2PH7A

Crystal structure of af2093 from archaeoglobus fulgidus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
227
structure length
220
Chain Sequence
GMDVEIVEELSKMLAGRKAVTEEEIRRKAIRCALKIMGARLVGIDAELIEDVTCSLIDLHFSEKVKIGDVLFYHPHVIKPEKEDFEQAYFEYKQSKKFLDAFDIMREVTDRFFEGYEAEGRYMRKYTKDGRNYYAFFSTIDDTFEDVDIHLRMVDEVDGDYVVIVPTENELNPFLKFFKQYSEDAKRAGLKIWVVNPDEKTIDPFIGYPKDFRLLKGFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AF2093 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein AF_2093
total genus 54
structure length 220
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3400.10 Mainly Alpha Orthogonal Bundle af_2093 domain like fold af_2093 domain like 2ph7A01
3.40.50.10670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold af2093 domain 2ph7A02
2PH7A
chains in the Genus database with same CATH superfamily
4ZQEA 4CDRA 3I28A 3RVKA 4WADA 2H1IA 4N7RA 2B4RO 3OQBA 3RYHA 4A8JC 1NXSA 3A6GA 1MR3F 2HNAA 3FDXA 2VQ3A 1GGVA 2B5OA 1AURA 1QG0A 1SB8A 3L7IA 1S96A 1R5BA 1JW9B 4WK0B 4DMKA 1PYOA 1T1IA 1XEWX 5JSKA 5M29A 2WHEA 1TTQB 1A2KC 1DBVO 1IQPA 1TK9A 4DS3A 1HOXA 2B5VA 3M1YA 4L8LA 1L4MA 3PIDA 4QD3A 4E07A 2VN8A 4MS3B 1CUHA 1ZSNA 3AP1A 2PWBA 5CDYA 3CKMA 2PLWA 4NVRA 1BMFD 2BSAA 4JCCA 5TPZD 3DTVB 3U4GA 4CV2A 3I83A 5JQWA 2GLTA 2CL7X 1ZEJA 2QX7A 3D4OA 2ZIUB 4NDAA 4XDZA 2Q7DA 1VBMA 1CHDA 1CK4A 5F5LA 4BCDA 4EA9A 3QF4B 2CXTA 2NAPA 4KGVA 5LR6A 5F3RA 2JFNA 1IHUA 2NU7B 3MHPA 2SBTA 4HDNA 2NXCA 3OJ0A 2VTVA 4MUBA 4ND4A 3T7IA 3ZN2A 1V5GA 1KEZA 4Q1CA 5DJ5A 3VU1A 3ZH9B 4TVKA 5DGTA 2YXPX 3O31A 3TN7A 1YZTA 5LBUA 1QRSA 4Y2RA 4YRDA 1FDUA 1RNLA 2QTLA 1H2XA 1G9SA 1MXHA 3IEKA 1OFTA 1R74A 3R5TA 4EMSA 4HZIA 4BFLA 3PNPA 3LDFA 3VTKA 2BSQA 1P7PA 1F7VA 1THMA 4ZAZA 3PFIA 5K8VA 1QVWA 4UM5A 3SLKA 3W9BA 4WKNA 5TIIA 3R7BA 5KJ6A 2CXUA 5KCZA 5KSZA 3THYB 1YIDA 2FQQA 4XLTA 3OMWA 1JVNA 2VBFA 3OWXA 5J40A 2FF7A 2FK7A 1JEEA 2ID7A 5KOYA 1N0HA 4RENA 4N65A 1FMLA 3ONVA 3BXHA 1K98A 4FLEA 1H9AA 3N3AC 1KI1A 1Y6GA 2WWRA 4EB0A 1PFVA 3CH5A 4R1OA 3FB1A 3VDMA 2ECKA 4NCKA 3T9EA 2ZWIA 3WK6A 4HZUB 3L9XA 4C0SA 4G2NA 5H3LA 4S0ZA 3ZWMA 1KZGB 2GBFA 2GFIA 2AN3A 2QIPA 3DL2A 4GI5A 4XYEA 3VZDA 1O0BA 5T4EA 3OJLA 1NQUA 3CF4G 3VPSA 4CR7A 5A5FA 3FWYA 1IBMB 2Y68A 3QYAA 4FR0A 1I7DA 3ROXA 1JPUA 3RE1A 3GBVA 1DBIA 4PSVA 2VDNB 5EKTA 1Q1NA 2VAXA 3GAZA 1JAYA 4D44A 2I6SA 1YVRA 2LRHA 2QRJA 2ZI7A 5E6SB 4ER3A 1NBIA 2WKQA 3A04A 1QS0A 4GOMD 2XUIA 4H0NA 2OQIA 4XWWA 2YYYA 1I9CA 4ARSA 2IYNA 3W4KA 4B7XA 4C0JA 4MI1A 5G1NA 2A1TS 2VXOA 3M1IA 2HA5A 4UHBA 3NMUF 5K2OA 2IUSA 4JEHA 1EDDA 1Z6YA 3C3BA 2P69A 3EE6A 3VO9A 5CITA 2F1HA 2WF9A 4H7DA 4M8IA 4Z86A 4OMFG 1BA2A 5CIYA 2D5LA 1VCHA 3ACBA 1QIGA 3ASYA 1I14A 3GJXC 5JALA 4X65B 3ST7A 3HCWA 2F9MA 1U8FO 2HNBA 3AMVA 4NJMB 3CNNA 1QYXA 1RLIA 4GLOA 5EXDA 4ZT7A 5FUMA 1J2YA 1KBZA 3BB1A 3HRKA 2Q99A 2SKEA 3Q8WA 4A2CA 1E94E 1SOVA 3PI7A 1SKUA 1Q14A 3M4YA 1IBKB 1C9JA 3FB4A 3G9TA 1JPNA 3OJXA 1Z2NX 1NU6A 2JFOA 3G1UA 1G63A 4H3KB 1RAEA 2JIOA 1RJWA 3CN9A 4OU4A 4H59A 2X0JA 1NG9A 3A6ZA 4QUJA 2IH4A 2E5WA 2BDTA 3NX4A 1LPNA 1YDFA 1XP8A 5JAQA 5THKA 2DG2A 2VJKA 1FSZA 2GKGA 4J8PA 3S2ZA 1PQUA 3VKGA 3QHPA 5GONB 1KVRA 4ZXFA 2BI4A 2AW3A 2OO5A 2Q9UA 3QVGB 1KS9A 1JR3A 1PKEA 4Z7QB 1R6AA 2JA2A 4PLFA 2F1KA 3CM0A 5HK9A 1XB2A 2PKRA 2B8JA 3C1OA 3KL2A 4LDJA 4OB7A 3DAOA 3L92A 4GG1A 3GNSA 4DCMA 4EGAA 1RIIA 5FBZA 4RXTA 3VHXB 2DLNA 1T0PA 5EWLA 3W5VA 3ZV6A 4AKSA 2FCAA 4BMXA 2YKGA 4OEHA 1G5TA 3KXLA 4BQRA 3HXOA 3ZHUA 2Q4TA 4LECA 2AYZA 2RG1A 1JHZA 1MDBA 3IGFA 5EN4A 2FI1A 2F1RA 1H6CA 1FNSA 1LA2A 2C9ZA 1KO7A 3EPPA 1WXGA 4HAYA 1SC9A 3QBEA 3SI7A 5I8WA 4EJSC 1YVEI 4EUSA 3LF2A 3G1WA 3D1LA 1MB0A 3K9GA 3UJAA 5BN5B 5EGNA 3DQQA 4NSNA 1SXJD 5B57C 3ZY5A 2ZULA 3IIEA 5K8CA 1XCJA 1SXJC 3OLYA 4G0PA 4ODIA 3RIXA 2PYZA 1Z2OX 4Q9LA 1PUXA 3ZBUA 1PD1A 1XFDA 4FLFA 4MUAA 1UBRS 2JCVA 4P4UA 4B2PA 1QIEA 2BFEB 4G0MA 3BE8A 4MQMA 5HG0A 5HPYB 4MKIA 3ENKA 4UDNA 1PN3A 1ZK3A 5B6IA 2YHIA 5KOJA 2KYRA 1UUFA 3HCCA 3IVAA 2Z2IA 4HYYA 4IHJA 3K0AB 5HWSA 1JR2A 2H0QA 4RZHA 4PSUA 3GO4A 4M8LA 1JG3A 2OILA 4CIWA 5I45A 5JECA 3L4BA 5EJIA 2XNCA 2FX3A 1KO5A 3O7MA 2H2WA 2EEZA 3NC0C 5HUJA 2QU7A 1JKIA 3HGMA 4Y67A 2ZJ0A 2F59A 3LBYA 5DO9A 1VIVA 2CFCA 1Z62A 2C4MA 2IE0A 2PM8A 2H2AA 3ABOB 3NJ8A 3OLWA 4R0MA 2J3IA 3UNXA 3LD9A 4UZSA 2PSFA 3OHPA 1G8FA 1JAZA 1G64A 1K89A 1KU0A 3AEUB 4MVJI 3PQ5A 1UBHS 3T7JA 4D4LA 1OC2A 3AF0A 3M34A 3N9IA 3JVDA 2ZDHA 2AUNA 4J0KA 4W5RA 1UWKA 4RVNA 2EJWA 2BGGA 1Q84A 4ZALA 3FSRA 3AP3A 4D6XA 2P41A 1Z5OA 2GCPA 3KZXA 3MQ2A 3PHHA 3RNLA 2AI1A 3OFKA 4RM3A 1BU8A 1TQDA 4Z0NA 4A2QA 1W34A 4X1IA 4L5CA 4AJEA 1WV0A 1TUGA 4B3RB 2JJ2A 1VXOA 2X8BA 4LSWA 2B4TO 5AKEA 4BU0A 3LKZA 5K99A 4XDYA 2AFHA 5H9WA 2QP9X 2JBWA 1ZJYA 2YH2A 3HYTA 4RCVA 4ZAVA 4K9OA 4MIEA 3JQBC 4P3PA 4Z9YA 5KOIA 4RTNA 1Y3CE 1N25A 3AUXA 4LTDA 3DCNA 1O0SA 2GNPA 4MINA 3E35A 4RA9B 2ZM5A 4AY2A 5CB6A 1TJ4A 2HIHA 2JGNA 2YIDA 1YR8A 4A82A 1UBSB 1YJBA 2WF5A 3VH1A 3E5MA 3D1JA 2QMQA 4KQWA 3P9ZA 1N7HA 2E9SA 4TM8A 2HTEA 1Z7GA 3Q6NA 1ESDA 1QH9A 5A03A 1JB1A 1NQAO 4PLGA 3NM6B 3G2NA 1TLTA 3LKBA 1K2VN 3AUYA 4C3VA 2Q1UA 3KTDA 1XKTA 5A04A 4FD3A 1EGMB 3CCBA 4LMBA 