1KHTA

Adenylate kinase from methanococcus voltae
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
NKVVVVTGVPGVGSTTSSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEENLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTGDEILMRRMSDETRVRDLDTASTIEQHQFMNRCAAMSYGVLTGATVKIVQNRNGLLDQAVEELTNVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of thermophilic and mesophilic adenylate kinases from the genus Methanococcus
pubmed doi rcsb
source organism Methanococcus voltae
molecule tags Signaling protein, transferase
molecule keywords adenylate kinase
total genus 72
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1khtA00
4TMWA 2Z6VA 4JLBA 2WOOA 4QHYA 4ZIRA 3KKMA 1SHZA 4A0FA 4C3ZA 4CEJA 2JLRA 1OYYA 3CRQA 2NGRA 2OV2A 2ZSBA 2P65A 1OKKA 3JVUA 3IUYA 4LY6A 3T61A 5JRZA 4B2PA 1T3HA 2QGNA 3LX5A 3MWYW 4GSYA 1EWQA 3NVAA 4NMMA 4KVGA 4Q9HA 2C03A 1A5TA 5AJYA 3SJCA 4TYPA 5FTJA 4XTRA 1YKSA 4A6PA 1KO4A 2O0HA 3K9LA 1OH5A 2RB4A 2GNOA 2YOHA 3QXJA 3QVUA 1A2BA 1DELA 2N46A 4TT3D 3BB3A 2CHVA 2O5VA 2Q9AA 1E2FA 1PLKA 2F1IA 4B32A 1OH8A 4QOSA 2HXYA 1T91A 4YDHB 2F1RA 2AK2A 2PL3A 2XB4A 1BMFD 5J4HA 1VKJA 4JZKA 1BIFA 1R8SA 4P4SA 1W4BA 1UADA 4ESVA 3ZVRA 4LV5B 1VYVA 4BFYA 2QN6A 4C7OB 1YRAA 1KNQA 2R2AA 4JVSB 2FPMA 3C5HA 3PG5A 2VQSA 2WSMA 2C77A 4JYBA 3SR0A 1VECA 4A82A 2CL6X 1TF2A 1E0JA 1ESNA 3B78A 4NL4H 4NP6A 2ZRHA 1F5NA 1D5CA 1NY5A 3GJ4A 3AM1A 4A0HA 4URYR 3KTAB 1J8MF 1NMXA 2PT5A 4CW7A 1H8HD 1OXXK 3HPQA 1TAGA 1GSIA 1J70A 1ZNZA 1E9BA 4RFVA 5HPYB 4HEJA 2OBNA 4D4KA 3IIJA 3KQKA 4MDEA 5CK4A 4JMPA 1PUIA 4XD7A 1Q20A 3CF6R 2Z5FA 4IVRA 2FF7A 2IUTA 1MO5A 1N5LA 1NJGA 1SVKA 4CT4B 4EPVA 4P33A 3AVVA 2LCFA 3AVPA 1R2QA 5SZJA 5L8VA 3IO5A 2BWJA 4LHYA 1FUKA 2RCNA 2QE7D 4Z1MD 4BASA 1YJ5A 5DI9A 2Q0HA 1VCOA 2JLZA 1Z6TA 1G4UR 2CMKA 3PR1A 3GJ6A 1G7TA 2H16A 2W00A 5H70A 4D81A 4TYQA 1SVOA 2YINC 4DIEA 2JJ1D 2ZRMA 4PO1A 1SQ5A 5KU1A 3CR8A 3T5GA 4PHTA 1S1MA 2DB3A 5FTNA 3SQWA 3U4QA 2W83A 1GZSA 1ZU4A 4UKDA 1Q3TA 3TUJC 4H9GA 4HZUB 4NCHA 4EFMA 2XEXA 2BBTA 1R6BX 2CCGA 1IXRC 1MO6A 2REOA 1ZNYA 3KXIA 5C4GB 1IJEA 2GK7A 2BM1A 2JJ8A 1RRGA 2GESA 3NBYC 1UFQA 5AJVB 5BYKA 1AQYA 2Q6TA 4B76A 3RRNA 2O8DB 1LF0A 2FGJA 1WQ1R 3NBXX 4JLJA 5FUWA 1UKEA 1XMIA 4IVPA 2QMUA 4PC1A 3IBGA 5D3MB 4CDGA 2BIFA 2ZRBA 1EFRA 1VIAA 1MO3A 2GXAA 1NVUQ 1N6NA 4JLNA 2IEZA 4FINA 4NONA 2C9YA 2F43B 2IUUA 2QTHA 2Q3HA 3W5JA 2QA5A 2NO0A 3RDPA 2JJ2A 3Q5EA 1G8YA 2ODWA 3QQ5A 4FD2A 2BCGY 1P2SA 4OI1A 4LJ8A 3EPKA 2R6AA 3WNCA 3NXSA 4D0GA 5BXQC 1F6BA 2CHGA 5CIWA 1OB2A 2W2TA 3TW4A 4Z8XA 2OBMA 2ZE7A 2ZIAA 1JJVA 3CIOA 4US1R 4V0ME 4YDSA 3F3YA 1OFUX 5AUOB 4BZPA 4C2UA 2C5LA 5P21A 1N6HA 2JCSA 2EVWX 1HT1E 2F6RA 1GL9B 4AC9A 3SS8A 3KQNA 4TTRA 1XMSA 4HLUA 2GXUA 2ORVA 1ZUHA 4URWR 1IY2A 4YMUA 1RRFA 5EZ5A 4AYWA 4EJSC 3U44A 3BWDD 3NWJA 1KSHA 4M21A 4Z51A 4Q4JA 2ERXA 3B9PA 5F2EA 3AF1A 3ICEA 2H8KA 5BN5A 3SBDA 3ZVMA 5E7MA 1Z29A 1G5RA 1KI6B 2WHXA 2YOFA 3OE7D 4PZLA 1N6KA 1YR8A 3VHLB 3KKOA 2J59A 2VO1A 2EFDB 1E99A 4JBYA 1ZRHA 4D80A 3QJYA 5EP3A 4URXR 1A4RA 1DBSA 1J90A 3SOPA 5JHHB 2J0SA 5KNCA 3NBZC 1XU4A 2RMKA 1Z0IA 1S96A 1CULC 3UATA 2CLCX 4Q4AB 2CNWA 3OAAD 2I3BA 2WV9A 4D4MA 3U7GA 4TZ0A 2A2ZA 3KXKA 5AUNB 1R0XA 4MGZR 1TF5A 3KTAA 3REGA 3B8HA 4Q02A 5K8LA 2JDIA 2RGCA 2F43A 1F48A 5FTKA 3OFNA 3WXMA 4MKFA 5LBIA 421PA 2KI5A 4UNSA 2BBWA 1Q44A 5D3QA 3W6PA 2AXPA 3EA5A 3GLGB 2OE2A 1JQLB 2D3WA 4NYIR 4NBSA 5JJKA 2R6CA 3ZQJA 1M7GA 5G3YA 3THXB 2IYSA 3A1UA 2FPLA 3LQQA 1Y3AA 1AZSC 1QHIA 4JJZA 4OYHA 4PO8A 4F91B 3C41J 2PLFA 2X2FA 4EPYA 4ZIRB 3ZH9B 3T15A 5HCNA 1SVSA 2UVQA 3O8BA 4LOAA 2B6HA 4A2WA 1DAKA 3EZ6A 1KDPA 5FR2A 2OCBA 4US2R 4DIDA 1MR3F 1NL3A 5GJVC 1HEIA 3PFIA 1DAGA 3KX2A 4UNQA 3BIFA 5F3WB 3A6PC 3M6AA 1C1YA 1AS2A 1VG9B 4UJ3A 3U44B 2RGNC 2VRWA 3GD7A 3A4LA 4ESHA 3LRPA 4DSTA 4BLTA 2E87A 1XX6A 2OFWA 3QXCA 3QSYA 1GL6A 3KFVA 4M1WA 3EG5A 3PEWA 1GUAA 3U6KA 1K5DA 4DCTA 3AF3A 2GJKA 3TRFA 4G5RA 3W9YA 3CO5A 4GT1A 2CHQA 2IYXA 2R9VA 2NTYC 3THYB 5BYJA 4F4CA 4AYXA 3CW2A 4KJZA 2EFGA 4QXAA 1U8ZA 1KKMA 2XXAB 4P0TA 1LF5A 3E2IA 4GNKA 3RAPR 1ZD9A 3QXHA 4TT3A 1WRBA 4NYJQ 5AK0A 1DO0A 2H92A 5JEDA 4ASUA 1YZQA 1GL7A 3VKWA 2ZI7A 2UZ3A 3MWLA 2OBLA 1S3SA 2ZETA 3THOA 4CEJB 2D7CA 5JWRA 3SFZA 3BH7A 5KNBA 2J7KA 3B1WA 2EFCB 3K0CA 4A9AA 2J5XA 5TVKA 2X8AA 4YMWA 4MYTA 3C8UA 5HR5A 4FMDF 4KITB 1U94A 1W44A 1E6CA 3VKGA 5AJXA 3NHAA 1R5BA 4FWTA 5FH9A 5L3SA 4Q9JA 1OXTA 2A7QA 2B7BA 1E79D 2Z43A 2ZJAA 2X77A 3CPHA 4P31A 3V00A 1G6HA 1KNXA 1NLZA 1TPZA 5JLJA 4S35A 2JJ2D 5TV2A 4CF7A 5J47A 4MRPA 3WYGA 4F4JA 4A2QA 3VX3A 5ANRB 3QNUA 4AKEA 4HLQB 2ZJ8A 3MUFA 3FMFA 4IDHA 1BKDR 1T3SA 4ERNA 2QM7A 4KXFB 4PHGA 2XZPA 2UKDA 4G01B 4PPQA 4BRWA 4AWXA 2XTMA 4LRWA 4HB2A 4NYIQ 3CH5A 2O8EB 3TMKA 1SKQA 1ZM9A 4HB3A 5KSYA 4LJ9A 4M9ZA 1JAIA 1N0UA 1IY1A 4LYAA 1MKYA 3D3QA 1NKTA 2ZE6A 3D31A 2IK8A 4RD6A 5JWHA 3ZIAD 5FOWA 4DLVA 2XNDA 1A1VA 1JR3E 4PZYA 4V0MA 1N0WA 1P3JA 1EESA 2ZAMA 1EFCA 4MRNA 1FQKA 1W48A 3PITA 5KSPA 5IDVA 3WYAA 1U9IC 5JSZB 3BBPA 3T5DA 3GLIA 2IBMA 1BO6A 4Q1DA 3OE7A 3TLXA 1XFAA 3SJAA 1G7RA 4KFSA 1R0ZA 2ZTSA 4TYWA 2VYFA 4Q01A 5JSZA 3QE0A 3B6EA 1IN5A 3KJIA 