1CLUA

H-ras complexed with diaminobenzophenone-beta,gamma-imido-gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
160
Chain Sequence
MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Guanosine triphosphatase stimulation of oncogenic Ras mutants.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cluA00
1WP9A 1G1MA 3UG7A 4DCUA 3FFAA 1Z63A 1BMFA 3OIVA 4O3MA 1YR8A 2XX3A 2HJGA 3LXXA 5LD2B 2ATVA 3WBKA 4OI2A 2JIZD 1G21E 2FGJA 3CPHA 1Z8FA 4HATA 4C0SA 4DC9A 2O8BB 3AVOA 1TAGA 4X8LA 1E0KA 1T9HA 3RRNA 1NG1A 1NIPA 4PHHA 1EGAA 3GLHA 4GI7A 2ZRNA 1ZCAA 3I32A 3OEHD 1TEVA 1S2MA 2WMOB 4IJMA 1LVGA 5EE5B 1EG7A 1KNQA 5F2EA 3N2IA 3WNCA 1VPLA 3Q9LA 1E96A 2BEJA 3TAUA 3U2QA 4ESVA 3FFBA 4TYQA 3ZS9A 1MV5A 3NHAA 5CLQA 4TLDA 1E32A 4URYR 3TKLA 2IYLD 3T34A 3I1FA 4PPNA 1IONA 4BFVA 1U99A 1H8EA 2OXRA 4BZXA 2ZM5A 3CRQA 1UJ2A 1GTVA 4Q1DA 2AD5A 2C8VA 5JCZA 4JLPA 2W2XA 1NVVR 3WRYC 2VSXA 5FUXA 4NYJR 2XOKA 1G6OA 1MOZA 2BMDA 3PUVA 5JJLA 1W5TA 1Z6GA 1GITA 4PHGA 2XNDD 4FXPA 4ZDJA 4PO1A 3H1TA 4FN5A 3EWAA 3GPLA 3M6AA 2REOA 1W4AA 5EE3A 4DUGA 1T91A 4MA4A 4Q1FA 4MYHA 3P32A 3IBYA 4MYCA 4PAQA 3GJ4A 2NZJA 3CX8A 3T1VA 2QAJA 3PV0A 1GKUB 1KAOA 2XXAA 1UFQA 3SHFA 2CE2X 2NZ8A 4TMTA 2R6DA 3THYB 1MR3F 1FPMA 2VO1A 1NY5A 2AL7A 2JDID 4RD0A 4DSOA 4IXNA 1COWA 1YQTA 2D2EA 1CULC 5EXXA 4EAQA 5K8TA 1Z0DA 3K0EA 3MWLA 4FMCB 4CYMA 5TVKA 2ZETA 4BE7B 4GZMA 1U8ZA 3OFNA 3M1IA 3RANA 1ZIPA 1R0ZA 2GVZC 2PL3A 3OAAD 5KDOA 2ZSEA 4PHTA 5JEDA 2D7CA 3K0AA 4Q9IA 1G3MA 4RD4A 1UBCA 2WSMA 4AD8A 3Q5DA 4XD7A 3N2EA 1VCOA 2ZSFA 2QTHA 1FTSA 3M0EA 2JJ1A 1P9WA 4Z51A 1OXUA 5KPJA 1E69A 3B1YA 1RFLA 3AVXA 5GJWC 3VMFA 1BS1A 3C15C 4OI0A 1E0JA 1G16A 1W48A 4KSBA 1JJVA 3B2EA 2O0HA 4LWZA 4HUTA 3J81k 1XTJA 3AVVA 3QG1A 1IY0A 2IUTA 4AI6A 2W0SA 5JI2E 4TT3A 4NYIR 4TYPA 3KKPA 1AM4D 2SHKA 3I8XA 2OCAA 5FUVA 4U5XA 5EQTA 3P26A 2V9PA 4AG5A 1WB9A 1GVNB 1KO1A 2W6IA 3QIAA 1SVMA 1G8HA 4QOSA 1ZINA 6Q21A 3O8BA 4V0KA 4KBGA 4LOAA 3SBDA 4D2IA 4F91B 1G3QA 2NIPA 3AVWA 1G9XA 4RD3A 4B76A 5JCPA 1E2IA 4CEHA 1KSGA 3KQKA 1UPTA 4R71A 2FU5C 2D3WA 1Q1BA 3QF4A 1HE1C 4URWR 2A78A 1ZUIA 2JIZA 4RD6A 3S1AA 1WF3A 3EZ7A 2ZITA 2L0XA 1KGDA 4JSYA 2VHTA 4M9ZA 5LD2C 4M4SA 2GZDA 2A5DA 1ZVQA 2H8KA 3DM5A 3K0FA 4OJQA 5CK5A 1NP6A 4JLVA 5CJPA 2CL0X 5AJYA 3I8SA 2N1BA 2X19A 2VPPA 4XVUA 3D31A 1ZAKA 1UM8A 4JBYA 2ZUDA 1T6NA 3IIMA 3OEHA 2ODNA 1O87A 2QORA 2CHQA 2ERXA 3HJNA 4PPFA 1ZM9A 1NVUQ 4TQUS 1P3JA 3LQQA 4JJZA 4WAUA 1Q1ZA 1WCV1 4HDOB 1E6CA 1T0HB 1ZD1A 2V1XA 3QEJA 2FFHA 4KBFA 3TRFA 5A4JA 3W6PA 3KTAB 4UJ3A 1WQ1R 2MMGA 3TVTA 1FP6A 3WP1B 3RS4A 5J4LA 5KO2A 4TTQA 1TPZA 2QRZA 2RHMA 3CLVA 2GESA 2O0KA 4Q03A 3NBFA 3TE6A 1G18A 5EP3A 2ZU6A 4NCNA 5D3QA 3DM9B 5EP4A 2RB4A 1VDZA 2AXPA 4U7DA 1LFDB 5G40A 3W5JA 5C4MA 3IHLA 4HZIA 2ZTSA 2A5JA 2UVQA 4FI3C 2PH1A 2XNDA 4UXJA 5DHFA 4II7A 1SZPA 5EE1A 2BBTA 1TU4A 2QY9A 2ZEJA 3CZPA 3EA0A 3SN6A 2UZIR 3SQXA 4QBGB 5EE0A 3VX3A 2CNWD 1Z5ZA 1V5WA 2JLXA 3UKDA 1U90A 1E2FA 1K6MA 3CNNA 1TF5A 2GVDC 2ORVA 4WZAE 4URVR 1X1RA 3SYKA 1OYWA 2JLVA 3HU1A 5KSPA 2JDIA 2QMOA 2ZR0A 4S35A 1Z0JA 1ZP6A 2QGNA 1OW3B 1XJ0A 2BKEA 4B32A 1OE0A 3B8HA 5FOSA 1I4TD 2O8DB 1U94A 4Q1EA 5TARA 1H8HD 1T3SA 3OAAA 2QNRA 5KPDA 1FNMA 2IX3A 5BYJA 3ADKA 5FOTA 2VL7A 1G4UR 3GMTA 1ZNYA 3QG5A 5IDVA 4HB0A 3DZ8A 4C3ZA 5F9HA 4JVMA 1ZU5A 3UXMA 3THWA 1QVRA 5EUMA 2C99A 3CBQA 1NI3A 4P0TA 5FTJA 3KFVA 4BLTA 2ZRGA 2D62A 2ZYTX 5DI9A 4OHXA 3R8CA 2RAPA 1HYQA 5L3SB 1GL9B 3CNOA 1RC8A 5E3HA 3IIKA 2WOJA 5FPYA 2EYQA 2DWQA 2QT0A 2DFLA 4RKEA 1CIPA 4LV5B 4QM7A 2X2FA 2OCYC 3BORA 2B8TA 2OM2A 4FMDB 2WIBA 4JLJA 2DB3A 5C1BA 3FPAA 5AR1A 4B2IA 4DXAA 2ZQ5A 2G6BA 4FCVA 5EUQB 3THXB 1KJYA 1HQYE 2J5XA 1QHSA 3BERA 4W9MC 1EESA 1FP7A 2VHUA 2ATXA 2YHSA 1U9IA 4MQBA 1NMZA 4I81A 3PEVA 4H9GA 4RFSB 5TY0A 4LHVA 1SVOA 1GL6A 2KI5A 2ZRJA 1Z0FA 2A5GA 4MRSA 4P4SA 1JQJC 2F9LA 1QG2A 2OT3B 3AQ4A 3QE0A 3I5XA 3VTKA 5BWMA 1DOAA 5IT5A 2DFKB 2VP4A 1P5ZB 3MG9A 2F3RA 4DEXA 4HLUA 1KI7A 4ARZB 4MKHA 1E2EA 1WBBA 3GLIB 1LV7A 5KNBA 3HDTA 1G7TA 1K5DA 3TLXA 2DHRA 1LS1A 3ZIAD 3AP2A 4JIMA 2Q3FA 2R62A 3AUYA 4W7SA 4CEJA 4KYUA 4BFWA 5P21A 1KI4A 2F1HA 1Z2AA 2O8EB 2ZANA 3X1WA 4C0AC 3SBEA 1E1QD 5KTYA 5FUYA 3C8UA 5AUPB 1JB1A 1RVDA 2RHDA 4GP7A 2F43A 4TZ0A 5JFGA 4ITRC 1Z47A 2EFGA 2QZ4A 2C9YA 2PEYA 1NBME 4W5WA 5JMTA 4US2R 1X6VA 1R7RA 1XFAA 1PLLA 1SXJD 2DYKA 4D0NA 1CJVC 2CNWA 2W58A 1KK0A 3DMNA 4A2PA 4IHQA 4LBYA 1R2QA 3A8TA 1LNZA 3GLGA 1KIMA 4B33A 2FFQA 1Q21A 3K70B 2V54A 5DN6D 2ZS8A 3L0PA 2GCOA 2KSQA 5SZIA 4BFZA 3PIRA 3E5HA 5DSZA 1PVOA 4XVQA 3LDAA 1K8RA 1R8SA 5DE3A 4P31A 3TK1A 2EFDB 4Q9LA 1IN5A 2D74A 1GKIA 2NO9A 5DH9A 2FSHA 1ZJ6A 4ZDKA 4PSAA 3F3YA 1P72A 4TYWA 1H8HA 3D6TB 2FH5B 3EA5A 1KJZA 3U4QA 2Z83A 4G3XA 3CF0A 3TJZA 4WXPA 3ZVRA 2GAAA 3FMFA 2HT6A 2ZRDA 1M34E 2GEVA 2PX0A 4YC7A 1SHKA 2YOGA 3T5DA 1E9EA 1W5SA 4DCSA 2CEAA 4NE2A 1N6IA 3NG1A 3K0SA 3IPYA 2OESA 1NLYA 4CDGA 4I1UA 1NN0A 4C30A 1XEXA 2H92A 3TUIC 4EDHA 3KX2A 3M4YA 3P20A 1SHZA 3ECCA 1AS2A 1PZNA 2GDJA 4DT1A 5KDDA 3V00A 2ZI6A 2HCBA 2RGAA 4HZUA 2FV8A 2WWHA 4TMZA 3W6OA 2QBYA 1JR3E 4NCIA 4KVGA 2QAGB 1YRAA 