2PH7A

Crystal structure of af2093 from archaeoglobus fulgidus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
227
structure length
220
Chain Sequence
GMDVEIVEELSKMLAGRKAVTEEEIRRKAIRCALKIMGARLVGIDAELIEDVTCSLIDLHFSEKVKIGDVLFYHPHVIKPEKEDFEQAYFEYKQSKKFLDAFDIMREVTDRFFEGYEAEGRYMRKYTKDGRNYYAFFSTIDDTFEDVDIHLRMVDEVDGDYVVIVPTENELNPFLKFFKQYSEDAKRAGLKIWVVNPDEKTIDPFIGYPKDFRLLKGFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AF2093 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein AF_2093
total genus 54
structure length 220
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3400.10 Mainly Alpha Orthogonal Bundle af_2093 domain like fold af_2093 domain like 2ph7A01
3.40.50.10670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold af2093 domain 2ph7A02
2PH7A
chains in the Genus database with same CATH superfamily
1RKUA 4ALKA 2Y0PA 5JAQA 2IUEA 4JI6B 1YDMA 2ZRCA 1ACMA 3M1AA 3PQ2A 4BLVA 5KX5B 3PHLA 4HPXB 1K7YA 2NQ8A 1E96A 2GCEA 4K9QA 3WB2A 2OYCA 3QH4A 1WTAA 2Z9BA 1K5DA 2GAFA 4O0LA 1J8FA 1WOYA 2Q46A 3TUZC 4TVBA 1BE6A 4R40A 4RPHA 2F4NA 3UF0A 5B53A 5IYZB 1NY6A 3FCUB 1KE2A 5TLSA 3SJZA 1P9OA 5DI9A 1XXHB 1Z82A 3DYBA 3KKKA 3TD2A 5IFLA 3BRSA 1Q6YA 2XB6A 1KQNA 4ECAA 5BPFA 4Q18A 1R10A 1FRFS 1TTHA 1UAGA 2JH8A 3W9UA 2R68A 3M6FA 3GLTA 2FZ4A 2GEFA 3MRXA 1QNFA 1YMUA 3V4PB 4Y3UA 4ZEXA 1QFJA 4PHHA 2FNAA 2IH5A 4YRMA 2CJPA 2D0DA 5ILQA 3TWOA 4ARBA 4ZGGA 3OD1A 3SVTA 2Y27A 2JLZA 1BU8A 1RBQA 3WGNA 5KYXB 2O8EB 4HX9A 1LRKA 1VG1A 4I1SA 4I1IA 4QWWA 1WEKA 6ABPA 2O8CA 1AIPA 1TT5B 4D9JA 2BGUA 2C4WA 2JFZA 4FC7A 4A8JA 4WA8A 4Y2UA 3UM9A 1E3DA 1NVDA 2PO5A 3EASA 4IJMA 4MUGA 5KTSA 4MLZA 4CE6A 1WXEA 3E9RA 4JKYA 4J03A 3BGOS 4NBWA 1I3NA 1L7PA 4QYXA 5BSVA 2NIPA 3ZVMA 4BO1A 5I9IA 1WBDA 2YXNA 1GNTA 1WSDA 4WEOA 5JWHA 3I9FA 2PRYA 3Q3VA 1M8KA 5DSTA 1IPHA 4WNYA 5H7XA 3WHKA 4C05A 1DWPA 2I7VA 2Y6UA 3AJ8A 3BE8A 5E1MA 2HDNB 2WJPA 4CF3A 3B6KA 1DV2A 3PKZA 2E37A 2JNWA 4K9MA 1PJTA 1QCCA 3C3MA 4NE2A 1T4GA 3DV0A 4LCEA 4IDHA 3U9LA 4E2XA 4EHBA 2RGGA 4IDCA 1TGYA 1J5XA 2A88A 3SZRA 3EZLA 1G2PA 3JZMA 4PCVA 1HYEA 1KORA 2W6JD 1JU3A 1V3VA 3RUDA 1VCHA 2OYRA 2G5GX 1CNMA 2CD7A 4FQ7A 5KYNA 2HJVA 4JEMA 2GCOB 4MCHA 3DAOA 3IR6A 4EY5A 4F4UA 4UARA 1V8ZA 2EJBA 2VPXA 3M6XA 5CDFE 2ZCJA 3CMCO 4MDEA 4Z0NA 5DSXA 4PZEA 1G4UR 4OGWA 3SHTA 1CUJA 4MQFA 4HAYA 4W8GA 5DLYA 4ZU1X 3WLHA 1A9SA 4QM7A 1RW4A 3HO8A 5DTMA 1Z5ZA 2YZ2A 1SXGA 2OM6A 4RAQA 4TRRA 4F2DA 3AKCA 3OLQA 3UENA 3RVQA 2GNAA 1F6DA 5CLQA 1EUYA 5JDCA 4G0WA 2PUHA 3GGSA 2ZIUB 1Y1LA 4X90A 3HXLA 2LDBA 2GPYA 2HXGA 3K0AB 4CG2A 1R00A 4RF5A 3EGEA 4P4NA 5HKBA 1UT6A 1RPZA 3NBYC 4DLTA 1NM5C 4ZVOA 2NN3C 1JFTA 4WY2A 4R7ZA 1QH8B 4AO7A 1QIHA 4W5TA 4EHAA 1AKUA 4EABA 3SC3A 3T9DA 1L4KA 1QO9A 2J3LA 4BY9E 3LQ1A 4ZAWA 3MOGA 1I3MA 3V34A 4AP5A 3CF4G 2EXXA 1J5PA 1EJBA 3AUYA 4RLQA 1O6ZA 4N0MA 1Z16A 5ALHA 3JVVA 1Z0IA 2IXDA 5AW9A 4BFLA 2H0RA 5HUHA 1KH3A 4R8MA 2ZYRA 3O73A 3SE0A 4PX2A 3AZQA 3QUSA 4WFKA 4NK5A 1Z18A 4JUFA 4HYYA 1HYHA 5DXFA 3EC7A 3ZHBA 2QTHA 3GJ6A 3BAFA 1JKIA 2XNDD 3AFIA 3H5LA 4MLDA 3AOEC 3W04A 4E22A 2F1JA 1JBEA 3T4XA 2QMOA 3DMRA 3LBIA 3U7EB 1CUYA 2NUTA 3PHJA 3K20A 1LK5A 2G72A 4ZXPA 1US8B 2G7ZA 1TNDA 3USZA 1RI3A 4HLQB 5CG1A 1C0LA 3ENNA 5E9WA 3WDLA 3K9GA 3QE4A 4OHCA 1OFTA 1DLIA 5C34B 3QXCA 1C5KA 3MB8A 3X44A 1KA9H 3BXXA 3NAZA 3STTA 3NANA 1AS3A 1BE1A 1E64A 1QZTA 1T5SA 2ZTHA 3GRUA 3PWKA 3VJLA 4DE5A 3OKCA 1KH1A 2CXHA 2B7BA 3RYCB 1ODTC 4JT9A 3DYIA 1CG6A 3G7UA 2AC4A 1MIHA 4C0HA 4HR7A 4LRQA 1KJIA 2G0TA 5TGTA 1OZ0A 2Y71A 4HEQA 3TD6A 3RGGA 2UXBB 3H5OA 3TLKA 3DDUA 3IH5A 4KJZA 2ARKA 1EHYA 2FV8A 2P9YA 3NNSA 4BE7B 4AI6A 1ZU5A 1MR3F 1UJCA 5K0LA 1USWA 4HGRA 4JUAA 3ZCPA 4BQQA 1V5IA 4E15A 2XR1A 1GT91 3CU5A 3U7HB 3TKLA 1XN4A 1EK0A 2FWAA 4HN2A 5CW1A 2ZLBA 1N5DA 2GT1A 2QLJA 5L7YA 1RZVA 1MQSA 2NSYA 4G5HA 2HR1A 3R0IA 3LF1A 3G2IA 1YQDA 2FEXA 4PFKA 3BS4A 4RGBA 4RD0A 4YCDA 5ALQA 2WAXA 1CY2A 4NBKA 1VSQA 5CCDA 5BXQC 4JQOA 4OGKA 4QWMA 2IEDA 4WXYB 4HEHA 3TZBA 5LJLA 3EGOA 2QSJA 3VKGA 3QP9A 5DFAA 1FW8A 1RIIA 1XQ9A 2OO5C 1YAJA 3NH9A 3DWFA 3U13A 3RAEC 2XTAA 3EFOA 1A3CA 2PGXA 5CA1B 4FFOA 4DUGD 1KDZA 3ANTA 2GUWA 3WRWA 1G7CA 1S3IA 4YJDA 2OK8A 5JJ5A 5CX1A 1D6SA 3HRKA 4ZHQB 4QYWA 1JIQA 4JJFA 2WFZA 3IA2A 5A62A 2BZ0A 3I4CA 1JEJA 1DAGA 2ZB8A 1EFUA 1W47A 1HLDA 4GZ5A 4KRGA 5DXAA 1I6LA 4DY6A 1G19A 2GSWA 2PA0A 3DMFA 3VR4H 4TLDA 5TT0A 4YXFA 1R0YA 2DFTA 3GBSA 1C8KA 3R5KA 3MJFA 4OXQA 4EG3A 1IBRA 1HT2E 3OD5A 4G5RA 1TU0A 2QRHA 1N0IA 3K05A 4M8NE 1RJWA 1KYIA 2V7PA 3RC8A 2P0YA 4M0UA 4K6GA 1QB7A 1NYRA 3CQ9A 3R0ZA 3VVMA 4B6QA 4B6FA 1EKXA 3X2SA 3MZ0A 3D7SA 4DEVA 2NACA 5D5HA 1V6CA 4RVNA 3HUTA 4LGVA 3I2GA 3QPUA 5IBCA 2IYQA 2A86A 3PUWA 3C3DA 5BSKA 5I01A 1YFLA 3BH7A 3QVGA 3FYHA 4EUKA 5DVZA 3TTSA 3YASA 5KVAA 1NKTA 2ADOA 1V5EA 3L18A 4DSAA 2ZUTA 4AKTA 1E0KA 4DFDA 1U8EA 3D64A 4I1YA 3BMNB 3QF7A 1GP2A 3IMFA 2X7HA 2HSJA 2WLTA 3GVPA 1SPXA 5JS8A 1N8KA 3H5AA 4B80A 1MKYA 2YJGA 2UYGA 3QOWA 2O3SA 2AFHA 2OGSA 5AKGA 4ZRMA 2C7QA 1ZR2A 1CDDA 1UEIA 2YXPX 2IYPA 3ZZUA 3UC5A 1ISHA 4FN5A 4BMZA 4FUTA 3DDWA 3QNUA 4H0FA 4PS0A 5FA5A 1AD2A 3BJIC 1DKLA 1E8NA 1LBTA 1XRMA 5D3MB 4LMAA 