1D0SA 1I7LA 5IEBA 3ZWQA 1LX7A 1CZKA 3OY2A 5D3KA 2JFVA 2WJ6A 1YE5A 7ABPA 3T3DA 2COKA 2XHEA 3LCJA 3NLLA 4ID3A 1N7GA 1VKHA 5FBHA 2O8FB 1TJYA 4I7EA 4KE7A 3VYTB 4OQPA 5AH0A 5K0TA 4MP8A 1PT7A 1KKUA 2OV1A 2F43B 2PE5A 1U3WA 2ZI4A 5JJLA 1C3XA 5LP6A 1O94A 3AI3A 3RS0A 1XZCA 2R5FA 1G5QA 3A1VA 1XTZA 1YBMA 2Z3VA 4WCVA 2CL0X 5ITWA 3NI2A 4C5BA 3QI2A 3A2LA 3SSNA 1OZ0A 2FE4A 4INZA 4CFYA 5I9LA 2CLFB 1SM4A 3SM9A 4ZOQI 2AK2A 2PT5A 2XUDA 3HJCA 1ACJA 3AB3A 2PNFA 2YY6A 1YONA 4HQKA 2XZLA 3BXZA 1QRUA 1A4XA 1D7AA 1GTVA 1WPGA 4G4SP 2VT2A 2HPHA 5TF0A 4B33A 1J39A 3GYGA 5TQJA 2FPXA 3JWJA 1JNYA 4I1UA 4DDTA 3GAAA 4MDYA 1V11A 4MLZA 3QU2A 1JDUA 4PPYA 3TEFA 3KR1A 4LYGA 1HGXA 2FMTA 3MCZA 1H1LB 4Q3NA 4AJKA 4PTYA 5B3AA 1P4AA 1EM8B 1OWOA 4I08A 2XA9A 5DMXA 2WU4A 1IUOA 3STUA 1U6IA 3TD6A 4H7EA 3EPKA 3H9QA 1U0FA 2OD2A 3I0MA 1Z6TA 4K03A 1OASA 4FJ0A 5FBLB 2PGIA 1MRSA 2W6ZA 4HEHA 4QBGB 3ILYA 4DNFA 3IQHX 4E5DA 4DCOA 2H1HA 2NO5A 4EJ0A 4JL5A 1H4QA 2UXDB 1XAHA 1J8FA 3TZHA 3QSYA 2GT1A 1NNI1 1NMYA 1GKLA 2G25A 3R8CA 4COKA 1AZTA 2Q6KA 4D5GA 4EJMA 1S2DA 3H6KA 3LQ4A 1E79A 1RMTA 4EBBA 1ZD3A 2C4VA 3SOZA 4MP6A 4E6PA 1R0RE 4UE3S 3N2YA 1VIDA 1T9HA 3L01A 3QE0A 2YJNA 4UU1A 4ZOEA 5EXPA 2FWNA 4JIMA 1X3LA 5KSYA 2HXYA 3F7OA 3FGNA 1QR6A 4Y98A 4BWYA 1LV8A 3HZHA 3NBQA 5L7WA 1CUYA 5IMBA 3ZCVA 4MGHA 3NIWA 4GVPA 2N3ZA 4LXQA 3IHWA 4MTLA 1MU0A 3KBBA 2ZI9A 5TNXA 4AMVA 1LVGA 4EW1A 3UCFA 4IEIA 4CEIA 2OPBA 2XWSA 4D25A 1OC4A 9GPBA 3V1TC 3H7IA 5CD9A 2JZOA 2HY7A 3R3ZA 5EHQA 2ZPUA 3RRZA 4A0SA 4M55A 1E4EA 3L7DA 4U63A 5F7OA 2JJ1D 5FTNA 1TT7A 3JCZA 2H9AA 1VHDA 1Y9ZA 1GZDA 2FQXA 2REBA 3NBFA 3OAAA 4AZTA 4EAAA 1VZ2A 2OZLB 4YCMA 2GASA 1QE0A 2F43A 2MSKA 2RKBA 2PSJA 3NBYC 4AJ2A 4Q82A 1R0CA 3NTXA 4ND3A 3DJFA 4ZIRA 1CUWA 3Q7TA 3HY4A 2B8TA 1TVCA 4KW7A 1UKEA 3AR5A 3DYIA 3W8DA 1G291 1U9CA 4CCAA 2P6PA 1DCMA 2UYOA 1OR8A 2YXEA 1FFHA 3KJHA 1BJRE 2HDOA 4PCLA 1FYXA 3TL6A 1JB9A 4PAQA 1USKA 2QTZA 3ZJ5A 5F98A 1B6RA 1ZUHA 3BPSA 2XEXA 2BFCA 1XKLA 2LP4Y 4KJXA 3UG6A 4RJTA 3U09A 1ZL0A 2IEIA 4TKUB 1J8QA 1UDRA 3AOEC 4JYBA 4NKRA 1XCPA 4XWGA 4EKDA 4J9UE 1RHJA 2GBLA 1HZZA 4B3JA 1WZEA 3P5BA 3CURA 2IVZA 1HE2A 2HBRA 2XGGA 3C3JA 1Z5GA 2I99A 4AURA 2XSZA 4JODA 5MFPA 2BH2A 3AI2A 1FDWA 1JEDA 2DBVO 3FGOA 3HRHA 1JU3A 1ADYA 4KSBA 4NZYA 3FFAA 2G0TA 4M22A 2IS4A 5U4QA 1XTKA 1L5FA 1IB6A 4XDHA 5GPBA 4LDPA 4ER5A 2BTQB 1F20A 4FU0A 3RWOA 1KI9A 2DRIA 1PT9A 2JCYA 1E0JA 4AO8A 1DZ3A 7AT1A 5C18A 3RODA 4UVGA 5HFAA 4GWGA 1GPNA 3RUCA 3OO1A 3VGPA 3NWEA 4UBIA 5BQ3A 2INGX 2J3DA 5A7HA 3UJ8A 3ZLUA 2J3KA 2Q3MA 2TYSB 2WNSA 3G0GA 1YOVA 2KJQA 4MYHA 4MJLA 1E1MA 3E22B 3FFXA 4RELA 1LQUA 1YRWA 1Z0AA 4YT8A 2LIVA 4URVR 4MKRA 3UH1A 2NVWA 3RIHA 4IHQA 2V58A 3TPZA 2X76A 4HAUA 1NLFA 1R0XA 1X7ZA 4RF5A 2X0EA 2AR0A 2A6PA 3KD3A 5J9FA 3DKKA 4X41A 2ETVA 2XDAA 4NH4A 4LS3A 3CV3A 1LLFA 3PNKA 4PZCA 1TC1A 3UGKA 3HBLA 3P9PA 2OORA 5FLXA 4E5KA 5BY2A 4J49A 5SYAA 4WZAB 4IEEA 5EKDA 1Z2DA 2XXAB 2MR6A 3EIFA 3QWFA 3PUHA 5A1TA 1DG1G 2G6BA 3KYDA 2WTAA 4DY4A 3OETA 3UMCA 1Y7PA 4KH1A 4XJXA 2DKNA 4MLCA 1TVKA 5CFRA 2VZEA 4Z53A 5IVIA 4MYDA 4Q47A 2IXAA 4FUTA 1T6YA 1OWNA 3DEFA 5EKSA 4Q15A 1E3WA 4KR2A 5KTRA 4BFVA 1T36B 1DAGA 3I04A 4HNGA 4UBLA 1PK7A 3MK31 2UUPA 5JC8A 5A6VA 3BGWA 4OUKX 3U19A 1UADA 2H3EA 3OQMA 3FOZA 1JEQA 3NUQA 2J5XA 2QSYA 4WZBA 3DD1A 2O2DA 4U2BA 3W5DA 2NXJA 1GWNA 3IKMB 3QUSA 2F17A 3L0CA 4U6SA 5IVDA 1KP9A 3BF7A 2CF6A 2H31A 1UK7A 3E9CA 1G7RA 3NTUA 3Q85A 5BNTA 3PJGA 4GC5A 5EMNA 3FVWA 2GA8A 2WZDA 3LOUA 4J6EA 3U3JA 2I7DA 5K0EA 5LXTF 5C3MA 1U1DA 2BR3A 3VR3A 4XRGA 3AHFA 4WA7A 3LQ1A 5FA5A 5T57A 3BRWA 4MR7A 4Y2PA 5LYJA 4AJ4A 4ALKA 5IF3A 2JKZA 3HJHA 5CVCA 1U0JA 1Y6JA 2WT8A 2ZB8A 3DDUA 4U9HS 3RJ5A 4L6IA 1KZHA 5I3CA 3KPYA 3TQHA 4JLVA 3HZRA 4R7GA 1M6YA 4DT1B 4LHVA 2YV2A 1L8AA 3FH0A 1QGOA 1GRNA 4XQGA 4OHRA 5CLQA 3ZCUA 4GSLA 3G82C 2GM3A 5IX8A 4MB2A 3EYAA 1Z0DA 4RDHA 4R1PA 3NANA 5JS7A 3QNWA 4FFDA 3V32A 1YCHA 2EP8A 2C20A 3BRWD 2OV3A 4E09A 4XGRA 5LQKA 1KI2A 1MENA 4XTRA 4BY9E 4MYRA 1QPBA 5CIQA 4EABA 2F9LA 1BIFA 1NUQA 4URZR 3S28A 1SULA 4ARZA 1SK9A 3NTLA 4R69A 3U0VA 4IM7A 3IUPA 1F2UA 1YH3A 4QSHA 3WO1A 3NFYA 4OJNA 5DMHA 4DQ0A 4DLZA 2AEJA 2ZWOA 3HXLA 3MCVA 3Q88A 4TMTA 4Z7JA 1P2TA 4U8HA 3CWCA 5CCBA 1HT1E 4C4YA 2X4GA 2H7XA 4HXYA 4QREA 1YHYA 4UD2A 2C95A 1TLFA 5I7EA 2WJYA 1NIPA 3KWFA 4YUWA 5CUQA 3URMA 5FOVA 3R5JA 2C7GA 4DR4B 3H9CA 2XCUA 4D1YA 4DLAA 4EPXA 4D9MA 3HDVA 4ZP1A 1N32B 3QLVA 1UC4B 2DUUA 2X1VA 2ZUSA 1XDGA 2IK8A 2J41A 1RCFA 2PKXA 3LCVB 3PUYA 5H81A 3PPVA 1EVZA 2HQ1A 2PS3A 3RWMB 3ZZNA 3BD6A 2VYCA 3BMNB 3WIUA 1YA4A 2NVOA 3H5OA 1ZCJA 3I6YA 2BGNA 3MBIA 3W1WA 1Y3FE 3KQOA 1KDOA 1OKKD 1Z35A 4MPDA 3B82A 2JI9A 4FQ5A 3SBDA 4DIUA 5FWAA 2WVGA 1XLTA 2HA4A 2KMLA 1A98A 1ZA1A 3B85A 3HL4A 4X0EA 4G0OA 3DL0A 5DN6D 4BIMA 4YI3A 4DV6B 4W9MC 3GGDA 3K1YA 1U3VA 5C1OA 3PYLA 4Z9AA 1P4RA 3NIBA 5K3AA 2DF8A 3N2ZB 3FMIA 3QVMA 4J7AA 5C8YB 1P1BA 2HSGA 2HU5A 4F3RA 4HMPA 4N3BA 4RJLA 2ZTUA 1OD6A 1Z4LA 3ANNA 3QVGA 4C1NA 3ETLA 3GELA 1W29A 4MGZR 4BTVA 4GQIA 1CU1A 1U3CA 1J0AA 2EKQA 5J4KA 6CHYA 3J80A 3DWIA 2I6QA 1Q1QA 1M0TA 2FUCA 3R0VA 4XCQA 2D5IA 2CNNA 2WKSA 3PGXA 4DC1A 1MABB 2BMEA 3LLCA 3EWSA 