1CLUA

H-ras complexed with diaminobenzophenone-beta,gamma-imido-gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
160
Chain Sequence
b'MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Guanosine triphosphatase stimulation of oncogenic Ras mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cluA00
5K8UA 1H65A 1Q3TA 1JR6A 2ZSAA 2FFAA 1GRRA 4Q1DA 3VTKA 4Q9LA 3C16C 3ICEA 2IYSA 1KDRA 2QI9C 2ZANA 5LD2C 1FUKA 2ZI7A 1D9XA 1OV4A 2A78A 2BV3A 2F43B 4IEEA 4P4SA 4IOKA 4C0QC 4RFSA 2E87A 2GBLC 4A8JA 1FZQA 1U0JA 3I1FA 4JL8A 1SZPA 3SEAA 4POAA 2QEQA 1LS1A 1ZM9A 1KI4A 4HSEA 2LCFA 2W2XA 3RAPR 1H8HD 3DPUA 5DI3B 5FR2A 5JBQA 3K8YA 4HEJA 4TL6A 1FX0A 3U44B 1TUEA 4PX9A 4G0NA 4PC2A 2B7BA 2G88A 4TQAA 5LBIA 3FE2A 1YZTA 5CM9C 3U3RA 1NJGA 2KSQA 821PA 3FFAA 3GFTA 4JT2A 4XVQA 1OIXA 4FWTA 4OK6A 1SVKA 4IVPA 1GL9B 2ZRIA 3B9QA 3BWDD 3K0AA 3P20A 1N5KA 2VSOA 1II8B 1ZUNB 1E2DA 4WZBE 4EPYA 1W2HA 1E2NA 1OFUX 5J4LA 4YMSA 2MMGA 3UIEA 2QM8A 3PXGA 1CJUC 1W46A 3IHWA 4B6FA 2LKDA 1IN7A 3AP2A 1Z6YA 2JLQA 4ILEA 3TKLA 3PEYA 2I1VB 2IYUA 2V7QA 2REXB 3BGWA 5H1YA 4IHQA 3WP0A 1E4YA 4GMXA 4HLQB 1TF2A 1HEIA 1NKTA 1Z83A 2J3EA 1YVDA 3W90A 1E9EA 2C8VA 1Z2CA 2I1QA 3KDSE 3JZAA 1GP2A 5B2ZA 1KDPA 2FPKA 3IBGA 2ZR9A 1M6NA 1CBUA 2ZRGA 3FWYA 1XMSA 1BH2A 2GJSA 2GK6A 4EPWA 3OEHD 4IXMA 1SVSA 1Z28A 5JHHB 4QM6A 1YZLA 3B8HA 5CB6A 2NOAA 2IYRA 3W3AA 3U3KA 4DRZA 5FTKA 3AV0B 1Q1BA 5FTMA 3TW8B 1Q44A 1S4QA 2RMKA 2FNAA 4M1YA 1ZNZA 2FN4A 1XZPA 1R0ZA 2OXRA 2QRZA 4KU4A 4P3YA 3NC0C 2WZQA 5P21A 1OT3A 2GXSA 2ZI6A 1MABA 1I2MA 2ASEA 2ZQ5A 4B71A 1DEKA 4I1VA 2C03A 4LK2A 3U2QA 4DSTA 1L4UA 1BIFA 1WP9A 3LO5A 4YMWA 3K0FA 5SZHB 3EPKA 1O87A 3H2YA 4KCGA 5E7JA 3T1OA 3MAAC 1UEIA 4PHTA 4DBLC 3HPQA 4CW7A 1Z8FA 4P4TA 2OHFA 4LJ8A 2MMCA 4XSGA 2GVZC 1XPUA 4IDPA 4TTRA 2WJIA 4FCVA 5JECA 2O0HA 5FUVA 4LCBA 4M1SA 3UANA 4JS0A 3CIOA 1VDZA 2REBA 2ZVPX 1JJVA 1NF3A 3MWKA 4MUBA 4FMCB 4I1OA 4XSHA 3U3MA 4RD4A 3A1UA 1WBBA 1WMSA 2YOHA 4UJ5A 4Q4AB 4BLPA 2H17A 1N3BA 4CZ2A 1JR3D 2IYYA 1F3OA 2WJYA 4DIEA 2FFQA 4TSFD 1US8A 4D0LB 4MITA 1IXZA 4LC1A 1II9A 1VG8A 2F6RA 3LRPA 4NYJQ 2WAXA 3AKYA 3TGPA 4FN5A 3E2IA 2G9NA 3WYFA 4LPSA 3PJRA 2ZS8A 3EW9A 2WIBA 1S0UA 2GHIA 4M22A 2O0KA 1QRAA 1JXOA 2AKAB 4Z1MA 3OHMA 1SKQA 5CDFE 1GOTA 2CL7X 3OESA 5J4KA 3K70D 1N25A 4AYTA 1DTSA 2J0VA 1G18A 2ZE8A 4IVRA 2JLWA 2GJ8A 3WXMA 3GJ3A 1YU9A 3FOZA 4B2LA 2BJWA 2EYUA 3QF4B 3QJYA 5KNBA 1E2LA 1RYFA 4P33A 2R44A 1I2DA 4DIDA 3A1TA 1AKYA 2F43A 2IW3A 4DVGA 1G5PA 1GIAA 4ASUA 2O5VA 1XJCA 4HB4A 3C41J 4NONA 5LD2B 4AKHA 3K0CC 1A82A 3CRW1 3RLFA 2HDNB 1CKEA 2QP4A 4HB2A 1NSFA 1K6MA 3AQ4A 3DMNA 3GLGE 1WCV1 2W83A 3THXB 3Q9LA 2X2EA 4JSTA 4Y0AA 5DI3A 3TUZC 3U3OA 4I99A 1D2NA 3PUYA 3U44A 3U3JA 2CEAA 4LBWA 1IN6A 1OB2A 2ZI9A 1RRFA 5FFMA 3IIMA 4C0JA 1M7BA 3PG5A 4B44A 5J5CA 1N6LA 2IYTA 3QENA 3K0SA 1P6XA 3OIVA 4N0DA 1S1CA 4K81B 2G83A 5EUMA 5H70A 1II8A 2FOLA 2ECKA 4LHWA 2RAPA 4PZLA 2ZPTX 1KMHB 1GG2A 3R20A 3CR7A 4B3BA 2GCPA 5HE8A 3SJCA 2AK3A 4HDQB 4EJSC 2RKOA 4AYXA 3ADCA 3ADDA 3IKJA 2WIAA 3RC3A 2ZSBA 3BAFA 1UDWA 4LYAA 4AKEA 2BEKA 1HQYE 5KPJA 3AVUA 4JKIA 3PQCA 1ZNXA 2RHMA 2ZI3A 3AGQA 1R0XA 3GJ6A 3QVUA 4XOIA 1W44A 2DB3A 3GEIA 4NTZA 1UJ2A 1T3LA 3K09A 1KJWA 1N6IA 1W0JA 4X8MA 1TEVA 2WJJA 2FDCA 2YJTD 4JLBA 3P4XA 1N5IA 4MRRA 4TLCA 5JWHA 1NVVR 4ZPXA 3RSLA 4TMWA 3VNUA 2OM2A 5TB5A 3VR5A 2X2FA 1W4RA 2KBFA 3EZ9A 1P2SA 5TMPA 1OH5A 3FMIA 4XWOA 1Z08A 3VX3A 2A5DA 2IA5A 2QY9A 1KYIA 1W36C 2ZXUA 4V02A 2D62A 1EFCA 1MO4A 2VP0A 3CX7A 4Q18A 4Q9JA 4D2IA 2C77A 2GETA 1WA5A 4OJKA 4B75A 4TL9A 1JECA 4HI0E 4JLNA 4Q7KA 2W00A 2XGJA 2ZJYA 1NSTA 3T35A 1YRBA 5BWMA 1HTWA 5EE0A 5J4YA 3GLIE 4TMZA 2J7PD 1ZCAA 2BBTA 2BM0A 4Q19A 2PLFA 3VR2A 3QUSA 1U8AA 3CBQA 3B1YA 5FH9A 2OCAA 5HZHA 4EFNA 2X8AA 2A9KA 5FL3A 4V0ME 1Z07A 3GCGA 4WZAE 4DLSA 2RCNA 1ZU4A 1G4UR 1UKEA 3MMPA 1IONA 1CIPA 1ZNYA 3LW7A 4OHZA 3WMEA 4TMVA 1YZGA 3RHFA 1EX7A 1JAHA 4Q1CA 1R5OA 3BFVA 2ZJ8A 3U7GA 1PUJA 5EE9A 3TH5A 1KK3A 3NWJA 2GCOB 1EWQA 1LY1A 5IK2A 4OBEA 4WVFA 1N6NA 1M74A 1P73A 5G53C 5K8LA 1XJ0A 3JVVA 4Q02A 1TTTA 4PR0A 1C9KA 1MO5A 1SVLA 1TF7A 5IHPA 4HAYA 1U90A 4FXPA 4Z51A 3KJEA 4AYWA 2WMNB 2H92A 3QF4A 1DAFA 4V0NA 1S96A 4BLQA 4A8JC 1W0JD 3KKMA 4G5OA 1D2MA 1QG4A 2JJ1D 5H68A 4M0LA 1DG3A 3TBKA 1QHSA 1PUIA 4AURA 4QBHA 2WWXA 1NVUQ 3T06B 3FB4A 4PO9A 2YINC 2NO0A 2HYIC 5L3VA 3FMFA 5D3MB 5BXQC 3N2IA 4LYFA 3ASZA 1W5SA 4BPBA 4M53A 3AVPA 4Q47A 3WP1B 4MYHA 1JALA 2R2AA 1B0UA 1G3IA 3THXA 2OBMA 4QM7A 4DLVA 1NI3A 2Q3FA 5KU1A 3O8RA 3BERA 2TMKA 5B57C 2NZJA 4GOJA 3BORA 4JVLA 5CYOA 3ZVRA 2NQ2C 1CR2A 4UNQA 4CF7A 3KL4A 2XEXA 4LHYA 1KDTA 4OL0A 2ZJZA 5BYJA 1U99A 3GLHE 1OXUA 2BBSA 3FTQA 1V43A 4BEJA 1CJTC 4H1VA 2EFGA 3C14C 2ZJBA 2ZSEA 1XXHE 3HP1A 3LXRA 3PEUA 2J46A 2ANCA 1KMHA 2QROA 4DCNA 2G1KA 3LLMA 1C4OA 1FQJA 3BXZA 3MJHA 4M8NE 4BFTA 2Q3MA 2WJHA 4QFMA 2C5LA 1KSGA 1KAGA 4QBIA 1FMLA 4QNRA 3U6KA 4HUQB 4GOXA 3NBZC 4N3NA 3O8CA 3R9WA 4JJZA 1OHHA 4PPQA 4CVNA 1N6HA 3B6EA 3A4NA 2D06A 1UPTA 4MDEA 3PV0A 4C9BA 4EAQA 4XTRA 3EX7C 4CT5A 4XD7A 1KO8A 4FCTA 5EP1A 1N6PA 4QL3A 2D3WA 4L9WA 1IBRA 1VPLA 