2PH7A

Crystal structure of af2093 from archaeoglobus fulgidus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
227
structure length
220
Chain Sequence
GMDVEIVEELSKMLAGRKAVTEEEIRRKAIRCALKIMGARLVGIDAELIEDVTCSLIDLHFSEKVKIGDVLFYHPHVIKPEKEDFEQAYFEYKQSKKFLDAFDIMREVTDRFFEGYEAEGRYMRKYTKDGRNYYAFFSTIDDTFEDVDIHLRMVDEVDGDYVVIVPTENELNPFLKFFKQYSEDAKRAGLKIWVVNPDEKTIDPFIGYPKDFRLLKGFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AF_2093
publication title Crystal structure of AF2093 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 54
structure length 220
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3400.10 Mainly Alpha Orthogonal Bundle af_2093 domain like fold af_2093 domain like 2ph7A01
3.40.50.10670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold af2093 domain 2ph7A02
2PH7A
chains in the Genus database with same CATH superfamily
2Q49A 1DX4A 1WXXA 2L18A 1UXGA 4H59A 3I2FA 1ZD4A 3U9TA 1E7WA 2X1VA 4A2WA 1A95A 1GR1A 3AJRA 3NM6B 4A10A 1YZLA 3UGJA 2AZXA 3WKBA 1UCFA 2AE1A 5HIAA 2C7PA 3OZCA 1ZK1A 1YRQA 4PTLA 5BN5A 1GCUA 2RHCA 4M9XA 5HBGA 3IXQA 1MB4A 3CW8X 4JS0A 4RACA 4U2GA 3RYHB 4PG6A 5B1DA 4AIRA 1V16B 3UYKA 1IE3A 3AF2A 4NJMA 4LWPA 1JU3A 4JELA 1FNSA 1UFRA 1OLSB 1WW2A 2EGHA 2QUAA 4HPJB 2VJOA 4XPIB 4IV8A 3GT7A 4TMWA 5AW3A 1RZVA 1UL1X 3FCEA 1ST3A 1NX6A 1ISPA 3IP1A 4ZCIA 2JANA 1JHUA 3FVWA 1F1BA 2E37A 4BB0A 3OECA 5ESRA 3LXUX 3OFND 5D1NA 1VJGA 2C5GA 5HJ2A 2PS1A 3ED1A 3O1JC 3WI7A 4KLNA 4E1AA 1XI2A 1U2TA 2B94A 1USVA 1F2VA 2Y1DA 2FFJA 4HAIA 3CZ5A 3A0UA 3IKVA 3SEAA 4LDRA 3EGOA 4GR5A 2NAFA 3T95A 4LXTA 2QAJA 4HB3A 1P2TA 1JQKA 3N87A 3DZCA 2HF8A 4MWTA 1N6RA 4DV7B 4OQYA 5DI3A 2XUIA 4FGLA 5A02A 2RG1A 1S96A 2LKCA 3B13B 1NQTA 3LI2A 4M1WA 3FWHA 4OJYA 3ROMA 1O95A 1XX6A 1FE8A 1P1HA 3BMNA 2QL9A 3VH2A 2QLJA 5E0KB 4KWCA 4TUYF 3PS9A 4HR7A 2H5IA 5CYOA 1KK2A 1PJ2A 3JWGA 5A4IS 1R5OA 1TNDA 2G8NA 3A05A 3HUFA 3QUAA 4X00A 5FLXA 5ELXA 3NIBA 1BZYA 4Y6LA 3U19A 4X45A 2HCRA 4HDKA 4KACA 3O74A 4IBOA 2P9ZA 2ZTHA 3OZUA 1ULBA 3BJZA 3MFQA 5BOSB 3AERB 3WO0A 4MW2A 1J2YA 2QZPA 4FOOA 3K70B 2QORA 5EUCA 1JFFA 3RS5A 1SB9A 1SG6A 5IVHA 5I9IA 3O2QB 1M2NA 1L9XA 2QTNA 4YRRA 2MHCA 1QJCA 1H3FA 1VBKA 3CEAA 1AF7A 3SC3A 4C20A 1SUFA 3SIWA 4OKIA 5T6BA 3UV3A 2C31A 3R0ZA 3UJ9A 3SYKA 1Y34E 3OT4A 4NCAA 3S44A 5G0UA 4E5VA 4N8DA 2D8AA 1HLDA 3OHPA 1JEYA 1RCFA 4KO4S 4U7FA 2WU1A 1XTKA 5DK4A 5EYPA 2PUAA 1VZ3A 3BERA 4ZV4A 1PHRA 1QV6A 4YCNA 2HUPA 3NDBB 2O8BB 3IMGA 2EKZA 2GF0A 1QO0D 2VJPA 3HUUA 4DCMA 2PSHA 3DDWA 5MFPA 1JFVA 3KPVA 2GESA 4ZVVA 4CKBA 4DHEA 3P2YA 4P9NA 4RHTA 3PRHA 3K0CA 4ITRC 5JCZA 3ZJVA 4F4JA 2X5OA 4LW8A 1F38A 2ZU6A 4ZI7B 1GR0A 3C48A 2JDID 5ALNA 5L3SA 3H86A 1TZCA 2MMCA 1ZLYA 1JG3A 2J9FA 3HDQA 3RSZA 1ZOSA 3GFVA 3TW6A 4X65B 3E9QA 2NVBA 5TY0A 2I62A 1ECJA 1JA0A 1I4WA 2WB4A 1GEEA 3EPLA 2B8NA 5KJCA 2FW1A 2OENG 4C0JA 1MT0A 3KSMA 1FJHA 1VJ5A 2ENWA 4OQMA 4YRIA 5IYZA 3QKRB 4BLWA 1H5QA 4YAWA 1RIFA 4B6SA 4HQ6A 2BM9A 4MYCA 2NU9B 1JHRA 1IEWA 2C8KA 1YZNA 3F73A 421PA 5TF0A 3S3TA 3V3TA 3ESQA 2Q7XA 2Q21A 4MDYA 3MTIA 1GDHA 1CXZA 1KI7A 2DFDA 3DDNA 1YTUA 5I5GA 2HWKA 3NGMA 4GI1A 5BQOA 1XK6A 4C2AA 3BA1A 2OQRA 2HBZA 2VT7A 3V1TC 1NJ5A 3B3AA 4RETA 5DBGA 4OH1A 4UNIA 3E2MA 1EA5A 5LKAA 1M2GA 4BNZA 2CDRA 2XB8A 4MGZR 3D7SA 2JJ8A 3FWKA 1CY8A 2OLEA 2Y0BA 3DTTA 4FN4A 4OPMA 3TCXB 2X77A 5EZYA 2NM0A 1Z7GA 4RX1A 3C45A 3BHMA 4E11A 4MVJM 2YVAA 1I4EB 4A0RA 1E2JA 2O3UA 3VX3A 1BKDR 5LQUA 2PQMA 2AFIA 4BPRA 3C5EA 3NHKA 4HB4A 1N34B 1NVMB 2DBVO 1FLNA 4GG1A 3VPGA 5EERA 2JFGA 2XOKD 3NHAA 3QVJA 1NW7A 1JLMA 1WE2A 2OGWA 2FPMA 3KVYA 3MRXA 3OPNA 4IDHA 3F6RA 4MRMA 2ZEJA 3F71A 3H2BA 4TWAA 1WV1A 3IBGA 1UC8A 3NYWA 3QIVA 5JDIA 5JFGA 3GUUA 2GZRA 2I29A 3OZFA 4WCVA 2Z8YA 3S99A 3ZXIA 4TUYB 2ONJA 2W2KB 5EGNA 1GQQA 3QOWA 1LQTA 3VJKA 4NBRA 3LMKA 4DSZA 3JWEA 5I7RA 1QRRA 2EJBA 2J4CA 2DFLA 2IWRA 2UYHA 2H7XA 2YMMA 4D4IA 1PJQA 2ZSEA 1JG2A 2CHQA 5FOVA 2ZBFA 3B5JA 4DA8A 3CUYA 5AH0A 3BSSA 3G9QA 4GZ3A 1JJAA 3CT4A 3UBMA 1MIHA 4KKXB 2ZBEA 4AUNA 2ZWOA 3I8SA 2UVPA 3EY9A 2C78A 5AUOB 5HS4A 2GJSA 1V8DA 3C3WA 4A8JB 2RK4A 2QN3A 3ITEA 3P0FA 4IDPA 4NQRA 1RM3A 4B74A 1DUIA 3HU2A 3I04M 4H3HB 4R3UC 3BXPA 3WSWA 1JBQA 4KAFA 3R6GA 1Q7BA 2R5WA 3GUZA 3Q7PA 1W6UA 2QD1A 2XKBA 3LWNA 1JX6A 3OOWA 1X7ZA 3RIMA 2A0XA 2XMBA 3LC7O 4QAQA 4DCVA 2OO5C 3KWJA 3HABA 1G8HA 2LKDA 3D4IA 3CNOA 3LHSA 3MUNA 3H5VA 1IHDA 4DWWA 3F9CA 1ZHHA 1K92A 2YIMA 3R5HA 4OYYA 4PWZA 3ZCSA 1L5OA 1UKCA 4OHCA 4MQFB 2V4MA 3UVEA 3P9NA 3QVGA 3GDFA 1A27A 3GVIA 4QFMA 4TTVA 2JL1A 2GJ8A 1NULA 2Q1WA 4QYWA 5EPEA 5K0BA 2BBOA 2PQ6A 3I9FA 4LRTB 3MCUA 1XCGB 3QEBZ 2IOFA 3KOMA 1D4AA 2G83A 4R1TA 3URKA 2JBAA 4TTQA 3KZKA 4PPGA 5F9HA 4RGQA 1L8AA 1EFPA 5HUJA 4CCYA 3LKVA 4CI0B 4YH1A 5JD3A 5TPZA 1RACA 4QXAA 2ZGVA 4MGIR 2NTJA 4P92A 4PSUA 2VJMB 4RVSA 4L74A 4R3WA 1FNCA 4BNDB 5JBNA 5IKXA 1NFRA 3F78A 4ZOLF 4P4NA 5C9ZA 3TSWA 1A50B 1U7PA 2OHXA 4MI9A 4X8LA 2EC5A 4XJXA 5FCDA 2GDZA 2NW6A 1ND6A 1TC1A 2W42A 2N9UA 4TL8A 3OEED 5IJZA 2HXSA 5ITWA 1LV8A 1QTRA 2O2JA 2QL7A 4HQFA 4AS1A 2CNBA 2HJSA 2VDNB 2JGFA 3ZDQA 4AKEA 4D4LA 5AK5A 2X0RA 3IAHA 2V03A 2OWDA 2XVZA 1EDZA 3IJEB 3K6KA 3PGKA 3M82A 