5EFZA

Monoclinic structure of the acetyl esterase mekb
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
347
structure length
347
Chain Sequence
SYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel esterase subfamily with alpha / beta-hydrolase fold suggested by structures of two bacterial enzymes homologous to l-homoserine O-acetyl transferases.
pubmed doi rcsb
source organism Pseudomonas veronii
molecule tags Hydrolase
molecule keywords Homoserine O-acetyltransferase
total genus 132
structure length 347
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5efzA00
3QPAA 1PFQA 1CUBA 2WILA 3G02A 5BV7A 2QXUA 3O9MA 5AKHA 3FYUC 3OC0A 4QDUA 3PI6A 3HLKA 1GPKA 2FJPA 4DMFA 3R3ZA 4OCZA 3HSSA 1MX9A 1CUYA 2GBIA 5HQ3B 3BIWA 1WCYA 1CUDA 1ZI9A 2R8BA 1T2NA 5AOCA 1R9NA 3FWHA 4KRXA 5AP9A 3DNMA 3H2JA 3I2GA 2YYSA 1TCCA 3C6ZA 4IQ4A 3TEJA 2XQFA 1DWOA 4X3CA 2WU3A 3IA2A 4QA9A 1WOMA 4FLFA 3OPMA 2AXEA 2PVSA 3C8DA 5DTJA 1AQLA 1GT6A 3VKFA 4B0PA 1W52X 3BDIA 3HXKA 1QLWA 3MUNA 5A7GA 1U8EA 3JW8A 4BVJA 1IUPA 3I1YA 2V97A 3C8HA 3W9UA 4DSAA 2HFKA 3QMVA 1CQZA 2QUAA 1NU8A 1SC9A 5AKXA 4ARAA 4IH4A 4Y2YA 5EIHA 4J0GA 3STXA 2QKYA 3D2BA 3BE8A 2J3QA 3JYHA 4B7ZA 1UK9A 4P93A 4AXBA 4MJ3A 2ZVDA 4W63A 4U2BA 4DSZA 2WG2A 2XQJA 1N5RA 2E3JA 2PSDA 3VDXA 1SCIA 3D3NA 3F98A 2OCLA 1USWA 1EK2A 1QE3A 4MWTA 4RGYA 3U1TA 4A23A 4AO7A 3PUHA 5AHXA 3IBTA 4QE3A 5LKAA 4U2GA 2WJ3A 3IUJA 5C8ZA 3WKAA 5CXXA 4AN1A 1QOZA 2JGLA 4AQDA 1VXRA 2AJDA 1QIMA 2XQKA 4ZREA 1BEZA 2GBCA 4FBMA 3TGLA 4LYDA 2H9YA 5A7HA 3DD5A 1DWQA 2BJHA 2PKYX 4UHBA 3WIBA 4MQMA 5CXUA 5JD4A 3WIOA 1XQXA 5ESRA 2HA0A 5FXMA 4XVCA 4GI1A 3BDVA 4H7DA 4IO0A 4X71A 3QVMA 1ZGCA 3ANSA 5LKRA 2ECFA 3O4JA 3G9UA 3IURA 4EA6A 3FYUB 4EUSA 2WUDA 4J0HA 1ODTC 2QUBA 1XLUA 3CCBA 2GZSA 2V96A 5LZ4A 2G63A 1KEZA 3AINA 5AM4A 4O08A 2WHRA 2VATA 2JGJA 3GA7A 2AJLI 2HRRA 5T4HA 1N1MA 3V48A 1F0PA 2AJBA 1XZGA 1A8UA 2GBGA 3V1KA 5HCUA 4FTWA 2WSLA 1R1DA 3BXPA 4BYMA 5ISMA 2LIPA 3O4IA 4P08A 2HA5A 5LP1A 1IUOA 3FSGA 1EI9A 1QTRA 5AKYA 5CT4A 1AX9A 3ESAA 4QWMA 1CUEA 2PSHA 5LZ5A 3IB3A 3PF8A 4ZV7A 4KAFA 2XB6A 3AFIA 1UZAA 3WWEA 3WZMA 3BJMA 3WWCA 4Y2JA 3SK0A 3WKDA 4L72A 3R3XA 2ZSHA 4LIPD 1CUXA 5JZ9A 1YR2A 4G5XA 1ZOIA 4MYSA 1ZIYA 3ICVA 5JAHA 3DLTA 2C5FA 5AIAA 4Y2QA 5AKGA 2XDWA 4J7AA 5LZ9A 1WPXA 3E1GA 3H2IA 1F6WA 1CUUA 1QONA 4UBIA 4G8BA 3ZPXA 3AJAA 1YCDA 5AM0A 3H19A 5ALGA 2Z3WA 5LZ8A 1BRTA 1A7UA 2O7RA 2QMQA 2CKMA 2VT7A 3KD2A 3STYA 1JT2A 1RWQA 3F96A 2ONCA 1G42A 1VKHA 4G9GA 5CMLA 4WY8A 4QEKA 1VA4A 2O7VA 4WDQA 5IVKA 2CUTA 2Z8ZA 1YAHA 2WJ4A 4HRYA 4G9EA 1E8MA 4C4XA 4YX9A 2WTNA 1P0MA 4RNCA 2XMCA 1UOQA 4Y7DA 1CLEA 3GZJA 4B80A 1FSSA 1LPMA 2VT6A 1OXMA 1D07A 3C87A 2XMSA 1LBTA 5BWBA 4E11A 3FSGD 4H7IA 1Q83A 1MX1A 1RYYA 5ALNA 3BL8A 4E14A 5ALPA 5D3ZA 5ALMA 3G9ZA 2WFLA 2DSNA 4BZZA 3IIIA 4IHAA 3I2JA 1SFRA 4S0XA 4K6KA 2FUKA 3G0BA 1W76A 2Y2UA 4JYPA 4EY5A 1T4MA 3H2HA 3C70A 1CUAA 3HRHA 4Q3OA 4BBZA 4UHFA 4Y2RA 1ORVA 1MO2A 3E4DA 4KR0A 4BRZA 3SC2A 4BZWA 5ALTA 2CEKA 4H35A 5AI6A 5D7BA 5CH3A 1BU8A 4C01A 4HTAA 3RK4A 3WK6A 3DL4A 4C89A 4J0CA 2IX9A 1ZICA 5IVIA 2RAUA 1VA5A 4CG2A 2JGMA 5FLKA 1QFSA 4KRYA 2HL6A 4G4GA 4B6GA 2QOEA 4G8DA 1SCQA 1RP1A 3FVTA 5KBYA 2ZSIA 5AI9A 1BS9A 3H0CA 5AOAA 4ZV9A 1BE0A 4DM7A 1CFJA 4EY8A 7YASA 3QMMA 1YA4A 2WFZA 1Q0ZA 1MNQA 2OQVA 2BFNA 1ZD2P 3U0VA 1AURA 4BCDA 1XZMA 3ZLVA 4UHHA 1O6GA 3JWEA 2QZPA 3C5VA 4XJVA 4BP8A 3PE6A 3OM8A 3SX4A 2XUIA 5HKBA 2RHTA 1FFEA 3DS8A 3D2AA 4DNFA 3YASA 1DWPA 2W22A 1CUCA 3I2IA 4X92A 2Y6VA 5DYTA 4EHBA 1JMKC 1XZIA 4X90A 1UK6A 1LPNA 2G5TA 5JAPA 1JU4A 4YASA 3HJUA 3N2ZB 4C88A 4Y2VA 2WKWA 5AK4A 2VJCA 1YAJA 4DIUA 1QO9A 5CT6A 4JNCA 4P9NA 2B61A 4W1SA 1XZKA 4XIIA 1THTA 1LZKA 3IULA 4QDZA 3GUUA 2BUCA 4H7KA 2YXPX 1ZGBA 1WPRA 5EIEA 3Q8WA 1H2WA 5JADA 1DQZA 2ROQA 1H2XA 4JYMA 4F5ZA 4B81A 1VE7A 1XZHA 1MAAA 4DMKA 3D59A 1LZLA 1CUGA 4X95A 4BCBA 1JJIA 2HU7A 4WFKA 5JIBA 4YK7A 4Z49A 4K5QA 3AIKA 4X7BA 1U2EA 5ALDA 2JEYA 4B84A 5CH8A 3AUKA 4UFNA 4UHEA 4X97A 4I4CA 5CW2A 4K6GA 2C0QA 3UMJA 2HU8A 1K4YA 3CN7A 5AI0A 1CEXA 1YSCA 5JZSA 3BJRA 3FCXA 3TRDA 5ALXA 1XRLA 3BWXA 3IUMA 4X91A 3AILA 4FNMA 3RM3A 2Z8XA 4Y9SA 3H2KA 3P2MA 1KU6A 4XWGA 3VXKA 1E5TA 4BE4A 4BDTA 4CIBA 5EGNA 3F97A 3B12A 1C7JA 5FPQA 3AZOA 5ALLA 3I6ZA 2ACEA 4B83A 1UT6A 2XMDA 4G1FA 1MT3A 5FDFA 3NWOA 1H2YA 3OOSA 1OCEA 2DQYA 1YASA 2RIPA 2CBGA 2ES4A 5CRIA 2W6CX 2HA3A 2CB9A 2WTMA 2VJDA 2DHDA 4DLNA 5AK5A 3ZLTA 1CUWA 2ACKA 3ZLUA 1GPNA 4AMYA 2WFLB 4KE7A 2QJRA 5JD5A 2I78A 3VJMA 2VSQA 1C4XA 2GYUA 4L9AA 2X5XA 4HVTA 3T52A 2GZRA 1QIGA 3R0VA 5A71A 4WCVA 5DJ5A 1FFAA 1UXOA 3WZLA 2PBLA 1XZDA 3LS2A 3QZUA 2K2QB 3C6BA 4H0CA 4I19A 5EHNA 3K9BA 1WB6A 5AO9A 1MJ5A 1TQHA 4TGLA 5AI4A 5YASA 2P8SA 4UFPA 5DTIA 4ZXFA 5T4BA 2XLCA 4AB1A 4WDRA 4B82A 3OTQA 4C6HA 2RHWA 1JU3A 5EFZA 4DMCA 2WUEA 3G9TA 2QM0A 3GROA 4M0MA 1MPXA 3C45A 3W04A 1QZ3A 2RI6A 1X2EA 5K3FB 4FWBA 4ARBA 4DNQA 3H18A 1QIFA 3LLCA 2O2GA 5CT5A 1CUHA 3GBSA 4AZ0A 4FFVA 2XQGA 1FJ2A 5A2GA 4PNZA 4QWWA 2I3DA 2WIGA 1FFCA 4X6YA 2EEPA 3VJLA 1XRRA 5D6OA 5AKKA 1GGVA 2PSFA 3G9XA 3W05A 1JJBA 2HDWA 1P0IA 4Q82A 4X6UA 5AI5A 