4KEAA

Crystal structure of d196n mutant of monoglyceride lipase from bacillus sp. h257 in space group p212121
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
248
structure length
248
Chain Sequence
SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
total genus 94
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4keaA00
5K5EA 2J3DA 2ACKA 4U2CA 1DWPA 1DWQA 4BRZA 5C81A 4BZWA 4DMFA 5C8VA 1EK1A 3G0GA 2EDCA 5ALMA 4NS4A 4OD0A 3FYUC 3IULA 1UWCA 5YASA 4IO0A 2Y1KA 4W1RA 5A71A 2QUBA 2E3JA 2K2QB 1CPYA 2P8SA 4X90A 3H0CA 1MTZA 3DCNA 1TK3A 2V96A 2RIPA 1A8UA 5AKKA 4QWWA 1DQZA 5DYTA 4UFNA 4DMKA 3RK4A 1PJAA 2JGLA 1XLWA 4Q3LA 3DL7A 2R11A 5K3DA 4X94A 3ZWQA 3UMJA 3KOOA 2OLEA 4DNQA 2AJ8A 1QIIA 4M0FA 4LIPD 4WFKA 1XFDA 5KWIA 5LIPA 4WJLA 4DMHA 2VT7A 5ALSA 1W6RA 3C8DA 2R8BA 2BJHA 1UK8A 4B0OA 2WG1A 4LXHA 4U2DA 5K3AA 1E8MA 2VF2A 1EH5A 5ALTA 2GBFA 5HQ3B 4ZRDA 4H7DA 5LZ2A 4IH9A 4B81A 4AQDA 5AI9A 3O9VA 5C8XA 4GI1A 2ROQA 1CUVA 2RGUA 1JKMA 3QITA 1GPNA 2AXEA 3GROA 3WKDA 1R88A 1CUHA 1WHTA 3PDCA 5A2GA 4HRYA 1U8EA 1YAHA 4KYVA 1HKHA 3NOXA 4X00A 1ODTC 2WFZA 5ALOA 3R3WA 5DLPA 1EDDA 3G0BA 4BC1A 1DX4A 3H04A 2WJ3A 4RE5A 1XKTA 1EB9A 2OQIA 3I2HA 2G63A 3IUNA 3FLEA 2DQZA 5K3CA 2G5TA 3WIBA 2BUBA 2JF0A 1JJFA 3DLTA 3I2KA 1BS9A 2CMFA 3TJMA 3AJAA 3E3AA 4B82A 3D3NA 3M82A 3D59A 3DQZA 2PBLA 5JD5A 4EY7A 4BDTA 3HXKA 4H7HA 4BVKA 4ZREA 3BDIA 4X3CA 2WU4A 4IQ4A 4QDOA 4MJ3A 4CIBA 4G4GA 2WU3A 5HF6A 1CUIA 2DHEA 2QXUA 4U2GA 2C0QA 1CUBA 3C8HA 1XZGA 4QEKA 5AH0A 1D07A 2HADA 2X5XA 5IKXA 3FLBA 1U2EA 4KE9A 2WHQA 3BJMA 2GYUA 4XVCA 1XRQA 4KAFA 2V97A 2XUJA 2H1IA 1LBTA 3HI4A 4WY8A 4WFIA 2WIFA 2HU7A 4ZXFA 1UKCA 1YB7A 1Q0RA 4KACA 5AO9A 1YA8A 4KE8A 1VLQA 2XMCA 2GYWA 2C5GA 1AC5A 5BOVA 4DGQA 4F5ZA 1EDBA 3D2CA 3LCRA 5CXXA 5ALZA 1UZAA 4J0CA 4ROTA 2PM8A 2Z3ZA 2DCMA 3STTA 2FUKA 3O4HA 5AI6A 2DQYA 4QDZA 7YASA 3FYUA 4BTLA 2FX5A 4K5QA 2DHDA 3BIWA 1MAHA 1T4MA 4C87A 4UHHA 4DNOA 2RHTA 1YASA 4PQEA 3I28A 3WK7A 1W4LA 3AUKA 1DT3A 3QH4A 3ICWA 4F60A 2DHCA 5AKYA 5AM3A 4LYDA 5ALDA 5DTIA 4BTVA 4OUKX 1TCAA 2B61A 5EHNA 4RPCA 3RARA 2JGKA 5JATA 1Y37A 5LYYA 3G9TA 1QZ3A 3N2ZB 3R3XA 1WCYA 3PUIA 1XRRA 1MNQA 3U0VA 2OCKA 4BBZA 2I3ZA 1CEXA 3IA2A 3WKEA 1BROA 1TKRA 5LZ7A 1G4HA 1XQWA 2VA9A 2J4FA 1MAAA 1ACLA 2O7VA 3FYTA 3G0IA 5LP1A 1E89A 3WWEA 3DNMA 2WIDA 5T4FA 1CIJA 2OAGA 5D6OA 5A7HA 5ALVA 4Y2VA 5AIAA 5AOCA 3BXPA 3RKSA 4C4XA 1CUUA 4G4JA 3IURA 4CG1A 2I03A 3WQHA 1JU3A 5JZSA 1ZD2P 4G9GA 3HJUA 5JIBA 2OGSA 3G02A 2OCGA 4B80A 1EINA 3QMVA 4X85A 1K4YA 5EGNA 5DWDA 4AO8A 3A6ZA 4QDXA 2VJBA 3I1YA 5AI4A 2AJCA 1XZBA 2RONA 4FBLA 1TIBA 5HF8A 1A8SA 3UUEA 1TCCA 2VSQA 1C7JA 1GKLA 1R50A 4QA9A 4HTAA 4ZWNA 1K5PA 4NZZA 4AZ0A 1LPBB 1ZJ5A 5AKXA 4A23A 4A5SA 3LIIA 1K8QA 2XUIA 4M0EA 1GQSA 3WIOA 3QMWA 5CRIA 1LLFA 1PFQA 2WJ4A 1H2YA 1P0PA 2HA3A 3EIOA 1KU6A 4AN0A 1Y7IA 1ETHA 4I3FA 2VAXA 1QIFA 2VJAA 3F8SA 3DDUA 1UFOA 4MQMA 1QGED 4BP8A 2HRQA 2OGZA 3L1JA 3FYUB 1AMNA 3DKRA 4X7BA 1XRNA 3WK8A 3WK4A 2CBGA 2QUAA 4GHWA 1QIHA 4Q82A 3WL6A 3F9CA 2H7CA 2XQIA 3W05A 2WUEA 5FXMA 5EIAA 5AKEA 1XQYA 4Y7DA 1K63A 1CUYA 5AM2A 4ARAA 4UHEA 4UHCA 4FMPA 2FJ0A 4QE3A 2HU5A 3FCYA 4HXFB 2OPHA 2WIKA 1C4XA 1CR6A 1UKAA 4CG3A 5C8ZA 3C6BA 1UK9A 5AKHA 3G0CA 1LPMA 2ZVDA 1W1IA 4P08A 2XI4A 1H2XA 4U2EA 3HABA 3FVTA 3OG9A 3IB3A 5HK9A 3L1HA 3HEAA 2BUCA 4BYMA 2HU8A 3C70A 3P2MA 2OCLA 4Q34A 1CUFA 1QTIA 2XMSA 1AUOA 1GQRA 2HA5A 4PV7A 3U1TA 3WYDA 3GUUA 1QTRA 4BDSA 4J0KA 5AK5A 3KXPA 2HA7A 1E66A 4EY8A 4CCYA 1EB8A 3R3ZA 3WZLA 1GKKA 1NX9A 2ZSIA 1SC9A 4K6KA 4FDMA 2XE4A 1LPOA 5ALFA 2H7XA 1ZJ4A 3ESDA 1EVEA 1XZAA 3JWEA 4XIIA 1Q83A 3BF7A 4G8CA 4OU5A 3C5WP 2H9YA 2NW6A 1CVLA 3G0DA 4JEIA 2WG2A 1CV2A 5DNWA 4HRXA 4Q1VA 3A2NA 5AOAA 1BEEA 3G7NA 5AKZA 1DU4A 1L7QA 5HFAA 1R3DA 3OTQA 3VKFA 3H17A 5LZ4A 2B9VA 1LPNA 1VE6A 5ALEA 3PUHA 3V1MA 4J03A 3M81A 3I6YA 1EXWA 1W75A 5HK8A 5AKGA 5IH7A 4N8SA 4DLNA 1RWQA 1ZI6A 2XB6A 2C0PA 2PL5A 4BAGA 4GWLA 1QIKA 1YS2X 1XZLA 3MUNA 4N8EA 4BP9A 1A88A 1GT6A 4OSEA 3IUMA 2I78A 3C45A 3BDVA 3O4GA 4MYDA 5CXUA 5CW2A 1ZI8A 4L72A 1Y7HA 1W52X 3D2AA 4WCVA 1HDEA 3QZUA 3IUJA 2VAVA 5JD6A 4DIUA 4DMCA 4FTWA 4GLBA 1E8DA 2HFKA 2FJPA 4KRYA 1ZI9A 2ORYA 4DNPA 5D3KA 2WIGA 4H7KA 5ALNA 1MT3A 2WTMA 4UUQA 4RE6A 1XKLA 1QLWA 3ANSA 4KR0A 4Y2XA 4FFVA 4B83A 2JGFA 2HIHA 2OXEA 2JIDA 2OCIA 4KAJA 2O7RA 3ZLUA 2WJ6A 4X6UA 1N5MA 4BCCA 4HZGA 1EI9A 4XWGA 5I9IA 5K3EA 1FFDA 5AICA 1ODCA 2I3DA 3VJLA 4B85A 1CFJA 1UOOA 1QONA 3WWDA 3HC7A 3LP5A 2VJDA 1JJBA 3M3DA 4MYSA 1SCKA 3O9MA 1JMKC 3G9UA 5ALRA 2EDAA 4C6HA 3B12A 2QOEA 3X3HA 2VQ6A 5IVDA 2GYVA 1UKBA 4NVRA 1X2EA 3PFBA 2ZYIA 1CUCA 2JBWA 5ALKA 1PV1A 3VJKA 1C7IA 5CTAA 4BB0A 3HLKA 4EY5A 2WHPA 1Z68A 3V1KA 2BGRA 4Q3KA 4ZV7A 1UXOA 2XQKA 4BE9A 4CCYB 1HL7A 4X91A 3WA6A 4FOLA 1AGYA 4XJVA 4KEAA 4GBGA 3H2GA 4QNNA 4DM7A 2QJRA 4L0CA 1CUDA 4Y2RA 3DOHA 3STVA 3YASA 2PPLA 2HA4A 1GGVA 1S8OA 5AK3A 5AM1A 3CN7A 4BC0A 4CIAA 1EDEA 4MXDA 4G8DA 4H7EA 2JGJA 3L1IA 2XMGA 3V1NA 3D0KA 3ZLTA 5E2IA 2B4KA 3K2IA 2XLCA 3DJYA 5AKJA 4WFJA 5J3JA 1IUOA 5JAUA 2PU5A 1K6EA 3ZPXA 1XQVA 4E15A 1EVQA 5LKAA 5CT5A 