3BOSA 3VR5A 1YHNA 1XPOA 4FW9A 4EPXA 2OFOA 4LDJA 4UNRA 2B6HA 4CVNA 1GRRA 1CU1A 1IY2A 4HUQA 1CP2A 4GOJA 4OHVA 5BN4A 3CNLA 4DBLC 1S9DA 3EZ2A 2NPIA 1Z28A 3A36A 3RRZA 1XDBA 4G01B 2IWRA 4XWAA 3RS7A 4BQSA 4LY6A 1J2JA 3SE0A 4KXFB 1MT0A 5CYPA 1OFUX 2I4IA 2LKCA 5J40A 3REGA 2GNOA 3K09C 4LJ6A 5FPTA 5KNDA 2FGKA 3H84A 1CR2A 1SVLA 2VSOA 3GD7A 1RRFA 3QF7A 4D4LA 4FD2A 2IYZA 4NONA 2J87A 4MRPA 2QM8A 2OE2A 2DFNA 421PA 4KCGA 3CR8A 1AIPA 1WBDA 2RGNC 1AZSC 2WWYA 4A92A 4E07A 3FTQA 4Q4LA 1T0JB 4R2IA 4G5OA 3THOA 2IWHA 3FOZA 3TNFA 1RJ9A 1XCPA 2JLUA 2DWPA 4L9SA 1RW4A 1CJUC 3VKGA 4NTZA 1AGRA 2C03A 4Q48A 2KB0A 2QMEA 1NL3A 4FMDF 4M0LA 1GZSA 1E2NA 4Q9HA 2NTYC 3FE2A 1OHHD 4NDZA 5HCNA 4QFMA 1B0UA 3IPXA 1XEWX 1E9CA 5B57C 1E1QA 2A2ZA 4TL9A 2GJKA 1S4QA 4MH0R 3ADDA 3ZH9B 3TIFA 3IQXA 4RFVA 1QHHA 3QXSA 4UQOA 1N2CE 1N6NA 4IKEA 1R5BA 2Q21A 3TQCA 2MSCB 3BC1A 5B30A 4YDHB 3ZVLA 4HSEA 1G17A 1GNQA 3R7WA 4BFYA 2JAQA 1N5JA 1XPRA 2ZS7A 3LW8A 4XH9B 1P9RA 4PO9A 3RVBA 1SXJA 4DVGA 4BEJA 3X1XA 3Q5EA 2Q9CA 1IAQA 4LJ7A 4H1UA 4CEIB 3DEFA 4TN1A 2WPDD 2HLDD 3B82A 1P6XA 2YOHA 3GFTA 5DN6A 4DDWA 4A0FA 3EAQA 3HP1A 1ZM2A 2IA5A 4LUCA 3IGFA 5J5CA 4ERNA 1J8YF 1O3YA 4BGDA 4FCWA 5EE9A 3K70C 2IYUA 3ETLA 1JPNA 4V03A 5C4GB 4BASA 2GETA 2V1UA 1EK0A 1GKYA 3RWMB 2BCGY 1LF0A 1KO7A 1L7VC 1U0HC 4R98A 1G5RA 5DHAA 1KNXA 2KE5A 4DKXA 1FFHA 1M1YE 1F6BA 3FKQA 3LVQE 4DLXA 4Z1MD 5ELXA 1FMJA 1K5GA 1VCNA 2P5SA 4W5HA 4A2QA 4NHOA 2F1JA 4TLEA 4DCTA 3DO6A 1DADA 3X2SA 4MGZR 2OLKA 4D81A 1OYYA 1RRGA 4LJ9A 1XMSA 4L4UA 4M1OA 2P2LA 2Q3MA 4PPGA 1TU3A 2PT5A 2PJRA 1OIXA 4OQMA 1ZD8A 2IYSA 5CB8A 3HWSA 2Q6TA 3W8RA 4M53A 2G77B 1Z07A 3VR6A 3KXLA 2NG1A 1Z6XA 2IYRA 3B13B 2CHVA 3KQNA 1MABA 1ELOA 3VR4A 1E2DA 3N70A 5JHGB 3L82B 4A8JC 1VHTA 3NEJA 4EQ6A 3VNUA 1OKKD 2A7QA 3B78A 4L16A 4WIAA 4B3CA 4DLTA 3CO5A 2BDTA 1FL9A 1E98A 4CW7A 1AQYA 1NMYA 2G9NA 1W36D 1CBUA 4M22A 4EIWA 2GHIA 4Q7LA 2ZRFA 1E2PA 2QAGC 4POAA 1F2TA 4JT4A 2OV2A 1Z83A 3IQWA 3EG5A 1TQ6A 4RKFA 5GJBA 1A2BA 2J7PD 2QQEA 4ACBA 2ZROA 5JSZA 4B2PA 2ASEA 4K46A 2R44A 2HF8A 3BFVA 2DR3A 4B6FA 2ZR9A 1PLKA 2AKYA 5FTKA 1RIFA 4M21A 3D8BA 3X1DA 4S2EA 4V0MA 3KXIA 2G83A 3LXRA 1E0AA 1HEIA 2RGBA 1A82A 3ASZA 4MRVA 3KJGA 4LCBA 4YMTA 1II9A 2PLRA 4B3GA 2FE4A 3SJBA 2BMFA 5TMPA 2I1VB 4KITB 1GG2A 2CXXA 2BM1A 2PT7A 1OB5A 4B71A 2ZAMA 3L0SA 1E1RD 3UMSA 2GJAA 1P7CA 2ZI4A 1XU4A 1S9HA 4RY2A 1XJCA 4IFBA 1PV4A 4NYIQ 2H1LA 3ZQJA 4M2LA 3CUEF 1N0VC 4PC1A 4XTRA 4G0NA 1NVXQ 3ND9A 4Q4HB 1WXQA 4X8MA 4OQNA 4G5SA 4XWKA 4N1AA 2GWHA 4MKIA 2OBLA 3IEUA 2HV8A 2FJUA 3WNDA 4NKRA 2J0SA 3LBIA 1YR9A 4LHZA 3Q7PA 4JKYA 5KSOA 2EW1A 1OHHA 2OILA 2P6UA 1I4DD 2ZU0C 4A6XA 3LX8A 1OXSC 1VG9B 1TQDA 2ZRLA 1U2RA 1W47A 1XD2B 2CVHA 2RGGA 2ZREA 4PZYA 1HH4A 1FX0B 1BYUA 1HE8B 2CLDX 2QRNA 3QF4B 5ANRB 2GF0A 1NN1A 2Z5FA 2ZUCA 2NO6A 2AFHE 3RLFA 4AIIA 1R0YA 2VP6A 1IN4A 4DSNA 4TYNA 3AVTA 2BMEA 3V4RA 1E9FA 3P4YA 2WPDA 2HLDA 4PX9A 2WWGA 1E9BA 4CGZA 3I62A 2V6IA 1IXZA 3C5HA 1CTQA 2QROA 1I2MA 5KUTA 4C2UA 4LC0A 3KFXA 3AF0A 2J59A 3IIJA 2WJVA 1QDEA 3KJEA 1LW7A 3VKHA 1D6JA 2AXNA 5EXPA 3HPRA 1G5TA 3CR7A 4FCTA 4HB3A 3SC3A 2QU8A 2ZSBA 3LQRA 2J45A 4Z1MA 4F92B 1E79D 3QBTA 1R0WA 3LNCA 3TAHA 2OCPA 1OXTA 1MO3A 2H18A 3AUXA 3WBJA 1HQCA 3FWYA 4HI0E 3ZDQA 1KSFX 3AP3A 3RYTC 1D9XA 2W83A 2R2AA 5F9FA 1F5NA 1KMHA 3IUYA 2OUKA 3CWZA 4GBMA 2CHGA 3ZD6A 3HU2A 1TQ2A 2VEDA 4M1SA 2EFHB 4AYWA 3FKSD 3NH9A 4OKSA 1KJWA 1IY1A 2A3RA 1MRNA 2C04A 2OFXA 2C9CA 2XAUA 3WYGA 5CDFA 1CF4A 3P27A 3QUSA 1RZ3A 1IXRC 2ANBA 3W5IA 4C7OA 2CLSA 2EU8A 4LC1A 2WWIA 5BW8A 1XXHA 3E2IA 4Q1CA 3U3KA 2ZJ2A 4E5UA 4HDQB 1LS6A 2ZJ8A 3ZQ6A 4DEYA 2ZUBA 3NVAA 1UBEA 2C9OA 3G5UA 2D7DA 3MFYA 1VKJA 4LSGA 2QSYA 3LVRE 2V6JA 3O8CA 2J3EA 1OFIA 1G291 2YV5A 4HAUA 3VHLB 1KOFA 2YINC 4JBXA 4LHYA 2QMUA 2GZAA 4LYJA 2J7PA 4JKIA 1S3GA 2QQ0A 5J4HA 2FZLA 1IJFA 2JLRA 2I3BA 4U00A 1W0KD 1C4OA 3A4MA 2QP9X 2ZI5A 2MSEB 4EFLA 1J99A 1FUUA 3BB1A 1E2LA 2OCBA 4D25A 2WKPA 1E2GA 3U6KA 3KZ1E 1ZW6A 3MRSA 3W90A 3U7EB 4PHFA 4IVPA 5IRCD 2J41A 5CB6A 2J0UB 3RC3A 3THWB 1UADA 2BKUA 4PQYA 3RAPR 1TTTA 3DPUA 3DKPA 3SJCA 2FG5A 2JJ2D 1E1RA 3ZVNA 4URUR 4YQFA 2GXQA 2R6AA 1OV4A 1X1SA 2ZRHA 3A1VA 3GJXC 4IW3B 1GNPA 3CH4B 5JBQA 1N6HA 3QPUA 2O52A 2O8FA 2J7KA 2WJHA 1EX6A 4HAWA 1UKZA 5IF9A 1A1VA 3AVYA 3A4NA 1WE2A 5DNYB 1DAIA 3WXMA 4UNQA 3FHCB 1JECA 4ZPXA 3AKEA 2WJGA 5A0FA 1T3HA 4P4TA 4ASUD 1EWQA 3AF2A 2WJIA 1OB2A 2HJVA 2XJ9A 1OT3A 1A5TA 5DO9A 1DS6A 3PG5A 1AKYA 2YC2C 4RCYA 5GJVC 2CDNA 3PENA 1AA9A 3NC1C 3VR3A 3GLFA 2IBMA 3K8YA 3MSXA 4LYFA 2CCGA 3D3QA 4DZZA 5FPHA 1DG1G 1CR1A 4MRNA 4P4SB 4QBIA 5HKKD 3U44A 1W4CA 4QM6A 2GBLA 2OXCA 3PVSA 3U3JA 4QJ4A 3GJ3A 3W6NA 5JEEA 4BEBA 3LW7A 1ESNA 2VQSA 2JA1A 5KSZA 1EFRD 1N0UA 3Q3JB 1P60A 2Q9BA 1D2NA 3RS3A 3OIYA 3JVUA 2UKDA 4HLDA 2VF8A 3T15A 1XBTA 3IHWA 3W8NA 4QBFA 2JGNA 1SVSA 4QC2A 4Q18A 2ZI7A 4OL0A 3L8YA 2NPFA 2C77A 2BBOA 4M9QA 5GVSA 2IS1A 1N5LA 1M2OB 2QPAA 3CRW1 1E79A 1P61B 3CRVA 3SJAA 1NKTA 1G19A 2FEOA 4LBWA 1VG0B 2QTFA 2W2TA 3QJYA 3BD9A 3CIOA 4JL6A 2LWIA 1N5IA 3NKVA 4WW0A 4CF7A 2WKQA 2F43B 3H2YA 2VYFA 5A5GA 2FA9A 2XB4A 1WDTA 