5EFZA

Monoclinic structure of the acetyl esterase mekb
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
347
structure length
347
Chain Sequence
SYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine O-acetyltransferase
publication title A novel esterase subfamily with alpha / beta-hydrolase fold suggested by structures of two bacterial enzymes homologous to l-homoserine O-acetyl transferases.
pubmed doi rcsb
source organism Pseudomonas veronii
molecule tags Hydrolase
total genus 132
structure length 347
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5efzA00
2V98A 4W1QA 3AZPA 1N5RA 2WU4A 5HFNA 2PU7A 3PDCA 4G5XA 3C70A 1ORWA 2HL6A 1NX9A 2DHDA 5HKAA 3WZLA 4J0JA 2HU8A 1JMYA 3R3XA 3MUOA 4Y2JA 4WY8A 4QE3A 3FBWA 3WK4A 3ESCA 1XFDA 3DL7A 4J3JA 4UBLA 1SOMA 1BRTA 1MJ5A 1UK9A 5H3HA 2FX5A 2X5XA 1ODSA 4S0XA 1DWOA 3ZPXA 5ISMA 4W9RA 5C8VA 2RHWA 3WKBA 4GW3A 4Y2QA 5A62A 1WB5A 5AOBA 4QDOA 1PV1A 3ZV7A 4KE9A 1ISPA 1XZCA 1ACJA 1JJBA 4C4YA 5AKGA 1CR6A 2HU5A 2XQGA 1MO2A 3D0KA 2GBFA 3F97A 4J0DA 1D07A 1F0NA 1R9NA 1UKAA 4UPDA 2XUAA 1T4MA 1SCIA 2OCLA 5D3ZA 1QIHA 3IBTA 2XLCA 4RPCA 2JGLA 5FRDA 1ZD3A 4X00A 4MWTA 4KYVA 4DSAA 5K3FB 3OURA 1U4NA 1Q0ZA 2ZYIA 4Y2TA 3ZWQA 3HLKA 1UKCA 4AX4A 3CCCA 4RGYA 4JNCA 5JARA 3ANTA 4AO8A 2ACEA 4DIUA 1QIMA 2WU3A 1TRHA 5AKLA 4UFPA 5HKBA 1P0QA 3K6KA 4DMCA 1ZJ5A 2GBCA 4X7BA 3F67A 3D7RA 1YS2X 2WJ3A 1DQYA 3T52A 3BDVA 3S8YA 1EINA 4HXFB 3O4JA 1XZLA 2H7XA 5CT6A 3A2MA 1A8UA 4X6UA 1CUGA 1QIEA 3WL8A 1UT6A 3VDXA 2CMFA 1BU8A 2R11A 2XUOA 4QEKA 2XT0A 2ES4A 1K6EA 5AK4A 1A8SA 1CPYA 1XLUA 1RP1A 3DNMA 2XQKA 4LYEA 4BVKA 4PF1A 4UHHA 1WPXA 3QPAA 5CXUA 1AC5A 4Q34A 4PQEA 1ZI9A 3G0CA 3R3VA 4X3CA 3GA7A 4BRZA 1W1IA 1KU6A 1YS1X 2C5GA 5EHQA 2ZSHA 2K2QB 3WK7A 2R8BA 2OG1A 3I6YA 3G0DA 3PUHA 3QMVA 4MQLA 4UFOA 1O6FA 5ALDA 1EK1A 3EQ7A 4J0CA 4IQ4A 2ONCA 4GWLA 5KWIA 4DMHA 2XMZA 4ITVA 3G7NA 4E15A 4MQMA 3E1GA 4CIAA 3PUIA 3BWXA 3STXA 1DTEA 2AJCA 2IIVA 1QIFA 1QOZA 2H7CA 1S8OA 4Y2XA 1VKHA 1ETHA 3IIIA 1XZGA 1H2YA 1YAHA 2PVSA 5AKZA 5E4JA 4C88A 5JATA 1W4LA 1USWA 2YXPX 4F0JA 4KACA 4J0HA 1GQRA 4FBMA 5LKRA 3SC2A 3DL4A 4G9GA 2ZYRA 3WJ2A 1TK3A 1XZBA 1QJ4A 4UBNA 5JD5A 3IUNA 4Y2SA 1UOPA 3JYHA 4JUIA 1CUXA 3DLTA 2XB6A 3IA2A 4XIIA 5DTIA 4C89A 5JZ9A 1YB7A 5IKXA 3HACA 4W1PA 2BGNA 5AIAA 5JAUA 3L1HA 4FFVA 4Q3LA 3KDAA 2UZ0A 4UBMA 1J1IA 3H0CA 5I8PA 3H2JA 3PI6A 2VJDA 4JEIA 4KEAA 2X76A 4CCYB 3G02A 5DNWA 1NU8A 3UMJA 4B7ZA 3ESDA 1QONA 1H2WA 1DT3A 5JD4A 1K5PA 2JGEA 4BYMA 5ALRA 3DQZA 5EIEA 5JZSA 1R4ZA 2H9YA 3Q0TA 1ZIYA 1VA5A 4IHAA 1J07A 1HKHA 1WB4A 2OCIA 1CQWA 3FCYA 3WYNA 4EY8A 3GFFA 4GECA 4U2CA 1K63A 4OB7A 3RK4A 5CURA 2PL5A 5HF8A 4BTVA 3C6YA 2WFLA 4P9NA 1K8QA 4DSZA 3KWJA 2LIPA 2WSLA 1GKLA 4LIPD 4U2BA 3BF8A 1H2XA 4KRYA 5T4BA 3UUFA 2XUQA 2HRRA 5BWBA 2Z8ZA 2WJ4A 4C87A 1VA4A 3BE8A 3H2KA 3W04A 5ALNA 2V96A 4H7IA 4WDRA 4N8EA 2C7BA 2OGZA 1FFBA 5CH8A 4EZIA 3AILA 5FKJA 2FJPA 2HA7A 4Q05A 3G0IA 2O7RA 1ZIXA 2HA0A 2P8SA 1N1MA 4QDZA 2OQVA 4H7KA 1EH5A 3PFCA 2QZPA 1R3DA 5EFZA 2HA5A 4B0PA 2DCMA 5JANA 2G5PA 1XROA 4FDMA 1GPKA 3BJRA 2IX9A 5AKYA 1C7JA 2HADA 1CUUA 1QO9A 1VOTA 3QPDA 1PFQA 4X94A 4CCYA 3NGMA 3R41A 5AI0A 5ALKA 2H7YA 3PFBA 4FHZA 1F0PA 1DU4A 3QM1A 1XRNA 3FWHA 4EA6A 4K2AA 2BGRA 2VSQA 5CBKA 1UWCA 5HF9A 3OG9A 2EDCA 2WHPB 5A6VA 3HABA 3R3ZA 5EGNA 5HQ3A 5JALA 5JZBA 1EVEA 1CV2A 5C7YA 2QXUA 5JD6A 3O4HA 1EI9A 3EQ8A 3FVRA 4B9AA 1W6RA 2C58A 3F96A 5AM4A 2J4FA 3HXKA 4E46A 3WA6A 3JWEA 3FSGA 3FLBA 1C4XA 4QNNA 4DNFA 3GUUA 3O4IA 4DLNA 5DNUA 1AURA 4EUSA 1E8NA 3WL7A 3ED1A 4HXGA 3C6BA 3I2GA 2O7VA 2W22A 3DOIA 5A7HA 3ICWA 3I1YA 4DYHA 2C0PA 4QDUA 4WY5A 4BC1A 2PSJA 4H18A 1XQXA 3STUA 4PNZA 4BZZA 3FNBA 4UHFA 5AI4A 3ZI7A 4U2DA 2FJ0A 4GEGA 1Y7HA 5AI5A 1BROA 1EX9A 2XMRA 4DNQA 2VQ6A 1XQYA 1P0PA 1YR2A 5T4HA 4FTWA 4AO7A 4D9JA 4HRXA 2XUIA 3BJMA 3WI7A 5LIPA 2XLBA 3LLCA 5IVIA 2PSFA 1YA8A 2HA4A 4CI9A 2RI6A 3ESAA 3FAKA 5EHZA 1LZLA 4X71A 1XLVA 3D5EA 3WWDA 3FLEA 5K3EA 4H7EA 4OCZA 3LS2A 2QOEA 1O6GA 1WB6A 2DHCA 4RNCA 4TGLA 5AKIA 4QZVA 2XUPA 4MEBA 1I6WA 3OC0A 1U2EA 3RM3A 5ALUA 4OD0A 4G8BA 2HA2A 5A7FA 2GZSA 2WHRA 2PX6A 3IUJA 1YSCA 2C0QA 4YX9A 4B81A 3EBLA 2QRUA 3LIIA 2HFKA 2OGTA 1SFRA 2Z5GA 3C43A 2DQZA 3U1TA 1UK8A 5EI5A 4JH0A 3D59A 3W9BA 4OSEA 1H23A 2JBWA 5DYTA 1EK2A 4G8DA 5CT5A 3WL5A 3DYIA 5D6OA 5AM5A 2HIHA 3KD2A 5AM2A 3VXKA 3HI4A 1QIKA 1QE3A 2XQFA 2ZVDA 1PJAA 3A6ZA 2WHQA 1R88A 2OAGA 2WUFA 3CXUA 1ODTC 1KU0A 4B84A 4YK7A 3WKEA 5C8ZA 4W63A 1JT2A 2WIGA 3U0VA 5DYYA 4JYPA 3FYUC 2WKWA 4IH9A 2QUBA 3VISA 2XDWA 2HRQA 1FFCA 4A5SA 5ALZA 3I1IA 2WG1A 1G42A 2RGUA 1H22A 2VJBA 3WKDA 3H19A 3G8YA 3QPCA 4ZRDA 4L9AA 4ZXFA 1UFOA 5A2GA 3CN7A 1MTZA 4FBLA 3C5WP 1CUCA 4G4GA 4HXEB 2RONA 3AIOA 5YASA 3G0BA 4FMPA 4FNMA 2PSHA 4E14A 2QS9A 3M81A 5ALEA 2PM8A 1TQHA 3D2CA 4HTAA 2XI4A 1TCAA 3I2JA 4V2IA 1L7QA 4Y2RA 5FV4A 2OGSA 2OPHA 2GBIA 1EDDA 1G4HA 3WJ1A 4YPVA 2CKMA 5LKAA 1ZI8A 2JF0A 3L1IA 7YASA 1R50A 3VVMA 3NUZA 1UZAA 1XZIA 3WKCA 1QGED 2I03A 4IH1A 4BAZA 3I6ZA 1A8QA 1CFJA 2PKYX 4J0KA 1FSSA 3EQ9A 5AHXA 1EHYA 4H7DA 3DKKA 1GPLA 1JJIA 1JU4A 3WIOA 4PSDA 1VE6A 1X2EA 5JAHA 3WIBA 