1KHTA

Adenylate kinase from methanococcus voltae
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
b'NKVVVVTGVPGVGSTTSSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEENLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTGDEILMRRMSDETRVRDLDTASTIEQHQFMNRCAAMSYGVLTGATVKIVQNRNGLLDQAVEELTNVLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords adenylate kinase
publication title Structures of thermophilic and mesophilic adenylate kinases from the genus Methanococcus
pubmed doi rcsb
source organism Methanococcus voltae
molecule tags Signaling protein, transferase
total genus 72
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1khtA00
5FOTA 4URYR 3C5HA 4DEYA 1WBBA 1VYVA 1OFIA 4TL9A 4ZIRB 1CRPA 1QHIA 3TAUA 4PC6A 2Z6VA 3IILA 1UFQA 5A5GA 5GJVC 4IKEA 1QF9A 4IOLA 1KKMA 4IOKA 3J81k 4L4UA 1QRAA 2ZIAA 2EU8A 2AR7A 1U99A 1RRCA 3GLIE 3D6TB 4Y0AA 3MWLA 5AR1A 3U6KA 2AD1A 4KO8A 1G3UA 3REFA 2HV8A 3PUVA 2CVFA 1DG3A 5FOXA 3V00A 3RRMA 3U61B 5DH9A 3EA5A 1DARA 3LQQA 1DBSA 2Z43A 4FI3C 1D2EA 5C4GB 2NZJA 3SNHA 4QKQA 3VR1A 2JLWA 1J7KA 2GJSA 2ZXUA 1R8QA 2OAQ1 4H1VA 3DKVA 3O47A 3QKRA 1GFIA 2BBTA 1AN0A 3DKPA 3UIEA 2OESA 4KYUA 1VCOA 2G0NA 3GJ3A 2V55B 2DY1A 2VO1A 2ASEA 1F2TB 4IXNA 1AJEA 1E69A 1L8QA 1SVIA 1W5SA 1GRQA 3U3OA 3AB3A 1E9EA 4B71A 8OHMA 1XEFA 4JJZA 2I4IA 2QORA 4V03A 3K0FB 3PIRA 4A0HA 5KOYA 4R71A 3WY9A 1AKEA 3EPLA 2C78A 1ZW6A 1YJ5A 2CCGA 3HPRA 2PX3A 4B47A 3WRYC 1J90A 1ZU5A 3IIKA 4Q9JA 5CM8B 4R98A 1OIXA 1Q22A 2FH5B 2E87A 3CF6R 4AG6A 2C9YA 1A2BA 1SXJA 4NONA 4UJ3A 4CEJB 2O8CA 2XJ4A 3BK7A 1E2EA 1SXJC 3PV0A 2WBLC 3M4YA 1P61B 4JSTA 2GXUA 3I61A 1HE1C 2REXB 1QHSA 1XD8A 4GDFA 4WA7A 2O8FA 4EQ6A 4LJ4A 3RS3A 1E2IA 1Z63A 1KK0A 3W3AA 4PHGA 4ZKEA 1CLUA 3BFKA 4OHYA 3P4YA 3PEYA 121PA 1G9XA 3LD9A 3CB4A 3IPYA 1UEJA 3NKVA 4NCNA 4UJ5A 1FOEB 1G8FA 1EX6A 1EG7A 1VG8A 2OZEA 4RD1A 4P4UA 5GADl 1ZUHA 3RANA 3GJ7A 4TTRA 2D2FA 3ZQJA 4FCTA 1SXJD 2QBYB 3U4QA 4MDFA 3K70C 1UKYA 5B2ZA 2IT1A 5GJWC 1GIAA 3AUXA 1W7AA 5DI9A 3SQXA 1XJ0A 2CL6X 2GJKA 3VKWA 2MMCA 4PZYA 4F93B 3X1WA 2FDCA 1F60A 3E2IA 3TUIC 4B44A 1P6XA 2Q3FA 5IF9A 1N6OA 1Z6AA 3UMRA 2ZSDA 1X8LA 3UANA 4DWJA 2ZAMA 3IO3A 3SOPA 1G3QA 3QKSB 3VU9B 1YVDA 2AHOA 5AJVB 1VMAA 1F2UB 1DAIA 3QENA 2YOHA 2IXEA 5BXQC 3K70D 3WRXC 4L15A 4D0LB 1YE8A 2GTPA 4OKSA 3FVQA 5JZVA 2NO0A 1G7SA 2ZRAA 1OB5A 5LPNA 3NWJA 2QAGB 3M1IA 4DCNA 1OJLA 1IXZA 2O0JA 3IHLA 3W8RA 2WV9A 1VG0B 3FOZA 2F3TA 4Q66C 1ZP6A 4C2UA 1N5JA 4PHTA 4EAQA 2V54A 3HU2A 3THXB 3EZ2A 1YHNA 2V1XA 4X8MA 3RNLA 1YR8A 2I1QA 2Z5FA 2EYUA 3MJRA 5TMPA 2OBNA 4Q4AA 4GI7A 2CL0X 3W6PA 3CF0A 2DHRA 4OL0A 4CRWB 2VH5R 2ZRPA 2EVWX 4RZ2A 3I8XA 2C95A 4A8JC 5L3SA 4D4JA 1J70A 1DELA 3OEEA 3DHWC 1M34E 3WNCA 2OSBA 1JR6A 2FE4A 4Z51A 2P3SA 4MKHA 2ZITA 4TTQA 3CWZA 2YOGA 3MLEA 1II8A 1LS1A 4C0HA 5AK0A 2QPAA 2ZYVX 1WB9A 1DS6A 1JALA 2SHKA 3THYA 3QEJA 1I4LD 1GAJA 2CEAA 4X8HA 2F3RA 1U94A 5KPJA 1U81A 2H18A 2PLRA 4LDJA 2Y8EA 4PXAA 5EE5B 2A5GA 3UPUA 2QA5A 3LBIA 3MJHA 3LV8A 1Z5ZA 3HR8A 1P9WA 5FL7A 2IUUA 4BPBA 621PA 3IBGA 4TYQA 1QVRA 3OEED 4NE2A 2FX3A 1II0A 1E96A 2CL7X 3P20A 1VHTA 4NCKA 3FE2A 4DB2A 4LY6A 4B73A 1GKUB 2QL6A 2ZYWX 3HDTA 1TF2A 3NTUA 2N1BA 4RCZA 3UWKA 1X8KA 3AKCA 4Q1CA 5CJ2A 2ZYTX 3P27A 4O3MA 2GAOA 3BFVA 1JPNA 2IF2A 1T0HB 3LLUA 4B6FA 1ZIPA 1G4AE 3GEHA 3AVVA 3GJ8A 3KDSE 4XOIA 1Q3TA 1YR7A 1Q57A 2A5YB 2NTYC 3SEAA 3EZ7A 5LD2B 1L2TA 4MYCA 4YMSA 2LCFA 4G5RA 4MYHA 2BM1A 3KJEA 1G3IA 5DNYB 2CLSA 3BERA 3ECCA 4II7A 2YINC 3B6EA 1FP6A 1AQYA 5GJBA 2W83A 2ZI9A 4CEHB 3N2EA 5J47A 1OH8A 1XNJA 2GF9A 2YNMA 5E7IA 2EFCB 2PH1A 3QE0A 1ZUNB 4URXR 3AF2A 4RFSB 2F9MA 2QP4A 1MO3A 3K09A 1R8SA 2AXNA 4Q9HA 4YDSA 3PQCA 4LYJA 5CITA 1FFHA 1Z29A 2ONKA 3KB2A 4Q01A 1M6NA 4M21A 4D25A 2PJRA 2H8KA 3W6OA 3UG7A 2GEDA 1P72A 4ZIRA 3HJNA 2KBFA 1UM8A 2NQ2C 4JKIA 4WXPA 2AK3A 2ZJYA 3MFYA 2ZAOA 1E0AA 1FW6A 3I5XA 1KO4A 1E9RA 1T3HA 2IK8A 3LWNA 1D2MA 3THWB 3A6PC 5HCNA 3GQBA 2FJUA 3VX4A 1CJVC 1UDWA 4DC9A 4KU4A 2QEQA 4AYTA 4Q18A 3TMKA 2C03A 3QKTA 2ZE8A 2Z4RA 2FEOA 3CZPA 3BB1A 3KB1A 3LQRA 4BFYA 4ZI3A 1IQPA 3HYTA 2DPXA 5KO2A 2FPKA 3RVBA 2FFBA 2ZRIA 3C14C 4JBYA 2QT0A 5SZKB 3MRSA 4M1SA 5JS7A 4JBXA 2GHIA 2OCYC 1NJGA 4NH0A 4A1FA 2WIBA 1UKEA 2AXPA 4OHXA 2ZR7A 3B9PA 3RSLA 4AI6A 3CO5A 2V3CC 1TQDA 2EWVA 4TT3A 2NPIA 3ZS9A 1KY3A 2CBZA 3TBKA 4I1UA 1G5PA 4DSOA 1JI0A 3I32A 2VHTA 4RVCA 3GEEA 5IT5A 2FFAA 1F2TA 2CE2X 4HB0A 4B2PA 4YMTA 5CLQA 3QBTA 4QG7A 2RGAA 2REOA 1ZYUA 1OF1A 2O5VA 1GP2A 4DB4A 4HB3A 5IRCD 1RE0A 3K0FA 3OHMA 721PA 4I1SA 5JHHB 2BMJA 1N25A 4NMMA 4YXWD 1Z0FA 2ZJZA 3NXSA 2IC5A 1ZUIA 2BV3A 3B85A 3MWJA 1R7RA 5K8IA 3BC1A 4YLGA 3AGQA 4LCBA 3GJ0A 4PO8A 4QGGA 4CEJA 4V0KA 3CR7A 1FPMA 1GITA 1H8EA 4LBWA 3W6NA 2DFKB 1N0WA 1EFUA 2IA5A 2PZFA 3LVRE 3NBXX 1S4QA 2WMNB 2A5JA 3H84A 1KO5A 1XXHB 2BKUA 3BH0A 4LOAA 3THOA 4LC1A 5FBWB 5FUXA 4GMXA 3VKGA 3A1VA 5DN6A 3MWKA 1W4AA 2GESA 3KL4A 2JLZA 1JJ7A 4OQLA 4R2HA 2JLSA 4KCGA 4C30A 5G41A 2MMGA 3HWSA 4WVFA 3EIEA 2QBYA 2O8BA 2ORVA 2MSEB 1XXHE 1QHXA 5TVKA 2WPDA 3QY0A 1E1RD 1W46A 1H65A 1H8ED 4B2IA 1KTVA 2WWXA 1ZM7A 2Q3MA 4BFSA 3TAHA 3SYNA 1LF5A 2D7DA 5SZIA 