1CLUA

H-ras complexed with diaminobenzophenone-beta,gamma-imido-gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
160
Chain Sequence
MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Guanosine triphosphatase stimulation of oncogenic Ras mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cluA00
1U81A 2FWRA 2PT5A 4TLCA 3VR3A 1M34E 1SKYE 1MR3F 4HUQB 4BECA 3IPXA 3K0CA 1F2TA 2I1QA 4R71A 3K0FB 5JFGA 2WWGA 2XTZA 1DG1G 1D2NA 2G3YA 2Q3FA 4S2EA 2YWHA 4TTRA 5G3ZA 3GLGE 3SR0A 2ORIA 3FVQA 1VPLA 1H65A 3UG6A 4PAOA 3PFIA 1N6KA 4M1YA 4B2IA 3ZVNA 1G17A 1KSGA 2Z4SA 1F5NA 1LY1A 2KWIA 1KK0A 2QAGB 1NBME 2GNOA 1IQPA 3CIOA 4CIDA 3KQLA 1Q0UA 2OCBA 2J46A 4EPWA 1Z07A 2RB4A 1YR8A 1IM2A 3DDCA 3IHLA 3U44B 4G5OA 1U8AA 1P3JA 3LBHA 3SJZA 2OCYC 4F38A 3QJYA 1DBSA 2AHOA 3KFVA 4PSKA 3QF4A 1FOEB 4NCHA 3M4YA 5BYJA 3TK1A 4C2UA 4BZPA 1KI1A 4HAUA 1M7BA 2GKSA 3VR6A 2J0UA 2V6JA 1U94A 4AG6A 4A8JC 2NO9A 3T5DA 1NVUQ 4F4IA 4IDQA 3A1VA 4LJAA 1R7RA 1N6IA 3EZ7A 4FW9A 1BS1A 721PA 1W36B 2O8EA 1CRPA 1M2OB 2O8DA 121PA 3B78A 1W0KA 4G01B 1S3SA 4JL5A 1AGPA 2ZROA 4V0MA 3W6PA 5KDOA 5E7MA 5FI0B 4LGMA 3BH7A 3BK7A 4D4KA 2D62A 1XMIA 4IKEA 1BYUA 3RS2A 4LC1A 4C0JA 1DAGA 1AQUA 1OE0A 4NYMQ 3V4FA 3L0SA 3LQQA 1AZSC 2DWPA 2X2FA 1TL7C 2IL1A 4S35A 1BH2A 1HT2E 3CUEF 3W3ZB 3PEYA 2DYKA 3M0EA 3X1DA 4BFZA 2YKGA 4PC2A 4D2IA 1EXMA 1SVMA 4PANA 1GKUB 4BEBA 2G83A 3PENA 4A92A 5K8TA 2GRJA 3CZQA 4FMCB 2ZRGA 2P6RA 2G88A 2YVUA 2ZAOA 3N2EA 3LRPA 2C2HA 3THWB 2O8FB 1SHKA 4TMKA 3UPUA 1VCNA 2BKEA 3TQFA 1A82A 1QDEA 1G16A 3DKVA 2FFBA 2NG1A 3Q8XB 5G41A 1P9RA 2QG6A 1UBCA 4K8OA 4A2PA 5J4LA 4RD0A 3RC3A 4PC6A 3ZQ6A 2C78A 4TL9A 1OIVA 2GAOA 5F3WB 1NSFA 2VTKA 2W00A 2GBLA 1KKMA 4B47A 4EFLA 2JGNA 4BGDA 1JECA 3WMGA 3DMNA 1GAJA 3K9NA 4GP7A 1JI0A 1GG2A 1C9KA 1JALA 4QHYA 4C9BA 2A7QA 4O2RA 4BASA 1FTSA 1UF9A 3IEVA 2JLZA 1HE1C 4ACBA 2WPDD 2QAGC 2PZGA 1XPOA 2ZS8A 2GK7A 2NPIA 3CF0A 3ZD6A 1SQ5A 1Z8FA 3TKLA 4QBFA 2OFOA 4A0GA 4DLVA 3TUIC 1SVKA 4GP6A 2ZRCA 5FUWA 2F3TA 2PBRA 5GVRA 1FX0B 1CR0A 2YJTD 1QZXA 3LNCA 2Q6TA 3QXHA 1J70A 3RAPR 3ECCA 4AI6A 1UADA 1T0HB 2GHIA 5LBIA 4Q7JB 3B85A 5E4FA 3ZLJA 4PZLA 1F2TB 1W36D 4V03A 2GWHA 1P5ZB 3NG1A 1NN5A 2FSGA 3KXKA 1SULA 3K09A 3CX7A 3UG7A 2AD5A 2W58A 3CRRA 1YRBA 1Z0FA 2HLDA 3FDIA 4URUR 2RGNC 4PO8A 3UWKA 2QBYA 4HLUC 1KOFA 3B1VA 2X1VA 2OUKA 4YMUA 5IK2D 2WKQA 4DJTA 4UXHA 1E1QA 1C1YA 3H0KA 4DLTA 3CKLA 1EFTA 2JA1A 5FPHA 2ZJAA 4D4JA 3AKCA 1SVOA 1XXHE 2AXPA 2QMHA 3LW7A 4KCGA 3M1IA 1TU4A 2REBA 5JJKA 1SXJC 5EE0A 3B1WA 4X8MA 4M2LA 2AL7A 4B3XA 3KJEA 1NY6A 3BAFA 5EXPA 1UEJA 1KI9A 3QVVA 4MKHA 4IOJA 3U2QA 1G8YA 1AQYA 3C7KA 4LK2A 1T8TA 4Q1FA 1WP9A 4IJMA 2OXCA 2HT1A 1XFAA 2IHBA 2CVFA 1Z6AA 3QF4B 3D3QA 3BC1A 3KL4A 2ZU0C 6Q21A 1W1WA 2J0UB 4EPRA 1E1RA 3ZIAA 2GTPA 2O8EB 4FXPA 5IRCD 2D7CA 3A37A 2O8DB 3WMFA 5EXTA 3JVVA 4QRHA 2Q21A 2J7KA 4ACAA 5FTKA 1PLKA 3W9YA 3KQNA 5JCPA 1XEWY 4DWJA 2FPMA 3T1QA 3NEJA 2VIIA 1PUIA 4JLPA 2CNWA 2GDJA 3LLMA 3UXMA 2VP5A 5IF9A 2C5LA 3DZDA 1KSFX 3NXSA 4UNNA 1TEXA 5AJYA 2P6NA 3Q3JB 2KJQA 3O8RA 4B48A 4HAYA 2YC2C 2NZJA 4AKEA 3A1UA 2ZI4A 3AVUA 1ELOA 1ESNA 1YZLA 1ZINA 2ZJ8A 3HU2A 1KAOA 2CVHA 2GVDC 2HF8A 5HE8A 4DCTA 1Q22A 3L82B 1B0UA 2R65A 3IKJA 1ZM9A 3VFDA 5KO2A 1LFDB 1AIPA 1ZYUA 4CT5A 2BM0A 4CGZA 2QSYA 4EUNA 4LX0A 4ESVA 1GILA 2ZITA 1W4BA 5B2ZA 1PLJA 3CBQA 2MSCB 3KXLA 2CEAA 4PAQA 2E87A 4YLGA 2QU8A 1ZMXA 4GI7A 3X2SA 2Q9BA 3LX8A 3WHKA 1IHUA 4BFVA 4DUGA 4RFVA 1X6VA 3LY5A 1R0WA 3FFAA 4BFYA 4B3GA 1XPUA 3SHFA 1JXMA 3IUYA 3HWSA 4EFNA 2GETA 3TIFA 2TMKA 3LBIA 1KI7A 4UNRA 1XU4A 3B1YA 1Z6GA 4IOMA 4O0MA 1W48A 1Z28A 5J47A 5P21A 1NIPA 3DM5A 4RFSA 3QXXA 1GRRA 1E99A 2CMKA 3K0EA 4XOIA 4D4MA 2X2EA 5CYPA 2XZPA 2VP9A 2CLSA 2J87A 4WZBE 1XX6A 2VHCA 5CLLA 4Q7LA 2OV2A 3A58B 1PLLA 2J45A 4LPSA 4QBGB 5KNCA 5FPYA 3RS0A 2W2XA 2D06A 3TNFA 4WA7A 4IDNA 1KSJA 1VIYA 1VYVA 2J9RA 2PEYA 4N3NA 1G8HA 1GZSA 5FTJA 5LB4A 4ZKEA 4OYHA 5AJWA 5CITA 2IS4A 2QTVB 2FN4A 5F2EA 2IW3A 1IN7A 1AN0A 1ZC4A 2FFAA 3L0IB 3L2OB 1X8KA 4MYCA 2OM2A 3IQXA 3CB4A 3TUZC 2I1VB 4JLJA 4JLAA 3FE2A 4DT1A 3RABA 1OJLA 2QBYB 2FX3A 2IYXA 3KX2A 1S2MA 3QEOA 1XZQA 1G5RA 4BE7B 3F5FA 3G82C 1FP7A 5G3YA 2BMEA 4N1AA 4B6EA 4MRPA 3NVAA 2WAXA 4HAXA 2ZSDA 3PR1A 4DCNA 1YRAA 4FMCF 2OO7A 4YMWA 4NYJQ 3RRZA 5TVKA 2V9PA 2WHXA 3RS3A 4RZXA 3OEHA 4C7OA 2WWIA 3DPUA 1LW7A 1COWA 4TYWA 4IEEA 1EX6A 3BE4A 3FMFA 3IBYA 3THYA 4LRWA 1JB1A 1EGAA 1E0SA 4IVQA 2KSQA 1TU3A 421PA 4Y0VA 2R6AA 4XSHA 1CXZA 4JVMA 2DFLA 5FR2A 3AP1A 5FUVA 4TMZA 4EPXA 3NHBA 2EWVA 1W47A 3DO6A 1E9FA 1EG7A 1QF9A 1ZU5A 5BWMA 4JLVA 3SBEA 1M1YE 4KVAA 4D25A 1D9XA 4LJ4A 4FCTA 3RSOA 2HDNB 4Q1BA 5EUMA 1N0UA 2JLXA 2QT0A 4HB4A 2WKRA 4Y0AA 4NCJA 4W7SA 1J90A 1TAGA 1XRJA 4ZI3A 4US2R 3VR1A 1CJMA 2QEQA 2WJJA 5BN3A 1XB2A 2FSFA 4LSGA 3KQHA 3T15A 2J5XA 4C0HA 4AG5A 1HA3A 1EFUA 3QKTA 3TVDA 4B3CA 2CHGA 5L8VA 3U5ZB 1OKKA 2OXRA 4M1SA 4RD4A 4RKFA 2ZI5A 1N25A 1Q1EA 1Z6XA 1ZIPA 4BZQA 3ICEA 4TYQA 1G8GA 2LKCA 2NQ2C 2BBTA 3TH5A 3D6TB 1RYHA 1OF1A 1OYWA 3AVPA 2JLYA 3QUSA 3BOSA 1LF0A 1Z3IX 2FFHA 2A78A 5D3MA 3SJCA 1MV5A 2ZRNA 2X77A 1W2GA 