4KEAA

Crystal structure of d196n mutant of monoglyceride lipase from bacillus sp. h257 in space group p212121
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
248
structure length
248
Chain Sequence
SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermostable monoacylglycerol lipase
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 94
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4keaA00
2UZ0A 4UHEA 2DFPA 5HQ3B 4H7HA 2IX9A 4S0XA 3B3QA 4C4YA 3ICWA 4F5ZA 1K5PA 5AO9A 1CUJA 2QXUA 4W63A 3FYTA 3NWOA 5AM4A 4OU5A 1QFSA 5CH8A 1YAJA 2VSQA 3G9TA 4FNGA 4Q05A 4QLAA 3WYNA 5EIHA 2JGFA 4FLEA 2HHAA 4G9GA 1UK7A 2XUFA 5AKZA 1YAHA 1LBTA 2O2IA 5AKYA 4F0JA 4PQEA 4UFOA 4KEAA 2XUGA 1U8EA 3WL6A 3M3DA 5CT5A 2Z8XA 2QMQA 3E3AA 3D59A 3DLTA 4MWSA 2DCMA 2JGMA 2JEZA 3ESDA 3HSSA 1QLWA 1P0IA 2RHTA 4NVRA 1MAAA 4CIBA 1QIMA 3SK0A 4X6UA 5ALYA 1QIEA 1QIIA 3H2JA 5AM0A 5ISMA 1I6WA 3ZLVA 3WI7A 4AO6A 4AXBA 3DOIA 4AO8A 2XQIA 5E4YA 3T4UA 1LNSA 1AURA 1L7QA 2DHCA 4EY8A 5DNVA 3P2MA 4UBKA 5AM2A 4LYDA 5JD6A 3U0VA 4ZV9A 5EGNA 2XMDA 2ZYSA 2WTNA 1GGVA 4DIUA 3C6ZA 2WG2A 3AJAA 2D5LA 1IZ7A 3WWDA 4BYMA 5ALIA 2Y6VA 2I78A 4N8EA 2XQJA 4N5HX 3VVMA 1DX6A 1UT6A 2EDAA 2HRRA 5JARA 1TK3A 1CUYA 5ESRA 2CMFA 2XLCA 3STVA 4G4IA 3OOSA 1ODSA 4Y9SA 1CRLA 5HF6A 4WJLA 1UOOA 1JJFA 3STWA 4DYHA 3BDIA 4B84A 3C45A 2PUHA 4GEGA 1DINA 1C7IA 4N8DA 4DTCA 1N5MA 1EVEA 5HFAA 5D6OA 4BRZA 2WFMA 1VA4A 1SOMA 4X92A 1HDEA 4KACA 4C4ZA 4BE9A 1W76A 2QR5A 4KAAA 4DNQA 1KEZA 4TVKA 4PV7A 2GYWA 4K6KA 5AOAA 4FLFA 1QTRA 3DKRA 4YK7A 4M0MA 3BE8A 4WDQA 2WQZA 1Y37A 2HU7A 5CXUA 1P0QA 3WIBA 4C89A 3O4GA 4WFJA 1BEZA 1A8UA 2XT0A 4X95A 3AINA 3V1LA 1XZFA 3N0TA 4EUSA 5ALOA 1ZD5A 1ETHA 3H2GA 2C0QA 1XZCA 5ALHA 5F4ZA 4EB0A 3DS8A 2WIGA 3GUUA 2Z8ZA 3WKAA 1UWCA 5DWDA 1UOQA 5AKHA 2PX6A 1LBSA 2QOEA 1XZKA 2XUDA 2OLEA 3R3VA 5A7GA 4Y2PA 2AJLI 2QUBA 3WWOA 4X7BA 2HADA 3WK7A 1AGYA 4Q3LA 4H18A 1WB4A 3IURA 4ZRDA 3L1JA 1CPYA 3I6MA 1F8UA 4X3CA 3BF8A 3L1IA 1XLVA 4N8SA 3O9VA 5JANA 1N1MA 5BV7A 4X6YA 4IH1A 1RP1A 4D9JA 2WIKA 4HVTA 4JEIA 1HLGA 3C8HA 2AJBA 5A7FA 2ZYRA 1BU8A 4J0DA 2WSLA 4PSCA 4HRXA 1XZDA 5EI5A 2OXEA 5IH7A 5ALTA 4GDMA 4A16A 5DYTA 3WKCA 2GYVA 3BDVA 1DWOA 2XUPA 3LS2A 3C87A 3DL4A 4RE5A 4BCBA 2D0DA 2XMGA 3D2CA 3D3NA 2P8SA 1DQZA 3S2ZA 5DYYA 3PFBA 2XMCA 4HXFB 5C81A 2AJ8A 5SYMA 5JAPA 1UKAA 4B85A 3WJ2A 1GPKA 2ECFA 1CUSA 3HLKA 1TCCA 4J0HA 5EIEA 1R88A 1JMKC 1QJ4A 5LP1A 3FYUA 4UHFA 3EQ8A 2XUAA 1GQSA 4BTVA 1WOMA 5AOBA 4X93A 3R0VA 3K9BA 5HQ3A 5IVHA 2PSEA 4UBLA 3F8SA 2O7RA 1BCRA 4DLNA 1AMNA 1DTEA 1R3DA 3MVEA 2R11A 5JATA 2WHPB 3VDXA 5ALFA 5LKAA 4ZGBA 4BE4A 1LPBB 2G4LA 1OILA 5YASA 5JD5A 1BE0A 1O6FA 3T52A 2XMQA 1Y7IA 4EY6A 4UUQA 3HC7A 5EIAA 1CUFA 5E4JA 1SCIA 3KDAA 1QO9A 1T2NA 4BVLA 5K3FB 2VT6A 3C70A 1EX9A 1EVQA 1N5RA 5T4FA 3AZQA 3HACA 4LYEA 4G8DA 4BDSA 1FFBA 3OURA 3EF3A 5A7HA 3FCYA 3D4LA 1TRHA 3WJ1A 4C88A 5AHXA 4DGQA 4FOLA 2CJPA 1CQZA 1ZOIA 3D5EA 1Y7HA 3OM8A 4MJ3A 2V98A 3GA7A 3DJYA 4XVCA 5ALJA 1ACJA 3C43A 1WPXA 4BATA 5SYNA 3VJMA 2ACKA 5AKXA 5LZ8A 1JI3A 2JBWA 1CUCA 4KYVA 1ODCA 3G9ZA 5K3CA 1XQVA 4B0PA 4G4JA 3B12A 2J3QA 3HYSA 2PSDA 3F97A 3KSRA 5A6VA 4KJXA 5LZ4A 1UFOA 1EDEA 4AX4A 4UBOA 3I6ZA 4P93A 1R9NA 2WUGA 3G9UA 3M81A 2WFZA 5ALQA 5DTJA 4F21A 2YXPX 2V9ZA 2Y1KA 1LGYA 3C6XA 4YX9A 5JYCA 4A23A 5A71A 5JASA 1XZEA 4PSDA 1JKMA 4HXGA 2CZQA 3WL5A 3R3YA 4RE6A 1QIHA 4FTWA 3KOOA 2G5TA 4BTLA 4K2AA 1J06A 3KD2A 4OPMA 4MEBA 4EHBA 3HEAA 1AX9A 4ARAA 1H22A 3AIKA 5CT9A 4U2BA 2XUKA 5AH0A 1SFRA 1VZ3A 2V96A 1YS1X 4HS9A 2HM7A 1XZLA 5AKIA 3A2NA 1G42A 4FKBA 1IZ8A 4IQ4A 5KWIA 3O4HA 4EZIA 4PF1A 4LHEA 3F96A 4UFNA 1ZGCA 1TQHA 1UK6A 2C5FA 5HK9A 4P9NA 2XMBA 4AZ0A 1GPNA 3OC0A 2JGKA 1EH5A 2OCLA 2VT7A 4H7DA 4F60A 4HXEB 3RARA 3ILSA 4BAUA 3CCCA 1MO2A 4LXGA 5FOQA 1W1IA 4N5IX 1EDDA 1XROA 4EY4A 3QVMA 2DHDA 4KR0A 1B6GA 2QM0A 4FDMA 1XKTA 3DYVA 4B9AA 2VAXA 1XLWA 4WY5A 1ZJ4A 2C7BA 2IITA 2XQFA 4Q1VA 1UKBA 4BP9A 2VJAA 