1KHTA

Adenylate kinase from methanococcus voltae
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
NKVVVVTGVPGVGSTTSSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEENLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTGDEILMRRMSDETRVRDLDTASTIEQHQFMNRCAAMSYGVLTGATVKIVQNRNGLLDQAVEELTNVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of thermophilic and mesophilic adenylate kinases from the genus Methanococcus
pubmed doi rcsb
source organism Methanococcus voltae
molecule tags Signaling protein, transferase
molecule keywords adenylate kinase
total genus 72
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1khtA00
4CT5A 2BOVA 1KK3A 2OUKA 2RHDA 4PO8A 4MYCA 3QVVA 1QF9A 2A5GA 4Q4JB 4QXAA 1IXRC 2D62A 4DUGA 2ZAOA 1E94E 3WBJA 4C2UA 5SZJA 1P2UA 1SZPA 1HQCA 4Q4HB 5DNYB 3RC3A 4KCGA 1E1QD 1ZM3A 2ZYWX 1AS3A 4RZ3A 1M6NA 1P2VA 1ZM2A 1R8SA 1CULC 1UKEA 3CPJB 1AS2A 3R20A 3EZ2A 3AP2A 3EZ6A 3CLVA 2PZEA 3GLFA 2R62A 4Q1BA 1KGDA 5J4LA 2VRWA 5JCZA 1Q20A 1QDEA 1DAHA 5HZHA 1G6OA 1W4CA 1XXHE 2QRZA 2ZIAA 3GJXC 1OHHD 2C9CA 1D2NA 3QXSA 4OQMA 2KE5A 2WWXA 2RGNA 5KDDA 2IF2A 3BH0A 4PC7A 1SULA 5E3HA 4JLBA 3A4MA 2UZIR 2CCKA 4M8NE 3R7WA 2X77A 2O8DA 2IXGA 4M1MA 4DSTA 5G53C 3MWYW 5EXTA 1E69A 2REBA 3TUJC 4ACBA 1VYUA 2QL6A 3IILA 2H17A 1W4BA 3KXKA 3G0HA 3PUVA 4GOKA 1P3JA 1N6IA 3QSYA 2ZRDA 4PC1A 3O8BA 4DLSA 1VCOA 1SVMA 4DCNA 4MUBA 3FKSA 4PZZA 1EFHA 4JBWA 4UNRA 1NBME 3B1VA 3LV8A 4Q9KA 1XTIA 2VSXA 4KVGA 5KU1A 3KFXA 4EFLA 1WA5A 3KTAB 5JEDA 4G5RA 2YWFA 1IONA 1ONBA 5E4FA 1VHTA 3V4FA 4EKDA 4M9ZA 4C2TA 2NZ8A 4PHGA 1G5RA 1RRGA 1UADA 3GLHB 3GFPA 1KJYA 2ZU6A 4LV5B 1BIFA 2J9RA 1II8B 2IBMA 1AS0A 1AQUA 4IVRA 1PLLA 1DOAA 3B1XA 3OEHD 3B82A 3VMFA 2P6NA 5CYOA 2ZI7A 1F2UB 3A58B 3X1WA 3KKNA 2O8BA 5C1BA 4HDQB 2VP0A 5J4KA 1OFHA 1Z2AA 1NY6A 2MSDB 2YWGA 4TL9A 8OHMA 5AWFC 4DDTA 3AUXA 3FB4A 1MOZA 3SFZA 2ZYTX 1S1MA 1Z6AA 2QT1A 3QPUA 4KODA 3SS8A 1Q1ZA 3VX3A 3OAAD 1ZMXA 4PZLA 3GPLA 4XSHA 2QN6A 5KNDA 3U44A 2F7SA 2ZSEA 1CS4C 4BFVA 2YHSA 4A2PA 1MH1A 4TZ0A 1GP2A 2GZAA 2PJRA 4IHQA 2QORA 3I1FA 3RS2A 1BMFA 2V1XA 4QGAA 1KAOA 1IOZA 2OM2A 3AF0A 2CEAA 1U2RA 3B8HA 3LXRA 2ZE8A 4D0NA 1B23P 2DPXA 1E6CA 1FTNA 3EZ7A 3GLHE 4K81B 3AVYA 4BFWA 2REOA 1XB2A 1H8HD 2NO1A 4TLBA 2DYKA 3C5HA 1G3RA 1GIAA 5C46F 3B78A 3IEVA 3K9GA 3MWJA 3B9PA 3N5CA 4RJLA 1W46A 3A1UA 1U8YA 1JI0A 2J7KA 1M8PA 4AKIA 3W34A 1CR0A 2ZITA 2A5YB 1TUIA 2BHRA 5EE9A 3IGFA 4NL4H 4C9BA 2XZOA 3X2SA 2A7QA 2WJIA 3IHWA 1KNXA 4HZIA 2EFGA 4Q48A 5FI0B 1EWRA 4JKIA 2BKEA 1GILA 2CL6X 2WKPA 2XSZA 3CNNA 3SU8A 1ZCAA 2E9SA 2OE2A 4G3XA 4HAYA 4C0HA 3VNVA 1UM8A 1KY2A 4LGMA 4PZYA 3R8CA 4TYPA 3SYNA 1ZIPA 2KI5A 1J2JA 1DS6A 2QGZA 3QF4A 4NDZA 3K9HA 2JLSA 5EUMA 4E07A 2JIZD 3Q5DA 4PC3A 1P60A 2ZR9A 5EP2A 4YONB 3THYA 4LBYA 2QI9C 3NBFA 3Q7QA 2VP2A 4CRWB 4G01B 3U4QA 4BPBA 2GETA 4R98A 2XTZA 1SGWA 1DBSA 4DDUA 1SHKA 3ZIAD 2ZR0A 4TLAA 4JVMA 3GJ4A 4PR0A 1OV4A 1D9XA 3Q7PA 5AJXA 2FEOA 4Q66C 1IHUA 4A9AA 1CJTC 3TBKA 3IEUA 4D0GA 1E9RA 1EFRA 2VEDA 2VHJA 4UXIA 4W5HA 4B2LA 621PA 2IS2A 4H9GA 2GNOA 1K6MA 3J81k 3CO5A 3I8XA 3O47A 4JSYA 3FTQA 3I72A 3U3OA 4AD8A 2AKYA 3AUYA 4R7ZA 5IRCD 3AF2A 3FMFA 4HATA 3ZVRA 2KBFA 2YINC 3A6PC 1F2TA 2Q6TA 4YDSA 1Z06A 1JBKA 4QNRA 3KKQA 3THWA 1ZD8A 3QKRB 4C0LA 5E7IA 4AKEA 1GUAA 3BD9A 4HB0A 4Q4HA 4V0LA 3A37A 5CM9C 4ZDKA 2FEMA 1DO0A 4GFDA 5DSZA 3REFA 3ZD7A 3SYLA 1TF7A 2OXRA 4FN5A 1WMSA 3C41J 1G7CA 4XTRA 1DARA 4X8HA 5LBIA 3PENA 4NONA 1UDWA 5FUVA 1XZPA 2OFOA 5KYKA 1OIXA 2ZRMA 4AURA 5F9HA 3BJIC 1DADA 1TEXA 2E1RA 2OCBA 1JJ7A 4IJMA 4URVR 1ANKA 2QM7A 2ZSDA 3GCGA 1RJ9A 5BXQC 4UQOA 3T5DA 2OILA 1GOTA 1N6KA 3SHWA 3SN6A 3EWSA 4YMWA 2RGAA 2XTNA 1N0WA 2DR3A 3D7MA 2O8EB 1VG9B 1WDTA 3AQ4A 4FIDA 3FWYA 2IYZA 4I1UA 3U6KA 1TU4A 4HLQB 4EAQA 3TK1A 1VECA 1E2NA 1YZKA 4QG7A 1E9AA 4TYYA 4HLUA 2AK2A 1KI4A 1Q22A 3CH4B 4KLZA 4RZ2A 5FL7D 2CVHA 2RGXA 5KPJA 2W2TA 3WMFA 1IBRA 1T8TA 3MAAC 3QUSA 4LY6A 2LKDA 3UATA 2PT5A 1YR7A 4LHWA 4LV6A 3K0AB 3ND8A 4FCWA 4Q02A 3U3MA 3PR1A 3F8TA 5J5CA 2C99A 5IK2D 4JBXA 1O3YA 1ZM4A 2VHUA 5TB5A 4I1VA 1K5DA 2JASA 4Q9HA 4JLVA 4ZKEA 1S3SA 1UBGA 4G5GA 4LBWA 2PEYA 2PEZA 1YQTA 4II7A 4XVRA 4JMPA 1F3OA 3BGWA 3PUYA 2XEXA 1AK2A 3WYGA 3I8SA 2EVWX 4JYCA 3QXJA 1KOFA 3NG1A 1JR6A 1E2IA 3PEWA 1XZQA 4YC7A 3SJZA 3TAUA 2O8FB 1WRBA 3GLFB 2VL7A 1ZP6A 4P4UA 1NN0A 5HE9A 4R71A 1TMKA 1OIVA 2YV5A 4XD7A 3SFVA 4M9SA 3SHFA 3MRSA 3EPHA 4LJ4A 3DKVA 4FCVA 2IYXA 3C7KA 4LCBA 1FOEB 4KV9A 4NE2A 3RS4A 3GLIB 1NLYA 2CBZA 2GAOA 1U0HC 1C9KA 4LX0A 4TTPA 4QM6A 4MKFA 1XXHA 4IFBA 4RD3A 3W6OA 4PC6A 2IS4A 4PQYA 3NC0C 1M74A 2GEVA 1H65A 2QP9X 5FH9A 4IXNA 2PBRA 3L8YA 3S1AB 4DSOA 4NCIA 4NKRA 4BFSA 1GL7A 3K0CA 3AKCA 2R6GA 4Q1DA 4LJYA 3U7HB 1QHSA 2D3WA 2IYVA 3CONA 3L82B 3LX5A 4O2RA 4QBFA 4URZR 2IL1A 2MSCB 4RD6A 1H8HA 1US8B 2X2EA 1G8FA 1L8QA 4US0R 5FBVB 3HR7A 2RGGA 4HZUB 4D25A 1E99A 2ZETA 3FOZA 1PJRA 1D2EA 1SVIA 1NIJA 3L0OA 3LO5A 2JA1A 1KKLA 2BMJA 3NBZC 1IM2A 4JLMA 3I32A 3P27A 3KKMA 2OV2A 3LBHA 1E4VA 2H16A 1K8RA 5KSPA 3WHLA 2YOFA 4OI4A 2QMOA 1XD8A 2YNMA 3QPVA 3RS7A 121PA 2ZSAA 1MABB 4EQ6B 1P2SA 1EFCA 3GQBA 1KSJA 2XNSA 3I92A 