1CLUA

H-ras complexed with diaminobenzophenone-beta,gamma-imido-gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
160
Chain Sequence
MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Guanosine triphosphatase stimulation of oncogenic Ras mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
total genus 56
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cluA00
5FPSA 2N42A 2ZU0C 3ADKA 1OB2A 1XFAA 3BH6A 1AKEA 1P72A 1Z6GA 3T5GA 4HLUA 4XD7D 4URVR 4TLAA 3QEJA 2GTPA 4IDNA 1CULC 1SVMA 3K0CC 4DLTA 4XTRA 2DWPA 2GKSA 5FOUA 1UBFA 4FMDF 5FPYA 1N5JA 3QBTA 1AZSC 3VFDA 5C18A 2GILA 1UKZA 5EZ6B 3QXCA 5G41A 2NTYC 3BB4A 2AWOA 3O47A 2Q9BA 1YRBA 1BKDR 4N0DA 2F55A 1GKIA 5G3YA 1XD8A 1ZIOA 3K09A 2YV5A 4PAQA 1P2VA 4GZMA 3T1VA 4XTCS 1EFRD 4JLBA 3QPVA 2F1RA 1TU3A 1XEXA 3G5UA 1M6NA 1F48A 3FVQA 1XCMA 3VNVA 3TAHA 3N70A 4Q01A 2V6JA 4Q4JA 3N2EA 4JVMA 2OM2A 2XEXA 1R0XA 2ERXA 5EXTA 5JJKA 5TB5A 5HCIA 3PEVA 3E5HA 3O8RA 4A92A 3LD9A 4RZUA 1HE8B 4PPQA 3ZD6A 4N3NA 1E9FA 3CF0A 3AF1A 1XD2A 4BFYA 3PENA 4HAXA 1GRQA 4TMWA 5LB2A 4A8JA 3B5JA 3QXXA 1AS0A 1WRBA 2PZGA 4V0MA 2VP9A 3HR7A 3FFBA 1JNYA 4G5RA 4M9QA 3IGFA 3IQWA 3K0AB 3GLIE 1XRJA 2DPXA 3U5ZB 4HB0A 2E87A 1OH6A 2D06A 2EFEB 1Z22A 3QIAA 4CEJB 1P6XA 1LF0A 1W36C 2OZEA 1ZNXA 4LGMA 5E4FA 4HB2A 1E1RD 2YOFA 2OG2A 3AP1A 3I3SR 3LVRE 1RKBA 2JIZD 3AVOA 4Q1EA 3RWMB 4DLYA 1RPZA 4KO8A 1W2HA 1D2MA 1DTSA 3T1OA 1Z6AA 2OCPA 1JB1A 3C7KA 4PC2A 2AHOA 2DR3A 3ZIAA 3QKRB 1CR4A 1E2GA 4S2EA 1OH7A 1E2EA 4LK2A 2QMUA 2X8AA 3GEHA 1SXJD 1W5SA 2I4IA 4GP7A 4AG5A 4CEJA 2QAJA 3U4QA 4F4IA 1ZU5A 2QT0A 4YXWD 4QJ4A 2DWOA 4LPKA 5BW8A 1W0KD 3WNDA 4CZ2A 4G01B 4Q47A 1SXJE 4A8JC 4IKEA 1DAHA 3K09C 3MJRA 3OAAA 4BUJA 2ANBA 4BASA 1D9XA 3KJHA 2J46A 2VO1A 2RGNA 3VHXA 1F2UA 4KSCA 4GBMA 5DI3A 1J2JA 3K53A 2QP3A 2ZRMA 2QI9C 2G9NA 3CH5A 4EFNA 5J4HA 3LX8A 4XVQA 5D3QA 1M8PA 3TRFA 3VU9B 2QY9A 2XNDA 3K9NA 3MSXA 5TXGA 1NG9A 1TQ6A 1VCIA 4MGZR 1SXJA 4NP6A 1WF3A 2CDNA 3BH7A 1R0YA 4W5HA 2V6IA 2FOLA 3Q7PA 3K70C 4UXHA 1R5NA 5BYJA 5KSYA 3GLFE 3GLGB 5C1BA 1XPUA 2PMDA 1J8MF 4UNNA 1Q0UA 4XWOA 3AH8A 3OIVA 4M1SA 1JJVA 4PPNA 1XEFA 5E7MA 3O8CA 1GRNA 1R4AA 3BGWA 5DYGA 5K8LA 2IHBA 1YZTA 5KTYA 1AZTA 3CB4A 4ESVA 3ZVMA 3SZRA 1L7VC 2CLDX 1OIXA 2JAQA 3KTAA 3LBNA 3A1VA 1Q1ZA 3U6KA 3ZVLA 2IYVA 3RLFA 2BMEA 5EZ5A 1T91A 4CT4B 2R65A 1WDTA 3PVSA 1TQ2A 2VRWA 4C30A 5JI3E 2OXCA 3WYFA 1P2SA 4HAWA 4QFMA 3VKGA 2AK2A 2J87A 3B2EA 4L9WA 4NYMR 2XOKD 1J90A 1S1CA 3SYLA 3TQFA 1E79D 2ZI6A 1NN5A 5AJWA 3BB3A 4ITRC 5GJWC 3FKSD 4ABYA 4RFSA 2LKDA 2BIFA 2VF8A 1KDRA 3SJZA 2WJVA 4RKEA 2QRNA 3I72A 2IYQA 3FPAA 1GAJA 5KSPA 1NIPA 3B1YA 1HT1E 2DHRA 5HZKA 4MYHA 1NKTA 1U90A 3VR4A 1XCGB 4H9GA 3QNUA 4QL3A 1G3RA 4OI1A 4DIDA 1QVAA 3IPXA 4IHQA 4TYWA 5KNCA 4HB4A 2NO0A 5AUQA 2O0KA 1NMZA 3KQUA 1IM2A 1JR3A 2GCOA 3I62A 2RKOA 2ZI3A 2FFQA 2ZE7A 4TWZA 3PUZA 2GK6A 1QRAA 4JSTA 3RC8A 2B7BA 3EG5A 3OHMA 4B2IA 4YMTA 2OHFA 3BXZA 2DBYA 2I1QA 1I2DA 3DOEA 3IBYA 5J47A 2QTVB 1FTNA 1YJ5A 3W3AA 2XOKA 3CX8A 3BJIC 4RJLA 1Q12A 3QG5A 3BWDD 4LBWA 6Q21A 3OIWA 1PUIA 1S0UA 4PR0A 1E2QA 3PUYA 5J4VA 2IYSA 1E3MA 3FB4A 3CZPA 3KKOA 4TL7A 4CEHB 1T5IA 4BZXA 1TX4B 2AXNA 4NPHA 2OBMA 4OJKA 2ZRNA 4DSNA 1QHGA 1X8KA 1QDEA 3NBZC 4DEXA 3QENA 1AQYA 2ODWA 1EX6A 1NVXQ 2OFOA 4O2LA 3NBFA 4JYCA 1E0SA 1KK2A 4DCUA 4DUGD 3K70B 4QHYA 2HDNB 4KBFA 3TQCA 2IX3A 2P6RA 2CXXA 1E2LA 1G8FA 1U81A 3QJYA 1WA5A 1N5LA 1DPFA 4DIEA 3MCAA 3DPUA 4KVGA 2W2VA 1LVGA 1NN3A 4DLWA 2GXQA 2NO7A 1NY5A 2G77B 3IIMA 4OHVA 4Z51A 3TUJC 1L4UA 2OFXA 1FOEB 1O87A 2CNWD 2KB0A 4PC7A 2C98A 5FUWA 2DFKB 3SBEA 5CITA 3IILA 5HE8A 5BQ5A 4A8JB 3OEED 4GFDA 3ZDQA 1FX0B 1Z06A 2EVWX 2GCOB 2ODNA 1QHYA 1SHKA 2FJUA 3DEFA 3A37A 3TJZA 1RVDA 1HE1C 2H57A 3TUIC 1Q1EA 1G19A 1EWQA 2IUSA 2XTNA 1TQDA 1N2CE 3LW7A 5IDVA 2YOHA 1G7SA 1DOAA 4B47A 3FMIA 1OYWA 3CF2A 4YC7A 1YZQA 2F1HA 3K70D 2BBTA 3I73A 4IVQA 4KSBA 3A36A 2VSXA 3JZMA 4QG7A 1FQJA 1C1YA 2PX3A 3P4XA 5AWFC 1RW4A 1ZYUA 3B8HA 2VYFA 4M4SA 4PPFA 2ATVA 3AF4A 5TY0A 4E5UA 2C5LA 1NVVQ 4BFVA 3MMPA 1S9HA 3D6TB 2QNRA 1KZ7B 4HLDA 1M7GA 4JS0A 4R7ZA 2GZDA 4OI0A 1OH5A 5KNDA 3MG9A 4TMKA 3SJBA 1US8A 1XCPA 3EC1A 4M9XA 4GNKA 4JLJA 1A1VA 3VKWA 5HZHA 2RGEA 1P9WA 2X77A 2BM0A 2F7SA 3JVVA 4TN1A 2PH1A 1NIJA 1JR3E 4ZCIA 1IAQA 3HU1A 3G0HA 2JDIA 3QF7A 3A1WA 2RGCA 2GDJA 4HAVA 1Z5ZA 1IN6A 1WP9A 3AVWA 3AEZA 2IS1A 1KO4A 2QMHA 2GEUA 2X1VA 4FWIB 1N6NA 5LD2C 2OT3B 3QPWA 2GBLA 2QP9X 2G88A 2QQEA 4JSYA 1DG1G 4UNPA 4OQMA 3N5CA 3CNLA 5AR1A 4BFZA 3A6PC 5F98A 4K46A 4V03A 4EIWA 3K9HA 4PC1A 4MUAA 4CF7A 3B1VA 1SKQA 4D25A 1U0HC 4ZPXA 1GRRA 5K8UA 2C9CA 2QG6A 1KDPA 3H2YA 3W3ZB 4KVAA 2PJZA 1TTTA 1CKEA 1SGWA 2V55B 3TLXA 5F2EA 4BPBA 4AY2A 2J0UA 5D3MA 1U98A 4D2IA 2ZR9A 1XXHA 2VP6A 1AK2A 1YR7A 2ZVPX 4I1OA 2VHJA 3QUSA 521PA 2NGRA 1UEJA 4MITA 3U3KA 3I8XA 3CIOA 3RABA 4US1R 5CIWA 5EE3A 4P4TA 3W8RA 2Z4RA 2WWXA 2G1KA 2WWFA 4F91B 1VHLA 2ZI4A 4LYFA 2B92A 3KKQA 5JWOA 2GF9A 3PITA 3A4LA 3KQLA 3M0EA 4DLSA 2JEOA 2WHXA 3LFUA 5EP4A 4EPTA 2SHKA 3A4NA 3L8ZA 4FINA 4A0FA 2ZRIA 2NIPA 5FI0B 3KKNA 4CEHA 1KI4A 5K8IA 2P67A 1W36D 2C78A 4NTZA 5H1YA 