4C4XA 1XQWA 1LPOA 5K3CA 4K6HA 1HPLA 1IUNA 3WWEA 4AXBA 4PO3X 3V1LA 3AINA 1IVYA 1LPMA 1UKBA 3AZOA 4ZREA 4QDTA 5ALGA 4ARBA 1VJ5A 5IH7A 3F9CA 4B80A 2DR0A 5JAOA 2WIFA 4CG1A 1TCBA 4OYYA 5C8XA 1SCQA 2JEYA 1B41A 3KWFA 2WJ6A 1CUJA 3TJMA 1ZGBA 4OUKX 3SK0A 4FOLA 4BB0A 2WFLB 3O4GA 4CCWA 1SC9A 2GYVA 2VTVA 2ZYSA 4BE9A 3RARA 4GHWA 3QYJA 3IB3A 3M82A 1MAHA 3LCRA 2X8BA 3H17A 3DS8A 1EXWA 2GYUA 2RIPA 1UK7A 3QMWA 1NU6A 2W6CX 2WUGA 1RYYA 2WIJA 2AJDA 5E4TA 4C6HA 2XE4A 3T4UA 1LPSA 3Q8WA 4H0CA 3G9UA 5LZ2A 4H7HA 1FFDA 2B20A 1R1DA 2AJBA 4OPMA 4NZZA 1MNAA 5KBYA 1LLFA 2XMCA 3WQHA 2Y2VA 1EDEA 2AJ8A 5CH5A 4B85A 4W1RA 1CLEA 2VA9A 2WILA 2XUJA 4UHCA 4LYDA 3DDUA 1IUPA 4EY7A 3H04A 3O9VA 4Y7DA 5AM3A 3CCBA 3DOHA 3DEAA 4EY5A 4C01A 1DX4A 4F60A 4QLOA 2CJPA 3OPMA 1LNSA 5BOVA 3V48A 4MEAA 5SYMA 2J3DA 1GT6A 1E3QA 1GKKA 4FWBA 3DCNA 5JIBA 4P93A 1AZWA 4HS9A 3A2NA 4DGQA 3TGLA 5HF5A 4BVJA 2XUDA 5HQ3B 5D7BA 3L1JA 3WK8A 3VKFA 1AMNA 1JKMA 4UBJA 2JGMA 3DD5A 1M33A 1XZJA 1ZD5A 3WK6A 3HYSA 4FLFA 2RAUA 3V1KA 1E89A 5FPPA 4MYSA 1TCCA 4A23A 4KRXA 1QIDA 3GELA 3GBSA 3LIPA 2J4CA 5DYWA 4Y2YA 3FYUA 2WQZA 4GLBA 1XRQA 2QMQA 4X93A 4AB1A 3H2GA 1E8DA 1CUHA 2QKYA 5DNVA 3D2BA 3QBJA 5AO9A 5K3BA 4BATA 1GQSA 2QVBA 3TRDA 3ZLUA 4ZV9A 1J06A 5LP1A 3W06A 1QIIA 2WG2A 3HJUA 1THTA 2ROQA 4U2FA 1THGA 5AOAA 3QH4A 1VZ3A 1MX9A 2Q0XA 3E3AA 3PF8A 1YA4A 1K4YA 4BZWA 4AQDA 4G4JA 3NOXA 2OLEA 1A88A 2CBGA 4LXGA 4BC0A 1ZI6A 3KSRA 4BP9A 1RWQA 4AMZA 4LKOA 4WDQA 1JMKC 2Y6VA 5JYCA 3ILSA 5HFAA 2DSNA 3H2HA 5AKHA 5K5EA 4QDXA 3TEJA 1MAAA 3K2IA 5AH0A 3HRHA 3I2FA 1QTIA 4LXHA 2HDWA 4HVTA 1VXOA 1VZ2A 1JJFA 4INZA 1MN6A 3I28A 4F5ZA 4ROTA 5FLKA 4C4ZA 1IMJA 2XMSA 3V1MA 4IH4A 1W76A 1LBSA 5D3KA 4DMKA 2C5FA 4BCCA 5BV7A 3O0DA 1CUVA 1FFAA 1G66A 1Y37A 4X97A 2PSDA 1CUYA 2D5LA 1CUDA 5AI9A 3ZLVA 3QITA 3C5VA 3G9XA 2Y6UA 4CFSA 4G1FA 3VJLA 4UBOA 1LPAB 3AIKA 1TKRA 4BE4A 2HA6A 4Q82A 4P08A 2VATA 3A70A 1OXMA 4AZ3A 2GZRA 5AI8A 3WYDA 5AP9A 1Q83A 2BCEA 4WFIA 2I78A 3R3YA 4QLAA 5I7UA 4PSCA 1R9MA 1QFSA 1VLQA 3MVEA 4O08A 3QVMA 4AN0A 3AZQA 4NVRA 4WJLA 4M0FA 1LZKA 1MU0A 4J0GA 4EHBA 1XRLA 4TVKA 2Z3WA 4F21A 1HDEA 5KWJA 5ALFA 1UXOA 1XZKA 5AKKA 4X95A 2I3DA 5AM1A 1VE7A 5EHNA 1E8MA 3VJKA 2CZQA 4LXIA 1W75A 1XZMA 1XZDA 5HF6A 3WK5A 4UFNA 4P92A 5FPQA 2XUFA 4Y2VA 4U2EA 5CH3A 1FJ2A 4BRSA 2QT9A 5DTJA 3BIWA 3G0GA 4W1SA 2OCGA 4B9EA 4CG3A 5ALTA 5ALJA 2WIKA 1Q0RA 5LZ4A 1KEZA 1OILA 5CTAA 1BE0A 1LPNA 1N5MA 1ZGCA 5FUMA 2VT7A 3PF9A 3K9BA 3QMMA 2QJWA 5LLSA 3EF3A 4H7FA 1FFEA 3WA7A 4N5HX 2VT6A 5EHXA 2G5TA 5CT8A 4CG2A 3FOBA 4XX1A 1WPRA 1BS9A 2ACKA 1WHSA 3M83A 4QWWA 1T2NA 3A2LA 1ZICA 1A7UA 4BVLA 5CT9A 1AKNA 5FOQA 2JGJA 3KXPA 4GXNA 4KAJA 5AK6A 4Q3KA 2QTBA 1BN7A 2ZJFA 4BDTA 2OCKA 1WHTA 4I4CA 1ODCA 1QFMA 4MWSA 4QA9A 3H2IA 1BEEA 2XUKA 2O2HA 1WOMA 4BP8A 4KR0A 1E66A 2ZYHA 4LHEA 1DQZA 2WFMA 1TAHA 2V97A 3OOSA 3NWOA 1CQZA 2ZSIA 3N2ZB 2WUDA 2XUHA 1HLGA 3ESBA 4MJ3A 5SYNA 1DX6A 4ARAA 1CIJA 1QTRA 1CUZA 4B0OA 1QIGA 5CRIA 3DYVA 1CUSA 1XKTA 1QIJA 1AUOA 3VJMA 2JGKA 3R3UA 2WIDA 4H35A 3I6MA 2WM2A 5ALHA 1BCRA 4G8CA 4K5QA 3FSGD 4EY6A 6YASA 1XRPA 5ALXA 4ETWA 4OU5A 3D3NA 4WFKA 1WCYA 4UBIA 1QZ3A 3BXPA 1W52X 5K3DA 4G9EA 4GBGA 1B6GA 5IVDA 2BUCA 5AIBA 1UOOA 1U8EA 2JGFA 4BBZA 1CRLA 4UHDA 4UBKA 4NS4A 1UOQA 2BUAA 4J0IA 2JEZA 5AI6A 3V1NA 2CUTA 1MNQA 4MXDA 3G9ZA 5ALMA 3MGAA 3H1AA 5CMLA 1U65A 3W2TA 4BCBA 2IITA 3I2HA 3FCXA 3R3WA 1IUOA 1BN6A 3D4LA 3C8DA 3H1BA 2HA3A 4PV7A 1C7IA 4AZ0A 3R0VA 5AICA 1G5FA 3BF7A 2V9ZA 4NMWA 3FVTA 3STWA 3O95A 5EIHA 4G4IA 3BDIA 3BIXA 5CW2A 2GYWA 1QO7A 1MPXA 2ZJ7A 4YASA 5A71A 2G63A 1SCKA 4AO6A 4FNGA 1F6WA 1MX5A 4KJXA 4B6GA 1BEZA 4ZV7A 3GZJA 3N0TA 5KREA 4DTCA 5JAPA 2FUKA 4QWMA 4ZI5A 3STVA 4KE7A 3HZOA 5A7GA 2B9VA 3AJAA 4UUQA 4X6XA 5BWCA 3WL6A 2DQYA 2QXTA 2JGIA 2CB9A 5IVKA 1XLWA 1L7RA 4JYMA 4TPKA 1HL7A 1ZD4A 1N8SA 4EBBA 3WMRA 2DFPA 2B4KA 4Y2PA 4DNOA 3SX4A 5C81A 4OB6A 2C4HA 2BKLA 2XMGA 3FYUB 1LGYA 2H1IA 4DM7A 4H7JA 5AK5A 3M3DA 5E4YA 4AN1A 1XZFA 1XRRA 3CN9A 4WCVA 5AK3A 3F98A 2Y1KA 3QZUA 5K3FA 4J03A 3R40A 1WM1A 5HZGA 4XWGA 2D0DA 1Q84A 3GROA 4KE6A 5ALVA 4M0EA 3FYTA 1JFRA 2VJAA 3WK9A 5LZ8A 1EB8A 2VF2A 2ECFA 2QJRA 3E4DA 4HRYA 2HFJA 3X3HA 2G4LA 2XMBA 4PW0A 5HK8A 4FFWA 3KOOA 3RLIA 4U2GA 1XKLA 2PSEA 2YH2A 4X92A 2DHEA 1ZD2P 3O9MA 2YYSA 4Q3OA 2JIDA 1TIBA 3AFIA 2B61A 3WWOA 4X90A 3MUNA 1E5TA 3IDAA 3F8SA 5J3JA 4GI1A 5ALOA 1AQLA 1GPNA 4Z49A 4BTLA 2VAVA 4Y9SA 2BUBA 3VVLA 3C45A 5LZ7A 4FLEA 1CVLA 1DT5A 4KE8A 3IURA 3LP5A 2NW6A 2VEOA 2WTMA 1X70A 1XRMA 2HHAA 3HC7A 1P0MA 1AGYA 1ZOIA 4BDSA 3D2AA 3IUQA 2BFNA 4ZWNA 4AMYA 2RHTA 3RKSA 2WG0A 1MT3A 4DNPA 5F4ZA 2WUEA 2QM0A 1L7AA 1GGVA 1HQDA 1IZ8A 2ZJ6A 5ALIA 3ANSA 1YB6A 2BJHA 3PE6A 5AKXA 5LYYA 2OQIA 3OM8A 4MYDA 3H18A 1CUWA 5ALSA 5ALPA 3STTA 5FP0A 1F8UA 2I3ZA 2XUGA 5IVHA 5FDFA 2PPLA 3BL8A 4I3FA 5DWDA 3STYA 3DJYA 3C8HA 5ALQA 1GZ7A 3WLAA 4EY4A 1Z68A 2Z3ZA 2XQIA 2PBLA 3YASA 5LZ9A 3JW8A 4N8SA 3PICA 4Q1VA 4HAIA 4HZGA 5CXXA 2EEPA 4OYLA 1CUAA 4B83A 2QR5A 4EB0A 3FLAA 4CIBA 5ALLA 5HK9A 5E2IA 1J2EA 1LPPA 4I19A 4N5IX 4RE6A 3AIMA 1CUFA 5DJ5A 4KAFA 4BCDA 1CUEA 5I9IA 2XMDA 5FXMA 4BAGA 4BAUA 1EB9A 