2YWHA 1AQUA 1KJZA 1UADA 1Y3AA 2ZU0C 5EQTA 1G17A 3THWB 2O8BB 2SHKA 1JBKA 2ZYUX 2VF8A 2FMXA 4LBYA 1MO3A 2J9RA 4MKIA 1S3SA 4QBGB 1Z63A 3DMDA 5HZKA 2BBOA 4Q9HA 1ZBDA 1LFDB 1AGPA 1J7KA 3UK6A 4ESVA 4XH9B 2O52A 5A5GA 3UMRA 3P27A 1ZAKA 3ZYCA 3IEVA 2D2FA 1FQKA 1PLJA 1G3MA 2R6CA 5TDHA 4DJTA 2ZITA 3KZ1E 4L4UA 1SVWA 1NLFA 2W6IA 3KXIA 3DKVA 1COWD 3MRSA 2F3RA 3AVOA 1G5RA 1GRNA 4F4CA 4NCKA 4GZLA 1RRGA 3S1AB 1BMFA 1N5JA 1IN4A 3FDIA 3PR1A 3L0SA 2VIIA 4PAQA 3CRQA 2Q9CA 4PSAA 4ZO4A 1OIWA 2XTZA 3CRVA 3KJHA 4Q1EA 1OB5A 4W5WA 1Q1QA 2G3YA 1OH6A 1E9BA 4BFUA 4X8LA 2PJZA 3RVBA 2NO7A 2ZE7A 2C95A 4QNMA 3PUXA 1KKMA 4MKHA 3NBYC 3KUDA 5FL7A 1F60A 2GKSA 2G6BA 3L2OB 4CDGA 2QZ4A 2R8RA 1KSFX 2PZFA 4AKIA 2V55B 1PLLA 1Q22A 1Z2AA 1UKYA 3EPJA 2GCOA 1RKBA 1FUUA 5F9HA 2DPXA 2EVWX 3NEYA 4DKXA 121PA 5K8IA 2AWNA 2QENA 1R8QA 2FFBA 2XTMA 2BEJA 3B13B 2QMOA 4AY2A 3GEHA 2JA1A 3I62A 5DYIA 1G4AE 2RGDA 5DE3A 1TL7C 1U8ZA 2GEVA 5AJVB 4I1SA 2OT3B 3IO3A 1AM4D 1LF0A 4BFVA 2JAQA 4YLGA 1P61B 1QHGA 2ZREA 5FOWA 1R8SA 2W0SA 3OAAA 5D3MA 4IRUB 1LNZA 3ZJYA 2ZI5A 3K0CA 4KITB 1G6OA 5KO2A 3R7WB 4C4PA 4ZI2A 2BCJQ 4F4JA 3OFND 4ZKDA 1R7RA 2OXCA 2KJQA 3SZRA 1KI3A 3NHAA 2F55A 3WNBA 5IRCD 4JBYA 5FI0B 3TSWA 5B64A 4NE2A 3W5IA 3LX8A 4RKFA 2HT6A 1Z06A 4LJ6A 4OHYA 3AKCA 2XTNA 2QT1A 2B7CA 1NN3A 3EPHA 2F9MA 1E2IA 4Z8YA 1CS4C 1T5LA 4KYIB 1N0VC 4LJ9A 4ZCLA 2ZYWX 3P4YA 2HCBA 1Z6AA 4EPTA 4QGHA 2Z0MA 3VHXA 1PZNA 1AKEA 2OFXA 4C0KA 5JHGB 3CH4B 4HUQA 4E03A 3K09C 1ZC4A 3LVQE 1W7AA 2BMDA 4JKYA 4QJ3A 3K70B 4HAWA 4AKGA 1UBGA 3MD0A 3HR8A 4C2UA 1AJEA 2BOVA 5E95A 2IYXA 3WNDA 4KO8A 3CONA 3OE7D 3CZQA 5FBRB 2XZPA 2H18A 2LKCA 2BWJA 2YVUA 2JIZD 2IXGA 2PZGA 221PA 1W4BA 2IYLD 2RGCA 3RABA 5DHAA 5J47A 3Q5DA 2O8BA 4DB4A 3THWA 1KK2A 1P7CA 4PC1A 1Y63A 2DCUA 1G9XA 4KLNA 2J0QA 1JB1A 2C78A 1S9DA 4O2RA 4TQ9A 5GVRA 3N70A 3TVTA 1DO0A 3QVVA 2J0UB 3QKSB 2OAP1 4OQFA 4EFLA 2WVJA 3BRWD 4YMVA 2EFHB 3MG9A 3KXLA 1K5DA 2A2ZA 5CLLA 1XRJA 5EP2A 4PQFA 1P9WA 2JATA 4DCTA 5DYGA 2B8TA 1J70A 2EFCB 2ZSDA 2XXAB 3IGFA 1EFHA 1NY6A 1G21E 5EZ5A 2ZROA 2CE2X 3PENA 1DELA 2WMOB 4BFYA 4EFMA 4IDQA 1XMJA 2WWFA 1UKZA 1SQ5A 2MSCB 1LF5A 3VR4A 3P26A 4BZQA 1Z0KA 4M1OA 5CLQA 4W7SA 4XVRA 4BFSA 3AVWA 1N6OA 2FEOA 3S1AA 1E4VA 1P5ZB 4YDHB 3QQ5A 2GAAA 5FPSA 1D2EA 4KV9A 1SVOA 2H1LA 4B2PA 1VIAA 2B92A 2ZRDA 3QXJA 2VHCA 3L43A 1MH1A 1W48A 1SVIA 1YR9A 1SKYB 1KO1A 2YHSA 4KI0A 5DSZA 1NMYA 1XX6A 5C46F 4B3CA 2D4HA 2VSXA 4Q5IA 1IM2A 3LA6A 5HKKD 1F5NA 4FINA 3BD9A 2GZHA 3R9IA 1YR8A 1TQ4A 3ZVMA 1H8EA 4Q03A 4C0LA 5EXSA 1KO4A 2EQBA 3GEEA 4Q21A 2AL7A 3R8FA 1SXJE 5CYPA 4NCJA 2ZRPA 2QA5A 3PUVA 3KX2A 3A1WA 2ONKA 2XITA 3OEHA 3AF0A 2EFEB 2NGRA 4QGAA 2N1BA 3ZQJA 3E1SA 4L8GA 2HCJB 1DBSA 2VBCA 4M1MA 3GLFB 3DEFA 1W4CA 2QMUA 4NCHA 1M1YE 1Q1EA 1XDBA 3AVTA 4RJLA 2N46A 2RH5A 1NBMD 2IBMA 4MDFA 2VYFA 5CJ2A 5G3YA 4TYNA 3I8XA 4B76A 1HE1C 3KB2A 4JVSB 2ERXA 1ZD9A 5JZVA 3FYHA 1AA9A 2ZIAA 1I4TD 5DISB 3GJXC 621PA 5KSZA 2IF2A 4Q4JB 1L2TA 3U7EB 1QHYA 4RD0A 1VHTA 3D7MA 4Q7MB 5KNDA 4TWZA 4B34A 4HATA 1M7GA 1U9IA 3R7WA 2C98A 4F7WA 1EX6A 2FSGA 2IEYA 2UVQA 4LHXA 4BECA 4IFBA 1OH7A 2YWFA 3EWAA 3LNCA 4ZI3A 2RGGA 4PC6A 1TU4A 2H57A 1OFHA 2QTHA 3E70C 4US1R 5L3RA 5HR5A 5IK2D 2YKGA 1ZYUA 1JXMA 3WYGA 3DOEA 4JZKA 1XFAA 1NG1A 1JR3A 4DEXA 3CNOA 4D4JA 5KYKA 1U8YA 4LX0A 2FSFA 4M21A 4TSFA 1T0HB 3CM0A 2ANBA 2F1HA 1E2EA 5AJXA 3WBKA 1RJ9B 1NMZA 4EPVA 2BKEA 3AVVA 3EARA 4GPTA 2V54A 4NYIQ 4OQMA 4EDHA 2GWHA 2GAOA 2CK3D 3SYKA 1H8ED 3ZQ6A 5JSZB 2ZAMA 2KWIA 4EPXA 1W4AA 2ZRAA 4JYBA 4PO1A 5K8TA 2IS6A 4CGZA 3D6TB 2ZETA 4G5GA 1E99A 3SFZA 1L8QA 1KK0A 2ZS9A 4KFRA 1OKKD 4IEIA 3A4MA 4AWXA 3GP8A 1WRBA 2AN9A 4D80A 2QG6A 3CWZA 4QJ5A 2WWIA 2XOKD 4QBFA 4MKGA 3J81k 1E2PA 5FUYA 4DCVA 3KTAB 5JEEA 4F38A 1FTSA 2J0UA 3QKSA 5CIQA 5EE1A 2J41A 4JLMA 4W5HA 4ACBA 5M04A 1G7RA 2PL3A 2VEDA 5FTLA 4XVUA 5TV2A 2XXAA 2D7DA 4C7OA 2FH5B 1FP7A 1HT1E 1Z6GA 1G8GA 5KSYA 3VNVA 1DAKA 3PIRA 4IOJA 1NVVQ 1E0KA 4BFWA 2DY1A 1VIYA 1G8YA 3L0IB 4NZYA 1MOZA 2IHBA 4TZ6A 1SHZA 1ZVQA 4HB0A 4EIWA 5SZJA 5TARA 5L3QB 4M1KA 1I4DD 4AIIA 2ZJ2A 3BH7A 4LV6A 2IT1A 3IQWA 3AEZA 3MWYW 3ZZ0A 5B58C 1E0SA 5FBVB 2O8DB 2FGKA 4URWR 4NYMR 2D2EA 4HYYA 2ZRBA 1XD8A 1GVNB 1QG2A 1TMKA 4IDNA 3UATA 3LV8A 4ON9A 4WA7A 1YR6A 3KQUA 4LYJA 1XCMA 5SZKB 1NLYA 2HT1A 5E3HA 1Q21A 1UDXA 2QRNA 2I3BA 5EJEA 2A5JA 3OEED 2V3CC 1EGAA 3BFKA 4MYTA 4OQXA 3RRZA 1Z0FA 3U5ZB 1CR1A 4LV8B 2F3TA 3KQNA 4HAUA 2ZU6A 3BOSA 3ADKA 3IIJA 3WHKA 2IS4A 3SQXA 2IWRA 1IHUA 2HF8A 4FMDF 1N5LA 4OK5A 1CEEA 3GLFA 1Z0DA 3W3ZB 1CRPA 1E9AA 1NY5A 1VCMA 1C1YA 4E09A 2LWIA 3RANA 3MLEA 4CEJB 1UKVY 1ZCBA 2HEIA 1U2RA 1ZC3A 4OI2A 4Y0VA 3QXSA 1E1RA 3AB3A 2C9OA 2KI5A 4GSYA 3SE0A 1GNPA 1VYTA 2QSZA 3TAUA 1IJEA 4Q4JA 4DLWA 1T6NA 2BCGY 1DAEA 2PMDA 2V9PA 1FNMA 2CLSA 2O8FB 3ZIAD 1OXSC 4MRPA 4JT4A 1CU1A 3FHTA 4WXRA 4TN1A 3Q7QA 3GJ7A 1ZJ6A 4BRWA 1QDEA 4J0QA 1N0UA 2J7PA 3ZGXA 1SGWA 4A0GA 5C18A 3NKVA 2AR7A 1TAGA 3UWKA 3M1IA 2C96A 2YC2C 4M2LA 5CITA 4JVMA 4R7ZA 1P9NA 1NVXQ 4DB2A 4BGDA 1X86B 1R5NA 5DNYB 2PT5A 3ZS9A 2EWWA 1E0AA 1E9RA 4LGMA 5CK4A 1RRCA 4HAZA 1A2BA 3QY0A 