4I99A 5KUTA 3RS0A 1KKLA 3AVQA 1Z08A 5GJCA 4AKEA 3B5JA 4DDUA 3O8CA 1E0KA 2ZPTX 1QHGA 4G5OA 3H0KA 4HI0E 2WICA 4UNRA 2XOKD 3QKSA 3VU9A 5BN3A 4NL4H 1F2UA 2P65A 1AZTA 1TU4A 1ZM2A 5EXTA 5BYKA 5EZ6B 4M1WA 1ZVQA 1W1WA 2WWGA 4BRUA 2RKOA 4BLQA 1AKYA 3U7GA 1C9KA 1EFCA 2QG6A 2C04A 2ODBA 2QAGA 2ZRLA 4FWIB 3SHWA 2JJ8A 2QAGC 4W7SA 2BOVA 5E7JA 2C9OA 3AF0A 4HB2A 4JMPA 4LBZA 4XVRA 3TNFA 5DLQC 5FOWA 4PAMA 3TLXA 1KK2A 3TQFA 2A9KA 1SHKA 1I4DD 3SS8A 4ASUD 4D0GA 3THXA 1XTSA 2ATVA 2EFHB 1P62B 1D8TA 1XF9A 3Q85A 4KFRA 4JT4A 1MO4A 3PXGA 2J5XA 1G20E 1OLOA 4DSNA 2WJGA 3QVUA 1HV8A 4XH9B 2BCGY 1M74A 4KODA 4KFUA 1CJKC 4US2R 2H57A 3WP0A 1CR4A 1DG1G 1MOZA 3LY5A 5HR5A 2VYFA 4Q9IA 4QHTA 2FPMA 4LI0A 2OM2A 2V7QA 2GZHA 2MSCB 1E1QA 2OILA 2WIAA 4TSFD 4CEIB 2HF9A 4A0FA 1JQLB 4LYFA 3OE7D 4LPKA 1UKVY 2BEJA 5KDOA 5HKKD 2GXAA 4JL8A 4MRPA 1G8HA 1MH1A 1FL9A 2YWFA 1P9NA 2DR3A 2KJQA 2YWGA 3ZVRA 1X3SA 1T5LA 2WSMA 1FUKA 5CYPA 4CDGA 3VNUA 1Z07A 3RC8A 1K8RA 1NVUQ 3KUCA 3GEIA 4A0GA 3EPKA 4MGIR 1QG4A 3LAWA 3QXSA 4LJ5A 3X1XA 2V7QD 3KKOA 4I81A 3W9YA 1E1QD 1NMXA 1P2VA 1RRGA 5FPKA 1R5OA 3I8SA 5HPYB 2H5EA 1XZPA 1LNZA 1XFAA 5L3QB 3SJCA 4A92A 4Q1FA 3SI7A 2GVDC 1ZJ6A 2RH5A 1KOFA 2GZDA 1TQ2A 1T3LA 2J41A 2ZS9A 1YZTA 4LZZA 2F6RA 2OEPA 1D9ZA 2GJ8A 2RGGA 4HAYA 3QKUA 3NDBB 1Z47A 3ND9A 3SFVA 4DSTA 2W2TA 4L16A 4D4MA 1N5IA 1T91A 3RS7A 2CK3D 4KSBA 2D7CA 5LD2C 4ZKDA 4OBEA 3L0SA 1PLLA 5DE3A 3C4JA 2HEIA 5CDFA 3BOSA 1XU4A 2NMVA 3K0EA 3W5JA 4DXAA 4CEHA 1TF5A 4OK6A 4DRZA 1D6JA 4JLKA 3ICQB 2J0QA 2A5FA 2KWIA 1BYIA 1E6CA 4Q9LA 4Q4HB 3ZD6A 4LHVA 4RFSA 2D3WA 4JKYA 4RD6A 5IDVA 3WYFA 1E98A 2AD5A 3FFAA 1NIJA 2F1RA 2QTFA 4DLZA 2FGKA 3QNUA 2G3YA 1E2PA 3ZGXA 2RAPA 5KSPA 2IL1A 2ORWA 3JZMA 4TTPA 3VQTA 2ZRHA 3B8HA 1YZQA 1G64A 2XGJA 1M7GA 4HYYA 2J0SA 2Z83A 2R65A 3SU8A 2GCPA 2ZETA 4Y0VA 1WA5A 3P32A 3EIHA 4ON9A 2IW3A 4PAOA 3UATA 2P0EA 1PUJA 2VP9A 3THWA 2ZVQX 1AS2A 1ESMA 2HJVA 2QMOA 3RWOA 1XTIA 4Z54A 4ESVA 1L4YA 4WZAE 1G5TA 2VSFA 3FKSD 4UKDA 1KJZA 3GJXC 4Q48A 4MRVA 4BFUA 4WAUA 3C41J 4A82A 4O25A 4RZXA 4OJKA 4WW0A 4BFTA 4YMWA 4UNQA 1W2HA 3AF3A 2NG1A 3KFVA 2XSZA 5JMTA 3WBKA 4DVGA 3S1AB 3PFIA 2VF8A 3A4LA 2IWHA 1KO7A 4ESHA 5EZ5A 2QSYA 3K8YA 4HDOB 4E09A 2QPTA 1MO6A 4QNMA 1HQCA 3AQ4A 3KKQA 1CEEA 2BBWA 3LW7A 1ZRHA 1NI3A 1IBRA 1RKBA 1NKSA 3T61A 1CF4A 1OFHA 1PVOA 1D2NA 1W44A 3U2QA 4M9ZA 3HR7A 4LSGA 1A4RA 4YQFA 3NEYA 1NLYA 4XIGS 1NIPA 2J46A 5UKDA 4A9AA 2HUPA 1NVXQ 3CLVA 3QQ5A 4Q00A 4MH0R 4Q1DA 1XBTA 3B1XA 1S2MA 3PG5A 5A0FA 2B21A 1NBMA 5KSOA 4HATA 5C18A 3KX2A 1EFRA 4GOXA 3HU1A 4G01B 1U0JA 2Q9AA 1XB2A 3W3ZB 2P6UA 1XMJA 3B1WA 2TMKA 3OF5A 1OIVA 4N0DA 4AYWA 1R0ZA 2FN4A 2HJGA 1QBKC 1ZC4A 1VIYA 3EA0A 1YRBA 1C4OA 1DOAA 1EXMA 3SDZA 1KDOA 2HDNB 5BYJA 2GKSA 4TMKA 2FG5A 2BKEA 1Q44A 1IXRC 1HE8B 3CPJB 4ITRC 1KJYA 3GFTA 4EDHA 3AP3A 1XXHA 2ZS8A 3AF4A 2IYVA 2R6FA 2ZUCA 2CLDX 4MKIA 1NBMD 1EESA 1QHHB 1DAEA 2X1VA 1E94E 2CXXA 4JLBA 1O3YA 1S3GA 4LJ7A 4EIWA 3FFBA 1UF9A 2ZI7A 4EPRA 2N46A 1UEIA 4RFVA 2XTNA 2RGCA 4G3XA 5HZKA 2XEXA 4Q5IA 1KSFX 2VP5A 3WP1B 1YKSA 5DGXA 2PT7A 3GLIB 3CR8A 2IXGA 5JECA 2V6JA 2G1JA 4QL3A 3OAAA 3T5DA 1Q12A 2IYRA 2ZJ5A 3PEWA 2EWWA 4NCJA 1DAHA 3FMPB 1XTKA 5FUVA 1A2KC 1FTSA 2VQSA 2W6JA 4HDQB 4W5WA 1NN0A 3FDIA 2PZEA 1CR2A 4BFWA 1W4BA 4DBLC 1PV4A 1HTWA 1MRSA 1O87A 3D3QA 2CLCX 3ZIAA 3SBDA 1P75A 1I4TD 2GWHA 4UXJA 3EASA 2DBYA 4QBFA 2HT1A 3C7KA 4HAXA 4L9WA 4A2WA 2FV8A 3BB3A 3C15C 4DCTA 1XPRA 1E9CA 1HT2E 4KXFB 3CRMA 3SZRA 1G7CA 5CK4A 4Q7KA 3EX7C 2UZIR 3Q7QA 4IXMA 1XJCA 4XWKA 2KE5A 1N6NA 2WVJA 3A4MA 3E70C 1TUIA 1U0LA 2ZJ2A 4B3XA 2IX3A 3VKHA 2ZRJA 2PZGA 4ARZA 2AN9A 3NHBA 3ZIAD 1CR0A 3MCAA 3NIBA 1GG2A 4B74A 4EUNA 3D8BA 1HH4A 1GZSA 5EXXA 2HXSA 4EJSB 1ZNYA 1LFDB 1JNYA 1TU3A 1IN5A 1G8PA 1TADA 4Q03A 2GCNA 1XD2B 4TQAA 3QI2A 5JCPA 4B3FX 4CEIA 1Z6XA 1GNRA 4W5HA 5BW8A 5JRZA 2Q3HA 2G88A 4QRHA 3KJGA 1R0XA 2WMOB 1MKYA 3TVDA 4DJTA 4NHOA 2NO6A 3L8YA 4POAA 5HTKA 1ZC3A 4B76A 3A1UA 2JDIA 1HA3A 1Z0AA 2IEYA 3CF2A 2ZJAA 3D7MA 1WP9A 2WHXA 1G1MA 1UKZA 3H4MA 4QC2A 4MRNA 1BH2A 3IUYA 4L8GA 2QN6A 2QY9A 2ZRFA 1XTQA 1J99A 3BH7A 2EFEB 1CJTC 3SR0A 1NN5A 4H9GA 5BN4A 1COWA 5L3QA 5JSZB 1HQYE 1SGWA 4IFEA 4JLDA 2D06A 4PHFA 4P3YA 2HYIC 3NHAA 4BRWA 5E4FA 3CRW1 3LH5A 2JDID 1T6NA 5FTLA 2C8VA 4TYYA 1U2RA 1WCV1 1B23P 1W0JA 1IN8A 5M04A 1G3MA 1KAGA 4XVQA 5KNBA 3IBYA 1VYTA 2W2XA 1KSGA 4QHYA 3GLFE 3AV0B 3N70A 3WNDA 4R2IA 3V4FA 4KFTA 1FP7A 3AVPA 3LBNA 2AKAB 4NCIA 4Q7JB 3VX3A 4MYTA 1LTQA 521PA 1N0VC 2HCBA 1OH6A 1MO5A 2AFHE 1FMJA 1RIFA 5F2EA 4Q4HA 5JWHA 3SYLA 2QM8A 1OXVA 1P2UA 1G8GA 1Z0DA 3PR1A 2A5DA 4XD7A 3CRRA 2XITA 4NYJR 5EQTA 2IF0A 1W0JD 3TW4A 4V0OA 4A15A 1E2GA 4WIAA 2O8EB 1DAKA 1JR3E 1S0UA 5FR1A 4EPWA 221PA 3GD7A 3LO5A 3NBYC 4UXIA 5G40A 1T8UA 2P6RA 4URZR 3GLGE 1W4CA 3BBPA 4JVNA 4LHXA 3EXAA 4NYIR 2WJJA 1BS1A 2BIFA 1HUQA 2JCSA 2IYZA 3I92A 4PZLA 5CB6A 5CK5A 2ZU0C 1IY1A 3CPEA 5TDHA 1L4UA 3FMOB 2CCKA 2YWEA 5AUQA 1NLFA 3G5UA 4HUTA 5AJWA 4BECA 2JJ2A 4WOPA 1Q20A 2A3RA 2KB0A 2RGEA 3AP1A 3CWQA 3H1TA 4I4LA 3DOFA 5EP3A 1XMVA 2FFHA 2ZRDA 3KTAB 4K8OA 2OLJA 1QHNA 3S1AA 4YMUA 3CIOA 5FUWA 4A36A 1TX4B 1RZ3A 2ZREA 4BFZA 1JXMA 