5EFZA

Monoclinic structure of the acetyl esterase mekb
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
347
structure length
347
Chain Sequence
b'SYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine O-acetyltransferase
molecule tags Hydrolase
source organism Pseudomonas veronii
publication title A novel esterase subfamily with alpha / beta-hydrolase fold suggested by structures of two bacterial enzymes homologous to l-homoserine O-acetyl transferases.
pubmed doi rcsb
total genus 132
structure length 347
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5efzA00
4KAAA 2BUCA 2EEPA 4FWBA 5K3BA 1K63A 1XRNA 3WIBA 3WKCA 4BVJA 4K2AA 3QPAA 3HZOA 2PKYX 5CT6A 3IUQA 4Y2JA 3VDXA 4B7ZA 3WK7A 2XMBA 4I4CA 4C4XA 1XROA 3B12A 1CUJA 3WL6A 1D07A 5FPQA 5YASA 2C7BA 4L0CA 2PBLA 5AK6A 1G4HA 1TCCA 5DYYA 1Y7IA 2JIDA 3STYA 3VJLA 1P0MA 1R50A 2OGSA 4OU4A 4A16A 4I3FA 5AIBA 2GBCA 2WHQA 4BVLA 3W2TA 5AKJA 2XMRA 5D3KA 3WL8A 1Q0ZA 4GWLA 1OCEA 3WJ1A 5K3DA 4U2DA 4J0DA 2PM8A 1R4ZA 5A62A 3IVMA 2HU8A 5JZ9A 2AXEA 5JAHA 5AM4A 1IUOA 3GROA 5LZ8A 5CT9A 4C4ZA 4EY4A 4ZV9A 3DOIA 2ECFA 5DNUA 5HK9A 4I19A 3UMJA 4LKOA 4OCZA 1AGYA 4G8BA 5AOCA 5FRDA 2VQ6A 2WTMA 4EY6A 1YS2X 5A2GA 3DL7A 1VA4A 1QJ4A 4AN0A 1UOPA 2JGFA 1ZD2P 1UK7A 1R88A 1DWQA 4B84A 3R3UA 4FNMA 2HA5A 3WWPA 4E15A 4J7AA 3FYUC 3BWXA 1EX9A 1JJFA 1PJAA 3I2IA 1EH5A 1CUIA 2IX9A 4G4IA 4H35A 3WZLA 3DEAA 3O4HA 2FJ0A 1ZI9A 1EDDA 4MWTA 4HRXA 1OXMA 4CI9A 3G0DA 1R1DA 2GBIA 3IUJA 5K3CA 4QNNA 4PV7A 4Y9SA 5IVDA 2H7CA 4BP9A 2UZ0A 3O0DA 3ANTA 2XUAA 1F0PA 1HBJA 1YA4A 4UFOA 4OUKX 3G9TA 4Q3KA 2W22A 2Z3ZA 2ORYA 4EUSA 1XZBA 1NU8A 4FDMA 3MVEA 2HA6A 1DX4A 2QVBA 2X76A 5HCUA 1AC5A 1C7IA 4F60A 4QDTA 2BJHA 3WYDA 1DWPA 3C45A 1ETHA 2JEZA 4J0KA 1ZI8A 1N5RA 5LLSA 2PSEA 4Y2YA 3H1AA 2OQVA 5D7BA 2CB9A 4B9EA 4JYPA 4PW0A 1MJ5A 2AJLI 4BBZA 5ALRA 4DIUA 1AUOA 1JJIA 5ALTA 4BC1A 1FJ2A 2XUOA 3EQ9A 3W05A 4TGLA 2QZPA 2BKLA 2HA0A 3V1KA 3BDIA 4BB0A 1N5MA 5AH0A 2DSNA 1R9MA 2WIDA 2WU4A 5DJ5A 4Y2PA 4NZZA 4DNFA 2CUTA 1CUBA 2CZQA 4K6GA 4EZIA 4IH4A 4C4YA 4GEGA 1H2YA 1SCKA 1YA8A 3WJ2A 4NS4A 3VVMA 2JGLA 2B9VA 4UHFA 2XT0A 5DYTA 1YCDA 3KOOA 4P93A 1FSSA 2HFJA 5ALPA 2VF2A 2HFKA 3PF9A 3BF8A 3F97A 5ALQA 4H18A 1XZAA 3G0BA 2Y2UA 1VKHA 5AKZA 3WK6A 3K9BA 1BCRA 2B20A 3B3QA 3C8DA 3HJUA 1IMJA 1Z68A 4XWGA 3KDAA 1QIEA 5AKKA 4X93A 2Y6VA 3H2JA 1LPSA 3A6ZA 4LXHA 2JGJA 1K4YA 2G5PA 5AM5A 4EY7A 1UOQA 3OM8A 3WK4A 5K3FA 2AJ8A 3F8SA 2C5GA 1QFSA 3VVLA 2PSDA 3AZPA 1ZOIA 3OURA 2PU5A 4UBMA 3WKBA 1LLFA 3IIIA 1QLWA 3CXUA 4CIAA 2OG1A 3G9UA 3EQ7A 3O9MA 2DHEA 5HK8A 4UHCA 2V97A 1SCIA 1HPLA 4HS9A 1QIGA 4Q3LA 1E89A 5EHNA 3SC2A 1XRPA 3GFFA 2WIJA 5ALEA 4JH0A 4Y2TA 4LIPD 4UFPA 3FOBA 1CUSA 4GLBA 5E2IA 3BJRA 5AKEA 5FLKA 1VE6A 2AJBA 3WZMA 1JMKC 1UK9A 1A8SA 1CUDA 2FJPA 2CBGA 1LPPA 1P0QA 5AM3A 5AP9A 1ZGCA 3FLEA 3NGMA 4XJVA 4ROTA 2Z3WA 1C7JA 1E5TA 1FFBA 5LZ9A 1UK8A 2OCIA 3M83A 4HAIA 5ALIA 1TKRA 1LZLA 3D2CA 1ISPA 5AK4A 2VTVA 1BE0A 4J0CA 3KSRA 2O7VA 1EA5A 1ZI6A 1NX9A 5JIBA 3ZWQA 5FV4A 1QIJA 2HL6A 4QDZA 3C6BA 4RGYA 3GA7A 4UHDA 4G8DA 3HYSA 1VE7A 1J1IA 1P0PA 4C87A 2DFPA 5ALUA 4BCBA 1MPXA 4J0GA 4WDRA 3BIWA 3I6MA 1XZHA 1JI3A 4W63A 1O6FA 1DX6A 4Z49A 3FVRA 3QPCA 4PF1A 4A23A 4MQMA 4N8DA 4KRXA 2WLSA 1EINA 1GQSA 5EIHA 1BS9A 1WB6A 1CUGA 1YASA 2OPHA 3A2LA 3G8YA 1P0IA 4CCYB 1TRHA 4PNZA 1RYYA 2VT7A 2ZYHA 1YB6A 5ALNA 2H9YA 1S8OA 5IH7A 5AI4A 2QR5A 1MTZA 4Y2VA 2HA3A 2BUAA 4WY8A 4AO8A 3C8HA 5ALWA 3A2NA 3ZLVA 4KJXA 4M0FA 2OQIA 1T4MA 4X97A 4O08A 5CTAA 4EY8A 4CCWA 4N5HX 4FLEA 5AKXA 4CIBA 2VJDA 3BXPA 5HF8A 1GKLA 4S0XA 1Q0RA 1CUVA 3HRHA 1A8QA 5LZ7A 4DMHA 4LHEA 1UFOA 1XZEA 2VAXA 1QIFA 2OXEA 5J3JA 4INZA 1TAHA 4Y2QA 3VKFA 1A88A 2JGMA 2K2QB 4JUIA 2O2IA 4LYEA 4KACA 3F67A 4L3WA 4MYDA 2IIVA 1CFJA 4BRSA 1KU0A 3AIMA 5JD4A 5HF5A 3R3WA 3C6XA 5DLPA 2HADA 5ALDA 2ZVDA 3M82A 3D7RA 4BDSA 2EDCA 4QZVA 1CPYA 2D0DA 3OPMA 3ESCA 1FFDA 3KXPA 2VAVA 4AO7A 5IKXA 5JZSA 2RHWA 5HKBA 1CUFA 1SCQA 5BWCA 4CG2A 5IVHA 1ZD3A 4U2EA 1IUNA 5HFAA 4XVCA 1E3QA 5CT8A 1U65A 4U2GA 3FSGA 5ALZA 3IUMA 4BYMA 4WDQA 1QGED 3D0KA 1QZ3A 1XZJA 4X95A 1TIBA 3HSSA 1MNAA 1NU6A 4X6XA 4UUQA 1CUHA 4FFVA 2XMSA 1WHSA 3PE6A 2YH2A 2X8BA 3H04A 4J0JA 4NMWA 2ONCA 3RKSA 3FVTA 1AURA 1E8NA 2CMFA 1XKLA 4BCCA 5T4BA 4FBLA 1RP1A 3H2HA 2WIGA 4H0CA 5T4HA 3G02A 1ODCA 3IA2A 3ZLTA 3ZV7A 4G9GA 5AKYA 4DNOA 1X2EA 1ACLA 3D5EA 5JYCA 3SK0A 2CEKA 4FTWA 2Q0XA 3HI4A 2QKYA 5FP0A 4NVRA 4U2CA 5AO9A 4ZGBA 1ODTC 1IZ8A 1XZLA 4KR0A 1QIDA 4V2IA 3STXA 1E66A 1C4XA 3MGAA 5FXMA 2RHTA 2PUJA 2XMZA 3I28A 5KWIA 4QLAA 2XUQA 2HA2A 3HABA 1F6WA 5AOAA 2XB6A 1QFMA 2I3ZA 5EIEA 3K2IA 3V1NA 1ZIYA 1B6GA 4UBOA 3WQHA 1E8MA 3IDAA 1DQZA 5EHZA 2C0PA 2WU3A 1EI9A 1N8SA 5IVKA 5DYWA 1DT3A 1SFRA 2J4CA 1EVQA 4ZWNA 3N2ZB 1GPNA 3I2JA 4DMKA 4F0JA 3T4UA 3RARA 4CG3A 1SOMA 4DMFA 3STTA 1IVYA 1JU3A 2WIKA 2PPLA 3EQ8A 3W06A 5ALGA 2OLEA 3UUEA 3HACA 2V9ZA 1MNQA 2VT6A 1J06A 4CCYA 4KEAA 4BP8A 1VJ5A 1YAJA 2QMQA 5JD5A 4Y7DA 1AX9A 4WFKA 5I8PA 3I2HA 5JANA 3DD5A 5KBYA 3W9BA 3V1MA 1CUCA 1CUWA 4TPKA 2XUGA 4UBLA 1GPLA 5HFNA 5EGNA 4HXFB 5SYMA 4BCDA 3Q0TA 1FFAA 4Y2SA 5JAPA 1MX5A 