1ZU4A 1XP8A 2W00A 2EYUA 1XCGB 1P9RA 1I2DA 1E1RD 2PT7A 2GKSA 3LDAA 2GF9A 3BFVA 3T1OA 2NIPA 3SDZA 1GZSA 1RKBA 4GT1A 4WW0A 2AXNA 4D2IA 4JL8A 2GBLA 1EFRD 1LTQA 3RAPR 4JT2A 421PA 3KZ1E 5JEEA 2WICA 2N42A 5J47A 2EQBA 3E2IA 4B3XA 1UEIA 2PZFA 1NVWQ 3VHXA 1IY2A 1JAHA 4RD0A 2DFKB 3LAWA 1P62B 2ZJ2A 4EFNA 5KOYA 4FWIB 4DT1A 4TMZA 4IOMA 1Q1QA 1FP6A 1JECA 1KZ7B 2J3EA 2IW3A 1NVVQ 2VHTA 4LBVA 1G7RA 3NHAA 2ZYUX 1ZYUA 1E2PA 3HYTA 2XB2A 4JIMA 4PPFA 4ACAA 3NC1C 4WAUA 3KB2A 2RAPA 3ADBA 3BBPA 2QU8A 4A8JA 2Q21A 1G8PA 1L4YA 2C03A 3PITA 3KUCA 3W8NA 1ZD1A 3WRYC 2FFHA 2WWWA 4B35A 4ZIRA 3VQTA 1V43A 4TL7A 2F55A 3THXA 1G8HA 1XMVA 4Q18A 3UPUA 1DAMA 1AZSC 3B1ZA 4MKGA 4QGHA 1LW7A 3LFUA 4PX9A 4JKYA 2IC5A 1W7AA 1W47A 1U0JA 3B6EA 4EPYA 3OIYA 4NBSA 1MO3A 3EWAA 1T5LA 4B2IA 2ZQ5A 4M4SA 5IT5A 2JLRA 3TUIC 3NDBB 5FI1B 1KK1A 2F9LA 2BM1A 2J7PA 3K0CC 4DVGA 5LDDC 3VR2A 2QUZA 1Z28A 2G1KA 3IO5A 2WJVA 1P72A 4XVQA 5E7MA 1ZNYA 3AKYA 2O52A 3AGPA 2Z4RA 1UDXA 3NH6A 2FPKA 1IN7A 2BMFA 2DWPA 4RFVA 2PMKA 4WXPA 1X86B 4PSAA 2QPAA 3RS3A 4LJ5A 2IEYA 4OI0A 3GLGA 3QG5A 1COWA 4NZYA 1IQPA 3CKLA 2VPPA 1OH8A 3OF5A 4GOXA 1W49A 4TTQA 1IN8A 3KFVA 1YHNA 1TL7C 1AQYA 2YJTD 1CR1A 5HCNA 3ZVNA 2GAAA 2PH1A 4MGIR 2ZRPA 1CIPA 5CYPA 3EW9A 2IWRA 3AKEA 2QSZA 1CP2A 4GMDA 1T8UA 3U3KA 5SZIA 5F2EA 5L3QA 3RS0A 2ZJOA 5KDOA 5EZ5A 1DELA 4QGFA 3O8RA 3QEOA 2GWHA 1GM5A 2GEDA 1YZNA 2GJKA 1ZC3A 4B3DA 1NSFA 1VCNA 5L3SB 4KITB 1YZQA 4CEHA 3UK6A 2ATVA 4BRUA 4RCZA 2O8CA 3PV0A 2JLWA 2R9VA 5HCIA 1G18A 4QHYA 1SVKA 1GAJA 4V0MA 2VP6A 5LB4A 1SXJE 3CNOA 5ANRB 2WJYA 2VP4A 4C0JA 5FOUA 4LYFA 4ERNA 2H1LA 1E2JA 5DYGA 3VTKA 4LJ8A 4QBGB 1X1RA 2NGRA 3LVRE 2P67A 2QPTA 3SI7A 2WHXA 2P6RA 4PPGA 1MRNA 2IS6A 1P6XA 2ZU0C 1W0KD 2HCBA 4MRSA 1TQ4A 1UKVY 3QBVA 4LJ7A 1GL6A 1Q3HA 3HPQA 3A1TA 4JVSB 1NY5A 1KO7A 2JIZA 3UMFA 3TUZC 4Q4AB 3F0TA 3SC3A 1FPMA 1FNMA 2NPFA 4M22A 2KJQA 1P9NA 4CEIB 1HE8B 1A82A 1NKTA 4B75A 4NCNA 1M1YE 2Z5FA 3JVVA 5FTKA 2GTPA 3ND9A 2QROA 2FSFA 1R0YA 1N6HA 2ZJYA 3TW4A 3PFIA 1S4QA 1QZXA 5EXPA 3AVTA 3O8CA 4XJXA 5J40A 1SVOA 1DPFA 2EW1A 3C5CA 3Q5EA 3B9QA 2ZUDA 1ZD9A 2TMKA 521PA 4B74A 2WJJA 4Q7KA 3X1YA 3M4YA 3LW7A 1SVLA 1Q12A 2AKAB 3MMPA 4KAXA 3WP1B 3U7FB 3PCRB 4GZMA 3K9NA 1W36D 1Y63A 3CRQA 1JALA 1EK0A 1CR2A 3LWNA 3MJHA 5KNBA 2XOKD 1SKYB 3L0SA 3A1SA 4IOKA 4C0BA 1XPUA 3JZAA 1U90A 1NP6A 1OW3B 1OXXK 2A5DA 4F38A 4LBZA 5AUPB 4OHYA 3E5HA 3L2OB 4Q4LA 4EIWA 3C4JA 4F7WA 4Z51A 3QF4B 2CK3D 1OJLA 3W8RA 4GRAA 3KTAA 4QJ5A 4BLOA 4TYWA 5AR1A 3BK7A 1I2MA 4TMXA 1VG8A 3EXAA 3B1WA 5LD2B 2HXYA 4C7OB 1Q1EA 1DAKA 4TMWA 3P32A 3AH8A 4FMBB 4B43A 1KO5A 1ZUNB 3GEHA 1DAIA 4LJ9A 3HJNA 4DSNA 5H1YA 4M2LA 5CDFA 1Z0FA 4BLQA 2OBNA 3LQRA 1RYFA 1IN4A 2NO0A 3P1JA 2FSGA 1T4GA 2CDNA 4KO8A 3TGPA 1XF9A 3KB1A 3U3RA 3PEVA 4MKHA 4UNNA 3KX2A 1YZTA 5JJIA 1E32A 3OHMA 3SQXA 4MRVA 3THYB 2N46A 1HY3A 1NVXQ 2ZE7A 1G19A 2FJUA 1G3QA 2NPIA 4JT4A 1C4OA 4I1OA 2ZRJA 1N3BA 4TT3D 4QM7A 3KJEA 2I1VB 1VKJA 3HWSA 4F4JA 4X8LA 1PUJA 3OFNA 4XD7D 1Z6TA 2FE4A 2WWIA 2DY1A 1KO8A 3M1IA 5FR2A 2G3YA 3H1TA 4EJSA 3ZVMA 3THOA 2BCGY 3ASZA 2C77A 2RB4A 3IPXA 1L7VC 5TY0A 1MO5A 4CEHB 2FA9A 5G3ZA 2IYUA 1K5GA 1DO2A 2WWHA 4UKDA 1N5LA 1E0KA 1W0KA 2GJAA 2VTKA 1T6NA 4UNQA 4WA7A 3T06B 721PA 5GVSA 2RMKA 3D3QA 4UJ5A 3IIJA 4C0QC 2IYSA 2CLDX 2GZDA 3H84A 2YYZA 4TQAA 1Y3AA 2GK6A 2P3SA 3IIKA 4L9SA 4G0NA 1FNNA 2P5SA 2VBCA 1N2CE 1KI7A 2FPLA 2RH5A 4NH0A 1VTKA 1U8ZA 1KK0A 2CHVA 4I81A 3R7WB 1WBDA 1UF9A 4PANA 4Q1CA 4BZPA 2MMCA 1P75A 1JPNA 2PMDA 4TYNA 4N1AA 2DFLA 2NTYC 1BS1A 4ZIRB 4YXWD 2ZJ8A 4TYQA 4MRPA 2J0SA 3EPLA 4JLOA 1FQKA 3LH5A 4PO1A 2GXAA 2IYRA 1OE0A 3LQQA 3RVBA 1U9IC 1R6BX 4CYMA 1PUIA 1U98A 2FPMA 2H57A 4I4LA 3TSOA 4ESVA 4KYUA 4AKHA 2C9YA 3GLFE 1SXJD 3SJBA 4C0SA 4LYHA 4B76A 4ZI2A 3CR8A 2ZI6A 2X8AA 3TE6A 4HLDA 4R9UC 4CGZA 4C4PA 4QL3A 4M1TA 3CNLA 4Q1AA 2BIFA 1G9XA 2F9MA 2QGNA 2OG2A 3OIUA 1QHGA 5AJVB 1S2MA 2I4IA 3AF3A 2BBWA 1KHTA 4MGZR 5EE0A 2J87A 3RRYA 5KSOA 4DWJA 1AN0A 2O0HA 2Z83A 3S1AA 1ZINA 1YR6A 4XSGA 2GVZC 4A92A 5H8WA 2JLVA 3B13B 1GKUB 2V3CC 3DEFA 4MDEA 2HF8A 1XEWX 4OJKA 2JJ2A 2ZS7A 3Q85A 3LBIA 2ZXUA 4QHTA 1WBBA 1RVDA 2BMEA 4DLVA 1FW6A 2C98A 2C95A 1II8A 4IVQA 3FMOB 3PUWA 4OHVA 1N0VC 1XEFA 1XD2B 3WP0A 3PUZA 4A1FA 1EWQA 1H8ED 1IXSB 4DIEA 1Q1BA 3GLIA 3FHOA 2EFCB 3VR1A 3ZJYA 1P9WA 5JSZB 4F92B 2ZPTX 5AK0A 2C96A 3NEYA 3VR4A 1O87A 3BB4A 4BFTA 2VSOA 3LD9A 4KU4A 3BIFA 3X1DA 5EXSA 4LV8B 3ZVLA 2ANBA 1VG0B 1MR3F 3HPRA 2Q3HA 3M6AA 4B3CA 2WWYA 4KSBA 2NG1A 4AYTA 2XZLA 4KI0A 3L0IB 4G1UC 4BECA 1LB1B 1OKKD 4Q5IA 5KDLA 4BUJA 3GJ5A 1TF5A 4CF7A 5BN4A 3W9YA 4C0KA 1QHHA 4KBFA 2O8DB 2Z0MA 2IK8A 3EA0A 4P32A 3VNUA 1A2KC 221PA 2D4HA 3BS4A 4YMUA 4N0DA 2AN9A 4AG6A 5D3MA 2OAP1 1KDPA 3EPJA 3U2QA 4ASUD 1JPJA 2ZR7A 5TDHA 3ZLJA 3SOPA 1Z47A 1YZLA 3OE7D 2OFWA 1JXMA 4FMCF 1DAGA 3W6NA 3RANA 3WNDA 3I5YA 2A78A 1UAAA 1R7RA 4Q21A 5DI9A 1VYTA 2GJ8A 1B0UA 3PEUA 1XPRA 1G4UR 1G291 1MABA 2AD1A 3NKVA 1GNQA 1NKSA 4IXMA 1IJFA 3KKPA 5FBQB 3PG5A 5DIFA 2BM0A 1KI6B 1P2TA 4RZUA 1OFTA 1DAFA 1UEJA 5GJBA 1CJUC 4DEXA 4RD4A 1DE0A 2W6ID 3BH7A 2ODWA 2VF7A 5TVKA 1QHXA 2IF0A 4GBMA 4DUGD 4QGGA 3VKHA 4PAOA 4W7SA 