3SQWA 2HLDD 4A8JA 5TDHA 2ZRKA 2J3EA 3EIQA 1K6MA 1MOZA 3C4JA 4TQAA 4AYXA 2OHFA 1JR3A 4BUJA 2JLUA 2VP2A 2DFNA 3GJ6A 1RE0A 1TUIA 1KI8A 3GFTA 1E1QD 2Z6VA 4LJYA 1MO4A 1G21E 4PPQA 3TLXA 4DCSA 3RYTC 4Q48A 3ICQB 1EFRA 2GCNA 4OK5A 2F1IA 2ERYA 4B44A 1TTTA 1NLYA 2IS2A 3T5GA 4F91B 2BM1A 5C46F 4RFSB 2C95A 4UNSA 1XTKA 4PQRA 1E2IA 4JS0A 4ZKDA 1HV8A 4ZDJA 4BWYA 2RGCA 2WWYA 1JNYA 1Q1BA 1N5LA 5DO9A 3CPHA 4I1OA 2ZRIA 1QHNA 2ZJ5A 5CIQA 3IHWA 4TLEA 2EQBA 3QVUA 3RRMA 4B32A 5BN5A 3EC1A 4A0RA 4HB2A 1S8FA 1WF3A 1HUQA 3TSZA 4PZYA 1E1RD 1T91A 1A4RA 4M53A 5DYIA 3ZIAD 3DVLA 3AM1A 4A82A 1YR9A 2BMJA 4PXAA 2DWOA 3TW4A 1GP2A 1E3MA 1NVWQ 4QHSA 4DT1B 2FJUA 4NKRA 2HCJB 3DZ8A 4G3XA 3KXIA 3K0FA 2C8VA 3OE7A 3WNDA 2CNWD 1NJGA 4B73A 1PZNA 4Q03A 3IIMA 1WXQA 4M9QA 4Z51A 4N0EA 3KDSE 2VBCA 4KXFB 3U7HB 2J59A 4YXWA 3U3JA 1Q20A 4A4DA 1E69A 1UKYA 4RD2A 1FZQA 1W2HA 2HUPA 4KFSA 3AUYA 5JZVA 1E9SA 1OB5A 1GDDA 2PL3A 5E7IA 1R8QA 4LHWA 2ZSEA 3ZZ0A 1EESA 4C7OB 3IEUA 4DLUA 4KBGA 2F9MA 3CF2A 3VTKA 2C04A 2WJGA 1VG8A 4U5XA 1E2EA 3EZ2A 2ZJOA 1E32A 3THYB 4TLAA 5CM8B 1NMZA 4YONB 1GRQA 1Z6YA 2OBMA 3E70C 3W5JA 4LBVA 2RKOA 1VCOA 1SZPA 2IF2A 2ODEA 4DLWA 1E2FA 3VKWA 1BMFA 3VMFA 1IAQA 1W44A 2CLDX 1KY2A 2ZYVX 2BKUA 4F92B 1TQ6A 4DUGD 3WYGA 2WOJA 1FFHA 4WZ6A 3OFNA 2X8AA 4L4UA 2C9OA 4KSCA 2W0MA 2H18A 4PAMA 1R4AA 5E7JA 5JS7A 2JJ1A 4PR0A 4AY2A 4HLUA 3DL0A 2QPAA 1E2PA 5FL7A 3VHXA 2QMEA 3P4YA 4E5UA 1DAFA 5JRZA 2DY1A 2QI9C 2XOKA 2ZJYA 3DKPA 1DVRA 2ZRDA 1NSTA 4OI4A 3TJZA 2OAQ1 1P61B 1VHTA 2FEMA 1S9DA 4TMVA 1SXJA 3D8BA 3A8TA 3K9GA 1YVDA 2OLJA 4O25A 1M7GA 1GWNA 1NRJB 4KHZA 4KVGA 5DLQC 1YZTA 2P65A 3NBFA 2P67A 1VKJA 2OFXA 4AC9A 3FHTA 1CR4A 5BN4A 1E79A 4CEHA 5FBRB 4JBXA 4LYAA 3WBKA 3PUXA 2PMDA 3OAAA 2QN6A 2WMOB 2OSBA 3BS4A 3CM0A 3P27A 4PSVA 1R5NA 2WWXA 1S9HA 1W4RA 5D3MB 4A8JB 2BMDA 3BORA 2HT6A 1NVVR 1G20E 1MRNA 2VHTA 1NMXA 3EIHA 3R9WA 4OHYA 2O5VA 3Q85A 2ODBA 4ZCIA 4G5GA 2F9LA 4JJZA 3PEUA 4GZLA 1FMJA 3GEHA 3UKDA 4BLOA 4LCBA 1G291 2QPOA 3CX8A 4MA4A 1KO7A 1SVSA 4YQFA 1G3MA 4QGHA 1T8UA 3FWYA 3GQBA 4QOSA 4Q1AA 4YDHB 3UWOA 4TL8A 4LZZA 1LVGA 3U3RA 3NBZC 2D4HA 4LC0A 3FMIA 4TMTA 2AR7A 3OEHD 4JLDA 2WIAA 4OQXA 3ASYA 2ZM5A 4IVRA 1NN0A 5KPJA 3AVVA 2VRWA 4GT1A 2GEUA 3RDPA 2D74A 3UIEA 3WXMA 1Y63A 1CJKC 1R0XA 4KYUA 3GEIA 2AWOA 3IIKA 1KJYA 1TEVA 4QC2A 4OQLA 1D2MA 1DARA 1GUAA 2ZUBA 3B9QA 4M22A 3BB3A 3MMPA 3FMPB 1S4QA 2PZFA 4Q4HA 1HTWA 2FF7A 3K9LA 1ZAKA 4RD3A 1KJZA 2ZU6A 1OH6A 3B60A 3MWYW 3AH8A 3KJIA 3VR5A 1YZKA 2G77B 3A4NA 2DR3A 4OI0A 1WA5A 1CKEA 4PHGA 1PJRA 1CEEA 5B58C 2J41A 3AKEA 4K81B 1ZC3A 4A0HA 5AJZA 5B64A 2RHMA 2ZS7A 3EWSA 3QKUA 3C14C 2D2FA 2JCSA 4QBHA 1YZGA 1BIFA 2ZSFA 4C0KA 1KMQA 4JLNA 2EYUA 521PA 1Q1QA 2P2LA 5KOYA 2IXGA 2CCJA 1ZP6A 3KUCA 1OHHD 1P2SA 3QQ5A 4HI0E 3W3AA 1KO4A 3MRSA 2ZREA 5CYOA 4CYMA 3ZDQA 4KODA 2OILA 2ORWA 1KIMA 3PUYA 3U3KA 1DADA 1OKKD 2BBOA 2ZRPA 4LHXA 1VCMA 2JIZA 4YC7A 2J1LA 4E09A 3RC8A 5AUOB 1DAMA 2GXAA 3J81k 2IF0A 2IYTA 4GBMA 5KNDA 1KSHA 3MWJA 4BLQA 2QGZA 3EAQA 3W90A 2QMUA 4M9ZA 4JLOA 4Q66C 3TE6A 1CJUC 3RHFA 4HDOB 1VDZA 2D7DA 1LS1A 1US8A 1KO8A 2GXSA 1T4GA 4EJSC 1ZNZA 2HXSA 1XJ0A 2ZI3A 3KQUA 2WJVA 4D0GA 4NYIR 1NKSA 5TV2A 4D0LB 1P73A 1XJCA 3X1WA 5JEDA 2A3RA 1RPZA 2WWHA 4BFSA 1XD9A 2FH5B 3OZXA 2WSSA 4DLXA 3FMOB 2VSFA 4OHVA 5KU1A 2HXYA 1UBGA 1X8JA 3DOFA 2D3WA 2RGDA 2ZR0A 3DOEA 4B3BA 3VHLB 1SXJB 4BLPA 3F0TA 2JLQA 2V1XA 3SC3A 4ASUA 5SZHB 4B3DA 4KFRA 1UM8A 4WAUA 3Q5EA 4MUBA 1YU9A 2RGXA 1EWRA 3CWZA 3REGA 2VYFA 3FFBA 2NO1A 4CEHB 2GJKA 1Z83A 4TSFA 3NHAA 5FFMA 3U4QA 3SFVA 1QHHA 1RIFA 1JR6A 2Z83A 1UAAA 2PH1A 2QUZA 2ZE6A 4NP6A 3KB1A 4US0R 2EVWX 2RHDA 3IGFA 4WXPA 5A5GA 1XNJA 5AR1A 1G7TA 3OIWA 3ZQJA 4JL6A 1TNDA 5K8IA 3KKOA 5CDFA 2PZEA 4JKYA 3GLFE 5UKDA 3BFKA 4L9WA 2IHYA 3OE7D 2YYZA 1AKEA 2CHQA 3WBJA 5H8WA 1FUKA 1N3BA 4KITB 2GJAA 4II7A 4DCVA 3LBNA 3R20A 4U02A 1KK2A 4U7DA 4Q4AA 3CF6R 3AVWA 3H2YA 4YXWD 4BFXA 2ZS9A 1OXUA 2RMKA 2ONKA 5J4YA 1DAEA 3OIVA 1L4UA 5LD2C 5FBQB 1HQYE 1KJWA 3RS4A 3W34A 5DN6A 5EJEA 4MUAA 3EPKA 1DELA 1EFHA 4QM7A 4TZ6A 2KBFA 3B6EA 4JVNA 4LJ6A 5TMPA 3N70A 2ZSBA 5DISB 1G3RA 2H8KA 3GLHA 2BC9A 1K5DA 5A0FA 2V4ZA 2ZUCA 5FR1A 4DVGA 2YOGA 5L3QA 4FWIB 4A0FA 2ZJBA 3SHWA 1BMFD 1ONBA 3UK6A 1T3LA 3AF3A 2FZLA 4Q4HB 1ESMA 1OFIA 5LB2A 4WOPA 3EZ9A 2GZAA 2ORVA 3K0SA 2QTHA 2CE7A 3MFYA 3TW8B 5AUPB 1G8FA 5EP1A 1LNZA 4RSGA 2ODWA 2NO7A 5L3VA 1MKYA 3VKGA 3CR7A 1SVIA 3ZVLA 4FIDA 4O2LA 1OB2A 2BIFA 5DI3A 3WMEA 3LVRE 2JJ1D 4EPVA 4TQ9A 5FL7D 5LDDC 2CCGA 1F3OA 3PEWA 1G18A 5FH9A 5KUTA 1KI4A 2C9CA 2QM7A 4E07A 4M9XA 3LA6A 4KYIB 4HLDA 3GLIA 3BGWA 3BD9A 4MH0R 2EYQA 3DHWC 2WICA 4OHXA 3A36A 1Z2CA 5J4VA 3A6PC 3KJHA 3ZS8A 1DAIA 1SXJD 1XDBA 1OXXK 1P9WA 5EZ5A 2XTMA 2QRNA 2WMNB 3AB3A 3QF7A 2IS1A 4HAVA 4I81A 4DB2A 4PSAA 1W49A 4D80A 3ZZUA 4DLYA 4JLMA 4HSEA 5JJLA 3LXRA 1E79D 3SYKA 1JPNA 2CXXA 2YZ2A 3HYTA 4LI0A 4PC7A 3RLFA 4YDSA 2HEIA 3Q72A 2IYWA 5JWRA 4QBIA 3OAAD 2ZQ5A 3P20A 5DI9A 4ERNA 2ODNA 4LBYA 3QG5A 3HU1A 3ZVMA 2FDCA 3R7WA 4LUCA 5DYGA 1US8B 4URXR 4ZV4A 1EK0A 3B82A 2VF8A 3SDZA 2GCOB 4D4LA 4HUTA 5FTLA 1ZNXA 3GLGA 4AYTA 