2JF0A 2VJBA 1BU8A 6YASA 5CH3A 3TEJA 4YASA 3VJMA 1KU6A 1T2NA 4Y2RA 2OCLA 3AUKA 5DTIA 3IBTA 3QM1A 4LXGA 3H1BA 5JATA 2V98A 4E46A 5HZGA 3I1YA 3CCCA 3H2GA 2QUBA 3I2GA 3D2BA 4PO3X 1CLEA 4FLMA 4EBBA 4FLFA 1ORVA 3A2MA 4W1QA 4BAGA 4GHWA 1GXSA 4OYLA 3R41A 4G8CA 4B0OA 5K5EA 2ZSIA 1UOOA 3BIXA 2BCEA 3ZI7A 3CN7A 4W1PA 2P8SA 3AJAA 5A7HA 3IULA 3WKAA 2XQGA 3FLAA 3VISA 3GUUA 2WFLB 3WK9A 2WG2A 4FOLA 1H2XA 2WM2A 4GDMA 2C5FA 1WCYA 3DYIA 4W1RA 4G5XA 4Q1VA 1W4LA 1QTRA 2C58A 5LYYA 1Q83A 1DTEA 5ALKA 4YX9A 5T4EA 2WHPB 3HEAA 3G9ZA 4KAJA 4DGQA 2XQKA 4RNCA 1EXWA 4OD0A 2WUGA 1GZ7A 2VJCA 1UZAA 4OYYA 1XZGA 5K3FB 1MN6A 2HRRA 1ACJA 4X90A 1Y7HA 4LXIA 3BDVA 1CR6A 3DS8A 1KEZA 3WK8A 3ED1A 2ACEA 1LBTA 2B61A 1H2ZA 1DWOA 1THGA 3O9VA 5JAOA 5K3EA 1LPAB 4DYHA 5CH8A 1HKHA 5SYNA 5A71A 1K8QA 4B80A 3KWJA 2HDWA 3G9XA 1LPNA 3GZJA 4G4GA 4B85A 2WSLA 3FCYA 1JT2A 1QIKA 4DSZA 2AJDA 3AFIA 3C87A 2QOEA 5AI8A 2DR0A 4YK7A 3WA6A 7YASA 1BN6A 2OCGA 2O2GA 1EB9A 3WWEA 3RLIA 2WILA 3DL4A 1XZIA 4QA9A 3V1LA 4L9AA 5K3AA 3E4DA 2H1IA 1CV2A 5AI9A 1HLGA 3HLKA 4BE4A 5FKJA 3WYNA 3CCBA 2QTBA 1AQLA 3PF8A 2V96A 2BAGA 1XLVA 2WKWA 1MAAA 3G7NA 4X71A 2XMGA 1VZ3A 4MEBA 4CFSA 3DYVA 1TQHA 5CT4A 1XZDA 5EHQA 1W52X 4BZZA 4B0PA 4WCVA 1ORWA 1QONA 3ILSA 5AM2A 1X2BA 2D5LA 2YYSA 3FSGD 1WPRA 3QMMA 2YASA 4MWSA 4CG1A 5IVIA 1Y37A 5ALLA 3I6ZA 5CURA 1CVLA 3C6ZA 4FHZA 1F0NA 1MO2A 3DKRA 3GELA 1RWQA 1VXOA 3C43A 4QWMA 2JGIA 2JGKA 4HXGA 3AZOA 3BF7A 2GZSA 4RE6A 1PFQA 1CUYA 2JGEA 5AKLA 2AJCA 2ZYRA 3VXKA 5KREA 4OB7A 4ITVA 5JASA 2G5TA 4H7DA 1CQZA 2CJPA 4FKBA 1MT3A 4X7BA 1CUXA 4DLNA 5AKGA 1XZMA 4X6UA 3ESDA 3ZLUA 4JEIA 4ARAA 4X94A 4BE9A 2C0QA 2X5XA 1FFEA 4X91A 1MX9A 1EDBA 1K5PA 3O4IA 4E14A 1L7AA 2WFLA 2LIPA 2ZYSA 4QDOA 3F98A 4RPCA 4JYMA 1OILA 3I2FA 1MAHA 3UUFA 2WFMA 2I3DA 2HIHA 4E11A 3LIIA 2H7XA 2PSHA 3H17A 4QEKA 3SWWA 1DU4A 2XI4A 4H77A 5ALJA 3NWOA 4HVTA 4IQ4A 4OB8A 2WJ6A 4N5IX 4IHAA 3R3XA 3WWCA 1L7QA 3FCXA 2HHAA 4QLOA 2Z8ZA 1WB4A 4X00A 1H22A 3YASA 2WJ4A 4WY5A 5AHXA 3OG9A 4H7JA 1VXRA 2OGTA 1QOZA 1R3DA 3KWFA 1G42A 5AKIA 1WHTA 2WUFA 4GW3A 1LBSA 3DCNA 1HL7A 3WWDA 5ALOA 3PUHA 3WKEA 2B4KA 1XFDA 4B83A 2XQIA 3LIPA 5A6VA 4K5QA 4Q3OA 2PUHA 1R9NA 3O95A 4B9AA 2OGZA 4DTCA 2QT9A 5AI5A 2PVSA 3EIOA 3QZUA 2R8BA 1QIHA 3D4LA 2GYUA 2XUPA 3R3ZA 4Y2XA 3LP5A 1JMYA 1JFRA 1IUPA 5FOQA 4HXEB 1TCBA 5JADA 1LPMA 2G4LA 3FNBA 3NUZA 2NW6A 1W75A 2HU5A 1YB7A 4ZI5A 4ZREA 5C8VA 2QXTA 5HQ3B 2JEYA 3R3YA 1Q84A 4W9RA 2GZRA 3STWA 2WUDA 3IUNA 2OCKA 4PSCA 5ALXA 3EF3A 1E8DA 1XLWA 5LIPA 1XKTA 5C8XA 4AX4A 3C70A 3OOSA 2XUFA 1J2EA 2O2HA 1WB5A 2VSQA 1W1IA 1CQWA 5DNWA 3TJMA 5BV7A 3T52A 1XQWA 4GI1A 4L72A 3DLTA 3EBLA 4H7KA 5H3HA 4DNPA 4PSDA 1XRRA 3RK4A 3DJYA 4B6GA 4ZRDA 1WM1A 4H7IA 3QH4A 3QBJA 5CT5A 4BTLA 1U8EA 5FUMA 1TCAA 5ALHA 1G66A 1VLQA 4MXDA 3MUNA 4W1SA 4UBJA 3OTQA 4EA6A 2FX5A 1THTA 3HC7A 1ZD5A 1AZWA 3ZPXA 2Y2VA 3AIKA 1XZFA 3DDUA 4J0HA 2DQZA 5C8ZA 4AZ3A 1A8UA 2WHPA 3HXKA 4IH1A 2HM7A 5AM1A 4JNCA 4FNGA 1LZKA 3R3VA 4OU5A 2GBFA 2ACKA 4KYVA 2VA9A 1YAHA 5AKHA 4IO0A 4ZXFA 3ICWA 2XDWA 1JKMA 2O7RA 4KAFA 1BN7A 2I78A 4K6KA 4B82A 2OAGA 3AIOA 3X3HA 1WPXA 4LYDA 4DSAA 1UKAA 4BAZA 1GT6A 4C88A 3H0CA 5CXXA 2DCMA 4H7FA 1H2WA 5LKRA 1EVEA 1JU4A 4J0IA 3K6KA 1XZKA 4G1FA 2BFNA 1BROA 4M0EA 3JYHA 3D2AA 1YSCA 4HRYA 4OPMA 3I1IA 2ZJFA 4HTAA 4M0MA 3N0TA 3L1HA 2XQFA 2YXPX 1O6GA 4QDXA 1CUZA 2XUDA 3D3NA 3G0IA 3BJMA 3S8YA 2Y1KA 4J3JA 2G63A 2WQZA 2PSFA 2JBWA 1QTIA 2QUAA 1EDEA 4A5SA 4AXBA 2ZJ6A 3MUOA 5CXUA 4DM7A 4DMCA 1DT5A 1EK1A 3G0GA 1MX1A 5JZBA 4H7EA 2BGRA 5D3ZA 2IITA 1CUUA 3WA7A 3PDCA 1QE3A 3IURA 1BEZA 4WFIA 5EFZA 1ODSA 5HF9A 1ZJ5A 2DHDA 1CRLA 2WJ3A 2QJRA 1CUEA 1MU0A 2XQJA 3R40A 4UBKA 4N8SA 3FBWA 2BUBA 3W04A 3H19A 3V48A 3C5WP 3WWOA 5CMLA 1UKCA 3TGLA 1L7RA 4EB0A 5AK5A 1I6WA 3VJKA 5C7YA 3L1IA 1QO7A 1GPKA 2J3DA 3JW8A 2WIFA 3OC0A 5E4JA 3H18A 4BZWA 1W6RA 4F5ZA 1LPBB 1K6EA 4PSUA 4XIIA 4BAUA 5LZ4A 5LKAA 2PL5A 1ZGBA 3ANSA 1QO9A 2HRQA 1W76A 1FFCA 2XUHA 1USWA 1EB8A 5ISMA 4AO6A 4P92A 3LS2A 2C4HA 3PI6A 4BRZA 3F96A 4Q05A 3QPDA 5JARA 1HDEA 4C01A 1WOMA 1ZIXA 3DNMA 5KWJA 3W9UA 3M81A 1F8UA 3AZQA 5EI5A 2CKMA 2XUKA 4Q82A 5ALFA 4ZV7A 3R0VA 4X92A 3H2IA 4BDTA 3TRDA 1AKNA 2QJWA 2GYVA 3IB3A 2RGUA 5HF6A 2H7YA 2PU7A 3ESAA 1QIIA 3QMWA 5AI6A 2XLCA 3WK5A 2ES4A 3WI7A 4GBGA 1JJBA 2WFZA 3E3AA 1J07A 2VJAA 1H23A 4ARBA 3FYUB 4UHEA 5AJHA 3WL5A 2XE4A 2DHCA 5C81A 5CBKA 3SX4A 3AILA 1CUAA 3V9AA 1DQYA 2Z8XA 4BC0A 5ESRA 2FUKA 4WFJA 3LCRA 4AMYA 3E1GA 3U1TA 1DINA 4Q34A 1SC9A 4DNQA 3GBSA 3DQZA 4PQEA 3C5VA 4UHBA 2GBGA 5DWDA 1EHYA 5F4ZA 5E4TA 2ZJ7A 3ESBA 4UBIA 2QS9A 1XRLA 2WHRA 2EDAA 2ZYIA 1XLUA 4AN1A 5AK3A 2XMQA 5BWBA 4G9EA 2J4FA 4YPVA 3Q8WA 5A7GA 2QM0A 4MYSA 1XQXA 5BOVA 2R11A 1LPOA 3FAKA 4P9NA 4N8EA 4UHHA 3FYUA 3O4JA 2I03A 1YR2A 5CW2A 1BRTA 3LLCA 5HKAA 4MJ3A 3P2MA 4KE8A 3WLAA 2HA7A 4OSEA 3STVA 4QE3A 5EIAA 2XLBA 2HA4A 1B41A 1U2EA 2RI6A 5HQ3A 5JD6A 1LNSA 5T4FA 2VEOA 3A70A 3M3DA 3BE8A 3FWHA 2XMCA 1YS1X 4BATA 4EY5A 5EHXA 3PUIA 4UPDA 4FFWA 4FBMA 1EK2A 3FYTA 3JWEA 3DKKA 5LZ2A 3I6YA 5FPPA 2WG0A 5AOBA 1GQRA 4C89A 3G0CA 3BL8A 1AMNA 2HU7A 3D59A 3I2KA 4P08A 2QXUA 2RIPA 2ROQA 