3QBJA 4OB7A 4UBNA 3STWA 3ZV7A 4JUIA 3RKSA 2VAVA 1ZD3A 3NOXA 1QIJA 1YB6A 4CG1A 3AZPA 1CUJA 3L1HA 3WKEA 3KSRA 4KE8A 1L7RA 2QXTA 5JANA 5K3CA 1AC5A 5ALVA 2OGTA 1E66A 2QJWA 3MUOA 5AJHA 3L1JA 5ALZA 3BIXA 4EY7A 1BCRA 3AIOA 4J0DA 4PSDA 2H7YA 3MGAA 4GEGA 5JYCA 4JEIA 2X8BA 3I1IA 5HF6A 5I9IA 4OU5A 3O95A 1CIJA 5ALSA 2XUPA 5SYNA 4KAAA 3FAKA 2GBFA 4F0JA 4DNOA 2XMRA 3I2KA 4BTLA 3KWJA 2G4LA 5AH0A 5IKXA 4K6HA 1XZFA 3G0DA 1ACLA 1QTIA 3FBWA 1U65A 4G8CA 1VXOA 2QVBA 4N8EA 2I3ZA 1W75A 5T4FA 1XRNA 4L0CA 5SYMA 1WHTA 2YASA 4HXFB 1Q84A 2YH2A 3EF3A 4AMZA 1CQWA 2WHPA 1N5MA 1XKLA 3DCNA 3WA7A 1PV1A 4OB6A 2DR0A 3S2ZA 1J1IA 2Y2VA 1R3DA 4KE9A 2J3DA 5LLSA 5JAUA 3GELA 4PW0A 1LGYA 3H04A 3WKCA 1UK8A 2XMBA 4WY5A 2WLSA 4UBMA 3X3HA 5IH7A 4BVKA 5ALEA 1XZEA 1HDEA 3LCRA 4FLMA 3WK4A 1CRLA 1K8QA 3I6MA 1DINA 1AKNA 5I8PA 1CPYA 3KDAA 1ZD4A 5K3EA 2XUAA 4J3JA 1XZAA 5C81A 3V1NA 2IIVA 5FRDA 4DNPA 4E46A 4BC1A 3WKBA 4N8DA 5FUMA 5DWDA 4M0FA 1DX4A 4W1PA 2EDCA 5EI5A 3WJ2A 5DNVA 3WWPA 5AI8A 1GQRA 2JF0A 3WWOA 1EDDA 1ZJ5A 5HFAA 1WM1A 1WHSA 5AM2A 1OILA 3D4LA 2XI4A 3IDAA 4W1RA 3FNBA 2DCMA 1DQYA 1K5PA 4UHDA 5EHZA 5ALIA 5A6VA 4GECA 1GPLA 4Y2TA 1X2BA 2FX5A 3HEAA 3HI4A 1H2ZA 3HACA 4ROTA 2PM8A 3FYTA 4HS9A 2Y1KA 5T4EA 3FCYA 2BAGA 2OCIA 2GYVA 1W1IA 3M3DA 1ISPA 5I7UA 4H7HA 5A7FA 2VJBA 5K3BA 1B41A 5JASA 1ZIXA 3V1MA 4DMHA 2WIKA 1E8NA 3HZOA 5AK6A 2OGSA 3T4UA 4D9JA 1VE6A 1VZ2A 4OSEA 1CV2A 1HLGA 4EZIA 1EHYA 3NGMA 2XLBA 2WM2A 4FNGA 4C4YA 5ALFA 2XMGA 2PUJA 1QIDA 3GFFA 1J2EA 5AOBA 1MTZA 1GZ7A 2HIHA 2C4HA 1ORWA 2JIDA 5DNUA 4PO3X 2G5PA 2HA7A 4LKOA 3STUA 5IVHA 3EQ8A 5E4JA 2PSJA 2XUGA 4UHCA 2RGUA 5JATA 2XUJA 2VJAA 5C8VA 1PJAA 4N5IX 4QZVA 4ITVA 2PX6A 4UBOA 4C4ZA 3QM1A 4AO6A 1THGA 4UFOA 4MYDA 3QYJA 2ORYA 5HK8A 2OCKA 4W1QA 3STVA 2XE4A 4CCYB 4X6XA 3D7RA 3ILSA 1EVQA 4WFJA 1CUFA 1LLFA 3HABA 1A88A 2DQZA 2XT0A 3WLAA 2D5LA 1XZLA 2NW6A 5D3KA 3O4HA 1Y7IA 4BAZA 1XQWA 2I03A 3R3YA 3K6KA 1IZ8A 5JALA 4F60A 2CMFA 3DOHA 2HM7A 3W2TA 3LIIA 5AM1A 1W4LA 3WL5A 1UKAA 2WUGA 2J4FA 1M33A 2H1IA 2ZJ7A 2WUFA 5LYYA 2X76A 4A5SA 2O2HA 5ALWA 5JD6A 3A6ZA 4BE9A 3F8SA 1N8SA 3G7NA 5ALUA 4BC0A 4WJLA 2VAXA 3KWFA 3UUFA 5H3HA 3QITA 2AJ8A 3I6YA 3DKKA 4MWSA 5DYWA 4ETWA 2JGKA 1HPLA 2XUOA 4N5HX 4CCYA 1JFRA 1EX9A 1GXSA 3A2MA 4OD0A 1CUZA 4BCCA 1JJFA 1G5FA 4CI9A 3A2LA 3DYIA 2Z5GA 3WA6A 1QIIA 4UBKA 1IZ7A 5KWJA 3DYVA 2DFPA 3ZWQA 5HQ3A 4KYVA 3DDUA 3VJKA 3WK8A 1HQDA 5JZBA 5EHQA 1XRMA 4RE6A 4CG3A 2HA6A 2ZJFA 1TIBA 1MX5A 1EB9A 1VOTA 4KACA 2V98A 1W6RA 1CVLA 3H2GA 3R41A 3FOBA 1MNAA 5ALHA 1MAHA 3FLEA 4N8SA 5ALKA 4DYHA 1XZBA 2B9VA 3S8YA 3O0DA 1UKBA 2OAEA 4B85A 3L1IA 2Y6UA 1GKKA 2XMZA 3H1BA 2HHAA 2O2IA 1LPBB 1UFOA 2PSEA 4GHWA 1EA5A 3EQ9A 2PU5A 1SCKA 5AK3A 1DTEA 1ODCA 3ICWA 4CFSA 2OG1A 2WG0A 4KEAA 4GLBA 4HZGA 4AO8A 3AZQA 4PV7A 4KE6A 3VVLA 2C0PA 3C5WP 3WK9A 5E4YA 1VZ3A 3WL8A 2QRUA 2OCGA 3QPCA 4FFWA 2WFMA 4F21A 1QIKA 3EIOA 3I28A 3R40A 3LP5A 1G4HA 1VJ5A 2HA2A 4OUKX 1F0NA 1EH5A 1EXWA 2JGFA 4A16A 5AKJA 1ZJ4A 2B4KA 5EIAA 1ODSA 1EB8A 1H23A 1QIEA 2H7XA 3QMWA 1R88A 3PFBA 4U2CA 1DU4A 4QDXA 3V1LA 3ZI7A 3NUZA 5C7YA 4CCWA 2OGZA 4I3FA 1JMYA 2C5GA 5CT9A 4MXDA 1R4ZA 1TKRA 3C6YA 3Q0TA 2AJCA 1G66A 1XRQA 3A70A 1X70A 3DKRA 3B3QA 3WJ1A 1UOOA 1E3QA 1EVEA 3O4GA 1J07A 3G0GA 4X85A 5AKIA 2DHEA 5HK9A 3C43A 1VLQA 5AKLA 3DQZA 4IH9A 5FV4A 4UBLA 2BGRA 3VISA 2VF2A 4LXGA 3DL7A 5AM3A 5JAOA 3ESBA 1Z68A 2HRQA 3ESCA 3ED1A 5CH5A 4DTCA 1XZJA 4PQEA 4INZA 4HRXA 4Q05A 3M82A 3WMRA 5DNWA 3H17A 1LPSA 5K5EA 1IUNA 3OURA 5AM5A 1YS2X 3DJYA 1XLWA 1Q0RA 1EK1A 3IVMA 4FBLA 4KAJA 1DX6A 1P0PA 3HC7A 5CT8A 3FVRA 4B0OA 3A2NA 4Y2XA 5DYYA 4BVLA 4CIAA 4JH0A 1F8UA 5ALYA 1BN6A 2QTBA 5ALQA 2HFJA 4DGQA 4RPCA 1UKCA 3PUIA 4NZZA 4H7FA 4Q3LA 4NVRA 2XUDA 4IH1A 1HBJA 2V9ZA 1A8SA 3G0CA 5LZ7A 5LZ2A 1XROA 4LXHA 2XUHA 3WL7A 1TRHA 2PPLA 4K2AA 5KWIA 3STTA 1H22A 4LYEA 4TPKA 3E0XA 2OLEA 1TCAA 3WK5A 3D2CA 2WHQA 5CURA 3N0TA 4AX4A 3FLBA 2PL5A 4H18A 1DT5A 4NMWA 3AIMA 4EBBA 3CN9A 5K3FA 4GXNA 3KXPA 5C8XA 2GYWA 5KREA 5FP0A 3WYDA 4RE5A 1ACJA 4Y2SA 3WYNA 4UUQA 4MEBA 4PSUA 2HU5A 4H7JA 3W9BA 1BN7A 3K2IA 1IVYA 4U2FA 1GQSA 4OPMA 2C58A 3CXUA 3WL6A 3F67A 5HZGA 1LPPA 1A8QA 5CTAA 4J03A 1QJ4A 2WHPB 2JGEA 2HA4A 1QIHA 3G0IA 4W9RA 3M81A 2BUAA 5E4TA 1KU0A 3C6XA 5EHXA 1L7AA 2D0DA 1LPOA 4TVKA 2OAGA 1DT3A 3O9VA 1LBSA 2CZQA 3EQ7A 4Q3KA 1QO7A 4HXGA 1ZI6A 1C7IA 2UZ0A 2XMQA 5HF8A 3PICA 3I2FA 3H1AA 2XUFA 2XQIA 4H77A 1NU6A 3EBLA 4GBGA 5FOQA 1QGED 3D0KA 1AZWA 1WB4A 1LPAB 3FLAA 4Q34A 2CJPA 1UOPA 2J4CA 2BUBA 3I2HA 3VVMA 2VTVA 1AGYA 4QDOA 2B20A 2WQZA 3R3WA 1JKMA 2HADA 4FHZA 2ZYSA 2QR5A 4BAUA 4NS4A 3IUQA 4GW3A 3D5EA 4AN0A 4OB8A 2WIFA 5AKEA 4PF1A 1QFMA 2OQIA 4MEAA 4XX1A 1WB5A 2ZYRA 3RARA 5A62A 1ZI8A 4OYLA 3V9AA 3QPDA 3WI7A 1GKLA 4UPDA 1MU0A 5CBKA 5HKAA 4G4JA 5ALOA 5K3AA 1ZD5A 4FMPA 1FFDA 6YASA 2JEZA 4QDTA 1BROA 4EB0A 2BGNA 5LIPA 1BEEA 1K6EA 1CR6A 2EDAA 5FKJA 4GDMA 5HFNA 5HF5A 1AMNA 3W06A 2Z3ZA 4HXEB 4H7EA 1S8OA 2BKLA 3TJMA 4MQLA 2IITA 4OU4A 1CUSA 4AZ3A 2ZYHA 4U2DA 4ZRDA 4J0KA 3WQHA 4C87A 4FKBA 5AICA 3R3VA 3B5EA 4ZI5A 2BCEA 4BAGA 4KJXA 1R9MA 3PDCA 3PFCA 4BTVA 1XQYA 4Y2UA 3BF8A 5ALJA 4HAIA 