3UHPA 5I51A 4LJLA 5JSUA 4JEUA 4QXAA 4BNFA 2ZUWA 3N8DA 4DLWA 1OHHD 3SE7A 6GPBA 2Y67A 4K6MA 4OJMX 1BEUB 1J8VA 2VHYA 2Q3FA 2X9NA 2REQB 1NP7A 3ILXA 4M4SA 2OFFA 1F5SA 5SYMA 1YQDA 8OHMA 3WYAA 4F72A 3DXXA 3QELA 1SCQA 2IXBA 3W04A 4L8FA 4XGNA 3V80A 2W00A 3SICE 4GEKA 3SP1A 4XM1A 2GKSA 4CKWA 1BDMA 1TD1A 1QIHA 2PMCA 5DZSA 1GAWA 4Z3KA 4WXRA 3TIFA 3MRXA 3W79A 2VQEB 4P5EA 4GOJA 4K3VA 3BJMA 2X4DA 3F3SA 5KU1A 3UHJA 5HKKA 2A57A 1QTQA 1V8PA 1KIAA 4DJDC 4YYEA 1D2EA 2SICE 2O54A 1MRZA 2QAGB 4JBXA 5A06A 1P9LA 1S3GA 1WZUA 2QENA 2WU1A 3HJRA 3JRNA 4HWPA 4P5PA 2W6PA 4XWOA 3R40A 2Q4EA 1CUEA 3OZFA 4AWAA 3AY7A 1KH2A 3NTQA 4HUQB 1FJHA 3KHTA 2Q9BA 2EAUA 4NBVA 4YVFA 2ZBRA 3MOSA 1ATZA 3A28A 4O2LA 4L0DA 3CF0A 5G0WA 1UK8A 1R1DA 2O2XA 2UZ0A 4JH0A 4IJVA 5FOSA 1QANA 1OU0A 1CTQA 2EBFX 3Q3CA 4FCCA 4HS9A 4KPYA 3GRKA 1PTJA 3OKFA 4OBBA 5GOZA 3ILSA 1Q91A 3FFWA 3ZQKA 4GMKA 1QHGA 3EGIA 1JUDA 3OC0A 3LY7A 4RF4A 1ULTA 4IS2A 1NQVA 4GWLA 1Y8RA 1Z47A 2VUSA 4HD8A 3FTQA 3VGJA 2GEFA 2QZZA 1WMFA 2ADFA 1FMTA 2FN9A 2G4CA 4OBEA 2F3QA 3BFXA 3UEOA 4B31A 5ICGA 4AKTA 4EJFA 1LFAA 1P3JA 3U4MA 1IM8A 3EFHA 3OPYI 4DNQA 2WA2A 3D4PA 3ML1A 3OZSA 3OOJA 2ZRQA 1L5LA 3IOMA 4MYCA 4CT5A 4NYJR 3MJRA 4XM2A 4RTKA 1Q0LA 4LJYA 1YA8A 1EQAA 2X8JA 4GX0A 4OL0A 1O6GA 3C39A 4DLRA 3TUJC 4DLBA 2MYNA 5KBYA 4UBMA 3G13A 1OH8A 5FLEX 2GJSA 1OWPA 1BXRA 1YO6A 1PNOA 3E0XA 3DHEA 3MZ0A 1M1UA 1H4VB 1Z28A 1Y3BE 1SG6A 3FOCA 4WLFA 1JN0A 4KVFA 2O0KA 4F86A 1FLNA 1PNVA 3E3AA 4BO1A 2H2HA 4NS4A 2D00A 2LE0A 1FYEA 4YCJA 2J3EA 5FOUA 1J00A 1ZM4A 4NR0A 4MV9A 3RJ9A 5JTUA 5DNAA 3OCJA 2VR1A 4EI2A 3OP4A 2YYZA 4B6QA 3ADBA 5CDHA 3CLUD 3T7RA 1QB8A 4UNSA 1KAQA 4IGIA 3VBCA 1FQJA 2OD7A 1EFHA 1QZZA 1T8SA 3IOBA 4I81A 4YBZA 3UC9A 4UUQA 2VTBB 2BZ1A 2ZAYA 4H3VA 5CFZA 5ELMA 4JBIA 5FP0A 4IGKA 1KEEB 2OCLA 3VHRA 1S2OA 3EXHA 4Q00A 1LQTA 3P96A 4R1QA 2BUAA 1DUIA 4GPEA 4PWYA 4AMUA 4KXVA 4NZZA 5CW2A 4DG8A 1U7HA 2GYVA 1US8A 4UNRA 2H0AA 3OZXA 2ZATA 4GD3Q 1BS1A 1OFIA 1U7UA 4ZHSA 2VDMB 3WQHA 4QM7A 5F51A 1H3FA 3DZCA 1IOWA 3GEDA 1IBLB 1WV1A 2B20A 4Q4CA 4YRQA 1T6NA 3BIJA 5ETJA 1GPAA 1TEHA 5FF9A 4ZQCB 2FW9A 4RS4A 1CSEE 1HT2E 1Y7TA 5F1PA 1DO8A 1WOYA 5IAKA 2F7SA 3A9WA 4EYOA 1NVVR 4PNHA 4UVDA 3ZY2A 3TW4A 3BULA 2PUFA 1N2ZA 2V3CC 1R12A 5EI5A 1KFEB 3E2PA 4F4HA 1SEVA 4K0RA 5FUYA 2WV7A 3GJ7A 2CLDX 2REOA 2GN8A 3CNHA 1SCUB 2H51A 3PC2A 4KLCA 3D64A 4MZDA 4LF4B 3NOQA 5DW0A 4ZCRA 5BNWA 5IWAB 4RPJA 4B5LA 1HT3A 1RYNA 2A9KA 4L74A 3WL6A 4IJWA 5KYYB 5CLGA 3EQ2A 3G79A 1P33A 4EHDA 3M5WA 4IH4A 4S1NA 5DPMA 4BNHA 1TZCA 1QIJA 2WPDA 4OV6B 4BFYA 2OESA 2GR9A 4XUCA 3EG5A 3NBUA 4J03A 2JEZA 3UVEA 4DDMA 2RH5A 4D42A 1U0TA 2EATA 2ZUBA 4MW7A 5TMEA 4E7PA 2J59A 1IY1A 5CTJA 4DN6A 5EJ6A 2D3WA 4CF6A 1NP3A 3VX4A 3HXKA 2A4MA 1GLGA 1OH6A 3ZIDA 1KEWA 3E5HA 1QF6A 5E95A 1C80A 5HFNA 3S99A 4FWBA 3SJ7A 3OTOB 1G59A 4IDDA 1GRQA 3JQFC 5G0TA 3MWYW 3AF5A 3MCAA 4OHUA 4B85A 2W2VA 5ES3A 4HZGA 1OTHA 4K2AA 4TMVA 3AP2A 3QKRA 3ZH2A 4LQDA 4DCVA 2H85A 1M67A 4ZVTA 1Q3KA 3K9CA 1KDRA 3HB4X 2VAMA 4O2AB 3EWAA 1N0WA 4D92A 5KQPA 1CY1A 2VF8A 1K3TA 1N8NA 4KO2S 3G49A 5LFAA 2ZYAA 4ISCA 2AQ8A 3HY3A 4EENA 3AL3A 5LDGA 4GX5A 2OC4A 4JLMA 1JI0A 4U2FA 1HTBA 5A62A 5IYZA 3G8DA 1I3KA 1M76A 4CM8A 3Q7RA 1SVWA 2D3TA 2B34A 4PYMA 4MMZB 4D4MA 2Q7OE 3LU1A 4JQYA 1QONA 2Y93A 2NZJA 1TL7C 4F45A 4AMZA 3NS7A 4RKYA 2H8KA 3CINA 3ZHVA 1M54A 2C1EA 1E61A 2D7CA 2ZYRA 1FZTA 4GX2A 4CPDA 3BMXA 1M1ZA 3FUTA 3PC6A 1NQTA 1WO8A 1XCBA 1AHNA 4OGLA 1MA0A 1THGA 3RSFA 3RYFA 3TVYA 4EA7A 1N8SA 4EG3A 5KNDH 2B6NA 2BFPA 1QQ6A 2H9IA 3D3WA 1SHUX 3P0JA 1F9EA 3IESA 4UPEA 5HKAA 3JD3A 1FW8A 5EEGA 2F4NA 4JV5B 4WCFB 5K3DA 2Q5HA 3RVPA 4DHWA 2VJPA 2VWQA 1Y1TA 2EX4A 3L8HA 3QEJA 1A5SB 1BGXT 3BEOA 2A92A 1MT3A 2DQYA 2G0AA 1PCXA 1Q0HA 2BONA 1E4EB 2GAOA 2JVJA 4D2IA 1UIRA 1SKQA 2J4DA 1XKQA 4XD7A 2IHUA 3B70A 3TDNA 3KDPA 1LBSA 3MIZA 3KVNA 1VHWA 5B36A 1ULAA 2V7GA 1F12A 4MW2A 1XO1A 4FN4A 2WM9B 1RD4A 4DADA 3L1UA 3QXGA 1Q6ZA 3BDVA 1MGOA 1IQUA 1AZSC 2C78A 2MJLA 2P2YA 5COBA 1B6GA 3PBKA 2ODBA 3ECCA 4MQLA 4Z4CA 3B51X 4PCVA 3AI1A 2FEWB 2ZAGA 2Z43A 3AK4A 5BWOA 3BSYA 1E3LA 4YT4A 4CHGA 2JW5A 1QGYA 3VV2A 5D01A 3TINA 1FU7A 4PG5A 1GQ2A 3W5BA 5LYJF 2ZQZA 5EPEA 3LUCA 3ZV3A 3DE2X 3D3NA 5E2BA 3TPCA 2GWRA 1N2CE 2YV3A 1NSFA 1ZWKA 3KM0A 1ODFA 3MWDA 4WSOA 5HKOA 2DQKA 1JMYA 4NFLA 1PZGA 4EAQA 1R5NA 3EGXB 4AO7A 1E3DA 1M6WA 3H8WA 4ESOA 4O4HB 3AF6A 1DP4A 1WRBA 4NU0A 5KYXB 1E7RA 2PQ6A 3B1JA 3IUMA 4YMUA 2EJVA 3LX8A 1OXVA 4IIHA 5B2FA 2HBZA 3DBRB 1O95D 2PUHA 2AFIE 3E82A 1YB2A 3I8OA 3QFCA 4GQAA 1ST2A 4QTTB 3PEWA 1ADJA 3HA2A 3W9YA 3ZU4A 3U7GA 4CQMB 5KYWB 1FC0A 1J90A 1OBVA 2W6CX 5JS6A 1X77A 1R9MA 3ED1A 5KOJB 2HRCA 4FOSA 3F1KA 2F00A 3TMKA 2QTNA 3H5LA 1MEJA 4JJZA 2EKDA 3UTDA 2CV0A 5DHAA 3F8TA 3WGQA 1GKUB 1GUFA 1RE0A 2NSJA 2PL5A 2AOUA 1K92A 2ABWA 2QD2A 2XD9A 1QMGA 3CX6A 4M8KA 4BE4A 3ZTYA 2J9FB 3GRVA 3LHKA 1KNQA 2COEA 4G1UC 1YRLA 1KKLA 4L8WB 1CZHA 4S2EA 3OF3A 2HXSA 3MINA 3PD0A 2FPPB 1BMQA 1LTQA 3ZIAD 3R9WA 3LC2O 4HGQA 1XYVA 2P3QA 2P9FA 2FR0A 1VXRA 5IHPA 1GNQA 1IJEA 3U4IA 3AR8A 1Y1SA 2HC9A 4EGJA 3EK2A 2IYEA 1I6WA 2IXDA 2UXCB 4B17A 2HL6A 2OA0A 1S2LA 1MEEA 2GLXA 3R3JA 2UZ4A 1R9GA 5A7GA 