2AK3A 2A7QA 4FN5A 3W34A 1T0JB 4DEYA 3NBYC 2ZSFA 1XTJA 3R9WA 2IA5A 1XWIA 3FE2A 4A82A 5DN6A 4B43A 5BYKA 2W6ID 2VHQA 4DLUA 2WICA 4Z8YA 2R6FA 4BLSA 3T1QA 1OFTA 1K6MA 3ICQB 3P26A 3FKQA 1DADA 2G6BA 4BWYA 5L3QB 1EFRA 4NHOA 4PHGA 1N25A 5JSZA 1GNRA 4UNSA 5LBIA 4MRVA 2WSSD 3K0AA 2VSOA 3CH4B 4XWAA 3KB1A 2D74A 4ERNA 1W44A 1OXUA 1W4CA 3T61A 1A5TA 2IHYA 4AD8A 4TZ6A 1W0JD 1EWRA 1GZSA 3D7MA 3EC2A 3LBHA 2ZM5A 4N0EA 2FGJA 5KU1A 1XXHB 3PEUA 3TMKA 4G5SA 1ZAKA 4CEIA 4F4CA 1G3IA 4G5QA 1AS3A 1ZP6A 1T8UA 2ZRKA 3S1AA 3IIJA 4ZDWA 3D3QA 4EPYA 1E2JA 3LQQA 3L43A 2CE7A 2JLYA 5JSZB 3K1JA 1P5ZB 2JLXA 4QBHA 4US0R 1AJEA 2O5VA 4R2IA 1QZXA 2JJ2A 4V0ME 3IIKA 2FF7A 3K9GA 4ZKEA 1ZC4A 2WJGA 2GBLC 4FI3C 4Q66C 3SJAA 1KAOA 2ZR7A 2QT1A 1GL6A 2R62A 1IY2A 1RYHA 4D4KA 5BWMA 1XZQA 4QGGA 1MABA 1E9CA 4OQLA 4RD1A 3CW2A 1Z3IX 1ZMXA 1R10A 1N0VC 3G82C 3UG6A 1X86B 2F6RA 1KI6B 2W58A 2LWIA 4LHWA 1IQPA 4D4MA 4TT3A 4GP6A 4JLMA 1GOTA 3W5IA 4R71A 5DNYB 2WIBA 2XXAB 1WCV1 3A1SA 2ZRGA 2FE4A 2REXB 5CB8A 1KDOA 5H8WA 4EQ6B 3VX3A 2JJ2D 3BD9A 4JJKA 1E79A 4MRSA 1E1RA 4C0HA 4Q7LA 1E9RA 1IXRC 5KUTA 3L2OB 2NOAA 3N2IA 4FW9A 2V54A 2WPDA 2QSZA 1GDDA 4JMPA 4KYUA 1G8PA 2DFNA 1E0AA 3NXSA 4MYTA 1XP8A 4XOIA 2X2EA 4TLDA 2H8KA 5FBWB 2B8TA 3SHFA 2OCAA 3F5FA 3IUYA 2CHQA 4TQUS 3BIFA 4TMZA 3LO5A 3VTKA 3BAFA 4IFBA 4AYTA 4LJYA 4NCIA 5FBRB 3BBPA 3HPRA 4JL5A 3KQKA 4Q4HA 5JJLA 1AGPA 1AM4D 4QNMA 4HDCA 3WYGA 1NL3A 4MRRA 3RWOA 2O8CA 5FOSA 1M7HA 1NY6A 2VPPA 3AM1A 3KXIA 3MJHA 1VIYA 2R9VA 2AN9A 3QQ5A 5BN5A 3RRZA 2JLZA 2ZRLA 1YKSA 4A9AA 1T3SA 5CK4A 5AJZA 4EPWA 5EE5B 2Z0MA 3EXAA 3TBKA 4I4LA 5B64A 3HWSA 3NH6A 2G0TA 4KFUA 1G3UA 4B73A 5B57C 3B82A 3KDSE 3KZ1E 4BEJA 1BYIA 4ASUA 3L0SA 1KGDA 4UKDA 4BZPA 1Q3HA 1YZKA 2OEPA 2XB4A 3M1IA 3WNBA 4DHEA 3KFXA 2H18A 5JFGA 5GVRA 5EXPA 2ZYVX 2RCNA 4DKXA 2ASEA 1DBSA 1UBGA 3L0IB 3T35A 2QQ0A 1COWA 3AVYA 1AS2A 2CCKA 5AUOB 5JEDA 1SHZA 4RY2A 5CDFE 1UKVY 1GKUB 4U5XA 1OFHA 3ZJYA 3B1WA 4BLQA 2DWQA 1PUJA 1OXTA 4LC0A 3PCRB 4AKGA 5EE9A 2CNWA 1Z0IA 4PO1A 4C0JA 4DLXA 5HKKA 1BO6A 4B3XA 4O2RA 5KNBA 3ZS9A 2ZSEA 4W9MC 2QSYA 1Y63A 1ZM3A 3OEEA 2D2EA 5EE1A 2J59A 2VL7A 3CR7A 2AX4A 5FPTA 2Z83A 4MGIR 3SJCA 4O3MA 3AV0B 3OZXA 2H16A 5AK0A 4L16A 1S9DA 2FV8A 1GL9B 2PL3A 1G9XA 1A2KC 2P2LA 3IQXA 2BC9A 2IXEA 4HAZA 2QGNA 2IEYA 4LC1A 2YHSA 5F9FA 4HYYA 1JR3D 2HXYA 4B6EA 1KI7A 2AD5A 2QBYA 1W5TA 1FTSA 4DDVA 4ARZA 4RD0A 1HV8A 4UQOA 3SFVA 4IDPA 2H1LA 2ZAMA 1Z0FA 1XJCA 4Q7JB 4C0AC 4CEIB 4LY6A 5M04A 2GXUA 3JVUA 4IDHA 2CE2X 1R8SA 4S35A 1UBEA 2ZJBA 4DUGA 2FU5C 1NBME 4KBGA 2P65A 1WXQA 5DE3A 3BORA 1Z0AA 1NVUQ 4KLZA 1ZW6A 1KK3A 2PZEA 2V8OA 4Q4LA 4X8OA 5E95A 4B74A 3FFAA 4E22A 4YDSA 3U3OA 3UK6A 3BB1A 5DLQC 1XTIA 2R44A 3FDIA 3PV0A 5E7IA 1DAGA 4Q4AB 2OCBA 1F3OA 2HEIA 3X1WA 3TR0A 1Z28A 2PEZA 3U3MA 3RSLA 3UMSA 3B6EA 3L0OA 5KYKA 2C04A 3GJ0A 2XJ4A 1GTVA 2PJRA 4KYIB 4OHXA 4LCBA 1W4BA 2V7QA 3NBXX 4OK3A 1LS1A 4XWKA 3DM5A 3KJGA 2O8FB 2WKPA 2ZS7A 4OK5A 4M9ZA 4OKSA 2AD1A 3GJ3A 2J0SA 2IUTA 2OBLA 4CDGA 1GNPA 1Z07A 3ADBA 4FIDA 3LBIA 1XMVA 5FR1A 1FMJA 4KFSA 5CB6A 1S8FA 2YWEA 3CZQA 3LX5A 2X2FA 1FX0A 1AKYA 1T8TA 1WMSA 1NN0A 2A5YB 1JAHA 2VP5A 3OF5A 3ZH9B 1BOFA 2IYUA 5AUNB 3LY5A 3KQHA 1G16A 2ZI7A 4URUR 2GJ8A 2I3BA 3LLUA 1P2TA 4QC2A 1ESNA 1JBKA 4W5WA 2QM8A 3CLVA 4HLUC 3U7GA 2IS2A 4R2HA 4MKGA 1CTQA 3DKPA 3QKUA 4LJ4A 2QBYB 1J99A 2RH5A 5DHAA 1NLFA 2W6JD 1OXSC 1ZD1A 1PZNA 4BZQA 2XXAA 3CO5A 2R2AA 2EQBA 5TV2A 4ZDIA 4UXJA 4TYPA 5AJVB 1ZUNB 1P9RA 2FWRA 4RFVA 1HA3A 5DSZA 4Q9HA 3THXA 3QVVA 3VR5A 1QHHA 1AGRA 4LJ7A 1KDTA 2IUUA 3FMFA 2AKYA 2MMGA 4HZUB 1ONBA 1XMSA 221PA 4AKEA 4YONB 4RKFA 1VCOA 3H4MA 2XB2A 4C7OB 3KXKA 1I4LD 4JVNA 2BKEA 2CK3D 4EQ6A 1KIMA 5L3SB 2IEZA 3PIRA 4PZLA 1ZNYA 3P4YA 4GT1A 2YZ2A 3NG1A 2BMFA 4Y0VA 5D3MB 3DL0A 2PLFA 5CK5A 1OE0A 2C99A 2B21A 1X1RA 2WWHA 4D81A 4EDHA 3U6BA 4P0TA 2C96A 2KJQA 1IY1A 3CPHA 1TMKA 2V1XA 4LX0A 3R9XA 4TZ0A 2DFTA 1KKMA 3ZLJA 1II9A 4O0MA 4DJTA 4JT4A 1JEEA 4AURA 4U7DA 1NLYA 5DISB 3Q85A 5DYIA 1IN4A 2VHUA 4Z8XA 2A3RA 2D62A 3RYTC 1R5BA 5FBQB 3UXMA 3I92A 5EP1A 2ZRAA 4NCJA 4C0QC 4L15A 3LA6A 2WJHA 3WHLA 3B85A 1K8RA 3DMNA 5AJXA 4NCHA 3WNCA 4UJ3A 2QPOA 1CU1A 2FSIA 4QHSA 1XEWY 4I1UA 2ORIA 2QEQA 3T15A 4L8GA 2YVUA 3SI7A 1JPJA 4TYYA 2QU8A 3DO6A 2HCBA 4HB3A 3VMFA 1EESA 4Z1MA 2EFHB 4GOKA 1FL9A 4WBSA 4AKIA 1W36B 2ZJ8A 4KJZA 4B48A 4KHZA 1CJVC 5SZIA 1SXJB 1ZU4A 4HAYA 3TSZA 1AQUA 2HF9A 1UKEA 3CF6R 2GJAA 1G8YA 1R8QA 1VIAA 1SVWA 3HPQA 4LHVA 2PT5A 3QF4A 4RD2A 4KAXA 2B7CA 2D7DA 1E4YA 1WBDA 1BH2A 3GEEA 3ASZA 1NSFA 4IW3B 3THYB 3I8SA 1Z83A 2ZXUA 2RGBA 3ADCA 3C15C 3AVQA 1E9EA 4MGKR 2IWRA 1KO5A 3SE0A 1Q21A 4FD2A 4EJSB 3PJRA 4FCVA 3QKSB 2NO1A 1G17A 1TADA 1Z08A 2IS4A 5K8TA 3LQRA 4Z1MD 1KKLA 1OSNA 2B8WA 2HJVA 1I4TD 4LJ6A 5A4JA 3SOPA 2ZUCA 4ZI2A 2J7KA 2PCJA 4TQ9A 4ZIRA 1XU4A 4DBLC 4MRNA 4PHTA 2A5GA 3RC3A 3GD7A 1L2TA 1XF9A 3K0CA 3NVAA 1PJRA 1II8B 1NNEA 4JIMA 1ODFA 3BK7A 3L0PA 4PQRA 1SXJC 1RRCA 2A30A 4QRHA 1QG4A 3EPJA 1GKYA 2WPDD 3MAAC 1GVNB 1CLUA 1S4QA 4TT3D 4JYBA 1R2QA 3VAAA 1TL7C 4JLPA 1E99A 3FGNA 3SNHA 3THWB 4LSGA 1GM5A 1XMIA 2FA9A 4OI2A 1XPOA 1Q44A 