4Z9BA 2XECA 1AQNA 4DDHA 3L7MA 3MWFA 1G21E 1G18A 1FYDA 1RI4A 1XYGA 3EUWA 5DLDA 3W9BA 3L7LA 2JAHA 4FE7A 4ARZA 4Q02A 5JAIA 3EWNA 3JARB 1LCIA 2F64A 5TX7A 4F5WA 1E8DA 3BMOB 3OZDA 4F3NA 2JFQA 5LZ7A 3TVYA 4XPIA 3QOFA 4Z8XA 4ESVA 1W5EA 4IHAA 2FPPB 1RKVA 4FXOA 4AZ0B 5EXDA 4RZXA 2OHJA 5E6SB 4HZUB 1WZCA 2ZPTX 4KQMA 5IDWA 1A27A 3AF1A 2R1TA 4NU8X 1ADFA 3FWZA 4EQ6B 2CXRA 1RRCA 1EM6A 2EW1A 3D7MA 4PNZA 1PHPA 1NNUA 1T36A 4UCWA 1ZRHA 3AVQA 3RSQA 4PC7A 3QX9A 4EVRA 3HSYA 3HVUA 3ORQA 5AW6A 1GPNA 4ZYWA 3KJIA 2AFRA 1Y5LA 4NHOA 2FN3A 3QMMA 4B3CA 2Z2ZA 4LZPA 1PJ4A 2MDTA 1W35A 3FSRA 2XQGA 3E82A 4F4HA 1SVMA 2Q5IA 1OFIA 3EBPA 4G5FA 5F7XA 2I4OA 4H77A 2C78A 3AEKA 2HBQA 1WM1A 2BHNA 2ILVA 1MH1A 4XQEA 4KQHA 4A1OA 1SOAA 5K0EA 3O47A 2FW7A 2X6RA 1A7JA 1JSRA 3FAKA 3RANA 3SLGA 2H29A 1O6CA 4IH1A 1BMFD 3T1NA 1CYEA 1JWBB 4RKEA 5KJEA 5A3QA 1T10A 4A03A 2QM8A 1ESNA 4GMFA 5ALLA 3H5TA 3IHWA 1XA0A 2EBFX 2JD0A 3T7JA 4ZZ3A 1IG0A 3L7BA 3NRBA 4DKXA 5HEKA 3NGLA 4FOPA 3B7GA 5B7NA 1RI1A 1WU7A 1H2ZA 1OREA 2ALJA 3CWCA 4QTTB 4ZVPA 1ZUNB 2EERA 4YQEA 3ZHTA 1RZRD 3V8QA 3VKVA 4B3MB 4ZOEA 3N3AC 3PYLA 4TVKA 1JLLB 1T6BY 1V2HE 2GM3A 2A9VA 3CLUD 1ZGZA 1U3WA 4C2BA 1P62B 1GKUB 2FQQA 2VVTA 2WUWE 2XHZA 2ZUBA 3L1HA 4KLAA 4OXXA 5E38A 5C3UA 4A3SA 1YZYA 5TVGA 4AJHA 3K4PA 3L7AA 4RZ3A 2BE7A 4IIUA 3C3EA 2NAFA 5KQMA 3P0HA 3VR4A 3WP0A 1Q1AA 1SJ9A 3O3CA 4O0MA 4TWRA 2V7VA 2PS1A 3A3KA 4CWAA 5IKOA 1EQAA 3EQ2A 3T99A 1XDSA 4U9HS 1G60A 3TQTA 2QSYA 4IGFA 2ESRA 4RFVA 2J0QA 2BSAA 2YRXA 1T3TA 4O4IA 1QTIA 1KFJB 1Y1TA 3IEXA 3TE7A 4UTOA 5AVZA 1XPJA 1OXXK 2JFBA 2R6GA 2Z57A 3B2QA 3S6JA 4EB6B 1FP4A 4IIYA 4AMUA 5K7SA 3ANMA 5IKMA 4J90A 2INGX 1H3EA 4UNIA 2BJVA 3NEAA 1U63A 4B47A 1RWPA 5FBKA 4F91B 1OH5A 4J43A 1ZM9A 4RXMA 3D5QA 3NIWA 3S44A 1CZHA 3TEMA 2AWOA 3G17A 2EKQA 3LOPA 4WK0B 1I13A 2Q3EA 1U4NA 1PS8A 4Z4IA 3HR8A 3T1OA 3ZWBA 3F67A 3K0EA 4F38A 1ZICA 3H7AA 3RK4A 1PN3A 4D4HA 4Q9NA 1IY8A 1P0IA 2HV8A 2H1SA 3BM5A 3KVNA 4YMIA 4TSKA 5CX4A 4YY3B 1K75A 1V8PA 4WGGA 1X1RA 4HQ6A 2XJ9A 2JASA 4KB5A 3ETCA 1W36B 1T9GR 2Q5OA 3DXZA 2BSXA 1R6AA 4OY3A 1I2CA 3TOXA 2WF6A 1JJAA 4LOKA 3M3DA 3WLNA 1ZCZA 1DPFA 4N7RA 4PZYA 1WMAA 4RQUA 1E5TA 1VL8A 3CEPB 4GPIB 1ACLA 4DPLA 3QVTA 2PD6A 1PLKA 3UO8B 4BQEA 3MJEA 4KGXA 4QNRA 3DZIA 1ODJA 2ZUVA 3LPLA 1VRWA 3P4YA 4OXYA 2FQWA 4ZDKA 5IMSA 5T57A 4MQLA 1QZXA 1GQFA 4M60A 4M88A 3LDGA 1MQ8B 1M6VB 2I3BA 1E79D 5EJGA 3D6TB 3DMTC 3HEBA 2QLFA 1MP0A 1QORA 4J76A 5HF8A 1PFGA 2VF7A 5K4AA 3R9KA 2C88A 4D8WA 4DZTA 3SBDA 5KTYA 4QGHA 2KBFA 2IYUA 3BA1A 4IOMA 2ZJ0A 1ZI6A 2C57A 1LV7A 4PV7A 4YFYA 3AILA 2Q1SA 1HRDA 4P33A 3UMBA 4B8YA 5CFNA 3RWOA 4RANA 1VL2A 4W7SA 3OZGA 1WWKA 1XPUA 1N32B 2DT8A 3U3DA 4OEHA 4FYYA 2H65A 4Y7DA 5J58A 1Q12A 2VZEA 3ONFA 3QEKA 4LJ4A 3K5IA 4B34A 1JT2A 3GLGA 3T1YB 2LNDA 1IHPA 3QY9A 4YCSA 2DY0A 4DDTA 5J23A 4QYTA 1OIXA 3V48A 1GY8A 5C53B 3L7JA 4YI3A 4C4RA 2C94A 3LP6A 3QYJA 4YVFA 4F6CA 2HO5A 2AW3A 5CXXA 4GH5A 1VA4A 4L76A 2WU1A 1WCV1 1WULS 4WZ6A 2MSWA 1BJRE 4X1IA 4X1YB 1E79A 3QI7A 3T34A 2W7TA 4GO1A 1KK2A 4AYXA 3K72B 1YTLA 5AW5A 2HFJA 4Y9SA 1E59A 3JQ7B 3KVOA 2EGUA 3LFTA 5CT9A 1CUVA 3OLYA 4WI1A 4DWJA 3B5JA 3PQDA 2XJ4A 1VXOA 4RVFA 3RO7A 2HWUA 1RQ2A 2VDKB 3L6BA 2M2IA 3A1CA 4KSYA 4YAIA 2X76A 1DBQA 3A6GA 2BJWA 3K1YA 2EFEB 1MJGM 3BJZA 3KJNA 2ZRPA 2PNJA 1PNQA 4DA4A 4FMCB 5UKDA 5KNBD 1MMFB 4RKRA 1PJLA 4ZRNA 3AZOA 3WP1B 3MC1A 2VJAA 3C3BA 4C4PA 2PL3A 1XVLA 1CJCA 2HBZA 3G8DA 3QU5A 1G66A 1GSOA 1MN6A 3G02A 3UTCA 4D79A 4NNPA 5LZ4A 4R41A 1IAVA 4M7RA 2VOEA 2YJ5A 3QVMA 4H7PA 4I36A 3SHFA 3D6AA 4N0EA 1OZGA 1VPEA 4RQAA 5EMJA 5G2OA 1AXEA 4YQFA 3CV3A 4A10A 1MDFA 3F6CA 1MA0A 1UBOS 1USVA 3IJPA 5JU6A 2R7LA 3PEEA 3VKHA 4B4UA 1NLMA 1PG2A 1T2NA 3C3PA 7REQA 1XCPA 1JPJA 4M8SA 2I78A 3NMUF 3VGPA 2RGEA 2EDAA 2DH6A 1V8DA 2H7VA 4H16A 3WFZA 1BJTA 2CK3D 1F60A 1EJ2A 2QT1A 1TJYA 2HK9A 4DIDA 2GXUA 5EJ2A 3CLHA 2QE7D 4ER0A 3BMCB 2J07A 4UOZA 2J3KA 1S7GA 1DKRA 2P5UA 4IX9A 4WLEA 2G40A 1C3LA 1K9SA 1ZONA 3I1IA 1ESEA 3JR3A 1XNGA 3BD6A 3JYNA 1RTTA 4I7EA 3X1MA 4DMLA 4QGSA 3PL5A 3O95A 5L7WA 1T3LA 4JP3A 4D9IA 3E8MA 4DSOA 2XUPA 4TLMB 3KB1A 1OIWA 2G5PA 1NVFA 4KPUB 2Q0QA 3KZVA 4IGKA 3R7FA 2E4XA 1PZNA 2PS0A 3I5MA 4R0VA 4RWZA 3GXBA 4UUMA 5LP6A 1FP2A 2AN1A 2OUIA 2ZWIA 4HD8A 1WCIB 2ATIA 3HKDB 5TRTA 1QTQA 2FN7A 1VI5A 2QLBA 4TS1A 2V0CA 5LP6B 1YGPA 1M8GA 3DZJA 1HG1A 1U9IC 3HCNA 1LI4A 2HXYA 3QA3E 1L4GA 4Q3AA 1L5KA 5JMPA 4K9LA 2VDRB 3NTOA 1GPUA 3IP5A 4JBXA 1GPMA 3E3AA 3EYAA 4HEJA 3U17A 3TXXA 4Y18A 2IE0A 2IP4A 2WQ6A 3RRMA 1ZITA 3FIUA 1TIKA 1NRWA 4CR8A 9GPBA 1RADA 1ZD2P 3F78A 1OKKD 1SR8A 3OMLA 2FUCA 4UM9D 3TW0A 4GYWA 1IJKA 1CYDA 4V3BA 1JJVA 4ND8B 4ROTA 3CW8X 3UMRA 3WGVA 3CGGA 1H8ED 4U2KA 4NEQA 2ZJFA 5AI4A 2W2LD 4DV2B 2OG2A 3VOBA 1FBTA 1L8OA 521PA 2NPFA 4ENSA 2WKRA 3S0JA 3O90A 1J22A 2BMEA 4LYFA 1KZYC 5CK5A 1ONSA 5FIUA 2FGJA 4A0GA 3F6EX 5CBKA 3HKCB 3N9IA 3IX7A 3UHPA 3D2CA 4G3XA 1EWQA 2CC2A 1WUHS 1IDOA 2NZXA 2ZJOA 3IPCA 1QAOA 2ZDGA 3KVVA 4W63A 4TYQA 4L3WA 2O8CB 3ZY2A 5HRAA 5KSYA 4URHA 2K4MA 1L8XA 3QFCA 3KOZA 3S8EA 1XZLA 5AJVB 1GZUA 1GIAA 1H0RA 2H9YA 3NBFA 4OIMA 5EJAA 3SJCA 1PYDA 1KC3A 2OBBA 3GYBA 1KDPA 1PV2A 2X8BA 2ZJ3A 