4D9JA 1BEEA 4KRYA 5LP1A 1X70A 4OB6A 3KD2A 4B81A 1UT6A 1A7UA 4AZ0A 3PFBA 3NOXA 5A7FA 1UKBA 4C6HA 5JALA 4ETWA 4XX1A 2WG1A 3F9CA 1BCSA 2GYWA 2WUEA 2OAEA 2VATA 4X3CA 5LZ5A 2E3JA 1UXOA 1HQDA 4X85A 4IH9A 2Y6UA 4QWWA 5DTJA 5AI0A 4F21A 1XRMA 4X6YA 2PX6A 3PFCA 1UWCA 3WKDA 4U2BA 3QYJA 1ZJ4A 5CH5A 5ALVA 5ALMA 3O4GA 4KE6A 4QDUA 5AIAA 2RAUA 2Z5GA 5AM0A 1UK6A 5E4YA 1CEXA 3WMRA 2RONA 4HZGA 2DQYA 1N1MA 2XUJA 2XMDA 2PSJA 4H7HA 5I9IA 5I7UA 3B5EA 4RE5A 4Y2UA 2W6CX 3QITA 3WL7A 1VZ2A 1QIMA 5JAUA 2WTNA 1G5FA 4UFNA 1M33A 3CN9A 4U2FA 3PICA 1IZ7A 3U0VA 3C6YA 3STUA 5CRIA 5ALYA 4BVKA 5D6OA 3E0XA 5ALSA 2QRUA 1VA5A 1XZCA 4GECA 2BGNA 2ZSHA 4J03A 1GGVA 1GKKA 4FMPA 2J3QA 5AICA 3ICVA 4MEAA 3DOHA 1VOTA 3H2KA 4MQLA 3QMVA 4AB1A 3FLBA 4GXNA 4KE9A 5FDFA 4EHBA 5DNVA 1XRQA 1U4NA 4WJLA 1CIJA 4AMZA 3WIOA 4G4JA 4UBNA 3S2ZA 4AQDA 1LGYA 1XQVA 1TK3A 1ZD4A 3RM3A 3QVMA 4TVKA 3L1JA 2XUIA 4KE7A 4BTVA 1XQYA 4K6HA 1ZICA 1PV1A 3AINA
chains in the Genus database with same CATH superfamily
3B85A 1P5RA 2IXGA 3B6MA 4MA0A 3ICPA 2EEPA 1EDOA 3LFHA 1TKBA 1XRNA 1FS6A 4RW0A 4JY7A 1Z0UA 4JFAA 1RZVA 2PWPA 4UM7A 2ZWMA 1C30A 4HFMA 3GNSA 4NJMB 5SY4A 2VCYA 3RTBA 5IAOA 3SX2A 1E3LA 1NULA 3WKCA 4QECA 1KSHA 3DF7A 4K2AA 4Q1DA 4BVJA 4RA6B 1FBTA 2QX6A 3QPAA 4LX0A 2NO0A 1FCJA 1WZCA 1Q6ZA 1B76A 1UC8A 2PIDA 4HUTA 4Y2JA 4L6IA 4PNHA 2IT1A 1UWKA 2CVHA 1HRDA 4B7ZA 1TTTA 3EC7A 1ZCAA 3CISA 4GPTA 2J7PD 1UM8A 2GPYA 3P52A 4WJKB 1QE5A 1N5OX 2ET6A 4N5DA 3NQ41 3B12A 3JQ7A 2B94A 4IIYA 1R5BA 3A14A 2CBZA 2VRBA 3ENZA 4L0CA 3ZGVA 4WBSA 5F3RA 5LQSA 1Z5UA 2PBLA 4HX5A 1G9SA 4WUVA 3KSMA 2OUKA 1K86A 4CT5A 4EG8A 3QK7A 2C96A 1QR6A 4LQLA 1G4HA 5KQPA 1NKTA 1TQ4A 2HLPA 1BTOA 3B1VA 1NQWA 5JJKA 1TCCA 3UCXA 3CZQA 1P1IA 2F3UA 4NE7A 2DM6A 1UBUS 4QREA 1P0MA 5F73A 1WD5A 2GK3A 2ZEJA 4F9FA 1P4RA 5CDSA 3MINB 4HFNA 2G06A 2AHOA 4ZZIA 2VJMA 1GYPA 2X0RA 1DNPA 4ZGGA 2W83A 4KQ9A 1I24A 3CG4A 4JI4B 2OZLB 2GBCA 2PYIA 1TW3A 2WHQA 1W85A 3OP4A 3RUCA 2PJDA 3LLSA 1UC9A 4DLLA 1PVOA 1JEQA 5AKJA 3RIEA 5PNTA 2XMRA 1LBQA 5HUQA 1Q0ZA 2C7QA 4LRXA 5BVGB 4HP8A 1E4VA 2POQX 4ND4A 3HXTA 4OXIA 2A58A 4M0PA 1U6JA 4GKVA 1OCEA 4RV5A 3OOJA 4PINA 4BU1A 1SPXA 1P2UA 1PAUA 2BMWA 2G9UA 1JR3A 2D62A 4U2DA 2VQFB 2OO3A 1T1SA 4TT3A 2LDBA 1R4ZA 1BH6A 1IU9A 3UYLA 4HHEA 2OFFA 1NGSA 5BYAA 2SHKA 2ZPAA 5LMUB 1E2HA 3IVMA 2R6AA 1U8YA 1QHIA 2L82A 3KB1A 4MYHA 3IS3A 4EL0A 2PH3A 3CRRA 4BZXA 3L41A 5FOSA 3KT6A 1E3SA 1A4IA 1PJ4A 1V26A 2JH3A 1KZ9A 4ZVSA 1IUOA 4RF5A 4RCZA 3JYQA 1J23A 6REQA 4GXQA 3QOXA 5HCNA 2K2WA 5TQJA 3CZMA 4L9WA 2A57A 3QKUA 4Z7OB 5C5DA 2QN1A 5CT9A 3JPWA 5LDGA 3LPMA 3GD7A 2IPAB 2YUTA 1N5LA 3CURA 3K72B 4MX8A 5I9MA 3TIFA 2PUEA 4OLHA 2AZTA 4I19A 3V32A 4OCZA 1EG2A 1G63A 4R5HA 2VQ6A 1FQKA 2ID4A 2V4UA 5A2GA 1GGJA 1YS2X 2GZ2A 1L4FA 3BCUA 5E9JA 1US8A 3TSAA 1QJ4A 3UA3A 4LXTA 2D8AA 4NHEA 3VHLB 1Y4ZA 3H6HA 2ZUEA 3RWMB 3NVKI 1QUFA 3KU4A 1A3CA 2YQ4A 4BEWA 2D0IA 3VU9A 1SQ6A 4E15A 1DEKA 4K3UA 1UBLS 4ZVNA 4K6MA 1UDAA 4CJXA 3N53A 4Q4HB 3GPIA 4S3MA 5JCOA 5KJCA 3EXAA 4JT4A 3BWXA 1J0AA 2G8NA 2WE8A 5AT1A 1EH5A 3RC7A 1Y9EA 1DFHA 2MHCA 2JFPA 4RH3A 1PKXA 2IX9A 3UJ7A 4FYKA 1KDOA 2HSZA 1W44A 1FUYB 2FJ0A 1DJLA 1KGDA 2QTHA 3QX7A 3EOAI 2C4UA 3EDYA 1L3IA 3WSWA 4EH1A 5A06A 4WVFA 1ZC4A 2QTWB 4BO9A 3DP7A 2I76A 4N41A 1ZMOA 3I09A 2ST1A 3BCRA 1T0JB 2AI2A 1TKAA 2EBFX 3O93A 3SJUA 2PN1A 2Y3IA 5BMVB 1AMOA 3KAKA 4K86A 1EFVA 2I2AA 4CLXA 2A4KA 4O63O 1G20A 1NAHA 1NN3A 2EJUA 2OO5A 4FGJA 1G21E 2H7CA 4UULA 5BQOA 4JBXA 5AOVA 5EINA 3A1NA 4K9OA 1GUYA 3VR6D 3ZLBA 2UZ0A 3OQIA 1B8NA 3ZZUA 3D54D 1F0PA 2G77B 3PCRB 4UM5A 4IDEA 1O9GA 2W2XA 3TAHA 5TB5A 4M60A 4OUKX 3AX6A 4GMXA 4QUGA 4M9QA 4QPZA 4H15A 3PRYA 4IDQA 4WZBB 3TN7A 3TX2A 2DETA 2AQ8A 4V2UA 3V1KA 5EESA 3LVFO 2X13A 5DDIP 3UQYS 1T8WA 4DZRA 2IQIA 2HA6A 1J39A 1IDOA 3VAAA 2N9UA 5HKKA 2ZLBA 1X77A 2HLHA 2WUVA 4CN9A 4FU0A 1SA0B 4QM6A 3D7NA 4JWTA 3CGGA 4RIHA 1AUPA 2BFCB 4GUAA 4ZALA 3UV7A 2FLVA 3ELBA 4QDTA 3GT7A 4ZOLA 4F60A 4F4CA 5KZMB 1R5NA 1N0IA 3OT1B 3QJ5A 5C5CA 4RFLA 1Q3TA 3WYDA 1DWPA 3KYJB 2O9JA 1ETHA 4F56A 4IBOA 1PJCA 3N2EA 1DLJA 3AUXA 4KXXA 3R5HA 2IVFA 4Y6PA 3CX6A 4FFPA 1NYLA 1W4CA 2PZ8A 4ZC1A 2W8BA 4UARA 1XCJA 3HUEA 3SKYA 3WRVA 5JDIA 3HKDA 1U11A 5L3QA 1M1YB 2OCYC 1XQ1A 4M1YA 5F98A 3OZTA 4D5GA 1KIAA 5E7IA 4L07A 2QROA 4IDHA 1C1DA 4Y0VA 1WBDA 3GLQA 3MWYW 3ROXA 3DT8A 1TL7C 4TRMA 2OKGA 1DIOB 2ZTMA 1Y3FE 1SUAA 3EZ6A 1NVBA 5CGQB 4FEAA 3H1AA 2OQVA 4D9CA 4E31A 1U0EA 2XYQA 4ZQBA 1O97C 4D3FA 3RRNA 2AJLI 1ESZA 3BULA 2C2HA 4PG4A 2Q4DA 5CW1A 3JASA 4KQJA 1Y34E 5ALRA 2JIQA 1FP6A 1QHFA 1RPTA 4J1TA 4AQYB 1U5BA 4F72A 1R37A 5ALTA 5KTNA 3T5PA 5EIOA 4JMPA 3BWVA 5CCXA 1GKIA 4FI3F 2F3PA 3KV3O 2EQAA 3K9FC 3EQ9A 1J09A 4PGMA 2VNKA 2ZJ2A 1R0CA 3FJ1A 2ZG6A 4R8RA 4D5EA 1K5HA 4K6FA 2LPMA 2QZPA 3C4VA 3KPWA 3NDIA 2ZAMA 2ABWA 2BKLA 4B6JA 2CDBA 2WTXA 4EDHA 2XJ4A 1TECE 4AKIA 3BQ9A 4BB0A 3K09A 1R9MA 5CFZA 3IQHX 1HO3A 1G5HA 2XIQA 4MIYA 3CRW1 1Z0IA 2H48A 1C14A 2RH5A 3EGWA 5T7BA 3OTOB 1EP1B 2JVKA 1FNNA 2A5LA 1GO2A 5L9AA 4EZIA 3KOZA 2WD8A 3ROGA 5A4JA 2PSSA 4BNIA 4OYRA 2B34A 1MXFA 4XR4A 5G3YA 1JR3E 3VVMA 2ZBGA 5L3VA 4WINA 4NS1A 