4ZCMA 2DPXA 1I2DA 5KSYA 5KSPA 4B76A 2VPPA 5EXXA 1KMHA 1KK3A 2AWNA 4K46A 3P26A 3CO5A 3BERA 5DIFA 5HE9A 4DZZA 1IJEA 1FNNA 1HQCA 1YKSA 2D2EA 4HDQB 1NBMA 4C0BA 5H1YA 2Q0HA 3RS5A 5HKKA 2DB3A 4MRRA 1CP2A 1YHNA 1DO0A 4ZIRA 1OYYA 3VNVA 4KO8A 3GEEA 1DOAA 1K5GA 1NVXQ 2MSEB 3M6AA 2GJ9A 4OQNA 1GL6A 3BB1A 3EW9A 4DSOA 4LY6A 2ZXUA 2A5DA 4LV6A 1II8A 1HT1E 2F1RA 4EQ6A 2RGBA 3U4QB 4NH0A 3THXA 1QHHB 2IBMA 4QNMA 2IWRA 1S3GA 4DIEA 3MSXA 1DO2A 4V0KA 3EZ6A 1N6RA 2FEOA 5FOWA 1Q21A 5EXSA 621PA 2EFCB 4DCUA 5H70A 4A2QA 1G1MA 5J4HA 4MKFA 4XVRA 1OLOA 1KZGB 3NBXX 3HJNA 4IFBA 2RCNA 2W2TA 3PEVA 3PIRA 4RJLA 2MMCA 1FMLA 1H8EA 4DRZA 4V0OA 4Q4AB 3GJ7A 2JLVA 4LJ8A 1KO1A 4P33A 1GSIA 4PPGA 1QBKC 1HYQA 5DSZA 4GZMA 1FP6A 3FGNA 2VLIA 4I4LA 2UVQA 4NDZA 3HR8A 3R8CA 4NTZA 1E98A 3CRW1 1VYUA 3VX4A 3MWKA 3NH9A 1CJTC 1CS4C 2VP0A 4RCYA 4C4PA 1RRGA 2JIZD 4DSTA 3UANA 5JLJA 2W6JA 3K0AA 1NP6A 2Z43A 3GLHB 1IJFA 1PVOA 4ARZA 2C03A 1UKZA 1G5PA 1ZNWA 1T5LA 4LHYA 5L3QB 3CNLA 3V9PA 5JJIA 1OH8A 5JRJA 2EFEB 3I92A 4JVSB 4Q1EA 4D82A 1RFLA 1EX7A 1U9IC 2PX0A 1XTSA 2XNDA 4KBFA 2OLKA 3T34A 4JKIA 1Q3HA 2FGJA 1OPXA 3D7MA 4TYNA 4MGYR 4DDWA 4GMXA 3ZGXA 2ZR7A 3TR0A 5AUNB 1JEEA 1Z08A 3K8YA 2EFHB 4XTCS 3KQKA 1MO3A 3AVOA 1OSNA 1W0KD 1Z6TA 5DI3B 2C77A 4DDVA 1SVLA 1YJ5A 2JLRA 4QJ4A 4CEIA 5JSZB 2QENA 2WWWA 1KDOA 1E9AA 3EARA 4QJ5A 1XZPA 3LFUA 2V8OA 2IYZA 2O0HA 2EFDB 1JQLB 2OESA 2R6DA 2WSSD 2F7SA 3GLIB 1WBBA 5JWHA 1S1MA 2FFQA 4UJ5A 2Y8EA 4OI1A 1GOTA 2CLCX 1OIWA 1RW4A 2IYSA 1JJVA 1X1RA 2DFKB 2GEDA 4HLCA 4JYCA 4ASUD 4W5WA 2ZRLA 3TQCA 3LQRA 4GPTA 1AJEA 1U8ZA 2B21A 4Q9KA 3P4XA 4QGAA 2DFTA 3A1WA 4TSFD 3WRYC 2VL7A 2IXEA 4JYBA 3GJ8A 3EPHA 1XCPA 4G5SA 5G53C 2SHKA 1SKYB 4G5QA 2QMOA 2XX3A 2QP4A 3R7WB 3U3OA 2WOOA 3VX3A 4F93B 1XF9A 1L2TA 3CPJB 1A5TA 4US1R 4HDCA 4OKSA 3I4LA 3LW8A 1GNPA 2QRZA 3LAWA 1TF7A 4TQUS 3WHLA 3RWMB 4AKGA 1OFUX 2IX3A 5HTKA 3GLGB 3KTAA 4V0NA 4R2IA 5CK5A 2QQEA 2FZ4A 2AXNA 3G0HA 1KMHB 3SN6A 4JT4A 5KYKA 2XXAA 1HE8B 4DXAA 4QGFA 4JMPA 1D8TA 1N6LA 3H4MA 2IUSA 3PQCA 3ASZA 1XXHA 2BHRA 1MRSA 2IEYA 4ZI2A 5KHOC 2P5TB 3B5JA 4BFUA 3ADKA 3I5YA 1U99A 1J8YF 5DN6D 5EUQB 3CRVA 1T6NA 5KNBA 4ZIRB 1UBFA 4MDFA 2NIPA 4XIGS 2FG5A 3CRQA 1ZUHA 1JPJA 4UKDA 1Z0KA 5FPSA 1JAHA 5TARA 2F43A 4M1MA 1II8B 4EQ6B 3EIEA 4MDEA 2AKYA 2CJWA 3THXB 4D0NA 3K70B 3WP0A 3A4MA 2Z0MA 2W83A 1G6HA 1KK1A 2PEZA 4XVQA 2O8BA 4BLRA 1KAGA 1A2KC 2IYLD 3AP3A 1FW6A 4RD1A 1WQ1R 2XAUA 1NY5A 1MT0A 4MGIR 3PUVA 4TTQA 2FSHA 4DSUA 3CW2A 4C2TA 1OT3A 2FNAA 2OAP1 3ZH9B 1ZBDA 2WVJA 3FTQA 5IHPA 4Q19A 3U61B 3IDQA 5GADl 4FN5A 3CPEA 1UKEA 2B8WA 2QY9A 4W5HA 1DTSA 4EJSA 5E95A 3X1ZA 2Q9AA 3ADBA 3T35A 1E4YA 3OHMA 2IWHA 4PHHA 1ZW6A 1WDTA 3MAAC 3QENA 4Z8XA 3AF1A 3O47A 3IO5A 4JL8A 2IYUA 3GJ5A 1DAHA 4Z8YA 4HLQB 5L3SA 2JEOA 1AGRA 5FTMA 3FKQA 3GMTA 2P6UA 1O87A 3AKYA 3EG5A 3K0AB 2YC4C 4BRUA 3SQXA 1KO5A 1R5BA 4ZO4A 4M0LA 4Q1DA 1YZQA 2WTUA 4ARZB 1U0JA 2WWFA 2LWIA 4JJKA 2I3BA 4LPKA 1I4TD 1LV7A 1N5KA 4XD7A 1CIPA 4M1KA 3LD9A 2NO6A 2GESA 2PCLA 3CR8A 2ZUDA 1L8QA 3C15C 4WBSA 3F3YA 5LPNA 4B3FX 4B71A 1V5WA 3U60B 2PLRA 1RVDA 3QBVA 1KZ7B 2CCKA 2ZIAA 1IXSB 2QE7A 1HH4A 4DLSA 2WJIA 4KV9A 1HY3A 5JWOA 3PG5A 4FCWA 4FMBB 4F7WA 4PC1A 1LS6A 4CEIB 4IDOA 3I1FA 4CZ2A 4DEXA 2R6CA 2J0QA 3EXAA 3I8SA 3L43A 5JBQA 1E9BA 2BBWA 5GJWC 2OG2A 1TF2A 2IK8A 2QORA 1Q1ZA 1J2JA 2FPLA 2XB4A 1NBMD 2G0NA 1ZM3A 1XMJA 1A1VA 2GCPA 5HKKD 3V00A 4LV5B 3U7EB 4CRWB 3R9IA 2KBEA 1ZUIA 5AWFC 1HEIA 1N5JA 5EZ6B 2XSZA 4KU4A 5BYKA 4PZZA 4OHWA 4IXMA 1VMAA 2RH5A 3C5CA 3QPWA 3I3SR 4Q9IA 1JEDA 2QQ0A 5EP2A 2LKDA 1XCMA 3Q7PA 3K70C 1Q44A 1NJFA 3AV0B 4WIAA 3FB4A 3DEFA 3AUXA 3AVXA 2RGEA 4V0ME 1KNQA 3G5UA 2H7VA 2JLWA 1OFTA 4P4SA 3A1SA 4TLDA 3TAHA 4YMTA 1IN8A 1S96A 1Z0DA 1G6OA 4F4JA 3KTAB 1C4OA 1GKIA 1ZD1A 2PT7A 1EWQA 3B13B 1H8ED 3K1JA 2WPDA 5DE3A 1KYIA 3SYLA 3VR2A 1X3SA 1IONA 2XXAB 2J0SA 1ZIOA 3R8FA 2IA5A 4GOKA 1XXHB 1ZU4A 2YHSA 1W5SA 2GAAA 3OESA 2R62A 4U00A 4RZUA 3SEAA 2JJ2A 1E6CA 2ZRFA 1H8HA 3EX7C 4GOJA 1TF5A 2O8CA 1FNMA 4DSNA 5K8LA 1RRPA 3KB2A 4P4TA 2ZYUX 1DG3A 1UDXA 4GOXA 4IOKA 2I4IA 1P72A 4IXNA 4LJ9A 1P9NA 1QHIA 5C4GB 4LJ5A 4B33A 1E2LA 2DWQA 3AEZA 3N5CA 4GRAA 2XGJA 2F43B 3QPUA 1E2GA 1QVRA 1A2BA 1RC8A 3ZS9A 4AD8A 3I62A 2XJ9A 2ZE7A 2CJWB 5FUXA 4EPYA 3CRMA 3LO5A 4PHFA 4M1OA 5F9FA 2O8BB 1FTNA 4FMDB 2ZETA 1KNXA 2XNDD 1GL9B 3NWJA 3ONWA 4MKIA 1GNRA 2A5GA 1I4LD 3QY0A 2FMXA 2IYRA 4Q9LA 4EIWA 5SZIA 221PA 5JI3E 2ZPTX 3O8CA 3SS8A 4EFMA 2RGGA 4Q4JA 3SI7A 3ZZTA 2B6HA 3UMFA 4XH9B 2AX4A 4LYJA 4EJSB 1VIAA 2A5FA 4QFMA 4V0LA 3RSLA 2ZSAA 4QL3A 4IDPA 3CWQA 5DNYB 4L15A 4NCNA 4UNQA 1BKDR 3K9HA 5FOXA 5HR5A 1IBRA 2VA8A 3QXJA 1DAKA 3QXSA 4D6PA 2N1BA 3T1VA 3TAUA 1YR7A 5FOVA 5L3SB 5KDLA 1GKYA 1QHYA 4QJ3A 3H86A 3CX6A 3KKQA 4FD2A 3REFA 3FHOA 3CH4B 2W6IA 1COWD 5CLQA 1LTQA 2EFGA 4MYUA 3U6KA 4Q9JA 1FQKA 4URZR 5FPTA 1Q12A 4MGZR 3I73A 4BLTA 4TYYA 1ZM7A 2AFHE 2P0EA 4MRVA 5TY0A 4LHVA 4TL6A 2YV5A 2ZRMA 2P3SA 2N42A 4M1WA 3O8DA 2QL6A 3MJRA 1J8MF 1KDTA 4PTLA 5B57C 4OJQA 4C0SA 4TYPA 3U6BA 2NZ8A 4DBLC 4I99A 1D2EA 4JBWA 2AN9A 3H84A 3SYNA 1FQJA 1E2QA 4NL4H 3U3MA 