1T3TA 3D6NB 4LJ7A 2CNOA 5LP6F 2B78A 2V9PA 2WTBA 1D09A 1JTEA 4M76B 4CR6A 1P45A 4BNNA 1QGZA 2R62A 2X14A 5BV1A 1DKOA 4G0VA 5HBRA 2BGNA 1APBA 3AK4A 5A5DA 3KD3A 4BFVA 3TIXB 4YMSA 2AMLA 4NJMB 1E2GA 4PPGA 4WBNB 3JD4A 3PJRA 1RXYA 4C9BA 4NP6A 1O94D 1X14A 2QMUA 4G0XA 1NPDA 1UJBA 2DB3A 4N1AA 1GGEA 1RHUA 1UBKS 2G9UA 3AEUB 4MIOA 4RHXA 1AQYA 2EX1A 5K4HA 1NVKA 4RQAA 4YR7A 4GOJA 2BEJA 3OIUA 1LPOA 4GPTA 3QVKA 4M0CA 4QFDA 1JX6A 4XDZA 1L7OA 3I1FA 4OP2A 1UFQA 3M5CA 1R8QA 1Z5ZA 4XQEA 3W7AA 1F2UB 1H4SA 3B1KA 1KBZA 1IM2A 4TS1A 5LQJA 1UZAA 5DLYA 1JEYB 1R6UA 1TM2A 1IK6A 4FI3C 3QYJA 4BMXA 1FNDA 2F9MA 4DT1A 1EUQA 4I5GA 4OREX 1LCIA 4M38A 1XLUA 3DEFA 1C80A 1A9XB 2FCRA 3HA5A 5SV2A 2FR0A 1SU7A 1U9JA 3O74A 4M8NE 1BU5A 4P5EA 4M8IA 5ENVA 5AVOA 1C8KA 1U2TA 4QO8A 5LB4A 4JYCA 4DS3A 4CVNA 4YT2A 2JLUA 1E6WA 1Q7RA 4G23A 5LNK1 3D3NA 2OFPA 3L0BA 3UXYA 1QS0B 1W49A 2EERA 2MSCB 4CRWB 1VPDA 3HNOA 4AAYA 4L4RA 4IEEA 1H2RS 2DSNA 1GUBA 2JK0A 1CJMA 3DBHB 1TL7C 5CT6A 5A9RA 2GTIA 2C3PA 3PFIA 5EA2A 5HBGA 4MMYB 2P2LA 4RVDA 3P9PA 5CIYA 3HWSA 4UHDA 1SHKA 5K8IA 2WOJA 4J0DA 2AV6A 4YJ3F 2DVMA 4H1UA 3V2GA 1EWYA 4KIJA 1H05A 4LOJA 4NCJA 3ZCQA 4RSGA 4DUPA 3EXEB 3M3PA 1K7FB 3ETEA 1MZPA 3H4TA 2BGGA 3BXXA 3JD2A 4MQFA 1O9GA 4ZOLF 3HXMA 2IKQA 4EI8A 2AD1A 1QOQB 3OHSX 4J1QA 4O3FA 2VHJA 2GOYA 2X86A 2A2ZA 3CG4A 3NHFA 3FNHA 3S1AA 2Q1UA 5A6VA 5U4XA 1WPGA 3DVLA 3D4IA 1GYQA 1XZAA 1B1AA 3HM2A 3H6HA 3SFVA 3WICA 5J2UB 4G1BA 2A0UA 2NUTA 4B8ZA 2OSVA 4UUMA 3E81A 5LWHA 1NJFA 1C9EA 2O2YA 3L6BA 3MB5A 2ECPA 3M6WA 3KQSA 3N9IA 3LDHA 2IPNA 3NRCA 1G5RA 4LC1A 3T7DA 4CU2A 5C9ZA 4RY8A 1LD3A 3MSXA 3HLKA 4LJRA 3B38A 3KQOA 2HF8A 2ID4A 2JGKA 4B3JA 1YNSA 1TX4B 3EDYA 4KWHA 1J56A 4W4TA 3T0GA 3V8VA 1L4YA 1E3TA 3OM0A 3SJCA 2QUAA 1Q17A 4BDTA 5NLLA 2OZLA 2R6FA 4M83A 5EIBC 1SCUA 2E9SA 1JIXA 2ZYWX 3JQ7B 4LXGA 3U7RA 3A9VA 4CM3A 5CH5A 2P0EA 1KOJA 2YV4A 3COPA 4QOFA 1T3LA 3TW8B 4ZICA 3JWEA 3FPGA 1IY1A 1GTJ1 3FZYA 3WLLA 5DSTA 2O9JA 1B1CA 3C5VA 3I32A 3M1LA 2V7QA 4GG1A 5CNIA 5LYYA 4KX5A 2AQIA 4GLOA 4H7FA 1MO4A 2J85A 3OY7A 3OTQA 2QI9C 3X2EA 4KPUB 3NGMA 1NL3A 2EWMA 1UMCA 4RKWA 3KYIB 1Y7HA 4I9NA 1EJ6A 5DRYA 5AW7A 4MARA 3K73O 1N3LA 3NVAA 3BMQB 2JIDA 4F3KA 1ZD5A 1S5PA 5JG7A 3DD1A 4OLFA 4MVWA 4IDDA 2VAWA 1CZUA 4GL2A 1R0KA 3BUSA 4OA8A 4PPNA 4MV9A 2IUEA 2GX6A 2RI6A 1NXSA 1MVNA 5AXAA 5HGXA 1U0NA 3TFWA 1TUBA 1MO3A 3IPXA 5HOQA 1UKCA 4RZ2A 3ZYZA 4FFLA 1PQYA 5LIRA 4D79A 2Z5VA 3AT1A 1PUIA 1BGVA 3G7UA 2OAQ1 3QVTA 1M2HA 3KYDA 1T36A 1D6NA 1SPBS 2GGSA 2IS2A 2D0PB 4A6DA 1Z47A 3M2PA 1LUAA 3IIKA 1ADYA 4Q1EA 5FIUA 2ZQ5A 5I7AA 2N47A 4CN8A 3Q9LA 5AVUA 1MJGM 3H2KA 3O2JA 4XAQA 4XQCA 3B48A 4RU1A 5DJ5A 5G2OA 2H65A 3OA0A 4LHWA 2WWTA 4FILA 3WL5A 1GAEO 2R1TB 2X9VA 3LX4A 1HLPA 2ECQA 3GOQA 3ORQA 4IIYA 5G1PA 4RMIA 3QKIA 1ZR4A 2BFMA 1SXJD 1M34E 4F4FA 3DCNA 1NATA 4GBED 4MRMA 2AKAB 2JCGA 3ZE2B 5K6RA 1C4KA 4IO0A 2CWDA 3F8TA 5DI3A 2PXHA 2C61A 2XYVA 3L04A 1TT5B 3LUKA 1WSDA 4DCTA 4Q3BA 1M2KA 2XNDA 1C5KA 4KNWA 5JDCA 3LVRE 5C51B 3WGKA 2R66A 4J03A 1G18A 1DELA 2ZSUA 4NYJQ 3TX2A 2NN3C 4D25A 2HMTA 3ZXUB 4B5LA 1PGNA 3IE0A 4XPIB 3ZGZA 1IZ0A 2QP4A 2R6CA 2UZIR 1U2RA 1U2GA 1UPXA 1DO0A 3BHNA 2XTZA 5CCDA 2HH9A 3EZ2A 2EYUA 1SHJA 5ESDA 2NU8A 2XWPA 4TROA 2G4CA 1Y1PA 1E4YA 3ZLBA 4DMFA 4AZTA 3Q72A 4MAFA 2V7TA 4PTLA 1IOZA 1A5TA 1FC0A 4PCAA 5HOEA 1XJWA 5MDHA 4G2TA 1IEVA 3ZDFA 2CF5A 4S1NA 3RSFA 2JJ1A 2GTPA 2YYZA 1CUBA 1QHFA 3VRHA 1QWOA 4BY9E 3JSXA 4BMDA 4B33A 2R1VA 4EMUA 3S7TA 4ZV9A 2SCUA 5CVTA 2QQEA 4KO4S 4ACBA 4KJZA 2BFOA 1XV5A 1E5DA 2O2IA 4IX1A 5JY1A 3GRCA 3OHMA 1VPTA 2B36A 1Y4AE 1SQ0A 2FRDA 2EP5A 3UH1A 2G4VA 2BF4A 3IUPA 2AJLI 4M8LA 4NNPA 4B3BA 2WWFA 1I2MA 1WE2A 5I7HA 3VI3B 1D2CA 3JYNA 3JASA 2N75A 4EMSA 1EX6A 3O31A 1QGUB 3A04A 4MVXA 4LXQA 2BRUC 2H07A 4DCMA 4HDNA 5AKGA 1JEEA 2P4HX 3HJTA 3KV3O 3EGXA 3LYHA 4UASA 4BEWA 1DXHA 4QHYA 1EP1B 2AN1A 1AHNA 1ZISA 3NKFA 2P8SA 4EGFA 2KI5A 4BIMA 1QH9A 3OFKA 2GZSA 1QFXA 4EPVA 3EVTA 3LRPA 2CL7X 4M1YA 4P7FA 1KHHA 3DBLA 4R7GA 3SWWA 2K87A 3GAMA 1XR3A 1ISFA 1V11A 3F7MA 1N2JA 3C43A 4QLOA 3URKA 1G3IA 2AK3A 3GLIE 4GPIB 1S89A 1GEGA 4IXWA 5HNKA 4RAQA 4BVAA 1JKFA 1Q0PA 3P94A 4B3SB 4WZBE 1KO5A 1T3SA 2Y0BA 7MDHA 1XZJA 5BO5A 3I9FA 2DG2A 2ID9A 1ZR2A 4RFSA 2Q6KA 3FBWA 3D43A 3NHRA 3QLUA 1VBKA 5GIPE 5ELXA 3LDUA 3DHVA 3KRTA 4B76A 2QW0X 3VSEA 4XJTA 1T4CA 2GEDA 4IHQA 2X5NA 2IHTA 2FG6C 2YWGA 1IG0A 1AY0A 1R0SA 2X23A 3EXHB 3PC4A 2YWJA 5FFNA 1AZLA 2WJHA 3PIIA 1RIFA 3VAZA 2EIHA 3FPEA 4RGQA 1KYQA 4DBZA 2FKAA 5AQ1A 1F6WA 5A9TA 4NAHA 4UUBA 