5EFZA

Monoclinic structure of the acetyl esterase mekb
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
347
structure length
347
Chain Sequence
SYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Homoserine O-acetyltransferase
publication title A novel esterase subfamily with alpha / beta-hydrolase fold suggested by structures of two bacterial enzymes homologous to l-homoserine O-acetyl transferases.
pubmed doi rcsb
source organism Pseudomonas veronii
total genus 132
structure length 347
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5efzA00
4ZV9A 1UKAA 1VE7A 4IH1A 2K2QB 1WB4A 2AXEA 2H7XA 1H2YA 1XZLA 4Y7DA 4ROTA 3BIWA 1YA4A 3UUFA 5JD6A 4JYMA 1VJ5A 5AK5A 4BAUA 2WU4A 2Y1KA 3ANSA 2PL5A 2CKMA 4BVJA 1CQWA 1XZDA 4CG1A 1ZI9A 3ZLUA 3WKDA 1A8UA 5AKXA 2PSDA 3OM8A 3OOSA 4ZREA 2X76A 2RI6A 2OGZA 5LZ8A 3WL6A 1EB9A 3R0VA 3DNMA 2FX5A 3C6BA 2O2IA 4FKBA 5AKGA 2OCGA 1FFAA 3F9CA 3NWOA 5FLKA 1O6GA 2QJRA 3D2CA 5CT9A 4RGYA 1E3QA 4BVKA 5HQ3A 1QONA 1TIBA 1WHSA 4OSEA 4PNZA 3CN7A 3WA6A 2HU5A 2Z5GA 5EHXA 4EY7A 4MYSA 1WB5A 3CCCA 1IZ7A 2RONA 4X6UA 3WJ2A 3W9UA 1LPNA 3I2IA 1UT6A 4ETWA 4H7DA 1ZJ5A 2HA0A 2PSEA 4HAIA 2JGLA 2BFNA 3G0DA 1J1IA 1UKBA 4G1FA 5DYWA 2VSQA 3H1BA 4U2EA 1XRPA 3I6ZA 1JU3A 3D0KA 1AX9A 4KYVA 5CT8A 1CUCA 2CZQA 4FFVA 4LXGA 5J3JA 2WKWA 5FV4A 3GFFA 2GBGA 2ES4A 4J0KA 5K3FB 3V48A 2JEYA 1UK9A 2XMQA 1CUUA 3DDUA 4G8CA 5FP0A 2Y6VA 2HA6A 4KE8A 4BZWA 4GECA 3O4IA 4OYLA 3C8HA 2WJ6A 4K5QA 2OQIA 2BUCA 3WK9A 3WLAA 3JYHA 4BAGA 3WJ1A 3F97A 1ISPA 3RARA 3CCBA 1PV1A 5CH5A 4I3FA 4L9AA 5FKJA 2DHCA 2XT0A 1KU0A 5K3DA 1UOPA 1TCAA 1XFDA 3IUNA 4XWGA 3OC0A 1Y7HA 1FFCA 2ORYA 2XDWA 3VVLA 3WKAA 5BV7A 4UHEA 4PSUA 4CFSA 3NUZA 4H7IA 5D6OA 2WIGA 5LZ5A 4BRSA 1PFQA 3MVEA 4BZZA 1SCQA 4YPVA 1TK3A 3WL8A 2H9YA 3I2JA 4BYMA 2HDWA 4X93A 2CEKA 5E2IA 3IBTA 4CG3A 1A8SA 5BWCA 2IIVA 5LIPA 1VOTA 1CUVA 3FLBA 3A6ZA 2VT6A 5IVKA 1VA4A 2OGSA 2C0QA 4J0CA 4BTVA 4IH4A 3DOHA 1LPSA 5ALPA 4Y2TA 5EHZA 3QH4A 3MGAA 4FDMA 5AP9A 1Z68A 5FPPA 2DHEA 5H3HA 2QZPA 2V97A 1L7AA 1MNQA 3WZMA 5ALRA 2CMFA 3GA7A 1SFRA 1U8EA 2XUIA 4X6XA 1LNSA 4B0PA 3UUEA 4W9RA 3T4UA 2WUFA 3G0CA 4EA6A 1AMNA 3HSSA 2HA5A 2WJ3A 3SWWA 3HYSA 4MEBA 5JATA 3HI4A 5AOCA 4X91A 1SC9A 4BE4A 1ODCA 3WL5A 1RWQA 3B3QA 1W76A 2GZRA 3D59A 2ACKA 2PSJA 3WKEA 4CI9A 1E8MA 4P92A 4E11A 2VA9A 1SCIA 1XLUA 4QNNA 2O2HA 4Q05A 2PSHA 3FBWA 3BXPA 4DSZA 3G9ZA 2JF0A 2PVSA 2JIDA 1LZLA 1LPBB 3B5EA 1WCYA 3HC7A 2BGNA 3ANTA 2W6CX 2WIKA 5K5EA 3DJYA 3H2JA 5D3ZA 4BE9A 2QXUA 2VF2A 2RGUA 1DTEA 4EUSA 1EK1A 5ALXA 1GQSA 4FLEA 1UFOA 4FNMA 4PQEA 5CH3A 3GUUA 5I9IA 2WJ4A 3FVTA 4HZGA 3FYUA 1VXRA 2XQFA 4CCYA 3M83A 3G9XA 4E46A 2XMCA 4F60A 3GBSA 5I7UA 2BGRA 2HA3A 1CUGA 2B4KA 4PSCA 5KWIA 1GKLA 3DYIA 5AM0A 2OCIA 2WTMA 1XZJA 4KE6A 4IO0A 1YB7A 1XQXA 4QWWA 5CT5A 2PKYX 2QRUA 1XZGA 3G7NA 4HXGA 4GBGA 3WYNA 4CCWA 1DWPA 3DKRA 1R1DA 4BRZA 2V98A 2QTBA 5AO9A 5T4HA 1BROA 3VVMA 1IZ8A 2XMGA 2XUDA 4L72A 2FJPA 1W4LA 4GDMA 3QPCA 2G4LA 3NGMA 4KRYA 5JADA 1ACJA 4TPKA 1CUXA 3O4JA 4IHAA 3V1MA 1BS9A 1J07A 1ZI8A 1H2XA 3EQ7A 4WDRA 4YK7A 3R40A 1DU4A 3C6YA 3STWA 2R11A 5F4ZA 1R9MA 1CUEA 3LCRA 5ISMA 4Y2XA 2HRRA 3O9MA 4HXFB 3IB3A 5A7GA 4KACA 2WTNA 1L7QA 3C70A 3WK7A 4KAAA 3TEJA 2WUDA 4A16A 4M0FA 3HACA 1MX5A 2C5FA 1QIGA 1XZKA 5DNVA 1DT3A 3DKKA 4XIIA 4FFWA 4WFKA 2WIJA 1WPXA 3K9BA 3U1TA 2OQVA 4JUIA 3WIBA 2V96A 1L7RA 1LBSA 4NVRA 3STUA 1VZ2A 3JWEA 4J0GA 3STTA 5C81A 1H2ZA 3H2IA 4P9NA 4U2DA 2HM7A 4K6KA 4C4ZA 4C87A 4DNFA 2ZJ6A 4H35A 1HQDA 4X85A 3L1IA 2HU8A 4X94A 3F8SA 3KSRA 1IUNA 4J0IA 2WUEA 4CIAA 1ORVA 1YAJA 1TAHA 5EFZA 2WG2A 2WFLA 1JMKC 5AKYA 2BUBA 1CUJA 3R3WA 4HRXA 2XUPA 4AO6A 2QM0A 4MQMA 3QVMA 3PUHA 2XQGA 2CUTA 3EBLA 1XZBA 5ALZA 4KEAA 5K3FA 3DD5A 4LKOA 4E14A 2G5TA 4MXDA 1QGED 1UOOA 4J0HA 4UHDA 3E3AA 1R50A 1ACLA 1AURA 1EB8A 1CUSA 2PU5A 3QBJA 3LIIA 5ALUA 5CXXA 2JGEA 4OPMA 5AI5A 1YS2X 2ZSHA 4N5IX 5IH7A 1WM1A 4X92A 3SC2A 1QIMA 3WI7A 4YX9A 5ALHA 1S8OA 1TQHA 2HL6A 3DCNA 5LKAA 3BF7A 1JMYA 2CBGA 1CUBA 4GWLA 4Q3LA 2E3JA 3ICVA 4RE5A 5IVDA 3BDVA 5CT4A 4QLOA 1WHTA 4H18A 5E4JA 5T4EA 3DEAA 4H0CA 3M81A 1CR6A 2YASA 1MNAA 4F21A 1XZFA 3DS8A 2PUJA 4UBIA 5ESRA 1UZAA 5A7HA 4Q34A 5D7BA 2WHPA 5ALWA 2ROQA 2XMZA 2B9VA 1E8NA 3ZLVA 1T4MA 1IMJA 3IIIA 1QIKA 4C4YA 4JH0A 4HVTA 2EEPA 4FMPA 1MAAA 3WK8A 5A71A 5AI9A 1DINA 4OU4A 1UKCA 5DTIA 2WIDA 3FYTA 3AINA 4D9JA 3KWJA 3U0VA 3VJMA 1XRLA 2VAVA 3E4DA 4E15A 1EVQA 1P0PA 4XVCA 2FJ0A 2WILA 1ZGBA 4QDOA 4F5ZA 5AIAA 4CIBA 3AZOA 1XROA 1YAHA 2PPLA 4OB7A 2EDAA 5DJ5A 5JZSA 1EDDA 4X00A 3EF3A 3I1IA 1BRTA 4ZXFA 5JARA 2HHAA 1CVLA 7YASA 1K5PA 4X90A 3G8YA 3I6MA 4QZVA 3HLKA 5ALMA 4Z49A 3I1YA 1EK2A 4EY6A 3IULA 5C8XA 4OCZA 1R88A 2JGMA 1HL7A 3LP5A 2WHQA 1HDEA 3K6KA 4PV7A 1ORWA 5EIHA 2H7CA 3RM3A 1EA5A 5JALA 4RPCA 4ZV7A 2ZYSA 5YASA 5AKIA 3WK5A 3QITA 1K8QA 2WIFA 4K6GA 1IUPA 3D7RA 3KDAA 4MJ3A 3VDXA 3MUOA 4N8DA 1Q0RA 5BWBA 3STYA 2PUHA 4KE9A 1B41A 3I2FA 5C8ZA 3WKBA 4WY5A 4Q3KA 4PF1A 2CJPA 1XQYA 3OURA 5HF8A 4U2BA 1CFJA 2OG1A 3H2KA 3Q0TA 1QIEA 3EQ9A 2WLSA 1FFBA 2BAGA 2QR5A 2WFZA 2HU7A 4WFJA 4AB1A 4PSDA 1UWCA 1CV2A 1H22A 4RNCA 4QDXA 