1RJ9A 1P2UA 2BC9A 4NDZA 5GJWC 1KI6B 4IVQA 5DI9A 3DHWC 2ODBA 2PZEA 4BLOA 5AUOB 4PHGA 1XCPA 1NN0A 2GNOA 4PSKA 3A1VA 4LHVA 1DAGA 5JSZA 3RS0A 1ZM7A 2PJRA 2OBNA 4IDHA 1KI8A 1OXXK 1NN1A 1X8LA 1ZM4A 1GNRA 1IOZA 4JIMA 1KO5A 5EP4A 4OHWA 1ESMA 3K1JA 4GRAA 1FMJA 4DXAA 4D0GA 2P2LA 4YMUA 4C0AC 4DCSA 1KY3A 2JJ1A 4EQ6B 3PUWA 2PH1A 5E7MA 2C9YA 1HQCA 1KGDA 3SR0A 2Z4RA 3AGPA 2WBLC 3SS8A 3B9PA 4UXIA 2QP3A 3CZPA 1P75A 1RZ3A 3MFYA 3KTAA 2Z4SA 5J4VA 4E07A 3MWLA 5FUWA 3OIYA 5FOSA 1E1RD 4P0TA 3LWNA 1VHLA 4TLBA 2DFLA 2BIFA 3KXKA 1ZD8A 3FGNA 4Z8XA 2ONJA 4DHEA 3MGCA 4ZV4A 1YHNA 5F2EA 3UMFA 4NCNA 2WSSD 2FWRA 3H1TA 3QPUA 1XTSA 2VH5R 3NVAA 5C4MA 4AG5A 1XPRA 1GRQA 2JASA 4DLUA 1Z0AA 1T8UA 1EFRD 4D4MA 1R4AA 3Q3JB 2WV9A 2GZDA 2I4IA 2JLVA 2ZYVX 4S2EA 1NKSA 2DBYA 2UKDA 5L3QA 1OXTA 2EU8A 2RGNA 4H9GA 4HB3A 4V03A 2WJGA 1CJMA 1QHIA 1VCOA 2WHXA 3I5YA 2O8DA 2FPMA 2P5SA 2WOJA 4Q4AA 1DARA 2XNSA 2P6NA 1TU3A 4TQUS 4LPKA 1P3JA 4RVCA 3U4QB 1XNJA 3X1WA 2OUKA 1NIPA 2D74A 2F9LA 2WSMA 4PHFA 1XMVA 1TADA 4IKEA 3B1WA 3K9HA 3B1VA 4D4LA 3MCAA 1Q1ZA 3W6OA 4BEBA 4LWZA 2QGZA 1UM8A 3THYB 2OLKA 1OSNA 1ZW6A 2NTYC 2BJVA 3VU9B 4KFUA 5JEDA 1YZNA 1LB1B 5CJPA 4PZZA 2GXQA 3A8TA 4TT3A 1MKYA 5FUXA 3T15A 2QBYB 1PLKA 2J5XA 3CF0A 3X1DA 2GK7A 3RS5A 3QEOA 3U6BA 5EZ6B 4CEJA 1NG9A 3AF4A 5L3SB 3F3YA 3I5XA 3KJIA 1E79D 4TMTA 4Z54A 5KHOC 1U9IC 2H16A 3CKLA 4KODA 1Z3IX 3LVRE 1F6BA 2QQ0A 2P6RA 5BN3A 5HCNA 2GZAA 1IXRC 1COWA 3V00A 3LLUA 4A82A 3SDZA 1E98A 2O8FA 2VP9A 2PCLA 2WWWA 2RGAA 2FU5C 1KI7A 3N2EA 2G1JA 3QEJA 2XSZD 3MSXA 4YMTA 2AK2A 2QT0A 3ZD6A 2YOFA 4AI6A 3OF5A 2YV5A 3QBVA 1ZP6A 2ZEJA 4ZCIA 3U60B 4WXPA 2IS2A 1WQ1R 3I73A 421PA 1P72A 2PT7A 5EE5B 3WHLA 4PHHA 3GMTA 2A7QA 3O8BA 1J90A 3I8SA 3Q72A 4C0HA 4KBFA 6Q21A 1IN8A 1CR0A 2QAJA 3TJZA 2V1XA 3Q8XB 3LQQA 2DFNA 2OILA 2QORA 2VHQA 3LD9A 3GLGB 2HLDD 4KLZA 3K70C 4ZCMA 2WJVA 4CT4B 1HT2E 1KI6A 5IF9A 3I72A 5C1BA 4HAXA 1E32A 4FCWA 4JMPA 4C3ZA 4KFSA 1XEXB 2ZSFA 2V4ZA 1JPNA 2REOA 2ORIA 2AWOA 4XWKA 3UG6A 4ARZB 3SJZA 4XTCS 5LDDC 2P67A 3LDAA 2IX3A 1CJVC 1YR7A 4O3MA 3M0EA 3BB1A 3CNLA 2QP9X 2GCNA 4BWYA 5KSOA 2FA9A 5DHFA 4URYR 4EQ6A 3IQXA 5EP3A 3GD7A 2AFIE 1JQJC 4DLXA 3W6PA 1HYQA 3K9NA 3CLVA 3U7HB 3BK7A 1KAOA 3OZXA 2O0JA 2OBLA 4TT3D 4D4KA 2R65A 1Z5ZA 4UQOA 1R6BX 3G0HA 1XTRA 4MUAA 1OH8A 1KOFA 4QHTA 2F7SA 2W6JD 3QXCA 4HLCA 5EXTA 1VMAA 5BN5A 2GF9A 3TK1A 3M4YA 3H4MA 4GMDA 3BS4A 5GADl 1M2OB 1PVOA 4HDCA 4KJZA 1JJ7A 2UZ3A 3OFNA 3KUCA 2CNWD 1SXJD 3DZ8A 3UG7A 1SHKA 4RSGA 3NIBA 4EUNA 2OESA 4D82A 2PX3A 1G16A 4D26A 2ODEA 3UKDA 1E2MA 1RYHA 3FMPB 5FBLB 3TR0A 4QOSA 4OYHA 2Z6VA 2XB2A 4Q4HB 1VTKA 1YZQA 3EIHA 4JSYA 4C0BA 2Q6TA 3SC3A 2IK8A 1N2CE 4IXNA 1LV7A 2AFHE 1S8FA 1G19A 4LUCA 5L8VA 2YOGA 2IEZA 1L7VC 4GP6A 4LJYA 4A2PA 3GJ0A 1FL9A 3CX6A 5HCIA 2IUUA 1GFIA 2JEOA 4D6PA 3THOA 3GFPA 2WPDD 4B35A 3IHLA 2VPPA 1LVGA 1QHHB 3D8BA 3BBPA 5G41A 3QOFA 3LBNA 1S1MA 4O0MA 3U4QA 4A0FA 3SBDA 5JS8A 3SJBA 1IXSB 2F1JA 2FSHA 3OIUA 5ELXA 1JNYA 3IBYA 3OE7A 3ZZUA 2ZR0A 1DOAA 3EZ6A 3PVSA 3VX4A 4MA4A 1E96A 1F48A 1B23P 2JIZA 3W6NA 3QG1A 2BHRA 3GLIB 2XB4A 3MUFA 4FI3C 3THYA 1GL7A 5CM8B 1KNXA 3RRMA 2NO6A 2PLRA 4A4DA 3NTUA 2GEUA 3VU9A 2CE7A 4M1TA 1CXZA 1S2MA 2AXPA 3WMGA 4G5SA 3PEWA 2QBYA 1JEEA 1GSIA 2FFHA 1CP2A 4QHSA 2W2VA 4B3DA 5HPYB 5KDOA 1E3MA 5JJLA 4OQLA 1BYIA 1VYUA 3KKOA 4QHYA 4B32A 4WOPA 5KNCA 2RGXA 5L3SA 3T1QA 3NEJA 4B74A 2VTKA 3SQWA 4UNRA 1CR4A 4PSVA 2VP5A 4FMCF 4OK3A 5KOYA 1RPZA 3EWSA 5CDFA 2DR3A 5JI3E 3R9XA 2OCYC 2Q9BA 3X2SA 1XMIA 1E2GA 1YRAA 1JI0A 2JLXA 1E2JA 2FPLA 5AK0A 5FOTA 4NKRA 4F4IA 3UXMA 1FPMA 3TLXA 4YDSA 1DAMA 1MRSA 2ZRHA 4BASA 2ORVA 1P2VA 4LZZA 2R6GA 4G3XA 2RGBA 3QKUA 4WIAA 1X1RA 2GVDC 3LBIA 3ZVLA 2D7CA 1QHNA 3CW2A 5HKKA 1XEWX 1NRJB 5AUQA 3AF2A 4NCIA 4UKDA 4Q1AA 2PEYA 3AF3A 3CR8A 4RCZA 5DGXA 1DPFA 3GLGA 4PPNA 4B48A 4WAUA 5TXGA 4TMKA 4YQFA 4RZUA 5JLJA 1Q57A 1XEXA 4KBGA 2OCBA 4ARZA 1A1VA 4TYQA 4BLSA 2ZVQX 3B82A 3GLHB 5BW8A 1E9DA 5AJWA 3LH5A 5H8WA 2HUPA 3REGA 1T0JB 1E2HA 3DZDA 1IY2A 1XXHB 4LC0A 1J8YF 1NBMA 3CH5A 3LBHA 1W0KA 2OFWA 1KI2A 4QKQA 4MRNA 4AC9A 2ERYA 4PANA 1GTVA 1EK0A 3GJ8A 3IILA 2PCJA 3NBFA 3F8TA 4KSCA 4YXWA 3RC8A 1F2TB 5AJYA 2FEMA 4ZDKA 3EAQA 4AD8A 1DAIA 1JAIA 4G1UC 5BYKA 4JVNA 3EZ2A 3CRMA 4A36A 3B60A 2VF7A 3VR1A 2GF0A 5FR1A 1NLZA 4A1FA 3HDTA 1P9RA 1U81A 1ZM2A 4PQRA 2JDID 2RGNC 4Q9KA 1G8PA 1LTQA 3NH6A 1CULC 4Q4HA 1DAHA 4QGFA 1E2FA 5F98A 2MSDB 3M6AA 4RZ2A 5JCZA 1QVAA 1TUIA 1XCGB 3CF6R 5ANRB 4E22A 1KIMA 2IXEA 3TQCA 1RC8A 2W2TA 2R62A 2BMEA 1AS2A 1W49A 1E1QD 1GWNA 4QGGA 1M34E 3ZLJA 1OYYA 2CK3A 5FTJA 1AIPA 3D3QA 2FV8A 5SZIA 1QHHA 1CLUA 2ZS7A 5TY0A 3T5GA 4NBSA 2XJ4A 2ATVA 3B1XA 4WZ6A 1G20E 4PAMA 1Q0UA 1HUQA 3BH0A 5FOXA 4ACAA 1VYVA 2E9SA 1OKKA 4WW0A 2OV2A 3GLIA 1EWRA 3ZDQA 3VKHA 4PO8A 3FHCB 4I1UA 4M4SA 1EESA 1S9HA 4QJ4A 4U7DA 3EA5A 2IUTA 4DEYA 2XOKA 4JLDA 3HU1A 4V0MA 1OF1A 3RS4A 4A6XA 1GKIA 2K5UA 2OO7A 2DWPA 3CNNA 3KFVA 4JLVA 4OQNA 4RD2A 4NYMQ 5JWOA 2XX3A 2IYZA 3KJGA 3ZVNA 1RVDA 2ZJ5A 1W0KD 3V4RA 2Z5FA 1NIJA 3CWQA 4DT1B 3LQRA 2XZLA 1UFQA 4LRWA 3SNHA 4B6EA 3KB1A 5GJBA 4MGIR 4YXWD 4MRSA 