3UMSA 3EPHA 3E5HA 5KNDA 4MGZR 4FWTA 1W49A 4JL6A 2OFXA 3AVOA 3RSOA 1G19A 2FPLA 2G77B 4NYJQ 3CX8A 3U3MA 3VHXA 3O8BA 1ZMXA 1OYWA 2R62A 3P1JA 4BLTA 2YWHA 1JEEA 4HB4A 2FWRA 3RYTC 3ZVMA 4ZPXA 4RCYA 2FGJA 1TQ4A 3WYAA 2YVUA 4HLCA 1OIWA 2HYDA 1U90A 4KJZA 2J0UB 1BYUA 5EE1A 4NYIQ 3OESA 1WBDA 3EAQA 2QENA 3FHCB 4KVAA 4M22A 3GFOA 4BZXA 3RS4A 1ZD8A 1KNXA 2OCBA 5E3HA 2WJYA 1P2SA 2WWIA 4Z1MA 2C5LA 3L82B 4QBHA 5AUPB 4UNPA 1TEXA 3RAPR 2QGNA 1OHHA 2JLRA 3EPJA 1DVRA 1G21E 2ZSBA 3DEFA 3LXRA 2ZM5A 3VR4A 3H86A 3ADDA 4DCUA 5FL7D 3OIYA 4IOJA 3MAAC 2IYTA 4ERNA 4JLJA 3F3YA 5FR2A 1FX0B 3C8UA 1QHHA 1Z06A 2G83A 3U7EB 1S3SA 3W8NA 1SVKA 1TTTA 4LK2A 4RKFA 1NG9A 1KMQA 2RMKA 2CE7A 2EQBA 2QI9C 1G8YA 2XX3A 1ZM3A 2GJAA 3FYHA 2G6BA 3FWYA 2ZANA 3X1DA 3IEVA 1G5RA 4QFMA 3ADCA 2GRJA 4Q7MB 4OHVA 1LW7A 2R6GA 3HYRA 2QMHA 4Z1MD 1SZPA 1W0KA 4ABYA 3K09C 1G18A 1Z22A 4DLTA 1BMFA 2OCAA 2QQ0A 3DVLA 5JEDA 3GLIA 3IO5A 3LFUA 4GBMA 2WJHA 3F8TA 4NPHA 6Q21A 2ZI4A 2YZ2A 1T8TA 3VHLB 1Z28A 4I1OA 3QOFA 1Y3AA 3ZQ6A 5DIFA 3T1OA 4C0QC 2OFWA 3LLMA 3TSOA 2PL3A 1KSHA 1E99A 3DMNA 4XJXA 1HT1E 2HT6A 5IHPA 2OT3B 4KFSA 2B7CA 1OB2A 1VG9B 4EFNA 1S8FA 3EWAA 1SVLA 4NYMR 1KI6B 2VHQA 1XTJA 1X1RA 1P60A 5EJEA 4IVPA 4Q4LA 4QGFA 1BMFD 4EPVA 4TN1A 3U5ZB 1E2LA 1AS3A 3NH6A 1SVWA 2J0VA 4OHWA 4TQUS 1YR6A 4WZBE 1E32A 4GNKA 1GUAA 2Q9BA 3BORA 1OXTA 2YYZA 4FMCF 1E9FA 3SE0A 3C16C 2LKDA 2CDNA 4K81B 1U8YA 4Q02A 2QP3A 1IJFA 4BEJA 1U0HC 3QBVA 1GNQA 1YR9A 3R9IA 5JEEA 4UNNA 1Z2AA 3NBFA 4BZQA 3P4XA 4JYBA 4KV9A 4RZUA 2GXQA 2BCJQ 4MITA 3T34A 1EK0A 5BN5A 4U00A 3LX5A 4EJSA 4B34A 5HE8A 1NY5A 3CONA 3FHOA 1GNPA 4Q19A 4WBSA 5E7MA 5SZHB 3WYGA 1TUEA 1XD2A 2FEMA 2IHBA 3UMFA 4D26A 5FPYA 2JLVA 3BGWA 5JJLA 4IVRA 3OIUA 4B3CA 2JEOA 4TT3D 3UK6A 1ZNWA 2DB3A 1GOTA 4P0TA 4NYMQ 2HF8A 5FI1B 5F98A 3EG5A 4I1VA 3Q9LA 4OQFA 2PEZA 4V0ME 5ANRB 1J8MF 3T1QA 2IYQA 1ZCBA 4CT4B 1E2KA 1JECA 1IXSB 1J8YF 1Q1BA 5JBQA 2OXRA 2WSSA 1GVNB 1RVDA 1HURA 3AKEA 1GM5A 4JVSB 2EYQA 4ZI2A 1KDTA 1Z0JA 4TLCA 4QGAA 4DLRA 1YU9A 2J9RA 5FH9A 3AVYA 2R6DA 3BAFA 2WJIA 1UBEA 1CP2A 1CJUC 1RJ9B 4GMDA 4M1KA 2CNWA 1RRPA 2GK6A 5JJIA 3QXJA 5J5CA 5DSZA 3N2IA 2VLIA 1P2TA 5JSZA 4ZCLA 4P4SB 5FPTA 5L3RA 4TMTA 4V0NA 2BMFA 1TAGA 1YZNA 1Z8FA 1W2GA 2CHVA 2V9PA 4F4IA 4XVUA 3PENA 4IEEA 2QMEA 1PJRA 4OI1A 4HZIA 3TIFA 2WOOA 5H70A 2JGNA 4URWR 2RGNA 2WWYA 3X2SA 4ZCIA 4QM6A 5GVRA 2RGNC 4QJ5A 1W48A 2PCJA 1CS4C 4FXPA 5DN6D 4TMZA 1WQ1R 3U7HB 1DEKA 2J1LA 2CHGA 1QDEA 4RJLA 4OJQA 2GZAA 1E0SA 4X8LA 2BVNA 3PJRA 1ZNXA 2D4HA 3QF4B 1KJWA 2WPDD 4HZUB 5C46F 2DWOA 5CIWA 4DZZA 5P21A 3K53A 4LJ6A 2IYWA 3Q5DA 3IQXA 4PANA 4XWOA 1DAFA 3DO6A 3QPVA 1AA9A 1Z6TA 1TNDA 4PSKA 2F1JA 2O8EA 5C4MA 4C7OB 2IS6A 1WXQA 2J3EA 1GL9B 3ASZA 4M9SA 1NVVR 2ZEJA 4LBYA 3U6BA 3KQNA 1ZBDA 1XMIA 3G82C 1CJMA 2AFIE 5IK2A 4OI2A 1I2MA 5D3QA 5TARA 4B75A 4DLVA 4J0QA 3B7GA 1KAOA 1OW3B 4EFLA 1W36B 3VNVA 1W5TA 5C1BA 3I62A 4QGHA 3UG6A 5KHOC 3LX8A 1KK1A 1N5KA 3SFZA 5DI3B 2GILA 1H8HA 4Q47A 5BWMA 2FU5C 3QJYA 2ZUBA 3UWOA 2JLQA 4BZPA 1R6BX 5HZHA 1XRJA 5B30A 2X2FA 1NRJB 1E2QA 3FTQA 1AGPA 4RD4A 2GA8A 2RHMA 3GJ6A 3EWSA 4EKDA 4DDTA 2QRNA 2UVQA 2WAXA 4DLYA 2BJVA 5EXSA 3AH8A 2RGDA 5KSYA 5IK2D 1OV4A 4U7DA 2ZR0A 4X8OA 5EP2A 2V1UA 1ZNZA 5EP1A 4HLUA 4HLUC 1R5BA 3RDPA 2PLFA 1NVVQ 2QM7A 3EZFA 5FL3A 2XXAB 2CJWB 4LJAA 4UXHA 2XZOA 1E2MA 3NC0C 1DE0A 4IDPA 2J0UA 1R5NA 2NZ8A 3VFDA 4DSUA 4DLUA 2ZRNA 4A2QA 4LC0A 4A4DA 4Q9KA 2QROA 4JLVA 2BHRA 3RS2A 3EC2A 4GP7A 3PUYA 5KTYA 4NCHA 1NVWQ 2B92A 1F3OA 3NVAA 4JVMA 2NO1A 3R8CA 4LHYA 2OXCA 5A4JA 1SKYB 2OCPA 3UKDA 1WRBA 3VR3A 1SXJE 4W9MC 4B3GA 3HPQA 5EE9A 2DYKA 1VKJA 2QNRA 4GSYA 2JJ1A 3TUZC 1FX0A 4U02A 1GRNA 4FMCB 2JLYA 4NZYA 2VF7A 3IHWA 2FZLA 4AWXA 821PA 1SULA 1SKYE 1FZQA 2QPOA 1NNEA 4PPGA 3KJHA 1UBGA 1ZIOA 1R0YA 3N5CA 3CM0A 4S35A 1II9A 3GFPA 1M2OB 2QE7A 4LPSA 1T5IA 1VECA 3DL0A 1ZCAA 1IN6A 4BQSA 2JLXA 2I3BA 4B33A 3CRVA 3SBEA 5HCIA 3CNOA 2DWQA 2FSGA 1OXSC 4KVGA 3ZS8A 4IW3B 4HAVA 4C0SA 3C5CA 1FNMA 4DUGA 4KAXA 4AKHA 1G6HA 1M8PA 4GZMA 4C0LA 1BIFA 2CVHA 2WAYA 1E9AA 1IOZA 4TZ0A 2WOJA 2ZI5A 4IJMA 3B60A 4A6XA 1KI6A 3NEJA 3OIVA 1A82A 1JQJC 4GPTA 2Q0HA 3TH5A 2VEDA 3DZ8A 4NP6A 3KJIA 1G7TA 2D74A 3MMPA 2O8DB 4TYPA 3RC3A 1JJVA 2IS2A 1IN7A 1S9DA 1XP8A 3LVQE 3CX6A 1CBUA 4QOSA 4A6PA 4BASA 3AM1A 2R2AA 1K6MA 2ONJA 4Q21A 3X1ZA 4P4TA 4V0LA 3BS4A 1C1YA 1YZUA 2JIZA 4OYHA 1RYFA 2ZU6A 2BM0A 2REBA 1VCIA 2GBLA 2RHDA 3QXHA 4JL5A 4LHZA 5J40A 4A8JB 2GBLC 1SQ5A 4IDNA 2QP9X 5G3ZA 4V0MA 2XNDA 3ZVLA 2B8TA 4CW7A 2XSZD 2DFLA 2R6AA 1N0UA 3CW2A 4TYNA 421PA 4IFBA 4G0NA 2I1VB 2PT5A 3OIWA 3DMDA 4ZO4A 3O8RA 1GKIA 4AKIA 4B32A 1NSTA 5JFGA 1OKKA 1R4AA 1JXOA 5JI2E 3BWDD 5CIQA 3FGNA 2JIZD 5HE9A 4M1YA 3V4RA 1DTSA 4GL2A 2ZSEA 2W0SA 4HUQB 1YZKA 2B6HA 4JLPA 1RW4A 1JAIA 2QRZA 2XNDD 4PQFA 3W34A 2QGZA 5FUYA 2FSFA 2PMKA 4HSEA 3L8ZA 3A1SA 4IHQA 2AWOA 5GVSA 2H1LA 2P67A 4IDOA 2JA1A 5J4HA 3P26A 4C0KA 4PTLA 5KU1A 4CYMA 1RJ9A 1HY3A 4AC9A 4AD8A 1EFRD 4G1UC 3WNBA 2DFNA 4OI0A 5J4KA 2QZ4A 1KDPA 1Q0UA 1PLKA 2YC2C 1W4RA 3QXCA 4P4SA 3X1YA 4GT1A 1RFLA 2W2VA 3REGA 1SHZA 3CPHA 3B13B 1GWNA 4BFVA 4LV6A 2GAAA 4EPXA 4DHEA 4JLAA 1KI3A 