1TK3A 5K3DA 1IMJA 2WIDA 2WG1A 1XRPA 4EY4A 5FPPA 1L7QA 1XQVA 4X94A 4Y2PA 1CUIA 1LNSA 4X93A 1O6FA 1Y7HA 1UK7A 2PUHA 3DEAA 4FOLA 2XUKA 4X00A 5AIBA 3MVEA 4EY6A 5DLPA 3E3AA 2ZYIA 1SOMA 2JGIA 1EDBA 4ZWNA 1YS1X 3PF9A 5BOVA 4GWLA 4BRSA 3G8YA 2VA9A 4G4IA 4BP9A 4ZGBA 1HKHA 4QLOA 3ESDA 3UUEA 1XFDA 5ALRA 2H7CA 1YA8A 1J06A 4M0EA 4L3WA 1XLVA 4P92A 4B9EA 1EINA 1B6GA 5F4ZA 3LIPA 2WJ6A 4U2EA 1P0QA 3DOIA 1EDEA 2OXEA 4BDSA 2QT9A 2WIJA 2XUQA 2OPHA 1Y37A 3ANTA 1HL7A 3FYUA 2DHCA 1FFBA 4J0IA 5IVDA 3KOOA 1XKTA 1E8DA 1XZCA 4FDMA 5E2IA 3QH4A 4LXIA 4BB0A 4YPVA 5JARA 2Q0XA 5J3JA 4Q1VA 4B9AA 4WFIA 3F9CA 3WWDA 4J0JA 3IUNA 3WK7A 1ETHA 4OYYA 1E89A 4BATA 3R3UA 2WU4A 4QLAA 1YB7A 2FJ0A 3CCCA 5AKZA 3OG9A 1MN6A 3BF7A 4E15A 2PU7A 1NX9A 5HF9A 2ZJ6A 4V2IA 1TAHA 1UWCA 2C7BA 2R11A 3HYSA 1BCSA 1U4NA 4UBJA 3SWWA 2VEOA 1I6WA 4QNNA 2QS9A 4PSCA 1CUVA 4FLEA 4LHEA 3M83A 1R50A 5BWCA 2JBWA 2VQ6A 3RLIA 1JI3A 1TCBA 1AUOA 2RONA 1K63A
chains in the Genus database with same CATH superfamily
3G1UA 1Z5VA 5H3LA 2BTQA 2SKDA 3G02A 5IC5A 1VJCA 3T7EA 3TJRA 3L7LA 2AOUA 2IYNA 4QDUA 3B1JA 3PI6A 5JO9A 3ZDCA 1CETA 3LU1A 4DMFA 3R3ZA 1CDOA 3NHAA 3V2HA 5DNEA 4DV1B 2CFOA 3FTPA 4S1TA 1TCUA 2BFPA 2N9UA 4P36A 4U63A 5E1BA 5G0SA 3SOPA 3I61A 3DP7A 3ADOA 1E3EA 1MX9A 5TARA 3WOVA 2XDAA 2GBIA 3H65A 3KVRA 2QT1A 3IP8A 3IO5A 1CF4A 1FNSA 5FTNA 2ZP1A 5MN4A 3BA6A 4L8LA 3N2GA 3RC2A 1PI3A 1ZI9A 4P58A 4TMVA 1NW5A 3UH0A 1PR4A 2GERA 2AFHB 2DY0A 3KOZA 4K03A 5AJUA 2GVDC 1D09A 4A2CA 1RQXA 4RKFA 3G2OA 4IJMA 1JI0A 1Z0AA 1BHQ1 3FXAA 2D6FA 5KTPA 5KX5B 1R9NA 2OV6A 3ID6C 4KMRA 1VHTA 1X7XB 4Q37A 3DNMA 3ENNA 2FDXA 3FTDA 3C6ZA 1YCGA 1NMYA 2H65A 3HGQA 3HLTA 1LEHA 3LUDA 4R6WA 3U62A 4G5OA 4IQ4A 2Q5CA 3HUDA 3RV3A 1DWOA 5FI1B 2J0QA 2VDNB 4KQWA 2WU3A 4QA9A 3ZWNA 3BWMA 4LGYA 3ZCSA 5DW3A 3LQKA 4PANA 1ILWA 2VUIB 1A96A 1W0JD 3OPMA 3UXHA 4AY5A 1RBYA 2E5LB 4JELA 3LC1O 1FSFA 1E59A 2IHUA 3HVHA 3IBSA 3C8DA 5BO5A 4JWTA 4P2BA 3USCS 1ECGA 4R7ZA 4PBRA 4HZUA 4KLAA 1XI2A 4WLUA 2FYTA 3EVBA 3ZHUA 3GQVA 1ZJ6A 2ORVA 5DNCA 5HKOA 5KYXB 4CLOB 3EFBA 5EMLA 3ZIAA 2XODA 5LU9A 5CM9C 2R1ZA 5CGZA 1P7CA 1FFHA 1RBQA 1SVIA 3L41A 4YY3B 4WSOA 4ZEXA 3K0KA 5I45A 3HSKA 1U3UA 2GBLA 2R60A 4Q9IA 1XEFA 5F77A 5A7GA 2VXYA 4YI3A 4PIMA 3TQTA 4CR8A 3UZUA 4QGHA 2JAUA 4AZ3B 3I1YA 1J7KA 1LDNA 5IBRA 5ARBA 3BE6A 1JQBA 5JVDB 1NT2A 1TQ8A 2A3NA 1CQIA 1I36A 1X1TA 1Y8QB 2HFKA 2HPVA 2NYVA 1BGVA 1VTKA 4KDRA 5ED0A 1BQ3A 5FUXA 1T6XA 3FG9A 4DJ5X 3L8EA 3OKPA 4PG7A 1ZU5A 1SC9A 2GZDA 2HWKA 5F3DA 5TGDA 4QJIA 3DB1A 3UGQA 1G4UR 4ARAA 1EJBA 2NV0A 3GFPA 4XQ9A 1BYIA 5GONB 1BU5A 2PQMA 3A1UA 3KVOA 2ET6A 1ZZEA 1T91A 3D2BA 1V7QA 1XEXB 3KLBA 4O4JA 5CB4B 2EL9A 4KFTA 4UUOA 1SXQA 1XCOA 2QLBA 3JYHA 5KKAA 4AY6A 3FE2A 1KAHA 4P93A 2GAIA 1IN6A 3IQHX 4O4LF 2D7DA 1POXA 1XD9A 3DHWC 2DECA 4MJ3A 3FMFA 3L4JA 2ZVDA 5J2TF 1G21B 2Q7XA 1WZIA 1E4OA 2Z5VA 1N1GA 4DLRA 2XQJA 2GD1O 3MRSA 1M1UA 4V3BA 4DWVA 2D5CA 4JJFA 4XTRA 3M5PA 4UXIA 1IJBA 1N5RA 1KMCA 3KZMA 3GJTA 1JDPA 3ICPA 2X8WA 5HE8A 5AYVA 5LQMA 3JPWA 2WAOA 1YZ3A 3LP6A 5GAJA 3DFIA 3WP0A 3FJYA 4LDPA 2GA9A 1QE3A 4MWTA 2RKBA 1N78A 2QTAA 3FHLA 3ZHRA 2PV0A 4BP3A 2W7TA 5K0EA 3KYBA 3OPXA 1GPDG 4TS4A 4AO7A 3K94A 3OPNA 2CXTA 2ZIZA 1GL3A 5JHHB 1OFUA 4I55B 4QE3A 5LKAA 2OC4A 3AFHA 1JU9A 2XE8A 3QLUA 1MUUA 1W46A 1L5FA 2WJ3A 4U3JA 2WJGA 2GNOA 4MLZA 3WADA 1JAXA 1V8DA 3IUJA 4HXYA 4D6YA 5LPNA 1RJ9B 5C8ZA 5CXXA 1ECPA 1P1HA 4XD7A 4RKYA 3QP9A 1QOZA 4L7VA 4MDHA 2J3HA 1RHRA 2WJIA 3IAS6 1VXRA 2AJDA 3H5NA 2I33A 5FWAA 4C0QC 4S2UA 1H9AA 4ZREA 3FOWA 4L2IA 3ONNA 3O8DA 5A4AA 3D6NB 2WE8A 1EFVB 3MS4A 3QKSB 1GV0A 2G8LA 2JARA 3KE8A 3ZIDA 5C5DA 4AF8A 2H9YA 2MT9A 5GJBA 2I6QA 4OBEA 3D6VA 4YI5A 1DWQA 2PKYX 3WGUA 4UHBA 4QVIA 3HJGA 2PA3A 2PIAA 3MTAA 1BA2A 3IHTA 4LCBA 4XM2A 5CXUA 5JD4A 3HCRA 4Q4LA 1SUEA 1XQXA 3L8HA 4G1MB 5KNCH 2HA0A 2H06A 2Q8PA 2WSBA 4B32A 4DKXA 1LQTA 4MVCA 5HDQA 3TD6A 2FPPB 1HRKA 4EB3A 4QUDA 4D81A 1QKIA 3UKOA 1UKEA 2DQ4A 2PZ8A 3WLNA 2Q27A 1HL3A 1GFSA 2E49A 3MERA 3DD1A 2CW5A 1SUPA 3G7SA 3O1IC 4FYWA 4FX5A 4NFYA 3W4KA 1NY6A 1MB0A 2QJFA 4OLHA 2PUFA 3B9RA 3KOMA 3D0QA 2EQBA 1TO6A 1D04A 2ZSKA 3BRCA 3DHNA 4J0HA 5DPMA 4DHEA 3B8EA 2C9DA 1M5RA 5GZ3A 1NR1A 2PVCA 2J31A 4FYYA 5EZ6B 5CYGA 4FI3F 2NYUA 1S8FA 4ADSG 2GZSA 4CM7A 3T1HB 5J59A 1UAAA 3MJEA 3HZRA 2D1RA 3IMKA 3OFNA 3D1LA 4K6FA 3PFWO 1XPUA 2VATA 3FLMA 3AONB 2H4XA 3GA7A 5LJLA 2B7BA 5T4HA 3TPZA 3PUJA 4C0LA 2IA5A 1DL5A 2FDRA 1TYEB 2W5UA 3M5WA 4HDNB 1VRVA 4DN6A 4UE6A 4IVRA 1A8UA 3NGLA 4Y9UA 4DARA 1JF8A 1QHEA 2GBGA 3G6KA 2IGTA 3GEIA 1UOEA 2CNKA 5A3SA 4LCJA 2Q2OA 3EVCA 5HTKA 4JITA 2R9VA 4OH1A 2C03A 1W5BA 4N0EA 3PNBA 5ISMA 1DOHA 5EPOA 4F2PA 4I6GA 4DR7B 3I5YA 1YQQA 2VJKA 3WDKA 3IALA 3A3OA 4EECA 2UZAA 3DONA 3KETA 1QTRA 2PDAA 3OP4A 5KYYA 1SRQA 4CKZA 3FKSD 5CT4A 3QWFA 2QMZA 2A5YB 3C1UA 4JL8A 4YGXB 3NT2A 1EWYA 2X2FA 3AFNA 2GM5A 4B8YA 2R7AA 3IB3A 1RXVA 4EF6A 1OXXK 1K2VN 2VUUA 1DEAA 4KAFA 1UZAA 1QCYA 3WWEA 4F9TA 2ICAA 2XZLA 1I3MA 3ZDEA 1RBZA 1D03A 2CXSA 2YV4A 5COBA 2H2FA 1ZHFA 2VRCA 4ESVA 2MINA 2A9KA 4TMWA 3WKDA 4U00A 1JVBA 4L72A 2O1EA 1J2JA 4LIPD 2HN9A 2IYQA 3DGEC 1YR2A 3HYLA 