2J3QA 3LLCA 1YR2A 5I7UA 1WOMA 3EQ9A 4OPMA 1BCRA 4DTCA 2HA6A 5ALHA 2C5FA 1H2ZA 1P0MA 4UHFA 2YXPX 5ALXA 3QYJA 2W22A 4MWTA 5FUMA 3D2BA 3FSGA 1LPAB 3A70A 4OB8A 1XRLA 1R1DA 2PSJA 4CCWA 4ETWA 3ZV7A 5CMLA 2XMZA 2O2IA 2QS9A 1J1IA 4HXEB 3BF8A 4FLEA 1H23A 1R9MA 3IUQA 2ZYRA 2G5PA 2ES4A 3HYSA 4UFPA 3BL8A 1ZD4A 1JMYA 5JADA 2CUTA 4LHEA 2YASA 3H2KA 5FKJA 4UBNA 1CRLA 1X2BA 3IBTA 3MVEA 1IZ8A 5EIEA 4G1FA 3VVMA 4FLMA 2WIJA 1XZEA 3O4IA 1XZDA 4J0JA 5LZ8A 4OU4A 3KWFA 2UZ0A 1DTEA 2QR5A 5K3FA 2AJBA 1QIJA 3FOBA 3SWWA 4YPVA 4EY6A 3W9UA 4BZZA 4ZI5A 3FBWA 1TQHA 1FFEA 3I2GA 2EEPA 4W63A 3GFFA 2ACEA 1VXOA 1GPKA 4V2IA 4Y2SA 1EA5A 3H1AA 2WTNA 1CUZA 3R3UA 4W1PA 2Y2VA 5KREA 1AX9A 2XMDA 1RP1A 1N5RA 1QIEA 3AFIA 4KJXA 4H7IA 3M83A 2QRUA 4U2FA 5JALA 4C88A 2GBGA 1SOMA 1J2EA 2PSDA 1L7AA 3W04A 5AP9A 1FFAA 3DYIA 1AKNA 4N5HX 4B0PA 2B20A 1DINA 5BWBA 1WB5A 1ISPA 3ESBA 4GW3A 4INZA 3C6YA 1EX9A 2Y6VA 1LGYA 4G5XA 1LBSA 4B84A 4X6XA 1MNAA 3FVRA 4J0DA 2J4CA 1OILA 4QLAA 4W1SA 5ALJA 4BE4A 3S2ZA 1YSCA 4S0XA 1WHSA 3LS2A 4OYLA 2VATA 5HZGA 3BJRA 4N5IX 2QTBA 4L9AA 5CT9A 3Q0TA 1P0IA 3V1LA 1MPXA 4G9EA 4KRXA 3H2IA 2PU7A 4E14A 4PF1A 5E4JA 3OC0A 1IUNA 4CFSA 3EQ8A 5JANA 3H19A 2OGTA 1B41A 2BKLA 4FFWA 1RYYA 5JZBA 3H1BA 4KE6A 3T4UA 1DQYA 1VA5A 4BVJA 3PF8A 5T4BA 4GEGA 4MWSA 2W6CX 3WL7A 3K9BA 3OOSA 1ZOIA 2JGEA 3VJMA 5EI5A 2PSFA 2RHWA 2XUAA 1LPPA 5AI0A 5KBYA 1CUGA 5A7FA 4F21A 2ZJFA 2WQZA 1ZIYA 4I4CA 1QOZA 2HL6A 3ZLVA 3IIIA 5EHXA 1VOTA 3MUOA 2JGMA 3ESAA 3Q8WA 3WJ2A 2BUAA 5FPPA 3C87A 4YX9A 1TCBA 3F98A 1XLUA 1ORWA 3O95A 5LZ5A 2HFJA 4H7FA 1LZKA 4W9RA 1BCSA 4CG2A 4IH1A 4ARBA 1YAJA 3DOIA 2WLSA 4Y9SA 2AJLI 1F0NA 5CURA 1QFSA 4PO3X 2ONCA 4UBJA 5FPQA 1QO9A 3AZQA 4U2BA 1FFCA 3DEAA 1GPLA 2C7BA 1CUWA 5HQ3A 4H77A 3WLAA 4PSDA 3E1GA 3C5VA 2XUGA 5D7BA 1QIDA 4UBMA 2YH2A 4AO7A 5IVKA 5AM5A 3QMMA 4YK7A 1GXSA 4PSCA 4WDRA 5K3FB 4AX4A 1G5FA 4TGLA 5DYWA 3ICVA 3FSGD 4FWBA 1ZIXA 3R41A 5BWCA 1BEZA 3VVLA 1WPXA 2BCEA 4Z49A 5ALUA 3I2JA 4PNZA 1QIGA 1MN6A 1X70A 4H18A 2PUJA 3G9XA 1DX6A 2C4HA 2DR0A 2PX6A 4OCZA 4Y2QA 4KE7A 4H0CA 5HF9A 4JUIA 5DTJA 5LZ9A 1IVYA 1XZJA 5IVHA 5AK4A 4Q05A 5ALIA 3ED1A 1W76A 3UUFA 4DSAA 4G8BA 2AJDA 4G4IA 1IMJA 2VEOA 1G66A 1CQWA 5CT8A 1XQXA 1MU0A 3AZOA 1KEZA 4HS9A 4RGYA 1THGA 1CUJA 3HRHA 5HF5A 1O6FA 1MX9A 3B3QA 1VJ5A 2Z8ZA 2ZSHA 3F97A 5AK6A 3W2TA 2WUGA 1BN7A 3H2JA 3KDAA 3WZMA 1O6GA 1T2NA 1AQLA 1MJ5A 1XZKA 1MO2A 3A2LA 3JYHA 5LLSA 2Z3WA 1WPRA 4UBKA 3I6MA 3R0VA 3SC2A 1DT5A 3HACA 1R9NA 3EQ7A 3AINA 2JEZA 2XUDA 4DNFA 4QLOA 5JASA 1GZ7A 4GECA 1N1MA 3QBJA 2LIPA 4FBMA 4MEAA 2WILA 2PSEA 4AXBA 2WFLA 4BVLA 2XQGA 2BAGA 4P9NA 5T4HA 2HA0A 1TAHA 4BRSA 1EK2A 3F96A 1ZGCA 3O0DA 5JAOA 1FSSA 3V9AA 3FCXA 5JAPA 3C43A 1XZCA 1J06A 1E5TA 2VTVA 3STYA 4BAZA 5CH8A 3WI7A 1A7UA 4IHAA 3I2IA 1YB6A 1F0PA 4AB1A 2X8BA 3IDAA 1AURA 1XROA 1BN6A 5CH3A 3EBLA 1CUSA 5DNUA 3WMRA 2VJCA 3O4JA 3WL5A 3CCCA 3WKBA 1ZD5A 5FP0A 3PE6A 5CT4A 1M33A 3JW8A 3KD2A 2XDWA 1LPSA 3AIMA 3KSRA 3VXKA 1LNSA 4BAUA 3WJ1A 4JH0A 4UBOA 3RM3A 1FJ2A 1LZLA 2Q0XA 3BE8A 1QFMA 1SCQA 4X92A 4QDUA 4RNCA 4J0HA 4Y2PA 2QVBA 2RI6A 2QZPA 3PI6A 4Y2UA 5SYNA 1JJIA 2DFPA 2Z8XA 3WWCA 5DNVA 4UHBA 5JD4A 3CCBA 5H3HA 3ILSA 4QWMA 3WK6A 4LXIA 1VA4A 1UOQA 3OPMA 3SX4A 4XX1A 4OB7A 1L7RA 4AMZA 3RLIA 2GBCA 5AM4A 3W06A 5JAHA 2WG0A 4PSUA 5JZ9A 4Y2TA 5E4TA 1DWOA 2ECFA 5SYMA 3WA7A 5ISMA 4X93A 3PF9A 4P92A 2ZJ7A 2HA2A 3GBSA 3DL4A 3F67A 4FLFA 4B9EA 3SK0A 2OAEA 2GBIA 5EIHA 3W9BA 5DYYA 3C6ZA 1SCIA 5A6VA 3TRDA 1VKHA 2GZSA 5AM0A 4ITVA 2CEKA 2D5LA 2WUDA 2QJWA 5CBKA 4J0IA 3QVMA 4M0MA 4X71A 3V48A 1FFBA 5HCUA 3NGMA 4IH4A 2H7YA 5AKIA 4I19A 1OXMA 3WKAA 4EUSA 2HDWA 2WUFA 3NWOA 1Q84A 4X95A 1XZHA 5I8PA 4C89A 4J3JA 5IVIA 2WFLB 3NUZA 1KU0A 2XUPA 3E4DA 5EHQA 4DYHA 3AILA 3WK9A 1J07A 4H35A 5T4EA 4C4YA 1CUXA 5F4ZA 4J0GA 5AKLA 4L3WA 4OYYA 3FNBA 4CI9A 5A62A 4UBLA 4KAAA 5AJHA 4GXNA 4FNGA 5ESRA 2QXTA 1WB4A 5ALPA 1XZMA 3CXUA 5FV4A 2QMQA 2GZRA 2DSNA 4EZIA 1A8QA 1BE0A 4HXGA 4K2AA 1H2WA 4UFOA 5AIBA 4H7JA 3A2MA 4YASA 4AZ3A 1ZGBA 1VE7A 2V9ZA 4E46A 3T52A 4A16A 2JGIA 5ALGA 1XZIA 4JNCA 4LYEA 4JYPA 4Y2YA 5AI5A 1HBJA 2QT9A 4TPKA 4QZVA 3BWXA 2XMBA 3R40A 3AZPA 3OURA 3QPDA 4LXGA 2WSLA 3VISA 3ZI7A 1AZWA 4BATA 2RAUA 3KWJA 3STUA 3CN9A 3C6XA 2XUKA 5A7GA 5ALLA 2O2HA 4EHBA 3DD5A 2HHAA 2XQFA 1OCEA 1QE3A 4W1QA 5CH5A 1UK7A 3MGAA 1THTA 3R3YA 2WHPB 5ALYA 3OM8A 2G4LA 4BCDA 1I6WA 2WHRA 5EFZA 5AI8A 3G9ZA 4C01A 1F8UA 3D5EA 6YASA 2PVSA 1ORVA 3E0XA 1JFRA 4EB0A 5KWJA 4EA6A 4EBBA 3STWA 2X76A 4WDQA 2XUFA 1NU6A 1G42A 1F6WA 4ZV9A 3TEJA 4QDTA 5HFNA 3N0TA 5E4YA 2Y2UA 5AHXA 1ZD3A 3K6KA 2CJPA 1P0QA 5LKRA 1U4NA 5FDFA 2QKYA 1HQDA 3I2FA 2XLBA 2ZYSA 1HPLA 2XUHA 4PW0A 3VDXA 3FWHA 3LIPA 1TRHA 2XUOA 4DSZA 1YS1X 3D4LA 1VZ3A 5AOBA 1WB6A 5FLKA 4D9JA 3FLAA 2QM0A 3S8YA 2PSHA 4UHDA 3EF3A 1B6GA 4MEBA 1H22A 2OQVA 2JEYA 1QJ4A 1CLEA 5HKBA 1QO7A 1NU8A 1VZ2A 2CKMA 2XQJA 2XMRA 3AIOA 5C7YA 3AIKA 2XMQA 2Z5GA 1XZFA 1CQZA 1SFRA 5FRDA 3H2HA 4C4ZA 4AMYA 3DKKA 1ACJA 2HM7A 4N8DA 1VXRA 2BFNA 5K3BA 1EHYA 1ZICA 2O2GA 4K6HA 3I6ZA 4ZGBA 1E3QA 2HRRA 4AN1A 4EY4A 4P93A 4HAIA 1R4ZA 4LKOA 1MX1A 1BRTA 1QIMA 1CUAA 3WWPA 2D0DA 1JI3A 3WK5A 1UOPA 4OB6A 4UBIA 1YCDA 4Y2JA 4GDMA 1UT6A 1CUEA 2IITA 3FAKA 4K6GA 5ALWA 3D7RA 4NMWA 4X6YA 1WM1A 1XRMA 1E8NA 3BIXA 1UK6A 4J7AA 4B9AA 4WY5A 3WWOA 3G8YA 5HKAA 4X97A 1U65A 5ALQA 2IX9A 4AO6A 3PFCA 1ODSA 4UPDA 2V98A 2WM2A 2XT0A 3GZJA 4FNMA 3QPCA 2CZQA 1IUPA 3B5EA 3HZOA 3GELA 4O08A 3ANTA 1MX5A 1XRPA 2PUHA 2PKYX 2BGNA 2WFMA 2OG1A 3DYVA 2CB9A 4B6GA 3QPAA 3ESCA 3WYNA 2C58A 2ZYHA 1YA4A 1BU8A 5D3ZA 1IZ7A 3HSSA 3STXA 1JU4A 4F0JA 3WKCA 4HVTA 5FOQA 3WL8A 3PICA 1Q0ZA 1N8SA 2VT6A 3I1IA 3H18A 3GA7A 2WKWA 4FKBA 2IIVA 3R3VA 5DJ5A 3QM1A 4FHZA 5EHZA 3TGLA 5JARA 4E11A 1HLGA 1XLVA 2YYSA 2XUQA 4TVKA 4BCBA 4B7ZA 1USWA 2Y6UA 4JYMA 1JT2A 5JYCA 3IVMA 4Q3OA 4MQLA 2ZJ6A 5CT6A 5BV7A 3DS8A