3WHLA 1N6LA 1KI8A 4LV5B 4TL8A 1IONA 1JBKA 5D3MB 5AJZA 3BB4A 4P31A 3MD0A 2XTMA 5DHAA 5AWFC 1JPJA 1WMSA 3JZAA 5TV2A 4ZDIA 3ICEA 4F91B 2QMUA 3U3KA 2V8OA 1WDTA 3FMIA 1G291 3TQCA 4EPTA 2NPFA 3QF4A 4JVLA 1ETUA 4PSVA 4BE7B 4BEBA 4HZUA 2NIPA 1M1YE 3DPUA 4A2PA 4DKXA 5B64A 2HLDA 2CMKA 1RC8A 3BFXA 2GCOB 5JI3E 3LBHA 2IYXA 4LX0A 2YKGA 2ZYUX 4JSYA 3OAAD 5TY0A 3AVUA 4PR0A 2BJWA 3VR5A 1AGRA 4C7OA 1KK3A 3K1JA 3FPAA 1KDRA 2W6JD 4HLQB 3WXMA 2X19A 1N5LA 4JLOA 2K5UA 1KI7A 2JATA 1A5TA 4OHZA 4QNRA 4JIMA 3BJIC 2YV5A 3SJZA 3ZZUA 1EGAA 4ILEA 5FBLB 3WMEA 1W36C 4RKEA 4US1R 2C2HA 4U5XA 2D62A 4MGKR 2GETA 2VHUA 3I72A 4N0EA 1IY0A 5JWOA 2HLDD 1ELOA 2ZSAA 1VCMA 3DZDA 5DI3A 1GILA 1JB1A 1R0WA 3AP2A 3DM5A 3VR6A 4MDEA 3E1SA 4MKFA 3KZ1E 5DO9A 4LBVA 4MUBA 2VPPA 1GTVA 2A30A 4LGMA 1TF7A 1G3RA 1VIAA 3VR2A 4TYWA 4DT1B 4TLBA 1FQJA 2WKQA 3OEHA 3RRZA 1XZQA 1N6KA 2ERYA 4HAUA 5JCZA 1Q3HA 1DADA 1GRRA 2ANBA 1W36D 3KQUA 4XTRA 3I4LA 5SZJA 4M2LA 2Q21A 3ZJYA 5DHFA 1PZNA 1XEWX 3GLHB 1VDZA 3AVXA 2IUTA 2CCJA 3WMGA 3ZD7A 2XXAA 2C77A 4DIDA 2CJWA 2FFQA 2XZPA 1T3SA 1P9RA 2YHSA 3A36A 1E4VA 4DLWA 1G41A 1SVSA 1YZGA 1D5CA 4B48A 4BLRA 4O2LA 3A4NA 1DAGA 1FUUA 1TPZA 3OEHD 4L9SA 4D82A 1Q21A 3GLFB 2ZROA 5KSZA 2WJVA 2RGXA 3GLHE 4CGZA 4MRRA 4Q1AA 3KFXA 2ZE6A 1MABB 3WBJA 1SVOA 3FKQA 2ZRBA 3MUFA 2GJ9A 3L0IB 1US8B 3TSWA 4ZDKA 1E3MA 2GF0A 3NG1A 2JAQA 2IS1A 1N2CE 4MRSA 4PZZA 1MR3F 1UDXA 3L0OA 4BLSA 3B9QA 1VYUA 2E9SA 3VTKA 1T0JB 2ATXA 2O8BB 1L7VC 1COWD 4Q1BA 2H17A 2AWNA 2C99A 3KKMA 4TLAA 2ZR9A 2VP6A 4RSGA 1OT3A 3RS5A 4DCVA 1DPFA 4CF7A 3GLGB 3MGCA 2ANCA 4H1UA 5FOSA 5K8TA 2J7KA 2WM9B 1KHTA 5L3VA 4M1OA 2DWPA 5KNCA 4PQRA 4K46A 4AKGA 1A7JA 3IQWA 3AEZA 2FF7A 4DLSA 2ZTSA 3AGPA 4PC1A 1P5ZB 4AURA 2QU8A 4A0RA 1Z2CA 2AX4A 1KO8A 4FMBB 2CHQA 1TL7C 3FB4A 1RPZA 1E2DA 5KDLA 1KIMA 1UPTA 2W6IA 4PC2A 2J7PA 2VP4A 3RWMB 3TKLA 4M9XA 2BDTA 4Z8YA 3K0SA 2H16A 3ZDQA 2NO7A 3NH9A 3TRFA 3A58B 3LW8A 2VSXA 2B7BA 3PCRB 4XD7D 1NL3A 4DDWA 2EFDB 3W5IA 3AF1A 4ACBA 3QPUA 5FBVB 2ZI6A 4C0AC 2BWJA 3D31A 3SC3A 1EWRA 3M6AA 3QIAA 3A1WA 1TMKA 3KXLA 4AG5A 3G0HA 3K0CA 4CZ2A 2XB2A 5EP4A 2O8DA 2QQEA 5KPDA 3K0CC 1NG1A 4C0BA 4LYHA 1VHLA 1LB1B 4M0LA 2W6ID 4C9BA 5KDDA 2IYSA 2J7PD 2XJ9A 4UQOA 1KNQA 4RD2A 3PUWA 3T15A 2PX0A 4JZKA 5AUOB 2HXYA 1E9SA 2C9CA 1XPOA 1ANKA 3IGFA 3KUDA 1KO1A 4A8JA 2QUZA 5F3WB 3SHFA 4JT2A 1RYHA 2JJ2D 3LXXA 4C3ZA 2ZE5A 1XEXB 5FTMA 3PEUA 5DISB 4G5SA 5FTJA 5F9FA 1SKQA 2Q6TA 1M7BA 3QF7A 2P5SA 2ZRGA 4O0MA 1KGDA 1KSJA 4LYAA 2O52A 5CLLA 1NN1A 5FOUA 2VSOA 5E95A 2AKYA 2NO9A 5AJXA 1MT0A 1GSIA 4V02A 4N1AA 4M9QA 1YQTA 4MYUA 1OH5A 4JS0A 2W0MA 1ZM9A 2F9LA 4W5JA 5FBRB 4BLPA 1V43A 3R7WB 1UBFA 2YC4C 1GL6A 2VTKA 4HUQA 3EZ9A 4JYCA 1ZM4A 4PO9A 3RHFA 5C2JB 3QSYA 2PCLA 4FIDA 1MV5A 2A2ZA 2AK2A 5CYOA 5L8VA 1E79A 4HDCA 3U60B 1T4GA 2BEKA 3ZZ0A 3KXIA 4LHWA 3KQKA 1ZAKA 4RD3A 5JJKA 4IDQA 1XPUA 3K0AB 2ZJBA 1F48A 1XMSA 3QVVA 2P2LA 3UXMA 1TEVA 1QG2A 4PSAA 3IEUA 2WKPA 3HU3A 1Q1EA 4E07A 3RRNA 2UZ3A 3I5YA 1KY2A 4D80A 2YJTD 1LF0A 2Z0MA 1OHHD 1K5GA 3RLFA 2BMEA 4KBFA 5D3MA 4OK5A 5ELXA 4AY2A 1VTKA 3Q7PA 5KYKA 1LY1A 1E79D 1EFTA 3PVSA 5JHGB 1UBCA 4D81A 4M1MA 2OE2A 2G0TA 2A7QA 3EW9A 3BRWD 3K9LA 5FPHA 1P3JA 2HCJB 5G3YA 2PMDA 4URUR 1IM2A 2XNSA 2R9VA 3KQHA 1AQUA 4PPFA 1W0KD 3A37A 5CDFE 3B1ZA 4Q4JB 5J4LA 3I3SR 1D9XA 1PUIA 5K8UA 2GCOA 1EWQA 1CR1A 3CH4B 4N3NA 4PPQA 4EPYA 2P5TB 1NKTA 4PC7A 1DO2A 4XWAA 3I73A 3MG9A 3R9XA 3BD9A 4YONB 3PEVA 1KMHB 5EXPA 5EUMA 2GEVA 3IIJA 4TL7A 4M4SA 2G9NA 1LS6A 5FBQB 1FMLA 3CH5A 1Z0IA 1YRAA 2VP2A 2YOFA 4AIIA 2IYLD 3T1TA 2ZE7A 3GPLA 1NY6A 4NKRA 3SQWA 3JVVA 3V9PA 2QAJA 2ZRCA 1F6BA 4YXWA 2NOAA 5EE0A 5H8WA 2IUSA 1T9HA 2ERXA 2RCNA 4HLDA 1P4SA 4EJSC 4L5BA 5K8LA 1XD9A 3AUYA 3Q5EA 4DT1A 2H92A 4FINA 4P32A 5F9HA 2A78A 3U44B 5FTKA 1XEWY 2ODEA 1Q1ZA 2FNAA 4HEJA 2PBRA 4IEIA 2RB4A 4DLXA 1P73A 2O0HA 1XCMA 4GP6A 4DIEA 4M1TA 2IYUA 3GLHA 1WE2A 5TB5A 1UAAA 3GCGA 2XAUA 4RY2A 2BC9A 1UJ2A 3TR0A 4G5QA 3L43A 1QVAA 2GK7A 1OE0A 2Z4SA 4DDVA 1ZD1A 3O8DA 2LKCA 5DYIA 1P7CA 1W47A 4NDZA 4LJ9A 4NTZA 4BUJA 5CB8A 4F4CA 1CU1A 2XZLA 1A1VA 3CNNA 2OO7A 1E1RA 1U9IA 3GLFA 2F43B 1TQ6A 4DEXA 4MUAA 1FTNA 1NBME 1SVMA 1U9IC 3U3RA 2VHJA 2F7SA 1PLJA 3CKLA 2B8WA 2QTHA 1MABA 2IYYA 1N6HA 1R2QA 1Z0KA 2KI5A 1CRQA 2QSZA 3FMFA 2WSSD 1KI4A 2EFGA 1IHUA 2VBCA 2XB4A 2J45A 3JVUA 1US8A 3RRYA 3TE6A 1G17A 4WZ6A 4QJ3A 3DDCA 1ODFA 4QM7A 3KKPA 5FTNA 1OPXA 2XOKA 5H1YA 1ONBA 3Q3JB 4ZDWA 3SN6A 3R20A 3ZVNA 3MSXA 4B3DA 2FSIA 4FMDF 2CNWD 4GOJA 4QJ4A 2VRWA 1S96A 1EFHA 1U8ZA 3QG1A 1GDDA 2V4ZA 1JR3A 4ZDJA 1N3BA 3GMTA 5LBIA 2D2EA 1S1CA 3W90A 1N6IA 2R6CA 2OBMA 3GLGA 3K9GA 1R10A 3R9WA 1VPLA 2WWHA 3L0PA 4KLZA 1ZINA 2WKRA 3FHTA 1OXXK 4GRAA 4TLDA 4D6PA 5AUNB 1E0JA 2WWFA 4MGYR 1UADA 3AKYA 1Y63A 3QUSA 5DYGA 4F7WA 1NSFA 1KZ7B 4NU0A 4ASUA 3CX7A 3TSZA 4YDHB 4XSGA 3I1FA 1ESNA 1NJFA 2QT1A 3GJ4A 3IDQA 1CKEA 1KZGB 1Z3IX 4CIDA 1JR3D 1Z6YA 1MRNA 2GXSA 1E2FA 4FN5A 4KYIB 3SJAA 1NMZA 4GZLA 1X8JA 4F38A 1G16A 1Q1QA 4LWZA 2ZRMA 4ZV4A 3SJBA 1XX6A 4B2LA 4HAZA 3KTAA 4OK3A 1XJQA 4TSFA 2F55A 5JWRA 1Z6GA 3BIFA 2F1IA 5JRJA 1NN3A 3QKRB 3OE7A 3KXKA 2DCUA 3T06B 5HKKA 4TLEA 