1ZOIA 4G5XA 4WK6A 3T41A 3FSEA 4OJTA 1RXUA 1RM5A 1T36A 4HKTA 4XIJA 4G09A 1E77A 5B6JA 1TUGA 1RAHA 1ZIYA 1FP4B 1GY8A 3FNEA 4BNHA 3LRTA 4YJ3B 5CDTA 1YS7A 1FXUA 3DVQX 1VMIA 3I34X 3GP8A 3K0AB 2HYIC 1OXUA 4YAEA 1TC2A 4Y2QA 1Q15A 1QP8A 3SNKA 3TTYA 5FWXB 3ODPA 2Y76A 3LY7A 3HZZA 1FJHA 2Q6VA 3ZNQA 1FBTA 1G8KA 2ZWPA 1WPXA 1XJ5A 3NT4A 4PX2A 4QUJA 4CM6A 4YPOA 1EFRA 3IAM6 1Z7EA 5B53A 2XYVA 4XXHA 4EFDA 1E2KA 2G09A 1AQYA 3IVGA 4IHJA 4FU0A 4RW0A 4BJ6A 4HQFA 5AXAA 4KDFA 4EW6A 1KJNA 2AKYA 2PZBA 2Z3WA 1BRTA 4JKYA 4TLMB 3X1JA 4TYYA 2OFWA 2QMQA 2ILVA 3AM4A 3PR2B 1RHJA 2RHDA 3RHSA 2LKDA 1IBKB 2C2YA 2V4ZA 1QHHB 1P33A 5BV2P 5GJVC 3STYA 1X9IA 2WNHA 2XJ4A 1QHFA 4NENA 4B7UA 4MVJH 1S8NA 5A5GA 2HO5A 1AA6A 1DE0A 4K9OA 1VKHA 1VSUA 3AERB 2WKRA 1OIVA 2APJA 3U09A 2J5KA 1VI6A 2XRZA 4WDQA 5IHXA 3CVYA 4R7TA 121PA 4HFRA 4L15A 3ND6A 4ED9A 3H6HA 3EPLA 1J8VA 4RGVA 4DB2A 3WGKA 1NVDA 3DPUA 3HDGA 2VP6A 1JDTA 2HQ1A 3L2OB 1WXEA 3RWOA 3SKXA 4BO3A 4F6RA 3K6SA 3W8NA 3DAPA 4C4XA 5FTWA 3IQWA 2O57A 3F6EX 5AD1A 3WGYA 4J1QA 1DDIA 1VJDA 4Q1CA 2XMCA 1NV9A 4GNKA 3WGGA 2Z9DA 3P9PA 4Y7DA 3WO1A 4YR9A 4D98A 4D9KA 3KU1A 3MXOA 3DXYA 3KQWA 4UHKA 4E7OA 1RFGE 2AEFA 1N2GA 3KS9A 4IO1A 4UHJA 4B80A 5A4KA 1E1CA 3S2GA 3I5AA 1BGWA 3CGGA 2POCA 3MB5A 1OXMA 2W93A 3FUCA 2FHSA 4IIHA 1M8PA 5D1NA 3O38A 3P9KA 2XZPA 3PEVA 1WXGA 4G0MA 2PTHA 3C87A 1LBTA 5BWBA 4JBWA 2FW0A 3P2YA 3FSGD 4E11A 2BEWA 1WZUA 4G1CA 1S1MA 1YR3A 1HQYE 2B5VA 3C48A 3HPRA 4RIFA 2EHJA 4YP9A 1H1LB 3K6JA 4KWHA 1JUDA 4JQZA 2JJQA 1BVRA 3FWZA 3PYMA 2Z6QA 2WJPA 1MX1A 4MKZA 4OEHA 3TBHA 3VKUA 3RW9A 1SXJD 3LD9A 4J1TC 3MMZA 4RETA 2IDKA 5KDDA 4W5TA 3J7AC 3KJQA 4V0LA 2XE6A 3KJEA 4LKRA 5D3ZA 1SRRA 2UYOA 3BHNA 5DM70 1G1MA 1Y7PA 2DSNA 4NL4H 3ABOB 1RBMA 3OQJA 5REQA 4CXMA 1OVMA 3HSYA 1M76A 2CBZA 3NB0A 2QEQA 1O8BA 1RJEA 2VNSA 2PQ0A 1AKVA 1G8AA 2JIPA 3D7MA 2QB5A 4FMDF 2G1JA 2D54A 1Y8RA 1Z07A 5DIFA 1DO0A 3DLAA 1MORA 1D8TA 2HYDA 2Y2UA 5ECYA 4I81A 3EGEA 3HP1A 4PN3A 3W2IA 4WAUA 3WE7A 5CDHA 1QUEA 1T4MA 3H2HA 1NURA 3NKVA 1AKYA 1PWHA 2AFIA 2C98A 2DY1A 3HRHA 4HGOA 1IN5A 1DIAA 4Y2RA 4N40A 4DA0A 5BOSA 5CYPA 3PIIA 3HN7A 4HH3C 3AEQA 5IABA 4C7BA 1Q0PA 2J46A 1UP6A 3HY3A 3LPNA 1QH9A 9GPBA 1Y3AA 3RRFA 5D3MA 1EFDN 4ABYA 3LK7A 1IHUA 2Y93A 3KV3O 5WRFA 3ORYA 4PLFA 1OZ0A 3NPAA 2JBHA 5JH7B 2PLNA 4U8GA 3RF7A 3SC2A 2BMWA 2QQ0A 6ADHA 4HPWA 4E03A 4F11A 2A6PA 1OT3A 1X7ZA 3OT1A 1L7XA 4H35A 4XYBA 5LN1A 5IF9A 1K4KA 3NWPA 2WDPA 4L28A 5CH3A 5D7BA 2QENA 1YBFA 4RGBA 5CPFA 5DYIA 5HKKD 2O8CA 2QR3A 3QEOA 3IKTA 1JEOA 3RVKA 3T3GA 1TTHA 3GVCA 2H6EA 4C01A 4PE5B 5CX1B 4RV4A 2ZKIA 3M1LA 1TO2E 3I1JA 1WF3A 5JSKA 1CY2A 5CVTA 3HCFA 4TSRA 4TMYA 3RK4A 4MUJA 2ZZKA 4ALNA 4LF8B 4LWZA 4G85A 1Q7RA 1LLQA 3DL4A 2CY0A 3B13B 1T5IA 3PJDA 3U4IA 4J0CA 4WOJA 4ZQEA 3VYSB 4DR6B 2WMDA 4GX0A 4Y3UA 3KSDO 2BHSA 2MSKA 5DM1A 4BGUA 4B3HA 2BMJA 1QVRA 2JGMA 2Y1XA 1SZJG 4KN8A 4YAGA 5FLKA 5K8VA 2RBGA 3TOSA 1EIWA 1OWOA 1RRMA 4B6GA 1Q92A 1Z15A 1IK4A 3E15A 1YI1A 3ZIAD 1KJWA 1RP1A 2BFFB 2O3QA 3VPCA 5FR2A 5DASA 1XCGB 5DI9A 2OFFA 4MVJE 4BWGA 1BXGB 2F64A 1HORA 2W9XA 1TGVA 1Z8NA 5E1DA 1P9RA 1BS9A 2BFCA 3NX4A 4U6SA 2J5RA 3H0CA 3QX9A 1ADJA 4ZV9A 3T9CA 3KLOA 1VLZA 1QZXA 4XB2A 4KXLA 1L3IA 1KK0A 1E7QA 3CNEA 2NU6A 4DM7A 3A4NA 5AVYA 3IPLA 5IUJC 1SO8A 2X6QA 5D6NA 3ZEIA 1JEEA 3Q0IA 4HNAA 2JRCA 4BL5A 2R00A 1YA4A 2K6GA 1B26A 4B46A 4Q7QA 2GKOA 2OQVA 3OUZA 2P1ZA 4C2BA 2BFNA 4BWFB 3GGCA 2WM9B 2QAIA 4NYIQ 3FVQA 2C82A 3OCJA 1TF5A 3U0VA 5F33A 2BCJQ 3VR4H 1FU8A 2CD7A 5FOWA 1MC4A 4YJ3A 1M1NA 4AJPA 2N47A 3RVMA 4QGSA 4UVEA 4RUKA 1C8KA 1XZMA 4AUEA 2AIRA 3KXDA 4G5HA 4UHHA 3I0NA 4REQB 4JHXA 3FNFA 3AFOA 1DAMA 3AEQB 4IJUA 1BHSA 3GH1A 2HAEA 5LQSA 4ABTA 2W71A 1L4NA 2ZJ1A 2V3CC 4BP8A 1L4EA 2VOJA 4NOMA 3CLUD 5BNZA 2VPPA 1WUKS 4JBYA 4M38A 1TJNA 1XEAA 2XUIA 5A9TA 3ZYZA 4QG3A 1C3JA 4FR5A 2RHTA 2GHTA 4MUGA 3QEAZ 2BM9A 3D2AA 3M9XA 4DXDA 2D1FA 3YASA 3DZJA 2PEYA 1DWPA 1HOTA 2W22A 5B64A 1CUCA 2P4QA 2R96A 1PR3A 1KH3A 3CRRA 4EELA 1QHXA 3KK0A 4C3VA 3T35A 1B6SA 1F2UA 4X92A 1ONBA 3KC2A 5IMBA 3Q3EA 1NVGA 5K0NA 4LMPA 3L8MA 4I1UA 1HA3A 4N39A 4ZCMA 4P33A 4HEA1 1SKUA 4GG1A 2Q5HA 4DG5A 3U40A 2WW8A 4EHBA 4PG8A 1PJSA 1VPWA 4HVAA 4KGZA 5BN5A 4OHYA 4P80A 3TLXA 1MKYA 1AMOA 3VH2A 1YZTA 1OMOA 1XDGA 1PJZA 3CZRA 4DCUA 3HDTA 3OLVA 3G49A 3H11B 4GYWA 2FHPA 1Y5LA 3CLKA 4NZMA 4WKBA 4X90A 4DUPA 4EHIA 1EBFA 1R15A 4NOLA 4AVYA 1UK6A 1VB5A 4F6RB 2G5TA 4WI1A 5L3SA 3IQZA 3COZA 3EMBA 1JU4A 4YASA 4H1VA 4IL5A 1NZDA 1WXWA 5ARDA 1ONNA 1BJRE 1MR3F 2JG3A 1VL1A 3CR3C 3OCVA 3U3ZA 5EJ9A 3WBKA 1GCOA 3FNIA 3DOUA 3UQYS 4XYEA 1G21A 4RK0A 2O6LA 3PGVA 2IEZA 2P4EA 5BY2A 2CV0A 5JWHA 3A2KA 5AK4A 3B2NA 3UW1A 2N1BA 2G80A 2GVNA 5CT6A 3QNMA 1TVCA 4HQNA 4J0EA 4P9NA 3SR4A 3NAQA 4GGOA 2B61A 1O95A 2FCRA 2HT6A 1PJQA 3INRA 4GMXA 4OQEA 3E6AA 1Z34A 3R76A 5ECDA 4D82A 1LZKA 1XKQA 4OH7A 1GAXA 3PC6A 4P8RA 2BUCA 2O50A 4EWLA 4PG6A 2WWVD 3EG5A 2G3YA 1YO6A 2GF9A 3LHKA 4YJ2F 3FWYA 4WOKA 3FIUA 1DPGA 3GFQA 1DLJA 1MV5A 1NVUQ 1SC3A 3M5CA 1RMYA 3Q8WA 4ZICA 3AEYA 1TJYA 2X0NA 1DQZA 1N0UA 2ROQA 3JQ8A 3L6OO 1H2XA 4QAJA 2QLFA 3EYAA 2AG6A 5BN3A 4N0PA 1GVNB 1GGHA 