2ONCA 1BEZA 2VQ6A 1G5FA 2ZSIA 5BOVA 3PUIA 2DCMA 5ALSA 3WL7A 2RHTA 3PI6A 2QKYA 1BN7A 2QT9A 1MPXA 3KD2A 1JI3A 1R9NA 3WZLA 1XZAA 1B6GA 2JGKA 1QIFA 2VTVA 1IVYA 5CT6A 1YS1X 4H7KA 5HK8A 4BCCA 4J7AA 5EHNA 4DYHA 1F8UA 2JGJA 3SX4A 5CBKA 3K2IA 4B9AA 2AJCA 3ICWA 5SYNA 1G66A 1QOZA 2ZJFA 5JANA 3AILA 2Q0XA 5C8VA 1CUAA 2QMQA 3VXKA 5DWDA 5CW2A 1GKKA 4QDZA 2DR0A 1J2EA 2XLCA 5AM3A 2HIHA 1JFRA 4DMHA 5ALDA 2XUKA 4XX1A 1ZD4A 4KAJA 2QS9A 2VAXA 5AOAA 1AKNA 2Z3WA 4U2GA 4P08A 2X8BA 3QPAA 1XQVA 4G5XA 5AHXA 4DSAA 4X6YA 1LPMA 1LLFA 2I3DA 3DYVA 4LYEA 4NS4A 4EB0A 1SCKA 4WJLA 5AKKA 2ZJ7A 4ZRDA 2VJDA 3LS2A 5KREA 4UBKA 2I3ZA 4BDSA 1XRRA 4UBMA 3WWEA 4L3WA 4Q82A 1XZIA 3HRHA 2RIPA 4HRYA 4LXHA 4G8BA 4IH9A 4AN1A 1UK8A 3C43A 3HZOA 3G0GA 4CG2A 4DTCA 2Y6UA 4YASA 3A70A 1Q84A 4J0DA 1G42A 1WPRA 5JAOA 5JZ9A 2P8SA 3G0IA 3O4HA 4I19A 4Y9SA 3B12A 5LZ2A 4FOLA 1J06A 2OGTA 1XRNA 1YB6A 5AIBA 4J3JA 4EY5A 4Y2UA 3D2AA 1X2EA 2RHWA 1JJIA 3G0BA 3C8DA 2WSLA 3M82A 5EIAA 1ZIXA 5K3CA 3O9VA 2XB6A 4UBLA 5ALLA 3L1HA 4AMZA 5HFAA 2ZVDA 3S8YA 3ESCA 5A62A 4QA9A 4IQ4A 5AKJA 3R41A 3LIPA 5LLSA 3H0CA 5JZBA 5C7YA 3FSGD 3IUMA 2QVBA 5AM2A 3QM1A 2C5GA 1DWOA 1MO2A 2XUFA 4H77A 2OLEA 3TRDA 4UHHA 4Y2JA 4TGLA 4BDTA 1AGYA 3PE6A 4PW0A 5DNWA 5A2GA 5DYTA 4FBMA 3RKSA 1MJ5A 3F96A 1QFSA 3WWCA 3V1NA 5AK4A 3DL7A 3N0TA 1CPYA 4LIPD 1DQZA 4G4GA 1YA8A 2C4HA 1RYYA 2XUAA 4KAFA 3R3VA 4PO3X 1F6WA 2GYVA 1FJ2A 4W1RA 1XRMA 1WOMA 1T2NA 4QLAA 3PFBA 1H2WA 2R8BA 4DMKA 4J0JA 1CUWA 1OILA 5K3AA 2Y2UA 4MWTA 3LLCA 3FNBA 2O7VA 5HK9A 1FSSA 4BB0A 2AJLI 4G9GA 2BUAA 3D4LA 3FLEA 4UBJA 4N8EA 1EDBA 3AZQA 3FAKA 1XLWA 5AKHA 4I4CA 5ALTA 1HKHA 1ZD5A 2IX9A 5AJHA 3A2NA 4BP8A 1CUHA 3WQHA 2GYUA 4FHZA 5EGNA 5LP1A 2X5XA 1YASA 3W2TA 1N8SA 3EQ8A 3H18A 5FXMA 3GZJA 4OB8A 4QE3A 1A8QA 2EDCA 4MQLA 4U2FA 1E5TA 2XI4A 3IURA 4JYPA 1TCBA 3H1AA 1JT2A 3W04A 4GEGA 1MAHA 1ETHA 5K3BA 2GBIA 5AM5A 1QE3A 2J3DA 3HEAA 4DNOA 2PM8A 3HJUA 4P93A 3V1LA 2WG1A 2WHRA 1N1MA 3BJRA 2ECFA 1I6WA 1XZMA 2NW6A 1CUFA 2YXPX 3ZWQA 1XQWA 2Y2VA 1LGYA 3SK0A 3WWPA 4N5HX 3WMRA 4UPDA 2C0PA 4H7EA 5CXUA 3VKFA 4FLFA 4BCBA 4BTLA 2HADA 1C7JA 5LZ9A 2XMDA 5AOBA 1C7IA 4AXBA 1H23A 2HA7A 2W22A 3QMMA 5JASA 4WY8A 1CUIA 3AFIA 3FYUB 4WDQA 4L0CA 3IVMA 4F0JA 5SYMA 4CCYB 3KXPA 1X70A 3O0DA 3D3NA 5KWJA 1Y37A 5E4YA 4X95A 1LPPA 4FNGA 4A5SA 1MT3A 3F98A 4AO8A 1BCRA 1USWA 5ALNA 1TCCA 3IDAA 1GPKA 1GZ7A 2GZSA 4OUKX 5ALIA 1VKHA 4QDUA 2QJWA 1KEZA 5FPQA 1BCSA 1LPAB 2XMBA 3C5VA 1EHYA 4B7ZA 3VISA 1W6RA 4AZ3A 1QZ3A 1GQRA 4LXIA 3ESDA 4HXEB 5T4FA 2YYSA 3BIXA 1ZGCA 4BCDA 3HXKA 5AKLA 1JU4A 3BJMA 1QLWA 4V2IA 3WYDA 3R3YA 1NX9A 1WB6A 1EVEA 2JBWA 3ESBA 5AK3A 1HLGA 1RP1A 2XE4A 4UFOA 1R3DA 3ED1A 5JYCA 3FOBA 2OCKA 3D2BA 2O7RA 2VATA 5CH8A 5AKZA 6YASA 2DFPA 1DWQA 3UMJA 4MYDA 4NMWA 2UZ0A 4UBOA 1ZIYA 4O08A 5A7FA 1TKRA 3PF9A 4GLBA 5JAUA 3C6XA 1W75A 5K3EA 2DQYA 4OU5A 2WM2A 5JIBA 4LYDA 5CURA 2CB9A 1CIJA 1EH5A 1W1IA 2VJAA 3AIKA 3IUQA 3ZV7A 3C6ZA 2O2GA 3QYJA 4UHCA 3ILSA 2XUGA 1A88A 4GXNA 4Y2YA 1SOMA 3AZPA 5ALGA 4OYYA 2WU3A 1PJAA 4UFNA 1OXMA 3N2ZB 4A23A 1GPLA 2JGFA 4AQDA 3QMWA 1QTRA 3CXUA 1BN6A 3VJKA 1E89A 1VA5A 2OPHA 3BWXA 4BP9A 1LPOA 2HFJA 2ZYRA 5E4TA 2XUJA 1UK7A 5HF9A 1MX1A 2ZYIA 3ESAA 5DYYA 4ZI5A 4H7FA 4Y2SA 2FUKA 4C4XA 1GPNA 2WFLB 4FLMA 5LZ7A 1EI9A 2OXEA 3A2LA 3I2GA 3DL4A 2GBFA 5ALOA 4KJXA 4LHEA 3O95A 3JW8A 4DMCA 1U4NA 4GW3A 3V9AA 4C89A 1GT6A 1CEXA 4G9EA 4Y2PA 4DNPA 4JEIA 1QFMA 3Q8WA 4Y2RA 1X2BA 1ODTC 3AIOA 4X97A 1VXOA 1MN6A 3WWOA 4EHBA 1NU8A 3PF8A 2H7YA 3KOOA 1QTIA 4QWMA 1Q83A 2QUAA 5I8PA 4OD0A 1NU6A 2Z8XA 1AUOA 1JJBA 2Z3ZA 3G02A 2IITA 4JNCA 3FCYA 4B82A 3H19A 1THGA 5IVIA 4BAZA 3AIMA 4K2AA 3ZPXA 4GI1A 2HA2A 3AJAA 2VJCA 5AI4A 5IVHA 5CRIA 4J03A 4G8DA 1JKMA 4ZWNA 4B84A 1ZD2P 4FBLA 4M0MA 1OCEA 3WWDA 2GYWA 2AJBA 4AO7A 5LKRA 5CMLA 3T52A 1P0IA 3DQZA 2JEZA 1P0QA 3I28A 2WHPB 2XQIA 1A7UA 4EY8A 4Y2VA 4Q3OA 2HRQA 3BL8A 1EX9A 3STXA 1LZKA 5D3KA 2QUBA 5JD4A 4BVLA 1CQZA 1QIDA 2YH2A 2WG0A 5AI0A 4UBNA 2OAGA 4W63A 2I03A 4X71A 1Q0ZA 3W05A 3H2GA 4UUQA 5A6VA 3G9TA 3OTQA 2GBCA 3I2KA 3RLIA 2VT7A 4B6GA 1N5MA 2AJ8A 1G4HA 3ZI7A 3G9UA 5HQ3B 3HABA 4NZZA 4AMYA 4WCVA 1MX9A 2I78A 2BKLA 3IUJA 4N8SA 5LZ4A 2J4FA 2XMSA 3RK4A 1BE0A 3H04A 5HZGA 4H7JA 1W52X 1XZCA 5ALFA 2JGIA 5JD5A 4FTWA 5AI8A 5ALYA 2BJHA 1GGVA 5HCUA 4HTAA 4WFIA 4KE7A 2PSFA 3FWHA 1MTZA 4OB6A 1TRHA 1O6FA 1K4YA 4B81A 3C5WP 1DX6A 4HS9A 5HKBA 3OPMA 2OCLA 4C01A 4B83A 3M3DA 4EY4A 2WUGA 4DIUA 1P0MA 3S2ZA 1ODSA 4C88A 4MEAA 5HF6A 3DOIA 3W9BA 3FCXA 2J3QA 4FWBA 1QIHA 1UOQA 1QIJA 1GXSA 4H7HA 3C45A 3FSGA 5ALEA 1ZICA 2G5PA 1QIIA 1VLQA 2XQKA 1XZEA 4AZ0A 3D5EA 4G4JA 1XLVA 2HA4A 1UK6A 1XZHA 3W06A 2XQJA 1YSCA 2XLBA 4B0OA 1EINA 4BC0A 5FOQA 5ALVA 5AICA 3R3XA 1XKTA 3WK6A 2BCEA 5JAHA 4GHWA 1E8DA 5DTJA 3WIOA 3YASA 1UXOA 5HF5A 1XKLA 4MWSA 1DQYA 3TGLA 3V1KA 4UHBA 4DMFA 1AZWA 1E66A 5FUMA 3WA7A 4QEKA 4DNQA 2OAEA 1K63A 1CUDA 1ZJ4A 4XJVA 4Y2QA 3GROA 2DQZA 5KBYA 2G63A 1BU8A 4G4IA 5EHQA 5HKAA 3CN9A 2B20A 4AN0A 4TVKA 4ARBA 4BBZA 1THTA 4U2CA 2RAUA 3O4GA 4W1SA 3BF8A 4ITVA 3PDCA 1F0PA 1YCDA 1EXWA 3H2HA 3VJLA 1FFEA 3R3UA 3F67A 1QJ4A 3IA2A 1VE6A 3A2MA 3FVRA 