chains in the Genus database with same CATH superfamily
3VPXA 3E4CA 2J3DA 3SM3A 3VR5A 2QD3A 3MOIA 1WULS 3BB1A 3MGKA 4I8DA 4PS1A 4H0FA 4BRZA 3IP7A 1JQAA 4L7VA 5AHKA 4ZMSA 5C81A 1EWQA 3OEED 4ZZ2A 5JFGA 1WBDA 3Q6NA 2GN8A 1JHRA 4RMNA 3X1ZA 3ETNA 5C8VA 1D7AA 5ECGC 4D8XA 2WU0A 4J91A 1EK1A 3U17A 3HN6A 3UB4A 1L5NA 2IEZA 2GCPA 2PWPA 1R8XA 3NH9A 4NS4A 1IWOA 1GGJA 2COEA 3FYUC 4HGYA 4ZP1A 2H1SA 1TPYA 2O6HA 2HY7A 5DMXA 2H3HA 5G1NA 1RCUA 5H7XA 3V6MA 3N28A 4DG8A 3L1VA 5YASA 1Z88A 1Y9DA 1UJ6A 4WZAA 2AUNA 2IU0A 2Y1CA 3I76A 3PHLA 2HSWA 3RWMB 4EYEA 5A71A 5HZMA 2FSVA 1V4NA 1ULUA 2VEDA 1KQNA 3KKQA 3GG9A 3M70A 4LC9A 2ZI6A 2P8SA 4K6MA 2PYZA 2V6GA 5I9LA 1VYVA 2WWHA 2AS0A 3CUYA 3LUBA 5AXCA 1GM5A 1GTRA 1YGPA 2YL2A 3H0CA 4HQ6A 4YAOA 5E6UB 3H4MA 3DUFB 1Z74A 4UXHA 3FCUB 2FZVA 3A0UA 2C9YA 1E1LA 3DVSX 5C3UA 4KR6A 4AC9A 5DK4A 1A8UA 4OXRA 1NC3A 1QU2A 3GLQA 3I4CA 3GRVA 4ZZ0A 5LXTF 4RV9A 1RFLA 1R5NA 1XPUA 4ND4A 3OQHA 2GJ8A 5C4MA 5FOSA 2ZDQA 3KELA 2ZUTA 4U1RA 1EQ2A 3RT9A 2CT8A 4YCMA 2ASEA 1B8VA 1ZNYA 2WHXA 1UM9B 4ZK2A 2JGLA 2KJQA 1XLWA 2UZIR 2WJWA 4HH0A 1AJEA 2VZ9A 2R11A 4Q3NA 4BNHA 1JIQA 4G89A 1U7TA 3FJOA 4ILEA 1NMSA 3S29A 5C52B 3PNVA 2P78A 2HBRA 1OFUX 3N87A 4H6WA 3WRYC 4YRGA 1JAXA 2HYDA 3KOOA 3SFZA 2JFXA 3ZGOA 1CW2B 2RGDA 3RHFA 5K0FA 3THSA 4GBED 3LVRE 3OVMA 5AXDA 3GGJA 1LKZA 4PYIA 1PWYE 1YC5A 2VP0A 4AG3A 4YJ3B 1EGHA 5CD9A 1M9NA 1SAYA 4RGQA 4I1OA 3LY8A 3BMNA 5AJYA 4WFKA 1XFDA 1RBYA 1VLVA 4LXQA 1SRQA 1E7MA 5BSFA 4NZOA 4DARA 4MWGA 1Z4NA 1DBSA 1UWKA 2CHUA 3NEAA 4Z1MD 4PG8A 2VT7A 5ALSA 4YFYA 1ZYUA 3V97A 3VV3A 2NT3A 4GZ3A 2DR2A 2DVMA 1N3LA 1FMTA 5BN1A 2WLTA 5LDHA 1FPQA 1QQAA 1L8AA 1SBYA 1WLSA 3DP9A 3II6X 1RCTE 5BR1A 1E8MA 1OLXB 5DVZA 1G2OA 5ESWA 1AK1A 2C3UA 2O1WA 1EH5A 3MGCA 4R9VA 5TMDA 3RRJA 4EITA 4YAUA 3QPUA 5HQ3B 4OQPA 4PS0A 3A1TA 2OAQ1 2V3WA 4M7OA 3RUIA 2B4YA 2EYQA 4IH9A 1GN9A 2ZE6A 4RCZA 1SULA 4H4DA 5IFKA 1TLFA 3SDSA 4B81A 1NR7A 4KQCA 5KYNA 3BC1A 5IMBA 2HXYA 4NI5A 3X1WA 1JEYB 2J5XA 2Y0CA 3KYBA 4MGHA 3KR2A 1CUVA 5HMMA 1F5SA 3RIYA 3ZWPA 1ZOPA 1U1DA 5IJXA 4EY3A 1L4MA 2Y1GA 3HDTA 3U7GA 3PHCA 4QKQA 1CZOA 3GROA 3HVKA 1PZFA 3CX7A 3WKDA 4DIMA 3WNZA 3R7LA 3S5JA 4BGVA 4E2FA 5JMPA 3ZE8A 1ESDA 2P30A 1QG0A 1DMRA 2Y1FA 4ZIRA 4HGRA 1VMAA 1FDVA 2INGX 3NTQA 1KQ3A 2C5SA 3GRRA 2X6RA 3NH6A 4GXTA 4YC7A 5CPBA 5EKSA 5EVJA 5A2GA 3I5XA 1IG0A 2FUNB 1U8EA 4HLUC 5EGSA 3PQ4A 4X00A 1DP4A 3I30X 5KNBH 2WFZA 3MJ4A 4NL4H 5ALOA 1XHEA 3LC7O 5B4VA 5IN4A 2O57A 4LNAA 2REBA 4N6NA 2XEXA 4YWJA 2QV7A 3KKMA 1KOGA 1JALA 1T4CA 3NV9A 1CZRA 1XKTA 3EWSA 1CRPA 1ULHA 1PHRA 2I3BA 3AJDA 1EB9A 1VMEA 4QXMA 5BSUA 4DA0A 5A1TA 2LDBA 2NSJA 1OX6A 2G63A 3EZ2A 2PV0A 4JI2B 1YWGO 5C5DA 2DQZA 4R8VA 3WIBA 4EATA 3E81A 5GTDA 3B2QA 3OKCA 1L8OA 4QASA 5FWAA 4RESA 3T7RA 3DVRX 5DNYB 1VE9A 3PA8A 1Q11A 3KPYA 1Y6JA 4M0CA 3I2KA 3VHQA 5CFQA 3TJMA 4IHJF 4QUEA 1SUAA 3AJAA 3TW8A 5KSYA 1T8TA 4CTJA 4F5DA 4G6ZA 1MABB 4G4SP 4IJQA 2ZS8A 3D3NA 2D59A 3F46A 1QH1B 3DJFA 4D56A 3IE2A 3D59A 4CQJA 5JD5A 2Z5FA 4L50A 4Q03A 2E89A 2HHJA 1APBA 4BDTA 2VG8A 3UC5A 5CB4B 5TS2A 2X2EA 1YVEI 5CLGA 4QXOA 4CM7A 3REQB 1P7PA 1CZKA 3ESQA 4FYKA 4GH5A 4YRLA 5FLEX 3VDNB 3ELYA 1XR3A 1ZGAA 1AB5A 1E2DA 3BDIA 4OHCA 1GGEA 2C96A 2QTTA 1XPRA 3K0FA 1GUAA 2DBYA 3I2YX 4E5PA 3TAXA 4TYMA 3UMFA 4CKEB 2JHAA 2QLTA 1NFQA 2D8MA 2ERXA 3GJSA 3TFQA 3IODA 2C2XA 5HF6A 1ABFA 1ISHA 1E2QA 4FHEA 2DHEA 2YHUA 1LFDB 4W7HA 1MC5A 3L0OA 3ZXUB 4JYCA 3RG2A 2B1IA 3O2JA 5MFPA 3N59A 3BGIA 2ZXUA 2IHVA 4LYHA 5EXXA 3LZ6A 1WP4A 3HYCA 4MICA 3JAKB 4DLUA 4KPYA 1T5IA 4UMEA 4ND1A 1ELOA 4BJ1A 3JZAA 3EQ2A 3ACDA 4G5GA 2GYUA 4O2BF 4WBNB 1M34B 2G36A 3CZ9A 2IV3A 1XRQA 1SKBA 1MJNA 3CB4A 3L92A 3JU3A 3SZUA 1BX1A 4I8XA 1DQNA 3DCYA 4L2IA 5JSYA 1Y8ZA 1GADO 1DJNA 1PGPA 3C4JA 4WGFA 3QFHA 4RY2A 1H8ED 2H1IA 1QBKC 3HR7A 4NBUA 1LBTA 5F35A 4BN4A 1FLVA 1IATA 5G4LA 4CM8A 1IN1A 4MS1A 2QTWB 3DAGA 1GSAA 1UKCA 1QYRA 1LUAA 5J5CA 1E99A 5F5XA 1DCMA 1GCIA 2X4IA 4PGFA 3GDGA 2P77A 2GZHA 2WR8A 1CDOA 4KACA 3RTDA 4IKOA 3JAMA 1OLUA 2BJVA 3EMVA 4BWYA 2GT1A 2C5GA 3AETB 3I61A 3UY4A 2QEQA 4RTOA 2GF2A 1TUGA 5E9WA 3UJHA 3KUCA 1AC5A 1KVUA 3ILHA 3NBAA 1ZCBA 2QR2A 4Q9HA 3WMFA 2FPPB 3VHXB 5KCMA 1OGIA 2BZ0A 2IF0A 1MMFB 3QQPA 4YBRA 3FMVA 3T3HA 4DGQA 3V3TA 2NOAA 3K0EA 3NNNA 1NRWA 3FNQA 4OIFA 4P82A 1QCDA 3IUBA 3A2KA 5BR7A 3ECAA 2R6HA 2QRHA 2LVBA 