3EIQA 4C30A 1G8FA 3ZZTA 3C5HA 3BC1A 3AKDA 1NNEA 1UAAA 1D5CA 4E5UA 1ESNA 4O25A 2YWEA 3D31A 3TSOA 3W5JA 2CCKA 2ORWA 2C2HA 2JJ2D 2R6DA 2OSBA 521PA 3CO5A 4U00A 3TIFA 2FX3A 3HPRA 2CL6X 2OE2A 3A4LA 2HV8A 4A0RA 2YZ2A 1VG1A 2ATXA 5IT5A 4KAXA 4Q4LA 3W34A 5KTYA 2CHVA 1OXVA 4LJ7A 4X8HA 3HWSA 4HLDA 3L8ZA 3PEVA 1CTQA 2IYVA 1EFTA 4OI4A 2AD1A 2WKRA 1TQ2A 3G82C 2X77A 3LAWA 4CIDA 3L0PA 1GAJA 2PBRA 3TUIC 2CXXA 2HJGA 5E7IA 3ECCA 2OG2A 4DDVA 4R2IA 1HE8B 2BMFA 4RZXA 4JYCA 1W36D 3FHOA 1CF4A 3OEEA 4P31A 1NMXA 2NO1A 1E9CA 4LJAA 2GXAA 1OFTA 2A5FA 4F93B 1X3SA 4DDUA 2VHUA 3VKGA 5EUQB 3I61A 4QG7A 1O3YA 3GLHA 2EYQA 3B2EA 1HURA 4JBXA 2KE5A 5FBWB 1XXHA 2JLSA 4LBZA 1OFIA 4KVAA 2RB4A 5DLQC 2J7KA 2F1IA 4BQSA 4LJ5A 4U02A 1AGRA 4TL7A 5E4FA 1MV5A 5KPDA 1YJ5A 4FIDA 4IW3B 2O8CB 3OIWA 1XD2B 4BFZA 1ZIPA 1F2TA 2G77B 2V6JA 2VP4A 4B43A 4M9QA 2ZRMA 4A9AA 2Q3HA 1TQ6A 3AUYA 1ZD1A 4NHOA 3ADBA 1OE0A 1BOFA 1GKYA 4F92B 3Q85A 3ZIAA 4R71A 4QC2A 1G6HA 4PPFA 3AVQA 1J99A 2R6AA 1GILA 1KTVA 4JL5A 2OAQ1 2DFTA 2BDTA 1FP6A 3X1ZA 4DLRA 2P65A 5LB4A 4W9MC 3HYRA 1J8MF 4I81A 1R5BA 2UZIR 4LBVA 4NH0A 2ODNA 3AUXA 2E1RA 5FI1B 4U5XA 5HTKA 1TQDA 4ITRC 3WNCA 1TF5A 2J59A 4HLUA 3SHWA 1Z0JA 1MT0A 1GNQA 4ESHA 3T1VA 1XP8A 3FVQA 4L15A 4QRHA 3RWMB 3QPWA 5KSPA 3TE6A 5BQ5A 1OW3B 5EE3A 1V5WA 3FKQA 2KB0A 2C99A 3VAAA 4TYWA 3B85A 4R9UC 2B8WA 3SN6A 3BB3A 1UBEA 1XTIA 1CRQA 4DWJA 4DLTA 5BN4A 3REFA 2Q0HA 3KKQA 1IJFA 3NHBA 4US2R 2V6IA 1QVRA 2IL1A 4TTPA 2BMJA 5KDLA 3UWOA 1ZRHA 2P6UA 3NC1C 2B21A 2O8EB 4PTLA 2V8OA 2VSFA 4HDOB 1GKUB 3JVUA 2WKQA 2Y8EA 4PAOA 4BUJA 4DDTA 1EXMA 3TSZA 1Z47A 4PZYA 3EXAA 2H7VA 4A92A 4DSNA 1W1WA 4D25A 1X8JA 4RCYA 1XEWY 1A5TA 1W5TA 3QKRB 4MGKR 2HYDA 2V7QD 4DT1A 4TMXA 4CEIB 1G7SA 3SBEA 3Q7PA 4MYUA 3X1XA 1S3GA 2HJVA 1Q20A 4IFEA 2ZI4A 1MO6A 2BKUA 2FZ4A 1KHTA 3DOFA 3H86A 1SXJB 2JGNA 1P62B 3P32A 3F5FA 4C0SA 1YQTA 3C5CA 1CJKC 1RFLA 2WSSA 4URXR 1ETUA 4KHZA 1KNQA 1E2KA 2QMEA 4DSUA 1VECA 3WY9A 2QUZA 1IY1A 3ND8A 1Z6XA 4GI7A 4GNKA 2EFDB 1XEFA 2B6HA 2GXUA 3L8YA 2DHRA 3K9LA 1EFRA 2YYZA 5IDVA 1GDDA 4GZMA 4V0KA 4K46A 4G01B 3E5HA 1SVMA 1PV4A 1IY0A 2P3SA 3QXHA 4Q00A 2L0XA 3FMOB 3ASYA 4ZDWA 5F3WB 1UEJA 4JLKA 2J87A 2QAGC 5A0FA 3VHLB 2ZYTX 4A2QA 4Q7JB 4US0R 4B73A 4NYIR 1ODFA 3BB4A 1KI1A 2VQSA 3NG1A 4RD1A 3UPUA 3MJRA 4HUTA 3RDPA 2ZRFA 1Z29A 1WE2A 5JRJA 2JLZA 1MRNA 1QF9A 2GJ9A 8OHMA 4B3GA 1P4SA 3PFIA 1UBFA 1IN5A 2EW1A 3WMFA 2CMKA 4OKSA 4NU0A 2F1RA 3V4FA 1ZIOA 4HZIA 1Z0IA 2ZRLA 3CUEF 2CHGA 3H0KA 1AS3A 2FG5A 2FSIA 3T12A 3VR6A 2R6FA 1NBME 1P2TA 4MRVA 1IQPA 3IPYA 1G3QA 3RWOA 2ZR7A 3UMSA 4CYMA 4LHZA 3RRNA 3VMFA 2VRWA 3NH9A 3U61B 2WKPA 1R10A 1WB9A 2OLJA 4G5RA 4CRWB 1NL3A 1E79A 1KKLA 1U0HC 2A30A 2QTFA 3HU2A 2O8CA 1XD2A 4RZ3A 3GQBA 3QG5A 2GESA 2ZM5A 1Q3HA 3QF7A 4JLPA 4P32A 2A3RA 5FPKA 3LW8A 5UKDA 3DM9B 3IUYA 4DC9A 4Z1MD 4DUGA 2CCGA 3NBXX 1VKJA 1RW4A 3I3SR 1BS1A 2XSZA 2CLDX 1WF3A 3EASA 1WBDA 3DL0A 4DZZA 2DWOA 2RHDA 4KXFB 3WBJA 5D3QA 5KUTA 1N6KA 1X8KA 4DSOA 3SYLA 3QKTA 2DWQA 3ZH9B 4ASUD 4URZR 2JLUA 3PITA 1T5IA 3AP3A 1G64A 2X19A 3TUJC 2G0TA 4AG6A 5G3ZA 3IO5A 5J4HA 1E94E 2MSEB 1XTQA 3O8DA 1M8PA 4K8OA 4X8OA 3KQHA 2HLDA 1HH4A 3B78A 4MYCA 3IIKA 2QSYA 4C2TA 4NYJR 2VP2A 3DDCA 3ZS8A 4PXAA 2IS1A 1XTJA 2X1VA 4EKDA 1SULA 3BH6A 4FMBB 2CJWB 2QPTA 5JRZA 2Q9AA 4GDFA 2AKYA 4UNPA 1G3UA 2GTPA 3F0TA 1OPXA 1P60A 2FZLA 3CF2A 3A58B 3GJ4A 4TLDA 5G40A 1YE8A 2PMKA 3AVYA 3SOPA 3B1ZA 2IUSA 4LOAA 2XNDA 3ETLA 1DE0A 4V0OA 1U94A 1TNDA 2WICA 4FD2A 5FPTA 2O8EA 3NDBB 5C2JB 3I32A 1G1MA 1G291 3B5JA 2AXNA 5AUNB 1D9ZA 4NP6A 2CVHA 3P1JA 5FTNA 3SFVA 4IDOA 2QM7A 4KFTA 3QKRA 4L5BA 2W6JA 4TZ0A 3EC1A 4MGYR 4CEIA 4MQBA 1ZINA 1R0YA 4DDWA 2DYKA 1UBCA 4Q7LA 1VG9B 3HYTA 2QN6A 4A2WA 2GDJA 2CNWA 1SXJA 1VG0B 5DO9A 1UF9A 2P5TB 1L4YA 3QE0A 4R2HA 4UXHA 5DIFA 4W5JA 1G3RA 3RS7A 2RGEA 3HJNA 3G5UA 5FPYA 3IDQA 4DUGD 1ZUHA 5JFGA 1U98A 5AJZA 2NPFA 3WRYC 2OEPA 3TAHA 2P0EA 2ZRJA 2QPAA 4LDJA 4B3XA 1G5TA 5JCPA 3BIFA 1NN5A 3CB4A 3CPJB 4ZKEA 1LW7A 3VR3A 1DO2A 3KKNA 1JR3E 2ZE5A 4V0LA 2NIPA 4FWIB 4LYHA 4NPHA 2GBLA 4UNNA 3I92A 3T61A 2WPDA 3MWJA 2QU8A 4YC7A 1N0WA 4LJ4A 2ODWA 1X6VA 4D0NA 4CEHB 2YNMA 3T1TA 2WM9B 1ONBA 4DCUA 1G41A 2QAGB 1KY2A 1KDOA 3CX8A 1OIVA 2IYQA 2JCSA 3NXSA 5J40A 4ZDJA 2H5EA 2WOOA 3T34A 1II0A 3SI7A 4LV5B 1Q12A 4II7A 1GUAA 3VFDA 2NPIA 4KSBA 4RY2A 3RRYA 2ZRCA 1BYUA 2JLYA 4P4UA 2WWYA 4BZXA 3QPVA 1E6CA 2CHQA 2ZRKA 4H1UA 5C4GB 3ICQB 2QGNA 1WDTA 3AM1A 2HXSA 2CVFA 3TQFA 1K8RA 2HXYA 2XNDD 4B3FX 4ZIRB 3SYNA 2CL0X 4M9XA 5FPHA 4KVGA 2OZEA 1DG1G 4M9SA 4OJQA 4R98A 4TTQA 3A37A 3CPHA 2IC5A 2VP6A 5JWRA 2WTUA 1FOEB 1GITA 1D6JA 4EJSB 4OI0A 2AHOA 1QZXA 5LB2A 4FW9A 2H8KA 4B33A 1QHXA 3L0OA 4OHVA 5DN6A 1D8TA 2NZ8A 3A36A 2VHTA 3PCRB 1F2UB 4KYUA 1KK1A 2QL6A 2QTVB 4GFDA 4OHXA 1M7HA 3C4JA 3LXXA 3NDPA 3AKEA 3R8CA 1KO7A 3KQKA 3LX5A 1KMQA 1BKDR 721PA 2IWHA 5JJKA 2Z83A 2VHJA 4HLUC 4GBMA 2GRJA 3QBTA 4JJKA 1T91A 1XJQA 3C8UA 3TR5A 2PX0A 4ZDIA 3C7KA 4GT1A 4N0EA 2QNRA 3BE4A 3CRRA 3W8RA 2NMVA 2R9VA 4N1AA 4I4LA 1SKYE 3HU3A 3A1SA 3PUZA 3DM5A 5FOUA 2BBWA 3VKWA 4GOKA 4PQYA 3EA0A 4BFXA 3EPLA 