4Z5XA 1X0VA 2OO3A 5EWLB 3PFFA 3U81A 3DNMA 2JFWA 1E1KA 1A9OA 4KIFA 4XEUA 2DUJA 3ZOZA 1LJUA 1N78A 2QQ5A 1BCSA 5L7YA 2OMEA 1ZINA 3GC6A 3PQ4A 1FFGA 4QM6A 4TMZA 5ENZA 3HJGA 5F7XA 2VH2A 1UOOA 3V8BA 1AQJA 1SWWA 4XR4A 5DASA 3FPLA 3CNBA 1W94A 3JWHA 3A1WA 3EZNA 3WJ2A 4EEXA 4F1WA 1KA9H 3NYRA 4ABYA 2WF7A 3QX9A 1NU8A 3QKIA 4YNBA 3NRBA 4LGCA 5EESA 1QHEA 1R5OA 1A9TA 2CXPA 4ZVQA 2WINI 3ELYA 5ALUA 4PSDA 1O0CA 1IN8A 5HX7A 4XYBA 3SX2A 3NHPA 4QE3A 1T2DA 2IYLD 5EE3A 3G2QA 5EXTA 3CMCO 5I47A 4MB6A 5IF9A 5J2TF 1QSGA 2JF0A 5CAEA 2AEMA 1GZ3A 2BMFA 3K6RA 5C7OO 1DAIA 3WS7A 3A2KA 3NRJA 4ONEA 4MR8A 1NHWA 1C3JA 4AS1A 5L6MB 1FTNA 4CNBA 3SQWA 3A37A 2XLBA 1T29A 5JCZA 2VDOB 4MVJP 2P1RA 3JTMA 4XQEA 5BMVF 4X62B 2FTKE 2VHQA 2HIMA 3JAMA 1Y4UA 2BKVA 1PK9A 2WE8A 3NNDA 3R0XA 4MA5A 3IL2A 5T4BA 2O8FA 1S7GA 2V6GA 2QRKA 3GHYA 1JNXX 4WLNA 2PUCA 1CEXA 3RJZA 3IAFA 4KO4S 4O2AA 5CA0A 1K86A 1MRNA 2Q8NA 4MCJA 1PZXA 3C6XA 4L8GA 2XTJA 4QXOA 3EVEA 1MJGA 5F7JA 3EN0A 1AKQA 1NF9A 1E9RA 4O25A 2GSWA 4C7KA 1Y9JA 3PE3A 4EITA 4RQAA 1SB9A 3COVA 4FFPA 4N0QA 3TSZA 4ZYVA 1UR5A 2W8ZA 5HCUA 4LV5B 5REQA 4BQOA 4BMCA 1M66A 1NBHA 4P4GA 1NFQA 2V4ZA 1XLWA 3GLHA 2BRUA 4TLLB 3BRQA 5E3JA 1I5EA 1ORHA 5HJ2A 3SEQA 1PGJA 4UUPA 4CM9A 4E15A 5I9TA 2IYOA 1XVTA 2DU8A 3I73A 1N2XA 2I7VA 2YR0A 4FONA 2R1VA 4JGBA 4N5IX 1KAOA 4E2ZA 1MO2A 1I3LA 2EJCA 2FSVA 3MBOA 2WP0A 3WIBA 1DT3A 1VKNA 1JKMA 3UAXA 4E1VA 4XPZA 1GZHB 1UPBA 2HWUA 3AQIA 2WHYA 1SUEA 3AUSA 2IZ0A 1A4UA 1CNFA 1LSJA 3C8HA 3IP8A 3MM4A 4YQYA 1AXGA 3AEUA 3IAUA 1H23A 4DBZA 4F56A 5BN4A 1PWYE 5E4FA 2E7ZA 1WP9A 4DAEA 4OLBA 1KZ1A 1E62A 3A11A 3UOGA 1JXAA 3FPGA 5HS4A 3MGGA 5LQAA 4JUFA 4BP1A 2AE2A 4QASA 5KWIA 1ZI8A 3WY9A 3G59A 3H19A 1IBSA 1FFEA 5I5EA 2YXDA 1T9GS 3SS7X 2GK6A 2O5CA 1AKEA 3UHFA 2QD3A 4IJMA 1EK6A 2P8JA 2C54A 5H5JA 1NKVA 1M6NA 3DTTA 1WXEA 4R0VA 4YWHA 4D3SA 2O2ZA 3DZBA 4HCJA 4CLXA 1XI2A 2ONZA 1HYEA 4IIFA 3C98A 2FETA 3DE3X 1Q7RA 2XMBA 4H4EA 1U81A 3SN6A 1WETA 5A5VA 4NI5A 2XYQA 5ALYA 4IDEA 5EVCA 3LUKA 1VL0A 3A1NA 3E0QA 2OHXA 3O90A 1RRVA 2BN4A 2P9EA 4QO7A 3R75A 1TMOA 3U4QA 3HY6A 1XZJA 3ZGNA 4LXYA 2Q21A 3GYBA 1CZOA 2CLCX 1EGQA 4MWEA 2O8BB 2XUJA 3OUZA 1VPVA 2W6MA 4EG4A 4INOA 4P7GA 4RO0A 2ERXA 1I5OA 4U0JA 1K8ZB 4X91A 1T6XA 4L5BA 2Z8ZA 3VNUA 1M34E 2ZXEA 1C7QA 3RUFA 1ZEMA 3RQSA 1W76A 2AOVA 2P68A 3EF1A 1GHTA 2X2OA 3FWPA 3OLCX 4Y9RA 4EM6A 5ARBA 3DMDA 1BS9A 3PG5A 2VJNA 4EP1A 4A16A 1A4RA 3S27A 2WWVD 4C29A 1QCZA 1UPCA 2IYQA 2NO0A 3CPSA 3VZQA 3NB0A 2J1LA 4V0LA 4FFNA 1ZNYA 5JEEA 4AY6A 1G19A 2P35A 2QS9A 4XYGA 1D8AA 2WKPA 4TL6A 3R3SA 1SVMA 4UMEA 2DKFA 1ONOA 1KZ6A 1EM8A 2BM0A 2VJMB 2G9QA 2XYGA 4UTVA 1LLDA 4A0GA 3L6DA 4YHBA 1BXRB 3ZQUA 3JXEA 1N2CB 1Z22A 4I14A 1XVUA 5DYYA 2OBLA 2XQIA 1NYRA 3N28A 2XMDA 1BW9B 3E84A 1UKVY 1PEAA 1XCGB 3AHHA 1RQXA 4K1LA 4L15A 3G2HA 5J1TB 4CKWB 2HCBA 5C32A 4FFVA 2Y6UA 2JFBA 2XNSA 1J24A 3B1KA 5EIXA 1B42A 1QH0A 4H77A 3DFMA 4HGOA 1QVVA 2IOHA 2QMYA 4RSRA 5DDIP 2P3SA 3VAYA 3V4VB 2HA2A 1KSJA 5AOCA 2F3UA 4BNGA 4HQ6A 4U7DA 2J67A 2FPRA 5FPQA 1RWKA 4LFCB 3WX0A 4NPHA 1WKCA 2OFPA 3SF8A 5ITZB 4DV5B 1CUGA 4ATNA 3OIGA 4IIDA 3CVVA 1SD1A 1JE0A 3AERA 3U7QB 3ZIUA 1L8LA 3MNFA 1YRAA 2A84A 1K8XB 3UC5A 5ICSA 2EU8A 4IEFB 4DCTA 1Y4SA 4GPZA 5DM1A 4YN3A 4QYMA 1B43A 3I4LA 2ACKA 4U7PB 3IMCA 4NJMA 1GGJA 1P74A 3C5EA 4L6AA 3SEAA 2HH9A 1YB6A 2JFXA 4YXWD 1JR6A 1DARA 3IALA 3T61A 2AGVA 4G26A 2FQWA 3LVRE 3K09A 1OJ7A 5KKCA 3ZNNA 3Q5EA 3KOYA 1PZNA 1ZL2A 3UAOA 3UXHA 5ALVA 3DMTC 5E3HA 2XVXA 1TU3A 2FLVA 4ALMA 4JC5A 1XELA 4BQPA 1EFKA 4G0WA 1YZYA 2HTFA 4CI0B 4NOLA 4MWZA 3ZCPA 1Z2AA 5C52B 2GPWA 4KDCA 1GU0A 1ZJZA 3UYLA 1XRJA 4Z2AA 5EJ5A 2AD1A 4CKXA 5MGNA 3KKKA 3RGWS 4LOIA 2PZKA 1MFZA 4QT0A 1WQ4A 3C6MA 2JLRA 3OZ7A 3RKRA 2OEPA 4DWOA 5JO0A 3HK2A 1NFRA 2XWBF 1UFOA 3N2KB 2NU8A 1N0UA 4ZEVA 1CR6A 3NP9A 1OQAA 1PJTA 4C7XA 2IX9A 3QLUC 3QV2A 1FRQA 2NXNA 4LRYA 4BJ5A 2JVKA 2YMLA 4JP1A 3L7AA 5D3MA 5AHKA 3GX1A 3PNSA 3LL7A 2P77A 1CQIA 3W6PA 3EOAI 4Q48A 1QV7A 4PGHA 4JSRA 1U0OC 4CKCB 1MQ9A 3L7JA 4TKZA 2ZRLA 3GAFA 5G4LA 3EXHC 5GJCA 2WWIA 5LNK6 3AM4A 3A9TA 3PXXA 1DKQA 3H97A 3WSVA 3GR6A 1UAYA 4EQZA 4S1PA 2DCMA 4Z7NB 3KQKA 4BZZA 1FFWA 2R4UA 3UWOA 2JDID 4AT1A 4H17A 1R0KA 1R5JA 1SBQA 4RK5A 4EFKA 1H6BA 1JRLA 3VH2A 1N2GA 1FFXA 2QUJA 5H1YA 3ZUPA 5BYJA 3ANMA 2H06A 4XTCS 2LXNA 1VSUA 5J2UB 4G5HA 1WIWA 3KKNA 4Z0TA 3NT2A 4X1YA 1E99A 2PQMA 4FMDF 5B7GA 4S12A 2ENWA 3LUGA 4RXUA 3PHCA 3RS2A 3CLSD 3TQRA 1W1WA 1L7RA 5FV7A 3L4JA 1R6UA 1J2TA 1I6MA 4FHGA 1ZI6A 4MUKA 1H1TA 3HKCB 5F52A 4AC9A 1K6MA 2NP6A 1USUA 3CR3C 4L08A 3OQNA 1H94A 2FMKA 3WL8A 1U0GA 5KYUA 1LW6E 2J0UB 3FAZA 2Q3HA 5BMVB 4MRMB 2L82A 4F06A 4RLSA 2E4VA 2LKCA 2QL7A 4O4LA 3T0FA 2FJUA 2JLUA 1ZX1A 2H7YA 3KV3O 2N9UA 4K6KA 4HLNA 5L53A 3T1QA 1GCOA 1K4MA 1XUOA 1R4AA 3D7MA 1HORA 4TLCA 1EFVB 4W6ZA 3BTUA 4RIEA 5JAOA 1Y33E 3I42A 1JQKA 1Z8HA 5DGDA 2AA3A 5AKGA 4YDRA 3BF8A 4C0WA 4KJZA 3H5NA 5ADHA 4EG1A 3A6PC 3NIGB 3CIOA 3VHXA 3SHTA 3SXJA 1HRKA 2K6GA 3MG9A 5EE0A 3Q15C 3SDBA 1QV9A 2AEFA 1H1DA 4ESHA 3MT8A 3HDJA 1OCEA 1X7XB 3ADKA 3KTAA 4Q1EA 3EXG2 5AKLA 5L3RA 4KWTA 5E0KB 4CF3A 1E1NA 2RB5A 2O1WA 1Z88A 3OMXA 4IQ0A 2YZKA 1PGQA 3K0CC 