1RAFA 1JR3E 1ZM2A 2I3GA 3OOJA 1PCXA 2Y71A 2C5EA 3CLUC 3MGKA 3B6JA 3VSCA 1PG0A 5KSZA 2JEZA 4BVBA 3S28A 3DXFA 5E2BA 1CV2A 1N0WA 1P4GA 2VK1A 1Y8QA 5H4GA 2X0IA 1HK7A 3H65A 4XOIA 4EI2A 4Q12A 1DIHA 1Q3HA 2RFLA 2P5SA 3OJOA 3NHBA 1CVIA 3MZ0A 2GI4A 1Q74A 4LYGA 5LOVF 5CT4A 2WSLA 1NRWA 2RBEA 4FMPA 1UBUS 3T9DA 4M22A 3ZVLA 4B3IA 3R75A 4Y3UA 1X7WA 5KMGA 2HXSA 2WP0A 1U2DA 3JD0A 2ZIZA 3EZLA 1BMTA 1Y8AA 5LXTF 2CBXA 5JAOA 2ADOA 2X6RA 5ICSA 5KYKA 1G60A 2BY4A 2YIVX 2C2GA 4Y2YA 2H7VA 4CCAA 3K0SA 2EFHB 4IY1A 3G0HA 4HXFB 4DOMA 2UUOA 2BISA 4B75A 5AR1A 3BWVA 1R2QA 2XE7A 3DLPX 4OHMA 4TL8A 5JQGB 3SC2B 3H5WA 4RHYA 1KNXA 1J1ZA 4GNRA 1LU9A 4BMOB 5B58C 1P1JA 2B7BA 4HGNA 3L7KA 5DX1A 5B4TA 1H1TA 9GPBA 4MPRA 1BVYF 2PEZA 5B7GA 4ECAA 3NTRA 1D7OA 1P1RA 2XRFA 3BB3A 1SCBA 2IJGX 1J70A 3TRIA 5KYXA 4G0ZA 5A0VA 4GZ6A 4YMTA 2ZB7A 3THWB 1CY0A 1HDEA 1QORA 2AX3A 1QYXA 2FH5B 3FDXA 4B6EA 4BNDB 5K3EA 4GWKA 3VGJA 3H1GA 1A8HA 2PZEA 3G1UA 2FB9A 2HPVA 1NI3A 1ZEJA 4Q66C 4YAUA 2PA0A 3LO5A 3TE6A 4OQDA 4QC2A 5I7OA 5T7BA 3F6BX 5JSKA 2LKDA 1NVUQ 1USWA 5J2TF 5D1HA 4L8LA 3FB1A 1GYRA 1QVVA 3TG2A 1PWXA 1MCZA 2ZRJA 2GQ0A 5ITWA 4V0KA 4FE7A 2QAJA 2BV3A 2FV8A 2WKRA 1VB5A 3ED5A 4XGRA 3O3MB 3OESA 4B87A 1GUDA 3TPCA 1K3TA 5L51A 1EESA 1U9ZA 2X77A 1R9JA 3HCCA 4X24A 2QM7A 2XQIA 4I5EA 1DKMA 3FSGA 5CITA 1DFHA 2A5DA 3REGA 4MQ4A 3ESXA 2DH5A 3I9V1 1C1HA 4N01A 5IBPA 1CX9B 1TIBA 3DAGA 621PA 3P4XA 2BSXA 4NABA 1EP3B 5B57C 1P80A 3KZCA 2ZTSA 1UDXA 3GCXA 3DFZA 1IN8A 2RONA 4W7SA 5H80A 1U28A 1ZK0A 4OQLA 3DTTA 3EEYA 1LZKA 3ADBA 3QV2A 1NV8A 2G5PA 1BQ3A 4OMUA 3DHWC 3F6PA 3ZCUA 2HJWA 3LCJA 4PE5B 5ED0A 3VZQA 3IVCA 4EHFA 3FTDA 1YQGA 3ORYA 1OI7A 3THXA 5AHXA 3K1JA 4OB6A 1V0JA 3P27A 3ZR4B 3VZDA 1V8FA 3N2IA 4BCBA 3HY4A 5TSDA 5KZMB 3BKWA 4PCUA 2Q5EA 1A77A 2WWVD 4N7RA 4X6XA 5ALFA 4D56A 4JI0B 2OZPA 4QVGA 4YRAA 1SVMA 2NW6A 4XFDA 1M7GA 3VYVA 1QQTA 4LZJA 4CLOA 4KPYA 5F5XA 3VR3A 2D1TA 1TI7A 5L4LA 4EVSA 1P8AA 3QMVA 4LK2A 1P33A 4F6CA 1FVHA 1THGA 2XODA 3PTZA 4D97A 5DN6D 1P3JA 4AJPA 4Z4IA 5IHPA 4RPJA 2GA9A 4TKLA 2UU9B 5EXSA 4XXHA 3CPHA 3DNMA 4JUIA 4YFYA 3BILA 2ECFA 4DDTA 3S7ZA 2ZPAA 1YBVA 2WD9A 4ZODA 1ZGGA 1JDTA 1W6RA 4NNJA 4UJ5A 1DIAA 1E1QD 1Y3BE 4WLFA 4DIDA 2QP9X 4JFAA 5D3MB 2B4AA 1RM3A 3O8DA 2VWHA 2PWZA 4UBIA 1RHRA 4M0DA 4AJ9A 1IN5A 2B4KA 2CXXA 3BD8A 3Q6MA 3RIMA 3WXMA 4M9UA 1DRVA 1MORA 4L5JA 2R7MA 2PZBA 5FAXA 3PWKA 4ZCPA 3HO1A 5ITVA 2CUNA 3WSVA 2BFEB 1OT3A 2LE0A 4TWAA 1TLLA 3NDPA 1K4YA 2J33A 1Z8FA 3WIOA 4EBBA 3IOEA 3T7CA 4QDXA 3TQOA 3I23A 3BCUA 4BZPA 3UMJA 4BNYA 4DPMA 3ROQA 2O07A 3KKOA 1XX6A 2Q1YA 2X8JA 4HNGA 4IZOA 4UXJA 4ZCRA 3NG1A 1VGVA 5FPHA 2VJMA 2Z3ZA 3U4DA 2GF0A 5JS7A 5IKXA 3W5UA 2IV7A 1P73A 4B6JA 5KJFA 1HT1E 4NV0A 1HMYA 4D6YA 3IE2A 1JSZA 3O1LA 3PXXA 2BTQA 1WA5A 4QQRA 3UMGA 1TEVA 4BNGA 3R6GA 1GPDG 3OI7A 4DLYA 4J94A 2PYZA 2R00C 1Q1ZA 1XZQA 2O8DB 4O2BA 2C2XA 3FETA 3NT5A 4L8YA 2LIPA 2GO1A 3EGOA 2P5YA 1K68A 2A92A 2XDAA 2WG1A 4R1OA 4EUFA 4OD0A 3SEAA 3VYWA 1GPH1 1Z0IA 2E2WA 2PWYA 3IEUA 3N0VA 3HWRA 2WF9A 3LUDA 4XIJA 4QM6A 1WZEA 3P9QA 5JFTA 2Q9CA 2FJ0A 1EX1A 1QIHA 3O8QA 3SN6A 4AMBA 1ZIOA 5TMPA 4RK7A 4F8EA 7YASA 2PKXA 2ZRAA 1NKTA 2ZU6A 4MW2A 4A16A 4B48A 1HYGA 3VNUA 3AB8A 5KWIA 1HYEA 2Q8QA 4KP7A 4DCUA 4YJGB 3FMFA 1XWIA 3U09A 3TOZA 1UAGA 1ZLXA 2CHGA 1VKJA 4MJLA 4PC1A 3ACDA 4WOKA 4Y6GB 421PA 3AU8A 3E9ZA 3CB4A 1HTTA 1JLMA 4HN4B 1KI3A 2CDRA 3DE7X 2GBGA 4TYWA 4WZAA 5G0SA 4BKPA 4XH9B 1MABB 1K92A 3IT1A 1C8LA 3RGWS 3TVTA 1QAQA 2EX4A 2FGKA 2CNWD 1G21B 3AVQA 3EQ7A 3I28A 2WYWA 4ZU6X 1IQRA 3D7NA 2UVDA 4BKOA 3M34A 4BKMA 2DLNA 5GMOA 4JJ6A 2Z5FA 3AWDA 4OHOA 5B64A 2YHUA 4M9ZA 1E89A 1JQJC 3VZCA 1TLTA 3WGZA 5AW0A 4NE2A 5D86A 1W85B 3L1UA 1EFUA 2A1IA 4FXPA 3H3XA 4YWHA 1HEYA 3VKUA 3IV9A 5I45A 2RJNA 1RLMA 1V5IA 2BEUB 4FW9A 4FB5A 1B4DA 1NN5A 4KC0A 1ESMA 1JHVA 3VHQA 2C7OA 1UOQA 3F6CA 3PD7A 3LT1A 4HB3A 4TWZA 1JIQA 2BM1A 2GFHA 3NVDA 3GFSA 3T35A 1G7TA 1X0XA 1ZIPA 5L3RA 4QBKA 4Q18A 1QB8A 4HADA 3QELA 2WZDA 1R18A 3T0IA 4YCCA 4QXQA 1ZC4A 4ZCSA 2YRWA 5FKJA 3UV7A 4YRFA 5KWEA 2MR6A 2HCTA 4HNVA 5F76A 1D07A 1IHUA 1K5GA 4KO1S 3RAJA 1Z2EA 4M0UA 2XZTA 2NUPA 5B3KA 1SUIA 4F4UA 5E4YA 2CNBA 4RYDA 3MK31 4I8DA 2BE9A 2QMQA 1P5FA 1GN9A 4YLGA 1YJCA 4AL4A 1OXBB 2RGWA 2JGFA 3WGJA 4YUYA 1N7JA 4KZKA 2C7BA 5IU6A 5KSYA 5B30A 5E7MA 1ZS9A 3KOOA 3NJ4A 2BEVB 4RWZA 5KQRA 4ABTA 2X9NA 1VPVA 2YV5A 3W5DA 5KJEA 3PWZA 1QRAA 3PXBA 2VDWB 2XXJA 2B21A 2CYBA 4QPDA 1RBZA 2GZRA 2HA0A 2NP6A 2ZVDA 1AKRA 5A6SA 5JDIC 5KNCH 2XY4A 2NU6B 4PX2A 5F7JA 3MWJA 