1KHTA

Adenylate kinase from methanococcus voltae
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
NKVVVVTGVPGVGSTTSSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEENLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTGDEILMRRMSDETRVRDLDTASTIEQHQFMNRCAAMSYGVLTGATVKIVQNRNGLLDQAVEELTNVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords adenylate kinase
publication title Structures of thermophilic and mesophilic adenylate kinases from the genus Methanococcus
pubmed doi rcsb
source organism Methanococcus voltae
total genus 72
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1khtA00
1LVGA 1D5CA 1RVDA 3DO6A 4DLUA 4PHFA 4Q19A 2QSYA 5EP3A 1YKSA 5K8UA 4G5OA 2ZI6A 1YE8A 2C9OA 2ZSFA 1Z63A 1E79D 3NBYC 4DLRA 2QY9A 4LPKA 3Q5DA 1VECA 2ZSDA 3MUFA 5IDVA 1Z47A 3C4JA 3NBFA 4RCYA 1RJ9B 4KVGA 2PCJA 3GD7A 1WCV1 5DNYB 1BYUA 1E2IA 1F60A 4HDOB 2VLIA 3E2IA 2XZOA 1NIPA 4JVLA 3FKSD 4RZXA 3BGWA 3RRZA 1CR4A 4MDEA 4PHHA 2OXCA 2WKPA 1CKEA 2BVNA 5SZHB 5F9FA 2HCJB 2VTKA 1AA9A 1QZXA 3QKTA 4YC7A 4ACAA 4ESHA 1F48A 1DARA 4FMDB 2WAXA 4FCVA 1FOEB 2GKSA 1OXSC 4Q1CA 4ZIRA 1T9HA 4GFDA 2WJVA 3DMNA 2BHRA 2GNOA 4Z8YA 2CJWB 3R7WA 3UANA 2OBLA 3NIBA 4HB4A 2FOLA 4LV8B 2DR3A 4JLDA 1G19A 4DLZA 5AJYA 1E99A 4LJ5A 5FOSA 1UJ2A 3KKPA 4LHWA 4Q47A 2QN6A 1OIXA 1E2HA 3BC1A 2A78A 2F9MA 2YOHA 3ADCA 4Q21A 4JYCA 5EE5B 4D0NA 3ZYCA 2GVDC 1ZUHA 4KO8A 4OQNA 5J40A 3K0AB 1AKEA 3THWB 1OHHA 4EQ6A 2PEYA 5FBQB 1SVSA 3AF4A 4BRWA 4QFMA 4Q7LA 1W46A 2P0EA 4ZCMA 4DB4A 4CEJA 4MGYR 2PJRA 4JLVA 3VU9A 2YWGA 5FOXA 3SJAA 3VHXA 4D80A 1DAKA 1P75A 3MWKA 4L9SA 2R8RA 2NG1A 3QXCA 2ZRLA 4DIDA 1CJUC 1P4SA 1YZUA 3SC3A 4DCNA 4G5SA 3AVXA 2A5FA 3AP2A 4MGIR 3QPVA 5CYPA 2OV2A 2H1LA 1P2VA 3O47A 3BK7A 4RKFA 3F0TA 2PBRA 4U02A 3T1VA 1XEWX 4C3ZA 3D6TB 4KI0A 2F1IA 5EXXA 3V4FA 4DCTA 1YZLA 4NMMA 4OI0A 3RRNA 2O8CA 2ZSBA 2MSEB 3KJHA 5IRCD 2EYQA 3MWJA 3QKUA 1D2EA 2IYTA 1IY2A 3KUCA 3KZ1E 4LJYA 4R98A 3C14C 1JXOA 4TQUS 2O8EA 1AGRA 1FMLA 2BBSA 1MO3A 1IXZA 1QHHB 4DLTA 1G8PA 3VKHA 4GP6A 2HJGA 5FUXA 3RWMB 3AGQA 2BEKA 2IX3A 2Z4RA 1WRBA 3OIWA 1ZCAA 1NRJB 2ATVA 2LWIA 1OXTA 3DEFA 3B82A 4DC9A 2ZUCA 5E7IA 4QG7A 1NN5A 1RRCA 1W7AA 1E9AA 3I5XA 1RRGA 1Z0DA 2IHBA 3A4LA 4JKIA 4YONB 4NE2A 221PA 3L8ZA 2D7DA 3BB3A 1JEDA 1K5GA 1NSFA 3IIMA 4PO8A 4ZDJA 1E98A 2WWHA 4XTCS 4Q9IA 1BMFD 4UNRA 2P6NA 5FBVB 1XTRA 2H8KA 2WJHA 4PTLA 1ESMA 5BN5A 2OCYC 3SBDA 2BDTA 1P5ZB 1W4CA 1Z08A 2BM0A 4F4IA 1NLYA 1WE2A 1Z6YA 5EP2A 1LFDB 2ZI9A 1PZNA 3A4NA 3B2EA 4CGZA 1GITA 1MO6A 1QRAA 4B35A 3AQ4A 1YZQA 2V7QA 5AWFC 1NY5A 2ORVA 2ZJYA 1ZU5A 2XGJA 2QM7A 4M9SA 4DLYA 1R10A 4M4SA 2RGCA 3S1AB 2QRNA 3THXB 3I72A 2ZRJA 4DEXA 4E09A 1R2QA 1KI7A 3PEUA 5DIFA 2FFBA 1GDDA 2IXEA 3KKQA 3AVPA 4US2R 4FINA 3LXXA 1Y63A 3CX6A 3WRXC 1P2UA 1Z28A 3CPEA 3MCAA 1E9DA 3CW2A 2R6GA 3WHKA 1FQKA 2XOKD 3GLFA 4NYIR 1HEIA 1YU9A 3A1SA 5CB6A 5D3QA 3FGNA 1FW6A 2O0KA 4KBFA 4A6PA 2OLKA 2G83A 1EWQA 3RC8A 2ZJ5A 4JS0A 3GLIE 1H65A 3JVUA 2A7QA 4B2PA 5DLQC 3BB1A 3MLEA 1G3UA 2REOA 3IUYA 5HTKA 3X1XA 5CYOA 4HLUC 5CM9C 4JMPA 5JMTA 821PA 3SBEA 5DI3B 1G17A 4YLGA 5G53C 5K8LA 1U0HC 3A6PC 1XJ0A 2B8TA 2TMKA 1QG4A 4M1WA 3CKLA 1KMQA 2NIPA 2DFKB 4JT2A 1T0HB 1MABB 1P60A 3HU2A 3H2YA 1GKUB 3K09A 2QORA 1IQPA 3RRYA 3ASYA 1OKKD 5J5CA 3KDSE 1IJFA 3OEHA 4CT4B 2HXSA 2ZE7A 2OCAA 1N6IA 2O8BA 2DWQA 2WBLC 4CT5A 3CF2A 3VKWA 2IT1A 4DSTA 1XJCA 1YRAA 2RHMA 3UWKA 1E4VA 5JWOA 1XTJA 4CEIB 3WXMA 5BXQC 4IVQA 4NKRA 4KV9A 4Q4JA 3B6EA 5JCZA 5FPSA 3EA5A 1LS1A 4M22A 2ZI7A 2JIZA 5F98A 2ANCA 2XSZD 4LBZA 1U90A 4OHXA 3THYB 5HCNA 3EASA 1DELA 4IOKA 3WHLA 4PO9A 1X6VA 1RJ9A 2ZS7A 5KTYA 1Q20A 4X8HA 1KTVA 2XB4A 4BRUA 2YKGA 2A5GA 2ZU0C 3IQXA 3VNVA 4TTQA 2EFGA 2JJ2A 2G1KA 4KXFB 4X8LA 4YMSA 1NJGA 3OIVA 2ZE5A 1VG0B 1XEWY 1CXZA 2XJ4A 2I1QA 4JZKA 3DOEA 3K0FB 1AM4D 3FMOB 1A7JA 4D4JA 4AI6A 3HJNA 4IVRA 4QHYA 4UNPA 3DM5A 2IXFA 2GXAA 3FWYA 4TYWA 1G7CA 2WPDD 4JLJA 4AD8A 4PX9A 3L0IB 4TMXA 2FNAA 1Q21A 5CK4A 3SEAA 3IBGA 3SR0A 4OHZA 4B47A 3MG9A 4C0HA 2VHJA 1EFHA 1TF7A 1RW4A 1UDXA 1US8B 2NMVA 1KI9A 1Z06A 4LK2A 3SDZA 5HZKA 1SVLA 4R7ZA 3LXRA 3U4QB 2QL6A 3KXKA 2ZI5A 3RS7A 5J4HA 1JBKA 2QENA 3FMFA 4LV5B 1TUIA 4Q4LA 2EYUA 2GJKA 2ZM5A 1NVVQ 2AX4A 1ESNA 2WWYA 3LQQA 3K0AA 3U7GA 2PX3A 3FDIA 1SKQA 4NCNA 1FP6A 4PSAA 1MT0A 1U8AA 4URUR 1XMJA 1Z0AA 2WWGA 4JSYA 4RD3A 3AKCA 1KZ7B 5GVRA 4PZLA 2WOOA 1F3OA 3FMIA 2PLRA 4ZO4A 1KY3A 2BJWA 2KJQA 3V9PA 2CL6X 3GFPA 5KNDA 1XU4A 4NU0A 4M9XA 1BS1A 2VBCA 3RANA 3EWSA 2DFLA 4O2LA 1G8HA 5FOTA 5G3YA 5AUNB 4IHQA 3CZPA 4HZIA 3EARA 2GZAA 2CCJA 2MMCA 4HAXA 4R9UC 1R0WA 4P33A 1V43A 1W2HA 3LWNA 3T61A 1S1MA 1UKVY 2FSIA 3CRMA 1FMJA 2PMKA 3MAAC 1KNQA 2J9RA 1S3GA 4LHVA 2C99A 2V6IA 3C5HA 5EXTA 5A4JA 2BCGY 3QXJA 4DZZA 5HKKA 2H7VA 1I2MA 4O2RA 4M2LA 1UADA 1VTKA 3LDAA 1G5RA 4G1UC 1T3LA 721PA 4NCKA 1QHHA 3ETLA 2IS6A 2FWRA 1WF3A 1GRQA 2PH1A 2QQ0A 4FXPA 3T06B 3T1OA 5K8IA 2BOVA 3SI7A 1HY3A 3UK6A 2W2XA 4URZR 3JZMA 3AF0A 4PSKA 2P67A 4BFTA 4DCSA 3GJ8A 1ANKA 2Z0MA 2ZRCA 3H84A 3KXIA 3QI2A 1UDWA 1JEEA 4F91B 1A82A 1EFTA 1JJVA 3KQKA 1OH7A 3I8XA 3AB3A 2JLSA 1P7CA 3RDPA 3W6OA 2IYQA 4FMDF 1P2SA 