1XJQA 3GFOA 4TMTA 3WYAA 2GRJA 1JALA 3SDZA 2BVNA 2QPAA 3MWYW 2JIZA 4URYR 1Q3TA 2PZFA 4JBXA 1N6KA 4A0HA 5FI1B 4UXIA 4MKIA 2YINC 1G4AE 1TAGA 2YOGA 1RJ9B 2CCGA 3EA0A 4B44A 5JEEA 1IJFA 1FP7A 4Q1CA 3Q3JB 5LD2B 3PQCA 4TMVA 1YZGA 3A1TA 4F93B 4JKIA 4DSOA 1RIFA 4G5OA 2P3SA 1E6CA 2C9YA 2J1LA 1NKSA 4HAUA 2NMVA 2RAPA 3O8DA 4KXFB 3IBGA 4DSTA 1QBKC 4ACBA 3VHLB 1YZNA 4Q4AA 3UWKA 2BWJA 4AG6A 4B34A 1XX6A 1SZPA 2CL0X 2HT1A 3THOA 4CRWB 4EJSA 3Q5DA 4PAMA 1U0LA 3BERA 2OUKA 1RJ9A 1E2DA 2FX3A 4FMDB 2ZRDA 3NH9A 3H86A 1V43A 4DSUA 1VMAA 3R8CA 1HH4A 3EZ2A 2FNAA 2W2TA 2ZR0A 4GOXA 2XZPA 1X6VA 5H70A 3CRQA 4BQSA 1T0HB 4DCSA 5FR2A 1Y3AA 2ONJA 4WVFA 4DXAA 2ZE6A 5J40A 1KMQA 2EU8A 2ZSDA 1KSGA 1KMHB 2FSHA 4EUNA 4E07A 3LXXA 2Y8EA 3BFKA 5EXSA 1GWNA 1VG0B 1G64A 1W49A 5SZJA 3T34A 1H8HD 4P32A 3SQXA 1OT3A 2R6CA 1Q1BA 2JASA 2OE2A 4Q7MB 3EPLA 1IJEA 2ZSAA 3P20A 1DARA 3EIHA 2NPFA 2O8BA 1E0KA 3GLHB 4HATA 4C0BA 5JZVA 1Q1QA 2VSFA 2FEMA 1F2UB 2Q0HA 2XSZA 3WMGA 2IF0A 2Z4SA 1FW6A 3CUEF 2RGGA 5KDDA 1JECA 3Q9LA 2C9OA 3IHWA 1NP6A 3Q7QA 4ZCMA 4A36A 2CJWA 2XX3A 3NKVA 2P5TB 2ZSBA 1MV5A 2XITA 1V5WA 4AWXA 2ZJOA 1QHHB 4Q9JA 2A5DA 4W5JA 4QNRA 5BN4A 4GSYA 1Z63A 4RSGA 1NJGA 1ZM7A 3W6NA 2JJ1A 2Z43A 4D4JA 3X1YA 1R0ZA 4LHXA 2XJ9A 3U7EB 3ZIAD 4B75A 4NYMQ 3B9PA 3KQNA 1ZCAA 1G1MA 1KK0A 1US8B 1KSFX 3LRPA 4JL8A 2FH5B 2GJ9A 2A5JA 2PBRA 3ZZUA 1B23P 1OF1A 4YXWA 1NVWQ 5DGXA 2IS6A 1ZUIA 2XAUA 1GIAA 3OIUA 3TVTA 1E9BA 5JWRA 2RHMA 2QGZA 5GJBA 2MMCA 3FHOA 4URZR 1E2HA 1MKYA 4Q48A 3GLGA 4NE2A 2AL7A 2J3EA 4TL8A 2VF7A 1BMFA 2D7CA 4UNQA 1MRSA 2WOJA 5J4KA 1Z29A 5CLQA 4KFRA 4JVLA 1Z0KA 1EX7A 5A5GA 5FOVA 3PUXA 3V00A 1N6PA 3RS2A 1LNZA 4BFXA 1G3QA 2BBOA 4ACAA 3MD0A 3UKDA 5IF9A 2H17A 1CJUC 1ZCBA 1VYVA 2NO6A 3CWZA 4FCTA 1FUKA 2GK7A 2W0MA 2J7PA 2XNDD 3AGQA 4AYXA 2ZANA 1E1QA 2O8EA 5EXXA 2DYKA 2QTFA 1OKKA 4C4PA 3BFVA 3EWSA 5CJPA 4HLCA 4K8OA 2JA1A 1AA9A 1DAMA 2BCGY 3QG1A 4BECA 3ADDA 3EZ6A 2JLWA 1H8EA 3R9IA 1E2PA 3IO5A 2QL6A 1KSHA 1P73A 1HEIA 2QTHA 2BBWA 4PSVA 1OHHD 1U8AA 1GSIA 1Z6TA 2B6HA 1U94A 2VP0A 3AF0A 4OK6A 2BJWA 3L8YA 2OLJA 4X8LA 1LW7A 3QF4B 4V0OA 4URXR 1O3YA 1DE0A 1L4YA 1G3MA 3UATA 1NBMD 1G7CA 4HI0E 4ARZB 2AFHE 4IFEA 3U7FB 2XZOA 1CIPA 2GJKA 2EFDB 3AKYA 4E03A 1C4OA 4KV9A 2IC5A 1ZUHA 5SZHB 3B1XA 4NH0A 4RD3A 1II0A 3W9YA 4BLTA 1SKYB 2C8VA 2QUZA 3AKDA 3F3YA 4LYHA 1I4DD 2QP4A 5KPJA 5FOTA 4OHWA 5JCZA 3NIBA 4TTRA 1ZIPA 1G7TA 1G41A 2FSGA 2W00A 3SHWA 1EK0A 2OILA 2WKRA 3HP1A 2FN4A 3PFIA 4OL0A 2XZLA 3SFZA 3IO3A 1ZM9A 1CRQA 4A2WA 4RZ3A 2V7QD 5JJIA 4OJQA 3BFXA 1XEWX 3CWQA 1U8ZA 3NEJA 1MO5A 3A8TA 3GMTA 4PO9A 4Q18A 1HTWA 4QM7A 3BRWD 2ZEJA 1GILA 4HUQB 3TR5A 3DKVA 5EP3A 3SS8A 4LV8B 3TK1A 1U8YA 3Q5EA 1QF9A 1TNDA 2OAP1 1D8TA 3WXMA 5CIQA 1GUAA 2IT1A 2WMOB 2P0EA 2IL1A 2UZIR 4YMWA 3SBDA 2ZJYA 3JZAA 2F9LA 1DAFA 2WVJA 3WMFA 2WWIA 3WBKA 2JDID 1G20E 1A2BA 2BEJA 2CMKA 5EUMA 2ECKA 5KHOC 2QROA 1WE2A 4M22A 4QKQA 1G8HA 4CGZA 3I5XA 2O8DB 4M1WA 2WJIA 4AC9A 3V9PA 1GG2A 4RVCA 4TLCA 3DZ8A 1PLKA 1RRFA 2V4ZA 1A4RA 4GOJA 4Q9KA 2J45A 1P3JA 4RCZA 3T12A 4B32A 5JLJA 2FPLA 2DY1A 5CJ2A 2GESA 2IYRA 1XPRA 4QBGB 4PFSA 5SZKB 4ZKDA 2BOVA 1XXHE 1W4RA 2ZRPA 4C2UA 1KI8A 4JBWA 1MO3A 1N0UA 4TL9A 5AJYA 5TVKA 1RZ3A 3AQ4A 3LWNA 4AI6A 4Q5IA 1YR9A 1EFHA 5JI2E 3AB3A 3F8TA 1D9ZA 2ZE5A 3DHWC 4JJZA 3RDPA 3PR1A 1ZNWA 1OV4A 2GCPA 2O0HA 5EQTA 2X19A 4CW7A 1FZQA 1KHTA 2CLSA 1KSJA 2HUPA 3Q72A 4BRWA 3OEHD 4QXAA 2DCUA 4WXPA 3MRSA 2QORA 3B78A 4DDTA 3MWKA 2ZE8A 4QJ5A 1CEEA 3J81k 3EWAA 5BXQC 4LJ8A 3WBJA 5IK2D 2F9MA 3FOZA 3I1FA 4P4SB 1VG8A 2KBFA 2R6DA 2RGNC 3RAPR 4P31A 3I32A 4M1OA 4Q4HB 1ZM2A 3KKPA 4C0SA 1EFUA 4HEJA 3AVTA 3ZS8A 2GXSA 2F43B 3U44B 2QAGB 1T9HA 1W7AA 1J7KA 3IDQA 1KY3A 4YMUA 1EXMA 2W0SA 2IBMA 1YVDA 2AKAB 3FMOB 5LB4A 1SVKA 5FUVA 5KDOA 4XVRA 2OCYC 5EE0A 3GQBA 2ZJ2A 3A1UA 4V0KA 3QVUA 1LV7A 1UBCA 5P21A 1XTSA 4B3BA 1OPXA 1LF5A 1DO2A 1NMYA 2CEAA 2P6UA 2ZYTX 1RRPA 1OLOA 3K0FB 2J0VA 2LCFA 2ZETA 1LB1B 1F60A 1XNJA 4XIGS 4IOJA 1K5GA 4G5GA 5CYPA 3GLFA 4ON9A 2QMOA 2W83A 4MDFA 1KJWA 3MWJA 1NLZA 4KU4A 2DFLA 2IXGA 1WQ1R 1F5NA 1KJZA 2VBCA 1S96A 1OH8A 4Q1AA 4QBIA 3NDPA 1FNMA 1WB9A 5FBVB 1N6RA 1XTRA 2PMKA 1G291 4KLNA 5FL3A 3EZ7A 4C0KA 3RS3A 4V0NA 1BIFA 2GETA 4PANA 5BN3A 1NMXA 2VP2A 2ZRCA 3THYA 2RB4A 4JZKA 2WSSA 1CJTC 4V0LA 3VR6A 4NYIQ 1N6OA 4EPRA 1P75A 3R20A 4A6PA 4LDJA 3AUXA 5UKDA 4KFTA 5HPYB 3VQTA 2PT7A 4AYWA 4EAQA 5HR5A 2C95A 3DM9B 1TF7A 3GJ5A 4P4UA 5KDLA 4A15A 4HZUA 2HLDD 2AWNA 4D4LA 4M9SA 3AVPA 5ELXA 1UFQA 3E1SA 2KI5A 2QZ4A 3UMRA 4MH0R 4EKDA 1K5DA 2BDTA 1NJFA 5C4MA 2PX0A 1YE8A 2AFIE 3TUZC 3U4QB 3GLHE 2G3YA 4I99A 3RRNA 4G3XA 3A4MA 2ZI9A 4OQNA 5EUQB 2VIIA 1VECA 4M8NE 1D2NA 2IYTA 4YLGA 1QHXA 1WBBA 4ILEA 5JHHB 1OFUX 1VG1A 3AKEA 1FQKA 2ZPTX 4G1UC 4IDOA 1G6OA 1IBRA 3THWA 5J5CA 4EJSC 4D82A 5JMTA 4A6XA 2EFCB 4LYJA 2FPMA 2XSZD 1KZGB 1W0KA 3NTUA 1SQ5A 1YRAA 1NVVR 3NHAA 1ZRHA 2OO7A 1VTKA 3QXSA 1H8HA 4TSFA 4RFSB 1EGAA 4I1SA 3EASA 3SQWA 1ESMA 4MGYR 2MSEB 3BC1A 5L3VA 2G0NA 2BM1A 1KI1A 2YWHA 4K81B 2RGAA 1EFCA 2W6IA 3PXGA 4Q21A 4DLZA 3RS5A 1CF4A 5KSOA 2GCNA 1IHUA 1Z2AA 4MRPA 3OAAD 3AF3A 1VG9B 