1P0IA 2OXEA 2CEKA 2WFZA 3IUMA 2PU5A 1EVQA 3IVMA 3WWCA 1XZAA 3B5EA 4RE5A 3AUKA 4L0CA 3WWPA 1CEXA 3WKAA 1ORVA 1DWQA 4K6GA 4H77A 4ZGBA 1YASA 5LZ5A 2Z8XA 4X85A 2OAEA 3EIOA 1LPBB 2AXEA 2YASA 2GBGA 4Y2UA 2PUHA 2XQJA 3G9TA 3HSSA 3E0XA 2HM7A 2J3QA 4N8DA 3S2ZA 1Y7IA 5JASA 1GXSA 1XQVA 1YAJA 5AKEA 4UHEA 4K6KA 1H2ZA 4XVCA 3P2MA 3C6ZA 4WFJA 2VJCA 4OU4A 1IZ7A 1QLWA 5CT4A 1MX1A 3UUEA 4A16A 1CUIA 2O2GA 4XJVA 5AOCA 4UHBA 4X6YA 2ORYA 3OTQA 5HCUA 5AJHA 4M0MA 1EA5A 3IULA 4KAAA 3HEAA 2Y2UA 1EDBA 4PSUA 4E11A 5AM0A 1X2BA 2XMQA 3W05A 5JADA 5AKJA 3SWWA 2VAXA 3B12A 4X91A 5K3AA 1UK6A 4L72A 3ZLTA 5ALYA 1VXRA 1OCEA 3C6XA 4IO0A 3WZMA 4L3WA 2O2IA 4FLMA 5ALWA 1BCSA 2AJLI 2WLSA 4OB8A 2HU7A 2EDAA 1DWPA 1ZJ4A 1ACLA 1YCDA 1CUBA 3C87A 1XZHA 1LBTA 4FKBA 3B3QA 2WTNA 4GDMA 1XZEA 2BAGA 5DLPA 1JU3A 1DINA 3I2IA 5ESRA 3DKRA 5T4EA 5T4FA 1JI3A 2PUJA 4J7AA 5EIAA 2WHPA 3W9UA 4DMFA 3I2KA 2E3JA 1AX9A 3ICVA 1HBJA 4B82A 2QUAA 3V9AA
chains in the Genus database with same CATH superfamily
4AZ0B 1X94A 1DAFA 1JQ5A 1TT5A 2ZB2A 1R4NA 1CLUA 2PU7A 1J0AA 3AJ9A 1IOVA 3CLSD 3KWLA 4I4LA 4Y1RB 3PDCA 2PIDA 1OLUA 2P9GA 1Z8NA 3C70A 1P91A 2OQRA 1WV0A 2CYCA 2CNOA 2ZJ2A 4HMPA 3V3KA 4FI3F 4L3OA 1WXWA 4MVWA 3GQVA 1NX9A 2DHDA 4PG6A 1F8GA 4YXWA 5I3CA 3AJDA 4QJIA 2ADOA 1RCTE 4MVJD 3WZLA 2GF9A 4G5FA 3AWIA 4J0JA 2OR3A 3W1EA 4P4SA 4C6TA 2B30A 2HU8A 1NG1A 3RSHA 4CMIA 3M1LA 4Z86A 3JD0A 4DB2A 4NEGA 4HAVA 2C4WA 1A04A 2HNAA 4QQNA 1OYWA 4YMTA 1L6RA 2C2GA 4QE3A 4FIDA 4M9XA 5NLLA 1NQ5A 3C7DB 3P0HA 1DZ3A 2RHCA 2ZCVA 4LDQA 4PRYA 4C1NA 4BX9A 4ER6A 4I4NA 1WVIA 3VZBA 3MT8A 2YFQA 1HEUA 2GQ0A 2FR0A 2GVNA 1N3IA 2FEMA 3RFTA 4J3JA 2X5JO 1E1LA 2I99A 4JASB 3QSYA 5C5EA 1BRTA 2ZZNA 4B2PA 2HF2A 5E6RB 1KPGA 1PKEA 5TR9A 1GQQA 2R68A 1JUDA 1XVTA 4F85A 3DT6A 4C0HA 1EQUA 3IOEA 1E60A 1I2BA 1C1XB 1M67A 2C88A 3D4OA 3K1YA 4FQ8A 3I0ZA 4JUFA 1J8YF 4P98A 4E31A 3T61A 5G0VA 4NDNE 4CQLA 1TT7A 3T95A 2GNPA 1ODSA 3V32A 5B1YA 4S0XA 1DWOA 3TK1A 4QQFA 1D2MA 1NRIA 2WE7A 3DBHB 2QUJA 4K40A 4W9RA 2HQBA 3KT3A 1HFKA 2X0JA 4MUAA 4Y2QA 1X6VA 2H4HA 3H9QA 1J2YA 3QLVC 2CFTA 1GD1O 4A2PA 4HTFB 1C4WA 3X1YA 2WV7A 2G6BA 5GOTA 4ZI3A 5AOBA 5I45A 1XWFA 3R4CA 4QDOA 2VJOA 1R6BX 2IY8A 1HTWA 4IKOA 4PYMA 3KZKA 1VHQA 3LCJA 2YYAA 2ZRFA 5DSTA 1ISPA 5FA5A 5GONB 5CCBA 1ACJA 2E6UX 4OLHA 5AKGA 3S81A 4FMDB 1GU1A 3JRNA 3MD0A 2IYEA 4WOBA 1Q6ZA 1AKEA 5IC5A 2D5BA 1R9NA 2QRNA 1LX6A 5KKAA 2XUAA 3EA5A 1ORHA 1BNCA 4NMMA 5FBVB 1G6KA 2OCLA 3G8AA 3O21A 4LYJA 1QIHA 3IBTA 4OQPA 4PYRA 4ME6A 3CKKA 3AKCA 4DV2B 1E6EA 2RHLA 4RD1A 1FXSA 3FSJX 3UG6A 5BNWA 2H5IA 3NBXX 3VDRA 2GMWA 3NDBB 2JJYA 3B82A 4YIKA 4DLVA 4QYWA 3VU3A 1WMDA 4TLDA 2VYNA 1ZQ1A 2CLEB 3E3LA 3SI7A 3SJ7A 3FHJA 1WMAA 5EXPA 5J2TB 1N2CE 1ZDMA 2P6PA 2TYSB 3HKBB 2IGTA 4MP8A 1OHHA 4L4ZA 3WLLA 3VYUB 3ICCA 2G9NA 3R6GA 1A97A 1UKCA 5JO9A 2B4AA 5B55A 1DFHA 1E92A 1ZIDA 3EARA 4HQ0A 2VBFA 3CV3A 4ZRMA 4MKZA 2E4WA 3L04A 2JW5A 4NENA 2LTAA 3ANTA 3B1XA 3SQMA 3NIBA 3PHJA 4RS3A 3L4SO 3LGSA 3GYGA 1H1DA 4RY8A 4WKOA 4OX9Y 5K6AA 2AKEA 1E64A 1N9GB 3NHRA 4C0JA 4PZLA 4MRPA 1HSOA 2FSVA 4OQLA 1CEQA 1OTHA 3HU5A 2YTZA 4GPIB 3HCOA 3PSAA 4R4JA 1B6RA 1ZJ5A 2GBCA 2JAWA 3DFUA 3CLRC 4XH9B 5DRTA 3IQXA 2J6HA 3H9GA 4H4CA 1QRSA 3UYLA 5ADWA 2DSTA 1L2TA 3P1JA 3VR6D 1DQYA 5BV2P 1KNXA 1PK7A 4CKBA 1X9IA 3BXEA 1YDHA 2H16A 2R85A 3IGFA 4X7PA 1EINA 1PL7A 5KDDA 4JLPA 4XGNA 4HXFB 4QUAA 3JQRA 1RTTA 3B51X 3Q12A 4KNWA 2H7XA 3TG8A 2JFFA 5AK0A 2JCGA 2P0AA 2POCA 1CUGA 1ZN7A 3KOUA 2P9CA 3OJEA 2X8JA 4UMDA 1UT6A 4WAUA 3U9SA 5M7EA 3E2IA 4M8KA 1F2DA 4N3CA 3B78A 1WDKA 4LDZA 3SBEA 1BU8A 3FIUA 5JXJA 2DPXA 4X64B 1DHTA 1I5EA 3DT9A 4TYPA 3D3WA 1WZNA 3ZQKA 4FC7A 2WM3A 2JRCA 1YUBA 3BICA 3C7KA 3M4XA 2XT0A 3GUHA 4EFMA 4MKFA 2ES4A 4FGJA 3TZCA 2B4TO 3O93A 5K8IA 1QFJA 3RS5A 1YT5A 3CT6A 4RKWA 4U9HS 5AK4A 5LYJB 2HCRA 1WSBA 1YHZA 2LR0A 4IDBA 2R751 1J9ZA 3WGZA 1MRNA 2JCBA 2DY0A 1KZYC 1GTSA 5B58T 3TLYA 2HHJA 4B32A 4A36A 1XFAA 1SZCA 2NXJA 2XQKA 3PGA1 4LZZA 4LYEA 4PF1A 1D7AA 1EZ1A 1TA0A 4BVKA 5AW7A 4U7GA 5AWFC 1P7WA 1VKRA 2BGKA 1LJ8A 3FWZA 4DE5A 4DLWA 2HBQA 5CXUA 1S02A 2AN4A 4PQEA 3G0CA 4PX3A 1BRMA 4X3CA 4BQNA 4C0LA 3RUCA 2I5PO 2VUUA 1X7YB 1I80A 4XQ0A 3CZ9A 3LMKA 3V4VB 3ZQ6A 2O8BB 1Q2UA 5EY5B 4DA9A 1T5OA 3SIPA 5A4FS 2IZ1A 3TLCA 1V5GA 4WLNA 2H51A 4TZ6A 3SZGA 4CIDA 1U98A 1X80B 2JLSA 4RU1A 1XNJA 4RAQA 8GPBA 1YZKA 3DMPA 1KU6A 3K5HA 4C9BA 4KXQA 2QE7D 3PPWA 1ZGAA 1C7RA 4MI6A 1TK9A 2XVYA 4L4RA 1SA0B 1CERA 1UP4A 2CWDA 2R8BA 3T4UA 3WLKX 4LRYA 3G0DA 1QZXA 1JAHA 2CF5A 2D2EA 3VPFA 3VFDA 3ER8A 1ZZGA 4A6PA 1TJYA 2CLIB 1QVAA 1K75A 1RJGA 3NWBA 4J0CA 2E4AA 3TM5A 1Y1KE 4BFZA 4IQ4A 3PD7A 4HNVA 4GUAA 1A9XB 4ZT4A 5KWVA 1PBTA 4LOAA 2G71A 4XFDA 4DMHA 3HVJA 1TXGA 4ITVA 1AGXA 2KX7A 1YMUA 3G7NA 5JJCA 3RYCA 4C08A 3QNUA 2VQEB 1D2EA 2G04A 4DSTA 4EG4A 1HL3A 3E1GA 4MQMA 4CIAA 1GTZA 3VC7A 4E6EA 3JTEA 1ATZA 4QYSA 2YJGA 2ZFUA 3GLIE 1YQGA 4IGIA 4F84A 2QMZA 3QXCA 1VIAA 3SS8A 3STXA 3SHTA 4BKRA 3RBXA 1HE3A 4PGGA 1EJ2A 4UM7A 2B2NA 1Y1LA 3THYB 4EHHA 2PS3A 4GR4A 2ODQA 1WCXA 4JWKA 2GAJA 2ZIEA 3B3AA 3VZSA 1F9AA 1NVAA 16PKA 2PVSA 5HKKD 3SZRA 4MS3A 1XV5A 4R6WA 2VNAA 