1H5UA 4IIVA 4C4ZA 1TRKA 2FSIA 3AETA 4RFSA 5DT2A 4BYMA 4IXDA 3RT9A 3FXAA 1C2TA 1XROA 4XD2A 2ZAIA 1OPRA 4H6XA 3E48A 4QEKA 3G0CA 3UY4A 3SZMA 2D8MA 2JJQA 4P4SA 5CXQA 2O06A 4I19A 4NCHA 1ST3A 2HJVA 3T12A 2QTVB 3JZDA 2NGRA 2ILTA 4A3SA 2WTUA 1CFZA 3ESXA 3K05A 1PJ3A 3EG9B 4OLJA 2KB0A 2GJAA 1OXTA 1K68A 2VZ0A 3ZEIA 1KJIA 4GH5A 3L1KA 1FFYA 3HU5A 4GMFA 5H3CA 3U26A 1HK7A 1CRPA 3LQKA 2WICA 1W73A 3LDAA 3G7UA 2F9FA 5GV7A 1V1RB 3BXFA 1B76A 4IRMA 4AQYB 2AC4A 3NCHA 3R3VA 4BVLA 1XN4A 3W8RA 1TK2A 4WL0A 3N39C 5CVJA 3S0JA 2PZLA 1ZK1A 2WV9A 4MWTA 2NNLD 4RKFA 4UAJA 5B55A 2IHZA 4PFSA 1HE5A 4YJDA 4WA8A 5JARA 1SOWA 1KQPA 4O4IF 1QOPB 2L42A 2ERCA 3OO0A 2HXGA 4NIMA 4URHA 5FTWA 1E4VA 4YQEA 1I2AA 1HX7A 3AUKA 2R6DA 5JH7F 2Y4OA 1FS4A 3D3EA 4HDMB 5EQTA 3DDNA 5HS6A 3C5WP 2Z6QA 3VMMA 1P2SA 3MQ4A 1TM7E 2XKJE 4D45A 2ZWAA 1WXXA 3AEXA 3LYLA 4NBSA 5D85A 4FNAA 4K40A 4U3JA 4PYNA 1XCMA 3QBJA 4WLUA 5LKRA 2A1IA 1VYUA 2X7JA 1V3UA 1E8NA 3I52A 2SNIE 4Q18A 1H2ZA 5JO9A 4B3GA 3NG1A 2OZPA 4M9CA 3Q7IA 1WNFA 3ZX5A 2IEYA 4ZQBA 2D1YA 4LJ7A 3INTA 1OI3A 4PWZA 5EJ7A 2C61A 5AXDA 1NQXA 3GUZA 4OIFA 5D2CA 1RVV1 3E1GA 3I8XA 2GJKA 2GEVA 2ZSUA 4RQUA 5J2TA 3KOXA 4FSHA 3RRNA 1WW3A 4ZYXA 3KVYA 4JI0B 5E3IA 3WL5A 4AMYA 4DJ5X 4P3XA 4KITB 1RRMA 3SC6A 3V3TA 3K0AA 3GEPA 4F85A 4DA9A 3DFFA 2IU3A 2GILA 1JTVA 1P0IA 5AW6A 4IV8A 1WUHS 4MKHA 4UQOA 5DVZA 2IP2A 4R3UC 2WMDA 4ND7A 1NI5A 2D4AA 4BDSA 1MCZA 4YCNA 2PDAA 2JRLA 2BMWA 2ZS7A 3DO5A 2O50A 2GRJA 2ZYDA 1VRVA 3E9RA 3NWBA 3OT5A 5AK0A 2YQ4A 1D2AA 1YQGA 2OWDA 3YASA 5AM2A 2P5YA 1FYVA 1A8HA 2HRBA 2YV1A 1RZRA 1MABA 5JNVA 1Q44A 5IN4A 3FPAA 1L4EA 1T9CA 3GQBB 3SZRA 4DKJA 2Q6IA 2OO5C 5KYTA 3WICA 3EBOA 3SBXA 1XXHA 2PZFA 3OU2A 4PCAA 4EB6A 3PDIA 4E32A 3DEZA 1AUXA 3DOEA 3D6HA 2Y92A 2BHNA 4HWGA 3FZEA 3GLGA 5IVKA 2Q50A 3DMRA 4ZI2A 5DGIA 5FL7A 1QGZA 2V0NA 2CEKA 1L8XA 3CKYA 5CNJA 3SK0A 2OHJA 2P67A 5B58T 1EX7A 1RKQA 1VDMA 2JJ8A 2NW6A 2HX1A 3CZAA 3VI3B 1I94B 4Z99A 3N1UA 4LXGA 2NTVA 3AKYA 1L7OA 3C6YA 3DZKA 3NETA 3QJYA 1VHJA 3QZUA 4OVKA 4K5QA 4B4VA 1RXCA 2GDZA 2QJTA 3FI9A 3FLBA 1XTJA 4DBLE 4D6PA 3CF2A 4LBZA 1NF3A 4UEKA 4REMA 3VNQA 4F2PA 3PJRA 3PFKA 1UOEA 5F78A 1CW2B 4S2UA 3VAZA 1V9LA 1P0FA 1LTHR 1SNYA 4TYPA 4CM6A 1EIZA 3NYIA 2P9YA 3UXMA 1MB2A 2EFHB 3OI7A 3GEGA 5B7NA 2M1ZA 4BWFB 1U2QA 1UKAA 1Y5RA 4OXYA 2W7TA 1C7FA 4IW3B 5AESA 3T5PA 4R83A 5DWVA 2OE2A 2WUFA 2ZANA 2IPAB 1U2DC 3PPYA 2X15A 1K97A 1NVFA 1MH1A 2NSDA 3KR9A 1ZGCA 3LX6A 4HAOA 3HB9A 5LD2C 4PYKA 1EHCA 2WI8A 4ALJA 5CA0B 3OF2A 3ONNA 3WGNA 1VPDA 5FBWB 2VHXA 3GRPA 4V39A 1S8FA 2XH8A 4J9VA 1MZPA 4Q1FA 3QW4B 5B7PA 3IULA 2Z04A 4CN9A 1WBJB 4G1CA 2A33A 1PU2A 1DTWB 2ECPA 3RBAA 3AFNA 1Z07A 2GWHA 5REQB 2J9RA 3P5SA 2CBGA 2H1FA 1XQ1A 3LYHA 2NP7A 1FDOA 4OIMA 4P92A 4ZMSA 1EI9A 3ROTA 4IDOA 4FDVA 1E32A 4FR2A 4ARBA 1DC8A 5JXHA 2C3MA 1QWOA 3U3MA 4NNOA 2BTQA 5HIKA 4GKVA 1S9HA 4ASUA 2P91A 5HF5A 1VP9A 2FN4A 3U48A 3QTBA 1M2EA 3L7BA 3H2YA 3VO1A 3E1SA 4I5IA 3OSZA 2C07A 1ORTA 4EFDA 1R50A 4BZPA 2G9VA 1A27A 2MIIA 1DMRA 1QYCA 2HMTA 1BMTA 2Y77A 3O0DA 3RFCA 1ODTC 4AZ3B 1CIJA 4K8OA 3OG9A 3VTFA 4M9SA 3ELDA 2PRYA 2Z30A 4DNPA 1K06A 3T8YA 1F9AA 1CZLA 1T3GA 3RRFA 3AU8A 4IUDS 4MR8B 3PDJA 3B2QA 3V1LA 4N0DA 2QGFA 3A7EA 4LZAA 5AOBA 3K8OE 3OTWA 3OKAA 2PGLA 3NAZA 4BMYA 3DEHA 4UHJA 1JHYA 1N9KA 1VSQA 2GBPA 2PJUA 3I1FA 3DBOB 5TSDA 2W37A 3P1JA 4PHHA 3WYBA 3I2YX 2HU2A 1Z3IX 3BWCA 2X6QA 4YJ3A 2H2DA 2WU8A 4KAJA 2L17A 1Y81A 4X54A 3UICA 1M33A 3THWA 2ZI3A 3AFGA 3RGGA 4EHHA 2A5JA 3FCYA 1T4BA 5FOQA 2H00A 3GLVA 4EB6B 5JTTA 4A4DA 5CX1B 4CRWB 2RGRA 1QGDA 4IUBS 5BN5A 1U4NA 3IJPA 3KPVA 4I55B 3B7PA 3FVVA 3JASA 4KACA 2O2JA 3CUVA 1ZIPA 2NTYC 3HYNA 4O3MA 1OY1A 4F3CA 1OFGA 1GA1A 1OZAA 3JVVA 3UB4A 4I4TF 221PA 3X1KA 5I3ZA 1O95A 1ZCFA 5F3DA 4OQEA 3OWOA 1ZVJA 4LNUB 4KOEC 1EGVB 2I54A 2GA9A 3PUKA 4TWBA 4EHIA 1J0DA 1GILA 1NN3A 1UXGA 1WHSB 1WBDA 4BVBA 1AQLA 4UJ5A 5FNVA 5GGXA 2WM2A 3CPJB 3G8CA 4OAQA 1FP4A 5JH7B 2JCGA 1KJ8A 1WE2A 3RM3A 3TJZA 4DF3A 3TGLA 4XOIA 1AV6A 2AOTB 2CV2A 1M10A 1OA0A 3KE8A 1ACLA 4PG6A 4CTOA 1E1RA 2P30A 1GG8A 4HQLA 1N5DA 2CUNA 4PBTA 4A7PA 2XYHA 4N6OA 2B4AA 2JK0A 2VFAA 3BKXA 4FILA 1ZUNA 4QXMA 1RAAA 4CG1A 1TJPB 1QCYA 2P4HX 5BVGB 1K4KA 4IWXA 13PKA 3PYMA 1YZUA 3DZJA 3PGMA 5AW8A 1YR7A 1XWFA 3GMIA 5BUZA 4M0PA 5TE9A 2RAUA 3ZGYA 1IXZA 4EY7A 2DSTA 3HR7A 1Q77A 1UP4A 2YJ4A 1RPAA 2J5KA 4YMIA 3GUYA 4PHFA 3F4KA 3SJUA 1UAAA 4RVUA 4OXRA 5JFTA 3TZEA 3COZA 1EE1A 1F8XA 4RQBA 4ZDWA 2DVMA 3DAHA 3UHOA 2HSEA 3MAJA 2V7TA 1AO0A 2CFIA 5DP2A 1DTWA 3WGUA 3UCXA 1KF0A 2W6OA 3GFVA 4G5FA 4HX9A 5ALFA 3GG9A 4TKUA 4EO4A 4GUAA 4M0KA 5JD4A 1SU7A 3NO4A 4X90A 1GSOA 4FGZA 5HGJA 2QVGA 4UZFA 4NQRA 1AU9A 3D6JA 5EQFA 1AM4D 2X8WA 2YZNA 4QWWA 2JA1A 4HYEA 3DYBA 3PIIA 1A5AB 1N9GB 3R0QA 5IEJA 4KXFB 1Z7EA 3Q12A 4GKKB 3J81k 2CHUA 2GXSA 3D5EA 5K6TA 2R85A 3NWJA 1PWEA 1NAIA 2HUNA 4FMCF 4PSKA 1N2EA 5EP3A 4BCBA 4CM7A 2YC4C 1C7JA 2WT9A 1JDJA 3IEPA 1QK3A 4I2VA 4D9EA 4CQMD 1JH9A 1GDDA 3UA3A 4Z1MD 1KK0A 2IU4A 3AEKA 3ODGA 4F9FA 3AM1A 4B9EA 2E48A 5I4CA 4PXAA 3G5MA 4DLPA 3QVWA 2YHIB 4WPGA 1E9EA 2HA3A 1Y6QA 1E7MA 5FJJA 3KKQA 3AR4A 3MEQA 3MLBA 1GARA 1T9KA 1TMYA 3TQTA 4XUEA 4D8VA 