4PSAA 2XOKA 1GFIA 2WWYA 5J4YA 1E9CA 5KYKA 3FOZA 2Q9CA 1NN5A 2PZFA 1KY2A 5AJZA 1GAJA 1W5SA 4ZDWA 3KZ1E 2CL7X 3FGNA 3LA6A 3AVTA 1VPLA 2QT1A 1WDTA 4FN5A 1HA3A 4LJ4A 3VR5A 3A4MA 2IS4A 3FFBA 1RYHA 2VTKA 3EAQA 4TL7A 2VSOA 1UDXA 3PUZA 2B8WA 1MABB 1L7VC 4YMTA 2LKDA 1DS6A 1UKZA 2DHRA 1CJVC 1EFUA 3DPUA 1KAOA 4HATA 4KHZA 3EZ9A 2L0XA 4KU4A 1PLLA 1RE0A 1XBTA 3AKEA 1XD8A 3ADCA 2GAOA 1XD2A 2XNDD 4NPHA 1TQ4A 1OSNA 3B5JA 3PVSA 4LV6A 1QHSA 4IOLA 1ESMA 3HU3A 1XXHA 3TIFA 3QBVA 1Z28A 2R8RA 1WBDA 3IKJA 1Z47A 4XIGS 2OUKA 2V1UA 1R0YA 3BH0A 3BD9A 2XITA 3FHOA 4GP7A 2FA9A 1W5TA 4DBLC 3AVQA 5TARA 3WP1B 5HZHA 1JXMA 4POAA 2ZR7A 3U7EB 3UXMA 2CCKA 1I2MA 3JZMA 2JGNA 1T5IA 5KOYA 1ZNXA 3OIWA 2KBFA 2OXCA 4EQ6B 5IK2D 1U8YA 4FCTA 3RS5A 5G41A 1EFRD 2IHYA 3O8CA 4PZZA 5J40A 4B35A 3TE6A 3U3MA 3U6BA 2FSIA 3VMFA 1X8KA 3QY0A 2ZYWX 4HLCA 1CRQA 4QHSA 4DCVA 3THXA 1P75A 1M1YE 4BLSA 1KI2A 1XWIA 4DDUA 2ZM5A 4ZCMA 3LBNA 1L4UA 1SVLA 2YYZA 4Q00A 1K8RA 2BKEA 1XEFA 5FBVB 2AKAB 2VHTA 1KK0A 2XTNA 3T12A 1HH4A 1KI8A 1EXMA 3Q72A 2JLXA 2RGGA 3FYHA 3BE4A 3TR5A 3CB4A 1KO5A 1OF1A 1ZM3A 4DEXA 1U81A 2WJHA 3MWKA 1W4AA 1FTNA 1NN3A 2ZITA 4IVQA 2XJ4A 4TLAA 2TMKA 4O2LA 2VA8A 1UBEA 5SZHB 4PPNA 2QTFA 2OEPA 4L16A 4LZZA 3SHWA 1ZMXA 4EKDA 4TL8A 4MGYR 4KODA 3FHTA 5EE3A 2NPFA 2R62A 2FG5A 3THWB 1ZCBA 4AK9A 5TB5A 1YZKA 1XMVA 4HAXA 5CDFE 4BFTA 2QENA 3OZXA 3BB4A 1XEXB 3AUYA 1P2TA 1M8PA 1XZQA 3A58B 4R98A 3SC3A 1KO8A 3I8SA 4A92A 2A9KA 3A8TA 4Q19A 1PZNA 3R7WB 3U7FB 2V7QA 1KY3A 1TUIA 2YKGA 2Z4SA 3RNLA 3TVTA 1IM2A 4XVRA 3BFVA 3R8FA 4D4LA 3X1WA 1XCMA 1NLYA 4M9SA 4PQYA 4FCWA 2IUSA 4M1SA 1F2TB 1W4RA 1HE1C 2VP0A 4EAQA 3IHLA 1OIWA 1Q1ZA 2OG2A 4PSKA 3SJZA 5K8UA 1Q3HA 4U7DA 2JJ1A 1NNEA 4DB2A 2FE4A 3W5IA 2ZE5A 5G3ZA 1KAGA 1NVVQ 1NVVR 1YR6A 2AD1A 1Q0UA 2VF7A 2V55B 4LJ6A 4D4JA 2OFOA 5JS7A 4HB0A 1E69A 4KYIB 2DFTA 1FX0B 3WMGA 1N6OA 1XTQA 2MSDB 1OFIA 3A1VA 2DFKB 2W2XA 3AH8A 2PX0A 1Z0FA 1UBGA 1S4QA 1W1WA 1E9DA 4QL3A 4QJ4A 2F55A 3P20A 1FQJA 1AGRA 2QAGC 1G16A 3R9IA 5JWOA 2FH5B 2OAQ1 4TMKA 1E2KA 1MT0A 2DWQA 1ZAKA 2QSYA 3OFND 4RY2A 1MABA 2W0SA 1GKUB 2OCAA 4O3MA 4A0RA 1GITA 4U00A 2QROA 5B64A 2AK3A 1KGDA 4JLKA 1TL7C 2FN4A 2E1RA 3OEHD 2O8EA 2VP2A 4D82A 5J4VA 2CVHA 2WKQA 4BZXA 4URUR 4MH0R 3OEEA 3MSXA 1XEXA 5A0FA 4F7WA 5E7IA 4UNNA 4X8LA 1J7KA 3MWJA 5SZKB 4DDVA 2ZQ5A 2ZRDA 3GJ7A 4L15A 2P6NA 2VF8A 3BJIC 4FI3C 3CR7A 5IF9A 5GJBA 5LD2C 3OEHA 1CJKC 5LDDC 1EWRA 2WKRA 2G3YA 3FMIA 2VSXA 2OSBA 1G3QA 3CM0A 3IHWA 4MRSA 1T4GA 4JT4A 2PT7A 4IOMA 3EC1A 3SYLA 4EQ6A 4DB4A 4RZ2A 3EPHA 2CEAA 2F1JA 2ZI5A 3A4NA 2F9LA 1G3IA 1R8QA 2KBEA 3LBHA 4MKHA 2C98A 1NKSA 3K0EA 3I73A 3TVDA 4YLGA 4LHXA 1ZYUA 2WJJA 5DSZA 3UKDA 3ONWA 2J87A 2O8CB 1TU3A 1QZXA 1E0SA 4OQMA 3VAAA 3AKYA 1KJZA 1YE8A 1KI9A 1KSGA 2PX3A 2DY1A 1P6XA 3AUXA 4YMSA 1V43A 1S0UA 2HCBA 2XTZA 3SYKA 1E0AA 2YWEA 2FWRA 1Z2CA 3HR8A 4IDNA 1DADA 4RJLA 2XOKD 2K5UA 1GNQA 3K0FA 1KHTA 1RFLA 2ZRKA 4C9BA 3CBQA 1NIJA 1P9NA 5EE1A 3KQHA 4TYYA 5JS8A 1U2RA 3WHLA 2BC9A 4DC9A 4YC7A 4B71A 3O47A 1OPXA 2GCNA 2ZVPX 2I1QA 4JSTA 1US8A 3ZLJA 1XRJA 2WKPA 4Q1AA 5JECA 2CJWB 3IIMA 1M34E 5F9FA 4KAXA 3R7WA 2GXQA 1Z22A 2YV5A 1N6RA 3CRW1 521PA 1N3BA 1TEVA 2IW3A 1CJUC 4S2EA 2KJQA 3JVVA 4R2HA 2BMFA 1W2HA 4MKIA 3FVQA 2VHCA 3R9WA 1CEEA 2QPTA 2YJTD 5DHAA 4ACBA 2PZEA 3S1AB 4M9QA 3UMRA 3C15C 1E79A 1ZIOA 4OQLA 1PVOA 4AI6A 5DN6A 2O8BB 2NOAA 4AKGA 3GLIE 2R6DA 4GI7A 4ITRC 3C14C 4N1AA 3A1TA 5H68A 3NIBA 4BEBA 4PFSA 1NI3A 3MJHA 3MRSA 2Y8EA 4PQFA 2VPPA 3RS2A 1XMJA 2HT6A 3KQLA 4HYYA 5KPJA 2P67A 4L5BA 4NKRA 4JBWA 1NBMA 3UMFA 4BFVA 5JI3E 1JR6A 2AKYA 2YWFA 3EIHA 5C46F 1E0KA 3T06B 4AKIA 3FKQA 2WJIA 2BDTA 1YU9A 1XJCA 1DPFA 4UNPA 3W90A 1OFHA 1P60A 2ZRGA 4DEYA 1LNZA 1NG9A 4A36A 1Q12A 2B92A 3LVQE 2PJRA 3WRXC 3QENA 3GP8A 4IOJA 2BOVA 4C4PA 1W36B 1KKLA 2PEZA 2FEOA 1NBMD 4RCZA 4DSUA 3BGWA 1DAIA 2NO6A 4X8HA 2AX4A 3L43A 2HLDA 5EE0A 3C5CA 4IFEA 3AGQA 2ZUDA 4HDOB 3BC1A 3EA0A 4PAOA 3BB1A 3CX6A 3SYNA 4DXAA 2Z4RA 2ZJ5A 4FXPA 2GJ8A 2WVJA 4QRHA 1DE0A 4ZI3A 1HQCA 2R6GA 5KSZA 2FV8A 5C1BA 2GDJA 2J41A 3Q85A 4KLZA 1NMZA 4JKIA 3ZQ6A 5DN6D 5K8TA 3GEHA 3J81k 2GCPA 821PA 4JVMA 3QG5A 4YMVA 4Q4LA 3X1ZA 4WZAE 2ORWA 4KFRA 1IN8A 1W36C 1Q1QA 3K0AA 1CF4A 5D3MA 5FR1A 4QGFA 3N2IA 3KB2A 4P4SB 1XTKA 4WOPA 1U8AA 2F1HA 3PUWA 3WHKA 4WAUA 3KKPA 4RD0A 2QG6A 2JLYA 4J0QA 2YC2C 5JFGA 1QVAA 3RSLA 2QZ4A 5DO9A 3AVYA 4DT1B 5EE5B 2A3RA 1OFTA 3DDCA 4CVNA 5CLQA 1KDTA 3VR4A 4B34A 2BCJQ 3QPVA 3NDPA 1ANKA 3T1VA 1W49A 2BEJA 2W6JD 4PPFA 5IK2A 4ARZB 1WB9A 4Q1BA 3IBYA 2GK6A 4DLZA 3ZD7A 2VHUA 4BFZA 2OFXA 3GJ0A 1XCGB 1Z06A 3A37A 2ZRAA 3L0SA 1E4VA 1L8QA 2R6FA 1CP2A 3ZS9A 1P7CA 3L2OB 3HU1A 5AJWA 3P26A 1AKEA 4Q1EA 4C0KA 2WWHA 1GNPA 4DUGA 1FMLA 5TMPA 2HV8A 4TMZA 2D62A 1XTIA 5CITA 2Z0MA 2NZJA 4TLDA 2WJYA 2V6IA 2ZJOA 5HE8A 5E3HA 3WBKA 2QAGA 1XD2B 2MSEB 2ZRFA 2VSFA 3I61A 2ANBA 3Q7PA 4GMDA 3ZZUA 1CR2A 2AHOA 4B48A 2WWGA 2IWRA 4JVNA 3L8ZA 1T6NA 4NH0A 1AS3A 4NE2A 4BLPA 1XXHE 1MH1A 4A8JA 3NTUA 1IN6A 1E2JA 3NDBB 4DLTA 4CEIB 2ZS7A 4M2LA 1ONBA 2QPOA 3PIRA 3WNDA 2VH5R 1JJ7A 2WICA 1W46A 3IPYA 4GOKA 5EE9A 4FMBB 4N3NA 4QFMA 2FFBA 2QMEA 2DCUA 4OI2A 3DVLA 