3LWBA 4I4LA 4EX6A 2QS9A 4MQUA 2QBYB 3HFSA 4V1CI 3LECA 2C59A 3QX8A 5FX2A 4ZV7A 4ENUA 1FYDA 3I0ZA 3C1AA 4NBLA 2VJOA 3C3XA 4F6LA 2CSUA 2JCSA 2PCLA 3CX3A 5T8KC 1E4OA 2OXIA 1ZCZA 4NEHB 4ZVNA 3GLFE 3QXXA 3L0YA 5JJ5A 2MYUA 3KEGA 1RWPA 4Y8VA 5IFLA 1NVDA 2DFTA 3QPDA 5AVJA 3EXIA 1ENOA 1OIWA 2OFXA 3IHWA 5I7RA 1UCFA 1DJMA 3I3OA 3ST7A 2I2CA 3K96A 1QMPA 1XKQA 4IVNA 4YJ3B 4O2RA 3IIMA 4UPDA 1RPAA 2VUTA 4JR1A 3S2EA 3TFOA 3ZKWB 1Z75A 1G7SA 3IHKA 5IJXA 3IULA 2GN8A 2YWFA 3ZBTA 1NA5A 1FE8A 3GXBA 2P9TA 4ZOLB 1DTWB 4AJJA 1DBRA 3M6FA 3Q98A 4CDGA 3ON5A 5DLPA 4MJ3A 1XT6A 3IOMA 1QYRA 2HPAA 4Q16A 5DI9A 3ZWKA 3X2FA 4TQGA 2ZI3A 3DE4X 2FF5A 1CJKC 2AB0A 1UPAA 4J1SA 4JSYA 1D4ZA 5FI3A 4H60A 4B46A 1SY7A 1W96A 4D44A 3KTAA 3JSAA 3HJGA 5ES4B 4PY2A 1YB6A 1L0BA 3C4VA 4YRJA 2RKWA 3WDMA 4DWOA 4IJ6A 4LJSA 1C1DB 4L6IA 3B82A 2G9RA 4TM8A 3T1VA 1S8OA 3WE7A 2BP7A 1RXUA 3DFFA 4GYJA 4MRSA 2X4GA 2Z1DA 3I39X 3ZY3A 2HLNA 3HP1A 3EWNA 2CHFA 2HLDD 3WKEA 1DL5A 5CXQA 4DDUA 2FCAA 3WV5A 4ZAFA 5A9SB 2L69A 1I36A 4L74A 3AW8A 3HR7A 1SZJG 1WNTA 4BLPA 4Z4QA 5F4BA 1VYTA 1QKJA 1ATIA 4KKXB 2P75A 1A7JA 3LC0A 3ZUGA 5BNTA 1U2SA 4CUZA 3RM3A 5E2AA 3H0EA 3LU1A 4RF3A 1JA0A 3OLQA 5GZ6A 3AL3A 2YS6A 1H4QA 2O8BA 1E2FA 1DCKA 1H4TA 4JB8A 4FPXA 2R8ZA 5CX1B 1Q6YA 1YC2A 1UDBA 4HQ0A 3WWCA 1KFCB 4D9NA 4C6RA 4CKWA 1P18A 4E51A 4QATA 2ZPTX 3OIDA 1QZXA 5CDFE 1YVDA 1TZKA 2B0CA 3D3JA 3ORHA 1GO2A 4GZLA 4HQFA 3VHXB 1BKSB 1KYVA 4ACAA 4DM4A 3JVDA 1G63A 1ML3A 3A2LA 4B7XA 3SZ3A 4IGEA 1RQPA 3UFBA 1M54A 5DIFA 4MJ7A 3AVYA 1WW8A 2J41A 3ET5A 5GM1A 4RDXA 2V5VA 4LDRA 3ZGLA 2IYVA 3D02A 3D5TA 2R8EA 1TO2E 1J6UA 4PSVA 3R0VA 4PF1A 3IBTA 4Y67A 2J4FA 3KXDA 2BI8A 3I4CA 4RK1A 1J8FA 3TGWA 1A7UA 4AY6A 1MH9A 5DNUA 2REOA 3GRVA 3L5KA 4KVZA 3VMFA 2BSQA 1ABFA 3FR7A 4IO1A 4C7OB 1T1RA 3RV3A 3R7FA 4R0MA 2Q29A 4XSHA 1WY5A 5G02A 3TZCA 2HKIA 2WHRA 3JWGA 1YB1A 2HBQA 4A4DA 1OVMA 3LQFA 1WD7A 5F7OA 1V4VA 2IHBA 1YK0A 1X9GA 5TC4A 1FDUA 4QRIA 1CLEA 3T9EA 2RHTA 1ZCJA 5LP6B 3A4VA 4GSKA 3A3PA 4MKRA 4U5XA 2P4EA 3OTOB 4Z3DA 1A2QA 2QNIA 3CNOA 2VBIA 3TLMA 3P96A 4F0JA 2O2DA 4UM8B 4C0AC 1UOEA 4BS9A 1AX9A 5IKOA 4YRSA 1H6BA 1HXHA 4N49A 1K98A 5K3FA 3RO7A 2CK3A 1P31A 5K3DA 1UM8A 3UXMA 1FVOA 3GT4A 4Y7CA 1NC3A 1J21A 1NY6A 3M70A 1UBMS 3PEEA 5K0EA 1ULAA 4KLRA 5ECDA 3BBPA 1KIFA 1H3EA 4XJVA 4PQRA 2ZIAA 5IJZA 3DO8A 4HBGA 1ITZA 2ZR0A 1HY3A 1WCWA 1BRMA 3F6SA 4AP6A 5TR9A 3SDBA 1PT9A 3PVSA 5F2KA 1Z4PX 4XWGA 2GF9A 1U1CA 2D0OB 3OJCA 3QFRA 2WSMA 1LDGA 1WXFA 3NFRA 4Z3OA 2A7XA 2ZBVA 2OFOA 2ZI4A 1VKZA 3C2QA 2O52A 1UP6A 4HWKA 1IATA 4JEIA 1HNXB 3H9EO 3O8CA 2IXDA 2XGGA 4XM0A 3T7RA 4O63O 1RAAA 4Q1FA 5ALZA 2E4XA 3OT1A 2BL4A 4FR2A 4LMPA 1AKWA 1YFKA 1KR2A 1DT5A 2CV1A 1VIAA 1E79A 2BKLA 2WMDA 4OH1A 2F3TA 1PFKA 2H63A 2Q3FA 4ZVLA 4BYGA 4UOZA 2R6AA 1E1CA 3AINA 3DDCA 3OC6A 1IBMB 3BF7A 1PJZA 5DOZA 4BZXA 3VR2A 3PT9A 3WIBA 2AG8A 1HZZC 3RFUA 4ARCA 4YDRA 4UCFA 3GPLA 1J0CA 1GCAA 3E0XA 3CBGA 4MI1A 4KPFC 5C37A 3T7KA 2WMOB 2XGOA 5IAOA 1DX6A 2W2KB 2O3UA 4OMFG 4WXYB 2Q3MA 3BGSA 5JWRA 3KNZA 1MD9A 3GGCA 2QL9A 1PJRA 3GLIA 3ZE1B 1ST3A 2YZMA 3VV2A 5I01A 3CH7A 2VP4A 1LS1A 2ZSIA 3P2EA 4ZO9A 3SJUA 1UMDA 4WZBA 3W5BA 4MCAA 4CTJA 5M04A 4TKUB 4BNZA 1O4WA 3L43A 4C7VA 3LL4A 3I2HA 3K6SA 1HT0A 3A0UA 1MOZA 4GNKA 5BSVA 4MB2A 3ZHYA 2QYTA 5HCIA 4JS0A 4YMVA 2VJAA 4O1MA 2H4HA 4URUR 3V42A 3GELA 2VCYA 3G0OA 2GCOA 3AV3A 5BV7A 5JIBA 2REXB 3DAOA 1LPNA 1UT5A 1XLWA 2EYQA 1I24A 3QBTA 4BZWA 5D01A 4KN9S 1M1YE 1MB3A 4MS4A 3LQ4A 3PJEA 3W5HA 2OQVA 1GXSA 5ITSA 3MPOA 4JA2A 2OHIA 3AERB 3CTMA 3KHTA 2VRCA 3KO8A 2C98A 3R23A 4UUNA 2CNLA 2R60A 4P7KA 2GWHA 1OC2A 4ZEVA 1XMQB 2P3SA 1LH0A 1YRAA 4DW8A 1VHDA 3EDQA 4FQ7A 4E5NA 4WXMA 2C07A 5I7VA 4RD3A 3X2SA 1A9TA 1GSOA 3A4LA 3G2MA 4JOSA 2AMFA 1AD2A 1ORDA 1SA0B 2ZIGA 3ND6A 2HLPA 3MCVA 2C82A 3E3LA 4KLNA 2GSWA 2ZAMA 5IMSA 4WGGA 1P9WA 3CRVA 3KB2A 1XPOA 1R12A 4EH1A 4KRFA 4EFLA 2OC9A 1NT2A 3BXZA 2O2CA 1P62B 3D4LA 3ZU2A 4AUEA 4BMYA 5KWVA 1EK6A 1SXQA 4INZA 1CUGA 4HGRA 2JEOA 3KR9A 4K87A 3GLHB 3AC0A 2QIOA 3KJFA 5KTTA 4ZOEA 2XUJA 1GITA 1X13A 4RE6A 4CFSA 4BB6A 1BHO1 4A2CA 1R50A 5FBKA 3RT1A 3MIZA 3BM5A 2VQDA 1CDZA 4DLUA 1ZJ5A 2GTHA 1R6DA 1M8JA 1VP3A 3NAGA 5D51S 5DBHX 3CM0A 2B35A 2O3QA 2PRZA 1WNFA 1J4AA 1XTJA 2CZGA 2R4TA 3GJ4A 3MFQA 1L7EA 2YHBA 2ZJ0A 3O94A 4JJKA 7REQA 4YJHA 2EW8A 2PEYA 3ZZUA 4JXXA 1CBUA 2NXJA 1QH1A 2IU3A 3ZCSA 3UK0A 3B1ZA 2SKDA 4M1OA 1O54A 2JHAA 1ODKA 3ELUA 4RZUA 4JUAA 2EJTA 5DYIA 3BGVA 4DC1A 4COOA 3OY2A 1JDBB 3OMLA 4C3UA 3L1VA 4NFSA 2X0FA 3C70A 5DGXA 2IA5A 