3PPWA 2QRVB 3LA6A 1M34B 3L0YA 2GN2A 1QGED 2FRXA 2GPWA 2BR3A 3EXG1 1Y81A 4RM2A 5A4JA 3OQMA 3VYSB 4IIDA 3SEFA 2ZATA 3S2YA 3QFFA 4TMZA 4HQRA 1EWYA 5DYYA 1F9AA 4UPVA 2VTDA 1M1YA 3PUKA 3AFNA 1VFNA 3GQVA 3QITA 3RJ9A 4ZDIA 1BU5A 4XLTA 3QX8A 2EW2A 3WLJA 4EKGA 3EHDA 2D0PB 3FPBA 3RFXA 1E9AA 1E5XA 3EISA 4G1FA 1R7RA 2H2FA 1V45E 2C58A 4HDCA 1YA8A 1ZMXA 1NLYA 4L02A 2A1UB 2QL6A 3DQQA 4JSYA 5CJJA 3SKXA 1K88A 5E4TA 1IY9A 2H5LA 2J41A 3DCJA 4IHKA 1UDXA 4B6RA 1DI0A 3IUBA 1YAHA 1H93A 4TKLA 1KOGA 3AL2A 2IYEA 2E2WA 3N8KA 4TV8B 1EUQA 2RJOA 5KS2A 4UU7A 3WFIA 4DA8A 2QVBA 4X3OA 1N2ZA 3ASUA 4DDMA 2LZ0A 4J1TA 3N0VA 3GK3A 4I3GA 1TTTA 2YS7A 4B7XA 3QV2A 2HHHB 1YFJA 3R7DA 4DCVA 3BZUA 4XFDA 1VGVA 2FHSA 2XQKA 3FB1A 1V7CA 4YROA 1KYWA 1KYXA 4QPDA 5LQDA 1PL6A 4KAXA 2AVDA 4MZDA 1QHXA 3AKZA 4YRQA 1L5GB 1MIOA 5T7BA 3U60B 1RP1A 2JZCA 3MUOA 4PYMA 1Z0FA 1W9MA 5CM9C 2Z08A 4ZD6A 3RGWS 1N33B 1DPGA 3ZD7A 1OBVA 1X7WB 4N39A 4MP3A 2CVPA 4LHVA 2CL6X 5DRYA 1KOLA 1DXQA 3BZWA 2FDXA 3R6WA 4FCVA 1IZ9A 4K6FA 1JI3A 1T36B 3TCKA 2G0AA 3UTDA 4XD7D 3DMDA 3CVWA 4MH0R 1K0FA 3BHJA 5IKEA 1M1NB 2H4ZA 4R01A 5B3KA 4R7TA 1JAZA 2DH5A 2FZKA 5BMOA 1VHWA 3NWEA 4N3NA 3RVMA 4F9GA 1HDEA 1H23A 3HLTA 4RIHA 5ALFA 3VM6A 4AZ0A 1NWCA 3KTFA 2W71A 5IAJA 4XTRA 3L4JA 2FSHA 2JGKA 2R3SA 3O9VA 3QVOA 3EXHC 2V3VA 4JGBA 3SBXA 3SJAA 3V2GA 5B6IA 1E9BA 1CUIA 2B1QA 2RC5A 4M1WA 3HRHA 3L7IA 4B4OA 3UIEA 1LBEA 2IIVA 1FSPA 3WMFA 3INYA 1I1HA 4MZXA 1ODKA 1B43A 1I36A 1U7XA 3HB9A 1YOVB 2QUZA 2B2NA 3BQMB 1GPAA 2NW6A 3DE3X 5TS3A 3HJGA 5GWXA 1KSGA 1K8QA 1M73E 1CUGA 2R5NA 1ABEA 3RJZA 1YC2A 3LHKA 1OLXA 2HWWA 3MT7A 4KN9S 2D2VA 3MNFA 4TS4A 4OQLA 4URZR 1W94A 3QPBA 4PAWA 1PNVA 5GGYA 3RRJA 1RWKA 1M1ZA 4DBLE 4XJSA 2PGDA 4OJYA 3H9EO 4G89A 3REOA 1R37A 1SRQA 4FYMA 3VPCA 3VZCA 4MDFA 1L7MA 5GV7A 5AFSA 1TLTA 4JOCA 1PR3A 2F9LA 3ZVNA 4LYGA 4NH4A 1YT5A 3FBGA 4FYHA 4B48A 2IEGA 1EX6A 2L19A 3RM3A 1WV1A 1WSBA 2FF7A 4MKFA 3TSCA 1S2DA 4U8HA 3GA5A 3ZWKA 2PJRA 1ECJA 1MB9A 4KGVA 3H8JA 5M04A 1K08A 5KPJA 2J3MA 1QYWA 1T1SA 3HY6A 3ETDA 4JCCA 2FFQA 4MKZA 4D8VA 1H9CA 2P5YA 4HDSB 4KX5A 3KYCB 3EFHA 3TGLA 3MFYA 4CEJB 1X1CA 1UMKA 2VYVD 4M1MA 1YZ3A 2CNLA 1T4BA 2E4VA 2ODQA 3I9KA 3K70D 3SZOA 4R51A 3H04A 1JEAA 3MJVA 1MPXA 3Q3IA 5HFJA 2ZANA 1NOKA 4F6RB 4ALIA 1LDMA 3CLTC 4NPHA 5D8DA 4CF4A 4LC9A 3Q7PA 2XY4A 4W99A 4AAYA 1GQOA 3W06A 3FZYA 3DMYA 3VZPA 3AU8A 1EGQA 3Q5EA 3IURA 3TIXB 3A4VA 3Q11A 2OO5A 3GRKA 2GHTA 3S2FA 3ESRA 3S7ZA 1DEXA 1DBRA 1CHNA 1IEQA 3SM3A 2GXSA 2HTEA 1CHDA 4QDXA 4YYZA 4ZK6A 8ADHA 1BE0A 4XYMA 2XNJA 2HU8A 1H5NA 1KI8A 4ISBA 2ZSEA 3LPAA 4OQ4A 1JIVA 4LJKA 4M37A 2REQB 5FNVA 4K9SA 1OAKA 1ZXLA 4LV5B 3OFSA 2Q8QA 4JH0A 1JDJA 1L0BA 4N18A 3AVXA 2Q07A 2P67A 4ZCIA 5AK0A 2IODA 2NU6B 1EYZA 4G4IA 3VOSA 5IDQA 1NQVA 3HU2A 5BR1A 2VDWA 1JHZA 2B35A 2XT6A 3IP8A 3DLTA 5DOZA 3BJEA 3S99A 3ABQB 1ICEA 3PLNA 5B55A 3I9NA 1SAYA 3OUTA 4RF2A 4KQJA 4RK6A 3CR8A 4KLCA 5D3QA 1XJ0A 3D3WB 3IMCA 5B1YA 3HO1A 4HSGA 4KSCA 3D4OA 5IDXA 3PPYA 3IEPA 1CRWG 2A67A 2UKDA 3CLSC 4DMFA 1UK7A 4C30A 1FLNA 2FPWA 4D0GA 1I6MA 2BF4A 3QRWA 4E4YA 3I6BA 3QKWA 1H42A 1N75A 1EBFA 2O14A 5B1SA 3TZKA 2XE8A 3CRRA 1F8YA 1WDWB 3D6JA 5BUZA 5HK9A 3K71B 5BSWA 4JD5A 5KQGA 1U8ZA 3RVNA 3JY6A 4ZC1A 3KYIB 5A05A 2PVSA 4B3IA 4QU5A 3D7LA 3V1MA 2W90A 2BMVA 2WU3A 3K35A 4JV5B 4LSWA 2XRYA 2G67A 2HRCA 4Q00A 1S2MA 2LKDA 2P9ZA 3O74A 3ABRB 2WIGA 5C0OE 4FYJA 2PKQP 2WZQA 2YY7A 2P9FA 3L7DA 1G2IA 5GQSA 1T1GA 1Z56C 1BRMA 3PEVA 2ZTLA 1HSZA 4HNVA 3I2KA 4PLVA 1M2GA 1UEXC 3U0VA 6CHYA 4O2AB 4J1SA 4PYJA 3EVTA 1YQEA 3LFUA 3E35A 4M1EA 3PLRA 3HU1A 3NHBA 1HTWA 4GUDA 4BVKA 1S2NA 3N7AA 3UK2A 1KYYA 2FDCA 1DKMA 4G4SO 2IYSA 4CR6A 1ZN7A 3VSCA 2Q5HA 4EGFA 5TMEA 3ITKA 4HB0A 3VV2A 2QU7A 1H8HD 3D7NA 2H63A 1SURA 5JALA 3CVUA 3AONB 4IDNA 2YWEA 3ON5A 2GCOA 2GTPA 2W2TA 1DARA 5L9AA 5TIIA 1XIVA 2PZJA 3VTAA 2C42A 2ACEA 2ZXFA 1YZFA 4WW0A 1TCCA 4K0RA 4UUOA 2WWVD 3VU9B 3PRKE 2ZJZA 3ZY3A 4ZYXA 2C2YA 3ZDAA 2JF0A 1XTKA 3D3NA 2VHQA 4FIDA 4TV8F 3P0RA 2QXUA 4CFSA 3ONNA 3NEJA 1J1IA 3FI0A 4LXTA 4W5QA 5E4FA 1V71A 1B6GA 3R3SA 1R66A 4JVOA 4YT4A 4YBRA 1SC4A 1RLUA 2QRUA 5GZ6A 4ZJPA 4J8PA 3KVYA 2EBWA 3NATA 4AO8A 2WHEA 1MFZA 4DNXA 5A6VA 1JDTA 4QATA 5E3IA 1OI3A 2Z3ZA 3S8MA 3K9FC 1OZHA 1XWFA 3F9IA 3OM0A 4NOMA 1GZVA 2C4TA 4JYAB 2H0QA 2MINB 2QXYA 3OHSX 5DZSA 5JJIA 1K6XA 2QMEA 4DSZA 4ALJA 1OFGA 4O5OA 3R8XA 5AOCA 4G0PA 4A5OA 3FDFA 1ISGA 3AM4A 3GDFA 4J0IA 4J6FA 4LNUA 4OHWA 3DTYA 5JG7A 5HR5A 3FLBA 4FWTA 2ZU6A 2A3NA 2EYQA 1FK8A 2J3EA 2P4EA 5J5VA 2A2ZA 1Z7YA 4R9RA 4KYTA 2VPZA 1I7PA 2X5NA 4KIUA 4AMBA 1ZH2A 1V39A 2CE2X 1ULTA 2P3QA 5LZ8A 2HHLA 1NG9A 1AN9A 1F4LA 1XN1A 2A9QA 1GLNA 1SCQA 4Q9KA 3SDBA 5MDHA 2EEZA 2P9HA 5DHTA 4E6PA 3WG9A 1A9YA 1KFBB 1QP8A 2E5WA 4KOEC 3RRXA 3ZXUB 1RRFA 2W2XA 3IYLW 2DR3A 1ZMTA 2FZCA 3O4RA 4IQGA 4TV9B 4BNXA 5KNLA 1H2BA 2BWJA 1QX3A 3HCOA 1SZPA 2G1JA 3B7PA 5FPSA 4PGFA 1M1XB 3K8OE 4XWYA 1QGOA 3BXEA 5HIMA 3H83A 1FNMA 4LK2A 2ZPUA 3DVAB 2O8FA 2XNCA 2TYSB 1GYPA 3IAM6 4QFMA 2JHGA 2BMFA 3CXRA 5EP4A 3P0EA 2BFCA 2HLDA 1NHGA 3ONVA 4Z0TA 2SCUB 5TT1A 2IYLD 1U65A 3KKEA 4C87A 5KB3A 4AZSA 2F8TA 4TQGA 2VTBA 3GJ5A 2VHZA 3NKVA 4XJVA 1RZ3A 5B7GA 