2ZAOA 4B47A 4M1OA 3CRVA 5G40A 3AVWA 2C9CA 4EPWA 4WA7A 1TQ2A 3A36A 4NCJA 4LJAA 2RGEA 4MA4A 4EFLA 2BM0A 2VLIA 2UZIR 1II8A 1KDRA 5TDHA 4OK5A 4NDZA 2ZUCA 1E1QD 5BN4A 4EJSA 2OLJA 4XD7D 3TAHA 5CIQA 4TZ6A 4JJKA 4KCGA 2CL0X 4W5JA 2V3CC 1QVRA 4LYHA 1QHYA 2FMXA 3MG9A 2ZI4A 4A4DA 1BH2A 3WYFA 3VNUA 3CF2A 3L8YA 2CLDX 1U0LA 4JLMA 1KO7A 1AZTA 2VEDA 2MSCB 1E1QA 5JCZA 1ZVQA 1E9RA 1EFTA 3RRMA 1VTKA 2ZSEA 4HAVA 4DLWA 3B60A 2ZYVX 3VKHA 2NO7A 4XJXA 2GEDA 3AF4A 2GBLC 3D6TB 2A30A 4IXNA 4YONB 2KE5A 4BUJA 3H0KA 4Q7KA 4LJ5A 4IKEA 5IT5A 2A5YB 1Q22A 4PX9A 1IJFA 3OF5A 5E7JA 2PZGA 3TBKA 4XVQA 3K0AB 1D8TA 2ZJYA 2QP9X 3H86A 1T8TA 1X1SA 1SHKA 2EFEB 1E2IA 4QM6A 2OXRA 2ZR0A 3DO6A 5EUQB 3H4MA 3LW7A 4BFXA 4RSGA 1RVDA 1J2JA 1TF7A 4OK6A 3B85A 2LWIA 2WM9B 4NYMR 3LBIA 5HZKA 4A15A 5DI3B 1F2UA 2CBZA 1UEIA 4PSVA 1JB1A 1QHXA 3QPWA 5KDDA 3I92A 2FX3A 2FSHA 5FPHA 1DARA 2NG1A 1MRNA 3EX7C 1X8LA 5DYGA 4EIWA 3L82B 1VIYA 3BFXA 4I1OA 1KZGB 1SXJB 4DWJA 4PC2A 4A8JC 1ZU5A 3WBJA 3BXZA 4CEHA 1U0JA 1XZPA 2ZYUX 4TMXA 4MYUA 4PC6A 2MMGA 3OIVA 2O8CA 3AP2A 4Q1FA 3PEVA 3QIAA 1JI0A 2IYUA 1II8B 1ZBDA 2GZAA 1AN0A 1U0HC 4HB4A 2ZVQX 5LB2A 3ZDQA 1FP6A 2WOJA 4W9MC 2O0JA 2RGBA 2XNSA 3D7MA 1N6LA 4Q4JB 4FW9A 4A2PA 2WZQA 3AB3A 2QTVB 4MYCA 2WWXA 1KOFA 2LKCA 4B6FA 2R65A 3LLUA 2P0EA 2WAXA 2RGAA 4V0OA 2IYLD 3B1YA 4CZ2A 1DAFA 3RS3A 3RRZA 2G1JA 3HJNA 5KPDA 2IYZA 2BMJA 5EXTA 4PHHA 1CR4A 4DLUA 4WIAA 4U02A 4C0SA 2V6JA 5FOSA 4Q4AA 2PCJA 1BYUA 1XPUA 2H17A 4B74A 4ZKDA 1RZ3A 5FOXA 3DMDA 4M0LA 5B30A 1ZW6A 3MMPA 4KYUA 2NPIA 1LS1A 3O8DA 3U61B 4TLEA 1W0KA 3A1WA 4B3FX 2FEMA 4PR0A 2OHFA 4GMXA 3LFUA 3I62A 5B2ZA 3ZVLA 2IA5A 4W5HA 3GLFE 2Z83A 2CLSA 1G5PA 4LHZA 4C2TA 2JLVA 4TMTA 3TKLA 4OHVA 2IYQA 1SZPA 2QGZA 1E9EA 2OM2A 3NEJA 4L4UA 4BE7B 2W58A 2ZJBA 3W8NA 4B75A 3M4YA 3OHMA 4XOIA 1W0KD 3EZ7A 2ZS8A 1H8HA 1OKKD 4P4UA 1AIPA 4KSCA 1ZJ6A 4AY2A 2NQ2C 1YZLA 1OHHA 2QQ0A 1L2TA 3P4XA 4II7A 1ZCAA 1G9XA 4IEEA 1SXJA 4XTCS 4ARZA 2WBLC 3FHCB 1OT3A 1CJTC 2ODBA 3ZVNA 1ZUNB 3I8XA 3AV0B 4M53A 4NCNA 2QORA 4RZ3A 1R10A 4TSFA 1DO2A 1Q21A 1IN7A 4BZQA 2XZLA 2IL1A 3E5HA 4NYMQ 4DKXA 4E03A 3TGPA 5CJPA 3G0HA 3R8CA 2KSQA 3BS4A 4I81A 5FI0B 2BMEA 2CCJA 5L3QA 4DLSA 3K1JA 2MMCA 2W0MA 2YWHA 2F3TA 1P9WA 4EPTA 3R9XA 2RAPA 2QUZA 3K0FB 1KI4A 1HE8B 2NZ8A 2REBA 3P32A 1E32A 2GZDA 4GL2A 1YZGA 1N6PA 2ZR9A 1KSJA 3U3KA 3VU9A 4TQAA 3K09C 1Z07A 4DDTA 2EWWA 1R5OA 1JQJC 1NSTA 2QAGB 3CLVA 3CF0A 2BVNA 1FW6A 1WE2A 1K6MA 4XVUA 2GBLA 3SN6A 3ADDA 1G8HA 3UK6A 1I4TD 4LPKA 2ODEA 4WXRA 5E95A 3TNFA 4DJTA 3K70B 2Q21A 1FNNA 3QPUA 1Z3IX 3SFVA 1SKYE 4M22A 3TW8B 1OHHD 1U98A 4LBVA 1EX7A 3H2YA 4FCVA 4KO8A 1VHLA 1SXJD 1S8FA 3AF0A 1VDZA 2PMDA 3BORA 5TXGA 2IS2A 2GWHA 4CEHB 3ND8A 3HDTA 3IEVA 3HR7A 1U99A 2ZSAA 5CLLA 2KWIA 3W34A 2OILA 4RFSA 3EC2A 1OE0A 4C0LA 1Q1EA 3OIYA 2YWGA 1P62B 5KNDA 1RC8A 2IYVA 2BV3A 3QF4B 4ZDKA 1E94E 1A82A 4GRAA 4BFUA 4JLOA 3LX8A 3AKCA 1G41A 1IAQA 5IRCD 2IS6A 5HTKA 1G6OA 3W6OA 2V4ZA 4C0HA 3U2QA 3CZQA 1GVNB 1SVWA 1GOTA 2FSGA 4XWAA 2XZOA 1PUJA 4D0NA 3F5FA 2ZREA 4KI0A 1S1CA 3GFTA 3MLEA 4MYHA 1CU1A 5FBQB 1FUUA 4C0JA 3RC8A 1DEKA 4ON9A 1AM4D 1PLJA 4URZR 5EJEA 3GLFB 2ORIA 4L9SA 4JT2A 4Q21A 5EXXA 121PA 1WF3A 3W3ZB 2PH1A 2HLDD 3RS0A 5ELXA 4MGIR 5GJWC 3RHFA 4HLUC 1R4AA 2B8TA 5DH9A 4G5QA 3LW8A 1GDDA 1O3YA 2N42A 1JR3A 1RJ9B 1SKYB 1E98A 3O8RA 3U4QB 3H1TA 5AWFC 1O87A 1X8JA 2GILA 3VR6A 1VG0B 3I72A 5FI1B 4QNRA 3CPJB 2BKUA 1IONA 3HP1A 4Q7JB 4LJYA 3OAAA 2RHMA 3I3SR 1OV4A 1UAAA 3SBEA 5F9HA 1ZUIA 4QBHA 1G18A 4BFWA 3CX8A 1FFHA 4MKGA 2J0VA 4QJ3A 3Q3JB 621PA 4G5SA 1G20E 2H7VA 1KI7A 1AGPA 5G53C 1W2GA 4UXJA 4M9XA 1UJ2A 3GJXC 2E9SA 2EFHB 1LB1B 3KKQA 4BQSA 2I1VB 1HUQA 2JLWA 1DAHA 2ZI6A 1G19A 1UKVY 2G9NA 1Z6XA 1GRNA 1CKEA 2YZ2A 2AN9A 1Z6YA 4LV8B 1TMKA 1ZD1A 4DCNA 1Z83A 2YHSA 2X2EA 3RRYA 1CRPA 1ZIPA 2IC5A 3LV8A 3QVVA 4OHZA 1SXJE 4LDJA 3UG6A 3ZGXA 4EFNA 3VNVA 4E07A 3MAAC 4OQFA 3PJRA 4Q7MB 4LBWA 3I4LA 4UQOA 2DFLA 2HF9A 3GEIA 1G3UA 5JRJA 1XF9A 1OXVA 3T1OA 5GJCA 2GTPA 4JVLA 2YVUA 3GLFA 2ONKA 2FSFA 1RJ9A 1I2DA 4B43A 4R71A 4Y0AA 1Z0DA 1NJFA 1VG8A 5EP1A 4AD8A 1D9ZA 1MV5A 3QG1A 4M1TA 2QNRA 4KSBA 2X1VA 4IDQA 4Q4HA 3DHWC 1X6VA 4RCYA 4LYJA 4AIIA 4DHEA 3B13B 3LNCA 1OLOA 5FBWB 1CIPA 5LD2B 4Q4HB 3RS7A 4AURA 4P3YA 1QRAA 2G0TA 2J3EA 2F3RA 2GA8A 3IEUA 4RFSB 3ADBA 1NIPA 3E70C 4IDOA 3HYRA 2ZUBA 1H8EA 4LJ7A 2ATXA 3ZD6A 3T1QA 2P5TB 4I99A 4NCKA 4TQ9A 3FDIA 1GG2A 4E09A 3AVXA 1PV4A 3I1FA 1G8PA 2DWPA 5CK5A 1Z2AA 4ABYA 1A7JA 2GJAA 1E2MA 3E1SA 2W2VA 3ZS8A 3TSWA 4A6XA 4K8OA 4B3CA 5DGXA 3D8BA 4MUBA 1Z8FA 4QGGA 4IEIA 3PCRB 2BJWA 1ZC3A 1CXZA 1JEDA 4JL8A 2QBYB 2RGDA 5LPNA 2PBRA 2YNMA 3IIKA 3MJRA 1AS0A 1BOFA 1S3GA 3RLFA 3W3AA 4P32A 1NY6A 3C7KA 1E3MA 2OAP1 5DE3A 3ZYCA 1C9KA 1NVWQ 2G77B 4M8NE 1HYQA 4LC0A 2WPDD 2XX3A 1N0VC 3DM5A 4PPGA 2JIZA 3DZDA 1E2PA 4N0EA 2CJWA 4V0LA 1PJRA 4GBMA 4QBGB 3UWOA 1TTTA 1IY0A 2VL7A 1WA5A 1UDWA 2WIBA 2QI9C 2FNAA 2OESA 4MQBA 1LY1A 4TWZA 3X1XA 4NU0A 1QG4A 3NKVA 3GPLA 4G1UC 1CR1A 2GJSA 4MGKR 1AQUA 3TSZA 1VCNA 4GOXA 1TEXA 2P3SA 1Q57A 1P2UA 3EASA 1ZNWA 1B0UA 1Z6GA 5CJ2A 2AFHE 4RD4A 4BRUA 3ZIAA 1HURA 1T5LA 2GF9A 1HT2E 1E1RA 2IYWA 