2P5SA 5F9HA 2MSCB 1BYUA 3GLHA 4GRAA 2F1IA 1SVIA 1KO8A 3ETLA 3RSOA 2CVHA 3FMPB 4JVSB 1E2IA 2QE7D 3W90A 5B2ZA 4IXNA 4NCKA 3TVDA 1UEIA 4MQBA 1Q57A 5F3WB 3X1XA 2RMKA 4JL6A 4TSFD 2JLRA 2ZS9A 1T3LA 3U3JA 1CBUA 1HQYE 2IXFA 1DO0A 4PO8A 5FTNA 4D6PA 421PA 1U9IC 3TW8B 1F2TA 1B0UA 2ODBA 2WV9A 2UZ3A 1NN1A 3K0EA 5L3RA 4DCVA 3UPUA 4IJMA 2YNMA 4BFWA 4NL4H 1TEXA 3VKHA 1HURA 1KY2A 1Z8FA 2VEDA 4D0LB 2ZU6A 1YU9A 1CJMA 1TUIA 4DDWA 2C77A 1KOFA 1AN0A 2BCJQ 2K5UA 4CIDA 4BEBA 5J4LA 1RFLA 2XGJA 4YMSA 4MYUA 2AR7A 2REOA 1W46A 5B30A 2WWYA 4TLEA 4NYJQ 2VLIA 2HCJB 5C4GB 4GDFA 1BMFD 3K8YA 3B13B 3KJEA 2NPIA 4R9UC 4QBFA 2Q9AA 1GITA 4L4UA 3TAUA 4IOMA 2GZAA 4II7A 2JJ8A 4QOSA 4L5BA 1CP2A 4D80A 3TH5A 1TPZA 2IYZA 3R8FA 4C7OA 2WKQA 4BLRA 4ZV4A 4ASUD 4FMCF 2WWWA 3FKSA 2F3TA 2VP4A 2KWIA 2HF8A 2WAXA 2OXRA 3R7WB 4Q4JB 2JCSA 3MUFA 4Z54A 4DB2A 1SULA 4Q9LA 1UPTA 3X1DA 4M0LA 3TSWA 2GWHA 2JATA 2O8FA 1KI9A 3IHLA 4PX9A 3I4LA 2OLKA 1DAEA 1JJ7A 4IEIA 5FTJA 1KO1A 2WBLC 3P27A 2ZTSA 4GZLA 2OSBA 5ANRB 1G5PA 1XD2B 1LS6A 4A1FA 2OFWA 5FOXA 4PSKA 2IWHA 2BMDA 2CL7X 2CHVA 4I81A 1DAKA 3OESA 4NDZA 3A58B 3NC0C 4V02A 4Y0AA 3BS4A 1W48A 4CVNA 4F92B 2EYUA 3OE7D 3EIQA 4EPVA 4Q02A 3SEAA 4ZCLA 3T1TA 4B76A 2O8CB 1JI0A 1XBTA 2ZRBA 2YYZA 3U44A 2A5FA 2ZVQX 1G18A 2C2HA 4MKHA 4US2R 5JECA 3GLIB 2FFAA 4KI0A 3K0FA 3T06B 5CM8B 4URWR 3SU8A 2VH5R 821PA 4BLPA 3THXB 2NZJA 2WM9B 3LNCA 3PUVA 4LUCA 4OI4A 5A0FA 4B3FX 2E1RA 1E0JA 2VHCA 1E32A 1EFTA 5FL7D 4BRUA 1IN7A 1MO4A 2G1JA 1OIWA 1YZUA 4IVPA 5CYOA 2V3CC 3KFVA 4LOAA 1S3SA 1FMLA 2EFGA 2EWVA 3K9LA 3ASYA 5HTKA 1E4VA 3CR8A 3GP8A 1X1SA 4R98A 5FUYA 3GLIA 2OESA 3R7WA 1IY0A 2VA8A 2ZRHA 3C4JA 4QGHA 2ONKA 4CYMA 3U7HB 2ZIAA 4B2PA 5JRZA 1F6BA 5TMPA 1DG3A 1SVOA 5DH9A 4TQAA 4HSEA 3CRVA 4KODA 4ESHA 1COWD 4IRUB 1U9IA 2EYQA 5HE9A 3O8BA 2FZLA 1DVRA 1TQ4A 3ZQJA 3B1ZA 4ZDJA 1LFDB 5EJEA 4BFUA 2Q3MA 8OHMA 2CVFA 4NBSA 3NDBB 4FWTA 3GPLA 4MDEA 2D2FA 3RANA 2V1UA 4YQFA 3L82B 2ZJZA 3IEUA 1E98A 5HKKD 1U0JA 2QMEA 2ZI5A 1NG1A 3AP2A 2CHGA 1XMJA 3QKTA 2FMXA 1T5LA 2ORVA 2FG5A 4EFMA 3CM0A 4B35A 4F7WA 1M2OB 3EAQA 2BMJA 3EZFA 1P61B 2UVQA 4NZYA 3OEHA 2YC2C 5EP2A 1VHTA 3CX7A 2ZRJA 1G8GA 3T5DA 1OYYA 4XH9B 3LDAA 4AK9A 4JLNA 1IN5A 4M21A 2P6NA 2BJVA 3QY0A 5JBQA 3RVBA 2Q21A 3LVQE 4DDUA 3KTAB 3KJIA 3EPHA 3RRYA 1J70A 4BGDA 4XSHA 3AUYA 2XTZA 3M4YA 3ZQ6A 1E2FA 3P1JA 1CJKC 2H5EA 4UNRA 4PC3A 1HT2E 4RZ2A 1LY1A 3E70C 1U99A 2R6AA 3HR8A 2HXSA 3WP0A 1GFIA 1MRNA 4FCWA 1G6HA 3AVUA 3UMFA 4WAUA 2Q3HA 3QSYA 1S3GA 2FGKA 4WA7A 1FUUA 5DN6D 1KNQA 1F2TB 4F38A 4A4DA 3TNFA 2O0JA 2IYYA 3CONA 1FPMA 4P3YA 1IXZA 2GEVA 2N1BA 4PQFA 4M1KA 4DCNA 2C03A 1XB2A 5FTKA 3UANA 4X8MA 2ORWA 4TMXA 2WTUA 1QVRA 3QXHA 4PAOA 4WZ6A 5DIFA 2ANCA 2CLCX 5CM9C 3TW4A 3RNLA 2ODEA 1G5RA 3ND8A 3TKLA 5TDHA 4M1TA 1OXXK 4LBVA 4DLVA 3GJ6A 5E7JA 5JS7A 1IXSB 1YZLA 4XSGA 1W2GA 3DZDA 3TIFA 5GJVC 4XD7A 1XDBA 5LDDC 4IEEA 1JXMA 5KO2A 1A82A 4B6FA 3W6PA 2ZUBA 5H68A 1SKYE 4C9BA 3SR0A 1FP6A 2GVDC 3C5HA 1MH1A 4QHTA 3HU3A 1G21E 3I5YA 4Q1FA 2G83A 1Z6XA 3EPKA 2QN6A 3RRMA 3SYNA 1W47A 4PZYA 1JPNA 3GJ7A 1G5TA 2XNSA 4D0GA 2W2XA 1QG2A 1N6IA 2HV8A 3AVXA 1XD9A 1HYQA 2IYXA 1KI2A 3HDTA 4LBZA 3C5CA 3QE0A 3ZZ0A 1PVOA 5IK2A 4LHZA 2Q9CA 5L8VA 4B3DA 4U00A 3AKCA 3OFND 4RD4A 5JHGB 3GLGE 1R5OA 2CBZA 4WOPA 4A0GA 3WP1B 1RYFA 1ZC3A 3CRRA 4AIIA 1ZVQA 1VCMA 3EARA 1Q22A 1OXVA 3AGPA 1XEXB 1Z0DA 1UDWA 2KBEA 1NSTA 4QJ3A 1MO6A 1YR8A 1VCNA 3ZGXA 3AVVA 4DVGA 3HJNA 1CR0A 1XJ0A 3KL4A 2KSQA 1NI3A 2BKUA 4OQXA 3B60A 4NU0A 2F3RA 3WMEA 4RD6A 3CRMA 3HU2A 4WZBE 1C9KA 4WZAE 4DWJA 2RGXA 5KOYA 1CRPA 1ZINA 3ZYCA 2OAQ1 3HYTA 2QAGC 3P32A 3ECCA 1T6NA 1JAIA 1X3SA 4LI0A 3OIYA 4C3ZA 2MSDB 3IKJA 4B2LA 1W0JA 1P60A 4QGFA 5FOWA 1P7CA 3DOFA 1KAGA 2QM7A 3KKMA 3QOFA 4HZIA 4XVUA 4A2PA 3IPYA 1TEVA 2WOOA 4HDQB 3REGA 2BHRA 2FFBA 2ZS8A 3BOSA 4DT1B 4JBYA 3SN6A 2R8RA 1W4AA 2EW1A 4B3GA 1E94E 4POAA 2WJJA 1CXZA 4C2TA 3GLFB 2ZYWX 3PUWA 3CRW1 2CJWB 3QPUA 2UKDA 3SYKA 3CPEA 2ZYUX 4MUBA 2HYDA 3IEVA 1D5CA 4O25A 4A2QA 4BFSA 1KI6A 4F4JA 2GAOA 4GMDA 3ND9A 1X8JA 3QKSA 4NONA 3FHCB 5JRJA 1KYIA 4LYAA 3I61A 5IHPA 3QBVA 5FBLB 1Q20A 3MLEA 4MYCA 4JLAA 3RS0A 3K0SA 4Q9IA 1N5KA 1E9SA 1Z6YA 3LH5A 1E9AA 2RHDA 3LV8A 4L9SA 4JLKA 5FTMA 3WHKA 2GXAA 2A2ZA 2AXPA 3ONWA 2GEDA 3FWYA 1I2MA 4A0RA 3NHBA 1JEDA 3DVLA 4IVRA 2V9PA 2QE7A 3ZD7A 1DAIA 3TGPA 5J4YA 3H1TA 1RE0A 1JXOA 1KI3A 1PLLA 2HLDA 4OQFA 3TE6A 2CCJA 1CR2A 2J0QA 2FFHA 5DI3B 4DB4A 1L8QA 1HY3A 1N3BA 1ZD8A 3UWOA 4LRWA 3AF2A 1T4GA 4TL6A 5HCNA 5L3QA 1VYTA 3WY9A 4BE7B 2O8EB 4G0NA 1KK1A 4Q00A 2ERYA 4M2LA 2HT6A 4ZIRB 2WSMA 4TYQA 4WW0A 2JLVA 4GI7A 3H0KA 4FMCB 1OFIA 3MFYA 4P33A 4Q1DA 4BLOA 5E3HA 2REBA 2GJSA 2ZJAA 2J0UB 3E2IA 3QI2A 4PHHA 2IW3A 1M1YE 3DMDA 4OHYA 2Q6TA 1Z0JA 2GF0A 3GJXC 3TSOA 1TU4A 3AP3A 4MKFA 3PEYA 1G4UR 2YC4C 1HQCA 1J8YF 5FFMA 3X1ZA 3RHFA 3KX2A 4W7SA 3ZVNA 3W6OA 4HUQA 3KB2A 4GL2A 1YHNA 3F0TA 4C0LA 1PLJA 2GZHA 2WZQA 1ETUA 1H65A 4BFTA 5C46F 1S2MA 4LJ9A 4NKRA 2N46A 4JLDA 5DI9A 2ZREA 3OE7A 4X8HA 4NMMA 3HYRA 3EIEA 4YDHB 3EW9A 4ZI3A 4LWZA 1FNNA 1QHSA 3CKLA 2GA8A 4GPTA 2BEKA 2D4HA 2JLSA 2EWWA 1UF9A 4LBYA 