2WM9B 1K0UA 4TZ6A 2IW3A 5EE3A 1KK2A 4JYBA 3DW1X 5FBVB 1SVNA 2KPOA 2WAOA 1YCDA 3LL7A 3OAAD 1YRYE 4M8LA 5DYTA 3E2PA 2HFJA 5C7IO 1HZJA 1N2HA 1G21A 1LV8A 4A3SA 1JUDA 4YAIA 3KCQA 3PF9A 3TXXA 2NTNA 4QELA 1YI1A 4JN6B 2CFCA 3DQPA 4OYHA 3CYFA 3BXZA 3R5XA 1G7SA 1ZH4A 2OESA 2M98A 1WUYA 4Z2AA 3BWCA 2Y0PA 2VK4A 3U1BA 3GEPA 1FYEA 4HDSA 2XEXA 4WKGA 5A9SA 5JFTA 3P0HA 4WCFC 3U44A 3DHNA 3GLFB 3K9BA 1SNYA 4IX1A 1NTOA 1U1IA 3FPFA 4GVLA 3GCXA 3HJUA 2V74B 3INNA 2QQ0A 3B6IA 4ZQCB 3MXTA 3N6RA 2A1UA 1RLIA 1E1NA 2J0UA 3HJHA 4S2UA 4QUJA 1Z68A 1DSSG 1SXJE 2IYSA 4K3VA 121PA 4HNUA 2ZJ0A 1BXGA 1W1WA 3PK0A 3CVVA 4FM9A 1I3LA 4ETNA 2Z09A 3PA8A 2HJGA 3RR2A 3ZK7A 2X15A 4O33A 1EUQA 1ACMA 2R1ZA 3MQ2A 2ZRGA 1HYBA 3MB8A 1IJBA 3A6ZA 2R6DA 3U5ZB 5F33A 1FVFA 3MGGA 4RTMA 4PQFA 3HXMA 5JY6A 3B8HA 4TV8A 3VC3A 1IOZA 4D9BA 1WA5A 2XVZA 3FPGA 2IU6A 3GYGA 4ZOAA 3A9RA 2PSDA 5FJJA 2X0NA 4KFTA 3HZRA 2FDCA 3FWNA 4O4JA 2JFFA 5HE9A 5CG1A 4NI5A 4D4KA 3IDOA 4UBMA 3ZWAA 2X5OA 5ADUS 2ENUA 3T54A 4EYSA 3WKBA 4JLSA 4D3ZA 4DT1B 3PVCA 1CIPA 2GXAA 3EIWA 1WZEA 4R2HA 5L4LA 3IVRA 2OG1A 2WMDA 2HQBA 3I9MA 2VBIA 2VZEA 1SIBE 4IYJA 4I8DA 3ILHA 4IVPA 4ENVA 4RZSA 1J90A 4G0NA 3D3JA 4UHCA 3RWOA 3AWDA 4CM9A 1SCIA 3KHUA 4HS9A 1XMOB 1PWXA 1W5BA 3LQ1A 4GKBA 1FRZA 5KNDD 2OBXA 1OHHA 4PZDA 4EI8A 1LWOA 3NFRA 1DHRA 4QOIA 1A5SB 1NW9B 1P4GA 4TMTA 3HYLA 2WIJA 3JD4A 4JH0A 4WK4B 4Y2TA 1FU7A 4LIPD 3RJ5A 3FOBA 1DFGA 4WK6A 2ZRCA 4JI5B 4PYJA 4P35A 3H5NA 3RYIA 3BJRA 1JHXA 3MELA 2F3TA 2AJBA 5TF4A 1D0SA 1JMKC 4CMEA 2YZMA 1B00A 4G9BA 3RJZA 1M5UA 1FXWA 1NT4A 4KHZA 1RM3A 1L1QA 3IUYA 2R84A 2ZVQX 3WLPA 5ITZA 1K8RA 4NK5A 5NULA 5JFOA 1P0QA 4I36A 3ML1A 1KQFA 3D3KA 3O47A 3AJRA 4ROTA 1FNDA 1W4RA 3EUAA 1E5TA 1X7YA 2FPLA 1YHYA 1KTVA 2FQQA 1ORTA 3HN2A 3KJQA 4YBZA 1F4VA 5KNCA 7AT1A 4LRWA 3M83A 4HAIA 4JXJA 4MR7B 3CLKA 4FGWA 4MVJH 3BORA 4NMXB 5EJAA 5JCPA 2KE5A 1TKRA 3M4ZA 5DISB 3RFCA 1RHKA 3ZS8A 2D1TA 1ISPA 4C2AA 1ZQ1A 3WGNA 1L4BA 4KXNA 3WQRA 5JCOC 2H2HA 4R8SA 1TZKA 1BE0A 3NOOA 2C98A 4TV8F 5FHQA 4H1WA 1BVHA 1VHJA 3QELA 1O5OA 5B1HA 4B3HA 2J9GA 3R0ZA 1V6CA 5TT0A 4WN9A 4F9TA 2CWWA 3T38A 1QIJA 3KKPA 1E9EA 3Q2OA 3AKCA 1M6YA 2XXJA 3CB2A 1MB9A 2DFKB 2REOA 4RIFA 3R7AA 3GA7A 3R5TA 4UHDA 3U40A 4G8DA 3HU2A 3KIPA 4IDGA 3O8OB 4EW6A 5TMEA 1PRYA 1UMCB 2CLFB 1GL6A 1PGNA 1Z3IX 2EW2A 4HX2A 5LOVB 4C87A 2BDTA 2DFPA 2OZVA 3HDTA 4M83A 4BCBA 4KR3A 1JT9A 3B9PA 4AIRA 2VFAA 4B4VA 2O3RA 2H4XA 1B73A 1MPXA 3CF4A 4J0GA 2O3TA 3I6MA 4UTVA 1FYDA 1XZHA 4DGSA 4F2HA 3N9IA 4Q24A 3Q7TA 2FB9A 5I7VA 2JIZD 1SA0A 1O6FA 2Q3HA 3PC2A 4PZCA 2C4MA 1XMVA 4Z49A 3V8BA 1U2RA 1R0SA 4MVCA 1D4ZA 4TXMA 2AQKA 4CM9D 4B47A 1P17A 5BSGA 4ZO4A 1KQ3A 1NNLA 1L4GA 4ZRNA 4F2GA 2B7CA 3L7BA 3SHFA 3UJPA 4PF1A 2GRUA 3C7DB 1N78A 1SULA 1T5TA 2QLTA 2ZREA 4N8DA 3BM5A 1U8UA 3HGMA 4B31A 4DQUA 5L95A 5KYXB 4JI2B 2H1LA 1FSPA 3IAM6 4WEOA 4RS4A 1NUTA 1VJGA 2DOKA 2J3EA 3QLTA 1YQTA 3DXFA 5JT1A 1KDPA 3DLPX 2Z83A 3N8KA 3LKDA 2A33A 1IQ0A 3IPXA 4R2MA 3A36A 4RUKA 5C3MA 4DHEA 2AFIA 3FNIA 3PC6A 3TBFA 4PX5A 4FOPA 4O5AA 5ECWA 3UFXA 5A6SA 4GMKA 2OPHA 4PXYA 3A2LA 3E9QA 4BMSA 3EZLA 1TF7A 3G8YA 1HXHA 2ZRIA 1ESEA 3GLVA 2UU9B 1GOTA 3E70C 3IDFA 4Q00A 1AKEA 5F3DA 1BEUB 3CC8A 2FK8A 3KUKA 3KB2A 5FF9A 3REFA 3GLUA 4JVMA 2KB0A 4N7BA 5D3QA 1NUQA 2AEFA 2A2ZA 4TQ9A 3TF5A 4F1KA 3DMFA 3KU1A 4CMKA 2OUIA 3LV8A 1FP7A 4KPUB 2QR5A 5IH7A 4PAWA 4FCTA 4Y9DA 3LCUA 5HIAA 1I1QB 5BVHA 1JZTA 1KC3A 2HA3A 4D46A 5HMMA 1U02A 3DZ8A 3THRA 4RZUA 3QXGA 4TUYF 2H1VA 4P83A 1CP3A 3AONB 4WY8A 3T12A 2D3WA 3V4VB 1YQ9A 4AO8A 3HM9A 3C8HA 3GLGE 1YA6A 4BVEA 1APBA 1UZNA 2J67A 1PNQA 3W8DA 3EPRA 2FPPA 4Q21A 5DYNA 3QVLA 3LX8A 5BORA 4O08A 3WYFA 4RQAA 1B1CA 2XSZA 1U4OA 2DT8A 1J4AA 1JPNA 5E6UA 4KPYA 4HLCA 1EK6A 4PXAA 4YAOA 2FMUA 4Z1MA 5C32A 3QLUC 2NP7A 4YJFB 4ZVMA 3GDGA 1O5IA 1DADA 3EGEA 1UXJA 3MJFA 1TGVA 4GZ6A 1QAMA 2P90A 1CUVA 4JA2A 4YEDA 2CEAA 3NBYC 5A9TA 1UFOA 3FDFA 1LNQA 3LY8A 3L7CA 4CQMA 4KCGA 4UAJA 1QIFA 4LOLA 1J8VA 5DBIA 1L2TA 3FWKA 3AW9A 1QYWA 5J3JA 5BUQA 1TAHA 4WCFA 1GTRA 2M9MA 4W5HA 3SVZA 4AUMA 3INYA 1C0PA 2P2DA 4PX9A 1B3BA 4M22A 2FQ1A 3CJQA 3FFTA 4MYDA 4CKBA 2X8WA 3L7LA 2ZE7A 4PYKA 2WWRA 5JD4A 1E3JA 2FG7C 2VDKB 3C6XA 4FMDF 2YYYA 3ETHA 4L2IB 4EPRA 1F4PA 1TD1A 3BWDD 4LHSA 2ZVDA 4UUOA 3TW0A 5BV1A 5BVGA 3M82A 1N0HA 1KK3A 2UVDA 4DDUA 2W2NA 4YAJA 4Z51A 5J47A 2OYCA 3AM5A 2AIRA 2G71A 4KNVA 3ZE9A 1HYQA 4B5LA 2MYNA 2PL1A 4WFQA 4ZT4A 2YVAA 4EGSA 1V6AA 2D0DA 3DWEX 2GA8A 5NLLA 3A3NA 4LVUA 4OMFG 2UYGA 1C7FA 4GOJA 1OROA 1RM0A 3ZUPA 4BVFA 1WSAA 2UXCB 2IV7A 5IKXA 3PGXA 3KZXA 1ZDMA 3SI7A 3OLVA 3LT2A 1U0OC 3L8YA 5DW0A 5KVSA 2RHWA 1XTQA 2OV6A 4L8WB 1UPAA 5TMDA 4NL4H 4TKLA 2GX6A 3AL3A 3ETDA 3NUQA 1S3IA 4CG2A 2IYAA 2VIIA 1NR7A 3HVRA 4DYVA 3MT9A 1E63A 2BFAA 2CNLA 2GCOA 2ZS8A 4U2EA 1C4KA 3T3PB 4TWBA 3M6AA 1CR2A 1XA0A 2GXQA 4TKUB 5HFAA 5KSZA 5KDDA 3UHFA 1E3QA 5I8WA 4RPHA 2RJNA 3KYCB 2NO1A 4TXLA 4C2TA 4D3DA 2RK3A 5I7SA 4U2GA 1FDOA 4U5QA 1WBJB 1Y5NA 5ALZA 1LU9A 1G6Q1 4DMUB 3L43A 3MWLA 5C3UA 1JLLA 5H70A 4FS8A 4WDQA 5C1IA 1ISJA 2R7MA 1IHYA 1QZ3A 4OQQA 1XZJA 3A1WA 4X95A 4EYEA 1F6BA 2VDVE 2XCLA 4DA6A 1EWRA 