3AQIA 3FROA 1FDSA 4ZALA 4PO1A 4BVGA 1K7EB 4N54A 4Y0NA 3S5UA 1Y1QA 3FUTA 1N2XA 2XT6A 1S2GA 1YV9A 3KJIA 1KTVA 4QYTA 2B25A 4IKOA 1T34A 4NOMA 2H0RA 3WHLA 4DQKA 4KIUA 2VF8A 2G1AA 4ALKA 2IWRA 1PX2A 2H2HA 1PL0A 4NEQA 3TAUA 4REOA 5LIPA 2YXEA 1GQOA 4ZT3A 5FPKA 5DWQA 1TA9A 4FHFA 3PVCA 4LY9A 2Z8YA 3HYLA 4UFOA 3L7DA 1XYVA 3LKBA 3HGQA 1SB9A 4I1UA 2IEIA 3IA2A 4XLLA 3UT5A 3WOVA 3RADC 3FFBA 2H11A 4YXFA 5A06A 1WZUA 1MAVA 4EUSA 2YWCA 4RVCA 3TM4A 2AUTA 4Z4CA 5KYUA 4RL6A 1Z7WA 2VSYA 2Y0EA 3N6VA 3DBRB 2BGUA 5CLQA 3IJ5A 4D5EA 2PG3A 5G41A 4DUGD 2GPYA 2HJGA 4Y2TA 2ZW9A 3KUXA 3TS1A 1UXIA 2FWBA 1R4AA 3N8IA 1S8AA 4HRAA 3H18A 3P9CA 1JFRA 1GPNA 4OKIA 2VDUE 1Z7BA 4WAUA 4L51A 4NENA 2AOVA 2Y1GA 3JAKA 2AOUB 4RTJA 2WU1A 4C89A 1M72A 3R9WA 4CMEA 4GPBA 1KP2A 4WRRA 3K4PA 4OF4A 3SF8B 1IDN1 1ECJA 3K0CC 2YH2A 3P52A 3PA6A 3Q3GE 2GZ3A 4HNTA 3ELDA 4CLHA 1KIAA 4HR7A 4P4SB 2X3FA 2VAVA 3QI2A 3TIGA 4DNFA 4ENWA 1TM5E 4JQOA 3GLVA 3HKCA 5KAPA 1IBRA 2YQ4A 2ZJ5A 1W5TA 1THZA 1XL0A 2JGMA 4GGOA 1Z4NA 4WESA 2KM1A 1FU7A 2BN4A 1RJWA 2MYNA 3UFXA 1F8FA 5DLEA 4F1KA 4DV3B 1G6Q1 5ISMA 2O5RA 2FWNA 2P41A 2AG0A 4LHXA 1FMJA 3TLKA 1PEDA 1FNMA 1NDUA 3KQWA 4C7MA 1AM4D 2GN2A 4J6EA 4JBYA 4ZA2A 4V1CA 5DHAA 2W83A 4X1IB 5BSUA 1T5BA 1XB2A 5JAQA 1SH7A 3TQCA 2O1SA 2OB1A 4U9HS 4BQFA 1NP7A 3NCTA 1B8OA 4B80A 3KB6A 4FFWA 2H1HA 1Y7PA 1GKKA 2HOQA 4YASA 1JF8A 1IN6A 4DQXA 1G20B 2ZT6A 1XRJA 2C3UA 3K70B 3AEZA 1XKLA 3FWZA 3NC4A 4KWCA 1E6MA 2DBVO 5H4HA 3OFND 2AN3A 1Z28A 1ABEA 4O2BF 2YXDA 4RANA 1RRVA 5TX7A 1UP4A 1UZUA 4L8VA 1A1VA 1OA0A 1UC8A 2QVCA 2VT7A 4D42A 5REQA 5BORA 2WTNA 1M8GA 1NQAO 3D81A 4F96A 1LVGA 2RGDA 5LCXA 1H8ED 1KTIA 4LJ5A 3T9CA 1XDGA 3ZK7A 1Q1BA 2FPXA 2WHQA 4FINA 4HGYA 4AIIA 4ZYVA 4PINA 1RKBA 5K2OA 1SPXA 1A2KC 2NPFA 4I4TA 3LT2A 1RI5A 1K7YA 2GCEA 3EY4A 4RQBA 5CG2A 1P3Y1 2ZU0C 4EO4A 3FPCA 4OUDA 1YR2A 2ZRKA 4K6CA 3W3AA 4MEBA 1JFFA 4I1YA 2VJKA 4C5AA 3M83A 2DUWA 4GZMA 1E0DA 2JFGA 4HNQA 2IBTA 2YXBA 3PI6A 4NJOA 1ZNYA 5BUQA 1TMOA 2XKJE 4B2PA 5JMOA 1ZD2P 2PXXA 3PUYA 3PQ5A 5A3SA 3VNQA 5CYGA 4HLCA 5P8WA 3RFTA 1F9AA 1CE8B 3HJBA 2FHPA 3BTVA 4CCWA 3ZV4A 1DARA 2FZEA 1IEWA 2PT6A 3M6XA 2QZ9A 4P35A 2WT9A 4A0GA 1CP3A 1GZ3A 4YCNA 1VECA 4S1TA 4C0XA 4AECA 3CZ4A 3SXPA 3RS3A 1VE1A 2FPUA 4CIYA 4WI1A 4TUYF 3RS4A 3IRVA 4P31A 4RZXA 1KERA 2VG8A 3H9JA 1L5FA 5D7BA 3ETJA 3JALA 3WYEA 1V6AA 5A4JA 5AJTA 2OZKA 2P2SA 3DYVA 2CXNA 1ES9A 2X1VA 3EA0A 5DYNA 5C3UA 3A26A 3ANNA 3O91A 3O75A 1QHYA 4XOUA 4UTNA 3OM1A 1UIMA 4NULA 1LEHA 1MN6A 2AJDA 3BSWA 4L4XA 3W78A 4CEHA 2K7FA 2V9ZA 3G2IA 2FK8A 2CFOA 5C18A 4YIHA 3U48A 1LPPA 3K4HA 3J81A 3LQ2A 4MWZA 3EPJA 3FJ1A 5EJ8A 2PUAA 1SCAA 3LXRA 4PZEA 4AN4A 1C3JA 3L7MA 1KJNA 5EHGA 1C7FA 4M53A 2VZLA 3PC3A 4RZQA 1GD1O 3UJPA 4YRLA 4BAZA 4EW2A 2QENA 4KCGA 2MSWA 1M6HA 4B2YA 3U16A 4L85A 5D7NA 2YFKA 4MS1A 1H2EA 4AI6A 2UYYA 3R7AA 3MJEA 2V7PA 3R9XA 4PSDA 3TLZA 3ZHCA 1BHSA 1PVVA 1P8JA 3C24A 3GNSA 2VRWA 3B5IA 1ZIXA 1E5QA 2JK1A 1U7OA 3D7LA 1W94A 2O7NA 2WP8J 3JQPA 4CM8A 2ZBRA 1U94A 5GIOE 1FJ2A 5T67A 4WK6A 4WLOA 5EMNA 4R8RA 5HF5A 2QTTA 2RDMA 1ATZA 1SVLA 4ZZ0A 3VNAA 4YY3B 1YHYA 1IMJA 3EIQA 3ZK8A 1NRIA 2EZ9A 2ZSHA 3EXHC 3ENQA 1RCFA 2NWQA 3TR0A 4C2AA 5M7EA 4N03A 4BO8A 3QM1A 2GASA 1KOFA 3LBNA 5DOVA 1YQTA 2YN4A 521PA 1NJ8A 3U0VA 3T06B 4XEHA 3W7VA 3C6BA 2OOSA 2REBA 2FU5C 3GRFA 2IV3A 5JARA 1HE2A 5KEIA 3DGFC 1P1HA 3BE6A 1RC1A 1TMGE 2IHZA 4A2PA 5AM1A 1NIJA 1EQAA 3HA2A 2DUNA 3WQSB 1FP4A 1HSOA 3B36A 2DAPA 2ANBA 2NYRA 3DAHA 4NZYA 1SQSA 4OQQA 5BV8A 4UDYX 4HDRA 5AHKA 4ND6A 2HWYA 1RJEA 4CQNA 3UOAB 4WFQA 5ARDA 1EH5A 2PBFA 2RJ3A 4GR4A 4LOAA 4CYMA 4JB0A 4G3XA 4LVNA 1YZVA 1AKTA 2RGNC 4UTOA 5JV5A 4MDYA 5DBFA 2YUIA 5BP7A 4Y2PA 3C74A 4BJHB 4GRAA 5CVDA 2F48A 3OTWA 5CEJA 4J07A 4QGGA 1LWOA 3S1AB 3SFZA 1NI4A 1S2LA 2HRRA 1TC1A 1H0KA 2XUFA 3A0RB 1P61B 1IXSB 2O1XA 4QU9A 5CT5A 3VU9B 2I4LA 3C3WA 1EX9A 2ZCUA 4XX0B 3SS7X 3UUFA 1GDTA 2O2HA 5EY5B 5BPFA 2B5VA 4OQFA 4B32A 4O4HA 5E7JA 4C0HA 2M6LA 4B3FX 2FQYA 3I6MA 4BO5A 4GWGA 1ORTA 3FKSD 1M2WA 4MROA 1P2FA 2LW7A 5G3YA 2C5LA 2YOHA 5EAIA 4Z7NB 3FWHA 1ZMRA 2QAGA 3NV7A 3U3KA 3USCS 1JFTA 2VF4X 2OZLB 2XXAA 1FXUA 3B2NA 1IM5A 4JZYA 1Z5UA 3FJOA 4NICA 3T7EA 3RVPA 3NTVA 2PSHA 3HBNA 4DEYA 2E7ZA 3BRSA 3RROA 4OGGA 3VTZA 3GJYA 4MZXA 3E15A 4Z1OA 1AGPA 1R6AA 3QKUA 4Z7QB 2HCJB 2Y0DA 1X0VA 4GMXA 5EESA 1E2MA 5LN1A 4JASB 1GKIA 3WVNA 3ZWWA 4BRUA 2YYAA 3OCJA 4S1OA 1JKJA 1ZRNA 5FNVA 3TAHA 1CYEA 2VP2A 4X63A 4E13A 1QHEA 2O1WA 1SHLA 2OXTA 4E2YA 3B3AA 4GQAA 2X8WA 4P33A 4ARBA 1XJ0A 1QCZA 4G97A 