3AZOA 1QTIA 2BUBA 1EK2A 2HA7A 4W1PA 3FSGA 3KWJA 1XZAA 1EI9A 2HA4A 1F0PA 5LKRA 4B7ZA 1E8NA 3IIIA 5AI5A 2HU8A 4MXDA 4K6HA 3ESBA 4M0EA 2VAVA 1LZLA 3F9CA 3VKFA 4W1SA 1KU6A 5DTIA 4B6GA 2HFJA 4Y2VA 5AJHA 4A5SA 3ANSA 4FHZA 2QJRA 1ZGBA 1CUHA 2ZJFA 3FNBA 5ALPA 2FJ0A 3R3WA 4BBZA 1WB6A 5DLPA 2DQYA 2WUFA 3WLAA 4E15A 2IIVA 5BWBA 4RGYA 4PW0A 4OU4A 1AC5A 1XZHA 4U2CA 2BCEA 4OYYA 3RKSA 3WKDA 3CN7A 2WHRA 3GBSA 1THGA 2PPLA 2ZSIA 4JNCA 5AI0A 4DNOA 3HI4A 4ZREA 4Y2XA 4BCCA 5ALRA 3NOXA 4MYDA 4X91A 4W9RA 1OXMA 4G9EA 3DD5A 2ZJ7A 1LPOA 3BWXA 5AKEA 2WHPA 2ROQA 2QZPA 3E1GA 4CG2A 3AIMA 3IB3A 1DT5A 3U1TA 4Q3OA 3WA6A 3ANTA 4K6GA 2XE4A 1QIJA 3EQ7A 1E66A 5AIBA 4UFPA 5FLKA 2OAEA 1EB8A 4BAGA 1CIJA 5K3FA 5I8PA 1XRLA 2Q0XA 5LZ2A 5ALSA 3DEAA 2Y2VA 3MUNA 3DKKA 1VZ2A 3W2TA 1VE6A 1MN6A 2XI4A 3VISA 2VQ6A 2WIJA 3JYHA 2WUDA 1CUBA 2VJDA 2VJBA 1R4ZA 3FLAA 2ZJ6A 5LIPA 1UZAA 1OCEA 4Q3KA 5H3HA 2JGJA 4NMWA 3N2ZB 1JMYA 2BGNA 2VTVA 3M82A 3QM1A 2W22A 3QMMA 5LLSA 2X76A 2CEKA 4H0CA 1K4YA 1C7JA 5DNUA 2WFLB 1VJ5A 2J3DA 4BVKA 2PSJA 1XQXA 2BAGA 5AKJA 1ZI9A 4X90A 3PF8A 1X70A 2PU5A 5K3DA 1XRNA 2OGZA 4CCYA 4BB0A 4PNZA 2XUJA 4C4XA 1VE7A 1VOTA 4CIAA 1F6WA 2BJHA 1H2ZA 1AQLA 2JGLA 2QKYA 5LZ5A 1CUWA 1DQYA 4W1RA 2H7CA 3D2BA 1GXSA 1CUDA 1YSCA 4RPCA 1SC9A 3V9AA 2BFNA 5T4BA 1CUXA 5HKAA 2V97A 5EHXA 3KXPA 1GPLA 3D7RA 3LCRA 3MGAA 4J7AA 2FX5A 3PE6A 3WWPA 3FVTA 3DL7A 3AZPA 1CUAA 1NU6A 5E4TA 4ITVA 4ROTA 3VXKA 4MQLA 4KAFA 3G0GA 4AMZA 3WYDA 2PVSA 3WQHA 2OPHA 2ZYHA 2J4CA 3O0DA 3AUKA 5I9IA 1A8QA 1ZIXA 3C8DA 1MX5A 1XQWA 1ORVA 4GLBA 2XMSA 4DMFA 4GECA 4QDZA 5FKJA 3GFFA 2HA6A 1XRMA 5JAHA 2QT9A 1QOZA 4GBGA 1L7RA 1EB9A 5JZ9A 3GELA 4QDXA 3AILA 2GBGA 1YS2X 1W52X 4FLMA 4U2GA 3R41A 1MU0A 4UBMA 3Q0TA 4TPKA 2XB6A 4KRXA 2HA3A 5ALKA 3WKBA 1U4NA 3IULA 3RM3A 3C6BA 3QPAA 2VEOA 3WA7A 4H35A 1JFRA 5A62A 3FOBA 2O2GA 3G0CA 1USWA 2CBGA 1U2EA 1ZD3A 2HDWA 3FLBA 5LZ9A 1XZBA 1CUIA 3D0KA 4Y2YA 4RNCA 4PO3X 5ALEA 3GZJA 1RYYA 3W9UA 5FDFA 3NUZA 3QBJA 4DSZA 3SX4A 1THTA 1WHSA 3F98A 4IHAA 2XDWA 3HJUA 1QFMA 3WK4A 1CVLA 2X5XA 4Y2RA 3VVLA 1CLEA 4HTAA 4H77A 4WFKA 3DOHA 2XMZA 2HFKA 3B5EA 4PSUA 2RAUA 5T4HA 5AM5A 3VJLA 2CB9A 3RK4A 3STUA 1R1DA 1UKCA 4DNPA 4Y2UA 4AN0A 3LLCA 5CBKA 1YASA 1XLUA 5C8VA 1M33A 3G0IA 2OQVA 4HAIA 1BS9A 1LLFA 1E3QA 1MX1A 1IUPA 4O08A 3TGLA 2RI6A 2Y6UA 3C5WP 4J0JA 1DWQA 2GYUA 3DQZA 2OCGA 3UUEA 5ALWA 1HQDA 3H2KA 2G5PA 2R8BA 4FFWA 1HPLA 2OAGA 2QXTA 4QWMA 1R50A 1TCAA 2OQIA 2XUIA 5ALUA 5CT6A 3KWFA 4BVJA 3O4JA 1LPNA 5AKLA 4IO0A 4Q82A 2YASA 4U2FA 3O9MA 1EHYA 4J0GA 2WKWA 1UK8A 4UBNA 1RWQA 2OGTA 1BEEA 3IUNA 2NW6A 1LPAB 4U2EA 5AIAA 3TEJA 1NU8A 4B82A 5IVIA 3X3HA 1YCDA 1BCSA 3H2IA 4UHDA 5AI4A 1S8OA 4NZZA 3I2GA 1VA5A 1FSSA 4AMYA 2PKYX 4OSEA 3IVMA 1ZIYA 4U2DA 3ZPXA 1VKHA 2CKMA 1X2EA 3EBLA 3W05A 1ZJ5A 1HKHA 4KAJA 3AIOA 4FBLA 1GKKA 3QPDA 4UPDA 3W06A 2OGSA 5CRIA 3EIOA 2DQZA 2W6CX 2XQKA 4AQDA 7YASA 4UBJA 4BC1A 3OG9A 5JZBA 4LKOA 5CXXA 5DNWA 4CG3A 4B0OA 5HFNA 3O95A 1XFDA 1VLQA 4C6HA 5D3KA 2H1IA 5AKGA 2AJDA 5HZGA 2H9YA 4LIPD 4Y7DA 1SCQA 3I2JA 4Q34A 2AJCA 4P92A 2ORYA 1KU0A 1X2BA 3RLIA 1K6EA 4OD0A 4KE8A 1QIDA 2GBIA 3OPMA 3UMJA 2WUEA 4OB6A 4QZVA 3STTA 5AK3A 3GROA 2OCKA 3WK5A 3CXUA 2WG0A 4ZWNA 3H2HA 4X6XA 1FFDA 4I4CA 3WK6A 3L1HA 2OCIA 3TRDA 2QTBA 4XIIA 5CURA 2WFLA 4X94A 4DMHA 3A2MA 1AZWA 3QMVA 4FWBA 2QVBA 5ALXA 2BUAA 3IUMA 4UBIA 5JALA 4L72A 3QZUA 3G7NA 4FFVA 4E46A 2WLSA 4XJVA 5AK6A 2BUCA 3V48A 5D7BA 1J2EA 2VA9A 4X85A 2C5GA 3PFCA 3BXPA 5JAUA 2LIPA 4KE9A 5EFZA 2WILA 4XX1A 5T4EA 4CG1A 2ES4A 2CUTA 3ZV7A 4LXIA 1DWPA 3V1KA 5ALZA 3I1YA 5EHQA 1U65A 1GZ7A 1DU4A 3BL8A 3IUQA 2H7XA 3I6YA 1CUEA 4QDTA 1H23A 1UOPA 4CI9A 1JT2A 1K63A 2QS9A 2HA2A 2HA5A 3DNMA 3IA2A 2WJ4A 4Y2SA 1ORWA 4UHHA 4DNFA 5AI9A 4QNNA 4UHCA 3WZMA 5JADA 5C8XA 4B9EA 1XKLA 3NGMA 4DM7A 4H7KA 4CFSA 1A7UA 2AXEA 2BGRA 3H04A 1Q0ZA 3HZOA 5KBYA 2WU4A 2H7YA 3FVRA 2GBFA 3WWEA 5I7UA 4H7JA 3QYJA 3C6YA 2QUAA 4C01A 6YASA 1XZGA 3DCNA 3LP5A 