4KLNA 3U7FB 4HYYA 4NZYA 1SHZA 3KFXA 1S0UA 1X1SA 2AFIE 5FBVB 5H68A 1WE2A 1I2MA 4PC3A 4MYTA 1VTKA 3NIBA 2ZTSA 2ZI9A 4HEJA 3EPLA 2BEJA 5LD2B 2CL7X 4PO1A 1NNEA 1G7CA 1E96A 1P75A 1ZRHA 2BV3A 2GJSA 2C96A 4I1SA 1R0ZA 4KFTA 3HU3A 2E9SA 3GP8A 2WM9B 4ZDWA 4DB4A 1KI2A 1ZJ6A 2PX3A 4P4SB 1EFCA 3ZD7A 5FBLB 4A15A 1U9IA 1VG1A 4X8LA 4F4CA 3DMDA 4CF7A 4TT3A 2YNMA 1Z22A 5AK0A 1J99A 3WY9A 3TR5A 4QNRA 4Q01A 5EP4A 1AS2A 3A1TA 1CTQA 1G4AE 1DE0A 4ZDIA 1JR3D 3AGPA 2FGKA 1CULC 4QG7A 3W6NA 1N6OA 2VF7A 2GCOA 5SZKB 4DDTA 1W7AA 4A1FA 2ZVPX 4C30A 3EZFA 2W0SA 3RS7A 4MGKR 4E22A 3PJRA 4L16A 2EU8A 1EFRD 3TMKA 1GRNA 2O8CB 2ERXA 4UNPA 4Z54A 1NG1A 2BJWA 4JZKA 2OCAA 3LLUA 4XSGA 3SE0A 2Q3HA 1RRCA 4XWKA 3QIAA 2IYVA 3ND9A 4YMVA 4TL7A 1UKVY 4C0QC 2UZIR 2VHQA 4UJ3A 1AS0A 3IIJA 2ZRHA 2R2AA 3NBYC 5J4KA 2DHRA 1ZD8A 3RRYA 1V43A 4XD7D 3L0PA 3WP1B 1OIXA 4L9SA 2QA5A 4M1TA 1N6HA 3T1TA 1UJ2A 1JXOA 3QPVA 4XWOA 3GJXC 5K8UA 1N0WA 3BJIC 1G19A 3QNUA 5C1BA 5DHAA 1OXTA 3MUFA 3THOA 3TSWA 2QE7D 3QOFA 4DEYA 2AK3A 2ZRBA 3HPRA 4L8GA 3KZ1E 1N6PA 3QSYA 4LOAA 3UMSA 4Q4JB 3FPAA 3TVTA 2IXFA 5FOSA 3TRFA 1F2UB 1RJ9A 4JLBA 2BJVA 1IXRC 2GA8A 2UKDA 1PV4A 1NLZA 1RRFA 2WIBA 2GK6A 3WNBA 1S1CA 2VEDA 3SNHA 1Z0IA 2YINC 2DCUA 3RNLA 2E1RA 4BQSA 3BH6A 4R7ZA 3CZPA 3EA5A 1ZVQA 4RZ3A 5L3RA 3BFVA 4NPHA 2XSZD 4FI3C 3C16C 3F8TA 4NE2A 4TMWA 1VHLA 3VQTA 3B1ZA 1BYIA 2FU5C 2IT1A 4BLSA 2YWGA 5BW8A 5DH9A 1ANKA 5EE9A 4OJKA 2ONJA 1P60A 4IOLA 2Q9CA 1PUJA 1NF3A 3I8XA 3IQWA 1M7HA 2OZEA 5EE3A 2WJYA 4IRUB 3LV8A 1WRBA 1SVWA 4JIMA 2L0XA 1P6XA 4HZUA 2BEKA 3SFZA 5EP3A 3ADDA 4PQYA 2ATXA 1NVVQ 2QTFA 4KI0A 4B43A 1I4DD 5JCZA 2OCPA 3SOPA 2G6BA 2IEZA 4CDGA 4AWXA 1Z63A 1F6BA 3KKMA 1NI3A 1KDRA 2RGAA 1QRAA 3WRXC 4GL2A 2C9YA 3KUDA 4RCZA 5AJXA 1UBEA 2VP4A 4B34A 2GXUA 3OFND 1E2HA 4TLBA 3WNCA 2OFWA 2GVZC 2XITA 4X8HA 1DS6A 4XWAA 1G9XA 2JJ2D 5JSZA 1H8HD 2PMKA 4KJZA 5AUQA 2WBLC 5FPKA 3A4LA 3OIYA 2XOKD 4I1VA 1GTVA 2A5JA 4NYJR 3MD0A 4HAWA 1YR6A 3MLEA 4HATA 4FMDF 2V6IA 3CONA 1N6NA 4B2LA 3P1JA 1W36C 1N2CE 4GDFA 2BMFA 1E9EA 1IN4A 2ZANA 3FHCB 4JSTA 1P2TA 2QT1A 2V1UA 2IUUA 2ZEJA 2A2ZA 4X8OA 3PV0A 2ZJZA 4PPNA 2GJ8A 4M21A 3QEJA 1U2RA 1R6BX 1OH5A 3B9PA 3AF2A 1YE8A 5KSZA 2ZI6A 3X1YA 2VSXA 3ZJYA 3P32A 2JLSA 2QROA 1YZNA 2ANCA 3WYFA 2BBSA 4WVFA 5F98A 1NMYA 2H5EA 3EA0A 3NDPA 4B2PA 2B92A 4DHEA 1GL7A 4B6FA 4BFTA 1DEKA 1XEXA 2VQSA 2HV8A 3CNOA 1TQDA 2QPTA 1T9HA 2HYIC 1XTIA 1AA9A 1Z5ZA 4LHZA 3I32A 3Q9LA 2F55A 4NMMA 2AK2A 2PLFA 2WSMA 5F9HA 4W5JA 5HZHA 4LYFA 2QP9X 1ZCAA 2JATA 3LVQE 3DM9B 3BWDD 2W6ID 1E2JA 1M6NA 4KLZA 3HDTA 4DKXA 3MG9A 4P4UA 5GJCA 1Y3AA 4WW0A 3T06B 4MKGA 2EWWA 2BCJQ 2GZDA 5CJ2A 1XEFA 2KI5A 4UXJA 2F3RA 4TWZA 1XMVA 3FOZA 3UMRA 3WYAA 1W46A 3BH0A 5HCNA 1JR3E 2NGRA 4NONA 1R8SA 1TADA 2FSIA 3QI2A 4NYIQ 2Q3MA 4BEJA 3SJAA 5GVSA 2B7BA 3BIFA 4G5RA 4KSBA 3QE0A 1M74A 4Q7KA 1R0YA 2H17A 3AVTA 3VAAA 2XZOA 3ADCA 1RJ9B 3E1SA 4L5BA 4I1UA 1XCGB 2CL0X 3QKRA 1KI6A 5ANRB 2V54A 1W4CA 2B8TA 2Z4RA 5EQTA 3ZVRA 5KPDA 3TBKA 1W0JA 2CK3A 2QNRA 2OE2A 4QGGA 4OQMA 4P3YA 4DLRA 1CF4A 4Q1CA 5FI1B 1VYTA 4LV8B 4P32A 2DBYA 1F60A 4OHZA 5CJPA 1ZCBA 4CT4B 3SU8A 4DC9A 1E94E 3RRNA 5GJBA 3NH6A 3PVSA 1E2NA 4TZ0A 1XTRA 1E2KA 2CL6X 4URWR 3AF4A 4H9GA 3K0CC 2PJRA 2O52A 2XZLA 2AKAB 5E3HA 4NU0A 3GJ4A 1FPMA 1OH7A 5HZKA 2CBZA 5IDVA 2J0VA 4IHQA 4D26A 1WMSA 4HZUB 1ZM4A 1R5OA 4M4SA 2YOHA 4C3ZA 2V55B 2J7PA 4POAA 1U90A 4AKIA 4MQBA 3HP1A 3VKHA 4TT3D 5D3QA 1XD2A 3QBTA 5JHHB 1K8RA 2HJVA 1RZ3A 2GF9A 2WAYA 4RVCA 1T3SA 3GLFA 1AKYA 1G8PA 3EC2A 4B75A 4QKQA 4ESHA 3QG1A 1KI3A 3KKNA 1MABA 4CW7A 4H1VA 1MO5A 1AZTA 2GF0A 2IUTA 1W4AA 2CDNA 1T0JB 1IY0A 3JZMA 4BFWA 2O0JA 2F6RA 2WV9A 4ZCLA 1D5CA 1SGWA 1AM4D 1ZM2A 3ETLA 1IN5A 1UDWA 2A9KA 2VP6A 3FKSA 1E2MA 1KY3A 3C8UA 3GFPA 2ATVA 5CB6A 1UEIA 2OT3B 5JEEA 3KJGA 1OFHA 3W5IA 2ZYTX 2NPFA 1XWIA 4B35A 1X8LA 1G7RA 1XEWX 3PXGA 5ELXA 4UQOA 1T5IA 2QZ4A 3CLVA 1NN1A 4OL0A 4TMXA 4Z1MA 4KFUA 4V02A 1FL9A 1XBTA 4WZAE 1IXZA 2G0TA 3I72A 2NMVA 1E0AA 1CU1A 2ZI7A 1XJQA 1NL3A 2H1LA 4ITRC 4QXAA 2HF9A 2JDIA 2AD1A 3LXXA 4OK6A 4AKHA 2BOVA 1E2DA 2WKPA 3MJHA 4QHTA 4R2HA 2G1JA 3TGPA 3OEEA 1TQ4A 2VHJA 1XEXB 3GPLA 5B30A 2BDTA 3PITA 3QKSA 821PA 1U98A 2VHUA 3EASA 5CB8A 4HB3A 2R6FA 1LF5A 1QHGA 3Q7QA 4A6PA 2V7QA 3EPJA 1RKBA 4Q47A 1D6JA 1Q3TA 1SXJE 1TX4B 4N0DA 3LDAA 4RY2A 1E9RA 1D9ZA 5JMTA 1XP8A 3NC0C 3L8YA 4OQFA 5CM9C 1II9A 2PCJA 2JJ8A 3VR4A 1E9CA 2GILA 1E9DA 3W8RA 4NHOA 3GD7A 5C2JB 4BRWA 2ASEA 1GITA 2C98A 2GBLC 1WCV1 1Q57A 2ZVQX 5EE5B 4EDHA 1NG9A 4IFEA 2ZRAA 2ECKA 1TQ2A 1Z29A 1P62B 4ZPXA 4EPTA 5A4JA 3BFXA 2KE5A 1WB9A 4HAZA 1CR2A 2ZJ2A 3FYHA 4LYHA 2MSDB 4G0NA 3E5HA 3VU9A 5HCIA 1HURA 2BVNA 5IT5A 4ON9A 4HB0A 4PO9A 4A6XA 4NCIA 4GFDA 4RZ2A 4QM6A 1G3QA 3QKRB 1KI6B 1OHHA 1KGDA 1XTQA 2JASA 4GSYA 3T1OA 4MRSA 1BO6A 2XTNA 2IC5A 3JVUA 1R10A 4IEIA 4LJ7A 1JJ7A 1O3YA 1XD8A 3X1XA 3OIUA 1QG4A 1NN3A 4G1UC 4GNKA 1QHSA 1OW3B 2H92A 2NTYC 2R9VA 3MWLA 4JT2A 4JVLA 4MYHA 1WBDA 2V3CC 1BOFA 4FINA 3GFOA 1G4UR 4CVNA 5C4MA 2HCBA 2P5SA 4B74A 3I61A 3SBDA 1GFIA 5KDDA 3R9XA 3QXCA 3S1AA 2GEVA 3BBPA 5JI2E 5G40A 2YWEA 5GJVC 3K09C 