4FMDB 3LY5A 2ZTSA 5KDDA 1X1SA 4NMMA 2GJAA 1W36B 2OCPA 4B47A 2IF0A 1XTKA 1ELOA 3AVXA 2CJWA 4PFSA 3KQLA 2IHYA 3AF1A 1TEXA 2N42A 4A15A 1AZSC 3FPAA 5HE9A 3FFBA 4M9ZA 2GEDA 1ZM3A 4HZUB 1XD9A 3ND9A 1Z22A 4RD3A 1TX4B 2CDNA 3GPLA 1LS6A 2ZUCA 1HY3A 2IYWA 3GLFE 4XWAA 3QIAA 5GJCA 2ZE6A 1KSJA 3BFXA 4G5QA 2ZJOA 4D81A 2WAYA 1GM5A 1ZNWA 2BVNA 4XIGS 1OYWA 4UNSA 1KZ7B 2CCJA 2NG1A 4IOMA 2HF9A 5AWFC 4A0HA 3B7GA 4BE7B 3K53A 4S35A 4JLAA 4AK9A 1GL6A 3EG5A 3SHFA 1OHHD 1T3HA 3TNFA 5TVKA 3TVDA 1MR3F 3H84A 1VCIA 3EZ7A 3KFXA 4Q01A 4XD7D 5F9FA 2DFKB 5DN6D 1NVWQ 1FFHA 2C9CA 5JMTA 4P4SB 2IXFA 3IPXA 2PEZA 5EXXA 4BRUA 1T8TA 1Z6TA 4MGZR 3SU8A 2JDIA 1W47A 4A6PA 5LPNA 4MH0R 3A6PC 4RFSB 2A5YB 2XZOA 4A8JB 4PC3A 1NJFA 4PPGA 5FOVA 3K0EA 3AP1A 3TW4A 3X1YA 4XJXA 3FKSA 2YWGA 1G7TA 3DVLA 4RD6A 4ERNA 4TLEA 1A7JA 2AD5A 3RYTC 2ZRNA 1E1QA 1T4GA 4IOLA 1I4LD 1XZQA 2ZJAA 4RKEA 1FX0B 2QMHA 3O47A 2FJUA 4IJMA 2J1LA 2W0MA 4RFVA 4CEHA 1RE0A 3W8NA 1EFUA 2QAGA 1JPJA 1XB2A 2W6ID 4LY6A 1G7CA 4JL6A 4M1WA 2J45A 3ONWA 5FBQB 3K0AB 1DADA 4GP7A 2VA8A 4ABYA 3EC2A 1XF9A 3CPEA 1HA3A 1ANKA 2KBEA 1BMFD 1E2QA 2FF7A 4Q1BA 1XU4A 2Q21A 3ZD7A 1DS6A 1G8HA 2ZAOA 1YZUA 4Q48A 2QE7A 1BO6A 4JBWA 3TMKA 1FW6A 1R0WA 1T9HA 4UXJA 1XWIA 4ZIRA 5GVSA 4OI1A 5AUPB 2A5GA 1AQYA 2JJ8A 2VL7A 3AH8A 1KZGB 4LSGA 1E69A 2ZUDA 1K5GA 4BLRA 3IEUA 5JS7A 3KKPA 5FL7D 4JLJA 4UJ3A 2XAUA 4EJSA 1J2JA 1W2GA 1HV8A 1OJLA 5JI2E 4TYYA 2WWHA 1JEDA 2G0NA 2Z43A 3LFUA 4NL4H 5GJVC 3EIEA 1PJRA 4B2IA 4LI0A 1AN0A 1E9SA 1F2UA 2JJ2A 3W9YA 3RNLA 1RRPA 4EPRA 1FNNA 3EZFA 1IAQA 3DKPA 4Q1FA 2JLRA 1A4RA 2W58A 2C04A 1JQLB 1YZKA 4Q66C 3GJ5A 1DVRA 1NP6A 2XJ9A 5CIWA 1T3SA 1KI9A 1ZUIA 1VCNA 5B30A 1H8HA 3N5CA 1MABB 2GJKA 3FKSD 1A2KC 2WWGA 4PC7A 4F91B 1WXQA 3WYAA 1FTNA 3OAAD 4C7OB 5JJIA 3RS2A 1AS0A 1QBKC 3K0FB 5AR1A 1TPZA 3HR7A 3RSOA 4BZPA 3WRXC 4L9SA 3V9PA 2V1UA 1ZMXA 1E0JA 4BLTA 2AX4A 2QQEA 1AZTA 2GA8A 3I4LA 1R2QA 2J0SA 3L82B 1RIFA 3QXXA 5DH9A 2OFOA 4YONB 5A4JA 1N6RA 4MKFA 5EXPA 4GL2A 1EG7A 1YKSA 3T5DA 4HZUA 2GILA 1KSHA 1GZSA 2ZUBA 4Q9IA 4O2LA 3U7FB 5CB8A 3TRFA 4TL8A 2BM1A 2FGJA 2QPOA 3QI2A 4QXAA 4DLYA 2NO9A 2CBZA 1AK2A 1KJYA 2FE4A 4L16A 2VLIA 3JZMA 2VO1A 2QE7D 1ZU5A 3DO6A 2EWVA 3Q5EA 4JLOA 1US8B 1U0LA 3K9GA 4HAVA 5CK5A 4URVR 2CLCX 3QSYA 4TYPA 3C15C 1XBTA 1SXJC 4URUR 3RS3A 3BJIC 4WBSA 3VQTA 2YC4C 4DLZA 3GFOA 3SJAA 3QNUA 1XPOA 1OLOA 4TLAA 1E9FA
chains in the Genus database with same CATH superfamily
4QPJC 4DA4A 3FRJA 1O0CA 3ZV3A 2HOQA 2FOXA 2G9ZA 3UHOA 1L5SA 1MAUA 1HE2A 4K3VA 2IYSA 3AIKA 3BKWA 4A8PA 2VP3A 2BV3A 2JS7A 2C5BA 3ZGYA 2E89A 3OTWA 1Q3KA 4PLHA 4RFSA 4N7MA 3SHOA 3BREA 3Q7RA 1YBFA 2AN3A 1U0JA 2ZIXB 3DAFA 3I1FA 5BW8A 4MR9B 3SEAA 3UJPA 5I8PA 2ROQA 2COKA 4YT4A 3IDFA 4OATA 4POAA 4FR0A 3RFVA 3PEEA 4FFDA 1P5RA 2E4YA 2IUEA 2H7YA 3EVZA 2M6KA 3B3AA 3HDVA 3KWMA 1MQ8B 2OGUA 3DBRB 5DI3B 5K3OA 5FR2A 3SXPA 4BO8A 3C1AA 2PTHA 3MTDA 5AXCA 1AG9A 1HG0A 4PC2A 2Q5JA 2B7BA 2G88A 2WYWA 3EISA 3MT7A 3OTQA 3KDAA 1HFEL 4OKNA 2XQVA 2C7BA 1G8AA 4ZICA 2A7XA 3FRHA 1SG9A 4N3AA 3GFTA 1I3LA 4L74A 1OIXA 2VLBA 1LBSA 3NT4A 1JXAA 3KOUA 4MW9A 1ODIA 2FQXA 3IQZA 3L1UA 4IVPA 4JUIA 4XLTA 5DWQA 4ZAXA 5GQSA 3RR2A 1K3TA 3WSVA 4E88A 1H23A 1II8B 1F6DA 1E2DA 1EINA 1JVNA 1ZUNB 1Y81A 5AM1A 3D2BA 4L8YA 4EPYA 4HWOA 1QP8A 1E2NA 1C81A 1OFUX 2BFOA 3BRSA 3H9CA 4Z2YA 4GOMD 1OAAA 1Z4QA 2YFHA 3DHNA 3HB0A 2A1UA 4IH4A 4LWQA 2QM8A 2AOUA 3W9BA 5FX2A 1CJUC 5AKKA 2W11A 4FN4A 1Y5MA 2W2OA 4ILEA 2WYOA 3NBAA 2I1VB 5EMJA 1GHTA 4B80A 3IT0A 3KBOA 4V3CA 3UMYA 4DBVO 1GPUA 5H1YA 5BW4A 2WYHA 3IQFA 2WF6A 5C5EA 4HLQB 3IUJA 3AR3A 3W90A 2WHYA 1GPAA 3R0QA 4OLBA 2QSUA 1NXTA 3JZAA 3PQEA 4EKYA 3L7CA 4UD2A 1ZJ4A 3IBGA 1FNSA 1M6NA 1S7GA 1UWCA 3FWYA 4Y2TA 3ZWPA 1POWA 4KI7A 3MJFA 3OHSX 1PT5A 2GK6A 5FFNA 3ZXYA 3T7IA 4EPWA 3R5SA 1K5PA 1UPCA 3BWVA 1SVSA 1Z28A 3IQGX 4JR0A 4TVBA 5JHHB 1LPSA 2ZJ6A 1YZLA 5CB6A 2I22A 1ORVA 1YQWA 2Z2IA 5FTKA 3QK7A 3JARB 1CUXA 4YP9A 2F48A 3GNSA 5EPUA 3EIWA 5EL0A 1X7GA 3R5FA 3FY4A 4J7AA 3E8XA 3WV4A 1CX9B 3QE9Y 1WZEA 3UYLA 1XZPA 4OGWA 3VC2A 1KXJA 3QVTA 4G0YA 3K71B 3JAWB 3KQOA 3CUUA 4HO1X 3PHGA 3UW1A 2R47A 4JOBA 2ZQ5A 4U1RA 4KDRA 2JI7A 3EA4A 4B71A 4EAAA 3JQ7A 3GRPA 1BN6A 3DL2A 4I1VA 1U0EA 4LK2A 2RGYA 3U2QA 1D4AA 1JDBC 5F7JA 5BQOA 3O8NA 4PFKA 3UKJA 2BTQB 4LC9A 5KNDD 3EPKA 2HJRA 2W90A 4KCGA 3DV0A 1DRVA 5JV5A 3AINA 2W6PA 4GZ5A 4EB0A 4HRYA 1TCCA 4IIDA 4KN9S 1Q74A 1QLWA 1SBZA 4HJRA 3BDAA 2WJIA 4GVPA 3I39X 1EZ1A 2X5XA 1AV7A 4TTRA 3T9FA 5HM8A 2AEEA 3JATA 5E6SA 1A9QA 4UM8B 2WI8A 3U81A 5JR3A 1K8XB 4YJKA 1YXMA 3I45A 1JJVA 4UBKA 1MOQA 1HDOA 4FMCB 4J7XA 2X58A 1ULZA 1CUIA 3A1UA 3PPVA 3HJHA 4EMTA 1QQAA 1N2CA 4ALJA 4AULA 1D3AA 4M1ZA 4OQQA 2Z5GA 1CHDA 3C3BA 3OOYA 4R2XA 4EB6A 1DG9A 1R6UA 3T9BA 4D4GA 4DIEA 4BKMA 4D0LB 2CDRA 1P0CA 3KELA 1E8NA 1TYEB 5BVHB 3E6AA 4UEOA 1RAEA 3AKYA 4PZUA 3TGPA 1P39A 3LLVA 1PK9A 1PVVA 2IHNA 3PJRA 1RM0A 4MKXA 3OE1A 3UXYA 2XECA 2GHIA 2P27A 4KW7A 3JRWA 4YIHA 2O0KA 2AKAB 1JXOA 1UDAA 4Z1MA 5CDFE 2XKBA 2W8BA 4Y9RA 4MVJF 2E4WA 5J4KA 5AVWA 1N25A 4TMYA 1G18A 2C7QA 4IVRA 1EP2B 3DTNA 3GJ3A 5K05A 