5C8ZA 1TAHA 3WMRA 1VXRA 2C0PA 3OTQA 2I3ZA 3G9XA 3HRHA 1ISPA 2FJPA 3IUJA 4L3WA 5AM1A 2O7VA 5ALGA 4AO7A 4J03A 4BC0A 4ETWA 5IKXA 2PSHA 2FUKA 1EA5A 3STYA 3PI6A 2DSNA 5ALVA 1GT6A 5AP9A 4BAZA 4W1QA 5FRDA 4BDTA 4E11A 1XZJA 2OG1A 1CQWA 3A2LA 4X00A 1A88A 2XUHA 4FMPA 1YB6A 2JEYA 4Y2QA 4WY8A 1A8SA 4EY5A 1TIBA 3UUFA 1CR6A 1XQYA 1MT3A 3M83A 1H2YA 3STXA 4JYMA 4G5XA 2J4FA 5J3JA 3SWWA 4MWTA 3C5VA 1DX4A 3I2FA 2VATA 1J07A 1G4HA 2JGEA 5LYYA 2HL6A 4OB8A 4CCWA 1ZD4A 1WB5A 5D3ZA 4C87A 5JIBA 2C58A 3H18A 1ZICA 1XZMA 1H2WA 5AM3A 2PBLA 1F0NA 3S8YA 3K2IA 4OYLA 1K8QA 3R3XA 3W9BA 3V1NA 2VJCA 4LXHA 2GBCA 3MUOA 4XWGA 1W4LA 5K5EA 4QDUA 2GZSA 1XRRA 1T4MA 1YA8A 5CTAA 1QO7A 3WL8A 5JAOA 2WU3A 1MAHA 5IVDA 3H0CA 4HZGA 4GXNA 4K5QA 1P0MA 2X8BA 1UXOA 5FXMA 3Q8WA 2I3DA 4OB7A 1DT3A 1QIFA 5FV4A 3IBTA 4WDRA 2YH2A 3WK9A 5CT4A 1G66A 1ZD2P 5HF9A 1QGED 3ICVA 2RGUA 3I1IA 4JH0A 3WK8A 1BRTA 3VJKA 4B83A 3ESCA 3FYUC 3HABA 2QJWA 2ZVDA 3I2HA 5ALMA 4Y2TA 4Y2JA 4IH4A 1Z68A 4QWWA 4G8CA 5BWCA 4X97A 4H7FA 5CMLA 4DSAA 3W04A 2G63A 1C4XA 1Q84A 4BCDA 5EHNA 4KRYA 1VXOA 4QDOA 3H1BA 5K3EA 1W6RA 5HF5A 1QIGA 3ZLUA 4DMKA 5A2GA 3E4DA 5FPPA 2EDCA 1YB7A 3SC2A 5LZ7A 2WJ6A 5FP0A 4J0CA 2WM2A 4ARBA 5K3AA 3R40A 4J0IA 4IH9A 4NS4A 4J0KA 2JIDA 1GKLA 1WPRA 3H17A 4QA9A 4BZWA 2WTMA 3WL7A 1YR2A 4JUIA 3R3UA 2RHWA 4JYPA 1MX9A 2WJ3A 2HRQA 2BKLA 1CEXA 2VF2A 1WCYA 1WM1A 3BIWA 3ED1A 1P0PA 2ONCA 2HA0A 2Z3WA 1FJ2A 1D07A 1PJAA 1HBJA 1Q83A 4BP8A 1ODTC 5EHZA 1MNQA 4WCVA 5C7YA 1HL7A 4G8BA 1CUVA 3E0XA 5ALLA 3FWHA 4EY7A 4GW3A 1QONA 3ZI7A 1N8SA 5E2IA 3QITA 4B81A 2K2QB 2DR0A 5AICA 4YPVA 3AFIA 3H1AA 1PFQA 4H7IA 3WWCA 2E3JA 4KE7A 3PF9A 4L9AA 1EK1A 5ALDA 1LPSA 1MJ5A 5HCUA 1LPMA 1FFAA 3BJRA 1AUOA 5CW2A 1LPPA 2XUOA 5AI6A 1CUGA 1IVYA 4MQMA 5FUMA 2ZYIA 4G4GA 5DYWA 4MEAA 1MNAA 1B41A 2B61A 4HRYA 2XLBA 3BJMA 4OCZA 2B9VA 2C4HA 3H19A 2B4KA 4B80A 4AN1A 5AK4A 1CV2A 1XRQA 1CUZA 3HXKA 4G1FA 3LIPA 1EXWA 2Z5GA 3CN9A 1R9MA 1XRPA 4FBMA 4L0CA 1J1IA 5CH5A 3LIIA 4X71A 3IDAA 2XQGA 3O4IA 1PV1A 1ACLA 4QE3A 4GI1A 5CH3A 4EA6A 3FLEA 3DYIA 5ALNA 1IMJA 5HK8A 1MPXA 2Z3ZA 4INZA 5CT8A 1TKRA 3TJMA 5HKBA 3FCXA 1SCKA 4AB1A 3ZLTA 4QLOA 1ZI8A 3F67A 3V1MA 1Q0RA 4I19A 2ACEA 1ZI6A 1E8MA 1QZ3A 4OUKX 4AZ3A 4MYSA 2QRUA 3PUIA 3PDCA 1W75A 3I28A 1O6GA 1TCBA 1XZIA 3CCBA 2B20A 3WKEA 3EQ9A 2HU5A 4EBBA 1BROA 3I2IA 1E5TA 5KREA 1QE3A 5AI8A 5HF8A 2WIDA 3YASA 1CUUA 3BIXA 4YASA 1G5FA 1FFCA 4CCYB 4J3JA 4ZI5A 2ZSHA 2Y2UA 5K3BA 3A6ZA 4GHWA 3PUHA 5KWJA 1EDBA 1JJIA 3JW8A 1E89A 4UHBA 4WFIA 5IVKA 2JGIA 2PUJA 3G02A 2PSFA 4FNMA 4QEKA 2WIFA 5DJ5A 4Z49A 1AKNA 1UK9A 2PU7A 1JU4A 4BZZA 2EEPA 4ZV7A 2DHEA 4TGLA 3G0BA 3A70A 3DDUA 3WZLA 5JZSA 1JU3A 1BN6A 2JF0A 3FBWA 4V2IA 3K6KA 1LZKA 3FSGD 2WG1A 3QPCA 2I03A 1L7AA 2XMRA 4ZXFA 5FPQA 3G0DA 4BRSA 2XUQA 2YYSA 3BF7A 4E14A 2O2HA 5AOCA 1YA4A 1WHTA 1GQRA 2RONA 5JD4A 3R3ZA 4I3FA 3FAKA 1H2XA 5BOVA 4DMCA 3JWEA 5AKKA 2PL5A 4P08A 3ZWQA 3WIOA 5AK5A 3I2KA 1CFJA 4KE6A 4H7EA 1QIKA 1FFEA 1MTZA 1IUOA 2GZRA 4M0FA 3QMWA 1NX9A 3G8YA 1E8DA 1JJBA 1BN7A 3PICA 4GWLA 2PM8A 3ESAA 1IUNA 2WHQA 2RIPA 2HIHA 3QH4A 1EINA 3D2AA 3FYUB
chains in the Genus database with same CATH superfamily
1H6AA 1GJRA 2B5OA 4RIHA 3RTCA 2QQFA 2X4LA 1GD1O 3V7WA 4RL4A 2FU5C 4H9GA 721PA 5FYDA 2WJPA 3NANA 3OM0A 3TBFA 5JR3A 3KQNA 4R2KA 3AB7A 5HQ3B 5FL7A 4NBTA 4H7HA 1NJ5A 1YL6A 3RRYA 4C4YA 2VF8A 3U9TA 3NHJA 1RYFA 2I6GA 2ZT5A 5AO9A 1RI1A 4F5YA 1I8TA 1T3SA 4MW7A 1IRIA 3ACCA 3NWOA 1VPLA 3EWSA 2B8EA 3GB9A 1E6EA 3V4FA 3PNOA 4P31A 1ECJA 1DO0A 3FGOA 3AHFA 2TSYB 1QFSA 1Z0IA 3A9TA 2F3SA 4RM3A 4AZTA 1JXAA 3T1QA 2FFAA 2K6GA 2X2OA 1V37A 4QLAA 5DTQA 3WGQA 4KH0A 2D1FA 5JDCA 2FEAA 4AZWA 2YVLA 5JS8A 3C16C 3I5UA 4KZPA 4R84A 2VYFA 1NXXA 2RH5A 3PL1A 3NTQA 1RJWA 5C51B 3MERA 3O4FA 5F3DA 1NPTO 3RWMB 1DNPA 1FP4A 5AKZA 2OECA 4JS0A 5K8UA 1ATZA 1LBTA 4LOIA 4AI6A 5AKYA 4F0JA 3G13A 1VRWA 5I48A 2O8CA 2Z0MA 1D6JA 3QQPA 4WA7A 5B30A 4R2MA 1ZJZA 2Z8XA 3KSMA 3MFYA 2HF7A 