4QBHA 2CHQA 1AA9A 2CJWA 3BB3A 4QBIA 4WOPA 1OB2A 2FSHA 2W58A 4L5BA 2GILA 4CIDA 1ZUHA 4DRZA 3TQFA 2CVFA 2IS1A 2DWOA 4Q4JA 3DL0A 4Z1MA 2HYIC 5J4VA 2OCAA 3EZ9A 1XPOA 2ZANA 1RPZA 1JR3D 4GPTA 1SKYE 1LVGA 1R4AA 4RY2A 1VIAA 3K53A 1NRJB 4MRRA 4KJZA 3RC8A 2VP5A 2C8VA 4P4SB 4RD2A 3WRXC 4B3FX 1IY0A 4M1SA 1XTRA 4HSEA 4BEBA 4BFXA 1YR8A 4OI1A 2GK7A 1GRRA 2WAXA 3WMGA 3PVSA 5TARA 1DAEA 3NHBA 1G3MA 1G1MA 1Q0UA 1Z0AA 1Z0IA 4GOJA 2R44A 2WWGA 3B7GA 1E2FA 1R0XA 4MGKR 1E98A 4JVNA 1Z6YA 2N1BA 1YR9A 3IDQA 1NL3A 2Z4SA 1U94A 3K0FB 2F3TA 4A2WA 1XEXB 4D26A 1VHLA 3DO6A 4BLSA 2WMNB 1OFIA 3ZH9B 1MO6A 3K09C 4LJ6A 4EPWA 4MGYR 1N5KA 1XFAA 1LNZA 3AP1A 3TAHA 3KJIA 5F9FA 4Q00A 3W90A 4EPVA 3U7GA 2NQ2C 2GDJA 2ZI3A 3UG6A 3DMNA 5FTLA 1OH7A 3CH5A 3DVLA 1JEEA 4DLRA 2OFXA 1UPTA 3IHLA 1VCIA 4A82A 2QPOA 4UXHA 2HXSA 2HF9A 5CIQA 4BRWA 2A2ZA 2ERYA 4I99A 1JB1A 2GXSA 4ITRC 4JLAA 3CRVA 1E9DA 3EZFA 2W6JA 1OYYA 2ZYVX 4PSVA 4IDOA 2ZEJA 5DN6A 4YLGA 4W5JA 2J0VA 3W6PA 1M7HA 2JLQA 3B2EA 1X6VA 2H7VA 4US1R 2WOOA 3CZQA 2A30A 4JL6A 3FGNA 4KFUA 1XCMA 1SHZA 3RRNA 3R9WA 2R6CA 1AGRA 5JWHA 5CIWA 3OIWA 3U61B 1G6HA 4G5QA 4MKIA 5JRJA 1AM4D 2DFNA 4FMDB 1XU4A 5B30A 2D7CA 1E79A 3WMEA 1CF4A 1RRPA 2EU8A 2F3RA 2EWVA 3QVUA 2AL7A 4N3NA 1EG7A 4O2LA 5IDVA 4TMKA 3LX8A 5K8TA 1UFQA 2JGNA 3GJ6A 3FVQA 4URYR 4TLCA 2GJ9A 2VP9A 3ADKA 5GVRA 1LF5A 3OE7A 3AVXA 2W2VA 3AEZA 3ONWA 4S35A 4DB4A 1OXUA 3TLXA 3NIBA 4JSTA 3KQHA 4ARZB 3OIVA 3T1VA 5CLLA 1OFUX 1ZU5A 1XMIA 5B2ZA 1FP7A 1W5SA 2GCPA 4URUR 5JJLA 1HQYE 3T61A 4EFMA 5C18A 1N6NA 4X8MA 3EX7C 3QKRA 2V7QD 4XWAA 3THWB 2JATA 2FFAA 3QKTA 4PSKA 2CE2X 5DI3B 5CITA 2DB3A 4DB2A 4TZ6A 5JRZA 3VKGA 2WM9B 1WB9A 4HAXA 5CM8B 3DHWC 3QQ5A 2AD5A 2PZGA 4HYYA 4MQBA 1AZTA 3MUFA 2CL7X 2ZI5A 3CRRA 1CJKC 4MRNA 1XRJA 5FTNA 1GRNA 3D6TB 3TVTA 4ARZA 1Z2CA 2J0UB 1HTWA 4TTRA 1F2UA 1N6PA 4PHFA 3ADCA 4GL2A 2OO7A 1G5TA 2QBYA 5EE1A 3SR0A 5AUNB 2JJ8A 4L16A 1XWIA 3U5ZB 1G17A 1VCMA 1W44A 2GZHA 3A36A 1ZNZA 4OQXA 4YDHB 3UIEA 4CT4B 1W0JD 4NCKA 1OPXA 3UG7A 5F98A 1R5OA 3GLHA 4LZZA 1HUQA 1QHNA 4GMXA 1ZUIA 3FDIA 2HT6A 3KL4A 4A8JB 3SEAA 4D4JA 4M53A 1NN3A 2Q3MA 3UANA 1EFUA 5JI3E 3ASYA 3ZZTA 3CF6R 2A5FA 4PFSA 1NNEA 4D82A 2Q0HA 2G0NA 1WE2A 3QG1A 4Q7JB 4V0ME 3ICQB 3LLUA 3UWOA 1E9EA 3QBTA 1P73A 1RE0A 2OZEA 4ON9A 4M1OA 3CWZA 2ZE6A 2ASEA 3ZIAA 2XJ9A 4Q9IA 2WKRA 1FFHA 3U3JA 2ZVPX 4G5SA 4PXAA 3ADDA 4Z54A 3VHLB 3V4RA 3EIEA 5B58C 4ILEA 3CRW1 4HB4A 2W6JD 1R0WA 2C04A 2AR7A 4RCYA 4DXAA 2A9KA 3LW8A 2I1QA 5AJYA 5FFMA 5J4YA 1E4YA 3T1TA 2JLYA 3I62A 4F4IA 1XJCA 3CRMA 5JS7A 2ZRNA 1T3LA 2Q9AA 3LA6A 1U8AA 3EIHA 1FQJA 3I3SR 4IDPA 1ZBDA 4E09A 2ODEA 3NBXX 2HT1A 2GXQA 2R65A 1HYQA 1N5IA 3BFXA 4POAA 4WVFA 5LB2A 3PIRA 3ECCA 4LOAA 3SE0A 3ZS8A 1R10A 1GRQA 2BVNA 4RFSB 2P0EA 1EFTA 1KAGA 1Z22A 4PQRA 2VF8A 2CCGA 1UJ2A 3TMKA 3C15C 2A3RA 5CK4A 2OEPA 5FOSA 2WPDD 4HUQA 1E1RA 3KJHA 1W4RA 4M1KA 1I4TD 3VX4A 4DCSA 1XJ0A 4JZKA 2QTFA 3MGCA 2RGBA 1IN6A 1P4SA 2OLJA 4EPTA 1KDOA 3DOFA 2RGNC 2K5UA 5HPYB 3W3ZB 2B92A 5FUXA 2P65A 2XNDA 4LPKA 4QJ3A 2ZTSA 4DSUA 2WMOB 1G8GA 3SNHA 5DE3A 1CRPA 4BWYA 2QE7A 2WOJA 4PHTA 2QNRA 2G1JA 4OK5A 4YMSA 2AX4A 1U9IA 3RSLA 5FBLB 3RHFA 5JMTA 3QF7A 2BV3A 4DC9A 2J46A 1KYIA 2BBTA 2QA5A 1RYHA 1XEWY 1NN1A 2F1RA 3L43A 2FGJA 2GBLC 1CXZA 4JLDA 1FMJA 1AJEA 5DGXA 1NSTA 4RVCA 4DIDA 2BKUA 3GEEA 5K8IA 4URWR 1A4RA 2G77B 4RD1A 1BYUA 1WQ1R 5E7JA 4LDJA 4BASA 1CEEA 5GADl 1A5TA 4I1SA 1E2HA 1HURA 5JS8A 2FN4A 2YOGA 4PPNA 3TR0A 1G7SA 2J7PD 2DFTA 3Q9LA 2HLDA 4M1YA 4MITA 4RSGA 4CW7A 1U99A 2AFIE 3GP8A 1NG9A 2IYYA 1R5BA 1G8YA 3DZ8A 2ZJBA 4QHSA 2BEKA 3KXIA 2IHBA 2V8OA 5HR5A 4K8OA 3T1QA 1CBUA 1X1SA 4IW3B 4GP6A 1II0A 2OHFA 3KQLA 3FKSD 4FI3C 2GJSA 1PV4A 3K0EA 2B8TA 3A1WA 4EQ6A 2O8EA 4AK9A 1CTQA 2V54A 2W6IA 2WJHA 1COWD 5L3RA 2QG6A 2CLCX 1M34E 5DHAA 3G5UA 4OQLA 2HDNB 1TF2A 2ODBA 1G3IA 3K70D 1WF3A 3T15A 5JHHB 1T0HB 5BQ5A 3K9LA 1TU3A 1G16A 2YVUA 3OFND 3CIOA 4QRHA 4ZDIA 1GKYA 2BC9A 4OKSA 5G3YA 2ANCA 2ORVA 3CF2A 3HR8A 2WSSA 1BKDR 3AP3A 1XD9A 1AGPA 3GLGE 4A0RA 3OEEA 3AF1A 4D4KA 4U7DA 2VHQA 3RNLA 5KNCA 5CJPA 1ZM7A 4IOJA 2FNAA 1ZNWA 2QAGA 2XOKA 1NLZA 1OXTA 3R9XA 4TLEA 4BZQA 4MDFA 5JJKA 1YRBA 4D81A 1CLUA 2GVDC 4PQFA 1EXMA 1XXHB 1JR3E 3A1VA 2P2LA 2YC2C 3M0EA 2BBOA 1OXSC 3CW2A 1QHHB 1X3SA 1W1WA 1CJMA 3PUXA 3BB1A 2VIIA 3PEYA 4IDHA 4O25A 4NP6A 1DG3A 4UJ3A 2WV9A 2KBEA 1Z63A 1L4UA 4V0OA 1FL9A 2D74A 1CJVC 1NLFA 2FZ4A 3LRPA 3EARA 4HUQB 2J59A 5SZHB 1RRFA 5DN6D 4OHZA 3KJGA 1BMFD 5FPYA 1Z29A 2PCJA 3B60A 4BEJA 3A4NA 4LHXA 5JFGA 3CUEF 1TQ6A 4QJ4A 2QAJA 4XOIA 3ETLA 1E2MA 1KSHA 2HCJB 2O0KA 1A7JA 2JJ1D 1NMYA 3ZS9A 3QNUA 1TEVA 3RRMA 2AFHE 2C2HA 3BE4A 3X1XA 2WAYA 1TX4B 2BMDA 4C30A 1G41A 1D5CA 4AKGA 3QOFA 1D9ZA 4MA4A 1Z07A 4JLJA 1E2QA 1OH5A 4QFMA 5JBQA 4NPHA 2RGEA 5LPNA 2BJVA 3VKWA 1R5NA 3I73A 3CWQA 2J0UA 3F5FA 5FPHA 4CVNA 4DLWA 4Q7LA 2ZSFA 4JLKA 4TL8A 4DCUA 4LPSA 3LXXA 5BN3A 4US2R 2V6JA 1H8EA 4AYWA 4C7OA 1NJFA 1GTVA 3P26A 4A4DA 4YMVA 3TSZA 1U0LA 3FFAA 3CX8A 5KUTA 5FPKA 2X19A 3TH5A 1E0AA 1IN5A 3IBYA 1KTVA 1RC8A 3AV0B 5JWOA 2F6RA 2OXCA 2QT0A 3P20A 5FPTA 4RFSA 4KFSA 5H70A 4LHZA 4UXJA 4FCTA 1W2GA 5GJCA 4EJSB 1KI1A 