3M7IA 4I50A 1ESCA 4P4SB 5JAIA 2ODWA 3B36A 4KH1A 4ND8A 4HDRB 4FYYA 4DY6A 1SUAA 2BN4A 3L6CA 4X54A 1R6BX 4J0IA 4RIEA 1WZUA 4FB4A 1UM8A 4EY5A 1H85A 3TLAA 2CFRA 3I1YA 5HKAA 1YACA 5ESDA 3LYAA 1U9IA 4FSHA 4CIWA 2X4GA 4FUTA 5JS1A 1JG1A 1NKTA 2ADFA 3HY3A 3M9XA 1K2WA 2WC1A 4HLUA 3P32A 4P4UA 4S1TA 3AIOA 3WNZA 4AD8A 3MM4A 4Z7OB 2IYQA 3SBOA 2ZB3A 4C2TA 3MHPA 4HNAA 1GPLA 5I7OA 4GS5A 1VCNA 3CONA 3KTOA 3VPSA 2Q0XA 4BVHA 3FDZB 4JLWA 3ZU2A 2NXJA 2YZNA 5D01A 2I80A 5F1PA 3RO7A 2VBGA 1XG5A 3TVTA 2YS7A 2ZLBA 3BRWD 3D3QA 5T57A 2C5AA 3TRIA 4IUCS 3UB2A 3U81A 1P5ZB 2ATVA 2J5QA 3DZDA 2HY7A 3SX2A 3ZGVA 1E7YA 4EPRA 5L7TA 5KTPA 1AMOA 2WQ7A 2FMKA 1O6ZA 1B6RA 2RIPA 3KOUA 3Q7TA 2CC2A 3CX8A 5MF6A 4P34A 1Z7EA 1WXIA 2OILA 3LTEA 4MKFA 1FFXA 4JXJA 4CR6A 4DV2B 1ZUIA 4BATA 4WK6A 2QTHA 1TPZA 5CVDA 5C7OO 4WDQA 2BJWA 1W0JD 4O4IA 3ROPA 5DNVA 1PGPA 4A8JC 3OIYA 5B6IA 2WA2A 4IR7A 2ZAYA 5CX4A 3NBQA 3S8YA 4WINA 2H4XA 1O58A 2B1GA 2C2MA 2JLQA 2FPPA 1DOHA 4ZAYA 4PAQA 1V9SA 2TECE 4ZFNA 5IVKA 2Y1FA 3KB1A 1Y0BA 1E6WA 1OAOA 1Q91A 5CXSA 4ZQIA 3EEQA 3WOVA 4C7OB 1U94A 4BMYA 2QY6A 3FCOA 2B0JA 4IGFA 3BL8A 1KI9A 2ZI4A 1XXHB 5KOYA 3DHNA 1KK1A 5BRJA 5DU2A 5JAZA 2C00A 1EIZA 4R9NA 5BMVA 5CNIA 1E79D 4XIFA 1LVGA 3M2TA 3EPJA 4WBXC 2WF8A 1FFHA 1NPTO 5LBUA 1ZINA 2F3TA 2ZR7A 3LJKA 2H8GA 4CCWA 1YD7A 3TXXA 1MOSA 1TYBE 3H2ZA 2W6ID 4NK5A 4UULA 3FRHA 1LEHA 5GGXA 3LXRA 1RE0A 2TMKA 3IP6A 3ST7A 2XBMA 4FSXA 3F67A 1PV4A 1K5HA 5C5CA 3WRXA 3WGVA 1JN0A 1T4CA 1X94A 1NA5A 1T0PA 3OJLA 2GBIA 3JU3A 4JLSA 4L75A 2KJQA 1E3SA 3KHSA 2PH7A 1ZN7A 2V7EA 1GKLA 1GPMA 2BM1A 2VAVA 3EXHB 3T4XA 4UU1A 4ZOLB 2XMZA 3HY6A 5CFOA 2ZRKA 1Y4DE 3A6KA 2WYWA 4NRDA 4XEUA 4Q9DA 3LLUA 4XX0A 2PWBA 3IJPA 4EI9A 2PUTA 2ZAMA 2PUFA 3KYIB 3OE4A 4F5WA 5BNIA 2EIHA 1ISHA 2XDWA 4C2UA 2I6TA 3O73A 3RRZA 2YVLA 3DAGA 2ZYTX 4C01A 3RHTA 3IOMA 3I64A 2ET6A 4BX8A 1GPNA 2QRVA 3WXMA 2QN2A 1KORA 2JFNA 3CLSC 3QVXA 1QO7A 3MGBA 1MRZA 1SOWA 2GAFA 3GJ3A 5DHRA 3CTPA 3PX7A 1Q0ZA 3NAQA 1M34A 1H5UA 3IL2A 3LUJA 4XI9A 1YXMA 2H3HA 2X1HA 3OZXA 2DE0X 5IKPA 1SPBS 2ZSKA 5LMNB 5DHAA 3J7TA 1I9GA 3FVTA 1XZMA 1KAOA 3JQDA 5DCWA 1W4RA 1BVHA 1EFDN 2I8LA 4Q1CA 2JLWA 2OV3A 2OHJA 2RHRA 1O96A 2AG8A 4YGYA 3DG9A 1EXWA 3CUKA 1WQ4A 3IAS1 4BY9E 3NYIA 5IKMA 2IDZA 3IQXA 3U7JA 2IV7A 5CB6A 1HLPA 5GJCA 3CLRC 5SZJA 2PLNA 1I4OA 4G89A 4DCGA 4AJNA 5K0FA 1TMGE 3GEPA 3M4YA 2HWWA 4W9RA 4HLQB 4PG8A 3TLMA 3I2IA 2L82A 5HGXA 1ZK4A 1FYXA 2REQA 1TF2A 3BIWA 2Z8XA 4FYHA 5AKJA 2WY2D 3U37A 4CQJA 1T10A 2NVOA 4D5GA 2GK6A 1WS6A 1D9XA 2MYPA 3T0GA 3KLMX 1YULA 1IBSA 2AMYA 2KBFA 4ODIA 8GPBA 1IZZA 2JS7A 3AZPA 3C15C 3CUUA 2YFYA 4H3VA 4I3GA 4WOPA 4EUEA 5JVDA 2QA5A 3FN4A 2DLCX 3FKSA 3TEJA 4U5XA 5LD2B 4CLRA 1ZOLA 3OQ1A 2IU0A 5JS2A 4GT1A 2ODBA 1E59A 1HE2A 1Z2PX 4YWJA 5TPWA 5HZGA 4R1SA 1BA2A 1MF7A 4BLRA 1QU2A 3EIWA 2ZIFA 3SZLA 4TYWA 2D1TA 2DY0A 4NZNA 5HKKD 5ITZA 3PQFA 1TQDA 2VXYA 4BQRA 4IHAA 1Z0UA 4LXUA 2PZBA 4M1KA 1PLKA 5KSYA 3AW9A 1RPAA 2OG2A 1V35A 2R00A 3PJEA 1VB5A 5FEUA 2BISA 3D81A 4Q3KA 4FFNA 3W8RA 3X1MA 4S2UA 1Z5WA 1XZGA 3Q5DA 1UKEA 3S7ZA 3VKUA 3UOWA 4MPTA 1XAHA 2RCYA 1VSUA 2P9BA 4YQFA 1QLJA 4MB0A 5EE5B 1P0MA 3KJQA 3RYCA 4LQDA 5JSFA 3ZY2A 1S3IA 5TXGA 4B6GA 1ZN9A 1F2TA 3ZCQA 4AJKA 3MB5A 4UHKA 3RSSA 3PC8A 4AUKA 1Z22A 2GM5A 1W29A 2WVGA 2ORWA 3CUWA 4N65A 3ZK8A 3U44B 1YJ5A 2MYTA 2DU8A 1WIWA 1G7RA 4MQEB 2WWHA 4GEKA 1BN6A 4MUIA 3C3KA 3KVOA 4OQDA 3B1YA 1KZ1A 3IUNA 1QANA 3UMVA 4E5DA 2F1IA 2ZYIA 1E2MA 1NU8A 4R98A 4TV8A 1DTEA 1YQXA 1YZTA 2JLCA 2JAUA 2Z43A 3GX1A 3MEQA 1EJ2A 1LXCA 2PGLA 3D8TA 3OEHA 3RAPR 3O8RA 2F4VB 3NBYC 4QWWA 5CD1A 1RKXA 3H3FA 1I6WA 5HE8A 2JEYA 3EQ8A 2BD0A 1MUUA 3MJSA 5AYVA 4MUBA 3RVRA 1OB5A 1F7VA 3QW2A 5CVEA 4YT4A 4N6NA 2VLIA 1RZRD 2ZIVB 4DJAA 5E6UA 2NO5A 3ZNOA 1LNSA 1U8AA 4G0UA 2Z6QA 4TZ6A 5CA0A 3T0IA 1KQGA 1K6MA 2CZGA 2PZEA 5TGDA 1Z34A 4C2BA 1JIXA 1HL3A 1P1BA 5GZ6A 1J25A 4E4YA 5JSZB 3EFOA 4LXQA 4BN4A 4RXTA 1OHHD 4ZMRA 3L0DA 4ZAXA 4YRBA 3Q7QA 2BLNA 3INNA 4D0SA 1JZTA 2JLAA 3IELA 5EIBD 2GPYA 1E6MA 3REQA 2C7BA 4YJHA 1RLJA 1WEHA 3OJWA 2J08A 4OGFA 1L7DA 2ZRJA 3GHHA 1S2IA 1YKSA 5A9TA 2Q6OA 5E1MA 3F4KA 1CSEE 3QOFA 1FW8A 2R7AA 3DOFA 1GTSA 2CVZA 1FW6A 1Z7WA 1QAQA 3UMGA 2JI6A 2VRCD 2FPIB 4YPFA 1JTFA 2X9LA 1BXRB 3P9ZA 4UW9A 1T1SA 4DCUA 1DO0A 2R97A 1EWYA 2YINC 4CBVA 4F5EA 1A82A 2VOEA 3NHZA 4LDNA 5A0VA 1VGQA 4U8GA 1EUQA 3AY3A 3L5KA 1SQ0A 1X7XB 2Z1MA 3QPDA 3TD2A 5C18A 3OG9A 3RASA 2PRSA 3JZMA 1VIYA 4TRRA 1WBBA 1XPUA 1R00A 3QUCA 1YI1A 3KEOA 3DYBA 3ROXA 5K3SA 3W4IA 4KRGA 1T8RA 2QGFA 1OH6A 3INGA 4M36A 4B5KA 1GTMA 1ZMTA 3L7IA 3ZJ5A 1I0IA 1IOZA 1Y4AE 2H06A 4OB8A 2WILA 4AN4A 2E5WA 3HSSA 3CPSA 5INTA 1BDIA 5FPQA 1IOWA 2HO4A 3BDAA 3ZLUA 5HRAA 5AXDA 1JPUA 3ZYCA 5BP7A 3ESCA 3EMDA 3R3UA 4GE0A 1JTVA 2IPLA 1II0A 4IRMA 3R20A 5AM1A 1NYLA 2JJMA 4KQIA 2BSQA 3PL5A 4MDEA 3OC6A 2ANBA 3HBLA 2AUMA 2CHVA 5ALEA 1SY7A 1UEJA 4DS3A 4MAAA 2MR5A 1AZTA 2WFZA 4JUDX 3ZYZA 1PL0A 3GNQA 1T8UA 4OSOA 1H6BA 3VMMA 2UUAB 1P9RA 3GJQA 1MO2A 1JKIA 3VKWA 3WGTA 3EF3A 2ZTMA 4DQKA 7GPBA 4Y1RA 4PC2A 5JV5A 5AOVA 1YDEA 3JW8A 4DPKA 1HE4A 1K08A 2HEGA 3B3FA 3QELB 4MJ7A 3HJNA 2OSBA 1RAIA 1O4WA 4I55F 2IQIA 3L5OA 3A1CA 