2J45A 2G04A 5C34B 2NU8B 5CDFA 5I4BA 2LD4A 3CKKA 3D4PA 2JLYA 1LPMA 2G71A 4GE3A 2O7QA 4U7GA 1EM8A 5K3CA 3HCNA 1JFLA 1NNI1 1TUBB 3U3JA 4PZAA 2IITA 5TNXA 3H9CA 3A6HA 4ZYUA 4Z8XA 1T3ZA 3RHZA 3WKCA 1VI5A 4RDIA 4XRGA 5COAA 3L77A 1T5HX 3MWEA 3C6MA 4PAOA 4ALIA 3U60B 1T6ZA 4X00A 4DNPA 3U4IA 2FFJA 1I01A 4UHJA 1DAIA 3VUEA 1GLGA 1RZUA 3DV0B 3HJRA 4KXWA 1YR7A 1EHYA 5JC8A 3H42B 1ULUA 2OC4A 2PYDA 3E8XA 4GMGA 3B20A 1Z16A 3STTA 1ACJA 1V8ZA 4LYHA 5AIBA 2CLLB 5FEUA 4N3CA 5DWDA 2QXYA 1EDZA 1W2GA 4UHBA 1TIPA 1XHLA 4UNSA 3FOCA 2IH5A 2Y76A 2J4CA 2O3JA 1RD4A 1PZEA 2BDEA 3JQFC 2AUNA 3ESDA 4DDVA 1U98A 2PKYX 4HO1X 4UU1A 4MHTA 2ZUSA 1GZ4A 1WDLA 2JLSA 4BP8A 1L5NA 1A2BA 3JRNA 4RZIA 4RZSA 4I5FA 2VAPA 1QUFA 2OMEA 4QQFA 3F47A 3SHFA 1UM9A 1Y82A 3JQCA 2ZK7A 1T9KA 5KKNB 2GNAA 2XWJI 5TGDA 2BHTA 4MLDA 4B45A 1Z5WA 4Z5XA 2G7MC 2GYWA 3GJTA 3HXOA 5IEBA 2PSDA 3GFOA 5A05A 3C14C 1X7DA 4E14A 1PP4A 3PNYA 2D6FA 1VI6A 2AUMA 3AGPA 2UYCA 3EULA 1FFDA 3RE1A 2EFGA 3L18A 1SEVA 1NMSA 1BEZA 5A03A 5KAMA 2IXFA 1TJYA 3A28A 3KVOA 3L84A 4LDNA 2HU7A 3CWZA 3V00A 2GJ9A 5EJEA 4FOSA 3PQDA 5JNUA 1SBZA 4FR5A 4Q3EA 3QF7A 3FA2A 3HI6A 1AZWA 1A7KA 2BDUA 2VBCA 1M2OA 1BHJA 4QGHA 2UVQA 3TZLA 4KU4A 3T1HB 3CZQA 2AI3A 1YU6A 2QRVA 4BFXA 1W4AA 3LPDA 4UM9D 2YVQA 2AFRA 5EJFA 3B1XA 3NRBA 4K86A 2PVCA 1YR6A 3CN9A 1IIBA 4DYHA 2HQ1A 1O6CA 2YW9A 5ALSA 4MR8B 4BWVA 4ZN6A 1U2PA 3TQTA 1U7PA 3OPYB 1B8UA 4CG3A 1E3JA 1HSZA 2GRAA 1NASA 1KAOA 3B13B 4R0NA 4C3ZA 5B12A 4LJAA 4YAWA 5EEGA 2UVPB 1BGXT 1N6PA 3KVYA 3K6KA 2XUDA 2QF7A 1CY6A 1MT3A 4LECA 5EZ6B 3WYFA 1VZ2A 3I8XA 4JSTA 4UBNA 1AMUA 3I5UA 2HRBA 3OLVA 3T5GA 3OEHA 1HE1C 4EHDA 2HNKA 2WIDA 2CJFA 4KBYA 1NVVQ 3U4AA 3VR5H 4BPBA 2FQXA 4N8SA 1ORRA 5DNWA 3T4EA 4G5YA 1TU0A 5CTJA 4HWGA 4BP3A 3QRWA 3BXFA 3RSCA 3ADOA 2EXXA 2QZ4A 3R0JA 4LTNA 2BT4A 5CYFA 3U3OA 3B1YA 1USKA 1MIOA 1VFPA 2H1WA 3WO1A 4FKMA 4BWFB 3ROXA 2IK8A 3EGDB 4JEHA 3KV1A 1N78A 3MTAA 3VH3A 5IG2A 1NJSA 4LMAA 1ADBA 3BIOA 4UHHA 4MUXA 1ZOOA 1F14A 2QUZA 3DXXA 2FDRA 4DJJA 2D5LA 5IRCD 1P2VA 4DLSA 2ZUEA 3LF1A 2F64A 4HPJB 2CMDA 2IZ5A 4J7CA 3ESBA 1L5LA 3REQB 1V9CA 1KPGA 5CW2A 2DH6A 3GLQA 4LQ4A 2VUHB 1BNCA 5L8VA 3L40A 3B6ZA 4AP5A 3G7NA 5ALVA 3UJ8A 4RE5A 4RA9A 3NI2A 1EUCA 5IULC 4LWQA 4PR3A 1I33A 3MTBA 2HY7A 4K6GA 3N6RA 1OX4A 1E1MA 1EFRA 5A5GA 1I2CA 1BMDA 3F90A 4QFBA 2FMTA 2AQ8A 2P2DA 3MWLA 3R41A 5I5GA 1NFRA 3RVOA 2M1ZA 3OCUA 3PR3A 1FUIA 1CJCA 3QSYA 1ZO8A 3SSNA 1AS0A 1LPAB 2Y6VA 3X1KA 3UATA 3GL9A 2E4ZA 2DY0A 2HX1A 3RSHA 3MINB 1GIAA 2P9ZA 2Q6IA 3G88A 1Y8QB 2ZUWA 3O2NA 1RQLA 5JS6A 3O1HB 2YASA 3SXUA 4YCJA 1Q50A 2J0UB 3KJHA 4HFRA 4NE7A 4R41A 2JFXA 2QRMA 5AO9A 2BTOA 4CLRA 1KZ6A 1FTNA 1QSGA 1QV7A 1U0FA 5AXCA 4NU5A 3HFGA 1MXFA 2FLWA 4M9XA 1H2BA 1X7WB 2X1HA 4NJEA 1SVUA 3EFOA 1MU0A 5KOYA 2ZZMA 2V5AA 3A4IA 4K0KB 3DAFA 3OICA 1R8SA 3FR8A 4ID9A 2REQA 3TNJA 3ZIAA 2IP4A 5EQTA 3O8RA 5E1MA 1U2QA 2NXCA 5EUBA 1OB5A 2A1TS 4RTQA 2WAYA 4EITA 5BYKA 1DRUA 1MAUA 3KFXA 4LW8A 1S4QA 3PQ7A 5BRJA 2VPPA 1VJ0A 1G17A 1TRHA 2BFCA 1D5CA 2OILA 3AP2A 4KFTA 1Q16A 4B71A 1IUNA 4DXAA 4BJ1A 1JDUA 1VSQA 5DU2A 1WABA 1KO1A 1X2BA 2OBBA 3ASVA 2GPWA 3W05A 4B74A 4CU5A 4MI9A 3R7DA 1N5DA 4OEHA 4OVKA 5HQJA 4CQLA 9MHTA 1NUUA 1U1FA 3DE1X 4C5CA 3KQQA 1RKVA 4WD3A 1FP7A 3SU8A 5KYXB 4HNAA 2FW0A 4BZZA 1N32B 4BNHA 1ISGA 1ONOA 4UAUA 3CLRC 4U2BA 4EY6A 3T3OA 4L5AA 4QXMA 3AM1A 1CUAA 1XD2B 1XZNA 3BG5A 4EL5A 3LH5A 3QXHA 3AIKA 3OZTA 2CEAA 1W581 5TS3A 1JLRA 3JPWA 3KQHA 2FSIA 1DC7A 2AQKA 1XP8A 3DE3X 3GAFA 3IDOA 4KN8A 5AW9A 3UHJA 3G68A 2J5XA 1M74A 2AF3C 3EJ6A 2ATEA 2ZJAA 3F4LA 4K9DA 3RSQA 4PRKA 1Z2AA 1CS0B 4Q47A 2I1WA 2WFMA 4EG0A 5LD2C 1L7AA 2OV4A 4NZZA 2EFDB 2QVXX 1WVGA 4EVIA 3PWSA 2HUNA 2W2MA 3VC1A 4FDAA 3KVRA 4GPD1 3AUKA 1UPBA 2FMKA 4CW7A 5LSAA 2C3OA 2V4UA 3PC2A 2BD0A 3ELYA 5KNDA 1LVHA 3JQQA 4H6XA 2P3QA 4W5NA 2IEDA 5JZMA 1XZLA 2R85A 3MA0A 2WTUA 1JHPA 2CZQA 5HDQA 2WWHA 3TB4A 1A96A 3DOIA 3A2MA 2VZ9A 4ETNA 2VYCA 4OO3A 3MTQA 3X1WA 1JLHA 1XQ9A 2JKVA 1E94E 1NVMB 1BCRA 1Z13A 2AEMA 2VJLA 3FWKA 4UMDA 1MDBA 3DMRA 3QUQA 1ZI8A 4XR4A 4Y1FA 5BW5A 3AM4A 1U7TA 3GMDA 4OQXA 4RLHA 5FULA 5HMMA 1RC8A 1W6UA 8MHTA 4J0JA 1NBWB 5JNVA 1T9AA 4LZZA 4ZEXA 4TL6A 1RCTE 1QUEA 5EVJA 3A36A 3ENKA 2B34A 2IXBA 3IERA 2OXFA 3OZGA 1QYDA 2VHCA 4FOOA 4QOGA 5UKDA 2OM6A 3BVPA 3PIDA 2FE1A 4TLEA 3B6EA 4ARZA 3QEMB 2DPLA 2DR3A 4Z2YA 4IUYA 3PG5A 3C16C 3BIFA 1SXJE 1J5XA 4XE5A 3TSYA 4OQNA 3K05A 5IAGA 1LBHA 1RLIA 2YICA 2I3DA 4RSMA 1PVOA 1JUDA 3OM9A 4N40A 1IYZA 4TGLA 3O95A 1Q2UA 1P17A 2OFWA 3O4FA 1PNVA 