3L1JA 4C6HA 2VJBA 4EZIA 4S0XA 4AX4A 1ZOIA 5ALQA 1MU0A 4QDTA 2J4CA 1U65A 5AK6A 1M33A 2PU7A 1QO9A 2WFMA 3FYUC 2D5LA 4ZGBA 1DT5A 4B85A 3QMVA 1BEEA 1LBTA 5DNUA 4KR0A 2H1IA 1CUYA 3QPDA 2DSNA 4Q1VA 1CRLA 4RE6A 2VEOA 5JAPA 3I6YA 3STVA 3C87A 2ACEA 5AI6A 1FFDA 3PICA 1IUOA 3P2MA 1YR2A 3ZLTA 2PX6A 5AH0A 3H17A 2ZYHA 2C58A 4UHFA 3DLTA 3OG9A 5ALJA 2DHDA 4B80A 1KU6A 3PFCA 5CTAA 2C7BA 5HFNA 2WQZA 2XUQA 3KWFA 2QOEA 1CLEA 4X3CA 3BDIA 4KRXA 4K6HA 3X3HA 3QZUA 5T4BA 4DM7A 3AUKA 3TJMA 5AKEA 4UFPA 3E1GA 5DLPA 5EIEA 5EI5A 1R4ZA 2D0DA 1N5RA 1ZD3A 3BE8A 3R3ZA 5FRDA 4W1QA 3E0XA 3WKCA 4EBBA 1XRQA 2XMRA 1F0NA 5IKXA 4B9EA 1HPLA 1U2EA 1HBJA 1JJFA 4DGQA 1AC5A 1D07A 2B61A 5AM1A 4INZA 3FLAA 1C4XA 1ZI6A 4BC1A 2Z8ZA 5FDFA 5ALKA 4X7BA 1CUZA 2XUOA 3WK4A 1K6EA 5LYYA 1DX4A 3NOXA 3GELA 2PBLA 4W1PA 5AM4A 3I2HA 1QO7A 2LIPA 3EIOA 1VZ3A 1Y7IA 2XUHA 3MUNA 1AQLA 4ARAA 2HFKA 2QXTA 1EDEA 4BATA 2AJDA 4DLNA 2V9ZA 4M0EA
chains in the Genus database with same CATH superfamily
2R00A 5C2JB 1P81A 4MVJF 1Y80A 3ETJA 1RABA 1X14A 1ZMTA 1L4BA 5THXA 1DEOA 1NW5A 2B8EA 3OLYA 4LXUA 4GC9A 2Y27A 4WQMA 5I9TA 4RTSA 4CF3A 1XZLA 5H02A 4ZJYA 4CIVA 4QPDA 2WNIA 5EVCA 2UYGA 3Q98A 4J43A 5IUJC 4WK4B 4LDNA 1TTTA 3HKEA 1VJ5A 1KYZA 4LJYA 4KSBA 4JX8A 4KDRA 5CVVA 4JLUA 4XB2A 2Y1KA 4HGPA 1EK0A 4NABA 1QRTA 4GSYA 5DTQA 3O3OB 1ADJA 3ONFA 1PBTA 4MWCA 3GQVA 4LXQA 4O2AB 3WBBA 2YIDA 1FQKA 2B8TA 2IK8A 2RH5A 4PZPA 1EUCB 2W8BB 1PL7A 3V42A 5AESA 1IXSB 3I30X 3FWKA 2H2AA 2XKAA 3EUFA 1T8SA 2C9MA 3M4XA 3NUQA 5AVKA 1P7CA 4FUTA 2HTEA 2IELA 4IIEA 4Z2AA 3N7AA 1MMFB 1QS0B 2UYQA 1IUKA 1D2CA 4B4WA 5KYWB 3V80A 1DLJA 3EEQA 2OGZA 4WVLA 2C7VA 1T0UA 1Z17A 3WIVA 3M6XA 4Q7KA 3IKLA 1Q1AA 3AEKA 3S5JA 4HNUA 2PRZA 4ALKA 3AGPA 2LP4Y 3C6BA 3RVPA 4YMGA 1T4GA 1OIXA 5FCDA 1L5ZA 1G20E 2QUHA 2D8AA 3GV0A 2BCJQ 4HLNA 2C5HA 2Q62A 5DF1A 4YMIA 1IOVA 4BNDA 5JZVA 2OCGA 2W2TA 3A1SA 3IO5A 4Z3OA 2CJWA 2BMWA 2W2KA 3ETNA 3F9CA 1WMAA 1T9DA 2FXVA 2X9GA 1IHUA 3OX1A 2P4SA 4UUNA 1O6GA 3OQ1A 1XZ8A 3I53A 1PL8A 4JL6A 4I81A 4R3WA 3U6KA 4G1EB 4BVKA 3SXJA 3QI2A 2AFHA 4PLPA 3RHZA 3UWKA 4GE3A 4U9IS 1KI8A 4YWJA 1PT9A 3REFA 3WJ7A 1LW6E 1AKTA 3M6VA 3KT6A 4DG9A 3B53X 4PNZA 4RTQA 3GNQA 4F7DA 3ILXA 1OYWA 1C8VB 1BNCA 2F3TA 4FQ8A 4CVNA 3WA6A 4IWNA 1IU9A 2VH2A 4PZYA 4Y98A 3U6BA 5LXTF 5EHXA 4GPZA 2G36A 2OCBA 3FNGA 4POOA 1QGDA 2X0DA 1V2GA 2V3CC 1DUSA 1MDBA 1PZNA 1QE0A 1VGVA 1VKZA 2VJPA 3GRUA 4G26A 4KPUA 2PXHA 3UAVA 3WJ2A 5K99A 4IR7A 3NOQA 2V6JA 1KZYC 4CKWA 1YKFA 2GPWA 3T3DA 4EHFA 5H68A 3RUPA 1U0FA 4H7DA 2AC2A 2FE1A 3LO5A 4KO8A 3ROQA 2JGAA 2PSEA 1Y34E 3BFJA 1SUIA 5IC6A 3W5VA 5JY6A 1TCUA 1SBNE 2PWPA 1I4DD 3ZQKA 2HH9A 5A6SB 2WR8A 3KAPA 4QECA 4Q93A 1SUSA 4OM7A 5DYWA 1UKBA 2BWJA 5DM60 3HXMA 4U2EA 3OQOA 1HUQA 1CERA 3D4OA 2QTCA 2WU1A 5JSFA 3PVZA 4ZI7B 3CJRA 1B8PA 1C0LA 2RGNC 2RJOA 3D0KA 3DB1A 2F3UA 2JFGA 2Q07A 3IP9A 3P0IA 3WMXA 2LKCA 1JB9A 3DE1X 4NQRA 1CUCA 3E0QA 3R6TA 3EZYA 5CVEA 3CINA 2YZMA 1K9SA 2VSFA 4YRCA 3GZ4A 3FXAA 4LCEA 4QNRA 3W6ZA 5LQRA 4EDFA 4H2DA 5A04A 4YAKA 4LXGA 4NXMB 1LRLA 1JEDA 1RBYA 4XVQA 1LLDA 3KLPX 2GBGA 2P6OA 2C3OA 1P39A 1ZYUA 2RKWA 4Z4HA 4J0KA 2QLNA 2GFQA 3V48A 1PT5A 2CNBA 2NUAA 1ZHFA 3BJZA 3S2YA 2JEYA 1T2VA 4D8UA 1MO4A 3OZXA 4JUDX 1DXOA 1E5XA 3FGZA 3BQMB 2L69A 3RH0A 1VTKA 4BV8A 4R2MA 4IHJA 1CUUA 3LGXA 5IVPA 2R9VA 5K0BA 5FP0A 2A5JA 3IIEA 4FHEA 3NTOA 2HA6A 4LYFA 2DEUA 2XEXA 1W4RA 2XY4A 5TQ2B 5CB4A 4BZWA 1B74A 4YMHA 2NZ8A 3DMGA 4TMTA 2ZYTX 3OHMA 2WB2A 3C1OA 4P3YA 1O0BA 4WKBA 3G0OA 1IJFA 3KUDA 3VAYA 2R6DA 2OQIA 5JJLA 4OHFA 1XZPA 3KKLA 4ZAVA 2PUFA 4YROA 2Z1DA 4NWIA 1KMCA 2BUCA 1FTYA 3T9FA 2X9VA 1H2AS 4N9QA 2RFLA 4BAGA 3W2IA 3CFYA 2FVXA 3ACBA 1F12A 3IHTA 3KU4A 4G65A 1XXHB 1GAWA 2O0LA 3PQCA 3RARA 1TX4B 1Y3CE 1PV1A 2DX7A 2W83A 5EE0A 5J5CA 1QYVA 4M1SA 4QATA 1Z0AA 4D57A 2ILTA 2DHCA 2PMWB 2YMMA 5TLSA 2OXIA 2QTNA 4FEEA 1KU0A 4U5QA 2FUG1 1OTXA 3RRXA 2G5CA 2FJUA 4EVQA 2IPOA 3O8BA 1NVMB 1HT3A 1JJ7A 1GZ4A 1O0SA 1XFDA 2YX1A 3OQJA 4JQCA 4O02B 1L0BA 3ROZA 3V4LA 1EMDA 4XWGA 5TARA 4YJ2A 4R6XA 4Y8VA 3P9KA 5EINA 5JPDA 4J91A 4XPIB 1JQ5A 1Y7HA 5GPBA 4QQFA 5BV7A 1ZG3A 3VKGA 3O90A 3W6OA 4D9NA 5FAXA 2G40A 5IAKA 2W43A 3JVUA 1QK5A 3NDBB 4HJRA 3DT6A 4KDCA 2FSUA 3UG6A 5F5LA 5L3QB 3R20A 3OICA 3JSXA 5D6OA 5PGMA 1JNXX 3UB3A 3RJ9A 1T8TA 2AFIE 1OKKA 2Q1WA 2WIGA 3E9RA 5LZ5A 4BRSA 3ZU6A 1N0HA 1Y81A 1POXA 2HF9A 2JL1A 3AY6A 3ITNA 2BHNA 3E8MA 1QMPA 2HJHA 3SE0A 3U7QB 2EL7A 3QSYA 4R9UC 4CM3A 2MTBA 2PMCA 4P81A 2DPLA 1HURA 4IDGA 1BCSB 4XWOA 3OF5A 5AW0A 2IS2A 2NVUA 1CU1A 1J7KA 3G7UA 3D31A 3OEYA 1RMTA 2ZANA 4RD2A 2OPBA 4QTZA 1TVEA 3RKUA 4C78A 3VDMA 4EBFA 1BGWA 3K94A 1J25A 4JJFA 4AZ3B 3UMMA 1YQEA 1SXQA 5IASA 2Z08A 3DUFB 1QR6A 3SJBA 1WF6A 4E2YA 2SHKA 2AMVA 2ORED 4L6AA 5C5DA 1ISIA 3FLBA 4O2BB 4R69A 2JHCA 3WGHA 1TNDA 1CR4A 3RRJA 1QMGA 3IGFA 2A84A 4IIVA 5JSZA 3EW7A 1GO2A 1IXYA 1PJQA 4JJKA 3VO2A 4BTVA 4IH4A 2PL9A 1W2GA 1SVOA 1H93A 3PGKA 1LPSA 3R5SA 1S2MA 4EI8A 1PW7A 1XMOB 4Y2TA 5LSAA 3K0FA 3DZDA 3QH4A 2CVHA 2OO5A 3DC7A 3GJ4A 4UEQA 3WLPA 1TA4A 4Q9IA 3ASZA 4E12A 4A0SA 1F38A 2QUKA 1IPHA 4RAOA 4RVHA 5AP9A 4GM4A 1IPEA 2DHEA 4DM4A 