4KW7A 3RBVA 3W5IA 4CLXA 3DQZA 3S81A 2ZYSA 1SU7A 1CNEA 1S2MA 5C3UA 1ZIYA 1ZRNA 1M1YA 4NHEA 1CZUA 1I1QB 4P0TA 1OZHA 4MKRA 3E3NA 2BSAA 3ZLJA 5F3DA 5FUYA 1ESNA 3CLKA 1DLJA 1VHLA 1OLXB 5JH7F 4X6UA 2W6JD 3DE3X 2QD4A 1Q7RA 1CUSA 3NJRA 3NTLA 1VRWA 1BYIA 2GN2A 1OFIA 1ZD8A 1NPYA 2GTPA 3FA2A 3H8JA 4G36A 3M6MD 2PFGA 1CZKA 1GIAA 1KP3A 2WICA 1HFKA 2JJ2D 2Y68A 2ZVJA 3NBZC 5B1EA 1G21E 4DANA 1UPAA 5EJ7A 1FFCA 4KX3A 2CXQA 1F51E 3PJDA 1M2JA 4ZQEA 4ZOCA 5DLYA 4CEIB 1IHPA 3FKJA 2YJ4A 5J1TB 1C0IA 2E18A 2XUHA 3TZ6A 4EW3A 2CV0A 4DNQA 2N42A 1INLA 2VK2A 4Q21A 4EFDA 2VATA 3AXTA 1N5RA 3ZVKA 2R1VB 2HT1A 1JA1A 2COKA 2R0QC 3ISVA 2H1OA 3RC9A 5JAUA 4QJBA 1XYYA 4ZZ3A 3ER8A 3V33A 3DKVA 3PUWA 3ZOZA 3FYUC 2VQEB 4CL2A 4PFQA 3P0JA 4GOJA 4D6PA 1JH8A 1I51A 3K9WA 2WWTA 4YO8A 1U28C 3RAJA 2EFEB 1X8JA 2C9ZA 4D4KA 1X1SA 3EEIA 4V0RA 4CHGA 4G9BA 4WZZA 4ENRA 1NBMD 5ERGB 3TG2A 2XSZA 3G88A 1SCDA 5CK4A 3S2SA 2QX6A 1EAYA 3RFVA 3PE6A 1A7KA 4N6GA 4R81A 1XMJA 4JUFA 4PRYA 4C3ZA 1T5HX 2WF9A 3P8ZA 4WVFA 4RZXA 2MCFA 4DIEA 1QQTA 5C4IA 1HEUA 4XD2A 5DM4A 1IXKA 2PO5A 4FNMA 1U7ZA 5K5EA 3IPRA 4JITA 3LHFA 5JJKA 2XCRB 1OH7A 2OCKA 3IE0A 4HZGA 3E8SA 3W2IA 4UARA 1JRLA 3DA8A 1GRRA 2VTEA 1CF4A 1V37A 1KDYA 1YGPA 2SKCA 5FI1B 1YR6A 2QX7A 5ULLA 1ZUHA 3I9MA 5K0ZA 4JI0B 4ASUA 5J43A 1WXDA 1X2EA 5EKUA 1KDZA 1EQAA 2IVFA 3UKOA 4WK0B 3AKDA 4X1YA 3R1IA 4N7RA 4BFYA 2CVHA 3FPSA 5AKKA 4OL9A 2VEOA 3AOEA 2DUJA 3DBOB 3P20A 3HB1A 1UPXA 3LQ4A 1C7QA 5G0SA 1H2YA 1MJ5A 3W04A 5FDFA 1CUHA 2NV0A 1XZKA 4FKZA 5JSKA 3C5HA 3W5AA 2BUAA 2FXIA 4ME6A 4BFZA 3V46A 5EI5A 3KSAC 4TSFD 2E5FA 4JT4A 1A8QA 1OW3B 4JVOA 5BR7A 1NQUA 2QV0A 4IICA 3FE2A 3SR0A 4GVXA 2P8SA 2W2LA 3IHLA 5JLAA 5FFFA 2RJ3A 4R16A 5DM0A 3U09A 1B2LA 3E81A 5LMUB 1L4YA 4BNHA 3M83A 1NC3A 1XWWA 2DT8A 4RY9A 2RJOA 2GO1A 1L5VA 1QYRA 2FWPA 4NCKA 4N12A 4C6HA 4ZJZA 1F0PA 2FDRA 1E6EA 1MMFB 1NONA 4JBYA 1PT7A 4M8LA 1Z6PA 3LY5A 1QE3A 3T9BA 1AK2A 1ECFA 5GQSA 3BQ9A 3WDLA 4JI5B 3ZE1B 2GH1A 3VQTA 1FTSA 2PXXA 1B8UA 3FVQA 4FU0A 2ZB2A 4DIBA 2G88A 2XKAA 9ABPA 5JH7B 1GAQA 1NNUA 1YZVA 1B43A 2A94A 3LZDA 3QKWA 4I9GA 1F0YA 5DYYA 2LCQA 3SX0A 4EF5A 5A7GA 3QXSA 2HRDA 4FHFA 1Q0TA 1KL7A 1F17A 2FA9A 4HSEA 5J4LA 3WKAA 2BR4A 4CDNA 5H82A 1QKIA 2WINI 3LKBA 4OI0A 5JPCA 3C74A 2QT1A 4PGMA 4F2DA 4XKJA 5AVVA 5GY7A 8ATCA 4WKBA 1N5MA 2BM0A 1YRAA 4YN3A 1W0KA 3GJ6A 1GYQA 3N59A 3SYNA 1CIPA 1CE8B 3IH5A 4KGZA 2KW5A 1JHVA 3NBXX 4RD0A 2DZDA 1ZL0A 4RPGA 3VYVA 3WAKA 1EZ4A 4WJZA 3NTRA 3BWDD 4KLRA 4PYOA 3GJ7A 3LSTA 1CLUA 1OT5A 1XKTA 3BL6A 2OVFA 4QYTA 3A1DA 4RDHA 5GJWC 3ELBA 2HRCA 3WL4A 4TSKA 3T1NA 4Y9SA 1GUDA 5EMJA 3ZGXA 3ISTA 2HHJA 4LC0A 1JXMA 2DPLA 2NV6A 4LMBA 5FUWA 3ZD6A 1CRLA 4M7PA 5D84A 4QA9A 1QX4A 4GPZA 2PGAA 3IHWA 2FKAA 1YUBA 2CT8A 5JFTA 1P1JA 1T9HA 3I01A 3TXYA 1Z4IA 2PNJA 1FDIA 3IIIA 3F5DA 3P0EA 2CXRA 5CU7A 2AL7A 2QMYA 4OP2A 1R3UA 2BE7A 3OIFA 3AG6A 3JZAA 3WB0A 4EZBA 4KAXA 2X7XA 3R41A 3DMGA 3EARA 4WUTA 3BTVA 3HU5A 4ZCSA 1FYDA 1AS0A 4D8YA 4A3SA 1HG1A 3NT4A 3MPOA 5CBPA 4AZWA 4NEGA 4UEOA 4X3CA 1CZLA 5DWQA 2IBSA 2GO7A 5K8VA 2A0FA 4TRMA 1PR3A 5JXWA 2W6OA 1PU2A 3W6UA 4AJLA 1BHJA 5E4YA 4Z4IA 2R8BA 1CVIA 5CDSA 3P1JA 3IEXA 3T1HB 1UAYA 4D4MA 2D00A 1U3WA 4R5MA 1JJBA 5FTMA 1JSZA 1DWQA 1UBCA 3ZZ0A 4AM8A 1AHPA 1T0IA 2PKEA 4LY9A 3LQFA 2WZDA 1A71A 1NTOA 5J5CA 4EP1A 3FI9A 4OLAA 3A6GA 2EWMA 1EI9A 3LRXA 4N0PA 3DAOA 3DOEA 4EAAA 5BVGA 2XOXA 1B1CA 4JP3A 4CF4A 5KHLB 5F3WB 4MITA 3WLJA 3JPWA 3ER6A 3DEKA 2A1TS 1LBTA 1ZWKA 3GLFE 1RLOA 3A3PA 3QIAA 1L5WA 5KQMA 4QUBA 2DQ4A 2YIDA 4WGFA 1QIFA 1KIFA 2PT5A 4LSWA 5I9MA 4RD6A 4K26A 1L4UA 1JLSA 1JDUA 2QDKA 3H3JA 3JVIA 2KM1A 2PS9A 1RLMA 2PT6A 1EP3B 3LP6A 4BS9A 1GUAA 3T61A 1U3CA 2FQ1A 4NMLA 1HRKA 4B80A 1RRGA 2Z9CA 1M10A 1SXJE 1Z0IA 4LK2A 1H0RA 4ND3A 4URUR 5ECDA 5TF4A 4J7UA 1DEKA 2G5PA 2ZS7A 4GUDA 1TT5B 1J06A 3V00A 4EBBA 1UMBB 3JQ7A 1ZGAA 4ZVUA 5B53A 2QRUA 4EUFA 2FW7A 1U0NA 3ESZA 4DB2A 3FGOA 3V2HA 1UMDA 3NEAA 4ZCPA 2MSNA 4YCJA 2D62A 3W79A 1EQ2A 1DTWB 1DWOA 1RXIA 4RZHA 3RUCA 4HNHA 4FPXA 3QI2A 2SKDA 1NZDA 5HKBA 2NZUG 2MYUA 2WG0A 4J4TA 3UUWA 4ND7A 4DGSA 2C61A 2NWQA 4CMIB 2Q3FA 3MJEA 3VU3A 1OFHA 2OFXA 5LQMA 4KQCA 4UUQA 1ILEA 3WYNA 3IAFA 4L7QA 1GGMA 1VSBA 4AYXA 2O06A 2QLTA 5AFSA 3LP8A 3QI7A 5D3KA 3ZKWA 3EGXA 4Q3AA 2RHMA 1NI5A 1F0NA 4XGRA 3ULKA 1JDBC 2O8EB 1CPYA 4HNTA 4DR4B 4MS1A 2GCOA 4ZHQF 3NVKI 2OAP1 3OY2A 4NG4A 3ZCUA 1JYSA 5DCYA 4UZFA 4UOZA 5KEIA 1EFKA 4JLKA 3FCYA 1KDTA 4JKYA 4PC6A 4QNNA 3RUEA 4DDKA 3HKEB 2BFBA 3CRW1 3GRFA 2QEQA 1JP7A 3A36A 1Z8HA 4YV0A 2G77B 1YSCA 1IBCA 3ZLTA 4B0OA 1QMPA 2X5KO 1K86A 3T38A 1TQHA 2G5CA 5JNUA 3B6IA 1UJCA 1X0VA 2ZRFA 3GDHA 3B78A 1KOJA 1GKIA 1OFUA 4MR7A 3RS4A 2G71A 1Z68A 3K4QA 4WEOA 3IA7A 4PHTA 1DRJA 4KVFA 1RJEA 2IYRA 2I1QA 1S1MA 4OBBA 4A8TA 4IQ8A 3RTCA 2ZUBA 2IY8A 2YR0A 1T2NA 3H9EO 3OFJA 3OUUA 1UDBA 4IIVA 5K2MA 1K7XB 5ARDA 4WWHA 3UKJA 4AL4A 3OSZA 4HY3A 5TQ0B 1RCUA 2B34A 4DLZA 3SJAA 4MRNA 2BH9A 2JHCA 2JW5A 5DP1A 2X19A 3ADKA 3MJFA 4KR3A 1W76A 2Q9AA 2UYQA 4QG3A 3E5RA 2H0QA 1ZLXA 3V1NA 2ZVDA 4H0FA 2XYPA 3D8UA 3WNVA 1WXFA 2QUJA 2Q5JA 3BYZA 4H35A 2XQKA 3QKSB 3DUWA 5EWJB 1GCIA 4Q66C 4IGAA 5KYUA 2C42A 5TX7A 4Q4HA 4XD7A 5KYNA 