3H1EA 1P5RA 5ERXA 3ZHBA 3K31A 2ZJAA 1USWA 4Z51A 5TS2A 1L5GB 1DZIA 1F9EA 2WKRA 3LYHA 1GQRA 3MBIA 4MQ5A 5IEBA 3G23A 2IT1A 3MJSA 5I8ZA 4RENA 3RO7A 4FBMA 2NACA 2DUNA 2YZKA 3F5FA 3G68A 4Y0AA 5DE3A 4G0ZA 1E1QD 3PK0A 2H18A 2FMUA 2QT0A 4Q9AA 1GGNA 1UR5A 3FFTA 2K5UA 3I5MA 1XZBA 4XX0A 4N1AA 5DBOA 4IXTA 4M7RA 3MT7A 1N6RA 1YQEA 4OTZA 1G17A 4L0MA 1E1KA 3UH1A 4CEHA 3ZZ1A 4BKQA 1GPMA 2Q5OA 1CUXA 2UYQA 1U0HC 1YJ5A 2Q99A 1Z8DA 2XB6A 3E15A 3NANA 2X2OA 4BFTA 4ZICA 4IMIB 1O87A 5E1OA 3THRA 1JQAA 2NYAA 3QIVA 4XIIA 4YC7A 3UJDA 5KTRA 3BGSA 5D8DA 3PWZA 3MD9A 1U1DA 1OX4A 2EC5A 3OM1A 5AUPB 2WICA 2FUG1 2ZXEA 4W1PA 13PKA 2GPWA 1ZONA 2FEPA 2P4UA 1ICEA 3E35A 1R6DA 1E3WA 3LKVA 1ZVVA 3ZD7A 2LKCA 3EXFA 4Q7JB 1NXTA 1YZGA 3KDAA 2UZ0A 3KR2A 4B6FA 2AFHB 1J1IA 2MSLA 1BJKA 1UBMS 3JQAB 4W7HA 3ELYA 1VPDA 4TV9F 2ZIXB 3PI6A 3MYYA 1OHHD 4J7XA 3ZN2A 4KEAA 2X76A 3B38A 3FOCA 4IIHA 3SZMA 3UGKA 4AZTA 4EEKA 1J09A 3NH9A 1GZ5A 4JVSB 4ZJYA 5JWRA 1T1SA 1WZUA 4WKGA 1NU8A 4FOTA 3ZUPA 1PCXA 3GMDA 4UAGA 3RRXA 1OGJA 2YVAA 1MQ8B 2YV5A 1QONA 2OYCA 3KSUA 3DBVO 4LVOA 4R5MA 4CQMA 3CMCO 3SEAA 3NYQA 1Y8QB 4ZGGA 2A33A 1E9SA 1YDFA 2C04A 3MMXA 3OEHD 4HQLA 5DTRA 4B44A 2F2TA 4BYMA 5JD4A 1NR5A 4JI0B 4H6PA 3HHEA 3K35A 1MJNA 4M1KA 5ALRA 5FTMA 4AP9A 3UIEA 3PGXA 1CDOA 4C2AA 5JECA 1P8JA 3BGOS 3PPVA 2FPKA 4QOHA 2ONJA 4LEIA 3K5PA 1R0XA 2JI7A 5DCUA 4WWHA 1HYBA 2H9YA 4C4PA 1LNQA 1RHKA 1OT3A 2A5FA 3W6PA 4Q01A 3C4VA 1Q3HA 1XDZA 4EF4A 3A6LA 5B3LA 3Q0TA 2V6FA 3RTGA 2MYPA 4ZALA 4JI8B 1YK0A 3I72A 4XQCA 2XPCA 3BD8A 1JR6A 3ZWVA 1FA9A 3WGJA 2FPSA 1WKCA 5K4HA 3WLQA 3WRYC 2ZTMA 2C94A 2XIQA 3ETCA 3FF1A 2BGJA 2QTCA 1MO5A 4IQ0A 3R8CA 3EA4A 4BFXA 1K66A 2BY4A 3V6MA 4EY8A 1RS0A 1GXSB 4UZSA 1K63A 4KOEC 1VJRA 3MAAC 4OB7A 1DFIA 1E2HA 2ATCA 4WXRA 4B43A 3U60B 3COZA 2GZ3A 2W2TA 3BMCA 3JVUA 2J59A 3LI2A 3H0KA 4X54A 2B36A 1V1RA 4ZOCA 2WFLA 4P9NA 3QLVA 1K8QA 2VZ0A 3ROGA 1R9GA 2A1UA 4YJGA 1WMBA 1GKLA 3ZKWA 4MPJA 1RWKA 3RKRA 1Z7GA 2ISQA 4JDPA 4U2BA 3CRZA 3VO2A 3ZE0B 4KNYA 1GNLA 3E05A 2O0MA 1DRWA 1JJ7A 4JBXA 4U5XA 5K03A 1W44A 4ENTA 2IRWA 4KRYA 5JSYA 3G5UA 1CJBA 2BTOA 1XDBA 4LF9B 1Y3DE 2CLCX 4KR9A 1BS1A 5KSPA 2XRFA 3KTDA 2Q2VA 3HN2A 3RVRA 4H17A 3EW7A 1N2EA 4CNBA 3BMNB 2O0KA 4OQEA 4GRIA 4IR7A 3ELUA 3RYIB 2VPIA 1O08A 4H7IA 4KQ1A 2R4TA 1UWKA 1PRYA 1KIMA 3U7QA 4BNZA 2AEJA 4S0ZA 1JWLA 1GTMA 4O5AA 4ZMBA 4C3UA 2CXTA 1TCUA 3VR1A 1NHGA 1E59A 1MXFA 2RGBA 2XITA 2C7BA 2EYQA 1F17A 1FFBA 3AILA 3MTIA 4HQ6A 2IEAA 2JANA 1M7HA 2B92A 3KZ1E 3CX8A 2HA7A 1Q15A 4XCQA 1YS9A 1N2GA 3RT7A 4IZHA 2FRVA 2JAPA 4M4SA 1AF4A 3P9NA 2HA0A 2P8SA 3WNCA 1KARA 3H5VA 3VR5D 5KMGB 1II8B 1Z5VA 3CX6A 3G49A 3UXMA 2J0QA 2WR8A 2BEWA 3S55A 3HGMA 2HMUA 3CR7A 4RHTA 4X1YA 5TPWB 4EOGA 1SXGA 1Z16A 2JI4A 4H7KA 2GR9A 4D9NA 1Y6RA 1M0EA 1GAJA 2AGVA 2PCJA 3NKFA 4DL9A 2R66A 5H16A 3WE7A 3KJGA 4AG3A 3N8IA 4BVGA 1NNUA 1QAMA 3ABRB 1KJ9A 4JBIA 5DCYA 5EUQB 1BE1A 4W5QA 4FI3C 4CEJB 5BN4A 1TYEB 2YXNA 3OSZA 4CV3A 4C4AA 2G5PA 1OH7A 3LHIA 2I2AA 4BO7A 1C3JA 4DW8A 4WGFA 4BIIA 1ADFA 2B1RA 2YJ6A 4FDMA 4LCJA 3FHOA 4M6WB 2FSUA 3PXUA 4OHYA 3PFHA 2FF5A 1D6NA 3V2GA 5IF9A 5DLQC 4J7CA 1VSVA 3L8DA 1T1JA 3QPDA 4CCYA 1W5FA 3JR7A 4R8LA 1A9YA 1DJPA 2B2XA 5D5HA 1NW3A 5ALKA 3ZU4A 2WWTA 2VJPA 2V65A 3OKPA 2H29A 1EA7A 1L8LA 3NHMA 2AZXA 4E51A 3L6EA 4AJJA 3LDFA 1OAKA 4NP6A 4BN4A 4EVSA 4BQIA 1P7PA 3DVRX 2C29D 2GTPA 2RGEA 5EN4A 1JEYA 2H9AA 2VSOA 3ZHCA 4Q1EA 5CPBA 4DCJA 1E6CA 1Q3KA 3IQZA 1GUFA 2OUKA 1M2OB 5BQOA 1E7YA 2IYYA 2EDCA 1KVQA 4IRUB 2IYFA 1JG1A 1ENYA 1SKUA 1ULBA 2PQ0A 4HDNB 1H4QA 2VPYA 3HS3A 4QUEA 4DM3A 2OQ2A 1E7WA 4JSYA 2OTCA 3H86A 5DV9A 3C3DA 4KVZA 2DH5A 1MG0A 3DFFA 3R3ZA 4LTMA 5HQ3A 2F3UA 1FUUA 5JALA 5KNCA 3N75A 1RD4A 2WHXA 4LJ5A 1EVEA 1CV2A 5C7YA 5F3DA 1E1NA 5JD6A 2A58A 4G0MA 2Q27A 1EI9A 2FB9A 4LE2A 3RHTA 5LP6B 2C96A 2L82A 2ZU0C 3PDHA 3WYEA 2HU2A 1NP6A 2NO5A 1X0VA 3GCZA 4NRDA 821PA 2B1QA 1DKNA 2DZDA 2R97A 2YY7A 1T8WA 3DQQA 1NQWA 1RI5A 4IDQA 2CFIA 4F6RB 3K94A 2VL7A 4HWOA 4KUEA 3EW9A 2YKGA 2EU8A 3ASYA 4LV6A 1Y89A 3CUKA 5AM4A 3AM5A 3EMBA 1LF5A 4MQBA 2QJTA 4OFXA 1LVHA 3GBVA 3F8WA 2G7MC 4PLTA 4YJ3F 5CM8B 3RVKA 3UHAA 2CLMB 1JGTA 4BJ1A 2DKOA 2WSYB 5FUBA 1KAQA 3ND6A 3R5SA 4OXIA 4QNNA 3E82A 3A1DA 1JR3E 4L0DA 2NUAA 3OH8A 2OLKA 1FP4B 1OWOA 4KBGA 2BR4A 3B9QA 4LZWA 2IE0A 3TINA 3CUSA 2UXDB 1M6VB 2AR0A 4LYFA 5DNUA 1ZXXA 1CP3A 1ND5A 2GESA 3ZBPA 3WL7A 3QVXA 2CNDA 3ANLA 3L7IA 4P7JA 3VR2A 1ZUNA 1NDHA 1T9AA 4HXYA 4X1KA 3I2GA 1IJBA 3I4LA 2XGOA 2O7VA 3IVAA 1XMOB 2W22A 2NU7B 1JA0A 2W2PA 4WKNA 1AB6A 4BX0A 1RI1A 2Q3CA 3EYAA 3C7AA 4RJKA 2RHOA 3CF6R 3CRNA 3OU6A 3GFQA 3IBYA 1NBME 4QDUA 3GJSA 3LW8A 1QG4A 4OG2A 4WK0B 1XKQA 2HSEA 3WBBA 1FFXA 2HSZA 5IBRA 1XJWA 1XQXA 2QAJA 5EJMA 1TM5E 4FB5A 3G8CA 4X84A 2VDJA 2FSGA 2NOAA 2GAOA 2XVZA 3BGDA 2W4MA 1XP8A 2YWDA 4FFMA 3NNDA 3BH7A 5A3JA 1KDRA 2QNIA 4GEGA 2FWMX 2C8KA 4K6CA 2QTMA 1EX9A 4DLTA 1P7YA 4O8ZA 3KQMA 4QHTA 1C1DA 2X0IA 1XVVA 2CXSA 4WBNA 2GXAA 1GHTA 3JZIA 3OLZA 2H11A 4GLJA 4L2IA 1TO2E 1YQDA 3CLTC 4LMPA 4RF5A 4S24A 5AJTA 3ZZTA 4DUGD 3OWOA 3TVTA 4EI9A 2CMGA 5JUWA 3VR0A 1NYQA 4MRSA 1OPRA 2X15A 4IUBS 3N2NA 4XIJA 