3RABA 2FFHA 2HWWA 1NY5A 4D0NA 2VRBA 4C05A 4PYNA 1MNQA 3KJIA 2GM4A 4XJSA 1IWBB 1ONSA 3TQFA 2IXBA 3UMCA 3WZMA 2C7GA 1UIRA 1UXIA 4PCLA 4QULA 1JQKA 4D9FA 2RHDA 2Y1WA 1JDZA 1XMSA 4I4LA 3TL6A 3TPCA 3MTQA 2Q28A 3GJZA 4WKCA 1P4JA 4NV3A 1YOVA 1CR0A 5CR9A 5FR2A 1EFVA 2PBZA 2POCA 1WPQA 1Z22A 4HRVA 4ZCSA 5K03A 1TC2A 1NURA 5E2AA 4WHMA 1GKYA 1GCUA 2PQMA 3QVSA 2G6BA 4JP3A 4QUHA 4DDMA 1W73A 4LZZA 3A9CA 3GEGA 3G0CA 2Q9UA 1GPWB 1C30B 3ELUA 1NXPA 4ZYZA 5EJAA 1HQCA 1OB5A 1DJMA 5BWMA 2C96A 4XYMA 1KH2A 3M5DA 4AS2A 1M8PA 5KSOA 3DR3A 5LQMA 1WDTA 3JS5A 4C9BA 2AJTA 3EMVA 3GJTA 5E7IA 3W4KA 8AT1A 2HA5A 1JLHA 1JBQA 2C4UA 2VTKA 2WJ3A 3FF1A 2Y1DA 3IR5A 2I4LA 2BZGA 3TLBA 1QG4A 3SWWA 2C7QA 2Z5FA 1N6PA 5EY5B 1M6EX 3P5BA 3HYSA 4XPZA 1B0ZA 1K1EA 3MJFA 5JNSA 4CN9A 4KXLA 1W5SA 5LC1A 4DBZA 5TJ9A 1XAJA 3HI4A 3KLBA 5AOCA 4E1BA 4EG3A 5JATA 5KOJA 2KBFA 4X91A 4UU1A 5C5EA 4ND2A 4BE4A 1S2IA 1VL6A 4JBXA 3I9OA 3EVCA 1G6OA 2YV3A 4MMZB 4PG7A 5EMMA 1T3LA 2IYZA 2N42A 4NF2A 2XHEA 3TBHA 1WETA 2IOQA 2JGNA 2PH1A 4ND1A 4LC9A 4AWXA 1S0UA 4I55F 3ZWOA 2PT6A 1GTG1 2DKFA 2BKAA 5CA1B 2N1MA 2Q1YA 3CHYA 3KJQA 1EESA 5B4TA 3CSSA 3NC1C 3SIXA 1O0CA 2JFUA 1MOZA 1QAOA 3AB3A 2OO7A 1D2MA 3IJEB 1UXHA 1JQDA 1GNLA 3KJHA 1MR3F 3O03A 2FMIA 3BXPA 2WSSD 2FPUA 3OT4A 4B33A 3R8XA 5FTLA 3G9ZA 2PVSA 1LPBB 3VO1A 1ATZA 1DVRA 4R8LA 2YIVX 4P4UA 4P86A 3U1VA 4HWSA 5DHFA 4G8JA 3L82B 2BLLA 3QX8A 1JN0A 2WIKA 4PR3A 4YAJA 3W4IA 5J4KA 1XFAA 5HYVA 2QLLA 4AMVA 1YJ5A 5D3ZA 1NJ2A 1QHIA 1C7RA 1ZGAA 2VF2A 4WBXC 4E21A 4WN9A 5A9TA 2RARA 1B7GO 1NQ5A 1U1CA 3OFSA 3GT0A 3MQ2A 4FLEA 2AQ8A 4EYSA 4NFSA 1QHFA 4E2ZA 3PNLA 5JJKA 3EDYA 1ACMA 1KZ7B 1T3HA 2EWVA 4PQEA 8GPBA 3PQ8A 4YRBA 3FR8A 3EZNA 4P5PA 1PLJA 3G5UA 4GP9A 1L5WA 5KTOA 5I9IA 1G7CA 3O82A 3Q87B 1PLLA 1Q2UA 1V7PC 3BM5A 3P9QA 5CAEB 1MFZA 2WJ4A 4IYJA 5CFPA 1PJ2A 4PZDA 4CF6A 5DBIA 2GPSA 4RZ2A 3CGGA 1M34E 4BXOB 1BGVA 2HLPA 3AUYA 1BW9A 4B48A 3K8YA 4G36A 1I94B 3VI4B 4KOAA 3X1JA 3QW2A 1PFKA 2HLHA 4WZ6A 3RJZA 4MQEA 3ZC3A 2VPPA 4RA6A 1MC5A 3IKTA 1NRXA 3QXGA 2ECOA 5KKNB 1Z5GA 4HSEA 4L8GA 1ETUA 4Q1AA 1XVIA 3R9KA 1XF9A 5I7UA 3N6XA 2BGRA 2HA3A 3F7TA 5DK6A 3ZI0A 1S96A 2Y68A 1GKLA 3ISTA 5AM0A 5E95A 3G6KA 4JI3B 1QX4A 4ASUD 2C5EA 5G1PA 4UAJA 1XR3A 1XZJA 1WX1A 2HX1A 4G25A 4ISBA 2ZUTA 4BE7B 2ZYVX 2P3QA 4CIDA 1JAIA 3IELA 3VR3A 2SICE 4B3FX 2D62A 2PY6A 4XGNA 1QPBA 2H52A 4BFYA 1MTOA 3IJ5A 2ZKLA 3NCTA 1BFDA 5JNTA 2LVBA 3ENWA 4BFCA 1R18A 4RTJA 3AW9A 3RSQA 2QRGA 4X5OA 2EBUA 3PWKA 5BY2A 4F1WA 1F9EA 2RKOA 3PGXA 1T0IA 4RM3A 1BX0A 3UMVA 4IKPA 5EZQA 1K7FB 2EP8A 4CQJA 3DOCA 5HVNA 1DWPA 3BAZA 3B2QA 2XOEA 2O8NA 2QAGB 1T3GA 1WVGA 2ZJ4A 5B1YA 2DH5A 4BL5A 2X7JA 3ANXA 5A4MS 1H3EA 3KNZA 1PL6A 4FJ1A 1NP3A 3VVMA 4YJ3F 1E3JA 4D45A 1UPBA 3I6QA 3OOHA 5KTNA 2IZ0A 3GA5A 1G3QA 2XUDA 3ZV5A 1FJGB 3VU8A 2FV8A 1O5OA 4GDMA 2CJYA 3CWZA 5JAZA 2HAEA 3IHWA 4NBRA 2D2EA 4OMFG 3U9SA 3ZVRA 2D1TA 4HDKB 4YO8A 3HCEA 5F35A 5BMOA 1EFCA 3GLSA 1TUBB 2PX5A 3IEPA 1BS9A 1O94A 3NNDA 1J07A 1TTHA 3E05A 1C3LA 4B75A 4EVSA 1J33A 4KPYA 4OJMX 1FY2A 1H2XA 1QDLB 2RK4A 4W7HA 3EQ7A 2JHGA 4KQIA 4WDRA 1Z5NA 1IK4A 1QDUA 1C0KA 1XTIA 5T6BA 2QTGA 2FN7A 3C6YA 2HK6A 3F6BX 2IYRA 4LJRA 2UUPA 5HS6A 3HXLA 2VPWA 4GGPA 2V65A 1HA3A 1JHYA 3VSDA 2QTWB 3L7OA 5FHRA 3DTVD 5MGNA 3B9PA 1DBVO 2QM3A 1E7RA 4RF4A 4H1TA 4PN7A 3D8RA 5ISMA 1XX6A 1X1DA 2DPYA 4I1RA 4Y2XA 4K9LA 5K4AA 4EHDA 3WZ2A 1IHOA 4RX1A 4BWYA 1WZEA 1T5BA 4WINA 3IEMA 2EZ8A 4BFTA 1S2NA 4IAOA 2X8AA 1GR0A 3P4YA 4NRDA 2VDUE 1E0AA 1OAKA 1QK4A 3OPYI 1RXUA 4N65A 3NIGB 3FTEA 2EVWX 1ZCJA 4GPIB 1E5LA 2JLYA 2ZB4A 2GSDA 4M0FA 1C3EA 3LD9A 3PRKE 4HOYA 4XFKA 3SKVA 4B2PA 1V6AA 1CF2O 1QIGA 1SCNE 4RKFA 5CK4A 1L4MA 4CCSA 5DBEX 1N92A 3COPA 3GMIA 1U0SY 2YWEA 5DNVA 1S2LA 3TX6A 1ZK3A 3UY4A 5ICCA 2NGRA 3R0QA 4D8VA 2DR2A 1NMZA 3QX7A 3AUUA 3QIVA 4Y9DA 1JLKA 5EHGA 5ER6A 1Z82A 4EW1A 3LPCA 2YWBA 3VZPA 2SECE 3IHLA 4FFWA 5L3RA 4NLLA 3X1MA 1PNTA 3RVLA 1FUEA 4R2IA 1JB1A 4D42A 4MYRA 4JT2A 1EUZA 3AF3A 3GUHA 4KVFA 4CQMD 1U90A 5K8VA 1P5JA 3USCS 1LBSA 3R0XA 1GDHA 1SWWA 2GXSA 4ZHQB 3QYAA 1G41A 4DZRA 3DDWA 1QNFA 1SPXA 1Y4ZA 4J0GA 3X0DA 3ZVNA 3J81k 4KN9S 4P9NA 1BSVA 1YL7A 5LMCA 1HFWA 3ICPA 3N58A 4KBGA 4OHYA 2ERXA 4DS3A 2HM7A 1FTQA 4C4ZA 1WZNA 3DDHA 3OKPA 1PL0A 3PD0A 4QPNA 5BN3A 2P9HA 3FYHA 1QB8A 2FSFA 4PZCA 4KFUA 4GXQA 4H35A 2O1WA 1YB2A 1AQYA 1D2HA 3HA3A 2I6XA 5FUVA 4WZZA 2X4LA 4LECA 4GR4A 1EWRA 3UBTA 4BO7A 4LDPA 1NW7A 2YY7A 3WB1A 1V3UA 5EUCA 1P0FA 1IUNA 3OZDA 4Q19A 3W5IA 4YEDA 1VDMA 5U1PA 4F5WA 3B9QA 3HFSA 1ORVA 3ZGZA 2MWMA 3DE6X 2EKZA 1PQWA 1TAHA 2XZTA 4C0HA 2FEOA 3ZY4A 1V6CA 4IF6A 1AB5A 1V5WA 4TRRA 3IPCA 3RI3A 2BDTA 4ZZ0A 4A36A 4C3UA 3U4CA 2E87A 2VUSA 1CUJA 1YQGA 1SQ5A 3R3WA 4TLAA 4UVIA 4FEAA 4TSFA 1Y1PA 2BEJA 2V58A 5FTMA 5F3RA 4AO6A 3C8UA 4BFWA 3BE5A 5DB4A 4F85A 1WBBA 3ET4A 2R6JA 4NOJA 4MQMA 4OQLA 1OI2A 1VP9A 1U6KA 4TVOA 4W9NC 3PUHA 2PZLA 5HKOA 3LZDA 2PPVA 2CUTA 3LC0A 3P8ZA 4LJAA 3FCCA 1EGVB 5BSFA 1RIIA 1RFGE 5KYNA 4PHHA 1AHNA 2BHSA 5A0TA 4QODA 4PFQA 5H3LA 3AO0B 4IJUA 4NAHA 1H0SA 1R27A 4O8ZA 4ZODA 5I9NA 3VH2A 3E3AA 3U26A 1SUBA 3VR4H 3WRXC 4LWZA 1QP4A 3LBYA 5FFFA 