3KO8A 5B58T 5TQJA 2QMQA 5FPKA 3E82A 3B38A 4QXPA 1DOZA 2HRBA 3S3TA 1LJ8A 3U4DA 2Y0CA 4D57A 3F9RA 4E7OA 2LPMA 1P61B 1RQRA 1SIUA 1YQGA 3DLTA 4L4ZA 4LHZA 3T12A 4EABA 4ATNA 3E8SA 4EB6B 3HSSA 2QF7A 1VKNA 2WAOA 4NZMA 1QOPB 2ZIEA 3LQ1A 3N3AC 2QE7D 3UC9A 2MOKA 2RHTA 4IEEA 3RSSA 3NEYA 1I3LA 1YXMA 3B6MA 4NVRA 4P7FA 2CCGA 5JSZA 1YOBA 4MA5A 3OFJA 5EP4A 1P39A 1YRWA 1Z8HA 2HQ1A 2JI6A 3AHCA 4JZYA 3U40A 4CLRA 4YP7A 4YCCA 5LU8A 1GR0A 5I47A 5FA8A 2EHJA 3HKEB 5HSGA 2XGJA 5JCOA 1G21A 1KFCB 1R74A 3SXPA 1HDCA 4N6OA 5H4HA 1I6WA 3I01A 1FNDA 5G0WA 1A96A 1GRVA 4LRTB 4FC6A 3WI7A 1JTVA 1U3CA 2YV2A 1AM4D 5FJIA 3Q72A 4ZRNA 4NJEB 4AO6A 4E0BA 2WF8A 2VDVE 2KWIA 1Z07A 2R7MA 2RHCA 3DOIA 1V8DA 3P71T 1XRJA 3K0BA 4L27A 1LNSA 2XD4A 2RAPA 4Q1BA 2HZBA 3RWBA 2VJMB 1T5LA 3DV9A 2Y27A 4D96A 4EY8A 1RLUA 3JYLA 3LM8A 1P6XA 2FFJA 2OCBA 3BXZA 3HXLA 4IOKA 4NKRA 5EKDA 4F4FA 1BH2A 1N32B 1Q77A 5SZJA 4UBKA 2F1JA 2GX6A 5L3QB 5FBLB 4BVEA 1USGA 5CIWA 2IHBA 1BXZA 5DGCA 2O8FA 4LYDA 3A31A 4HADA 4XPZA 4FB4A 5JD6A 4DABA 4R2XA 4P54A 1CQJB 1C8LA 2PGNA 4JBYA 4LGCA 4Y6PA 1E5QA 2C9YA 3FFAA 3O3OB 2AWOA 3ZDXB 2XRMA 2GA8A 2HMYB 4G0OA 3GVCA 1YS9A 1GGVA 3AETB 3C6ZA 5AXAA 4AS2A 6REQB 2WG2A 4PTLA 5C34B 1F1BA 4MW4A 4FGKA 1IZ7A 1YKFA 2XDQB 4YI3A 1QBGA 3OZCA 3V33A 4L74A 1G9TA 2EIHA 1KH3A 3PZRA 5C0OE 1R0CA 3OQOA 1V3TA 3K1AA 4LF5B 5L6LB 3A4YA 1N0IA 1B4DA 4D45A 2BZ1A 2Y6VA 3KT0A 3IILA 1U28A 1NUHA 3LUAA 1LDNA 3LA6A 4HZUB 4BNKA 1ZVVA 3EPHA 4A6XA 3AVTA 2PL9A 3NBYC 2VP3A 4RF3A 1M3SA 3DHWC 3VVMA 2CDCA 2AZ4A 2EDAA 3BL6A 4YRJA 5J2TA 4KUEA 2DWQA 5ESRA 4PBSA 2CMFA 2XA2A 4LOJA 4F6RA 1NSFA 3F6CA 4G4IA 5EJGA 2ST1A 3AF4A 3H75A 2PUBA 4DDUA 3U3JA 1PDWA 3WMGA 1R6AA 5LR6A 2XF8A 4LQCA 1P19A 2X4DA 4BMCA 3D3WA 3LRTA 4N03A 2JJYA 3EGOA 3KFVA 1UOOA 3CRQA 3QG1A 1JJFA 4HFMA 1TUIA 5HIJA 4DUGD 4U7GA 4KNYA 2YHIB 5CR9A 3OEEA 2CF5A 2X5OA 3MBOA 1DHRA 1PL8A 1XTUA 2DWOA 3GUYA 4D99A 2ZBUA 1O08A 4NK5A 4PLWA 3N07A 4NG5A 3PQ8A 3KJQA 3I4LA 3LKVA 4P84A 3J81A 4CTJA 3AESA 2CW5A 1LTKA 3VYRB 4IJQA 4NCJA 2C31A 2P5SA 5HFAA 1WBJB 2QX7A 1F2TB 2J6BA 5HQJA 2WZCA 2WFMA 1N8KA 2TMGA 4OG2A 1VA4A 4R31A 3G2HA 5K0EA 1SOMA 5J4YA 4X92A 2FN7A 3BICA 3GLSA 5EMJA 5ITWA 4RA6B 1R6XA 4OSOA 5FTNA 4D0GA 1YTLA 2IYZA 3EASA 3V7UA 3DTYA 3LXMA 3VNUA 1MF7A 1UP4A 2ZAMA 1SUPA 4LJKA 1XYGA 5C8YB 5IS2A 1QK4A 3JS5A 2IUEA 4NOLA 3UK7A 5IKPA 1SCNE 1O97D 4E12A 1SKAA 1MLDA 3ILYA 5I3ZA 2F62A 3E22A 3S68A 1AOXA 2YFKA 3HJTA 4QHYA 1AMUA 1PJTA 1W0KA 5AOAA 4FLFA 5B12A 1PX2A 2W8ZA 5BSFA 1Z12A 1S2GA 1NXWA 1TD9A 4RHUA 3PNYA 1RCTE 2MYTA 2YQ4A 4LYHA 1HFKA 2ZRIA 3AX6A 4MUYA 5ETJA 2C8LA 3RKUA 1JEYB 5AHKA 2LTAA 1C5KA 3NWJA 5CXUA 4NR0A 4QYSA 4JUCA 3TKYA 3JQQA 3VKWA 2IU0A 3VTKA 2IHUA 2EKBA 3E53A 1EG7A 3AINA 1HUQA 1Y8RA 3LD9A 4JLOA 3FMPB 4OI4A 4MPRA 3V2IA 1C2TA 3S8EA 4H31A 5JZVA 3W2FA 4RMGA 1SR8A 3D8SA 2FWMX 5KNDH 4X62B 4E09A 3DZGA 2VWHA 4G0YA 1ZD5A 2H4JA 1ETHA 2PYIA 2GH1A 2DJIA 3H2GA 3NHUA 5G2OA 1EXVA 5ALHA 4EB0A 2J6CA 2Z8ZA 3ORHA 2R2GA 2CD7A 3IC5A 3K9QO 3ZHXA 5C4MA 1VIYA 5AKHA 1RTTA 2H4HA 2R00A 2YUIA 2WSIA 4OKSA 3JXEA 3ZY3A 4BQQA 2EARA 1XMXA 4CUJA 3IPLA 4KYIB 2B0CA 2FWAA 3R9KA 1VPWA 2Y92A 1XCBA 3OUTA 2QOEA 1J70A 1VI6A 3A6LA 5EMKA 1D2EA 3WLTA 5CFPA 2ZATA 4P34A 3TZCA 2ZOSA 1H9BA 4RPHA 3BQ9A 3DE6X 2E4AA 2CNWD 1XU4A 1JQDA 1RFGE 4A7PA 4N41A 3ID6C 2Q4TA 3CR7A 3WWOA 1NBAA 3EBOA 3R77A 1KDVA 4O0LA 2P11A 4V03A 5JQGA 4ZEWA 5KQGA 2Q9BA 1AGYA 2JRCA 4AJ4A 5CGZA 1KSHA 2AR7A 5BSWA 3UFBA 1WB4A 3P2YA 1M74A 3MT8A 2NZXA 3UWPA 2DULA 3PNBA 1SQ6A 5HRAA 2ZEJA 1XLVA 2D4AA 2ZJ3A 2AXPA 2ZE6A 4QSMA 3I8OA 4EVSA 4N8SA 2OO7A 4NF2A 1Z4PX 1WXHA 2ZR0A 3EEFA 3MRSA 5DGDA 4C29A 4E08A 1JLLB 1NW5A 4G5FA 5HE8A 3TCXB 4KL8S 3ISJA 1FRNA 1FW6A 1Z22A 5JANA 1SULA 1SQGA 3VSDA 2FWNA 4OHUA 1U3GA 4Y8VA 3VKHA 3ZBPA 3GZNA 2GHRA 5G0TA 1UKZA 4ZOQI 2GJ9A 1KDPA 1OWNA 3M2PA 3FUWA 3OD1A 2QVYX 1X1RA 3IVXA 4KP7A 1FQKA 5REQB 4PX2A 4GKVA 4Y67A 5JSYA 3A58B 2GJKA 2EKPA 2GN8A 1VL2A 3ZHYA 4ENWA 