2V98A 3UK7A 4FJ1A 4Q1VA 4X85A 1P4SA 4X3PA 2DM6A 2OEPA 2WUEA 3IVRA 5AXBA 1BX1A 2QTWB 2UVDA 1CUAA 2QBYB 2SHKA 5ALFA 2W2NA 4JLOA 3GRCA 4EYOA 1OAKA 4AJPA 1GZHB 2VDPB 4NNPA 1BOOA 3O38A 3COYA 2WUDA 2ZT5A 4Q9LA 1WZIA 3P0HA 2CVFA 1R4NA 4NV3A 1Z13A 1N2JA 3EZ9A 4JBXA 5CVVA 1QUEA 2IIQA 4ARAA 4D8TA 3TAUA 2X6QA 1JYEA 2YUTA 4XOUA 1KPIA 5HF6A 2F59A 3L8YA 3BE5A 1Z0FA 2R1ZA 1GGHA 1Z0JA 1UWCA 1SBHA 3OURA 3QEMA 4UM5A 3WQRA 1ODSA 4BNMA 3FLBA 5JZMA 3D0RA 4NEHB 1FVHA 3BSFA 4BFWA 3DL0A 1Q1QA 2NU6B 3D8SA 1FFDA 4HLNA 3TZQA 3WLSA 1A8IA 1N6LA 2PL1A 4DZRA 4JI8B 3THSA 2JK1A 1XN1A 3C7AA 2IEZA 3LBFA 1DFIA 1X8XA 1EJBA 2PZJA 5JANA 1P7VA 1GZSA 5IJ0B 1H93A 2CLCX 2DVMA 1JEQB 2Y4OA 4OMCA 3USCS 1VTKA 4Z4HA 5KSOA 1XC7A 3O8NA 3KR0A 1JVBA 2GWRA 4QUIA 4LYEA 2DETA 4XB6B 3AINA 4NI5A 4M54A 3LIPA 3ORSA 5CK5A 5ALUA 4XW2A 1Z4KA 4G6ZA 1XZIA 1BWSA 4HTFB 2JGIA 5ALHA 2W4MA 2YN0A 1JJIA 3ORQA 1BFDA 4MWCA 3N2LA 4FFLA 3V8RA 3HZRA 5C3MA 2ZCVA 2WKQA 1P77A 2YWCA 4FWIB 4HPWA 2BR3A 2YZ7A 3DF7A 5F33A 5CDFE 4MQ4A 2ZZNA 5K3FB 4RMJA 4U5QA 5EPUA 3LQKA 3EAQA 3LWDA 2XW6A 3K4HA 2AC4A 1UPFA 5GV7A 2F90A 1CWUA 1RQLA 4FHGA 4KQKA 1KI4A 4Q4JA 2Q5LA 1EFCA 1IL0A 1DC7A 1YZHA 2Z4SA 3DLTA 3BOSA 1DKNA 2ZVPX 2XE7A 5TQ2B 3VGJA 5FA6A 3DKPA 3OZAA 4BQPA 4LBVA 1PDOA 2ROQA 3EVCA 5T4HA 4ND1A 1LPPA 4K1XA 2RKBA 2B25A 4EHIA 5L7YA 4CQLB 4B48A 1H6DA 1Z75A 4G5FA 3ZY3A 1H66A 1LSJA 2R86A 1Z83A 2UUPA 5JMOA 4GI3A 3RTEA 3MERA 1EFAA 1CS0B 1MVOA 4CM9A 4PLTA 1V8FA 2PGIA 2C0QA 4G4SO 3R7FA 3RJZA 3VMFA 1EIWA 2JLXA 4OATA 1FB5A 1THGA 3IJRA 4PZUA 1VIVA 4HNVA 3IAUA 3NXSA 1HOTA 2QE6A 2P27A 2WKWA 4YHBA 4Q4DA 5FD8A 4QZVA 1IVSA 1DO8A 3ICQB 1RRPA 4CKCB 3BJMA 4OK3A 4CMHA 5K20A 3ZI4A 2IHJA 2Y1WA 2Z2JA 2MINB 3DLIA 5F78A 3AF0A 3EE6A 3LQYA 4P82A 3OMLA 4PLCA 2GHIA 3CN9A 4YJGB 4EJSC 5FBKA 4PINA 1QGUA 2O8NA 3HCAA 4ZGBA 1OBOA 2FHSA 4ETNA 2PVPA 2VZLA 3HRIA 1ZM3A 3QKUA 2QZZA 3KEGA 2OCGA 5DTEA 1QIKA 2HK9A 2YHIB 1MD9A 2Q1XA 2VQDA 4A1FA 4AG3A 4I2NA 2QRQA 2FZWA 4IG4A 2GGSA 3PUIA 2O20A 2XUZA 1N8SA 2JLSA 3NXKA 4GECA 4IINA 3TLGA 4RTOA 1CD5A 4MCJA 1DP4A 4HEHA 4OA5A 1CQIB 3JQAD 1Y5NA 3DOUA 1ISJA 2YNMA 8ADHA 1C7RA 1G2PA 5JD5A 4EF4A 1FEZA 3PHLA 1CUJA 4JL6A 3ZU4A 1DEAA 2H3EA 2F3SA 1F0KA 1N7GA 3AUJB 3EDOA 4XVQA 5A0TA 4BCDA 4N3NA 1IPEA 2GN6A 2WV7A 3IKJA 4RLSA 1XXLA 1XMIA 1T3HA 4XM0A 4WNAA 3TECE 4BQOA 3WNQA 3ANSA 1K8ZB 1LLDA 3OKCA 5LQCA 5L45A 3BD7A 3AUYA 1PS0A 5BN5B 5DYNA 3WVNA 5C1OA 3E48A 3GVHA 4DR3B 3Q7IA 1PR0A 2NSDA 4GYJA 4L9WA 1DJPA 2QW0X 3K0FA 3DMTC 4JC8A 3G85A 3AHDA 4RQAA 1AN9A 4A26A 4YQZA 2ZTUA 1O2DA 4DLSA 1THMA 1B8PA 5BV1A 2QN6A 3CZ4A 4AY5A 4D41A 3MAAC 4Q37A 5A7FA 3VDMA 5CYGA 4OM8A 5JWHA 3WQHA 4RVOA 4HUQB 3U3DA 3BS4A 2I9PA 3BJIC 3PXUA 4L57A 4LC9A 2QX8A 5ALTA 5ILQA 4US2R 1R5JA 2XA2A 4JLDA 1E0KA 3ILYA 4JYZA 2XT0A 2ZUEA 2PKQP 3GYGA 4LYDA 4RANA 1TQ4A 1NLZA 2A9KA 4TVBA 1KE1A 2Q41A 5KZMB 3BWVA 2GX6A 1DHRA 1KJWA 3EISA 3WLEA 1NAIA 2XE8A 1WCV1 5FV7A 4PIMA 3RIHA 3R7BA 2XZTA 4U4AA 1J0EA 3EK2A 1I1NA 2E4UA 3RDPA 2G5TA 3FPAA 2GPSA 4BNIA 3WSVA 2ACWA 4B3SB 1PHPA 2DH6A 2RAUA 3DDZX 3DXZA 3SBXA 4F3RA 1PKXA 1QG0A 1GXSB 1RHKA 4OHMA 3U62A 2EDAA 2VPTA 3A9VA 3O1LA 4YRLA 4YBZA 4NZPA 3OHSX 3AEKA 1G8FA 3LA6A 1MB3A 3C41J 5BVHB 4WJLA 4LHYA 4HN4B 1HDXA 4IH9A 3DMPA 4IVPA 2D13A 1BD4A 2NXWA 3WWOA 4B2PA 2EFGA 4XDHA 1O5OA 4OTZA 4KMRA 2IL1A 2YWGA 2CF5A 4MROA 3LQ2A 4RYDA 4ZZ0A 3D4BA 4FXOA 5FX2A 2H2IA 2XTZA 3ZLBA 1U0LA 4M0LA 3QF7A 1IATA 3NT2A 3WOHA 5ALVA 3PQ2A 1G2IA 2P90A 3R75A 1AIPA 2JFWA 3F4BA 2HRQA 4MHOA 1PUXA 4Q0MA 4DIUA 1ZQ9A 4MKZA 5J2TA 5IDVA 2IITA 3GFFA 3HMQA 2V6MA 4J0JA 3FBTA 1PQWA 4DA4A 1NHWA 1BQEA 1U8YA 1DIOB 3MOIA 4LF7B 4LV5B 5GTDA 5EXDA 2GZ3A 4UAJA 2DUNA 4E07A 1W36C 1I9CA 4RMGA 1OFVA 4DDHA 3AUUA 3D7MA 3OLXA 2V7XA 3ELDA 4TLAA 1NBIA 1L5YA 4KODA 4NKRA 2O3RA 5B1SA 2G09A 3KYCA 4Y18A 3AP3A 1VJRA 1Y3CE 1TZJA 1RWBA 3GFRA 3HB9A 3QHAA 1BOFA 1O94A 4XASA 2BEVA 4MMYB 3U5ZB 5BSUA 1E4EA 3PK0A 1DU4A 1DSSG 4X95A 4N9WA 1J24A 1M76A 1SCUB 3HQ4O 3NP9A 4F46A 3NI2A 4MMZB 1XJWA 1OIVA 3W5JA 2E4WA 4Q9JA 2C4TA 4PYKA 2PMKA 5C8XA 1HL7A 1MX9A 4C06A 3AFHA 1VB3A 4DYVA 1U1GA 4QULA 2HK6A 2AKAB 1K6IA 5I7FA 2QRPA 3H17A 2B6NA 1A2BA 3E9NA 4FMBB 5J4YA 4WKGA 2C7QA 4F4UA 1J0DA 4DUYB 2GJAA 3WMRA 1O97C 2JH8A 4UHFA 3K9FC 2VJYA 1N2IA 2PPVA 3H5IA 4YAIA 1C4WA 2ZAOA 4FE3A 4DREA 1XYGA 1KY2A 2W0SA 3VR5A 3AL0C 4RZ2A 1P62B 2JHGA 5DXAA 4XWWA 1L5KA 1U9JA 4I5IA 4PAMA 3RVBA 4COKA 2YXPX 1VHWA 1E79A 1ENOA 1J2EA 4DRZA 3RU7A 5E6RB 1QYDA 3M5PA 3IQWA 1IXZA 4XM2A 3TJMA 1SK9A 4DHWA 4YRNA 3UPTA 3RREA 3A9WA 5AM4A 3ZS8A 2IOHA 3I2GA 1AKEA 3OKFA 3FCCA 1IB6A 1O3YA 4A2QA 2AFIB 2P8JA 1JQLB 1LPMA 1YRLA 1CUXA 3QPWA 4LGMA 1U98A 1LW6E 3GGOA 1ZU4A 2D1FA 5AKEA 2F62A 2FJPA 5AJTA 5ER9A 4EGAA 4Y6SA 3N0WA 2ZB4A 5EJMA 3SKVA 5LR6A 2GYVA 1VKHA 4OUKX 5EWLB 1OXVA 4RTQA 2JVIA 4ECEA 3BMQB 4Z4CA 3B85A 1EM8A 3DFUA 2CE7A 3GIWA 4KTVE 1PSZA 4YCBA 1K7CA 1A5TA 2D0IA 5A3VA 3GQVA 4IXTA 4WZBA 4NENB 1UKAA 4G0PA 1SJ9A 4M1YA 2PCJA 1LNQA 1SA0A 2C04A 3JTMA 2WZQA 3KKOA 3L0CA 4HG2A 3WGHA 4EMBA 3REFA 4EKYA 2AMLA 1WCYA 2Z8YM 3L41A 4H2DA 3F47A 4J1NA 4N54A 5DOVA 3V1LA 1E3WB 4MRRA 1OZ0A 1ZNZA 3HJGA 4ISCA 4XUDA 4N18A 4A5OA 3GN1A 