2YIDA 5F5LA 5G0WA 2VPZA 4J0CA 4ARUA 3IJRA 4EOGA 3NHRA 4MCJA 4TWZA 4WACA 4ROTA 1WMAA 3FOWA 5CA0F 4HGPA 1Z82A 1A76A 1HO3A 5ENVA 1NULA 1SHZA 1IZYA 1BO6A 3KEFA 2Q8PA 3QFRA 2WNIA 2O3TA 4YONB 4DBVO 1VSTA 3D5QA 1VI6A 1ZN9A 5AI6A 4P6VF 2Q21A 4N47A 1G5QA 2EFCB 4NCJA 5JMWA 2X4GA 4V0SA 5GAJA 2EFHB 2XX3A 2YIJA 2YNMA 3E1SA 3M6MD 4IDBA 4U9HS 1Z6QA 3FZYA 1FP4A 4KUEA 2JIMA 4HYEA 2H4ZA 5FNVF 1ZBQA 1T4MA 4MKXA 5ELMA 1E2EA 2YC2C 1N4DA 4ZT7A 1FLAA 1YASA 2OC4A 3Q0IA 3QF4B 2IDMA 2V58A 1VCNA 4PQEA 5T67A 1X15A 3TTYA 2HPVA 4EL5A 2WSMA 4PSKA 1PSZA 1ORIA 1QCCA 4Z7JA 2BFFA 2ILTA 3F6PA 5SY9A 1DT3A 1OZAA 4AN4A 1Z5WA 4DJDC 2PFSA 5CJPA 1M1NA 2A0KA 3QH4A 4XVQA 3NWJA 3ZQKA 4C04A 1XN1A 3ICWA 4LF7B 1BYUA 3G79A 4QVGA 3CLTC 3GDOA 5G0SA 4QYIA 4L0DA 3OOHA 3RRNA 2NQTA 5EMMA 5HCIA 5JSKA 1FL9A 2FSIA 2DJIA 4F12A 2F17A 3IDOA 1PJ3A 1D2MA 1FYFA 3BQNB 4IIHA 3FTPA 5H70A 2BFBB 3ZI0A 5DTIA 1ZSNA 2RGYA 4BTVA 3I9V6 3MTQA 4OUKX 2ZWOA 2B6HA 4JDPA 4XQ0A 2NUTB 3E2PA 3WOHA 2YIMA 3A1NA 3GJ8A 1I7DA 4RJIA 1Y5MA 4OJKA 4JYZA 1SCJA 1C0PA 2GCEA 2J33A 3TLXA 4WERA 5KYKA 5IKPA 4RF3A 3BGDA 2GKGA 5CCEA 5JATA 4EPTA 3X0DA 3WNCA 4RLHA 1SZPA 2IZOA 1C3EA 4KC0A 3ABOB 2Z2ZA 5CB0A 5TT0A 3CIFA 3KLOA 4E33A 3BHJA 3EC7A 4GUAA 4PLFA 2VJYA 1P74A 1KC1A 4P81A 5DNCA 1COWD 4HQLA 2C9MA 1L1FA 3KYIB 5T3YA 2D5AA 2BKUA 3QKRB 1A7KA 1FMLA 3OF5A 3OAAA 4YCSA 1XRRA 1JQJC 3RG8A 3X1YA 1R74A 3L40A 3UB2A 5I4IA 1JKFA 5T7BA 3LNTA 2B78A 4OMCA 5JSHA 3PYLA 1UM8A 2OCKA 2NYVA 4R3UC 1G2PA 5ESDA 4BBZA 2GN4A 2I3ZA 1GL9B 1KO1A 1QK3A 2G8NA 3FOCA 4AI6A 3GLIA 1P18A 3WKEA 3DEZA 2FG7C 1N2JA 2GRJA 5K8CA 3KETA 2YWXA 2GD2A 3VDMA 1VLZA 3PWTA 2RH5A 4KR7A 1CVRA 2W4IA 3HVIA 5F21A 1E1QD 2VA9A 3Q98A 5CBPA 2J4FA 3SMVA 1MAAA 1ACLA 1CB7A 1TU0A 2O7VA 2P4EA 3O84A 4YYEA 1AQIA 1E89A 5A0TA 4EKDA 2QMUA 1T1EA 2WIDA 2P1ZA 4L5YA 2OAGA 3MMXA 2M98A 2RK3A 2QENA 4OGLA 2IYOA 4Q4AB 4AP5A 5MN4A 5JU6A 3H87A 3TD6A 1T4BA 3COYA 3NC4A 3PLRA 1FJXA 5IDQA 3QXXA 2PH5A 3GXOA 3K0CC 4HNAB 4G0VA 1TMYA 3LPNA 2B5VA 1PL7A 5CX4A 1QFXA 4XW2A 1P61B 1A97A 2IC5A 2R84A 3OY2A 3QWIA 3A9WA 2F1HA 4HUQB 3RKSA 1IHPA 3LUAA 4MUFA 4XX0B 3EIFA 1NVVR 4W9NA 2O8FA 2C99A 3C6KA 1VCOA 4PCVA 1X7XB 2R68A 3PC7A 4AKIA 1TC1A 3BWDD 3TD2A 3TQOA 1BXGB 2C1ZA 1M1XB 4U7DA 1LLQA 5CR9A 4CQLA 1I1NA 3OD1A 4Q7MB 5JFOA 2XIQA 2OV8A 5JZSA 4JBGA 3MYRA 2PHZA 3RU3A 1QXSA 1MOSA 3K0SA 2DXIA 3QNMA 3UT0A 2Y66A 4M87A 3ZCUA 2Z4RA 1GGFA 1HDOA 2O4UX 3FH0A 1F2TA 4Z0HO 3PRYA 4EEZA 5EIBD 4B80A 2FFJA 4X85A 3AO0B 4KXNA 3BN3A 4UUNA 5EGNA 5AFSA 1GPDG 2VJBA 4OX9Y 1Z7YA 1U2GA 3ASZA 5L3SB 4ZTBA 1M6EX 2JJYA 2WD8A 2WJHA 3CJRA 5JEDA 4EEKA 1DDGA 1HE8B 3KZ1E 3I1YA 1U7WA 3ZE1B 3N0WA 5BR8B 3HJFA 2NAPA 3N2NA 3FFXA 3BD7A 4E70A 4N76A 3IMGA 2AJCA 5FYDA 2PIAA 4B47A 5DGXA 1QHHA 4I55B 2BTOA 1XZBA 4CT5A 1E9BA 4YMUA 1IWPB 1L8LA 2DUMA 2JB9A 1HYBA 5IULC 1ECGA 4F1WA 2H57A 3H9GA 3L8FA 4YJGB 1XDGA 3DZBA 3RBZA 1CT9A 1M1YA 2CHQA 1CE8B 3VNAA 5E7QA 3UUEA 3OPYA 4EHLA 2VSQA 4CNQA 1M83A 1SBZA 1IZZA 2BFPA 3LY7A 1ID1A 4IJ6A 4TMWA 5F73A 5KQSA 4QA9A 3K6SA 1NYRA 3B9RA 3GJXC 1K2VN 3OE4A 3HU1A 2W7TA 5LMZA 1LLDA 4OK5A 1K5PA 1BOFA 3MLAA 4AZ0A 2PL9A 1BMFA 1NAIA 3LG2A 4JOBA 4C4RA 3SF8A 4A23A 2XYRA 3JQBC 1TTPB 1YE3A 4HAVA 5IX8A 4BXOA 1NLYA 3TIFA 3WYFA 1SQ0A 3KAPA 3VV2A 1GQSA 4MUIA 4A6EA 3AY3A 3LF1A 5HRUA 3PQ3A 1PFQA 5HIJA 2YMPA 3NEPX 2UAGA 2HA3A 4JBXA 3U3OA 1KU6A 3B20A 3IB6A 1ONOA 1CJCA 2FN8A 1KOLA 2ZROA 1HX7A 2PMCA 1I7NA 1VB5A 4IKPA 2ERCA 2ZZKA 3ZGVA 2Y67A 1Y9ZA 1YS6A 4JB3A 2P79A 1XLTC 1R8QA 1Z3CA 1D7OA 3HNPA 3PQFA 4NQRA 5C8YF 1OI4A 1FB5A 1YQEA 3ZY6A 1I1HA 4F9EA 3F8SA 5U4QA 2NYAA 1R12A 4ZMBA 3O8RA 4PIMA 1NBEA 4BP8A 2JD1A 5CEFA 1MF7A 4ZVUA 2OGZA 3ZIAA 4YCDA 3L1JA 4MRAA 4TUYA 3DOOA 4ENQA 5JROA 2GEUA 1L0BA 4A8PA 3DKRA 2R6ZA 4C06A 2PA3A 2ZEJA 2IZZA 5HRAA 3WK4A 4DR3B 2CBGA 4ZYWA 2J09A 2BSQA 1YB4A 4I50B 1QIHA 2H0AA 4B3HA 1W30A 2HSZA 2H7CA 2VYND 4QDKA 4RQBA 1N2XA 5IARA 3X43A 5FBVB 3RNLA 1K7XB 1N5OX 4FQ7A 2L17A 3JYLA 4AZ3B 1K3FA 4MP3A 2A7QA 2OHFA 4Q6WA 4TVBA 5FXMA 5AXBA 4NFSA 4YRCA 2GLXA 4KNYA 1FUYB 1BMTA 4KV9A 2C0CA 4MVJG 1K63A 3IPYA 4HN4B 5AM2A 2SKEA 3B1ZA 3R44A 2Q45A 1AHPA 4UHEA 1RFGE 3KFXA 3AEQB 3HN7A 3WMWA 3T5AA 1CQJA 4NG5A 3T5GA 4EB3A 4K28A 1N0IA 5IC5A 4HDQB 3VTAA 1BEUB 521PA 4D1YA 3QQ5A 1UR5A 2DZDA 2X3FA 4K3UA 3IP8A 2XB4A 5F1OA 5TT1A 4DQVA 4DZTA 3VYWA 3B6MA 2A1IA 3ESXA 2OB2A 5ERXA 4BX2A 4JVOA 3RADC 1TAQA 1UP4A 2B82A 2P4SA 1NG1A 4NKRA 1OFTA 3N2GA 1C0LA 4EKIA 4OX9B 3HWSA 4KWIA 1UANA 1YU6A 2B30A 4HJXA 1Y8QB 4F3YA 3WXBA 3JQ8A 1CR6A 1UKAA 1GTG1 2QMZA 4CG3A 2F3RA 1N9GB 2XNKA 1J8YF 1ONBA 3P20A 4ZCIA 3V8PA 5KMGA 3HY3A 3MILA 1FUEA 4MH0R 1GG8A 3G2MA 1YE5A 4GLLA 4HNGA 4E88A 1LPMA 3AI1A 5CDTA 5KJFA 1D2CA 3GJTA 3UC9A 2FF7A 4XM2A 4BX8A 2W6NA 3PQ8A 2DYKA 3D3QA 2XI4A 1H2XA 3HCDA 4IOJA 3HABA 1SQFA 2JH3A 2Z9BA 1N2EA 4XH9B 4D0NA 6Q21A 3L49A 2L69A 3NTOA 1JKJA 1K08A 3HEAA 1YQUA 1Y33E 3FI0A 1VL6A 1QYXA 4OVKA 3OZDA 3Q9SA 4L6CA 1VP3A 2BM9A 4LTNA 2NV6A 4QLBA 4N0MA 2OCLA 3ZE2B 1YONA 2VTKA 1S7CA 1C5KA 1CUFA 3K2BA 3ZNQA 2XMSA 3NIFB 3WYDA 5L3VA 4ZI2A 3U1TA 1IXYA 4ISBA 4F46A 1PZMA 3WQBA 