5FPKA 4B3CA 2F1JA 4TLBA 1D6JA 1N5IA 2IYWA 1TF5A 3C8UA 2O8DA 1Z2CA 2PCLA 1P4SA 2VHTA 2H92A 4Q19A 1XZPA 1MOZA 2ZROA 3NEYA 2JGNA 3GCGA 2LKCA 2IK8A 2O8BB 1Z47A 1KNXA 2QA5A 4E09A 721PA 4LZZA 3KUDA 3DDCA 1KO7A 2XTMA 3X2SA 4YMVA 2FSFA 3LW8A 4NYJR 1X8LA 2NG1A 4B71A 3U2QA 5JCPA 2Z5FA 1KMHA 1RRGA 1UJ2A 4IOLA 4Q03A 3FHTA 3CNOA 4M1MA 1MABB 3ZVRA 2R6GA 1MR3F 5IT5A 1EG7A 2GNOA 4PC6A 3BE4A 2WMNB 3C16C 5FH9A 1GL7A 2L0XA 1OIVA 1OW3B 4JT2A 3CNNA 3GJ4A 4WIAA 1CR1A 2ZUDA 1JQJC 3FYHA 1ZJ6A 3GFTA 2WAYA 1NF3A 3FTQA 4QM6A 4ZO4A 4D0NA 5FL7A 3CPJB 3D8BA 2J9RA 2YJTD 4IXMA 5JWHA 4LJAA 1R6BX 4JLOA 3UG7A 1E96A 4PQYA 2IF2A 3S1AB 1E1QD 1GP2A 3C14C 4PHFA 3M6AA 5GVSA 4OYHA 3EZ9A 1KJYA 3REFA 1OKKD 2ZJ5A 3SC3A 1TUEA 3ZZTA 2ZITA 4M1YA 3B9QA 5G3ZA 4OBEA 4DRZA 1IOZA 3W5JA 4Q7KA 3QKRA 1N0WA 2Z6VA 1OB5A 1U2RA 1H8ED 1GNQA 1HUQA 1ELOA 2ZQ5A 4UJ5A 1P62B 2NO9A 4KITB 1OHHA 2A9KA 4IDQA 5FTLA 3V4RA 1A7JA 3KXLA 1JQLB 3VR2A 1SVSA 3PG5A 4PXAA 1P2UA 1IN8A 1T3HA 2IYLD 4LJ5A 1JR6A 2VTKA 1LTQA 2OV2A 4M53A 5IRCD 1ANKA 3U3RA 2QRZA 1DEKA 3W8NA 3D31A 3WRXC 4B33A 2GVZC 1E9DA 2I1VB 3VR1A 4DT1A 2BV3A 2YWGA 2JJ1D 4TTQA 5C2JB 2J41A 5CLLA 2JLUA 1R7RA 3H84A 1QHNA 4DZZA 4P4SA 1DS6A 2BBSA 4D26A 2PEYA 3LAWA 1NBMA 1E2KA 1VYUA 2D3WA 4LPSA 5G53C 5B58C 4FMBB 1UM8A 2QENA 5DHFA 3VR3A 3NC1C 4DCTA 3UIEA 1W1WA 3WRYC 2KE5A 4HUTA 4OHZA 4FXPA 1IONA 5FPHA 4CT5A 1OJLA 5L3SA 5LPNA 2NZ8A 2FDCA 4LHYA 1R0WA 2A78A 3CX6A 3GEIA 4N1AA 4WXRA 5DO9A 5FUXA 2J5XA 3MGCA 1D2EA 4NYIR 4PTLA 4QGAA 2GHIA 4PPGA 2O52A 1TF2A 1VKJA 5KPDA 3V4FA 1MT0A 3QXJA 1G7RA 4GMXA 2WIAA 3QEOA 1KTVA 4H1UA 1UADA 4PZZA 2F43A 1RC8A 3VNUA 2J7PD 2QAGA 1ZNZA 3U61B 4DC9A 4TYNA 3EX7C 2DB3A 2E9SA 4PSAA 621PA 4RCYA 2FEOA 1CS4C 4EPXA 2NQ2C 3B7GA 3KUCA 1E2NA 1SVLA 2WJYA 3ICEA 1S1MA 3LLMA 4DLRA 3VX4A 2RGDA 2W6JA 2FZ4A 4HDOB 4EFLA 3U60B 2Q3FA 3GJ8A 2HYIC 1AIPA 5JS8A 1M74A 1DELA 2CK3A 3OFNA 1ZM4A 1VPLA 2ZRFA 4TTPA 1P9NA 3CBQA 5GJCA 2ATXA 4RZXA 5CDFA 3RS7A 2JLQA 2YWFA 1NRJB 3VU9A 1XTKA 2QPTA 4LV5B 1UAAA 2VQSA 4H1VA 1BS1A 3C41J 5G40A 4I1VA 2WWGA 3EA5A 1YR6A 1M7BA 5GADl 1E2MA 1XTQA 2GAAA 4J0QA 3BH0A 3RS4A 3LXRA 4ZDKA 2OBNA 4MA4A 5KSZA 2FPKA 1E69A 1PV4A 1FFHA 1ZBDA 2CL6X 1M34E 1UKYA 1YQTA 1QHIA 3GFPA 4U02A 121PA 4IOKA 3MWLA 1UDXA 1VDZA 4JKYA 1ZD9A 4KCGA 1II8A 3NWJA 4XJXA 1N6LA 4HLQB 5TARA 5AUPB 2TMKA 4AKHA 4JLVA 3PEWA 4LV6A 1N6HA 3Q8XB 2HJGA 2ZAOA 4Q1BA 2YKGA 2H7VA 4NCNA 2PLRA
chains in the Genus database with same CATH superfamily
2J9ZB 2W2OA 2ZU0C 3ADKA 5EFZA 2AG6A 1P72A 1Z6GA 4P5DA 3IB6A 2W4QA 1SIWA 4L72A 4ND3A 4OAPA 4URVR 4Z3OA 5FWDA 3NTOA 5I7AA 4B3MB 2Q1SA 2GTPA 4IDNA 1Q0PA 4WOCA 4XE5A 3RYIA 3K0CC 4MV7A 5G4LA 3U4MA 1KDVA 3Q2KA 1Q91A 2GKSA 2C3YA 3NNSA 4G9BA 5FOUA 2OD9A 3AERB 5FPYA 2PG3A 1N5JA 4ZOAA 5C18A 5EZ6B 1BA3A 4LTNA 2NTYC 2O3JA 4ZRDA 3T3NA 3DV0A 3O47A 1YRBA 1M5UA 1WUKS 5E9JA 4N47A 3QELA 2ZBVA 4PIVA 4PAQA 4A2CA 5IBRA 3T1VA 1W581 1Y42X 1M34B 2FY8A 2RHLA 3T6KA 1E6KA 1EFRD 3WR5A 3SS7X 1Z5PA 4POOA 2VRCD 1SCUA 1XEXA 3G5UA 3VVMA 3LDHA 1QGAA 3CEJA 4R1SA 1XCMA 2Q1XA 2F3PA 3MBKA 4N9WA 1DAOA 4FUQA 1QOPB 4DTCA 1P4HA 3N2EA 1QSGA 1R0XA 3BTOA 3Q4GA 4CCAA 1EXDA 1H6DA 4C3VA 1JUDA 1PEAA 3P9NA 4HQ6A 4XR9A 1HE8B 1U65A 3F2IA 3A0RB 3ZY2A 1NSYA 2VTVA 3ZD6A 4GMGA 3CG0A 5KQMA 2QUKA 3LU1A 3WBFA 4XQCA 3V80A 1ZL2A 3CB2A 1P1KA 4HBZA 1NWCA 5CGQB 1F8UA 1MD9A 4D3ZA 3IAM6 2FP3A 3VOAA 3QXXA 3U4DA 1L5LA 1RJWA 4LCJA 3FOFC 1RJDA 3GZJA 3IAFA 2F8MA 3MJDA 2BUAA 2C2MA 2NN3C 3PGA1 2Z95A 1EJ6A 4JASB 4LYGA 2RAUA 4M9QA 4ALNA 3IQWA 3PC8A 2W37A 1T8SA 2H29A 1P1BA 4I50A 3GLIE 3DT6A 3A70A 4LW8A 1OH6A 3G2OA 4FC7A 3DDHA 3IODA 3QIAA 3MWGA 1W36C 4NJMB 4OX9B 4Y7CA 5CVVA 2OZEA 3DNMA 3RYIB 4KH0A 1YI1A 1UJMA 4FZJA 3KAQA 4YRMA 1QK5A 3OFKA 3LKZA 3QZUA 2OG2A 1FRFS 3AP1A 2OV1A 1GHTA 5IAKA 5BSGA 1NXXA 3E5RA 3GNTA 9LDBA 4GVPA 3IMEA 4KO8A 1W2HA 1D2MA 2JZOA 2IP4A 1Z6AA 4Y2JA 2HK7A 2XCQA 5ULLA 3C7KA 1MXHA 3I05A 1P1RA 2P62A 4PC2A 1LNQA 3QKRB 1E2GA 4QQFA 4S2EA 4UD6A 1KRHA 1L5KA 1E2EA 1VE7A 4E5PA 2X8AA 3NFYA 1SXJD 3O21A 4CEJA 1NV8A 3U4QA 1MX9A 1R4NB 2I2BA 2B20A 1ZU5A 4X63A 1D3AA 2QT0A 4F4IA 4Z53A 3OX4A 4IGFA 4CM5A 2RARA 1FP2A 2P9JA 1NHWA 1FU4A 1BEZA 3KAPA 4RVOA 3UMBA 3DFIA 3FZNA 4INAA 4IKEA 3K09C 3MJRA 3VH3A 1U2ZA 2Y1WA 4U7JA 2ANBA 1AUVA 4IXWA 1PWZA 1U3DA 5K3OA 1ZGGA 1T2NA 4NU6A 3QA9A 1VKNA 2VO1A 4OV6B 5LA6F 3UBMA 3ZY5A 1XJWA 5DI3A 1J2JA 4EFNA 2ZRMA 3AEKA 2CHFA 2X42A 3ITKA 5KYNA 1G60A 4XVQA 2IKSA 3FYUB 4ZQBA 3VPGA 1JWAB 1LPOA 5CT6A 4CUKA 5B7QA 1M8PA 3TRFA 4QT4A 4FM9A 1Q16A 3K9NA 4NCXA 3NATA 2CNBA 4GWLA 4U7HA 4DM4A 3D8HA 1ZAYA 2LIPA 3DONA 1OASA 2CDNA 5HTOA 1R0YA 5KOJB 2QTBA 3GLFE 1DIBA 2WB4A 2ZBDA 4UNNA 1C1DB 4M1SA 3PFFA 1EUCA 1RXCA 5FA6A 4DLLA 3WVNA 4ENTA 4ESVA 5KTYA 1YZTA 5EERA 1AZTA 4HGRA 4BS9A 1RBZA 1CY8A 3SZRA 3KYJB 4G8JA 3AB7A 4ES6A 5E1MA 2D5IA 3H5VA 4DFDA 4EMUA 6NULA 3LBNA 3A1VA 2NYUA 1A8QA 1Q6YA 1WOYA 4DPLA 3H2SA 1UIRA 3RF6A 1J1UA 1S3IA 1T91A 2R65A 1TZ2A 4O1IA 4PZEA 2DHQA 3INGA 3BPSA 1NASA 1P2SA 4QFMA 4ARUA 4D9FA 1Y3HA 2J87A 2BTQA 4NYMR 4CR7A 4AXBA 1J90A 1F20A 1S1CA 2QSUA 2OD2A 1KE2A 5AJWA 4DY4A 1VXRA 