1Z4KA 1MC1A 3HA3A 3SXPA 4RHCA 1M6EX 2FWJA 4I55A 4QX6A 1DKMA 2VXOA 3PNSA 4F5ZA 1IG3A 2ESRA 2RAFA 3UQZA 1S89A 3A9VA 1XZHA 1MAAA 2PS3A 1J0DA 4WZ6A 4E6EA 1FW6A 1K68A 1R6TA 3T54A 4YACA 3DL0A 4FPXA 4R05A 3KZCA 1PJBA 4YS6A 1LZLA 2J3JA 4MQ4A 5FUVA 3QEBZ 3EZ6A 3VX4A 4WLEA 1Z73A 2I34A 3PG5A 4XASA 4YK7A 4Z49A 3GLGE 5JTUA 1A04A 3AIKA 3QU9A 2FEOA 4Q4DA 1SD5A 3FDXA 4DLSA 1ZR4A 1JEYB 2YIMA 3RTEA 3NWEA 3N87A 1DARA 1EU1A 4U9UA 1NYQA 3PFGA 3F6PA 4CV2A 1PX2A 2C84A 4F4IA 4UFNA 4Z4EA 1ZCAA 1IVNA 1J22A 4U02A 2FKNA 3WB0A 1U7HA 2O2CA 1JKJA 5JS7A 3UMJA 2C0QA 2HU8A 3PL1A 3WP1B 1K5GA 3OLWA 4KSYA 1IHOA 5ENZA 1GZSA 2IHTA 1LXCA 1CEXA 3GXOA 3U61B 2O1XA 4QVKA 4UATA 3R7LA 1FRZA 2GN0A 3I4LA 2RK3A 3DFMA 5EMKA 5JZSA 3FCXA 3GZNB 3KXKA 4MV6A 4DABA 3B82A 3BYZA 1E20A 1EZZA 1TYZA 3M6FA 1R0CA 4L7QA 4CKBB 1T4CB 4DQXA 1UPTA 4LJLA 5TVKA 1Z75A 3QTTA 3TBKA 5FEMA 3TMKA 1KI6A 2YUTA 3BD8A 5TE9A 4WJKB 4AKTA 2YCBA 4ACBA 4FNMA 2DUNA 3KQQA 2VPYA 1HT1E 4TT8A 3DZHA 1ZK4A 3C7KA 4QU0A 3RM3A 4R1SA 1WMEA 3ROZA 1WAMA 4P2GA 3DT9A 3P2JA 5BMVA 2EP8A 5I5EA 4ZCLA 3V5NA 4CUKA 3AEUB 4CIBA 3ZGYA 1TZKA 2AQHA 2ZVJA 2VN8A 3GLHB 3GP5A 4M0UA 3FJ1A 3PEWA 4Q9HA 3D54D 4EX7A 2DFDA 3HKEA 3TLYA 2ZUVA 4KQJA 1OB2A 4NBTA 1FB5A 4DQVA 3AVYA 3OY7A 1QYDA 2Y8EA 4X1KA 4DM3A 4LTNA 3ECSA 3ZCXA 3AZOA 3HGTA 1I13A 2GF0A 4CMEC 5BWLA 2DPLA 5A3RA 4FOTA 2FVYA 3U26A 3AOEC 1K8ZB 2P68A 5E6RA 4BJ1A 1SBHA 1X1RA 4ZPXA 4ND6A 3OOSA 1OCEA 4R98A 4ALIA 3WQHA 3CCFA 2ES4A 2H11A 3FB4A 5KQSA 1D6SA 2B5WA 5CRIA 4IYRA 3NNDA 3ONVA 1JDNA 4I5EA 4PZLA 4RIGA 4TMXA 3RVPA 2PQ6A 2ZM6B 2VDVE 4KTTE 4ID9A 2DUWA 3CBQA 2CHQA 4MR9B 1U2GA 2HQOA 4QATA 3VC3A 1VL6A 5HE9A 4PPNA 3RS7A 2J3KA 1EUCB 1Z26A 4DLNA 4LBVA 4FMBB 4XSGA 3CLHA 5KTTA 3FGOA 2ALJA 1AH2A 2OA0A 3S28A 3E7DA 1DAFA 1Q21A 4PFSA 2ACKA 1RWWA 2RH8A 1DLIA 3WNQA 1UBHS 2A7QA 1V41E 2V9PA 3JYPA 2ONKA 1JHPA 3EXIB 3LGSA 3MT9A 3NYQA 3HJCA 4AMYA 1BDMA 1A9ZA 4B3CA 4REMA 1EVJA 3P2OA 4C08A 4IJKA 4RS4A 4HWPA 4RVGA 3Q2IA 1EXVA 3F7NA 3M1AA 2I78A 3RU3A 3VJMA 2H1VA 2RBKA 2R5FA 2ZUDA 3B3JA 3BIJA 3IDFA 3A58B 4JVOA 3DA8A 5DTEA 4E5PA 1L7OA 5TRTA 4L9AA 3LO8A 2X5XA 2I54A 1V6AA 1U7ZA 2FPKA 3T52A 3VVBA 2FSFA 2O2YA 3CQ9A 4EUFA 1IG0A 4F71A 1Z6TA 2ST1A 5CITA 4WCVA 3HVJA 4JLOA 4TV9B 2YXLA 3L6RA 4RIHA 5IXYA 4O5OA 3JWGA 3HKDB 1UXOA 3LHFA 4G23A 4R69A 3NFRA 5BR8B 4GSYA 2A1TR 4I14A 3ISTA 2HCBA 3PYLA 5JE8A 1P7VA 2ZSAA 3KO8A 4C7XA 3U44A 3QPUA 2YFKA 4C1BA 5BN1A 5CIWA 3H83A 2FWMX 2BZSA 2K2QB 2WPNA 4H0CA 4I5IA 4I19A 5TS3A 4F8EA 2ZAOA 1RPTA 2P2YA 3T34A 1EGAA 5LOVB 3ZI0A 5FHQA 3T0FA 2M6LA 5AO9A 1EFUA 3H97A 3N6RA 1NYTA 4IIJB 2OOSA 4H08A 2W2XA 1X3LA 4IGIA 3E5NA 3QE2A 4MVJA 5E6SB 3SZRA 3A05A 3MS7A 3JZMA 1RAEA 5K99A 4TGLA 1V11A 1QBKC 3LK6A 4JZYA 4K81B 3DTNA 2ZROA 3OHSX 1GGNA 5EJ7A 1DJLA 2OL4A 3HKCA 3EJWA 4ZARA 5G40A 1D2AA 1UBRS 4YMHA 2PGAA 4FFPA 2I5PO 2REQA 2B6HA 2F1JA 1L7MA 2V59A 1STOA 1N6OA 1E5DA 1KMMA 3V3TA 4BX8A 5JMWA 3CC8A 3DWFA 4AB1A 4WDRA 4ASUA 4B82A 2W6OA 4W9NA 4C6HA 2V6FA 4YONB 4L16A 2RHWA 3GAAA 2GCPA 4QT0A 3I01M 1JU3A 3C98A 5EFZA 2WUEA 4PSAA 2BBWA 1BA3A 3EAFA 3GROA 3NV9A 4L9SA 4H3KB 4LDNA 3RU7A 1J0EA 2QTHA 1E1QD 2VNHA 4INOA 3ZDFA 4BUZA 4HNVA 2O59A 1BO6A 3ADPA 3MMPA 4U7GA 1QZ3A 1JECA 4QGBA 5C37A 4G26A 2WT4A 2A35A 2ZB8A 3GPDG 1SVLA 4FGJA 4I1RA 2YR0A 3NIDB 4JXZA 1C50A 4KC0A 2JGDA 2B3TA 5GM2A 2AMYA 3WRVA 3KZ1E 5I7SA 3AETB 3BB3A 4EYKA 5LMCA 1NNSA 5TS2A 2LDBA 2H4YA 4X54A 5TB5A 5BNFA 2ID4A 1SNYA 4GC9A 1ZR2A 1QH1B 4Z6KA 1YIDA 3UB4A 4OA8A 4AZ0A 4FFVA 1ZD9A 3VYTB 5F51A 5ADHA 1Z0DA 2D59A 2VLIA 1TK9A 4J16A 1M2EA 1GU7A 4OQFA 3TAXA 5BUZA 4I4TF 1PZNA 2JFHA 1T6NA 5FB3A 3RTDA 3EA5A 2GF2A 3OIWA 1R64A 4I8XA 1A5BB 2NG1A 3DO6A 4K1XA 2Q62A 2XA2A 3BXFA 1G21E 1HDRA 2OC9A 2XNDD 3B7WA 5EZYB 3HUEA 4LF7B 1O94A 2OSBA 4GF5A 3BZUA 4A8JB 5DISB 3GGJA 3VGJA 3G9XA 3Q5EA 3JQBA 3IOMA 2HDWA 4QGFA 4TQUS 4OQDA 4JJ7A 4ZVOA 4MWGA 2Y1EA 3ZVNA 4X6UA 2W6ZA 1XTQA 1QHSA 4H6WA 4I0WB 1T3TA 2VTKA 4RD3A 5ARCA 1SCNE 2I22A 2DMRA 3ONWA 4OB7A 4JODA 2HHHB 2EARA 3GJRA 1ADFA 5CIQA 2REXB 1R74A 5ERYA 1KI1A 4L4ZA 1NG1A 5TT0A 4DF3A 1TE2A 3STWA 1JH8A 5KU1A 4CKWB 2DRIA 1FDUA 3BFJA 3GFSA 2VAVA 4E0BA 3U4QA 3U81A 2OCPA 3ETLA 1D5WA 3K15A 4P5EA 2GPYA 2VXCA 3OY2A 4WZBB 1YB6A 4C5BA 2LKCA 4P7BA 1BMQA 3NM6B 3L84A 1SHLA 3IO3A 1JDVA 2QIOA 4ETMA 1RRGA 3ORFA 5FBQB 1AQUA 1JG2A 4L9WA 3NCHA 2IEAA 4IFTA 3WKEA 1S2MA 1O5OA 4E4YA 2M9MA 2WWWA 3AVWA 4EGSA 2E2WA 3HP7A 1Q77A 3NH9A 2OO5C 4G5YA 3EDCA 5E6UB 5INTA 3IAEA 4FEYA 4E33A 5IKEA 2QJWA 1XP5A 3GGOA 4O4JB 5AJHA 3L1JA 1I1HA 4EPVA 4M1OA 1W85B 5EXSA 1JSRA 3BIXA 2GJAA 5DM0A 5KC9A 2B25A 2JNWA 4MP6A 2NO7A 3TEFA 4AYWA 1GZVA 4GE3A 3AR2A 3QFTA 4KXWA 3JVIA 3FCEA 1OC2A 3VYVA 1CZLA 3BMNA 1F4PA 4YUVA 2O3RA 1TA0A 4JC4A 3EGDB 3HG7A 1F2TA 4JI3B 4F56A 1DFIA 1KJJA 3KQYA 4C14A 3WNCA 4TKUB 1T13A 5GY7A 3THWB 1B2RA 1T2CA 4MYTA 4KQ6A 4BQQA 1F3LA 2J4DA 4CR6A 1BW9B 2G76A 3MHTA 2CYAA 3I1IA 3VHXA 1JH9A 2OZEA 1PNRA 3IJ5A 3FTFA 4NZ9A 4LF9B 3DMFA 2KBEA 4AKIA 4NJEB 3O95A 1CJVC 4U7PB 4DAOA 4KLZA 2EZUA 4NBUA 1O2DA 2GBFA 2KWIA 3BILA 4B43A 4BQPA 4Z7QB 1HETA 4R84A 4QYWA 4DNOA 1WNFA 2BP7A 4A10A 1DQSA 3S1SA 2IPNA 