3NIFB 5CP8A 5A71A 2WSSD 1AX9A 1Z8DA 3JQ9C 2GRUA 5AI5A 1OB5A 1W76A 2OECA 4TTQA 1U80A 4BKMA 1U31A 5AP9A 5AVXA 5HVNA 3R6DA 1ZM4A 4MGYR 1J8YF 2CHFA 3MCUA 1T6YA 2F90A 4YALA 3M5DA 5A6SB 4RH3A 5K0TA 1IG3A 1FTQA 5EERA 3R3XA 1SOUA 5EZ5A 3DKKA 3AVWA 3C87A 5IEBA 3UEOA 4HUQB 4CFZA 1WF3A 4X8MA 1E2UA 2IZ0A 4KACA 1O6BA 1SQGA 1FTGA 1K6MA 3E9CA 4P92A 2E7ZA 4Y1RB 4X63A 2YV2A 5HZGA 1O54A 4PZUA 2P4UA 4HH0A 4FUQA 5JD3A 1Y7PA 1C4KA 1JLHA 2IPLA 3B5IA 4UUAA 1UXKA 2A9PA 4FFDA 3AEUB 3PR3A 2OWEA 4R2IA 4RVDA 3SBEA 4C6SA 1EXMA 4BV9A 5C52B 3SX2A 1DC3A 1HORA 4GKAA 3RNOA 1XTIA 1MU0A 2GXQA 1G7SA 4C76A 2Z6VA 4EYSA 3W5HA 5I3CA 5TDHA 3GNLA 1L6RA 4QU0A 5DM4A 3N2EA 3QIAA 5HXAA 3A6PC 3PNSA 3EVFA 4NDAA 1P5ZB 2L42A 5K3SA 4KR9A 3T35A 1UP6A 1VRCA 1ZOPA 3A31A 3DUFB 4F2HA 4KO1S 4WV3A 4XWOA 4G65A 3W2GA 4KDEA 5I9NA 3CUVA 2WEKA 4BTEA 3D8SA 1QKKA 5C1OA 5J4VA 1EA5A 2BFEB 3EW7A 2EF1A 3KLBA 5F51A 3UWOA 4QE3A 3WLRA 2O3QA 1P45A 4L0DA 2JI8A 4QVGA 5JADA 3TIGA 3HGTA 3WWDA 3PGLA 3RSGA 4N5MA 5KAPA 4JU9A 4QRDA 5I7UA 3M7IA 3P19A 4UCXA 2AZ4A 3RYTC 1E9RA 1IBKB 3EGDA 4GIBA 3MA0A 4GL4A 2WVHA 3AI1A 4GQAA 2GTHA 2GEUA 3I2YX 3B1VA 1EK6A 3HWWA 1E3WA 3QBDA 3WNVA 2PX8A 1P6XA 3PRJA 2HAEA 4KEAA 2P4SA 4DDUA 2QTWB 2Y0BA 3QEMB 1ADJA 4PC1A 4E21A 1E3WB 4FC6A 4C0XA 4U7PB 4BP9A 2XZPA 2WK1A 3HV2A 3I04A 2GZRA 3O26A 1KSFX 4MR9B 5I7RA 1IXSB 2PSSA 2Z1DA 1R9JA 1BHSA 1H6DA 3CINA 3ITDA 4WZAB 5CA0A 4KUHA 3T0GA 3TBHA 3TBKA 1BMTA 4Q5IA 2Y66A 3WYAA 2I67A 4HBZA 3QLVC 2WYHA 3FYCA 4DV0B 3F7OA 5F52A 1QCDA 1DTSA 3A37A 3I3OA 4ERXA 4NJEB 4GOKA 4MVJG 3IJRA 1A98A 1YHZA 2HU7A 4JT2A 2XCQA 1NBHA 3AEQB 1PKEA 4QDTA 4JZYA 2ZT7A 3A1FA 1S8OA 2CXPA 4YLYA 3P2KA 3WOHA 5BNIA 2AJTA 3SNHA 3W05A 1J2TA 3F97A 3J80A 3EVCA 1K6IA 1CJMA 1Z0DA 5I7HA 1JSLA 2PLAA 1JSXA 3W8DA 4BKRA 2QMYA 3T94A 1Q7TA 3WK9A 3S8YA 1I4LD 1V5FA 4ZAGA 4DQKA 1YJ8A 5IAKA 4AKIA 1F2TA 1FMCA 2V4ZA 3JQCA 3LP5A 2MYPA 4L8YA 8AT1A 1NT4A 2HWKA 5AM5A 4L6IA 3I12A 1KDVA 3KETA 1VL0A 1P1HA 4HX2A 3ZI0A 4D44A 1O94C 1YQUA 3IE0A 1UFOA 3I52A 3KEGA 4FE4A 4KQ6A 5AUNB 4IQ4A 4WK6A 4MI3A 3IUNA 3I39X 1SXJA 1H2EA 1W5TA 2XUGA 1FLVA 4K26A 4REMA 1HDRA 1NYQA 1KPIA 3OZBA 4TPKA 5JC1A 5B4UA 1P7CA 1Q84A 4G2TA 2QVXX 5DNUA 4XDHA 2PANA 3EZ6A 4UD6A 3TQQA 3HJNA 2B94A 2JLCA 4RA6B 1DAPA 5HDBB 4I81A 1FTNA 2CDAA 2AMVA 1J1ZA 1E0JA 1NXVA 1ZK2A 2K87A 2WIAA 1ES9A 3ER6A 4F2WA 1KFKB 1ONBA 1BH6A 2GRAA 2WPDD 3N0RA 1J70A 5HZMA 4DZZA 3FZGA 1LFDB 4FHDA 2P5SA 1CC1S 3A3OA 5IDVA 2G88A 2EWMA 4KWTA 3WIOA 3GHYA 1QGYA 4LZJA 1I32A 4KREA 3HL0A 1KRXA 3K32A 1QE0A 3UBTA 1C7RA 5AJUA 5U4QA 1IEWA 1CQJA 2QVYX 3D2LA 2H8GA 3ROPA 2A9KA 4JCOA 1XMJA 4UPDA 3STUA 4E94A 4F7DA 1FIUA 2C9BA 1RQXA 3ZJYA 4DR3B 3INNA 1Z0SA 2XNKA 4FONA 4WN3A 2V58A 1SHTX 1EE2A 2OCKA 3A05A 2OVFA 1CQIB 3KOXA 1GNPA 4Q48A 2CY0A 3LVFO 4QG7A 4XVUA 1SG6A 1SXJE 4UVGA 4DNOA 5CITA 4MUAA 3WGQA 3WYDA 1ZVVA 1EIWA 3U44B 4MLPA 5AKYA 4XRGA 1VIDA 2WTMA 2XAUA 4GMKA 4Z4GA 1CNEA 2A30A 5AW8A 4E2YA 4TV9F 1O7JA 2EOAA 2L0XA 5AW3A 5IEJA 3HJHA 4POOA 5F1PA 2AZXA 3WOVA 4TTIA 3WK7A 4QECA 2IOHA 4DR6B 3LWZA 2ZJ4A 1L5VA 5TPZD 2QE7A 5KC8A 1YJAA 3KBOA 4JEHA 3RI3A 3N05A 1KE1A 1WE2A 1J6UA 4MUEA 1BFKA 1JAIA 1NONA 2DPGA 3G8BA 3KZXA 1EFPB 1ZK4A 1U11A 2FQXA 2ZT8A 1XYVA 2V3WA 1SCAA 1KYVA 3D3KA 3P9IA 2KLBA 2Z2KA 4GKVA 5DE3A 3VC3A 1GPKA 1PD0A 1OLUA 1X87A 3RDPA 3CX3A 4PHGA 1AKTA 5EJEA 3W6UA 2QIPA 1EESA 2HK6A 2BEVA 3L84A 1R0WA 3GRYA 4UHKA 3STXA 2AN3A 4AQDA 4DCGA 1STOA 3F2VA 5LUAA 2JZNA 1T25A 3ZNQA 4DLXA 4I8XA 2QSUA 1XL1A 3DP7A 2G04A 4HS9A 3KT3A 1K7SN 4KE7A 2F3QA 2YZGA 4LY0A 3U3ZA 1E6KA 1ESCA 5DGCA 4H6VA 1GCOA 1AQYA 1THTA 1KGSA 2OILA 1IBMB 1TUGA 2NSJA 4KXLA 2VWQA 3MGCA 4GWGA 2GEKA 3IE2A 5DNAA 1G2OA 1BD3A 2VDQB 4HH4A 2MHCA 4B3JA 3AFGA 4DV4B 1F06A 1DV1A 4EY3A 3L92A 3THOA 1RCTE 1SKAA 3BIWA 3VNBA 1UDWA 4EFLA 4Q66C 3MGKA 3OJFA 2K6GA 1O97D 3OJLA 3WWCA 5LM3A 1J42A 3AVYA 2VCYA 4QUBA 4MPPA 1GTRA 4PANA 2VKTA 2V97A 2P6UA 3FFXA 1MZVA 4Y7CA 2II6A 4BNJA 1SUSA 5JZSA 1RAFA 4PSUA 1L7AA 2GD1O 2PXCA 3EF1A 4GZLA 4WK4B 1IWPB 4YAFA 1YDGA 2ZRBA 3L5OA 1YUBA 1N1GA 1R5NA 3JZIA 2W48A 4R1QA 4AS1A 5I9MA 5FBWB 4F8YA 5AVRA 2WC1A 4B46A 1N6KA 1X80B 4WY8A 4JJ4A 2Z4SA 5I5EA 1USGA 5BOSA 3FUTA 2FOIA 1WB9A 4M8IA 1Z5PA 3LCVB 4P53A 4JYZA 3MT0A 2CVFA 4KDFA 4FDUA 4C1NA 4NMHA 1JHPA 1NJFA 3BMNA 1Y3IA 1PJAA 2R8ZA 3SHOA 1KQGA 2Z5GA 1TJ3A 4IVQA 1NV8A 2PA3A 4OUKX 5A4KA 3BMCA 5PGMA 1DIGA 3NIBA 3OPYI 2GN4A 3JYOA 1DBIA 4O2RA 2VHYA 5IULC 2QTRA 1GCUA 4C89A 3SR4A 2Q6LA 4U6QA 2UUOA 5AWFC 2CMFA 2JFFA 4U7DA 1KKLA 3G5LA 4KFCA 3L8ZA 3MN1A 4ES6A 4FD3A 4MR7B 4PHTA 4BVLA 1XDZA 3HV0A 4EKIA 4WA7A 1V47A 2V0GA 1PW5A 3H4TA 2QL7A 2ZJ2A 5HS4A 2TMYA 1PT9A 2GQ0A 3B1ZA 5DASA 1G8PA 2R7KA 4N5DA 5G02A 4CCYA 3EE6A 3OWOA 1RFLA 5IBRA 4OKSA 2W42A 4LDNA 2BISA 3E9NA 5A3RA 1NSTA 3OP1A 4EJ2A 2UZAA 3P2OA 2FH5B 3MT8A 3SHVA 5DXJA 1JEDA 4KXYA 5BN1A 4ODIA 1QG4A 1RHMA 4M0EA 1AMNA 1JIJA 1WPQA 1E99A 3TQSA 1V2GA 2VRCD 4A26A 5D86A 4ABTA 3L8HA 1UWCA 4OK5A 4QBFA 2HO4A 1W88A 3GJZA 3NCHA 4HNAB 4I46A 4J4TA 4JYMA 4NONA 2OD9A 3QU9A 1W2GA 1WXDA 4RTMA 4MV7A 1ZXBA 1JTVA 3GEHA 4PLWA 4F6LA 1IL0A 1L8AA 2BW0A 2FN8A 2OC4A 3KZ1E 4DCMA 3ACBA 2Y92A 4D9GA 4A8PA 