4UM7A 2DQZA 2SKCA 2HA2A 2BGJA 3IIEA 4E2XA 3FKSD 4OXRA 4RFSA 4U2CA 3ZJTA 3MPUA 1KDRA 2HV9A 2OQRA 3Q1KA 3SJZA 3I72A 3HXOA 3FZGA 1MLDA 2XDWA 4PX5A 2OHGA 3LKBA 3KETA 1AGXA 1J2TA 1NIPA 1JLLB 3OWHA 3B1YA 4DIBA 1M2KA 5FPPA 3WK5A 3HJHA 3BD6A 2H2DA 5BW6B 3QNUA 4TYWA 5EMMA 1QVAA 2J09A 3IPXA 4DUZB 1EAMA 4HB4A 4ZVSA 4CFSA 5A5FA 1A9TA 2VJCA 3LX6A 4Y2HA 3C3JA 3SZGA 1IM2A 4ZCSA 4BB9A 3NFRA 2FFQA 2VHXA 2ZE7A 4TWZA 3FPJA 1GGJA 5SYMA 2RHWA 2FWMX 4WOBA 4KIJA 2VA9A 2Q3LA 2OHFA 3BXZA 3CZMA 1A2OA 3FDFA 4P92A 4AFNA 1P7PA 1S4MA 2B99A 5DU2A 2UYOA 3D5TA 5G0VA 4YJ3A 4FNOA 4OB6A 3HUUA 3UGTA 5J47A 1TCAA 5CVEA 3N7AA 1HRKA 2RSLA 3S27A 4F45A 1I3CA 1YZYA 3BJIC 3HJRA 1AHHA 3KUXA 3ASUA 4F46A 3PUYA 3ZV6A 3KVVA 4CQMD 4EKIA 3KKOA 1X2EA 1FLVA 2IOFK 2FB9A 2IHKA 1E3MA 1T5IA 4U3JB 1MO2A 2ZT7A 4MW5A 2AXNA 4MO9A 3LCRA 5E4TA 2P3QA 5C8YF 2LZ0A 2FPIA 1GG8A 4DSNA 3KTFA 2FJ0A 3GY0A 4MKZA 1DDIA 2WZCA 4M89A 2BE9A 3KYDB 2ZBFA 1NYTA 1EX6A 3LIIA 1PV2A 2ZOSA 3LMKA 1X1AA 4KPGA 4O2LA 1U2GC 1GCGA 4JYCA 2XWQA 5ALGA 1KK2A 3CCBA 3EGCA 4IF4A 2QTRA 4UFNA 1JU3A 4ZV7A 3AR5A 1Z4OA 2HRCA 2P4SA 2X23A 5K51A 3ZE0B 4EYEA 5H4GA 3KLNA 1EDZA 1JMVA 4L0CA 1U81A 3GBVA 3HB0A 2QW1A 3OEWA 2A88A 3E9QA 4R16A 3UJCA 2Z6AA 2H06A 3L0ZA 2C3OA 3MCAA 2DCMA 3A2MA 4FQ8A 1GTJ1 4B3JA 2W2VA 2AHRA 2AOTB 2PX2A 1LVGA 3GVCA 3BXXA 3KQPA 3PRJA 3VR2D 1RQGA 2GXQA 4B4UA 1N32B 1P1FA 1HTTA 1NXVA 2W2KB 4GZ6A 1UPBA 1PG2A 5F7JA 4PC7A 1QYXA 3A28A 3O3OB 2C98A 5FUWA 3FCOA 2NUTB 3UYKA 1OVGA 3B9BA 5DLEA 5HYVA 4LN1A 3L7DA 1JLKA 3F5SA 1JB9A 5BQ5A 3OKAA 1CRWG 1E7MA 3I4FA 1QZZA 2R7LA 3MINA 4OLAA 4HG2A 1Z06A 2GCOB 3R5XA 4G97A 4BPRA 1BHJA 3DEFA 3Q3CA 1RVDA 2O4CA 1XPJA 3A6EA 2ID9A 3GAMA 5LQSA 2JD2A 4OB8A 1CYDA 5A6SA 2D6FA 1KFEB 2IYFA 3LKDA 1SHJA 2X2OA 3MTQA 3GMIA 1BX1A 3BIXA 2F1KA 4H60A 2YOHA 1G5IA 1G7SA 1DOAA 3HQ4O 1CPYA 1OYWA 3PP8A 2QMYA 5AHXA 2PR2A 1YZQA 3ENVA 3V1MA 1JDVA 3VR5D 3ZJVA 3B6ZA 5G4KB 2BBTA 5BRNA 2I8CA 1MZVA 3I73A 4KSBA 3DKIA 3OKFA 1NNSA 4IIUA 2AN5A 2IYOA 3JZMA 1MOPA 2QL7A 1OX6A 3CSSA 3FNIA 4BNHA 2E2WA 2H2GA 2XUOA 3C5VA 3GN2A 3UB3A 1RQLA 2B36A 4CM6A 2C5LA 1MJFA 3UAXA 4K6HA 3USCS 1W2WB 3JQ8B 3MMPA 3D6TB 3GX1A 1M7GA 1PW5A 2XQIA 2GZDA 5DBOA 1XHLA 3MG9A 1SRQA 2GYWA 3O6VA 3KDPA 3SJBA 5IDYA 3EC1A 1IIBA 4OXQA 3IESA 4C7VA 1C3EA 4IDEA 3Q11A 1GPMA 3KOMA 4GNKA 4IYRA 3VKWA 5HZHA 4LZOA 3D6UA 1ZX1A 2X77A 1MVOA 5K6RA 4TN1A 5KBYA 1JR3E 4FQ7A 3IDFA 4LE2A 3TTTA 1LBIA 4DLAA 4UTRA 1TFUA 3G0HA 1V4BA 1JHDA 1WPQA 1Y4SA 2EJCA 4MLCA 3AOEA 2GHQA 2R1TB 4IHKA 3S7TA 4KLAA 4XIIA 3UM9A 1CUSA 4HAVA 3THWA 1WP9A 3MMZA 3AEZA 1JPVA 3GL9A 5K3DA 1PVDA 2XYQA 2X1VA 3NT2A 4FWIB 5CFNA 3LPMA 2ZTUA 3UC5A 2QTGA 2QLMA 5LD2C 1D8AA 3VTZA 3WIOA 3P97A 2B5WA 5B3KA 4R0VA 2PH5A 3L05A 4KXWA 5IBPA 5TSDA 2KQUA 3C7CB 3UO8B 4M8SA 4BEVA 1I0LA 4JSYA 3GGCA 3N5CA 2HDWA 2CJXA 1Z3CA 1F8XA 4MP3A 1GV0A 1GAEO 2TS1A 1KJJA 3NYIA 5CMLA 5AR1A 4J03A 5FP0A 3MT8A 3QYAA 4G2TA 4CGYA 5DTMA 2C97A 4DLBA 4RADA 4RF5A 2HF2A 3EY9A 3K9HA 1F4PA 5CIYA 3LGSA 3AT1A 4ZPXA 3WKBA 4OJMX 4Q39A 2COKA 1UFKA 2PJZA 3K4HA 4KVAA 4KMMA 1NI4B 2F4VB 5F2EA 4AY2A 4MTLA 3ZCVA 5D3MA 2MOKA 3SJUA 4D2IA 1XSEA 2ZVPX 3B12A 5JSQA 1YR7A 4XJTA 4BMCA 1MNQA 2VATA 2CXPA 1N78A 3ZW7A 1GPUA 1T34A 4DC0A 5BMOA 3SBXA 4YMHA 3RABA 1QO9A 3KVNA 4US1R 1QO0A 4NZZA 3PGKA 3CNEA 3FYDA 4MQFA 2Z4RA 4KXUA 2WWXA 4F91B 3JCZA 2ZI4A 2Y0DA 5K2MA 3HA2A 1U6KA 3O82A 3CF4A 3B36A 3QMVA 4FGWA 4WXHA 3TTXA 1L5QA 3P96A 5CR9A 1DV1A 4J1TC 3OCJA 4DE5A 3M0EA 4CI0B 2PV7A 4E4RA 1Z4JA 2JEOA 5D84A 1DEOA 1U8XX 1M5RA 1NZJA 4W99A 4RIEA 1QX3A 2RHRA 4L0DA 4XDZA 5EP4A 4JEMA 2LE0A 3AG5A 4LISA 4EPTA 3IEPA 5J23A 4TPKA 5DMXA 4FINA 4A0FA 2HHHB 3HBFA 2NIPA 3EZXA 3O8OB 3KKNA 4JCOA 2XT6A 5H1YA 2I2DA 3AHCA 1OOEA 2AK3A 3ME5A 3OZRA 2V98A 5EIAA 5JLAA 3SX4A 4DEYA 3NALA 2HI0A 3MHTA 3VBCA 3ROXA 2HNBA 1UPAA 2IA5A 3G1UA 5KTRA 1M75A 1KMIY 5F9MA 5TGZA 2BFDB 3G8BA 4B43A 5BYKA 4D8WA 2GBFA 2VHQA 3E3MA 2WICA 4F3YA 4Z2AA 2O3RA 1FLAA 4XDYA 5L95A 3VZSA 3T1QA 4LAFA 1OFTA 1K6MA 4G36A 4TRRA 3AZOA 4ETMA 2MR5A 2G6BA 4BWYA 1DG9A 2QVBA 5IAGA 4PHGA 3L4KA 3C5EA 2NZ2A 1GNRA 5T4FA 4CUJA 3EVNA 1TKCA 2R3SA 4UNSA 5LBIA 3K0AA 1PU2A 1GQFA 3O4JA 4FBGA 4WK0B 3IC5A 3DEJA 3PIDA 3L1UA 5B1SA 1PNVA 1QNFA 4D9HA 2WTBA 4O29A 9LDTA 1NDUA 2FEPA 4YCSA 4ZYVA 1P0MA 1OZGA 4KXYA 4ZQEA 3TMKA 3PNSA 4OFBA 4CEIA 2D3TA 2PQMA 1G3IA 3KLOA 3S7ZA 2Y1XA 4RYDA 4I9HA 3ZDZB 2FUKA 3QU4A 1E89A 3SZOA 4ZDWA 1BGWA 1ADBA 3D3QA 5DHUA 4AN1A 3ZX5A 5IFLA 3LQQA 3VR6D 2VOJA 1WV1A 3LUCA 1VDMA 4QBHA 4US0R 3W5SA 4R1TA 2JJ2A 3C1TA 1B2RA 2FF7A 3K9GA 4YMGA 1PK7A 2X9QA 2HQOA 2GBLC 2LUOA 1TT5B 3WKEA 3SJAA 1WMBA 5AKJA 4F21A 5HGJA 4F8JA 2QT1A 3D54D 4HJXA 1N2IA 3RVLA 1RYHA 3S99A 4D4KA 1JZSA 3F6PA 1LDGA 3GLUA 4OA5A 1RMTA 4MLZA 2JGDB 4QYWA 9ATCA 2ZIVB 1R10A 1SQSA 2FRXA 2IHTA 4I3FA 3EQ9A 2F6RA 1PSZA 4IUYA 3RIGA 1E92A 2ZB3A 4MUYA 1NF9A 2WAMA 4QUDA 4JDUA 1Q77A 3H3JA 1C2YA 1O57A 1Y3DE 3LPDA 3EHEA 4TT3A 1G59A 4OX9Y 1L1FA 2BMAA 3RC7A 2VYVA 2WIBA 3V7YA 3FNBA 2AOXA 2XMZA 4MZXA 5BPHA 1NZDA 2SKDA 3P7MA 5IVKA 3CF4G 5FB3A 4Z4EA 3R5SA 2DPYA 3QUQA 2AQKA 4GXNA 2XNJA 1DC8A 1U1CA 2WJ6A 