4D97A 3QA3E 4IZOA 1SEPA 3R7BA 2PWBA 1CUSA 3B78A 1XEWY 3V4RA 8ABPA 2XXAB 3REGA 4GLLA 3RUDA 3VMMA 3GLKA 2PGNA 3BCRA 1GV1A 2P2DA 3EXFA 3IQHX 5LDGA 3U4HA 1GCOA 2JGEA 2B4QA 3CIFA 4E5PA 5JT1A 4PHTA 3A7EA 3WBFA 3R0IA 2WT8A 2ZSHA 1O7JA 4X92A 2I7XA 3PWSA 2N9UA 4ZVUA 1AQIA 3N74A 1E6LA 4GGOA 4MRRA 3V8NA 1QIMA 1HT1E 1KXJA 2PKQP 4LE2A 4YX9A 1K0UA 1J70A 2ENWA 1O6ZA 5ALHA 2CVQA 1H69A 2FSIA 3DCNA 3N6RA 2P2YA 3BF7A 3MJ4A 2PMDA 3Q0EA 4YACA 5JD3A 3BGWA 3LXUX 5BQFA 1PYDA 2Y77A 2CBGA 1MB9A 4Q3LA 1F0KA 3NHAA 1L7MA 2EKQA 1Y3IA 3K5PA 4KQEA 3ET5A 1XDUA 3O8LA 1M2VA 1KKLA 1WHTA 1Z5UA 1U0EA 4H18A 4JIGA 5E4JA 3N7UA 1ZH6A 3QVLA 4GIBA 4EX7A 3OJFA 2YJ5A 4HHEA 4DCSA 2I6SA 2B7BA 1GZSA 4IXNA 1JV2B 3L0OA 3P4XA 4UZFA 4A4DA 4CKEA 4YCAA 2VHXA 1F7VA 1DI0A 1IZ0A 1RLOA 1S2DA 2Y93A 4RFVA 5JS2A 4X1IA 3T5CA 4LFBB 1WUIS 2DFKB 4YT4A 4U8HA 3GEEA 2JAOA 5DHSA 3QFHA 2F67A 3RG2A 5KI6A 2PFGA 3H99A 3ZKWB 4KIGA 3D6HA 3DS8A 5TJHA 1AGPA 1JSXA 1JEJA 1GGMA 1W34A 2R85A 4UBIA 3TK1A 5KWEA 4IOKA 6LDHA 2ZSAA 3CC8A 1WLYA 1G8KA 5JE8A 1BZYA 3IOYA 4G5YA 5D7BA 3UJ9A 4B3IA 1FDTA 2WHPA 5ALWA 3BHJA 4I6EA 4X24A 2A6PA 3LUBA 5MFPA 3AY3A 3ZDXB 5LDHA 3RVQA 3WNQA 3LHDA 1IONA 4K81B 1OAOC 4KVGA 1GFIA 5EKSA 4LFAB 5EJGA 3JALA 1D2EA 1T4MA 2IE8A 1GGJA 3SF0A 1QIKA 5M34A 1Z2DA 4CGZA 3QVXA 4HVTA 2OHHA 4Q1EA 4A26A 4F2DA 5CYOA 1ZJZA 2XAAA 1N7JA 1Q1QA 3L79A 3QKRA 4R2JA 3MYYA 1SXIA 2YINC 4CV1A 4BWGA 2OBBA 3QENA 1T1IA 2AUNA 3RANA 5CHEA 1DINA 3IRVA 2LCQA 1A9PA 3G8DA 2GQ0A 3H6HA 1DJQA 1BU5A 1C4KA 1MO5A 2D00A 2PIAA 3UATA 4O4HF 3CZCA 2IT1A 1IVNA 5KMGB 1RLIA 3L7LA 4MQ4A 5FUYA 3DFIA 5EOVA 3FYTA 1MJGM 3L4BA 4LDQA 2CW5A 3R7NA 4HDCA 4UREA 1DKLA 1ZH2A 2ZZKA 2OV8A 1O96A 1WB9A 2YRXA 4UVGA 4QRDA 2WKRA 3PQFA 3GEHA 3VJMA 2XE6A 3X1DA 4LF5B 2VAVA 1Z6QA 2FLKA 3EFOA 4BGDA 1UJ5A 3IERA 3E4CA 3LV8A 5JJCA 1EVQA 4XGQA 1P0PA 5JLJA 3EZLA 3VYRB 1Z6XA 2FJ0A 2WILA 3K16A 1WD7A 3H8VA 4FGWA 4HADA 1VRCA 4HQLA 4IFBA 3VBEA 4F5ZA 4CIBA 5ELXA 1Y8ZA 2O8EA 4FDLA 3BSFA 4YRDA 1HKUA 1YB1A 3IUPA 2ONYA 3MJCA 3TVDA 3CKLA 4FEGA 1WTCA 1RHMA 2V0NA 4XI9A 5DJ5A 2ZJZA 2ZJOA 1NVFA 2B6NA 1LD3A 2IZOA 2PAFA 2ZJ8A 2GEFA 3D3WB 3K0BA 3OSZA 4FZRA 4DSUA 4HDMA 1SBYA 3BJIC 4I9FA 2ZS7A 1FU7A 2J33A 2YUTA 3BMNB 3FVWA 4KVAA 1C3XA 3A6LA 4TKUB 5FO0A 3RQIA 4W7SA 4K6OA 5BWNA 3GFBA 1QUFA 4LWQA 2YJNA 4E4RA 2CFCA 2WHYA 1ZN8A 2A5FA 4NU0A 3IKVA 4X00A 3HTXA 2MCFA 4PHGA 3CVYA 1T9GS 2HMAA 3BWMA 2G9RA 2HHAA 3I42A 3R4CA 3KQSA 1K5PA 1RXVA 3ZK7A 1BKYA 2HNBA 3CR8A 1XEXB 4IDNA 5A3JA 3QKSA 3K5IA 4EFNA 1RTTA 3FPCA 3IVRA 3KKMA 5HX7A 1D3AA 1GZ6A 3HLKA 3R7SA 4F11A 3I92A 1QKKA 4MHOA 2F4VB 3NR2A 2PRSA 1DP4A 1OR8A 1PAUA 1RR6A 2J07A 3BIFA 3HEMA 2VCEA 3CRNA 2Q5EA 3IULA 5L7YA 4IDQA 4OCZA 5C8XA 1MX3A 1RYDA 1LKZA 1R88A 3BWCA 5F5XA 3BWYA 1D1TA 2QAJA 1V1RA 2BRUA 2CKDA 1G2QA 4KB5A 2VRWA 3RQSA 1FBNA 5GONA 1SNYA 2IEIA 2BCGY 2HUPA 4EG1A 3C8MA 4YYZA 2ODPA 1ORWA 5AQ1A 1HORA 4PCVA 4MQBA 4NJMA 1NBMD 1E98A 3A6EA 4X3OA 1I01A 4JJ7A 4ZV7A 4TKLA 4AG5A 3JWHA 2ZYSA 3K9NA 3PYMA 3L02A 1GYRA 3WK5A 4S05A 1MG0A 2BELA 4MK4A 4F12A 1XMJA 4RV5A 3HH8A 3QKUA 1P3Y1 3WTCA 4AJJA 2NZVG 2F3PA 8OHMA 3VDXA 4CNQA 3QGMA 3D1LA 3LDHA 2XPCA 4JBHA 4HLDA 2ODBA 1IMOA 2DQKA 3QSGA 1ISMA 4PLZA 5BWBA 1T8RA 2R6AA 2X22A 3STYA 4IV0A 2P9GA 1TM2A 4KE9A 1EA7A 5DLEA 2BFMA 4AKHA 3LPAA 4YREA 1RC0A 5KJCA 2FLVA 2H0QA 4GP7A 1FIUA 2ZU0C 3N9IA 1U2GC 3KFXA 3G23A 4YJFB 3EMDA 4YP0A 3VYWA 4KR2A 1XQYA 1Y4DE 2H5EA 3H7IA 5HF8A 3TOCA 1Q6ZA 4P54A 4Y0NA 2XZLA 1OIWA 2JJ8A 1PZFA 2OG1A 3H1TA 4IHKA 5B1IA 4XARA 2ZG6A 4IRUB 4F56A 1HQYE 1RQGA 1VBNA 3LKBA 1WOYA 1BDBA 4CGYA 4F4FA 1JPVA 2WJIA 2Y1EA 2BAGA 1UIMA 2QR5A 1Y48E 2HU7A 2VLIA 4HQRA 4JSTA 4PPGA 4F9FA 2ZEJA 1UWCA 2FPMA 3UT0A 5E7QA 2BBOA 4RNCA 2FWPA 4BMPB 2Q49A 4DA7A 4HDSA 4MRMB 4BJ1A 1ZNWA 2ONCA 2OE2A 1MD9A 4MR8B 4UOZA 1QC5A 4L15A 3M6LA 2ENUA 4PGHA 4ALMA 3UW1A 1BFUA 4DCPA 2CB0A 2ZSIA 2FZWA 1IG0A 3DH0A 3PUIA 1V2HE 2LUOA 4QAJA 3TEFA 1DOZA 4HWRA 1V1JA 1HYBA 3AVQA 3FPEA 3WXMA 2X0KA 3IDFA 3AP3A 3LVFO 3NWPA 4BVHA 3ND5A 4NBWA 3JTMA 1N0UA 1V3TA 3I37X 3PI6A 4JJZA 1V8ZA 1HSZA 4PGMA 1N5KA 4GX2A 3SDBA 4ETMA 1BN7A 3K35A 4K26A 3EAGA 5HPYB 1MPXA 2QRQA 4FI3F 1Q19A 4U7PB 2VKTA 1DV1A 1P1IA 1R9NA 5FPYA 4HL6A 1TW3A 1D0SA 1E0JA 3PC8C 4N18A 2WKPA 4XIYA 4TZ6A 1ECGA 4YBRA 1FYEA 3K53A 3LJKA 4C7BA 1IVYA 3H2ZA 1TEZA 1CJUC 5CT6A 2CDNA 3FIJA 1ITZA 2B1IA 2EIXA 4PYQA 1YS1X 3TYXA 3L9XA 2BBWA 4U7FA 4YPOA 3GJ5A 1X8JA 2GCGA 1JWLA 2EJWA 1F8UA 5DBFA 5U4QA 4OHKA 4Y6OA 1L4KA 5SYNA 3S29A 1VYTA 2WJYA 3LFTA 2ILVA 2IKQA 2XCUA 4V3BA 5AJWA 2AK2A 1OASA 1BO6A 3GP8A 4WE3A 4V0QA 4DEVA 4UTRA 5LQKA 1T91A 3H84A 3C85A 4TL8A 2AE1A 5H83A 3GLIA 2ZJFA 1Y8QB 2YHBA 4FDUA 1VPLA 3J80A 1MRSA 3S5UA 4B4KA 2JGDA 4EVIA 1DDGA 2GK6A 2Q0XA 4FGLA 1NAHA 1CUAA 4UE6A 3RIYA 4WOBA 3CBQA 5IYZA 3BMCB 3U60B 2B30A 2V74B 4RDHA 4EI2A 4HNAB 1GKKA 1SIBE 2HWYA 5T57A 2QMYA 1M2EA 3LTEA 5LOVF 3JQGA 4GZLA 1RLJA 2HIHA 4DMHA 3PFGA 2MT9A 4S3MA 3D8BA 3GF4A 3UEOA 4LY6A 3GBVA 1G8HA 4G1BA 1N32B 1NLYA 4AKEA 1OD6A 2XUKA 3L5KA 1JEYB 2B8NA 5SY9A 1XCBA 4F06A 1CY8A 2PFKA 5IBPA 4XX1A 3BTSA 1ZD4A 4WEQA 1BYIA 3KUUA 1Q1BA 3HS3A 3PKZA 3DKVA 