4ILKA 1UM9B 4P6VF 5SICE 2EKQA 1IQ0A 2JJQA 4W6ZA 5CEEA 1F2DA 1DIRA 4FHDA 4MIOA 4NZ9A 4BWFB 4D3YA 4EEKA 1Z47A 4M0FA 4J8PA 4JJEA 1OTYA 1JA9A 1TLFA 2I76A 2QRGA 2XE6A 1M8GA 2ZQYA 3H4IA 4XWTA 3CRZA 4L3VA 4NONA 5AKXA 2M6RA 5L51A 3HTXA 4RENA 1H4VB 1OVGA 5HCNA 3PVSA 1ATZA 1K7YA 1FXWA 4HMOA 3K73O 4BAGA 4GKVA 3B7PA 4FJ2A 3AIIA 4RLQA 4K05A 4YBRA 5C7YA 3SE7A 4BMNA 5JEDA 4P81A 3CG4A 3RUFA 5IUKC 3EOZA 3HZHA 4NOKA 1IHXA 2XMPA 2ZWPA 4TLLB 1FA9A 2YMQA 4BVEA 4YUVA 5GINE 1KEWA 4OMFG 3P96A 4R5HA 3DVLA 2H18A 5ARBA 3RROA 2PMDA 2DBZA 5ENZA 4H1HA 3AUAA 2WD9A 2AA3A 2QVLA 2QT9A 4US1R 3O7MA 3Q7RA 2BI8A 3G2PA 4HDCA 4RNCA 2WKPA 4BNWA 4U7PB 2XIJA 1L7RA 5COAA 2JBAB 3WWDA 3KDSE 1QBGA 1HKUA 4HJXA 1U1FA 2JGAA 4K5QA 3RSCA 2O0MA 1WF6A 2UVQA 4AMVA 3NLLA 5B7PA 5JC8A 4BXOB 4X1IB 3DS8A 3GNLA 1L5QA 3PPYA 4G86A 1JALA 2BP7A 5CAEB 3H5AA 4TLMB 5KSPA 3Q15C 4YT2A 3E9MA 5JNVA 1YT5A 5ICFA 1SKYE 2B8EA 2VUSA 1U31A 4TROA 4MS4B 2YTZA 1XZ8A 3L7OA 3OM8A 1JIUA 1X70A 2CNWA 3HBAA 4DM3A 1EHYA 2C2KA 5FNZA 4NECA 3IERA 1PVVA 3ILHA 4BQNA 4GI7A 4R1LA 4XB1A 5AMXA 1WZEA 5KINB 3NH9A 3WDKA 4I50B 4MW0A 3UB4A 5KB3A 1RIIA 1YUMA 2IJGX 2YQZA 3NHWA 3DAHA 4UAGA 1P2UA 2VC2B 5CA1F 4Q3NA 3FUCA 3EIXA 1USKA 3K9NA 1ML3A 4WUVA 5G0WA 4AW9A 1EQUA 2A0YA 3BMXA 1EFVB 1OI7A 1DGQA 3O8DA 4L4SA 2WTXA 3T5GA 1GQOA 1RT9A 1YZGA 3ZBTA 2PX0A 1A7JA 4YO7A 1J6UA 4B3MB 1J39A 3CQ9A 3A1EA 1T5DX 5HIMA 5I4KA 1ZZEA 1ABFA 2PQ2A 1WKBA 2Z3VA 3KLNA 4ZP1A 4B6PA 1XP5A 5E2AA 3WTCA 4DNXA 2JI9A 4LYFA 1ST2A 2ZE8A 4G3XA 3K5HA 2FAXA 2Z04A 4O4HA 3UG7A 1OU0A 1JQAA 2ZJ2A 4ITUA 1PQ4A 2OAQ1 4W82A 2QAIA 1WCXA 2IGTA 3NHBA 5FORA 3HCOA 2FZ5A 2LCFA 1JHYA 2E6UX 3BEDA 3GDWA 4IYRA 1Y9DA 4RNDB 1GZ7A 1T2FA 3NAZA 2DLNA 1W36B 1MDBA 3LA8A 3PP8A 1JSCA 1QB7A 3V7YA 1DBPA 2BFEA 3BXGA 3PNOA 3A4LA 4YAEA 4D8UA 3KQKA 2GHTA 2GXUA 5MFZA 1NLMA 3AF4A 2DB3A 3E0XA 2X1LA 3LHDA 3G0IA 1DKLA 3HDHA 1HQCA 3JQ8B 3PYXA 4LJLA 4PNZA 4Y7CA 3BTSA 1BX3A 5LZ5A 1L8LA 1XROA 2A78A 2B2XA 5KNCH 2ZJ4A 3MMPA 4YFYA 1JIVA 4C07A 5ESXA 4B6FA 5KNLA 3RABA 2ZDGA 2NIPA 2X4IA 1EG2A 3QA3E 1L4NA 2IKSA 4U3JA 4EI2A 4R05A 2OQ2A 4J1SA 2W70A 1FQOA 1S3FA 4Z0PA 4IJMA 1DEXA 3NVDA 3OOYA 4DR2B 5BWBA 5HGJA 1ZKDA 1Y6GA 2NXNA 3RLIA 4BLTA 3GEBA 3D3WA 1T9ZA 4Z8XA 5FOQA 3AILA 4K6HA 2AFRA 4E5PA 3IQGX 2VH1A 1XRRA 3U0BA 5MN6A 2ALJA 2AJ8A 2WIBA 4MUFA 3WWPA 2O0KA 5BMVB 3L0ZA 1BIFA 1WPRA 2PUDA 3N2GB 1Q1NA 2P3OA 5BWOA 3HVIA 3WISA 2WUVA 4ZOBA 4LZOA 1RYYA 1ZG3A 4FX5A 2B78A 2O2XA 3A4NA 4GBMA 4LHXA 3GJYA 4OJQA 4NNJA 5DN9A 4ARZA 4HLDA 4DCSA 2OSVA 5LOVF 1HETA 3HUEA 3VR4H 1FTGA 2R84A 4HQOA 3SYRA 1IZ7A 4OLFA 1QVWA 4OX9B 4QYSA 3Q40A 5DHSA 4OFXA 4TZTA 1JE0A 1T4CB 1RM0A 1VHDA 5C7IO 4YP6A 1C8VB 3I6BA 4KQ1A 3X1JA 2GEKA 2VTBB 3AV0B 5L3VA 1AKQA 4YC7A 2XVXA 4BTLA 5DJ5A 3QOXA 2WPDD 3KJNA 1NW5A 4J6EA 5FBQB 1UQTA 1ECGA 1FDSA 2F1JA 2X8WA 3IQHX 3E7WA 3OP4A 3GLTA 5EXEA 3DL7A 3KJIA 4NE9A 3QTTA 4IF6A 4IDAA 3WAJA 2O8FB 4TXHA 1BRTA 2YKGA 2YWDA 5BYAA 3A31A 1E7QA 2OP1A 3P7MA 4IJKA 3IAM6 1U8XX 4RE5A 2AJBA 4TT8A 3FROA 5TE9A 1I6KA 2F1RA 4UQPA 1OI2A 2Z4TA 3HBMA 1I3MA 2NU8B 4MH0R 5CA1B 3SXJA 3BPSA 1RPNA 3KIPA 4XFJA 2NTNA 2A7XA 2WSSA 3EVAA 1P9LA 4KMMA 3COVA 5A6VA 2H2DA 3IIJA 1SEVA 2H1SA 5AUPB 1I3NA 1HQKA 2A0WA 4KXFB 3K31A 1JF8A 2QN8A 3NAGA 4BX9A 2W0MA 4G23A 3R7NA 3KPJA 3I8OA 4ALIA 4CPDA 4QVIA 2FV8A 1H69A 3EULA 4CXMA 5BUCA 1CBUA 1XFAA 3ZVNA 2LWIA 4BE9A 3FFBA 2RHJA 1ZW6A 1P80A 3NB0A 1RLIA 3MWDB 4QUEA 2XI4A 3GFGA 4RIFA 3C2QA 1XZCA 3HSYA 4WFKA 5A0FA 2O54A 1QFXA 1T4DA 1WDMA 2H2HA 1YBHA 2BFWA 5JRJA 5JYDA 3C39A 3T3GA 4B8WA 3PDCA 4HFJA 1G8KA 3SK0A 4OQZA 2A92A 1NUUA 2IDKA 2CL0X 3Q3HA 4QECA 3STTA 1GKYA 4LC1A 1XF9A 1FX0B 3FYHA 3D5EA 1LDBA 3AFNA 2R6HA 4OP3A 2ZIZA 4FCVA 1RWWA 2DUMA 3RT9A 2PSFA 4D9NA 1QAMA 3FCAA 3VNVA 2O5VA 4WLEA 3I4LA 1GSHA 5F76A 5A1TA 3GLGB 2QG6A 1KYYA 2ST1A 3HKBA 1ICIA 2YICA 3LQ1A 2IYSA 4HGZA 2I4TA 4P0PB 4PZLA 1DC5A 1D3AA 5FKJA 3G2NA 1MO3A 4WBNF 5ITZB 4EATA 3K53A 1I3LA 1H6CA 2J0SA 3LC0A 3VNUA 3H0CA 1TA0A 4ND4A 4XSVA 2JFVA 3TFWA 2PTHA 1X2BA 4L51A 2BKEA 4DDVA 3DMFA 2YJ6A 4YJKA 5F73A 1ZH8A 3CKKA 3G3EA 3SLKA 1YKGA 2ZW9A 3H11A 3S28A 1LZLA 3RYCB 4E1VA 5FUQA 1O4VA 4XGKA 3GI1A 2C4VA 1AKTA 1F2TB 2JPDA 2AQIA 2WVAA 4H6VA 1JILA 4LY3A 5E2IA 5E9JA 1JDPA 2ORED 2ZJ6A 3GCDA 1NNEA 2SNIE 3I4FA 3L01A 4BDTA 3CH4B 4WZAB 4P7FA 4IEFB 1EX1A 4JI6B 1AQYA 2R44A 3BH0A 2I7XA 3EA0A 4KN6A 4W1SA 5LIRA 1ADBA 3FPBA 4L27A 5BQXA 3KJEA 1UMCB 4TV8B 4GC9A 4TMYA 3OOJA 1SQSA 4RD1A 1ELOA 2PYIA 5K0LA 1L5RA 2QG9A 2VF7A 4BB5A 1QWSA 2IZ7A 3AG5A 5C8ZA 3GFOA 5AQ1A 2ZUCA 1MAUA 3FMFA 1IK4A 3MQ2A 1I4TD 1VG8A 2H5LA 2FZ4A 3P27A 5BYKA 3IKLA 2Z09A 2REOA 4UVEA 3H13A 3F98A 4DZZA 3UY4A 3A1WA 5T6MA 5E6UB 1X7DA 1EWTA 2EXXA 2W71A 3PVZA 1JR4A 4OKSA 4Q7MB 4TSFA 3ZJTA 3N1UA 2VHEA 3EVNA 4FNGA 2OCIA 4O0MA 3PD7A 4ND5A 1QHYA 4NPAA 3CLSD 2ID9A 3TUZC 2CJWA 4FHZA 3TINA 1YA8A 1YQWA 4PLFA 2FEOA 1GQ2A 4NOLA 4WNYA 4ZVMA 1R0KA 3U9LA 1JPNA 2FOIA 4NPCA 3NHMA 2K5UA 4RY0A 5DNUA 2WNIA 1N0WA 1TECE 2ILTA 2YUIA 2GD2A 3WGYA 2CLKB 4I9FA 1EE9A 3ETEA 1R0XA 5DCLA 3Q0EA 1SHLA 3Q5EA 4IZ6A 2WJPA 3HE3A 4CMEC 1MHTA 1VQ1A 2G4LA 5CCBA 1YS1X 4Q1BA 2CKMA 4DJTA 2ZQ5A 4UBMA 3AR2A 2QLNA 2YCBA 