1ZJ6A 4TS4A 5IC5A 1BFUA 2OD2A 3JYPA 3QXXA 3IPAA 3OESA 4G36A 4X6XA 4CMCA 4NARA 4HMPA 2XMSA 4V1CA 1WHSA 2NLOA 1X1TA 4L51A 1QYDA 1KQOA 1NZJA 1AY0A 1NBOA 3IQWA 4KVGA 3VPCA 1AZLA 1XVVA 1AURA 2YXEA 2IEBA 2PLWA 2GWRA 3OLXA 1V71A 4MVJA 5HS6A 3RRZA 1FS4A 4Z0HO 3T7DA 5JDIC 1VPTA 2KHZA 1UUFA 3FF4A 2P9BA 4RKQA 2PDAA 1YCFA 3RTAA 2QYOA 1M6WA 2P7IA 1CEQA 3ZV7A 5GJWC 2OCPA 1VI6A 2ZYWX 3EN0A 5AKYA 4B6FA 4QBTA 5J5VA 4XSHA 821PA 1PL7A 3EQ2A 3TSCA 2CVFA 5F3WB 3KOXA 2MSWA 5JAZA 5JYCA 1CP2A 4N4AA 4HH1A 1N2XA 2FFHA 2VUUA 3H5AA 1QUEA 2QENA 3L7KA 2VDQB 3SIWA 3ZU6A 3ZHRA 2Q0XA 1AT1A 3JTEA 2FUG1 5KJFA 5F77A 2LWIA 2CLDX 2BFOA 4YJKA 1DAEA 1QG6A 4HPJB 5FP0A 1XSEA 3W5DA 1KYTA 2RGEA 1U1CA 2V03A 3A0UA 3HY4A 2V6MA 1ODTC 3BTVA 3E3MA 2QR3A 4MGEA 3S6JA 1IZ8A 3TDNA 4C0JA 1P4HA 3CJTA 3T1TA 4S1OA 1O0CA 1VMKA 2ODEA 3ZHQA 1MJHA 4X5OA 1PJLA 1WQ3A 1Z0KA 3STXA 2I4RA 2LBPA 4K46A 4Q5IA 3KELA 4P7FA 2Z3VA 1GTSA 1BMTA 3VBCA 4JJ7A 4UTZA 4CM3A 1I9CA 1P9NA 2M1XA 3BZWA 3HP7A 2EATA 1TU3A 3IVGA 2DKNA 4MOWA 5FXMA 4BU0A 1S2GA 3FTDA 5ITSA 3N07A 2QN8A 1WXQA 3PLAE 3HXLA 2WU0A 1WPGA 1JA0A 3IKMB 4CKBB 5JCJD 4QPDA 4GC9A 4W5TA 4PZPA 1RAFA 3OIVA 2CMKA 2LDXA 5A2QA 4KC0A 3Q3JB 2XUQA 3HJNA 4YRKA 1RZ3A 2O1XA 2G88A 1CEYA 2UXBB 1HT2E 2IJGX 4G97A 4FYJA 4CMEC 1V3TA 1T8PA 4JQCA 4ZJYA 5H02A 3MHTA 3PNMA 4AF7A 4AMUA 2R1TA 3QVVA 4IV8A 1V8BA 1ZIYA 6NULA 1Z4OA 4BX8A 1G21B 3PG5A 3WNVA 2GAJA 3WQHA 5GONF 3OY2A 4R9UC 4E5SA 3IDAA 4M8NE 1TVEA 2C0PA 2IEAA 4GAEA 4B6OA 5EHZA 2NN3C 5I7WA 4R41A 3THWA 4D4LA 1N8SA 1MJFA 3FW1A 5JDCA 4CEJB 1ZISA 5HEKA 5IVKA 1A1SA 2XY4A 1PFVA 3NEAA 3NRBA 4J91A 1QHEA 1SFRA 4CM8B 1YJXA 1Z6PA 1EVQA 3ADOA 4OMUA 3ZGYA 2ZZKA 4Z0PA 3N2ZB 4AWXA 3T94A 3I2JA 3NXSA 1A9RA 3WTCA 2P6RA 4TZKA 4F0JA 4LDRA 1CZRA 3T4UA 4UM9B 1SOMA 3VYSB 1AOXA 2HMTA 1JZQA 2J4DA 2EG9A 4HDKA 3U7GA 4HWTA 1ZL2A 2GHIA 3S0JA 3STTA 1L8XA 1IVYA 1RXIA 3NOQA 3FRIA 1XL0A 2NO6A 2PPLA 2EF0A 2WICA 4XA8A 2NZ8A 2VPPA 4XI9A 3WB0A 2JAPA 1JG7A 1BRMA 1ULTA 2BHSA 4ZPJA 2O1EA 2C3OA 3W06A 4CDRA 5GJBA 1C0EA 3O1LA 1HE4A 3ZDYB 1E1CB 1JZSA 2VG8A 3R5FA 2QVGA 1MNQA 5C7OO 2ENWA 3JQ6A 4EPYA 4BNUA 2VT6A 5FUXA 1KR5A 4NNJA 1H85A 2Y27A 4HQ6A 1FTQA 5L40A 3AGPA 1L7PA 1XXLA 5JVDB 1GZ6A 2QVLA 4R7GA 3WLMA 3UY4A 3B6ZA 4ARUA 5MFZA 1I3CA 4W99A 4UTRA 5JD5A 3L82B 4QM7A 4WFKA 1LTKA 1U3DA 5I8PA 2GLUA 4TQAA 4W5OA 5BRAA 2WUWE 4IAOA 5JANA 3DD5A 3DOUA 5L4NA 3PQFA 3V1MA 1JDNA 4GBED 3G2OA 1C7EA 2HQOA 3EXFB 3IV9A 4TUYA 3ZCVA 3VU3A 1L5GB 3W1WA 4TXNA 5JC8A 4TPKA 4OGGA 4RTJA 2A9QA 4R1OA 2PR7A 5IRCD 1GG5A 2AK2A 3ZJYA 4D3SA 5DLDA 4DUPA 4YAKA 4M1QA 1KHTA 2QD3A 1PHPA 2B3DA 3N87A 1QDLB 3WLIA 1MZPA 5DGTA 5HFNA 1S01A 4BNDB 5EGNA 3ZBUA 3HCDA 4KQXA 3ASYA 5JMPA 4K81B 2VPXA 3OC6A 1UAYA 4Y2SA 3KEQA 2FDRA 1HY3A 1Z29A 4JUDX 2JF0A 4TXJA 4WVLA 1MB0A 4E5UA 3HJFA 4G1UC 4HY3A 5BWNA 1UBJS 1K7YA 6YASA 5IM4A 1II8A 1N9GA 3PSAA 1ORIA 5DV9A 5AVJA 3KYDB 1Q0QA 3L6RA 3ND6A 4R1LA 3DUFA 3VU1A 1GR1A 5FWXB 1FSZA 2P6OA 1PR4A 1OA0A 2X8JA 2V7QA 3ITKA 3AUKA 3N2GA 3I3SR 3TE6A 3ZQJA 4ZICA 1PV4A 3ZLJA 1AGNA 3JQQA 4KP7A 3SGLA 3QM1A 2FMHA 3H1BA 5FR1A 4NBNA 3AG5A 2VN8A 3DAYA 3GJ4A 1A1VA 3I9KA 4UZSA 3TLGB 5FFMA 2EP8A 3CZ9A 2E87A 4DRZA 3VGPA 4Y0AA 1Y8QB 2I7DA 4F6RA 2Z6AA 3GGJA 4KUGA 5BSRA 1VMDA 3JVVA 5G0TA 2JLWA 4B46A 5EZQA 4LSWA 1AG9A 3NDBB 5J5AA 2HWUA 3HL4A 2GWHA 1ADJA 1E62A 2JAWA 2HKIA 2LZ0A 3FN4A 1X7WA 4OREX 4AJ9A 2OYSA 2OHJA 4BB9A 4MPJA 4A0HA 3GBPA 4DKJA 1Q50A 5FL7D 1SXJA 3H9EO 1YTUA 1FBNA 2Q5QA 4F8EA 1ORVA 1WEKA 2GOYA 1GZUA 2AVDA 4QODA 1E1MA 3QI2A 5FPSA 5L3SB 3EC1A 4GHWA 1EFVB 3DB2A 3EWIA 3LX4A 2OV3A 4YXWA 4DSUA 4LTDA 1GXSA 2XXAA 3DBLA 3KOMA 1C41A 3KEGA 4N39A 3LPDA 5LWQA 1VC2A 4WBNF 2QAGB 3G0HA 3OM9A 2SNIE 5F2EA 2X22A 2ZSIA 1UOOA 1RZRD 2B83A 1V1MA 4JGBA 4M87A 4YGXB 1X7HA 3S70A 3TJRA 1H65A 4I1UA 3QW2A 4W1PA 3KSUA 5KNBA 1TTPB 4IJVA 1Z6AA 5FEMA 4MI6A 1IE3A 4BN0A 1V2HE 2WFLB 4TXHA 2I67A 2C3PA 2V6BA 2QPAA 4D81A 1YMQA 3ZIAA 2V7XA 3OTIA 4PAQA 3LYUA 4MRMB 4RKFA 1WKVA 4XIFA 2GPTA 4HNSA 4GDMA 4IVNA 3CWZA 3OJ0A 4I1RA 4AQ7A 1WXHA 2DKFA 2APJA 2IEIA 2E48A 1N2BA 4W1RA 4P4SB 2WW8A 3BSFA 1W4LA 1P2VA 4CM8A 5KSWB 2JKYA 2XNDA 1QTRA 2C58A 1Q83A 1DTEA 1RI5A 2JLYA 3OE7D 3NGXA 4KX5A 5T4EA 1OIXA 1KYQA 3EWSA 4AX8A 3HEAA 2EP5A 1V9LA 1QHYA 3THWB 3C3XA 3A9WA 7ABPA 3N74A 2ZBRA 3V4SA 1DG1G 5EIBD 3VR5A 3OO1A 4R3UC 2QRQA 1VG1A 4TTIA 1E2FA 3IJRA 1HFJA 1WOYA 3QE9Y 3TI9A 3TB6A 3BDAA 1EPUA 3WQSB 5HPYB 4JA0A 3K6JA 5I7HA 3Q8XB 1AV6A 1H6AA 1Q6YA 4TRNA 4OLFA 5KTKA 1O5TA 5EXPA 3GJ5A 4X9XA 3UWPA 1OUMA 5K3FB 4M4SA 1QGOA 3BGIA 3SHTA 3AEKB 1T43A 3TZHA 3UWDA 3AKZA 4ZO8A 4DC0A 3FM9A 4YT2A 3ZU2A 1WCV1 4X90A 5L7WA 4LXIA 4XQEA 1EQUA 1TAGA 3Q88A 3L46A 3U3DA 3UGTA 5HIKA 2IPOA 4ZVOA 1NVKA 5JCXA 3SC3A 2X8LA 2XWQA 1KWKA 3DS8A 1D2RA 2G5CA 2VZ0A 1Z36A 4ZZ2A 3HI6A 1OJ7A 1H2ZA 5FI0B 1U3WA 1DWOA 4LJ5A 2P3LA 3LLMA 5CFOA 4CMGA 3QU7A 4P4TA 4BPRA 1EVIA 3WDLA 1K6XA 4JBLA 4EYGA 2UZ4A 1LPAB 2QF7A 3I45A 4AROA 4DYHA 3DHVA 1HKHA 2HCFA 1A04A 1Y4UA 1XK6A 2XZTA 1M2WA 4O8CA 1K8QA 2VK1A 4WXHA 5ESWA 4XQCA 3MT8A 4DWOA 3KCNA 3FOZA 3RYCA 1S4QA 4DR7B 2GQ0A 1Q16A 2EFEB 3PNVA 1NI4B 2D2IA 1LPNA 3PFHA 1Y48E 