2F1HA 5JECA 4PQFA 1UFQA 3L8ZA 4W9MC 1L7VC 1P7CA 2ZRJA 1DPFA 3B8HA 4AYWA 4EAQA 4Q21A 4LBZA 2ANBA 2QM8A 3NKVA 3T12A 1XD2B 2N46A 4BPBA 4XVUA 1N5IA 1AS3A 2NO0A 2FPKA 4RKEA 3NDBB 2EW1A 3PUWA 3GLFB 2GXQA 4AIIA 2IYQA 4A36A 1VG0B 4JLKA 4PPFA 3VNUA 1CBUA 5EE1A 1U0HC 3O8BA 4Q7MB 1GIAA 1MABB 1QHXA 2IYYA 2LCFA 3NC1C 1R2QA 4PHTA 1YZUA 1GVNB 1YQTA 1U8YA 3B1XA 3AKDA 3JZAA 3N2IA 5DHFA 3H1TA 1P4SA 5C18A 3AQ4A 2ZE8A 1A7JA 4R9UC 1E0KA 1G3IA 3C41J 4WXRA 5DGXA 3W8NA 2R44A 4DDUA 2QP3A 2WZQA 1G41A 3NEYA 3PCRB 1IY1A 1XPRA 4CEJA 5J5CA 3GJ3A 1KTVA 1E0JA 1GNQA 3HPQA 3TSOA 4TN1A 2PJZA 4HUQA 4DIDA 4R98A 2K5UA 3LWNA 1P2UA 4Q18A 3C5HA 3IBGA 4M8NE 2YOFA 3K70D 5FUYA 2YWFA 2OBLA 5KSOA 1N0VC 3RWOA 2OBNA 1ZUNB 3MCAA 4XTRA 2CHVA 4AURA 1TUEA 1KKLA 1U0LA 4UXIA 5CK4A 1JAIA 2FOLA 4PX9A 5KTYA 3GJ0A 1XTJA 2XB2A 1W5TA 5BQ5A 1KHTA 1J7KA 4ABYA 1G7SA 3IPYA 3EWAA 2ZE5A 1JQJC 3SJBA 3IO3A 2QSZA 3QKSB 1W0JD 2G9NA 2QAGA 1NKTA 1VECA 2CK3D 2NOAA 4JSYA 4XJXA 1MH1A 2HJGA 4PFSA 5HPYB 1Z06A 4M9SA 4Q5IA 2Z5FA 1Z0AA 2X19A 2HYDA 3Q5DA 2A5YB 4ZDKA 1JBKA 4NYMR 3U44A 2IS6A 2FV8A 1XMSA 4P0TA 3LX5A 3SZRA 5JHGB 2ZYWX 2REOA 2MMGA 1OV4A 4TTPA 8OHMA 2XNSA 4IW3B 3E2IA 5TB5A 1UPTA 4OI2A 1VCIA 2G1KA 1FUUA 1KDPA 2B7CA 2W6JD 3TUJC 2VSOA 3V4RA 4LDJA 3ZYCA 4C0LA 2VO1A 3AGQA 1T3HA 3W6OA 5FOUA 3T61A 3AVYA 5CDFE 1AK2A 1NIJA 2J7PD 3D31A 2H57A 3HYRA 1Z47A 4FCVA 3KKPA 1LB1B 4HZIA 5AJVB 1RYFA 1ODFA 3GCGA 3K53A 2F1JA 3VU9B 2RGNA 3AVQA 3UATA 4H1UA 2GZHA 4NBSA 5IK2A 3CNNA 2W2VA 4D81A 4ILEA 4Q9HA 5FTNA 2A30A 4O3MA 1II0A 4C0AC 2QAJA 3CH5A 4FWTA 3U7GA 1ZD9A 2O0KA 3B7GA 2FA9A 4OK3A 4IDHA 4KAXA 4Q02A 2H16A 1F2UA 3PUZA 1P2VA 5J40A 1QVAA 1Z0JA 2BCGY 3ND8A 4LWZA 4E03A 1M8PA 1Z2AA 1OXVA 3OF5A 4A9AA 1OXSC 4YMSA 3MGCA 1TMKA 1GM5A 3GLHE 4Q4LA 2C99A 3FKSD 1ZNYA 2R8RA 2OEPA 3L0OA 3RVBA 3S1AB 3THWA 1X86B 2O8FA 3B2EA 1G5TA 1IY2A 1TPZA 4A2WA 2KB0A 2ZR9A 2REXB 4DLZA 5SZJA 1F48A 4URVR 4MITA 5JS8A 5M04A 2UZ3A 1L4YA 2BWJA 3LH5A 4Z1MD 1CR1A 1SKQA 4URYR 1IN6A 4RD6A 3IILA 2CE2X 2XJ4A 1G64A 2JDID 5FL3A 4EKDA 4J0QA 4NCKA 2WJHA 5BXQC 1CRQA 4AK9A 4BZXA 5CIWA 2FE4A 2XEXA 3OEED 4JBYA 4Q00A 3GLIE 2VH5R 1VG9B 1G3UA 4GMDA 4OBEA 3I5XA 4P31A 1ETUA 2V7QD 5FBWB 1QG2A 4MRNA 1B23P 3BB4A 4LBWA 5TXGA 3NTUA 3RANA 2R6GA 1CLUA 3BRWD 2RAPA 2QGNA 2ZAMA 1FX0A 3HR7A 1IOZA 4IVPA 3BXZA 2JAQA 3AP2A 5FOTA 1CJVC 1NLFA 4CEJB 1MO6A 3AF0A 1E4VA
chains in the Genus database with same CATH superfamily
1H1DA 1F2DA 1U81A 1W93A 1UKCA 1K3TA 4LOIA 3DAHA 3VR3A 4HUQB 3AHEA 4HNHA 3WMFA 1UJ5A 4ER0A 5LP6B 1AG9A 2I1QA 2O6HA 3U81A 4AF7A 2BZ0A 3C2QA 3L8MA 4NG4A 4NPCA 5K51A 2XRZA 3BT7A 1L7EA 4NBRA 3I53A 1BE1A 2Q4RA 2HGSA 3CLTC 3H99A 4XUCA 3IX7A 4EI8A 5K3DA 1RQNA 2GBGA 1QGED 4TLLB 4KBYA 3PXXA 3FCOA 3DV9A 4EGJA 1GD1O 1VPTA 4YRJA 4R7GA 3PFIA 2AE2A 1UBSB 4K9LA 3ZVNA 1WCIA 2OM6A 1G17A 2JKVA 3DXFA 5L4LA 1VI2A 4EZBA 3QXGA 3EFHA 4MQEB 1LY1A 4WCDA 4EG8A 4HDMA 5DM70 1FRNA 2W71A 3C6MA 4FFPA 3LT4A 4MUGA 5FWDA 4DA9A 4EW1A 4QLBA 2B1JA 3ZJTA 5DXAA 1Q0UA 2OCBA 3OQIA 2IYAA 1BQEA 1YR8A 3IHLA 4C78A 1UK7A 3U44B 2H00A 5C4IA 4Z4IA 2CDCA 1U8AA 2I4NA 3DE3X 3LBHA 3SJZA 5COAA 2OCYC 4RTLA 1HR0B 4J9UE 1AZWA 2Z8YA 1W85A 2I6SA 2JS7A 4RH1A 5FLEX 3E7DA 4K6CA 3DZFA 4KGXA 3RGGA 2XZTA 2YHIB 3PLRA 1KI1A 1PT7A 2C1EA 1WUHS 1WMDA 2W11A 3DWGA 6PFKA 5AQEA 3I6ZA 4OAQA 3Q12A 1DRVA 1NVUQ 4F4IA 3DZHA 4AJKA 4WNCA 1H4SA 1N6IA 1PSWA 2OHIA 3VPXA 5KOHA 1PF7E 5L40A 1GCOA 1W36B 4F3KA 3IT3A 3LUHA 4G4JA 4PSKA 3S29A 7REQA 1KAEA 3K6RA 2QRUA 1S3SA 4V0MA 3W6PA 5FI0B 3L4JA 2VN8A 1BCSA 4V0QA 1VLQA 1RHMA 3BH7A 3BK7A 4D4KA 4YT5A 4GIBA 1IZYA 3Q1LA 4WY2A 4ZAWA 1VYHA 2HF7A 3CISA 1NR1A 2CXQA 2OQRA 3DEJA 4G0PA 3ROQA 4G8DA 4K26A 3LQQA 2I6UA 2ZBDA 5HXAA 2IL1A 2JCBA 4S35A 1KETA 2FPGB 5EI5A 4E30A 1LU9A 4BATA 2DYKA 3CO0S 2G8LA 3G2MA 4PC2A 1EXMA 1RBZA 4D2IA 1SVMA 3FVWA 2MR6A 3K0HA 6LDHA 4RKRA 2MIIA 1NPDA 3KYJB 1TT5A 1AHHA 1SWVA 4YMUA 3AINA 4EGSA 2YVUA 5EFZA 2BEVB 1V7QA 2FWNA 3THWB 2YZGA 1VCNA 2ZXFA 3DDOA 3ZY2A 1A82A 3UFXB 4AZ3A 3K9FC 3VH4A 1GZ5A 3AZQA 3FD8A 2NG1A 3Q8XB 3SC4A 5G41A 4E21A 5J4LA 5U9CA 1QKKA 4Q4DA 5M3BA 3RC3A 4GM1A 1IHDA 3AFIA 2C78A 4DIBA 1A8SA 2FEWB 1ISFA 1KKMA 4LZLA 1NHWA 4EJMA 4GS5A 5AJTA 2VF2A 5FWXB 4V1CI 4ZWNA 5AVXA 3PQDA 4HH3C 3NXKA 4KPFC 2F00A 3PF9A 2WJ3A 2LDXA 1JALA 4MP8A 4QX6A 1KJIA 4ZALA 5EQJB 3TZLA 2A7QA 2QD3A 1NF2A 3EIWA 5DBHX 4DIOA 4X62B 1VL2A 4DR2B 2A33A 2GYUA 1IC6A 4ACBA 1ZIXA 2PKYX 2PZGA 3BXGA 3JQ8B 3ZD6A 3L7JA 4J7CA 2ZZNA 2I4OA 2FSVA 3C7CB 2JCVA 2J3JA 3LPMA 1T9KA 3EEIA 3D7KA 4IPTA 4Q3KA 5C80A 3DDSA 2FPIB 5AVSA 1SA0B 1O6BA 3M6MD 3FA2A 4QBFA 4ENUA 1DHTA 5A5FA 1ZI8A 1B7GO 1FE8A 1EP3B 2BUAA 4LZAA 1ZG3A 3TUIC 3ZHTA 1SVKA 1X1AA 3CLKA 2ZUSA 4TROA 3HXQA 4WE3A 1FX0B 1W59A 3LNCA 2Q6TA 4ND8A 1PFVA 1P2DA 4KE7A 3I83A 4DDHA 3BTUA 4Z3KA 1HDEA 3FOEC 5LOVB 5E1BA 3ECCA 1YO6A 3ZJUA 3HCAA 3ZY5A 5JASA 1R6DA 3RT9A 1AH2A 5ALVA 3SK0A 3D54D 1F2TB 3C3XA 2CFSA 3L7AA 4PWZA 5CVEA 3LBAA 4ATNA 4QUKA 3MTAA 3D3NA 4GVPA 4NFHA 1O6GA 4IQGA 3UG7A 1V4NA 2G08A 1E3IA 1UDRA 1Z0FA 2IYOA 5FPPA 2DR2A 2JL1A 2PBLA 3ROPA 4PO8A 2BGWA 7AT1A 3ZTYA 