2REXB 3IQWA 2B7BA 3H0KA 3FFBA 3VR3A 1QHIA 1YE8A 2ZI4A 5EP4A 3RWMB 2WVJA 1IAQA 1QRAA 3IIMA 3CBQA 2G6BA 2BWJA 2GF0A 5B57C 1E96A 2J0QA 1CKEA 1GNPA 2ORIA 2QMEA 2VH5R 3AB3A 3GJ3A 4JS0A 2H18A 1OT3A 4KFRA 3RABA 1GVNB 2D2EA 1R2QA 2CE7A 1GSIA 2F1HA 1QVRA 4YMTA 3QKSB 2FMXA 1D2MA 1N6LA 5EZ6B 1ETUA 1RW4A 4HAWA 3TJZA 4ZV4A 4CEJA 3H2YA 5DO9A 4Z8YA 1F2TB 3AGQA 3CZPA 4D4MA 3EAQA 4HUTA 3U7EB 3QJYA 4NYMQ 3L0PA 5AUOB 4JL5A 2PJZA 1T0JB 1YU9A 2BBSA 2F1IA 4HI0E 4BLPA 3BC1A 3QEJA 1BYIA 2EFEB 4TSFA 2GEUA 5FUYA 4IDQA 3PXGA 1DTSA 4OK3A 1Z6GA 2AK3A 4L15A 3TNFA 1WP9A 4GZLA 2RCNA 4Z1MD 3PJRA 1Z5ZA 2HV8A 1E9BA 3MD0A 3TKLA 1XX6A 2GXUA 4BZXA 5C4GB 1GITA 1S96A 3T35A 1N25A 2P5TB 1ZCBA 2ZI9A 1CU1A 4EPRA 4W9MC 4P31A 2EWWA 1J99A 1NG1A 1DG1G 3LBNA 3U4QB 1W4AA 1BOFA 2F43B 4TQUS 2WIAA 3TSWA 4NTZA 3RYTC 4D4LA 1KO1A 3NDPA 5EE5B 3U60B 2YOHA 3TVDA 3GJ0A 1KKMA 2LKCA 2WSSD 2JEOA 4ASUA 5G41A 4FXPA 5K8UA 1IXZA 1N6RA 2PLFA 1E2LA 3MWKA 2PL3A 1HE1C 4H1VA 3GD7A 4A0HA 4OHXA 4S2EA 1YZGA 5TMPA 2CHGA 4RZXA 1TQDA 1ZJ6A 4H1UA 4OK6A 1NMZA 4IFEA 1KZGB 3QKSA 4Q19A 4AYXA 2Z43A 1SQ5A 1E0JA 1OIWA 5F3WB 2G0TA 4TSFD 5CJ2A 3CB4A 1EX6A 4CEJB 5L8VA 1E9FA 5LD2C 3VFDA 2WPDA 2ZAMA 4G5OA 4M1WA 1MRSA 4JJZA 5G40A 2EYQA 3MG9A 3Q3JB 4OQNA 4DDWA 5BWMA 4Q9LA 2RKOA 4KVAA 4JLNA 4B47A 1G3UA 1A1VA 3NEJA 2NO6A 2FFQA 1KI2A 1HT2E 3IKJA 4EPXA 2J41A 2CXXA 4A6XA 4OL0A 3ZZUA 4OJQA 3THXB 2BJWA 2V7QA 2EFHB 4P33A 4DLUA 1SKQA 3WYAA 1G4AE 4C0AC 821PA 1GG2A 3UKDA 2O8CB 1AKEA 1ODFA 2IHYA 4BQSA 4ZCIA 4NYJQ 5IF9A 5CLQA 2X2FA 2ZUCA 4LWZA 1TAGA 1TPZA 4JVLA 1XNJA 5UKDA 4WBSA 1TNDA 1ZW6A 4B33A 5HZKA 4A15A 2ONKA 2ZE5A 2ZJAA 1Z0JA 3VU9B 1LFDB 5DISB 1S9DA 5BYKA 4RKFA 3AKDA 3K1JA 5H68A 4FINA 4A6PA 3H4MA 1MKYA 1ZIOA 3BAFA 2H5EA 2GCOA 3KUDA 2R6FA 2BCJQ 1F60A 2GESA 1AIPA 1S0UA 2QMHA 4N0EA 2SHKA 2JDID 3EG5A 2IA5A 2ZUBA 1ESMA 4PAMA 4BFZA 4Z8XA 2FSIA 1E9SA 4OHWA 1FTSA 3HYRA 3MLEA 4DHEA 2PCLA 4V03A 3KQKA 5GJWC 4LHVA 1YRAA 5D3MB 5JHGB 1E0SA 1KMHB 2ZRBA 3CR7A 3ZGXA 5EQTA 4L8GA 2DHRA 3CX6A 4F93B 5L3VA 2G83A 4HAUA 4NYJR 3IBGA 2HJVA 3KDSE 2QY9A 4MYTA 4XWOA 5B64A 1OXVA 2FWRA 5KSYA 2HUPA 3ICEA 2VLIA 1RZ3A 2V55B 3N2IA 3N2EA 2BDTA 2IYQA 5JI2E 1C1YA 2J5XA 4JLPA 3U44B 2B7CA 4WIAA 3NVAA 1T9HA 3QY0A 2YC4C 1KI6A 1I4DD 1GNRA 4V0NA 3SZRA 4CZ2A 1NN5A 2QAGC 2MMGA 3MWLA 1M7BA 1OB5A 4DLYA 1HT1E 5FUWA 3ZD6A 1R8QA 2CLSA 2FFBA 3CPEA 4B3GA 1JQJC 5JSZA 4Q1FA 3KQNA 5FOWA 1NF3A 2C78A 3QXHA 4AY2A 2LWIA 1SVWA 2W0SA 2B8WA 4CDGA 2F43A 3K70B 4U00A 4DBLC 1VYVA 3ZYCA 3IUYA 4IRUB 5C2JB 3TRFA 5A5GA 3FHCB 1DVRA 1U81A 2QEQA 2CMKA 2QMUA 1KK2A 3DM9B 3KKOA 5CDFE 2WJGA 4P3YA 2KB0A 3GLIE 3GFOA 3UWKA 3K70C 3SJAA 1R0ZA 1P61B 4B3BA 1JR3A 2KSQA 2CK3A 4DZZA 1GDDA 3WHKA 1KIMA 1QG4A 4NMMA 1GWNA 2J45A 4TT3A 4DLTA 3P4YA 1HH4A 3EC2A 1GL9B 5EUQB 4KSCA 1M2OB 4HB3A 3W5IA 2UVQA 3REGA 4HLUC 4W5WA 4WZ6A 3TW8B 2ZREA 4MUAA 1CRQA 1QG2A 5FBWB 2NO7A 2IUUA 3W5JA 5EJEA 2FV8A 3WNCA 4LYAA 3RDPA 3FHTA 2O0JA 5FTJA 5FPSA 1JAIA 1NIPA 1XJQA 1CR4A 2AXPA 5DYIA 5FOTA 5CB8A 4EUNA 5ELXA 3B1YA 5FOXA 1PLJA 3VR6A 1WCV1 2VYFA 6Q21A 4BLTA 3NBYC 2MSEB 1SXJB 4GSYA 3RS5A 2IXFA 3LNCA 2RGDA 2WIBA 5BW8A 1XTQA 1YVDA 2XJ4A 3JVUA 4ZDJA 2B6HA 2PLRA 5CB6A 2JJ2D 2WBLC 3BRWD 1P7CA 1OKKA 2FG5A 4B48A 1E79D 4Q7MB 2Q9BA 3HP1A 1KDRA 1ZM9A 1ZRHA 2R6DA 2ZS9A 4AI6A 4ZCMA 2V9PA 4IEEA 2FX3A 2QM8A 4M9QA 2A5JA 4JYBA 4XWKA 2GCNA 4WXRA 4Q1EA 3D31A 1KSFX 2IYLD 1D6JA 3DOEA 1XD2A 4LI0A 4ZO4A 3L8ZA 1W36C 3V9PA 1E2DA 1KMHA 2D2FA 2FH5B 4ZI3A 2EFDB 4LUCA 1MT0A 2ERXA 2NOAA 3DDCA 1NJGA 3SBDA 2RGCA 2QP4A 2R6AA 4E03A 3FPAA 3TQCA 2JJ1A 1J8YF 2FU5C 1EGAA 3DMDA 3PQCA 1BH2A 1X8JA 1Q21A 4ABYA 4EJSC 5FTMA 2IT1A 1W2HA 2CJWB 2ZRLA 3V00A 2IYWA 3QIAA 4PPQA 1Q44A 3W3AA 3OESA 4P4TA 2XTMA 2ZRIA 1PLKA 2NO9A 4NYIR 5TXGA 2FF7A 2WKQA 1OYWA 2HYDA 5IK2A 5DI3A 2QSYA 3H86A 1OSNA 1RIFA 3R8FA 1XTKA 3B85A 2XX3A 4QOSA 3SJCA 2PX3A 2FZLA 2WZQA 4DJTA 1OLOA 2GA8A 5KTYA 4QKQA 3N70A 4GDFA 4Q4AA 4RKEA 2XXAA 4V0KA 5EP3A 2ZS8A 1ESNA 3X1ZA 2QTVB 3A4LA 3MSXA 4F91B 1HA3A 1G64A 3O8DA 1VDZA 5JLJA 3VR5A 1ZAKA 3IQXA 2QQ0A 4YXWA 2OESA 2ZM5A 1Z3IX 1UBEA 2OSBA 3QE0A 3RRZA 2QENA 1X8KA 2ZRFA 2QAGB 5DH9A 3TIFA 3ZDQA 4AIIA 4X8OA 4TL6A 3CPHA 1AKYA 2CNWA 1LY1A 1LF0A 1JXOA 4L4UA 2ZVQX 2QQEA 2Q9CA 3C14C 2W0MA 5L3SA 2OAQ1 3CM0A 5DLQC 2ONJA 4PO9A 3QI2A 2R2AA 4ZDWA 4TMTA 1T3HA 3EASA 3AVOA 5IHPA 4A0GA 5BYJA 3LLMA 4U02A 2IEZA 2OCYC 2V6IA 3BWDD 4FD2A 5HKKD 2O8FA 5TV2A 1FUUA 3NWJA 3QXCA 4D80A 4A0FA 3AVPA 3QENA 2G9NA 3OAAA 3QKUA 3GEIA 1XDBA 5SZKB 1VPLA 2KWIA 2ZRKA 3BXZA 4NU0A 4ESHA 3I5XA 1P5ZB 2PX0A 3T5GA 3OZXA 4MH0R 5FOVA 4DEYA 5D3QA 2JLZA 1LS6A 2ZROA 1N0UA 3BH6A 4OYHA 2OBLA 1J7KA 2OCPA 3OEHA 1W48A 1YKSA 2ODNA 3FE2A 3ZQ6A 1OF1A 3U6BA 1VMAA 5AUQA 1RRCA 5FL7A 2ZRAA 5AJWA 4O0MA 3CF0A 5C4MA 5JECA 3GJ8A 3EA5A 3RLFA 1NVVR 1NVUQ 4DCVA 3GLGB 3BERA 4K46A 3ZZ0A 5DHFA 3AVQA 2H92A 4NCJA 4Y0VA 2W83A 4BFUA 2WSMA 1VG1A 3ZQJA 4BLRA 4DCTA 2JLUA 3FMIA 1F6BA 4TLDA 2XITA 4TMVA 4D6PA 4JJKA 4DLXA 3UXMA 2CNWD 1MO4A 2I3BA 1G21E 3EPKA 1ZVQA 2IYTA 4OQFA 1S3GA 4L9WA 1TTTA 1Z6XA 1GFIA 2HEIA 4DKXA 4LHYA 1YJ5A 4B2PA 4KFTA 5CK5A 4DLZA 1FX0A 2P6UA 3QPWA 