4QRHA 2RGGA 4BASA 3OF5A 4NONA 5EXSA 1WBDA 2WWIA 1LB1B 3IGFA 1LW7A 5CIQA 3IBYA 4EDHA 1GL9B 1TU3A 3PG5A 3P4YA 3IEVA 2CCKA 2OXRA 5FI0B 5FOWA 1BMFA 3LA6A 1ZNWA 5GJBA 2KI5A 3CH4B 1W44A 2RGXA 1TQ6A 2A5JA 2WJJA 3QF4B 1ZM3A 2W2TA 1TX4B 1SXJB 2QT1A 3N2EA 3U7EB 4G5RA 4B3FX 2H16A 4QBHA 3ZDQA 3TSOA 4DBLC 1NJFA 2VHCA 1L2TA 1WB9A 4NTZA 4DJTA 5FPKA 1P62B 1ZD9A 4FWTA 2D62A 3MFYA 2J0UA 3U3KA 1H8HA 2I3BA 5LPNA 2IYUA 2W00A 3VR2A 2H57A 3ZS8A 3NHBA 1K8RA 2QMUA 4IDPA 1IN4A 1L8QA 3BORA 1ZIPA 4QL3A 2VP2A 2FJUA 3S1AA 4UXIA 2WSSA 5B30A 1P9NA 3CF0A 4LBVA 1JI0A 4WA7A 3U60B 4LUCA 5HPYB 2GK6A 1E2KA 1R5NA 4ZDWA 1VHLA 1X8KA 4QJ4A 3T5DA 1FL9A 1XWIA 5GJCA 2P65A 2FPKA 2HDNB 4JLKA 3WNDA 1AJEA 1WDTA 2ZPTX 3HPRA 1G6OA 4OJKA 4TQAA 2WKQA 3HU1A 3LVQE 3OFND 4YMUA 3CIOA 3TUZC 2VP5A 2G9NA 3KQUA 1W47A 1XTSA 2ZROA 3CX7A 4LJ6A 3TNFA 3ADDA 1XZPA 1A4RA 3PXGA 1PUJA 2CVHA 2ONKA 5JWHA 4P3YA 5DI3A 2OO7A 2PLFA 1MKYA 5KOYA 1JPNA 2FN4A 2LKCA 1T3SA 2BMDA 2DBYA 4U7DA 3I62A 1KMHB 4LYAA 1DG1G 521PA 4EPWA 1NMZA 5EQTA 1DVRA 1NP6A 1G3IA 2DFTA 2VP6A 4Q7KA 2OT3B 1OH6A 1NMYA 5L8VA 4O25A 3IO3A 5KUTA 1OKKA 1UBCA 3H1TA 3VX4A 1ZIOA 3WMGA 3RWOA 2XXAB 4LOAA 3FVQA 4HAYA 4TL8A 3VR4A 2QI9C 1FX0B 1XJQA 5HCIA 1XXHA 2D06A 4ILEA 5DYIA 1AS0A 1G4UR 1UPTA 4RFSB 5DGXA 1Q44A 4DDTA 5E3HA 1B0UA 1Q1EA 1E2LA 1SKYB 1SXJC 1Q22A 2RGNC 3K70B 2XEXA 3I61A 2W83A 2OBNA 3UMSA 1S9DA 2C9CA 1HE8B 4XVUA 1G6HA 1FP7A 1XEXB 1MO4A 2JATA 4Q1DA 4B2IA 1OH8A 1P9RA 2C98A 2VP0A 4EFLA 4GPTA 2FF7A 3EW9A 1Z29A 3GLIA 2JDID 2ZXUA 5KU1A 4QHTA 1XB2A 2P5TB 1TMKA 4KITB 2ZUDA 4V0OA 5BW8A 2VEDA 5FPYA 2J45A 3GEEA 4JBXA 2EFCB 1M7HA 3MJRA 3GLFE 1XFAA 4C9BA 3F5FA 1HH4A 3K0FA 3LAWA 1HUQA 1IJEA 4ARZB 4CRWB 3BBPA 1YZKA 1S8FA 2OE2A 3GMTA 1KKLA 4IDNA 1Q0UA 3Q5EA 2CLDX 3B8HA 2VSXA 3L43A 3B13B 4IDHA 2BIFA 3K0SA 4DSUA 4XWOA 4NZYA 2B92A 3SYLA 2RB4A 1GFIA 2J0SA 3SN6A 2P5SA 1EESA 3FTQA 4NCIA 4C0KA 3RRMA 2JCSA 1NKTA 2ZJ2A 4Q1AA 1CLUA 1AS2A 4TYPA 3KKOA 2QAJA 4WZ6A 1KI1A 1QVAA 4Q1EA 4OHVA 2NGRA 3REGA 2QBYB 1KAOA 4R2IA 2GK7A 2QGZA 3ZZTA 3U3JA 2IS2A 4GT1A 4K81B 1VYVA 1HT1E 1W1WA 1QHNA 4JIMA 4L15A 3WYGA 4M9ZA 1U8ZA 2ZJOA 4KSCA 1MRSA 1OJLA 2VHQA 1VDZA 1SVWA 2GEDA 2ZR9A 3EAQA 5EP1A 5CITA 2BKEA 2ZAMA 3WP0A 1J8YF 5G40A 4A0FA 2F9LA 1OT3A 2IEYA 2A5DA 5JI3E 121PA 1W48A 2Q3MA 2GRJA 2YC4C 4M1MA 2B8WA 2GCOB 3K0CC 1CF4A 1CBUA 4LY6A 4GBMA 3GFTA 4RD6A 4UNQA 2O8DB 3M6AA 3NC1C 4FW9A 2QMEA 1MO5A 2VP9A 3H86A 1VIAA 4FWIB 2ZS8A 2OM2A 5FBLB 5J4VA 4XIGS 5GADl 3PENA 4PAMA 3U3MA 3PIRA 4HUQB 1OYWA 4NYJR 3VQTA 2IYWA 1KSFX 3K70C 3EZ9A 2WM9B 4F4CA 2ZJ8A 1JB1A 1E94E 2QMOA 2XB2A 4I1VA 1IBRA 2FPMA 4EPRA 5BWMA 2AN9A 3B7GA 3X1DA 4KSBA 4DXAA 5L3VA 2ZYWX 3AEZA 5FOVA 1K5DA 3SHFA 3QG1A 1JR3A 1G1MA 1II9A 2Q9BA 3NDPA 3IHLA 4LJ9A 5B57C 4P0TA 5J4YA 3CH5A 4LPSA 1II0A 3CB4A 3DKPA 3FFAA 1Q12A 2BBWA 3A36A 4DT1B 1TQ4A 1R4AA 1NMXA 2VRWA 3CRW1 2MSCB 2JLVA 3H4MA 5SZJA 4BZQA 3I92A 3RLFA 2JIZD 3WRYC 2J0QA 2J7KA 4H1VA 2CXXA 4KCGA 1MH1A 2IYYA 4MITA 1RKBA 5KNCA 5DI9A 1DE0A 2O0HA 3FKQA 4BFWA 3BXZA 4PPGA 2B7BA 2GCPA 3ONWA 2C5LA 1UF9A 3CRQA 4LWZA 1UKEA 1F5NA 2JJ2D 3OIUA 4BLOA 1OSNA 3C5CA 4HB3A 4MDFA 4BPBA 2RGNA 3Q8XB 1SXJA 4MRRA 3QIAA 4DLSA 2X2EA 4KVAA 2R9VA 1W36B 2C96A 5J47A 4U5XA 4Q7JB 1CP2A 3WBKA 3AF3A 3K1JA 4NYMQ 2QP3A 3KQLA 4IFEA 1TTTA 2DCUA 3UXMA 4OK6A 4EAQA 4HZUB 4LBWA 2NO9A 3PR1A 3CBQA 3BAFA 4NCHA 4W9MC 4WXRA 4PC6A 3LVRE 3V00A 4D4LA 3IEUA 3QEOA 3R8CA 1CJTC 1U98A 2GETA 2RGBA 4CEHB 4F93B 1LNZA 2IL1A 2VO1A 2C77A 3BIFA 1GNRA 1JQJC 2GZHA 3FMPB 3QNUA 4OYHA 5TDHA 2O8FA 3AUXA 4HAZA 3ZD6A 3BJIC 5FR2A 4CIDA 3CPHA 3K9LA 4Z1MA 4BFSA 2FG5A 4OHYA 2BMJA 1JNYA 3MJHA 1I4DD 1N6HA 3OFNA 3TR0A 2UKDA 4TLCA 2FX3A 3AH8A 3MRSA 4OL0A 3HYTA 2F7SA 1BIFA 2ZANA 3OE7A 1XMSA 2RCNA 4C7OA 5B64A 3KKMA 4LJ4A 3QVVA 3DM9B 1XTQA 4TMKA 3TKLA 4TMWA 4OJQA 1QHGA 2Q21A 4OI1A 2JLRA 4AY2A 2IS4A 2QAGB 1QDEA 5D3MB 1DPFA 2OZEA 4RCZA 1X8LA 2X1VA 1OFUX 2HF8A 3DMDA 3W3ZB 2OCPA 1E2DA 3EPHA 5JEEA 4TLDA 4XJXA 3TW8B 1IXSB 1KSGA 3GLGA 2AXPA 1J8MF 5HKKD 1QHIA 3K0CA 4TL7A 2ZS9A 2J5XA 1FFHA 2XXAA 4TYNA 1UEJA 4AKHA 1U0JA 3UWOA 1FX0A 3NG1A 4JT4A 2NPIA 1N5JA 3IDQA 4XVQA 1EFRD 5HR5A 1XD9A 3W3AA 4B43A 4LJ8A 3A1WA 2CVFA 3NEJA 2ASEA 2Q3HA 2FE4A 1KO1A 1GSIA 1KAGA 4RD1A 4KBGA 2ZR7A 1EXMA 1W36C 5DO9A 1M8PA 2BM1A 2FH5B 1XEXA 1O3YA 1G5PA 3KL4A 2ZUBA 3U44B 1TQDA 2O5VA 3CNOA 2BKUA 4JLPA 3ZZ0A 2NZ8A 1TPZA 4HLCA 4XOIA 3TK1A 3FHCB 2JDIA 5AUQA 1IHUA 5F9HA 2AKAB 3GJ0A 3THOA 4BEJA 4Q4HB 2IEZA 2KWIA 5FFMA 1E2PA 1JPJA 1HV8A 2HV8A 5C18A 3SQWA 1H8EA 4PO1A 3A37A 4NL4H 4ARZA 2ZE8A 3REFA 2IW3A 1KY2A 1E9BA 4B74A 3CRVA 4OQXA 3Q72A 2YOGA 1X1SA 1NVUQ 3QKSA 4I99A 1OIWA 2OCBA 4O0MA 4BGDA 3FHOA 2GBLC 1ZJ6A 2IF2A 3GJ5A 3PUVA 5P21A 1H8HD 2NQ2C 1SVKA 3GJ4A 3TLXA 2FEOA 2AWOA 1OXVA 3ZQ6A 2QTHA 3QXXA 4B44A 4WZBE 1KI6A 3CM0A 4IDOA 4PC1A 4WIAA 2XX3A 5L3RA 4UXJA 3ICQB 4IOJA 3DKVA 1N2CE 2AK3A 3AKDA 2IWHA 1ZBDA 2GXUA 3EZFA 3SFZA 2WSSD 3BRWD 1KZGB 4EPXA 2DWOA 2QEQA 2ZE6A 3WMEA 4GOXA 2A3RA 3N70A 2QAGC 3BH6A 2IA5A 4URXR 2VPPA 3EC2A 1XXHE 3W6NA 4X8MA 5TV2A 2GXQA 4JLAA 5C1BA 3TQCA 3U7FB 2HT6A 3KB2A 2P6RA 2KBFA 3L8YA 4YDSA 3MD0A 4GP7A 