5BUSA 2WP0A 2Z30A 4ZZ1A 1K9VF 1XKXA 2W2OA 1KOGA 4FKMA 3PEWA 2X9GA 2JIMA 3HFJA 4QUJA 2IKSA 4R51A 4OAPA 4MDEA 5IK2D 2BGMA 3L07A 3K15A 4GLLA 2L18A 2IDZA 4MQEA 1YE5A 4O6VA 3KKEA 4P4SA 4I3HA 4Y9TA 1OLXB 3LQRA 3P0FA 2FRDA 3UWKA 5BVGB 2XY4A 5M29A 5KHLB 4U7DA 3T1NA 3PWZA 2ZBVA 3Q2IA 2Q28A 4NH4A 4PSCA 3HVIA 1F60A 4R0VA 5B1SA 1VHTA 1RZRA 1FJXA 4AKGA 3HZRA 2OXEA 4YECA 1EIZA 1S7GA 1WIWA 4GBMA 4D3DA 1MD9A 3W8NA 4C7VA 2KW5A 2B83A 4GDMA 2UVPB 2FPSA 5DYTA 1MQ9A 4GQBA 4K9PA 2YWFA 3B3FA 4TLAA 5EESA 2B21A 2NSDA 3KU1A 2R4QA 3D0RA 4I50B 4P4TA 1KQPA 1P5ZB 1FK8A 1O54A 3CM0A 3N70A 1RRMA 2QGNA 2GSDA 4G9BA 4Z99A 4HV4A 2UUCB 3L41A 2C3UA 3DBHB 1L4BA 3P4YA 4D9MA 4TZ6A 3U48A 5JPIA 4MLZA 2D4HA 1GKIA 3FPKA 4L4XA 3SY8A 4ND4A 3S2ZA 1ZUD1 2IY8A 2N47A 2QU7A 1TT5B 1V5EA 2PWYA 4NECA 1B26A 3HUUA 2PH1A 2I2FA 2Y1LA 2FEXA 3B89A 1VP9A 1EJBA 3QI7A 1T0IA 3FFWA 2AJ8A 5SYMA 5JAPA 3CVXA 5L3ZA 2Q2OA 4IVQA 1YFKA 1PK8A 1GPKA 2ECFA 1CUSA 3CKKA 4B85A 4V1CB 5EIEA 3UNXA 5K8CA 2G06A 5BNIA 3B78A 3I8XA 3IT0A 3DMDA 4YAJA 3KQUA 1JMKC 2CL0X 1J5XA 5HS6A 3V3KA 1XMIA 2H5LA 1EK0A 1WCIB 2OZEA 1QYIA 3JQBA 3K70B 3FYUA 4GI7A 3SMQA 5JS6A 2ORVA 4O1MA 3F73A 4BTVA 1OD6A 4X93A 1CNMA 2BBWA 1W5EA 1HG0A 3NIFB 1QG2A 3W1VA 4CQMB 4DRZA 4KO8A 1DV1A 1M34B 1MC5A 1Q14A 1U3TA 4PPFA 1XPRA 2B8NA 3ZZUA 3A7DA 5IVHA 4ZVPA 3ENZA 2FI1A 3D0QA 3B6EA 2AIRA 3BG5A 3D4NA 4D8TA 1AKRA 1L4YA 1N2JA 3KCQA 2GJSA 3KL4A 4KHZA 4MDHA 3COZA 4I2NA 5CFZA 3T1HB 1R3DA 4WUVA 5A5VA 3CLHA 3TZLA 4DV0B 1F51E 4CQLB 5CG2A 1UC8A 1E2EA 4RWZA 4UM8B 3WJ7A 3OFND 1P7CA 4DHEA 3Q88A 4ABYA 1X42A 5TEVA 1OUMA 3H1TA 3QXHA 4LBVA 3ZCPA 2ZVJA 1VMDA 4GE0A 2ZZNA 4MW9A 1AQYA 2HO4A 2O0KA 4DJEC 4BE4A 2AI2A 1Z0KA 1ST3A 2XYHA 4JN6B 5D8DA 4MULA 3DA8A 3K5HA 4C0HA 1VE3A 3A1UA 4UDNA 4AP5A 4DR1B 2FR1A 2CLCX 1L8LA 4D80A 2A9RA 1D0IA 5IH3A 3NFYA 1VMKA 3UT6A 4JELA 1MAUA 1ULAA 4K0KB 3CX4A 5EIAA 5E4JA 3VR5A 4NE2A 4RMHA 3SVZA 4ZU3A 4CMEC 4WK2B 4DIFA 2P69A 2GAIA 4OQDA 4EYOA 1NYTA 4RHYA 4BVLA 2H2WA 4DLZA 1HDIA 2DG2A 2VLBA 5CD9A 2EFCB 3JATA 3IOCA 3EIHA 5G4LA 3ROKA 4X65B 3I9FA 4KXMA 1RPNA 1H4TA 4GT1A 3ONNA 3TFQA 1P4AA 2XTAA 1J7JA 1I4EB 3GOQA 3MBIA 3M4YA 4IL5A 4PBRA 1YH3A 4XARA 5SZKB 5T4FA 1PTJC 3AZQA 3SSNA 1COZA 5JAIA 2JFWA 1Z6XA 2VS1A 3TW4A 3PTAA 3THXA 3Q9UA 4Y6GB 4BDSA 4ARVA 1ZG3A 1ZJJA 5GOTA 4ALNA 2AK2A 1MAWA 2A33A 4UNRA 4QATA 4ZO6A 2DT5A 4UNIA 2LNDA 3EF3A 2PRKA 1E2UA 3FCYA 4JD5A 1CZUA 1MOPA 2IHTA 2SBTA 1SN7A 2KLHA 3VO1A 5KVSA 2DUMA 1RMTA 4HB2A 4BKPA 3AR2A 2QTMA 3QOFA 4KR6A 2PFKA 1L2TA 4RV9A 5E6UB 3UK0A 1T8UA 3F2VA 1P2FA 2AFIE 2FDRA 4WLNA 4ENPA 2W6ZA 3NW9A 2O8DA 3HWSA 3KLBA 1PR3A 3KOWA 3OM8A 4KDEA 3IEVA 1VJ1A 3QTLA 2V98A 1I5EA 1FFSA 2IUTA 3AVOA 5NLLA 3RTDA 4E5VA 1GN8A 2VZLA 2R4UA 3R7FA 4BBAA 4ILKA 1X87A 4EGSA 4XVCA 5K0BA 5SZHB 1W88B 2G0AA 1SHKA 4PSAA 2ENUA 5ALJA 2XVZA 4L3VA 4LZWA 4MPTA 3FNIA 1NY5A 2HHLA 4II2A 3C43A 1WU7A 1K7YA 2X6QA 4JL8A 1D9XA 2QG9A 5SYNA 4DAOA 4CDGA 5AKXA 3NGXA 2G9ZA 4UAJA 4OIFA 1PHRA 1WAMA 3WRYC 3V97A 2BFMA 4M9QA 3JTMA 1QO0D 1V9SA 3AHEA 3BA6A 4ZGGA 4ZIRA 1AD2A 1ABFA 2EJBA 1SHJA 4GOXA 1F6DA 4KIWA 1DXYA 5K3CA 4ALMA 5GADl 1L7PA 3TVTA 1X7ZB 5BWLA 1YHNA 2XVAA 3RO7A 4B0PA 3C3KA 1TTTA 4MPDA 4D0SA 4U7JA 5DM0A 4D9EA 5E6RA 2KMLA 3MJHA 3UKJA 5FUWA 3F97A 3G2OA 1X0VA 1ZKMA 2OHFA 1QHGA 2YVKA 5A6VA 5KHOC 3G85A 3ZGXA 2A3NA 4KJXA 3AHDA 1QVRA 2PNJA 1EDEA 3WWYA 5C37A 3I6ZA 4NP6A 3KPVA 1QYCA 5EJMA 3RT1A 3NC0C 4WLVA 1X0XA 4GYJA 4TQ9A 3TAUA 3LZDA 5IZ4A 4I1YA 1R9NA 2WUGA 4G5RA 4XDGA 3S29A 3VR6A 1GPMA 2R47A 2VNKA 4DCUA 2O6HA 4GE3A 4JP1A 5J5CA 2QDKA 5BP7A 5FEUA 4GLFA 3UAGA 4L2IB 3O47A 4OQ4A 4QVGA 3RAFC 2Y1KA 3S1AA 3DAPA 1L8AA 3LC1O 1LGYA 3JZFA 3N28A 3NDIA 4OBXA 4UREA 1Z4JA 5F7JA 5AW2A 5INTA 1TFUA 3K9FC 1S2IA 2AG5A 4A0GA 4RV4A 1WLYA 2R8ZA 1VGVA 4GO1A 3HZHA 4GC9A 4YAFA 1DAHA 1ZUNB 2PXAA 1K9SA 2PKWA 5IYZF 4A23A 2WUVA 3LQYA 3O2JA 1WEHA 3PXCX 2Z83A 2I1QA 2C3PA 1V1MB 2PMEA 1M2WA 1TUGA 3SQLA 1PLKA 2DFVA 4M76B 