3FKSA 2P0EA 5GVRA 1G7SA 1W49A 4KFRA 3AKDA 2BIFA 2REBA 4L5BA 4H1VA 4QJ5A 2IYTA 1G64A 4YMSA 1KI3A 2ANCA 3GEHA 5JJKA 4YLGA 1F3OA 2VTKA 3CKLA 3CPJB 4Q1BA 3GLGB 2E1RA 3OF5A 3ICQB 1KZ7B 2WBLC 2GCOB 4QHYA 1NJGA 4D6PA 1VIAA 4G5GA 1ZNXA 2EFEB 2LKDA 2QL6A 4XSHA 5L3QA 3WMGA 1E9AA 2ZRPA 1KDOA 4OK5A 2H17A 4M1TA 4OHZA 5KOYA 1GRNA 1NVWQ 4XTCS 1W0KA 1DAFA 3X1YA 2V4ZA 4X8HA 2HT1A 3U4QB 4O0MA 2AK3A 1G3IA 2J46A 1KO4A 4FMBB 4LJAA 1XTIA 4O25A 5B64A 3O8RA 1SKQA 3BK7A 4FWIB 4Q4JB 1NY6A 3UMRA 1R6BX 2HDNB 3IO5A 3NIBA 2V3CC 4LBVA 4CZ2A 3QQ5A 3CRMA 4KO8A 3FVQA 3QKSA 4YMVA 3AB3A 4Q1AA 4XVRA 2NOAA 4MYTA 2JJ2A 1XEXB 3PQCA 2WIAA 3THYA 3ONWA 1T4GA 1YZTA 4DLVA 3LY5A 3RRYA 1AGPA 4TLBA 4B2LA 1KI8A 4DT1B 4E09A 4Q9KA 1Q22A 2Z43A 5JWHA 4HZUB 3K9NA 4AY2A 2NO0A 1E99A 4LPSA 2J1LA 2ZRMA 2B92A 3UANA 2A9KA 1S3SA 3BIFA 3PUZA 3U6BA 3A6PC 3LFUA 8OHMA 4HAYA 1JI0A 1OH7A 2ZAOA 4NU0A 4GMDA 3G0HA 1E94E 4US0R 4ASUA 4A15A 1II8B 3SDZA 4IVQA 4HUQB 4DLSA 4ZI2A 4LHWA 1MH1A 1XTKA 1E9RA 2V55B 1M8PA 2G3YA 3BB4A 5FBRB 4FMCF 3WHKA 3NHBA 5KU1A 3ICEA 1TQ4A 3I92A 4ZIRA 3NBZC 1Q12A 1IN7A 2ZJAA 1DEKA 2XTMA 3GLIE 1U9IC 1XTRA 4GT1A 3UWOA 2RH5A 4I4LA 5HKKA 2FPLA 1NIJA 1XEWY 5AJXA 1A2KC 5AUOB 4MGIR 4QL3A 2V7QD 3DVLA 3W3AA 4IOLA 2HEIA 1BIFA 3PUXA 1YE8A 1EXMA 4BFSA 2EFCB 4O2LA 1EFRA 2REXB 4ZI3A 2MSDB 1FW6A 4GL2A 3GCGA 1DVRA 1SVWA 5FPSA 4BLRA 3C4JA 3T1QA 1Y63A 4TMXA 1E9DA 3RC8A 3A1TA 5B2ZA 4HAXA 1RJ9B 4HLUC 3REFA 4Q66C 1T5LA 3T06B 1UDXA 2G1KA 4LHXA 2VBCA 5CM9C 4P32A 2AHOA 4TLCA 1Z0IA 2PZFA 1YZQA 2Q3HA 1CJMA 3IEVA 2ODEA 2P5TB 3KB2A 3EZ9A 2ZIAA 2QG6A 5EP1A 3QVUA 5J4YA 3HU3A 1NMXA 1OXVA 4JMPA 4TYYA 2N46A 2XTNA 1OSNA 4YDSA 1HY3A 1QHHB 1Z3IX 1W7AA 4JJKA 1CLUA 1N6PA 3L0OA 3KXKA 3SHWA 4HB4A 4KV9A 2IS2A 3AGPA 4Z8XA 2IF2A 1QHGA 3O47A 4GZLA 4NH0A 1P2SA 4B74A 5JI3E 1UEJA 4GNKA 4DDUA 4TZ6A 4E03A 3TBKA 3RABA 2OG2A 2D2FA 1U98A 5H70A 2JLWA 5FTNA 1F2UA 2HCJB 1U8YA 1U8AA 2W00A 1HURA 1NJFA 1Z06A 4HDCA 4KODA 3AM1A 1ZRHA 3FYHA 3KTAA 4Y0AA 1T3LA 2RGXA 2ZJ5A 3V4FA 3U60B 3A1SA 4RD1A 4UNSA 3DOEA 3IILA 2KBEA 4I99A 2Y8EA 1RRPA 3KQLA 3O8DA 5UKDA 3AF1A 2ZI3A 4JT2A 1QHYA 4WXRA 3C41J 4UJ5A 2F55A 3LX5A 2GK6A 3AKYA 1Z0AA 3NBYC 3NDBB 2J0QA 3R9IA 1XCGB 3WNBA 4X8OA 5LB4A 5FBLB 3TUJC 2JATA 3U5ZB 3FHOA 5SZHB 1S8FA 4D4JA 2A5FA 4BLSA 4MRRA 1X8LA 1HTWA 1SVKA 4Q7MB 5DYIA 1OH6A 4QHSA 4BFUA 2WKRA 3C16C 4IOMA 2WV9A 3QXCA 3I61A 2IUSA 3IKJA 2OEPA 3HYTA 4AK9A 3A58B 2JCSA 1FOEB 4GP6A 1D8TA 3A4LA 2ZXUA 1MABB 3C5CA 3CZQA 2NGRA 2FOLA 2QSZA 5FL7D 3ADBA 2WVJA 4PC3A 1N25A 1Z0KA 4PSKA 1NF3A 4A8JB 1YR6A 2BJWA 4GPTA 4MKGA 1MO4A 2BWJA 3K9LA 4BZPA 1NBMD 1ZM3A 5FOVA 4DHEA 5KNCA 1F2TB 1NLZA 4YMWA 4GDFA 5FOUA 4PO8A 1ZM7A 1CR0A 2XZPA 3A37A 4RSGA 4UNNA 1TF2A 5BQ5A 3AVPA 3PR1A 4KJZA 3MWYW 2YOFA 1C9KA 4I1SA 2HUPA 4EPWA 3QKRB 3B1XA 1DAEA 2WJJA 4EPVA 4OJKA 2KWIA 4DLZA 1RYHA 5H1YA 1Z6TA 3L0IB 2F1IA 5E7IA 4ZKDA 1EFHA 4C4PA 5JS8A 3WMEA 4OHWA 2HYIC 1G8YA 2BOVA 1KI9A 1SKYE 2R65A 1KZGB 2V7QA 5FL3A 3Q72A 5FUWA 1DE0A 3AVQA 4QNMA 4CRWB 4LYAA 2MMCA 3ZJYA 2FF7A 1G8FA 3W9YA 5AWFC 4A0HA 3H4MA 3A1WA 4PZZA 2I1QA 1NNEA 1P75A 2OBNA 1QHNA 2YWFA 3ZS8A 4OHYA 5FTLA 4EUNA 4YXWD 3FHTA 3KDSE 5D3MA 4TMVA 4PQRA 2WM9B 5K8LA 1RKBA 3AP1A 3E70C 3MJHA 3SR0A 4QG7A 2HXYA 3EC2A 2YNMA 1DO0A 4AKGA 4KAXA 4NP6A 3U61B 1S0UA 2ZI9A 4RFSA 4V0NA 4QXAA 3K09A 3K0CC 3ZIAA 3GLHE 4XOIA 2RGEA 4A82A 4ZCLA 4RD2A 1SKYB 3LA6A 2PCLA 1JR3D 1UKEA 3CB4A 2BEKA 4LI0A 4NL4H 2OLJA 2PX3A 3U3RA 4V02A 4IRUB 4W5JA 1HT1E 3GJ7A 3PITA 1NRJB 2RGDA 1KY3A 2O0JA 1Q1EA 4CIDA 2W0MA 2XXAB 1QF9A 4N3NA 3FDIA 2GJ9A 4LV8B 4B75A 1L4UA 1XPUA 3L43A 5CJ2A 4AC9A 2E9SA 1VG8A 5HE9A 3KJIA 3CX7A 2CJWA 1MKYA 4LJ5A 4TMKA 4AWXA 2FWRA 3GLHB 1IN6A 2IK8A 4AKIA 3MMPA 4ZCIA 2ZE8A 521PA 4EJSA 1D5CA 4R7ZA 2RCNA 1L8QA 4L15A 2ODBA 3KKMA 3LAWA 4PTLA 2XZLA 3GFOA 2FZ4A 3NXSA 1KTVA 4TL6A 2RMKA 4GRAA 3RS2A 1US8A 3SNHA 2ERYA 1W4RA 1KDPA 5CIQA 3UATA 3KKOA 2VP5A 2YJTD 4NCJA 3ZYCA 2QM7A 3I3SR 2OBMA 3OIWA 4LPKA 4MUAA 5M04A 3KQHA 1BH2A 2B7BA 1F60A 4EPYA 2YC4C 3VU9A 3IO3A 1GIAA 2ONJA 2QPOA 3AF3A 1DTSA 2B21A 5LPNA 1VCIA 5CLLA 1KMQA 2ZRIA 5KDLA 3NEYA 3RRMA 1DAKA 2X8AA 4HAZA 1N0WA 3LD9A 1CR4A 2RGCA 4U02A 4ZDIA 1DAMA 1NLFA 3U7FB 1FMLA 4JSTA 3ZLJA 4EFMA 1G8GA 4JLNA 4AYXA 5FL7A 1ETUA 2FN4A 2QI9C 1UDWA 2GZHA 2WWXA 5DI3A 2D4HA 4OYHA 4RJLA 4RZUA 4DIDA 3CX6A 3OZXA 3PXGA 4F93B 4QGFA 5L8VA 1W36B 3I73A 5GADl 1KK3A 1NBMA 2ZRCA 4HLCA 4IOKA 4Q01A 1OH8A 2GKSA 2YYZA 2IYVA 4JYCA 3UWKA 3PEWA 4M8NE 3UMFA 4Y0VA 1HV8A 4OQLA 3ZGXA 1NSTA 4P4UA 1P73A 5H68A 3SJZA 4A9AA 3EZ6A 4RZXA 4JVSB 5F3WB 1GFIA 4HLQB 4OI4A 4J0QA 2WJYA 5LBIA 4JLDA 1P9NA 4DCVA 1W46A 3K0AB 4D26A 3VNVA 1YRBA 3GEEA 4HAVA 4Z8YA 2F9MA 1KI1A 4P3YA 1X8KA 1G7CA 1GOTA 2J0VA 3QXHA 3OEED 4ON9A 5FBQB 5AJZA 5TXGA 4URXR 2QMHA 2GJSA 2QAGA 4TSFD 4TMWA 1XZPA 4FIDA 4OI1A 1R8QA 4AYTA 1Q20A 1NG9A 3AEZA 5FFMA 4JVLA 2O8FB 121PA 2XITA 1SVIA 4YMUA 4GFDA 2D06A 4BRWA 1EWRA 5SZJA 4YXWA 2XEXA 4DIEA 621PA 221PA 3BBPA 5FI0B 3TR5A 1ODFA 1XWIA 4A2WA 4A36A 1UKYA 1ZUNB 1CEEA 1A7JA 1XB2A 2PZEA 3LLUA 1Q0UA 3TH5A 3KQUA 1ZUHA 1OIVA 4QJ3A 3EASA 