4EG1A 2GZRA 1MEOA 3QF4B 3QJYA 2WKWA 3KUXA 1RYFA 4PLYA 1DB3A 4PRKA 3T9CA 1IQRA 1OI7A 3K4HA 1QZTA 4LFBB 1PFYA 2QF7A 3ICOA 2VCHA 4I8IA 3KYCB 1GIAA 4RSMA 4RZSA 1V3TA 3HV0A 4P5PA 1HT0A 4X95A 4RQTA 5H3LA 3TLCA 1FFXB 3A9UA 1WL8A 3L5KA 4RGYA 3L1JA 4K8RB 1VXRA 4D8VA 2BN4A 3ED5A 3K0CC 1QO0D 1J97A 3KYDB 4PLPA 3AM5A 1T2EA 5JZBA 3N2KB 5ENDA 4ER7A 1ZRMA 4PYIA 2DCMA 2ZATA 4HB2A 4BLWA 1K6MA 2ZQYA 2FE1A 1RBMA 1QQBA 1WCV1 1ZSYA 2W83A 3O95A 4YQEA 3VNQA 1C3JA 4LIPD 1KYYA 5KX5F 3G6WA 1NJ2A 3OOJA 4Q3OA 4K0KB 3PUYA 1UWVA 1J21A 2CEAA 2OP0A 3TQIA 3EVNA 3Q7SA 2C3OA 1TKCA 1SCKA 3IIMA 1T2UA 4C0JA 1C9JA 4QODA 1M7BA 2IPLA 3FROA 4ZVLA 3SZOA 4B44A 5EHGA 3QENA 1EUCB 5AM2A 3DT6A 3DT8A 1A2OA 3LSTA 5J23A 1P6XA 1D0IA 1W1IA 3A32A 1S1CA 2RH4A 3B3QA 3OIVA 3UCFA 5H70A 1ECCA 4QQNA 2P35A 3A04A 1HBJA 1QH1B 1GG2A 2ZPTX 3R20A 3CR7A 3HCNA 2QZJA 3MSCA 4O2BF 4AWAA 4F3RA 4ZHQF 4UVEA 1SCIA 1KEEA 2QQGA 1AKTA 2P40A 3PWSA 3VH1A 4NDNE 1G66A 2AK3A 1A77A 4EJSC 1M8GA 1RAFA 2NTNA 1KETA 2RKOA 4AYXA 4CPDA 4LXYA 2WIAA 3RC3A 4MQ4A 3AI7A 3MOSA 5CUQA 4ZJPA 3M9XA 4FGZA 4LYAA 5EMLA 4HKTA 1GGKA 4AKEA 4LRXA 5F76A 4IFTA 3PQCA 7GPBA 1VIVA 2QRGA 4F97A 1E1MA 1R0XA 3K6RA 1V25A 4X20B 3QVUA 3E5MA 4XOIA 1FJXA 1XELA 3WWPA 1L7OA 1UJ2A 2LBPA 4ND7A 3QU5A 4EEKA 1N6IA 3ZBQA 4EOGA 3BWEA 2FDCA 4RF3A 2XBMA 1T25A 1WMBA 1JKJB 3QOXA 4TLCA 2WWTA 1A04A 2GT1A 4ZPXA 5K6TA 4BDSA 2PX4A 3DAPA 4LECA 4TMWA 3I8OA 1BE0A 2WQZA 3AUSA 4WN9B 4HNAA 5JSFA 1YUMA 3L4BA 2OM2A 5TB5A 2UUPA 3WI7A 4U6QA 5HIMA 2MSWA 1H2BA 2Z1NA 1W4RA 3L40A 1YONA 3VTZA 4BN4A 1CZOA 3AERB 5FEUA 5TMPA 1B93A 3FMIA 4QOHA 5FQOA 3UA3A 4XWOA 2A5DA 2OCXA 3K4QA 2IA5A 2YWXA 1YZVA 1KYIA 4DQXA 2YV4A 3D8RA 5K6AA 2QN1A 4HX9A 4V02A 1TOAA 2ZXUA 2P4QA 2D62A 1EFCA 1MO4A 3QELB 4YJGB 2ODPA 4Q18A 1QMGA 1UJ5A 2C77A 2R5WA 1WD5A 1OC2A 2GETA 2VHXA 4PR3A 4HR7A 4TPKA 1HKUA 1UUFA 2R84A 4B75A 1Z45A 2HIGA 2W4MA 3QMPA 1JECA 1UT8A 2GD1O 4TL9A 3RJTA 3EULA 4HI0E 1QYRA 4JLNA 1D2RA 5D3ZA 4DV3B 2W00A 5IVIA 3WGHA 2C5FA 3C8MA 4IUCS 2JFYA 3UTCA 4W5RA 4IJQA 3RAGA 2D5CA 4YO8A 2Z1DA 2PFSA 3WQBA 3VPCA 3QIVA 2F67A 1K9VF 2BBTA 2OD9A 4NZMA 2PLFA 4LK3A 4QUKA 4TMZA 4ZO9A 1V11A 3RVLA 2I6GA 4QYXA 5BUCA 4GR9A 2X8AA 5AJTA 2A9KA 3L1IA 3Q7IA 2ODAA 4X54A 4ZTUB 1EFKA 1Z07A 1O95D 3QEMA 3AOGA 4DLSA 5CDGA 1ZA2A 2RCNA 4Y2HA 2CXPA 1E3MA 4H59A 3MINA 1UKEA 3MMPA 1IONA 1VGVA 4WINA 1SUPA 2PKQO 1FP4A 1DZIA 2NM0A 4NI5A 3KOZA 4JN6B 3AIIA 4RL4A 5JOQA 3WGGA 4C1NA 3QX8A 2EQ5A 3U4AA 5EE9A 3FIJA 1PWZA 3MPUA 1JKXA 3PNOA 3BXFA 4YREA 2B8JA 2GCOB 3PFCA 4WE3A 1GSAA 4D74A 2FP4B 3FPCA 1M74A 1R66A 2PMBA 1AN9A 3EXHA 4UUAA 5G53C 2AXQA 4MB6A 4PR0A 3F1KA 1SVLA 3NZEA 4AJNA 4HAYA 3C5WP 5F3DA 4Z51A 3QMVA 4RYLA 3F74A 2E0IA 2WMNB 4J91A 5JZOA 4BLQA 5AKEA 2A0XA 3KKMA 3ZV7A 4ITVA 3O2QB 5K0EA 1D2MA 4V2IA 4RESA 4J1SA 4M0LA 1DG3A 1ZH2A 2AFRA 2UZ1B 3TBKA 1TLTA 4G84A 1JHPA 3AHFA 4QBHA 1J8VA 1O97D 4REOA 4DHWA 4DNFA 1Q7EA 2BFFB 3L18A 2XCRB 1U7HA 4BO3A 2Q3JA 5AUNB 3N86A 4HFJA 1ND6A 1XFDA 2HYIC 1IULA 1QIGA 2YN0A 5BXQC 1REQB 3N2IA 4LYFA 4M53A 3QE2A 2UVPA 3S68A 1SC9A 1XZCA 2GD6A 3RVNA 1JALA 3THXA 5TQJA 2XUDA 1UANA 3DKKA 4FFBB 4EFKA 1P31A 5CA0F 3ZK9A 5GINE 4EKGA 5KU1A 3O0DA 4JUFA 3WWOA 3BERA 4BTLA 1JWLA 3JQ9A 1ID8A 2BKVA 2JAPA 4EECA 3WWEA 5CYOA 4JVLA 3ZVRA 1FNCA 1ZUD1 3LYAA 4NIMA 3TE7A 1CR2A 2XNCA 1VBFA 3DKRA 4RDIA 4RH0A 4UNQA 1GO2A 4N6NA 4O2AB 3O3CA 2ZSJA 4H60A 4BX0A 2J09A 4OL0A 3VZSA 4BNTA 1RXVA 4P82A 5BYJA 2YYYA 1NXVA 5C8ZA 4MJ3A 2QTMA 3G7SA 1CJTC 2BM8A 1C1DA 4QASA 1H2WA 4W8GA 3E82A 4ER5A 1I14A 2ZSEA 3JQEA 1Y89A 3LXRA 1KMHA 1OZAA 5FADA 3AC0A 5TJHA 3SSNA 2FN7A 5IKMA 1U8CB 4JEIA 4M8NE 3VHXB 2WJHA 4F71A 1OROA 2TYSB 4KPYA 4OHUA 4QDKA 4NU8X 1I5OA 3C4VA 3F6YA 4QNRA 3WADA 4F9GA 4DMKA 1QR6A 2J9FB 3JAKB 3WNZA 3MTJA 5J1SB 1HC7A 1VFPA 4CVNA 2XGOA 1FQOA 1H22A 3A4NA 4BJHB 2JRLA 1IM5A 3PV0A 2JB9A 1KFEB 4H6PA 4PSDA 5JAQA 1WSWA 1KF0A 2XQFA 4EAQA 4F3KA 1HORA 4FCTA 5I7SA 5EP1A 1BXRB 2BDUA 1BSVA 1GA1A 1U8FO 1XGKA 1CHNA 2I80A 1IRIA 3VSEA 2ZB2A 4J16C 3LG2A 3E48A 1BDIA 1QAQA 4ADSG 1X7XA 1G8KA 2O8BB 3THWB 2MT9A 3MM4A 1SIWA 2D00A 4UTRA 3VSDA 4LF6B 3SM3A 5IX8A 2XW6A 3H5AA 3HY4A 4DVJA 4ZI7A 4HMOA 3DOHA 1IIRA 4M7WA 4I5FA 1MO3A 2WZDA 1PQUA 4MKIA 4U7HA 1C9MA 4QBGB 3ZJ4A 2B1QA 2YR0A 5G2OA 3AR4A 1AQ6A 4WEOA 3JYLA 4PU0A 1EMDA 3UCEA 2HBQA 3RE1A 3BMOB 3FPJA 1BXZA 2O52A 2CMGA 2H31A 3ZEAA 1CQIA 3VM6A 5K2MA 3A2NA 4TV9F 1PEYA 4UCWA 1ZAKA 1A76A 2D2FA 2ABWA 1S2LA 2HF2A 3ECSA 1PLJA 3DP9A 3HDQA 3HFRA 4LDAA 1AH2A 3KZ1E 3IBFA 3WG9A 1AKRA 1G0OA 2QVLA 3IOCA 1DUVG 2GPYA 3DKVA 3KSRA 4ZRNA 1A98A 4RTKA 2I65A 4CLXA 2XT0A 3DOCA 1AHHA 1H5QA 3ETDA 5B3JA 4ZYUA 3EPRA 1NUQA 5T5QA 1H1LA 5F2NA 2YIJA 5AIAA 2G82A 7AT1A 4Q24A 1TW2A 1DWPA 3L0SA 1ZCZA 1HDYA 4NOLA 3CRQA 1PR2A 2Q07A 4J9UE 1MJGA 2PMWB 2ZCUA 3HRHA 4R2KA 2Q9CA 2XTZA 3CRVA 1UBHS 2WUGA 4JUDX 5EERA 1K68A 3KM0A 3GLRA 2NO7A 3EYAA 4P93A 3BMQA 4IGKA 4CCAA 3QBJA 3NBYC 3KUDA 3ZCQA 2G6BA 3L2OB 1PTJA 4YPVA 2NN3C 5BV0A 2PSHA 4ZJYA 4LS3A 3PQ2A 2VJNA 4INPA 3I4CA 4OHPA 1PJ4A 5KOHB 4AU1A 1X3LA 1D0SA 1UKYA 4Y18A 3IPRA 5BT8A 3EPJA 3Q4GA 1WNFA 1O94D 2UV8A 