2PYDA 4J0KA 4YI5A 3P19A 2P7IA 5KX5F 2DR3A 3AW9A 2ODEA 2RB5A 1C8KA 3BRWA 2NGRA 1O97D 3BTOA 3FX2A 1J9ZA 1UQRA 1XBTA 4YECA 3H2SA 4M21A 1KI4A 4MCAA 4GPBA 2CLEB 5JS7A 1LI5A 3R3ZA 3K96A 1FFXB 4FYYA 1KVTA 2R6GA 4RD2A 5HA5A 4D99A 3M5DA 3CWZA 3V5NA 1GAWA 1ECCA 3EZ7A 1T8RA 2ZSIA 1SUBA 2PPVA 2UKDA 3OCUA 1D1TA 5FEUA 1M6HA 1I6KA 2WWGA 4S24A 3AKEA 1BHSA 1A9RA 3PC3A 4Y9TA 1T5BA 4UHKA 5SV2A 2E48A 4L4RA 1PZXA 2SHKA 4AYTA 2NT4A 4QXQA 2JH9A 1XTBA 2NTYC 3ESDA 3TCKA 5I47A 4C2TA 4XIIA 1Z5VA 2G80A 3IQIX 5D5PA 2Q4DA 4B3CA 3OIWA 3TUZC 3H5OA 4ZA2A 4UW9A 3U62A 2E4YA 4Y1GA 1KGDA 1H05A 2NW6A 4BPRA 4CTOA 2BISA 3A9SA 3A9TA 3LP6A 3ZHQA 1JAIA 1R0CA 3NORA 4V03A 3ELUA 2CVQA 4WXHA 5FPYA 1C8VB 2X4DA 3G0DA 4QO7A 1PJTA 5ADUS 3JWJA 4YJ2F 4ZRNA 1EJ6A 3AEYA 1DSSG 1NR5A 3DHWC 1G3UA 3P52A 1AHHA 2A57A 1C9JA 3GCZA 1IEWA 2OP0A 3CMMA 4OJNA 4O4HB 3PUVA 4TV9A 3BWMA 2EZTA 3MJEA 4YQFA 1CIPA 3RS4A 1FFSA 5HFAA 3R7WB 5KTYA 2Z6QA 5L4NA 1RBZA 1SB8A 2IWRA 4P0PB 3TOCA 4IGIA 4PIVA 1Q16A 3PLAE 3KSZO 2PZEA 4QGAA 5J2UA 1U0RA 2QG9A 4IFIA 1VIMA 1EIWA 1JSZA 2O4CA 1G18A 4J03A 2V7QA 4M38A 1FP7A 3M81A 4C3VA 3WLIA 3HKDB 4RKEA 4Q93A 1GKYA 2XDQB 4D57A 3FW1A 1CY1A 5HK8A 2O8DB 5DWVA 1GA6A 3B9PA 3EA4A 1PG2A 4URWR 2XT9A 4CCSA 1RHJA 3T7IA 2QRGA 2Z8YM 4JBIA 2YQ4A 3COJA 2C0PA 1N6PA 1LTQA 3E15A 4N7MA 1RRFA 1S2GA 2K2WA 4UDNA 1G21B 2JFUA 3BH6A 3CS3A 3JQAA 2I1LA 2IZ0A 2E7ZA 1V5WA 4LRWA 1T36B 3MUNA 2HEGA 4BP9A 4ZCSA 1A88A 2F62A 1GT6A 2OQ2A 1CDEA 4GKBA 1TUIA 3IHKA 1AF7A 4DMMA 4C0HA 1EUYA 2R7MA 2QVYX 1NJ2A 1NPYA 2XGMA 2CK3A 3INNA 4R8MA 3BB3A 3NW9A 3O4GA 2AXNA 1IBRA 3U4DA 2WI8A 4UVIA 1ZI8A 2P0YA 3HY6A 3K1AA 1FEZA 4J1TC 1L5HA 2VP2A 4KO4S 1HA3A 1GG2A 1QDEA 1Y7HA 3SR3A 3ZTTA 3V32A 4K3VA 3ROQA 3D2AA 3RIGA 1YR3A 3N76A 3NHPA 3DBIA 3LO8A 1ZXBA 2VAVA 4FTWA 2WTXA 1ZJZA 2XA1A 3HFJA 3RYFA 5B1EA 5JRZA 4R0MA 3MG9A 4KRYA 1CX9B 1ZXLA 3GF4A 1DC7A 3K5IA 3HG7A 4ZCLA 4IV5A 1RXYA 2JHGA 1J2UA 4DXDA 2ORYA 4XQEA 5KNBD 1WDLA 3OLQA 5D3KA 3FAZA 1ZC4A 1MT3A 2VSOA 4JBLA 4X3PA 3SS9X 3QVTA 3ZK9A 2WSSD 2ISQA 4UUQA 5E6RA 5DHPA 3AEZA 1AKEA 1G63A 4QOHA 3USZA 4W5TA 2Q0QA 4C0JA 1KAEA 2UZ1B 1I4DD 2JK0A 2D5BA 4NECA 1XL0A 1W0CA 4MVJM 3FVVA 3PR1A 2JGFA 1LDGA 4MB2A 2HIHA 3FUTA 3L5KA 1CF4A 3TS1A 5HYVA 4UCQA 1ML3A 2ZRPA 3EIQA 1UJBA 4IZOA 4YCBA 5A3QA 3QFFA 2FPXA 5K6AC 2W4MA 4YJHA 2O7RA 2OK8A 5C8DA 4AKHA 4JJKA 2WF9A 4X6UA 3VAYA 4KXQA 4XTCS 2BSXA 1OASA 1ECLA 3MTGA 3C7AA 1BU5A 3EEBA 1P2DA 5CIWA 4U5XA 1RQLA 2Q29A 3CRW1 3KTAA 2OWDA 4KODA 1M72A 3BM5A 1QUEA 3V4SA 2CXPA 3IFSA 2R6DA 2IODA 5HP4A 1PEKE 2ZBVA 1UPBA 2H3EA 4MVJE 5E2AA 5TNXA 4F2GA 2WTEA 3W9SA 3IBSA 1F2UA 4IJ5A 4ESOA 4CLEA 2J1LA 1PV4A 2F90A 2PFKA 3HO6A 2X6QA 1K9SA 4UXIA 4YP9A 1V1RA 2O7QA 2A9KA 3JQGA 1C80A 1Y3IA 2FNAA 4REQA 4XIJA 1D2AA 3WWDA 4XDYA 4D3XA 4KUHA 1NV8A 3FPHA 4GZLA 4ZOQI 5B7PA 5G3YA 3IVAA 1B26A 2JI4A 4G0ZA 3UAYA 4BO2A 1NAHA 1VPVA 3VR2D 1JMKC 5KVVA 3UT5B 4EG7A 3G9UA 5ALRA 1P75A 2JKYA 4Z0NA 2J07A 3M34A 1BXRA 1C0EA 1Y8RB 4CMEC 2QOEA 5TLSA 2VQ6A 1PZHA 5EWMB 4CF7A 1L7EA 1ZDMA 2FZCA 1J7KA 3MYYA 4L85A 3THOA 3HK2A 1X2EA 4FEYA 4MQBA 3KP1A 5F4BA 1EQUA 2BGKA 3CX3A 1EVZA 1PR6A 2XEDA 3P9SA 4FFBA 4V24A 1THMA 1MIOA 1W88A 2B4TO 3T7EA 2ZYIA 5KNDH 1JG2A 3G23A 4CKXA 2GS9A 1PV1A 4JR1A 3WIDA 1QF9A 2M9MA 2F9FA 3HRKA 5I9SA 1TOAA 4EAAA 3EQ6A 1U7XA 4O3FA 1KIMA 2CLMB 2H4XA 5HHTA 1XC7A 3HLKA 4LF8B 2WHPA 1NVAA 2ZIEA 3TSCA 2WPDD 4KBFA 2WKRA 1UJ2A 4H7PA 1BMQA 1Q5PA 2GKOA 3KQHA 3JQ9A 3R0QA 4I1RA 3O8OA 4Q3KA 5AVKA 5C4GB 3W5HA 1ABBA 1ACMA 4DHWA 1ZM7A 3AR5A 4A2CA 4BE9A 2FW0A 4FIZA 1C3JA 4CCYB 4WN9A 5KVAA 4JJIA 1ST2A 4EP1A 5KINB 1E2FA 2G1JA 3S81A 3R0XA 1IM2A 4H9GA 2RAPA 5FTKA 2IUUA 1QVWA 3Q72A 3MJCA 3GP5A 4HVLA 2R6FA 2IHYA 2Q3LA 2KQUA 2MSCB 3A6DA 4JSYA 4N3NA 3B7PA 2H5JA 4OO3A 5DEOA 3VZRA 2YJ3A 2ZRFA 4F45A 2FHSA 4KEAA 4KQ9A 5GZ6A 3WK8A 4CVNA 4HY3A 3CRZA 2OXRA 3EUWA 2QW0X 4MV1A 4U7JA 3OJOA 5LC1A 3QX3A 5H3CA 1HLFA 3L0BA 4JKOA 2PO7A 3W6OA 4RM2A 1O94C 3MD9A 2O3JA 2HCTA 2VJPA 3C74A 3YASA 1KKMA 1PG5A 3MHPA 1XA0A 1EFCA 4QBGB 5IF3A 2GHTA 4D8TA 3E48A 4R1SA 2QP4A 4BQFA 1HE3A 1RJEA 4TLEA 4CUJA 1E2IA 1LU9A 1QH0A 1S8OA 3F3KA 4FEAA 4HBZA 4PLPA 5AK3A 3TTWA 4DDKA 3D3KA 1CY4A 1T2CA 1PW7A 2N1BA 2D8AA 5AM1A 3P0IA 3I39X 5CTJA 5BN3B 1R7RA 5JNSA 1GP2A 4MXDA 2DSTA 1GLVA 1U9JA 4NAUA 4F2HA 1TA9A 2JBAB 3VYUB 5JPCA 1ZR4A 3OBBA 1DXQA 2JARA 3E5MA 3ZDQA 5D3MA 3NATA 2H2DA 1NPDA 3JWPA 4LJAA 4MWZA 4P3YA 2FFRA 5E2IA 3K2IA 5AKJA 3RU7A 5CIYA 4WFJA 2EW2A 3PC8C 4ED9A 4B6PA 3ZNNA 2BGWA 2VHQA 3JATB 4U5QA 1XD9A 2ENWA 2GQ0A 5D00A 3SQOA 2QRMA 3NBZC 4IMJB 2MJLA 4IS3A 4WZAB 3V1TC 3DHEA 4Q3EA 2D2IA 1PFYA 3AXSA 3D1JA 3AFNA 1EVQA 4HQNA 4IIJF 4RMGA 5CT5A 2GTHA 3SP1A 4Z6KA 4RTNA 2AKEA 4XOIA 4FYMA 2OPBA 1AKMA 1F38A 1WUJS 3Q2IA 1FP2A 5E1DA 4D44A 3SHTA 3PXUA 4EG8A 4FW9A 3IQFA 2NO5A 3EQ9A 1KI2A 4LGYA 1HV8A 2IVZA 5FUWA 1JDTA 1KI7A 3O38A 4TZKA 5CB8A 4FSXA 4IF6A 4Q37A 1G8FA 3NHZA 4DC9A 4UTPA 3A06A 3MTAA 4UHJA 2ZSKA 2O5RA 1PR0A 4KXFB 1U9IC 1Y48E 4RHCA 1W4BA 2V8BA 3QYJA 1DUIA 5G3ZA 4ZI7B 1Z6AA 2GEBA 3P97A 4LYGA 4FCWA 1PX0A 4TMKA 3WL3A 2FAXA 1NUPA 4CEJA 2AN3A 3KKOA 