4MUBA 2NO1A 4WA7A 4JLAA 1JR3A 2ZPTX 4OK6A 1OFTA 2EVWX 3GLFB 1TF7A 5C46F 1E2MA 4LJYA 4C0BA 1SGWA 1PJRA 4D82A 1R0XA 1EX7A 5FTMA 1Z22A 3P1JA 3NDPA 3S1AB 3U44B 1D9ZA 1W0JD 1JQLB 1U0LA 3B6EA 3K0FB 4DDTA 4US1R 2VLIA 3CPEA 2IS6A 1FNNA 3P4XA 2AR7A 4NBSA 5F98A 2HF9A 3GJ8A 4HYYA 4A0RA 3LLMA 3OE7D 4B3FX 3I72A 5CIWA 2IYXA 2AFIE 3VQTA 2XB2A 2CCJA 1UF9A 3WYAA 4Q4AA 1E3MA 3QPWA 1NN3A 2CE7A 3JZMA 2OO7A 1M7GA 4KFUA 4N0EA 3VHXA 2ZE6A 2VRWA 1XEFA 3BH0A 3BH7A 3TGPA 2BM0A 3CM0A 4LX0A 4A6PA 1ZM4A 2F3TA 4KSCA 1KI2A 3QXXA 2JLQA 2FSFA 4KU4A 1G4AE 3C7KA 4CEIA 3GQBA 1YVDA 3IBGA 4Q47A 2WICA 3EZFA 1ZC3A 3B60A 2ZRKA 4IDHA 3MWKA 3NWJA 5DISB 1M74A 3JVVA 2IXGA 3Q85A 1XZQA 4KHZA 4BPBA 1W2HA 2ZYUX 5G53C 4QBHA 2AN9A 4IFEA 3CW2A 2FFAA 5B58C 5HCIA 2O8CA 1KDRA 2W2VA 1RE0A 1OJLA 4V0OA 3EARA 1AK2A 1VECA 4NYMR 1OKKA 1UAAA 5L3QB 2GTPA 2X77A 4M1MA 1W36C 5EJEA 1M7BA 4PAMA 4MGKR 1QZXA 2FSIA 4KFSA 2WSSD 2CK3D 4TLAA 1G8PA 3H86A 3SZRA 2CVFA 2A5YB 2PMDA 4GMXA 4DLYA 1KI6A 5GJCA 2EWVA 2HXSA 1FUKA 2QPTA 2R6FA 1TEXA 3GJ0A 4GOXA 4LYHA 3SOPA 1G20E 2VF7A 4WZBE 2WHXA 2GEDA 4TTPA 4BZQA 5C2JB 4KLZA 1JEEA 3SYLA 3L2OB 4OQXA 3QKSB 4NCHA 3TSWA 1ZCBA 3OEEA 2IYQA 4MKFA 1DELA 3Q7QA 2H7VA 4HB2A 2WWWA 1E2JA 2DCUA 3CWQA 4PFSA 4TSFA 3SFVA 1XX6A 2BBSA 2P3SA 5H8WA 2JEOA 3TW8B 1E2HA 1FZQA 1YJ5A 2FDCA 4F7WA 5BXQC 5G3ZA 4MDEA 4B3XA 2BCJQ 2UZ3A 2ORIA 3UIEA 4TL7A 5IHPA 5E95A 2ZS9A 2GK7A 5JJIA 1XTSA 3ND8A 3VR1A 2FPKA 2WWFA 4RZ3A 1KKLA 1MRSA 4LV6A 3C14C 1Z08A 2EWWA 4C0JA 3VX4A 2DY1A 1BOFA 2XNSA 3BGWA 5AJVB 1OXXK 1YKSA 4TWZA 2PJZA 3OESA 3SYNA 2H5EA 5K8UA 3QEOA 4ZIRB 1XRJA 2JASA 3G82C 3HR7A 2DPXA 2P65A 3EPLA 3EPHA 2ZJYA 4DB2A 3W3ZB 2ZRAA 1E2KA 3TSZA 4R9UC 3EIEA 2G0NA 3T61A 1W0JA 2JJ8A 4Q02A 3RWOA 1IJEA 1VCMA 4Q4HA 2GEUA 4WZ6A 5EXSA 5KSYA 2GBLC 1XMJA 4CEHB 4AG6A 1OH5A 3QVVA 2BC9A 2Z0MA 3R8FA 3OE7A 2X2EA 4DDVA 2OAQ1 1XCMA 4CT4B 3SS8A 1BKDR 5J4VA 2VP9A 1ZBDA 1IQPA 1OFHA 4L8GA 3MCAA 2ORWA 4M9XA 5HZHA 2P6RA 2ZJOA 3FB4A 3KUCA 5JLJA 3E1SA 4NCKA 4DCNA 3Q8XB 1XD2A 2CLCX 1FX0A 5E7MA 4BRUA 4DLWA 1MO6A 4RCZA 3SU8A 3GLGE 3KKNA 4PAOA 5CK4A 3B7GA 4A4DA 4CEJB 5J4KA 1CS4C 1FQJA 2Q9AA 1Q44A 1S1CA 2BV3A 3NH6A 4IDQA 3F5FA 1QHXA 4A1FA 4EPTA 2O8BA 1JBKA 4NZYA 5JRZA 1PUJA 3V9PA 1G41A 1KO8A 2GA8A 4NPHA 4F4JA 2F1RA 1QBKC 1P2UA 1JAIA 3KUDA 3WMFA 2YKGA 1F2UB 1XMVA 2VH5R 4Q19A 4D4MA 5JECA 4XSGA 5K8IA 5JZVA 5E4FA 2IHBA 3I5YA 5G41A 5LDDC 1AS3A 5AUNB 5L3VA 2N42A 5EXTA 3H0KA 2WSSA 2CK3A 4HEJA 3WRXC 3SFZA 4Q7JB 3TUZC 4KVAA 3SEAA 4D80A 4B6EA 4C9BA 3X1ZA 3R20A 4Q7KA 4UXHA 1W44A 5IK2D 4LRWA 5LB2A 1T8TA 3EIHA 3IDQA 4I1VA 2CCKA 1AS0A 3K53A 2IYWA 3UG6A 5JWRA 1C1YA 3UK6A 2FMXA 1N6LA 4QRHA 1HT2E 2BJVA 2IXFA 1E9SA 4M1WA 4KFTA 4P33A 4PR0A 5TB5A 4FWTA 4QGGA 4TTRA 1HUQA 1GDDA 2BHRA 4C0KA 1J8MF 4BFXA 2QN6A 4UKDA 2WMNB 3PJRA 3EW9A 5G3YA 1UKVY 4LK2A 4ZCMA 4ESHA 3EIQA 1GP2A 3UPUA 3OIUA 2QBYB 2VP0A 4PSVA 2OAP1 5EZ5A 4F4IA 1KSJA 2QA5A 1UBFA 3MJRA 3BFKA 2H16A 2AK2A 1U0JA 3U7GA 4D4KA 2C96A 2IL1A 3BXZA 2J0UA 4JS0A 3AH8A 4PANA 5HE8A 1KHTA 1Z6YA 2HYDA 1JALA 1P2TA 3D7MA 5HZKA 4A0GA 1NSFA 2ZSAA 2ONKA 3BWDD 1KDTA 4BLPA 5JHHB 2BBWA 4AKEA 1Q1QA 1VIYA 1Z2CA 2XSZD 2QTVB 1YZKA 1L4YA 5FR1A 1Z29A 4JL5A 5FOWA 1E2QA 4D0GA 3DKVA 1N5KA 5FR2A 3ZZTA 2IT1A 3GFPA 5DLQC 4BECA 2DBYA 2FX3A 3AF4A 3T12A 5FBVB 1XD9A 1I4LD 2O5VA 1DPFA 1TNDA 1BYIA 3JZAA 1JEDA 4PPQA 2Z4RA 3B1WA 3BB3A 1CXZA 2VP2A 1ZC4A 5KHOC 3T35A 1TUEA 3K1JA 2PBRA 1SULA 2PEZA 3VR2A 5D3MB 2YZ2A 2KBFA 4G1UC 3SQWA 5EP2A 1SXJE 5C18A 1HA3A 1IOZA 1Q3TA 2YWGA 4MGYR 3B1ZA 4EKDA 4B35A 1VYTA 4DB4A 5E7JA 2IUUA 3CF6R 3ASYA 3BE4A 3EPJA 1BO6A 2IW3A 3RS0A 4F38A 4C2TA 3FMOB 5BYKA 1N6RA 1W1WA 3MLEA 1KSHA 1IBRA 1T5IA 2QUZA 1X3SA 3R9WA 1KKMA 1GNRA 1N3BA 4TL8A 4B48A 1YU9A 4M1YA 3TMKA 4B43A 4ZDWA 4C0HA 4UNPA 4ABYA 4ZV4A 1G3RA 3R7WB 3LO5A 1AKEA 1SXJB 1VMAA 3EPKA 2V8OA 1VYUA 4TQ9A 4WBSA 4R2HA 3GJ5A 2K5UA 2CJWB 3B85A 4D0LB 4KI0A 4IDNA 4OBEA 4MDFA 2NMVA 2ECKA 1EFCA 3B9QA 4EJSB 1ZYUA 2QE7D 2ZRBA 1YZUA 1AZTA 4ILEA 1AQUA 3QY0A 2ZYWX 821PA 4BFTA 1OLOA 2C78A 2VA8A 4XJXA 1US8B 2Z4SA 1N6KA 2AWOA 2GCPA 2QP3A 3BH6A 3K9GA 1EFUA 3EC1A 3WHLA 4ACAA 3QKUA 4PC7A 4JLKA 5IK2A 1TL7C 1DG3A 3CONA 4CT5A 1YR7A 1N6OA 3TSOA 1GRQA 2ZSDA 2R6CA 3QXJA 2OZEA 3VU9B 2VIIA 2WAYA 3DDCA 2PZGA 1V43A 5HTKA 3AVUA 1XF9A 2P67A 4GOKA 1YZNA 3GP8A 2QT1A 2G88A 4KLNA 4XWOA 2C95A 4WVFA 1YZGA 2GXUA 4JLMA 5AJWA 3MAAC 5DYGA 1TADA 2PLFA 3RNLA 5JS7A 2AKAB 2CMKA 1II0A 2AWNA 5SZKB 2WTUA 3OHMA 3K70D 3FMPB 2QEQA 2RKOA 4LZZA 4V0ME 1ONBA 1CRQA 2ODWA 5DI3B 1PUIA 5FPKA 2VHQA 3BS4A 1ZU4A 3CF2A 1LTQA 2O8DA 1E4VA 1DARA 1G7RA 1G5PA 1QVAA 4EQ6B 2YWEA 2ZE7A 3NC0C 4IXMA 4N0DA 4C0QC 3KJHA 2FFBA 4Q4JA 5JRJA 4EFNA 5FOXA 3U3OA 2YVUA 1NKSA 3MGCA 2E87A 1ANKA 1GILA 2GXSA 5AUQA 1AN0A 1H65A 1OIWA 1CKEA 2IEYA 5JSZB 2IF0A 1TX4B 2CL7X 1OF1A 3N5CA 3ZZUA 3EXAA 1U81A 2ZYVX 4RZ2A 5BN5A 3I4LA 2CL6X 2W6JD 1R5NA 2QP4A 3QSYA 2XSZA 3BRWD 4M9SA 4Q9JA 2R9VA 3F8TA 3QPVA 1XP8A 2GILA 4JBWA 1X86B 1Q3HA 1ZIOA 1JXMA 4AURA 2ZJZA 1XD8A 3NBXX 5L3SA 3LBNA 1ZNWA 1RYFA 2ZVQX 1FTNA 3AKCA 3KL4A 5JWOA 1XNJA 1E0SA 2CBZA 1G6HA 