3CONA 2WJGA 4C0QC 1TQDA 4KBFA 1G1MA 2GEVA 4M1KA 1VYTA 5J4KA 1ZD8A 3NH9A 2C9OA 5IHPA 2D7DA 721PA 2PEYA 2DWOA 2QMOA 2FZ4A 2EU8A 3ASZA 4X8MA 4FMCB 3GLIB 3TH5A 1E2NA 4PAQA 3VR1A 3EARA 1M7HA 3OESA 2FZLA 3C16C 1VCIA 3W8RA 1Z63A 1Z08A 2D2EA 3LO5A 1E9AA 2AR7A 2EYUA 2IEYA 4IOKA 1JPNA 3TR0A 1D2MA 4X8OA 1OXSC 2QP3A 3DM9B 1U9IA 3U60B 4GZMA 4XSHA 3QKTA 4KVAA 4CGZA 5C4MA 3NBFA 3SDZA 3K0CC 3GQBA 5BN3A 2OLKA 2DYKA 3LXXA 1GTVA 2HDNB 3MFYA 1OW3B 5C2JB 1XP8A 4ZKEA 1G7SA 3KB1A 4WZBE 2WAYA 3FWYA 4F38A 3VU9B 4DCSA 2R44A 3SU8A 2ZXUA 4LC1A 2ZROA 1UM8A 3AEZA 2GRJA 2ZI9A 3TQCA 3L0PA 1G8GA 2ZRNA 3QI2A 3PXGA 1XEWY 2IWHA 2IYRA 3VFDA 3AVOA 5HCIA 5FL7A 3ZJYA 3CWQA 3P1JA 4HZUA 4TYNA 1AK2A 1E2HA 3GCGA 3THWA 3WMFA 4XWKA 1NLFA 4OHWA 1RW4A 1P2VA 2HJGA 1GWNA 4Q5IA 1UEJA 4C0AC 1ZM4A 1X86B 1F2TA 1YZTA 2G88A 4WW0A 3UWKA 1P4SA 3AGPA 3RS4A 1HY3A 1TUEA 4ZI2A 3AP1A 3EW9A 3PUVA 1CR0A 2P6UA 2W6IA 3OIUA 3GMTA 4B3DA 1IN4A 3U3OA 5JJIA 4DCUA 1QHHB 2O8BA 1UBFA 2I4IA 3REFA 1F3OA 3NHBA 3BRWD 4DZZA 5FFMA 2OCPA 2GCOB 3LH5A 4BFSA 4HDCA 1E2QA 4D25A 2HUPA 2AD5A 1XB2A 2OO7A 4TMVA 2CNWD 1W0JD 1NF3A 2FOLA 4V02A 4F4IA 1RRPA 1JAHA 1S9DA 4H1VA 4C30A 2EYQA 3X2SA 1EGAA 3ETLA 1HV8A 1XNJA 1SXJC 5FOTA 1KO1A 3ND9A 4D0LB 4DRZA 4YQFA 2JA1A 4ZPXA 1CTQA 1DVRA 1RIFA 1VCMA 2B7CA 2ZPTX 2QPAA 2IF0A 5AUPB 3WP0A 1JECA 1G4AE 2GF0A 3AQ4A 3I32A 1YZUA 1SULA 2ONJA 1E9SA 4PO9A 5DNYB 2P6RA 1NSFA 1KK2A 1SVIA 2VP6A 3W6NA 2A78A 3ASYA 2OT3B 3B1VA 3EWAA 3NEYA 4QNMA 3CH4B 5KHOC 3R20A 4BWYA 4PC7A 1P72A 3V4FA 2V1XA 4B2LA 3K70D 4TTPA 1JALA 3I5XA 5KO2A 4MRVA 3RANA 3Q9LA 1COWA 2JAQA 2WWFA 3A1SA 3CZPA 4B73A 3KXLA 1IQPA 4G3XA 3SNHA 1BYIA 5EP4A 2CDNA 5KTYA 3PUYA 4LBZA 4C7OA 2YC4C 2ASEA 4GFDA 5JHGB 3LWNA 1GP2A 3QKUA 4OQNA 4PANA 4QGAA 4URVR 5FOVA 3AP3A 4Q1CA 1DOAA 2O0KA 4PAMA 4JSYA 2O52A 1WP9A 3B1XA 5FPYA 4F93B 5EZ6B 2IYYA 3GLGA 1QHGA 2ANCA 4IXMA 4DSOA 1T8UA 2CXXA 1GKYA 2QY9A 3U7HB 3KUDA 3Q5DA 2GJ9A 2GZHA 2HF8A 2DBYA 4FIDA 2FU5C 4AYTA 5FTLA 3CX7A 1HTWA 4W5WA 1VG1A 2WJVA 4Q47A 3K8YA 5JMTA 1R5NA 4ZDJA 2AL7A 2REXB 4N0DA 1A2KC 4PC3A 4FWIB 3DOEA 3RWMB 2D06A 3LXRA 3BH6A 3RVBA 1AJEA 4C0BA 5FUXA 1YZNA 4RKEA 3QOFA 2AWNA 3MCAA 3Q8XB 3TUIC 2WWWA 2H5EA 4I1UA 2QU8A 4HDQB 2XGJA 4B3GA 5L3RA 3K9NA 2RKOA 1YQTA 4QGHA 3SE0A 1FTSA 4OBEA 1T3LA 3TQFA 4BGDA 1TNDA 1DTSA 5BQ5A 3VTKA 2V7QD 4H1UA 4MRRA 1CBUA 2HJVA 1FMJA 1XEWX 3PQCA 2ZEJA 5BW8A 5HKKD 1TU4A 4LWZA 4TN1A 1NMYA 2GEUA 2Q3MA 1ETUA 2J7PD 3M1IA 1KK1A 4IW3B 1EX6A 3GLGE 2V8OA 3DKVA 1XCPA 5JI2E 3BAFA 2EWVA 5M04A 3N2EA 3B1ZA 3TSOA 5E4FA 1N6IA 1II9A 3UPUA 2AFIE 5H8WA 1N2CE 1JPJA 1KJWA 2QQEA 5FUYA 4LGMA 3TUZC 1WBBA 4XWOA 4DLYA 3WY9A 3UMSA 3BOSA 1SVMA 1EFHA 2GXSA 4EPRA 4A1FA 5KUTA 3WNBA 4AG6A 2BBOA 4LI0A 4O2RA 4B3XA 3LAWA 1D6JA 2A5DA 3CRMA 1ZP6A 2GETA 2G6BA 3IQWA 3SZRA 1FP7A 1G17A 4M1YA 4TL6A 5A4JA 2GAAA 3BK7A 4ZDIA 1GIAA 4Q9IA 5AR1A 4JS0A 2G0NA 2FFQA 3BFKA 4G0NA 2WIAA 3IDQA 4G5OA 1LV7A 1W47A 3T35A 1KK3A 1W0JA 2H1LA 1P61B 4M4SA 1YR9A 1Z5ZA 5SZIA 2ZSDA 1WMSA 4LBYA 1LFDB 3H84A 1OB5A 5GVRA 2DFNA 2NO1A 3RC3A 3G5UA 4B44A 3PEYA 1WXQA 1RPZA 3PV0A 4RD1A 1R0WA 3KL4A 3N70A 2WTUA 1EK0A 2BMDA 2C95A 1I4DD 3NC0C 4HLDA 3EZ2A 4O25A 2FJUA 4LX0A 2C2HA 1Z0JA 3QEOA 4KFUA 1MRSA 4M1MA 1T0HB 1G291 2GVZC 1YHNA 3EWSA 2AXNA 4DVGA 1E1RD 2H18A 5JCPA 4DLRA 4DLXA 1OIVA 2WWIA 3NH6A 5J5CA 5L3SB 1XD9A 3GEEA 2WPDA 5EUMA 1T0JB 3IO3A 1G21E 1LS6A 4JKYA 1GKIA 1KMQA 4E22A 2ATVA 2ODNA 3LLMA 2GVDC 5FTMA 1LTQA 1IXSB 1QHNA 4A0GA 2FFHA 4HAZA 2KB0A 1JBKA 3RYTC 2J45A 2F9MA 2CVFA 2QRZA 3B9QA 2CK3A 2AWOA 5B58C 3MD0A 2VP5A 3SEAA 2QBYA 4NYJR 3RWOA 2QT0A 1XTJA 2ZRJA 3QXXA 5FPSA 2CE7A 2FDCA 3QF7A 1TX4B 4I1SA 1US8B 2ZANA 4OL0A 4V03A 3FMPB 2VIIA 1XPOA 2C04A 4JLDA 4RD3A 3BERA 5CB6A 5B57C 4GDFA 3TK1A 4PTLA 3UIEA 3GFOA 2QP4A 3CKLA 3K53A 1GILA 2C96A 2QE7A 1AA9A 1KI1A 2JLQA 2V9PA 1NP6A 4Q03A 1AKYA 2QMHA 1W4CA 4TLBA 2EW1A 4TL9A 5DYIA 4LPSA 4GOJA 1YR7A 5C18A 4MDFA 4ILEA 4CT5A 5TY0A 4D2IA 1Y63A 1VMAA 2WSSD 3P27A 3ZZ0A 3IILA 5CDFA 3CWZA 2BEKA 1XPRA 3FE2A 5DISB 1FPMA 1N5JA 4B33A 1KMHB 4D26A 5JBQA 2C8VA 4CEIA 5CM9C 3NC1C 4BLRA 3VR2A 3HYTA 2HT1A 3GLHB 2CK3D 1Q1BA 2D74A 1TADA 5EXPA 1BS1A 2X19A 4LYFA 4EJSB 5JEEA 4JIMA 3DMNA 3N5CA 1DAEA 1QBKC 1IOZA 2J0UA 2W6ID 3WRYC 1M74A 2FGKA 2PMKA 4QHTA 1UBCA 1NN1A 3QKSB 2J9RA 1G3MA 1I4LD 2ZJ2A 3K9GA 1YRBA 3B82A 4V0NA 1NN0A 1N5IA 2PLRA 3KJGA 3CNOA 4V0KA 1NVXQ 4OK3A 3V9PA 1F60A 3EPJA 2J1LA 4K81B 2JLSA 1G5TA 1MO4A 5K8IA 3CNNA 4YXWA 3LY5A 2NMVA 3X1YA 4OI0A 4ZV4A 3SJBA 4IFBA 2XB2A 2QEQA 1JEEA 4E5UA 1N25A 3QXSA 4OHXA 1KJYA 3M0EA 5FOUA 1D9XA 4B2IA 4AKHA 5KSOA 2HYDA 3GJ5A 2WMOB 4JLPA 4HAUA 2DPXA 4HI0E 3EIEA 1JXOA 4BLOA 2F7SA 2O8FA 3DKPA 1Z0KA 2XAUA 1ODFA 3LDAA 2C78A 4OJKA 3ZZTA 3EPLA 5FPKA 4JYCA 1G8FA 3EXAA 3S1AA 3EIQA 4HAYA 1KTVA 1XJQA 2O8FB 4G5GA 1KI3A 4IJMA 1U90A 3HWSA 1LVGA 2PJZA 3KJEA 4IHQA 3FFAA 1KMHA 1FL9A 3V4RA 2OCYC 2IX3A 3ECCA 1EG7A 4K46A 2BBSA 3VX4A 1VYUA 2Q9BA 3KUCA 3IPXA 1P9RA 3Q7QA 4PHFA 2W6JA 4GP6A 2IF2A 4US0R 2ZU0C 2A5GA 5GVSA 2HYIC 2B21A 1G7CA 1FNMA 3TJZA 1II0A 3HPRA 4WBSA 2ZI3A 2XJ9A 3IGFA 5FUVA 3UANA 1DAMA 1KZ7B 1TQ6A 2XSZA 1J8YF 