2HYIC 2ZETA 2OFXA 1M74A 3L2OB 4Q1FA 2CK3A 3MMPA 1YJ5A 1NLZA 3JVVA 3O8BA 1M6NA 2HXYA 3Q7PA 3VTKA 1T5IA 4PAOA 2IBMA 2IWRA 4DIEA 4AWXA 1KDOA 1KYIA 1XEFA 2PT7A 3K53A 4LJAA 1A2KC 1E2JA 2A2ZA 4Q9JA 5JJKA 4FCTA 4MKHA 3QXSA 3U61B 2AL7A 1W4AA 2ZJZA 3ZJYA 4MRSA 3RHFA 4URWR 1G21E 1OF1A 1XCPA 5LB4A 1RE0A 4KFRA 1QF9A 1YR6A 4C0JA 1GNQA 4TZ0A 1QVRA 2Q0HA 2KBEA 2BCJQ 4KLNA 1TF2A 2QU8A 2ZR0A 2ZU6A 1VHTA 2XNDA 2W2VA 1D9XA 1NSTA 2EVWX 1ELOA 4PC2A 4MRPA 1Q3TA 2E9SA 5SZIA 3U3RA 4BECA 4AG6A 2GJ9A 3ZS9A 1ONBA 3CO5A 1XNJA 5DHAA 4ASUA 5EJEA 5KSYA 3T1TA 1R5BA 2R6DA 4G0NA 3TUJC 1X1RA 4M1TA 3GPLA 3VAAA 1F2TB 4PXAA 3AP3A 3RS4A 1Q1BA 3FB4A 3L0PA 3W9YA 3SU8A 5C4MA 3TGPA 1CR2A 3EIEA 4BFZA 2CLCX 1UEIA 1R0YA 1W5SA 3QKRB 3TIFA 1PUIA 4Q02A 1AK2A 4BLSA 1ZAKA 3V4RA 3K0EA 4KFSA 4LZZA 2BWJA 1W0JA 2P3SA 4QBFA 1OFIA 3EIQA 2XTZA 4N1AA 3EXAA 4BEBA 5TVKA 4B34A 1G20E 3F8TA 2JJ8A 5GJVC 2WWFA 6Q21A 3NH6A 1RYFA 4UXHA 4A8JB 3QVUA 4FIDA 4E07A 1COWA 3PEYA 1T4GA 2WV9A 3IQWA 1G18A 2HLDA 3SJCA 2V1UA 1RC8A 2L0XA 4MH0R 1M7GA 2W0SA 3DHWC 1GUAA 1E1RD 2CJWA 2HUPA 4P4SB 1Z2AA 4OQLA 4ITRC 2O52A 2CL7X 2GF9A 4LYFA 3SFVA 4DRZA 1PLLA 4QC2A 1CR0A 1IY0A 3SNHA 1NY6A 2FZLA 4QGGA 3QXHA 5KDDA 3G0HA 1DG3A 1P61B 2ZQ5A 1JALA 5TB5A 4W7SA 3P32A 4MGKR 4A0GA 3B1WA 1E0JA 3BFVA 2WZQA 3LW8A 4F38A 3Q85A 4ZDKA 2HT1A 3TMKA 4MUAA 2IF0A 1G64A 5FTNA 4GSYA 1JR3E 2FEMA 2WICA 4DSOA 1ZD8A 2GBLA 1OYYA 1NI3A 3LD9A 2WAYA 1D6JA 3B1ZA 4TMVA 2YC2C 3EX7C 3THWA 5AJVB 3CR7A 1YR8A 2R2AA 4DDVA 4AC9A 1KNXA 2CLSA 1ETUA 2GAOA 2ZRDA 3AVWA 4PC3A 3GFOA 3QQ5A 4LJ7A 2Q3FA 3GJXC 1ODFA 1DAMA 4OK5A 1E2QA 1S2MA 1YZGA 3QUSA 1DBSA 4ON9A 4EJSB 4WOPA 3KQHA 3PEWA 4LYHA 4LDJA 3SE0A 1BH2A 1GG2A 1P72A 1TAGA 4M8NE 1CR1A 2IC5A 4WW0A 3Q3JB 4QGHA 4US1R 1SXJE 1XX6A 2AHOA 4HYYA 1N6NA 1TUEA 2BC9A 1KI2A 3MWYW 3GJ7A 4TL6A 3AF1A 4URYR 2MMGA 3RSOA 4A15A 4QGAA 1E2GA 5CLLA 1KSHA 4HLQB 1Z22A 1JR3D 3LV8A 3PVSA 1J99A 2YJTD 4IXMA 4LI0A 4V0KA 1OB5A 1EFRA 4HLUA 2JLQA 1ZMXA 1F2UB 2V4ZA 2MSDB 1ZD1A 4Q4AB 1D2NA 4A8JC 3GEIA 2I4IA 4L5BA 4D26A 5JJLA 3I8SA 2OFOA 3NDBB 4JJKA 3EPKA 5JWRA 2DYKA 3KQNA 3HYRA 4URVR 2QT0A 4LCBA 5J4KA 4NYIQ 3RNLA 1IN8A 4PHGA 4B73A 1ZW6A 2YZ2A 1V5WA 5KPJA 2H18A 1SVMA 5FOUA 5IK2D 1GVNB 3OEEA 5DSZA 4A2PA 4M1OA 5IT5A 2OHFA 3G5UA 1IXRC 4UJ3A 5H1YA 3GQBA 1U2RA 3SZRA 2FFAA 4HAVA 5EZ6B 5FL7D 2ONJA 3KJEA 3E70C 1SXJD 3Q7QA 4UNSA 4DDWA 5EUMA 1XPRA 1P73A 3RSLA 1E1QA 1VG9B 2PX0A 4I1SA 4HB0A 3QSYA 2C04A 2BV3A 3B60A 1U99A 4AK9A 2J59A 2OLJA 5ELXA 1MOZA 4B75A 3B9PA 5FUYA 4M1YA 2PMDA 1AGPA 3VHLB 3A58B 5C2JB 5L3SB 1Z3IX 3W8RA 4BFYA 3LBNA 3ZGXA 2OSBA 1UAAA 3GLGE 3FPAA 3EG5A 1Z6XA 1NLFA 2NO1A 5FUVA 3T35A 2YWHA 1FZQA 3AKYA 3HR7A 4IFBA 3T5GA 3THXA 3DPUA 3LQRA 4L8GA 2VH5R 3PUWA 3Q9LA 3U6BA 1AQUA 3NEYA 4EJSC 1SVOA 3LW7A 4M1SA 1SQ5A 2QNRA 2DPXA 4ZCIA 4ZI2A 1B23P 3GCGA 4FCWA 4TQ9A 2ECKA 2ORWA 4C30A 5G41A 4JKYA 2JJ1A 2ZJBA 4N3NA 2OG2A 3C41J 3T34A 2QM8A 4DCUA 5JHHB 3M1IA 4ZIRB 1DO2A 4PR0A 3HP1A 3W5JA 1I4TD 1SKYE 1ZVQA 1G7RA 2WKRA 3M4YA 3R7WB 4B71A 4Z1MD 1P9WA 3ZIAA 1OIVA 4DCVA 5CDFA 4W5HA 1LF5A 2CBZA 4M53A 4GZLA 3RS2A 2W6IA 4DDUA 1QHXA 1YR7A 3OE7D 4R2HA 5JI2E 1NF3A 2JLZA 2BMEA 3IPXA 4KAXA 2NPFA 5H8WA 2BEJA 2FZ4A 3F3YA 3PITA 4Y0VA 4BZPA 3GJ6A 1R5OA 1O87A 4I1OA 3U2QA 1DTSA 1UFQA 1SHZA 1N6LA 4PZZA 4EQ6B 3LX8A 1CIPA 2IXGA 4EIWA 4MYUA 1XDBA 1MABA 1TNDA 1D9ZA 1M34E 3VR1A 2JAQA 3EA0A 2QPOA 5TMPA 2ZSAA 2YOFA 3GLHB 2HYDA 2ODWA 1E9SA 2GVZC 5LBIA 4MYTA 4JLOA 5M04A 1G3RA 3QE0A 2V9PA 5DHFA 4MYCA 5C46F 2GILA 4DKXA 4PZYA 4OBEA 4EPTA 4QM6A 1ZNXA 4JL5A 4I81A 4TL9A 3TRFA 5FL3A 1E9CA 3BFXA 2JLXA 3PJRA 3NXSA 2XZPA 4CEIA 1TADA 2ZRBA 3K70D 4JVSB 1F2TA 1CJKC 4BQSA 3AVOA 2D7CA 1QG2A 4A2QA 4QM7A 4B32A 3THYA 1KK3A 2O8CB 2CNWA 3RC3A 2EW1A 2VSOA 4Z54A 2AFHE 3PQCA 3DZDA 4PQRA 3GEHA 2NTYC 3EIHA 1FUUA 5KDLA 1GL7A 4GMDA 1E0AA 4D0LB 4JBWA 1S9HA 3L0SA 1H8ED 2C2HA 4H1UA 4ZI3A 4A8JA 3DZ8A 3CNNA 5KDOA 3VR6A 1OXXK 4OI2A 4G01B 3AVTA 1OH5A 1EGAA 1JXMA 2HJVA 3O8DA 3WNCA 2RKOA 4GNKA 2JLWA 2ZI4A 1QHYA 1ZC3A 2ZIAA 4MUBA 4MYHA 4V0ME 1E1RA 1JQLB 2E1RA 5E4FA 1GWNA 2DWPA 4DVGA 2F3TA 2GEVA 3TUIC 1UBFA 3P27A 1US8A 1P6XA 1CEEA 1HA3A 2EU8A 1GL6A 1TF5A 2CCGA 1IOZA 2V8OA 4XTRA 4D0GA 3U4QA 2WJYA 1G4AE 3VX3A 4BLRA 2ZRFA 1P3JA 4TWZA 5CK5A 1KJYA 1GIAA 1G3QA 2FSGA 2QG6A 4TT3A 3HWSA 3O8CA 1E9RA 1ZNYA 1Z8FA 4M0LA 2G3YA 5EZ5A 4YDHB 1OXUA 3QY0A 4CDGA 4L4UA 2GDJA 4U00A 3TAUA 5AUOB 3A1TA 1G291 4WAUA 2CK3D 2F1JA 2QROA 2YWFA 3OESA 2GAAA 1IONA 1VCMA 2REBA 1Z0KA 2ZAOA 4FMCB 2R6FA 1G8GA 2ZRKA 2Z83A 3WNBA 4EJSA 3LNCA 1XZQA 1HT2E 1ZP6A 3ND8A 3PFIA 1KK0A 1S4QA 2D2FA 2F1HA 4Q5IA 3X1WA 4A6XA 3I4LA 3TJZA 3G82C 3ADBA 2EFDB 3B5JA 1KDTA 1E2NA 1ZINA 2VSFA 2XNSA 2GTPA 1Z0IA 1PV4A 1DAHA 2B7CA 1GOTA 5AK0A 5KNBA 2W0MA 4DLXA 2DHRA 2ZYUX 1BO6A 2F3RA 4KHZA 4M1KA 2RGDA 5BYKA 5AJZA 4AKGA 1PJRA 3C15C 1DOAA 3W90A 2NO6A 3UPUA 4AKEA 2XNDD 3QBVA 5CM8B 1OLOA 2B21A 1S3SA 2XJ9A 3SHWA 1DAGA 1DEKA 5CB8A 1XPUA 2EFEB 1F2UA 3J81k 4Q4AA 2LCFA 2WSMA 4ASUD 4KLZA 3ZVMA 1ZM4A 3I1FA 1R6BX 4JLBA 4A1FA 3KJGA 2AKYA 1KJWA 1TQ2A 1OFTA 4PPFA 5DISB 1KDPA 5FR1A 4QGFA 1Q1QA 4PPNA 2G77B 2Q9CA 4A2WA 