1IBSA 4FM9A 2RBKA 3R3YA 3GVHA 4RE6A 5D2CA 2ODQA 4PNEA 1TJPB 4DLVA 3PX2A 5EKXA 3WGYA 5LVAA 4FTWA 5H9WA 4BTLA 4UHKA 1V45E 3A6HA 1C80A 1P5HA 1J06A 1XDBA 3KQSA 3HN7A 3O75A 1K88A 1RPJA 3EVFA 4B6PA 4BNWA 3Q15C 3L8HA 1MRNA 4O4IB 4EKDA 3RAGA 1QMPA 1YR7A 5CT9A 1A9XA 5AVKA 3IMCA 5FOSA 2NVWA 2QUZA 2ZU0C 4BU1A 2O2CA 2VA8A 3IERA 3IT2A 3NKLA 1M6VB 1LH0A 1C9MA 1OGJA 2EX1A 2R62A 3ZEIA 2QL6A 5KNCA 3U7IA 2V96A 4G63A 1UZMA 2IVZA 2R6CA 4NRDA 3QK7A 1M73E 3VZRA 1OZFA 1QG0A 3EAGA 1WSBA 1XVLA 4DRXB 1SIWA 3CY6A 3F78A 2A0UA 3QE9Y 4HS9A 4Q66C 2FSSA 5H70A 3WLLA 2BP7B 4TKZA 2Q07A 3FPHA 2VT2A 4AKEA 1TYZA 2GN9A 4NCIA 2AZTA 1D4FA 2CFOA 4QYXA 5JW6A 5JTUA 1ZGZA 1H42A 3GH3A 1BX0A 3SE7A 2PK3A 3WLJA 3O84A 4YRIA 2JJ2A 4CKCB 2FMHA 1QZZA 2AG1A 3W6NA 2P35A 3DV0A 4HQLA 2QX9A 3IDOA 4YMWA 5DNAA 3WFZA 3S2SA 2E89A 1EBBA 1PFKA 1ZJYA 1E7MA 2BSQA 3UHFA 4BFWA 5DISB 1KEVA 2F9MA 4Q39A 3WGZA 2QUHA 1ZGCA 3L7AA 2SHKA 4M3NA 1EJ2A 1ICIA 4MAAA 4C0WA 3JR3A 5AJTA 3IPAA 3VR2D 4E1BA 2ZZKA 3CEPB 3FPFA 5CLHA 3WAGA 2C5FA 1B8NA 4YRFA 2P68A 3A04A 1Z3CA 4V38A 4DQXA 1UBEA 4EHKA 1E7RA 4P9NA 1EEXB 4Z8XA 3U4GA 4AZ0A 5A5DA 3U09A 1UC5B 2J4DA 4IMIB 4U0JA 2YS6A 4OHZA 2OD9A 2DPXA 2JGKA 2WSSD 1S96A 2JGRA 3PIDA 4GSYA 1XVIA 2ZWPA 5FULA 4ZDJA 3HDYA 3GJ3A 2P6RA 1TRKA 1JU9A 2HMSA 1S5PA 4E6EA 2VZ0A 2HXGA 3FM9A 2EKQA 1L7DA 4MWEA 1R8YA 4TKVB 3SEAA 2HXYA 4JHLA 4L4UA 3M6LA 4LNUA 5A5EA 1WUJS 3RARA 1O96A 2PA3A 2WE8A 4F46A 1W85B 3ILSA 3OOEA 4BAUA 1ZLXA 3NIBA 1DKLA 1GU7A 1MO2A 3WSTA 3EC1A 4TKMA 3E15A 5BNTA 4QUKA 3FR8A 4MVJG 5LA6F 1T9DA 4G5QA 1XROA 3OZEA 3I53A 4K40A 1YBVA 4N5NA 2P3OA 4EY4A 1TYAE 1W44A 4KRGA 5HKOA 4CL8A 3OEHA 3B1FA 1KI7A 4ZQCB 1PGQA 1GHTA 3TWOA 2CNOA 4X7PA 2G09A 1XKTA 4FDMA 4H0NA 3VSEA 4EQZA 1EUCB 4OY3A 1KZ9A 4ZT3A 5CA0F 1XLWA 2JB9A 1YJ8A 2QUJA 1C1DA 3MMZA 4BUCA 2VJYA 1QP8A 2IITA 4HDRB 3SJAA 4Q1VA 2AFIA 5EC8A 1U2TA 3RUAA 3IVRA 4L9SA 3AR5A 4R2HA 2JNWA 1U31A 1X19A 1Z06A 1DO8A 2R8OA 1A2QA 3AZOA 4NYMR 2YDXA 1XZPA 4LVUA 1BOOA 2HA7A 4WTOA 3DC2A 5GWXA 1DSSG 1GUYA 2FMIA 3KWJA 1EI9A 1YD7A 2PBFA 3QWIA 3W4IA 4B87A 1F0PA 5IT4A 1WMBA 3JAWB 2HLHA 5CK4A 1KKLA 3MN1A 3D8UA 1U8AA 1BYUA 1YU6A 2V45A 2BEKA 5FWAA 1KRWA 5JU6A 1E60A 1E63A 1T4DA 2IEYA 2JKZA 4MVJP 5U1PA 1K6IA 3GDGA 3IIIA 4X8OA 3WDLA 2V7EA 3CUWA 3JWHA 3PWTA 3GJRA 3PVZA 5D00A 3KT8A 4KPUA 1YZ3A 2HV9A 3BA1A 4M6WB 5IEBA 2GM5A 2G08A 4JLUA 4LJ8A 4MXDA 4Z9FA 4D46A 5EJIA 3KELA 4E70A 3QHAA 4M0EA 5ELLA 1YC5A 1OXBB 3F9CA 5JH7F 3ZWPA 3UWDA 4IMJB 3S2IA 4B73A 3I32A 1L4HA 3NHPA 3MWKA 3QYPA 2ZM5A 1K2WA 1I30A 1QC5B 3L4KA 3LCMA 1GEGA 3IR6A 2AK3A 2UYYA 1XT6A 3C4QA 2GPTA 4PTYA 3DPSA 4Y2VA 1YKSA 1XA0A 1N2CE 4Y6SA 5AJHA 1RLJA 3WSWA 2GAFA 3EOBI 4S1NA 3WMEA 5K8TA 1NP3A 2ZQZA 1XTZA 4KGVA 3K7EA 4DDKA 3NHWA 2V7XA 3FCSB 4JC8A 5ALPA 2FJ0A 5KO2A 3PQDA 3NWPA 4GLOA 2FCRA 3BE4A 2WBLC 3TLXA 4BBZA 5ARDA 3RFVA 2A7XA 3B1VA 3O8DA 5CEEA 4U7WA 2A5DA 3C3WA 1NVXQ 3I05A 1QRRA 4PAQA 4R9SA 4JMLA 4U02A 4KQ9A 1ID1A 1OI4A 3WLAA 3O1LA 2R6JA 4MI9A 4ZT7A 3SHWA 1ZWKA 4V39A 4BEVA 3HQ4O 3A32A 1OPXA 3ENVA 4A10A 4E15A 1IAVA 1SY7A 3OQPA 3SFTA 2GESA 3CC8A 2X7HA 3NPAA 3P9IA 3UEOA 2LR0A 4H1TA 4BEJA 1KJ8A 4KGDA 1JALA 4RK0A 5GY7A 5BWBA 4US2R 3PV0A 5ABPA 2ZPTX 1AC5A 4XCVA 2Z57A 2WINI 1IHYA 1UC4B 2JCSA 3EPRA 4U2CA 3ZY4A 1K4KA 4B3SB 2VG8A 3FXAA 1ZEMA 4BPRA 821PA 2OMEA 5CBPB 5CD1A 3LL4A 3CN7A 3WGUA 4Q4CA 1DRJA 3GBSA 3JQEA 4WBNB 3L6DA 3JQ7A 1ZN2A 3H0EA 3H42B 4JNCA 5AI0A 1IMOA 3PR2B 4KIFA 4H16A 2HJSA 3FFTA 4K26A 1R4NB 1I4TD 1V4NA 4PFQA 5EE0A 3COPA 4MRRA 4DNOA 3DAOA 1ZO8A 1K6MA 4WI1A 4EA9A 1H9AA 4XB6B 5TF0A 3HI4A 4DS3A 1XUOA 1J7KA 3EOZA 2C88A 4ZREA 3H2BA 4Y2XA 2HSDA 1UBFA 2O5VA 3A4NA 3CLRD 1MC8A 4BCCA 1WD7A 2AG6A 2P6NA 4X91A 2CV1A 3QSYA 4CMGA 3MCZA 5FWYA 5KQRA 3N2GB 1NMZA 1V8FA 2VJPA 4FVTA 1GO2A 4NJMB 5TMDA 1MZPA 3WO0A 1YHZA 4G9EA 1JIUA 1IN4A 1Z6GA 1RRPA 3DD5A 1USIA 1C0KA 1VP3A 3F3YA 1KHTA 2JFVA 3AEYA 1FCJA 5M04A 3GAMA 1H2BA 1L5OA 3A1FA 3P26A 4LHXA 3EC7A 