3FWNA 4MVJF 1Y6FA 2AK2A 1U2RA 1FCJA 4QGGA 3KWJA 1C4KA 2EFHB 3BM5A 4CEIB 1NVBA 1AGNA 1Q1BA 2P9ZA 5AH0A 4YT8A 1FP7A 1NJ2A 1ENOA 4ALMA 1FXWA 2XEDA 2IKQA 4K6HA 2Z0MA 3K09A 4OHWA 5LD2C 1QTIA 1XT6A 4Q03A 1Z6PA 4LOAA 4G8CA 3L18A 4P4GA 4V0SA 2BBOA 3MMXA 3PLRA 3RC3A 3SDBA 1Y8AA 4IUDS 1N1EA 2BI8A 4N8EA 3TWOA 3NATA 4BLOA 5GVSA 4JJIA 2D2IA 4A15A 4IG9A 2YMPA 1O3YA 3OLQA 4D56A 4XDGA 4M99A 3IA7A 3MFQA 1XRNA 4OGGA 1WHTA 4RIIA 4HXFB 5AXDA 2YH2A 3KKEA 2H4ZA 5LNK6 4DG9A 1CQWA 3NTUA 4TMTA 4MW2A 4H3VA 1NBOA 5K03A 1T1RA 3ILXA 4OB6A 2FWAA 1I6KA 3IJEB 1O97C 2XWPA 3N2GB 4ROSA 3SFVA 2CD9A 4RD1A 4B6QA 4E2ZA 2P90A 1J1IA 2J0EA 4ZD6A 2X0EA 5IBPA 5LLSA 3O2NA 4I36A 3EZ2A 3TX6A 1M1ZA 1WSWA 5FI3A 3IL2A 4LF5B 2I2AA 3KXLA 5BNTA 4O2AA 2QJTA 4ENQA 3ELYA 5EKUA 2YVQA 3M4YA 3L77A 3QOXA 3S2FA 3H04A 3M5DA 3OC6A 2PH5A 4RF2A 4ME6A 3BRSA 3OAAD 4OL9A 3WDMA 2IZ0A 3BBPA 1HE5A 4EZEA 3C3XA 2F6RA 2HMUA 2O8CB 4GPBA 2XNKA 1PHRA 2J9XB 5A2QA 1YRHA 3X3HA 1BTOA 4JENA 2RAPA 5KHLB 3FWKA 4WCDA 2IUSA 4BVKA 5GGXA 1JDZA 4TSKA 3TZ6A 1HDEA 1WPGA 2I8LA 2QMOA 3LCRA 4FLMA 1MRNA 4WRRA 2YZ2A 3UUGA 3WK4A 3RRYA 1IVSA 1WQ3A 2J30A 2CV2A 1PTJA 4DWOA 2WICA 3EHEA 4F91B 1N2XA 2QLTA 5AJTA 3LGAA 1CJUC 2XCLA 5CDYA 1MQ8B 1QH0A 3H4TA 2XDQB 3A14A 3MT8A 1AUVA 1G2QA 2LV8A 3NKFA 2AXNA 4PFKA 2VPIA 4WADA 1D2GA 1XDDA 1ZMXA 1CPYA 3LQFA 4HDSA 4W7HA 1T5SA 3KDAA 2BFFA 2YXEA 3QNUA 5A4FS 2F55A 3HFRA 5BRNA 4RJLA 1FFXB 1CQXA 2AE2A 5C81A 4QHYA 2IIVA 2HOQA 2J3LA 5LB2A 4OMFG 3I92A 2HK8A 1QRUA 1EEXB 2ATVA 2IEIA 5F9MA 3ES9A 4MUAA 5JZMA 1YCFA 2CNLA 1QNLA 4N8DA 2GAAA 1UBEA 3PVSA 4C7OB 2YNMC 2H2IA 4W1PA 1E4EB 5DLEA 4D0SA 4RVSA 5JOQA 3BGVA 4GBJA 3HUFA 1N3BA 3CONA 2HTEA 3WWPA 2KX7A 4BXOA 4R2HA 1P73A 4HEA6 2XIJA 1AN0A 4JGGA 1E2NA 2JAHA 1EDDA 2X77A 4FJ0A 3KWLA 1IQ0A 1NOIA 3ZWVA 1P31A 1XVVA 1WM1A 2Z1MA 4X8LA 3GJ8A 1IH8A 1OILA 3D4LA 4NYJQ 4B7XA 3PKZA 4REQA 1ELOA 1BDIA 5FBZA 3HNPA 4D0LB 1J0BA 1PFYA 3QU5A 2ZTMA 3ZBQA 1KHTA 2DCMA 3TKYA 2K2WA 4DPKA 3KB6A 4HLCA 4UCWA 4UHDA 5EHZA 3NPMA 4INJA 4Y6PA 1E9AA 3HA5A 5H4HA 1YIOA 1M34E 5T67A 1U0TA 4JP8A 1FQWA 1A97A 3PLAE 5A4JA 3WLSA 3C3CA 1X2BA 1TEVA 1YDHA 1TA4A 1JG4A 2GD0A 3CJRA 3GUCA 3HEAA 3IKLA 2UUBB 1RQPA 3LI2A 4PHTA 4ROTA 1EVIA 2PM8A 2I6GA 3R75A 5KNDA 4K46A 3GAMA 1L7BA 2YV2A 4NU5A 5IBQA 4BEVA 3FCYA 1N5JA 2A9QA 1G3MA 2BAGA 5FBHA 3DULA 4IZHA 1W1IA 3M3DA 1OZFA 1OROA 4BRSA 2GAFA 3OIUA 3K9GA 1EVKA 2QUKA 4Z7NB 5E7JA 2HRZA 5BN5B 1XWIA 4NBNA 1P18A 5JCZA 2Q6TA 3MCTA 3WTBA 2GZ2A 3P7MA 4WN9B 5I7UA 1G5TA 2NZYA 1VE3A 4H7HA 4JLNA 4RF5A 3R7WB 2HCJB 1Q1NA 1RJGA 3ZD9A 5A7FA 4IJQA 1C3VA 3T3EA 3TLAA 1J1ZA 4J91A 4WT7A 3V1MA 1WBBA 5JSZB 4R71A 4YJGA 1GYPA 1SCUB 4O5AA 5LIRA 2W8ZA 2BD0A 1HNNA 1N6IA 4RTMA 2DPHA 4NEHB 4QARA 1JQDA 1NL3A 4XQCA 4D9JA 4ZV4A 1U8CB 3ZLJA 4FYPA 2XHZA 1E2MA 4P32A 4XYGA 2RB5A 3RVSA 5IS2A 4OLJA 1CV2A 4ALLA 1Y9ZA 2ISQA 3PC4A 1HLGA 1SCDA 5CNMA 2DQKA 4NCHA 4JI0B 1U7WA 2GB4A 1SQ5A 1ZVMA 1HZZA 2OUIA 5CFLA 1U0OC 3V7YA 1U6KA 2V0CA 2UZ4A 1U0BB 2XMGA 2QRQA 1W44A 3GFFA 5J23A 1FLNA 5JAMA 3IXMA 1WO8A 2FB9A 4ICIA 4KMSA 1IQPA 1MTZA 1RKQA 3UOWA 2HIHA 2BSAA 2JCVA 4FGSA 4KLNA 3CPSA 3QKIA 1PR5A 3HV0A 3V1TC 4ZAVA 2QBYB 2UAGA 1B0ZA 5TMDA 1O89A 1P60A 2BFDA 1Q20A 2PD4A 1ZOOA 4M8IA 2NUAB 3SD7A 2IRWA 4YRBA 5KDOA 2L82A 2Y1CA 4RBNA 3STUA 1PZMA 1FUIA 3QXGA 1KKLA 3KSUA 3M3PA 1WMSA 4EGFA 2DC1A 2DHRA 2VWPA 5E4JA 2OVBA 3WY9A 4CEJB 3ISVA 1J6UA 4F4UA 4CL8A 2ZS9A 1KPGA 1U9IC 4G37A 4NBKA 4UHCA 3TSWA 5ITWA 3LQ2A 1CJTC 3F49S 5JATA 4XTCS 1DRVA 3AU8A 2FEKA 1O0SA 1QG0A 1DAHA 1SKYB 1QVZA 1ULSA 4FBGA 4KO3S 3T15A 3VSEA 5DEOA 1M2OB 2LTAA 1W6UA 2YWEA 2YWBA 3U80A 4ASUD 1PL7A 2JJYA 4IZOA 2QI9F 4C4ZA 1NE7A 1EE1A 1Y8RB 4TKMA 4YCNA 3ICCA 3HR8A 1R7RA 3W5HA 3OJEA 3NHJA 2BLLA 2Z2KA 1EVYA 1YD7A 4GBMA 4GSKA 1GTMA 1XHLA 5AWFC 2CCJA 1T1JA 1MGPA 4ZANA 4FHGA 4FUQA 4YUZA 3QYJA 2ORYA 5EJMA 1NN3A 2HV9A 1SZDA 3A9CA 1A7JA 1T10A 1U0NA 1FEZA 2QTTA 4LVOA 1G20A 5FBKA 4CETA 1NQWA 2JRLA 3RTBA 3ILSA 1GT91 1ZIPA 2PX8A 3AT1A 4R9RA 2DTDA 1SKYE 1NNI1 3GJZA 2DBYA 1XCBA 2GN4A 2L42A 2QLMA 2W2QA 4AIIA 4TTRA 4QBFA 2MWMA 1MD9A 2XCQA 3BQ9A 3NRJA 3QOFA 1C9YA 1TMGE 3EOBI 2Z8YA 1A88A 3SS7X 1T25A 4LJ9A 2WABA 1LSUA 5TQ2A 3VH1A 2YKGA 2BR4A 4HO1X 1QRSA 1L4YA 3M6XA 1K7FB 9ATCA 5F4BA 3LO5A 5C8YA 1XZLA 3GT7A 1GRQA 1Q1GA 4NX2A 1CP2A 3VZRA 1K3FA 3N2YA 1FDRA 2X0JA 4UPVA 3RYFA 3W0LB 5L4NA 2O48X 2OE2A 4ZXPA 1LDYA 3OPQA 4DC1A 1XQWA 4KIUA 4NE9A 4DMRA 2BFWA 3AX6A 4GOJA 4AMUA 1O58A 4QJ3A 5B1EA 2I03A 1XD2A 1J97A 3K6KA 1V1MA 3UCFA 1FYEA 1XQ1A 3LV8A 1KK2A 3PXEA 4WV3A 5J2TB 3BJEA 4BP1A 3A06A 4XSHA 3OT5A 1PT5A 1IYZA 4E7PA 2CMFA 4BLRA 4OHBA 4DV6B 1F8YA 1P1IA 1TFRA 1TVKA 2W6NA 1L5WA 1URPA 5DULA 1YCHA 1K8XB 4JDUA 1T8RA 4ND3A 1Z4IA 4HSGA 3W2TA 4CN8A 3SSOA 3VNAA 5IHPA 3LIIA 1JDBC 1AUPA 1EWVA 3MTQA 3TN7A 5IZCA 1OV4A 2VOEA 4IFIA 3W1VA 2H4FA 1Q7GA 5KAMA 3WO0A 2ZYDA 2V7EA 4D92A 1FJXA 3RADC 4CKYA 2WUFA 4DCOA 4KZKA 3CZ5A 4A6EA 1D0VA 1XLTA 1VI2A 4JEHA 4J3FA 3AETA 4A5SA 5C4IA 1Z2EA 2GGSA 1W5EA 2PMFA 1XCJA 3E9YA 3G7NA 1T1IA 2VPQA 3RFXA 4XEUA 2Q8QA 5D00A 3IAS1 5ALUA 4F3NA 2YZMA 1ND6A 3TQFA 4DQKA 4MA5A 3I8OA 4O8ZA 4JVSB 