2DY0A 3QNWA 2QL7A 4NBSA 1X86B 3RUEA 3ESXA 4WK6A 4ZPJA 3H4VA 4P08A 1JRLA 2A3RA 4JCOA 4U2GA 5TC4A 1XQVA 4D8XA 1PNOA 5B55A 3ENZA 3U2QA 1FRZA 4DSAA 4IRXA 5A5DA 1MC1A 2F90A 4BQOA 4XVRA 1CEQA 1JL3A 5DYNA 1K08A 2C20A 3DYVA 4LYEA 5EE9A 3EH1A 3CKYA 3EGXA 2QL5A 4OAPA 2FR8A 3LF2A 4NICA 1YR8A 3I9NA 1I4EB 3N75A 4DSTA 3TNJA 3VR4D 5D1NA 2X5NA 2VJDA 3LS2A 3A4IA 4R9VA 3X1WA 1VHJA 5KREA 2PMEA 1ZK0A 2YWCA 2E1PA 3GZTB 2BZ1A 1KH1A 2WDPA 3E9YA 3KT0A 3T9BA 5I9MA 3UK0A 3W4JA 3DHYA 2BGKA 4PWYA 2I3ZA 3BVPA 1RBZA 2GD2A 3T9CA 1XL1A 2YV1A 2Z6VA 3A05A 1NUAA 2WMOB 4Q37A 1BDJA 1JTEA 3H6KA 4D74A 2BGLA 1Y8AA 2YXNA 3PZRA 4M98A 3QOWA 4L3WA 1S01A 3Q2OA 4Q82A 2B5OA 5EZYA 3RJ5A 1XZIA 2R1TA 2JAUA 4FYVA 3RODA 2ZU6A 1TYEB 4LJKA 1CK4A 4AT1A 4L27A 5CU7A 1WQ3A 3LG2A 5BYKA 1GEGA 2IVFA 4RV4A 4B6QA 2A14A 2PVCA 5REQA 2E89A 3QUAA 1PFYA 2VYVA 2WOJA 4DLUA 4H4CA 2VJYA 4KXFB 3RS4A 4LOKA 4XB6B 2YHSA 1L4LA 1QVRA 1SCBA 3DZJA 4DTCA 3GJXC 1A7AA 3A70A 2VTEA 3P20A 3OE7D 1FFWA 1X39A 2YOFA 3OA2A 1KP2A 4NZNA 4IXDA 3FPKA 4LJLA 5KAPA 1KEKA 5JAOA 5BR4A 1E4EA 1JIKA 2I8AA 3AFNA 3OCYA 3WLSA 2P8SA 5CEJA 3JD4A 3PGJA 2YC4C 3B12A 4Y9SA 2WYIA 1KKMA 1H5UA 4EUKA 3THWB 1XCJA 1V95A 5EKTA 6REQB 3NOOA 4RY9A 3MWDB 4U7TB 3UBMA 4MUXA 1PR9A 1V26A 3EODA 4MSUA 4FWIB 4EY5A 1W9MA 4UEOA 4JB2A 1X2EA 2WAAA 3TSWA 1IWPB 1W6UA 5GV7A 3W1WA 1A8IA 4CV0A 1VQ1A 5FHQA 4WLEA 1JFFA 2R8XA 3IAS1 4JITA 5AUOB 4NZOA 4WKNA 4ALNA 1C7QA 2I6GA 2W5UA 2NQ2C 3DXZA 3G0BA 2PGXA 2X1MA 3S2FA 1P6XA 1PFGA 3RTBA 1FYVA 4PPNA 1JVNA 3C8DA 4ARCA 2IGTA 1SKUA 1KAMA 1J2UA 2FG7C 3IEIA 4FK8A 4MO2A 1Z5PA 4ZAWA 5BN5B 5TRTA 5CIYA 2WVJA 3EPKA 3ZS9A 4YCLA 4US2R 1P6UA 4D6PA 1G8GA 1M2WA 2XGOA 3KM0A 1LX6A 3Q7TA 4LS3A 2QUJA 2IYVA 3HRIA 3RIXA 3W8DA 1RWBA 4ALIA 2P3LA 4EHJA 5LLDA 4HWGA 4IFIA 3IO3A 4BMVA 1ILEA 1OAAA 3FDZA 5IARA 5A62A 3AUSA 3N59A 3OEEA 4IQ4A 1CP2A 2FPKA 3R41A 4QA9A 5AKJA 3E18A 5J40A 4D43A 3LIPA 5AUNB 1JHRA 3W5UA 1PQ4A 4P3XA 1NIPA 4JD5A 1V3QE 3UKDA 5JZBA 3HZZA 1HO3A 3GEDA 1M5UA 3GL9A 2IV3A 3ROPA 4IRMA 1Y9JA 5C18A 2HRDA 4O3FA 1T9CA 4JQOA 4WASA 4M1QA 2A57A 1O9BA 3EPHA 1D1PA 2C5GA 3K1ZA 1V3VA 1DWOA 1ZUHA 4M55A 3SSMA 2O4UX 1A1SA 2ZR7A 2HWUA 5BSVA 3PNKA 3CE9A 1KA9H 5G1NA 3P9SA 5J4VA 4X45A 5HA5A 2F1RA 2NUPB 3GCZA 2FZVA 1JBKA 1HQKA 4M22A 3PE6A 4PW0A 4RW0A 3R75A 2NZYA 5DYTA 4ZOQI 5A2GA 4WECA 4FBMA 3RKSA 1QGZA 1SC1A 4RCZA 1HZZC 2Y66A 4MVXA 4MKFA 5C1IA 1BH6A 3FHTA 5E6UA 2HMVA 1RJGA 4GYKA 3V1NA 3BCSA 3DEKA 3MBOA 2W00A 4OGGA 5AK4A 5KWVA 1EWYA 4M0UA 3H5VA 3U3XA 4WA8A 1TCVA 1AMUA 1HE1C 4KLCA 1N2XA 3KJFA 1ZUD1 3T7EA 2RHCA 4G4GA 4LPSA 5LWQA 4CMAA 3EVFA 5JLAA 3MJEA 3REQB 1AE1A 2XUAA 4TS1A 3TLZA 1CZUA 3QELB 2GVDC 4MAMA 1VLJA 1V5EA 1E6WA 5TQ0A 1RRPA 2P9TA 1B73A 3A6JA 4OQ4A 2IYEA 2VHEA 3FI9A 3NV9A 1J00A 1JHMA 1P0CA 4WESA 3VZDA 3RSGA 4PFSA 2O59A 3E3MA 1PI3A 3N0WA 1N5LA 1T2NA 4G81A 2G76A 3ZBUA 4V38A 1HOTA 1ZUWA 2X6RA 3COZA 9ABPA 4L8WB 2WJZB 3LU1A 1H2WA 4H17A 5D86A 2HMUA 4K6CA 2C59A 4AW9A 4EHIA 4WJKB 2J6HA 3PV0A 1IBKB 1OWOA 2DPHA 1DZIA 1RHRA 2GLXA 3JZDA 3MWJA 1RQPA 4O2AA 4D4GA 2YJ4A 1EUCA 1F2VA 4C7MA 1YKSA 2AYXA 1WW2A 3LLCA 1UC5B 1DHTA 5AMXA 4AY5A 1XDGA 1SBZA 1T0BA 3FNBA 3Q41A 2O7VA 4IDOA 4ZQFA 4P0QB 2CBZA 4EGFA 3D3KA 4URUR 1IY9A 3R4VA 2Q2VA 3Q7IA 1QS0A 3OLZA 3WQSB 1NVUQ 2C99A 3NC0C 5IZ4A 1A7JA 3UQYS 2HPAA 2QROA 4IFTA 3UV3A 5K4HA 4QOHA 4N8EA 4WZAA 3AVXA 2QD4A 3H1PA 2AZXA 4CMCA 4Q4LA 4DV4B 3FAKA 3ORSA 4TWJA 4WXPA 2UKDA 4ZKEA 5EQFA 2PUGA 4YYEA 4FN5A 3HY3A 4G1MB 3CZAA 5DE3A 3IVXA 3HJCA 2VTBB 4LNUB 4HPWA 2AWNA 1EE2A 3CLRC 3R23A 3ZHCA 2WD8A 5AT1A 5KTRA 5FULA 1TM3E 3CLTC 3B36A 5FO1A 4WADA 1J0CA 5FTJA 4BP8A 4WMLA 3S8MA 3GVXA 3WQHA 2IXTA 2X19A 1KJ8A 1Y3BE 1FTWA 3D6MA 4Z1MD 2C3UA 3FPSA 3EXHC 2ZJBA 1BYUA 1QFYA 1D0VA 1L3CA 1NXVA 3GMSA 4R7ZA 1US8B 5DVZA 3CH7A 2O19A 2OLKA 2I6FA 2WWGA 5CYPA 4EENA 5F1OA 3G49A 3CUSA 4JOSA 4RESA 4D3YA 2C9CA 3GLGA 1TYZA 1I9GA 1JIJA 2EJBA 3FDIA 3AHJA 4MUHA 1PWHA 4JI5B 4U0KA 5DW0A 2J5XA 4ZYLA 5K0LA 4RGBA 1QPZA 3H1AA 1NNLA 1OLSB 2YHUA 2GWRA 3B7PA 4OJYA 1ISSA 1NY6A 4O1MA 1ZLYA 4UPEA 1O89A 3LQQA 3V3KA 1SUPA 1JT2A 3A3PA 3H9JA 5A6SA 3KEMA 4CR6A 2W37A 1L4FA 3A3YA 3JU3A 3ILHA 4AP9A 4URXR 3BQ9A 1G5RA 2I99A 5JTTA 4CL2A 2Q1UA 4MUKA 3TF5A 2GNPA 4M1MA 4CWAA 1XC7A 4HAVA 4ZRMA 2PM8A 3HJUA 4PQGA 4DLBA 5KC9A 2PCJA 3AFOA 3AJEA 2BGWA 1XLTC 3Q3CA 3GRZA 2HSWA 3MXTA 3BJRA 1GVHA 3SFTA 1AS0A 1FQWA 1JR4A 1O58A 2NW6A 3A58B 4K88A 2OFFA 5DOVA 2R5NA 4XUEA 4BMYA 4DDUA 1KEPA 3ZDZB 1LGYA 4N03A 2D8MA 1PX0A 2QK4A 3WLRA 4C7KA 4L08A 1FFHA 3TSZA 3WMRA 3GDOA 3F7NA 3VR6A 4WOPA 4GM1A 3D1JA 5FL3A 3C41J 4ZO7A 2J46A 3WQQA 3L4SO 3SCZA 4BMSA 1C8LA 1MCZA 3ELDA 2Q6VA 5KVQA 1ZONA 4H7EA 4BNUA 4DCTA 5TQ2A 4DXHA 5CXUA 2BE7A 4GMKA 3SG0A 3E9QA 2HQ1A 1PJ8A 3VKFA 1RYBA 1RQ2A 3ESRA 4B3TB 2QTTA 2WM8A 1E79D 2ZUUA 3OCXA 4GPD1 3RT7A 4FMDF 1C7JA 2DRIA 2ZRCA 3P9IA 3SNKA 4B4UA 4KDFA 4WZBB 1C7IA 4AZSA 3O91A 3QMMA 2W22A 1BMDA 4L4RA 1XXHA 4B43A 1UADA 4WY8A 5B7NA 5KTSA 2BHLA 3D6JA 1B1AA 3RBAA 1R0LA 1PJSA 1RZ3A 1ZISA 3V8EA 4UUBA 3FYUB 3OQ6A 4WDQA 2PV7A 3D7MA 4L0CA 2I8CA 1QNLA 3SHFA 1S8FA 4O4LF 1RT9A 2RH4A 3OOWA 3VTFA 1HYQA 1WZCA 