4W7IA 3GZJA 1Z25A 1M7BA 1Z2OX 4LNHA 3ONEA 4B85A 5ICEA 3V8RA 1RS0A 4YFYA 3CBQA 1O0BA 5CIQA 5EJIA 1ZU5A 2F1KA 2Q4OA 3ZIAD 3ZUGA 4BLPA 3F4BA 3PHCA 5DMHA 4PZAA 4NZOA 1VP3A 3OE4A 1IOWA 1QGUA 2BMVA 4HZIA 2ZYVX 3A9UA 4LSZA 4HRAA 2WY2D 1SXJD 4CDMA 4BNYA 3ONWA 5TPWB 5M04A 4PN3A 4C76A 1CQJA 4XOIA 1WPQA 2DR0A 3F6SA 4LQDA 4E5PA 1GARA 5E0OA 4JL5A 3VZQA 1JKJB 1RPZA 2IA5A 3S7TA 4UJ3A 2OCGA 3K0KA 3PEUA 4O4IF 1PTJA 3OCVA 3OETA 1TQ6A 2NTEA 3P9XA 2O2GA 3WWEA 2EFDB 2ZSJA 2VT2A 2X9LA 4FMDB 3QE2A 1P7VA 4KTVE 4ND6A 2W6IA 4P22A 3UB4A 3ZCRA 3RLIA 4XWYA 3WBFA 4IIXA 4FYVA 2J7KA 5FTJA 2MDTA 3KZOA 2IOFA 4J49A 3UXYA 1XZIA 2RG1A 1QGDA 3IMCA 4HEA6 3RFFA 5KTTA 4PWZA 3R6DA 4L9AA 2PKEA 3GGSA 1ZA1A 3WGYA 3HB4X 4GPEA 1L0BA 2ZUVA 2DFTA 5IWAB 4C29A 4BKOA 3EG9B 5DM4A 2BEVA 2ZAYA 4UZFA 1TQDA 3NZEA 3CY6A 4HH3C 4QGBA 4WXPA 3RG2A 2R79A 1KYVA 2OXIA 4KSYA 3PX7A 1ULBA 5AI9A 2CVOA 2HJ9A 4OV6B 1KXZA 5K0GA 1N9ZA 5FKJA 1GCOA 3SYLA 3TZ6A 3ASZA 2H18A 1ZCBA 3DMNA 2IYXA 1RXVA 2BAGA 1U7WA 3DOCA 3Q0IA 4PGAA 5KU7A 5D7NA 4MLCA 3SHVA 2I7TA 3B3GA 4MVJP 3HB9A 5IHXA 1SZDA 2NX2A 2PS9A 2Q49A 4JQOA 4OHUA 5LP6F 3BRWA 1P39A 1JEJA 3G7NA 5J2TB 2A0UA 4X1IB 3DYVA 3TDKA 1NT2A 1NYQA 3H7AA 5KX5F 5CX4A 5EHQA 2BH9A 1G59A 3AY7A 2ZSEA 4Q3DA 4F12A 2R6FA 4B0PA 4WCVA 5CB4B 2Q50A 4RVFA 4F9GA 4BMOB 1YZHA 1WU8A 2XB4A 2ZTSA 3RT9A 2YYSA 1XOIA 4MUYA 3OEYA 2WWWA 5DLQC 5AVSA 2VRCD 3R7BA 1ZNQO 1C3VA 1WPRA 3KEOA 4C4SA 3RYCB 1H94A 1KBQA 3ODGA 1OLXA 1QVWA 5K0FA 4GOXA 3VU0A 1N77A 3MOGA 4KUEA 2PO7A 2RD2A 3V8QA 1QFZA 3LC0A 2PKCA 3C6ZA 5CURA 2AKEA 1KZHA 2GESA 3LOPA 3DKRA 4HWKA 4RVHA 5HKKD 2IHNA 3H9CA 3P96A 3W2EA 3IUPA 3B2EA 1SO8A 1P2SA 2Z1DA 2GPAA 4FMBB 3FCUB 5JBIA 4BLUA 5ED4A 3EAFA 4HXGA 4CUZA 3Q9UA 4UAUA 4NFYA 5JXIA 3EXG2 4TWJA 3JWGA 5I7RA 4EJFA 3GJ7A 5B12A 2RHMA 2VZ8A 1XAJA 2VJQA 3T0GA 4ZARA 2WHXA 5L8VA 3FKSA 5HZMA 1Z0FA 4PRYA 2H4FA 3IOCA 4D8TA 5KYVA 4X60A 5AKLA 4NZMA 3L6CA 1SQ5A 1YZGA 2AJCA 3K0FB 4O2AA 4O2BB 3VXKA 1N75A 5HS4A 5IF3A 1MC1A 1RR6A 3MCAA 3NLLA 1LFDB 4N49A 4WLFA 3QW4B 1GRNA 5BSTA 4FGUA 2QUKA 1W29A 1QKKA 3I9V6 4H7DA 3LQRA 3OIUA 3DHEA 3T5BA 1GNTA 5FAXA 4Z4HA 1K6MA 2PRSA 3FPLA 3LUBA 1AKUA 2IX3A 1TVMA 2OV2A 1CUXA 3OQIB 1GU0A 3Q9SA 5CA0F 3V80A 5LM3A 1WY7A 1LI7A 1E7YA 1G20B 1MRNA 2IYVA 3GLKA 3JQBC 1HFEL 1NMZA 1O9HA 1VDMA 3OEED 2JI9A 4JEIA 4L15A 4L73A 5JSUA 5MDHA 2BGWA 2G1JA 3GY0A 3X1XA 1FL9A 3CLUD 4D9FA 4JMLA 1FDRA 3O38A 4S24A 3IFSA 3PXCX 1IHUA 2B92A 1SKUA 5DE3A 2NUTB 4KL8S 6Q21A 2W7TA 1U0BB 4EI9A 1J2TA 2ZE8A 1XELA 2C0QA 5GY7A 4JQYA 3MTGA 13PKA 1LXCA 1VTKA 2J87A 3IOMA 4L4XA 2GTHA 3S2FA 4YR7A 2NT3A 1SHKA 4KK4A 1GG8A 1LLQA 2WNHA 1EDBA 1JKXA 2VHWA 3EPKA 1K5PA 4HAWA 3GGDA 4E14A 2NU6B 2C7VA 3FTQA 4KPUA 5KOJB 1V47A 3WICA 1AXRA 4HB0A 4PLWA 4GOMD 3VU9B 4EX6A 1NW5A 1Y3CE 3WHPA 2N1MA 3URKA 1UFQA 1MAHA 1YZKA 3K1ZA 3EVBA 2O8CA 2O7SA 2AFHE 2WFMA 1G5TA 3QYAA 2GK4A 5K4HA 3JWJA 4MW6A 4TT8A 4E11A 3HUTA 4LY6A 2QAGA 3H17A 4PWYA 1RPJA 2VNAA 1L7BA 2XNHA 3PQ6A 3NBFA 1G8FA 1CHDA 3OY7A 1D8TA 3CUTA 5DT2A 4AUKA 2BJWA 3ANYB 1P8AA 1Q0SA 3HU5A 1U1EA 1ZUHA 2AK3A 2UZ1A 3MOIA 4IDCA 4W5QA 3NWOA 3W6UA 1K8ZB 1K98A 1Z4JA 2FWBA 1GUDA 1XTJA 1CG6A 4MARA 4OB8A 3Q15C 4PYLA 3RBAA 2GDJA 5JNUA 2DSTA 1GTZA 3FWPA 3NEPX 2HHAA 3ZZNA 1MHTA 4IQ8A 2QVCA 1RWWA 3VPFA 4QLOA 4YMVA 4KODA 2Z8ZA 2X8AA 1U6KA 1UFVA 3LL4A 2VTBA 4MUMA 2O23A 2QMEA 2JDID 4PHCA 3K4PA 1C1DB 1MIHA 1ZR4A 1R0WA 3BHIA 3C7CB 3F8WA 3VO8A 5C37A 3PNYA 3FYCA 4NU5A 1Q3KA 2G76A 2QMUA 1ZMRA 3FCEA 4P2GA 4R68A 3OG9A 2OGTA 4MA4A 1QH1B 3JD0A 4KN9S 5EPUA 5A4DA 3SFTA 3L05A 5A4FS 3KZCA 3KWFA 3LSTA 2GILA 1WQ4A 1Z9BA 4IFIA 1V8ZA 1AN9A 3TTUA 3IERA 1RBQA 4WT7A 2EZ9A 1WHTA 1QAQA 1QKIA 5IDXA 4DC1A 4IX9A 4DQXA 4WTOA 3N2GB 2XBUA 4NEQA 4ZMSA 4FEEA 5C35A 5JEEA 4GW3A 4B3MB 2HC9A 4FGLA 5AVKA 5KHLB 4IOJA 5FNZA 4PXSA 3UG6A 3SXUA 2YCBA 2ZAGA 3CINA 1XDSA 1HL7A 1Q7BA 5ED0A 1KSJA 1UXGA 1AU9A 3DKIA 3WKEA 3L1UA 1QCDA 1RWVA 1XFDA 3K6SB 2HN9A 1G8JA 1CWUA 2XQIA 3LIPA 5ER6A 3WAJA 4CM6A 1VB3A 3K9HA 3QF4A 2SKEA 4BGIA 5B30A 2CT8A 2VJMB 4AZ0B 1RKXA 2PCLA 2VRWA 5FBKA 2XCRB 2VP2A 4TWRA 3F73A 4YVFA 1BW9A 4B9AA 4EPWA 1IL0A 1J25A 4C0LA 2H00A 4KAXA 4JI1B 4L50A 3ZCPA 3WHKA 2D5IA 2QTFA 2XTMA 2ZR7A 3DMRA 3EZ9A 3JYOA 4JLOA 2ZTVA 4KB5A 4P0TA 3WVNA 1UZMA 1ADFA 5IANA 2MSLA 3UW1A 2IUTA 3HYNA 4Y6OA 1J8MF 5DGHA 3PFFA 2FSGA 2WKPA 1PJ3A 1UXHA 3D4LA 3WBBA 2FZLA 3MCZA 1L5HB 1C9NA 4FEGA 2XUPA 3PXAA 5EZ6B 2RCNA 4MCAA 3B3AA 3OCUA 3J80A 4ALMA 3SS9X 3JQ8B 2P8JA 1GRVA 3LDHA 3AJEA 2Q6KA 4WNCA 4E6PA 4PFKA 4XWKA 1JFRA 1E0AA 2XWSA 3HRIA 3QWHA 4MVYA 5BYJA 3S1AB 4N5NA 3R6TA 4AWBA 3ZZMA 5FOQA 4KO3S 4QQRA 1TCBA 2MCFA 3KJFA 4RJIA 3CRZA 3TTXA 3P19A 3KO8A 1LPMA 3OZ7A 3SMQA 4TTSA 4I3HA 5IEJA 5ICFA 1XCMA 3AU8A 4GSLA 3AF3A 4XQGA 3KOYA 1W75A 1JG3A 1YB7A 3PQ3A 4ZCTA 2V9PA 1CR4A 4A6DA 1KRXA 2QXTA 1KNXA 2W0SA 3G2MA 4DAOA 5HQ3B 3KKQA 2OT3B 3NAZA 2O05A 1GG9A 2D3TA 5TQVA 5AK0A 1BJKA 2V9CA 2GZRA 4W9RA 4FGSA 3HBLA 2REBA 2OCKA 1GPDG 1K3UB 1WMAA 4PSCA 4Q19A 4YCSA 2G7ZA 4NF2A 3V9PA 2NUTA 2WWXA 1XKTA 5CIYA 1ZKDA 1QH0A 2WAAA 4TN5A 4NMMA 5KC9A 3CG0A 2GCIA 2P9YA 4OUDA 2NO5A 6LDHA 5ENVA 3LG2A 4MRAA 