1K06A 2GDZA 3RLFA 1H1TA 1E2IA 3Q3CA 4OXKA 1F8XA 1BMFA 3K9NA 5BW4A 3TJRA 1Y6FA 4QASA 2PUBA 4FTWA 1IXSB 4AO7A 4F9GA 1GPH1 2BR3A 2XUIA 3NBYC 3D6NB 4JC4A 2H8KA 4IDCA 3FPSA 4MCHA 2FEXA 2Q9CA 3WI7A 5LIPA 4JB3A 3GQBA 4BMOB 3RT9A 1GN8A 2PLFA 3A1CA 3HCFA 3LLCA 4H6XA 3CLVA 4IFIA 4OMDA 3OY7A 4RTPA 4P38A 1M8JA 4NYMQ 4DCVA 3SLRA 2J6BA 3ESAA 4RL4A 4X44A 1DJMA 4FHDA 1Z6TA 2RKOA 2I33A 3RC3A 1VC2A 3FLEA 3EZ9A 5K3EA 2E87A 2GO7A 1ZN9A 4H7EA 4OCZA 3AY6A 4GOND 3U4GA 3U7GA 5HJEA 5CITA 3K0FB 1AN9A 2O0LA 4PFQA 4Q39A 1HSZA 4BIMA 5KJCA 4NXNB 5HP4A 4IIJA 4RNCA 3WLFA 5K2OA 1BKSB 4URHA 5AKIA 1GLVA 3RG8A 2CB0A 2YW9A 2XUPA 3BWDD 4CN9A 1C7EA 4E2ZA 3V2IA 1HT2E 1LEHA 1IEWA 2C82A 3E27A 5F4BA 4CF4A 4G8BA 4TS1A 1UOEA 2VXYA 1YR3A 3AR6A 1GUAA 2OHGA 2Q3DA 4D42A 1G7SA 2IH2A 1BFKA 1YSCA 5J1TB 5JJ5A 1JAZA 1U2PA 2LV8A 2Q1WA 3ODGA 5BNFA 4PNEA 1PLKA 3BK2A 4XE5A 5SV2A 2HCTA 4UM9D 3TPCA 2DERA 3LIIA 2HFKA 2OGTA 2J5KA 3UOWA 1SHZA 2YV4A 3HYCA 1H65A 2FMKA 5JWHA 3U19A 1YF3A 4NEQA 5T5QA 4GLOA 2ZDQA 3VHQA 2CXNA 4ZO4A 2XD9A 2C0CA 1JE1A 4MKIA 3S1LA 1MEJA 1HNNA 1H23A 4QVIA 2Q6VA 3EDCA 1QGYA 4QC2A 5DYTA 1NF3A 1VL6A 4XUCA 1L0BA 5FYDA 3ROPA 5CP8A 5JPIA 3R7SA 3WRYA 4EW2A 4IOJA 5EQJB 2O23A 2NVUA 4JP2A 3T3MB 1XWIA 3IELA 4C0XA 3C98A 3MGBA 1H8EA 1ZRMA 4N3GA 1ZHFA 2A9OA 5AM2A 1DC4A 4O02B 2HX1A 1YUMA 1Z3CA 2EW1A 3FOFC 2Q0SA 2PANA 3ZDXB 1FL9A 1R74A 3GR6A 4IVQA 4ZT7A 5EWMA 1IM5A 2HCJB 3HI4A 4XTRA 1YRQA 1M8KA 2XQFA 5F78A 5EJ6A 1RI3A 2CHGA 3IMEA 4IFEA 4GPD1 3VNAA 3W4JA 1NFRA 2UYCA 3LLUA 4PC1A 1Z4NA 3B3JA 4HAYA 3AX6A 2Z95A 4QPNA 4RKEA 1BMDA 4JLBA 4TRJA 4HSGA 2J9ZB 2QIOA 3VZDA 1XTIA 5JS7A 2C7GA 3TIIA 3WL4A 4PYKA 2WUFA 1Y9ZA 4K6FA 2OB2A 4RABA 1A7AA 3CPJB 5KNCD 4KWEA 2A5YB 2KM1A 2VYFA 3C5EA 4BB5A 1USKA 1XQ9A 4WZBE 2GRUA 1E1CB 5BUZA 7AT1A 4W63A 5I4CA 2JFQA 3U0VA 2XRZA 2DBVO 2JVIA 3GGCA 4I5DA 4LMBA 4WRRA 5DYYA 3W4IA 4ZMRA 5B4VA 1P31A 4L8VA 2WKWA 2H4WA 3BWBA 3QI7A 1GVNB 3FKJA 4FINA 2EQBA 4IH9A 3EASA 4OJMX 4NJOA 2HLPA 4XDYA 3OOWA 3Q5EA 2HRQA 5EAIA 5K0NA 3SE0A 3VISA 4A5SA 3R09A 2EL9A 2IKQA 5JD3A 3P9YA 4MVJI 2PBRA 3DAHA 4TWZA 5CCDA 3OQ6A 4JLWA 2ISCA 1OBHA 1VGVA 3H19A 1U8ZA 2PQ6A 3G8YA 1WXXA 2OOKA 2FW8A 2IYRA 2VP5A 3IPAA 3JRXA 3M5WA 2G0AA 1SH7A 1H85A 2RAPA 3O94A 3QPCA 4AJ4A 1JHYA 1TZJA 4Q00A 1TMYA 1MENA 2Q4RA 5CB6A 1JIVA 1JPVA 3IKMB 3V80A 3RV3A 3DDZX 2W8ZA 1IPEA 4JP3A 4YAWA 3DCJA 4MVXA 4LZJA 5TMPA 4RF4A 4ZVOA 1Q1ZA 2HRCA 2P2ZA 4XW2A 5LPNA 1PUIA 3K0SA 1RIFA 4PO1A 1G8PA 1RI4A 1SUSA 2RHGB 2FLVA 2ZXUA 3SQXA 3BE6A 2GSWA 3OF5A 2R6R1 4E07A 1O7JA 5YASA 2EJUA 2PFKA 2IHTA 3K05A 1LKZA 3RTCA 1Z4PX 1W4AA 3ND8A 3MS4A 2PSHA 4GQAA 1IM8A 1SBZA 3MQ4A 3N53A 4CR6A 3M81A 3A6GA 5ALEA 2PM8A 2ZREA 4Q3EA 3KV3O 3ZXXA 4FEGA 4TMWA 2PMKA 5EXTA 3EPHA 3W5CA 1PV4A 4QJ4A 1CHDA 3CS3A 3BFVA 4Y2RA 1IATA 1UJ2A 5FV4A 3CO0S 1HDXA 3RG2A 1FP1D 3BB4A 5E6UA 2WNHA 3AVPA 7REQA 121PA 1JILA 1AQUA 1EDDA 2J08A 2VNJA 2YWJA 3GDHA 3K9QO 4Q4LA 2ZWVA 1E98A 1H2BA 4OFWA 2Q9AA 4UNPA 3GD7A 5LKAA 1N0IA 4H08A 1W35A 1I2CA 3OO0A 4QPCA 4WBXC 5FFMA 3WBFA 5A4DA 1GAQA 3OTIA 8LDHA 1I1NA 2BJWA 3KYBA 4JLDA 4QXRA 3V8QA 1BO6A 2BGIA 3IRUA 1NQTA 2I7CA 4FFLA 2XVAA 3ENQA 5KHOC 3KOMA 3PCXA 5DISB 4G07A 2CNBA 3HN7A 1TO1E 2X3FA 4LXYA 1UFKA 1UZAA 3W4KA 4EARA 5HUHA 1ZGGA 1VPVA 1CETA 1MP0A 2IXGA 3L7KA 3R74A 1HEYA 5FPSA 3WKCA 3MG9A 4IRXA 3K53A 4IH1A 3RUHA 3UBTA 2FRXA 3ES9A 1CKEA 2HR1A 1Z29A 3JAWB 1CFJA 4BGVA 4J0KA 1FSSA 1NWCA 3MT9A 4FC6A 1SUIA 3ORFA 1ESCA 3SDBA 2WWXA 3A6DA 3EQ9A 2ZRHA 1EHYA 2FDCA 4HNAA 1L7MA 2VCEA 3VO9A 3T5GA 3RBVA 4O4HB 5EP3A 4PSDA 1H5NA 2ZBFA 4J3FA 1N1DA 5EE3A 3ZCRA 4TWBA 4D6YA 1UJBA 5JAHA 1GZ4A 4OUDA 1T9BA 1VG1A 4Y1FA 2WJIA 2WJGA 4HG2A 5K3CA 5ICCA 3TEFA 3ANNA 1RC8A 1V45E 1IUNA 3WWEA 4AROA 1VSUA 4AXBA 4GRDA 1V43A 3WLTA 2FXVA 5DF1A 3UWDA 1Z18A 3P9IA 1LPMA 1R0RE 1UKBA 1EGAA 1G7RA 1QX4A 2PZKA 1G19A 3RAEC 2OFWA 4MWBA 5AT1A 1RU3A 5C34B 1SZDA 4GUDA 3VVBA 2IYPA 4JVLA 4QDTA 1NI4A 4CLXA 2PHZA 3NP9A 2ZPUA 1PF7E 4ARBA 3VTKA 4D44A 3HA7A 2EYUA 4D3XA 2JH8A 4GFDA 2JZOA 4B33A 1ULAA 2R86A 5B37A 4C0KA 5JAOA 2WIFA 2REQA 1W30A 3NYIA 1TCBA 1WNFA 1LJLA 1WD7A 1AHIA 2AC4A 2B1GA 3IOYA 3PUKA 4AJ9A 3RANA 4F45A 5C8XA 5K4GA 1NN0A 1Q7BA 2IYAA 2JCXA 4W6ZA 4BMXA 4ZFNA 2AN3A 3SICE 3OPYB 3WISA 4F38A 3BWYA 1YDWA 1NBOA 3Q7IA 4AY5A 4G01B 4QM6A 3KWFA 5EERA 4HFMA 2UU9B 2WJ6A 1P4AA 3L77A 4IDAA 4G4SO 1ZGBA 4XLLA 3OJOA 1H5UA 1HNXB 3PBKA 5JCXA 2I29A 4H4DA 2BHNA 1NBMD 1L5FA 4R8MA 1RWBA 3OIUA 3PQDA 4DOMA 3OA2A 4EHJA 1YVRA 3TTTA 3OCVA 4EQ6A 5KCMA 3OKCA 4TN1A 3S70A 1HKUA 1BWPA 4HD8A 1N7JA 3E84A 1SC9A 2OORC 1AG9A 3BRQA 4OXYA 4TT8A 2GYVA 4E7PA 5B58C 5C8DA 4NKRA 2D59A 4GZ6A 1CT9A 4E08A 2F3TA 3M82A 4BNKA 1XQ1A 1FTSA 2QUIA 1S01A 1AUVA 4ZODA 4B2IA 2PGAA 2PWAA 5CYPA 5BN5A 1LUAA 1IH8A 2SKDA 2WKPA 3B85A 2Z56A 2X8BA 2H0QA 3H17A 2WF7A 3G1UA 2YQ5A 3PC8C 1D2RA 1WXIA 5FR2A 1G291 1X0XA 2RIPA 2Z2ZA 1UK7A 4HB0A 2ESRA 2J41A 1SKAA 3K0BA 4XFKA 2WSBA 1YVDA 2JLQA 1R5OA 4N47A 4E2WA 1T3HA 1NU6A 2J3JA 3HHPA 1JDUA 3SEZA 4XM1A 5JVDB 5CK4A 1RYYA 4JDUA 4JB0A 4LN1A 1R15A 3LCMA 5JJKA 4JITA 5ENZA 3I73A 1S3GA 3QEMA 1FEZA 1SQSA 2QMYA 3KSAC 4NZPA 1B6TA 3AP2A 