3T3MB 1ZOSA 3B3AA 4DABA 2ZWMA 3D3NA 5IKEA 1CRPA 3QVWA 3UJ8A 3V7UA 2LNDA 2AS0A 4B3DA 3AI1A 1Y37A 5DU2A 2YMQA 2WDZA 4XPIA 1W36B 2YVAA 1R8JA 4WFQA 1LPPA 1GY8A 3QLVC 5ESDA 1NRWA 2NTEA 1W0KA 1YBAA 3F98A 5LLTA 5K2OA 2PUDA 4QQ8A 5L3QA 1CB0A 1TCCA 1Y8CA 3HP1A 3A3OA 2Y3IA 4YP9A 2XNCA 2ZYUX 1GPKA 5F3WB 2ECPA 2OVBA 3KJXA 3OETA 1R4AA 2GAFA 4HNQA 4PR0A 3U7QA 1M83A 3VOBA 3WOHA 4ARVA 4R9RA 1VKHA 4GMHA 4L7QA 1FW8A 4ERNA 4QDUA 1FX0B 3H1GA 1DEAA 3TLGB 2F64A 1T0JB 1BCSA 1P5FA 3GNTA 3OTHA 3GDFA 4LA4A 1LPAB 1ZK2A 3C5VA 1FXSA 3WBKA 4A10A 1JDNA 2YFHA 2EFCB 1BXGB 3H9BA 4JZKA 4B7ZA 3IP6A 4N0MA 3VISA 2WAYA 4TLMB 3Q4GA 1XMXA 5IFKA 1W6RA 2FP4B 2REQB 3PJEA 1SHKA 2IPLA 2E37A 3AV0B 1IL0A 3I9V1 3PQ2A 4QJ5A 4DV3B 3DUFA 4HXEB 3TEMA 1FYXA 2IIBA 2YY5A 2P0YA 2WSBA 3P0RA 5BQXA 2O3QA 4O2BA 1U31A 3BJMA 1QLWA 4DIDA 1P7PA 1SURA 2X3FA 4U0JA 1P8JA 1K6IA 3R3YA 1NX9A 3KUXA 4OMDA 1MB3A 1FUYB 2BW0A 3CRZA 1K92A 3OFND 1DARA 1WB6A 1Y5IA 3KZVA 3NRCA 3OZRA 4I6GA 3TNFA 3ZE8A 5ADWA 1T3SA 1XPUA 1ZM3A 2IHBA 1A76A 1FP6A 1C1YA 4BGUA 4UFOA 5F2NA 1CS4C 1SUWA 1HNXB 3AR3A 2R84A 5H16A 3VKWA 3VNBA 1UP4A 3VBCA 1XD2B 3DTNA 1YQUA 3FOBA 3C6MA 3EW9A 2DTEA 3B9BA 5LP6F 1Z7YA 3SGLA 2P9CA 2Y0DA 4TSRA 1IHXA 3EZ7A 3W8EA 1G0NA 2DWPA 1D4ZA 3AJ9A 1DWQA 2BC9A 1V6SA 2JCSA 2MHCA 3K1AB 3OIYA 4Q1FA 4NMWA 3IR7A 5KINB 1XCLA 4L07A 4RVFA 3TXXA 4CQNA 2UZ0A 1P5RA 3TW8B 3QUQA 4KQHA 3OQVA 2JI7A 2QD5A 3FI0A 4MW4A 4GL2A 4BO1A 4O08A 5G0TA 2W58A 3ETEA 4B87A 1FDSA 3WGLA 2RHMA 5DISB 4Z4EA 2OSVA 3MFYA 1IDN1 1OXSC 2R1UA 5HBRA 3RPEA 2UVQA 1LS1A 3VMFA 1JXOA 4EWLA 1B6RA 2BISA 4NOKA 4ZEVA 4BKOA 1DS6A 1GDDA 221PA 5JAUA 3C6XA 3ZEIA 3Q3IA 1C30A 2DQYA 4OU5A 4YTEA 2CXNA 2ZTLA 4BJ3A 1W88B 2F1HA 3GX1A 2QBYB 1WF3A 2ZTUA 3DA8A 2CB9A 4P3PA 3B38A 1W1IA 1FYFA 1RZUA 2VJAA 3KHUA 1T5SA 3L7NA 2BPOA 3AGQA 2XCQA 3BX1A 4OLFA 5DCLA 5AW6A 1F8FA 1MJFA 3ZV7A 3EYWA 4ND3A 1AKEA 1BQ3A 1X19A 2ARKA 2PD3A 2O2GA 1AOXA 3F7OA 3U49A 1DJNA 4C4RA 2JVIA 2LW7A 3UANA 3BXOA 2J31A 1A88A 4AG6A 5KNCA 3GGGA 5KUTA 4ACBA 3L6RA 4ZVPA 1JA0A 4OA8A 5G02A 4HQ0A 4CM9D 5AW4A 2X8WA 4JLBA 3V1UA 3T5PA 2HDNB 4MJLA 1RYHA 1SCDA 2WD9A 2ZJ5A 3AZPA 4TSKA 4GXRA 3TAXA 3N28A 4D3XA 4OYYA 3KV1A 1BMTA 5CYGA 5LU8A 1Q7GA 5EEHA 3IUYA 1CJMA 3AHHA 3LY8A 4AU1A 1ZITA 1I24A 3A1EA 2GPYA 4LQLA 4AQDA 5BOSA 1QTRA 3IQWA 3CXUA 4CBVA 3VJKA 2W6MA 1U3TA 2W6JA 4U00A 1A77A 5CA1A 2QR3A 3TXAA 5ITSA 1OZ0A 1KBZA 4X54A 2I91A 4TXJA 5BR7A 4A5OA 3RYFB 3C39A 3IIKA 4ZTZB 4CMEA 1I2MA 4EL5A 4XUDA 1VPWA 2E4YA 1DRWA 3EVNA 4XJTA 1U5AA 3JZFA 3T3EA 4HN9A 3L07A 4DQUA 3UWOA 4OFBA 4ISCA 4AXXA 1VE3A 2I2BA 5CGQB 2J3KA 2P1ZA 3VPAA 2XUJA 5JHHB 4FCTA 1UK7A 5HF9A 4X1KB 5HCNA 3K4HA 2GN0A 3ESAA 4YDRA 3BWVA 5DYYA 4ZI5A 4B3JA 2ZXFA 4YMTA 1MF7A 3VDRA 4C4XA 4ENPA 3C1UA 1GPYA 3VAZA 4AYTA 1IBCA 1JPUA 1GPNA 2RBKA 1JAZA 3A6KA 3D54D 1WSWA 4OHVA 2GAAA 3ZD6A 1VL1A 3GCWA 3DAGA 1XL0A 3LPMA 3SZOA 2UUBB 3A6PC 3KQUA 3IV7A 3QKIA 1GNRA 2AHRA 1BDHA 2HIAA 4E30A 4YAIA 1XK7A 1N2CE 2PZEA 3I1FA 4MZXA 5DLQC 2C7OA 3WLNA 3LHIA 1XMPA 5BWLA 5CAEA 3FUCA 1NXOA 4GI2A 2IBTA 1YDFA 3HHEA 2V7BA 4G5HA 4Q9NA 2VQDA 4FC6A 1K3TA 4G0OA 2XIJA 3RUCA 4BXOA 1E3WB 4GMFA 1DC6A 4GW3A 3K8OE 4IS3A 4GLOA 3AKDA 1E63A 1WBJB 2HEGA 3NHWA 1L5LA 3SBOA 3V7FA 3X2FA 4KQCA 2XNDD 1QUEA 1VLVA 3WYAA 4D4KA 5FTNA 1GT6A 3LGAA 4GVLA 2ZTHA 1NOIA 2J32A 4Y2PA 4DNPA 4DV2B 3CT4A 2RGBA 1QFMA 2RG7A 4Q7QA 4FNOA 5DI3B 5JS6A 3RVRA 2NACA 1RXYA 3SS7X 1LSUA 3LECA 2LPMA 3H5NA 2G0NA 1RI5A 5DT9A 4X97A 2G1PA 3LW8A 3I1JA 4MUJA 1HC7A 4EHBA 1KZ4A 4NZYA 4LOAA 2K87A 3L6EA 1AKMA 2VZ0A 4FE3A 4GNKA 2C03A 2H7YA 1J24A 1QTIA 2VHJA 3LNCA 4G63A 4UDNA 2J9GA 4I4IA 2IHUA 2WZDA 2QUAA 2VN8A 4AAYA 3H9GA 4D4HA 1B3BA 1RCUA 3VPXA 5I8PA 2JBHA 1EK5A 3T8YA 1OBVA 3TRKA 3CEPB 4LHVA 1R37A 4PO8A 1EE1A 1T5IA 1KK3A 1AUOA 4H15A 2FFRA 2BFAA 4DLXA 2RC6A 2IITA 3DHVA 1Y8RB 2EJVA 3TIXB 2P30A 4JNCA 5GQSA 2GS9A 4R1LA 5JZMA 3NWJA 1R12A 4TMVA 3M0EA 4EECA 1T6ZA 1WA5A 4F6RB 2ZT6A 3TCXB 1NVAA 2CNOA 4UTZA 5TSDA 1THGA 4HYEA 4A27A 4ABYA 4MLDA 1Z08A 3KB6A 5IVIA 1C0PA 1EM6A 2GA9A 4EF6A 2G4CA 3DDCA 3ZPXA 1QGAA 2VDPB 3OF3A 1QKJA 2CDRA 1NYTA 1ZMOA 2XT6A 3OZBA 1K27A 3JVEA 4IIHA 2XXBA 1FP2A 3EGVA 5CRIA 4J03A 4OXQA 2B4YA 4G8DA 2RGYA 3BORA 4LHYA 3CVUA 4AQYB 4DIKA 2PT9A 4CKYA 1WZ2A 1Z34A 1UBUS 2F4NA 2V7QA 4Z7NB 4KQXA 3LHSA 1VCHA 1MLDA 4G37A 4L73A 4ZZ1A 5BNIA 3TQRA 2REXB 4BJ5A 3BERA 3SYTA 5I8WA 1GJRA 3AVVA 1AHIA 3GEPA 2FMTA 3NIDB 4HDKA 4CKCB 3LUFA 2AJBA 5LKRA 1UP7A 1TUBA 4GKJB 4JJEA 3M9XA 4O6VA 2BN4A 4PFKA 3TAUA 1GZ3A 1L5OA 2YS7A 2H7VA 1FOEB 3DQZA 1A4UA 4OM8A 5FI0B 3UUWA 4CFYA 1ENZA 1ZWKA 1G17A 1SKYB 2JEZA 3GIDA 1ULZA 3I28A 4MCJA 2XQIA 1DFHA 4NK5A 3ZU4A 1EKXA 1PGNA 1A7UA 3B1WA 2IIPA 1ECPA 3HMKA 4JP8A 2XHZA 2ZIEA 4Y2VA 2AI1A 3S55A 4RABA 2FWIA 3J7TA 1NVVR 4E5UA 1SBQA 1KARA 1ZX1A 4YC7A 5D1HA 3ETHA 4FD3A 2QTAA 5JWRA 2XDYA 3DBHB 4PLTA 4Y6RA 4YRSA 3V97A 3PPXA 1U3FA 2B21A 2W6QA 2CFTA 1PTKA 1ONPA 2AI2A 2ZSJA 4J7XA 2LIVA 3KALA 2E0IA 3NUGA 1G60A 2J6IA 1LZKA 1QH0A 2NU7B 2QUBA 4H08A 1N75A 5D7NA 2FPWA 2I3GA 2YNMA 3JQBA 4MYUA 4TTJA 1CP3A 4B35A 5JD4A 1QU3A 4IDEA 4P4SB 3GY0A 4H59A 1F2UA 2HQBA 4KX5A 