2WIDA 4DW8A 3CZAA 2G63A 4O25A 3AFOA 4AJ1A 5KTNA 3CVVA 2XZLA 3HI6A 1M0SA 2Z1NA 1IM5A 4MLCA 3MUEA 2QUAA 1FTWA 2DQYA 1YBVA 4R69A 2HRBA 3GJQA 1W5SA 2HMSA 2FF5A 3UGJA 3S1SA 1XRPA 4ZVQA 4DA6A 1RABA 2BI7A 3PYMA 3AR5A 3TOZA 1NBMA 2W43A 3RH0A 1NP6A 3DE6X 1MG0A 4MCAA 5LNK6 4WBNB 2IIBA 4IWNA 4EHFA 5H59A 2VP5A 2IYVA 3HYLA 4BFCA 4F1WA 2YOGA 3WK8A 1DQSA 3DG9A 3I2FA 4HDQB 2VDOB 3ENKA 1PRYA 1V43A 2PMBA 4FX2A 4LDZA 1TIBA 3ROEA 5G0UA 1XHFA 3SGLA 3VYVA 3ZWAA 1MH9A 3WWYA 2H48A 4ZIRB 4JJZA 3DCIA 4HAWA 4AQ7A 3NVDA 4DA0A 2RHCA 1KETA 4OJKA 1IHOA 1GRQA 5JCOC 2RC6A 3AGQA 2PZMA 5DOVA 3ZDCA 4WASA 3HA7A 3ZBPA 4R7GA 4O2AA 1HYBA 1SOMA 1P75A 4NCHA 4MVJE 4OH1A 2KM1A 5GVSA 2MYUA 4HTFA 3TNLA 2DHEA 1GRNA 2B5WA 2GOYA 3GRRA 4L5AA 3ZU4A 5CDGA 4Z7QB 2PQMA 1ZMRA 1HY3A 4BV2A 1NDUA 1C7IA 5TPZA 3AIKA 2JW5A 4XUEA 4UNRA 5DGDA 1U1FA 1E8MA 2HNAA 3A3YA 3B9BA 4N0QA 4BNGA 5JEDA 3DLHA 3E23A 1E32A 5KDOA 3GPLA 1LH0A 3C3CA 4Y9RA 1DJLA 1QO0A 4LZZA 4DR2B 4FYVA 4GX1A 4LYJA 3THWA 4KKVA 1YIDA 5DSZA 3ZWCA 2ZE6A 4KVAA 5AW1A 1I14A 4OV6B 1IWOA 3D9QX 1UM9A 1IOZA 1XVIA 2QZ9A 2QP9X 3F9CA 3N76A 2XBMA 1A9XB 1EUCA 4ZTBA 4U2GA 3BB3A 2ZQ5A 3TLJA 1VECA 3QEJA 2QLTA 1LNZA 3O82A 3AWIA 4FK8A 2Z2XA 4HZUA 2C9MA 4IJ5A 4RC9A 5T3UA 3RRNA 2WM2A 3VTFA 5AVTA 2BTEA 3CYFA 5LBTA 4ZJUA 2W2KA 5KNBH 3KT6A 4O1MA 2O3TA 1HDCA 3PDCA 2H4HA 2PCJA 5HGJA 3PSAA 3OJEA 3VSAA 1TA9A 2YINC 4TMFA 2PDAA 3TVDA 5FI1B 2V7QD 2PMKA 4ZGWA 1ATIA 3U40A 1L3BA 4D9FA 1LQ2A 1KYTA 2B30A 1QR2A 1JEYA 1DQYA 4YDRA 1LZKA 2AD1A 1P8JA 3ASZA 3CHYA 1JS1X 4HNQA 4TL7A 5DNWA 4F97A 1KYQA 4ENUA 5L6MB 5AK4A 2ZUWA 5IN5A 2C7GA 4DCNA 2JRCA 2WOJA 1HC7A 2AXQA 2Q4OA 2C2WA 4MYHA 3GCGA 2TMDA 3LV8A 2WIFA 4WFQA 5F77A 3UG6A 4C14A 4WCFC 3FMVA 3FNRA 3VRHA 1OASA 1N8SA 4P5DA 2ABWA 4KZPA 1XKTA 2EFCB 2N1BA 3T54A 4CG3A 5BVGA 4B71A 2AQ8A 4ML3A 1H5UA 3RSFA 3EIFA 2J3IA 2X4LA 1L5YA 3BRCA 2Q6IA 1OLXB 1U3CA 3GDWA 4GFDA 1Z33A 1KNXA 1VE7A 3C8ZA 3UB4A 4JMLA 3UMFA 1SM4A 5JSFA 2ZAYA 4Q93A 2PT9A 3HJFA 3AM1A 4P4UA 3FWHA 5CXQA 1SCIA 2P6MA 2ZI6A 3DDOA 4LMBA 5C1DA 2ZS8A 1G1MA 1HF3A 1BX1A 2OEPA 2ZYGA 3BREA 4B3RB 4ZCSA 2Y9MB 1QBKC 2JLBA 5FHRA 2Z5VA 1YJBA 2I4MA 1BAPA 1IJFA 3OUZA 4PZDA 2XUZA 3IPXA 3THYB 2BKXA 1OFHA 2HQRA 5D5PA 1DXOA 5LU9A 3RQSA 2VPTA 1YVDA 3IP6A 3ABSB 4M54A 4H4CA 2IPXA 1RPTA 2O0KA 5DWDA 5E7JA 3V7FA 2NO5A 2FQ1A 2TSYB 3KO8A 4X8HA 5F2OA 1YR3A 5DGXA 4YP7A 4E2WA 1N2CA 2C0QA 2YFYA 2KYRA 4YUYA 2P5TB 3WIBA 1EDDA 1AKRA 3DCNA 3PWZA 3QX7A 1SULA 4OMFG 1ZBDA 3KLNA 5BN4A 4CMIB 2GJAA 2WWTA 3H2SA 3SCZA 2FMIA 2D1QA 2O7VA 3I23A 4MTCA 2GK3A 1Q22A 4O4LF 4IGEA 1Z47A 1J8DA 4XUCA 4R8SA 2FMFA 1M2EA 1FNCA 2B36A 1M66A 5FTLA 4Z9FA 5ERGB 3M9LA 3MOSA 3KD3A 3LO5A 2QHXA 4BAZA 3IMEA 4BN4A 1GAWA 4XUGB 5D2CA 5KYUB 1RAIA 2XDWA 5JAMA 5IH3A 4MP8A 3OO1A 5F4BA 4K87A 2VP3A 3CFYA 3M9XA 2C8JA 2HCJB 3OC6A 5ALKA 1QH8A 4UDYX 4PLPA 1DX6A 1KVTA 4H3SA 3SZ3A 5E3JA 2XXJA 2GVDC 2J31A 1P91A 1U0JA 1V7PC 1E3SA 2XIQA 2YOFA 3C85A 3H5RA 4S1VA 4YMUA 1NJGA 3A9WA 1HNXB 3O3MB 1A50B 1JQLB 1UP4A 2HI0A 2Q3JA 4MW9A 4DF3A 3LQ4A 2QTLA 1GM5A 4DIOA 1IQPA 1PR4A 1Q1EA 1UBLS 2HL6A 3DE1X 4MV6A 4WCDA 4UUQA 1Q0ZA 1KAMA 1IZ8A 3N6VA 5A9RA 4RNDB 1A9XA 1E5VA 2Q5LA 3DEZA 4MNTA 2F59A 3ZLBA 2CCGA 1G4HA 1YCHA 3TKYA 3SYLA 3KR9A 2YN2A 4FFWA 1HETA 1TZBA 2FMXA 2ZUEA 1NSYA 5BRNA 1U2TA 3BGVA 5BWNA 2BGNA 4X7MA 2ZSAA 3KQKA 5C9ZA 4PTYA 3PPVA 2C77A 2P1RA 3LXRA 5LN1A 4NE9A 1EK1A 1OSNA 2C83A 2VUHB 2Q1UA 2XRMA 3G1TA 4G4SP 4P3YA 1KZ7B 2O2DA 4GM4A 4R3WA 2JLXA 3ZY4A 3IEKA 4MRMA 1IBLB 1JXAA 3ST7A 3WISA 3GLHB 4LJ9A 2H9IA 4MJXA 3DVAA 2O8FB 3KEMA 3LUAA 2GBLC 1N5LA 3NBMA 2OKGA 3GVCA 1CDEA 2ENUA 4G97A 5JSZA 4ZVRA 5GGXA 4HS4A 4DZRA 1SUDA 1U04A 3GEEA 3AJAA 3OLVA 4LGCA 1UINA 1WSAA 2Z30A 2OOSA 2IZOA 1L1QA 3I1YA 3W1EA 1ZJ6A 3B20A 2X5JO 4D9EA 5I47A 3H16A 2BPOA 3QKSA 3P71T 3BB1A 3ORHA 3R20A 3FVVA 4FN4A 3KSUA 4OBXA 4LE1A 4BFWA 2X0KA 1JNYA 1QOZA 4OSEA 2ZE7A 2ATVA 4UAUA 2C1EA 2GD0A 4IO1A 3VZBA 1K3FA 4Z1OA 1DKUA 2I8CA 1T9DA 5REQB 1G21A 5TQ0A 3FHJA 1Q44A 3SMQA 4EAAA 2FPMA 3MQFA 2UV8A 4BFSA 1AZWA 5HPYB 2BFMA 3LY8A 4HUQA 4CCYB 5EJ6A 1AKYA 1EBBA 1XQVA 3PTZA 2FK7A 3SHWA 4AWAA 4ZMSA 3NC1C 1CNFA 3C3JA 2NNLD 2QRMA 3PNMA 4S1TA 5EMLA 3JWJA 3O8OB 4C9BA 1SFRA 2R6AA 3BSSA 3GU3A 1DIAA 1FRZA 1EFPA 4GOOD 3V46A 4OPMA 3ZYZA 1EWKA 4D4JA 5E0KB 4E13A 3EFBA 5EUQB 4BO6A 1MG5A 3PEUA 1O9BA 2V9ZA 5E6UB 1GPYA 3QK7A 3BGIA 3UH0A 1G38A 1PWXA 3UGTA 3ZZTA 4IDFA 1Y3FE 2A6PA 1EAMA 5ALGA 2PUAA 1VJ5A 1M9NA 3OE7D 3G85A 1SA0B 3P94A 5TGZA 2O06A 3IL2A 3FRIA 5I6DA 2X5XA 4G5YA 4Q6BA 5J4KA 3K6KA 2JGIA 3GMIA 5ED4A 4X54A 3O4HA 2ZSBA 1SA0A 4N01A 1C4WA 4L57A 4O4HA 3S2IA 4WERA 2ZJ5A 4GPZA 4MW7A 4PO1A 5DT2A 3SQDA 3UHFA 3SWWA 1NULA 4LI0A 4P34A 4R1UA 2FWIA 2JBAA 4F56A 5A4MS 3J81k 1NJ2A 3HGQA 4IKEA 4K6OA 1DOZA 1YDWA 3MUFA 3V8EA 2CHEA 2ZSDA 4AW9A 2YHBA 4YCMA 2WIBA 3GZTB 3UBMA 1ZRMA 4ZV4A 3E1SA 3BGSA 3LUHA 5JMWA 3BFXA 3H9GA 4LY9A 2JGAA 2P9GA 1VCIA 1BDBA 2R85A 2PD3A 2Y1DA 4L15A 4UFOA 2VJCA 1RJ9B 5CLHA 1XJCA 5JSKA 2I6UA 1X7ZB 4ACAA 1RAEA 5DCUA 2QYSA 1XXHE 1Y5IA 4DUPA 3OOHA 2PD4A 5FF9A 4LE2A 1BXGB 2G77B 3EAFA 1YL7A 2HREA 4RK0A 4LNAA 4OQPA 3SMVA 3VNUA 5FH9A 5BY2A 1C0EA 1M2OB 4G9EA 