4RZQA 2A35A 1PK8A 2MJLA 5KVVA 1RXWA 1NNEA 5JMTA 4NK4A 3B5IA 3TW8B 2ISQA 2B37A 4JDUA 3O8RA 1T4CB 3OOSA 5ELLA 1J2EA 4XD2A 1NVXQ 1UBMS 2Y76A 1ZJWA 2VSQA 4O4JB 1W47A 1OLUA 5GM2A 2X41A 4Q66C 5LN1A 2JRLA 2DTDA 3NOVA 1BAPA 1B16A 4KQHA 4YN3A 2KBEA 3RODA 3DZFA 5EXSA 5I9BA 5HVNA 2V65A 3OA2A 2B35A 3F5MA 2QRNA 1OX6A 3K73O 4RF3A 1WQ1R 1XQWA 2NZ2A 3ZLVA 2DUMA 5K03A 2GN1A 3V42A 5LDDC 2I80A 3HK2A 3DLTA 5H3HA 3TXYA 3R74A 1OQAA 4N40A 4PSDA 3RK4A 5JJ5A 1OJLA 3GO4A 4DR3B 3ISJA 3DJYA 1QFXA 3BOSA 4AZSA 5JQGF 3W2IA 5BMVF 1IJEA 2WD7B 1N9KA 2XR1A 2F1JA 1ADCA 2P30A 2RAPA 4FE3A 4JZYA 2JPDA 4R84A 3U31A 2YFHA 4Z7QB 4KLAA 3H3FA 3RSHA 3IEVA 1JJ7A 5CT5A 1NDUA 3TE7A 3A25A 3CBGA 3I61A 1G66A 4XFKA 4Y3UA 1TO2E 4EPXA 3KSBC 3MBKA 1RP7A 2YZ2A 3I04M 3L6OO 3Q4GA 4TV9B 4Y7CA 4URUR 3KFXA 3M6LA 3OZVA 4W1SA 3HNRA 3B3FA 3K4HA 1GUBA 4DMLA 4KFCA 5AVYA 4QJ5A 3DV9A 1BVYF 3VZBA 4DLUA 1RXCA 2XTNA 1I3OA 1Y1PA 1UT8A 1XQ9A 2Y67A 3M9WA 2RHJA 4XLTA 4ZAYA 1I10A 1Z73A 2I3GA 2GEBA 4MKRA 4UQPA 3E22A 5IYZF 4AZ3A 1QE0A 3B82A 1A8UA 3LZCA 5EPOA 4UU1A 2XCQA 4MJ7A 3DPSA 4RY2A 2RH4A 4XGRA 4P1ZA 1EWYA 3K0AB 2FA9A 4M55A 1L5LA 3ORYA 1P7WA 3JWPA 2HM7A 3BRQA 3GFVA 3GN1A 3PXXA 4KDEA 4RIIA 5BRJA 2EX1A 3M34A 1ANKA 3M6WA 3WNDA 4Z53A 2GEVA 1PWYE 2I34A 3B20A 4JNCA 5F2KA 4DVGA 3B6JA 5D3MA 2EP7A 5JNVA 1XLTC 3KB6A 4TYMA 2GI4A 4JB3A 1I6KA 2D6FA 5CYPA 1RLJA 4RKYA 1YH3A 2ASEA 1TF2A 2WVJA 4DJAA 2GBFA 2ACKA 2BEVB 3TFQA 3D8NA 3CTMA 2C8LA 1SB8A 3SF0A 4NZNA 1XN1A 5JAQA 4MULA 1EEXB 3A4LA 3QOYA 4ATNA 1KZGB 5AKHA 1Q7CA 1WCIA 1YONA 4B3XA 3PEEA 1GGEA 4I4LA 1E7WA 1G38A 1PUJA 2ZW9A 2XDWA 1L4LA 2O7RA 2VP4A 4KAFA 4Q02A 2AI3A 1YRHA 3E15A 1E2LA 1QG4A 2P4HX 3BMCA 1E9BA 3FNQA 5EWLB 2CLOB 3SDBA 3DV2A 4JCOA 1XXHE 4YDSA 3OZFA 1KVSA 3SU8A 2I78A 5DTRA 3WRXC 2OORC 5TGDA 5CLIA 3PYLA 5BSWA 3O4VA 2GZMA 1SXGA 2YCLA 5JYDA 4AG3A 4UDNA 1DJPA 4TKUA 4WCDA 1H66A 4HEA1 1FVXA 2IU0A 1OX4A 1UKAA 5BP7A 3TM5A 1GT6A 3ZG6A 1EU1A 2PVPA 1HG1A 5JFGA 1DC5A 4OQLA 2OHVA 1NDHA 3OQJA 4K88A 1T1JA 4XW2A 2JJ8A 5IZ4A 3K9CA 1YDEA 3MWDB 5GGXA 1SVOA 4PPYA 1KEVA 4DLPA 3OMXA 4URYR 5LMNB 4GI2A 1XPJA 2HJWA 2H3HA 4JEHA 2C9ZA 1PN3A 4GVXA 1TGYA 2P4SA 1H2WA 4DDKA 1NJSA 2VNHA 1A96A 2ARKA 3M2TA 4QU8A 4NYJQ 4QDJA 1WABA 2L18A 1IXYA 1T2AA 5TF0A 4YRLA 1HFWA 3NIDB 4FR2A 3ZY2A 3U5TA 1XDDA 3I0ZA 3KTFA 4BO8A 3DR3A 3BXFA 1TJ3A 1J2RA 3MTAA 1XZKA 2CHGA 1JNYA 2CCGA 2GVZC 3PXBA 2ZJZA 3Q9LA 4MB2A 5FNVA 2OR3A 3RS4A 2TECE 3QY0A 1L5OA 1ICEA 4DM3A 1M10A 1XAHA 1V7QA 3D2AA 3H2BA 4DLTA 2VKQA 1BKYA 4U7PB 3STHA 4IGKA 1YSCA 1XI2A 4LYGA 5D2CA 5M7EA 3TG8A 4DR6B 4HB3A 5EMMA 4O6VA 4GYJA 5EEGA 2M6RA 2X40A 1XA4A 4ZVPA 1ZGJA 3GLHA 2FFRA 4HDMA 4LJ4A 2Z30A 3C0KA 5JMOA 3I1IA 4UU0A 4BQNA 4RZXA 4BLTA 3DBOB 4FYMA 4YRPA 5REQA 4DV2B 3L1HA 3A1SA 2YXPX 1TYAE 3RS7A 1IN4A 1OXXK 4HADA 3B7GA 1TO6A 5F35A 3RD5A 5DK6A 1QRAA 2J5XA 3LUFA 5BPHA 2NO7A 1USUA 2XUDA 3RUAA 2Q3MA 4RAQA 3RWBA 3S55A 3VSCA 3D3NA 4ZDKA 4F5EA 1KJ8A 4B4UA 4JENA 3WQQA 3E3LA 4YB8A 3BJMA 1I6LA 2AC2A 2BFEA 4J3JA 1MOSA 3U7RA 3B7PA 3RK1A 3BD6A 3R76A 1K4MA 3K1JA 3LA6A 2JLXA 2E21A 4F2PA 2PKRA 2V5UA 1B8VA 4HI0E 4PTLA 2HQSA 1JR3D 1DV1A 1YZVA 2WIAA 4EJ0A 2Y92A 4DIBA 4BB6A 5DULA 1DAOA 5DTQA 3VZSA 3PWSA 3E5RA 3PITA 4IHJF 2IDMA 3DEYX 3MUOA 1XHEA 2VBFA 4QBKA 3AB8A 4PRLA 2JVJA 3S8MA 2B1RA 4ZDIA 2NSJA 4YP9A 3DV0B 2E4UA 2SCUA 5JZBA 1B8OA 3CEJA 1RKQA 4REQB 5FBRB 2B2NA 2E85A 3E7WA 5FTMA 4MITA 1AQYA 2WJHA 1G291 1ZH2A 1ZX1A 3GFRA 5FI5A 2C9OA 3L0YA 3QLUA 1V48A 3L02A 5IH3A 1TT5B 3ZQ6A 4BBPA 1L5RA 1SOAA 3PNLA 3WA7A 2O8DA 1VSBA 2VP3A 3OWXA 1BEZA 8GPBA 3LWZA 4WFIA 4QTTB 4NKRA 4JLMA 2J85A 4TTTS 2M32A 1O8CA 4QUDA 1Q77A 2A84A 2JFWA 1TTQB 4QU0A 4MINA 3ZX5A 4BFVA 5U9CA 3L0ZA 4MVJD 2KJQA 1UKVY 3WB2A 2XQJA 5ITVA 3OKAA 1CDDA 4IIJB 3LUPA 3MM4A 3SMVA 3KHSA 5LPNA 4IHJA 1GLGA 2GAIA 3SOZA 2JZNA 4X1KA 3FBWA 4C43A 2BUBA 4R1SA 4EKIA 3V48A 3CUSA 4CM5A 1DRKA 3SIRA 2C61A 2Q4BA 3N2KB 1UKCA 2CXOA 4P7BA 1LS6A 5CMLA 4P3YA 2K6GA 2EIHA 3TGLA 2C5SA 6REQB 1AB6A 5IXYA 1GNQA 1S3SA 1VYTA 2G0NA 4HR7A 3V8PA 5JHGB 3TMAA 2YXNA 4ZCQA 4TLAA 2BONA 2VUIB 1T25A 5KVAA 4QGGA 3RAGA 2IF2A 1M75A 1QO7A 4JUFA 1GPKA 5ALIA 4KGXA 2VXCA 3KXLA 1JYSA 1G6KA 3BG5A 3LO5A 3OTGA 2AJTA 3FHTA 4W5WA 4HMOA 3COSA 1U81A 2VOEA 3HCOA 2BEWB 3IO5A 3DE0X 4A8JC 4ECAA 4EUHA 3BRSA 3P0EA 4HN2A 4IDOA 2R7LA 2NZYA 4TSRA 1W6RA 1XN4A 1YOVB 4NOKA 4PG5A 1YS6A 3X44A 3GT4A 5AVXA 4LW8A 2E55A 3GRUA 4A6EA 4D8XA 1JEQB 4NV0A 5DT9A 1F48A 3RQIA 2IF0A 2VPQA 4YP1A 5LOVA 4F06A 1MG0A 2I6QA 2AFIE 2OZLA 4JHXA 4CIXA 2P79A 4I9GA 4U6QA 4JYCA 4GOND 4H1TA 4JELA 3ZHOA 3NHKA 2Z56A 4OJTA 5EIFA 1PEAA 1C81A 3ZZ0A 4PHTA 4XZ3A 2JHGA 4HQOA 4F5YA 6CHYA 5K8IA 2G3YA 2IUSA 3K2EA 2XUHA 3K53A 1TU4A 1YI0A 4MW2A 4PAOA 5FPTA 1R4NA 3VH1A 4EB6A 3FYSA 3ZWPA 4OJNA 3UTCA 5B7PA 1HNWB 1UANA 3KYBA 4R1UA 3P8ZA 5FI1B 4TUYB 4N7MA 1LNZA 3BS4A 1IXSB 3ROZA 3UAXA 1N34B 1M1YE 3NTUA 2Q07A 1SHLA 5CDGA 5JXWA 4EVSA 3NWPA 4QICA 5DEIA 1P60A 3SFZA 4CCAA 2HLDA 3ER9A 4DB2A 5EUMA 3QPDA 1U9CA 5JARA 1HDEA 1AJEA 2WJVA 4PHGA 3HU1A 4B1FA 3ZE6A 4QBIA 3GIDA 2LIVA 2C2KA 3EVTA 1GA1A 4EPTA 4YDQA 5KWJA 1MC4A 2ZUWA 1G1AA 1TA4A 3TTSA 