2GJ8A 2ZJBA 2PCJA 4L9WA 5DIFA 2A30A 4TQAA 1AJEA 1II8A 5J47A 4I1OA 4B73A 5BN3A 3BAFA 3W34A 3ADCA 4LJ8A 3QI2A 3F0TA 1CRPA 1GWNA 4DLRA 1W2GA 2JLZA 3THXA 1DO2A 3DL0A 4IOJA 3PCRB 3HYRA 1R4AA 4JLOA 3HR8A 2C2HA 2F7SA 3LRPA 4YONB 4MYUA 3FGNA 1VG1A 3TQFA 4XIGS 1J7KA 3R9XA 2NQ2C 5AK0A 3T1OA 3U7HB 1OPXA 3PFIA 2EQBA 5FBWB 3FMIA 3ZVMA 1RRCA 4JYBA 4LGMA 1TMKA 2AX4A 3HPQA 4JL8A 1DAGA 1Y3AA 2H57A 3LWNA 3AGQA 3CRRA 2G0TA 2RGNA 3TR0A 5KYKA 2XTZA 5L3RA 3DMDA 3QKTA 3DHWC 1RPZA 4ARZA 2OSBA 4C0LA 1SQ5A 1SXJC 1X8JA 2F6RA 3K0CA 3GLIA 3BJIC 3LBHA 2C5LA 1W4BA 2X1VA 4BWYA 1QG4A 2OHFA 4URZR 4PXAA 4LJ4A 1ZNZA 2QE7A 5FH9A 2FSGA 1QHIA 5CDFE 4Q4AB 2O8EA 2Z6VA 4EJSC 1JR6A 1VYVA 2TMKA 2WAXA 1XXHE 2G1JA 1DAHA 3PEYA 1GAJA 1MO5A 1BMFD 4PC2A 3VAAA 5FI1B 1GM5A 1T8UA 3WYFA 1P4SA 2WOOA 4OQFA 1QRAA 4DWJA 1A4RA 2YWHA 4IVRA 2NO7A 4QNRA 1P62B 2XJ4A 3WY9A 1JJ7A 1KMHB 4B44A 3LH5A 2PMKA 3PUWA 2C98A 5EZ6B 1S1MA 1PLJA 1LY1A 1FQKA 2QENA 4DSTA 1ESMA 1GUAA 2VHJA 4B47A 4C7OB 4F4CA 2BVNA 1XXHB 4NYMQ 2O8CB 1IHUA 3T5GA 4GSYA 1F48A 1TUIA 3RHFA 4FINA 1S96A 1CJTC 1EFTA 1Z6AA 1NVVQ 1ZMXA 721PA 4NYJQ 4Q00A 2IEZA 2IS4A 3QBVA 4UXIA 1E4YA 3CH5A 3TW4A 4BUJA 1P2VA 1M7HA 1H8ED 2ZE5A 3TVDA 4DRZA 2R8RA 2FPMA 4JLBA 2AD1A 1KI6B 3QNUA 3RSLA 2R6GA 2QGZA 4NMMA 4PZLA 3LV8A 1JXOA 2W6JA 2B8WA 2XOKD 3ZZ0A 4JZKA 4MITA 2IYYA 4JVNA 5CM8B 3KKQA 5HR5A 3MUFA 3SI7A 4Z54A 1J90A 2EYUA 1JPJA 2IHYA 5CYOA 2XGJA 2J9RA 4QGHA 3GJ6A 4LBZA 4A8JA 5TV2A 3B9PA 2ZR7A 4DSUA 4DUGD 4EPRA 2VSFA 2FNAA 1B23P 4O2RA 4DJTA 1IN8A 5HPYB 1ZD9A 2BMJA 1UBGA 3GLFE 2VHCA 4OK3A 4AKHA 1LF5A 3AV0B 1WMSA 5TDHA 2GCNA 4B3BA 1R10A 3EWSA 1IXSB 4Q21A 3KB1A 4PQFA 4B3DA 4E22A 3U3MA 1WRBA 2GAOA 3NTUA 1COWD 4IEIA 4WOPA 3DZDA 5CITA 4PC6A 1KY2A 2OFWA 1VHLA 3MWJA 3OFND 4IDOA 1R5OA 1JAHA 1KAGA 3QKRA 4G5RA 1Q57A 3RSOA 1XTQA 3QENA 2DFTA 4Q5IA 4KYIB 3K9HA 1GSIA 2GRJA 2FEMA 3BFXA 3B1VA 4IEEA 2IC5A 4IDPA 1LB1B 4XD7D 3VFDA 1NN5A 3T1TA 4QHTA 4QGAA 1GL7A 3WP0A 2JJ1D 2ZVPX 3L8ZA 3VKWA 4BLOA 3EX7C 2GXAA 1I2DA 2Q0HA 2JLYA 1IM2A 3PEUA 1J70A 2XZOA 2DWOA 2WZQA 1D2EA 3RS5A 3GEIA 1VTKA 3QOFA 3ZD7A 1WA5A 1KK1A 1G3UA 1L2TA 4ZKEA 2LCFA 1UEIA 3PUYA 3B5JA 1D2MA 4TT3D 4ZO4A 2GF9A 1JNYA 2B7CA 1KK2A 4K8OA 4RVCA 4DLUA 2KJQA 2P6NA 3A1UA 5DGXA 3DOFA 4G5QA 1KYIA 1YZLA 2IXEA 2JLSA 2W6ID 4M1KA 4BLQA 3MD0A 1XMIA 4QKQA 1KO5A 3RDPA 1XJQA 4V0LA 1CJKC 4K81B 4B34A 1DBSA 1M6NA
chains in the Genus database with same CATH superfamily
3ISVA 3UT5A 4O4LA 4DMCA 1WP9A 5HIAA 3RSHA 1XDWA 3FFAA 4NCAA 5FCDA 4PX5A 2FRDA 2ZUTA 3OIVA 3LXXA 2C3OA 1LTKA 1IIBA 4TUYB 1CFJA 3CIFA 3EOAI 2JARA 4GZ6A 1NNUA 2P79A 1HX7A 3CEHA 3VGPA 4E70A 4NV1A 2O8BB 1DWUA 2XQVA 2C84A 3W9SA 4B6PA 1VIDA 4Z9XA 4DUPA 3ESXA 3L8DA 5EJMA 1E0KA 4FSDA 3TRIA 4B7ZA 1I9GA 3A05A 4M86A 3CLHA 4LCJA 5CB4F 3GGDA 2QUAA 3GLHA 1ZCAA 1ULHA 1QWSA 1JW9B 2HX1A 1WO8A 3GFVA 3O4VA 4RQTA 2ZT7A 4UZFA 4PLWA 3COPA 1OVMA 2O7RA 5I3CA 1M67A 1ECPA 4ND3A 4G0MA 1GXSB 2FKAA 2R85A 2WLSA 3RVDA 4KIJA 2WQZA 3I6MA 4ESVA 3ZS9A 3DV0B 4CM9D 2W11A 1AGXA 3G59A 3CO0S 3OOHA 3UXEA 4O2BB 1KORA 5ES3A 4QX6A 2J4FA 1UC9A 4UVHA 1RM4A 1Z39A 2ZB7A 4F5EA 4GX2A 3BXOA 3LT0A 3N2ZB 1X7GA 1U99A 3HLTA 3QOXA 5AHKA 2HL6A 3ZCVA 4ZC8A 1UJ2A 2W4MA 4Y1FA 4D9EA 4BBPA 5KWEA 4U7DA 1BCRB 1D6NA 5EMHA 2AGVA 3DHVA 2B20A 4JLPA 1KEEB 2W2XA 1NVVR 3UCEA 1Z4PX 4ALNA 5JE8A 2OM6A 5I7SA 3GPCA 4BO0A 1G6OA 1MOZA 2QD2A 3PUVA 1G0NA 1Q0PA 4YRKA 1GITA 2ZUFA 3OIDA 1M2EA 3ZDRA 2K7FA 2W8BB 3H1TA 4FN5A 4IBOA 2ZAYA 4K6HA 4QDUA 3T4PA 2JJMA 3GPLA 4DR6B 2HQ1A 3FDZB 4KX5A 4FNMA 2RHOA 1WUTA 1DCMA 2X86A 4Q1FA 3BSWA 1T9KA 3ANSA 1VKNA 4MYCA 4YROA 1ZDMA 5LBUA 1NF8A 3I05A 1W581 3ER9A 2HTFA 1KAOA 2PXAA 3AJRA 1UFQA 1LLUA 3P9SA 4XZ3A 3SHFA 3ZE2B 4H6WA 1FVXA 3BHJA 4UREA 1FPMA 3TZHA 1PZGA 4CWAA 1ACJA 1UQTA 2AL7A 3OCJA 4AMBA 4DSOA 4IXNA 1PJLA 4MMYB 5LQAA 1YQTA 3B2NA 3PXDA 2BFEB 3C43A 3IOMA 1CHNA 5ESDA 4I5IA 1X15A 1GLVA 2JGKA 3K0EA 1B7GO 3VPCA 2ZETA 4GZMA 3NXKA 1Q19A 1U7PA 3M1IA 4UEOA 3BDVA 3NEPX 4KB5A 3RANA 3K9FC 1WUIS 1ESEA 2HCFA 5B4UA 2X40A 4XUGB 5KDOA 4PHTA 2XIQA 2A0FA 4HH0A 1QGDA 2Q4RA 2P2NA 3U4AA 1N5RA 4D5EA 4OCZA 4TZKA 3IDZA 3FI9A 1TLTA 2RH9B 4YMGA 5ITWA 3MYRA 4ED9A 2JJ1A 4JUCA 4AUMA 2VRCA 1P9WA 1S6YA 1OXUA 2JHFA 1E69A 5FP0A 4B6JA 2FRVA 3HNPA 1FS5A 1RFLA 4D45A 5CDGA 3AVXA 1RAAA 4N6GA 3VMFA 4OI0A 1G16A 1Y9EA 5IAAA 5IM4F 3B2EA 1Y5MA 1W88A 1VJ0A 1TJ4A 3BFJA 3EMKA 4QJBA 4WBXC 4WI1A 4HUTA 1XTJA 2VWGA 5LN1A 2WT4A 3PEFA 4O4IA 4YRNA 4E3WA 2VT3A 4NYIR 4D9GA 1P4HA 2BHTA 4KWTA 2SHKA 2PWBA 2FSUA 3DFUA 3I2HA 3IUPA 3K6KA 4UMFA 4JAVC 5EQTA 3SLKA 1W76A 3GFSA 2IODA 4AG5A 4CIWA 2O05A 1WB9A 3QIAA 2W6IA 2ZPAA 4QPNA 1YCGA 3EGWA 3V7UA 1KJNA 1XZKA 4AUKA 4QOSA 1ZINA 4RK5A 3CEPB 1RIIA 4HFJA 3BXXA 3BD7A 5D86A 2NIPA 1WXGA 1N2SA 3IBFA 3MWFA 4RK0A 3UJ9A 4BKPA 4RD3A 5JCPA 1IC6A 3L9WA 3Q1LA 1TYZA 3JQ7B 4QOJA 1KSGA 3UC9A 4CEHA 1PT8A 4QICA 2FU5C 3WGLA 3QF4A 1I4WA 4OGWA 4URWR 3MQFA 3SFTA 3R0ZA 4RD6A 1RQ2A 2HMYB 3MF4A 4GL4A 4CIAA 4JSYA 2VHTA 5ICEA 5TS2A 2FX5A 2GZDA 4BBJA 5HRAA 5JZBA 2DY0A 4FSXA 4OJQA 4O33A 1O0BA 1GZ6A 2DFDA 5CVTA 2E1PA 4JLVA 2H3HA 