2D2FA 4Q18A 4Q9KA 2Q3FA 4AG5A 1W36D 4HUQA 5JZVA 2GCOA 1NRJB 4CYMA 3K0SA 2ECKA 3QKSA 1IHUA 4UXIA 4RZUA 1IBRA 1M2OB 1QDEA 4I4LA 1E9FA 2EQBA 4ZCIA 3C4JA 4IRUB 3AKDA 5FL3A 4QKQA 3QF4A 4QBIA 1JNYA 4RZXA 1C4OA 1COWD 1FX0A 3FMOB 2J46A 2ZJZA 4CIDA 4KLNA 2GHIA 4QG7A 1G64A 2P5SA 3K09A 4F92B 1FOEB 3IQXA 3QKRB 5CB8A 2JATA 4U5XA 2WMNB 4PXAA 3KJHA 2SHKA 4FMDB 2QSZA 4CRWB 4DDWA 3KQUA 1G3RA 1E2LA 4UNRA 2FPKA 3QKRA 1WCV1 2A5JA 4W7SA 5EP2A 2IS1A 3G82C 3SI7A 4EDHA 3CRRA 2ZYTX 4KV9A 2IXGA 3U3JA 4FMCF 1W7AA 1S9HA 3K9HA 3QBTA 4Q66C 3T34A 1NG1A 4B3BA 1DG1G 1XXHB 1V5WA 4KBGA 1XTRA 4RKFA 4JL6A 3OEED 5DI3A 3CPEA 2IHBA 2YOGA 2PCLA 5JJLA 3MGCA 1NBME 4MUAA 1KIMA 3EZFA 3AVUA 3FPAA 4NCIA 4OKSA 1B23P 4TLCA 4HAWA 1OXUA 2O8DA 1N5KA 1QG2A 1HQYE 1E2EA 2HEIA 1H8ED 1S2MA 2V54A 3P4YA 4ZO4A 3WMEA 4DSNA 2ZRLA 3KFXA 3FKSA 1CLUA 5F98A 4KFTA 2ZU6A 4LSGA 3B7GA 3DOFA 4R9UC 4QM7A 3FTQA 5KDOA 2QRNA 3LQRA 5CYPA 3CNLA 3LVRE 1RYFA 4JLVA 4Y0VA 3SHFA 5DLQC 2JDID 4B6EA 3QEJA 4WVFA 4JLAA 4LHWA 1VHTA 1BMFA 1OYWA 1Z0AA 3ICQB 1KSFX 1XJ0A 4Q7LA 2H57A 8OHMA 1LW7A 4QJ5A 4OI4A 2VHQA 1R7RA 5FBLB 1ZC4A 2BJVA 4EUNA 3KDSE 1K5GA 4RD2A 2HCJB 2GKSA 1CS4C 1XTSA 4OJQA 2ZRIA 4ACAA 3CUEF 2IXFA 4Q48A 4RVCA 5LB4A 3VHXA 4HUTA 3F0TA 3ADKA 2J7PA 2JIZD 2VP4A 3UG7A 2VBCA 3I5YA 2ZE8A 2NIPA 2JASA 1ZM2A 1M7BA 2VP9A 2IT1A 2NO9A 4NTZA 4OQXA 4JBXA 3THYA 1E4YA 3RSOA 3DZ8A 3GJ8A 4YXWD 5J4LA 4NHOA 1XDBA 4TQUS 5UKDA 3VR3A 1T9HA 1F2UB 4R2IA 4UJ5A 4ASUD 5A5GA 1ELOA 3GJ3A 2P2LA 1MOZA 1M6NA 4L8GA 1E96A 2RGXA 1ZM7A 221PA 1SGWA 2RHDA 3PEUA 2G83A 1J99A 3FKSD 5GADl 4DT1A 3NG1A 3VQTA 4UXHA 2HXSA 5L3VA 1QF9A 4EPXA 4WXPA 5DIFA 5FBRB 3JZAA 3FB4A 3PENA 4NZYA 4XH9B 4HZIA 4Z1MA 3GFPA 5CYOA 1UPTA 1KDOA 1OH7A 2G1KA 2ZRCA 1Z6AA 4WZ6A 1OJLA 1UF9A 3QUSA 2ERYA 3L0IB 4LUCA 2N1BA 1FZQA 4BEJA 3TAUA 1RKBA 1KYIA 4QC2A 2DR3A 2QAJA 1JR3D 2WSSA 4HSEA 4BLQA 4P4TA 1GM5A 1L4YA 3LD9A 3PUXA 2JLUA 4PQRA 2RGNA 1GNRA 2FFAA 4MITA 5H1YA 3RABA 2ZS9A 4HUQB 5DHFA 1CJMA 1OH6A 4D6PA 5EQTA 4O0MA 1RRCA 4OHYA 3KKNA 1P73A 1KI6A 5L3QB 6Q21A 3L0OA 4TSFD 5HKKA 2XSZD 2ZRPA 3B2EA 2IXEA 4TTQA 2J0QA 5CM8B 5AUQA 4QBFA 3HU2A 4R7ZA 4BECA 4GZLA 5BWMA 1P5ZB 5HE9A 4Q9LA 3U5ZB 2C99A 3DEFA 5KDLA 5EXSA 2QM8A 1D2NA 2CE2X 2D4HA 4L9WA 3F8TA 2RH5A 1GRRA 1E2DA 2JEOA 3SQXA 1IXZA 4ZCLA 3AF2A 1D2EA 2IYTA 2OZEA 1OIXA 3X1DA 1UKYA 1DG3A 4I1VA 3GLHA 4BPBA 2BHRA 1X3SA 3DL0A 4LK2A 2ZSFA 4A8JB 4Z54A 2VHJA 2QL6A 4DUGD 4JL5A 4LHVA 5FPTA 5FL7D 2J0UB 1QHHA 1GRQA 2XXAA 1H65A 2A5FA 1E2GA 1YVDA 4LCBA 4GPTA 4Z8YA 3T1TA 4XSGA 3U3RA 1X1RA 3GLHE 3K70C 1ZINA 4IDPA
chains in the Genus database with same CATH superfamily
3K6RA 2VFAA 3EUAA 2Z6VA 4ENPA 2ZIVB 4DCPA 4EO7A 1HBJA 2B1IA 4QU9A 9MHTA 2I4RA 5B6JA 3HCCA 2EHJA 2P75A 4BV2A 3CRQA 4DTIA 5I7VA 2NGRA 4RVDA 3HXOA 1G5IA 1XZLA 2BZ1A 2ZSBA 3GC6A 3K5PA 4O5OA 2P65A 3BSSA 4ZVTA 2OMKA 3O1IC 1E5LA 3KVNA 2Z8XA 3BIWA 2OV1A 3HN2A 3OC0A 2HGSA 2R4TA 4ZOQI 1SIOA 1TCUA 1DXQA 3R5XA 4LSZA 3WR5A 2B8NA 5C9ZA 5JRZA 1T3HA 3MWYW 1PWEA 4KVGA 4LMAA 4Q9HA 3S1LA 3SJCA 5LFAA 1JIKA 4GM1A 4TYPA 2O50A 5K20A 4A6PA 1KO4A 1IDN1 2O0HA 3DDUA 4D6YA 1RJFA 1RR6A 1CEXA 1VFNA 2YOHA 5JAIA 3QXJA 5BSKA 1I7DA 2PGOA 2N46A 1TA0A 3RPEA 2LNDA 3BB3A 3VYVA 2Q9AA 2Y4OA 1PFUA 3EXHB 4HDRB 3WGIA 1REQB 3MJCA 4B32A 4H1WA 4V1CI 3E61A 5CA0B 1MTZA 3U3DA 1K1EA 4YDHB 2ZWMA 1J6UA 4L0MA 4J7XA 2RHBA 2XB4A 3ZHZA 5J4HA 4NZNA 2EQ5A 4X0EA 1WKCA 2OP0A 3I2GA 4E4YA 2NN3C 3FTNA 4KXUA 3HRHA 4N3AA 3U62A 1I3MA 2EGHA 5I5GA 3ZVRA 5K8VA 1XI2A 2YWDA 3GFQA 1KNQA 4Q0MA 3EY9A 5C4IA 4MIEA 3M6WA 4IM7A 3WQRA 3ET5A 4FYWA 2C77A 4BFCA 1CRWG 1VECA 3UMMA 1YHYA 3PU6A 3ZTYA 5A9RA 2X42A 3IBTA 1JTEA 4M1ZA 4HXGA 4RA6A 4RMGA 3LCRA 1R9NA 3VHRA 4DCMA 1RFGE 1YR2A 1M2FA 4URYR 2PT5A 1NF9A 4CW7A 5LQSA 1OXXK 4I19A 4ECAA 4I9FA 1E92A 2I7VA 5FNVF 4XR4A 3WL4A 1TZJA 5IUJC 4KR7A 3PJGA 4FQ5A 4CIAA 2FUEA 5JZBA 4D0SA 2VJPA 1ZH6A 4PHCA 3G89A 3IIJA 4J43A 4JEUA 2A9RA 2OZLB 3AF5A 4MV8A 2HLHA 2LPMA 4X84A 5CK4A 5FV7A 4DA7A 5LQRA 1PNRA 2ENUA 4RNCA 2XQVA 3GFFA 2P2SA 5BNTA 1SVKA 5C32A 3LTNC 3JQBA 1ADFA 4P33A 5AJHA 1ZX1A 1OFUA 5CR9A 1QZUA 4D9IA 1VE7A 5SZJA 1R2QA 1YOBA 4EG6A 1DSSG 5A3RA 2BWJA 5K6AA 4ARUA 3GEDA 4KMMA 1L7EA 4JBHA 1DXYA 1J5EB 2XGMA 2C9MA 3BMOB 1WB4A 3NHWA 3O8LA 4BASA 4BNVA 4YEDA 5AVWA 3E3MA 4R9SA 1N9GA 3H97A 5E2BA 3LK7A 1Z17A 5A7HA 5H70A 4ZT6A 5JROA 1EJ0A 3O82A 3GWZA 4P34A 2UUOA 5IM5A 4CKXA 4GC5A 1SVOA 4JQCA 3IE1A 2FEWB 2JJ1D 1QPGA 2GD0A 2DUUA 2NT3A 4M89A 4NU6A 1GPDG 1JH8A 4PHTA 5ADWA 3QEKA 1S1MA 5FTNA 3GT4A 2HHJA 3SQWA 1YF3A 2BKAA 3EZLA 1ZU4A 3OIFA 2P8JA 3GD5A 3QFTA 1YI0A 4KLCA 3TQSA 3WKAA 4NCHA 1NAHA 4R2JA 2Y71A 2NU7A 1R6BX 3I9MA 2X0DA 1KWKA 1MO6A 5C4GB 1IJEA 2ZULA 5D85A 3THSA 1RRGA 4I55B 3R5FA 1GQ2A 5FF9A 5AJVB 4PO3X 3T9DA 4BV3A 2Q6TA 4QFCA 5GGYA 2YVAA 5FI3A 1T9KA 1WQ1R 2Q3JA 3I45A 3NBXX 4JLJA 3U80A 2I6XA 5I01A 3MPUA 4EVRA 2HQOA 1GG9A 1X80A 4Y1FA 5DT9A 5T8KA 1B8NA 2BELA 5BWNA 2ZRBA 2JK0A 2W2NA 4H6PA 1VIAA 3NIGB 4IIJF 4UCQA 3QLVA 5FUBA 3E3NA 3FVRA 4EFDA 2B99A 2GPNA 4JLNA 2GXAA 3HKCA 2F43B 4AS3A 2TECE 4X44A 2IUUA 1B2LA 2QTHA 5DV9A 4BO8A 1O95A 1ZH0A 1AUXA 2QA5A 4RHTA 1PU2A 2JJ2A 