1MB4A 3WHPA 2X4DA 2P27A 3GJSA 4HNRA 4OBBA 3ROTA 1J25A 1SN7A 3PQ8A 4IHAA 3V8PA 1NVGA 1A50B 2QU8A 4ZQIA 4XUGB 3A9CA 3NOOA 4F2DA 2IIBA 2RHLA 3KAKA 4GU5A 5IWCA 1RXSA 3VPSA 4PPFA 1I2DA 1TK2A 1B23P 2CN1A 3AIIA 1XZEA 1SZCA 3QSGA 1T5DX 1M76A 4I8IA 4IRUB 3CY6A 4IIDA 2OO3A 3RVMA 4BUJA 4OUKX 4CCYA 1TF2A 1MAHA 2I54A 2JFHA 3JU3A 6ADHA 1FX0A 2BSAA 3R7WA 1Z0AA 4CFYA 2UZ1B 2O8CA 4F2PA 1KU6A 3KKKA 2AN4A 2H1SA 4W5JA 2WD8A 3UNXA 3FVVA 2ZS9A 3BGOS 4Q00A 2V3VA 3G5MA 4Y0VA 1R64A 4NZMA 4LAFA 2CNKA 1SQGA 2GVZC 2OBYA 1AHPA 2QKYA 1G8YA 2B8JA 5T57A 2DWPA 1RSZA 2WTAA 3UYLA 2ZM5A 3LYAA 1OKKD 2NU7B 4H08A 5C8VA 4K46A 1LWNA 2RB5A 2ZDHA 3O9ZA 1TCVA 2YIJA 5T4BA 2IQ5A 4ZT5A 3EJWA 3KZKA 4RC9A 3LS2A 4P84A 5AI4A 1NPTO 4FMDF 4E33A 4PTZA 2DUUA 1WLYA 2GHTA 3T3EA 5CLGA 3DUFB 3FG9A 1NUSA 3EDRA 5K8JB 2JGJA 2CXQA 2ZBUA 1VIVA 3I6ZA 4MA4A 3UMVA 2W2LD 1QO9A 5E4FA 5BY2A 2G9QA 1M73E 4BEVA 2VDQB 1VRWA 4LWZA 3ZDXB 1GGNA 1NNSA 1JR4A 2OYRA 1I5OA 2ON6A 4NOKA 3V4ZA 2BZ1A 4F3CA 4V2IA 3E1GA 5F51A 1KHTA 3L7YA 1G8JA 4OQPA 4R6WA 1H2FA 3K5WA 1HR0B 1F8UA 3UCFA 4Q9DA 3S55A 5F1PA 3X1DA 2DFPA 1O8BA 4IHKA 1WDWB 1NVWQ 5KOJA 4HD8A 3TUZC 3KHUA 3WP0A 3EHEA 5L3QA 3PX7A 3D6JA 4KDCA 4QTTB 1QG6A 3VPGA 4N41A 1RQRA 2X2EA 1YOVA 1QZ3A 1KFEB 2J5RA 3TM5A 1N34B 3MHTA 2QTHA 4TVKA 5A7GA 2IYNA 2ZT5A 1XDDA 1CUYA 1BCSB 2JC3A 3HBLA 5CYPA 3HSSA 5EFZA 4X62B 1CEEA 4CM9D 4NECA 3H1BA 1N6OA 4WMLA 3ECSA 4AJ2A 1KRXA 3CS3A 3GD7A 3PKZA 1RYFA 1FBNA 2AOWA 3JWJA 4PVDA 2AQHA 1MXHA 2CL5A 2ZB4A 2WK1A 3WDLA 2TRSB 1OHHD 1G0NA 2GLXA 4OSPA 1U0GA 1SG0A 4B7ZA 3IEKA 4EW3A 4HVAA 4OSEA 4PG6A 3A1DA 1BWRA 4IIGA 5CUQA 5EP3A 1KDYA 4YCMA 3TEJA 1BDMA 5ICGA 2E4AA 3W8EA 4G4IA 3R0XA 1JI3A 1QYCA 4V24A 5DISB 4E70A 1DHRA 1V8OA 2IDKA 1AT1A 1Z2DA 1A71A 4Q4JB 4TUYB 3QV1A 1BSVA 4O0LA 1FFEA 1QGDA 3KYCA 4HNHA 1KAMA 1FPMA 4F45A 1RJFA 3GPIA 3I6IA 3OQHA 3IL2A 2WF8A 1WB4A 5EGNA 2M98A 1GR1A 3AJRA 2CYCA 4AURA 1KO7A 2GT1A 3QELB 3T6KA 3I45A 1FFCA 3FRIA 2ZR9A 1Y33E 4IINA 4W6ZA 5F33A 2GBPA 5LLDA 1PWHA 3OZFA 1OTYA 2ECKA 2GCIA 2R6R1 3JARA 1G2OA 2J7KA 4M1QA 3UF0A 1IBKB 4HX9A 4HYQA 5BMOA 2GJAA 1JQAA 1G9XA 2J3KA 2WA1A 2IEAA 4G1FA 4IIVA 3LQRA 2Z6QA 1ZP6A 2BBTA 3EAQA 1FYXA 1Y1SA 2AI2A 3UWDA 2NUPB 1EQ2A 1A8UA 2C9DA 1U6KA 1XA0A 1YE5A 2BM9A 2C0PA 3G9ZA 4YAFA 4PCVA 3HO8A 4F8JA 2OHVA 1A4XA 3H9UA 2AWNA 4FFBB 5JD5A 5D84A 4F5ZA 1X1EA 2A0KA 1UIRA 1IXZA 1ZN2A 3LOQA 4COKA 1O87A 4GP7A 1JNYA 3K35A 4QXPA 2P4QA 4JMLA 3D3QA 4QOJA 3VHRA 5JR3A 5JJIA 4KE6A 4EY3A 1ZGAA 3A1CA 2K2WA 1CVLA 3CNQS 1B0ZA 3CHYA 2DWUA 3IJPA 4O5AA 1ZSVA 2WWIA 3CPJB 3WBFA 1I0IA 3ESYA 2H51A 3IP8A 4IZHA 4JLNA 2IYXA 4Z7JA 4F92B 1GQRA 3KR1A 4ZEOA 2JI7A 3R7BA 4AJIA 1QO0A 4LWOA 5HW0A 4IW3B 2H1OA 3RVJA 3TIFA 2IYQA 2DX7A 4QEKA 3B9RA 3IYLW 3V32A 3ABOB 4HGPA 1HQCA 3EW9A 2NGRA 2YXPX 3JVEA 2MMCA 2BLLA 3R3JA 1AIPA 1IY8A 1QOZA 3OOWA 5THKA 4FD3A 1U63A 1BS1A 3AR8A 3NEPX 3NM5A 2YNMA 3F4BA 4I3FA 3TSCA 3AY3A 1VRCA 3ZCPA 3T1TA 3HQ4O 4DEVA 3M81A 5D5PA 5T3YA 1HKUA 5IXJA 3MC1A 4L22A 2V03A 1KVUA 2IYZA 3DFMA 3DE6X 4NDNE 1AXGA 2RK4A 3FF4A 4Q21A 5JH7A 3OCYA 3E23A 2XBMA 2Z98A 3HPRA 4ZU1X 3IBGA 2EBHX 4GEKA 2XT9A 3SE7A 4AP9A 1QRUA 3B3GA 1MQSA 4F11A 4O1IA 1VSBA 2QN2A 3NX4A 3WGYA 2FFHA 3I04M 2WM9B 1XQYA 3SZLA 2NZ8A 5I9MA 3ZC3A 4LDAA 4BB9A 5C1DA 3O7WA 2W43A 4KTTE 1ZJWA 3KZMA 3AVUA 4S35A 2FR1A 3GA5A 5EHQA 1E63A 4OATA 4ZAYA 3TTVA 4AJ4A 1AF4A 3C39A 4HXEB 5FI0B 4TTQA 3PGLA 3FAKA 2I65A 1KEWA 1MENA 2UUPA 2HU5A 1VJCA 3D9QX 1BX0A 1JG3A 2F1JA 3W1EA 4OV6B 2QD4A 3G13A 3GWZA 3ZQ6A 4EY8A 4O4HF 3IIIA 3S8MA 1RRCA 3HNPA 1IZZA 2ERCA 5KSOA 1DVRA 3LXUX 2NSYA 1AMOA 3M82A 3R3WA 2YZGA 4RTRA 3GT3A 3PZBA 3T3PB 4DDMA 4J75A 3BXHA 3H1EA 3K16A 3GYGA 1JL3A 2BP7B 4TVSA 2W0MA 1J99A 4IIBA 1XELA 4QYSA 1E2EA 3CUTA 1J49A 1XVUA 1ZKMA 3UV3A 2X0JA 2IKSA 1ZICA 4D98A 3E0QA 3I01M 4IM7A 4ARUA 1RPZA 1TO1E 3K6JA 5HZMA 2ZANA 3ADDA 1R8XA 5GV8A 4E2XA 3PEYA 3RDPA 3D2CA 2QN8A 3N2KA 1XTKA 4XWTA 2ONZA 3HACA 3OWOA 5EXPA 5LYJA 4CEIB 4NG5A 3GFFA 3HYNA 3A1NA 4YMGA 2C8JA 1YAHA 3U9SA 2A30A 1ICIA 4UD2A 3B6IA 2FW1A 2PHZA 3C97A 1RJDA 5PGMA 2IUFA 5JMPA 1XP5A 2HWXA 3U7QA 3V2HA 2B8EA 4YMUA 1CQZA 1Y6GA 1ZSYA 3M3DA 1H1LA 4YV7A 4G4GA 3QE4A 1YZTA 1SOWA 1C0PA 4BQQA 4Z51A 4RV9A 4HMPA 2G40A 3LCVB 2Q4RA 3HCEA 1IRXA 1ZCFA 2BGWA 4INPA 2QSZA 4I55F 3KZXA 5FH9A 5DT9A 2MJLA 2CFSA 4BFSA 3C98A 5CLLA 3PQ3A 4PGMA 1YZFA 4MWEA 1XL1A 1J8MF 4K9PA 1IHYA 2WTMA 2VNAA 4C4TA 4UMFA 3ZU3A 4LRWA 2XCTB 5JBNA 1L4MA 2I03A 2WFLA 2VZ8A 3K6RA 2QJOA 2NZVG 1AS2A 2WV9A 1LX6A 2WWWA 4D8YA 4Z4HA 