5HM8A 1E5DA 2W6ID 3LLSA 1MGPA 2W22A 4P80A 3AM1A 1XU9A 1UF9A 4ND3A 1EG7A 1TZBA 5FUMA 1N6RA 2O5CA 2ZB8A 3FNFA 1Q12A 1ESNA 2CGEA 2QAJA 4R1PA 2JLRA 2OK7A 3VU9A 1JDVA 1XXHE 1MXFA 2CXNA 3KR1A 4FHCA 4O2AF 4R83A 3U2QA 3OD5A 3CLSD 3DEKA 2ISSD 3V4OA 3DR5A 1XD2B 5ENZA 5THQA 1RI1A 2FPMA 2ID9A 4K40A 2OCDA 5HG0A 2GD1O 4ZO9A 4CCWA 2OV1A 3WO1A 1L7VC 1SCDA 2YUIA 4E30A 4MVXA 2M32A 3THYA 3BMNB 5CMLA 4O4LA 4BB6A 3KT0A 1DRVA 2VNHA 4NPHA 1NLZA 4QJ3A 3GUYA 2YDYA 4Y0AA 2B25A 2M6SA 2O2IA 3F7TA 4O29A 4RX1A 3T06B 3BWEA 3WWYA 1A98A 3LT5A 4GX2A 1H4VB 2X9QA 3JD1A 1CEQA 3DVQX 4UE2A 4HHEA 1HDIA 1ZD8A 1V0JA 3A6EA 3S2SA 4HSGA 3D3WA 4E6PA 3HSYA 1G6HA 4I2NA 1YCFA 5C1OA 2BL4A 2CUNA 1K97A 2JJMA 4HUJA 5CAEA 2V3CC 1H2HA 4E1BA 2B37A 2B98A 4QRIA 4CEHA 4UFPA 1ZD4A 4FDUA 5EZYB 2PD3A 3PD1A 4R68A 4YREA 3TDMA 2RAVA 1GFSA 1RYNA 1UBKS 1JMYA 3ZS8A 5JXGA 3AEXA 3UXHA 1ZKDA 3L02A 5A4KA 2C9ZA 3ORYA 1YUNA 2A4MA 1GZUA 2YASA 2B1GA 2F9MA 3ID6C 4NV3A 5CGZA 1W0JA 2Q5QA 1E1KA 4DR7B 1W6UA 1W9HA 4XSVA 1LVHA 1SQSA 1SUFA 3UH0A 3IBTA 5EIEA 1IZ8A 4OUDA 3I9MA 5KU7A 1IY9A 4ZO7A 4FINA 4YP7A 5E1OA 4DCVA 4DUZB 2FU5C 1D1PA 3O4IA 4J0JA 4M7WA 1WD7A 4FNOA 4J4TA 4TTIA 2Q9AA 4ZIRB 5EY5B 4PICA 2BGIA 4LJ7A 1LRJA 3HUUA 1QZZA 4CDGA 1DTEA 3HN2A 2CNBA 1YRWA 2V6IA 3A1DA 3EYAA 5K3FA 2AJBA 3QVWA 4LWPA 4Z5XA 1HNWB 3UXYA 5DM1A 4JP2A 1JA9A 1WY5A 3SWWA 1WETA 5CVEA 4EY6A 4ZYZA 5IEBA 1EXMA 1E98A 1ZISA 3EULA 3GR6A 4TMFA 3FBWA 4BZZA 4NF2A 2PVCA 3R2JA 4MCHA 1OXKB 1T4CB 5EERA 3GIWA 1DAEA 2Q1UA 1GZ5A 2Q7XA 5CUQA 1KZ7B 5KZMB 1NJ5A 1AZTA 2ACEA 2NVUA 4FJ1A 5HX7A 2X8LA 1O5IA 1EA5A 1XF9A 2WTNA 1CUZA 1E7QA 1QHFA 4W1PA 2ZR7A 4HKTA 4H6XA 1QBGA 3KR0A 4L9RA 4RIEA 5F1KA 4DIBA 1C41A 3KZNA 1RP1A 3EOZA 2XYVA 3U6KA 1N5RA 1WKVA 2JI6A 2VOEA 4W82A 3R7SA 1QIEA 3AFIA 4KJXA 2EFDB 3T7DA 3ZCTA 2HMTA 3M2TA 4OXXA 1SZDA 3Q87B 2Z3VA 1WZ2A 3N6RA 1J2EA 2HCFA 5A9TA 2I2BA 5AP9A 3ZVKA 5F7ZA 1TTTA 1FFAA 3FYSA 4IHQA 3PTAA 3U9SA 2QYOA 4LOKA 3ZV5A 3PNMA 4N5HX 2OOKA 1DINA 5BWBA 1W8IA 1WB5A 5C37A 2J3EA 7REQA 3CG0A 4P7JA 4RKFA 3PEWA 3HV0A 1Y5NA 2CYCA 3RFCA 2DHRA 1CY7A 4EFLA 5K0ZA 4FUQA 2OB1A 1FQJA 1UL1X 1CETA 3DLHA 4ZEWA 1JFVA 1LI4A 3NM4A 4INZA 5CFRA 4NEHB 4JLVA 1A9OA 5EJ9A 2SKDA 4WTOA 4RZQA 2I33A 3SYLA 3K9FC 3QUBA 3FVRA 1F6BA 2R751 3M3HA 1ZPDA 1OILA 5M3BA 2V7BA 2VH1A 4J0FA 4QLAA 4R9RA 1TQ2A 4W1SA 3REGA 2P9FA 4YMVA 2CLOB 1GSOA 2W2XA 2PMEA 5BNWA 4BE4A 3CX8A 1MRNA 1OROA 1DB3A 2HH9A 3HJNA 1S2MA 3S2ZA 1YVPA 2I2AA 4U9UA 3OKAA 4DVJA 4JUAA 1K5HA 3GRFA 1E1DA 1WHSA 4S0XA 4C30A 3LS2A 4OYLA 2VATA 5E6SA 2JLYA 3Q3EA 3C24A 4N5IX 2K7FA 2I1QA 4L27A 4GNKA 1ETUA 1T2DA 1HWYA 2AFVA 4M99A 4H08A 4RLSA 2E2WA 3I42A 4DY4A 4MGEA 1F06A 3W5JA 4ON9A 1KFBB 1QKJA 3IP3A 3O2NA 5TPZD 4IDQA 1VBKA 1MPXA 2GAAA 3WGGA 1N1EA 2W71A 4KQJA 4KRXA 3CKYA 2J6IA 1OKKA 2ZBDA 3FDZB 3ZHSA 1QQ6A 3UAOA 4XJXA 5DGHA 4MW0A 1N6KA 3QVOA 5GJCA 1JU9A 2PZLA 4QD3A 4POAA 1Z33A 3TLYA 4CFSA 5LQJA 4PCAA 2DETA 4MRNA 5EJ7A 1KYXA 3VO9A 1N2ZA 1W0KD 4TS1A 3H19A 1LEHA 2FRDC 5EIOA 2D1FA 2LCFA 4A6PA 3NTVA 2OGTA 3ADPA 3DR3A 1OLUB 1Y3BE 1TZKA 1M0SA 2BKLA 4HBGA 3K4PA 2C8LA 2ERYA 4PSAA 5JZBA 4TMZA 4DPKA 4FMBB 4QUJA 5IKEA 3UHPA 5B6PA 2V9CA 1S8AA 3PF8A 4KQEA 2VSYA 2FR8A 3E9ZA 3HA7A 4E1VA 4LOHA 3TSYA 5J2TA 2W6CX 3SBXA 4D6XA 1BMDA 5F1YA 4BPBA 4YDSA 3OZRA 2OG2A 3PIDA 3PQ7A 2R2GA 4NENA 3KRTA 2I80A 3DGEC 2EZ9A 1JHXA 3GPIA 4A0GA 1QJCA 5TX7A 3SC3A 3VJMA 4IF4A 3Q12A 2PEYA 2JL1A 2RHWA 3DMHA 3T41A 1EFAA 2PUGA 2FPIA 3OQIB 5AI0A 4A8JA 2VRWA 3BXHA 2BVNA 5TMPA 2HN9A 5A7FA 1M6VA 3VKUA 2ZE8A 4EPVA 3DQQA 3LHFA 4JL6A 4MA5A 1F60A 1IYZA 2QYHA 2PNFA 1KS9A 4AJKA 5KYYB 4GP7A 1I33A 2IPLA 3ZLVA 3BTSA 4EHJA 4Y9UA 5EHXA 3KVYA 2FKNA 2WOOA 3NYWA 3L8GA 3EX7C 3VDRA 2HHHB 1C1HA 2OBNA 3NJ8A 2EWVA 2FZWA 3OUZA 4CLRA 3I1JA 1PFGA 3KL4A 3Q8WA 5U1PA 3DMTA 1NVWQ 1SM4A 1YCHA 3RT1A 4RZXA 3WJ2A 2JC3A 3HCFA 4KW7A 4F6RA 5FPPA 4D96A 4F92B 4L6AA 2AZ4A 1FUUA 2I2XB 3FZQA 1TCBA 1DBPA 2BI4A 4WQMA 1XLUA 1XMVA 5BNIA 3CZMA 2WMDA 5FTNA 3PFFA 4DV5B 1Z6TA 2BFFB 3ZI4A 1JDBC 3O95A 3THXB 3JVUA 2BR3A 5LZ5A 6NULA 1NZFA 2HFJA 5A9RA 4MIOA 1G38A 1QR6A 2GPBA 4DXAA 2QMEA 4W9RA 3TRIA 3NTXA 4IUYA 3RC3A 3U3JA 4Y9SA 4JLKA 5KYXB 4FEEA 4CV1A 3ISTA 1ZRSA 3P9YA 4EB6A 5CURA 1QFSA 1TA0A 1GNVA 1UFRA 3AZQA 1ABEA 1KL7A 2BEJA 1TZMA 5EC8A 4D42A 3DEAA 4P34A 4OHWA 3U1BA 1F4VA 2C7BA 3FHOA 3NQ41 4ZVRA 1T3SA 5AWFC 4WOJA 2O0MA 2QQGA 3H3XA 1H4QA 4Q4LA 2IPMA 3L4BA 2EJBA 1F2VA 1LLUA 1ZM2A 2CXSA 3C5VA 1KORA 1NPTO 3OZFA 1TDJA 1HQYE 1IOLA 1C3OA 3H05A 4KB5A 3CPHA 1DAKA 2XD4A 3MNFA 5EESA 3U9LA 3RWBA 3JRXA 3VSEA 2WNHA 4YK7A 4C4PA 4MWOA 3SXUB 2JRCA 1NOJA 2R7NA 1IDN1 5DTQA 4PSCA 2PUFA 3OU2A 1YDGA 1W25A 3ER6A 3IQEA 4AX4A 1J24A 1E20A 3GG2A 1C9NA 3QY9A 4I1SA 5FI1B 2ZQZA 3FTNA 3F73A 4TGLA 2YWEA 3BCSA 3FIUA 3ICVA 2AMLA 3HKEB 4BNTA 4FWBA 1B0ZA 3DZHA 4OLFA 4NH4A 3JV7A 4RCVA 4RFLA 3QX7A 3ZNOA 5BWCA 5KWEA 2WZBA 3RR2A 3GLIB 1H3EA 3G0OA 2I4RA 4ALJA 3VVLA 3C7KA 3PJGA 3BERA 4LVOA 5HMLA 9ATCA 2GESA 4CU2A 2P5TB 4EGFA 3CZCA 1M7BA 1UJ4A 3QVXA 5E7IA 4Q9DA 4Z8XA 3OOEA 4PR3A 4ZOCA 3CF6R 4NK4A 1T2EA 5JNTA 3FDXA 2O1XA 5G4KA 2XYQA 