2WKQA 4MHTA 4DJTA 3WIEA 3AUSA 4S2UA 1JHQA 2X4IA 1GVHA 4RBNA 5H9VA 3H0KA 3N53A 2CZGA 2JA1A 2RK6A 1QK5A 1SHUX 2AXPA 3LW7A 1AHIA 3GAFA 2D1FA 3JARA 1MGOA 4NX2A 4ZVNA 1Z7WA 2PKQP 5SY4A 3SGLA 4DADA 3CUYA 3JV7A 3C8ZA 1F6WA 3B1WA 4X8MA 2VVTA 4IJKA 5EWJB 4BMNA 3BBLA 2Y0DA 1WHTA 4Q39A 1E1CA 1JG1A 4ZOLB 5KTNA 2P77A 1NY6A 3BAFA 3CYFA 5EXPA 1KI9A 4OXRA 1ISSA 4MKHA 1G8YA 2Y2UA 3C7KA 3Q3EA 1KQFA 3JQFC 1YD7A 2PYIA 2JPDA 1QYVA 3L0CA 1YQXA 2C0QA 5A06A 1Z6AA 3QF4B 2FZVA 2ZXEA 3ECSA 4F1KA 4R2KA 2C9MA 4XSVA 5EPUA 2J0UB 2MR5A 2DG2A 2OHJA 2WTBA 4M1EA 4EPRA 3AONB 2Q5HA 3FTDA 2WYWA 3HKDA 1L9XA 3ETJA 1E6LA 3L0ZA 2FKNA 1RWPA 4P80A 5LC1A 5B3KA 5KYYA 1EFVA 2O8DB 5LM3A 4PLWA 4JP2A 3SCZA 1IK4A 2BFAA 2Q21A 1DUVG 4CKWB 3VYSB 2AZDA 3SDBA 1VHQA 5K3EA 4HQLA 2O23A 4GSKA 4IJVA 1K5PA 4IHAA 3U13A 2PUBA 3EAGA 3AG5A 1ACJA 1PLKA 1A9ZA 4OD0A 2YXPX 1X0XA 1NVBA 5IBCA 3U4DA 3NEJA 1PUIA 2IYNA 3E05A 3VV3A 5IASA 1KC3A 1AB6A 5DBFA 3UXMA 2Q7OE 1YR1A 3DZDA 2WJZB 2XKAA 1D6MA 1U9JA 1IK6A 1TEXA 2IGTA 3Q3JB 1LNQA 3O8RA 1JN0A 4ENSA 2RKWA 3WOHA 3AW8A 4CF4A 2YC2C 2ROQA 4AKEA 1ONPA 1QLWA 2ZI4A 3F9CA 3RTBA 4GR9A 1YZLA 2ZIXB 2ZJ8A 2NW6A 2GVDC 4Y1RB 2BHTA 2O2YA 4Q7EA 3G88A 1B0UA 1EEHA 3IKJA 4RNDB 1M2FA 2E4AA 1LFDB 4WLOA 1AIPA 4NF2A 1ZYUA 2JGLA 1A88A 3VAZA 2B5VA 2J3KA 3EG9B 3LUJA 4XUGB 2JBWA 5EJGA 4ESVA 1RABA 3GUUA 3SIRA 3GJTA 2VC2B 1W4BA 3UV6A 1GPYA 5J1SB 4JODA 3ORQA 3HXMA 3CBQA 2GPSA 5CPBA 1NQOA 2CEAA 2E87A 1EE2A 2ACWA 5IBPA 2XGSA 4J2TA 1V5GA 3EF3A 3KR2A 5KX5B 3FYUA 4WH0A 3VO1A 2YTZA 2FW1A 5JROA 3HVKA 2J5RA 4DUGA 3QVLA 3LXMA 4RFVA 3TB4A 2D00A 4B3GA 1XPUA 4JJFA 4BHTA 1LDNA 1Z5WA 1N2SA 3IUYA 2NU8A 1YS1X 3JD0A 4PRLA 4D44A 2ZSHA 4IY1A 4MV3A 4J16C 2VNJA 4UU7A 3P94A 4CQLA 4EI2A 2VWPA 4D3YA 2NV6A 3OJLA 4UNRA 4YMGA 3HN6A 5IS2A 1KRWA 1T8SA 5LA6A 3B1YA 5JS2A 3HYSA 2GERA 4EKNB 1W48A 4EO9A 1Z28A 4B7ZA 2WU3A 4Z5XA 5J47A 3TTTA 1NIPA 2PS1A 3DWFA 3QXXA 3TYXA 5BMVF 5JNWA 1E99A 2CVPA 1U3WA 3K0EA 1QFXA 4G63A 4FDLA 3BL5A 3UB2A 2VP9A 3TQOA 3PWTA 4O4LF 3NCHA 5IH7A 1VBFA 1XX6A 2X23A 4Q7LA 2RG7A 3ANMA 2XI4A 3QUQA 5JMOA 4Q9DA 4MV7A 5KNCA 4BN0A 2W2XA 2D06A 4Y2HA 5AJHA 5TLSA 1ECCA 2GQ0A 4QD3A 1BWPA 3FPLA 3ELWA 3FR8A 3SIWA 1VYVA 2OPBA 4I3FA 4N3NA 3PXAA 2VHEA 5FTJA 5EIBC 1DXYA 2X3YA 1KJJA 1L3IA 2C4WA 3GEBA 3H04A 4M7OA 3R7AA 2FN4A 1A71A 5FX2A 2G40A 4N5DA 1HOTA 4QASA 3FCYA 5A0VA 1ZC4A 2DRIA 2FP4B 5JNTA 1X8KA 3DTVB 4W5TA 5J1TB 5TMEA 2W6NA 3CEJA 4CBVA 4KR6A 3CG4A 4JLAA 3REQA 3TRKA 2JD0A 4PQGA 2IDJA 3TTWA 5KNDH 3TECE 3RABA 2QBYB 3LLVA 3IAFA 1Z2OX 3DV2A 1BGXT 1XZQA 2Q5CA 2YMMA 2HWKA 3O75A 1DKRA 1IRIA 4J4HA 5AW5A 3OZTA 2RJ3A 3RSZA 1PL7A 3IVXA 2WAXA 2IW1A 2D1RA 2JRCA 3BGDA 4KE6A 4HAXA 2QJRA 1QU2A 1YRAA 4FMPA 3DAYA 2PPVA 3HKBA 3U3XA 5B1DA 2J6CA 3SF8A 4RTNA 1KYYA 4NYJQ 1XMOB 2I7CA 2ZTMA 3BD8A 1EEXB 2DT8A 3GO4A 3OEHA 4RIIA 3NYQA 1O89A 1E5TA 2ZR8A 1LW7A 3GW8A 3BE4A 3KT0A 4YJFA 4XASA 2XRMA 3T5MA 2X9NA 3L07A 3SSNA 1CY4A 5GGYA 4TGLA 2X8LA 1N2HA 4HDRA 1TU3A 5AESA 4YPVA 4B6RA 5DU2A 2NUPB 4QPNA 1ZJWA 2XF2A 4JVMA 1WB5A 3DAGA 4KR7A 3N6XA 5FUVA 3LDHA 3TDMA 1IJBA 2DTEA 3DF9A 1QF9A 3FNEA 4U39A 1WMEA 3GGGA 1AQIA 4YB8A 3AR7A 3JQGA 4CMEA 2ODPA 3SBEA 4UTXA 1Z33A 4KVAA 3QWIA 4D25A 4RKYA 1QTIA 1EUYA 2P2CA 3LC7O 2FMFA 3ZLUA 3K15A 1N0UA 1QDUA 2WAAA 1Z5UA 4IH4A 2JLXA 3BMOA 3STUA 4RMNA 3R7SA 1OILA 4R2JA 1VE5A 4Y0AA 1DXHA 3DVAA 2DTDA 1J90A 3OJFA 4W7SA 2Q6LA 3PKZA 3T94A 4E5PA 2QSJA 1XRJA 2Z95A 3QUAA 3TEFA 1ECGA 1SUIA 3O6VA 1EFPA 5I9NA 3T4XA 4BBPA 3LP8A 2FSFA 4M7PA 1C3VA 2CJFA 3KQHA 4X61A 4FNGA 4AG5A 3DL4A 5GWXA 1PV2A 4I5EA 2R1VB 2M1ZA 4URHA 5BWCA 2EX1A 3WDSA 1OKKA 5F7XA 1WKBA 1XRQA 2OXRA 4K40A 4EW3A 4M1SA 2EP7A 3NHPA 4LY0A 4JAVC 4BDTA 2VKQA 1ZIPA 1RYYA 1MEJA 3G13A 1VSUA 4RHTA 1U7TA 3PI6A 1EGHA 4TTSA 4MQLA 6AT1A 1LDMA 3QP9A 2HD4A 2PFKA 4OMFG 1RYHA 2FRDA 3VKFA 4RPLA 3QUSA 2A9FA 2QX7A 3BYZA 1U2SA 1RI4A 2WHYA 4MNTA 4ZAGA 2E21A 3SJCA 1MV5A 1W2GA 1PJQA 4LY3A 4CNBA 4CV1A 1MOZA 4AYXA 1BHO1 4R9NA 4EK9A 4KQHA 1JR3A 3FPBA 4BUZA 1N2EA 2VP2A 2DFNA 3KYBA 4R9VA 4DW8A 3PDJA 1RE0A 2WF8A 1LXCA 2QN7A 4RFLA 2BKAA 2G09A 1E1QD 2W43A 4X3OA 5JR3A 1URPA 2JZCA 3EVZA 4OM8A 2FJPA 1Z4LA 4ZOBA 5FI3A 5EHNA 2XA2A 3WGTA 1SD1A 3HQ4O 1DBVO 4QTTB 3B89A 3R41A 4MW9A 1NLYA 1RHJA 4WN9B 1JHVA 4M3NA 1KGSA 4UBKA 2BM1A 4D99A 2YFYA 4RFSB 4PPYA 4C14A 4RTJA 3LOUA 2VTBB 1CUVA 5IW8A 2Q8PA 3MJDA 4ZDJA 2PKEA 2QUIA 1JNYA 3OQNA 1U28A 2ZRIA 1ESEA 4HTFA 2DHEA 2WE8A 2ZJ3A 1DXOA 4TLEA 2DJIA 4MW0A 1Y8ZA 4B32A 3QK7A 3H4VA 4MQMA 2OA0A 4I4TF 4R2XA 2DBRA 1AB5A 4D9JA 4IO0A 3TSZA 4ESOA 2VWGA 1MORA 1E1RD 1NX9A 1A4RA 4M53A 2JJQA 1V5EA 2GKGA 4EY4A 3EVGA 4A82A 4BMCA 3VJLA 3SJUA 1Z8NA 3E8MA 4MP3A 4U9UA 5I9BA 4LWOA 4QHSA 4DT1B 1FQOA 2WLTA 1E1NA 2OL4A 3AM3A 4HRXA 3IUNA 4YRRA 1YUNA 4WUTA 1T36A 3K0FA 5IDYA 1T3ZA 5IJZA 4OFXA 5CVUA 4RPKA 1G9SA 3OE7A 3WNDA 2CNWD 2IRWA 2IXTA 3P0HA 1V3QE 4B73A 1I8TA 4BVHA 3ELDA 5A1JA 4M9QA 1RLIA 4N03A 1U3UA 1RHKA 2VBCA 3LPNA 5H5JA 2I4MA 4TZTA 3C3MA 4A4DA 1UKYA 4RD2A 1W2HA 4EB0A 5LDHA 3WIUA 2P27A 2PRYA 3AHJA 3AUYA 2ZTLA 3A0UA 2WD7A 4LMAA 4EGAA 5JZVA 2PL3A 3LHDA 4BQIA 3PZBA 