1IN6A 1XBTA 4G5QA 4E5UA 2JLUA 4MKIA 4HAWA 1KGDA 2YINC 5IK2A 2GXSA 2RMKA 1ZUIA 3B1VA 4A9AA 3WMFA 4KFUA 3A1UA 1LTQA 1W0JD 1OE0A 4DEYA 5JZVA 2FGKA 2HCBA 1RYHA 1LS6A 5FTKA 3QF4A 5TARA 2XAUA 5FL7A 3OAAA 5LB2A 2ORIA 2LKDA 1CU1A 1W36D 1VIYA 2P6UA 4Q4JB 1AKYA 1COWD 3MSXA 4PHTA 2QE7A 1T0JB 2HLDD 4XWKA 3D3QA 2GCNA 4B2LA 5KHOC 1DADA 3SYKA 1PVOA 1W4RA 4B48A 2CHVA 4LSGA 3B78A 4C0QC 1FTNA 3BE4A 2GZDA 5L3SA 5FH9A 3JZAA 3TAHA 1BKDR 2EWWA 3PUYA 1Z0JA 2R65A 1HURA 4QJ3A 1G41A 1NN0A 5K8TA 1U94A 2GA8A 2WJGA 1SGWA 1KIMA 3VFDA 5TXGA 3TSZA 4B76A 4MKGA 2ODNA 1JAIA 1ZM9A 3K9NA 4IOLA 4LC1A 2CE7A 3NVAA 4MRVA 3FFBA 4C2TA 5CJ2A 5H68A 4MA4A 5FPHA 3WBJA 4A92A 4RD2A 4RSGA 3ZZUA 4ZPXA 4QOSA 4B33A 1KJZA 2WMOB 4RY2A 1GZSA 3LLMA 4US0R 1CULC 3AUYA 1LV7A 1EFUA 1IY1A 1IAQA 5JEDA 4XVRA 1U9IC 4FMBB 2H5EA 1FUKA 5CIWA 1IN5A 3VKGA 3UG6A 3CZQA 4I4LA 1KK1A 3BOSA 2X8AA 4KFTA 3X1ZA 3TR5A 4JYBA 5AJWA 5JSZB 3L0OA 1GKYA 2J41A 1EK0A 4BFUA 4Q1BA 5B2ZA 2R44A 4N0EA 4X8OA 1KMHA 5IHPA 4YXWA 3LFUA 1U81A 2G6BA 4TMTA 1U8YA 2EWVA 1W0KA 4V03A 3BB4A 4IKEA 1C1YA 3KX2A 2ODBA 1A1VA 3CR8A 3GLHA 3K09C 3IKJA 2IUSA 1CS4C 1ZYUA 1S96A 2QSZA 3X2SA 3CUEF 4XD7D 5F3WB 2J3EA 3HPQA 1RFLA 1ZM7A 2IK8A 2QPTA 2WVJA 1FPMA 1YHNA 4HSEA 4J0QA 4A0HA 2OUKA 3BD9A 1GAJA 3VR5A 2K5UA 1FQJA 1E69A 4Q7MB 4RFSA 5JRZA 2BBOA 5JS8A 4RZ2A 2YWEA 2YNMA 3R20A 4RJLA 5EE0A 2ODEA 3U7HB 1E2FA 5BYJA 4OHWA 1OFHA 4LGMA 3SYNA 4LBYA 1L4YA 1R7RA 3ZVLA 5JBQA 2NOAA 2PZFA 2GHIA 1EG7A 4JL8A 4DUGA 4Q66C 4Q01A 4NCJA 1T5LA 2VP4A 3OEED 4Q9LA 1Z2CA 2GJSA 5CDFE 2W6JD 4BUJA 4D82A 3KUDA 4W5JA 3LH5A 2OBMA 4NYJQ 4HDQB 5B58C 5JLJA 4HAUA 4WXPA 1NVVR 2XTMA 2ZRMA 1E1QD 3KXLA 2F43B 1HQYE 4JVMA 4KJZA 4M9QA 5FUWA 3LO5A 2RH5A 4TZ6A 4ABYA 1CJMA 4Q18A 2PJZA 1W49A 2GEUA 1WMSA 2IUTA 1XMVA 5AR1A 1NG9A 1MRNA 3B1XA 4RZ3A 1N3BA 1P2TA 1XCMA 4IEIA 5UKDA 2J87A 2D4HA 5FPTA 3ZH9B 4B6EA 4RKEA 4TYQA 1XD8A 4HI0E 2QBYA 3EWAA 4EFNA 3H0KA 2ZRGA 1II8B 3ZVRA 1IM2A 5JECA 1CRPA 3DVLA 4HATA 2EQBA 3RAPR 4QJ5A 5BN3A 3C16C 2JJ1D 4LHXA 5GJWC 5DN6A 3TSWA 1N5IA 1YZNA 1S1CA 4TLEA 2J0UB 1KO7A 4AURA 2R6CA 2PL3A 4HB2A 3MWLA 1WP9A 3P26A 3RABA 3AVQA 2Q6TA 3ZIAD 4CW7A 4RVCA 4K8OA 4NPHA 4AIIA 2QA5A 4C0SA 1VMAA 2ZRAA 2GCOA 5FTJA 4ERNA 621PA 3ADKA 1AIPA 1GILA 1UBEA 2W6ID 3CLVA 1QHSA 2O8DA 2J7PA 4Z51A 1VYTA 1Z6GA 3QEJA 1R0XA 2KB0A 1J7KA 3HDTA 1WA5A 1KDRA 1XP8A 2DFNA 2JLYA 2WWXA 5H70A 1KO5A 1YR9A 2RHDA 4PQFA 4V0MA 4DWJA 4HUQA 5KPDA 1KKMA 4BLQA 3WYFA 1AZSC 3FHTA 1HQCA 2IYXA 4BFXA 1C4OA 4K46A 4KYUA 5J4LA 4BLTA 3T15A 2QP9X 4AYTA 4JLMA 4LYJA 3NC0C 3NWJA 2Z5FA 3UG7A 1YZTA 4C0LA 1DAIA 2QTVB 5HE9A 2QP4A 5KYKA 1U9IA 3CF6R 4LX0A 1NG1A 5HZHA 3R9WA 3BFKA 1WBBA 3CRRA 3D8BA 2VYFA 4GDFA 3KB1A 4G3XA 4JSTA 4OQFA 3NBZC 2GESA 4Q48A 1NVWQ 4V02A 2ERYA 1Z6AA 3AGPA 2UZIR 2CEAA 4DT1A 1TL7C 2Y8EA 3A8TA 5LD2B 3CWZA 3EZ6A 5HE8A 1ZC4A 3ZVNA 2OAP1 2ZRHA 1NNEA 1XCGB 2D74A 1J2JA 2H92A 1NBMA 3AF2A 3ECCA 3OZXA 4PANA 5KSOA 4JLNA 2H17A 2CNWD 2D3WA 4N0DA 4EKDA 1NL3A 5ANRB 1N0VC 3RS3A 5G3ZA 4KODA 1GM5A 4D81A 1G8FA 1XRJA 4GL2A 2AWNA 3IO5A 2AXNA 3IHWA 3NTUA 1XXHB 4NP6A 4EPVA 5EP4A 2XZLA 5EE1A 3AP1A 5SZKB 3TBKA 1N6OA 1SHKA 3TE6A 5TY0A 3A4MA 4YMVA 3ND9A 1GKIA 2BMFA 3CPJB 4PFSA 1NKSA 3WP1B 1E79A 3AKEA 1EX6A 8OHMA 1Q1ZA 4HZUA 3OHMA 1JJ7A 5BQ5A 3K9HA 4EPYA 1Z6TA 2FSHA 2OAQ1 5L3QA 1U0LA 3GLIB 4GOJA 1K6MA 5AJXA 3PV0A 4JJZA 2QPAA 3BH0A 4I1UA 3U3OA 3EPLA 1E9EA 5FBWB 2R62A 5DE3A 1YQTA 3FKSA 3E1SA 1RRPA 3I73A 4ZV4A 4CF7A 4CEHA 1DAFA 2G88A 4ACBA 4FMCF 3QF7A 4A36A 4D4KA 4UJ5A 4WBSA 1FNMA 2WJIA 4UNNA 4XWAA 5A5GA 3AVVA 3DDCA 3VNUA 1JECA 1MR3F 4TT3D 2REXB 5CJPA 2QMHA 2X19A 1ZRHA 2DY1A 4HDCA 3TH5A 3CONA 4PPQA 2W58A 4Y0AA 1TU4A 3BWDD 4NHOA 2WIAA 2XTNA 1JAHA 2ZTSA 3R9XA 2A30A 3ZLJA 2FFQA 4KU4A 1XTKA 4E03A 2FPLA 4JBYA 1Y3AA 1DS6A 4OKSA 1EWRA 5FTMA 3N5CA 4QNMA 3UATA 5JSZA 4BE7B 2QAGA 1KI3A 3QENA 3WY9A 5D3MA 1Z83A 1XD2B 1KO4A 5JJIA 1E2MA 2BBTA 4POAA 1I2DA 3HU3A 5LD2C 1A5TA 2WIBA 3KTAB 3OIYA 3I3SR 2KE5A 2QGNA 4D25A 1G7TA 1AZTA 4QKQA 2N46A 3N2IA 1J90A 3EC1A 2IUUA 3B9QA 1VG8A 1CJVC 1Z07A 2FU5C 2YYZA 4FN5A 4B3GA 1M7BA 4C0BA 4R71A 4XD7A 5KO2A 2NO0A 4XSGA 4D6PA 3UIEA 2DB3A 1N6KA 2QZ4A 2I1VB 3A1VA 4GMXA 1PLJA 4TSFD 4DLWA 2VF7A 4NBSA 1C9KA 4P4TA 4MKFA 5L3QB 4PSVA 3SQXA 4OK3A 4MQBA 2BJVA 2JASA 4WZAE 4AG5A 5JRJA 3EPJA 1RPZA 2HF9A 1RZ3A 1W5TA 2O0JA 1FNNA 3QPUA 4ESVA 3ZD7A 4F4JA 1OV4A 2V54A 3K8YA 4Q00A 3ICEA 1MV5A 2CHGA 4LHZA 4P4UA 2YVUA 3U44A 3LX5A 1VCIA 3SJZA 3RS5A 1CTQA 2OFWA 2FFHA 2UVQA 4XSHA 1KO8A 4ZDIA 4PAQA 3GP8A 1E9FA 2KSQA 4B3BA 1J70A 1KI8A 2VQSA 2ZVPX 4A4DA 4DB2A 1HYQA 1N5LA 4Q4HA 2X2FA 2AD1A 1AQYA 4A0RA 4Q9KA 3FYHA 2W6JA 4C4PA 1UKZA 1W4BA 3M0EA 3FE2A 1R8SA 4F7WA 3OAAD 3TW4A 1M1YE 3LRPA 4E22A 4YMTA 2FGJA 2RAPA 2F43A 4BZXA 2NZJA 4BFVA 4JVNA 4CVNA 2QE7D 1T6NA 1SZPA 3VMFA 1EX7A 2OILA 3VR3A 2G1JA 3CX8A 1N0WA 3UMFA 4HEJA 2OEPA 2E87A 5GVSA 2IYSA 4QBGB 5EXPA 4IVPA 2G0NA 2ZYTX 4TMZA 3GLHE 5FBRB 2Z43A 3KJIA 1DAEA 3C8UA 1JR6A 3B1YA 1GRNA 4L16A 5E7JA 2IS1A 4B3DA 1II8A 3BS4A 4JL6A 4UKDA 1VKJA 4IRUB 4V0NA 1E4YA 1GRRA 1E3MA 3MGCA 1Q57A 4LHYA 3AVYA 3ASZA 3SJBA 2CDNA 4MRNA 3QJYA 2AK2A 