3NEYA 1EBUA 3UK7A 2WF7A 2AWNA 4G5FA 3ZHYA 4B3RB 1R8QA 2AJCA 5LBTA 4YRTA 3B13B 3CY6A 3NGMA 4M8LA 2M1ZA 2HU8A 2VJYA 4WHMA 1LX7A 3HA2A 2JA1A 3ZVKA 1G4AE 2RGDA 5DE3A 5B4TA 2EARA 2W6OA 2ID8A 2HBZA 1U9CA 3IULA 1YBHA 2P75A 4GMHA 3U4IA 1NYRA 1UMKA 2NYUA 2YV3A 1AX9A 4B7UA 4AY6A 3ZPXA 1QHGA 2PUVA 1UPFA 3VR0A 1XQYA 2UUOA 3OAAA 5D3MA 4D98A 4YRBA 1W52X 4L72A 5JFTA 4AQYB 1JFVA 1FJ2A 4TKVA 1VI5A 2AG8A 3QWAA 1CQPA 2OYSA 4KITB 4RM2A 1LSJA 4I1PA 2UUAB 5HCUA 1ADBA 1FDIA 1H2AS 5B7GA 5JC1A 2P6MA 4I08A 1S2GA 2QVCA 2J31A 2JKVA 4KPUB 4F4JA 3SZRA 4ZI2A 4ZKDA 1QU2A 1UFKA 1KI3A 3KTOA 3PF8A 4FUQA 2VOJA 4JBYA 4RPJA 3WNBA 4FHZA 2G5TA 3RS8A 4C5AA 5KNLA 3W5IA 1E61A 3GAMA 1G42A 1T0IA 2FZWA 4PCUA 5EMHA 1SCNE 2C4HA 1PS8A 2E4XA 1PWYE 1PNVA 1QS0A 1Z4LA 1I30A 3HL4A 3L3BA 4LJ6A 3R23A 2G8NA 5BQ3A 1NN3A 3HY6A 4M0CA 5C53B 1DU4A 4D9HA 3DEAA 1ZD3A 1CS4C 1GDTA 4GXNA 4AJ1A 3ECAA 4EPTA 1IVYA 3OCXA 3DDHA 5EHQA 2Z0MA 1PZNA 3M5DA 4RQAA 1JHRA 2POCA 2OA0A 1KEZA 4PLTA 4ZT7A 2NSDA 1KOJA 5JHGB 1MX3A 3CSUA 1Z2DA 3KRTA 2RC6A 3NHUA 5CTJA 1U0RA 3ZWBA 2J32A 3L7AA 1EZ4A 4ND8B 5A5DA 3F1LA 1W7AA 3DJFA 4HBGA 3HR8A 5HZGA 2CSXA 1Y1PA 1Z68A 2BOVA 5M3BA 3VOBA 1UXIA 2XMCA 3OE7D 4J0JA 3CZQA 5E8RA 4AVYA 4DJ5X 4Z4EA 2I7DA 2XZPA 1ZUWA 2H18A 1TK3A 2LKCA 3DEYX 2YVUA 3KD3A 4EW6A 1DKOA 2PZGA 3DZFA 3GRFA 3MB8A 3N2GB 5T4HA 4X7PA 5AH0A 2FMIA 5DHAA 3VPFA 5INTA 1FTYA 2UUBB 3DV2A 3PUKA 3Q5DA 1T2CA 3FYDA 3E5NA 3FJ1A 4PC1A 2ZKLA 1Y63A 1PSZA 1ATIA 1CY4A 1G9XA 2B1JA 3G2IA 3N2ZB 1JB1A 2C78A 4ENVA 2PSJA 4O2RA 3WLSA 4BAZA 1MIOA 3HGMA 3I1IA 3Q1LA 3QKSB 2R7KA 4YMVA 2C97A 2JFNA 4L22A 2EFHB 3IAEA 4KQIA 4D3YA 1RI2A 3EVGA 4CG1A 3HWRA 1XRJA 2XT9A 1ZJJA 2QRQA 3SIPA 1P9WA 3LUDA 2JATA 5AQ1A 2ZPAA 5DYGA 5BVGB 1J70A 2ZSDA 2C5SA 2BJHA 3ONVA 1V8FA 1E6EA 4X60A 5ALNA 1Y8ZA 2FKAA 1MVOA 2IYOA 1MC8A 2FMHA 3WLPA 5GY7A 3ZHZA 4BFYA 2QV0A 1B76A 5EZSA 4IDQA 2WWFA 3H1EA 5A4IS 5KJ1A 5KQPA 2HO5A 1Q7RA 3VR4A 2BMAA 3P26A 4BZQA 4M1OA 4XVRA 5JT1A 1QXSA 1SHLA 4CN9A 3AVWA 3PU6A 1QDUA 2AOTA 2OGZA 3N8NA 1SH7A 5BO5A 2PKRA 2WT4A 3QQ5A 3L1VA 1FVHA 4Q7EA 2NU9B 3RJMA 3DLIA 1RQ2A 4KV9A 5FPSA 2PZ8A 1UXKA 3QXJA 1P1RA 4BU1A 2VHCA 2OY0A 4EGJA 1ZH6A 1U6KA 2XTJA 1DT5A 3CNEA 3CZ9A 4ME6A 4MR8B 4E15A 4PG8A 4KXVA 4CUJA 1SVIA 5EJ9A 1GQSA 1OTHA 4E5DA 4KI0A 4TGLA 1UDCA 5DSZA 4QPDA 4U0KA 3EAGA 4MUGA 4D8YA 1C0EA 5I48A 1IM2A 3PR3A 4LHEA 4IILA 1J9ZA 2E3JA 4UVGA 2GZHA 1C3XA 3WK5A 1IEXA 1TQ4A 4Q34A 3WWYA 3THSA 3VV3A 2PGIA 4BVHA 5FPPA 2CY0A 3MOGA 3IAFA 2NZUG 1ZNQO 3DQZA 2MINB 2XB8A 4FU0A 3R8FA 3N2LA 1M5UA 1SXJE 2R1VB 3B6KA 2PX8A 3IXQA 4IGFA 3SZLA 3DCIA 5HZMA 3N8KA 2DHDA 2WZCA 2O2JA 1PQ4A 4IQFA 3OEHA 2HSWA 2EFEB 1UK6A 1NQ5A 4MS1B 4L8GA 4CKXA 4EMUA 5KC8A 2CFIA 2HNBA 3EY9A 4MCJA 4M60A 2G7ZA 3EAFA 1W4CA 1K66A 2ACEA 3H1GA 3P96A 2ZZNA 2QMUA 3HB7A 1Q1EA 4NCHA 2RK6A 3AVTA 4INAA 1OA0A 4E0BA 2V03A 1EVEA 2YXPX 3NCHA 4GZ6A 4LHSA 2UZ0A 2Z2KA 5DBGA 5CJ2A 3ZGVA 2XUIA 1HLGA 4A0SA 1YL7A 5EKTA 2QUAA 2QLLA 1X7HA 4N54A 3GY0A 2IHUA 1P1CA 1Z26A 2ERXA 2HJSA 3LU1A 3HA3A 4MA5A 4BQPA 4CL8A 1AHPA 2JL1A 4WMLA 1YRHA 4F6LA 2CLOB 1ZX1A 1IXYA 4Q4JB 1E5TA 1H69A 2WG1A 3U7EB 3O6VA 2OKCA 2F8MA 4UAVA 1P1FA 4Q7MB 2C9MA 3O94A 2QT9A 3HWWA 5FWXA 2R6HA 3JYQA 3KJZA 3M4ZA 1U5CA 1KMIY 3U0VA 4B4UA 5F7XA 2AMLA 1U9IA 2CVPA 4F7WA 1QIFA 1EX6A 2FPGA 1SC4A 3FJYA 2FW8A 4RVOA 2RGGA 5BV7A 4L3OA 1H4TA 1Y7PA 1O7JA 1N7HA 1BQEA 1K2VN 2H57A 1MHPA 1IUOA 1AD2A 3LWDA 4I1IA 5JSHA 2VOEA 3AYXB 5HR5A 1IY8A 1OI3A 2YKGA 5F78A 4ZCSA 1GCOA 4Y6OA 1ZYUA 1JXMA 1ENPA 4I4TF 4PVDA 4WXMA 4ER3A 4EYSA 5I7WA 3WYGA 1JR3A 3QFCA 5KYKA 1BE1A 4ND6A 2CLKB 4I4CA 4TSFA 1NU8A 4CMIB 1IMOA 3DZJA 2ANBA 1BJKA 3WBKA 1O94C 3QJGA 4EPVA 3HHPA 1JFSA 3AVVA 1ZVJA 1L3CA 2VEOA 3FNIA 4AJ2A 4PAWA 4GM1A 5DLEA 1IHPA 2GWHA 2CK3D 4PZ9A 5AOVA 5EINA 3SYKA 1NI4A 2QJWA 2VT2A 1P80A 1H8ED 4U2CA 2L69A 1U7OA 2OFPA 3OKPA 1BQ3A 4JYBA 2IS6A 2I6XA 4CGZA 1KBOA 3L0BA 2ZETA 1MQ9A 1QMPA 2VJOA 3MIZA 2YXEA 1XRQA 2LIPA 2X8WA 1L8QA 2HNAA 3O21A 5F4ZA 4BC0A 2YZNA 4C88A 3CLHA 1LDGA 3GFBA 3R09A 2PSFA 2DAPA 3T1HB 4YECA 3RC2A 4PVCA 1WRBA 1BVUA 4QJ5A 4QBFA 4DZRA 1QG0A 2IHJA 1GUBA 3WRWA 3J81k 4P5DA 5FUYA 1SHTX 1VE7A 2OQ2A 5DRYA 3KTAB 3H7IA 5CIQA 5ES4B 5FLKA 5KTOA 1UXJA 3ZDAA 3DFKA 1X9IA 1UMCA 1H5NA 5KYWA 5FTLA 1HDZA 1T9GS 5KYXB 1GNVA 3GAAA 4C7OA 5HIJA 2P7HA 4AJKA 3OP1A 2WB4A 1BHSA 2P4HX 2Y67A 3TG2A 5KSYA 2NXNA 1FRZA 1GQOA 2GHQA 2IHKA 2NVOA 1DAKA 1PJ3A 2R8PA 3PIRA 4WUTA 1HR0B 3HI6A 4KUHA 1YCFA 2Z3WA 2R1TA 3OFJA 1QX3A 4M54A 4ZU3A 2JGAA 4O4HB 4D43A 4DBLE 2DY1A 1U9ZA 4B0OA 1MOZA 1AXGA 1FFCA 2ZB8A 4DMRA 3K8ZA 5DIZA 3ZUPA 1Y7LA 1X7ZA 3INGA 3LP6A 3QQPA 2H11A 5C34B 1ISIA 5TARA 3N0TA 1O6GA 5HFNA 1C3OA 1JP7A 3JASB 3NS7A 1TD9A 2P3QA 3D5QA 3G2OA 3DR5A 4DUPA 1YBVA 2IT1A 3MWYW 4MI3A 3ZZ0A 2C29D 5B58C 1E0SA 3FDXA 3LYUA 2ZBUA 1EE2A 3H3XA 4IJWA 4MW0A 4QUHA 2FGKA 3AESA 3CQ9A 4URWR 1Y1KE 2IEAA 3DQQA 3GJRA 3ETCA 4IDNA 4FGUA 2XVYA 3LV8A 1ZN8A 2BH9A 1ZGZA 4GWGA 4R6WA 2R8BA 4LYJA 4NVRA 3G85A 2JIMA 5SZKB 1NLYA 2JGMA 5LQAA 4NE9A 2D0OB 3C7DB 3RHSA 1RD4A 4D42A 3C98A 4H7FA 4B3JA 5JBIA 1ZR2A 3OEED 4E30A 1QPBA 