3RVLA 4CDNA 1VLHA 4E2ZA 3I01M 4C7OB 1UINA 2BSXA 2C88A 2J0EA 2Y4OA 3G6KA 2Q99A 2HQRA 3IEUA 3CF2A 1EINA 1M0EA 3RD5A 1EGVB 1XKTA 2Z2YA 3NNNA 4NCXA 2XUAA 1TMGE 1G63A 2XT9A 1NQXA 3H6HA 4C06A 2ZJOA 4D8YA 2CN1A 4FIZA 4JI4B 3BDIA 4RHEA 1TCAA 2J6BA 4QSMA 2PKRA 1NMZA 1YIAA 1N8KA 4FGZA 1Z6YA 2FK8A 1NAHA 3H2HA 1VP3A 3HVHA 4NZZA 3W5JA 1N36B 3L79A 5A03A 3F5MA 2IF2A 1S7CA 2ODEA 4RK0A 4DLWA 4BP9A 4P9NA 3T1YB 5ALWA 2Q5JA 3VMFA 1IAQA 3UUGA 2HAEA 3G9XA 1CETA 2CLDX 1YDMA 2HIHA 3NMUF 1I5RA 3N2KA 5CT5A 2ZYVX 3CR3C 3DBLB 1L4HA 4AMVA 2FR1A 3GWGA 3BSSA 1BXRB 4R8VA 2BR3A 2AIRA 1FFHA 2YICA 3OKAA 3QE4A 1JWAB 3KPJA 3QMPA 1TFRA 3C3EA 2H18A 3OCZA 4PAMA 1AO3A 4ARSA 5AW7A 3QFFA 1XGKA 3KPVA 4MROA 4WWHA 5E7JA 4NMLA 4PR0A 2J9YB 1ODKA 5FL7A 3KG2A 4IZIA 4M6WA 3B3FA 2QMEA 1DAFA 2AI3A 3NM5A 3DKPA 1DVRA 5A6SB 2VXYA 1SR8A 3A6JA 1EI9A 1S9DA 4TMVA 3VI4B 2Z30A 4Z4GA 1OCEA 3OMWA 5A04A 1YUMA 3CVYA 4S1NA 5CEEA 2OLJA 3RBAA 1ZZEA 4ESEA 4KVGA 2D2VA 1AXRA 4C4AA 1VKJA 2HBQA 2YVKA 1A5SB 5I7VA 5HIKA 1ZONA 1LZLA 5ESDA 2ECOA 3A3NA 4LYAA 2B4QA 3WBKA 1X9HA 1KPIA 4R8MA 5FXMA 1RJDA 3O74A 4H17A 2XMZA 2XY4A 3THRA 2XXJA 2IP1A 5D3MB 1XZBA 3CVOA 4RXUA 4LTMA 2R00C 4IUCS 4NOJA 3IULA 3LQ1A 1SBNE 1L7OA 2WR8A 3OLQA 4MCIA 4AMZA 3W2HA 1GQSA 1R6VA 1WTCA 3PPVA 4OHYA 1Z7YA 4H60A 5A4DA 3WLJA 2BFMA 5DOZA 4ZCIA 2PZKA 3PLNA 2F9LA 2IDMA 3L6CA 1UBJS 4LK3A 4DYHA 3LZCA 3GEHA 2P5UA 3CX8A 1LKZA 4RHXA 3FOFC 5ULLA 4BMXA 1ICEA 1E7QA 4U7HA 5LZ8A 3STXA 4YQFA 3EVBA 4BJ5A 2DR0A 3DKRA 4L9RA 3FWYA 2C29D 1SQGA 4G85A 5TGDA 4LZZA 1LVGA 1VM6A 5AM4A 3U3RA 3NBZC 4LC0A 4O4HA 1PR4A 2QD1A 2GTHA 2WHEA 3BCRA 3FMIA 3H2JA 4TMTA 1XI2A 5TNXA 4C3VA 1EJ0A 2WIAA 2AG8A 3ASYA 5KVVA 4OMCA 4FFNA 3DHVA 5F4BA 2NYAA 4YXFA 4ZYUA 4WFQA 1J1UA 4TRNA 3M89A 3RI3A 4GT1A 4KPUB 5BN5B 3WLPA 1QZ3A 3NR2A 1Y63A 1CJKC 3CKKA 2AWOA 5EQFA 3ACDA 1KJYA 3IIKA 3ESBA 4LDNA 3V2HA 4QC2A 1CDDA 1DARA 3EIXA 3WB0A 3TO5A 1P8AA 2N3ZA 4TV8A 5C8DA 1J33A 5FBHA 3VH1A 1N2OA 1LPSA 3VZBA 1V71A 1ND6A 5I45A 2ZTVA 4UQLA 1W94A 2LD4A 3KRTA 4MI9A 3AH8A 4CMEC 3HXLA 4XZ3A 3WLRA 1MUUA 5BSUA 4AY3A 4OI0A 5DB4A 4PHGA 1JQ5A 4BUCA 2EFYA 4E1VA 1PJRA 1HK7A 1IXYA 2P1DA 3CLTD 4EB8A 4K81B 2UVDA 4GYYA 1ZC3A 3QMVA 4A0HA 5AJZA 3W78A 2PGJA 2Y71A 1Z34A 5HBGA 2FG6C 2D2FA 2JCSA 2ODTX 2PLAA 1YZGA 4XB6B 1QQAA 1HDRA 1KMQA 2PYZA 2EYUA 1DCKA 1OAOA 2QU7A 3VU1A 1U2ZA 4CTNA 1NJ1A 2P2LA 5I51A 2CCJA 1P2SA 1KO4A 3MRSA 2ZREA 4GI1A 4HRAA 3PQ7A 2FWIA 4PINA 4DNFA 2NUTB 2OILA 1PN3A 3W5VA 1KIMA 2Z8XA 2HIGA 2I7TA 4P0QB 1JDVA 1DADA 1YDWA 3GL9A 2ZRPA 3SS9X 3CHYA 3DT9A 1TYCA 1QF7A 2KM1A 3E9CA 3NAZA 1VA4A 2A1UB 1DAMA 2EG9A 2JGEA 1AC5A 3J81k 3LY8A 3UOAB 2E18A 4GBMA 1NR7A 4O1MA 5HDBB 3CC8A 5CFQA 3SZMA 2W2LD 1G8JA 5HVNA 4OIMA 3MWJA 4BLQA 2QYTA 3EAQA 1E64A 4YUWA 3FDJA 5KWVA 4M9ZA 3IAS6 3U19A 2RG1A 1TVEA 2ACEA 3GUHA 5KNBH 4EYKA 2D7DA 1KFBB 5L6LB 1TJYA 3NRBA 4ZICA 1TVMA 5HM6A 1OLXB 1U1DA 4H15A 1DDGA 2V0NA 3FTPA 1EP9A 1MN6A 2ZQZA 3IXQA 2PX2A 1P1FA 1IHYA 5FO0A 3RBXA 2PQ0A 4B8WA 2ZI3A 2EX4A 4GW3A 4PAWA 1XDZA 4QDZA 3UAVA 3WVNA 4NJOA 4NYIR 1QQTA 4D0GA 1P73A 4A3SA 3M70A 4D5EA 3DUFA 1WV1A 3VDQA 5JEDA 2A3RA 2B1GA 3VHXB 2VOJA 3UZUA 1LLDA 1MQAA 2C4TA 1XD9A 2W8BB 3GA0A 3MUNA 4JBLA 3TZBA 3BJMA 5KU1A 1F06A 1YNSA 1ENYA 2HXYA 1UBGA 3A4YA 3G2PA 3TFWA 4BQEA 3AM4A 5C5IA 3TZ6A 4PNHA 1WB4A 3VHLB 1N2ZA 3UKJA 1SXJB 1T2AA 2C2XA 4BLPA 3SC3A 2Y0BA 5AKXA 1OLSB 4C4TA 3ND5A 1WS6A 2ACKA 3OHPA 3Q5EA 4CQMB 1FVHA 4FYPA 5TS3A 5HS6A 3CWZA 1Z68A 5BN4B 3V1UA 4XLZA 2Q3LA 1HMYA 2PIAA 3UJCA 3SFVA 2A4MA 3NORA 3GUYA 1DBRA 3K2QA 4XWGA 3SFTA 4BV8A 3TG8A 3PNOA 4US0R 1ULHA 4J0GA 3AOEC 5ER6A 1SKAA 1G7TA 2GK4A 4J1TC 3VO8A 2DP4E 3FWPA 4N41A 2CNBA 5CP8A 4BNTA 1TNDA 2VXBA 3OSUA 4FHEA 1SKMA 2ZJ6A 1U65A 5CDFA 3RC1A 1ZD2P 3RR2A 2PZEA 2AE1A 3DGEC 3DJFA 3GOHA 4F5ZA 2QL5A 5T4HA 4L9WA 4CMIA 1OI4A 2VQEB 2CHQA 1N9ZA 2X86A 4KITB 2O54A 5J2TA 3RU9A 3LBNA 1Y9AA 2EGUA 4ZO7A 1KK2A 3HZHA 5H0IA 4N76A 2F3QA 3CF6R 1LPMA 3C70A 2G1PA 1L8AA 3H2YA 2JZOA 4FGSA 3ILYA 5SY9A 3PSAA 1Q0QA 2GEKA 4XCVA 1UXKA 2RMKA 2ONKA 1ZESA 1IOLA 3DVSX 1IRXA 2BFDA 3H0CA 4IR7A 5E2IA 2YZ7A 5LD2C 4CF6A 3WOVA 3VO9A 2FN7A 1M1ZA 1U3GA 1ZSNA 3W34A 3G2IA 4A2CA 4KWTA 5A7FA 1PZXA 4U7JA 3V1NA 3EXEB 4IF6A 4KOAA 3G0DA 2KBFA 4U8HA 4D98A 3P2KA 4H77A 4LJ6A 2I71A 4FDAA 1VMIA 4L5CA 4AZTA 3GLHA 3KYCB 4QQ8A 2BC9A 3G7UA 5DHPA 3AR3A 3UYLA 3ZHVA 5KVAA 2HO5A 3IVGA 1RR6A 4EQZA 1OZHA 4DVGA 4HJRA 3GGPA 4FWIB 2ZJBA 5FV7A 3SHWA 4A0FA 5KC9A 4ZI7F 3LOQA 3W8DA 4Q4HB 1H2HA 4YCNA 5K3CA 3EZ9A 1Z56C 3AR5A 3BA6A 3KZCA 3H6GA 2HQOA 3ZNOA 3K0SA 2CBXA 5EP1A 3I2JA 2UUAB 2NO7A 1M2EA 4C03A 3VKGA 4C2BA 2CW5A 4C4ZA 4DANA 4LRQA 5DI3A 4Z6KA 1N8SA 2Q9UA 3VNSA 3LVRE 2JJ1D 3CX4A 4HT3B 2VOEA 1T2CA 4EPVA 5LDDC 1HG0A 1F3OA 5FH9A 1E2UA 2C9CA 5F21A 1LPPA 4M9XA 1KAMA 4KYIB 4MIKA 5HJ2A 3GLIA 2QLLA 2C92A 4BNWA 3BD9A 4C7JA 4CGYA 3GJYA 2Z2IA 4NLLA 1L7AA 4U63A 1R18A 2VSYA 2E4WA 2PIDA 5KAPA 2X0FA 3T7AA 5MGNA 1OXXK 4AX4A 4EA9A 2CUTA 2X1HA 3JSXA 4N12A 5FYDA 5EZ5A 3HCPA 2IS1A 2WMNB 3AB3A 3O03A 4V0SA 1VKOA 4PNZA 2DLCX 3AO0B 4HKTA 1W49A 4PSAA 5HFAA 3IERA 1Y9ZA 4CMHA 