5CDYA 3OZDA 5CX4A 4PCVA 1ZONA 3RV4A 3AW9A 2CHFA 4LE0A 4OLHA 1UBGA 2CGEA 5TT1A 2XKJE 5IW8A 3NRBA 5ITVA 5M2QA 1FRFS 1RM0A 1DJQA 1PK7A 2BGTA 4ZVKA 3G0HA 2AEEA 3GJSA 3R74A 2QU8A 1H4QA 4Q3OA 1ADJA 1O6BA 3ECAA 3ANTA 3GGCA 3GJ0A 3Q40A 4K6GA 3VOBA 1V2GA 3KQTA 4AWBA 1SQSA 1FSGA 2ZJBA 4QBFA 4O4LB 3QY0A 2Y0EA 1A5AB 5EMLA 1FTNA 2IEIA 1BJTA 1ODKA 3FCCA 4YJFA 1BDJA 1ISGA 1I3CA 1ZMOA 1MIOA 2ZUUA 4NHOA 2C5EA 4A1OA 5FLKA 2FR0A 4K87A 2I7XA 2ZBDA 3FWPA 4GP7A 5K3FA 1UP6A 2X4GA 5AR1A 3D3JA 1LV8A 3LW7A 4RHEA 1X7DA 1E3WA 3DEAA 5HJ5A 4FXPA 4UMEA 3NR2A 4Z8YA 3WGOA 3JQFA 5CLJA 3MUNA 1E20A 4P6VF 2YWJA 1VZ2A 3W2TA 1VE6A 1XIVA 2ILTA 3MINB 4QQ8A 3VZPA 4B6OA 1HFJA 3EIQA 2B94A 3VH2A 2DWPA 2XI4A 4DUPA 5AVYA 2NZYA 4U5XA 3DEHA 5DT9A 3NZEA 3TNFA 3AI1A 3DWFA 4CWAA 2H07A 1PZHA 3OJOA 3CRNA 2NYUA 3CW9A 1LRLA 2CFCA 4FHGA 2NU8B 1C14A 4DV6B 2PBZA 1DIGA 2ZB8A 2UZ1B 4AU1A 3N6VA 3AO0B 1E0JA 3UKOA 1MJGA 2IUYA 2VJDA 1KAMA 3D31A 3ILHA 3T38A 4DQLA 2VJBA 1F2VA 2R6DA 3P9YA 2RFLA 3LDUA 2FOIA 4HX2A 1SB9A 1KZGB 5FCDA 2J5QA 4NC9A 5LIPA 1IXYA 2GJAA 1DAGA 4C3ZA 5GM1A 1E1NA 1UZAA 4RHCA 3ZOKA 3FHLA 5H3HA 2JGJA 1N2ZA 3KEGA 3N2ZB 3O73A 3U3OA 4DBVO 4Q21A 1U1IA 1GQFA 2EFEB 4IQ8A 4EPTA 1ZR2A 5ELMA 2C0CA 1R0SA 1KDRA 5L95A 3M82A 2Y1GA 1CJMA 1KZ4A 4GL4A 1L4MA 4C7OB 2RMKA 5D87A 4F91B 3TN7A 3OZSA 3SQXA 2H57A 3I37X 3DWEX 5LLSA 3MMXA 4PXSA 2X76A 1G0OA 2YRWA 3GEDA 3SSMA 1ZUIA 2CEKA 2HHJA 3LWBA 4H0CA 3CEMA 4RDIA 1UINA 3BIOA 4XWTA 1C7JA 4YH1A 3VNRA 2GCGA 4QGSA 3ZGZA 2EKLA 3JV7A 1LUAA 1CIPA 2Z8YA 1KORA 1SVOA 2J08A 3QKSB 4K81B 1SG0A 2OGUA 4BVHA 5MHTA 2O8VA 1H93A 3PZBA 4OGFA 3A1CA 3D7KA 5FLYA 3OOJA 4GG1A 1ZLYA 1TQ8A 3EHEA 2BFPA 2XCOA 4MKGA 1WF6A 1UM9A 2CKDA 1OTYA 2PV7A 4QEZA 4V3BA 2ZJ1A 1GITA 2OGZA 2YS7A 3A1NA 4IX1A 5A6SB 3WYGA 3FG9A 4EGCB 1KC3A 3T3OA 1N2CA 4C4XA 2G70A 5I7SA 1PF7E 2CNBA 3GWGA 4NDAA 2BJHA 4XGIA 4BLQA 5JUWA 1HURA 1H2ZA 4NSNA 2H1VA 1E2FA 1EK5A 1O94D 2OHHA 3OZWA 1XNRB 5B64A 5I4BA 1I94B 3ESQA 1Q20A 1AGNA 1G3RA 5B7QA 3RVMA 3DMPA 1AA6A 4LF8B 3INNA 4YONB 1ZK2A 2QD2A 2YZ2A 4WCFC 1W29A 1ZXXA 1EXMA 2RD2A 2GARA 4RPCA 1VYHA 4K03A 3WLIA 1FNBA 2Z9BA 3Q98A 1EVYA 2RI1A 2GI4A 2X86A 4FSHA 4Q7EA 1Y1PA 4BNYA 1MB9A 1MW9X 2BFNA 2H1LA 5T4BA 3ZUGA 4B43A 3USES 5TLSA 1PFUA 1Z7EA 4JR1A 1YOVB 3EIXA 4GR4A 5EHXA 5CLGA 3HL0A 2A0FA 1G2OA 4DV3B 1JG4A 4M0LA 2VC2B 3N0XA 4E5UA 3D7RA 2QTLA 1LQ2A 2PGDA 3ELUA 5IZCC 3W5SA 4MUAA 5DB4A 1WG8A 4WK0B 4K1LA 2JIOA 4ZAGA 1H1LB 3WE7A 3HJGA 3IS3A 4QYTA 3RU2A 1X1BA 3MT0A 5IT9A 3DL7A 4YDRA 2Q5CA 5E6SA 5E4TA 5B2ZA 4B33A 3VXKA 2R1VB 1JKJA 2VUTA 1MO5A 5IFLA 3B6IA 4GBJA 1RJDA 2W2TA 1TVKB 3TGWA 4DJ5X 1NYLA 4FFBA 1FDRA 1IM8A 2O4CA 4ZMRA 1PFGA 3TZ6A 2WTAA 1NW3A 3R8CA 2OPHA 2X3FA 3ASUA 3GJ8A 3O0DA 2X14A 2FEMA 3QEMA 1AGRA 1UUFA 5CVJA 4XWYA 1SUFA 1O2DA 1RWNA 2GPNA 2RARA 3DUFB 3OE7D 3EVBA 3OY7A 3W9YA 3MS7A 3K5PA 4K86A 2E49A 3WIVA 1BHO1 4IXWA 1J8MF 3NVAA 4J1QA 4GLBA 1TJ3A 2PR2A 5IYZA 2WY2D 4EFDA 1V39A 4MWOA 4YRRA 3ZXYA 4DMFA 4TV8F 1Z15A 3AW8A 3I5MA 3ZHBA 4M8LA 3AVUA 2VDUE 4F97A 2H51A 1Y6FA 1XRMA 5BVHB 1H2FA 3P27A 4KNWA 1E3DA 5DCWA 5BT9A 3PXDA 1LY1A 3BMOB 3L1VA 1KIAA 1EB9A 1FS5A 5AVRA 1GNTA 3L2OB 5CFQA 3T6KA 2HF2A 3BL5A 3F3MA 3QPWA 1TE2A 2GBGA 3K8QA 4TZ0A 2OSVA 2M2IA 3QBTA 1IYZA 1ML3A 1R8XA 1PBNA 2B7BA 4DY4A 1XELA 4NOKA 3ZU4A 1PG2A 1YS4A 4B48A 3HEMA 4QYMA 3ZCUA 3U2QA 3E5RA 3VAYA 4TPKA 4BKOA 2IIQA 1SD1A 4UJ3A 1WY5A 2K87A 1IBCA 4C0JA 4C07A 2M1XA 5E7MA 3KSZO 5GONA 3V4LA 2PXXA 3OCWA 3GG9A 2WUWE 4PGHA 3WNVA 2CWWA 2C9CA 3RM3A 3HKBA 1JB9A 4I5GA 4HEHA 1DADA 1QKKA 2OCAA 3N5CA 3TXAA 1E92A 2GN0A 1MA3A 4MAMA 4P2BA 3VR3D 5F1KA 2R751 4AWXA 8ABPA 2WT4A 4F5WA 4Q4JB 3TYXA 2YWCA 1S6YA 1YJBA 5A03A 5KYNA 5C53B 4MTCA 1VI2A 1EKXA 2O5CA 1TEXA 1JFRA 4K6MA 1FYEA 3MRVA 2Q6LA 3IGFA 3TR5A 3ZE8A 1PNVA 4DG8A 4HNAB 4P3KA 4NABA 3T3HA 1ZD3A 3SDSA 4XKJA 5LZ9A 1I01A 3DFKA 1WL8A 1O9GA 2NIPA 2XV1A 3WMFA 1KVRA 2R44A 1VKOA 1ZEJA 4BP3A 5A9RA 1UPBA 2JLRA 3D6VA 1S2DA 