2XGMA 1JEYB 5J2UB 2N1BA 2TECE 4MEAA 2SKDA 2X19A 3KDAA 4NFLA 3URKA 1ZAKA 3VO9A 5FX2A 2W2PA 3ZKWB 2A9PA 4JBYA 3FLEA 1T6NA 2I6QA 3B8EA 4DMUB 1MG0A 5LIRA 1XZBA 5JMWA 2JAUA 1T3TA 1NGSA 4Y2TA 2B4QA 1HL7A 2VDPB 3EUFA 3NLLA 3DQQA 1FPQA 4CM9A 4EY8A 5KNBD 3I2FA 3H04A 1Q1ZA 5B1DA 1PFWA 1T0HB 1ZD1A 3RTCA 3R6WA 4UMVA 5EWJB 4RYLA 3RS4A 4X63A 2V9CA 1BHSA 1PTKA 3G8YA 1SQFA 2X0IA 1TPZA 3G0GA 3S44A 4ZZ2A 1QZUA 2O2CA 3CLVA 4IJ6A 3SYTA 3L8FA 4Q03A 4CGYA 1DC5A 1GZ5A 2ZCVA 1E6EA 2HLNA 3M9WA 3O5AA 4JT8A 3RAGA 3SQLA 4ZO9A 1WOYA 2AXPA 4R8SA 1U5BA 2XECA 3S70A 4FWBA 1UDBA 3VPXA 3WRWA 4BJ1A 2PS3A 3QTLA 3T52A 1F2DA 4CUZA 1A0OA 9ABPA 2PH1A 5JPIA 4UXJA 5DHFA 3ZGOA 4MICA 3IVMA 4AKHA 2PTHA 2ZEJA 3IR5A 2IDKA 5EE0A 5M5BA 2H31A 3B9RA 1CIJA 3PS9A 3QE4A 1U90A 4PNPA 3IP6A 4JDUA 2AJBA 3W2TA 1LRJA 5C80A 1SIBE 1K6MA 3DR3A 2ORVA 2IUYA 1IBCA 3QSGA 3WKAA 4DPKA 3BWXA 1GTZA 5CRIA 4U7JA 2QGNA 4QO8A 2YV3A 2W2KA 3V4OA 2X42A 4B32A 3UAYA 3BCSA 3B8HA 4B9EA 4RLSA 5K3OA 4WUTA 3B12A 3FFTA 3NHWA 5K09A 5IXSA 5TARA 3OT5A 4RIHA 4AX4A 3WGUA 1H8HD 2BDUA 1HKUA 2W6QA 4INPA 1YOVB 2G4CA 3VZSA 4DQDA 1XRNA 1CS0A 4P7JA 5KQLA 1JIVA 1YDHA 1AUPA 3NTVA 3FUWA 4BNYA 5ALGA 4EG0A 1E92A 2ZT8A 4L3WA 1H4QA 1X1CA 2G67A 1ZSNA 3GMTA 4DNFA 1HGXA 3PYLA 3QG5A 1K7XB 2JZNA 3E1GA 4DS3A 2GTIA 4BXOB 1EE1A 3UXMA 3NYWA 3BKWA 1QVRA 3V4LA 3UWMA 2ILVA 1IG3A 4P0TA 2VQ3A 2YL2A 2JFYA 3KFVA 5FTJA 4MULA 1ZAYA 5EMMA 3EDOA 4GYYA 1EAMA 1HEUA 1UJ6A 2GN1A 1QUEA 5I4IA 1HG0A 1JMYA 4OHXA 4YJFA 3LQ2A 3SNKA 3DL7A 4E5NA 3JQCA 1X39A 3CUKA 3AERB 3C3KA 5E3HA 2EZ8A 3W05A 2WOJA 5FPYA 1BS2A 1OC2A 1JF8A 1GUZA 3VR5D 2RBKA 2RHCA 4LECA 4S1NA 3S2UA 2X2FA 5EVJA 1RLTA 1XYYA 2B8TA 2NSJA 1OZGA 4WUVA 1JHXA 4NRDA 4CM7A 4D1YA 2FPGB 1GTMA 1K8QA 2V58A 3IX7A 2WINI 1QG0A 3F78A 2HRRA 3V8BA 2C8KA 3F7OA 4FCVA 3ROFA 5EUQB 2VF2A 3AWDA 4YAWA 5ITSA 3T1HB 3ILYA 1FP7A 2DT5A 2VHUA 1JJIA 3CLTC 4QXRA 2I99A 4GPAA 4NR0A 2OBXA 5TGDA 1U9IA 4B3TB 2N1MA 2Q3JA 3W6UA 1NMZA 3EBLA 1KEZA 5KHLB 1OI4A 1PR4A 1BSVA 1JS1X 2J07A 4I50F 2A84A 3SZLA 1TFRA 3R9XB 2XCIA 3CZCA 3JTEA 5ALLA 4C87A 4PY2A 3D8TA 1XR3A 4R2LA 1JQJC 4O63O 2Q4OA 3R7NA 4BB6A 4ZYUA 5FA6A 1UMDA 4FJ0A 3EZYA 3T3NA 3RSSA 1KXZA 4KUGA 3IAUA 5ECYA 4CV2A 3HVKA 3AM5A 1PW5A 1YUBA 5DM2A 1B2RA 3E3AA 2DFKB 4B3RB 1Y5NA 2VKTA 5IZCA 2VP4A 3B52X 5E8RA 5B3LA 1E5XA 2GN4A 5AK5A 4ARZB 3ORHA 2D0OB 3TM4A 1E2EA 2X6RA 2YZNA 3GOQA 4EI8A 4PNZA 5B2EA 1JHZA 2FG7C 1LV7A 1A8HA 5KNBA 5FJIA 4MWZA 3ZJ4A 5EXDA 1K5DA 4AN1A 1F17A 1MB9A 3DUFB 1QCZA 1L5RA 2RI6A 3IE0A 1W25A 2EFYA 3ZIAD 3D81A 5D3ZA 3WQSB 2FWMX 5TEWA 4W7SA 4QXQA 3T9CA 4F04A 2VJNA 4K0KB 2VSNA 1TTHA 3M82A 2F1HA 1Z2AA 3L9XA 1NATA 1NZJA 2EARA 1F1BA 2Q1XA 3BJMA 4FNOA 1BDBA 3TLAA 2C1ZA 1KIFA 1KERA 5FWXA 2HHJA 3EQ7A 1ML4A 2YZKA 4D46A 2FPRA 2RH4A 3L84A 2XNJA 5EERA 3VA7A 2RHDA 3GJRA 1T6ZA 1Q1GA 5JFGA 3B1FA 2EFGA 2QZ4A 2C9YA 5ICCA 3EF0A 1G8MA 4D44A 3P9IA 2ADMA 1Y5IA 2YXDA 2XVYA 1XDZA 1XFAA 1R00A 3GRAA 2IHNA 3GO4A 2PKXA 4D0NA 4EF5A 4P80A 2W58A 4A2PA 5TR9A 4LBYA 1DEHA 4AUEA 1JDBC 4ESEA 2WTNA 2YASA 4W9RA 5DN6D 3ZGLA 1DT5A 5SZIA 1EQUA 2QZJA 2WF7A 2VDLB 3F49S 2VG8A 4E32A 4MRMB 2V5AA 3T1YB 1R8SA 4WK4B 5DE3A 1QIMA 2YY6A 2D74A 1F8YA 1V8DA 3KKKA 5T7BA 1Z82A 4EJ2A 2HJ9A 5HQ3A 1NX6A 4FR5A 4NAUA 1O89A 4PSAA 3F3YA 3O1JC 5FLEX 4AZ0B 1H8HA 1TGYA 1L5KA 4PLYA 2C5FA 2I34A 2FH5B 1PQPA 3K1TA 1B4DA 1T25A 2XWQA 3OZBA 4G0QA 4BUCA 2VTDA 4H6XA 3H1AA 4X6YA 4A6DA 4Z4FA 4JBLA 4EW1A 2GAAA 2HT6A 1OGIA 4FGUA 4ECEA 2G1AA 4RMHA 2VUHB 5BWLA 2YYYA 4ZWNA 4UBJA 4YC7A 1SHKA 5IAOA 2GCGA 4Q3EA 3OTIA 4N8SA 1VXRA 2CEAA 1O97D 1B6GA 4DCSA 5AOBA 1KR2A 3IPYA 2FWAA 3A26A 4CDGA 2B82A 5F73A 5NULA 4ZT2A 3A11A 3P0HA 1XEXA 1FXWA 1OI7A 1XCJA 4EDHA 1B2LA 2YX1A 1KVTA 3RU2A 3VYSB 1IWBB 3ECCA 3SC2B 5GIPE 1AS2A 2Y9MB 4TV8A 1CUHA 4RJTA 4ROSA 4N5DA 2HCBA 2V7GA 4LK3A 2WWHA 1PR9A 1HLFA 2HMVA 3D59A 3W6OA 1GCIA 3GA5A 4NCIA 2QAGB 2OPBA 2FOIA 3VR5A 3RKUA 1XPOA 1J1IA 3MWDA 4FW9A 3ORFA 4EPXA 1U9ZA 2BGJA 5A62A 3I76A 4UM5A 3QHAA 4LDJA 3TJMA 1Z5WA 2B36A 2BRUA 3FR7A 3NRCA 1COZA 4IKOA 1V9SA 4RMNA 5AKKA 4ZVUA 1RXIA 3ZR4B 3V48A 1GRRA 4DJDC 3H2ZA 1X70A 2BFCA 4OLFA 3N2GA 3FUUA 2V8BA 3R40A 1IFXA 2ZG6A 2NPIA 2GBPA 1Z28A 1LU9A 1G8KA 3A36A 3HCAA 1YWGO 1Y1LA 3G1TA 4D3FA 1PJAA 2IWRA 3RRFA 2E4WA 4XWAA 4BIMA 1S3IA 4LY6A 3O94A 2D1SA 2NPOA 1CYDA 1C41A 2H1IA 4HKTA 5CYPA 3PX2A 3REGA 4BZWA 4RA6A 3AJDA 4XD2A 4L0DA 5E38A 5ALXA 3H84A 1Y1TA 4ETMA 3R5SA 2FMTA 4QTXA 3WO0A 5EHQA 2GFHA 3QF7A 1V7PC 3HZOA 4FGWA 4FD2A 4D4LA 4DVJA 1T6YA 4I5EA 5DNAA 1Z4KA 1BE8A 2J87A 4MRPA 3K9QO 5CX1A 5JQGA 2OE2A 2DFNA 1NKVA 5JD3A 4IICA 4RTNA 3FM9A 3VTZA 1CUJA 4F12A 1L7EA 4E07A 3LYUA 5B3JA 2AN1A 3GD5A 3TNFA 2DAPA 3D43A 1NV9A 4WLNA 3UB4A 4UUOA 2PFSA 1HOTA 1K63A 3DF9A 5KKNB 3P96A 3E3MA 4B6QA 1NL3A 4M0LA 2L42A 1E2NA 1SIUA 2D2VA 3OOJA 1PZHA 5IVHA 4NC9A 5H3LA 4YI5A 2DBQA 4QDTA 4QFMA 4IGIA 1E9CA 1NPDA 4DNPA 2A2ZA 5JSKA 3EEYA 4TL9A 5B57C 4OX9B 3FTPA 1S4QA 4MH0R 3UJHA 4A1OA 2NVWA 1NXPA 5I45A 2B25A 3ACBA 4NIMA 3R7LA 1QHHA 3QXSA 2R8EA 1DJNA 4JFRA 1N2CE 1MEJA 1R5BA 1EXWA 1H2ZA 2Q21A 3S5UA 3TQCA 3TZLA 4YDHB 4BFLA 