3VTZA 2C5LA 2VAXA 4R4JA 5KNBA 2JANA 2QTWB 1BMFD 2ETVA 1DAEA 4Y18A 1ZGAA 4AF7A 5K45A 3HVIA 1KDOA 3AVVA 1P91A 1NLYA 1NOKA 1QYIA 2FSHA 3I45A 4ZO7A 3NMUF 2PR2A 3GU3A 4L8GA 1ZQ9A 3PEEA 1MGOA 3E48A 3OTOB 2BRUA 2JGKA 2PXXA 5EZYF 3NS7A 1U90A 5C32A 3FM9A 4NF2A 1T2DA 1SVWA 3E2PA 4WUTA 2BE7A 4DJJA 2YZ7A 2FPUA 3UV7A 3QBDA 2NUPB 4ETNA 2C1ZA 4OD0A 5F12A 3TLGB 1NJ1A 2QV0A 3U4AA 3ZW8A 2EAUA 4CQNA 3FD8A 3MWDA 2O5RA 3ZDQA 2ZE5A 1G5FA 3WSVA 2AYYA 4N9WA 4EQ6B 1LSSA 4ER3A 3IDOA 3LPAA 1OYVA 2GYYA 2VWGA 3P9YA 2QRZA 3DYVA 3LW8A 3CX8A 5AW1A 2ZJ0A 3ZWQA 1DC6A 1NIJA 4BWYA 7MDHA 3PGA1 4KYVA 4EMSA 2B35A 2WINI 4UOZA 3G3EA 3EQ2A 3HQ4O 4YJ2A 3W4JA 3ZGOA 3VDMA 4XR9A 4EI2A 3WK8A 1LJLA 2QTGA 4BZQA 5EHQA 4CLXA 5B58T 1UDWA 4QQFA 1F7VA 4CT5A 1NQUA 1PJ2A 1NUSA 1S3FA 1RWXA 1BE8A 2HA6A 2J3MA 2JCXA 3A4TA 1I1QB 2YIJA 2ZBGA 3F3YA 3I39X 4YWJA 2NU9A 4DIOA 3T5PA 2BEUB 3TB4A 2VUTA 3D3EA 1RLJA 3I5UA 4GAEA 4ENSA 3GVXA 3MCUA 3RGWS 5CFZA 4KACA 1KY4A 4ARUA 1MB2A 1UMDB 5DLDA 1T34A 1VCHA 1XXHE 3SZUA 2X8LA 1CVLA 3TNYA 4CGZA 3VOAA 1R8JA 1E1YA 2ZJAA 4BQEA 1CEQA 3EGVA 4EQZA 3R41A 5BPFA 3E8MA 5D01A 1MNAA 1NTRA 2HPZA 2V7GA 3OX2A 1R5BA 1ISSA 1MAHA 2HY7A 3SBOA 4EVIA 1JTVA 4F7DA 2IYEA 3CPJB 3KB2A 4O59O 2R7LA 4K7JA 1XZBA 2B9VA 1VBNA 5FUYA 1GTRA 2R3SA 2WMYA 3E3MA 3O8OB 4MWEA 2EW1A 1DXQA 4O2RA 1GRVA 1RYEA 4NMLA 4P53A 3RHZA 4FR2A 1FVOA 3KZNA 4D0RA 4XQ0A 4BO0A 1PZGA 3X2EA 1K06A 2PWBA 3K2QA 4MX8A 3DF9A 3L3BA 3ZLBA 3KR9A 1AHPA 1LPBB 2ZIXA 5FJJA 4CTKA 3OWHA 4YRPA 2P6NA 1JDSA 1I7NA 5LYJB 3O84A 2IW3A 2ZYUX 1EA5A 2ZYVX 2ZYTX 4O3FA 4J7CA 2HMAA 3ZGNA 4TYWA 1HSZA 2G71A 2RBEA 1PU2A 1NVVR 1OOEA 1XPRA 2PMKA 4L8VA 4TXMA 2RGYA 3MM4A 4I7EA 2IT1A 3A25A 3R3SA 3SE0A 2BKXA 3NYWA 4CFSA 3MRVA 1Z2NX 4N7JA 4FFRA 4M8KA 4I3GA 4F38A 2XNCA 2C1EA 2PZFA 3DZ8A 1NFQA 5JC1A 3BGOS 3NM4A 3BTSA 2AN1A 4PV7A 3ZW7A 2ZT8A 2A0YA 1KDRA 2C9MA 3Q85A 4KE6A 4LOJA 3VVLA 2Z6AA 3A1TA 1GAEO 3PZRA 2BEUA 3DV0B 1KOLA 5E4YA 2UXDB 2VIIA 2EZ4A 2DH6A 1TM2A 4FYVA 3RIGA 3RYIA 4ZIRA 3QPCA 1GYRA 2RG1A 4FFWA 1L1FA 2WFMA 3ORSA 3N07A 1ZK3A 2QAGA 1QIKA 2QXYA 3DMPA 3EIOA 3I28A 3R40A 4WBNA 3A1FA 1HC7A 3DDCA 3LP5A 4NP6A 1Q2UA 1UC9A 3QENA 1MO5A 3QXXA 3PVZA 4UXHA 4QSHA 3AV0B 2AT1A 5CVVA 3P0IA 3U2QA 4C0XA 3JD0A 3MTEA 4Q66C 3NQ41 3RYHA 1L3BA 4D41A 3G85A 4IF6A 4I1PA 4UVGA 3RVOA 3THYB 1P9OA 5M29A 1PGNA 1XDZA 4YGYA 1S5PA 2H7XA 1EB8A 1H23A 2HWWA 3QMWA 5BT8A 3OE7D 4A26A 3BXOA 5BURA 3T3DA 4KQKA 1AKUA 2HLPA 3GW8A 5HKLA 3U49A 1SUWA 4BMOB 3MELA 4ITRC 3HCBA 5H70A 4JLWA 3NUZA 5C7YA 1W8IA 5JNRA 5DM2A 3L8DA 2NO1A 4GS5A 4I3FA 4IDDA 5CK5A 5TIIA 3LVRE 1JMYA 1T8WA 4MLCA 4L27A 4E5NA 1CNFA 3OH8A 1EVZA 1L0BA 3Q0TA 3QKTA 1G66A 4QFCA 1CQPA 1XRQA 1NE2A 3KZVA 3WHKA 2Q21A 2JFPA 3A70A 3NNSA 2WZCA 1P8AA 1QAMA 1UOOA 1X9HA 2XNDA 3E81A 3O2QB 1TKCA 1EVEA 3O4GA 4TUYA 3G0GA 5LD2B 2FZ5A 1ORHA 2R7KA 1T4DA 2AFHA 1QGDA 4RPLA 4EY3A 1XMVA 3LCMA 3TAHA 5DYNA 4XPIB 2R47A 3C7TA 4IOMA 2VJMB 5TXGA 1CU1A 2ZIFA 3DHYA 2RGDA 1II0A 3L4BC 4X1IA 3B2EA 2BI7A 3CGWA 1VHDA 4IH9A 4OFBA 1BFUA 3T3IA 3MJFA 4HLUA 2PGDA 3K32A 3TW8A 2HT1A 1Z08A 2I91A 3AHDA 1NR7A 2WKSA 2G67A 2OO3A 2QRNA 1RAFA 2VF2A 3FCCA 2PGXA 1ULBA 3MJCA 4W5OA 3C5HA 3ESBA 5ES3A 4Q7JB 1KMIY 1PL6A 4DB4A 2NACA 3ED1A 5CH5A 3EVDA 2O3UA 2JHAA 4J76A 4A8PA 1GCGA 4GI7A 3UY4A 4EB6A 5J2TA 1R0SA 1U3WA 4KXXA 3ROEA 1Z5NA 4D3DA 4ZDIA 2FSPA 1KARA 2RGAA 3GP3A 4QNRA 1BQ4A 4C0JA 1U80A 3TZBA 1U7XA 2Q3LA 3CRMA 5UKDA 4IFBA 4LGCA 4HRXA 4PVCA 3GLFE 3JD1A 4OO3A 3NBKA 4HZUB 3PX7A 4DREA 1FF9A 4M54A 1L5GB 3T61A 5KINB 2W42A 1QC5B 4A03A 1ZOSA 1RWMA 2Q5QA 3RBZA 4CL2A 1NVAA 2NVBA 1MO4A 2DLCX 4KPEC 5TPWB 1AQ6A 1W4CA 5DNWA 5J58A 2RHCA 4MZXA 3UANA 1W9HA 3LLSA 2GK7A 3SM3A 3EVGA 4EA9A 1VI5A 1QFZA 4K86A 5EUQB 4YA6A 3AESA 1PVOA 3PJFA 4V1CA 3TECE 1G8GA 1H0KA 3I4CA 3KP1A 1R0ZA 4HRVA 3IAFA 5BORA 4D25A 3P94A 4WKGA 5EVJA 4RZQA 1U4SA 5T6BA 1H0HA 5DLYA 4BNKA 5BQ3A 4KMOA 4K9PA 3RABA 1C7ZA 1N8KA 3HC7A 3HL4A 4UM8B 2H2DA 4NJMA 5CCXA 1RVV1 3MWJA 4B0OA 5EJ8A 3ZHCA 1JKIA 3PU6A 3JZFA 3TYXA 1KMQA 2D2VA 2VZ9A 1CLUA 4R0MA 3VAZA 4Y9RA 3UFXB 2E7ZA 4CIAA 1YFKA 4FMCF 4BJ3A 2CE7A 3O5AA 4PONA 3RRNA 1WW3A 4AURA 4F3CA 3OKCA 1DC7A 3BREA 3D6JA 5A06A 1E1RD 1VHLA 3GJ5A 2DT8A 2PEZA 2VDMB 3IUSA 3ZHXA 3WMEA 4EKIA 3PUXA 4HV4A 3KL2A 4V03A 1CF9A 4JR1A 4E09A 1L4KA 4M2LA 3DHVA 3F9IA 3GB9A 3CXRA 4H4EA 2GCOB 1PGOA 3PUIA 4JI5B 1EUZA 1HE4A 2YFYA 3FPJA 2IV7A 1M2JA 3CW2A 3G82C 1FQOA 1Y1LA 2VTDA 3KFVA 4QJ4A 2VPXA 4F6LA 2B1QA 2AS0A 4YP0A 5EINA 4HT3B 5DYGA 3ITDA 2BI4A 1G38A 2QPTA 4N0DA 4DIEA 4LZJA 1CCWA 3CBGA 2X2EA 4IH1A 1G41A 1HBJA 1MAWA 2FUG6 1RTKA 2QDXA 2H0AA 1X1SA 2BN4A 2OGUA 3OFKA 4OV6B 1JN0A 1W5TA 1M6VA 5D5HA 1ML4A 5IZ4A 3LVFO 4EF4A 2YYZA 3FUXA 2XUHA 3GJ4A 1K66A 4GH5A 1TRHA 2KE5A 4K2AA 4US0R 1Z4MA 1EFLA 5TGZA 1UC4B 4MJLA 1FLDA 1OFHA 3L7YA 4UUNA 2RE8A 2JAXA 2QGNA 3KZXA 4EMTA 3BDAA 1XNGA 1PVDA 2YV5A 3D6FA 2HJ9A 4YUYA 5FF9A 3GV0A 4WJZA 4ZVSA 1ZKDA 4W6ZA 4M37A 1I2BA 5H5JA 3ZGLA 3E0XA 2HF2A 1LBEA 2IYWA 2XECA 3N0XA 4NV3A 1IXSB 2JFZA 3WGMA 3WK5A 5DP1A 1FVXA 3PD0A 3LWDA 4AYXA 1DFGA 3D2CA 4I8DA 3M4NA 2YW2A 3N53A 4N5DA 1S7CA 4OTZA 4GPAA 3SZ3A 4LYJA 