2ODWA 1P2SA 2G08A 4FZ5A 2R68A 4ZQGA 5AI6A 3FI9A 3NXSA 4FUTA 2QHXA 5CIWA 2W2TA 2WI8A 4LFAB 4XLLA 3C3AA 2FPGA 5MHTA 1B42A 3VBCA 2ZE7A 4V0ME 2JGDA 3VBEA 3ESDA 4YDSA 4TTSA 1P7PA 4BZPA 2DHQA 2C5LA 2Y1LA 5P21A 1FYVA 1U3WA 4DJDC 5AJUA 3FHJA 2C1ZA 3DULA 4GLOA 2F6RA 4KX5A 1VHWA 4MV4A 3BE8A 5ECDA 3SS8A 1IXYA 4A0QA 2HPVA 3D9QX 2EDAA 3OOEA 1ZUHA 1YULA 5DSTA 4QVIA 1OA1A 4URWR 1DCMA 1RRFA 5EZ5A 3W9UA 4ANFA 4MQEA 2H1HA 3F4BA 4FFSA 5DP1A 1W73A 4Z51A 5F2EA 1ZJYA 3BMOA 4W5QA 2QE6A 3FUUA 3VPDA 1VCHA 3EODA 1KI6B 3OE7D 3VHLB 1GN9A 1PSWA 2BFOA 2FLVA 3Q9NA 3JWPA 1E99A 1XVIA 3W5VA 1KEPA 3JQBC 3MGKA 4DG8A 2PXXA 1OGYA 4HFMA 4YRLA 1J5PA 1F5SA 2YY7A 3TNJA 1A4RA 2J0SA 5FWXA 1FXSA 4BMPB 3NBZC 1XU4A 1KBQA 3LDFA 4AMYA 4EITA 1E0DA 1CULC 2CLCX 5JSHA 2B2XA 4I66A 2J5KA 3OAAD 2I3BA 3GCZA 4MUNA 4D4MA 4EYGA 1NNUA 2PUTA 2JFVA 4ZCSA 4DEVA 3E4CA 5ES4B 4BIMA 3OX1A 3LUPA 2JDIA 1A7AA 2RGCA 4F5WA 1XYVA 2HWYA 3PC6A 5E1MA 1BZYA 2I5PO 3RYFB 1IL0A 2H1FA 3C4VA 1Z7WA 5D3QA 3EA5A 3KKEA 4QICA 2OZLA 2XWQA 2D3WA 1CE8A 1TCBA 2WWVD 2FJPA 1J9ZA 1C7IA 3F6RA 3MWFA 3QVXA 5K4HA 3FLEA 1X19A 4NCBA 4B8YA 2H1RA 4IQFA 2YXPX 4C14A 3O74A 4V2IA 5KTNA 3OVMA 1QHIA 4PO8A 4KPYA 4LWOA 3WLSA 2A1TS 1M2EA 2YQ4A 4YAOA 3C41J 2PLFA 4JR1A 5JBNA 1K63A 4N5LA 3PWZA 3WLNA 1VBKA 2EBFX 3BKWA 2C84A 3RYIA 4QG3A 4BX8A 5HCNA 2HDHA 2IZ0A 2B6HA 2B1GA 1E3EA 1KDPA 1X0XA 5HFNA 2OCBA 4US2R 4YR9A 1LI5A 4QOGA 1MR3F 2BE7A 3F5SA 1MGOA 3RIEA 3BIFA 4DA9A 4CM8B 5TIIA 2XKJE 4CR6A 3ZHQA 1VG9B 2YV2A 3QTLA 1DEHA 1RHUA 1NBHA 1I5EA 2VRWA 3TD2A 1DBVO 5KYYA 1G38A 2R7AA 3LQYA 4DSTA 3GRCA 4BLTA 2J85A 2KYRA 1O58A 3GJZA 1QS0A 3QSGA 3U0VA 1ISRA 3HCEA 1FMFA 1PJZA 4OGFA 3KFVA 1BN7A 4UDYX 4AJ9A 2Y1KA 1GUAA 3EXHA 1V0JA 2IHVA 3DONA 3OIGA 3CX3A 3Q0IA 3QP9A 1QOZA 3CO5A 1YV9A 2W42A 1GTSA 1B6TA 3FR7A 4MV6A 4EQZA 1C7FA 1TI7A 1BG6A 3NBMA 4QXAA 1TJ4A 1U8ZA 4WCFC 1J2YA 1ORWA 5GM2A 1KY5A 4B1FA 4NMXB 1HZZC 5FHRA 1JDJA 3E2IA 3UM9A 4M8IA 3PC7A 3RAPR 3UT0A 5CFZA 3ERCA 2IYAA 1CUFA 1YZQA 4N39A 3EBPA 3ZQ4A 1KVSA 1P33A 1STOA 4K28A 4D5EA 3KC2A 2OBLA 3DMTC 2YZ7A 1SBZA 3GIDA 3C6QA 4IZIA 4L8VA 5AKHA 2ZETA 3W7BA 2QUKA 3UOAB 5SYMA 3IH5A 4AAYA 1LNQA 2DBZA 3H7IA 5LNK1 4QREA 3B1WA 3DAYA 1TB4A 2J5XA 3H8VA 1E1CA 3N86A 4YMWA 4QUKA 5AVVA 4KITB 4EMUA 2C31A 1E6CA 3MS2A 2WIDA 2E85A 4LY0A 3B6JA 1A9XA 1QO9A 2ZBRA 5BV1A 1RAEA 2HB6A 1AGYA 4XARA 5F64A 5LUBA 1A88A 3LZDA 2X2OA 3HSYA 4IDCA 5ADVA 2B7BA 1BAPA 4EA7A 2UUAB 1GAEO 4ZQEA 4P31A 2Q41A 4JA0A 3V00A 2KLHA 1BE0A 3CVWA 1NLZA 2I2AA 5BW6B 2OA0A 4ZHQF 4PYLA 1D7OA 2X7JA 2QDXA 1JAYA 4L7VA 2CHUA 4A2QA 3C6ZA 2VC2B 4KK3A 3UAZA 4P81A 1VIDA 2AW3A 4AKEA 3PK0A 1BKDR 1P1HA 1T3SA 2QM7A 4GR5A 4KXFB 3K6JA 2CXNA 3ZJTA 4G01B 4BRWA 3HDYA 1VKOA 1R6VA 4LRWA 2FWBA 4NYIQ 3SC4A 3X2FA 3CH5A 2QRPA 4ZTBA 4E3WA 4LNHA 1R4NB 1SKQA 2ID4A 4HB3A 4IPTA 4JNCA 4F2HA 3BWYA 1ZXLA 3L3BA 1GYPA 2SCUA 3FDZB 3CUKA 1CY6A 1ZMRA 2FWPA 1NUQA 4LYAA 2QTRA 3DTYA 3N87A 2BFFA 4AVYA 1Q7EA 2ZJ1A 5KZMB 1RBZA 5FOWA 4DLVA 1H2RS 3PWKA 5HFAA 3UYLA 2H1VA 3KAQA 4V0MA 1NRIA 1N0WA 2AGVA 2QLMA 1KFBB 1UBHS 1WPXA 4H3SA 4UHFA 4CKWB 1EESA 1SWVA 1FQKA 2J33A 2ZBEA 3D4OA 3PQ5A 2DX7A 3WX0A 1M1UA 3KFLA 3RODA 4ZMRA 1YJAA 5JSUA 3T5DA 1L5HA 4S1WA 4OMCA 1TRKA 2PBFA 1ABFA 3O8QB 4LQDA 3TLXA 5DM60 1HG0A 1G7RA 4BQEA 4KFSA 5F7XA 3EEYA 4TYWA 4GE3A 4KO2S 5JSZA 2AUNA 3QE0A 4LOHA 5DK4A 1XZ8A 4KTTE 1F8FA 2ZWPA 2VNAA 4BX3A 1C7JA 5J4YA 1E9CA 5KYKA 2Z2JA 1SCBA 1NN5A 5K0LA 2FW7A 5JUWA 1GAJA 4DGSA 4ZDWA 1RM4A 1D4AA 3L6OO 3R09A 3ECAA 2PUCA 1WDTA 2NU6A 1FS5A 3R5HA 1RI4A 3GLQA 3VR5A 5HZGA 1Z75A 1C0LA 1W25A 4YCAA 1DDOA 3HDQA 2IFTA 2VTKA 3IQIX 2VSOA 1UDXA 3PUZA 2IPNA 2NYAA 2BF4A 2HO4A 4DR2B 1ZN2A 2O1WA 3ZGNA 4YMTA 1KFJB 1W52X 2IHJA 2LKDA 3OZTA 1T5BA 4U2CA 1UKZA 1IMOA 4WZBA 2VDWB 2XDWA 5BN3B 1CJVC 1A9YA 4U1RA 5WRFA 2Z2YA 2UDPA 3Q7SA 2ZYDA 2QXYA 4TTTS 1PLLA 3AKEA 3RYHA 3ADCA 2O7RA 2GAOA 1XD2A 2GERA 2FEPA 3RTGA 1OSNA 4YRFA 5BSHA 3C5WP 4LV6A 1SQGA 2QK4A 2TRSB 4MR7B 4YAWA 5AM1A 2RJ3A 5FBHA 4P22A 1BDIA 4QGSA 1FRNA 1G42A 1R66A 1XXHA 4X1IB 5BP7A 3ZNOA 3TIFA 3EA4A 3SC6A 4LSMA 2K7ZA 4ZI7A 5HF9A 4L4YA 4DFDA 1T6YA 1KQ3A 4Y8VA 1D04A 1R0SA 1Z47A 3AWIA 4XIGS 1R0YA 1VQ1A 3OZEA 3ZV6A 1TAHA 2VNIA 4BMVA 5DXAA 2XITA 3H5RA 4O4HB 4GP7A 4N7RA 2IIBA 4BX2A 4BC0A 5IXYA 3WZ2A 2P41A 3UH1A 1JXMA 2B1JA 4POAA 4RQAA 4Y2VA 1NPDA 2RHCA 3QVTA 4MSUA 1I2MA 1SUBA 2Q5OA 3JZMA 3ZQKA 1M8KA 1BA2A 2Q0QA 1RM3A 3IDOA 2QG9A 3OIWA 4Q9DA 3SS9X 4YRSA 3GDWA 3ZXXA 4EQ6B 1Y0BA 3IEXA 3RS5A 1H1DA 1VP9A 5G41A 3O8CA 4JHXA 4AJPA 4MVYA 5LQKA 2WB2A 5J40A 1H4SA 4YRJA 2WB4A 4ROTA 2OD2A 2FSIA 3WOVA 4PG8A 1VPWA 1W4LA 3QY0A 2XVAA 2ZYWX 4Z86A 1CRQA 3TTWA 1P75A 3GZJA 2XNKA 4DDUA 3HRKA 4AO6A 1EHCA 5IC6A 4F06A 3KXDA 5TEWA 4U3JB 1K8YB 4ZEVA 1KQGA 2CZGA 4EJMA 4IDBA 3VVMA 1QDLB 4Q00A 4OQYA 1UC4B 4C7KA 2O3TA 1K8RA 1EE9A 3JQAB 5IUNC 4DZRA 2UXBB 2ZYIA 4JIGA 2XTNA 1VJ1A 2P1ZA 3DB2A 1HH4A 1BE8A 1KI8A 1SC1A 1SCQA 3CSSA 1OBHA 3Q72A 5KKCA 2YICA 4O2AB 2NYRA 3FYHA 3EFHA 3KYCB 2GH1A 4IS3A 4M37A 3W2EA 1TYBE 3CB4A 3DO8A 3KTDA 4OXRA 3P0EA 3WDMA 4YALA 4HBGA 4AZ3A 3KPVA 1NQUA 3FCAA 1RLOA 4K9KA 3KVOA 4UE2A 3LZCA 2IKSA 1DGQA 5KHAA 