3PICA 4ND7A 1DFGA 1JF8A 4UREA 5I7OA 5LB4A 4ENVA 2AFHB 1QVAA 5KNBA 2B4TO 1M2WA 3BCRA 3HKCA 3LY7A 3N0WA 4FXPA 3QXJA 2IP1A 4HDNA 4KBFA 4L51A 3RNLA 1QLJA 5E0OA 3RS3A 2HHJA 3E2IA 3ZK9A 2HDHA 3JQAA 4EYOA 3KAPA 1YVUA 1UBSB 2VP4A 2GHQA 3LX4A 4RDIA 3ZV7A 4A8JB 3IP9A 5TV2A 3RIEA 1K7FB 3KKNA 3PGMA 4LWOA 2QAGB 3C7DB 1EVKA 4LJ6A 2WJYA 4YRNA 1QVWA 4Q9IA 5ICFA 1FQJA 3FNGA 4N65A 3U4HA 2ZOSA 2W70A 2OHGA 4NMXB 1QQAA 4CUZA 4E7OA 2AI3A 3RR2A 1R0ZA 3HGMA 3WWZA 2IHYA 1QBGA 1ZUWA 2OB1A 1CUSA 5IHPA 4WQMA 5CLLA 2ZI4A 1C29B 2R6JA 2O23A 3N8DA 3OTQA 4QTXA 4X7BA 3V4FA 4X00A 3ZXIA 3DZKA 3I2HA 1Z5GA 1U3UA 3CN7A 3H18A 1JQAA 1GFIA 1XXHA 5BW8A 3N7TA 2GERA 4MRNA 3TSYA 3PJDA 4U3JB 4EJ0A 2PL1A 3AU9A 3OICA 5EUBA 5HOEA 3RKSA 1I7DA 1QIMA 1ILWA 1VM6A 1ISFA 4O3MA 2QN6A 3DNMA 3Q41A 3S2GA 3E4DA 3E70C 1PEYA 3UH1A 3DP9A 1P4HA 2OSVA 3NM5A 3ZU2A 1I3KA 2QAJA 4LS3A 4KQXA 3WNDA 2QQEA 4OK3A 1A9RA 3AERA 3K5PA 1BCSA 1MJNA 1BWPA 3THXA 1B8PA 1J0AA 3TPZA 5AM2A 2QQ0A 3K1JA 5TSDA 3V2UA 3H19A 2FR8A 2CV2A 3DT6A 4POAA 1U8XX 3GLFB 2N47A 3N39C 3VR2A 1PSDA 2CXTA 3H1GA 3HMKA 4HOYA 4I1OA 3WA7A 3BWVA 5BUSA 5A1JA 4I14A 3TAXA 2ZTVA 2F9MA 3GXOA 1G0OA 1EQ2A 1V8FA 4JN6B 4OUDB 1AQLA 4G0OA 1THMA 5DM1A 5ARCA 4YMTA 4CCWA 3B6JA 5C7YA 1UIMA 2GEBA 4IRMA 4NCJA 2VBIA 3AUXA 5M2QA 2PKXA 3DE2X 3CLVA 5CIQA 3RW9A 5INTA 2AUMA 4KPGA 1JJBA 4G9GA 2PGJA 1DWUA 5CVVA 3VAZA 2VBFA 1IN5A 1KK3A 1XVVA 2O6HA 5F5LA 3WL8A 4IKOA 2Z5LA 4GP6A 2OT3B 3UY4A 1HNWB 1MEEA 1OB2A 3K8ZA 1DO8A 4V0NA 1YL5A 2FUG6 3EZNA 3KU1A 3OQBA 1YZUA 4AG5A 1G5PA 1N1EA 3LQQA 1GZDA 3GH3A 3LDHA 5BSTA 2MYTA 3TNYA 2FK8A 3HBAA 3RVOA 4CF6A 5E8RA 3QIVA 1E9VA 4AIIA 2V6IA 3O1IC 4HZGA 1L3CA 2RH9B 2XYPA 3RYFA 5M5BA 3ZWYA 2CNKA 4F3CA 4E4TA 4ZYLA 2Z9DA 4RVHA 1YB7A 4F21A 1PTJA 1G5FA 2Y0DA 3NT5A 3K9CA 4DARA 4L6AA 2HU2A 3QLUA 3A9SA 3BEOA 4RYLA 5KNDH 4US1R 2FEMA 1RC1A 2FSUA 4UHCA 2AXNA 1GU7A 4M6WA 1X1EA 2B9EA 1X1BA 4CV1A 3JQFA 2WUFA 3KAQA 1N2IA 2C5FA 4I66A 3OBIA 2YWFA 1XTBA 1R27A 1MFPA 3EJ6A 2JI7A 2VP9A 1DO0A 2DERA 4F3KA 3FKSA 2CDBA 2WJWA 2BJHA 3IERA 3IB6A 3KDSE 3FVTA 1LI7A 3HFRA 4B3GA 3L4EA 5TGDA 2ONKA 1JR2A 3GPCA 1DKOA 2WP0A 4FX5A 5JECA 1KR5A 1WMFA 4K9KA 4P4SA 4TKUB 1U2ZA 1RQRA 1SRRA 3PCRB 2JI9A 2W4MA 2WTNA 2ACKA 4HLUC 5T41A 3TR0A 4DY4A 1GPWB 3R5TA 2BGWA 1HMPA 1IULA 3DV9A 2C4NA 2CZQA 3M5PA 4DV7B 4LSGA 1XEFA 1NN0A 5CVCA 3DEYX 5DCYA 2JIRA 4EY4A 4IF6A 1LNSA 3BXHA 2ZZNA 3NVAA 5AK5A 3OY7A 1FMLA 2XT0A 4A9AA 2C4KA 4KL8S 4G0YA 3FD8A 3HLKA 4J6EA 4ZALA 2ZJYA 2VYQA 4RV9A 5HNKA 1SNYA 2EIHA 2ZYDA 3FDJA 3R3HA 1IZYA 1N3IA 3MF4A 2DUWA 2H1VA 1IY1A 2VRWA 3KJGA 3MLAA 3N2YA 3K5WA 4KAFA 1VKOA 1SGWA 3RKRA 4E5SA 4KBGA 3G8CA 1JB1A 4TQ9A 3W5JA 1TYZA 4KQCA 4Z49A 4PEVA 5EWJA 3TI9A 4CMEA 3B3GA 4QUEA 4WECA 1V8BA 5JAUA 1TEXA 1YJ5A 3NNDA 3CRW1 4OQYA 5JC8A 2JGJA 2AA3A 1GSIA 1YMVA 2QGNA 1U3VA 3ZOKA 4PZZA 1UH5A 1BMFA 4LSZA 3PKJA 3OPQA 1JDSA 1BXGA 4RIIA 3TLEA 4GYYA 3OX3A 4KODA 2C0CA 5JJLA 3W9SA 1ST3A 4DMKA 4FT2A 3DQPA 3N8IA 1C0KA 1RAAA 2I22A 3R3UA 2CYCA 2B6NA 2Z43A 1O5OA 1IVSA 4N6OA 5J4HA 4X45A 1JEOA 1SU8A 3RSZA 2ZBEA 3NHRA 2VUSA 2C5EA 4BP1A 3H8VA 4XX0B 3NWJA 2QUIA 2BP7A 5CK4A 2A9RA 3NIGB 2JDID 5DV9A 4RPLA 2R9VA 1U0SY 4F5YA 3U16A 2JAWA 5EXSA 3C3YA 1X9HA 4MITA 1BDIA 1NMSA 4I6GA 3FSJX 2C99A 2PX2A 3ADBA 1HKUA 1OAOC 2HEIA 5KWJA 2ZSHA 4CM3A 4H2DA 1CUCA 3WTBA 1KOFA 3X1XA 4S0XA 1QQBA 4AKHA 5EINA 4OHMA 2Z2IA 2VH5R 1CDZA 3JASA 1E1MA 4QDOA 5TQVA 4PCLA 5EPOA 5DBHX 1GUYA 3PR2B 3ACDA 1QIDA 1XRSB 4I55B 4MAMA 2P35A 5DNVA 3CRNA 2PGLA 1JR3A 4QGGA 4QEKA 1XLTA 5CNIA 3T4EA 1N5IA 2R8OA 2AOWA 3PF8A 4OQXA 5EP3A 3BBLA 2QX7A 5CYFA 3JVDA 1THGA 5ESXA 3I9LA 5TC4A 2OXEA 4X71A 1AZLA 1XA4A 3EULA 3RVLA 3V4LA 4F93B 3ADKA 3K0AA 2JI4A 3C8HA 1J24A 1TM5E 3C5VA 1MABB 1SO8A 2QS9A 1OA1A 1R4MA 3N86A 2IKQA 2QG4A 2B7CA 4KC0A 3TLAA 2IYYA 1J8MF 1WDTA 1WY7A 4IILA 1OAAA 1VJ1A 3G2HA 3JQRA 5T4BA 2YVUA 2IBSA 3EG9A 1ESDA 4LV8B 3ZXYA 2A0FA 3QELA 1FFXA 2NYVA 1VZ3A 3GRZA 4KN8A 3Q5GA 2YBEA 2DBQA 1T24A 1U3TA 4EZIA 2FPPA 3E03A 2AZDA 5CDSA 4JWTA 1GG2A 4F4JA 1JUDA 4GZ3A 1NVEA 2A8YA 1Y80A 2MOKA 2BUCA 3UT6A 1DDGA 3HNPA 1GKYA 1J49A 4RJ2A 3KKPA 1U1CA 3QWBA 4IDQA 4LBVA 4IFBA 2X86A 3GARA 5M3BA 4DLVA 4YHHB 5CTJA 3AV0B 4TZ6A 1BVHA 5JH7B 2H3HA 3C7KA 1UMBB 3EMKA 3LVBA 2WNSA 1P2VA 1Q1BA 1E7YA 3PXCX 2FPIB 4OGLA 2VHWA 4QBIA 5T8KC 3HP7A 3JYPA 4YRJA 3ROXA 3RUFA 4QX6A 3QUAA 1F1BA 5MN4A 2ZTUA 1NAIA 1WJGA 4QU9A 3MRTA 5FD8A 2EJVA 1UDBA 4AMVA 5BN3A 3CGWA 1CJKC 3IHLA 4U02A 1YRWA 2LW7A 3PUVA 5HJ5A 2PZEA 5ETJA 4OHXA 2J9FA 2J5XA 3DBIA 4NPCA 4QOHA 1U7PA 3IBYA 4Z4CA 1G21B 4KP7A 2Q28A 4LBWA 4TZTA 1JFFA 3HYTA 5CYPA 3SJBA 4EF5A 1PJCA 4Q1CA 2D7DA 1GUBA 1JZTA 1IEXA 3A0UA 3OQHA 4BMCA 1SBCA 3JYQA 4I2NA 1KU0A 1N2CB 1Q7GA 2QPAA 2CNDA 1YZNA 2JJ2A 4NZOA 2M1ZA 2BUBA 3MTGA 4KLRA 1D0VA 2YWGA 2F55A 1F4PA 2GD2A 1GCGA 4DLKA 2Q7OE 1GZSA 1YR2A 4RFLA 1PGPA 2CCKA 2WD7A 4UQOA 3S1AA 4MI9A 4RL4A 5IPFA 3L4SO 1YRHA 4PWZA 4RSRA 4OK6A 1OR8A 4WKCA 3TJRA 4DTCA 5FPYA 3V4VB 1W5AA 3WGOA 4BCCA 4AG6A 1DQZA 4EX7A 4A0FA 1NOJA 1S4MA 4JC0A 1W93A 2YTZA 2XTJA 3QZUA 2M9MA 3GIWA 4ZEWA 1Z3CA 4CTMA 4I1VA 4RIEA 1Q95A 4GPTA 1XO1A 4NKRA 4C20A 4OX9B 2RARA 2D5LA 2E4AA 