3ZJ5A 2XE4A 3S2FA 1EBUA 1JVSA 1V48A 1RZVA 2P4SA 1LPSA 1Z6XA 1W2HA 3DPIA 3DTTA 2P5SA 3K2EA 4H0CA 5CTJA 5CDFA 4A0QA 5I51A 4ZCQA 3EN0A 2WTBA 2J0UA 4XUDA 1IQUA 1FP6A 3USCS 1OGIA 4Q4AA 1NJFA 1N75A 1Z0UA 3AJEA 5E9WA 2EW8A 4Q3NA 5IU6A 3FPGA 2AJBA 2GN8A 3IOCA 4WZAB 1ZBQA 2Q0QA 5HM8A 2OBFA 1U6JA 1EVIA 2N75A 4TSFD 2GPTA 2H4YA 4MGZR 2P7IA 4A3SA 1YQUA 3Q7RA 3IYLW 1VLLA 4MKGA 5FOVA 4ALLA 5KBYA 3MBOA 3CH4B 2AVDA 4BNWA 3NGLA 2LNDA 2JG3A 1QGDA 3C39A 4XSVA 4YRRA 2WYWA 4RUKA 3D0RA 4ZVPA 3QA9A 2IS2A 3UMGA 1FX0A 4UZEA 4WKBA 3ZV6A 3I30X 2VA9A 4RW0A 5E4FA 3JS5A 1XD2A 4F56A 1KEKA 3G8DA 1KBQA 1P4HA 1S4MA 2BEUA 3PGJA 2MWMA 5CIQA 5ECWA 5KVQA 4V02A 3HB1A 3THSA 3WGQA 3P9QA 4HOYA 1R66A 1RPAA 2CXHA 2XGMA 4TLBA 4TRMA 2HCBA 1HOXA 3EUAA 2C59A 4EHKA 4ETIA 1YZHA 1CF2O 4Q3BA 3CCBA 3BIFA 4Y7DA 5K51A 5IDWA 4P0QB 2GK6A 3DPUA 4FHCA 3UICA 4TM8A 1QYCA 4C01A 1SBQA 4EY5A 2REBA 4QLOA 4UNRA 2F59A 2D3WA 4JOSA 4MR7B 1B43A 2DFLA 1FSPA 1UMBB 1RAGA 1XTVA 4M53A 1VMIA 3KBBA 1N5IA 4UNNA 4ZTZB 3AH8A 4WBSA 5AUQA 1YB5A 3OVMA 3V48A 1XTPA 1FTQA 2BMEA 3I1JA 3DCYA 2FZGA 4E5PA 1R8JA 3DMYA 4OP2A 1GKKA 1NTOA 3OQPA 5DP1A 2CD9A 3DCNA 2AD5A 2F62A 3L7NA 1HI9A 3LWZA 3HDQA 2ADMA 1XOIA 3KL2A 4U9UA 1RXCA 4MK4A 1WZ2A 4EG1A 1JSLA 1WXEA 1D5CA 2M98A 4X9XA 4HUJA 5AVVA 5FOUA 3B6MA 3GUCA 4JS0A 4Q7KA 3TX6A 3UXEA 4F4HA 5CU7A 1W2GA 1X1EA 4YJKA 5DRYA 2ZE5A 3HA5A 3VKFA 4I55B 4A73A 1R8YA 4EHLA 5L45A 4LV8B 4KYUA 1JKMA 5EJ7A 4BX8A 4UBJA 3TN7A 1FDWA 4KLZA 4OLAA 3A4IA 1OVGA 5EE9A 4G5SA 1YA6A 2R8XA 1I9GA 2ZSBA 1TKCA 4KO4S 5LNK1 3IEKA 4GR9A 5FUYA 2QAGA 2HSGA 4EWLA 5EXXA 2VDRB 2ZE7A 2PJRA 3SIRA 2Y3IA 3CX7A 3BMOB 1BXRB 3DZGA 2W70A 1V5FA 3SS7X 1NQUA 1TI7A 2QDXA 2YICA 1CQPA 1DTSA 1JR4A 1W5TA 4WA7A 4B4VA 5HGXA 3MFYA 2WUWE 4MYSA 4KRXA 3PE4A 4I66A 3GBSA 5I4BA 4DLAA 1CB7A 3GLUA 3L6RA 4RV4A 4OHVA 1B8VA 2ACVA 2XNDA 2J4CA 2DU8A 2ZRBA 4ZYXA 5TQ0A 2NT4A 1RLIA 1DEAA 3HMQA 2RHJA 2NU9B 3DLPX 2WVAA 3SHFA 1BDIA 1T36A 4GVLA 4PPQA 5DBFA 2VHXA 3TNLA 1M2VA 1BA3A 1YRWA 2YOGA 3H2GA 3QE2A 3O3MB 3QUTA 1TAUA 1E8DA 2I22A 3AHEA 5DXAA 3TF5A 3ROEA 1IDN1 1SCUB 3QBJA 3JYQA 3G5AA 5EUMA 1TD9A 1RYNA 4BATA 2JLCA 4P22A 4F2PA 3QU2A 3VOBA 2I4NA 3WQSB 3TRDA 2QVBA 4XWAA 5T8KC 4B6RA 5MFZA 1XDDA 2WF8A 4OMUA 3U37A 1EWYA 1J06A 4LKRA 1Z5PA 3AY0A 4RLSA 4CGYA 1NBHA 3MQFA 5LP1A 4TV9A 1KZHA 1QIIA 1SPBS 1W47A 4YAFA 4IW3B 5FI5A 1JDBC 4U2FA 1I6KA 3EXHA 3ORRA 4BEVA 5BWNA 1BXKA 1SC6A 3E3AA 1FW8A 3HBMA 3PF8A 4LGVA 4NE7A 4B7AA 4ZAZA 3VI4B 2HPHA 2P65A 2JZNA 4R16A 2OUIA 3RWMB 5IZCC 1VE5A 2OLEA 4ERNA 1YRBA 4B3RB 1J8QA 2UVPB 5DN6A 5EYPB 3CMMA 3RIEA 4TZ0A 2R8ZA 1W0KA 3BX1A 1GFIA 2CBGA 2JK1A 3KJHA 3FTFA 3HWSA 1LBHA 4YMGA 4WOJA 1T24A 3TYXA 4I8IA 5EKUA 1VHWA 4DA8A 4DDUA 3KSRA 2DXIA 3GRZA 1GYQA 3ELWA 1W4CA 2I4OA 2RGRA 2OP0A 3KPVA 3S2YA 3LFTA 1PJRA 4ZQGA 3V2UA 5HFAA 3OCZA 1XTBA 2DSNA 2A35A 5D2CA 4D4JA 1T5SA 3PVZA 4DDKA 3GDOA 3MRSA 4G37A 5K5EA 1C3OB 4JQZA 2IZ6A 3ZDRA 2ZRJA 1M75A 1NOIA 4DADA 2D0IA 2KB0A 3EIWA 2VXBA 4UMVA 1TNDA 1C0IA 2H2FA 3H11A 2ZCUA 3CLTD 3KQSA 4Q24A 3HCEA 4S2UA 4HVTA 1VZ2A 3Q3IA 2SBTA 2RGGA 3AEQA 4H0NA 1TEHA 1XEWX 3NCTA 1RWMA 5H3CA 1PYOA 3FWNA 1K68A 1G3IA 2YDXA 2D0OB 2ZI5A 3FJOA 3HKEA 4RJIA 4US1R 4DCTA 1EIWA 2X2EA 5I9LA 3RF6A 4V0QA 5EXEA 2BFBB 2P2YA 1IMJA 5IXYA 3HY4A 2SCUA 3X0DA 2OL4A 3TW8B 4G0VA 2B0CA 4BGEA 1SK9A 1RSZA 4IH4A 4D41A 4FHGA 2FWBA 5D3KA 5DGDA 2GXSA 3OPXA 1G20A 4TTIA 1YL6A 4QUGA 2C5FA 1NFFA 5AJXA 1VFPA 4RY2A 4Z4FA 1A27A 3OX1A 5DLYA 3D6HA 4F4IA 1NMZA 3U4QB 4N6NA 4MR8B 2D4AA 1RP7A 2ZYAA 4GMKA 1TCVA 4J75A 4ALIA 3WJ7A 4G97A 3R9XB 1RRMA 1SQFA 1WZEA 4GMGA 2ZVJA 3IKJA 4PAGA 3TW4A 2QRQA 4FHEA 4J2HA 3KYJB 2PRZA 3A36A 4LRUA 4NFYA 2BL4A 5C1PA 5TJHA 4DJJA 4QFMA 3KVYA 5AI9A 1M2HA 4FFBA 1PFUA 1XF1A 1ECJA 4ZDIA 4TSKA 3N7AA 1G21E 4L85A 1HQYE 5KTTA 2AC7A 1UXKA 4PRZA 2BGGA 3GOQA 4OP1A 1V9LA 3G9XA 1RM5A 3M9XA 1X92A 1MQ9A 1WUTA 1JHDA 1SUPA 2Y6UA 3D6AA 1ZC4A 1EVJA 1IVNA 1BH6A 4UBOA 4Q9JA 3D81A 1O4WA 3NIDB 4CM1A 5KJ1A 5MGNA 1VJGA 3NHWA 1ZH8A 3ZS9A 3ZW7A 1NG9A 1BG6A 1QRDA 1TKRA 4AYTA 1I94B 2JLXA 2J3MA 3FSEA 3RASA 3TL6A 1JBQA 1YO6A 3R6WA 4Q82A 4B5LA 2CD7A 1TM1E 3M3HA 1A8PA 2XCOA 4AZ3A 1DPFA 1T2AA 5LOVA 5AI8A 3IMCA 4PQFA 1S7GA 2C99A 1A9QA 3DP7A 2EW2A 4CODB 2FR1A 2VWHA 3H5LA 3R3YA 5CNJA 2NUPB 1KYXA 3FF4A 4Z3KA 5I7UA 4G5QA 1SVLA 3ZWCA 1PBNA 3LX8A 2OORA 4M83A 3ZOKA 5CLQA 4DHWA 1Q20A 2WWYA 1UEIA 2X4LA 1QFSA 4BKMA 3ZLBA 5JQGB 1WQ1R 3O3CA 5TXGA 1VLQA 1XJ5A 3V55A 1Q1EA 1N34B 4WIAA 1P2UA 4OA8A 1QCZA 4HDKB 4NCKA 4AN0A 1O77A 3KB1A 4LC9A 5SZHB 1J9EA 3I37X 1DRVA 1T35A 4PGAA 1SKQA 3PC8A 4D8UA 3O8NA 1MU0A 4J0GA 3WADA 3TTVA 4DR4B 3HJNA 3M4YA 4Q1DA 4QRHA 4F06A 4M8NE 4DRYA 1JPUA 2Z3WA 4F21A 1QHNA 2JBAB 3RTEA 3I34X 4FJ1A 4BTEA 2RHDA 1HDEA 5JSQA 1GG2A 3E2MA 5J2UF 4AJIA 5EZ5A 2H5JA 4E7OA 3CB2A 2VDKB 1M1NA 1Y80A 4X95A 5DXFA 4BFLA 1CF4A 4XQGA 3AXSA 2I3DA 3LRPA 4KUHA 5AM1A 3I2YX 1ZKDA 1GADO 1W5SA 1VE7A 4HX5A 4EVQA 5FLYA 1X1SA 4J07A 1OFVA 2CZQA 1UAAA 1TQ6A 1GYRA 2VF7A 4HUQA 3OQMA 2PGIA 1HXHA 2R1TB 1XZDA 1BVYF 2BHRA 2ZATA 4X41A 3VKUA 4Y2VA 1OIVA 2CF6A 5HJ2A 3BN3A 2V4UA 3RJMA 5GZ3A 3VA7A 1EX1A 2H2AA 3M6WA 