2VA8A 2D2VA 1HF3A 2QTFA 4L16A 4LZZA 4ZAXA 1U11A 5FRDA 4TL8A 1IZ8A 3LVBA 3DC2A 1N2GA 4MGYR 2F64A 1EGQA 1NI5A 2JLCA 1Z5PA 1GU1A 1ZN8A 4KODA 2R62A 2G04A 3PRJA 5TMBA 2M6KA 2E7ZA 2I2XB 3DQZA 3DYVA 5G1PA 1XMVA 5TB5A 3O1LA 3B1JA 2QENA 1WXFA 2LXNA 3O0DA 3SHTA 2PUVA 4JJEA 2OC4A 4ZI7B 4R98A 4E3ZA 3SC3A 1FLAA 5AQ1A 1KO8A 3VPBA 4D8YA 1F4PA 1HO3A 2YWCA 3O95A 1OU4A 4UMDA 1PZNA 2NLOA 2VUTA 3EXHC 3R7WB 2YWXA 3ESRA 4TUYB 5F7ZA 3CG0A 2Z4SA 3KEFA 5FIUA 3T4UA 5ALIA 2C7QA 1QG0A 2ECQA 2VTDA 3COZA 4D4LA 4YUXA 1NLYA 3CY6A 4PQYA 2VTEA 1XDGA 4LWPA 2F90A 3U4DA 2HMUA 4M1SA 4WT7A 2ADFA 2IE0A 4FXOA 1DT5A 1PBNA 4GX2A 2ADMA 4MVJM 2VP0A 2FZ5A 3CV3A 1OIWA 3AO0B 3OLQA 3ZJVA 5ALRA 3SJZA 3Q9UA 1S8NA 3QUBA 1Q3HA 3GGJA 2JJ1A 5H3CA 2FE4A 4DB2A 3NB0A 1XZEA 2ZE5A 1KAGA 3QHAA 4HWKA 4D4JA 5JS7A 2IOQA 2UYCA 3JQAA 4NBUA 2EZUA 2XXJA 3URKA 3J81A 4HJRA 1U0NA 1N6OA 1AD2A 2C1XA 3FBTA 4M49A 4MULA 4EENA 1RCFA 3AY3A 1GXSB 1SY7A 1ADGA 2NZUG 2XUHA 1J06A 2IIVA 2OV6A 1UBGA 2PX0A 4DV5B 1E9DA 5B1HA 4QJ4A 1SFRA 4JBGA 4V0NA 3V4LA 5EJ2A 5JWOA 1DZ3A 1WM1A 4GKAA 2OP1A 1HOTA 1U7PA 4XIYA 3OX4A 1EJ6A 1IPFA 1ZAKA 3OFND 2K6GA 4RY2A 3BWXA 1MABA 2W0SA 3EQZA 1X1TA 4NPCA 5AM4A 1V5GA 1FTWA 1VGVA 3HV0A 3S8EA 2H1CA 1GITA 1H23A 3TQIA 3AZOA 5D51S 2AK3A 3Q2IA 1YS4A 1MQ9A 3R5KA 3L4KA 4JLKA 4HFJA 2QYSA 4JYAB 3WHIA 1G6KA 2OHJA 4BQRA 2AJCA 2E1RA 2G07A 1WS6A 2APJA 4A5SA 3QLVC 1G59A 1J0AA 1RIIA 2PRIA 3O9ZA 1QTRA 3EQ6A 3CINA 5HDBB 4MH0R 3PKZA 3ND7A 3QLEA 5E7IA 2J09A 2QUJA 1J7KA 1Z5VA 4X8LA 5SZKB 4DDVA 1JHDA 4ENVA 3WYEA 5KEIA 5ALXA 5G1NA 4L3VA 3GRKA 1GG5A 2ZRDA 2ID9A 3G0OA 1M6WA 4XB1A 1KEEB 1G20A 1M2WA 2RI6A 3FFWA 4XVHA 1IBLB 5BSVA 1PJ2A 3AESA 4MDYA 3CR7A 1ZLXA 4CQLB 4D9JA 1U2SA 3OEHA 3ZK8A 3MWEA 1EAMA 3PD0A 3IQFA 1O7JA 4HN2A 1SWWA 2PTGA 1F1BA 2VXOA 3DHEA 4YVFA 2OSBA 1IZ9A 2GPAA 5E6SB 4G4SP 5EEGA 1MC8A 3M6XA 3PFWO 4J0HA 4RZ2A 5KYWB 1W76A 1T6ZA 1OASA 3EXG2 1G3IA 5AHRA 4XEHA 4YYEA 1LPNA 1V8DA 3TVDA 2NYVA 2JAWA 1QHEA 3F6SA 3ETCA 4J29A 4JNKA 4NOLA 3UKDA 1JEYB 2J87A 3SGLA 2AI3A 3UJ6A 7ADHA 2PX8A 5BR8B 3VAAA 1N2EA 3Q3HA 2NAPA 1X39A 5HQTA 2QTAA 1MD9A 3QWIA 3L4EA 3SYKA 1GQSA 1DOZA 4I4TF 3X2EA 1P0FA 1Z2CA 2Z09A 2G1PA 2YXBA 2Q4BA 1NDHA 2OV3A 2G5CA 1DADA 1CUEA 4JLWA 1D4ZA 5CYFA 4ZC8A 3AYZB 2Q5QA 4GR9A 5JW6A 5D01A 3TIXB 5IULC 2ZRKA 3UOGA 2BONA 2X9QA 5C1PA 1I32A 3CBQA 1DBRA 1DT3A 1W0CA 1XKQA 2BFNA 1U2RA 4H7IA 2VAVA 5T3YA 3UUGA 1LPMA 4OCZA 3WHLA 3HEBA 1VPVA 2C7BA 3AK4A 2C7PA 3S2SA 1US8A 1LJLA 2EJTA 4HJXA 3OZFA 4PRKA 3ZLJA 3SKXA 2HPZA 4JWKA 3IIMA 2QWXA 3BZWA 3KEMA 4EHAA 1FRZA 2GXQA 1NNI1 2ZK7A 4YQZA 1OVGA 4ENSA 1N3BA 1TEVA 1L5SA 1XKXA 4H77A 1CJUC 2O57A 2FW9A 4OQPA 3FMGA 4YRGA 5HJ7A 4R2HA 3ZCTA 1RXEA 1NUHA 3DMTA 5KNBH 3R9WA 3GMDA 2QPTA 3UN1A 1Y5RA 3WA6A 3S55A 1JIUA 2XRYA 3Q6MA 1JQKA 3S1AB 5AI5A 3I58A 3C15C 4QLBA 2FOXA 1YDHA 4YCJA 2NOAA 3GLIE 1T34A 2R6DA 4O4HF 4YMIA 1PFGA 4N1AA 1NGSA 4M0MA 4Y2PA 4BEBA 2IGTA 4PFSA 1UL1X 3KJXA 3QU9A 1NI3A 3R3UA 1YAJA 1A5BB 4PRZA 4HS9A 1HDIA 1XMJA 5EZYF 2HT6A 5LZ7A 1PZHA 2ACWA 1QXSA 1Q95A 2JAUA 1Y3BE 3UMFA 1I3NA 1C4XA 1WHTB 1T6XA 2ISSD 2P9BA 3IKVA 4ZT3A 1IWOA 1N9KA 5JI3E 3EIHA 5C46F 5BT9A 4JT9A 5HX7A 2BZSA 2BDTA 1B3BA 5DT2A 4NJOA 4ZT7A 4FS8A 2HJ9A 4FE7A 1DPFA 1DUVG 3W90A 2UZ1A 1P60A 2ZRGA 4KLRA 4DEYA 4TVSA 4A36A 2MHCA 3BXPA 2PJRA 1SUDA 2LP4Y 4JUFA 2HJSA 3WRXC 1UDBA 2V7GA 3LT2A 2XYQA 4X92A 1UJBA 2HA7A 2AOTB 3OFVA 1NULA 3ABZA 1QGAA 1I4OA 1SBNE 1W35A 3OZCA 4FOSA 3VC2A 3GV0A 5EE0A 1HTBA 1KQPA 2CDCA 1NV8A 2ZUDA 4HDOB 3EA0A 3SYNA 1YAHA 4J3JA 3DMYA 5AD1A 3UHAA 2Z2ZA 1DX9A 3TIIA 3CVVA 2R6GA 5KSZA 3C3KA 1FX1A 1TM4E 3RD5A 4D98A 1YB5A 1SB8A 3PXAA 4KO4S 1KC1A 3FF4A 2J41A 3GUVA 4KLZA 4DRYA 1C30B 3ZE2B 1XRSB 3FNBA 3DWFA 4L72A 3SWWA 1IB6A 4FHGA 3NAMA 3QG5A 4DAEA 2W37A 5EIBC 4AMVA 3U81A 2FR1A 1MDFA 3HU5A 1LSOA 4WZAE 5LYYA 4MVJI 1Z7YA 4NIMA 1OX4A 1D8AA 1W36C 1CF4A 3D3KA 4QGFA 3KB2A 4I08A 4WOPA 1M76A 1YBHA 3PUWA 4RIEA 5LZ8A 2M6LA 3V32A 1DC8A 2PQMA 1XMXA 2HF2A 1V3VA 1JHOA 4BEWA 5HZMA 4KPGA 4K0KB 3VO1A 3GLUA 4J0QA 1KEUA 1QVAA 2BHLA 5DO9A 3QE2A 3SKYA 5F7OA 1Y37A 5E1DA 1L3CA 4XB6B 3DL4A 1UK9A 2X15A 1U8CB 1DHTA 3A6HA 4JB3A 3DDCA 4IIYA 5I7AA 5CLQA 3MGBA 1KDTA 2PIAA 4IDEA 1U2GA 3QPVA 1T24A 3NDPA 4M9RA 5F78A 1A9RA 3ZXYA 2PO7A 4CMIB 2W6JD 4WLNA 5IK2A 1WB9A 4Q1BA 3NIWA 2NVBA 4BNMA 1XZFA 3IERA 3M6LA 2Z6AA 2VHUA 4TXJA 2QYOA 2IW1A 5AW2A 4DS3A 4YHHB 4GPZA 4O4IA 3H1FA 5TE9A 4BY9E 4J94A 4LQLA 1O03A 4MW1A 1BCSA 1FP4A 3RRXA 1M2GA 3DDWA 3L0SA 4QLOA 1MH9A 5LQCA 4HZGA 1ULSA 4I50A 1P7CA 5EHNA 5K51A 1L8LA 1AKEA 2UV8A 1BMQA 4FILA 4AQ7A 3A1FA 4G24A 1CY0A 1U8TA 2J9GA 3CNQS 4WN9B 3HCRA 3TQQA 2HIAA 3ACDA 4LQCA 3VKVA 1XTIA 4EY8A 4H4DA 4UTXA 3VDNB 5A4IS 3P9RA 4IIVA 5AO9A 5C7IO 2EP5A 2IITA 2ZJOA 1ZA2A 1WXIA 5JVDB 2QAGA 2ZRFA 1MG5A 2VSFA 4CU5A 4U2EA 1GTJ1 1KJNA 3Q7PA 3DEJA 4XKJA 4ZODA 3V8NA 4B6SA 4B48A 2EW8A 1ECJA 4QYMA 3USZA 4C7MA 4RDXA 8ATCA 5K0FA 2QXTA 5DLPA 1IK6A 2QM3A 3JCZA 3PBKA 3N74A 4QYIB 5G02A 5BR4A 2ZIXB 1NHWA 4UUMA 4W8HA 3L8GA 2GQ0A 2OO5A 2D1YA 3CF4G 3BXXA 3IRVA 4YWHA 5CXQA 2ZS7A 3NDBB 1QORA 4RHXA 5B5SA 1TYDE 2QPOA 1USUA 5FBZA 3N28A 1M5RA 4RVHA 