4GNKA 1ZNXA 2QE7D 1SXJC 2QZ4A 1Q57A 4IVPA 5HKKA 1N6OA 1KSGA 2JAQA 3D8BA 4NYMR 1TQ2A 2B21A 1D8TA 4Y0AA 5J4HA 3GJ7A 2QRNA 3BFKA 3OEED 3WXMA 4TN1A 2OBMA 5FR1A 2AWOA 3EIQA 1G5PA 2UZ3A 3JZMA 1LS1A 3AF4A 1E2EA 3K8YA 1NBMA 2IXEA 4HDCA 4Q01A 2JDIA 4A2QA 3GFTA 1TUEA 1JQLB 1Z08A 1IJEA 4KYIB 4BGDA 2CCJA 5JWRA 5BN5A 4WZBE 2ORWA 1BO6A 2VSFA 3DZDA 1KI9A 2WTUA 2D06A 1E2KA 1FX0B 1FZQA 1NBMD 2L0XA 1IY1A 4XH9B 3T34A 4GI7A 1Z0DA 3CX7A 5FL3A 1EESA 2CL0X 1FUKA 3MJRA 1JEDA 1UBFA 3VU9A 3DPUA 4DDVA 4HDOB 3RSOA 4GP7A 3LY5A 3RWOA 1SXJA 1M7GA 4NHOA 1A2BA 1N5JA 2XZPA 1PVOA 3E70C 2HJGA 3B5JA 4UNSA 1S8FA 4V02A 1QHYA 4KBGA 4R2IA 4C3ZA 4IOLA 1II9A 2GHIA 4BE7B 1T91A 4M0LA 3DM5A 2YWHA 1WXQA 1KDTA 4XVUA 4URXR 2V1UA 2ATXA 2XNDD 1Z8FA 1XMSA 4LC0A 3WY9A 2ZSBA 4E5UA 1EX7A 4KHZA 3IPYA 4A36A 4FMCB 3FKQA 2Q3FA 1E2GA 1T5IA 4AC9A 2YKGA 3FMPB 1XTSA 1L2TA 3R9IA 4HAVA 4E22A 4F4CA 1UKZA 1JNYA 5KO2A 4HLCA 5FBRB 3I61A 3NXSA 1HV8A 3WBKA 4LK2A 4LRWA 1G20E 3K0FA 4UNPA 1NMXA 1E1QA 4J0QA 1Z83A 2XAUA 3AVUA 1J70A 2GRJA 2YWEA 4IDNA 5KSZA 4CEIA 2ZRGA 4TQ9A 2O8BB 1W0JA 4DT1B 3MCAA 5M04A 1S1CA 3IO3A 5A0FA 5A4JA 2JCSA 2YZ2A 4Q03A 5EXXA 1W5TA 3HU2A 3Q72A 4PC2A 2JLXA 2FDCA 4R2HA 2FGKA 2H8KA 4QNMA 2NMVA 1OH6A 2RHMA 2QBYB 3G82C 3AM1A 5HE8A 2XB4A 3UMRA 2D7DA 5EP1A 3P4XA 2VO1A 1SVSA 4B32A 4HB2A 3QXXA 1V5WA 1XBTA 4KXFB 2NZJA 3K0SA 5KPDA 3HDTA 1QVAA 2GCOB 1NI3A 2Y8EA 2IWHA 4HEJA 2FOLA 2X1VA 2ZRCA 1F48A 4B44A 2AHOA 1XEXA 4LJAA 3EC1A 1DEKA 2C9OA 4AWXA 3KQUA 1XTJA 3NH9A 5JCPA 4LSGA 3Q8XB 3SYKA 4ZCLA 1T3SA 1HEIA 4B6FA 4HAZA 4OI2A 3I4LA 1KJWA 4PTLA 1US8A 1Q3TA 1KO4A 3MFYA 3LVQE 3DKPA 2ECKA 4ZKDA 1E3MA 1OHHA 3AVVA 1KNQA 2Z6VA 1GKIA 4OBEA 3E1SA 1Z0KA 4FW9A 3SBEA 4B34A 1YZUA 4YQFA 3FYHA 5EE3A 3AVWA 1ELOA 2XXAB 1XMJA 3C16C 3NTUA 4M9XA 3C8UA 1KI8A 4ZPXA 5P21A 2G88A 2QP3A 2IUTA 1W36B 1S9HA 1RJ9B 1XCPA 3TR5A 1E9CA 1FMLA 1QBKC 1X8LA 2XGJA 4B73A 2OLKA 1KI3A 1ZC4A 1J8MF 2W2XA 5GJVC 3WNBA 1MV5A 2HLDD 2VA8A 5KHOC 1KY3A 1TADA 2ZJZA 1KMQA 1PZNA 1J90A 4A8JC 2VQSA 1RFLA 2ZJ5A 3BOSA 2IUSA 2UKDA 3K09A 2F1JA 3WYFA 2IX3A 4P4SA 3GMTA 1G7TA 2J1LA 4M21A 5L3QB 2O5VA 1VIYA 1F5NA 4AG5A 4U5XA 4B6EA 2R8RA 3K0AA 2DWQA 2V4ZA 5JZVA 4KLNA 2DBYA 4PHHA 5HTKA 1KJZA 1JJVA 4EDHA 4B71A 4FMDF 4IEIA 4BFYA 2OT3B 2VHCA 4NYIQ 2WWFA 2XSZD 4LYJA 5E95A 4Q47A 4JBYA 2ZRHA 1LV7A 1UBCA 1UKYA 4NCHA 3HU1A 3T12A 2QTHA 4TWZA 3A8TA 2C5LA 5AJZA 4PAQA 4P0TA 3UMSA 3BORA 4MYHA 4Q9JA 4XTCS 3SQWA 2E87A 3F3YA 4D0LB 4WZAE 5K8LA 2LCFA 1I4LD 4HZUA 3KXLA 2DCUA 4XIGS 4FWTA 4LC1A 3HU3A 2BEJA 3VAAA 4O3MA 4MYUA 4QC2A 2AWNA 4IKEA
chains in the Genus database with same CATH superfamily
2QT9A 1M6HA 5IYZF 3PC2A 2OUKA 1N7IA 2VJCA 2YFKA 4WECA 4BVKA 2WF7A 4G86A 4L0QA 4MYCA 3VTAA 2D13A 3FUCA 5B3JA 4XI9A 4DUGA 1QIFA 2ZAOA 3BIXA 3T5BA 3QIVA 1BCSB 1SZPA 3G8CA 4Q82A 3S0JA 1T0PA 3IX7A 1VJGA 3VR5D 1JQDA 4BUCA 5DNYB 5DNCA 1CZRA 1AXRA 1Y3FE 1ZM3A 4OVKA 1AS3A 4N01A 2IKQA 3BMQB 3HMKA 3LUKA 3NHPA 4G67A 5BN4B 4NJMA 3T8YA 3PXDA 1MAAA 2X0RA 4WMLA 5K9ZA 1UKEA 3CPJB 1UP6A 3EZ2A 2WP0A 2OZVA 2LCIA 1DV2A 1CUCA 2FDXA 3GLFA 4OAPA 1LWOA 1Z26A 2QOEA 2R62A 2AZTA 2B61A 4DQ0A 5KNBH 2VRWA 2JLBA 1R50A 1KIFA 1Q20A 3BTSA 1XAIA 3F7TA 4H7EA 2ZIAA 2RHGB 2Z1MA 2X7HA 3FWKA 3UAXA 4GEKA 5ALVA 2BGRA 1EFPA 1NW4A 4IF4A 2HHHB 2YZGA 4OQMA 4B6QA 2KE5A 3KYCA 2C7OA 2RGNA 4LZLA 3WGLA 2BFFA 2Z5VA 3M5PA 5BYBA 5KDDA 1J2YA 2QU7A 4PC7A 2XKKA 4AJHA 4BNMA 2O8DA 1X7DA 3DB1A 4FMPA 5AM1A 2IUYA 3ONNA 4GAEA 5SY4A 3A4MA 3TJRA 3WLNA 3D6FA 3GXOA 2DUJA 5DM70 1M1NA 3TECE 3H1PA 3R7WA 2X77A 3B1JA 4FOPA 4IUCS 1OC4A 5CUQA 1HLFA 1UAYA 2EDAA 2Z2JA 4UEOA 1J25A 5G53C 1IIRA 3RU7A 4RY9A 1E69A 1QK4A 2REBA 4WXMA 1VYUA 5AT1A 3GHYA 5TRTA 2H17A 3NTRA 1W4BA 2GWRA 1YUNA 3PUVA 4BQOA 5EIBD 4U1RA 1EZZA 1NBHA 2HQOA 1XQ9A 5DW3A 3V4SA 4BWFB 2C7PA 1MDFA 1MW8X 1LDMA 4WASA 2GSDA 2OPBA 1EFHA 4FFMA 2AMFA 1O2DA 2MWMA 4QFBA 3VGJA 3U81A 4JAVC 3LUDA 3NM4A 1QIMA 4GPZA 3S3TA 5KU1A 1WUTA 2IFTA 4EFLA 4O4HF 3T0FA 3HSSA 5JEDA 5CT8A 4G5RA 1QKJA 1RJGA 1Q6ZA 3LC1O 4CCWA 5TGDA 4YCDA 5E4FA 3RTAA 2WHPA 2VP3A 1WD5A 4CLRA 4M9ZA 3QITA 3QHPA 1IE3A 1FYXA 3PNBA 1T36B 2NZ8A 4PHGA 1TEHA 1DV1A 1U8CB 4RHUA 3R76A 3AJRA 2ZBFA 2ZU6A 3WLQA 3QE3A 5DWVA 1KARA 4CCAA 1II8B 4DRXA 4CDNA 1Z73A 4IVRA 1I36A 5AK4A 1PLLA 4H4CA 1DOAA 1T3GA 2EKQA 4EUFA 3B1XA 1O4VA 3SC6A 2WVHA 4MWZA 5BSHA 2GLXA 1XZKA 2RJOA 1UDRA 1LJLA 2R79A 3X1WA 2FY8A 2GSWA 2J08A 3DDWA 1OR8A 4E32A 4U9HS 3TTYA 3I9FA 2PRZA 1C0PA 2Q28A 1U9CA 3A11A 4Z49A 5LQNA 1W8IA 3LCJA 8OHMA 4DDTA 3UUFA 1T3ZA 3B2QA 1JSRA 2PY6A 3DMGA 4CM8A 4WQMA 1IUOA 5JZOA 4W5TA 4UPEA 2Q4DA 2ZYTX 1TDJA 4WJZA 4IH1A 4N0MA 4NECA 1M2HA 1Z4OA 1ZMXA 2CB9A 3UMJA 1DDGA 1SC9A 3QI7A 5KJEA 1UBUS 1YSCA 2F7SA 2ZSEA 5JJCA 4D8YA 3INYA 2YHSA 4UTOA 1MH1A 3JTEA 4A2PA 4AIRA 4U2CA 1G9SA 4YNBA 4BAZA 2QORA 3KJXA 2WF8A 1PQ4A 3RS2A 4BBJA 3CUYA 1IOZA 4WK6A 1YIDA 3LXRA 3AQIA 3NHSA 4D0NA 3RTBA 1B23P 3ML1A 2DPXA 4MI1A 1ZPDA 4D42A 4Z4IA 1L6IA 4RH0A 4TTAA 2G8LA 5A9SB 5KREA 3AVYA 4BFWA 1H8HD 3AFOA 2QRHA 4RTRA 3G5LA 1FYWA 1PBTA 1ZKMA 4WNYA 4YACA 3G02A 5EPOA 1YIOA 3B78A 1NU8A 3DAHA 5SYNA 3P9CA 1LNQA 3B9PA 3ITNA 4RK0A 1PJ3A 