1UMCB 2ZAMA 1YVRA 3JAMA 4MHTA 4DILA 2HXYA 4UBNA 4INJA 2I03A 1QQ5A 3F49S 3LT1A 1XJ5A 5DGTA 4M88A 2G9VA 3THRA 3OTIA 4H6WA 3W05A 4CEJB 2I65A 4P83A 4YCBA 2Q2NA 3T3HA 5CDUA 2V03A 1CQIB 3OPVA 4I4NA 1VI2A 3LO8A 4IQ0A 4JSRA 4AY6A 3E61A 1EAMA 1RQNA 2FLWA 4KYTA 1WXDA 1U1GA 1U8AA 5FEMA 1JGTA 3OA0A 3NJRA 2PRIA 1M0SA 2Y0CA 3D3JA 4ZC8A 1D4AA 1JZSA 4ZHQA 5M7EA 4LY3A 4MROA 1QQ6A 1XDZA 3OWXA 5BRAA 5K6TA 1KJNA 2PANA 1KFBB 2REOA 3D4PA 4DRZA 1AV7A 1Y1SA 3ZI7A 4W9MC 5E9AA 3G9UA 2JVJA 1PW5A 3FX2A 1FNMA 1Z4KA 2K6GA 3EVEA 5K0SA 2VF7A 4HPXB 4AMYA 5DWVA 4HQNA 5AHRA 5AXDA 3BXEA 5HM6A 2R60A 1KZHA 3LK6A 2VDWB 4XASA 4EYQA 2I78A 4HUQB 3VZCA 4L8FA 4UNSA 1N0WA 2V7XA 3LBAA 3PJFA 4CM4B 5L6LB 3NAZA 3H04A 3IBCA 2WYHA 3H13A 3SJZA 4X7PA 1F6BA 4H7JA 5EJ7A 1RAGA 4B47A 3L7AA 1FXWA 4R1SA 3V4PB 1IHPA 1HETA 2PXCA 4J9VA 4Y9UA 1JWAB 2AT1A 4QGFA 1IN4A 4UXHA 3LOUA 4MW2A 5EUBA 5L95A 3PEWA 1QF6A 4BFLA 5BV2P 5AI8A 1WNFA 2OKCA 2UVPB 4KX3A 3HVUA 1PGOA 2ZULA 3E81A 5I7HA 3J81A 3R8FA 5DM0A 1FMLA 4RMGA 5HCUA 3KQPA 4HTAA 3ANMA 1X3SA 1Z62A 5A0FA 2JIOA 1G20B 4IY1A 4O4JB 4WFIA 1IH8A 2PZKA 4KE7A 1ZD1A 2PSFA 2X2PA 1GR1A 2ZYGA 3AEUB 3K9GA 4U5XA 3U5ZB 3EUWA 3WLMA 2VA8A 2X2EA 3CSDA 5EJEA 3OCWA 4OGFA 1K4YA 2ATEA 5E0OA 4CU5A 4CJXA 3C5WP 1F7UA 1DX6A 4TWBA 4ODIA 5B5SA 5HKBA 2YCBA 2H1HA 1R10A 4CHTA 2KQUA 1WNTA 3DEYX 5L3ZA 4B83A 2XXAA 4FBGA 3RVJA 4YQFA 1M6WA 5A06A 1W85B 2NSDA 2IUYA 1EFUA 3PUKA 4DIUA 5SZJA 4I9HA 1PDVA 4M0CA 4I08A 3DVLA 3JYPA 4RKWA 5J9FA 1HGXA 4HAOA 4EHHA 4PANA 5A02A 3V00A 3ORQA 4PBTA 1UOQA 3MS4A 4ZI7F 1KFJB 2GNOA 1JUDA 1GXSA 3GVIA 1N6HA 1A2BA 2D06A 1KFEB 4ARZA 2A5GA 1P1FA 2Z8YM 5ALEA 1IULA 5I5EA 1CULC 2KX7A 4I66A 4Q9KA 4BQSA 1ZN7A 1YRLA 3DAFA 4D3SA 4K03A 2FFQA 3WMEA 5EP2A 5F9FA 1VGRA 1QIIA 5L53A 2XB9A 1SD5A 4QRHA 5H0IA 4AROA 3AL0C 3SZUA 3BMOA 3BMXA 2I2WA 1XLVA 1E6KA 1EFDN 3MPOA 1UJ4A 2VHTA 1WKCA 3GG2A 3OLQA 4RC9A 4ZICA 3IDZA 4BS9A 1DC3A 3PDHA 4Y1EA 5HM8A 1E1KA 4OQXA 3HN6A 3FTFA 2O8BB 4QRIA 3MUFA 4YRQA 1Z6AA 1M8GA 1N2ZA 3RS8A 4BC0A 3NTQA 5D3QA 3C5CA 3QTLA 4C0QC 1G5HA 4DCMA 1SB9A 2BH9A 1N2HA 5AICA 3V8PA 3VU9B 3VC7A 1HG1A 2ZR8A 1E1MA 5EN4A 3WX0A 3Q8KA 3BL5A 1B16A 1DNPA 1M7HA 2H00A 4GZ5A 1J9GA 2NO6A 3ZKWA 1YR7A 3BULA 4HGZA 2M1ZA 1UMBB 5IT5A 5DTJA 4XTRA 3LW7A 4P4NA 3FTQA 3WIOA 4HMOA 3C8ZA 3P45A 1L8LA 3LUKA 1C81A 5B1HA 5CFRA 4M1EA 5ES4B 1YZHA 4MWSA 1NYRA 4N7JA 1GTVA 4B4VA 1DQYA 3MTIA 3PXBA 3TGLA 3ZE9A 4M0LA 2HEIA 3KZMA 4E22A 1JVSA 4UHBA 2YWHA 1AZWA 1QF9A 5JXGA 2B99A 2W9XA 1B14A 2ZIGA 3IAHA 4JOQA 4DNQA 2I54A 4JZYA 1YTLA 2YV4A 4XJVA 3P97A 1PKXA 3WQBA 2W2LA 2CJFA 5FUWA 2PE5A 2DQZA 2ZSBA 1BU8A 1RHKA 1P1RA 1UXGA 2NYVA 2QN2A 3MHPA 1ZN9A 1D6SA 3ES9A 5HKAA 1II9A 4NCAA 1EIWA 3H4TA 3BA1A 1DX9A 3NTVA 1ZINA 4P3NA 5CVTA 4BBZA 1NBHA 4ESVA 1THTA 1SOAA 2RHJA 4YDHB 3AIIA 1X1TA 1ZUNB 3TNDA 2JLZA 3O47A 2PK3A 1FU4A 4OTZA 4K1LA 3PDCA 3W8FA 4Z53A 2FQYA 2JJQA 4CLRB 5KMGA 2CNWA 3LWBA 5A2QA 1IEXA 5I48A 1Q7EA 1GFWA 2FEPA 4ND7A 3BGOS 3CNOA 1O87A 2OV3A 3SHWA 4KWCA 3F67A 3E7DA 2OC9A 1KSGA 1I3LA 1QJ4A 2J87A 3FYDA 1VE6A 3A2MA 3B2NA 5BW8A 3L1JA 4C6HA 3D6TB 3I8SA 1WP9A 3PQ3A 1E9AA 2W2MA 4IGIA 5AYVA 4LY0A 4XH9B 2FCAA 3ILVA 3QWFA 4H6PA 4P4LA 4C4TA 3L9WA 5J63A 1OY1A 2JD0A 4F91B 1TJ3A 5DLYA 5IANA 3TMKA 2WFMA 1FTSA 3DUWA 4OQNA 2XBLA 1PGPA 2O0JA 3ERCA 3EC7A 5TS2A 4KV9A 4QJ3A 2V5UA 3NIWA 3PL1A 4UDXX 1M74A 4AYWA 2PCLA 1EXMA 3I39X 4MTCA 1W29A 3QMVA 3D3WA 5EJ8A 4A92A 4ZAFA 2JRCA 1V16B 2PGLA 5DNUA 3FUUA 5FL7A 1RJFA 3BMNA 3DOFA 3OTGA 4TKUA 4BTEA 4PIMA 4PLVA 2N47A 4RE6A 4I5FA 4IILA 4R1OA 4K1XA 2ZUEA 3EXG1 4BO6A 4IOMA 4JEHA 1PWYE 2YHIB 1FEZA 4YRFA 4Q3CA 1UXKA 3LCCA 4Q4JB 4CMKA 4RKRA 3KKQA 4HNGA 5AVYA 4GPTA 4PGGA 1YR6A 2VNKA 3CF4G 3K6RA 3BC1A 4BZXA 3VYSB 1ZGZA 3C6QA 4N49A 3DZIA 4V0ME 5J5VA 3SD7A 1FFDA 1XEXA 3TJRA 1H94A 3NRJA 1DELA 4C2UA 3GT3A 1N1DA 1O6BA 3P2MA 4G24A 1YR2A 2XNSA 1OI4A 3I0NA 5AH0A 4Z9FA 2PGAA 1MP0A 4K6FA 5GIPE 4F92B 2ZYHA 5HTOA 1V71A 5KO2A 3RK1A 3PQDA 3GCXA 5FA6A 4LTDA 3TTYA 4FZJA 1AK1A 5AUQA 1XJCA 2DCUA 3GAMA 5B7PA 1XTJA 1HT0A 2DUUA 4B3RB 3NVDA 2WE8A 3U7JA 1O95C 1NT2A 2DHDA 2R8PA 1WCWA 4PE5B 4JVSB 3V8RA 5K0CA 3KC2A 2M32A 3DMHA 2QPLA 2FEWB 5D6NA 3SVTA 4JFRA 2WQZA 2W98A 3PNVA 3ZJ5A 4DLZA 3LE8A 1RE0A 4M9RA 3C3DA 5LFAA 2Q7DA 4B74A 2OD2A 1YS7A 4KRXA 1QHSA 3GFRA 3T4EA 3TFWA 1X1RA 3X3HA 2MYTA 3T7CA 5CJJA 3IUSA 2JAHA 3LUHA 3AUKA 2GN2A 3VU3A 2ZM6B 3IV9A 1K8XB 3ADDA 5AKEA 2RJ3A 1OXBB 1MQSA 3IYLW 1Y98A 3IAM1 3EXEB 3LCMA 5EI5A 3BTVA 3DE3X 2VNJA 1XAHA 2R8RA 2EFYA 3PFIA 1BQEA 4MA0A 1XI2A 4YJFA 5E3JA 2GVZC 1I32A 1Q77A 4QAQA 1BMFA 3ZN2A 2XB8A 3BYZA 3E03A 4YRRA 1PTJA 1P33A 3JQAB 3MGKA 4BNKA 3QWBA 1JG1A 2EFHB 1SXJC 1RHQA 3OZWA 5DGCA 3KT3A 1T24A 2EW1A 4TQAA 3R7WB 5FBHA 3DPIA 4BWVA 2NV0A 1VIDA 1Z7EA 3UWMA 4DJAA 1KK0A 2AUMA 4FSHA 4B4OA 3JTEA 1F0NA 1F2TB 3F5MA 2O52A 1NI5A 1SBTA 4MRMA 1XPOA 2AHOA 4DGQA 1H5QA 1U7OA 2C3YA 1AC5A 4GM0A 4MR8A 1XTBA 1UQRA 3RWOA 4EM6A 1MJNA 1KVUA 3GAAA 1U7WA 1KXZA 3OJEA 1RI3A 4P7GA 3QU9A 3Q5GA 4WX2B 3UH0A 1XEAA 4CKBB 5JFGA 1C4XA 4QDJA 4HGRA 1XEFA 2Z8ZA 4I7EA 2V4ZA 4ER6A 3UMBA 5FDFA 3E7PA 2O14A 5ALKA 4GD3Q 3M6FA 1W93A