5MN6A 3GBVA 5FWAA 2Q50A 4GWLA 2ZS7A 2C29D 3K2QA 4MW5A 4R0NA 4XH9B 1ITZA 4JCCA 4BWVA 3Q5EA 2Q9CA 1ONSA 2DBRA 4JWTA 1E58A 4ATNA 2HLDD 1YH3A 2EEZA 2J3KA 2PS0A 1P6XA 1F06A 2YOHA 3SOZA 1TE2A 4B83A 4I8IA 5DN6A 2PVSA 1FNSA 3RLIA 1NOJA 1XOIA 2V6FA 3HP1A 3H3JA 3NWOA 2G06A 2F3UA 1PGOA 2G80A 2NU8A 1J49A 3K70C 3OQMA 3NUQA 1VJCA 1WS6A 1H1LA 1TJ3A 2GB4A 3ETLA 3QLVA 4G4SO 2H85A 4UNIA 2G71A 4BASA 3PPYA 1GFZA 1ZH0A 2FR8A 3LY9A 1P29A 4W8HA 2EJVA 4YEDA 1CE8A 4YT5A 3SGLA 3BT7A 1KO7A 1UT8A 1ULSA 3DOUA 2GYUA 5A06A 1O2DA 4JJ4A 3IR6A 3WIDA 2CWDA 1FFHA 2FG6C 3INTA 3K0KA 4U2CA 2YV4A 1F6BA 1M2GA 1ZWKA 3FKQA 3LVQE 3QX8A 2AA3A 3W0LB 1MQAA 1VCNA 4W5HA 5E4TA 3SZGA 3G2MA 4WV3A 1LK5A 3EHDA 5IW8A 2V6MA 2W48A 5LIPA 1EJ0A 1VGQA 3X2SA 2JFQA 1WB6A 3CEAA 4LJ9A 4N9QA 1XMSA 2B30A 4L4UA 2OV8A 3JQAB 3NHSA 2B6NA 2HSZA 2Q3MA 2V0NA 3NM6B 4TS3A 1YE3A 4D8YA 1AU9A 5FA8A 2IYSA 2ZTLA 2NXNA 5C8XA 1ONOA 3BREA 4NMLA 1QIHA 2G77B 4WLEA 1RKXA 1V8FA 3KZVA 5JY1A 1JG6A 2B4TO 4RMJA 4XB6B 3B13B 4NFYA 4MJXA 2B9VA 1ZRMA 2ZT5A 3KQNA 1ELOA 1GQ2A 1IM8A 1JEQB 1E2DA 1YI1A 3L82B 4A8JC 3DP9A 3TOZA 4EQ6A 4OJMX 3NGXA 1GU0A 1WD5A 3H97A 4CW7A 1W36D 1AQYA 1SBIA 1X7ZB 1V5IA 2D3TA 3OPYI 4C7XA 2GHIA 1VBMA 4M89A 5LZ2A 4BNIA 5A4DA 1Z83A 2WYUA 3UUWA 2ACWA 5TNXA 1NYQA 3WGZA 1TMYA 1U11A 3I9LA 2J7PD 3OFSA 4A8PA 2JA2A 4ACBA 3F73A 2SKEA 5LMUB 3T3HA 1K8XB 1R66A 2R44A 4K6KA 1X1BA 1CUCA 2C2MA 2DR3A 3BZBA 3NALA 3P19A 3T7KA 4Z4GA 3STVA 1RIFA 2OGTA 4K6GA 4RPIA 5E7QA 2AFVA 2I4RA 1A95A 1NC1A 3D8BA 4S2EA 3K6SB 3HUDA 1JSZA 4G5HA 5CLGA 4KAJA 5JSUA 1X1DA 2RGBA 2IP1A 3ASZA 4G4GA 1GSAA 2GZSA 4PBTA 4KPFC 5BNFA 1VKZA 4LF8B 2W2LD 4YRRA 5AW1A 3D6JA 1Z2PX 2BFBA 2NUTB 4AJHA 2I3GA 2ONYA 4L2IA 4P34A 2CXXA 2BM1A 4O4JF 3A6KA 1FVHA 2R6R1 1YS9A 4B4UA 1BZYA 1J21A 3L0SA 4B71A 1V1RB 2OV1A 3PUJA 4MKXA 1Z3CA 2ZI4A 2PKQP 1S9HA 2FEKA 3DAFA 3O2SB 4QXOA 3LHDA 3MMXA 2BEVA 4KR0A 4MR9A 3ZXSA 1KP9A 4H7IA 4H15A 4XTRA 4FR0A 1YCDA 2X3FA 4MTCA 2XCSB 4XPIB 5A9SA 1UK8A 2JGIA 2PWZA 4RNCA 3N86A 1EP1B 3WJAA 4OP1A 3O03A 3CVUA 1WXQA 3IEIA 3OJLA 1M0SA 1C7ZA 1JLLA 1T5SA 5FBKA 2OBLA 1ZJ4A 2HV8A 3M9LA 3WNDA 2XA9A 3VR0A 1M2JA 3GJQA 5U1PA 1YR9A 3F7NA 3Q7PA 4JKYA 2PSJA 5KSOA 4Z4EA 2P6UA 1LTHR 1Y7IA 1VJGA 2JIMA 2Z08A 4REOA 1T1SA 2ZU0C 4XRGA 1YTUA 1JVSA 1TQDA 3IBSA 1U2RA 1XD2B 4URYR 1Y8ZA 2WSBA 3MQ4A 1EWQA 2HWKA 1C1DB 1HE8B 4GO1A 2QRNA 3WGHA 3LUKA 5F33A 3QW2A 3KELA 4F7DA 2V0CA 3BTOA 4YV2A 2HU2A 3TIVA 4Y30A 1FFEA 4PIVA 2FRDC 3F5SA 2GSWA 3GEPA 4BKUA 1HDIA 2Z5FA 4OXQA 4AIIA 1V11A 3C1OA 1R0YA 2VP6A 4RDHA 1L5WA 5C81A 2C59A 2BMEA 2XW6A 3AVTA 2UXDB 1E9FA 2Z8ZA 3JY6A 3P4YA 2HLDA 3WSWA 2WWGA 1E9BA 4GXTA 4CGZA 3IMEA 4ISCA 3DAHA 4EUKA 1O9BA 1CQWA 4UATA 1VJTA 1A9ZA 1I2MA 4C04A 4C2UA 3KFXA 1YI0A 2ZR8A 3A3YA 3VSEA 4EHAA 3OURA 1THZA 4MPPA 2J59A 5JNVA 4HQKA 2WJVA 4RTKA 2WB4A 3HGMA 3KR2A 3WGTA 4MP6A 1LW7A 2WQ7A 5DNDA 4YQZA 1HLPA 1FDUA 1J9ZA 3UFBA 2OK7A 2VCEA 4E4YA 2PRZA 1MT3A 4XB2A 1N32B 2O6HA 3M4NA 3O1HB 1G5TA 3CLRC 5ESRA 4N18A 3OJ0A 1Z7BA 5K0BA 2PD6A 5K6TA 2YZ7A 5CEJA 5EQFA 1R0WA 2AFHB 1C3OB 2RHJA 4Q3NA 4ZAVA 5I3ZA 1Z74A 2H18A 2GUGA 3AUXA 3I9MA 4HI0E 4HXFB 3AOGA 4ZCRA 1BHQ1 3RYTC 2R2AA 4MR8A 4COOA 10MHA 3ND7A 5TPZD 1KMHA 3UY4A 2OUKA 3RVMA 1D04A 3QPCA 1NU8A 4GBMA 2AOTB 5E3JA 5SY4A 8MHTA 2QL7A 2VEDA 3B6JA 4M1SA 3RVPA 3HXKA 5SICE 5THQA 3GH1A 2A3RA 1EFVA 2C9CA 3ESDA 2PU7A 1HL3A 1UM9B 3B1KA 1OASA 3LF2A 3P27A 5BSMA 6LDHA 4MVJD 1UC4B 2OD7A 2WWIA 4LC1A 4E5UA 2ZJ2A 4PLGA 4HDQB 1LS6A 2H5LA 1BE6A 4QQ8A 5AI8A 5ER9A 4AQYB 3ZQ4A 3W5DA 1UBEA 2C9OA 4YI3A 5EEHA 4B7XA 3LPCA 1VKJA 4Q4DA 3NHKA 3EFOA 1ORRA 1TYEB 4LSGA 5E6UB 4UEKA 2O2EA 5A4FS 3QFSA 5KQGA 1AHHA 2YV5A 3VHLB 1NJ2A 4KZKA 5J4HA 5JZMA 2J7PA 1S3GA 2CHEA 4DV6B 1KIAA 4EB6B 2XUDA 5G1OA 2I3BA 5F7ZA 2COKA 1TO2E 3UM9A 1W96A 1BD3A 3H5IA 4R8VA 1KYXA 1PS0A 4QYIA 4C4RA 1FDVA 4E21A 1XROA 4PG7A 1ML3A 1ZVKA 2OCBA 2P4HX 3DOCA 1M10A 1NW6A 1OXKB 5GONA 1HQDA 2YZGA 1B76A 2NV0A 2W2LA 4I08A 4PHFA 4WKCA 2J0UB 4PN3A 4BWFB 1NASA 2FUEA 3LRXA 4JK3A 3WB2A 4PQYA 1P4GA 4XGKA 5DXAA 5FRDA 3A6EA 3KS9A 2VZ8A 3ZGNA 4OLHA 3FCYA 2FG5A 1P44A 3DS8A 1R74A 2VXYA 4YQFA 2GXQA 2I2WA 4IW3B 3A1VA 4QASA 4ND5A 1X7XA 3BWVA 4C08A 1SOUA 1J09A 3JWIA 2VHYA 1ZIXA 4YREA 4B4WA 4Z5XA 1AMOA 2POQX 2O52A 2O8FA 4R3UC 4RQAA 5FI3A 4YS6A 5BV8A 1A77A 1EX6A 1XZDA 1U0NA 3G2IA 3O7WA 1G20B 2PWYA 4HAWA 3HCDA 4HNGA 1SCIA 3S2SA 1O6GA 1WHTB 1JDVA 2FPPB 3PC2A 3QFRA 5DF1A 4CIVA 3O2NA 5CCEA 2IHTA 2O06A 3FCSB 4LNHA 1V8ZA 1B15A 1JIIA 1WE2A 3OEYA 3OP1A 5DNYB 1DAIA 3KCNA 4KNWA 3FHCB 1JECA 1X77A 3AKEA 4JUBA 2WJGA 2FWNA 4RHTA 3QI7A 4RVHA 2JPDA 3UJBA 5EJ6A 1CY2A 1D09A 1Z12A 2C7GA 3NAZA 4GLJA 4AULA 5COQA 1JDZA 4J3JA 5BV2P 3QLTA 4RY9A 3EVAA 4KKVA 3GLUA 1JWBB 3DE1X 2CDNA 3EG9B 4M60A 3GLFA 3GEGA 1D1PA 4AMGA 5K0LA 4BJ6A 4WPGA 2YRWA 1CSEE 2WJWA 4LYFA 3WIVA 5EWMB 4DCPA 4NJMA 1HT3A 4NOKA 4C2BA 2RH8A 3FSEA 3GUYA 4RU1A 7AT1A 1CR1A 5C51B 2O59A 3D6UA 4P4SB 4QBIA 2JB9A 4NE7A 5FLXA 1NOIA 1Y9ZA 1VP3A 1LJ8A 2GBLA 2YQ5A 4OYRA 3U3JA 2F00A 1GG9A 1UOQA 4QJ4A 3ABSB 4BLQA 3GJ3A 3DDUA 4EKGA 3LW7A 2VQSA 4QLBA 1HDXA 3R9KA 