4YRKA 2DHCA 2ZUVA 5BRAA 3R3HA 2JKYA 1B15A 2Z4SA 1FK8A 4ZCTA 3MTQA 4JUDX 4EY3A 3MGCA 1KXZA 1C1XB 2J4FA 2HK9A 3KSUA 4GYYA 4XFKA 3GT0A 4FB4A 1EFCA 2W5UA 1UZLA 3L6UA 4OH1A 5C8YF 3FOFC 5LC1A 2V0CA 1JQAA 2KS6A 2DOKA 1ZUD1 1KNXA 2AN1A 3BXGA 4K9LA 5CX1A 1WLYA 5DBGA 3AXTA 3F49S 4F6RB 4HVLA 1OF1A 2CY0A 1GPYA 1RJGA 4N4AA 1GUAA 3E3NA 5KTYA 1NMEA 3K8ZA 4L1KA 2XKBA 1XJCA 3GLIA 2I65A 3M9LA 2QWXA 2Q1XA 3HBAA 1PEKE 5DYTA 3EVGA 5DBFA 5F9MA 3RU7A 3SX4A 2PLAA 4C05A 2WUWE 5D1HA 1HDGO 1ODKA 3BFJA 8AT1A 3BE5A 4LRUA 1L3IA 1X6VA 3BWBA 1ZG3A 2JJMA 3CVYA 1WP4A 1SRRA 5IC4A 3PGKA 4LUCA 4J1TA 1Q3HA 4TKLA 5G0SA 3VBEA 5DIFA 5IZ4A 4X3CA 1TIPA 2ZIZA 4M1KA 5EIEA 1A76A 3DOOA 2QE7A 4WLEA 5AM0A 1VECA 5AM5A 2KE5A 4R2WA 1W49A 4EB8A 4QDUA 4R41A 1I6LA 5EA2A 4BXOB 1QU3A 3IBYA 3OM8A 3ZHRA 3MWDB 4PQGA 1W8DA 2VRCD 4OXNA 2YWBA 2JB9A 3QYJA 5DYWA 1SCDA 2R62A 3SHQA 4I1PA 2GXAA 1BVRA 4RZQA 1XA3A 3OZBA 4K6GA 3PZBA 2D2EA 1SHLA 2X7HA 3MSXA 5EHNA 2FEOA 5A1JA 1FSGA 1I30A 3KR2A 3GLFA 2I9KA 3O4GA 1EJBA 1TKBA 2ZOSA 1XDWA 1XA0A 3GLHE 1T5BA 1QFXA 1JMVA 4CETA 3F6PA 3AGPA 2P90A 1F38A 1FCJA 1J1UA 3QFHA 5FPYA 5FPKA 5IT4A 1FNMA 1GG9A 4YRCA 2AKAB 1NUTA 1C3OB 3HFRA 1BDIA 4QQFA 1NW8A 1NBME 2B37A 4QNNA 4BX3A 1MP0A 5KTPA 2FZ5A 4O4IA 4P9NA 4E13A 1FRZA 4BQIA 3R6GA 4EVRA 3E7PA 1DRJA 5JJKA 2WMOB 1E6EA 1P77A 2BC9A 4KWEA 5JH7A 2W83A 3A6JA 2B4YA 3LYAA 5T64A 1S8NA 2R6FA 3R0JA 3SQLA 4MQFA 4BASA 1KVQA 1ZGHA 4OJQA 3R9IA 2QM7A 2FEXA 2I1LA 3ISTA 4HQOA 1HEIA 1V16B 2I7XA 4BFSA 2GM4A 2YQZA 2J0UA 1JHRA 5ILQA 4RV9A 4JX9A 3RYTC 1JLLA 1C30B 2R7AA 3FUUA 5LWHA 3QOXA 4Q7KA 5JJCA 3LY8A 1OSNA 2N1MA 2G4VA 4QRIA 3UH0A 1KP2A 3QPVA 4BVJA 3A6DA 1J97A 5KYKA 3K70C 1G4AE 4KXXA 1ADFA 1P1IA 4JXXA 1IBRA 1ZJ4A 4V0NA 4E0BA 4BO8A 3ZU2A 4LXHA 2AN5A 4NP6A 2IKSA 1S7CA 3I4CA 4LOHA 5BN1A 2BMDA 3UQZA 1EG7A 2SHKA 5HKLA 1GZ4A 2HRQA 3N8HA 1Z7BA 3S3TA 1KI3A 5KNBD 4KRGA 1ESEA 1GYRA 2XIJA 1ZXLA 3AVYA 1VL1A 4TV9B 2Y05A 2UVPA 4BX8A 3DZFA 1ESCA 3QVXA 5EOVA 5F76A 3WB1A 3W5AA 1IWBB 2WDZA 1CP2A 5GADl 3AW8A 4QOHA 3HKEA 4LBWA 3C3WA 1P2BA 8ABPA 4IUCS 1Y98A 3EMDA 3IP6A 1KFBB 3F96A 1JDPA 1P1FA 4H16A 1JF8A 2Q1TA 1CDEA 2B7LA 3O3OB 2QM0A 2X9GA 3BD8A 2J33A 2KHZA 1QHSA 1UBUS 3PDHA 4FX5A 3V8EA 2ZZMA 3UKDA 2CLIB 2HQOA 2ZSAA 4JB3A 1KTIA 2ATVA 1NP6A 1NJ1A 2EDCA 2PMFA 2A7XA 3CONA 3G2OA 3OSUA 4GP7A 5EZ6B 4CM9D 1FW6A 1XNQB 3EGOA 2Z2JA 2XI4A 4ENSA 5ITVA 1UK9A 4HLQB 3E03A 4NARA 5M7EA 2HM7A 4GRDA 4HYQA 4RJJA 1SVUA 4OHPA 2AJTA 3RBZA 2IZ7A 1ENZA 2FSFA 3HDYA 1CVLA 3B53X 2LDBA 4D8WA 3PK0A 1ZW1A 3VYWA 2HBQA 4X24A 1FPMA 4LJ6A 1E3QA 1SD2A 2PKWA 3H17A 2Y99A 4HUJA 1U5CA 5DWQA 1E1YA 1XCLA 1PR5A 5JSYA 5JNSA 2IOYA 3T5BA 5IUNC 2BYTA 2PH5A 2JJ2D 3ANXA 2GZ1A 3LUHA 4D9BA 2MSDB 3KQUA 4RK1A 1FU4A 2GESA 1TUBB 2I87A 4NCAA 1OYYA 1V45E 1DG9A 3BJEA 3IMEA 1T0HB 3T1TA 2PJDA 2G5CA 3GLGE 3O1IC 2OHVA 1NI4A 4L85A 1Y1KE 2WUGA 4KEAA 4QDJA 4QDTA 4EI7A 2CJWB 1VA5A 3V55A 4RTOA 1P1JA 1ZNWA 1PE0A 2I4RA 1PTJC 1U5BA 1XRNA 5TDHA 5BXYA 4IDAA 3CG4A 4IDCA 1CUXA 1TM1E 5C5CA 1FSPA 2JAXA 1LVHA 1JJIA 2ARKA 1EWYA 4G1MB 4JA0A 4E51A 3C6ZA 3H5IA 1LRJA 1RAIA 4ENTA 5CVDA 5ALMA 1G8JA 4D26A 3ZI7A 4Q1DA 3S29A 2Q8PA 2A4KA 3L1JA 1QJCA 1U1GA 1ZCZA 2VXCA 1F14A 5EE9A 1YJ5A 3G02A 5IK2A 3VH3A 4J94A 2XRMA 4J76A 4MKGA 3OLQA 5AKKA 3DAGA 4KQ9A 2V9CA 4RAQA 2CLOB 2YVQA 4L9SA 4QELA 2YWDA 4Y18A 5FBQB 2PZAA 3IPXA 1YJAA 4UM7A 4X7PA 5JZSA 4DWWA 4HADA 5CA1B 1XQXA 2JI7A 4FBMA 1ZUIA 1KQFA 2RHOA 4IUYA 3ND9A 1XNHA 4F3YA 4IXMA 1G2QA 2V65A 5EUQB 4DB2A 1PJ2A 4JP8A 4B7CA 3HYCA 4Q1AA 5AW1A 1IEQA 5KTTA 3D2BA 1U3DA 2P7IA 3MJHA 2ENUA 4M7WA 5CB4A 2IYSA 2H1CA 4JT9A 1QPZA 1RJFA 1Z8NA 3NOXA 2JGRA 1G60A 4BJ3A 5B58C 1EFRA 4G4IA 2E5FA 3T6KA 4YJGB 1OU4A 4U6QA 1V9SA 4RORA 5CR9A 1KQNA 5TVKA 2GPSA 4EHJA 1KYTA 3DT8A 4YJFB 1XZMA 2Q62A 3RU9A 3R7AA 3SNHA 5BR7A 3U1VA 2TMDA 2FQ1A 4MVCA 5CT9A 3EISA 5A5EA 1D9XA 2FZGA 1NLYA 3I9MA 5K3FA 3W8NA 1L5RA 1K63A 3NBXX 3L06A 2IYAA 1DJLA 1KJYA 3I23A 4IV5A 5K5EA 4I5EA 4BO6A 4DXDA 2XZPA 1A77A 2AI2A 3ASUA 4UXHA 1OHHA 4BWVA 1XZIA 3TNDA 1J2RA 2QRNA 4INPA 4YJ3F 5LP6F 3EIWA 2R6AA 2HFKA 5LB2A 5H8WA 1FMCA 3ETHA 4WXEA 3NJRA 3HUUA 4CLDA 1F3OA 2PL1A 4KV9A 3KETA 1T3HA 2Q2VA 2XF2A 3KPJA 1F2UB 5ER6A 1J8MF 5JNUA 4ZWNA 2GYUA 1XPUA 1B8NA 1ARZA 2GD2A 1M74A 1GL3A 1TTHA 1KJ9A 2Q1YA 3NVAA 3OICA 2JFZA 1T8TA 3LT4A 2PYIA 2WDPA 4EVSA 2O1EA 4L8VA 3NGLA 3R5KA 4M36A 1QH1A 2ZUCA 4I4TA 1CUZA 4JUCA 3DE4X 3U7RA 5J4YA 4BMOB 2C2WA 1JEOA 3C6KA 4Q01A 3NHUA 3O91A 1HQYE 1ZGJA 2NZVG 3FSGD 1SC4A 4XQ0A 4ZKEA 3DW3X 1EXDA 4WZBB 2RHBA 4COOA 3TIIA 3ZGZA 4UAUA 3R7WB 4H7PA 2X0NA 5FNVF 4JJKA 1ELOA 2JD1A 1TFUA 4ZHQF 2O2IA 4JFAA 5JMWA 1T1RA 1I10A 4GIBA 5BNIA 5BVHA 1NOJA 2OHOA 2VP2A 3B12A 4I2NA 5CH8A 5BQOA 3ZDZB 4D43A 1B00A 4EYQA 3FMGA 3LBAA 4DLUA 3W9UA 4OHWA 3WIVA 4FDTA 4EX6A 2Q3EA 1CV2A 2O8EB 4C06A 3IDFA 2IIVA 3DFKA 4KMMA 3SDSA 1RM3A 1UH5A 4PG7A 4US0R 3K16A 3E6AA 2J0QA 3SQOA 4U2KA 3DLBA 1ZRHA 1W0JA 1XZ8A 3H5WA 1A8SA 5C5EA 4TLDA 1WPXA 5A6SA 1MB4A 1LI7A 1I01A 4B75A 5HHTA 2G5PA 4OQMA 4B3FX 1L7MA 1IULA 4L16A 3IAHA 4Y1EA 2O2EA 1FYFA 1VQ1A 4CCWA 1EK5A 1SO8A 2EFGA 4OFZA 3RANA 2AIRA 3V4ZA 4FNMA 3VHQA 4JUAA 2G1UA 1E79D 4ZZIA 