4HSEA 3HVUA 2ZYGA 3FJ1A 1DC6A 1DAOA 3AHDA 3HYTA 2WTNA 1O2DA 3RFCA 3RLFA 4YDSA 1YL5A 4QBIA 2AFIA 3OAAD 4I55F 3P20A 4X63A 3ZWAA 4RIFA 4ND2A 4ZRDA 1ODIA 2Q46A 3NYWA 1MC8A 4MWCA 4IX9A 3TQIA 3R7WA 2HQBA 2N75A 3I6IA 1ECPA 1PR3A 4QUEA 2COUA 4WOKA 4KR9A 2O5CA 1W581 1HLPA 2VF8A 3ZY3A 4CIYA 1P19A 3U1VA 1KYTA 5BVGB 2ZYDA 3FDFA 1ZNXA 1JDJA 3H42B 4KQ2A 3W5HA 2DPXA 1I2DA 3OCCA 5KSYA 4PX3A 5EXXA 3WSTA 1R0CA 1I1OA 3P26A 3CO5A 4YRFA 4CETA 2C84A 5EMKA 1YFJA 4AF6A 2C42A 2W4QA 1FNNA 1HQCA 3ITEA 4KEAA 1L6IA 4U2GA 3CXUA 3DQZA 4C0BA 3N9IA 3C3BA 2Q0HA 5HKKA 3VU3A 4PS1A 2YIMA 3G0CA 3P2YA 2IOFK 1HLFA 1SXHA 3LUDA 4PICA 1BMDA 2H63A 2HFJA 2YRXA 3HCEA 2GPJA 3PC6A 1U5BB 4HGOA 4HN9A 4KO8A 3GEEA 1DOAA 1NVXQ 1JHYA 2MSEB 2R11A 4OQNA 4DSOA 3FRIA 1NI4A 3N2GB 2BP7B 4IJQA 4LY6A 1DMSA 3VC2A 4KTTE 4RACA 2ONYA 2ZXUA 2A5DA 2XCTB 1HT1E 1M6HA 2F1RA 1O5TA 4MHOA 3U4QB 4IM7A 4QYIA 3HE3A 5M7EA 4QNMA 2BE9A 1B73A 2IWRA 2GMWA 4EG7A 1S3GA 1SBHA 3LF1A 4V0KA 2IV3A 3C87A 2J3MA 1M8FA 3F7OA 3OQPA 1NQWA 1M73E 5EIAA 2HK9A 1Q21A 5FOWA 4C22A 621PA 2EFCB 5C3UA 4NEQA 1G1MA 3VR5D 1L5QA 4F6CA 3SEFA 2HREA 1K7CA 3FSGA 2P9TA 5DHRA 2DPGA 4KC0A 2Q1YA 3PJDA 4WECA 4N7JA 3PIRA 5IJWA 2NN3C 1I01A 3LFHA 3QX7A 4ZCTA 1FMLA 3COZA 4KRYA 4M86A 3G2HA 4DRZA 1V11B 2I1LA 3QVGA 3TIXB 2JK1A 1EE1A 2GYYA 1KXZA 4DILA 4BKOA 1DKPA 1FP6A 1ECBA 3E4DA 2CNNA 2EOAA 5KTSA 1U02A 3FW1A 3VZRA 3W3AD 5JAUA 1ZH0A 1E98A 4BNYA 1VYUA 4KIFA 4RZIA 4E5VA 1PYDA 4H2DA 4RDXA 4RCYA 1T9CA 2JBAB 2JIZD 4N3AA 1ZRNA 2XECA 4DSTA 4DUZB 4H0CA 2BLLA 2W6JA 4P2GA 3K0AA 3HK2A 4LAFA 2Z43A 2QNIA 4G25A 5BNTA 2Q07A 1A4XA 3QITA 1ZH6A 3D8TA 5DHSA 3E0XA 5GV8A 2D0IA 4U1RA 4I19A 3DV0B 5BYAA 4RK1A 1VKHA 1L4NA 3L7MA 4D82A 2IH5A 2IHKA 5ALIA 2PX0A 1XTSA 2XNDA 3A31A 2VYND 4Y2RA 1RYMA 5F1OA 3ELUA 4JKIA 1J2RA 5I9TA 1YQEA 2FGJA 3L92A 1OPXA 3ZHXA 5LYJB 2H59A 2FXVA 1EFAA 4OV6B 1JEEA 2YN0A 3BRQA 5DYWA 4DIUA 4YO8A 3K8YA 2EFHB 3KQKA 2A0YA 1QG6A 2EIHA 2I4TA 4MB6A 4MJ3A 3II6X 4XI9A 5EIFA 4MVJM 3PB3A 2G17A 1EQUA 4JBGA 5EPEA 2M98A 2QENA 1KDOA 5C3MA 1NQAO 4F3RA 2C5BA 2H65A 4OGGA 4UTPA 2O0HA 2OESA 4EA7A 2F7SA 3LWZA 5JSUA 2XA1A 1JL3A 3FHJA 4PLVA 1HFKA 2B8JA 3U5TA 2CLCX 1OIWA 2NXCA 2RAVA 4H3VA 4HF7A 4JYCA 5FF9A 5I01A 4ASUD 2RH9B 3NKLA 5LQJA 4J03A 2ZRLA 2B2CA 3GUCA 3LQRA 1AJEA 1VIVA 1Z7BA 3WWOA 3VYVA 4UZSA 3ZLVA 2YJ6A 2XF8A 2HSGA 4KJXA 3AI2A 1QORA 2DFTA 4TSFD 1AK1A 3FJYA 3INTA 2VL7A 3P2MA 4KOEC 5LMNB 2IVZA 4JYBA 1P6UA 5CFZA 4HQ0A 3TW0A 4FUTA 5G4KB 3QLVA 3R6LA 2Z09A 4N5HX 2MT9A 2QMOA 2PWAA 2VDJA 4F8JA 2DLDA 1T8WA 1K7EB 1L2TA 3C1TA 3RC9A 5LNK6 3TTUA 4K0KB 1ZK1A 3I04A 4ZAXA 4BXOB 4YP6A 5HQTA 1B0PA 3LAWA 1TF7A 3PNQA 2P2GA 4JV5B 1VRWA 2IX3A 3GLGB 4V0NA 4R2IA 5IKMA 3DL2A 3OIDA 4ZMRA 1A9QA 3AR4A 2I22A 1J42A 2RH4A 4NSNA 5FULA 4NG5A 1HE8B 5KYKA 3CTMA 4M0DA 3BKWA 1VPVA 1QGAA 1F17A 1MO2A 5ALHA 3ASZA 1XXHA 4H7IA 4CUKA 1PG2A 2I6XA 1U9YA 3B5JA 3GJSA 3PUIA 5FNVF 4BFUA 3PRYA 2JFYA 3TIVA 1U99A 3C8DA 4PQEA 5DN6D 3CRVA 1L5HB 1T6NA 1JT2A 2K6GA 2X9GA 2P9FA 2ISSD 2DXIA 3CRQA 3LT5A 4TWBA 2HGZA 4UKDA 2HSJA 5ICFA 1JAHA 4M1MA 4WKCA 4YJGB 5FRDA 3P0RA 4N5IX 3MTIA 4KO2S 3RT1A 2AKYA 2CJWA 1TC1A 1WTAA 4GL4A 5FYQA 3A4MA 1JQAA 2W83A 3WP0A 1G6HA 2AZTA 3TIGA 1V47A 4KUEA 3IDFA 4MJXA 1A2KC 1ECFA 3AP3A 4G56A 1GT6A 4RD1A 4TTAA 3EOAI 4W8GA 1BQ3A 1NBHA 2QYOA 4GYJA 1PR2A 4TV9B 3AG6A 3PFBA 4C2TA 4KPYA 1RI1A 1UC5B 2FNAA 2OAP1 2AVDA 3I9FA 3SOZA 4C7VA 2C1ZA 3OZSA 3IDQA 3SYTA 4COOA 1QGZA 4I55A 1RWKA 3OU6A 4XLTA 3ORYA 1DTSA 1MX1A 2JGJA 2K2QB 2X5OA 3MCUA 1DTWB 3OWHA 1JU3A 1QJCA 2I03A 4AKTA 5H3CA 5JFGA 4FILA 4EHHA 1JQEA 3LNTA 3OBIA 1DC7A 1DB3A 4P3XA 1YT5A 4OA5A 4CMGA 1LDEA 1GQRA 1JDTA 1ND5A 3F8SA 1ISGA 4GECA 1WMAA 4QRDA 4W5RA 3DW3X 5CLFA 3KOMA 4GO1A 4JL8A 2IYUA 4J8PA 1DAHA 3K8OE 4Z8YA 2JEOA 2A1TR 2I8AA 4QRIA 5FTMA 2O3QA 5KWIA 3BXHA 1O87A 2R6ZA 4R9RA 1Q74A 3SQXA 1H0RA 4QPCA 3OURA 2I6GA 4BQPA 5JXJA 2WTUA 5IVHA 3AERB 3HVRA 1YS7A 2HRBA 5ALRA 3JWEA 3JQPA 1BHJA 2NPOA 1YQDA 3S27A 3KEQA 2NO6A 4BCDA 1BJKA 2LGJA 1OAKA 4FVTA 1SCJA 2ZUDA 1L8QA 3C15C 4HL6A 3RTDA 4V2IA 5A9SB 4WBSA 5LPNA 4MW4A 4WD3A 4JR1A 1XROA 2PLRA 4L8LA 4LFBB 1RVDA 1Z8DA 2ZIAA 1IXSB 2FHPA 2C5FA 1RJFA 2BH2A 3DL7A 2W37A 3AESB 4PBSA 1DRKA 4KV9A 3E6AA 4PCLA 1H1LB 1JKJB 1NVGA 2FW0A 3BZUA 1B8VA 3GMDA 1B8UA 4MRMA 4PC1A 2PD6A 5DW0A 4LFCB 4QYSA 1XJ5A 3L43A 4RH0A 4Q93A 4ZQGA 1U7XA 5JS6A 4EJ6A 1ORVA 2OG2A 3I64A 5K20A 4BVJA 1YTLA 2V7VA 4BBJA 3G5TA 4CT0A 1QC5A 5CVVA 1XMJA 3LK7A 1A1VA 2Z3VA 1SOUA 3E61A 2C83A 3P19A 4LV5B 1YS2X 5AKLA 5C0OE 3R9IA 2A35A 5JAMA 4UHFA 1GTJ1 3AY3A 3PD1A 4G36A 5BR1A 1HEIA 4LF6B 1N5JA 1X92A 2ZCVA 3K2IA 2GPWA 2CMHA 5AP9A 4PO3X 5JPDA 1WULS 5EYPA 4DHWA 2ZT8A 4GBJA 4Q05A 4Q9IA 2C9BA 1RAIA 1JEDA 3B6IA 3R7FA 2B7LA 2D5CA 1C0EA 3KOZA 2HX1A 4NMHA 4M0MA 1M83A 5K0FA 2H5LA 1PK9A 2V9ZA 4B6SA 1ZGAA 1Q44A 4OHFA 1YKFA 1JXQA 1TK3A 1SC9A 4WIAA 3AUXA 3E82A 4L28A 3QLUA 4S1TA 3ZOZA 3AVXA 5GP1A 1U2GA 1I1NA 4TUYF 1QZTA 1T9DA 1MNAA 4NRDA 3EISA 4BMDA 4BO1A 4LECA 4F4JA 2C8KA 3LE8A 3KTAB 4ALIA 4B7UA 1ZD1A 3R0VA 5J2UA 3RVMA 4WK4B 1EWQA 5D5HA 2BFPA 2WPDA 5TGTA 5DASA 5TQ2