2J46A 4RPLA 2AG6A 2APJA 2TS1A 3H1PA 3H8WA 4J4HA 3V8RA 2WJYA 1XQXA 4DIKA 3QEBZ 1F8YA 1WAMA 1EFKA 1XRSB 1Z06A 2PX6A 3IV6A 3PNBA 3T9AA 1W48A 2D1RA 4CHGA 1WETA 3ETLA 2P2CA 1WUYA 4HOYA 1YKSA 3EIUA 4UDOA 5AJXA 5LBTA 1R0XA 4HP8A 1TYCA 3GR6A 4PC6A 4WV3A 2QPTA 3LDFA 4M0PA 1UBFA 2NSJA 3DB1A 1E9CA 2Q3JA 2X0EA 1X42A 2W6MA 5TQVA 4GQIA 4P4NA 2ZXUA 1Y0BA 2HMAA 3DFIA 2J6BA 4GDFA 5AK5A 4NFLA 4U2KA 5K6AC 3Q85A 1OLSB 2NOAA 3JYLA 1YS9A 3RC7A 4MCHA 4FNMA 2ZG6A 4ZEMA 2OO5A 4CIVA 4ZCLA 3JATB 4XIFA 5TRTA 3V4LA 2ZR7A 5TMEA 4ROSA 2ILVA 1YE3A 2Z8YM 3GZNA 1G291 2FZ4A 2WJWA 2BBOA 2B1QA 3B3QA 3EVCA 3KJXA 3OLYA 3P8ZA 4QD3A 1XA4A 9ABPA 2FPIB 1V8BA 3I9OA 1KVRA 4GWLA 4RTPA 1Z08A 3QE9Y 2DEUA 3EVEA 4PLPA 4X44A 1M6YA 4WBSA 3GNQA 3QEJA 1T8YA 1JDPA 3LPNA 4FGKA 4K6FA 4B2IA 3FCYA 2HEIA 3LPCA 2XSZD 4DRXA 4YGYA 2ZIXA 1CUIA 3K5IA 3L0ZA 4RK6A 1ZMOA 2JHPA 2ZULA 3HZOA 5AK0A 4BC0A 1RADA 4CFZA 4HS4A 2NUBA 3MCZA 2GVDC 4PPQA 5KTOA 2VJNA 1UMBA 1DSSG 4FJ0A 1CIVA 1NW5A 1DI0A 2UKDA 4LJ8A 4OXIA 2DHCA 1YGPA 3MJVA 4ZT7A 4KV9A 2BFBA 2IIPA 1W8DA 1ODIA 2B61A 2CLDX 3K70C 2FEWB 4AJHA 3OT1B 2HF9A 1HOXA 1T4MA 1RRGA 1YRYE 4E5PA 3FNEA 4GOKA 2Z6VA 4LZNA 1HC7A 1YZUA 1WTAA 221PA 3W8FA 4RJTA 1JE1A 1Q95A 2CLSA 2VDNB 3NM6B 1T8TA 1AF7A 2V45A 1YJXA 2YY7A 3RGGA 1GSHA 1JJIA 4F4HA 2HPZA 2ZJ8A 4MGIR 1SM4A 2QRJA 1XNHA 4R1PA 5JROA 2Q5HA 3BL5A 3EH1A 3O84A 3AI2A 2C84A 3EDMA 3KUDA 3TNFA 1CRZA 4GXQA 2WA2A 2I6UA 1O94A 3GCZA 3GGGA 3QOYA 4J3NA 1TTTA 3B5EA 2XUIA 1K6EA 1ZJ4A 2JBHA 1JPNA 2ID7A 1RXWA 4BNIA 1EXDA 5I7WA 4CZ2A 4CEJA 1KZHA 4I4CA 3FVRA 1BXGA 3RVRA 1JZSA 1A8SA 1RYEA 2QRPA 3SHOA 3UWKA 3LTNC 1W4ZA 1ZINA 2XVXA 5JLAA 3WYNA 4ENRA 5E1BA 4D4HA 2O3SA 2G07A 5FP0A 4QTYA 1UL1X 1G16A 3O8NA 5JVDA 5BWOA 1DKQA 4IIHA 4C0JA 2Y9MB 1ECLA 5KU7A 2VHXA 3L4EA 4EHHA 3WRYC 3WGUA 2AR9A 4YN3A 1SOUA 1VE7A 1Y5IA 2JLBA 1RWMA 2YV1A 4JLAA 4UJ3A 4X85A 1NX9A 4MS4B 3TB6A 3QPVA 1ZSNA 3A6DA 1GXSB 1VIYA 2OBXA 2P65A 3BCRA 5AKZA 5JYCA 4NV3A 5C81A 1I3CA 2AEEA 1EU1A 2WWGA 1GCGA 2C9CA 4HUQA 3CINA 1GPYA 5EIXA 3WZ2A 3NH6A 1VC2A 1D03A 2XTNA 1YSCA 2C2KA 1KVSA 2VBFA 2ZRFA 4N5MA 4PHCA 1DU4A 4MDFA 1O6FA 1YJ5A 1DPGA 1XHEA 3HB9A 4LK3A 4EG6A 4CKZA 5THXA 4IXNA 4BRWA 4KN6A 2O5VA 3ENZA 3R5HA 4QT4A 3OQNA 1DAPA 1NPYA 1ZBQA 3L79A 4D9EA 2ZROA 2VTVA 4RKRA 1Q44A 1V1RA 4ZGGA 3ZV5A 3ZG6A 2W58A 1JHQA 1QBKC 1ISHA 4BQRA 1N25A 2BI7A 1P1KA 4HWSA 3LQYA 2H54A 4J0IA 1DG3A 3TD2A 1XZGA 3WGLA 1C8BA 3GLUA 1PK7A 2Z4SA 5FUMA 4LDPA 3TLGA 2PS1A 3BN3A 2EC5A 3MLEA 4G89A 2DQKA 2FZCA 4EATA 1O9BA 2JIOA 5BN3B 3ILYA 2UAGA 3L0IB 1C3OA 4LJ9A 4LQLA 3VZSA 2FPPB 4RGYA 4LV8B 1G7CA 2PMDA 3KOUA 3G2LA 2MDTA 1FTWA 4Z3KA 4TL9A 4BBJA 1R00A 4OLBA 4NAVA 1C1YA 4Z53A 4YX9A 5DM70 4WUTA 3V55A 4YAKA 4J3FA 3GIWA 3CBQA 1SU8A 1Z38A 2IOYA 1ZWKA 2J87A 5CH3A 3WKDA 2LDBA 4DBVO 4WJZA 4EYKA 2AW3A 4IKPA 3K1AB 4N5HX 4G5SA 2OOKA 3LKVA 2ZE8A 4RKEA 2OYCA 3QNUA 2WSIA 5IZCC 4OYLA 3BE4A 2IXEA 3PEFA 1JAHA 1IB6A 1L3IA 4HS9A 1KRHA 4DYDA 5HKKD 5DNEA 1UUFA 2FSSA 4GVLA 5F77A 4BN4A 2X5XA 5L53A 1XRRA 4OJMX 4HJRA 4ND2A 3M89A 1SK9A 1V45E 4MA5A 1UBSB 4MVJG 2E48A 4WCFB 5JJLA 1I9CA 1SCIA 3TW6A 2ZUUA 4GKVA 4LFBB 4NBWA 2PLWA 3AR5A 1KDRA 4OJQA 2ZYSA 2GM3A 3U37A 3GYBA 1X1CA 2QLLA 2NNLD 4JYZA 3AHFA 4UAVA 1RDFA 2AFHB 3U19A 1Q3TA 1X15A 3QBVA 4HGOA 3GDGA 3KZOA 4KOAA 1UK9A 3RC9A 1FUKA 4B6GA 5EJ5A 3AILA 1IBSA 1J9GA 2BUAA 2X4IA 3INRA 1YH3A 4GX0A 1XN1A 4V0ME 3VJKA 4KUEA 1CIJA 3I2GA 1P7ZA 2FEOA 3UZUA 1ZBDA 4NYMQ 4I08A 4M89A 3SBXA 3OF3A 4NATA 3SE0A 1VL5A 4KQHA 1AJEA 3BZWA 5GV7A 3WLIA 3VR6D 4BKRA 4G0PA 1EFDN 5D3QA 1T5LA 1K66A 1P2TA 3AH8A 4HWPA 4IMJB 3SR3A 3VVCA 4A1FA 3DH0A 3CE9A 4UMVA 3AF5A 1OASA 1MJNA 5JXJA 1EVJA 3JQAD 2EJVA 4EHIA 3KPJA 3O7MA 1SXJA 4ZRMA 5CAEB 2C2WA 1ZY2A 2J4DA 4CXMA 2PXCA 3LY9A 4B4WA 4PYNA 4XWYA 5CK4A 4J49A 4D9MA 5FLKA 3FZQA 4S2EA 4AJNA 4Z7OB 3A37A 5FHQA 1C50A 4NENB 5AVKA 3IUMA 2EF0A 2OQRA 1H66A 1XAGA 3CWCA 4KR0A 4OLHA 4MW1A 4URVR 3HCDA 1CZKA 1R10A 2PVPA 1S1MA 1A4RA 2G36A 2XUGA 3R3SA 3M4NA 4N5LA 3HUEA 3SVZA 3WWOA 4EKYA 1FK8A 4UAGA 2NNWB 3U7FB 3JQGA 4OMCA 3KALA 4O4LA 3RYIA 1TAHA 1RZRD 2OG2A 1O57A 2W37A 1K5HA 3Q8WA 4ZU3A 1EVIA 4JI1B 3R0QA 3I61A 1KH2A 4HDKA 3LHFA 4ZVSA 3BD6A 3N1UA 2ZIUB 3SEQA 1R3UA 3UFXB 5ENZA 1GAJA 4B47A 2VTBB 2AR0A 3H16A 5F98A 4GOLD 3BWMA 3NATA 4HEJA 2ZUFA 1H5NA 3D3WB 2HCBA 3SM9A 1T6YA 3WGVA 1GCOA 2OORA 4QBGB 4FSDA 3JX9A 4NF2A 5ARBA 4TRNA 3I37X 3TCXB 1B6SA 5KC9A 3ANSA 1CQXA 2CDAA 5T64A 4F7WA 3T7JA 1P7VA 2D2EA 1ECFA 1NF2A 4FWBA 3FYTA 4D9HA 2E18A 3BERA 1J0AA 4WNAA 5I51A 