1EGAA 2Y0DA 1GGEA 5FLEX 2Q7XA 4UHHA 4CR8A 1ZIXA 1CFZA 5CVUA 1ZKMA 3JYOA 2PR2A 3BOSA 1D4OA 2WSLA 5DNWA 2QX8A 3EXIB 5CNMA 2J3KA 1QUEA 4KGVA 4LMAA 2PUCA 4KZKA 3PXAA 4MUXA 4TUYB 1UBOS 3OZAA 4HCJA 4E09A 2LWIA 3RW9A 3RANA 4CEJB 1WCYA 2HEIA 3ZWAA 1RXUA 1W59A 3ZJTA 3L0CA 4BC1A 1E1RA 4EEZA 3H3FA 5IAKA 3G1WA 4MUIA 3GFSA 1DL5A 1SG6A 1WHTA 3U39A 1Y3FE 2CFTA 3HLTA 3IX7A 1IJEA 5JBNA 3GEGA 4I0WB 1VSVA 1EVYA 5FNVF 2BCGY 1DAEA 1A7AA 2KW5A 3G7UA 1Q17A 3CX3A 3QEKA 3ZQ4A 4M36A 4CWAA 3KWLA 2QN7A 1OXSC 3O38A 1CU1A 1CQJA 1GDHA 4GVLA 4UM7A 4G23A 4C5BA 3PHBE 1SUCA 1QDEA 4R8MA 1WUKS 4J0QA 2E4VA 2YFKA 4OFBA 2J7PA 4PBTA 5ALYA 3OCUA 4UTPA 3T7AA 4RTMA 5AI5A 3WFZA 3I76A 4A0GA 3T1YB 3KCQA 1KKUA 3UENA 2EX4A 4N39A 3TI9A 2ZBPA 3NHKA 1Z74A 1N9GA 1P9NA 1NVXQ 4QXRA 1NBHA 3VVMA 4DB2A 3S7TA 5EKSA 1R5NA 3AI1A 1QCCA 3L6EA 3DONA 5KNCH 5DNYB 2PT5A 3ZS9A 2GAIA 4KXQA 2EWWA 1LBTA 1CW2B 4P36A 5CK4A 1B3RA 5K9ZA 1RRCA 2XDYA 4MYSA 3MGBA 4B6JA 4XDGA 3QY0A 1RJ9A 5GJWC 5A4JA 1RAAA 3EYWA 5AUOB 4BLOA 4OB6A 2W48A 2GNOA 1DBPA 2QRHA 2FDRA 3DC2A 4X3CA 3DOIA 3UB3A 4B6RA 3EXFA 4EY8A 4PF1A 5JSZA 1Z0UA 4MP6A 3RS0A 3W9UA 5EHXA 4IDHA 3MBKA 4DV4B 3D1LA 1NN1A 1GNRA 1HK7A 1QGYA 3M1LA 1KO5A 3ONEA 3V8MA 4HNQA 4GRAA 1MB0A 1FMJA 2DFDA 3OWXA 4FZRA 4N3BA 4YMUA 4C0AC 1C2YA 4EQ6B 1GCIA 1I80A 5E7MA 1L6IA 1WUTA 3WQHA 1R8XA 4FHFA 2ATCA 1WXWA 2Z9CA 3GVIA 4X1IA 3TZ6A 4CMCA 1DGQA 3EGWA 3CURA 2PJUA 1EDEA 2Z4RA 1CV2A 3BMXA 4E5NA 5E1DA 6PFKA 2JCGA 3K0HA 3UWDA 3H3JA 5AW7A 4F45A 2QP3A 2HDWA 3CCBA 2Z4SA 3CSDA 5J4VA 2M98A 2OO5A 3MWLA 4HFNA 1LDBA 1PSDA 2FHPA 3MMZA 3W79A 1CK4A 5FOSA 2Z2YA 1MC1A 1VHLA 2ZWVA 2DFLA 2OGWA 4CLRB 1LDYA 2BIFA 5J9FA 4DYVA 2ONJA 4Z8XA 4TS3A 4RELA 5AI9A 4A03A 2WE8A 4MSUA 4KWIA 1YHNA 3DB1A 1NC1A 2FWRA 2I2CA 3QPUA 3UGQA 1X87A 2HMWA 2VH5R 2WVGA 3FLBA 3NVAA 1WO8A 4F4HA 3T41A 2YRXA 5T6MA 1GAEO 1VBMA 4XB1A 5C4MA 2QSJA 2JASA 4NAHA 5BWCA 4KPEC 4MLCA 2V45A 2I6UA 1EFRD 4IXDA 2SKDA 1R4AA 4YR9A 2CVOA 4OGLA 1LQTA 3FTFA 2JLVA 4FNGA 2ZYVX 1MCZA 2ZXEA 4S2EA 2DQ4A 1OXTA 1C80A 2EU8A 3AL3A 5H83A 5L3QA 3OQOA 3SK0A 2ZPUA 2PKCA 1JSCA 3V8NA 4PRZA 3FF1A 1SAYA 4R1QA 3MEQA 4RKYA 3OC6A 3OI7A 4OUKX 2RSLA 1DARA 1RFGE 5C7YA 1CS0B 1TU3A 5CP8A 2EJUA 1SUIA 4TQUS 2FN3A 1P3JA 2GO7A 3D4LA 3P2EA 1E62A 3U4QB 2OZLB 2A92A 2ZZKA 3D6HA 3RK0A 2OWEA 3F7TA 1I2BA 3UXHA 1XMVA 1O58A 1TADA 2QN3A 5KINB 1WXFA 3LKVA 4FGJA 3B1VA 4XUDA 5HIIA 2ESRA 3IAHA 2IH2A 1VKRA 1S8NA 3H0CA 1KRHA 2OXIA 3X1KA 4LWZA 2IU3A 3DTVD 3EWNA 3I6BA 4NENA 5FJJA 3THYB 1TIPA 2OLKA 3PGA1 1B2LA 3UA4A 3E61A 2O1XA 4KFUA 3VR6D 3MZ0A 1L3BA 1CPYA 4O0LA 4O4JA 3A11A 5JNUA 5LQCA 3AY0A 3HB1A 3JYPA 4EKEA 1NQUA 3A8TA 3G9QA 3GWGA 3G8BA 5FUXA 2WY2D 3QVOA 2J5XA 3CF0A 2GK7A 2IYNA 1O1YA 3OZRA 1K75A 4OUDA 5EZ6B 1CUVA 2G9QA 1FTGA 1DQPA 1I3CA 1UBKS 2FEAA 2PT9A 2QM3A 3MQFA 3RVPA 1PEDA 4BV3A 1P0MA 3F3YA 3I5XA 2DKFA 3KJIA 1DINA 2C42A 2IPAB 3HZOA 2JGRA 3K30A 2E5WA 4QJIA 1SBCA 5JS2A 1JAYA 1T6XA 3UJNA 3U4MA 4N12A 3CKLA 1JHOA 3MJEA 3LVRE 1X0VA 1F6BA 1OZHA 2P6RA 1V8PA 2FN9A 2Q0XA 2GZAA 5HCNA 4F3CA 5IDWA 3V00A 3SDZA 4H16A 3LDHA 4G41A 1TO6A 3OPNA 4CIXA 2WWWA 4OD0A 3M6XA 4JJ6A 1KI7A 2YBDA 4XWYA 3ZQUA 1SOUA 5A2QA 3MSXA 3RH0A 2AK2A 2QT0A 13PKA 2P2NA 4AI6A 3EGCA 2H2HA 3IP7A 1L9XA 5I7EA 2C20A 3RPEA 4MARA 4MQEB 1TCBA 3MYYA 3VHQA 3X1JA 2PT7A 1RM3A 2GPNA 3MTBA 3GMTA 3O8BA 5ALIA 2BP7B 4NE7A 4YUZA 6Q21A 3AJRA 4KBFA 2OV6A 2QAJA 4KE8A 2NNLD 4L0DA 3RYHA 3ER9A 1SKUA 1QFJA 2JH8A 2H52A 3NOXA 1BCRB 2YVLA 2X7HA 4AMVA 3TECE 2QQFA 4N7BA 4G0ZA 3ZYZA 2ZCJA 2HLDD 1I7NA 4E7OA 4ZCMA 1CUGA 3WMXA 2PSEA 2WJVA 1HT2E 4AO6A 1WBJB 2PSSA 4ZT6A 1F1BA 3A6LA 5C1BA 1E32A 1AXEA 2B8NA 4GM0A 1SZCA 4JMPA 5TQ0B 4C3ZA 4EYGA 4K05A 2ZSFA 5E6RA 3GP5A 2HFKA 2REOA 1LPAB 1P17A 3IJRA 4N82A 2AWOA 3SJZA 5LDDC 2IX3A 2CYAA 2G09A 3LDAA 1CJVC 2PFGA 3K6KA 4WK4B 4DQ0A 1UJMA 3BE5A 5KSOA 2PNFA 3WJ2A 1KGSA 2FA9A 2WU1A 4WZBA 3ZV6A 1T5TA 4OU5A 1HRDA 4LZLA 4M7OA 4PTYA 2H1SA 3MMSA 2O2EA 1H0SA 3B7PA 4BX8A 4DLXA 3U7HB 2P91A 4PQGA 3MBIA 3OZXA 4EITA 4RWEA 3TIVA 4TT3D 2O2IA 1LK0A 2R65A 1Z5ZA 3UJAA 1R6BX 4FE3A 5D5PA 3L4KA 1Z6QA 4K9RA 2GZ3A 4Y2XA 4YRFA 1XV5A 1Z34A 4BMCA 3KT0A 5BUQA 2GO1A 5DM70 1HEUA 3ENVA 2KS6A 4L57A 5BPHA 1M2OB 2H4JA 2PWBA 3PYMA 4KJZA 4D5EA 2RH9B 5L6LB 3DZ8A 1EJ2A 1SR8A 4RSGA 2I8LA 2XXJA 5HEKA 4L07A 3HTXA 2O50A 3CVXA 1G16A 4JYAB 1COZA 1SBNE 3KPVA 1JFFB 2H9YA 3PVCA 1RYHA 4O29A 3FMPB 3BFPA 5ARDA 2ZUFA 2VG8A 1IVNA 2IYPA 4GE0A 2O2CA 4RM3A 3N76A 4Q4HB 5JDIA 3TG8A 2XB2A 2V96A 5D6NA 4JSYA 4QFDA 4CM4B 4B3TB 3UFXB 2DRIA 3L8HA 1Z5OA 2Q6TA 3SC3A 1IEQA 1YMUA 2GYYA 4RA9A 4B1FA 2YOGA 4S0XA 3WO0A 3NM4A 4GP6A 4LJYA 3L0ZA 4Q3BA 4WTOA 5DTIA 5LLTA 2GCGA 5TQ2B 4ILKA 1A9XA 3DFZA 5CLJA 1Y6ZA 4S0ZA 3GFPA 3THOA 3ETGA 1FUYB 3ZDXB 2Y99A 3IC5A 1M2GA 2XCQA 3NHYA 2Q3BA 3JWHA 4G0OA 2VPPA 3D8BA 4I50A 1ONOA 3BBPA 2BI8A 1D04A 1EK2A 1O4WA 2WRZA 2B94A 1DCMA 3P0IA 4A0FA 2UXCB 4KBYA 2D2XA 2F1JA 4G6ZA 4KQ2A 2AUMA 3RGWS 1G6Q1 3X1MA 5IU6A 3W3AH 3ZBPA 1P0IA 1C0LA 3EZ6A 5IFLA 2O1EA 3G7NA 4MA4A 1F48A 3ONFA 4FTWA 2JIZA 4MWDA 5HKLA 4AJOA 4PIMA 2CB9A 2ZYIA 2XB4A 3FNHA 5K1ZA 3MUFA