3DQQA 1W46A 5FORA 1AKMA 1VOTA 1A72A 4KOEC 3SM3A 3TRDA 3UGTA 2BR3A 2A0XA 1JI0A 5CBPB 3QU9A 1FBNA 3JD3A 2BHTA 5EHNA 4AKIA 3F3SA 5KNDH 3NIFB 5L4LA 3N76A 3SSAA 1E89A 1TUIA 2RK4A 4ZT6A 4CV3A 1H9CA 2CFIA 3L7MA 4RGQA 1DIOB 4Q48A 2EFGA 2WNHA 3BWEA 2B2XA 3EFBA 2PWYA 3FUWA 3NOXA 3IPLA 5LXTF 3RBXA 4RTOA 1S6YA 1R74A 2QG4A 4DL9A 3EQ9A 1V8PA 3IOMA 1KJ9A 4HAYA 1UM8A 4LGMA 2XCUA 5A03A 2YXBA 4Y2UA 2HC9A 3LOUA 1I80A 4TN5A 2KI5A 1H5UA 1NW6A 4HLNA 1TE2A 2O14A 2B9VA 3O95A 3Q5DA 4PYOA 4A03A 4E07A 1T9GS 4FIZA 2QI9C 2QQFA 3KUXA 3DYIA 1FLVA 4U8HA 4G01B 4CRWB 3WWYA 1U2QA 3LLCA 4AJOA 3U4QA 1RWOA 2GETA 1VLLA 4MA0A 2XTZA 5AW9A 4DDUA 3RIGA 4YP1A 4WKBA 1UINA 2Y1DA 4HXEB 1YGPA 2BI8A 4KQCA 2V7PA 3QBEA 4N8EA 1U0OC 3L6UA 4YJGB 5CFMA 1D9XA 3Q7PA 1Q1NA 5KNLA 2FEOA 2P5UA 2HY7A 2NXNA 4WT7A 3DDSA 2UZ4A 1GNVA 4YV7A 2P9JA 4JQYA 3DNFA 3IEUA 3T7KA 4KR6A 4B09A 1XIVA 2VHJA 4UXIA 621PA 1ZK1A 4G8JA 2CUNA 2JARA 1FYDA 2GNOA 1OI4A 2FF5A 2ECQA 3LOPA 4K28A 1ZH4A 4FE4A 3SS9X 1UBMS 4JSYA 1SBQA 4ARAA 5I7VA 4F97A 1AURA 5IRCD 3AR2A 4R2LA 4HATA 5KYXA 4X62B 1JU4A 4PCLA 4DNFA 3FDXA 5LQDA 3A6PC 2CFRA 2JJQA 2HSGA 4MZXA 2Z8YA 1Z4LA 3THWA 4B6JA 2FEWB 3SQLA 1V1RB 4BGUA 1FXWA 4G24A 2ZT5A 4C0LA 1N9GA 4BO5A 1GCIA 4HB0A 4ZEXA 3GROA 1GCAA 1OZFA 3CLSD 1BOOA 3MHTA 1EH5A 2PZBA 5CT5A 5JAHA 5CLIA 2ECOA 1FW8A 2YQ4A 3NFYA 5DSZA 2WTMA 1ZL0A 5HJEA 3ZD7A 5DCUA 1TF7A 4RA6B 4PNHA 1XU9A 2OXRA 3RUIA 1POWA 2VPIA 2CD9A 3RYCB 3SP1A 3USCS 4DMCA 4YRLA 4XTRA 1DARA 4O4HB 1N8SA 5LBIA 4NONA 3TG2A 4D56A 5GMOA 1FTYA 5CDUA 2OFOA 4EW2A 5B4VA 1KEZA 4N54A 1XHFA 2ZRMA 4MHOA 5CFQA 3TW8A 3CLUC 1RR6A 2D8AA 1TEXA 2GX6A 1HYHA 2MR5A 2JKZA 3FCXA 2ZB2A 2OCBA 2BMVA 2BR5A 4P0PB 1JJ7A 1S5PA 1SUIA 1I2CA 2R6ZA 1WUHS 3GYBA 1EHYA 4IJMA 1VZ2A 5AXCA 3EGXB 1ZK2A 4IUYA 2GERA 3FCAA 1IDOA 1ESCA 3P71T 4RIEA 5EMKA 3EGDA 3SN6A 4AMZA 4NXNB 2JBHA 2AFIA 4Q7QA 3IE1A 4JOBA 3T99A 2JK0A 5CFOA 4UZSA 2P6OA 3FVWA 4F1JA 1WDTA 3ETDA 3RSGA 4FIDA 3RGWS 2TMYA 1Y82A 1DFGA 2EOAA 2DSNA 4NICA 4B7UA 1TU4A 1NR5A 4CXMA 5THKA 2AQKA 2RAFA 1E2NA 1NQWA 6REQB 2YBDA 1G2OA 3KVNA 1TYDE 5E6SB 4J90A 4XDYA 1IHXA 4BXOB 4MX8A 4QG7A 1E9AA 2AK2A 2PX5A 3PQ3A 5FL7D 4NPAA 3UV3A 2CWWA 3CSSA 1ST2A 1TKRA 3GP3A 5AVZA 2W2TA 3RF7A 1DKPA 3ZKWA 3KQOA 3EA4A 4LY6A 2RC5A 8MHTA 2PSSA 2GN6A 2PT5A 1YR7A 2UVPA 4LV6A 3AR9A 3RT1A 4P2BA 2WUWE 4FCWA 5HFNA 2WG2A 3U3MA 3PR1A 2FMFA 2OORA 2C99A 1L5WA 2XYQA 1W88A 1C7QA 4JFRA 4X97A 4BNKA 4CTKA 3F3KA 3OKAA 2FW6A 4I1VA 1NUHA 5B1IA 1EGVB 2WMYA 2XOEA 5TB5A 4DUYB 1PR0A 1S3SA 1TM2A 3ZD9A 1YQTA 4II7A 4BTVA 3GQBB 1WHSA 4KN9S 1F3OA 3FDFA 2W4MA 1B14A 1I1QB 2XEXA 3PUYA 4GPEA 4PZUA 3LY8A 2WU0A 3I8SA 4G1BA 2IIPA 4JI4B 2HB6A 2EZUA 3TAUA 3HBFA 3ESAA 4L78A 5BSFA 2C7BA 4P4UA 2XAAA 3HWRA 4R71A 4L5AA 2FB9A 3SFVA 4BFCA 1D4AA 4ND5A 1MGOA 3DKVA 2IYXA 2O1WA 3C7KA 3KSDO 3OZGA 1SU6A 4LCBA 4U6SA 5C8DA 1P29A 1MAVA 4RPGA 3J7AC 1NLYA 1HBJA 2VCEA 2HL6A 5YASA 4CQMB 3LCUA 3W5HA 1RMTA 2HBRA 4X41A 4V24A 4QM6A 1F4LA 4IFBA 4ZXPA 4RD3A 3UF0A 3W6OA 1EAMA 2IS4A 3NP9A 4PQYA 3P0FA 1M74A 2GEVA 1SHUX 3AJ8A 3G0GA 4KO4S 3IKLA 1QZZA 1VL5A 2VYND 3K0CA 2O57A 1NVTA 2Q1TA 3AHJA 4GG1A 1YR3A 3L82B 4E70A 4WN9A 1ZH2A 3OBBA 1DJMA 2IL1A 4RD6A 4IS2A 1H8HA 3L5OA 2OMKA 2XGSA 5C4IA 2ZVDA 2Q5EA 1L8QA 4CL2A 4HZUB 2RGGA 5G2OA 1ZXXA 4OKNA 2ZETA 4MK4A 3FFXA 1NIJA 1V0JA 2YS6A 4CKYA 2V7GA 2VTBA 3CTPA 2TECE 2QDXA 4MXDA 3LO5A 4DM4A 4WEOA 4Q15A 1MNAA 2NZXA 3W5BA 4JLMA 3I32A 5CCEA 3P27A 2OV2A 4XEHA 3VJRA 1UQRA 4MVJP 4ZCPA 5AVUA 4P3XA 4OI4A 4KXWA 4FBGA 3QPVA 3W7AA 1E7MA 3HVRA 3F2IA 3FGPA 3PNPA 2ZSAA 4RH3A 4R3UC 2H52A 4BNLA 3PL1A 1EFCA 1KSJA 2EKBA 2LXNA 3JXEA 3RREA 4Z7JA 1ULHA 1XP8A 2NXEA 2EYUA 3MGAA 1EBFA 2IZZA 2GKSA 1NQ5A 3BFVA 1INLA 3N5KA 1GZDA 2NIPA 3T1OA 1MUUA 4OSOA 4BYGA 4GT1A 4WW0A 2Q1YA 2AXNA 1L5KA 2F64A 3WAGA 2ZFUA 1Y7PA 4RGYA 2B25A 3HZZA 5LP6C 1PUXA 3TJMA 1PSZA 2E21A 3KOUA 1H5NA 4ZI5A 3IP3A 2WFAA 1VA5A 3FOCA 2PZFA 4C0WA 1NVWQ 4EB3A 3LUJA 1IY2A 4QDJA 1N7JA 1VPVA 2ZK7A 3WQBA 1F0YA 1WU8A 5KOYA 1NZDA 4RIHA 2B34A 2B6NA 3FNFA 1Q1QA 3HRHA 3K1YA 1ZGCA 5DBHX 1WTAA 1G7RA 4I19A 4DV1B 2YRWA 4GS5A 3QK7A 2G9UA 2WSBA 3N8GA 1A50B 1UJMA 2POQX 3H99A 3F6EX 4DN6A 5HIAA 2XB2A 2I9KA 3MCZA 1YL7A 3NC1C 1RI4A 2A9FA 2NLOA 2RAPA 3C6ZA 3DAOA 3IS3A 4D79A 4DS3A 3M3HA 3W8NA 1WV1A 3AJDA 3EVGA 1FLDA 3WRYC 2FFHA 4HDAA 4MR9A 4B35A 2GK3A 4QPZA 3KQSA 4X1KA 3HYNA 3VHQA 3VQTA 1QGUA 2ILVA 5AVRA 3MJFA 4Q18A 1N0HA 1DAMA 1Y5MA 3OQIA 4G9BA 4DJAA 4E21A 1U4OA 4RK4A 1I3MA 1SUAA 2YVLA 4PICA 1NURA 1C29B 5MN5A 1Y7LA 3A3PA 3KWLA 4JKYA 2Y0BA 3UT6A 2IV3A 1JB9A 1W47A 3JQ6A 2FRDC 3B6EA 4EPYA 4KNYA 5K3CA 2QIOA 4BP8A 3K72B 4FE3A 1NW5A 5JASA 3IKVA 5DMHA 3MXOA 1AHPA 4M4SA 4UHHA 2XGOA 4RMNA 2O3QA 3CG4A 1HFKA 3ORQA 4ZT4A 2DQ4A 1BX3A 3S8MA 1BVRA 5AW7A 2BTOA 3HNRA 4EQZA 3VSAA 1N2EA 1YBFA 3HN2A 3LP8A 4OP2A 5AKYA 1N77A 1SUBA 2ZSHA 3I6YA 2QUZA 4MLZA 4J29A 1QRDA 4YP5A 1R8JA 2Q2OA 3GELA 1GL3A 2OUIA 3EXG1 2VDQB 1RXCA 1K92A 4X1OA 5E7MA 3JYLA 3TLBA 3EF3A 5DGCA 4F6LA 5KTNA 2B36A 4W8GA 3NH6A 3UYKA 2DWPA 4J1QA 4BVGA 2I2FA 3LUGA 3QU4A 2PMKA 4NJOA 5FQOA 1X86B 3OHPA 4G6ZA 4PSAA 4C1BA 1Z4MA 5EZSA 3SOZA 5B6IA 4LJ5A 