4J0CA 3CLRD 2Z9BA 2RHGB 1KI6A 1U7OA 4K81B 4R71A 5P8WA 5FLKA 1UFVA 1ND5A 2F1KA 3EUAA 4RMIA 5AI4A 5DGXA 2GILA 5KYWA 4MICA 4K46A 3QX7A 1CKEA 1RMQA 4YB8A 5KTMA 3OFKA 4EB0A 2RGBA 1YL5A 2EV9A 1C9YA 4P3KA 1WP9A 1ZSVA 2F43A 2QAGA 3ZX4A 3P2JA 3EXG1 4MUAA 3OE1A 1V2HE 4NBKA 1NKVA 2ZIUB 4RQTA 1IBLB 4XFDA 7MDHA 5GZ3A 1UBFA 2O1WA 2IK8A 3QU9A 5IARA 1R74A 2XB6A 4H7JA 2B61A 2GCGA 4UFNA 4URZR 1GU1A 1LI5A 4B75A 2K6GA 2HADA 3H2GA 3Q6NA 4N0MA 4YJFB 2IW1A 5F9MA 3BB4A 3L7MA 4NV1A 4PPNA 2ZJ3A 5L3QA 4XLLA 2OK8A 4G8BA 1R0ZA 4TXMA 1L1QA 3ZC3A 5JAQA 4CE6A 5L8VA 2YN4A 4G5QA 4CT0A 3T4PA 4DLBA 4UBIA 4ZEMA 5JATA 4WBNB 2GD1O 1SCJA 1KYQA 4BO5A 1BMTA 1E99A 2Y6UA 5KJ6A 2ZYDA 4B1FA 2H07A 3IBCA 3WLQA 2I3BA 4RXMA 5B2EA 9ATCA 2X0IA 2BHNA 3D6HA 1VLHA 4PR3A 4BYMA 4OO3A 2YVQA 2QZ4A 3T8YA 1XELA 2AJCA 1LS1A 3KB6A 4LISA 3Q3EA 1VLMA 4O2AA 4R1OA 1P4HA 2GTIA 3UA4A 3WYFA 4NZYA 3KJHA 4MUEA 3T7CA 2JHPA 4BFVA 5BR8B 2HNKA 4OP1A 4QBTA 4TM8A 1JHZA 2DECA 2GK3A 1KJ8A 2RK6A 2VHJA 3DPIA 3HB7A 4JLNA 1Z82A 4LOJA 2BBSA 1R27A 2FRDC 4FQ8A 1M1YB 1VKNA 1M2KA 1CZHA 1TRKA 4RDIA 4BRWA 1GV0A 4IW3B 4EJ0A 1EE2A 1TAHA 2DWCA 3HR7A 3MBOA 4QPNA 5HUHA 2W6ZA 2WAAA 3M3HA 3VZSA 5M7EA 1ZAYA 3NASA 1AQIA 3ZJ4A 1ODFA 3DLCA 3G9ZA 3JR3A 4GMGA 1E4YA 1XVUA 2A1UB 4IMRA 4X63A 1LF0A 2Z83A 4IJVA 3QWBA 3HB0A 4NS1A 2KMLA 4R1NA 2A86A 1V0JA 2JCYA 3IESA 1LC0A 1XZEA 4KLAA 821PA 3MJDA 4QQNA 4EX7A 3B53X 3USZA 1H3EA 4XH9B 1DO2A 2NUPA 4OXYA 3CH6A 4N0QA 4MMXB 4UPVA 2QUHA 1LW7A 2N47A 2AQ8A 3FXAA 1W52X 2VYVA 3NGLA 2QRZA 4NCBA 3FIJA 4IIJF 2EEZA 1RWPA 2ISQA 1SBQA 2YHBA 1YRHA 3JSAA 4P4TA 4ZDKA 1SC9A 5JSQA 1QYCA 1TYDE 3PPVA 2LPMA 4YUYA 4L8FA 3MBKA 2GASA 1MJGA 1NVWQ 1PRYA 4GEGA 1VG9B 1W4CA 4H1WA 1KEEA 2XGJA 4E6EA 1K75A 4K6OA 4A2PA 4IWXA 1K8XB 3GAMA 2Y1KA 1SZPA 3AL2A 2G25A 3IQIX 1LTKA 4RZUA 1XMPA 5L4SA 1CEXA 1DAPA 2VQSA 3HA5A 2X0JA 1UDAA 1EWRA 1N7JA 1M6VA 3ZHRA 3HCWA 3N3BC 2NTEA 2QR2A 1IRIA 3FFAA 2HMAA 1M7GA 2IEYA 4RSHA 1L5MA 4IIGA 4ZEXA 3I83A 3UGQA 2HF9A 2Q4DA 5JWOA 2CLOB 3MJTA 1RM4A 2J9GA 5KYKA 1NW6A 4PHCA 4I4NA 3LHKA 4L16A 4CLOB 3ZWKA 4B35A 3T1QA 2WP8J 3H6GA 2OCAA 4KMOA 1UIMA 4A82A 4GMHA 5EY5B 3PSHA 4N3BA 5HQ3A 1PJ8A 2TMDA 1ZO8A 3D6JA 1Q84A 1Y7TA 2A5YB 3LDFA 5J4HA 3MINA 3P5SA 5TS3A 4AWBA 4D0NA 1P2DA 4U8HA 5DNAA 2GEDA 4MS3A 5LZ9A 2OOKA 1KF0A 1KH2A 1O9BA 5I9LA 1OY1A 5A6SA 2PSJA 5REQB 5LFAA 4ZCRA 5DYIA 3QX8A 4ZO9A 1ESMA 4X1YB 2C96A 3OPMA 2CWWA 1XK7A 2OBNA 2NSYA 4AMGA 1UPBA 3Q87B 4TTRA 1XTUA 1JIJA 3INYA 3ZXSA 1VE5A 4J0FA 3HKDA 4Q9KA 1ULHA 1K0FA 1XRQA 5EMLA 5JJBA 1GM5A 1UC9A 1UADA 4ZODA 1YQQA 5IF9A 1QJ4A 5C52B 1VJCA 1NMQA 2BE9A 2WHPA 5MGNA 1SXJD 3FWZA 2FX2A 3SYTA 3H3XA 2I3GA 2ZSUA 1ZD2P 3UC9A 3NCHA 4FDMA 3EG9A 4KN9S 5ALLA 2VF2A 4AVYA 4DLLA 5HZHA 2CE2X 4NAUA 2J0QA 2IU4A 5HG0A 2NXEA 3Q41A 4L22A 2DAPA 4ETMA 3AEUA 4G67A 2IZ6A 1XVLA 4M1SA 4TXJA 1QPGA 3QSGA 1R66A 2Q2QA 1U1IA 3OJCA 1E1NA 2XQJA 4HSGA 3T5AA 1IXRC 2CBGA 3CE9A 4R2LA 4RPIA 5A5DA 3KJGA 4FBGA 4D45A 4OHRA 4LV8B 2HV9A 5DULA 4FMCF 5KYVA 4C08A 1NG9A 2IOFK 2AOWA 1O6GA 1U7XA 3NBMA 4MVJE 3TNJA 1A8UA 1I2ZA 3KFXA 4IDNA 5C37A 3GZJA 2ETXA 3EMBA 4INAA 1QF6A 4DXDA 1DQRA 3L0SA 4Z54A 2MSDB 1QV9A 2SICE 1JQ3A 4M0CA 1JZSA 3TBKA 3K9QO 4RQBA 1NN0A 3RFXA 3SIXA 5K3OA 3C98A 2V3CC 3MT0A 4U7TB 2IF0A 4R3NA 2V0NA 1X7HA 1M83A 2B9EA 5AK3A 2AOVA 1FTWA 1CY7A 2QHXA 5TIIA 2WJ6A 3PFKA 1KJIA 1NR1A 1JBEA 4RKYA 1DQNA 4D9KA 3MWEB 1FUEA 1LC3A 4KQ2A 1OYVA 4PU0A 3TK1A 4B45A 4GC5A 4QDTA 2VP3A 4I3HA 4KMSA 1ZJZA 2QLFA 2XADA 2Y2UA 1WBJB 4HKTA 1FP4A 4EHDA 4OMDA 3EIEA 2OHIA 2PX8A 4L02A 4IIJB 4KIWA 3VVMA 4YDSA 4HH0A 2OUKA 3C3AA 2AKEA 4TWIA 4WQMA 5TT0A 3FSRA 3TLYA 1PZNA 4OHYA 1Q14A 5AWFC 4PHFA 1M73E 3TR6A 2CLLB 5FL3A 2AD1A 1DIGA 1RC0A 4NCNA 2FN7A 2HEIA 2O48X 1KEUA 4MUKA 4R9UC 3Q8LA 1DBRA 3QWHA 4G26A 5K8TA 1P60A 2V6GA 3GWGA 2HA0A 1RAFA 2IYVA 1AUQA 2J6CA 2OLJA 2C2YA 2FEKA 4JLJA 4Q4AA 1UBSB 2G63A 3CF2A 3NPAA 1AUPA 3HXKA 4EA9A 3MSXA 4EECA 3H9BA 4J4HA 4M8NE 2VP5A 4UDYX 4YP9A 1I2DA 3IHTA 4RJKA 3JZDA 2DCUA 4M60A 5D7BA 4QC2A 5FTJA 1BMFA 1NVXQ 1OE0A 2RBKA 3EOBI 2ZYHA 2XLCA 3I01M 4FNOA 4KIJA 1KKMA 5NULA 4BO7A 4D98A 2XYHA 3N0RA 5SZHB 5CBPB 1FUUA 2QI9F 3PEUA 4KYTA 4WJKB 1ZOIA 3B1VA 4AZ0B 1AKRA 1XRSB 4QBFA 4KOEC 4YMLA 5EHZA 1GGNA 4AIIA 3R7WB 3MD0A 1PJTA 1UXIA 2DSNA 2VKQA 3B6JA 1HGXA 4ND6A 2WM8A 4LGCA 3I62A 3RK1A 3QPVA 4Q05A 1QH9A 2VUHB 1CJBA 2LUOA 3KC2A 2GYWA 4INOA 3TR0A 3WLHA 2C1EA 3ZCRA 4DT1A 1GN8A 2O7QA 1Q0QA 1AKYA 2QGNA 4JENA 1QHIA 4LNUA 5TR9A 3RQIA 2V74B 4HDQB 3TTUA 3HXPA 1OV6A 1NRJB 1TK2A 4JT9A 1ORIA 2FWRA 2HAEA 2AK2A 1XDGA 3E22A 4ZVLA 3U4MA 4ZVPA 3PFWO 4BLOA 3QLVA 1E1RA 5A3RA 3DF9A 3A6ZA 4G0NA 3EIOA 4QG7A 2DERA 2D59A 1OLUB 5AHKA 1PEDA 5M29A 2VN8A 3CZPA 4PGFA 1Z6YA 4D6YA 1FUKA 1GHTA 4ZAZA 1V48A 4JFRA 1SHZA 3ZI0A 3VO2A 5K6RA 5H02A 3B1WA 4C0KA 3LX4A 2ARKA 3D6FA 3V8MA 2AZTA 2WT4A 2ZRLA 1C0LA 5BORA 2D7DA 1Z45A 3BHJA 5JEEA 1VXRA 3GH3A 1H23A 3ID6C 3HRKA 2QD3A 5HCUA 4CM4A 3AH8A 1ADGA 4RCYA 5HDBB 1OKKA 3DE2X 1CY0A 2J3DA 1D4ZA 4ZD6A 1U81A 4ZGGA 2WIKA 1BC5A 3OX3A 3B2NA 3C6QA 2FMUA 2R6JA 4RTJA 1KOGA 1Z8FA 5K8IA 1ZX1A 3AHIA 1L8OA 1HV8A 3DEFA 3EGDB 3Q2OA 5IFLA 5BN3A 1RBZA 2OBXA 1WDLA 