1UOOA 1WHTB 4N0PA 5EJ2A 2DBRA 1L9XA 2HADA 1R0LA 1CY4A 4ZI3A 4XR9A 3TLXA 3AFNA 1WLSA 2HF7A 1NOKA 3HSYA 1W88A 2H59A 2E85A 4HQOA 1ZGJA 1M1UA 3UJBA 4DA8A 3UKOA 3FW1A 1X80A 5F35A 4EHJA 9LDTA 5CCXA 4K9NA 5CPBA 5LKRA 1KEUA 2WF6A 1RAHA 1CZRA 4GGPA 4J1TA 4KN5A 4PVCA 3MMSA 4RSHA 4XTRA 3HE3A 1WXXA 4E2FA 3A6EA 4FMDB 5KU1A 2XF8A 1T1EA 2A0XA 1BFDA 4TTVA 3W5IA 4KFUA 3PGXA 1BVRA 3B5JA 4YP1A 4CHTA 5IJ9A 1M2EA 4Q1DA 5HXAA 1SC9A 2P91A 1ODSA 3L05A 2GKGA 1T5OA 1RACA 1JT9A 1VSUA 3L8HA 3AF2A 3PP8A 3NJRA 4O1HA 1PFUA 5CU7A 5JDCC 4B17A 1FNSA 5GONA 3AEKA 1JFFB 1SG9A 1VL6A 2HJHA 4WEQA 1NBMD 4BJ5A 2AWOA 1FSZA 4AQDA 2L18A 5CTAA 4LF9B 1HYQA 2I91A 1PQWA 4MHSA 4HC4A 2Q7OE 2Q49A 2CJXA 4W99A 3ESAA 4H16A 2I6GA 4JROA 4GSLA 1KAGA 1UEXC 3JZAA 1Z5OA 5FHRA 1XMOB 1QCCA 1IN7A 4ZQHA 5I7UA 3HC7A 3IP5A 5ERYA 2PR7A 2AJTA 2F00A 3KOYA 4RMGA 3TEMA 3I53A 2OO7A 2QRUA 2J9FA 2X8AA 4AJKA 3ZHZA 1C8VB 3CZMA 4GBMA 1YO6A 2CVPA 1VL1A 2NAFA 4P4GA 4X20B 4HAOA 5HUJA 3E6AA 2J3JA 2FPMA 1QIGA 2HSZA 3TW4A 1ZZEA 1G7RA 3H13A 1GFIA 3KLNA 4Z0PA 1IN1A 2IYAA 3J7AC 4WLVA 5B6IA 3JALB 2PUGA 2AMJA 1RQ2A 2ZAIA 3FSRA 5AIAA 4EIWA 5TIIA 3IBSA 1P4SA 1RMQA 1T5SA 2AI1A 2FRDC 2Z5LA 3FUUA 4CBVA 1H3NA 2ZQYA 5AW6A 3G8BA 4MWCA 4KRYA 4DUZB 3WK6A 5SZHB 3KDPA 1O08A 1CYDA 4I9GA 2QD5A 4MK4A 3AVVA 3BGDA 1XHFA 5IABA 4DMCA 3IPCA 3WK4A 2FN7A 3LI2A 1D6MA 2PIDA 2W9XA 3LPMA 5A4DA 1FMTA 2CLHB 1I14A 3K9WA 5HJEA 2G8NA 3H05A 2WJVA 3IQIX 2ZWVA 1Y6QA 2I2DA 1I9GA 3P0FA 4GKAA 1TYAE 2CLEB 2PD4A 4EHLA 1AO0A 3AESA 1JDSA 1QR2A 4KQWA 2Q7DA 3SYTA 3TTYA 3N74A 4TZ0A 2N46A 3C7CB 5C0OE 1QFZA 2GWRA 3OE7D 2FN4A 3VPCA 4C1BA 5B53A 5JCJA 3CZ5A 1KORA 3LX6A 5D6NA 5LZ8A 5AVSA 1TAUA 2A84A 2WVHA 5AMXA 2F7SA 1P7CA 2YZ7A 1YCHA 2ZRNA 4FZRA 3L49A 1LJLA 3QJYA 1VKOA 2RH8A 2RH9B 4C05A 4YVFA 3RVBA 1UF9A 2C00A 2OCIA 1Z2NX 4S1PA 3HY3A 1BJTA 2OCBA 3QLUC 4MP6A 4W1QA 5EN4A 2V8BA 1IN4A 3FDJA 5G3ZA 4ZI7A 2SNIE 2Y2VA 2EQ5A 4K05A 4DMHA 3Q7SA 5DHUA 1YQWA 3FFTA 4ECEA 1Q0RA 2BJHA 3HA3A 3SDZA 3E18A 4FX5A 5HIAA 2COKA 3RARA 4PZZA 1KI9A 1MIHA 3MF4A 3MFYA 5JXWA 1BXRA 1FL9A 1VCOA 2H29A 4HFMA 4B8YA 1A9PA 3QEKA 4JGIA 3EC7A 5JH7F 1UEIA 1Q57A 4MYDA 2POCA 4C76A 4EARA 3BT7A 2II6A 1IFXA 1J0EA 1JYFA 1OCEA 5AUNB 2EQBA 1BN7A 1TB4A 4YJFA 5I8ZA 4HTAA 2IUUA 3RVQA 4DLVA 3U4QA 1HMPA 1MMFB 1U7HA 1KZGB 3G2OA 2L19A 1WO8A 5ESWA 3EAFA 5HF8A 1DC5A 1EJ2A 5C5EA 5CGQB 4LYJA 2I6QA 4BU1A 4D45A 4R5HA 4BBPA 5AVVA 1M83A 1ZK3A 1ULSA 3D5EA 1F0YA 1BDIA 1RABA 2OEPA 4RF5A 4ZVUA 5K4AA 3LSTA 4JELA 1W30A 2O6HA 4NHEA 4Y6RA 1OD6A 3KQNA 1U2DC 1P0MA 3GNLA 3L92A 1G21E 2GN1A 3HP7A 1C81A 2P6OA 3A1EA 2H5IA 1D1QA 4O33A 5I7FA 1GZSA 2AOTB 2Q21A 3H9BA 5K51A 3RS7A 3NIDB 5D6OA 3RBXA 4FDVA 3QKTA 1DWQA 3ZNNA 2JVIA 3NTXA 4R0VA 4RV5A 2OWDA 2Z83A 3FPAA 4C7BA 1DDOA 2P2ZA 3GJZA 1J0XO 4L9AA 2VO1A 3UJAA 4QYXA 4U2FA 4D8WA 4EAQA 5A3RA 2EWVA 1HURA 4FEAA 1VG1A 2ONKA 5GJWC 2H48A 4KDRA 3CC8A 3TRFA 1Y9JA 3K09C 2G1JA 4K1XA 1PYOA 3PGVA 1P6XA 2PV0A 2YQZA 2EATA 4LQDA 1SUWA 4TT8A 5DKFA 2XXAB 1ZJJA 3ROGA 3GEIA 4QHTA 1M5RA 4N0MA 5KBYA 4IJUA 4EBFA 5LYJF 3VC2A 3WX0A 1ZK1A 1YR3A 4MOWA 4YRRA 3ZDYB 5DN6A 2PUHA 1Z83A 2X4LA 1EZ1A 3HCRA 3PNVA 5DIZA 2B2NA 3B7WA 2GZ1A 4WBNA 2F4VB 2J7PD 2PUJA 3H11B 3O2SB 3ZNOA 4GMFA 4YROA 3SC4A 3KD2A 2H3HA 3H75A 4RETA 3HYRA 1TM3E 3EWAA 4KYUA 4XYBA 4N0QA 2QLMA 4OHWA 5FO0A 1KY5A 2AHOA 1E1QA 3ZHUA 2JLZA 1PYDA 1YQUA 2PV7A 5E9WA 3WIDA 1JHDA 1H0RA 3L1KA 5DZSA 1EA7A 3WWEA 1NQTA 2VH5R 1PR1A 6CHYA 3ZDAA 3L0PA 3UB4A 5G40A 2QRZA 3EGWA 1T26A 3EFHA 4MB6A 2VQ6A 4FIZA 1FRQA 4JNCA 4MITA 3IMGA 3A2KA 5BSGA 1ELOA 1F2UA 1F1BA 2QTAA 1X86B 2IHVA 4XRRA 5DBGA 4CNBA 1EM8B 2KHZA 3IBFA 4HT3B 4F06A 3QVMA 1JEYA 1E60A 4W7IA 1TFRA 1L1RA 3EHDA 1G8PA 1P2GA 1WCIB 2P67A 3KQYA 4R01A 3IHTA 1U28C 3MWEB 3SR0A 4FDTA 3B85A 3V33A 3HGMA 2K2QB 1T13A 2ABWA 4P58A 4I55B 4V0NA 5C8XA 4LXIA 1CF4A 4BVKA 5LZ9A 2XYRA 1VSVA 3ENVA 1F2TB 4FE3A 4TV8B 4RHEA 1QS0A 4YAOA 3Q1KA 2YVAA 3R77A 1EDOA 2G1UA 2XGMA 5EMJA 1C3XA 2WE8A 1P0PA 3P5SA 2YMQA 3RI3A 2JIBA 4FYMA 1ADFA 1MAWA 1USIA 3RRJA 2E4YA 2HJVA 3WFIA 4YUXA 3NBAA 2J9YB 1LA2A 4LI3X 1PHPA 4R8SA 4RSRA 3OTIA 3IS3A 4L75A 4C4PA 3E05A 5JWOA 3PEWA 1QHGA 2P7IA 2OQIA 5DASA 3RYCB 3CR8A 1RMYA 4V02A 4F1WA 1KMNA 4AY5A 4M8SA 2FSUA 1FJXA 2A5YB 2H2DA 3AR7A 4G4SP 4UFNA 3GJ6A 4HAWA 1BH6A 1F3OA 1YZNA 3V1MA 5CNMA 2VUUA 4OHUA 4J9UE 4HX2A 5IXYA 2XMQA 5KSPA 4UCXA 3DOUA 1VPLA 3PSHA 4DV2B 4C2UA 1OXKB 2ZUTA 2JD2A 5J2UA 5AI6A 5JSZB 1PZNA 4L5IA 1USVA 1CG6A 4N65A 4UEOA 3QTTA 3BK1A 1IUPA 2P9QA 3FNQA 4YB8A 2FZVA 1MC5A