5F64A 3W9UA 1TNDA 1D2CA 3M81A 3UOAB 4LDPA 3DLHA 4F2DA 3W3AH 1JL3A 1YB4A 4WXRA 3KYIB 2XUKA 3G79A 4QUBA 3WGQA 4M9RA 3X1YA 3T41A 3KV1A 5T8KA 1NX6A 4Q48A 5C4GB 1DQNA 1QBKC 3OLQA 4G5QA 3F3MA 4RMHA 2A92A 2P3OA 3L4BC 1BSVA 4ZAWA 4BDTA 4RTPA 2H3EA 1H2HA 3E82A 1SVLA 3F78A 2IZ1A 2H0RA 2GYVA 2WWGA 4EI2A 1BXKA 1CS0B 1IONA 3ESAA 1NKSA 2BZSA 4DBLC 3RI3A 1XVLA 1Y6QA 2IUFA 2NYRA 5AI6A 5BQ3A 1WF3A 5J40A 1KPHA 3CSDA 1OH5A 1NJ1A 3EC2A 1SELA 2FE1A 4BKQA 3CEAA 3Q6IA 1ATZA 3WI7A 4C05A 3M9LA 4BNKA 3COVA 1KI7A 3RS2A 3LF2A 4XYEA 2X5KO 3RJMA 2JCBA 4C5AA 4M0CA 3DT9A 5J4HA 3LRXA 4PPQA 4EM6A 2P69A 5IXJA 2J41A 5LMZA 1BYUA 1VKRA 3AHDA 3FYUB 4GR9A 4UHEA 4DSOA 4MS3A 1DDIA 4H1VA 3L4SO 2GF0A 4OQYA 3AM4A 4DS3A 4EJSA 2X1HA 2PMEA 3AILA 4F9EA 5C81A 1EM8A 3ROMA 3CF2A 1H0KA 2FUEA 2PGOA 4UNPA 5ULLA 1M73E 2ZTHA 1IYZA 2AQIA 3E61A 4KGVA 4YONB 3JAMA 3CVOA 1NTRA 1S2IA 2W4IA 1G2QA 3D8HA 1UPFA 4PZLA 3EVGA 1DE0A 1WG8A 4Z0NA 1F7VA 2MR6A 2X3YA 3PGLA 4FCVA 4X41A 1PJQA 2ZGVA 1KEPA 3V8MA 3E1GA 3PR2B 2O0HA 2IYEA 2QRMA 3RB8A 1Q0UA 2RAFA 2WPNA 5FPYA 4HGYA 2O8NA 1E3WA 3ELYA 1HV8A 4ENQA 3GPDG 4Q3AA 3HCWA 2IYWA 4Q3NA 4XWAA 5CUQA 5IAGA 5A3VA 5SZHB 4NV3A 3A1EA 4PS1A 2O3SA 3T15A 3VYVA 5DWDA 1TDJA 3OJEA 2GFHA 3BFXA 3OZIA 5E4TA 5J59A 2AD5A 5E8RA 3E5HA 3KZNA 2HT6A 1CR0A 1W73A 2NPOA 2OC4A 3BK1A 2XMQA 3KLPX 5EWMB 1COWA 1E58A 1QHHA 5LB4A 1K08A 1UBEA 2NZXA 4G9EA 4NRDA 1Q1GA 3C1TA 3FGPA 3LYAA 5AXAA 3GVIA 1W0CA 1M0WA 5DSZA 3DTVA 5C51B 3L3BA 3S7ZA 5IJ0B 3DC2A 1FIUA 1PQYA 4LG1A 5LLDA 2D5CA 1JQBA 1U7OA 2BEUA 5J2UB 2RGCA 3SQOA 5A5FA 5EGSA 3C4JA 2ZFUA 5K05A 1GP2A 2R11A 1N57A 1H8HA 2ZXUA 4UHHA 5GV7A 3IT3A 2DULA 3O4JA 4DZTA 2PGNA 2PUWA 2F8SA 4L7VA 1QU2A 3A6LA 5DHAA 3KQPA 3OIGA 4K6OA 5CIWA 1Z34A 2AZDA 3BB1A 1V11A 3OZWA 4O1IA 2QG4A 1KO1A 4RCVA 3DMTA 3EDCA 5KTSA 1KF0A 4XCVA 3QEJA 3TOSA 3WDMA 3WNBA 1UP4A 1V3VA 1M6NA 2IU3A 3STVA 4Q9LA 3HVIA 3O03A 4W8HA 4ZAXA 4JNKA 2ZUUA 3K2QA 3NAGA 3RS8A 1TK9A 2JH8A 3FJYA 2NQ8A 1X7GA 2I29A 4TS1A 3IOYA 5AUQA 1RJ9B 2A0WA 3HR8A 2AB0A 1K7SN 1HE2A 3FTNA 3GC6A 4KSBA 4ZYYA 1CY2A 1U3VA 3D6FA 4OXQA 2P2GA 5T4FA 3ZWVA 3AL0C 4AYXA 2DERA 3M3DA 1M6VA 3MMXA 3FWHA 1YZNA 3LK7A 4ME6A 4B7UA 5JI2E 4B3BA 1GRCA 4H6PA 2GTIA 4FFWA 4JBWA 4FBMA 5EJEA 3RYTC 5FH9A 5IJAA 1E7SA 3EY4A 5LZ2A 1SCUA 2BHLA 4I1OA 3Q40A 4XM2A 1BOFA 4KQGA 1J6UA 1GQRA 5TSDA 4C89A 2UYHA 2I66A 4O2AF 1V7CA 2YKGA 3KYCA 3OZEA 4G0PA 2EKPA 3IAAA 1KS9A 1TADA 2CK3D 2QGNA 2IYNA 3AL2A 3BIJA 3BL8A 1VFPA 3I2YX 2P4EA 2D5AA 4I2NA 3D59A 1AMNA 3I2KA 3FAZA 3IR7A 3O91A 4P08A 4GYYA 1V16A 5KJ1A 4KFRA 2FRDC 3IR6A 5EZ5A 4D9JA 1ZK1A 3RU7A 3VUFA 2JFHA 4IQFA 4RZIA 4MZXA 4UXJA 2I91A 4TYWA 3OJWA 1BDMA 1PEYA 3RVBA 2NU8B 3X1KA 1MABB 4JT8A 2P2CA 1XKXA 4PX3A 4YJHB 1XEXB 4YRDA 1E4EB 3DJFA 2G4CA 2VTEA 1G2PA 1UT6A 2HWXA 2W6PA 3KD2A 1ZBQA 4HZUA 4J9UE 1VPVA 1YL6A 2HIMA 4C22A 3OIDA 4ENSA 5L3QB 3HKDB 5AW2A 1BA3A 5INTA 1WZ2A 1WP4A 4FE4A 1PR5A 2HGSA 2QAJA 4MROA 2Y05A 4Q12A 1N6OA 3D7MA 4P4GA 3CVXA 3FYDA 3FSRA 3K0EA 4C6HA 3GJYA 1HK7A 5H5JA 3W4IA 4D80A 1II0A 5ILOA 3AGQA 3DG9A 4IJ5A 1KZ4A 2FEXA 5E2AA 3WSVA 1KFJB 5C5IA 3TG2A 1XMIA 2CNDA 5JI3E 3F9CA 5A5VA 1DGQA 4G1BA 2XYRA 1BCSA 4HH0A 4NONA 4WZAA 4EHDA 2HY7A 3R7NA 5BQXA 5KQGA 1P1KA 2WUEA 2OAEA 5FTLA 1UQUA 2VATA 1NBAA 4ZMRA 2JFNA 4X3CA 1WDLA 3LCMA 4RSGA 4B71A 2E3JA 3PQCA 5HJ5A 3K92A 5CVJA 5H82A 4ZO9A 3ELUA 1MH9A 2OK7A 1BO6A 5BN3B 3GUHA 5KTOA 3Q11A 1MJGA 4ZHQF 5CLLA 5J58A 1B3RA 2YFKA 1IXKA 4GLJA 4Q7MB 4DJFC 1XRMA 3VZPA 3PFCA 3AJ9A 3WKDA 4JBNA 3MWEA 4U2BA 1X9IA 2EFYA 2HD4A 221PA 3GA5A 2L0XA 4C3OB 1Y80A 1ZJ4A 5EJ5A 1AQJA 4AZTA 4MV4A 1YGYA 4I5EA 4RFSA 4B3FX 3UMCA 3O7MA 2PHZA 3IJEB 3O4GA 1R0XA 4YWJA 3G49A 3OFJA 4ARCA 1NY5A 1ZUNB 4Q1EA 1U3UA 5I3CA 3T9DA 3MCUA 2I6UA 2ZUFA 2CUZA 1R00A 3DR5A 3E53A 1GTL1 2QU7A 1WETA 1Z08A 1E1KA 2ESRA 3IVCA 1Q14A 3I4LA 2BM9A 4FVTA 4YRQA 2M6KA 3ZI4A 2CV2A 2RI1A 1WLSA 4D6XA 2PSJA 1MEOA 3JQRA 4PC1A 3TQCA 7ADHA 2FE4A 5I9IA 4R2JA 5I7UA 4EVRA 2YN4A 4PIVA 1MF7A 3U7FB 1ZBDA 2AV6A 3U09A 1SUCA 1I7DA 3DWGA 5BVHB 3GFPA 3TIVA 4EUNA 1N6LA 3KSDO 3LXXA 3P0JA 3CMCO 3U56A 2F9FA 5IUKC 1VZ2A 2PQ0A 1ISHA 3GMIA 4FILA 3VUEA 3IAFA 4B76A 4YCNA 1KPGA 2PT5A 3WNCA 3T1HB 4P31A 2EJBA 1OFGA 2VK2A 1EJ2A 4HPXB 1PL0A 3P9NA 5JCJA 1GG2A 3DAOA 4JC0A 5TPZA 4C0KA 2XKJE 3FSEA 3G8CA 4FFBA 4PR0A 4WACA 4BFSA 4H4CA 4CFYA 5L53A 3PICA 2CFRA 1IZ7A 3PNKA 1DDOA 3STUA 2E37A 3NV7A 3PTLA 1RHRA 1GUZA 3HA7A 3QF7A 3ZY4A 1MQAA 5CRIA 1E9RA 3GGGA 1A8PA 2VYFA 4IFTA 4UXIA 4W6QA 1I32A 2RKBA 4ZCSA 1CQPA 3CKYA 3FIUA 2ZYAA 3TOVA 4LJKA 3BHMA 1UPBA 2G82A 2QRUA 1Y5IA 3CQ9A 5K6RA 5C52B 3THXA 3ZJVA 2X6RA 3R7SA 3IVAA 1E0SA 2I6FA 5D86A 4MYCA 4NX2A 4PC6A 4RH1A 4WAUA 1XMJA 2C9MA 5JEDA 3HUUA 4C08A 2A0KA 3ER8A 4IXTA 2WU1A 2O2JA 4AIIA 2RK4A 2PH5A 2P9GA 5IAEA 4AK9A 4NEGA 4EW2A 4TRJA 5BQFA 8OHMA 2E18A 1EYZA 3I04A 3ONNA 1ZVKA 4MKHA 1Z4IA 3SS7X 4A82A 4QKQA 4EG7A 3IJPA 1JXAA 1PZNA 1J99A 2FWIA 2Q1UA 2QMHA 3AJ8A 1SCDA 1JGTA 2RGNA 5IARA 1HQYE 3ME5A 4QHTA 4X66B 1G1MA 2XKAA 3EULA 2HTEA 4M1ZA 5AICA 5DB4A 2MOKA 1J24A 1ECBA 2JAHA 3A05A 3REQA 1KI2A 1XAIA 1BHJA 5FLEX 4U6NA 1NLYA 1PNTA 2I4NA 3FMIA 4LNAA