4JIGA 2XKBA 4G0NA 3G2PA 3DDSA 1JG2A 1SBTA 2IEZA 1FRNA 3BIWA 3HDHA 3LBHA 3O0TA 4LHVA 5GV7A 2BT4A 4BQQA 5CA0B 3GCDA 3E8SA 5IF3A 2X0NA 4KI0A 1FIUA 2O48X 1L8QA 2FQWA 3D6VA 4OQMA 3R7BA 3E81A 5KAPA 3K9FC 4Z4GA 2Y0BA 1Q0RA 5IDXA 5LXTB 5C37A 1G8MA 2JI8A 1VG9B 3L5OA 2BZGA 3GFSA 4G36A 1KDTA 2NIPA 3QWFA 3FBTA 1I36A 1R0SA 3RUAA 4YJ3A 1GFWA 1G41A 3FR8A 4IV0A 1CY6A 1S4QA 2VT7A 2C97A 3G13A 3PF9A 4B34A 4GVXA 4IQ8A 4RA6A 3EGOA 1GZUA 2CXRA 2VRCD 3DO5A 4ZVMA 3ZZMA 4CETA 3K9BA 5REQA 5KEIA 4C7OB 1XCBA 3AUXA 5HCIA 3QMMA 5AW1A 1OBFO 3KT6A 2GN6A 4V0OA 2R1VB 4UQLA 2WE8A 3NAGA 3D8SA 4H7FA 4MUHA 4J9UE 4JFRA 4A1OA 1WF3A 2XRMA 2OXTA 2OB1A 3A27A 3DA8A 1P29A 2Y27A 1EWQA 4WESA 2NZYA 2JIZA 5EHXA 1E1MA 4F5DA 4G0OA 1W0KD 3UGQA 2H06A 3S28A 1Q11A 3RI3A 4BWFB 2ZITA 3ZJYA 1G3MA 2FOIA 3HYNA 1RMYA 2IH4A 4ZEMA 1WEHA 1EHIA 4KO3S 1BS9A 4NPAA 2ZWIA 5CVDA 3IV9A 5ED0A 4AY6A 3VSEA 2VLBA 1BDBA 1M0WA 4M1ZA 4REQB 1K9VF 1KMNA 5F76A 4MLZA 3A1VA 3HE3A 1L7EA 1T2NA 3A2LA 3DZKA 4MW9A 3TIXB 2KW5A 5LFAA 1GGEA 3ZXSA 4Z3DA 1E2MA 5A9SA 4M38A 4CNQA 4C76A 2UUOA 4MTCA 2I6TA 2BZSA 3O8RA 3A1EA 3JXEA 3CH5A 1Q17A 3PYXA 2ZJFA 5JDIC 4KB5A 3GMTA 2J31A 1BC5A 3VPBA 1NUHA 2ECOA 2OCKA 4L7VA 3JQPA 1ODCA 1QFMA 3GCXA 1E5LA 4MWSA 3SYRA 1LLQA 4E4YA 5IYZB 1MH9A 1KH3A 1BEEA 1KPHA 1JIIA 2QTVA 3I5AA 2PZLA 3I9NA 2A0XA 3QLEA 5AOVA 1WOMA 1GCOA 4OQNA 2AE2A 3NV9A 4BGUA 2E1RA 3JQ7A 1W0JA 4OQFA 4MS4B 2WRZA 5HDQA 3MF4A 5L53A 1DHRA 1HLPA 3NWOA 1QGUB 3C8MA 2ZSIA 3N2ZB 4ZJZA 3L1KA 2W0SA 3ESBA 1NUSA 4R8RA 2VRBA 3CNQS 4FE3A 4YJHA 5A6SA 3K20A 1EE9A 3BL5A 1QIGA 2OV6A 5CYFA 3O7WA 1TA9A 4FCVA 4CIXA 2ZRNA 1I0ZA 3DYVA 1CUSA 1P77A 1IDOA 1JTEA 3IODA 3Q15C 4JSTA 2YZMA 4KQKA 2LGJA 3PUJA 1DC6A 1SEPA 2R5NA 3ND7A 5KYYB 1KQFA 5T8KA 2WIDA 1JVBA 1ELOA 1TMGE 3I6MA 1JLKA 5A1JA 3KQTA 5BVGB 1YQWA 4NR0A 2DBQA 4HEA6 1RABA 4K5QA 1LVGA 3FSGD 4WCFB 4EY6A 2PK3A 1DEOA 1EJ0A 1BX3A 2BISA 3G2MA 1Y1TA 3RCBA 4C3VA 3ZHYA 1RNLA 4RACA 4EKYA 1C9NA 4ETWA 4O4LF 4ZEXA 1VL0A 2Y1GA 4RFSA 4HMOA 2COUA 2JAQA 1N3BA 5BR8B 1QZ3A 3KELA 1W52X 5IJXA 4IF6A 5L6LB 1ZCBA 5IZCA 2WU1A 3IAAA 1UBGA 3QVLA 3U5ZB 1U5BB 1WG8A 3MMNA 1W5BA 3P2YA 4WERA 1TTHA 3ACCA 1UOOA 2M6KA 2JGFA 3ZVLA 3DEHA 2GZMA 1FBNA 3RGWS 3HFSA 3IHTA 3ZOZA 1SC3A 1IY8A 1TYDE 1V8BA 1O5TA 4UBKA 1O58A 4RO0A 3IX7A 5JZOA 1LSSA 2H54A 1JG4A 3HP4A 1DTWB 2Q0HA 5ITVA 2DT8A 1L8OA 2Q3FA 3U3DA 4TXJA 3C16C 1JHRA 3FDZA 3FDJA 3KYDB 2CUTA 3LDAA 2IYSA 2ZYUX 4XARA 4UUAA 3ESRA 2O2SA 4OHXA 1JKJB 5NULA 4JC8A 4ERXA 3R7NA 1Y8AA 4LY9A 3USZA 4AP6A 4ER3A 5CMLA 1W73A 2ZRCA 2ZBDA 4BCBA 4YV0A 3LQ4A 1B76A 4MQEA 2CGEA 5IG2A 1SXJE 5JY6A 4BBJA 2B35A 2C3PA 2NZUG 2R8PA 4V0NA 2I2WA 1IWPB 1IUOA 3HDYA 4RH1A 3L3BA 2P5UA 2VQSA 3C48A 4YRBA 3ZBUA 4OP3A 1PFVA 1P1IA 5A9RA 1QHHB 4BMYA 4JLJA 3SXUB 3FOZA 2C3YA 4CTNA 5BV7A 4YO7A 2RARA 5AVZA 4UEKA 3MA0A 4C06A 1E0SA 1C7IA 1G8KA 2BGLA 3WGNA 3OT1B 3NV7A 1XR3A 3TLXA 3A14A 1X8XA 3BF7A 5ECYA 3EGXB 5JROA 3MT0A 3NRCA 3FI0A 1J1UA 1E2PA 2H2WA 1RJDA 3KHTA 1IVSA 3ZDQA 4CTMA 3BDIA 1GSOA 2CDBA 2HRZA 4JVMA 1U3FA 2ZTSA 5BSMA 4I1VA 2UZ4A 1Z38A 3A10A 1DBRA 4CLOB 4NCAA 1J6UA 3ZU5A 3G2OA 2IY7A 4CLHA 1KJNA 4JL6A 1KP9A 4XYBA 2VFAA 2WAYA 2QA5A 1SCKA 4NBTA 3DCIA 4O33A 4QICA 1NLUA 1MX5A 4KJXA 3RRJA 1E3EA 1YRYE 4B6GA 3PIIA 4CM9A 3TQFA 5BMVA 4CTJA 4GX1A 3EZ6A 5A5DA 1NSTA 1ZOSA 1LW6E 4OL0A 5BWMA 5CBPA 4HH3C 3MWJA 1M76A 2CLDX 3M8KA 2FUKA 5KVCA 3H7IA 1HT3A 2AN1A 4D74A 1X7DA 2JFXA 2CUZA 2Z5VA 1KRXA 1OAOC 1ZJ6A 4KE7A 1AT1A 3WB1A 4PINA 3QPVA 1EX6A 4LJ8A 5DHPA 1WE2A 5FFFA 5LDDC 1EE2A 2WT8A 4K86A 5TDHA 5BYBA 5JZMA 4OOEA 2VSXA 2DFDA 3ZI4A 2GDJA 3U6BA 1IOWA 3AJAA 1HE5A 2BMFA 1SC1A 1TZ2A 2L18A 3S5UA 4GEKA 2YZ7A 4ENPA 5BWCA 1HE1C 5MGBA 3W6OA 1QZUA 2HWYA 3WL6A 4GZMA 2FY8A 1Z0AA 3FNEA 1FNNA 1JEAA 1REQA 4EYKA 4PGMA 4J91A 1XLWA 3SG0A 2JH9A 4JYMA 2A0KA 2RB4A 3OZWA 1R9JA 3Q0EA 4X6LA 4AIRA 1PW7A 1OJLA 1X7WB 1SVNA 3BBPA 4EBBA 4PVDA 3PJEA 4GVPA 2CXUA 2B4KA 1H69A 3N1UA 4U5QA 4Y2PA 1YVPA 1CD5A 1S1MA 3ENVA 3HRKA 4PLWA 3KR9A 3F90A 5H3LA 4BVBA 3ETLA 2WPDA 2JJ1D 4XASA 1DIAA 5J59A 1WABA 5DLEA 2XYPA 3FCUB 1IAQA 1Q91A 3KJZA 1U8CB 2GASA 3V5NA 3VH4A 3WGVA 4UTNA 4D57A 2YXEA 1KERA 1TRKA 2Q3MA 2JIQA 3QQ5A 4F3KA 5BPFA 5T3UA 1GKYA 2H1IA 5AK5A 1I51A 2G70A 2IC5A 2VF8A 3MYRA 4JJFA 3X1WA 4EPRA 5AW3A 3IERA 1Y9AA 4OJNA 3IL2A 1V7CA 1EX7A 1H2FA 1XRRA 3CN9A 3GYBA 4WCVA 3ZE8A 4FDAA 2PX4A 3N2GA 4BMCA 4QVKA 4CLRA 4I9HA 1NJSA 1WEKA 3CW9A 2QTRA 2QRHA 1W0JD 2EP7A 3LRXA 1Q0QA 1RTKA 5HZGA 3QJYA 3D8NA 3GLFB 2W6QA 4IOMA 1FDVA 2D0DA 4KODA 4M0CA 3GROA 3L7JA 2GETA 2QNBA 5K99A 1V41E 1W9HA 5DN9A 4MYCA 4UM5A 3CVVA 4I5EA 2C7QA 2Z98A 1IN4A 4IBOA 2PO5A 2VJAA 4YUZA 2Q46A 2HY7A 4URVR 1FNCA 3JWJA 5LZ8A 1EB8A 5EIBC 2ECFA 5AQEA 1ZR2A 3E4DA 3HG7A 3INNA 2BFMA 3WAJA 1OV6A 3IXMA 1EWVA 5DWQA 1DAEA 4AJNA 2GHIA 1PL8A 4PPGA 4RDIA 2GRAA 1PG5A 2J5QA 4IPTA 2A84A 4G3XA 3ZQUA 3I9V6 5IWCA 4YLYA 1HEIA 2FPUA 1M7GA 2V8BA 2FPPA 3VYVA 2TMYA 4D98A 3V4OA 1PJ4A 1RJ9B 1XKLA 1WA5A 2W2MA 2WM8A 4RPKA 5IBCA 1QHSA 3KYCB 5IH3A 1UKVY 2PL3A 3OZFA 4B76A 5AVUA 2YYSA 2AIRA 4AMGA 3F9RA 3BCRA 2YC4C 3EC2A 4OH7A 1N4DA 1OBVA 3WWOA 1NVTA 5C8YB 4CLEA 