4Y2UA 2CLKB 3EXEA 1JJ7A 2WICA 1DINA 2YYYA 3CBGA 4I9NA 4KWEA 4LSWA 4FMBB 3B70A 4N3NA 4WECA 2QL5A 3K32A 1EVLA 1L4LA 2QMEA 2QTBA 1YJ8A 4MYSA 3NCHA 1JS1X 3RAEC 2JBWA 1H2FA 1C8VB 1T10A 4M1OA 4M54A 4X6YA 2C9CA 3KELA 4W9RA 4W7HA 1KQNA 5LQUA 1AMUA 4Z4GA 3T9AA 2G71A 1NE2A 2C2KA 1LD3A 4Z1OA 4FGSA 4LJAA 1SKBA 5LM3A 1II8A 2PLAA 4QQRA 1NMQA 5DBIA 4OK5A 2GZRA 1ORRA 4X97A 1DWOA 4CMGA 5B1YA 4WOKA 3UFXB 4Y2TA 5CIQA 3UW1A 4RDCA 3V4SA 2CL0X 4W5JA 4B6JA 3GK3A 5HBRA 2FMXA 2GBCA 2PYIA 4JXZA 1V5IA 2CLDX 2W6NA 3PEWA 1KQFA 2XDQA 4LTMA 3GJTA 4IIBA 4OAQA 1QAMA 4HX9A 4CTKA 5MGNA 1U28C 4CFSA 1E1QA 1VTKA 2ZSEA 3WNZA 4BVJA 2PWAA 2PFSA 5AKXA 4KBYA 1QYCA 3PQ8A 4Q16A 3PXCX 3RT9A 1GGEA 4YONB 2IXBA 3B7WA 4FDMA 5KX5B 4Q7KA 2CV1A 5THXA 3HXTA 3TBFA 1I3LA 2WQZA 1Q22A 3OF5A 4NAUA 3K0AB 3BGDA 1UC9A 1FFEA 2LTAA 3SPXA 1R6UA 2HKIA 3IBSA 4P9NA 2ADOA 5AP9A 1JW9B 5T8KC 4DBVO 4AL4A 4DIOA 2CUKA 3I39X 4EARA 4RTRA 3P9KA 4EY6A 2WKSA 2QN1A 2OXRA 5SV2A 1J39A 3MN1A 1YVEI 1WD7A 3RYCB 4FB4A 4HUJA 1RVDA 3NV7A 3B85A 1LLQA 2LWIA 2WM9B 4NYMR 5JXGA 5HKOA 1XLVA 1FU7A 1NM5C 1Y34E 2EERA 1ZI6A 1V1RB 3A25A 1ZNQO 5GGXA 4NG4A 4CMBA 2FX3A 2DMRA 3OOJA 3WDLA 3NTRA 2Z95A 2NG1A 3IQDB 4XPZA 9LDTA 3DAPA 1ZWLA 2C29D 2PUHA 5JS8A 4FC7A 3T4EA 2HDOA 3VMMA 2X8BA 2OB2A 3MOIA 4I1OA 4INOA 3DLCA 1ZDMA 1ZU5A 3BXZA 3WBJA 2M1XA 4HGNA 4M60A 3BTOA 3VO2A 4BB9A 2O8CA 1F51E 1Q1NA 3N0VA 3O2SB 4M0EA 1B93A 3L0ZA 1Y81A 3QIAA 1II8B 5IYZF 4LRUA 4IHKA 1AXRA 3RTEA 3QQPA 3L0DA 3GBVA 4K6MA 1DDGA 4PZAA 3VNQA 3RBVA 2PK3A 5L40A 1N2CA 3D7MA 2YJZA 3W4IA 4A2PA 5T7BA 2I78A 5EJGA 1RXWA 4PLYA 3VDQA 2QIPA 1SUCA 4LIPD 1Y1KE 4CIBA 2BFDA 2R65A 1Q74A 2DHCA 5HFJA 5IFLA 2REQB 4V0OA 1UXHA 1NJSA 2XCQA 2IYLD 2CFTA 2JHFA 3ZWXA 4CZ2A 2A9OA 5IVHA 1SELA 1VJDA 4UTRA 2GNAA 3QE3A 4MVJG 2G1JA 3EGXA 2VAPA 3DE3X 4YJ3F 3CRNA 2IYZA 2BGUA 5EXTA 1CUUA 3MSCA 1WUJS 4PHHA 4AN4A 4EF6A 9ABPA 3S81A 4DARA 1CYEA 5H7XA 1ZUWA 2O07A 5D7NA 4Q4AA 1V8PA 4G37A 1XPUA 2H17A 4B74A 1JB9A 5KNCD 2CWDA 1RZ3A 3HFJA 3N05A 3DMDA 5FOXA 4V1CB 1DUSA 2F8MA 1G2OA 4KYUA 3MMPA 4Q3AA 4WWHA 3PXBA 2P9GA 2IEDA 2HOQA 1UDCA 3URMA 1W34A 3U61B 1O6BA 1CS0A 1SKUA 2ZLBA 4CDMA 5I48A 3GVIA 4C04A 1GZ7A 1EXDA 2FEMA 4PR0A 2OHFA 4YJ3A 2RAUA 3D1VA 4LYYA 3MCVA 4EJFA 1HZJA 4Y9SA 3D8SA 3ETHA 3FPEA 2M32A 1X1CA 2ZTUA 4RKYA 2PX4A 4LHZA 3WV4A 1Y3HA 4TMTA 1NVEA 2G9VA 2IYQA 1KRXA 1BU8A 1V26A 1E9EA 4BE7B 4L4UA 3CNHA 2A94A 2ZS8A 1OKKD 3OZSA 3AY0A 2FETA 1YZLA 3G88A 1ZRNA 4DLBA 3T1HB 3P4XA 3QU2A 4PY2A 2QJWA 2OAGA 4XTCS 1JIXA 1Z62A 3V5NA 3FPFA 4EHLA 3L7LA 1OT3A 1M73E 3O7WA 4E12A 3ZVNA 4CHGA 1UK6A 1GPWB 1HGXA 4RZ3A 1R10A 2XQIA 1E7MA 5K8CA 1L1FA 4F2WA 4EVQA 1M34A 3PQDA 4IIJB 5G0VA 4BZWA 6NULA 3JYOA 4WOCA 3A6LA 4E03A 1PW5A 4YP7A 2JIMA 2RHRA 4PNZA 4X95A 1QRDA 1P17A 3G0HA 2N0SA 5FI0B 1OXKB 4TZKA 4KGDA 3S2IA 1IM5A 1L5QA 2QAIA 3K1JA 2CJXA 2MMCA 2YWHA 4AW9A 1U0SY 3K9CA 4U7WA 1G8MA 5DHQA 3R4CA 5D2CA 3P32A 4ZQBA 1E32A 1QCDA 4HQ6A 2GZDA 4U2FA 4GL2A 4PLHA 1N6PA 1SNYA 1E4OA 5D1HA 3HBMA 1Z07A 3K09C 4QEZA 3VGPA 3C97A 1F4VA 1KPHA 5M3BA 4CV3A 4MI3A 3CLVA 5JO0A 3CF0A 2BVNA 2QIOA 3H5WA 3AUAA 2R1TA 2UXDB 2RH4A 5IKPA 3IUEA 1JSLA 2ZYGA 3AXTA 3MC1A 4EGFA 2OCGA 1QYIA 3NPAA 1IVYA 4MPPA 4XVUA 4FKBA 3SN6A 2Q3EA 5SY4A 4FHEA 3HUEA 3KJFA 1I4TD 1TA4A 3UK6A 1AQNA 4DJTA 4HN4B 3FTCA 1Z3IX 1SKYE 1XQ9A 1U98A 2O4UX 3K05A 4LBVA 4TWRA 1P2FA 4KO8A 5TJHA 4DQDA 4DA4A 1VDZA 2WVGA 2PMDA 3VZDA 1ULAA 5B3LA 2DT8A 4AJ1A 3ND8A 3PEFA 4PLWA 3HDTA 2XYHA 1VMKA 4ZVKA 2I91A 1VSUA 4DIKA 3IEVA 3C3WA 1UZUA 3A6EA 2KWIA 3E23A 4MV3A 4OUDA 4GOOD 2YWGA 2OVBA 5JYBA 3H4TA 1RC8A 4Q6BA 1A2OA 5ICMA 1VC2A 1WMEA 3TLGA 4ZZ3A 5A7FA 5DSXA 1E94E 3UQZA 1CUGA 2B78A 3PD7A 1KR2A 1GPNA 2X3UA 1G5FA 1BQEA 1FP2A 1ZVMA 2X5KO 4PCAA 4QXOA 5FLEX 3AR4A 1JG1A 3TQOA 3LDGA 4MIOA 3W6OA 4RL6A 2IS6A 3UCXA 1SVWA 2FSGA 3OQVA 3TL2A 1XAIA 4EECA 5KYUB 3CO0S 4DQXA 1PUJA 4OYLA 1ODLA 4IDGA 4BC1A 2ZREA 5C5DA 2DY0A 2J4CA 3NT5A 4J6EA 1QS0B 3IA2A 3MLEA 1CU1A 3BMQA 2O2XA 4JH0A 5CW1A 3OZUA 1VSTA 3ORQA 4WFJA 5CT8A 2P2DA 5ALWA 1ZN9A 2PBLA 1DEKA 3MGAA 5EA2A 3GIWA 2XF2A 4P4GA 4FQ8A 4TLCA 4PZPA 4G65A 1IAVA 4MQFB 5EHGA 4L9SA 5EXXA 3INTA 2IPXA 1U0TA 1P80A 4XX1A 2F17A 1YJBA 2BKLA 3D8RA 3L4BA 4QUJA 3CUYA 3RJZA 4RMIA 3I1YA 3FCEA 3LW8A 1XG5A 1GDDA 1O3YA 1RXIA 2G40A 1G55A 4OOEA 1O57A 1SKYB 5EJIA 2ZR8A 2GN1A 5AWFC 1UK7A 3CHYA 3PNQA 3HVJA 1K6JA 5U9CA 3I72A 4AN0A 4QNRA 3HB4X 4YJGA 1P5RA 2A4KA 1YXMA 3NTXA 2RHMA 2P9YA 3GPBA 1KOLA 3DKIA 3LE8A 4FFNA 1ZUIA 5F2NA 5AK4A 2QT9A 3GEMA 1CE8B 2PH5A 4LRSB 1FFHA 4QXRA 3KRTA 1U65A 4QJ3A 3Q3JB 4WEQA 5IEJA 1OC4A 4G5SA 1KI7A 3C48A 3D4BA 4LX8A 2VYVA 3Q0TA 2OQVA 2PZKA 5DJ5A 3LDHA 5KC8A 4DKJA 3AUTA 1UJ2A 2JCYA 5TGZA 1LB1B 4BQSA 1U0BB 4AJLA 4YRDA 1HYGA 5AXAA 1HLGA 2QJFA 1PL8A 4J9UE 3VYSB 5AXBA 1Z6XA 1Z6PA 4TWAA 4I9HA 1XZGA 1MRZA 2Y05A 1DQZA 3IIEA 3QX8A 1Z83A 2YHSA 1TMOA 4D96A 2BEWA 4FYMA 4UAUA 3TECE 1X14A 1YB2A 4G8DA 4D79A 4EKIA 2PG3A 2NT4A 4OYYA 3RRYA 1AKQA 4F84A 1S2LA 4KIJA 4MI1A 1HE4A 2IQIA 2OK8A 2QVLA 3LV8A 5K3BA 4OHZA 4LDJA 1Y6FA 3HWX1 3ZGXA 4N3BA 4E07A 3EMDA 5L6LB 2ECFA 5KYXB 3WGVA 1YIOA 1Z26A 3MINB 1LWOA 5AKIA 3F1LA 2GBIA <