3GP8A 2ZJ8A 4LUCA 5EE3A 5G53C 2UKDA 3VMFA 4O2RA 3CRQA 4ARZB 4HAWA 3IPXA 2WWWA 4FD2A 3KQLA 2ZS7A 3CBQA 3ND8A 2R8RA 1BOFA 2OAP1 3NDPA 4EFMA 5FFMA 4PQYA 1LVGA 1OXUA 3EARA 3TUJC 3A8TA 3TK1A 3BH6A 1J2JA 3BE4A 1DAMA 4OQXA 2VA8A 3ETLA 1KI1A 1H8HD 1XEXA 4BWYA 4QBIA 2FA9A 2W00A 2ZSFA 2O0KA 2GDJA 3ADKA 2BBOA 3B2EA 5B57C 4C2TA 5JLJA 2ECKA 5EUQB 3HP1A 4BLOA 2OV2A 1SXJB 4ZCMA 2O8CB 3ASYA 5J4YA 3CNLA 2F1HA 1F5NA 1XDBA 3LRPA 2DFTA 1OFUX 2VHCA 4BFXA 3LA6A 4P33A 2L0XA 4PFSA 4C0JA 3DM9B 2RGBA 3ADBA 3U7FB 4KSCA 3NC1C 2O8FB 4EQ6B 5FOVA 1YZLA 1XCPA 4WXRA 4R7ZA 3B82A 1M7HA 3R7WA 2CK3A 4E5UA 4E22A 4FCVA 4FW9A 4Q1EA 2OG2A 3LNCA 4XSHA 3PITA 1V5WA 2ODWA 3SYKA 4JBWA 1E9BA 4TMVA 4QHSA 5JS8A 1FQKA 2OHFA 4MQBA 1CIPA 1G6OA 4IVQA 5LB4A 3K9NA 3R8FA 1QHYA 1G7RA 3K70B 3CZQA 3U4QB 1U98A 4F4JA 3K0AA 3QEOA 2ORIA 2IWRA 2QTVB 4URVR 4BGDA 3TR5A 1HYQA 3EC1A 3L2OB 1AZSC 1KYIA 1IN4A 2KBEA 1X6VA 4F92B 3QPWA 4IRUB 4QBGB 4RZ3A 1JEDA 3OFNA 4E03A 4S2EA 1N6PA 2EW1A 1JAHA 3TW8B 2JJ1D 1GL7A 1OFTA 2FZ4A 2BBSA 4OQMA 4TZ6A 3T12A 2ZQ5A 4AYXA 4D4LA 3PUZA 1NLZA 3FKSA 3F5FA 5H68A 4PX9A 4G5GA 1EX7A 4OI4A 1IJEA 2JLUA 3NBZC 1BO6A 1WF3A 2KSQA 4GFDA 4PPNA 4Q4JA 2E1RA 2QE7D 5FPSA 3ZH9B 4B35A 1I2DA 3TGPA 3B1VA 4RD0A 2OBLA 3H2YA 4Z8XA 3QG5A 1OH7A 1VG1A 1XTRA 3OFND 3TVTA 2H7VA 3EIQA 4ACAA 1E9DA 1DO0A 2ODNA 3WMFA 3AVTA 1FNNA 3AKDA 2VL7A 4US0R 4DUGD 1KMHA 3GJ5A 5LB2A 1B0UA 4CVNA 2WTUA 4D4KA 4KBGA 4AK9A 4Q4AB 4LRWA 4Q7LA 3MWYW 1AS0A 5J4VA 2IHYA 4B3BA 4PAQA 1E2HA 1BKDR 2VP0A 1CXZA 5LDDC 2OFOA 5L3SB 2AL7A 4NBSA 2G1KA 1S9HA 3T5GA 2IS4A 3WHKA 3Q8XB 3PUXA 2PEYA 1AK2A 4KLNA 4LJ8A 2ZRKA 3T35A 4C4PA 3TJZA 2X8AA 2IBMA 3ONWA 3M0EA 4PC3A 4B6EA 1II8B 1Z83A 2IXFA 2J59A 2NGRA 2ZJOA 1VCNA 4FMDB 2R44A 5AJYA 3THYB 1AM4D 2JASA 1HEIA 3F0TA 4CT5A 3K9HA 3EZ6A 3U44A 4YMVA 1AIPA 1ZD9A 3IKJA 3T1VA 1N6RA 2FMXA 2GNOA 1X86B 3QXXA 1E2NA 1E2JA 3LDAA 4MKGA 3AVWA 2ZVPX 2XTZA 1GKYA 1X1SA 2IEZA 3RABA 5B58C 4DCSA 1U8AA 4IDHA 1NF3A 5TXGA 2BMDA 5CM9C 3DOEA 4QXAA 4TMXA 2W58A 1OSNA 1K5DA 2ZI3A 4JJKA 4LJYA 2N42A 4KHZA 1S1MA 3OZXA 2FOLA 2PJZA 4TL6A 2MSDB 2Q9CA 4TQ9A 5CJPA 1QZXA 4YC7A 2X77A 1OKKD 3CUEF 4JLNA 5FI0B 3VAAA 2VIIA 4KITB 1NMYA 1OYYA 2C98A 2F43A 4TWZA 1XWIA 1IY2A 4M8NE 4LV8B 3U3JA 4PHHA 3B1YA 4PO1A 4D0NA 2J87A 4IOMA 4R9UC 2OUKA 3ZLJA 1LV7A 4JLMA 4D2IA 3IIMA 4KI0A 3A1TA 1E4YA 2X2EA 3Q72A 2C96A 2GVZC 4UNSA 4FCWA 2P6NA 2ZUDA 3B78A 1NP6A 2WZQA 3BXZA 4TMWA 1KI9A 2V6IA 2GEUA 2LWIA 3KKNA 1ZU4A 4MA4A 1KI2A 4OQNA 4XTCS 4B43A 1G4UR 1RRFA 1XCGB 1IAQA 2FSHA 2OLKA 4GOKA 4M53A 3ZYCA 3ZZTA 1CULC 1CTQA 5BQ5A
chains in the Genus database with same CATH superfamily
1JQBA 1JIJA 3H2JA 5FOTA 3IPRA 2Z04A 5LQUA 2M6RA 4PR3A 4PRLA 1QO0A 1KJIA 1OASA 2FLWA 4DEYA 5C32A 1WBBA 3AUKA 1VYVA 1OFIA 3D0OA 1CRPA 1QHIA 3TAUA 4PC6A 1YXMA 2ZYIA 2XE4A 1LPPA 2HPAA 2LRHA 4G0YA 4KVFA 4UFNA 2RKWA 3IILA 3ICQB 4FHDA 3E81A 4IKEA 2G06A 1PKXA 3G2PA 4YJHA 2UUPA 1EFKA 2ZIAA 2W6OA 3G2MA 3JQEA 3Q98A 4AECA 3E4DA 3KVNA 5LC1A 2AR7A 1KDVA 1ZGGA 3S2SA 2GARA 4XWGA 3G5AA 3NHRA 3D3WB 4MVJP 4XWWA 4KO8A 3REFA 2UXCB 2VAXA 3LC7O 3K4HA 4RWEA 1YDMA 2GN8A 3RRMA 3U61B 3PQEA 1V7ZA 2YBEA 3OPMA 3UJNA 1W5BA 1RRMA 3A3PA 4FI3C 1WUYA 4IZIA 4K9RA 3Q3EA 1Z7EA 5C4GB 4QKQA 3WTBA 4O2BF 5D5HA 3LK7A 4LXGA 2B99A 4IVNA 4W5OA 4JJAA 4FJ0A 1IZYA 3GNQA 3KZXA 3OJFA 5FA8A 2OAQ1 4TUYB 2OCIA 4HGOA 3O47A 2HRZA 5CR9A 1GFIA 3HCBA 1F38A 4ZN6A 3F9RA 3TZKA 1ZR2A 4M0PA 1J23A 3NAMA 2HW8A 1UM9A 1XFDA 5ALGA 1GGEA 1AXRA 3ZDEA 2DY1A 4XWYA 4DNFA 1AJEA 1F2TB 1Y37A 1GUFA 1SVIA 1W5SA 1ACJA 2QZZA 2P8JA 1E9EA 2QT9A 3VSEA 4B71A 1KEKA 5CXSA 3M83A 4F11A 1CDEA 3H5IA 2CXQA 3A26A 1W52X 4TYMA 1MC8A 1PG5A 2CCGA 3EEFA 5CXUA 2PX3A 2OL4A 3ONFA 4RZQA 3VR6D 1J90A 3EGDB 1E5DA 1FVOA 1JTVA 2BRUA 1I1QB 2E4VA 3BN3A 1O8BA 3RRFA 3L6CA 4DFDA 1DKUA 1G42A 1DJPA 2AVDA 5C34B 4KH1A 3S29A 2BN4A 1Y9JA 2G1PA 2XJ4A 4CQJA 4DA6A 1TTPB 1KH1A 3F96A 3NCHA 2WBLC 3PV0A 1KH2A 4WBNB 5CEFA 2VT6A 2GXUA 1HE1C 3IODA 2Z6UA 4YECA 1AKTA 1TIKA 5KYYA 3U4IA 1TI7A 5AW2A 3CZ4A 2ID9A 3BJRA 4R6XA 5EQJB 4EQ6A 5LZ4A 1Q2XA 2Q27A 3ZDXB 4TKVB 4RHXA 3JALB 4E7OA 4C14A 4ZKEA 4OHYA 5M7EA 3BFKA 2WLSA 3EGCA 121PA 2B94A 4B6RA 4JA0A 3QEMA 1FOEB 2VLBA 1DJOA 1JHXA 2OZEA 1VBFA 1HFKA 2Y2UA 4HG2A 1J1IA 1ZUHA 2VUHB 2WKSA 4P4UA 1EFPB 1PEKE 2D2FA 3NT2A 3RANA 2Q4OA 4FCTA 2NU7A 1UC5B 1D1SA 5HILA 5GJWC 1GIAA 1FRNA 3JQAB 3IPAA 5DI9A 3SQXA 2CL6X 2R6JA 4N01A 5CHYA 4MQUA 3SSMA 1TJYA 3X1WA 1X9GA 3TZLA 3EISA 4E2YA 3QJGA 1KS9A 1P39A 1CWUA 2K7ZA 3GRVA 3QWBA 3K31A 5IW8A 5JQGF 4Y0NA 5KX5F 1E3JA 3GUUA 1ZJ4A 2AJBA 4JBHA 1Y6JA 3U39A 4BV9A 4DIUA 2CUNA 1KC3A 1MPXA 3QKSB 3FTNA 1T8RA 1AUXA 3DBLB 3FJOA 1ZZGA 3ZD9A 5BN3B 5AVYA 1VZ2A 1F2UB 2J6BA 1O58A 4FZVA 4URHA 4XAQA 3QENA 4M7RA 2IXEA 2IZOA 4O4JA 4JI4B 5I9TA 4M0KA 5AVJA 4PGFA 4G4SO 3VPXA 3HKEA 4NMHA 1OB5A 1OBOA 3RKSA 2Q4TA 3OZVA 4PO3X 5K8VA 3GHHA 1GU1A 4W1QA 4XI9A 3M1IA 4DCNA 1MIHA 5C51B 3LQ1A 1CQWA 2V5AA 1TC1A 1TJ3A 2QVYX 4LN1A 3W8RA 2Q8PA 5MFPA 3B1FA 1L4EA 2F3TA 3I2GA 4OLHA 3SMVA 4HVLA 1N5JA 2I1WA 2ZYHA 2ZJ4A 4RF4A 2GLUA 2C83A 1VFPA 1ZUWA 2V54A 4P4GA 1V1RA 5EMHA 1YHNA 3TFQA 2B34A 4NC9A 4JC0A 