4Z2YA 2VRBA 3G9ZA 1TYDE 1QAQA 1KIFA 5DRTA 4ARCA 2ZYHA 4UDYX 4CU5A 1Y5MA 4LAFA 1T1GA 1DE0A 4MRVA 5GM1A 5IYZF 3STYA 4DW8A 1K7EB 4ZK2A 3JPYA 4YCCA 4B0PA 3VPFA 5BWBA 5TPZA 1RYBA 3T5GA 1D5WA 3B6JA 3J81A 1Q83A 1PNTA 3GLRA 2H18A 1KO4A 3WQBA 4F6LA 5KJFA 2JG3A 1U90A 2FK8A 2NN3C 3EIHA 4GR5A 2EHJA 4MRPA 1ZN2A 4Y2GA 1GKKA 5DEIA 3SJAA 1MB9A 3CEHA 5EXEA 1SGWA 1IAQA 1TNDA 5DHQA 1RM5A 1GN8A 1GPKA 3LLMA 2EL9A 3OM0A 3A4IA 4TTAA 4B8ZA 3FUVA 4BU1A 2WYIA 4FNOA 4D8YA 3TNFA 3DJYA 4FHDA 4NBKA 3UJCA 1Z37A 1JHOA 4WV3A 5AFSA 4KYVA 4QU9A 1L7AA 2DQSA 2IP4A 2CF5A 2XT6A 1D0IA 3PC3A 4HF7A 4R2MA 1EFVA 3CZ5A 3BFPA 4QGFA 4W1SA 4AUEA 1I7QB 4KZPA 3TQOA 3LBNA 1DAFA 2OVFA 2WZQA 4ROSA 5CIWA 3RROA 2M2IA 2YRWA 2W43A 1H8HA 3L02A 3ZWWA 2W48A 4M0LA 2HLPA 5IC6A 3AF4A 4KC0A 2A35A 3R2JA 5CGQB 3L04A 4F3TA 2C29D 4AJHA 3DV0A 1UPTA 1QM5A 1VMIA 3IEIA 5CYOA 3N59A 3GFSA 3DBHB 3MJFA 4WXPA 1AN9A 4NAUA 2YVUA 2QD1A 3BAFA 2ZBGA 1HETA 2IWHA 2VHZA 4PSAA 3H8SA 4C6SA 1QHHB 4GYWA 4J07A 4QODA 3GLTA 2Q29A 5L4SA 4KHPB 3P0IA 4WAUA 3LDUA 3NWOA 2FKAA 4IIJA 2ANCA 2I4LA 3A4NA 5ESDA 3ZNQA 2P65A 4FKZA 4G97A 4CMKA 1SKAA 3F67A 3VPBA 2OQVA 4HDRB 3L8DA 4EPVA 3SDZA 3WLSA 1M6VA 1NNSA 3PFNA 4Z9BA 1ZR4A 3L6OO 2LDXA 4HNVA 4EG8A 5FB3A 3AJAA 2GN1A 4GLJA 3NDIA 1WMDA 3Q3HA 2X5OA 4E7OA 1PFYA 1F6WA 3JU3A 1IZ9A 1SUWA 1X1QA 1XD2A 1YZVA 4KXLA 4N7JA 1LNZA 1H5QA 5M3BA 4JI2B 1EUYA 2QN2A 5E2IA 3JWGA 1H85A 4KIJA 1SPBS 2BKUA 1EE2A 3PVSA 4KWCA 4RGYA 2Y6VA 4ZVPA 3LC0A 4F3NA 2ZRJA 1E8MA 1JSCA 4M1MA 4AECA 5A9TA 1C4OA 4JC8A 1ORWA 2P2DA 2R8RA 1XWWA 4M83A 1UK6A 3OCYA 2IEAA 2VJYA 1FQKA 2OCKA 2QJOA 2Y1EA 3KFVA 1X2EA 4L75A 4RY9A 3W3AD 2BP7A 2ZJ1A 1IPEA 4H60A 4DWJA 1VE5A 2B1GA 4LMAA 5FV4A 2QSZA 2PGDA 1P3DA 4DSUA 5AM3A 1SUBA 1YD7A 3H84A 2RK4A 2CXSA 4TL7A 4MV1A 2MYTA 1M2GA 2QE6A 3P2EA 3SQMA 3Q2IA 1AVTA 3ADPA 1XC7A 2J9ZB 5ALSA 4DV3B 4C87A 4S3MA 1XRRA 1CEEA 3WNQA 4HH1A 4AN4A 1A7AA 2XDQB 4D98A 3W3ZB 4ETIA 2XJ4A 3DBRA 3H2KA 1X70A 2Y1CA 4RTLA 4KVZA 1GA4A 1SUFA 3PCXA 2WAXA 5AIAA 5JDCC 1T3ZA 4CEJA 4RETA 4L4XA 5AUOB 3T3NA 5G53C 4C7MA 1PSWA 5LBTA 4JQOA 1GTMA 1DTEA 3UBTA 5CVVA 1VSTA 3DHVA 4BBAA 3AVWA 3ICQB 3D3KA 2DETA 1Q7TA 2PSEA 1WDTA 3ICPA 2W6IA 3R3WA 1K3FA 1NAHA 3KLPX 4YRGA 4UOQA 2GH1A 1KDZA 1C7RA 2GQ0A 1V39A 4R4JA 2JIPA 2O8BA 5AOAA 2M1XA 4RY0A 1C8LA 4HJRA 3ZXIA 4UNPA 3ME5A 4DJAA 3G9XA 4PPNA 1MC8A 5CCDA 1QO7A 2VWHA 2Y0EA 1BOFA 3EVFA 3T3OA 2JHAA 4KL8S 4GSYA 2FVXA 2NTEA 4JT8A 4D3FA 4U7JA 5DT9A 4JHXA 4Y3UA 3QYPA 1XDSA 5L3SB 1S6YA 3EMBA 4GLBA 4H1TA 2GPTA 5ED4A 1C14A 1KIMA 1OKKA 1M2HA 1SELA 4EA8A 5KVSA 3WLMA 2VP5A 3TEMA 3IBFA 1DRUA 3IJEB 3JAKA 3F47A 5DSZA 3JALB 1LBHA 5EPOA 4OQLA 4EGQA 1AKNA 3SQDA 1MTZA 1NVDA 2P40A 5IAOA 2FFJA 2VP6A 4EG6A 2BJWA 3C8DA 4N8DA 5LSAA 1VPLA 1KFJB 4BX9A 5EWJA 2NU6B 2QPAA 2GPAA 4QXRA 1KE1A 4F8JA 1RMQA 1Z39A 1N3BA 1WG8A 4O2AF 2C3YA 4HAVA 3LRTA 4D4IA 5DXFA 2I3BA 1E1QD 2FB9A 2YS6A 5DLYA 4ZTUB 1WZ2A 2XOEA 5TQVA 3LDHA 5HUQA 3O0TA 2OO7A 2VATA 4JKYA 1KZ7B 1K6XA 4MVJM 3DE6X 3O93A 3U9TA 2HQBA 5HZHA 3B3JA 2O20A 1XTQA 3Q9LA 4JP3A 3H5TA 2QAJA 4TPKA 5AOVA 4C1BA 4N6GA 4NYIQ 4X7RA 5CNMA 4WJLA 3KYJB 1ODJA 1GRRA 4LOAA 2HADA 4A6PA 3IUSA 4H15A 2PEYA 5G0VA 1LC3A 1YF3A 4PAMA 4YFYA 1ZAKA 1G7SA 1G8MA 5I7FA 3CE9A 4ZJZA 4XWTA 1VYHA 2GX6A 2OPHA 2OR3A 1RDFA 3WADA 2GUGA 3W5UA 4YK7A 4WACA 3I05A 2BGRA 4LJ9A 4DR5B 1EB9A 1HQKA 3FZGA 3MWJA 4TTTS 5AQ1A 2G1PA 2Q3JA 3DEKA 2UAGA 1F06A 2WSSA 3AKDA 3GDFA 3FI0A 3H9GA 3QF7A 2IODA 4KQGA 2GHQA 4MAFA 5KTNA 1G0NA 2JIQA 2AFIB 4ZT3A 4IF4A 3ZDCA 3NBMA 3FF1A 1VE7A 2VK2A 3BGSA 1E58A 3QXHA 4DMLA 5EIWA 4DM4A 1E9FA 1HSZA 2UYHA 3BERA 1VG8A 3MMSA 5TEVA 3THXB 1M0WA 1A88A 5C31A 2B61A 2AWOA 1N6IA 1OIWA 2E21A 4I1RA 4ON9A 3K9HA 2BCJQ 5GJBA 4FFOA 2X9QA 3BIWA 1XE3A 1X14A 4RWZA 1N2OA 3SJBA 3VDXA 2OHIA 4MQUA 2HSDA 2QP4A 2YJ3A 3VJKA 5BP7A 1G7CA 3F8WA 2QDXA 3O1HB 4BZQA 1K5PA 2VPZA 5JW6A 5C46F 2V54A 2JFUA 1L2TA 2VDPB 4YAWA 5K4GA 4C01A 5JQGB 1K8QA 4U2GA 4J29A 2AYXA 4N9WA 4GPD1 3V8NA 3EAFA 5DM60 5JISA 3I30X 4AY5A 1KZ4A 3CX4A 4G01B 5WRFA 5HR5A 4J2OA 3WO0A 4PYOA 5DHSA 3QIVA 1JSLA 1KO8A 4J3FA 4GHWA 3MTEA 2FQYA 2H2IA 3KSAC 1UC9A 4GZLA 2FAXA 5CB4F 3B6MA 3LPNA 2QP3A 4HRXA 2EFYA 4O0MA 1R16A 1B2LA 2PRKA 1GTG1 1RRPA 3OQJA 3OX4A 4IFEA 5AW9A 5IG2A 2FRXA 3T99A 3GL9A 1DAOA 1WU7A 3JQCA 5D86A 2ISCA 3GNTA 5F64A 5KPJA 3H2HA 4H3SA 3RARA 3VUEA 4X7BA 3GEEA 2IEBA 4DMMA 4D9CA 1MIHA 5G4KB 3R4CA 5BNFA 3I9V6 4LYYA 1M1NB 1GGMA 4HB3A 4MRAA 4LOLA 2AUTA 4P58A 1I7NA 1JPVA 4C0XA 4PR0A 3ZIAA 3PNOA 1NSYA 1FFBA 4M6WA 1SWVA 3KR0A 1RS0A 1Y8QA 4C4OA 4AJIA 4YMLA 2XCOA 1AO3A 1DAPA 3BS4A 4K26A 1WD5A 3EUAA 3I6ZA 4OSEA 5FYDA 1L9KA 4OXQA 3QGMA 4RMGA 4URYR 5A9RA 3VPDA 4WVFA 5HA5A 3LX4A 1PQ4A 4AKEA 1Z6AA 3WZLA 4ML3A 4FP9A 1N34B 3NJ4A 1E2QA 2VIIA 4DLTA 4F5EA 4R8KA 2JLQA 4TYYA 3K32A 1AHIA 1JJFA 4Z1MA 5CEEA 3A6FA 1PV2A 2ZKLA 3U3KA 4CYMA 1JFFB 4J7XA 4QU8A 4LHXA 2OC9A 2YYAA 4N7BA 4GQBA 4YJGA 1SBHA 5IBRA 1W93A 1K5DA 3KEGA 1ZUNB 2XJ9A 1OI2A 1QYRA 4YJKA 1L4UA 1L4NA 4GI3A 4B87A 1C9KA 3MYYA 2XWQA 1FVXA 2H4ZA 2FPKA 1B8PA 5H59A 2A86A 1E8DA 1FYWA 4ZYWA 2DUMA 3KKMA 3GVIA 4P7FA 4HNAA 1U2GA 4O5OA 2O1SA 3E2MA 3AXSA 3EA4A 3GCWA 3CUSA 4BVFA 