2FLKA 2J0UB 3JQ7B 3PWZA 4RD3A 3RTBA 3ZN2A 3DBLA 4FMCB 3DTVB 4MP8A 4S04A 1Z2OX 1EM6A 1E0SA 4MJXA 1T1RA 1HNNA 3TMYA 1N7HA 3M1LA 2XQFA 1QMGA 2GBLA 4QQFA 5G4KA 1TAUA 3WGJA 5CEJA 1TFUA 4LJRA 2DHQA 1Z5PA 1FU8A 5T67A 5D6OA 2KSQA 1T3GA 1E2GA 1PWXA 2PZAA 1YS6A 2V6IA 1H9AA 1K88A 1F9EA 4GLBA 3S0JA 1C3XA 3NOXA 4V24A 1K89A 4BQEA 1D6MA 1F8FA 2CXHA 2XWBF 4ZI3A 5F2NA 4LXYA 1A4UA 1J99A 2HSWA 4YP1A 3LY9A 2X8LA 1E6UA 3F6PA 5HZMA 4KRFA 4O63O 4EQ6B 1KZ6A 1XDSA 4G5HA 3RSGA 4NYMR 4B7XA 1WVIA 2QTCA 4HX5A 4U00A 5TC4A 2P79A 1RPJA 4BQIA 2YDXA 2E49A 2FUEA 3DV2A 4W7IA 3T7SA 3HN6A 4NESA 3TQSA 2YV1A 1OH8A 2MJLA 4GBGA 1R9MA 4Y2RA 1JWLA 3I92A 4MAMA 1K6JA 4FGWA 2X15A 4EAQA 2G07A 3HJTA 2FY8A 3P19A 4CFZA 1K5DA 1B8NA 1E8MA 1N3BA 1Z6QA 3IIEA 3IVAA 4LUCA 2I55A 1R6AA 4MW9A 2VTDA 2OCDA 3OZGA 2C3UA 3SHOA 1JDSA 5D3QA 2FN4A 1ZNXA 2GVNA 2QL5A 3PICA 1ZRMA 1Z26A 2MSLA 4DADA 1N4DA 2AEMA 2VT2A 4MXDA 2ZRBA 3W2FA 3FOWA 2BJVA 5IDYA 3K0BA 1WTAA 3LYLA 1GSIA 4UM8B 1JSXA 4W5WA 4U2FA 3OTHA 5G1NA 4OAPA 3THWA 2Z6VA 1BFUA 4QJ5A 1BJRE 1H8HA 4QBHA 4R84A 5HSGA 1NYQA 2MSWA 1WPXA 1E7SA 1NP3A 1XZBA 4KXUA 4Y2TA 1N2SA 3RVPA 3S6JA 3NDRA 4HS4A 2YBDA 3GRUA 4DSTA 4LRUA 5BSHA 4L73A 5AK4A 4YV7A 2C4NA 3TQIA 1LK7A 3V7FA 2ZYWX 3DFFA 5BSVA 3CSDA 4WZ6A 2V7PA 1SUIA 2XDYA 5EHGA 1D6SA 1V2GA 2H92A 5CMLA 4ER7A 4EG3A 1LDYA 4MCAA 2KE5A 3KZCA 3EB9A 4YRAA 1CQPA 5CH5A 2P5UA 2AT1A 3I3OA 2AN3A 2VT3A 4R1QA 1J8DA 1TW3A 3DNFA 5J63A 2XCTB 1U2GA 2IUTA 1M1NA 3HCNA 5F3RA 4JYAB 2HXYA 4PTZA 3F3KA 5DSZA 4WI1A 3SXUB 2I66A 2H85A 2W6PA 4ZEVA 4KR7A 1M9NA 1N3LA 5ILOA 2VDWA 1LPOA 1WNFA 1W34A 3KVRA 3CRMA 2HR1A 4V2UA 2DHDA 1OGIA 2YW2A 4YRCA 1KJ9A 2F8LA 4IS3A 3OZIA 4QU5A 3C6XA 1YVPA 2Q8PA 3UWSA 1JWBB 1X7YB 2YBEA 1OBCA 2ATIA 5BNTA 3Q88A 1IG0A 4C0BA 2HSEA 2OV4A 4RJJA 1KYTA 3ANMA 3GD7A 3N6RA 4ARBA 2AHOA 1BN7A 2IV2X 3NWEA 3U4QB 2OFWA 1OYYA 1MJNA 3KCQA 4PZDA 4OMUA 4P7JA 4B6OA 3JZIA 3BE8A 2RHTA 2YFKA 3G82C 3X1ZA 3SR3A 1LTQA 1R4MA 2V3VA 2XGGA 3HLTA 3R6WA 2RGRA 1PIWA 3U3ZA 1RJFA 5IDWA 2P2YA 3CJTA 1GUYA 2IEDA 4Y6OA 2O8CA 1XZHA 3PLRA 4LNHA 3K6JA 4GH5A 3T52A 4BRSA 1Z16A 1IH8A 2P4EA 2Y66A 3T5PA 4M88A 4E32A 3KFVA 4OK5A 1E61A 1U8TA 2LV8A 2PH1A 4ER0A 1LPAB 1SGWA 2I2FA 4XJSA 4ZQGA 3VGPA 4JYMA 5ICMA 3X1WA 3W6ZA 1DXQA 1PEAA 2X2OA 1DAMA 3GBVA 3LCJA 2DULA 1OI3A 4FOTA 5AR1A 4CMJA 4UBOA 3LS2A 1PBNA 1WV0A 2G6BA 4DIFA 5IANA 1E2KA 2NT3A 3SQMA 1KAGA 3FAZA 3O2NA 2IU3A 2QGZA 3HM9A 2BDEA 2OE2A 1ETUA 1NM5C 2ZDHA 4G5SA 2Y1GA 1TJPB 2GF9A 3F7TA 3D6VA 1NPDA 1RI3A 4LYJA 1T9BA 1CY1A 3T94A 5KC9A 5KKCA 2GNAA 1WMAA 2PGJA 3FNEA 3AVQA 4IIYA 3L6EA 3QY9A 1MQSA 2FQXA 4HRVA 2QP9X 2BY4A 1FMJA 1NJSA 3PG5A 3VO9A 3T35A 1A04A 3EOAI 3NKFA 4CL3A 1BA3A 1NUSA 4MVXA 2ZI5A 2HFJA 1NXXA 3MC1A 4WN9B 2LE0A 3CO5A 1H2BA 2QI9C 2WHXA 3KEMA 4ZQHA 2EZTA 2RAFA 5IVPA 3GFQA 2Q5FA 4NCXA 4HFMA 4HHEA 1PW5A 1JKFA 3E8MA 2C20A 4J16C 1CHDA 1IQPA 5E3JA 2O7SA 3GGJA 3LLSA 3EVGA 3H84A 1K6EA 4ZALA 1PG5A 3FHTA 3AUKA 1U5CA 4C5CA 3UKDA 3GP3A 5A03A 3SZRA 3NW9A 4LHSA 1BW9A 1HYGA 3WLLA 3GLVA 1IBMB 1ZIDA 2XE4A 2JGEA 1CNMA 1QZXA 1YZKA 1AC5A 3EVEA 5F51A 4C0WA 3GUVA 1QGUB 3H0KA 1E2QA 3ICPA 5DGCA 3ZHTA 3OPXA 3TOSA 5YASA 4BFCA 4GAEA 4J7AA 4LTDA 4B7UA 2OR3A 2FLVA 4B4KA 3SI7A 4F7WA 3NG1A 3RYIB 4JJKA 2C9CA 1R37A 1TKRA 2B37A 2QSUA 2Y1OA 3D0OA 4P54A 2GA9A 5FA5A 4MUMA 4N5HX 5KDLA 3SM3A 1SVMA 3RFCA 2QSZA 1WBDA 1B8VA 1D2CA 4NF2A 4TKVB 4BMOB 5IT0A 3IFSA 3C3PA 4HXEB 3KE8A 3NWOA 1OASA 1B00A 4QARA 1G8AA 4Y6RA 4WAUA 1SBIA 2WAMA 2GCEA 5FEMA 1TMOA 2ERYA 4JP1A 1Q7EA 2V9CA 1HRDA 1Y9ZA 3BGIA 1U7TA 1ZJ6A 4IAOA 2BUCA 5BN4A 3KEQA 1ZICA 3N05A 4PLZA 1OXXK 1BJKA 4U2CA 2XCLA 4LE2A 4WNAB 2YXDA 4Q7KA 3UM9A 5CDUA 2FQQA 4B79A 3AT1A 3VUEA 1UC5B 2W8BB 5F5LA 4FGZA 4KO1S 1VL1A 4B6QA 4TLBA 3GFTA 2FWJA 6LDHA 1I2CA 3D6AA 1AXGA 2XTAA 3K9LA 3ESYA 2HIGA 3JAWB 2BM8A 2QQ0A 1QRDA 3W8NA 1CP3A 4PXYA 3U60B 1OTXA 5A3QA 3K0FB 4QM7A 1FVXA 1VDMA 3R2JA 1DBSA 4A16A 4EG5A 1DPGA 1XNRB 1Z36A 2VKTA 1JJ7A 2FPGB 5CCXA 3LDAA 1Q6ZA 2IBMA 3PA6A 1TC2A 4YPOA 4F4IA 4AY6A 4FZJA 3O3CA 3W4KA 3V2IA 2VWHA 3G0CA 1NJ1A 4KAAA 3C8HA 3I9V1 2PX3A 4RLFA 3THRA 4C76A 2J3IA 4D0RA 4Z8YA 1YZUA 4O4JA 2P67A 1P5FA 2ZOSA 1CUFA 2PLRA 2PWZA 3CINA 3KPUA 1W75A 1XALA 3DZJA 3KBOA 4COOA 5T8KA 5IU6A 2BHTA 3OSUA 4RL6A 3V48A 4JLVA 2A9RA 3C0KA 3CMMA 5IPFA 3T9CA 4ARSA 3UMFA 5D51S 3K6SA 4IWNA 2FZCA 1ZSNA 3ZD8A 3KPWA 4GF5A 1MQ8B 4TT3D 3L9XA 4ZK6A 1GADO 1PFKA 2O05A 2CLMB 1H8EA 1JFLA 1V16A 3FB4A 2UZIR 3CX7A 5LDHA 5JARA 3WA7A 3IOCA 1OLSA 2CY0A 4LSMA 4Y9RA 1UT6A 4JJ8A 4R2IA 4XPIA 1WSDA 2ZI7A 2CL5A 1NVVQ 3G0BA 1K8YB 3AEKB 4AT1A 4BBAA 3BXFA 4AF8A 4ZV7A 2PMEA 5A04A 3C3YA 3FVVA 1GTL1 4XLTA 2QX4A 3E53A 3QWFA 4LCEA 4KE7A 2DBQA 1XTIA 1NJ6A 4N39A 3E35A 3GJ4A 3VDNB 1OR8A 1I5RA 1MTZA 1QIEA 3T3MB 1J42A 3UH0A 1T5OA 2Q9CA 1XQ1A 4Z7QB 5FAKA 3RD5A 3TUJC 1U1EA 4CEJA 5LBTA 4UC0A 3K8OE 3WKEA 3NV9A 1ZGBA 3QUTA 2FSFA 1IM8A 2OD7A 5H9VA 3G0HA 4JXZA 2NVWA 4IOLA 4LJAA 1N1GA 4XVRA 3ZUGA 3PGMA 4K86A 4PQYA 1A1VA 4E2WA 13PKA 3ZDCA 5THXA 4J7CA 3V4LA 3ZVMA 2IS1A 2NXCA 1NVBA 2QXTA 4WDRA 2H31A 3TB4A 1M7HA 1J49A 1SXGA 3JQRA 5CT9A 1DADA 4L0QA 1KK0A 1Y7IA 1UFQA 3I9OA 5FTKA 4FGKA 1XHEA 3ELYA 3AYXB 