3RNLA 4RNDB 3SJ7A 3D81A 2I1QA 3H4VA 1FNCA 2ONYA 2Y76A 1JKFA 2EYUA 3DW3X 4I1RA 5IBCA 4HSGA 4ZHQB 1Q0RA 1FK8A 1YULA 2EKBA 2QQFA 4E2ZA 3G9UA 1CPYA 3CNHA 4U5QA 4J1SA 3HU5A 3I34X 4RZ2A 3I8XA 4A8JC 1J70A 4MINA 3NQ41 1DELA 3LDUA 4QELA 1NNLA 1YIOA 2OSBA 3AJ8A 3O1JC 2VK8A 3S70A 3L07A 4G9GA 3AB8A 4Q39A 4MQEB 3EQ6A 3SHQA 3BGSA 5AK0A 5EWJA 4S0XA 5B1DA 1T43A 5C5DA 1JALA 4I14A 1YS6A 3QEJA 1SHJA 5FULA 1GAJA 1F9EA 1T9GR 4IDEA 1U94A 5CX1B 3HBLA 1NQXA 1X80A 3DTTA 3D1VA 4ZT4A 2FWAA 1T1JA 4G86A 4HS4A 4PXAA 4B3SB 4BIIA 3UK7A 1ISIA 1DJNA 3S5JA 2P9GA 3QPDA 4V1CI 4UC0A 4DPLA 1Y7IA 2X5OA 1Z5ZA 2NYAA 1MVNA 4LHSA 4V0SA 4IH1A 4UUOA 1IBCA 1AKRA 2Y2VA 5EMMA 2C57A 621PA 4CF6A 1CS0B 1LX7A 3AUTA 3O9MA 4LCEA 4TWJA 4JOBA 2C5BA 2UYGA 3PX2A 1II0A 3P20A 2CL7X 4NCKA 3FE2A 2YMMA 1P29A 4LY6A 4EH1A 1RSZA 2BHLA 5EPEA 5JJBA 1GPWB 2ZYWX 3OM1A 4RVSA 5BWBA 4KPUB 4EF4A 3ROZA 1X38A 1CY6A 3IQEA 3UWKA 2ZWOA 3VHRA 1P4RA 3H6KA 3P27A 3BFVA 1EP3B 1JPNA 2IF2A 3ZV7A 1BG6A 1WOYA 1XQ1A 1ZCJA 5EZYA 3CO0S 4BNIA 2YHUA 5K09A 2BEVA 1G4AE 3GEHA 4BN5A 2OC9A 4F86A 1EX1A 1G0OA 3GJ8A 3P94A 2I7XA 3HY4A 1SM4A 4HMOA 5CFRA 3PDWA 2R48A 2Q3BA 4MYCA 4YMSA 2LCFA 4BNYA 4V1CB 2XWPA 2QL9A 3O0DA 5JXHA 2HM7A 4KP7A 4E5PA 2BGWA 3FWHA 1GJRA 1UFKA 4BNLA 3C97A 2DR0A 3ZWDA 4JUCA 5DNYB 2QTCA 2YINC 1FP6A 1NONA 3G17A 3KV1A 3PGKA 2JCYA 1T2NA 3N2EA 1CB0A 1XNJA 2YNMA 3QGMA 5DT2A 5DLEA 3H04A 2CLEB 5F51A 3L6OO 2B1IA 4M1QA 1QF6A 4C6TA 4CN9A 1QP4A 3FY4A 3K09A 2KQUA 2FRDA 1EH5A 1R8SA 3VDMA 1P1IA 3WOHA 1P1HA 2AXNA 4U7FA 3DLIA 4DRYA 3EPRA 1NVAA 1OV6A 3IP1A 4LYJA 3IP9A 5CITA 1Z29A 2ONKA 5J5VA 2YRXA 3LCRA 1Z3CA 1OA1A 3MK31 3ZV3A 2IP2A 2Z30A 1V7CA 1Z56C 1BGVA 5K3CA 5KCMA 3K9FC 3UG7A 1N9KA 3AEUA 3RYHB 4IIEA 3SS7X 3LUJA 1QYDA 3B3AA 1UM8A 3KQTA 4CDRA 3KWLA 2YHIA 5TSDA 4DV1B 1E0AA 1C4KA 3OQIA 4M83A 4ALKA 3IUJA 1T2DA 3LWNA 1D2MA 4XFJA 4YAUA 3THWB 3GQBA 4KLAA 1Y8QA 3NHMA 2CVQA 4DC9A 3QXGA 3DBOB 2C92A 4Q18A 4AYTA 2C03A 1DL5A 2JFBA 3QKTA 4K3VA 4XEUA 2ZE8A 3KB1A 5TQ0B 1SD5A 2GBGA 3TBHA 4BFYA 3F6SA 2FJ0A 2PIAA 3O3CA 3R7SA 5CVDA 1M2KA 1O6BA 2FFBA 2GCEA 5I3CA 1HOTA 5CRIA 1TAQA 4GE3A 1Q84A 3FR7A 3P71T 2GHIA 4C6HA 1UKEA 3TNJA 3OE5A 3CXUA 1IUOA 4OHXA 1DIGA 4MVCA 3RSLA 1UMBB 1CNEA 4X1IB 3MTEA 2V3CC 3AEYA 4KWCA 4YUZA 5HZGA 3EVAA 1KY3A 2CBZA 3COVA 3DT9A 1DJLA 1G5PA 4I1UA 1IDN1 4N8EA 3TBKA 4ODIA 9ABPA 2PTGA 2R97A 1EKXA 1E6KA 2H0RA 4NG4A 4JHLA 3JPYA 4OVKA 4WKNA 4B2PA 3RUEA 3V8BA 4YMTA 5K7SA 1U1DA 2WYHA 3BEDA 2DSTA 1OF1A 2O5VA 1GP2A 3IEXA 3MT8A 4HP8A 4DB4A 3KT0A 1Y33E 2X2OA 1RE0A 2PGDA 3K0FA 3OHMA 1U9YA 2BMJA 5JHHB 3DZJA 1ZLYA 5L7WA 4PYLA 4YRTA 1Z0FA 3BKXA 1ZUIA 3MWJA 3ORYA 4IGIA 2WIKA 4C4ZA 3RRBA 4JJEA 1F6DA 2JLCA 4OYYA 4RZSA 3EIXA 3PX3A 4EB8A 4PVDA 1YACA 4BMCA 1V1MB 4IX9A 4ZGGA 1HO3A 2XA2A 3L5OA 4LCBA 3D6HA 4RY0A 4UEKA 1IWOA 4AZTA 3EF1A 4XYGA 1R9MA 3A6FA 1SOWA 1GFZA 4UPVA 1AA6A 5A4MS 1GITA 1H8EA 2DFKB 1IBKB 1EFUA 1F8YA 4WJLA 4H18A 1XKXA 3NBXX 4MP3A 5SV2A 1QAOA 3OP1A 4QDKA 4HDRB 3NV9A 3K6KA 4LDQA 1GSOA 4OV6B 3KE9A 2V97A 4I8IA 5LYJB 2HHAA 1QP8A 2XBMA 5A1JA 4Z4QA 4XPIB 4HDKA 5FUXA 4B4WA 3NTOA 1IJKA 5LOVA 1R8XA 3A1VA 1RLUA 3GUZA 1V8ZA 1LDBA 4MUMA 3KL4A 5WRFA 1NASA 3UJAA 4R2HA 4C30A 3M6XA 2JLSA 3TPFA 4L5CA 1EUCA 2HU5A 2VJPA 3EIEA 4RLSA 4EGCB 1CQIB 2ORVA 2BEUA 4P82A 3WLPA 1XXHE 1QHXA 3F9IA 4ZK6A 1E1RD 1W46A 1H65A 2BFEA 1NVEA 4Y2XA 1AKNA 1ZSVA 5KYUA 3UGTA 3ZW9A 1C3XA 5THKA 1K92A 2PZAA 4FR2A 4NI5A 2QLLA 1EIZA 3FA2A 1KKLA 1LK7A 3H3XA 1Z08A 2RI1A 5GJCA 3OTWA 3PKJA 4P2BA 5DTIA 2R1UA 4WUVA 2QRVA 2R2GA 5ICSA 4HI0E 4Z99A 3QVTA 3H9UA 2XOKD 3VU9A 3BF7A 2BGIA 2Z4TA 4I5FA 1WCXA 1XO1A 4Q6BA 1D4OA 2WNSA 1TU4A 5COBA 4LQCA 3HNPA 5CPFA 5B3JA 5HS4A 2L69A 1TVCA 5B3JC 1CQJB 1W1WA 4J94A 2WF8A 3CYFA 4G9EA 5EWMA 3IQZA 2I4MA 1GPLA 3CUSA 1EFCA 3GROA 4EVQA 4HS9A 3I6BA 4JBIA 5GONB 1ADYA 4MNTA 2JJ8A 1PZHA 3OBBA 3TLAA 1RKVA 3AF0A 3G89A 2HK6A 3PDIA 4PNPA 4XVRA 3OLWA 2V7EA 5DLQC 3TNFA 2HO5A 2Q29A 5A2GA 5KTKA 5H80A 3TLXA 2H11A 1I32A 5EAIA 1C7IA 4TWAA 4OU4A 2OYRA 2GB4A 4BYGA 4NHEA 4WEOA 3SS8A 3LHSA 4D0GA 5JAPA 3THXA 5AHWA 1QK4A 1XTSA 2EFHB 1XF9A 1D8TA 2Z6AA 3HWRA 4C3UA 4JT4A 3QVOA 4CQNA 1XAGA 5LFAA 5B3KA 2FHSA 2OHXA 3BE5A 2WD7B 2PL5A 4ENUA 1ZOIA 1DEOA 1M74A 2WM2A 4KODA 3GPDG 1XTUA 1W30A 4BVFA 1GZ3A 5C1IA 4HNUA 1E7RA 4J8PA 4OP3A 3WP0A 1DP4A 1DO8A 4I5DA 3L7YA 1AGXA 1KGSA 3JQ9A 3JX9A 2FPMA 2GT1A 3OPYI 2DX7A 3FRIA 1HDGO 3JQ9C 2OM2A 2PGAA 1AY0A 2IZ1A 2Q28A 3CISA 4INAA 4LI0A 4QRIA 4RK0A 3QVKA 4BN4A 1WDMA 3GVIA 5ALTA 1QE0A 4A0FA 4BNTA 4BZWA 4WEQA 2YMPA 5C53B 4RTKA 1PNQA 1ZK1A 4FT4A 4YJDA 1FMFA 2BZSA 1UKVY 3P2MA 4GEGA 5GZ3A 2AG0A 3BM5A 3ELUA 4MRPA 2PUJA 3K8ZA 3WWZA 3LVBA 4CG0A 7ABPA 2BSAA 1U5BA 1MH1A 4RU1A 5HKOA 2GZ3A 4HPJB 1WXFA 2DR3A 3AR3A 2KJQA 1SXIA 4YRNA 1BWQA 3E8XA 3N05A 5JH7F 1X3SA 5IVKA 3L41A 2VJQA 1X1BA 3PK0A 4LXTA 4RMNA 4Q82A 5HUQA 5IXSA 3IXLA 4CDGA 1OC4A 2H00A 2HJSA 1Z07A 4H3KB 1K8RA 5T6BA 1NVUQ 3FYUA 3KUCA 3ZJVA 3RSGA 2XMZA 3J81A 3SY8A 3EPKA 1XZKA 2Q41A 1QYIA 4MGIR 4W8OA 2BGKA 2ZB7A 3X1XA 2V7QD 2BZGA 3KKOA 4WX2B 1H2FA 2PS1A 3OPYB 1R5OA 4CIVA 2H59A 2VKTA 3JD4A 2H5EA 3LPAA 4L5AA 4Y9DA 2K7FA 1MJGA 