1NVXQ 1RIFA 2C03A 2V6JA 1TEVA 4IXNA 2VA8A 3UKDA 4FD2A 4IDQA 4DLVA 4WVFA 2B6HA 2CMKA 4TTPA 2FSFA 3ZQJA 3CWQA 4KYIB 1N5KA 2FMXA 1OW3B 2WMNB 1N6PA 3TQFA 2J46A 2O8FB 3L82B 4BWYA 3SOPA 3RS0A 3QPWA 2N1BA 1G8YA 2PZEA 2RGEA 2WHXA 4PQYA 1ZNZA 4A82A 4QNRA 3AVUA 4TYYA 1OHHD 2J0VA 1OB2A 4O3MA 2PT5A 1T3HA 2JGNA 4YXWD 4QBIA 3CNLA 4TLAA 4CEJB 1GP2A 4M21A 4Q9HA 2A9KA 3VU9B 1E32A 2XOKA 1W0KD 3PEVA 1G3MA 2CE2X 4IOMA 2QTFA 4YMWA 3LBHA 1G7SA 4Q03A 2ZREA 4B3XA 2JEOA 1ZU4A 2PCLA 4LV6A 4C7OB 4IJMA 3UMRA 4V0LA 2RGAA 3DOFA 4B6FA 4D4MA 3TVTA 1SVIA 2D2EA 2ATXA 2WTUA 4RD4A 5JS7A 2IHYA 3QOFA 2NO7A 4C0AC 4ZKEA 4C2UA 3R9IA 4H9GA 5C4GB 4NYMR 1E6CA 2SHKA 3DL0A 4OQMA 5F2EA 4DSNA 3P1JA 4P31A 2ZJAA 2PEZA 3W34A 4S2EA 5FTLA 5FI1B 1BOFA 1R8QA 5DYGA 3GLGB 5JHGB 3QKRA 4GOKA 1AN0A 1N25A 3IIJA 1W2GA 2FV8A 1VYUA 1E96A 3NKVA 4GRAA 2J1LA 3D7MA 2ZVQX 4DUGD 1E0KA 3NH9A 2F6RA 2O8EB 2GWHA 2ZSEA 1KSJA 2ZI3A 3KFXA 2C78A 1UKYA 2C95A 3LLUA 2ZEJA 3R8FA 1KI4A 1XMIA 3BH7A 3E5HA 4S35A 4IEEA 2FDCA 3X1YA 4EUNA 3W5IA 4HLDA 2Q9AA 2YHSA 2XSZA 2V55B 2N42A 5CLQA 2HEIA 2ZRNA 4RZUA 3K9GA 3QG5A 1AS3A 1L4UA 4P4SA 4LRWA 4EFMA 3D31A 2OESA 5DH9A 2GF0A 1T8UA 1OPXA 4OI4A 4DHEA 5AUPB 2P2LA 4NDZA 3AM1A 1D8TA 1PLKA 4II7A 2GJAA 4YQFA 5EE9A 3RVBA 4QXAA 1DO0A 4UQOA 3I32A 4F92B 3HR8A 3NHAA 4AYXA 2C8VA 3QBTA 1E2EA 3KFVA 4G5GA 2IYRA 3QKSB 3O8RA 2IYVA 1WXQA 2ERXA 4P32A 1UBGA 3GJ3A 5IF9A 1G9XA 3LBIA 3IPYA 1Q3HA 1I4LD 1YRBA 2WPDA 1N6RA 3T1QA 5DN6D 5E95A 1GNPA 1G5TA 1R0ZA 4NH0A 2A5YB 4IW3B 5EE3A 1RRFA 3W6PA 1XTIA 2JA1A 3W8NA 1ZUNB 2AFIE 3T12A 3EZ7A 2EFHB 4MGZR 2VHTA 1KI6B 2V7QD 1ZM2A 2PZGA 4BLPA 1NBME 3PUXA 5EUQB 4LC0A 1NIJA 3LY5A 3FOZA 1UM8A 1T91A 2ANBA 2VIIA 1HE1C 1X3SA 421PA 1XPOA 2J7PD 4QHSA 4HUTA 3C7KA 3I5YA 1XF9A 2ZYVX 3B85A 3U5ZB 4PC7A 1TEXA 1XD2A 4Z8XA 2FA9A 2C9YA 1SULA 1QBKC 1FTSA 1N0UA 2Z4SA 3NBXX 3KTAA 1M2OB 4XH9B 3PCRB 1F6BA 5KSZA 1HTWA 4D2IA 3WYAA 5E7MA 1S0UA 2Z6VA 2VF8A 3U6KA 2QRZA 1Z5ZA 2ZRIA 4AYWA 1KK2A 2F55A 1VCOA 2VHUA 5KSPA 3GLFB 1Z0FA 3P20A 2CL0X 2AR7A 2X77A 4AKIA 1KHTA 4GI7A 4L9WA 2WWWA 2ZRPA 5JFGA 3PUZA 4TSFA 2R6AA 2V3CC 5BN4A 4FI3C 4ZKDA 1D2MA 1YVDA 3TVDA 1VCNA 2IYZA 4B3CA 1E0SA 2XITA 1VG1A 2WOJA 1LY1A 1A2BA 1ZCBA 4CZ2A 4TTRA 1LF0A 4TLBA 4RFVA 3KKNA 4CYMA 2IYLD 3IILA 4ZCLA 2VL7A 3RYTC 1NBMD 2GJ8A 1WQ1R 2CHQA 2YV5A 5A0FA 1KOFA 2G0TA 3EZ2A 3OEHD 1CRQA 1X86B 1GTVA 1L7VC 1NN3A 1EFCA 1X8JA 4TN1A 2F1RA 2UZ3A 4W5WA 3IIKA 5JCPA 1G16A 2O8BB 1T8TA 1NN1A 3AV0B 1BYIA 2V1XA 1IN7A 5LDDC 4RD0A 3BERA 2QQEA 2QUZA 2ZITA 4GZMA 1VPLA 3P4XA 2AD5A 3SS8A
chains in the Genus database with same CATH superfamily
2Q7XA 2W2PA 1LVGA 4DLUA 3DO6A 3WQSB 5EWMA 2QSYA 5EP3A 4G5OA 5F64A 4RLFA 3NHYA 3STHA 2DG2A 4EF6A 1K8QA 1AUOA 3NBYC 4PGMA 4LPKA 3VR5H 4LF5B 1M2HA 1Z47A 3GK3A 3NBFA 3ZG6A 4RCYA 4KMMA 5FEUA 4KVGA 4ARVA 1G0NA 3GD7A 3HDVA 3FDZA 1GYQA 3E3LA 3FUUA 3SX4A 1MN6A 3HFGA 1E2IA 4PLWA 5ALLA 4U7TB 1AKQA 2PLNA 2ZBPA 5H4HA 3VV3A 5A0TA 2LCIA 1JGTA 1TTPB 4QSMA 1CR4A 4PHHA 2OXCA 3QA3E 1E77A 2WKPA 3FJOA 3AR3A 1UQTA 2GSWA 2HCJB 2P7IA 2VTKA 3AR8A 3QKTA 1ISGA 4ESHA 4M89A 2EHJA 1MAWA 4F2WA 3ABIA 3IC5A 1AKWA 2F59A 4ZIRA 3CN9A 3K8OE 4KP7A 1ZKDA 2M32A 2WJVA 1DIGA 3G2KA 1NZFA 2GNOA 3HBAA 5CLGA 5CB4B 3R7WA 4P0QB 5IT4A 3PP8A 3PI6A 1H66A 4PLFA 3UJPA 5HF6A 3SIPA 2R8XA 1NHGA 4LV8B 2WIKA 4L9RA 3KZNA 5KAPA 2R8PA 3HCBA 5EJ7A 3VBEA 2FMHA 1E1YA 3TM4A 1M2NA 1UJ2A 3EGEA 2F1OA 1J97A 1OX5A 4Q47A 2QJRA 4X3PA 1MO2A 3T7CA 2WWRA 3T99A 5HZMA 1M1YA 1MD9A 1E2HA 1Z6ZA 3GA5A 2Q5LA 1HNNA 4XX0A 3I9V6 4NABA 2LUOA 3FKJA 4P7GA 1TUBA 3CY6A 3KSDO 3ZYCA 2GVDC 3UTDA 1ZN7A 3KR2A 1UP6A 3EFHA 3PDCA 4YREA 1J20A 2VZEA 2VJOA 3MWDA 1SVSA 5E1DA 1WWKA 2OA0A 4DIKA 2AZXA 3N1UA 2PSJA 4MGYR 1YB5A 3FM9A 2C59A 1HEUA 4JLVA 3WL4A 1TIKA 3NLLA 3ZV7A 1T36B 1I80A 3VHXA 1XROA 3QEKA 4MQLA 1A7UA 4IX9A 4YDRA 3RS9A 1WZNA 4DIDA 1A27A 1P4SA 1UEXC 3AVXA 4G5SA 3EBPA 5CBPB 2BYTA 4BNUA 1HORA 3QPVA 2OZLA 4WBNB 5CYPA 4Z53A 4DA4A 1O7JA 2H1LA 1JG3A 1S2IA 4RPJA 4OF4A 1Q95A 1W9MA 2A4KA 3E05A 2IPAB 3TZCA 2VR1A 2L69A 3V4FA 2Y1KA 4MCAA 4YO8A 4NMMA 3L8MA 4QXMA 4JI0B 2DHEA 4FYWA 4YRBA 4XQ0A 1RP1A 3NM6B 2GZ3A 2CXUA 5IRCD 3GLUA 3G2HA 1FFXB 2W93A 4IIGA 1U1FA 1E7WA 1U7PA 2O48X 4KQKA 5EFOA 3C14C 2FKAA 3MXOA 1RFGE 4L4ZA 4QTUB 1N1GA 4AUKA 1XYGA 1V48A 4B2LA 2O8EA 1AGRA 2Q2NA 3PNQA 1QHHB 3NPAA 1ZGBA 4TQGA 4AF7A 5FUXA 4FPXA 4J94A 1DC6A 1M67A 3RWMB 2OLEA 3ESDA 2NUPB 3K9WA 4AZWA 4BMZA 3AUTA 3DC7A 2IX3A 2Z4RA 3K8QA 3S5JA 1NRJB 2ATVA 3DEFA 1VSQA 2Q7DA 2F4VB 2H85A 1WSWA 2AVNA 1GNLA 3MWEA 4IIEA 1Q0PA 5BSTA 3U4GA 4UTZA 4Y98A 2GBFA 1RRCA 4JJEA 2PIDA 4K1XA 3LC2O 1W7AA 1E9AA 2G8LA 4GX5A 2IHBA 1MVLA 1ZD5A 1M2FA 3A4LA 4OSPA 4YONB 5HIMA 1XDUA 221PA 4NE2A 4EYQA 4F86A 4RJTA 3ADOA 3BB3A 1JEDA 4QUAA 4R7GA 4BO6A 5D5PA 1MX9A 1SZJG 4E0BA 1IZ9A 3IIMA 5J63A 4G0VA 1E98A 4DJDC 3IP3A 3O75A 3T54A 1OD6A 5IS2A 4EFDA 3K1YA 2WJHA 1ENYA 2NVOA 1BROA 4PYRA 2G09A 1H2EA 2ZZNA 1QZTA 3UV7A 1P5ZB 2XGSA 3M9XA 1PJSA 1WXXA 1Z08A 2WM3A 3DDUA 3NDJA 5CNMA 3UH1A 5E2BA 4BAZA 4I6EA 2H08A 4L76A 4D9GA 4AJNA 2Q0XA 4BDSA 5EG5A 2BM0A 1PZEA 4F4IA 4YHHB 4JP3A 4TXNA 2Y1XA 4G4SO 1SZCA 