5C4IA 3ZZTA 1AMUA 1E5QA 4C6HA 4MVJD 4ALLA 3NHZA 4LRQA 1I2CA 3HU1A 4DRYA 2J8ZA 3SYNA 1QF7A 1TQ2A 3KNZA 1II9A 4IIEA 4LTNA 3KSDO 1DXQA 4F8YA 4CFZA 2V9PA 2VT3A 3K0CA 2F1JA 3JASB 1GITA 3KT3A 3DXYA 1XTBA 1V8FA 2QUKA 1F48A 4XKJA 3OEED 1U1IA 3ZE6A 3WMXA 3D59A 2DX7A 2OHHA 5EERA 5IAEA 2FPSA 4BO7A 4CI9A 5KX5B 2A9JA 4OI2A 3LO5A 3A7DA 3OIFA 2A3RA 1FMFA 3RADC 1FTGA 1HURA 2AKYA 4BZXA 5H82A 4KWHA 1EFTA 1RHUA 1XPJA 2X5NA 3BQNB 4MOWA 3ZUGA 3TB6A 2D13A 3FTEA 3PP8A 4GOXA 2ZJZA 3LPAA 3GBSA 5B4TA 3LTEA 1CQJA 5BSTA 3SU8A 2P0EA 4M1EA 5GWXA 4YEDA 3RFXA 4MP3A 3IOCA 1KJJA 2YMMA 3GEHA 2R84A 4HDAA 4N5DA 2E82A 3OH8A 2PL9A 1T5SA 3DE1X 3H11B 1ZN8A 3Q6IA 4NONA 4CMHA 1PWZA 2XY4A 3Q40A 2IOFK 4ND8A 1NJ8A 1JFRA 4QZVA 3CGWA 5FADA 1K7YA 3G5UA 3GA7A 5I7HA 1TPYA 3MMNA 5IHXA 5JYDA 3UW1A 2OKGA 5EJEA 2E0IA 1NVWQ 2Q3DA 5P21A 1BDHA 4YLYA 5C2JB 3TXYA 1N1DA 5EYPA 3IP1A 1M2OA 6AT1A 3AHEA 1M0SA 1M7HA 1BKYA 3IBTA 3HB1A 5TX7A 3UT5B 2BBSA 3ASVA 3BBPA 2QRVA 3V00A 4DRXB 3C87A 1T3LA 5DM2A 2BV3A 1X1SA 3GARA 3RV4A 4E2YA 5KS2A 3R74A 3ROFA 2D7DA 5AW4A 2FR8C 4G67A 2YNMA 3GCGA 3HDTA 3I5YA 4QGHA 1TZJA 4QC2A 3CX7A 1PG5A 1PAUA 2L0XA 4CNQA 4CMEC 3HEBA 1RWBA 1Z26A 3WMFA 4O4LF 5KPDA 2YN2A 1EZZA 3D7LA 1ZM2A 1ISJA 1SQ5A 4QRDA 1H42A 1ZM9A 2W2OA 2YHAA 4D9FA 4ZC1A 4F91B 2CW5A 2HQRA 1FNNA 3A4YA 3ZWAA 1W96A 2ZIEA 2JLYA 4TWRA 1DI0A 1Y5LA 1BN6A 1WCIB 1J7KA 2Z57A 1BAPA 2XD4A 4P54A 5D3QA 5HILA 3RIMA 3UOWA 4TKVA 2WIDA 4YRLA 4ZQIA 1JDSA 2EW8A 5GZ6A 3A0RB 3NUGA 4A27A 2C5HA 4ASUD 4DMRA 3TS1A 4J0GA 3IAS1 3AF1A 1XAJA 2HO4A 4PLWA 5IKOA 3B3GA 4MEBA 3G23A 3ON5A 1A4IA 3H0EA 3PCTA 4M1SA 4RFVA 1FL9A 3CJTA 5DWDA 3C4VA 3DC7A 2JLXA 1PJQA 2CMGA 2NUBA 4MYTA 1ESNA 1RJ9B 3DP7A 1U7TA 3LXUX 5BSKA 5U4XA 3EWNA 3L2OB 1HDOA 5LUAA 4CLOB 2C8VA 1XXHB 1J49A 3CF6R 2HJRA 3DGEC 3N5CA 4H9GA 3D3QA 4KPUB 5CFOA 5A4FS 4Q3KA 2X0IA 1I7PA 4QTUB 1OZHA 1TYBE 4G5OA 2KX7A 1LW7A 1L4BA 1V6SA 3JQPA 4MS1A 5DGHA 3B5IA 5AP9A 2MINB 1FUIA 2L19A 4H6WA 5CDSA 5KHOC 1RC8A 1X7XA 3KTAB 3GI1A 1P75A 5IT5A 1K8YB 4QBKA 3OOWA 1WB4A 1XZBA 1VSBA 4KI0A 4CIYA 4Z6KA 1TZMA 3CMMA 2AMFA 3O4FA 1G3RA 3PGLA 1PX2A 4O02B 5A7FA 2QBYA 4KR3A 4HN4B 2O7RA 4NV3A 3EGCA 4HFJA 4N1AA 4U7TB 4TTIA 2ZDQA 1N1GA 3MWFA 3OIVA 3D0RA 2CNWD 2WJ4A 4EHAA 1K4YA 3DV0B 1JVBA 1KOJA 2AW5A 3O8OA 3FF4A 4NENA 4YRFA 1W4CA 4EG5A 1YS6A 1AF7A 1DEHA 1ES9A 1RTTA 4QPJC 3VR1A 4D80A 3TGPA 3TR0A 3BHMA 1ZOPA 2P4SA 3B6EA 5AW0A 2VJLA 3LQQA 2X58A 4H0CA 4JSTA 4XUGB 1U7XA 4UXJA 4PO9A 3A1SA 4LGYA 2BZGA 4P82A 3GLFB 3ABRB 3JX9A 3WDLA 4KQ6A 1DC6A 2R11A 3NHYA 4C04A 4RTPA 2DSNA 3I61A 1JEJA 3LKDA 4YUYA 1F4VA 2PGNA 2D74A 3DXZA 5KNLA 4LZNA 4RK6A 1H6DA 2I33A 3V4PB 4C22A 3HG7A 4KR7A 1GTRA 2O5VA 5JPIA 3SZOA 1E1CA 1C9EA 4BAGA 1GG5A 1V7ZA 2LCQA 4XPIB 1W1UA 4L27A 2JJ1A 3OT4A 1V96A 4MI3A 2MSWA 3SS8A 4WGFA 2C59A 1UM9B 2Z1NA 3E3OA 3RO7A 2DP4E 3FLAA 3WJAA 2X8AA 4EFMA 1TVKB 2BD0A 1Y80A 1I4LD 4ZD6A 4B4OA 4DMHA 5F3WB 4QHSA 2ZSJA 1NLZA 2BEKA 1GA6A 1KI6B 2W4IA 4WN9A 8ADHA 2QW0X 5IT0A 1DXYA 4IJUA 3GFOA 3HN6A 4AZSA 1APBA 2FLWA 2OAP1 5ANRB 5BR4A 1RFLA 2UV8A 3BCRA 3C3EA 5K0ZA 1H69A 1TUBA 1VIMA 2OSVA 1FLVA 4Q7JB 4U39A 4E2WA 7ADHA 5JXGA 5DSXA 2BEWB 5H3HA 1LBIA 1D2NA 2MMGA 4BNLA 4KFCA 4MV4A 4MW4A 1A50B 5IJ9A 3IQFA 1Z4IA 3UYKA 3MWLA 4LNAA 3DDHA 4NECA 4EHFA 1ENPA 4D3ZA 2IPMA 1ZJ5A 1E5DA 2C82A 4L5AA 2DPGA 4YREA 2PVSA 2UZIR 2DTEA 2B8EA 2VTDA 3P9SA 2C88A 4NK5A 4AJNA 2O8NA 1G2IA 4P08A 3CH6A 2F62A 4FYYA 4I8DA 1RLMA 2X42A 3PSHA 4D02A 5B1DA 3RUDA 3JD4A 4PPQA 2H57A 1ZW6A 1E2JA 3DUWA 4IICA 2H1OA 3VU0A 1P6QA 4CN8A 2FN3A 2MSEB 1AD2A 3H04A 3PV0A 4IJ5A 4UARA 3DMTA 4WMLA 4LDRA 3QUBA 2OY0A 4QULA 3DAPA 3TLAA 1X1CA 4C76A 1W46A 1EHYA 5HMLA 3TOZA 1MA3A 2NV0A 4DUGD 1ISHA 4WN3A 2RBGA 3OFJA 3H13A 2O2SA 4Y6LA 3DFUA 3BVPA 2R7KA 3A4TA 3MINB 4FWIB 2UKDA 1EWQA 1QUFA 1V6CA 4XARA 1XVIA 2PMWB 3R76A 4MHOA 1Q1AA 1G9XA 1XJQA 4HC4A 3BA1A 1EQUA 5FWYB 4F2HA 3IKTA 3GMDA 3HJUA 5EL0A 1CDOA 3ROPA 3GROA 3SLRA 2ZM6B 4HNHA 1CYEA 4R2LA 5KJCA 4HLUA 3S8YA 3V4FA 4DZZA 2GYWA 4DVGA 3JWPA 1H93A 1QLWA 1T1EA 2LCFA 5FR2A 3UPUA 3EQ7A 2XITA 1UKBA 1W9MA 1GZVA 1OV6A 3QWHA 4E12A 4ZZ2A 2ECFA 3EWIA 4YUXA 5C80A 3WGIA 2PZGA 2VSYA 3CUKA 3GFBA 1FDTA 1UQRA 1YR3A 4YCDA 5K1ZA 4RPLA 3LQ2A 1KPIA 5FIUA 4YPOA 3WLRA 3SR0A 4DUGA 4ZT4A 5C34B 1E0AA 2C2BA 4IP0A 1GRCA 1YS1X 3O8QB 2BY4A 2NACA 3R6TA 3UMVA 5I4BA 2KLHA 2AUMA 2XNDD 4JLUA 4WX2B 2CBXA 2FUG1 3HXQA 1NJ6A 3H4MA 4LSGA 2ZZNA 3KJEA 2DHEA 1XMJA 5AVXA 1DEKA 1UBMS 1YVUA 1Z5WA 4GBMA 5E4JA 3H2ZA 2B25A 2RFLA 1SBZA 1NM5A 1FUKA 2QW8A 1Q0UA 3HB7A 3K9LA 2HZ7A 2XB4A 5ECGC 1T6BY 4DZTA 1ISRA 2ZUUA 3PZRA 4IIBA 3DFIA 5KJEA 4B73A 3IR5A 4LWPA 1U7WA 1NATA 2A59A 2G5GX 1COWD 3KUKA 4FQ7A 4G8CA 1WSAA 4PIPA 3RF6A 3WAKA 2HR1A 1P2DA 2REXB 1TO6A 3C48A 5LLDA 3SBOA 1R8JA 5FA6A 1CQIB 3VJRA 4KDRA 1OYWA 5F5XA 4R1NA 4DG9A 4PO8A 1I6KA 2DTXA 4DJTA 5LU8A 4GVXA 5AK5A 2QAIA 5EIBC 2Q4RA 3EEIA 1BE0A 3FCXA 3GJTA 4ZEOA 3BK1A 4I5FA 5K6AA 3LECA 4IVNA 1NQOA 2QKYA 4PQRA 1JLKA 3PNLA 2PWAA 4ZIRB 1XZFA 1RBYA 4BLWA 1LZKA 4F1JA 4MDFA 2CXOA 3CZ4A 3S2EA 2IYWA 2A1UA 5I7AA 1NUUA 2WA1A 3ZW8A 4C4PA 1I7SB 3TCKA 1M5RA 1TGVA 1YQEA 1GKIA 3CKLA 3DZIA 1NR5A 1O8CA 4GLFA