3SJCA 4EOGA 3TTWA 1HR0B 2C3YA 2GVDC 4CR7A 3C24A 1K4MA 3PJEA 3F74A 4I7EA 2Y9PB 1F4LA 2GJ4A 2GJ8A 1M6WA 3AJDA 1GLNA 3GBPA 4ZT2A 1VHJA 3I53A 1UT8A 2VFAA 2Z2XA 3ND9A 3SFVA 2C7PA 4L16A 3QYPA 4FSDA 3RS7A 2CK3D 4X1KB 3QELB 2F59A 3F2VA 1GEEA 5IT9A 1R0CA 3ELDA 3IEIA 4OBEA 1K3TA 5DE3A 4A15A 3C4JA 2HEIA 2O54A 2QTRA 4HAIA 5TMBA 3BOSA 3OCVA 3K0EA 5K0LA 3PLAE 4RABA 4W1SA 4RETA 2QX6A 1K8ZB 2ZBRA 1Y3DE 3PDUA 3PR2B 1Z4IA 2J0QA 1ZUNA 2I6XA 2JARA 3MM4A 5K4AA 3ZD6A 1EQUA 1BWSA 4MV5A 4LAFA 5LQRA 4NZOA 1NIJA 2FJPA 3N0WA 3QNUA 3NOXA 4UAVA 5KSPA 3MELA 2ORWA 2X7XA 3AWDA 4TTPA 4LRQA 1JFFA 1KQOA 1RRKA 2V7VA 3B8HA 3VQTA 3WGNA 5LZ9A 3MYRA 4Z53A 4O29A 4X6UA 3OT1A 1BVRA 4G26A 1M7GA 1A9PA 1XRLA 4HYYA 4RQUA 3EG9A 3RW9A 2R65A 2SKEA 2GCPA 4Y0VA 2J0SA 1OX4B 1PYDA 1WA5A 2YV4A 1CDDA 4PAOA 3R23A 4P3NA 5A4AA 4L2IB 2X4IA 3WYDA 3D64A 2ZVQX 1PJAA 1Q92A 2DSNA 2HJVA 1UMCA 4Z54A 2OGZA 4RHFA 2IH5A 1ACMA 1LEHA 1D5WA 2GWRA 3HA5A 2VSFA 1ORIA 3FKSD 1DXYA 1HDZA 3GJXC 4Y8VA 3WAKA 1W94A 3MQ2A 5CXXA 2V7XA 2Z09A 3B36A 4WAUA 4A82A 1G98A 1U2DA 4RZXA 3T41A 3R3UA 4MYRA 4YMWA 4QVIA 4U2CA 4UNQA 2GK4A 1U2DC 3AF3A 2NG1A 4XGRA 2A9VA 2DT5A 1JSZA 1VPTA 4EO4A 3S1AB 3PFIA 1CLEA 5ALDA 4ZI7F 1V1JA 2O7NA 4KGDA 4GUDA 4J29A 4PXSA 4C4OA 3O2QB 3DE5X 4P84A 4PG7A 4MB2A 1C5KA 4HDOB 4RE5A 4MUNA 2ZYGA 3ZHRA 5GTDA 4TMFA 1PD0A 3NXKA 2GUGA 1MO6A 1T2UA 3AQ4A 1GUDA 2RK4A 1B8PA 5CVEA 4QDZA 4ID3A 3WYNA 1NI3A 1IBRA 4O1IA 3NAQA 2IU0A 2HZ7A 3WGLA 1WMBA 2GRAA 3D7SA 4IJ6A 3BWBA 3L8GA 2ICAA 1SO8A 3QW2A 1PZXA 4B7UA 1NR5A 4DAEA 4IIXA 4JYPA 3U2QA 5DNDA 3U37A 1EXVA 4YQFA 1SWWA 1W5FA 4XIGS 4YJ2F 5EIHA 3BZUA 3TLJA 3SF0A 3WYEA 3V32A 5JQGA 5KX5A 3F7NA 3HJUA 5A0FA 3H8WA 4RY9A 2R1ZA 2BF4A 2YZGA 3MGKA 5TS3A 3ZHQA 1FX1A 4HATA 5C18A 4UEWA 3UCEA 1N2BA 4IHJF 2E48A 5F2KA 3WYCA 2NV2B 5A4IS 3W3ZB 4FFVA 4UCFA 3HCEA 1XMJA 4PZUA 7AT1A 1FZTA 2TMKA 2WUEA 5SYAA 3ZQUA 1CV2A 3ZJ5A 5AM0A 2FN4A 1QBKC 5KVCA 1PJ8A 1YRBA 1C4OA 3EFOA 4F2DA 3ONVA 1KDOA 4Y6PA 3TZQA 3H11A 4CQMB 1HWYA 4D0SA 1VIDA 2X0FA 1Q44A 1IXRC 4ITRC 2FAXA 2KHZA 3BMNA 3D7KA 1XXHA 1NW7A 4KR0A 3LUBA 5B37A 2ZUCA 3KYBA 3PIDA 4W1PA 3RHSA 5K5EA 1BZYA 4MKIA 4WCFB 5KWEA 4B31A 3WIBA 2X1VA 3QITA 2CXXA 4JLBA 5B1YA 4FQ8A 5EG5A 4EIWA 2ZI7A 2QX9A 4X0EA 1UEIA 3HDVA 2B0JA 4RFVA 4BMNA 1U31A 2RGCA 4BQEA 2DQYA 3GA0A 5HZKA 3BWEA 2Q4DA 2XEXA 1XYVA 2XAAA 4WT7A 4ID9A 4JROA 4DJFC 1BOOA 4M9CA 3O3MB 3PRHA 3AHGA 5JECA 4MROA 4NLLA 1TZMA 2LCQA 3GRKA 4H59A 2GD6A 2XUFA 4JU9A 1RXYA 1YUBA 1JG1A 2IYRA 5CGQB 2AUMA 5IZ4A 1HOXA 3L02A 3WWCA 2I8AA 3Q7SA 3HO1A 2R8PA 1A2KC 1HETA 3OOJA 3FPFA 5BOSA 5BUQA 2IH4A 4W5WA 4MTCA 5I8WA 1IK6A 1E8DA 2PZEA 3ZWAA 1CR2A 2C7GA 4JJIA 4J7UA 4KIFA 4J03A 4XDGA 2GHRA 4G8DA 5J1SB 1G8SA 1PV4A 1HTWA 4EYKA 2CLCX 3GGPA 2X9VA 4EKYA 2QRLA 3D8TA 2FMFA 4F46A 3PE6A 4GMKA 1I4TD 1VKRA 4RL4A 1N57A 2BMVA 3EASA 1AHNA 1X7GA 3IP8A 3EZNA 4BNDA 2HT1A 3HXLA 4HAXA 4NS4A 1RE1A 5HA5A 3TIIA 4UVDA 4QODA 2RONA 3S27A 3QEBZ 1E9CA 4ZO7A 3SZRA 2IHVA 3I2KA 3EX7C 4Q7KA 2R5FA 5DGTA 4BB9A 1V8BA 1J22A 1V96A 2C1EA 4R3UC 3ZKWA 4KN6A 5JNWA 2WVJA 3GVPA 4MW6A 2HIHA 4IWNA 3M82A 4WN9B 3VKHA 3IQGX 3KU4A 1WD7A 1UDBA 3C8MA 3JQGA 1N2EA 2QJWA 2XNHA 3KOYA 2XMSA 5H3LA 3NHBA 3ZIAD 3KO8A 4ARZA 2D0IA 2YXLA 1GG2A 5BN5B 3D8BA 4IZHA 1U3FA 2PBFA 3KJFA 4GH5A 1ISRA 2EDAA 3SZOA 1JFTA 1LFDB 3REOA 1DZ3A 1G63A 3L7CA 1G8PA 2Q2WA 1MHTA 5JCPA 3R0XA 2NU8A 2YCBA 3RTCA 1XQXA 4B3FX 4XD2A 5EJ6A 3MAJA 3HYSA 2QRKA 1YNOA 2A1IA 2W2KA 4B6QA 2G88A 4BNWA 4B5KA 1R0XA 1VB5A 2WMOB 3MS7A 4GSKA 3MQFA 4DJTA 3L8YA 3F78A 2BFAA 4R1TA 5HTKA 3SQLA 3Q10A 4NE7A 5PGMA 1PT5A 1J1ZA 3LHIA 3CEJA 2IYEA 4KC0A 1HA3A 2MT9A 3HN2A 2BFWA 5CFZA 3FLMA 2YVLA 4PLGA 2ORED 2R86A 2CSUA 2M6KA 1VE9A 2JKVA 3SC4A 1Q7RA 1WP9A 1B6TA 2LZ0A 1G1MA 2WHXA 3AINA 5JXIA 1DTEA 1PR9A 1BH2A 2FX2A 2HMVA 4MRNA 4OAQA 4Q16A 4YMIA 3ACDA 4L8GA 4K03A 4BVBA 3IFSA 1QIKA 2QN6A 2RBGA 2G1UA 2ZRFA 3IOMA 3OTQA 5I5GA 1SKAA 1TEZA 5ES4B 2VG8A 1QQAA 1NN5A 3PNLA 4H9GA 4I50B 1TJ4A 1P4AA 2HCRA 3Q7EA 4NMWA 3NETA 5IF3A 1SGWA 4OU5A 3VH2A 4I4TB 4TS3A 3O74A 4LWOA 2VVTA 1OFUA 5CJJA 2C0QA 1LK5A 4II3A 1N3YA 2O1EA 5JFTA 4W8GA 1TQHA 3O1IC 3SDSA 1DHRA 1WKCA 1XZGA 2NYUA 4P4LA 1HDOA 2PFGA 3WHIA 5MHTA 4LCJA 2W8ZA 4WY5A 3ZHSA 3A4VA 1J00A 4XVQA 2A8YA 3PC2A 5HMLA 1TLFA 1HSZA 2QPLA 3A9TA 3DKIA 4FNGA 1KSGA 5HQ3A 4CMJA 2EC5A 1OYOA 3N70A 3NOQA 3MUNA 4R2IA 4NCIA 1XLTA 3F4KA 3DGEC 2OKGA 2Y6VA 1M6VB 2GFQA 1BHJA 2XZTA 4DMCA 4EG7A 1N0VC 1OH6A 1B6SA 2AFHE 1HYBA 4Q4HA 5JWHA 2WQ6A 3O03A 4O4HA 3SYLA 1OXVA 4L57A 4YRKA 1LDYA 1ESCA 1X77A 1NQWA 2R3SA 4O2AB 4TS9A 3ZDRA 6YASA 2PMFA 2Q5OA 3PXAA 2CDCA 2WUVA 4J4HA 2XITA 3TI9A 5I01A 4JI3B 1PNRA 3P2KA 5DN9A 1IU9A 1W5EA 1KPHA 4FEYA 1R50A 5K0TA 5EQTA 1IM5A 4UARA 2OCDA 2GFHA 4G4SP 4V0OA 1XN4A 4ZZIA 3GPIA 5CB4B 2FW0A 3HJCA 4WIAA 5HF8A 5CX4A 4RTSA 2OOSA 1URPA 1DAKA 1S0UA 1T5OA 1P44A 2ZUUA 2EZ9A 3C1OA 1E3DA 2YL2A 3I0MA 1WXHA 3GD7A 4KK4A 5C5EA 5G40A 2QM0A 2P6RA 3EZLA 3IMGA 2E85A 3ACCA 4MB6A 1LLFA 3BBPA 3EXAA 1M34B 2WJJA 4FFBA 4WHMA 4XDHA 1C1DA 1T0IA 2HQRA 2ETVA 1H93A 2IYZA 2HZBA 4XEHA 5CK5A 4X1OA 3K0HA 5KU7A 1JU9A 3PU6A 4PINA 5ECDA 1C9DB 5C7YA 5KSWB 