4AMZA 3L06A 2ERCA 2V9CA 1AGRA 3QVSA 1S4QA 5DGIA 4OXKA 4KH0A 5HF9A 1X94A 3LPCA 3MCVA 4NYMR 1O77A 1X42A 4Q7JB 4AUEA 1IZ7A 2CLOB 2XMGA 4UCQA 4BNVA 3VR3A 1TQ2A 2OLKA 1D8TA 3D4NA 3FPSA 4DIMA 1DG1G 1XCBA 2IDMA 5FTNA 3K3PA 3KLPX 4IL5A 1P61B 4AWBA 2VSYA 5DM70 5CH8A 5LZ2A 3CNNA 3TZLA 3OECA 2J67A 3R8CA 3WL5A 4FQ8A 1G291 2VJDA 4JA0A 9ABPA 1DB3A 1POWA 3L4BA 4KRYA 3B89A 4JLDA 4PO8A 4Q4AB 3F4LA 4P32A 4Y2JA 1RPJA 2O0MA 1VG9B 1I5EA 2B8JA 1E7QA 3ZV4A 1O1YA 1PZGA 3U4CA 1LTKA 1KIMA 2BCGY 3CCFA 3OFND 4LZOA 5AK3A 4B84A 3DBHB 5TR9A 2AX4A 2JIQA 3PD0A 4O1HA 3IOYA 3PC4A 3WDMA 5BV2P 3FTFA 2PUFA 1Y1QA 2F3RA 2IHTA 4GGOA 4XW2A 4KKXB 3AF5A 4QASA 5FWNA 1E2GA 3OZTA 3PT5A 3W3AH 4DILA 1JSZA 5L3SB 1Q16A 4WJZA 4B17A 1O89A 2BTOA 5IM4A 3A6LA 3IFSA 4GM1A 5C1PA 2RHOA 1HQDA 1XZMA 2QAGA 4DR5B 4C6TA 1DXYA 2BELA 1CK4A 2HHCA 4NNJA 3D3QA 1XVUA 4ZV9A 3GDOA 1J9ZA 4MW1A 2VYND 3W8RA 3K30A 1GNLA 2P8JA 2ATEA 4RD1A 1SB8A 4XLLA 2ZDHA 3VAYA 3VUEA 1TZCA 5JYCA 4IY1A 1E2JA 3E5HA 3JQ8B 2B34A 1QRAA 5JI2E 4NSNA 4YHBA 1IONA 1ZH6A 3X1WA 1C1HA 2EZTA 1PYOA 4L5CA 1I5OA 3QFTA 4U5QA 5J2TB 1BWSA 2GASA 3QLJA 1CV2A 3EEQA 1KEVA 4Z99A 1T4CA 3H17A 3DOFA 3R23A 3U61B 3GELA 4ZV7A 3AY6A 5I9BA 2VNKA 2HMWA 1PEDA 1PJZA 3RARA 2NO1A 1C3EA 1EP9A 2C20A 4L8GA 4PX9A 3SIPA 1OGIA 4CKCA 4ER7A 3F73A 2GEVA 2BFFB 3ZGXA 1DOAA 2WUDA 4RY2A 4PYRA 5IFKA 2BGGA 4YRCA 1ZUIA 2WWFA 4DMCA 2BGJA 3CKLA 4M3NA 4Y2TA 4RTNA 3SC2B 4LYAA 1YDHA 2A94A 2WIJA 3A10A 3ZZ1A 1CR2A 5ADUS 3OLCX 5F78A 4Z2AA 3PC2A 3TMYA 3W3ZB 4B0OA 3F8WA 3F5SA 3RRBA 1G5TA 4H27A 3NONA 4WZAA 1EB9A 5FUWA 1YK0A 3GJYA 4MAFA 3FWYA 4S3MA 4BVBA 3NXSA 4BNDA 4DWWA 4XUDA 3KP1A 1Z0ZA 4LPSA 3GFQA 2H2GA 3D81A 2F4VB 3CF6R 5AI8A 1D2RA 1EEXB 2HJGA 2IHUA 2WPNA 2YS6A 4JHXA 4L0CA 1XROA 5DYWA 2DLCX 1WW3A 4TRNA 1EDBA 1P0FA 5EFOA 4HXGA 2NYRA 3E8SA 5HRUA 4W9NC 4X61A 3BH0A 4W5HA 3SZGA 3E81A 1UXGA 3SS8A 4QOGA 3I4LA 3BICA 3EUEA 2JK0A 3Q15C 5GJWC 2C9YA 2P7IA 2GAIA 1RRGA 1ISMA 4LDAA 4OMCA 5F5XA 1N2GA 3WRXC 5D84A 3ZCSA 4DLNA 4EI2A 4N8EA 1P7VA 2MJLA 1CY6A 3OPYB 4RMIA 3TX6A 5KOYA 1D1PA 4B82A 1ISSA 5H4HA 4MS3B 3JD2A 4LZLA 3RV3A 1NZJA 3Q9LA 4TVOA 3Q88A 3VHLB 3VH3A 4J0EA 3FY4A 4DADA 3CEJA 2J85A 2Q27A 5C7OO 3H9BA 2CMKA 3KJZA 1P33A 2YV4A 4EHNA 1U1IA 3E48A 4JUDX 1Z2OX 2O0HA 3B3FA 1ML4A 1YQXA 1JI0A 1ZRSA 3MUNA 4LDRA 3OLXA 1CJTC 3CKMA 1C9MA 2O7SA 3WV5A 1XZGA 5ALDA 4PQRA 4BZWA 3TTUA 1BVYF 4WZAE 4CKEA 2WSIA 5IYZF 5IJ0A 4MR9A 3FOAA 1NV9A 2HZ7A 3NBQA 2OBYA 2IXFA 3O03A 3WGTA 2XB2A 3VHQA 3NTLA 3DOJA 3QMWA 3PD7A 3UB2A 1JG3A 2BLLA 3WK4A 3S40A 5C7LO 1EDZA 2IF0A 1XA3A 3DKVA 1ISRA 3OF3A 4LYHA 1QK3A 4R0NA 3VZDA 1QP4A 3EUAA 1I01A 3HY4A 4NENA 1PU2A 2HIGA 3H84A 4P84A 1E60A 2J08A 3L1UA 2LWIA 1RXCA 1PNTA 3RF6A 1LJLA 3ZKWB 2R5WA 1Z26A 4UD2A 1WP9A 2BFDB 3OQIB 4G63A 5EEGA 4V2IA 4C7BA 1G8AA 2NPOA 3EY9A 5KYUA 5LC1A 4BWFB 4CU5A 4ZEMA 1U5CA 1E3TA 3PPXA 5BOSB 2ZYSA 3D4LA 3OKAA 1MV8A 3L0IB 4NCBA 1VHTA 3B6EA 3L0ZA 1QYIA 2QX6A 1XFDA 3TDMA 1JP7A 4HDAA 1Y4UA 2JI6A 1K4MA 3CCCA 5FYDA 5BSRA 3RKUA 3MJCA 2FTKE 3BIXA 4IZHA 2FZEA 1T9KA 4OXRA 4TROA 4YXWA 4B0PA 5HKKD 3ABOB 5ADHA 5KX5F 4DLYA 3C14C 4PNHA 4UTVA 2Z98A 4AX8A 2P9TA 4WVLA 5FT9A 4E11A 3S68A 1TIPA 2I7DA 3QFRA 5KC9A 1VBNA 1RJEA 3O0TA 4KFRA 4MS4A 5JQWA 4P6VF 2WQ7A 3AETA 4MW6A 4UTZA 1JHMA 3OPXA 4ZAVA 3ZE9A 4ZMRA 2IZ1A 2OCXA 2NZVG 3DE4X 4B33A 4ZA2A 2X5OA 3UAYA 3DVRX 4MQ6A 1JMYA 1B41A 2PPVA 1OPRA 5AVWA 1O0BA 1FX0B 1PBTA 2VDMB 2F8LA 2O1SA 2ZE5A 7YASA 1C3OA 1WB5A 1P0MA 2HRRA 4XIFA 2J0UA 2XD9A 3ICWA 4UM8B 3ZK7A 5CBPA 2KW5A 1D2GA 1DCMA 1Y6RA 1LBQA 1HO3A 1PTJC 2AYZA 3BDVA 3GFRA 5KNDD 5KVSA 2I2FA 4JVLA 2WW8A 2H2IA 1SWWA 1DAMA 3BTUA 3S55A 2G8LA 1AGPA 1KYZA 3DTVB 1T9HA 2HPVA 3LHFA 4ESEA 2CSXA 1E2EA 3DMHA 2WSYB 4MROA 3HUEA 1IY0A 4R31A 1YO6A 2R00C 4P4TA 1C3VA 2AI1A 5HE8A 1A2QA 3WADA 3PB3A 4I50F 1KJ9A 2I8AA 2WAOA 4RHTA 3KRTA 3ELWA 1KS9A 4GM0A 4JBGA 4HXEB 1NBWB 1ORHA 4N54A 1OX4A 3C48A 4ZHSA 3LC2O 2PZFA 4M1SA 1UBEA 2Y1EA 3TDNA 1HLFA 2RE8A 3O8DA 3R44A 4F96A 4QTYA 2REBA 4M1QA 2N0SA 1CS0B 3ZE8A 3H2KA 4NESA 4AECA 4KVZA 1ODIA 1H0SA 4HNRA 4LBZA 5DWVA 5EZ6B 1SHLA 3ILHA 3VPFA 4RJJA 4C0JA 3ILXA 1TD1A 4KIWA 4UFPA 1VSVA 4F5EA 2H18A 1MO5A 2YMLA 3KJHA 2VA9A 3LNTA 1G8JA 2IZ5A 5J40A 5B2ZA 4OATA 2JAPA 1T35A 4QBGB 4DYDA 3EIWA 4KHPB 1PV4A 2CHVA 4ZT3A 2GAJA 1T43A 5ALSA 2Q0XA 4FZVA 3CZMA 2AEMA 3ZWVA 4J2HA 3GG9A 3KPVA 1K2WA 2W37A 1AZTA 1FUUA 3I8OA 4LQLA 2X8WA 1WQ1R 3ETNA 4TVSA 1N8TA 2VUTA 2JHCA 3Q3GE 3ZQ6A 1RRPA 1NW8A 1O2DA 2M1XA 5DI3A 3AP3A 4LJLA 5JSHA 1NDQA 2CL5A 3OY2A 1CX9B 3JSAA 2ASEA 4XAQA 1IVYA 3I2IA 4QBTA 4W8HA 1E62A 2GZHA 4DEYA 1M2NA 2ECKA 4HDOB 1PZEA 4TTTS 4MMYB 5FWDA 4HK4A 5HA5A 4HGQA 1Y9JA 1JXOA 2Q3FA 3IBCA 5EE9A 1XK7A 4HVAA 1VMIA 3SC6A 4Q4AA 3U4IA 3D6MA 2QUBA 1L4LA 4YMGA 3I8XA 3PRHA 1TOAA 3EDYA 4EO9A 2M6RA 4YN3A 1I2ZA 3I9V6 1FDOA 3LYUA 1GFWA 1SU4A 2D1SA 1C1DB 1ORVA 2JBAB 3NFRA 3LGAA 4DXDA 1SZCA 3DOUA 4ZOBA 4UBLA 1DDIA 1FUEA 1MC8A 4BFVA 4CGYA 2E4ZA 4LX0A 3RYHA 1XRRA 3JYLA 3RIYA 4NBNA 3SQWA 5IVHA 1N4DA 1OX6A 1XZBA 4P82A 4Q1VA 1RJFA 1JDVA 2CSUA 5BQPA 4WKOA 2JEOA 4HT3B 3ADOA 3WK5A 1GTVA 2JLQA 2YASA 2CFRA 3BC1A 4JAVC 3NDPA 2C2KA 5B3JC 1Y5NA 2Y1LA 1KVSA 