5TQJA 2O5CA 3DUFA 5E3JA 5HGXA 4F2WA 5BN4A 3C1TA 2Y3IA 3GARA 3HB9A 1MA0A 2R5NA 3N8HA 5JWOA 3AG5A 4M36A 4BNZA 5EIWA 2JKZA 3EH2A 4ZOEA 4EBBA 2COEA 4BJ5A 3OQ1A 4PAQA 4YQYA 2ZIWB 4NATA 5GTDA 5HYVA 2AC4A 4GKJB 3WDLA 1XAGA 1V2HE 4EJSA 4UOQA 1PGQA 3ZX5A 4BFYA 3VKWA 2V55B 1TMOA 1K8RA 3QQPA 4G5SA 4XUGB 1R6XA 2XGSA 3SJUA 3KT0A 5H0IA 1D7OA 2QSJA 2YJGA 1WX1A 1ACJA 1K7CA 1M2HA 2WD7B 3AJEA 2WP8J 4CMKA 3WJ7A 2ZRHA 4ID3A 1P2BA 4QXMA 3U3MA 4OAPA 3MFYA 5BSTA 4H7JA 1QGUA 2OKGA 3EE6A 2SCUB 3L4EA 3MLBA 2B8WA 5KSZA 3K2IA 3NBQA 1YRLA 2GSDA 1C2TA 4TXNA 1UUFA 2ECOA 1E6EA 1YMUA 4OXKA 1N2IA 2XUZA 4S1VA 4U2FA 4B6OA 1TQ6A 4E1VA 2R6HA 3COJA 5JXWA 1MVLA 4OPMA 5DBFA 3HU1A 1RQNA 3W8RA 4HGQA 2BFEA 3QVLA 4Q1AA 3ZWKA 2WR8A 3NETA 4FC7A 3WL6A 2VHWA 2FWIA 2ZCUA 2ZJ3A 3C24A 2XCSB 1VM6A 3HXTA 2KJQA 2RHBA 4PLZA 4MQEA 1QDUA 1KIAA 2G9VA 3LHSA 3KYDB 3AKDA 2IY8A 3B5JA 3KSZO 3TE7A 4F84A 1UMBB 5CTAA 3KJHA 1NIPA 1V9LA 1VE5A 1X7GA 3G8DA 3PQ3A 2VI5A 2W43A 4HQ0A 3U16A 1Y0BA 2Y27A 3DBRB 1GPWB 1N3YA 2QVYX 2WHPB 1GLVA 4HBGA 4WVLA 4XA8A 2WTUA 1QIHA 1VJRA 2ACVA 3FX2A 1QHYA 4D80A 4EI9A 3RSLA 3C2QA 2O3TA 2YOHA 4LG1A 3PT5A 4L0DA 3TINA 5JSZA 4RDHA 3OKAA 4W9RA 3PEUA 2F2TA 2BUAA 5LQAA 1VIDA 3QNWA 4ATNA 5E4TA 2QL5A 3PCTA 1PT9A 1VYUA 4IMRA 4HJXA 2DAPA 4MGIR 1P29A 5EHXA 2YJ5A 4RVDA 4TVKA 4K9LA 3OE5A 3L92A 2Q49A 2W2KB 2XGGA 4BRWA 3OQNA 3FR8A 3TIVA 4LMRA 2CZQA 3DDWA 3EX7C 2DWCA 2JH9A 4QUHA 4BVFA 4IG4A 4LPKA 3O92A 1P4RA 5JWRA 5BSHA 1TB4A 4URWR 4CV3A 2OM6A 2AF3C 4IXNA 4PCUA 5DBOA 4B3SB 3WYAA 1O0BA 2GK6A 2FPGA 2IZ1A 2C9OA 2EJCA 3BFPA 3IKVA 4CHTA 3THYA 1N2BA 1PEDA 2G9NA 3QUQA 3T7CA 1SU4A 3PNKA 4NKRA 1XO1A 5MF6A 2ZWMA 3SKYA 4D9BA 3AEKB 1EJ2A 2XV1A 3EBLA 4RABA 1ZCJA 3CG4A 2IYXA 2Q1UA 1M1NB 3ZXSA 1QZZA 3FUUA 5J1TB 3U37A 3H7IA 2C5BA 3SF8A 4PWZA 3I2HA 4UNIA 3VVMA 3MILA 1K92A 2VTVA 3EGIA 5FHRA 3SSAA 5CDSA 3RO7A 4B6EA 3M6WA 2WQZA 3C4JA 3ON5A 1Z4JA 4MLPA 3LZDA 4F46A 1V3VA 2WU8A 3DV0A 3KYDA 3OSZA 5BQXA 4YDHB 1Y4DE 1W581 1A98A 3F6BX 4TKUA 2AX4A 2P9BA 2YWFA 3RK0A 3WIVA 1UC5B 3R1IA 5T7BA 3CIFA 2UVQA 1RLUA 5GJCA 1VKRA 1RQGA 3PDHA 1EHIA 2CHFA 3LXMA 3RTCA 4F96A 2O8VA 3AKEA 3FTCA 4PF1A 1WCIA 2R8OA 3GFVA 2G4VA 4H15A 3RU2A 3KSMA 3PXXA 4B6PA 4HGZA 1JFFB 3GLGA 4LJKA 1D4OA 2P30A 2P3OA 3DTYA 4M8LA 4O4IF 1TTTA 3IV9A 4X7PA 5DIZA 2V5AA 2VNIA 1AO3A 1KVRA 3I0ZA 5CLQA 2GJKA 4UUAA 1OBHA 1THMA 1S0UA 3V9AA 7REQB 3G5TA 1GKLA 2QP3A 3L4SO 1PT6A 2C3OA 1CE8A 4GLOA 3RG8A 4KYIB 1QU2A 4NBVA 5JYDA 4YQEA 3EXIA 4IILA 1NDQA 2IYLD 1QF9A 5K3AA 3U5TA 1OU0A 1UDRA 3DBLA 1UT8A 2CFSA 3EH1A 1L5KA 1AS2A 2PSSA 4YHHB 1GTSA 2HNBA 3D4BA 3EG9A 4I2VA 5BR7A 1RJFA 4O4LA 1PWYE 1V16A 3NEYA 2HK9A 1BEEA 1TU0A 3MCZA 2DM6A 4JIGA 2BTEA 3Q9UA 3GT0A 3RAFC 5TPWA 5HFNA 5TJHA 1VE1A 1KEWA 1WBJB 1CERA 3W06A 1SZCA 1HY3A 1VQ1A 1AMUA 1JB9A 1SD1A 1ND5A 1B16A 3D3QA 1N5DA 2WNIA 4H7EA 4KQGA 1S8OA 1KS9A 4V0MA 4BVEA 1H6DA 3NNNA 3BK7A 3P0JA 4UNNA 4XFDA 3UBMA 3UTDA 1LV7A 2C7PA 1KDYA 2QK4A 3E0QA 3AF5A 2DUJA 2Z2JA 3K1AA 2C59A 4LK3A 3UHFA 1QRDA 1U99A 3FCOA 1Z39A 2MU1A 1GDHA 5KYYB 5F9FA 1CQIB 1GADO 1QFXA 1Y8QA 2WYVA 3IGFA 3KB8A 4FKBA 1F0KA 2XCIA 1S4MA 2QX6A 1LLDA 2BCEA 5BN4B 4K9NA 4L4YA 4DSOA 3PDCA 2PJUA 5AVKA 5EXPA 1MC5A 2L69A 3TL3A 2GASA 2NQTA 4BTVA 4GR9A 4F2GA 3WR5A 4ARIA 2EVWX 4IJ6A 1VHJA 4JNKA 2ADMA 2Q4RA 4HQKA 1W34A 1A8PA 4ZT3A 4UMFA 4WEQA 4EL0A 1YTLA 4K28A 3PA6A 1GTL1 1I5EA 1S96A 2LE0A 1YFZA 2AG8A 2R7NA 1N0VC 4FP9A 2H18A 3NLLA 1GG8A 4HGRA 4TSFA 5D2CA 4MS3B 3CZCA 4EUHA 1OAKA 1TK3A 3V32A 1UPCA 5K3DA 3THRA 3VO1A 2BMVA 1IE3A 4EIWA 5L51A 4Z4IA 4YAOA 2YVUA 4MV0A 1M3SA 4MUBA 4JZKA 2X2PA 1PWEA 2M1XA 3BERA 5FPPA 1RZ3A 3V6MA 3QVGA 2YVKA 2IZOA 5I4IA 4N76A 3ANXA 1M2WA 1M6HA 3V4SA 2IS2A 3RJMA 2O1SA 3PD1A 3QLJA 3EQ6A 3WYGA 3KCQA 4BLTA 2E1PA 5HXAA 1NC1A 1N7JA 4TTIA 4TTJA 1IHXA 1PFKA 2RGGA 3VC2A 4D7AA 1B23P 1UK7A 3C7DB 1GNPA 2A78A 1VCOA 2ZR0A 4R8RA 5EMMA 1M34B 1M1XB 2HIAA 3KM0A 4OG2A 4X00A 3RS3A 1D1SA 2AMVA 4RO0A 1JR2A 1Z0UA 2H5JA 4LX8A 3VKVA 4EY6A 2W0SA 2W6QA 5KVSA 1UDCA 4JR0A 4B34A 1YKGA 4GLLA 5LP6F 1ICEA 3QYFA 5BSRA 3KWMA 4HX5A 1BGXT 1EDBA 1L7NA 1NZJA 1YS1X 2PD6A 4R1TA 4ZWNA 3KQNA 2EKPA 1K0UA 3ND8A 4HX9A 2FGJA 2C61A 3RQSA 1NGSA 1YL6A 4NBSA 4RLQA 4QXOA 1G6Q1 1ESMA 2FEMA 3GPCA 3G8YA 3PCRB 4D99A 3AERA 4ZGBA 4WD3A 3UUEA 1A77A 2ZVQX 3UWOA 1W0KA 5ALRA 3ODGA 1TM5E 4MB0A 5HPYB 3ROTA 1YA8A 2E9SA 4KP7A 1RPAA 1PJ4A 1BMDA 4MR8B 4CM9A 2ZT5A 1XLVA 3I73A 4L3WA 4N6GA 3J81A 4XWTA 4BO8A 4IDHA 3EODA 3NBYC 4HEHA 1KWGA 1JIIA 5FAXA 3SMVA 4RCYA 1ZA2A 3TPFA 1FMCA 2OHHA 4CIDA 1SOVA 2HCFA 2X8AA 3ADCA 1XAIA 1D2HA 2CK3A 1MQSA 4BKPA 3LIPA 3QWHA 4YRQA 5EQDA 4U2EA 5LA6B 2AEEA 3U9LA 3P2KA 2PT6A 1EFAA 1TQ4A 1TT5B 3GG2A 4Q18A 3CU5A 2WIJA 2OPHA 4RORA 1G9SA 4FDVA 1E7RA 1BDJA 4P3PA 2V45A 4REOA 3VR6D 2YS7A 3GCZA 3TSCA 1I24A 2VDLB 2VHYA 1V7CA 1VKNA 4FNOA 2R6GA 3TZQA 4CT0A 3KOOA 1Z5PA 1RZVA 2CGEA 1J9ZA 1ID1A 2XITA 1RE1A 2BPOA 3F4KA 4JL6A 5E0OA 1B8NA 1ZSYA 2B4YA 3BB4A 3T5TA 2AN5A 3ILVA 3ORRA 4XM1A 2CNBA 2D74A 1DQPA 4ZQCB 5J3JA 1UANA 4TV8F 4Q1VA 4RELA 2V65A 4YWHA 3RAJA 1CVRA 2CSUA 1PIWA 4WFIA 1OAAA 1E5QA 3VV2A 5A9RA 3IUNA 4OK5A 2WWXA 4V3CA