4HUTA 1B41A 3H16A 3SZMA 3GMIA 1UXIA 2JJ2A 2WRZA 1SG9A 3OX2A 2KB0A 3H1TA 3U4CA 1XMVA 3L4KA 4RQTA 3DTVD 4UU8A 3A1NA 4MV1A 2XUOA 1U02A 1IWBB 3AF5A 4F4DA 2LR0A 4A36A 3EQZA 1TX4B 3U40A 3M9WA 4BX2A 2J5KA 3F5MA 3LPDA 3UMSA 3EPHA 1YQUA 3KU1A 2E6KA 5KNDA 4WOJA 4EG0A 1W49A 2AHRA 4QBTA 1DUSA 3VR4H 1CUVA 4GVPA 5LP6B 4NYJQ 4ONEA 3ONDA 3VHXA 3KJQA 3U3MA 1LZLA 5IXYA 2ROQA 4ZVTA 1EWKA 1Z13A 2DWUA 4B3JA 1QCDA 3PEFA 5B2EA 1OYWA 2R62A 4Z3KA 4ADSG 3ORHA 5CVVA 1ZN9A 2IXBA 2FWRA 4G25A 4BO3A 4ZPXA 4TKMA 3EC7A 2FGJA 2PSEA 3OX1A 3WYAA 2H1OA 1XKQA 2YVUA 1T5DX 4V3CA 1ZCFA 2ZW9A 3E3OA 1UJBA 1JBEA 4NYIQ 2C07A 2VAWA 4QUHA 3ZBUA 1G21B 2PUGA 3UOAB 5HRAA 3EODA 2PD4A 3JQ7A 5AI8A 1T1SA 4G1EB 3UHPA 5CFPA 2PQ6A 1DRJA 2CXNA 2E5FA 2OV4A 3FOBA 4ZVVA 3TW0A 5HXAA 2PA3A 4ROSA 4FZRA 4H7JA 1CDOA 3OX3A 3TD2A 1TEXA 4JI1B 2VHWA 4RANA 5CEJA 1T2EA 2BF7A 2QGNA 2NVUA 4TXHA 3TQSA 3TLCA 2QB5A 5DLDA 1SRRA 1ADBA 4RHCA 3L8MA 2WB2A 4KPYA 2O5EA 3ADDA 1FRZA 3MAAC 3SFTA 4C7JA 4ZJUA 4D9CA 3F3YA 2EXXA 2ZBGA 3G13A 3C6MA 1MA0A 1C0LA 1QS0A 2J3QA 2G83A 3MJDA 1SG6A 2JHFA 3VKFA 4F1WA 4EY8A 5IZCC 1TVMA 3OKPA 4LK2A 3GF4A 3E5RA 5JTTA 1NT4A 2O2EA 4ZMRA 5JNVA 1I5EA 1ZM3A 2WHPA 4OHMA 1O8CA 2B2NA 3X1DA 4M89A 2PVPA 4Q7MB 4BO0A 5I4IA 3HYRA 2XUHA 1COZA 1SZPA 4GLLA 1W0KA 1JHUA 4NJEB 1H4QA 3W9UA 2OQIA 4EAAA 1OBVA 1BMFA 2OCAA 3DVLA 5JEDA 2FEXA 1VL5A 1C14A 1K7EB 3IO5A 4AMVA 3KVOA 4IMRA 4JJ8A 2GN1A 4AF8A 3GLIA 1E4OA 3F8TA 3VR4D 1XRSB 2Z6QA 3PJGA 1T8TA 2JFQA 3ZGVA 1HZZA 1Y3AA 3QOFA 3AM4A 4Q9DA 2XR1A 5EEHA 3TOCA 5EKDA 3GBSA 1ZWLA 3H1FA 3T3GA 1DAOA 2OB1A 3P7MA 1KSHA 2HLNA 4GZ3A 2CZCA 3KQMA 1TUBB 2ZBQA 3MJFA 3ODPA 2YNMD 5FWAA 1M76A 1EZ4A 1V45E 1U3TA 5IHPA 3E22A 3E0QA 3GRCA 5BNFA 1JF8A 1OB2A 4TKUB 4ZEOA 2WKWA 1SB9A 1SVLA 1ZXBA 5JH7A 4OXYA 1JYFA 1FYWA 1QSGA 3JQBA 4QGFA 4R1OA 3H05A 1CE8B 1X1DA 1E2LA 2COEA 3BDVA 1PJ4A 1UK9A 3IP5A 4Q0MA 4JI6B 5J3JA 2SICE 1IHOA 2VPYA 4OHWA 4BMVA 5FD8A 1GPDG 3CVJA 4IJWA 4CIXA 3W2GA 4MLDA 2YYZA 4FMCF 2Q2QA 1NC3A 1RJEA 3JQQA 3LCVB 3KAKA 1U3DA 4QXOA 1B8UA 5FUMA 4K81B 2AC2A 4EW6A 3BXGA 1FE8A 2XB9A 4Q02A 4BO1A 2FQXA 1IJFA 4Y2PA 4YYZA 3QBVA 5L3ZA 1GNQA 1J8VA 5KQMA 4QPJC 4RDCA 4RVHA 2BDEA 4OPMA 5LDGA 3TCNA 4RGVA 1I9CA 4BRSA 3NBFA 5FTWA 3P0JA 1FVFA 5B58T 4D8TA 2RHCA 3RRXA 1I3CA 2GXQA 3OU7A 1O96B 3T34A 3LFHA 4Z0HO 5FPPA 1SA0B 2JVIA 5DWVA 1YOBA 2HSDA 2OB2A 4R5MA 4G0XA 1JZQA 1PWYE 3MWEA 1NY5A 4UE2A 1OILA 1GNPA 2YDXA 4WBSA 1I3OA 5E7MA 5BVHA 4OJNA 1JLLB 3EE6A 2IHBA 1IBSA 1VKNA 1YDGA 4JUFA 4Q37A 5SYNA 3BGWA 5TPZD 2K6GA 2JD1A 4B3CA 3SYTA 4J6EA 4KNVA 3UA4A 5BR7A 1U7WA 4OLFA 2BW0A 4I1VA 2O14A 1D3AA 1J9EA 1RI5A 2GK3A 3T1QA 3MJEA 4PLWA 1B0PA 3PVZA 2I9PA 4GYYA 4HF7A 4CT4B 4DRZA 2AF4C 2BFFA 2BUBA 2ZGVA 2ZZKA 1HF3A 1IXSB 3DTYA 5FNVB 1YVPA 4AZSA 4BB6A 4NOLA 4NZMA 1SUAA 2IFTA 3P2OA 2EX0A 3BGVA 5AVOA 3VVBA 2QX7A 2X41A 3EN0A 1HURA 2YUIA 3AKEA 4B7ZA 5DM1A 3HO8A 4LQDA 2H9IA 1ZI9A 4PG5A 5GWXA 5ENDA 2I2FA 1YU9A 3MW8A 4FQ5A 4NFYA 2R6DA 2IH2A 3PHIA 4UPEA 2PFKA 3CZ9A 4BQFA 1KXJA 1CP2A 4M49A 3GH1A 1RJ9B 2LD4A 1KEZA 1PVDA 4DUPA 4XIIA 5FXMA 5BO5A 3IBSA 2X9NA 3HBAA 4FFMA 3N2IA 3EVCA 4GC5A 4MX8A 5IU6A 5JSZA 4YCLA 4QTXA 2CJFA 2BGTA 1LV8A 1BFDA 4TMTA 1YJQA 4AJJA 5HYVA 3NVMB 1RI4A 3TSCA 4DC1A 4ZVOA 3PX7A 1W2GA 2FQYA 3IALA 1BMTA 4L07A 3WG9A 3I4FA 5CMLA 3AIIA 2B8NA 3PGLA 2QMEA 4R6WA 1PJRA 3BSFA 4IG4A 1H2RS 1L3IA 1M1UA 1NXWA 1ZOOA 2QRGA 2VUTA 2WV7A 3QU7A 4FGKA 2GPJA 4LMPA 4LYEA 4YQZA 3UJ8A 4ZI7A 1E64A 4DQLA 4QM6A 5A9TA 3NWBA 1RQGA 3K4QA 5CGZA 2XF8A 1V4BA 1WLSA 4EX6A 1LUAA 3CHYA 3VUFA 3I1JA 2XECA 2J1LA 3ZDAA 1TDJA 2WDPA 3QOXA 1QDEA 5U4QA 4Z1MD 4AS2A 1QGAA 2LVBA 3H2KA 1D1QA 1JEYA 1H1TA 2BTQB 1P1CA 1QX3A 3IAHA 2C8KA 2ACWA 4JZYA 2MIIA 3HZRA 1D04A 2J4CA 2HNKA 3JR3A 3F47A 1BS2A 3H5AA 3IH5A 1RWBA 4B6GA 5C46F 5IT0A 3PFNA 2I65A 4LJ6A 4YJ2A 1K66A 1NQAO 1M2VA 3LA8A 5EHQA 5BRNA 3IQXA 4C6RA 4Z5XA 4L3OA 4CL0A 4R51A 3VSBA 4DMHA 1MZPA 4JBGA 5A02A 3QPVA 4CKWB 4IMPA 1U8FO 1WXQA 3D6JA 1L7EA 4DUYB 1ESDA 2TSYB 4M9SA 3T99A 4WLEA 1E3SA 2DP4E 2XYQA 3IUNA 3KQNA 1ZBDA 2YMLA 5CT4A 3G82C 3RU2A 1AXEA 4WLFA 1I2MA 2ISQA 2C2ZA 3UMMA 4J0QA 1KAOA 1Z4KA 2H2IA 4Q1VA 1W5TA 4QGHA 3SHVA 4MVWA 5KHOC 4IX1A 1Y8RB 2RHJA 3FPBA 1D2CA 1W87A 1CEXA 1A5SB 3C5WP 2W37A 3G8CA 1WXEA 5J2UB 1WDLA 4IV8A 1YVRA 2FZGA 4Q47A 5BWMA 1GR0A 2JLQA 2IOFK 2Q50A 1W35A 1DXQA 2WTEA 2QWXA 4DCPA 5HVNA 3FBWA 1KJQA 3B2NA 1TC2A 1WDWB 1B26A 5B30A 1BWRA 1FJXA 1NRJB 1WIWA 2LV8A 5EYPA 4F3TA 1QIFA 2WAXA 2NUPA 3IMCA 3USZA 2WA1A 4C04A 1KORA 2BFBA 5IK2D 1VSQA 2ZJ7A 3O82A 2ZR0A 2Y0EA 1OGIA 3QK7A 1C0EA 4MI9A 3E7FA 5AMXA 3UJDA 3KBBA 1MB2A 5EP2A 3RSSA 4P2GA 4ZARA 4MJ7A 1ZNZA 2FWIA 4XA8A 1JT2A 3DPIA 3IB3A 3WLRA 1F06A 4S3MA 1GTJ1 4JUBA 1R5BA 4GI2A 1MQ9A 2P78A 2PLFA 1SIBE 1NVVQ 1NVFA 3FNBA 4JT8A 3RAFC 1BAPA 3CSDA 2RHLA 4KMOA 4LJAA 3WWDA 2IBSA 3ML1A 3V1MA 2C4TA 3VFDA 4DSUA 3DB2A 3KYIB 2NUTA 4LNHA 4PLPA 4A2QA 3R3JA 5EJ8A 5E4TA 2VYCA 4P08A 4EB6A 1XGKA 2Y4NA 5EIXA 1QFYA 3I2FA 2J6HA 2E0IA 4JLVA 2BHRA 4MUHA 3PLNA 3NCTA 4K6HA 2Z8ZA 1ISMA 4O1HA 3G7NA 1BX0A 3AHJA 1IN1A 3MEQA 1P1RA 5HG0A 1NVWQ 2B92A 3NVAA 1CY0A 1RPJA 4JVMA 2PXXA 4XQ0A 1YBAA