2AMJA 1VPDA 2F48A 4L4ZA 4NY1A 4N76A 5BOSA 3NHPA 3AERA 2GD6A 1N5LA 2NO6A 1J20A 1M66A 2VHVA 1NN1A 3B1KA 4IX1A 4LJYA 3ROGA 5B6PA 2DG2A 3D3KA 2PSSA 1ZSYA 1GYRA 3K0AB 3NEPX 2CFCA 2BFFB 1OC4A 2H48A 1ZR2A 2O3JA 4QEDA 2DBRA 1LCIA 2FP4B 4UHJA 1RQGA 3ABQB 4UFOA 4CUZA 1W96A 4V0KA 5D7NA 1U8CB 1MPXA 2D5LA 4NC9A 3NC1C 2A6PA 2OXRA 2VCEA 5LQDA 3U56A 3OZRA 4IEIA 3B5EA 2GN8A 4WCFB 2QQFA 3D1JA 4NMMA 1WG8A 3S29A 2ZG6A 1WUTA 4B33A 3TJRA 3DPSA 3KVVA 3LIIA 1QP0A 4B3FX 2Y8EA 3LE8A 3DT8A 3P2OA 3HXTA 4GU5A 4FC6A 2O8BA 3GEHA 2OO5A 4JI2B 3FKQA 2A0KA 2NZWA 1YK1A 4M2LA 4O5AA 5M04A 3AM3A 3UAYA 3LBAA 3MJ4A 4HWTA 1JR3D 3PR2B 5CB0A 3HRHA 3PC4A 3DZHA 1WW3A 1Z18A 4FW8A 4ZI7A 1N6PA 4B3JA 1L7MA 3CB2A 2O0LA 3GAFA 2FTKE 3N8DA 4F6LA 5B55A 3P45A 1WMFA 4X71A 4KHZA 3RODA 5J23A 5KO2A 4G0VA 5DI9A 5JXHA 1PYDA 4MIKA 1CFZA 1WHTB 4U6NA 3X44A 1CX9B 1XB2A 1IIBA 4YY3B 4DEXA 3DMDA 3LH5A 1ZONA 4CF6A 4F11A 1ZKMA 3GRKA 3QKRA 1OREA 2EBWA 2JARA 4QWMA 3MMZA 3SS8A 3CXUA 3AVVA 1CRWG 1A9QA 1B6GA 4WLOA 1UBRS 2NU9A 2VHCA 1RRFA 1IUPA 1EK1A 5IT9A 1GL3A 1GZVA 1TU0A 3PYMA 3RK0A 2P0EA 2I4LA 1U2ZA 2VF5X 3EPRA 2B0CA 2XECA 3EFBA 2F1OA 3P2IA 1UUFA 5CP8A 1FFGA 2W2TA 3SG0A 1CYEA 4LBZA 2EGUA 2GHRA 4C7VA 1NXPA 1G5RA 5H59A 4EYKA 1I7QB 2RHWA 3PD1A 2G40A 1DJLA 1DC3A 2R68A 4K6MA 1DAIA 1E3JA 4AKGA 3ZHCA 3OQOA 3HCEA 1Y6RA 3P9KA 4RDXA 3DFIA 2YQ4A 3I2JA 2Q07A 1SIBE 1HPLA 1P44A 2A5JA 3C6MA 3I34X 2ZT8A 3KOYA 4X7BA 2CVQA 1CR4A 1S3SA 3KVNA 4RS3A 1UBNA 4S1NA 3DP9A 1A4IA 1G55A 1BVUA 3QLTA 1J7JA 4PZCA 1IYZA 1SURA 3QG1A 3H1TA 3K1YA 2D1SA 3R0XA 5BWNA 3DMNA 3OQBA 5GWXA 2WJIA 4LKOA 1XU7A 2ZQZA 3W4JA 2GM3A 1MJHA 3I05A 2CGEA 1SD1A 3JSXA 4JVSB 2FFHA 2I8CA 2WF7A 1L8XA 5KIAA 1Q7TA 3AF5A 4PX5A 3TZHA 4DA7A 3BH6A 1QDEA 4TUYA 3IEKA 1NQOA 2W2KA 3DO6A 5EKXA 3R7LA 4KXWA 4CTJA 4E30A 3JY6A 2XODA 3DONA 3EZGA 5CG2A 1ZH2A 4UEWA 5I5EA 5IM5A 3AVWA 1G4HA 2HI0A 2J1LA 5IVIA 3IT1A 3IVGA 3DB1A 1E1LA 4N47A 1QRSA 2BMFA 1LBIA 1NN5A 3ASVA 4CIVA 3B1FA 2IYXA 3ZW9A 3ICEA 1J1ZA 2WAXA 4OUDB 5KX5F 5T4FA 1E3DA 4UUAA 1TVCA 3B20A 4ZXPA 4Q9IA 4BKUA 5TVKA 1COWA 4FONA 1T3SA 4Z0NA 4GXQA 3KWFA 1JG6A 4A8JA 1W2WB 3E8XA 3FAKA 1PNTA 4BNNA 1WXWA 4UNNA 1PX2A 1MGOA 3Q3GE 4K40A 3WFIA 4F91B 3IEIA 4FYJA 1Q3KA 3GFSA 3PQDA 3CRQA 5LDGA 1K1EA 4QBKA 1N57A 2XUGA 3O94A 1RQ7A 4H3KB 4X5OA 5EUMA 1V95A 5A5EA 3O6VA 3U16A 4FM9A 4JIGA 3L8FA 2K7ZA 2DPXA 4NVRA 4LZAA 4IVQA 4LSZA 3I6ZA 4BNFA 1S8NA 1GWNA 3QNMA 4F5YA 4J2OA 2V5VA 1SXIA 2WHRA 3PQ8A 3M4NA 2C4UA 2B69A 3VH4A 4Y2PA 4CMKA 3EVBA 3PU6A 1K2VN 1D8AA 3A10A 4G0WA 1CQWA 1DRWA 4GYKA 3GRAA 4PX9A 4LMRA 4MQFA 4C7BA 1PZXA 3ILVA 5HRUA 1F3OA 2RI6A 1MOPA 4HT3B 1QIDA 1SBCA 1YIAA 2HMWA 1MEJA 5LVAA 2QUBA 3AR6A 5JY6A 1XMQB 5I7WA 3L06A 1E2HA 2GTHA 2IUSA 2PZKA 3BWYA 3DC2A 3R0IA 9MHTA 2Z2ZA 1N6OA 3DVRX 1M72A 4LZLA 1N2GA 1NP6A 1UDXA 4QNMA 1U6JA 3AWIA 3LU1A 3R9IA 4B85A 5ECWA 3Q8WA 4QIHA 1A9OA 3KETA 3LOQA 2VJMA 2E4AA 3NAMA 1KJYA 2PD4A 4IZIA 2AC2A 2WW8A 2P5TB 2VS1A 5KNBD 3DAPA 4J7XA 3NORA 3L4KA 3TRHA 1J00A 2HNAA 1UC4B 2RGGA 1J9GA 2X2EA 3UTDA 3ZJUA 4NYIQ 3VSAA 1MH1A 2FN3A 2P3LA 3EFEA 4O2BF 3V8EA 4OOFA 1EZZA 5G1OA 4EYQA 4H17A 5JLJA 4AY2A 2JIMA 4L5IA 1IWOA 1JQEA 3G8CA 5DPMA 3NTVA 1Z07A 4HDRA 3F8SA 1MC4A 4YRTA 2IHVA 4UE3S 4W9NA 2CMGA 2AFHB 1THTA 2O6LA 4DQ0A 4U7DA 4HFNA 1FDRA 1W44A 3JQPA 4L5YA 1WXQA 3U7GA 3Q8KA 2WG1A 3OQIB 2FLWA 521PA 2WPNA 3WL7A 4LY0A 1JT2A 2P77A 1RC8A 5CVCA 1SHJA 3M9WA 3F1LA 3N2ZB 3CVOA 3V1UA 4YCAA 4BFUA 5IM4F 3H5RA 2RARA 3HV0A 4JJAA 1IN8A 1YASA 4QDUA 4LHZA 3OQJA 1EHIA 1YU6A 2GJKA 2MSKA 2HJGA 3Q3JB 4EARA 3W7BA 1QK3A 2HWXA 4Y6GB 4AJ9A 3FDZA 1OZFA 4HH3C 1AB5A 4DWVA 4EL5A 3C97A 5JW6A 3UT5B 2V7QD 3NTQA 4R6XA 3BXOA 4GLFA 3A4MA 5JCJA 5EOVA 2CNNA 4XRRA 3EG5A 1EGVB 2IYWA 5HF9A 2C5FA 1H4SA 4DA0A 3M6UA 2Q9BA 3DBRB 3FFWA 4MA5A 2NSJA 2WVJA 3JD0A 4TQAA 4RKFA 5FI3A 4D97A 2X0KA 3JAMA 1U80A 3H99A 4X6YA 5K6AC 1HE3A 5KTYA 1Y7PA 5DISB 4LIPD 5KX5B 2F8MA 3ZD7A 1NXWA 2BMVA 5DDIP 3EC2A 2PKXA 2I7VA 3TD6A 3UMBA 3ZHVA 5FQNA 4E15A 1QGDA 4ARZB 2QSYA 2JGNA 1D2EA 1VBFA 3LOPA 1THZA 4HAYA 4Q7LA 3QU2A 1J21A 4C0LA 3NIWA 3ZY4A 2WUFA 3S2GA 2EU8A 1GKUB 2W00A 2VXCA 4BJHB 3CNHA 1KRHA 1PW7A 4DEVA 4C7OA 1C7IA 2O50A 5DM2A 3ADCA 1WHSB 5LDDC 4EI7A 1F3LA 1W581 2EX4A 3ZDYB 2PJUA 2QKYA 4ARUA 1R64A 3TQHA 4IMPA 4PONA 4ZVKA 3H04A 2JNWA 4CQMD 1XXHA 4QPZA 3BC1A 3FIUA 5G3YA 5BNFA 3CVXA 1VHQA 1XRMA 3I1FA 3KT6A 5DNEA 4RHUA 1R10A 1JIIA 3KPYA 4RADA 2G5GX 2VA9A 4HXFB 2JGJA 4KO2S 5ED4A 4MAFA 2OY0A 1DQSA 4GX2A 2OBMA 2AV6A 5IABA 1GA6A 5B58C 1SVOA 4AKHA 4BNGA 4LCJA 2VYQA 1T3TA 3PLAE 5AVZA 1VG1A 2J3KA 1TYZA 3NIGB 1A7UA 2I2AA 5T5QA 1B0UA 3ZDZB 2VHWA 5C80A 5JR3A 2BEWB 2IXGA 1KBZA 4CNBA 4WLNA 3EXHA 2EYQA 1NQVA 4ZOLA 4CW7A 1W5BA 3A8TA 5CT8A 1G8YA 3WGOA 2OXFA 3W8EA 4ZT6A 2IWHA 3H9GA 1N8NA 4KXXA 3VPCA 3QLEA 3QVKA 1WCWA 3A6HA 4OJNA 4YFVA 2W22A 4A03A 5BPFA 1DC6A 4U2KA 5G0VA 2AWNA 5JZBA 2FG6C 4ZRNA 4C9BA 4EWLA 2CEKA 3KLPX 4O2BB 4V3CA 5DWDA 5ADWA 3BWCA 4NU0A 4RM3A 4ZYYA 3TG8A 5KDOA 1NLYA 4CODB 3MTBA 4BGUA 2B7LA 1GLNA 2G8LA 2X2FA 3NONA 3OAAA 5AXAA 2LZ0A 3DQPA 4UCFA 1PJ3A 3K2BA 5F4BA 1AKWA 5JOQA 3MCZA 2C97A 2IEAA 3N0XA 1JW9B 4Q34A 4ER5A 4FB5A 3MFYA 1YE3A