1ECJA 3DDHA 3RF7A 1EFVB 1X7ZA 3JY6A 1X70A 4H18A 3B1XA 2PUJA 4PRKA 4BP1A 4WLOA 1A4XA 1ZUD1 1JW9B 2DR0A 4Y2QA 1OA1A 3U7HB 4LFAB 1Q77A 2OFXA 3G2NA 4H0CA 3MOSA 3TPFA 1U04A 3VTZA 2XXJA 4EI7A 2OXIA 5L3QA 5DP1A 1DHTA 3R77A 2LNDA 2QX9A 5CHEA 1E6EA 4C3OB 4D9IA 4BY9E 1OPXA 4WBSA 1IVYA 1L5MA 1O9HA 4MDYA 5K8VA 4NTZA 2HI0A 4OJMX 3DFUA 4Q05A 1HSZA 1CR0A 1OBCA 3AI3A 3LMKA 2YMQA 4IFTA 1W76A 2C2WA 3GA0A 3PUZA 4G8BA 4NRDA 2MU1A 1U2SA 4ND8A 2O8FB 1FFYA 4AS2A 3KEOA 3E1KA 3C3YA 4JGGA 2R44A 1FMCA 1ZK1A 3GCGA 1FX0A 3HCAA 4L7QA 5DGDA 4FB4A 3WLFA 2ZZMA 2R79A 1N1GA 5KU1A 4XJTA 2RMKA 1NXOA 2VHXA 3B3FA 4A03A 1B7GO 1XQXA 4GWKA 2BGJA 1WEKA 4FYVA 4ASUD 1LFAA 5LU8A 5LWQA 1OB2A 4K0RA 2QMYA 2O2EA 4MKRA 1GN8A 4RGYA 4B17A 1XQ6A 4CLOB 4BNWA 3ZDAA 5H3LA 1I2DA 1CEYA 3H7AA 4XKJA 4E5SA 1CUJA 4HN9A 3A6PC 5HF5A 1O6FA 2HJGA 4UTRA 1Z29A 2IV2X 2ZE7A 3H6HA 1MX9A 1LW6E 1KFKB 3B3QA 3VM6A 3KO8A 2BM0A 3LX5A 1UC5B 3ONVA 1MRZA 1V5GA 1G7SA 5FTMA 3RTBA 1QG2A 1GUDA 2AUTA 2B4QA 2RKBA 4U8HA 5EKDA 2AZXA 3H2JA 1J2YA 1G7TA 3KDAA 4ZVMA 3MPUA 2OHXA 2FGKA 4IDAA 1HFEL 4CETA 3TR6A 1T2NA 2FLWA 3GJ0A 1MJ5A 2W0MA 1XZKA 3N3AC 2R7KA 4HLQB 4KYUA 1Z08A 4RL6A 3A2LA 1GZ6A 5EIFA 3D1LA 4KI0A 5LLSA 1RM3A 3NHSA 4LE0A 3VSDA 1I3NA 2C31A 1QE5A 1WPRA 3EWIA 1E69A 1JQBA 1JHOA 1U81A 3LBNA 3R0VA 3QFTA 4LKRA 1X1TA 2CL5A 3OPYB 3ZY5A 3ZWBA 1CNMA 1KK2A 4IVNA 1X7WB 4OEHA 4P3OA 4CMHA 4IZHA 1NT4A 1VM6A 5CJ2A 3W9YA 3ZIDA 2JEZA 3K6SB 4NCIA 2CNWD 1GIAA 2BZGA 5TF0A 2OORC 1XEWY 3UMCA 1N1MA 4ZT4A 5IVPA 1FS6A 4HR7A 2XWJI 4HQ0A 4M8KA 3QBJA 1G5IA 1WUHS 3SIPA 1RJ9A 1DAOA 2W90A 2QA5A 4KIWA 5F1PA 3RYCA 4OV6B 1QMGA 2ZI4A 5JRDS 2WFLA 3MTIA 3OP1A 5JAQA 4BVLA 3FTEA 4P9NA 4OXKA 2FP3A 3P2KA 4ENSA 1N8NA 3PWZA 3Q7QA 3AJ9A 2Q0HA 1LJ8A 3NKLA 3Q3HA 4M6WB 2ZRMA 1PTKA 5E3JA 5KQPA 2W48A 2CFCA 4BLOA 2JFQA 1PFUA 2M6RA 5MDHA 3F96A 1AG9A 4CDRA 1NNSA 2W2LD 4G0PA 3BSFA 3O0DA 4RANA 3HLYA 1O3YA 4AJJA 3KQUA 4DA4A 4KOAA 1DC8A 3E5NA 3V9AA 1TKBA 4DSTA 3V8EA 3BD9A 1UIRA 1GQYA 1SCUB 2JH8A 4WVLA 3AG6A 4UU0A 1GPJA 3VHLB 4IP0A 9LDTA 2JFYA 1QDLB 3GL9A 3MT9A 4RKYA 1J42A 2ZB7A 3HLTA 1TVKB 1JDNA 4P4NA 3L1UA 4G24A 5HBRA 5CH8A 1EX6A 3WI7A 4ABTA 2P1DA 1A5SB 4MINA 5AW1A 1A7UA 5KNDD 2VSFA 2QAGA 1G2IA 1MO6A 1M8KA 3O8QA 3PXCX 1M2VA 1PQWA 2XHEA 3ROTA 3T3GA 3ZGZA 1S2OA 3O8BA 1OYWA 1G5RA 4Z2YA 3PT5A 1XROA 4RHXA 3WDKA 1TF2A 3SYTA 3UMGA 1BN6A 1I1QB 1U2RA 2EZ4A 3KG2A 2DRIA 4PHGA 2CXHA 3SGLA 3KKNA 1A9XB 2YY5A 4MI9A 1RRPA 5DNUA 2UVQA 1GAXA 1TMKA 2VJCA 2KE5A 5C9ZA 1WW8A 4AW9A 1FOEB 3P9XA 4DABA 3E3NA 4XGIA 2H7VA 3GUVA 5H1YA 1YZHA 1CCWA 2H1VA 2ZRLA 3MA0A 2MYTA 1CZNA 4LX8A 1T26A 4OJQA 5CT4A 1TFUA 4HQOA 1RRMA 3UKOA 2H48A 1KY2A 3DGFC 3AHCA 4TXJA 2XCTB 3VA7A 1Z0UA 4BO3A 3MWKA 4W7IA 4JI6B 3UK0A 4DLYA 1DC4A 4NOMA 5KMGB 3P5BA 3IALA 4JJAA 1N0WA 4N48A 4KNWA 4BAUA 1DV2A 1XA3A 3IT3A 3B7GA 3OPVA 3ORQA 2UZ3A 3CVJA 4JH0A 5HKKA 3FHTA 5JJLA 3L4KA 4WZBE 5D51S 4P4LA 3V42A 5BR4A 3CR8A 3ZXIA 4M98A 4YT4A 3F1LA 1FJ2A 1G6KA 1QP8A 1C30A 3N86A 4RM3A 1WW3A 5F76A 1YB2A 2OL4A 2VWPA 3URMA 2FX3A 4LNHA 2C7QA 1RLJA 1YBMA 1ZA1A 3OSZA 4IXTA 3ZD9A 2GBPA 3ZOZA 3KSBC 5BURA 2VDRB 4PO1A 1TYZA 1SCQA 1G9TA 2BHTA 1DL5A 4GMHA 1XNGA 5FI3A 3LFHA 2KBEA 3FYDA 4ZN6A 1YRQA 3UH1A 2P91A 4JLMA 4RNCA 4J0HA 4Y2PA 1LBQA 3F8TA 2QZPA 3PI6A 2HBZA 2HJWA 4JMPA 4QXPA 1YJ5A 2XNDD 3I05A 4IRUB 6CHYA 1JJIA 1ZH0A 4JP3A 3ZD6A 1KF0A 1RSZA 2RHLA 3FPKA 4HEA1 4TS3A 3V4LA 1CY6A 3EVBA 4OHBA 3W7BA 4E0BA 4DB4A 4UHBA 4EMUA 3CCBA 5H3HA 4EHNA 4IZ6A 1Q0TA 4CFZA 1NDQA 2VDUE 4QWMA 3EDQA 1RRGA 1ZK4A 5B7NA 1O7JA 4LZZA 5CVVA 3N7AA 2ONJA 4FE7A 4ESEA 5IK2A 3RUPA 3VNUA 2CCKA 3M3PA 3R9WA 2C5AA 4ZT2A 3HS3A 3QK7A 4XX1A 2EWWA 5EVCA 4EO9A 3QEOA 3IKJA 2V0GA 3NG1A 4CWAA 1LV8A 1LX6A 1L7RA 4AMZA 4ATNA 2IVFA 2B34A 3KSDO 4M9CA 2GBCA 4R4JA 4J94A 3T38A 5AM4A 4B79A 1P5RA 3IX7A 1BWRA 2GEKA 4PSUA 4Y2TA 4FWTA 2H2AA 3NBMA 4ZAZA 4TRRA 5FCDA 1K86A 2WKPA 4NOKA 1C14A 4NOLA 5E4TA 3ETCA 4GZMA 3EQZA 4FXPA 1SC6A 4HFMA 1A9SA 4WKBA 3NV7A 3F47A 2V7PA 4X93A 3LQ2A 4X7RA 4DDTA 3PF9A 4WOKA 3RV4A 4S1OA 1GL7A 3BMQB 1JEAA 3U3MA 1YL5A 2EG5A 3QMPA 1F3LA 3RS3A 2IYQA 5EZQA 4TV9B 1NA5A 3ZVRA 1IK4A 4OAPA 4UM9D 1IPHA 4WK0B 2H2IA 1N2GA 3DL4A 4QPNA 5IC6A 2QJTA 4DLTA 1D0IA 2ZYTX 4RETA 4NBKA 4DJEC 4IOMA 1MHTA 3AR2A 3WIEA 3BXEA 5EIHA 3KU4A 2YXBA 3C6ZA 2MWMA 5EJ2A 2G88A 2JW5A 2F43B 3KQYA 1HKUA 3KOWA 1OFVA 3MQ2A 3I9LA 1JJVA 4JXXA 3ODGA 4B3FX 3LVFO 4RTMA 1FTQA 3OE1A 1PTJC 3PZRA 5B6IA 1LNQA 2OCYC 2QTVB 3WLTA 4NYMR 1TECE 3OJLA 3D4IA 4XVHA 1RQNA 3GI1A 1TM3E 1JTEA 5L40A 2FPSA 2DUWA 1BGVA 4NQZA 4HFRA 4PEVA 4ZVVA 2IU6A 4PFSA 4EKYA 5SY6A 3F6SA 3H42B 3BFXA 4LG1A 3PKJA 3AVXA 3H9UA 1Z83A 4J0IA 5B64A 4EF5A 3PRJA 3TUJC 4J49A 1XJ0A 3JQAB 4KWCA 3V48A 1W85A 2Z8YA 4FFRA 5HCUA 5JS8A 4B3GA 1AH2A 3OE7A 3LGXA 4F3RA 2EC5A 3CW9A 1VGQA 2YS7A 2XHZA 3D6NB 5CFNA 4ANFA 1XOIA 3BH0A 3BWYA 1Q84A 3NWOA 3PIIA 4BKOA 1TQ6A 2ZQ5A 2DWCA 4JAVC 3OQJA 1Q7GA 4EHIA 4WNAA 3AI7A 2ZATA 1RLTA 4J3JA 3NUZA 2YWCA 5IVIA 3B3JA 2WWYA 2Q5OA 2XUPA 2BSAA 4MHTA 3SBEA 3AX6A 1KTVA 1QHGA 2NVWA 3TKAA 1ZBDA 1II8A 4ZAVA 3MZ0A 4XYGA 4QC2A 1C3XA 5T4EA 2VLBA 