1Z6YA 5EMLA 4U8HA 2Z8YA 1EUQA 1LFDB 2YMQA 3TAXA 1MA0A 1GITA 1MO6A 1QRAA 3MLAA 4HCJA 2O2ZA 3AQ4A 1YZQA 4ND7A 2FQQA 3R5KA 2V7QA 2QDKA 3UO8B 4YUAA 1G6KA 3OEYA 1TKRA 2ORVA 4JC4A 1ZU5A 5CT4A 5CFQA 4GHWA 2OBFA 4OJNA 4UE6A 3AT1A 1TKBA 1R10A 4M4SA 4ZOBA 4YV0A 4ZODA 4ZRMA 4H7JA 4BP8A 2Q41A 3I72A 4EB8A 1OA1A 4JOBA 4U6NA 1QGUA 3QU5A 2QQGA 3AW8A 3PZBA 4DMUB 5DIFA 3PWTA 3ET5A 3KKQA 3G8AA 5SYAA 3ZXSA 4FEYA 1VB3A 1V35A 1TPYA 4GWLA 2NUBA 2A9FA 1RLMA 1MVOA 1Z9BA 1RR6A 1O9BA 1SWWA 2R1VA 1K75A 1M2OA 2VJBA 3OOWA 4HFMA 4OQEA 4YJHA 3U3DA 1P2UA 4DIMA 1M5RA 4LXQA 3WNZA 3IDOA 1FQKA 1T2EA 4RDXA 2X0DA 1C3OB 3DZBA 4EGSA 13PKA 4EBBA 2UZAA 4EVIA 1JS1X 2O7QA 3FGNA 1R27A 4LF8B 5BORA 1SN7A 3R7DA 3RKUA 5ES4B 2JCBA 1EWQA 1DJNA 4FGZA 3L8HA 5DLDA 4P2BA 1G3UA 3OJCA 4IQFA 5DTEA 3T9BA 4BTEA 5ARBA 3DWFA 5JS6A 3O2SB 3UXHA 4BE9A 4JMPA 5JMTA 4UUQA 2RD2A 2RAUA 4AO8A 1PRYA 1FXUA 5DI3B 1U3WA 1X1EA 1U0HC 4TXJA 3R3WA 4E5KA 4P81A 3CKLA 2NIPA 2QX7A 5ALQA 3O4FA 3DEYX 3G59A 3D1LA 3HU2A 3N2GB 3QVOA 3H2YA 4H31A 3V3TA 4CCYA 3RK1A 3K09A 1HSZA 1U7DA 2OMEA 3QRWA 4N47A 1CQZA 4WE3A 5KIAA 3KYIB 1JFFA 2Z6UA 2BMAA 4YAEA 2ZULA 3RAFC 2HXSA 3OTQA 4QQRA 3EVCA 4JUAA 4CT5A 2AS0A 5C81A 3VKWA 2IT1A 4UUBA 2WUEA 1AMOA 4YAIA 1XJCA 1R0BA 1K63A 2HSWA 3QOYA 3FUWA 2W2NA 3RC2A 3T3DA 1N1EA 1E64A 4CF4A 3JYNA 4F56A 2X9GA 3EQ9A 3PBKA 2XY4A 1W25A 2WSLA 1GPKA 3EA5A 1L5QA 2Q3JA 2ZI7A 2HSGA 4M22A 5JDIA 4L9AA 4LBZA 3IJEB 4QRIA 2YRXA 3V2UA 3EIUA 4IOKA 1DELA 1Q1GA 1QFXA 5AK3A 1KMMA 2ZS7A 4R0VA 2BTOA 1Q20A 2PAAA 3SIXA 3DB1A 3RB8A 3VNVA 4TTQA 4N76A 2LPMA 2GBCA 2OUIA 4UMEA 5ALVA 4OKNA 4Y8VA 3O4JA 3OIVA 5ESWA 3M3PA 3LVFO 4HNTA 2MWMA 5DMHA 1TI7A 1V0JA 1YQ9A 2JD2A 4LXYA 1K7FB 4UDXX 4BYMA 3Q9UA 4AI6A 1QK5A 3KJNA 1T2DA 2PXHA 1MP0A 3DM5A 3S0JA 1AX9A 2TSYB 3ZDYB 4OMFG 1U2QA 3Q10A 4COOA 2GXAA 4I9GA 2WPDD 2HJHA 5AVSA 4PX9A 3L0IB 2UYQA 5HGJA 5CB4A 5K6TA 2BFAA 4TZKA 4GKKB 3LYAA 4YV7A 3V6MA 3OLCX 1EWYA 4M87A 3SR0A 4YLEA 3MG9A 1D6NA 2Z5VA 4BVBA 5LCXA 3O8QB 4C0HA 1UDXA 3T1YB 1RW4A 1YRLA 1QIIA 2IDJA 4L22A 2NMVA 1Z06A 4ZQBA 3Q3GE 3WBBA 2VDJA 3CVVA 3VBCA 5A5VA 1SVLA 3R1IA 3LXRA 3TDKA 4EG6A 1ZK4A 2ZI5A 4ZK6A 3B6IA 3M89A 4MS3A 1J39A 5EL0A 3GIWA 5J4HA 2VRNA 2UVPB 2QENA 2YMMA 3C74A 4EYKA 1PTJC 3QELB 4LV5B 2EYUA 1NF9A 5LZ9A 1NVVQ 1PEKE 2PFGA 1GZ5A 3PCTA 4HRVA 3U7QB 4O5OA 4MICA 1W76A 3R6TA 4D45A 1VMIA 3FDIA 1U28C 2PT6A 1EZ4A 3JD4A 1U8AA 3CSDA 1PGQA 2IRWA 4MV1A 4URUR 2J33A 1H69A 3CINA 5ENDA 3IEPA 3N58A 1F3OA 3FMIA 4R1QA 2IH5A 1T36A 3RSQA 5KNDA 1P17A 3NOXA 1COZA 1XU4A 4IUCS 4RW0A 2K7FA 3KDPA 3FA2A 4M9XA 1FUIA 2VBCA 1KS9A 4U2EA 1J7JA 1PR2A 3UAZA 3ROMA 4IZ6A 5AUNB 4D41A 5CBPA 1Z4NA 4WBNA 2JA2A 4Y9DA 3EARA 3I6YA 3KPUA 4R9UC 4OHMA 1Q74A 4PG4A 3T61A 3CO0S 2FSIA 2CNNA 3A6JA 1JIJA 1T10A 2HPZA 1AHHA 4FIZA 4QYMA 4LOKA 1R00A 1ECLA 3R4CA 3CUTA 1L6RA 2YHIA 4YJ2F 3SZLA 2V6IA 1QZUA 3D8UA 2RBKA 5DNVA 3ZHXA 4QEZA 1UXJA 2BUBA 2G63A 5A4JA 1PHPA 1EK1A 2BCGY 2H2DA 2YWBA 3MQ4A 4DA9A 1KZ9A 4E2FA 5HKKA 1I2MA 4O2RA 3CZMA 1U80A 4BO3A 1VTKA 2R5WA 1Z68A 3CWCA 1KDVA 1O9GA 2XLBA 3DPSA 4G1UC 3ROGA 5GIPE 1XZIA 721PA 1EVYA 1P7PA 2CYCA 5JAOA 1DKRA 3O93A 1F5SA 1QHHA 3ETLA 2GQ0A 2QM3A 4NR0A 2EJCA 4XM1A 4MQMA 4QEDA 2CZCA 5K8IA 5SY4A 5HM8A 3DJFA 1LQTA 1U2GC 2NUPA 2IEBA 5TMDA 1QV6A 1EHCA 2Z0MA 4EL0A 4HEQA 3AHEA 1U1IA 2I7XA 1JEEA 2HA2A 1T0PA 1EFTA 1HRKA 2Q1SA 3HV2A 1JJVA 3I9JA 3IVRA 3NORA 4NCXA 1GGMA 1WU7A 4AQYB 5EZSA 3WLFA 2B99A 1TYDE 5C1OA 2XR1A 4TS1A 5KYNA 1P7CA 3RDPA 3AR9A 1P2SA 2I6TA 5L45A 4JKOA 4EG7A 3VPSA 3OF5A 3BULA 3WMXA 3UK7A 4HDNB 5CB4F 2Q4OA 4S0XA 4KTVE 4EDHA 1GL9B 4MX8A 2VJMB 3B5IA 4XLZA 4ZO8A 5F33A 5F5XA 4BO0A 5JARA 1BMFA 3IEVA 1RXWA 1IEQA 3GVXA 5GJBA 1HKHA 1MOSA 2WV7A 1ND6A 2VUIB 2WJJA 1B6RA 4LSZA 5B4VA 2FX5A 2QT1A 3ANTA 4CLRB 3P9KA 4FFDA 3NBQA 3RTAA 3ZDQA 1NJFA 2VHCA 5TQVA 4NTZA 4AZVA 4F85A 5FPKA 5CIYA 1ZL0A 2IY8A 4FWTA 1XQVA 1BEEA 2WUWE 5L6MB 3E18A 4KGDA 3ESBA 2I3BA 2W00A 1SC1A 2H57A 3TLCA 4DXHA 1E6EA 3VJKA 1JU4A 3LWBA 3NHBA 5G4KA 4ALMA 1K8RA 1F4LA 2GEBA 4IXWA 4FSXA 3B48A 1EH5A 1RAIA 3VZPA 5LOVA 1OAKA 2CMDA 3D6AA 1YA6A 2PKXA 1XOIA 2ENUA 3BRWA 2AZ4A 3UGQA 4RACA 1WM1A 5JAMA 2UXBB 3NETA 3U60B 4NIMA 3GIDA 4LUCA 1QRDA 2X40A 2PX4A 2YZMA 4MKZA 1N0IA 2GK6A 4MMXB 3UUGA 4ZDWA 3W04A 1WU8A 2Y4OA 4E5SA 1VHLA 1CZOA 4WBNF 4TWAA 4WKOA 3IJ5A 1FL9A 3E5RA 2PUFA 1UPFA 5GJCA 8LDHA 2P65A 4N5IX 4TKVB 2FPKA 4YCLA 3ZLUA 1ML4A 1ISRA 2LD4A 3ZGNA 3WNDA 3EIFA 4OLFA 1WDTA 5K3BA 3SHQA 4E6PA 3Q4GA 2XA9A 4LVUA 5JYEA 4IQ8A 3FNEA 3CIOA 3L7BA 2NTNA 2VP5A 5A62A 3KQUA 1WDMA 4A8JC 2A9JA 2ZROA 3ZC3A 2QL9A 1KGSA 3TXXA 1HDOA 2QMZA 4ECAA 2K2WA 3ADDA 5L53A 1A4RA 5T8KA 3H8WA 4IJKA 1PUJA 2FXIA 3WGUA 3H2IA 1TAUA 4KWHA 2JGKA 2ONKA 3EDQA 3L5KA 5JWHA 4BGIA 4H59A 5DI3A 1GN8A 4UUMA 2NU6A 1MKYA 1JPNA 1K7EB 1SUAA 1T3SA 2LKCA 4QQKA 2BMDA 2C3UA 5CHEA 3ZBUA 1JPUA 4HDKB 2AMLA 2IOHA 1HYGA 1NMZA 4JJ7A 1DVRA 2DFTA 4X7MA 5ED0A 5EQTA 5GAJA 2C42A 4YT8A 1H9AA 4W1RA 1W5AA 1Y9EA 2EG9A 3VJMA 1LSOA 1LC3A 3E4DA 1JG1A 3IO3A 3E82A 4OHOA 5ECGC 5B53A 5IWCA 1GUDA 3VX4A 4HT3B 4PZDA 1ZIOA 5BSFA 4JYZA 1F6WA 3RK4A 1G38A 2C4NA 1DRVA 2FZWA 3T7KA 1DHTA 