4JJ6A 3RIYA 4KYVA 4G4SO 3CLUD 1H9CA 4BBJA 4E1AA 5BWBA 2O2XA 3ZXUB 3QK7A 3R44A 1QIMA 4MV0A 4BKMA 4Q05A 3MXTA 2NUAB 1MF7A 1JLHA 1R6UA 2OOKA 2BRUA 1PHPA 2WPDA 4IDBA 1WEKA 2DFNA 5DOZA 1Z82A 3RREA 3O75A 3AM3A 4YK7A 5FBWB 2WQZA 4LQLA 2B8TA 5FF9A 4D9IA 1HL7A 1GNLA 5AVOA 3W6UA 1SUCA 3RAFC 4G4IA 1ZIDA 3ZE9A 4BQEA 4QUJA 6ABPA 3BIFA 3M2TA 4TMZA 4EYKA 2E5FA 1UFOA 1UKBA 3AIOA 3M7IA 4IKPA 3EOZA 4AYTA 2VK2A 3BBPA 1FP4B 3E7FA 2IQ5A 2J48A 4UU7A 5GONB 3OM0A 4AMYA 5A1JA 3KQKA 4Q4HA 4QUBA 2PSDA 4FD3A 5LA6A 5JJLA 1LX6A 1AM4D 2GPTA 3BREA 3K9CA 4HDCA 1NL3A 4QX6A 5A6SB 4ZZIA 5AW7A 5FOSA 1M7HA 4QYTA 1ZHOA 3S4YA 3ZE1B 3KXIA 3MJHA 3HKBB 2Q5OA 3ORHA 3T8YA 2PGAA 2YICA 3FNQA 4N0QA 3VH2A 4BAUA 5BN5A 3BICA 1HQKA 4EB3A 4NZPA 4RTKA 2WSBA 2XPCA 1MJHA 5DLDA 2B69A 5C7IO 3EXAA 3TBKA 2BFEA 2J3MA 4I4LA 3BMOB 5KNBD 1R0SA 4ZOLB 2HY7A 1G3UA 4IIVA 3FAKA 2C54A 3FW1A 3OLZA 3P0RA 1Q7CA 4Y67A 5JSFA 3IHTA 3WWZA 4ASUA 5K0FA 1N5DA 3WQHA 1O5OA 2HWWA 2OEPA 5GMOA 5U1PA 1FFDA 1GAXA 1BQ4A 2B34A 1F0KA 1QVWA 2E4ZA 3IDZA 3QU9A 1R4MB 1O6BA 2O2DA 3OLWA 4NBUA 5EXPA 3NBQA 4ER6A 1O08A 5HHTA 4N3CA 1DBSA 3T35A 5I01A 5AQEA 2JARA 3EFHA 4XQGA 3WQSB 3O4IA 4P2GA 2Q7XA 5JEDA 2OGUA 3HEAA 4JXZA 3LC0A 2CB9A 1ZDMA 5DW0A 1ESCA 3IKMB 4M60A 3EQ8A 4C04A 2OZPA 2X5NA 5A3SA 3DEYX 3MBIA 3LCVB 4C3OB 5JSHA 1EX1A 1HE5A 2G1UA 2X4LA 4JLWA 2BI7A 2RC5A 2IXDA 3K4PA 3QOWA 4O4JB 1GPBA 1SKUA 1KZYC 5EE9A 1Z0IA 3OZEA 3EIWA 1WKVA 4FFBB 3KK0A 4QSHA 1MV8A 4L4ZA 4ZN6A 1P0CA 3S28A 4W9MC 1GRCA 2WINI 3GPDG 2AOVA 1XT6A 1Y63A 2Z1MA 3C85A 2I6GA 4P35A 1Y98A 1DCFA 4YRZA 3F2VA 1P4AA 2Y1GA 4JA2A 5AK0A 1S9DA 3HFGA 3TQRA 5G1PA 1CF2O 1BJRE 2AI1A 3I9LA 1EEHA 3IQXA 2IXEA 1ZRNA 2GEJA 2I29A 2IEYA 3QMMA 4JI1B 2V5AA 1A69A 4DQ0A 4HNTA 3BJZA 4MJLA 4D41A 3C3AA 3RFTA 1KI7A 2OC4A 2QBYA 3PR2B 1FTSA 3GFVA 3SKXA 1CY1A 3GRCA 4NMXB 3TLAA 2H1LA 4RETA 1R27A 4DMUB 1Z0FA 1XJCA 5DULA 1XZHA 3JVUA 3SIRA 1UM9A 1MJGA 3LXMA 1UBEA 3F9IA 2PX6A 2E4UA 1CUHA 1NBME 2WJPA 1ZGJA 3GXOA 3QPDA 1SXIA 4KBGA 1WXQA 2VDMB 1DWQA 2IDJA 5DE3A 1YC5A 2Q29A 2V4UA 3KKZA 1ZW6A 4B74A 1TJYA 3QITA 1X42A 2Q5HA 3BVPA 2O7RA 3DFUA 3FFAA 3HA5A 5E95A 4AMGA 3VSCA 3W1EA 5ALVA 1FJ2A 5ADVA 4ZYXA 3ZNQA 2I6TA 1U7OA 5A06A 3M89A 3M5PA 3CNBA 4Q4AB 1V3QE 1RU3A 2ZIWB 2H9IA 3OUZA 3R5TA 4NATA 1MQ9A 4LDNA 3X1WA 3NKLA 5BQOA 1IQUA 2LP4Y 3OUTA 1C5KA 1LRKA 1RC0A 3PGMA 3HXPA 3Q40A 1JHYA 4XB2A 5ITSA 1ZD4A 3GJ0A 2XCTB 3GQBB 4JD5A 1YV9A 4OHXA 4LCBA 3TSAA 1C1DA 2V7QA 4HGOA 3AM5A 4OK3A 4XWKA 5TT0A 3KJGA 4YP9A 3QLUA 2O8FB 1IYZA 3PNYA 4L6IA 2P9EA 4NOMA 2GYVA 5IXSA 1U8EA 4Z99A 4DMRA 3GJ3A 4GSKA 4DSZA 2J0SA 1DWUA 4M55A 1YFJA 1E77A 3ADBA 1Z18A 3HCRA 1V4VA 3TTVA 3WRVA 1U3FA 3CZQA 4YDRA 3IJEB 3Q3HA 2MT9A 3IUQA 1FX0A 1QTQA 1Y3CE 3N05A 1U31A 1VJDA 5B7NA 1UJCA 1NN0A 1WMSA 1XCBA 3AW8A 4X6YA 1JAHA 5THQA 4H6XA 3ZH9B 4BMOB 2IYUA 1P1JA 3LY5A 2O7NA 5IBCA 1NXPA 5ES3A 1N1DA 1NVMB 4URUR 2I3BA 4IRMA 3ZNNA 1C30B 2IW1A 3EDMA 2CNKA 4HLUC 4K88A 1JRLA 2HB6A 4UU0A 1AK1A 3M6IA 2QBYB 2ZSKA 2RH5A 2M9MA 5DHAA 1SQGA 3OETA 5KHLB 2F8SA 1ZD1A 4H3HB 3K5IA 2XQKA 5DLPA 3CO5A 2R2AA 5TV2A 3MTDA 1JT9A 1ATZA 4ZDIA 5HZMA 1NYLA 1RIIA 2QW8A 3AERA 3DXFA 1DMRA 1IHXA 3JU3A 1B41A 5DSZA 1JJFA 3FUVA 3GJRA 2E55A 3QVVA 2JLCA 2JIRA 2NSJA 4G8BA 3ZHSA 1LU9A 4Y1RA 4OU4A 3SEQA 4IF6A 3PQ3A 2IHNA 4TVBA 1M6EX 4EG4A 4K05A 1UBTS 2C4TA 4TV8B 5KAMA 4F1KA 3GMSA 2P35A 4W7HA 3UNXA 4YONB 4DARA 5I48A 2XB2A 1K8QA 3KXKA 1I4LD 1POXA 2AH5A 2RG7A 3DHVA 3E7WA 2CK3D 2Q46A 4N8EA 4RY8A 4PZLA 3UWPA 4ZO6A 4GT1A 3RRFA 4E5DA 1QOQB 2IGTA 3WGKA 4KE7A 3CVUA 1M83A 2BMFA 3I6BA 4JDPA 3DL0A 3KM0A 3LLVA 4XQ0A 5H82A 4EECA 3O1JC 5CK5A 3AI2A 1S2NA 1FJHA 3CNHA 3ZHCA 2WWHA 4Y6SA 3ABIA 3CPHA 2PKWA 1ORDA 2ZFUA 3BGDA 3N8DA 3PQ7A 4LZWA 1XLVA 2XB8A 4QPDA 3F3SA 1KKMA 3IXMA 3WLPA 1ECFA 1II9A 2HBYA 2X7HA 1DRJA 4G0ZA 1PQYA 4KGVA 3FWHA 2LCIA 4C7BA 3AV3A 3MSCA 4LOLA 2BF4A 5DISB 3H9CA 5DYIA 2VHUA 1U4OA 4Z8XA 4WBXC 3KNZA 5FBQB 3MF4A 3Q9NA 3O2JA 1GQRA 3HS3A 1TI7A 5ICMA 4C0QC 4QVIA 4O2AB 4TV9A 3LYAA 4O4LB 2C2GA 3WHLA 4DV3B 5KZMB 3ORFA 5HIJA 2ONZA 4PZDA 3WNCA 1T2EA 2QPOA 4K6GA 1LBHA 4QHSA 4UJ3A 3ANXA 3ZKWA 2ORIA 3ECSA 3T15A 2DOKA 2P8JA 5A1TA 4L8GA 2ZPAA 5JAQA 1NVKA 3JYPA 1EUCB 1NAHA 4CIWA 3A6GA 1E8DA 1IN1A 1O8BA 1C1XB 4KQEA 3AK4A 4XX0A 2VZEA 3VMFA 3RRJA 4DRYA 1QCDA 2EFHB 3L8EA 3QGMA 5AHRA 5DTJA 4EUKA 1MA3A 3TB4A 1VE1A 3V8RA 3SICE 4CFZA 1LJ8A 1UXIA 2EW2A 4B48A 5CB4A 5CBPA 3EG9B 4QUAA 1CJVC 3NIFB 1SXJB 3OJCA 5SZIA 2YFQA 1ZU4A 2OB2A 2BP7A 3U4IA 4GOLD 4HAYA 3PNLA 4LXGA 3ZYZA 4JVOA 3AM4A 2P78A 3TSZA 4C6HA 1RKQA 2QPLA 3GYBA 2HF9A 2QXUA 3RODA 3RU7A 4C4SA 2GJAA 4D3SA 4BUCA 3D5EA 2I3ZA 1TPYA 4BNLA 2FEKA 4X1KA 4EX7A 4KAXA 2FQXA 2D7DA 2G70A 5B3LA 1B43A 2XDAA 4RLHA 4C05A 1V2HE 2VBGA 4Y8VA 1KYTA 1MB3A 4IW3B 3V8MA 5ADHA 4M9UA 5J2UF 2RGBA 3GWZA 1Y5NA 2R2GA 1M0SA 4B45A 2PANA 2PMEA 1E9EA 3JR7A 3SE0A 1KO5A 1QKKA 2ZXEA 4FD2A 4H7JA 3BXGA 3OJLA 4FBLA 4FCVA 5F73A 3TCKA 4OQDA 1UWKA 1TADA 1Z08A 4BNUA 2ET6A 5ALYA 3EMBA 3DQPA 4CF6A 4RY0A 3C2QA 1GQQA 2RJOA 4D9CA 3DDZX 1KKLA 1KS9A 2B8WA 3DD5A 5EIBC 3IMCA 4L6CA 4ENVA 4OH7A 5A4JA 4ZI2A 1KBQA 