1MX3A 3PJEA 4AO6A 1FJXA 3KSDO 2PJUA 4OQEA 4WKNA 1RS0A 4GI3A 4V0QA 2ZB2A 1MTOA 2V4UA 3P9KA 1IOVA 1VI2A 2POQX 2XAAA 1YRQA 3IILA 4N5IX 4OTZA 1O58A 3IP7A 1FYXA 3X1JA 1DAIA 1GGHA 4FGJA 4W6QA 2WWRA 4Z3OA 2WU0A 3JVEA 3QENA 5IXJA 4HVTA 4OFZA 3D1VA 3LX6A 1DC4A 1B0ZA 3A1TA 5I48A 2FFBA 1X3SA 4EJSA 3HEAA 4GQBA 2OMEA 1GTSA 3GQBB 2HMAA 1M2KA 4ZEVA 4I9NA 2BOVA 3M4YA 4F60A 3FCAA 2BMWA 4EOGA 2AKYA 1G8SA 2JCSA 4HUTA 1G7TA 3CC8A 3CTPA 3CRMA 1D6MA 2AFIA 3DBOB 3NM4A 4MKIA 3T95A 2X42A 4JB8A 1U98A 3R7LA 5HQJA 3R77A 1FDVA 3RSCA 4DTIA 3MB5A 3FDZA 4PGHA 3P8ZA 2PCLA 1TVKB 4NG5A 4U7GA 4E3WA 5IBPA 3G6KA 4LJ8A 1XDWA 2AYXA 3OPVA 4AJ4A 3TJZA 4FNAA 2NUBA 3MTDA 4R2KA 5JXJA 1RXYA 1XR3A 3AKDA 5FWAA 5JCXA 5BURA 1N5OX 2B5VA 1ETHA 5DM0A 1V1RB 1QNLA 4ZOCA 1WXWA 5LBIA 4MMXB 3VHXA 1Z29A 2OV8A 3RU3A 3TZHA 1GITA 1V25A 2O2SA 3VKWA 2XGMA 1U2GA 2ZVJA 4NJEA 2Q9UA 1PK9A 2OQIA 4R9SA 2YQ4A 1KDYA 1M6NA 4DXHA 3NT4A 2GWHA 3SSNA 2KI5A 2MTBA 3E9MA 3IS3A 4PX3A 4IJUA 1T0HB 3QELB 4PAOA 3ILSA 3M1YA 3PT9A 5FNZA 1NJ1A 2KWIA 2WM9B 2PLWA 3F46A 1YS2X 3H4VA 3MQ2A 4BECA 2FUNB 1BSVA 2Q9AA 4QOFA 4AS2A 1Q0LA 2D00A 3EB9A 5B30A 1RVV1 2EEPA 4RHXA 3PD1A 4N0DA 5JD5A 1UFVA 5DP2A 2FU5C 3IDQA 1QDEA 1TTQB 2QUKA 5DEOA 1G98A 4Z1MA 4CHGA 3KYBA 5CVDA 2W2MA 2ZR0A 3HPQA 4ND2A 4D74A 4FHZA 4TMKA 4JYPA 2E85A 3RU9A 1Q11A 1V5WA 4P1ZA 4I4NA 2OA0A 3BILA 4ZI3A 5B57C 4UEWA 2YVAA 1W0KD 4US2R 3ICEA 1NW3A 2HBRA 1JR3D 2JB9A 1B1AA 3SFZA 3UJHA 2XGJA 3RFUA 1TU4A 4B83A 1I0ZA 2O05A 1NG1A 3KV1A 4DGSA 1QOPB 4W1PA 3HE3A 1TUIA 3OCWA 4P3XA 4ERNA 4K9DA 3CEAA 5B58T 3USCS 1EFLA 3OJXA 1N2HA 1XMXA 3H9QA 1O03A 4FWIB 3ZGOA 4IDEA 3HUDA 3EQ8A 3IOCA 4HRAA 1SVSA 3PBKA 5D01A 4BC0A 2GB4A 2I62A 1KZ6A 2UYCA 2JKZA 1RC8A 2KX7A 1O95C 3OEYA 1I4OA 2ENWA 4UPEA 1WA5A 2R2GA 1RSZA 1QIIA 3DZ8A 1EHIA 1FBNA 1QR6A 3F0TA 3QPDA 1SCBA 1YCGA 1A77A 2CNWD 4L8FA 1F38A 4RJTA 1M2VA 2CFSA 1Y63A 4B45A 2FPUA 4F3YA 1KZ4A 2WG2A 3ZDQA 3UHAA 1Y9DA 1MB2A 2J33A 4PSDA 4IGIA 3CZ4A 1RVDA 1D2MA 5EWLB 3LSTA 1G17A 4ER5A 1RHUA 2MR5A 3TRFA 2P6OA 4YRFA 2PKEA 4EVIA 3PCTA 1XTQA 4CQNA 1FYWA 5AJWA 3T6KA 2CJXA 5BV7A 2QT9A 3OHMA 3HY3A 2IX9A 3G7SA 1RDFA 4R2WA 3U7QA 4FFNA 5IM5A 3AF2A 5IUNC 3RJTA 4GE3A 1WNFA 5J1TB 1J99A 3SOZA 2ZIEA 5K3AA 1I3CA 1MJHA 5GINE 4KMOA 2C5BA 2BCEA 3M9WA 2LD4A 1DC5A 4UE3S 1C1XB 2XUDA 2GBFA 4U00A 3QXHA 1J90A 3H2BA 3JD4A 4L5BA 4ZVUA 1WCYA 4P7FA 1E2BA 3KS9A 1Q3KA 2WHRA 4KDCA 3KL2A 3T1QA 3ZY5A 4DYVA 4CEHB 2WWHA 2PWYA 4X85A 4DJJA 3O0DA 3PQEA 5LD2C 4FFBA 2NT4A 3PDHA 1JMKC 1Z4JA 1P8AA 2UZ0A 3K2IA 1FJ2A 2XVXA 3EOBI 5I8WA 4QOSA 4IOKA 4YJ3B 3DEJA 1Q3TA 1CQJB 4L9AA 4A4DA 1BEUB 2Q1TA 1F8GA 1IB0A 2VJOA 4Z7OB 3TRIA 1Q1NA 1RWNA 2DBVO 1HT3A 3DHEA 1CIVA 5KKCA 5LXTA 4C3OB 3R4VA 2AF4C 3MTQA 1H6BA 1UBGA 4NTZA 4L50A 1WDMA 1T0IA 1Y82A 3C74A 4QXAA 4YEDA 5JY1A 3OQNA 3EZGA 4Y6LA 5LP6C 3KBBA 2A5DA 3FOZA 4Y6RA 2X9LA 5KDDA 1UKBA 4KMRA 3VBEA 2VAWA 1YZHA 4IDGA 2VSOA 4FKZA 1TPZA 1NFFA 5CD1A 2C5HA 2OBFA 1AO3A 2ATXA 4HXYA 4FI3F 4QUAA 2CLKB 4TXLA 5HF6A 3T41A 5C8VA 4TSRA 1BOOA 1M3SA 1UOPA 1XJQA 2PWPA 4HAUA 1ZYUA 3OIYA 2FETA 3NUQA 1RLTA 5HBRA 2BMAA 2MSEB 1X38A 4MIYA 2A57A 4L73A 1U2DC 1U6KA 2H2HA 3C6YA 5DJ5A 1YNSA 4MR7A 5DCWA 2PE5A 1S2LA 2W5UA 3VI4B 2HH9A 2QTVB 4L4RA 3CX8A 4LWPA 4PAGA 2IZZA 4EJMA 5KWSA 2R4UA 3JVUA 5T4HA 2BI4A 2AOUA 1YGYA 1W75A 3HK2A 1F2VA 1K5GA 4BB6A 1DIRA 1XD2A 2XWQA 3GV0A 3I32A 1Q0TA 1J4AA 2PPLA 4HQFA 5IF3A 4A36A 2C2MA 3RYIB 1E3QA 2JIZA 4HB2A 1Y4SA 1LDNA 3QSGA 5AH0A 4KFUA 3AEXA 4C29A 3ML1A 4QREA 4YV2A 3GL9A 3A6FA 4UFNA 5KSWB 1YI0A 4Q1EA 3RYFB 3GH1A 4C4ZA 1XL0A 2CDNA 3ESXA 2CMHA 5AD1A 1NQXA 3V9AA 2WJ3A 5AHRA 1E4EB 1G5HA 1ZVJA 2R47A 3B2NA 3H1FA 5DI3B 4M1OA 1TCVA 3FTQA 2ZIWB 3J7AC 2P2SA 4W1QA 4OHOA 2BFDA 1IXRC 3GUUA 1DO2A 3FI9A 4RHCA 5EPEA 5F7OA 5ITZA 3A9VA 5G4LA 1GJRA 1SKYB 2EKZA 4QJ5A 1X1SA 3C5HA 1N9GA 2AK2A 5IC5A 1NVTA 4BFUA 4CL3A 1L7DA 3FKSD 2PZKA 3T3NA 1L6IA 1XAHA 2I3DA 4CM8B 4PPGA 2ZWAA 3K70C 3LWBA 1J2JA 3LLVA 2G5CA 1O96B 3QOYA 2OHVA 4I4IA 2AOXA 1LWNA 3DDSA 5EJFA 3PFHA 1LSSA 1BA2A 1RM5A 1YE5A 2XUHA 3H1EA 4Q3EA 1L4UA 4YP6A 3VO2A 5CFPA 1VIMA 2R44A 5HM8A 2NUTB 1GLGA 2QL5A 4QYMA 4EG1A 3C41J 4MHSA 4ANFA 5BMVA 3A6KA 1J2EA 4TM7A 3WICA 3VO1A 3VO8A 1YFKA 1MORA 2G9NA 1N2OA 2O8BA 1F5SA 1YKGA 3IPLA 1ZCAA 1K6JA 1I8TA 1QXSA 1WZEA 4UHDA 4HP8A 2PBLA 3PNYA 4BXOA 3LZDA 2CXOA 2YN4A 1P1RA 5EKUA 3FZEA 4ZYVA 2Q0SA 2JFHA 4ZMBA 1H4QA 4S1WA 2EDCA 1UQUA 3ZIDA 1MB0A 4C88A 1N3BA 3QKRB 3SIWA 4EY6A 4MQMA 1C9JA 3O8CA 1H8HA 5G4KB 3FN4A 1E2IA 1T29A 2A9OA 3IUSA 4LECA 2OYSA 5FA6A 3TOSA 5FAKA 1O08A 2PH3A 3AIOA 3DTVD 1SIBE 2WV7A 3Q12A 3LVRE 4DB2A 1CZOA 1EJ0A 4E5YA 2ZM5A 3D4IA 3O31A 4HTFB 3IXQA 3NKFA 3SQXA 2XMRA 4RMGA 3PDIA 1P0CA 4NVRA 1I10A 2VJNA 2GEDA 3HA2A 1GL3A 1JG1A 1HEUA 2JCGA 1F2UB 4QKQA 1F5NA 1FUYB 1YS6A 3JALA 2QD5A 1Q7BA 4FJ2A 2AL7A 1OGYA 2Y1KA 4F46A 3TG8A 2Q21A 2SKDA 1Y6JA 2Z6UA 3OCCA 1QK4A 3BT7A 1PR9A 3II6X 1LK7A 2PQ2A 1XEXB 1TUEA 3K1ZA 3AHJA 4Y9UA 4X62B 1UDCA 3D0RA 1UJ4A 3U19A 3T5GA 2AG8A 3CH6A 4RACA 5BN5B 3G2JA 3UXYA 3PHGA 2EKBA 2JFWA 4F71A 1S96A 4NX2A 1PR5A 2XMCA 1M5TA 3P2EA 3PCXA 2AEEA 2ZRHA 3DBLB 4P2BA 1DG9A 1PJQA 5ECYA 4PYNA 1AS0A 5HZHA