5DNAA 3ENQA 3KOOA 4G1EB 3U9LA 1FX0B 3UHJA 1XJQA 2SCUA 2D06A 3NHSA 1AS0A 2QG9A 3ICVA 2JCGA 3K9CA 3C3EA 1RZRA 2I65A 1B0UA 1SKYB 1VJGA 4J0EA 1SXJC 4DTIA 3NNNA 3K70B 1GPWB 3HZHA 2FWJA 2XEXA 2C9CA 4XVUA 2P91A 2B4AA 2XMSA 4Y9RA 4B2IA 1OH8A 5IKXA 3QP9A 2VP0A 1P0FA 1E5VA 1Z29A 4OXQA 4MR9B 3AY6A 2JJMA 2OC4A 2VUHB 4FBGA 3U19A 3PL5A 1IFXA 4JBXA 1HT3A 2FR8A 2J5KA 5ESRA 3SZUA 1Q15A 3MJRA 2XF2A 4BLWA 3GLFE 5JMWA 3N0TA 2F3QA 2B25A 1GTZA 2HU2A 1PJZA 3AQIA 2C61A 3LAWA 3PC8A 3DAOA 1DTEA 4FYYA 1RBQA 1S8FA 4AJOA 1KKLA 2A6PA 2E49A 4IF4A 5LOVF 3QEAZ 2ID9A 4EI7A 3OOHA 5A4MS 1NT4A 4RHTA 2OCLA 2JFFA 2QYTA 3GDFA 3N0WA 2BIFA 4IDHA 4CV1A 3K0SA 3ORQA 2D8MA 1MLDA 2Y1EA 1QUEA 4NVRA 1HQDA 4XWOA 2B92A 2E4WA 3F71A 5TPZA 1PJ4A 5KYXB 4FOLA 2J0SA 3EMDA 4Q3KA 2P5SA 4YRDA 5AI6A 1C3LA 3PX7A 1EESA 3IOCA 4C0KA 2ZB4A 2OGZA 1ZOLA 5B2EA 3FY4A 3BE6A 1RWKA 1YU6A 1PQPA 3E6AA 4JDUA 4TYPA 3WLKX 3WL3A 3S81A 5T4FA 3RG8A 1NJ5A 5EIOA 1OCEA 1RZVA 4Q1EA 4OHVA 3W2FA 2NGRA 4J7AA 1J2YA 4K6OA 2MU1A 4FNOA 5B1DA 4DFDA 1W29A 3L5OA 4PNPA 1H5QA 3AUFA 3U3JA 3ICOA 4K81B 2HJSA 3R41A 3K9QO 1Q6ZA 1A4IA 2JEYA 2QX4A 3KQPA 2AFHB 3Q3CA 4IBOA 3KWMA 2AJLI 1R50A 2ZAGA 3DE7X 4FFBA 4G0YA 1LQUA 3D7KA 2ZAMA 4HK4A 1IXYA 3QJGA 4L4RA 4IP0A 4A0FA 4F3CA 121PA 2ADMA 1W48A 1Z4PX 1RQNA 1R15A 3MERA 3VO2A 1UBNA 5DSTA 2GRJA 2B8WA 5DOZA 3AJEA 4A3SA 4F5WA 1BU5A 3NUGA 4KQ1A 4NEHB 1PJLA 3I30X 2YDYA 4Z4IA 4XR9A 3GFTA 4RD6A 1L4BA 2ZWIA 1FRZA 3A14A 4YRQA 3FZNA 3OU2A 1VGRA 2Y66A 1MO5A 2G67A 1X3LA 1VIAA 5FBLB 5BN1A 5L3QA 1VI6A 2CLHB 4LCEA 1JI3A 1Z2PX 5HF5A 4E08A 4YRLA 3GAAA 3M6MD 3G5AA 3VQTA 4EMBA 1CIJA 3COWA 4BV3A 3EZ9A 1A9ZA 2K87A 2ZJ8A 1NQVA 4ESOA 1JB1A 1E94E 2EKZA 4YAGA 3OY7A 1TJPB 1CERA 3V6LA 2LR0A 3KLBA 2TMYA 2ZSUA 4CQMB 4F3TA 3B7GA 1VRVA 2Y92A 1JMVA 1YRQA 4N6OA 4QU5A 2CF5A 3DBRA 1EM8B 3AEYA 3HABA 3VH3A 3N75A 1YJBA 4EYEA 1R18A 2LDXA 3IHLA 5BQOA 4LJ9A 3PGA1 1UJ4A 4LPSA 4XKJA 4C3UA 2PO5A 3DAGA 4C7MA 1LLFA 4AMGA 3I9NA 1Q12A 3L92A 3TX2A 1J5EB 2OHHA 2V0CA 1M0EA 1J8FA 4XLTA 3PPVA 3ZDDA 1JKXA 1R4AA 2VRWA 4PSUA 2MSCB 3O21A 4C0XA 4BZQA 4MYDA 3RLFA 2J0QA 4EGFA 5ALZA 2J7KA 3DDWA 2CXXA 1MH1A 2IYYA 3I1JA 2E2WA 3PD7A 3EPPA 4GAEA 4LZPA 1DE0A 4WD3A 2PS3A 4BFWA 3FOCA 2AW3A 4HDNA 4M0FA 3EB9A 4NENA 2OP0A 3LKZA 4DA0A 1N2HA 2VJMA 3KUUA 4LWZA 1RWOA 2SKCA 1OYVA 4DADA 4EGQA 1WHTB 4UTOA 4BLOA 4YHBA 4HB3A 3EW7A 4J1TC 3S7TA 2RGNA 3RJ9A 1E92A 3IUBA 2C2BA 4EY7A 2GERA 2X2EA 4E1AA 4DAOA 4MB0A 5J47A 1KFEB 3AF3A 1BTOA 2O2YA 1Q92A 4I2VA 3GDWA 1PJ8A 3GLRA 4EAQA 3LT0A 3DZGA 1T1RA 3WNVA 1PL8A 1INLA 5LFAA 4BMCA 2WTBA 4W9MC 1S5PA 1WNTA 4D1YA 2PBFA 4O63O 3DXYA 4XWYA 4D4LA 3LPMA 3KPYA 1KPHA 1U7UA 4YVFA 1KU6A 1ZISA 2C3OA 1D4ZA 2QQFA 3IEUA 3R8CA 2NP7A 2RGBA 4CEHB 3MJEA 4F93B 1H4SA 3RARA 4JA0A 5KC9A 4A26A 2HL6A 2H31A 5FCDA 2C77A 1VZ3A 4GR9A 3BIFA 3EY9A 3E23A 3QNUA 2EV9A 3EXG2 4RXMA 1KDZA 1Y5LA 3H97A 3H1GA 3C3AA 1H42A 1YBMA 2F90A 3SMQA 4TKVA 4Y2HA 3DQPA 4Z1MA 4BFSA 1UZMA 3TW6A 3ZWOA 5B6IA 4BDTA 1NW3A 2NV6A 2ZIZA 2QLTA 3KCQA 3MJHA 1G60A 4CM8A 5KNDD 4I1PA 4N9QA 1BGVA 2YXLA 1FK8A 1XZAA 3LHKA 5TGDA 4E11A 3DBHA 4OL0A 3HYTA 1JZSA 2F7SA 8GPBA 5JBIA 2BKLA 2OKCA 1T2CA 2HLHA 4U3JB 2OKGA 3DM9B 4BNNA 5IHXA 4NOKA 1TVKB 3CNEA 1PV2A 3DONA 1I0LA 3LQ4A 3WA6A 1FPQA 2Q2OA 2YZKA 5E0OA 5BXYA 5HILA 2X4IA 1DPFA 1K7YA 1RWQA 4G0OA 1UJBA 4RCZA 1NYQA 2QAIA 1WR8A 4HDKA 2ZJ3A 4V0SA 4KIWA 5JZOA 1RKUA 2HF8A 3BHJA 4JENA 4MI6A 4G41A 4TT8A 4YRGA 3K35A 1HTTA 5LBUA 1USUA 3OX1A 2MDTA 4XJXA 4B3HA 1JE1A 2AXPA 3FPFA 3M34A 4DREA 3WGMA 4A7PA 5HKKD 5K3OA 3D3JA 1QH1B 3WQBA 5H9VA 1Y4AE 1U0JA 1FX0A 1Y3DE 4J49A 2DUWA 2NPIA 3N6VA 4PIPA 1EINA 3VPBA 4W5OA 2XXBA 4UPVA 5DIZA 1QONA 3MM4A 1PUXA 4I50A 2OFFA 3VOAA 4EENA 3IEKA 1PR0A 4HH0A 5K3AA 4MNTA 3NEJA 2ASEA 2Q3HA 3DQZA 2D6FA 4BEVA 2P2YA 4ND5A 4Y1RB 3GUHA 1W36C 1J1UA 4QBKA 1GRCA 4KYTA 5DO9A 2WHPA 5CGQB 5J1TB 2BM1A 3CHYA 1AQIA 2B82A 4I14A 3SPXA 3KL4A 2ZUBA 1W6RA 4S1PA 3HE3A 1YTLA 2O5VA 5LN1A 1OZHA 2R1TB 1CUUA 4ECEA 3KYDB 3ZZ0A 2NZ8A 3ANYB 1RWNA 3L8CA 1J8VA 4FHGA 1XVLA 4G9GA 4JJFA 4MR9A 4UD2A 4ME6A 4WK4B 5BV0A 5I8WA 1ZHOA 1NOJA 4H7KA 4RGYA 3QVKA 3THOA 2DT5A 3VMMA 3OZVA 3JCZA 4BEJA 2KWIA 2QLFA 1JPJA 4G5XA 3UNXA 3IQZA 1KZHA 2VAXA 3GJQA 4R4JA 5GMOA 4PO1A 4X1OA 5HIJA 5A3RA 4PG6A 3REFA 1U2EA 1BE0A 5GWXA 3GRZA 4YACA 1E9BA 4RANA 4B74A 4OQXA 3Q72A 2YOGA 5GV8A 3CVWA 3K9BA 4RAOA 2NXWA 1UT6A 2VDRB 2GBLC 1DQSA 1ZJ6A 3B7PA 3VV2A 2HLPA 1Z0UA 4EJ0A 3OSUA 4XAQA 5KYXA 4O29A 3EWNA 4I4NA 4X90A 1YQGA 1ZSNA 3MGBA 2PTHA 3L6RA 1ZUNA 3TLXA 3L4EA 5F9MA 1XTZA 2QTHA 1KU0A 3QXXA 4WZBE 3EF0A 4ZMBA 3H8JA 4UXJA 3K6SB 3A9CA 3HGQA 2P90A 3EGVA 3KV3O 4HYEA 4BKRA 2OCDA 1EHYA 1N2CE 2AK3A 3AKDA 3AR5A 3KCNA 3MW8A 2IWHA 4U2BA 1FNBA 3BRWD 3TLAA 3TLKA 4U7PB 2JLCA 1E20A 1WLSA 1KZGB 3CN7A 2DWOA 1ZK2A 1XE3A 3GXBA 4GX0A 4OHCA 3FMVA 4MUHA 3BH6A 4JEMA 5CT6A 2IA5A 1OWLA 1U8TA 2VPPA 1XXHE 2AFHA 3DJYA 2ZQZA 3W6NA 1LDEA 3GDOA 1N7HA 3IT0A 1QP8A 2GN4A 2HT6A 4OY3A 4E5MA 3FAKA 3MD0A 1RYBA 4KQHA 2O7VA 1DCKA 1M74A 1PS0A 1MQSA 1YIDA 2CK3A 3WGJA 3MMPA 4Z4QA 2AIRA 4Z9BA 1YJ5A 3CLRC 4GRDA 1VI2A 1X80A 4E4TA 4EYSA 1EP3B 2LVBA 4ENSA 2I22A 