2YZNA 1E5TA 4KPEC 2B37A 4OM7A 4DWOA 4P7BA 2XCQA 3I42A 4BVFA 4KUGA 3JU3A 4ZI7B 1NYTA 1T5LA 3NT2A 2ZAMA 4S1OA 2BUBA 3KHUA 4S1NA 5L3VA 1IPHA 2P5YA 3Q72A 4DILA 2OV8A 4R0VA 4Y9DA 3ETHA 3NWEA 4Q0MA 4DA7A 2QRZA 2IPMA 3IKVA 1KI2A 3P2OA 4FLEA 1WMFA 3O8BA 1CVLA 4QL3A 4UEQA 1TECE 3ZK8A 5BV8A 1L5MA 4CF7A 4FZJA 5JJIA 1FDRA 1I4WA 1O1YA 3N86A 4KE8A 3LP5A 4FR5A 4YRQA 3KQUA 1UJMA 2BMJA 1ZR4A 3H99A 4KMOA 4EKNB 4Z4QA 1KYQA 3QTBA 4WLUA 1C9EA 2AWOA 3WRXC 4BBPA 2P67A 4OQZA 2F43B 1Y8RB 1GEEA 3ITKA 3OWHA 5GJWC 4P86A 4PWYA 5IRCD 3HC7A 4R01A 4ZP1A 1SCBA 3RRMA 3V42A 1OIWA 4N0MA 4YAEA 3RSQA 3D8RA 4J7UA 2JFGA 1TYCA 2WTXA 1Z2AA 1SBIA 4BDSA 1KRWA 5JDIA 3HV2A 5I8WA 2BFNA 2CSUA 1AV7A 2JJ8A 4RIGA 1RQNA 3V34A 3NIWA 2GM3A 5BO5A 5ECDA 3W1VA 3O8LA 2VUSA 3FUWA 1ZLYA 5EJ9A 5E8RA 4U6QA 4L27A 5JNUA 1ZNYA 3RRBA 1RYHA 3L43A 1H94A 3GLKA 3P8ZA 1QHXA 4H1VA 4QTZA 1D5WA 5AMXA 5F4ZA 3ZIDA 2F3RA 5JE8A 3HCPA 2GWRA 1H1LA 2I0FA 2A0FA 3WLMA 2G08A 1HY3A 1QK3A 1LDYA 1HQDA 1FYDA 1ZSVA 1V8PA 2OBYA 5ALIA 1TMOA 1YB6A 3I5XA 5JSZB 2BJHA 2O2YA 5EE0A 4HLNA 3DBLA 4IHKA 4M8IA 4V0RA 1KJZA 3ENKA 4A0GA 4D9GA 4ETMA 2KE5A 4ZMSA 5I6DA 3IIEA 1XJCA 3VYWA 4DNXA 3F5MA 3TVYA 4HB2A 3OM8A 3IDZA 4D8VA 3F3YA 4HNHA 1T4CA 4RQUA 1UANA 2YV1A 4MVJP 5ALSA 2R48A 3JQ8A 1RZ3A 1Y7TA 3K0KA 3Q88A 1JDTA 1NE7A 1R6AA 1RPJA 3N3AC 3OJCA 4OHUA 4Y6OA 3RYFA 3TIVA 2XUZA 3HJBA 2RJNA 5EE5B 1QO0D 2VHEA 4I4TF 5FDFA 4XZ3A 5KJEA 1H2AS 2W11A 3REQB 1GOTA 1FVXA 1UBTS 3QX3A 1WXDA 4Q4DA 1J99A 3VU1A 1PSZA 4Z0TA 2B1JA 4NV1A 3STYA 3AG6A 1GTG1 4BFCA 5JMTA 4KHZA 4HNUA 3B1WA 3IAM6 4AYWA 1PJZA 2L17A 1SVOA 1UC5B 1LCIA 2GHQA 3I6BA 3QMPA 5FUWA 3WLAA 1Z68A 2JHAA 4ND6A 3B1KA 4GOXA 3TXAA 2EFJA 4MS1A 1A72A 3ITEA 1LH0A 3PNOA 4OBBA 2PNFA 2QX9A 3T7AA 1DMSA 2JEOA 4MMYB 1MAUA 5GPBA 3TTUA 3M49A 1KQNA 1E7RA 1ENPA 2A9RA 1N2SA 3PICA 3OX3A 4QDKA 4RKQA 3V1TC 1A4RA 1ZUD1 2FCRA 4ESEA 5A03A 1VCMA 1W96A 4HVAA 4RX1A 3LQ2A 1I4TD 2EX4A 3OD5A 5CXXA 1C4OA 4OYLA 1CUAA 4MJ7A 5ITZA 3GLHE 3JQ9C 4RC9A 4J2TA 4UTOA 2VNKA 3ZGXA 1COZA 1M6YA 2NSDA 1T8YA 4L3VA 2GERA 4PZCA 5DM1A 4YP9A 2W6NA 5CVVA 4BNFA 2H1WA 4P1ZA 1UPUA 3DTVA 3LQKA 3ZD8A 1U9YA 2ONYA 3P9PA 2Q7OE 3H84A 3NZEA 2JATA 4UNIA 3IB6A 1GNPA 3DWEX 4FYMA 1R12A 4GSYA 4OSOA 2WPDD 4FMCB 2MSKA 1UMDA 2ZK7A 2O8FA 2SHKA 3IH5A 1P9RA 2VAWA 1POWA 3AIMA 2VTKA 2AKYA 4U6NA 3KPUA 3UKDA 2VDVE 4WV3A 3TVDA 1W59A 3ZXYA 5LD2C 5E1DA 3RREA 4BEBA 3NXSA 4AIIA 1G6HA 1CUEA 3CUEF 3R5TA 5DDIP 2HTFA 2IDKA 2OEPA 3LUFA 5T67A 3KOZA 3OE4A 2L19A 1U7OA 3G9QA 4Q4HA 2VTEA 3U80A 2RC5A 4AX8A 3DF9A 3FW1A 2F1RA 1W25A 4XGRA 1P61B 1R0KA 4U0KA 4X20A 1SIWA 1USGA 1EB9A 1NUUA 2QN9A 4FZVA 1AUPA 2CEKA 1N2HA 1ZVKA 1XMJA 4BNNA 5JAZA 4M9RA 1AN0A 4L4UA 5LJLA 3L7YA 3C0KA 3WWCA 5AVJA 4RA9A 4RE5A 2IU6A 3AUKA 5H82A 4K9OA 2BD0A 4F2GA 3H2ZA 2CW5A 3M2PA 5HIAA 4EI8A 1J0CA 1HO3A 1XTRA 3BORA 4GLFA 3QEOA 1YK1A 3S44A 4EZBA 3GC6A 1T8RA 1L8AA 2VJNA 3A05A 2ZJ4A 4DRXB 1DWQA 1B15A 5D5PA 1C0KA 5H5JA 1HZZC 4GNKA 4R6XA 4RYDA 2XWJI 4ZGBA 5F3WB 2OD9A 1VYUA 3MJFA 4WD3A 3CX4A 1YASA 5L8VA 3IFSA 3WC4A 1W36C 4X85A 3BD7A 5E7QA 5ESXA 3ND9A 4JQYA 4KDCA 3O2SB 1Y6QA 2W83A 3FMPB 4JU8A 3DAYA 2AR9A 4L8GA 3QVGB 3RSZA 3TRJA 1LU9A 1OYOA 1O0SA 1QE0A 3L8GA 1YZ3A 2AXEA 1VJ0A 2HK7A 3EWIA 1GCGA 3OX2A 5B3AA 4Z0NA 1G55A 1WHSB 2ILVA 5EQDA 2BF4A 1OAOA 2R5WA 2O06A 4JJIA 1KZ4A 4XVRA 3JPYA 2NYVA 2GD0A 1DV2A 4F72A 3M6UA 1QMGA 2I6FA 2NO9A 3LCUA 4OQDA 1EXVA 1B14A 3NW9A 3Q7QA 1CY2A 1BHO1 4G65A 2OZPA 3S99A 2C9DA 2FEKA 3GZ4A 2NP7A 5JXWA 1BZYA 2C8JA 1Q1BA 1XU4A 1NE2A 5EFOA 3WGMA 2HMAA 3P2MA 4Q1CA 4MUMA 1BH2A 2P2NA 1AHNA 3H5WA 2MSNA 3H5TA 3I9JA 2PKCA 3KU1A 1YBAA 2FG5A 2PXAA 3KPYA 1H6DA 1QLWA 3ODPA 4UARA 3KDSE 3R9IA 4Q93A 3D8HA 5BSKA 3UUEA 3C3MA 4QTUB 3ZDYB 1ZKMA 4A16A 3EDMA 1SJ9A 5FNVF 1J42A 1ZN2A 4JJGA 4ZU6X 2AR7A 2O2XA 3VU8A 3OSUA 3R5XA 2O2GA 3VI3B 1JG3A 3HVKA 5TQJA 4MUEA 1I9CA 2XYQA 4CMKA 5SY6A 1N8KA 5HIKA 2BMDA 5C1OA 2OHIA 5I7WA 2FMXA 1NQXA 4MITA 5AJHA 3TUIC 1A98A 2DRIA 4RVSA 4C22A 1I7SB 3AB8A 3R1IA 1RDFA 5T6BA 3N7UA 2A0YA 3GIDA 3GEEA 5F33A 3T15A 3EIHA 4FXOA 1ODLA 1H2EA 3IULA 3MILA 2VWGA 4HX2A 1A50B 4MTLA 3T4EA 3WLEA 5FWYB 2C1XA 2Y2UA 4BO3A 3UUWA 4JMPA 4R0NA 2P5TB 2FG6C 1ZSYA 3KQLA 1P1KA 4MEJA 3NBFA 2VNHA 2ZI6A 2WJPA 2V5VA 2XZTA 5AM0A 4X62B 4QHSA 5AKJA 4NABA 4R2HA 1LBIA 4N5NA 4O25A 2JFHA 2BEVB 3OE7A 5BSFA 2Y1CA 5ERGB 5EKXA 1UZNA 3N8DA 3WWYA 1YKFA 2EG9A 2FZCA 2HMWA 4JQCA 1GL7A 3BCUA 3OP4A 4R1TA 5FTNA 1D2NA 1JAYA 3EGIA 4WJZA 1VXRA 1OCEA 3SC4A 2BH2A 3C6XA 3A7EA 5ITSA 3WLIA 2H0AA 3PC2A 1BVUA 1DSSG 1H2RS 5ES3A 4EGSA 5LA6B 3P27A 2DOKA 3M5PA 2Z4SA 4FLMA 5HQJA 2D7JA 1D1TA 2DTDA 1UBCA 4ZZ1A 3L7OA 4XVHA 3V7FA 4DWWA 4QYTA 4P36A 5EIFA 1ZH4A 3T9CA 2AN5A 2FFHA 1YQTA 3Q87B 2EDAA 1DWPA 1JMVA 4FYIA 2E4ZA 2I1WA 1X9GA 4OB8A 1U28C 5A02A 2O3JA 1ZH6A 3HM2A 1S3IA 3GEHA 5TLSA 1BVHA 4UREA 5IS2A 3N2EA 2C31A 3DXYA 4X1IA 1CUBA 3JQCA 2QB5A 3WQQA 3DAFA 2M2IA 3T5MA 4LOIA 4GRAA 3B3QA 3G2KA 4S1WA 1E4EB 5IJ0A 4OJQA 1ND6A 3EVCA 1E2KA 1R6XA 1YI8A 2R6CA 3LW7A 4HGRA 1AHPA 4S05A 2CDAA 2B4QA 1Z6YA 2VC2B 2Z6UA 2D6FA 3TFQA 3D43A 4TV8F 1DINA 3I2IA 3KUKA 1OZAA 3NOQA 5IXJA 2FWRA 4JJEA