1L4EA 2J7KA 2CBGA 2PCJA 1PDWA 4YP1A 3RR2A 3ZI7A 4ZIRA 2NO5A 3DDOA 3M2PA 4PHTA 3RC3A 1DFHA 3C74A 3K0CA 4Y1GA 4I9UA 1RPJA 3D4LA 3PNVA 2Y0BA 4KG7A 4PZUA 4JIMA 3D7NA 3BK7A 3PXDA 2JIQA 1I5EA 1SXJC 3E27A 4PQRA 4XEUA 4QRHA 4D9NA 1RBQA 2I4RA 3FGOA 1CLUA 3MJCA 1QDUA 5F76A 4X1YA 2JGDA 4JLPA 4S24A 1E99A 3SNHA 2QLLA 5DM70 1PZEA 1XMIA 4FOOA 4YXFA 3AF6A 4CM7A 1XPOA 3NTLA 2JH9A 5AJHA 4TMTA 4EJMA 5AVYA 3B3GA 3PD7A 3I12A 4N6OA 1NVGA 1MAVA 2YXPX 5FV7A 3SDZA 2JIZA 1HGXA 4MR8B 1YJQA 3OTIA 3PHCA 5DK6A 1QTNA 4REQA 1Y8QA 2AXEA 4MWSA 3THSA 4A0HA 1VRCA 2C84A 3PL5A 5LBTA 3Q12A 4MXDA 1IWOA 1ECCA 1PZHA 3CW9A 4O2BA 2E1PA 2HRQA 1SAYA 4BFLA 5KWJA 1Q0RA 1CEXA 3Q3JB 1U11A 3PQCA 4TWAA 4A8HA 3PLNA 2ATCA 4FFNA 1GR0A 4JKIA 1ZITA 4OOEA 2Q6LA 1SXGA 3B51X 2P3SA 1O54A 4C4XA 3UEOA 3ZEAA 3O8DA 1RWMA 2HIGA 5L7WA 4NARA 1R88A 3P2KA 2IYEA 3VV2A 5TQVA 4M54A 4Q4AA 2A9VA 3R77A 3UWKA 2BWJA 4C03A 2PT9A 1LV8A 5DBGA 3ENZA 3NBUA 3AR7A 4QDTA 1VJTA 3OQVA 4KXLA 1M0WA 5CA0A 3GAZA 1BVUA 3THOA 1TO2E 4CETA 3AHJA 4GWGA 3C70A 4AN4A 3LUFA 2C2KA 4O6VA 3SMQA 1R9JA 2O7VA 1V43A 3EQZA 4I1IA 2BGTA 1FNSA 4EABA 2UZ1B 2ZR0A 4GOXA 1C81A 2NVBA 5JRDS 3WK8A 1EWKA 4AECA 4B6JA 2GWRA 2GFHA 4DCSA 5FR2A 3K1YA 1A8HA 5C51B 3TLJA 4IO0A 4RHTA 3O93A 1PFKA 3WICA 4DXDA 2EU8A 1L1RA 4R8KA 5SY4A 1WIWA 3ZD9A 1QGDA 3EXHB 3FH0A 1KSGA 3U7GA 4E07A 3OZBA 4B3SB 2Y8EA 1GWNA 1W49A 1Z25A 3H04A 4HGYA 2HRDA 1H8HD 3O8OA 2R6CA 1BRMA 3D6HA 1F06A 1K5HA 5KMGA 2JASA 3R09A 1R3DA 2OE2A 3EPLA 2RKBA 1B26A 5K05A 1K92A 1DARA 2R5NA 1DTEA 4EB8A 3LTNC 3CW8X 2GPNA 4CWAA 2O59A 1DRKA 1VBMA 1SK9A 3FVVA 3PXAA 1F2UB 3NANA 2XSZA 4GXTA 3S44A 3B52X 3IP6A 7GPBA 5LQDA 3SQDA 3OC0A 2P2GA 1J25A 1JECA 1F0NA 1SD1A 1XP5A 4Q3BA 4UTPA 4A36A 1KEVA 3NKVA 1DC3A 3MUOA 3QPBA 4P22A 5CBKA 2Y71A 4W5JA 3AJDA 5JNLA 4GSYA 4PGMA 4JJGA 4PINA 1RZUA 4HY3A 3MOGA 4RNCA 2HCFA 3W6NA 1T5SA 3BWBA 5ELXA 4D4JA 5COBA 4NU8X 4TXMA 1D0VA 3UOAB 2C1EA 3MK31 3U7EB 2EKQA 4D8XA 1CZHA 3CGWA 1RTTA 2PBLA 3WOHA 3VC1A 1KK0A 5EXEA 4JL8A 4E5VA 1BVRA 1I0IA 1JPUA 1CLEA 2A5JA 2FH5B 3EXIB 3HB1A 5REQA 1XA3A 4ID9A 4J16A 3WXBA 4DA9A 1KY4A 1DB3A 4MV9A 3W2TA 4EG6A 4H16A 4EARA 3GC6A 1QRDA 5L4LA 2V7PA 5IT4A 3VYUB 1TDJA 4UEJA 2IS6A 3MT0A 1GIAA 3B7WA 1R0KA 2RHMA 5JH7A 6LDHA 1YA8A 1RWKA 1V2GA 1X9HA 4TL8A 3QVOA 4OFXA 3H97A 3HSKA 2IZ5A 1M5TA 3B9RA 4J0GA 1KH3A 1Z0KA 3U1VA 1LD3A 3OE4A 3V00A 2ZATA 4OSEA 4BFXA 3UKDA 3RRXA 2YVKA 1J9EA 1RP1A 1RWOA 2J9GA 1VYVA 3R7LA 4YJ2B 2HKIA 4EW6A 1SNYA 3L7NA 1URPA 3AGQA 3DTVD 4B17A 3FZEA 2FPRA 1TTHA 2ZANA 3H16A 4EHDA 1ISSA 2PIAA 1B8PA 1HKHA 3PC8C 3PQ6A 3ICOA 5BUSA 2DYKA 3HY6A 3GUZA 3IH5A 1X70A 4RZIA 2JANA 2VPQA 4UU8A 2COUA 4OYLA 1PR6A 4Y7DA 2QTFA 3N0TA 3OMXA 4DL9A 3FNRA 3PI7A 3VGPA 3BFVA 3A9SA 3KOUA 1JN0A 2JA1A 2Q3DA 1DAMA 2BCGY 2EDAA 2PV0A 3W04A 4AB1A 3ADDA 2I6QA 3FD8A 4N0MA 3JWJA 3R9IA 2EQAA 3D0RA 3D1JA 1UP4A 3H11B 2FX2A 4HEHA 3RTCA 1Q6ZA 1O0BA 1KQNA 4N6NA 2PWAA 2BBWA 2ZUVA 4PSVA 1WB5A 2E4AA 2O0MA 2ODAA 5DTEA 5AOAA 3H9GA 1ZOIA 3DXZA 3B20A 4YCNA 1A7AA 2VYQA 1V9LA 3R4CA 5F51A 3WA6A 1NPYA 4NMWA 3LQ4A 3QF4B 4MJ7A 4URXR 1RBMA 1XTTA 4MRMA 4HNSA 3LQFA 3UATA 1CDZA 1NBMD 3K8QA 3RV3A 4ARZB 1CJSA 2FWJA 3AL3A 1RM3A 3BMNB 2C7OA 4YV2A 3I23A 5IMSA 1CIPA 2I71A 2EFDB 5TRTA 4E03A 1C4OA 1MDBA 2CMDA 2GMWA 1ZUHA 5L45A 2J5KA 4Y6QA 2POQX 1AZWA 1SKYB 2C8VA 3LQ1A 3LSYA 1JQ5A 2CXNA 5HFNA 5JD6A 3RTAA 1FSGA 3K2IA 4QATA 4FK8A 1NRXA 2NV2B 1SQFA 4TTRA 3A4IA 1QGOA 3LHFA 3FJYA 4HLNA 4D8VA 4BC1A 2R1VA 4F04A 2M6RA 4WVLA 2RAVA 2OILA 1VYHA 2CWWA 1C9YA 3HP1A 3KHSA 5I7SA 2AYYA 4G24A 5KX5F 3C87A 2QTVA 1ZM9A 3FPGA 1RE1A 3UW3A 4A2WA 3RUIA 1XLWA 4D1YA 4KBYA 1WCYA 1XEWX 1VPTA 3P9ZA 3GMTA 2E4WA 3MHPA 1KH2A 3ENKA 2RH4A 3NEPX 3E81A 3HCCA 3EDOA 1SH7A 3I64A 2O2CA 3BRWD 2ZEJA 4HUQB 3DT9A 3NWOA 5LYJF 2VHWA 3JQCA 5D7BA 5EP3A 5JMPA 5A4FS 3CJTA 4LOKA 4U2FA 5DP1A 1QF9A 1XMXA 1D8TA 4DRXB 5IKOA 1XNGA 3KG2A 1ZKMA 2IT1A 2WMOB 3ED5A 3ORRA 4H1TA 2GI4A 4J75A 3V97A 1WD5A 4IQ4A 2E5WA 2GNAA 2WDPA 1XK7A 3U09A 3SBDA 1WHTB 5EWMA 2IODA 2ZJYA 3UZUA 4EA9A 1DAFA 1JHZA 5A0VA 2Q1UA 2WWIA 5K3FB 4EW1A 1DUIA 1WDLA 1ZGAA 4H3KB 4LEIA 2BEJA 3IUJA 5EUMA 2WNIA 4B6GA 3O31A 2YQZA 5FHRA 1LEHA 1RT9A 1KEUA 4PGGA 4CGZA 3SX2A 1WXGA 1ZSVA 3FYSA 5H9VA 1NLMA 4IICA 1VLJA 1NV9A 2DT8A 3E9EA 2FETA 4RPKA 5DNUA 2UZ1A 4DNPA 2G7ZA 3EY4A 1BAPA 1A88A 4GOJA 3OC6A 1LPPA 2V7VA 4F8EA 5KX5A 2VC2B 1N7IA 2GOYA 4IDCA 4MS3B 3T12A 3UJDA 1QIKA 5JLJA 4A6EA 5CEJA 5CJ2A 3VYSB 4AP5A 4QFDA 1C2TA 4RHFA 4QBGB 1MB4A 4E21A 1O58A 3I5MA 4K6CA 1WU7A 3TQTA 5TQ2A 4ZKDA 4OPMA 5JNVA 5MHTA 2N47A 3USES 1XQ6A 2P11A 3R6GA 5DX8A 1A1SA 3LPCA 4RA9B 1RXIA 2AI2A 2IDZA 3MS4A 1NVBA 1OI2A 4TL9A 5DYYA 4CM4B 1XDUA 2RBEA 4AI6A 3W4IA 1X2BA 1NF2A 1M6VA 2FZGA 1MEEA 1YR9A 4PZPA 3ISTA 1P0FA 5HVNA 3DHWC 3ZWWA 3IE0A 3RDPA 3Q7SA 2GCPA 1OV4A 4CW7A 2YHAA 3PK0A 2CLSA 1KSJA 1FDIA 2HUPA 3DLAA 4RL6A 5JAMA 3G2NA 2DCUA 3U7QB 4UE2A 3B78A 3L84A 2AQIA 4QJ5A 3SQOA 4FFVA 4U5QA 1YS1X 3LHIA 4JI4B 1XRLA 2MSWA 1OWPA 5LKAA 1QVZA 3PWSA 4ZXPA 1DLIA 3I6ZA 4P31A 1WUJS 3WB2A 4RNDB 3A10A 4ZYTA 1SZDA 3DWFA 1JU9A 5J58A 4RWZA 2GXSA 2QTLA 2OC9A