5EIFA 3DE2X 4DNOA 3A9VA 4PAOA 1IZZA 3MCVA 3HJRA 1OBHA 3R5XA 1B3BA 1M75A 5IZ4A 4H08A 1GDHA 1KYIA 1L4FA 4O1MA 1EQUA 3D8TA 4B7XA 4LJAA 1A2KC 4Q9JA 5JJKA 4FCTA 3GARA 1USKA 4EA9A 3TIXB 1MNQA 4M0KA 5HKAA 3FVWA 2JFBA 2IEIA 4U4AA 4HQKA 5AW3A 1ML3A 1NYTA 4U9HS 3RHFA 1OF1A 1XCPA 3FZEA 5AJHA 4KFRA 4MAMA 2EJBA 3IEXA 4C0JA 3BDAA 3D6VA 3KPVA 1GNQA 1PYDA 3FZGA 1TO6A 3L0BA 1JU9A 2W37A 4I08A 2Q0HA 1QJ4A 2XOEA 4TKLA 1EK2A 3T7EA 3ZCUA 2QU8A 1EM8A 4XQGA 5SY6A 5HQ3A 3HJTA 3CUVA 1B73A 1K4YA 1ELOA 1UR5A 2EVWX 2PL1A 4PC2A 3WMRA 1SIBE 2QLBA 2QPLA 3G2QA 4H7EA 3TGWA 3H6HA 3VHRA 1ZOIA 2EIXA 2CDCA 2F9FA 1ONBA 1ZMRA 2GJ9A 2ZDGA 3CO5A 1RYZA 3GBPA 4P36A 4R6WA 1PDVA 3W2EA 3T1TA 5IVKA 3DEAA 1RZRD 3DWEX 3GPLA 2Z3WA 3I9V1 5FA6A 1FYFA 1QRUA 1F2TB 1CYEA 1Y7IA 3P8ZA 3TCKA 4BAUA 3GWGA 4REQB 3ZNOA 1CR2A 3H16A 3TGPA 4H60A 2AJTA 1PSWA 4BFZA 3ZWVA 3EUWA 2WABA 3E7XA 1TAQA 1ONNA 3T3OA 4FZVA 2BRUA 4NZNA 4B4KA 4Q02A 2Z04A 2FZGA 2PXXA 2Q1YA 3O9VA 1ZJZA 1ABBA 3K0EA 1FFBA 1HNWB 4BX8A 2BWJA 2SKEA 4B7AA 4WNCA 1ZBQA 3KD2A 4KV7A 4QBFA 2WSYB 4RESA 5ABPA 1TEZA 1DT5A 3CPSA 4N1AA 3VSAA 2WIDA 3MIIA 4TKUA 4M55A 1E3DA 2IYFA 1XKLA 3EMKA 5AW1A 5GJVC 2XIQA 5B6JA 2UYOA 1RYFA 4B31A 3KQTA 3GELA 3HCOA 4H1HA 1X19A 5BSHA 3LHFA 4E07A 3ER6A 1T4GA 2WV9A 5IM4F 1FEZA 3CTPA 5FLXA 3IOEA 4D9CA 1M0WA 2OOSA 3DL7A 1E6WA 1T35A 3M6UA 4U7FA 4ZCQA 5CAEA 4HJRA 1NJ6A 2HNAA 2XQJA 1XU9A 1GUAA 2KW5A 5BRJA 3OBIA 1QC5B 4ITRC 2O52A 1KAHA 1EXNA 4U8GA 5DM70 2CDAA 2WYOA 3SFVA 1DJOA 1G66A 4JITA 3BKXA 4ZQCB 2XT9A 3QVMA 4BV2A 3DCIA 4RHEA 1YI1A 5G0SA 3BJZA 5BVGA 5HYVA 3BSFA 1Y4ZA 5CXUA 5AVRA 1JALA 5TB5A 1JDZA 4W7SA 1SOVA 2AA3A 3B1WA 3BFVA 3LW8A 1Z5UA 5AW7A 1JAZA 3FNBA 2GDZA 2Z1DA 4GSYA 2QX9A 2Y05A 1JR3E 3DYVA 3IQFA 2FEMA 4HXFB 4QD3A 4C4TA 4RDCA 4TXMA 2GUGA 4G0ZA 4XQEA 1KP2A 1W2WB 2ORED 3ZPXA 1N33B 4TMVA 3THRA 4H6VA 2Z5GA 5AJVB 3THWA 1OTXA 2X5JO 2Z8ZA 3FTFA 2O59A 3LP5A 1TM3E 1Y48E 1XZHA 3P2JA 2O5RA 4RGQA 1KNXA 1VJRA 4IMJB 3CGWA 3UAWA 1ETUA 2EFJA 1YQWA 3FYTA 1ZK0A 3KDAA 3QQ5A 2VC2B 3I0NA 1QQ5A 2DHDA 1KJIA 2Q3FA 1X15A 3NJRA 4LJ7A 1NVMB 3UWDA 2HPAA 4MW7A 4OK5A 5C8VA 3S8YA 4FDUA 3QHAA 3AINA 1GPMA 4LMBA 3RT7A 3RVPA 4YRZA 3DTVA 1VP3A 4XEUA 4EJSB 5A4IS 5IAKA 5K6RA 4F2GA 1C80A 4LYHA 3SE0A 3N53A 4DR5B 3A7DA 1ZJWA 2OC9A 3OD5A 2M98A 4JJ6A 1RI1A 2YUIA 3NJ8A 1DQRA 4IH9A 4WW0A 3Q3JB 4KZPA 1SXJE 3HWX1 5IEJA 4ZT2A 1UP7A 1XX6A 2AHOA 2JFGA 4UVIA 4ZVSA 2WJPA 5B55A 1N6NA 2MSLA 1OWOA 4QVKA 5HS6A 7ABPA 4J4BA 4GZ5A 5DLPA 3L4JA 2B8EA 4CN9A 3E0XA 4E1BA 2ZGVA 3EIXA 4TL6A 1YQQA 5DBGA 4URYR 1TYBE 3RSOA 4XWWA 2AUNA 5DRTA 4QGAA 4JN6B 5CLLA 2W4QA 1UT5A 3ETGA 3KVOA 5ALFA 3ZWWA 1JPVA 1LPNA 1QYRA 3FLBA 4OB6A 3WLAA 2LXNA 2RIPA 3SQDA 3WRWA 1UBSB 4CUZA 4UOQA 3F7NA 3GEMA 3AJ8A 2JC3A 4JI8B 1T5OA 5EERA 5HIAA 5F2NA 5JAQA 3GEIA 1EUDA 3KFLA 1Z4QA 3OTIA 4BJ6A 4OIFA 1I2CA 1Z5OA 2A9PA 4PYIA 5JWRA 3KQNA 4N7MA 5SV2A 3TLMA 1MT3A 2I78A 3PE4A 1M2EA 2I4TA 3BFJA 2BD0A 3HKBB 3MT7A 4HWRA 4JC0A 3G2PA 1ZW6A 2H18A 4FMPA 5IK2D 1Q0HA 4LDQA 1X7YA 5IT5A 2PUHA 3BSWA 5H4GA 4KMRA 1K4MA 2VJKA 1L7RA 2JGJA 4DJ5X 1OR8A 4IDFA 2XUKA 1N7JA 3QXGA 3IP8A 4O1IA 4DMCA 4OYLA 5FL7D 2ONJA 4AMZA 4E2ZA 5F2OA 4F04A 3EEOA 1PL0A 5EUMA 4B3RB 3KRTA 1WULS 3KAJA 4JR1A 1QORA 1W94A 2I3ZA 2F8LA 3O94A 1V39A 4I1SA 2O2CA 1J8QA 2R8OA 5A3JA 4Z9FA 4HB0A 3VR4H 1TFRA 5LZ7A 5ELXA 4PYNA 3FYUC 5H02A 1H85A 1MJHA 1MOZA 4KVZA 3K30A 4B75A 4DCCA 3IOYA 3CLTD 5FUYA 2BDUA 2BISA 2WLSA 4M1YA 3G8YA 3H04A 1BGWA 1YJQA 4Z9YA 4X20B 4BGVA 2CWWA 5L3SB 2VHEA 3W6UA 3HU5A 1Y42X 1IG0A 4BFYA 2L17A 2X13A 4F3KA 1UAAA 3WWEA 3CVUA 1QKIA 2XD4A 2Y68A 3FPAA 5JYCA 1E4OA 1NLFA 1RJEA 1Z6XA 3DMHA 1YS7A 4WZAB 3AKYA 4L4YA 5FUVA 5LJLA 4EVRA 2VH5R 4IILA 4HXYA 1AQUA 3NEYA 2R60A 1Z34A 2C5SA 2VKTA 2DPXA 4M1SA 3TZHA 1ADYA 2F3UA 2V7PA 3IT1A 3O9MA 3VPGA 2ECKA 4BB6A 2FP4B 1GU7A 2ZSHA 4ZQFA 4C30A 4DV5B 2ZJBA 2OG2A 1SC9A 4MRMB 1DO2A 2PYZA 4PR0A 1LA2A 1Y34E 1ZVQA 3QLJA 1G7RA 2VXYA 1ZH4A 4QDJA 3HL4A 4Z1MD 1T5DX 4R1UA 4UM7A 3ZIAA 2HK6A 4L75A 4TWRA 3TFQA 3D7SA 3PWSA 3Q6MA 4ZO6A 5D5QA 3IKTA 1XCLA 3IV7A 4IIJA 4BB5A 4Z1OA 4M53A 2OFPA 3MRTA 2GAJA 2W6IA 4JBGA 1SXHA 1QHXA 2BEUB 3OM9A 5JI2E 2QUJA 3W2TA 3DVAA 2RKWA 2VSNA 3QLVC 4DM7A 3MJTA 3U56A 1PTJA 3PITA 2CY0A 3GFQA 2AG1A 3NU1A 4FNAA 2Y0DA 4X54A 3UAYA 4II3A 5IXJA 4KKXB 4MIOA 2O2DA 1UFQA 3HC7A 4E2WA 1SUSA 1W96A 1IVNA 4QLAA 3OOYA 4IUYA 2NO4A 5AI5A 1X13A 1RM3A 2AJ8A 3HUEA 1RCFA 3PQ4A 3T9FA 3UC5A 3ILSA 3M3HA 2WPNA 2EJWA 1U6KA 2JBHA 2J3DA 1MABA 4MVJE 1LV8A 3JV7A 3E3NA 4M0EA 2JAQA 1BWRA 1IVSA 2O4UX 1QGOA 3JQFC 3CU5A 2WIJA 2ZSAA 3CVXA 1OFGA 5LBIA 2ODWA 2GVZC 1N2CA 1ST3A 4F0JA 1FFDA 2YASA 1XFDA 2XUJA 2Y1WA 1U1DA 1Z7WA 5C46F 2WTEA 3DDSA 2O2GA 3A32A 4PYQA 3U26A 4BNDB 2UXCB 1BAPA 4OFWA 4V24A 1ZNXA 3SK0A 4AZ0B 3PFWO 4JL5A 3FGOA 3HRIA 4U6SA 3L84A 4XPIB 3E53A 5FL3A 5M3BA 1C9EA 3TZBA 1UMBA 4OXRA 4E5VA 3NXSA 3QIVA 1TADA 1GGFA 1NXOA 2ZRBA 3CEJA 4HBGA 4HKTA 1F2TA 4CIYA 3K70D 4RA6B 1YASA 2H51A 3AVOA 4REQA 2NU9B 2G7MC 3F9CA 4AY4A 4EY4A 4A2QA 2CHEA 1U02A 1YJ8A 4B32A 4PZ9A 3MYRA 3SNKA 3EGDA 2EW1A 4Z54A 1YHYA 1MZVA 4A8PA 4I6GA 2Q0QA 3A1CA 4WASA 4OQ4A 3U5TA 2Q8NA