1SC1A 1P60A 4XM1A 3RI3A 4GLBA 1D2NA 3A3KA 4F6RB 5BW4A 1LNSA 3HJFA 3OIYA 3WIUA 3IALA 2VF8A 1GNVA 1ZWLA 3EYWA 4JWKA 4AN0A 3IHWA 3NV7A 4BVHA 4CUJA 2WV7A 2CSUA 5I51A 1WXDA 2ZI7A 3JVDA 1CRLA 3FZQA 3R41A 1GYRA 1I1NA 1M1ZA 2ZJFA 2YFHA 1O96B 2QRJA 4IIYA 2VK8A 1JAXA 3CRW1 3QA3E 1P61B 2DPGA 4HNAB 3ZV6A 1P1RA 3ZWBA 3SJAA 1V1MA 4RK4A 3FTFA 1TTQB 4LBWA 4X54A 2QTFA 3JU3A 3BD9A 2PVCA 5EIBD 1MOSA 2NZ2A 4HNTA 4CT0A 1SC4A 5TPZA 1I80A 3QVKA 5GY7A 3MJCA 2WKQA 2F43B 2HIMA 3B1JA 4BYMA 4BCDA 5A5GA 3KE8A 3IS3A 2D0IA 4MPTA 1ZY2A 4PG6A 5C3MA 5JG7A 3MS7A 4V1CB 2WSYB 3LY8A 1K3FA 4HP8A 4MVJA 1KBOA 1ZIYA 3WDKA 4QLOA 3R8XA 3H87A 3RB8A 3HFJA 3CPJB 1FFXA 1NWHA 3MXOA 4J2HA 4JR2A 3GLGB 5LP6B 3OF5A 4PF1A 1CZRA 3ICQB 2WBLC 1QP7A 4QHYA 5K5EA 1W52X 1ZNXA 2B5WA 3ZHVA 3DB1A 3U19A 2EL7A 3V8PA 3JAKA 2HC9A 3JSXA 4Y2PA 1WZCA 2OMEA 1XJWA 2X8WA 5KTNA 3DEZA 2AS0A 1A7UA 4OK5A 5E3IA 3SC4A 5C5CA 4MGHA 4OHZA 1GRNA 2X7JA 1PFYA 3OD1A 4BZZA 1YS1X 2EQAA 4R9SA 4DUYB 4RH0A 1HDZA 2VJCA 3X1YA 3WGOA 2V4ZA 4X8HA 1EDDA 3B5IA 4DLAA 4O0MA 3CVWA 2J46A 3K2IA 1E4EB 1EA7A 3ZBTA 5B64A 1SG6A 2KX7A 2WC1A 2JIPA 1VPVA 3BK7A 3I58A 3PHHA 1R6BX 1U1EA 4Y1RA 3UMRA 5K9ZA 3ZE7A 3S8MA 1SEPA 3OZWA 4IYJA 2NNWB 3ETCA 5DNWA 2YN2A 4KO8A 3QKSA 4F97A 4YMVA 3CWCA 3P97A 3PNPA 2OYSA 4XVRA 3CFYA 4MYTA 3W06A 1WMAA 1OROA 1OC4A 4BATA 1ZD5A 3QV2A 1MEOA 4UAGA 5IJWA 2WIAA 2IU6A 5BN5B 1E5LA 1E6LA 1FJ2A 2O57A 4XIYA 5CFPA 4EUSA 1YZTA 3IQGX 1EWYA 3UUFA 3AHGA 4LY0A 4BP3A 2O54A 4JA0A 3ZWWA 1BXRB 5EZYF 4J7CA 4G65A 4HZUB 2GBIA 3L1HA 1AUXA 3R1IA 3ZHQA 3O82A 4PEVA 4LPSA 2J1LA 4EJ6A 4ID9A 3J7AC 1OWMA 2CB9A 3D3EA 1NXXA 1PX2A 3BIFA 3PUZA 1QQ7A 4P5DA 4PE5B 3UANA 1W8DA 4OYYA 3A6PC 3EUWA 1GTG1 1Y9DA 4HAYA 3CNQS 3ZI4A 1DC4A 4EI2A 4YRSA 1ENPA 3JVIA 5G0TA 1ODIA 4EG4A 1II8B 3CKYA 4IMPA 3QEKA 4HUQB 1VLQA 5SY6A 1UBKS 3MTEA 4DLSA 3RTEA 4WKOA 4ZI2A 2V55B 1YMUA 3BWCA 3WHKA 1G2QA 2Z5LA 1EDZA 4M3NA 4RTOA 2FP4B 1Q12A 1Z5UA 2PE5A 5EIFA 3R77A 1UOOA 2LCIA 3AETA 3CCFA 3NAQA 1OFUA 2LVBA 3SDBA 3TFQA 3LBYA 3GLIE 1U9IC 2Z30A 3N8DA 4GT1A 4RXMA 3UJAA 1T9AA 1XUOA 2ZYSA 3EYAA 3HKBA 4MK4A 4QDXA 4TRJA 5TQ0A 3TTYA 4ZYYA 2Q3CA 1RI4A 2CNLA 2Q49A 2C94A 3FPGA 3I09A 4FUTA 1RWNA 4UU8A 5AJXA 5H83A 3T95A 1X80A 3HC7A 4IM7A 4QD3A 3TXAA 4LF5B 3RD5A 3DVLA 1PL0A 1RMTA 4IOLA 2CMGA 4BFSA 2YXPX 2EFCB 4MV1A 1QO7A 1LUAA 4O2LA 1QR6A 2REXB 3V80A 1D4FA 3ZWNA 2EBFX 3H2IA 1P2FA 1CUZA 1XG5A 4J75A 5AIBA 1PJQA 3C24A 3C4JA 5IZCC 3RC8A 1TK3A 2VDQB 4PGAA 5T3YA 2HJWA 3LCJA 2ZXEA 4NAHA 4UASA 4B79A 4LSMA 1DPGA 3EDYA 5JLAA 4P32A 4WBNF 1GPMA 2BTOA 1Z0IA 1N1DA 2JIOA 2PZFA 3JXEA 4UBNA 2P5TB 3P9CA 2X6TA 5F64A 2A7XA 4B80A 3VDRA 1JE0A 2ZIAA 5EP1A 5ABPA 4OLAA 4IYRA 1Q0HA 3ENVA 4WNAB 3HU3A 4X0EA 2RKBA 1CZHA 5IVDA 3VYRB 4DBVO 2JRCA 2XTNA 4FQ8A 2W71A 4X62B 3NB0A 2D0PB 3OPNA 5ALJA 2QTZA 1CLUA 1N6PA 2UUPA 3L0OA 4GI3A 1T6BY 2HEGA 1Y89A 4UDNA 3VH1A 5JYEA 1M6EX 3K0HA 2H2DA 2YWJA 4U2FA 1IOWA 2C9DA 3JARB 3OUZA 4HTFA 1P2SA 4K6FA 4QOHA 4B74A 4DV4B 4MI6A 4CKZA 3TBKA 3HHEA 3ODPA 5AI5A 4WWHA 4EHJA 5HS6A 4D99A 3INGA 2JH3A 2JLWA 1IULA 2FUCA 1F2UA 2HCJB 2YUIA 1J23A 3PGJA 4P9NA 1U8AA 2W00A 1Q0QA 5K7SA 4D92A 1Z06A 4HDCA 4JSRA 3RV3A 1E6MA 4W8GA 1PJ8A 4HPJB 5IULC 3FYHA 4GSKA 3AM1A 3IDOA 3QXGA 2ADOA 4WVFA 3I9OA 3EISA 1KAEA 2QHXA 3IILA 3M1AA 4I99A 3OTGA 3KQLA 1H0RA 4I6EA 1EHYA 1SBNE 13PKA 1ISGA 4I8DA 4I3HA 3T5TA 2GWRA 2YVAA 3QX9A 4UJ5A 3H2BA 1JKJB 3A7EA 4MCJA 5EJGA 5B4TA 2JVIA 2W5UA 3G5LA 2IELA 1Z0AA 2X58A 3NDBB 3D9QX 5F5XA 3WQHA 2J0QA 1SHJA 5CR9A 3NANA 1L5QA 5LB4A 3TUJC 2I2BA 3DL2A 4IUYA 4N3BA 2AEEA 4ML3A 1ZCJA 2H51A 3HN2A 1OZHA 2A5FA 1YZ3A 5AOAA 1AX9A 4GS5A 4MRRA 1X8LA 4F0JA 3BXGA 1SVKA 2PX5A 3IJRA 1OH6A 4BFUA 2PUJA 4IOMA 2EEPA 4WNCA 3GA0A 4D3SA 4C07A 2VCYA 1FU4A 1U8TA 2C3UA 2IUSA 1QLHA 2X0RA 3LKVA 4ZRDA 5SY9A 3TLGA 2OEPA 4E1VA 3LHIA 3EIOA 3ETDA 3UHFA 2JCSA 3TLBA 1FOEB 5KBYA 3HCBA 1D8TA 4ZN6A 3DBVO 4B5LA 4AZ3A 1MABB 1I1OA 2EGUA 1AVTA 2FOLA 2NGRA 5FL7D 3PC7A 4PC3A 3HP4A 3DPSA 3OZFA 1Q0SA 1I5EA 1YR6A 2CLLB 2E21A 2OGUA 4ZQFA 2VHZA 1GVHA 1Y7TA 1ZM3A 3MGKA 4MWSA 5FOVA 3WLFA 2R0QC 5DEOA 4DHEA 2V96A 3FNHA 2WU8A 4PZPA 1GGHA 4DIUA 4XOUA 2GCEA 2XZPA 3NRBA 3WA6A 2BGWA 2HREA 3L8GA 4RSGA 5A5VA 1CUVA 2RG7A 1TF2A 3WZ2A 1FFGA 1HZZA 2QZ9A 1SM4A 3NT5A 3HYNA 2RGWA 3T3PB 1Z4NA 2AUNA 2C4NA 2ZIFA 4MS4B 4WZAA 1CVLA 4UU0A 1RJWA 3QKRB 1OLSB 1DAEA 1QYXA 2WJJA 1A9QA 5GGYA 1RYZA 5ITZB 3D7SA 3FGZA 1UMKA 2OECA 2Z4TA 1Z6TA 3GN2A 2F1IA 4ZKDA 1WULS 5JS8A 3WMEA 4OHWA 3COYA 4ZVOA 5A3RA 2C7VA 1QMPA 1KI9A 2BOVA 3NO4A 2P5YA 4FFVA 5FL3A 1XAGA 3ROEA 5JDCA 1W35A 3Q72A 3L0CA 1DE0A 1CY8A 3FVRA 3I9V6 4CRWB 1WZIA 1U3DA 4MVJG 2GN8A 3IEPA 1V4NA 3NR2A 3IQIX 5AWFC 2H2IA 2W6CX 4HY3A 4M6WB 4NZNA 3A1WA 4PZZA 4A0HA 2QUJA 1P75A 2OBNA 3ED5A 5FTLA 2XE4A 2QR3A 3AEKB 3EW7A 3KDSE 5AKZA 3H5OA 4FEAA 1NRIA 4PQRA 1AO0A 1RKBA 4WHMA 5B3JC 4MQ5A 3MUOA 3SEFA 2DFPA 1YCHA 2HXYA 3FCAA 3L1JA 4BQNA 4AKGA 2OORC 2XY4A 3IAS1 1Q5PA 4FYWA 2ZI9A 4K2HA 1W29A 4REQA 4ZGGA 3I1JA 1C9NA 3M1YA 4RFSA 4TTSA 4JENA 4V0NA 1ZGHA 2Q2NA 3GLHE 2X8JB 3IV9A 1TT7A 4RDIA 4WZZA 2PCLA 1JR3D 1FEZA 1F4LA