5IJWA 2IEYA 3GLGA 3LDGA 2LUOA 3NHUA 3PC4A 3LP5A 4TTQA 2I03A 2BGKA 4BMDA 1YHNA 1YF3A 2IOHA 2G4VA 2YJTD 3ZHSA 2ONZA 3DL2A 3P2KA 4KNVA 3FF4A 4O8ZA 3ZOZA 2XOXA 4OOFA 5HCNA 4DHWA 5IS2A 2PH1A 5HQJA 4F21A 4C87A 3LTNC 1L5HB 1LQUA 2EBUA 3RFCA 4NZ9A 2JVIA 3WGJA 4M0MA 4NBNA 4X95A 4F0JA 3E48A 3EW9A 2D0DA 3V8BA 3CJQA 3AKEA 4K9NA 1SXIA 1CP2A 4KIGA 1HZZC 1OLSA 5JCXA 4DMMA 3R41A 2NZYA 3WGZA 2EIHA 3HFSA 4I2NA 2ZIVB 2IP2A 2ZJOA 1WSDA 2IEDA 4K26A 5E9QA 4BKUA 4CIVA 1DELA 3GGJA 4YDRA 3BE5A 3NVKI 3QEOA 4X3PA 1Q0LA 1RMQA 3HXQA 4I4NA 3NDJA 3GT7A 2GJKA 2R00C 2Z8ZA 3HNOA 1ILWA 4KITB 1EWVA 5AQEA 3G0OA 1GG8A 3UK6A 2WU1A 4LE0A 1V3VA 4RESA 1X1QA 4O4JB 2C61A 3EGWA 5HCIA 4BBAA 4R0NA 1SVKA 3COVA 1XE3A 4V0MA 2E5WA 3P9ZA 5I7HA 2WA2A 3BMNA 3Q2KA 4HFNA 5LB4A 3VTZA 3EDRA 2WJYA 3PDJA 4PBTA 5FOUA 2C5AA 1IBSA 1T1SA 1XZAA 3EB9A 4LYFA 3JQGA 1TFRA 2H1LA 1E2JA 1W88B 4O4IA 4CMGA 1D0SA 4LJ8A 1L5SA 2P67A 3LVRE 1HC7A 5EHXA 2WHXA 4MMZB 4PPGA 2P6RA 5LQUA 1NDQA 1P6XA 1ZD2P 1ZRSA 2IS6A 4Q7EA 3DFKA 4M0EA 1GAEO 1GL6A 2C3OA 1Q3HA 1PDVA 2NZ2A 3HV2A 4GBGA 3RC7A 3TUZC 5AJHA 5KAMA 5JO0A 2Y4NA 3SC3A 1FPMA 3UGJA 2IZ1A 5E0KB 1XRLA 4RQBA 1HE8B 1A82A 3IT0A 4XGQA 8ADHA 9GPBA 3B70A 1WVIA 3UK7A 1JEYA 1E1NA 2CJFA 3CLKA 3JVVA 2DGDA 2GTPA 5H3CA 3DH0A 5JD4A 1DJQA 5B6PA 1N6HA 3PFFA 5C8VA 2I4TA 5IN5A 3LUPA 2G40A 3TW4A 1AMNA 1YONA 3AOGA 2Y71A 4FE7A 1YI0A 3AJ9A 3VAZA 4XJXA 3KTFA 1DPFA 3HGMA 3Q5EA 1DLIA 3QYJA 1JG4A 4QDKA 1P6UA 4XX0B 1SCQA 3QW4B 1MP0A 4PLZA 3RI3A 2WJJA 4Q7KA 4G2TA 1U9JA 2E1PA 1QU2A 3LW7A 4LOLA 1DRJA 4I5GA 1FP4B 2X41A 3CISA 1SVLA 3GZ4A 5I01A 1QVWA 2CGEA 2HMWA 4PZ0A 4M86A 1ZQ9A 4DV3B 4YRIA 2O48X 3JQBA 4GZMA 3QZUA 1AQLA 1W36D 1VRVA 5JE8A 2X3FA 4G09A 4L7QA 3AXSA 3KUKA 2CXUA 4ZOLA 5FCDA 3RJ5A 3ETEA 3G6WA 5KYGA 3A1SA 3CLTC 2P9CA 2Y92A 3KHSA 1OW3B 1OXXK 2F4NA 4RGBA 5FPPA 1K0UA 4ID9A 2DUMA 5JVDA 1I7SB 5K0GA 3C4JA 1OWMA 4L0MA 4E88A 1EZ4A 2J9FB 1OJLA 4II2A 2DM6A 1FFEA 3B3FA 1JDVA 4QJ5A 6GPBA 4PYJA 3K4PA 3K1TA 3OP4A 2RGWA 4W63A 2WI8A 1JKJA 3T9EA 1N75A 1I2MA 2C9DA 5TNXA 1DJOA 4TMXA 5TQ2B 2GN8A 5LD2B 3ACCA 3DWFA 4I9UA 4J7CA 4QGSA 1DAKA 4WA8A 5FUBA 5DGTA 3VZDA 4CLRB 4OD0A 4F85A 4B43A 3UMCA 1T1RA 5AHXA 1N2CA 4MA5A 3TQHA 1CYEA 4FFSA 1Z0SA 5H1YA 4F5DA 4FZ3A 5CDFA 1Z0FA 4DGSA 3MAGA 4H0FA 2OBNA 3IIEA 4MICA 1I32A 3OPNA 3P1JA 5HZMA 1T1EA 2CDNA 2AH5A 2MOKA 4I8XA 4B6SA 3HUTA 2DTEA 1XF9A 3K73O 3PGKA 1DRUA 1MOPA 3NT4A 1Z35A 3H1FA 4IUBS 3ZZ1A 4YRNA 1PR4A 2C1EA 4HGQA 5KHLB 3GLKA 4KX3A 4HRXA 3DYVA 1K89A 2N46A 1HY3A 1NVXQ 2X6QA 2C4NA 2NO5A 4IZIA 2NPIA 1EFPB 1G3QA 2FJUA 4MVJE 4KPEC 3NAZA 4H0NA 1Y1LA 3I9JA 1VKJA 3KJEA 3IAHA 4F4JA 3H5RA 1PUJA 3CLRC 3WLPA 1Z6TA 1C50A 2HMSA 2JI4A 2WWIA 3M1IA 2G3YA 1FA9A 3H1TA 4EJSA 1XZDA 3ZVMA 4AJNA 3THOA 2QRVB 5CG1A 1E3TA 1J09A 4MS1B 3DLAA 3IPXA 3K70B 1I6KA 2C3YA 1R9NA 5ELLA 1MO5A 4EB0A 2FA9A 1JHYA 3A7EA 1TM7E 3LL7A 3OMWA 3FYUB 5K0TA 3LWZA 2CV2A 5K2OA 3SSMA 2EKLA 2GJAA 3C3PA 1RP7A 1VP3A 5GVSA 5I7OA 1YA4A 3IMKA 3D3QA 3QELB 5EWMB 1YO6A 4C0QC 4KGVA 4KAJA 4TQAA 2QVXX 1JNXX 1GLVA 1GQOA 1V4NA 2BFPA 2IVFA 2YYZA 5CBPA 3TXAA 2Q7DA 1B8VA 3K5PA 3IUNA 3WGOA 3DF9A 1BRMA 1NFFA 1NRWA 1QYCA 2A57A 3L7OA 1VYHA 3WIDA 2G9QA 2XNCA 3AG5A 1U8ZA 3M3PA 4I81A 4AJIA 1WBDA 4PANA 1RXIA 3U7RA 3I9KA 3WV4A 2IVZA 2MMCA 1P75A 3A1NA 2OV6A 4HN2A 3GO4A 2DFLA 2XCLA 1BS1A 4ZIRB 4TYQA 3D7SA 1ZGJA 1NTRA 4OP3A 2QJOA 2Z1DA 3DCNA 3DD1A 2QQ5A 2HNKA 4O0LA 3BF7A 1PJAA 3IJRA 3TN7A 1UZUA 5IFLA 1OE0A 3IEKA 1U9IC 1U98A 1I3KA 2Z9DA 4GXTA 1J0EA 2P9FA 1IVNA 1RZRA 4KYUA 1Q0TA 5KJFA 2R3SA 3D7RA 4YQZA 3SJBA 2OQIA 4HQKA 4ZI2A 2EL7A 1JHDA 2ZI6A 3MQFA 4RVHA 2B37A 4QL3A 4MQFB 2YASA 4M1TA 3CNLA 1C5KA 2J6BA 2F9MA 3PNLA 3OIUA 2QJTA 2I4IA 3AF3A 3FWNA 3V4LA 2WJAA 1Y9EA 5EE0A 1FXSA 2F8MA 4RM3A 4I4IA 3SEQA 4K0RA 4FNAA 2FEAA 4MRMB 2PWAA 3COYA 2NXWA 1G21B 2ZS7A 4OJKA 3Q85A 4HL6A 5K7SA 2ZXUA 2FPSA 2O1XA 2W2KA 3DE5X 1GO2A 2IODA 1WBBA 2I34A 3H6GA 1BE6A 3FMOB 4HVAA 1N0VC 4JEHA 2A58A 1C9MA 2NVUB 3WWCA 3KSBC 4JR2A 4ZJPA 3GLIA 1GN9A 2EFCB 4H59A 1O6FA 3TTUA 3VR1A 3R9XB 3AUTA 4AJ9A 2ZPTX 5AK0A 3BG5A 4GXRA 3RFUA 5A1TA 2VHYA 2P9YA 5BOSB 4X0EA 2QTBA 4B7AA 1DNPA 4H3KB 3SPXA 4DMGA 4QQNA 4E33A 4F84A 3O90A 2ANBA 3TB6A 1MR3F 4M89A 4QODA 1GUFA 3CH6A 4MVJM 5CX4A 2RHBA 4ZODA 4KVFA 4ZJUA 2YHIA 4G84A 1MFZA 5D00A 3CWCA 3PCXA 4KI0A 4AJEA 1YZ3A 4BECA 3V8RA 3E3OA 1RQPA 4C43A 4N3BA 5A4KA 3HKDB 3ROXA 3GA5A 2JGMA 4HGPA 1BG6A 5BN4A 3WB9A 1MAHA 2X23A 3N1UA 3F97A 1QHHA 2CDRA 5HIJA 5JH7A 4GVPA 4QLAA 2VNJA 1I7QB 2VHZA 5JVDF 4BP1A 3PNSA 2WTEA 5AQ1A 2I6FA 3T7SA 4RM2A 5BV1A 1WSAA 2B0CA 1CK4A 1HE4A 4ZV9A 3KOYA 4DR7B 4YMUA 3VNUA 4E6PA 3DL7A 4H7IA 2I6QA 2AN9A 5D3MA 1Q2XA 2QG9A 1XYGA 3GJRA 4MR7A 4BPRA 1JFTA 3GDGA 4ASUD 4ENTA 5TDHA 2AG8A 3SHOA 2KX7A 4YT5A 3AHDA 3O1HB 1Z47A 3OX4A 3P94A 3ANXA 2ZYDA 4CLEA 4FMCF 3W6NA 3EUFA 4UMVA 5HIMA 2A78A 4TOIA 2NUAA 3RARA 4UFOA 5DI9A 3I5YA 1VYTA 2FG6C 3PEUA 2OGTA 3FN4A 1G4UR 1G291 2R87A 3VXKA 1KZHA 4DPMA 3DBVO 2SCUA 5G02A 1RLOA 1LI7A 4OHKA 1IJFA 2G0AA 4MW7A 4R2JA 1J2RA 2VDPB 2WG0A 5FJIA 4ARVA 3SVZA 3A2LA 2XRMA 4K1XA 1UEJA 2PGXA 3DOCA 3E18A 3R6TA 1CJUC 4P3KA 1MEJA 5A3QA 