1E2JA 3ONEA 4F7DA 1E2LA 3AK4A 4IW3B 5JCJD 4LF6B 3WSVA 1NBHA 1R6VA 4BGDA 4J0GA 2X2FA 1ILEA 5AKLA 3UVEA 3A4NA 1S2DA 4YV7A 1L8XA 2IHZA 3U4IA 2JIQA 4ARSA 3DE3X 4YRMA 1OLSA 1Q0HA 1QHXA 2H2FA 2QHXA 2EVWX 3GMDA 3H9JA 2CL0X 4MVJI 1IXRC 1OT3A 2A9QA 2Z04A 3EDRA 4QGFA 1SVSA 2Q4TA 4G5OA 3Q6IA 3K7EA 1ULBA 5AMXA 3GJQA 3H4IA 3STHA 3HGMA 3NTUA 2J3MA 5IAOA 4B3TB 1O9BA 2DERA 4P7KA 3DOUA 1HOXA 1ZN2A 1X7HA 1U3DA 1WMDA 2IYWA 3PQDA 4KSYA 4EJ2A 3L79A 4IYJA 4C7BA 5FWXB 2Q4OA 4R8KA 1ZN8A 3NNSA 5BYJA 4I5IA 3RO7A 3QXHA 1W44A 3CXUA 1G8MA 4IIEA 5IWCA 1MTOA 2JIZA 2DSNA 2VJOA 5F7OA 3AOGA 1TO6A 2VSXA 1O08A 1ZW6A 4Y6GB 4EZBA 1E96A 3FROA 2GF0A 2XVMA 2XWPA 1EWRA 1DI0A 2I71A 3UJBA 5LQRA 5GQSA 1UEXC 4MVJA 4WESA 4YJHB 1RYFA 1ZGBA 2LGJA 2ZUWA 1QCZA 3I5YA 1QV6A 3JQQA 4XUEA 4OI1A 5CB6A 2GKSA 1JS1X 2JGIA 1VE3A 4X1YA 5ALGA 1XZIA 3CJQA 4YRAA 4UVGA 5HDQA 4D82A 4JNCA 1NN1A 1SBHA 4LYEA 2YJ4A 4OG2A 4TOIA 1TJNA 5AI5A 3ZEAA 1N2OA 1TZJA 4Z7OB 1H3NA 2AF3C 5F2NA 3U19A 3RIEA 1A1VA 4JL8A 3O4VA 4I99A 4TLBA 4TPKA 5HM6A 3BPSA 2X0FA 3AONB 4P84A 4Y6QA 1BTOA 1K7CA 1PEDA 2BPOA 2XMBA 1T0BA 3R40A 4IY1A 3AZPA 3OURA 3RVPA 4BEWA 1V1RB 1J0EA 4W8HA 5BNZA 2PH1A 4REQB 3NYRA 3B3GA 5UKDA 4LNUA 3OH8A 2BEUA 1QC5A 3SZ3A 2NZ8A 3OQNA 4KQGA 1WB9A 1KOFA 4F4UA 2DFVA 1PBNA 1HXHA 2JFPA 2RGEA 4XDZA 1BXRB 3A1EA 3F6YA 4ARZA 4CIVA 2QE7D 4QAQA 4DEYA 2PRSA 1P4HA 1J70A 2XF2A 3ERCA 7ADHA 4Y0NA 4L15A 4QBTA 1QU3A 1ZIOA 4ZO8A 2PL1A 4DILA 4EHBA 1RRKA 1VHJA 3BGSA 1LV7A 4QHTA 3DPIA 1VPEA 2Z43A 3EW9A 1Z0AA 2IEGA 4L6IA 1NBMD 3G89A 1OCEA 2X5KO 3NAMA 2FDCA 4GL2A 4W1QA 3WL4A 4QRHA 2AYXA 3GGDA 4S3MA 2HIMA 2WHPB 2OHHA 1ANKA 1WBBA 1ZCAA 1QGDA 4O4IF 4QQ8A 2IW3A 4ND5A 4C7KA 3MLEA 1P4JA 3AR8A 3RVKA 2AR0A 5H82A 1YMVA 2ZBEA 2OECA 1KJYA 4IDEA 1IN6A 2HJHA 1SIBE 3G6KA 4PSVA 1Q7TA 1RXIA 1YOVB 1XHFA 3KNZA 1QGUA 3GLFE 4P7FA 4RHTA 6YASA 1YR9A 3HDGA 5K20A 1Y6FA 5DDIP 3S2EA 4DCNA 2HSGA 2PVSA 1MGOA 4XWAA 4AXXA 1NYQA 2CLSA 5KQLA 3NHJA 4RMIA 1U9CA 1WSWA 1CU1A 3E0XA 1CF2O 3WR5A 5JI3E 3CUTA 3AR6A 2ORWA 4R0NA 1YMUA 3UFBA 2FSVC 3FGZA 3DWGA 1A5ZA 2IYPA 3O2SB 2GN1A 1HEYA 2JHCA 2X1LA 1JTFA 4EA6A 4EBBA 3ESRA 2ZVPX 4KVZA 3KQOA 2X76A 4DQDA 2Z6UA 2XUFA 2FUG1 1NU6A 5FPSA 4PY2A 1YZUA 2O06A 3G1WA 3C1UA 5JXHA 2ATEA 4HDCA 1RRVA 2A30A 2YV1A 3R1IA 3SSMA 2QT0A 3ET4A 3RTGA 5BOSA 2B8NA 2ZJ0A 1E7WA 3FXAA 1ZD3A 3UFXB 3KT8A 2REQA 1QANA 1TZCA 3HHEA 4KLRA 4HLUA 4Q1DA 4L9WA 1U4NA 3M2PA 5KC9A 4U3JB 3TD9A 4YLYA 1ZSYA 1HQDA 1YOBA 1WUYA 2CCGA 2XR1A 3C98A 3PCRB 3R5FA 4P58A 2XLBA 3NRJA 3L46A 4LECA 2JZCA 1ADBA 3QXSA 4FGWA 4OA8A 4U6QA 4W99A 3RROA 3WG9A 5HGXA 1RRCA 4PW0A 4H16A 1U4OA 2ZVQX 1GDHA 3LIPA 3MJDA 1LSOA 1T8WA 1TRHA 3KSUA 4B6OA 1Y3HA 1P80A 4DSZA 2LPMA 3EEQA 3O94A 4RHYA 4BBJA 3H0KA 3Q7PA 2YYYA 5AOBA 3EHDA 4I4TA 1T1JA 3FLAA 4NBNA 3WSWA 3ZYCA 1E0SA 4HS4A 4JCOA 3ECSA 1RMYA 4RLQA 1Z4LA 4L8WB 5JO9A 4Z54A 2PE5A 3R6TA 2WD9A 1URPA 3NDJA 2CWDA 5COBA 2TYSB 3QHPA 3QOWA 4U6SA 2O8EB 1SC1A 4C0AC 3L43A 4B3DA 2DE0X 2ZSEA 1HT3A 3EUEA 3P0HA 4HDKA 4Y2GA 2FLVA 4JBYA 5JZMA 2Y05A 1E3IA 5E0KB 1GRRA 2IXFA 1XVIA 1XXHA 4EYSA 4NCKA 2Q6KA 3CUUA 4CEJB 2R4TA 3W5IA 1J8VA 2J6BA 3IOYA 3MT8A 1W9MA 4JT4A 4E4TA 4UDXX 2Z5GA 4TX1A 1YR6A 1Z4PX 4JEHA 2ZJAA 4M0UA 6ABPA 2YHSA 3F0TA 2CHGA 2XVXA 4IS2A 4ENRA 4YMHA 1XZFA 2DKNA 1R6DA 1SFRA 2A0XA 4PGAA 5IUJC 1ZU5A 3KXLA 4YA6A 3HMKA 3VU9B 2OWEA 3H2HA 4EM6A 4L4XA 4C4ZA 1B6TA 4AMYA 1RLMA 2ATXA 4P3KA 4MI6A 4OOFA 1GCGA 4WOPA 2HM7A 4JT9A 3EVFA 1Q1AA 5DRYA 1ZJYA 5D5QA 3W3AH 2J85A 4DR2B 1TU4A 3U48A 3AM5A 4RZSA 4R3NA 3GVIA 3GLHB 2IUSA 3PGA1 4NU0A 4BNJA 1BVRA 2W9XA 3D2LA 3GFOA 1NXTA 3HJCA 5DW0A 3W0LB 4EY4A 2V7EA 2AD1A 2F8MA 3GIDA 1EQAA 3V00A 2R6CA 1GUBA 3OKFA 3LXRA 2AFIE 1YIDA 3HPRA 1L7MA 4Q9JA 4JLNA 3DO5A 4RTSA 4Y1FA 1L5OA 1OWOA 2J59A 4ZVTA 1OXUA 1DAHA 2FUEA 3D3WB 1ODLA 1JI3A 2HPHA 2P9EA 2ZAMA 4G85A 2FWRA 3Q6MA 4YQEA 2FK7A 3ZYZA 3ZC3A 3HGTA 5CAEB 4BKQA 3K8QA 1T6XA 4UBIA 4KIUA 3O8NA 4LOAA 4N7JA 4CEHB 3PNSA 1WA5A 2HO5A 4IXNA 4QYTA 2WVGA 3ZY2A 4J43A 2IITA 1XAGA 4M9XA 3KV3O 3IR5A 1SVLA 2W6JA 2XT6A 3WICA 2HBYA 5ALWA 4Z7NB 4OKNA 3VR6H 3NS7A 5AUNB 2Q3EA 2KHZA 3TLMA 4YAJA 4X6YA 2FMTA 1T15A 1WM1A 2QF7A 3LW7A 5C5IA 2B3DA 3RREA 1T91A 4JXZA 1QVVA 4H27A 4E5UA 5I7HA 3TWOA 4MR9B 2QUKA 4OUDB 4TMVA 2A9OA 4WKGA 5DT9A 3TQHA 1E9DA 3ABRB 4LHWA 1NF9A 2FXVA 1QPBA 3G8YA 1ND5A 2HPAA 3BCHA 3WDSA 5HKAA 3GJ6A 1ZUNA 1A9YA 2BMVA 1DIHA 4MP8A 3MPOA 1EUQA 3D8RA 1V2GA 2IX9A 3GPBA 5DX0A 5EXDA 2WICA 1KK3A 1W93A 1V43A 1XKQA 2WU8A 1SGWA 4EJSC 1Z47A 1ORTA 2AYZA 2WSYB 3AMVA 3GAAA 1E1CB 2F8TA 2XT0A 5DGCA 3RF6A 3N7UA 4HDNB 3VR4H 3QPCA 1PUIA 4WXYB 1Z4KA 2Y1DA 1FVFA 1SHJA 1WX1A 4O08A 2VF8A 1E9AA 2VHYA 2PX0A 5ECDA 2PKYX 3EEFA 1Z0ZA 2HREA 3GVPA 1I1OA 4WCFC 2VNJA 3R7FA 3ZK8A 1S4MA 4B4KA 3EY4A 3WLKX 1RHRA 3DSRA 2OG1A 4ZZ1A 1Z75A 4TN5A 2I7TA 4UNQA 4YMLA 1LC3A 3CURA 3ESCA 3EY9A 5IT0A 1AZLA 2DGDA 1CR1A 1P31A 2WMYA 2C58A 2C07A 3DHVA 4O2BA 3NAZA 5AVVA 3TRHA 3DEHA 1DJOA 4R2HA 1L3CA 1M1ZA 1YV9A 3DVAA 1KQOA 3PBKA 4HDRA 1IZ7A 5K03A 4W5NA 1JIVA 3LF2A 2CNNA 3T54A 4C0KA 2HK6A 1JU4A 1XTVA 2DUNA 2X0KA 2GEDA 3EF1A<