2HI0A 3N7TA 3BH7A 4LC9A 2ODWA 4GR9A 4ZK6A 1EWTA 3IELA 3DYBA 2EGHA 1T6XA 1ULSA 1Q84A 1A27A 2PO7A 2J32A 4L85A 5GPBA 1AA9A 3U3OA 2EZTA 1YH3A 2WP8J 1OB2A 3OG9A 4PVCA 3AEQB 1BC5A 2OWEA 1BCSA 1XALA 5TR9A 4U3JA 5AI9A 1WKCA 2XE4A 4CIDA 2CVFA 1F6DA 2BFNA 1LDNA 1PT6A 1QR6A 2OOSA 3IC5A 1W34A 4Z1MA 3IQFA 3WK4A 5KKAA 5AKZA 4U2GA 1PEAA 1SKYE 2A35A 2HPVA 1L3BA 3OTIA 4HYQA 4JQZA 4E2XA 5BNZA 4JUBA 5E4TA 1VHJA 3SD7A 1FFXA 1H2XA 4WY8A 3RC8A 2C8VA 4OFXA 1XDGA 3RG8A 3SICE 1IUKA 2NU9A 4KB5A 4BFXA 3L9WA 2GK7A 1Y6GA 2WAXA 1W87A 1RYNA 3ZH2A 1CZLA 5ADUS 1RWPA 3RUFA 4WLOA 3ABIA 1X19A 1JIQA 2VDNB 4GMHA 4O5AA 1Q0UA 2GRUA 1ISJA 2R44A 2WWGA 4LVOA 4XJTA 2R0QC 4BEWA 1ND6A 1TKBA 3BK2A 4JVNA 2N1BA 2HHLA 3D1VA 4HYTA 3TOXA 5AM2A 4JASB 3R2JA 1LZKA 1CRZA 1XEXB 1VHLA 1XTTA 4D26A 4MMYB 1THTA 2O2GA 1KU0A 4U7JA 3PU6A 3R7SA 3GMIA 1CY6A 3JW8A 4QARA 5DNAA 1D6SA 4QUIA 3PT5A 3V9AA 4GP9A 3W90A 4O33A 4TXHA 3H42B 4M83A 4BUZA 2C2GA 1OH7A 2E48A 1XNRB 1JEEA 2WLSA 2XWPA 4X65B 2G6TA 2I1WA 5ALEA 5AVKA 1RPAA 3G88A 2HF9A 4OY3A 3ILSA 3OD1A 2A2ZA 4R1TA 2ERYA 1FDOA 1JB1A 1HLPA 1MGPA 2HU7A 2XUOA 4H7HA 2BGJA 3CRVA 1E9DA 4KL8S 2O20A 1PJ2A 1JG6A 1OYYA 5LC1A 3ZDDA 2HOQA 1WETA 1C14A 5DN6A 3TRKA 3GJSA 1ICIA 4XOUA 2IITA 3SKXA 4M9CA 3B8EA 4L8YA 4J8PA 4US1R 2H7VA 2E6KA 1N5RA 3BIOA 4DZRA 1PR2A 3ZIDA 4E94A 2VJLA 5F1YA 1WIWA 1QGED 1SHZA 3MRXA 3U31A 2CV0A 3RRNA 1ZN2A 5F76A 3R9WA 3EUEA 1UXIA 2R8BA 4RORA 5JWHA 5CIWA 3OIWA 3NRJA 4IYRA 4JHXA 4FNMA 1EAYA 1G6HA 5KOIA 1JLRA 4MKIA 3OZVA 1JDSA 1M0TA 3VVBA 3DW1X 1XU4A 5T4HA 1OXBB 5ERGB 1P8AA 5FD8A 1NVKA 2H4HA 2OYCA 2F3RA 5I9SA 2IYOA 1EG7A 4O2LA 2OYRA 2Y1OA 4FZVA 3OJWA 4TMKA 3FF1A 4HF7A 4D9FA 3CZMA 1RI3A 5B3KA 4ND3A 4NNJA 2YDXA 4MUEA 4TLCA 3PJDA 3ADKA 5J63A 4CIYA 4W1QA 4FXOA 2G7MC 3CE6A 2W2VA 4FS3A 3ONWA 3RYCA 4HRAA 1OXUA 5K0NA 1C0KA 1KMMA 4MZDA 4BTEA 1Q16A 4D8VA 4MW9A 3X1MA 3I76A 2GHQA 1PYGA 1W5SA 3CLHA 2E49A 4BV8A 5JJLA 3WNZA 5GONF 4Q3BA 3SKYA 3T61A 2SICE 4KQ6A 1HLGA 2ADFA 3VOSA 2PK3A 2GEFA 4XWAA 3THWB 2A7XA 4YP7A 1BXRB 1M2GA 2CE2X 2IEBA 1BJKA 3OO1A 3RPEA 1LPOA 1X1DA 3MB5A 2WM9B 4RZSA 5AW5A 4QTUB 2WU3A 3ZBPA 3GXBA 3RKRA 1KXJA 3DHWC 4OSEA 5CM8B 3ZV3A 1SR8A 3H9JA 1N3LA 4ZQHA 4KRGA 1HFJA 4HYYA 1T15A 4MQBA 1BU5A 2FSUA 2VUTA 2YYSA 2O3TA 3CRRA 3MUFA 2ZUTA 1CJKC 3CNHA 3WLRA 2QW0X 5ICSA 2WIDA 4CQLA 3PJEA 3W06A 1TVEA 3FBGA 3HSYA 4GL2A 3HXMA 1E5QA 3WX0A 4OUDB 1JHUA 1G5TA 2RKBA 5GP1A 1NUAA 4ZFNA 2JJ8A 2AFHA 3U5ZB 1PJ8A 1FMCA 3A36A 2Q0SA 4N9QA 3WNVA 3UPTA 3UIEA 2PZ8A 2RONA 1FFBA 4IUDS 1K9SA 1WXEA 3NNNA 5NULA 1QYDA 1BVYF 5IEJA 1ZR4A 5ARDA 1T5SA 2OKGA 3B7WA 4HNQA 2OECA 3K1AB 1HE2A 1S2GA 2PXHA 3TEJA 4LS3A 4M53A 4D4JA 4Q3KA 4CF3A 1CCWA 3UANA 3UHOA 4BATA 5FAKA 4ER5A 3E9EA 3H2BA 3IRVA 2FEXA 2DRIA 2GYYA 2Q0HA 3WAKA 2OHHA 3EYWA 3HGQA 3D7KA 3N87A 3ICQB 2HGZA 3UT5A 2FXVA 4IH4A 4YLEA 4S05A 4M1OA 1R0LA 4X71A 1Z7GA 3AO0B 5JDCC 1DEOA 3G79A 2O7RA 2HRQA 2WKRA 2Q6KA 1QQBA 3E58A 5BRAA 1FFHA 3QVXA 4GOLD 4QXPA 4PG7A 5COAA 3ZWXA 3A9RA 1SVUA 4Z54A 3VHLB 5AW0A 2O23A 2A3NA 3D1LA 3V1LA 2FTKE 3CRW1 2JVJA 4J3JA 4AS1A 3C8MA 2FYTA 3S2UA 1R0WA 2W2MA 3OJCA 3A1EA 1REQB 4NBLA 4Z99A 3I62A 1SD2A 3CX4A 5HFJA 5JNRA 2PXAA 1XJCA 4X6YA 3OLZA 4IO0A 3GEPA 3D0QA 3LA6A 4DSAA 4WBXC 1FQJA 4H7PA 2CSXA 4MTLA 1DX4A 4OH1A 5DT9A 2QLBA 3BFXA 1N5IA 2XWJI 4ZD6A 3WL4A 1C8LA 4LJLA 5L9AA 1QB8A 3DC2A 3U3DA 4EHKA 5FLKA 5H3HA 2XVAA 4G8CA 4QTZA 3WZMA 1R10A 3RHZA 2WD8A 2P0EA 1EFTA 3IJEB 2PS0A 2CCGA 4K6CA 3JS5A 5I5GA 4D9NA 5J1TB 1Q83A 1U28C 4FCCA 3EZYA 5DN9A 5FOSA 2AX3A 1QE5A 3OM9A 4YUYA 4X54A 3HJGA 3TSCA 4YJDA 1XJ0A 4AWAA 3HDYA 2QTFA 3RSSA 1D03A 5FYDA 2GQ0A 3ZI0A 4PFKA 3MGCA 4KRFA 3K0BA 4P81A 1IN6A 1P4SA 3ANMA 3DOFA 4FGWA 2XTJA 3EG9A 1C7FA 3WB2A 4BV2A 2G82A 2P2NA 1C3JA 1WXDA 1YRLA 2RGNC 3N7AA 5E2IA 1CY0A 4PG4A 2HU8A 5HPYB 3JU3A 3Q3HA 5AVWA 2CF5A 4PWYA 1Z36A 3VBCA 1PT5A 5AXBA 1UJNA 2ZTSA 3AHFA 2HSDA 1KR2A 3CW9A 3P9YA 1ZD4A 1GNTA 1Y6RA 4Y7CA 3SNHA 5KTMA 4O3FA 4ZO8A 3TGLA 2WOJA 2B4AA 3TX2A 4MUFA 3TVYA 4KNWA 5B53A 3D4LA 2HUNA 3KAKA 1ZIDA 2IEAA 1QF6A 1AUPA 1RC1A 2AX4A 3PDCA 5FBLB 1GZUA 3AX6A 3DJYA 1TO6A 1F4VA 1KETA 3UWPA 2QTVA 2J46A 3WQRA 1QIIA 1CDDA 1XF1A 1T4CB 1XSEA 3BXOA 2QA5A 3JQCA 2EX1A 3DR5A 3EK2A 3GNTA 2IY7A 3QW2A 4LDRA 3PIIA 1AJEA 4RPHA 2VF2A 4PYKA 2I8LA 5HGXA 1HR0B 3LBFA 2H1HA 5TGTA 4KG7A 3GEEA 3T4EA 1YAJA 4WKCA 2NU6A 4QXOA 1U0RA 3AJEA 4BO1A 4BU0A 1CFZA 5C37A 1H4SA 2P35A 3ASVA 4YJ3A 1Y42X 2JFFA 3JCZA 5ALWA 4UVHA 2H2IA 4RD1A 1V1MA 4CUZA 2P8JA 1SIBE 2SNIE 1ORWA 5D85A 1YVUA 2YW2A 3IT1A 1E2HA 5BUSA 5JS8A 2FN4A 1MB2A 3OZRA 4PPNA 4PCAA 4IG9A 3ZKWB 3FOEC 2GZ2A 2HLDA 3NVMB 4DMLA 3Q0TA 3LC0A 2XD4A 3LGSA 4OLBA 5ALZA 5BV2P 1L7NA 3SIWA 2VC2B 1NG9A 2BFBA 2ZJBA 2E4VA 3RTCA 3KXIA 5AJTA 4RANA 2WU4A 5HR5A 2V65A 4K8OA 5TQ0B 1CBUA 1KC3A 1WG8A 1X1SA 3HHPA 3STUA 3DMFA 4A2CA 4CLDA 2H0AA 2C5GA 1JDTA 5FI5A 4JV5B 4FI3C 4E08A 1A7AA 2V97A 4CKWA 1QLWA 2B8TA 3A1WA 2EZ4A 3EVNA 1CLEA 1BFKA 2EARA 1COWD 4YRKA 2CLCX 1M34E 2PD6A 4ALNA 3ZJUA 3AW9A 3IVAA 4UBLA 5EJMA 2Q0XA 1WF3A 4XFJA 1T0HB 1WCIB 2X6RA 1TU3A 2CL5A 1T2VA 3MRVA 3FPBA 4D4HA 1R88A 4ZDIA 3BXHA 2ANCA 1BWQA 1QV7A 2QRQA <