5CW1A 2HMVA 3KQYA 5F5XA 1KQNA 3VTFA 2BRUA 4CLOB 1GNRA 2V0NA 3FOCA 3QG5A 4RAOA 4UPEA 2IHNA 3PEEA 1SXJD 2OMKA 2ZRQA 4MEJA 1LVHA 3KBBA 1JNYA 2PYZA 2BEVB 4Q1DA 1E4OA 3NNNA 3WXBA 2ZUTA 3DMFA 3AEUB 5A06A 5K0FA 3KETA 1ATIA 1B14A 3QF7A 3SX4A 1T4CA 2Z56A 4FDVA 2O8NA 4OFBA 4YP1A 3RVLA 4MS3A 2CSUA 4OQQA 3WMXA 3NCHA 3Q41A 1MIHA 5KSYA 2Q1XA 3RS9A 3CVWA 2BSXA 2YW9A 3KS9A 2ODEA 4IHAA 5EGSA 1OFTA 4RSHA 2NPOA 3SC6A 4BMNA 4CLHA 2XDWA 5C9ZA 3H9CA 5KVAA 4ETIA 5JBNA 3T06B 3WK4A 5M34A 1EFTA 2X5XA 4WLOA 5LA6A 1KMNA 3I6QA 4PC2A 2DKFA 2Y1XA 5K1ZA 1WRBA 1YBHA 3DE4X 4EJSC 4W7IA 2N9UA 3E1KA 3BRQA 1NLMA 1SU4A 3LWDA 2G9RA 3DOHA 4IEFB 2O3RA 4LTMA 2XMZA 4I14A 1JFFB 2PS3A 1QYVA 2C04A 3CLTC 3DO6A 4B3FX 4D3FA 4XRGA 5CA0A 1DFGA 1RJ9B 3PNQA 5FTLA 1C9EA 1J8VA 1BMQA 2X9NA 1NBEA 3X1WA 2PZKA 5AM5A 3OCXA 5KI6A 4MCHA 3VJLA 4B09A 5C31A 3STUA 2YQ5A 3ND8A 1PE0A 2QD1A 4AN0A 5JSKA 1SU8A 2C07A 2C2BA 3NS7A 1KRXA 4OQNA 5C8VA 1XLUA 5EG5A 1ZSNA 4PTZA 2XYQA 4ASUA 4B7CA 4DPKA 1U1EA 4AP6A 4L73A 2A9OA 3WR5A 2F9FA 4OXRA 2WNSA 5CA1B 1NI4B 2VOJA 4N6GA 4QJ4A 4LE2A 5IDQA 1IUPA 3G79A 5G4KB 4ZHQB 1F4VA 1VDMA 4V3CA 3TGLA 1T5BA 1GM5A 2O8EA 2BVNA 2Y6UA 4QASA 4LHVA 4FC7A 2FWRA 4J0JA 3QUAA 2H0AA 1EWYA 1ZP6A 5IC6A 1Q3TA 4QG3A 1DOAA 3K8YA 3DQZA 1GVHA 2OCGA 2FR8A 3UUEA 4ZI7F 3U5ZB 1N5OX 1QHNA 5F78A 4YCDA 2B1RA 3ZDAA 5KVQA 5JH7A 3O03A 1GCGA 1Q2XA 3CURA 4LTDA 3LI2A 5A4KA 1UANA 5KYTA 4L50A 4ADSG 1EVJA 1WVIA 1L7VC 1W5TA 3H2ZA 4EOGA 2YKGA 3ETGA 2QAGC 4FFWA 4Z9XA 2HR1A 3R3HA 1JG6A 4LCEA 4J29A 4KVGA 4NCNA 2GM4A 1GAJA 4ER0A 5LMZA 1MPTA 2QRQA 2A57A 5KYYA 4NY1A 2BELA 5ADHA 5ERXA 3H5OA 4YEDA 4DB4A 3SXJA 2V7TA 1KO1A 4MPJA 4X0EA 4C2BA 4HFRA 3KDSE 4YAIA 1WD5A 3EXHC 2EZ4A 5KU7A 3RROA 4Q82A 3I5AA 2WU0A 4AD8A 1Z3IX 3K3PA 1SWWA 1T4GA 3HJHA 4G1EB 4J0GA 7REQB 2UVQA 2GERA 2R6ZA 5H16A 1TA9A 5DRYA 1CEQA 1K08A 3GNLA 4LRUA 3U4CA 2REQA 1BEEA 7GPBA 1Z25A 4AUKA 1L5LA 1EGQA 1HXHA 2BI8A 4QOJA 1RHJA 5CXSA 4GQIA 1T3GA 4R9RA 3M6UA 1Z5ZA 2DQSA 3NEAA 4KFSA 4M1ZA 2Z6VA 4UEOA 2TS1A 3EXEB 3ZZMA 4OQLA 2VXBA 1SK8A 4M9XA 4DQ0A 2NADA 3ZV3A 4B82A 3HBMA 5G41A 4LY6A 3OLYA 1O03A 5TS2A 2FPUA 5JC8A 1GZDA 2OLKA 1A1SA 3E4CA 5D01A 2GCEA 4PRLA 4YJKA 2FK8A 1AXRA 4UHDA 5AI4A 3VC1A 1H05A 1RMYA 2L82A 4NZZA 2WTXA 4FQ5A 1M7BA 3KHUA 1HT0A 1VA5A 4L9WA 4F85A 1QH9A 2QTVB 1QR6A 2PCLA 3ZGYA 3ROMA 1QKIA 1Z6PA 1QYRA 3ZV5A 2PKYX 5BO5A 1YQ9A 1ZRSA 4IKOA 3ZPXA 4NICA 1SAYA 3QV1A 4ZJUA 5HGXA 5IPFA 5JXIA 1J20A 2R60A 3DZCA 3H05A 5K0GA 2D7DA 1LS1A 1GU1A 1X2EA 2WWIA 1VI5A 5HM6A 5LQJA 5F33A 1N6HA 2ZIFA 4OSPA 3KRTA 1Q0TA 2FNAA 1KSJA 3EGXA 3H84A 1XPJA 3OJWA 1Y5NA 1NXTA 3DVAA 1QHEA 4UPDA 1W4ZA 1FX0B 3EIOA 2H31A 1NGSA 2ABWA 2BBTA 4M0PA 3CH5A 2ZUDA 1I3KA 2WJAA 2BM8A 3LRXA 5KNDD 1BOFA 2QPAA 1XTIA 3A14A 3P4UA 4PC6A 4BC1A 1GOTA 1V8OA 3DMTC 1E0AA 3OMWA 4ESOA 4XGKA 1QV7A 3DHVA 3VZQA 2CWDA 2XIJA 3D5TA 2J48A 3UT0A 3R3JA 2BHSA 3FZYA 5KINB 3NO4A 4QDJA 4CG3A 1MC1A 5IT0A 1UFKA 1SU6A 2WPNA 4PZYA 4RQBA 1YRAA 3BHNA 3CUYA 4BNJA 3U19A 1L8OA 1LDBA 4BNIA 2AJDA 4P86A 1KF0A 2NV0A 1EWQA 1FSPA 1T5HX 4B4WA 1NR5A 3CIFA 5A4JA 2IEZA 3UAWA 3DM5A 1AK9A 3LX4A 1YMQA 4FJ2A 5BN5B 2PMKA 1QAOA 4FGJA 1ZH8A 4MP3A 3ROTA 3TQQA 3GJ7A 3NLLA 1OFUA 3PLNA 2QRJA 4HEQA 4RZXA 2VF7A 3TD2A 4K9LA 2I6UA 4OD0A 3IVAA 2JJMA 2H17A 2QL9A 2SCUA 3DW3X 2WMDA 2GXAA 4S1VA 2WVGA 4P0TA 5FD8A 5FORA 2F67A 2P41A 5FB3A 5I9TA 3KTDA 4E31A 3F6YA 3UH1A 5IAJA 5FAXA 2OCKA 3IUEA 4XR9A 3ZW8A 2AOWA 1NDUA 1RQXA 2WG0A 2Z09A 3H2HA 5CLQA 2FV8A 1FFDA 1U3DA 4OLJA 4RY2A 2GPAA 1SCUB 3SF0A 5CNIA 1CYDA 2NNLD 4LBWA 2ZSFA 2GFQA 2QTBA 4IS3A 2P9FA 2XHZA 3PKIA 4MYUA 1KPIA 3D6FA 3FMFA 1L5KA 4BFXA 1M5TA 4I99A 4KMSA 5HDBB 1EVLA 2J0SA 1AUPA 4X94A 4AY2A 4J3NA 3EPPA 4J8PA 3ESRA 2ONJA 1Y7PA 1GNSA 1P74A 3AL3A 4KXFB 1CC1S 4FWBA 1QQTA 2KB0A 2VDQB 3I72A 3FI0A 2C4VA 3AR8A 1N6PA 4CGZA 2YMPA 1KERA 3A6FA 3EZYA 1PR9A 3T7EA 3W3AD 4C22A 2J7KA 1KI2A 4C05A 5A4MS 2A7QA 3RGWS 1NVAA 3CR3C 3EUEA 4NZ9A 4O2AB 3UJ3X 5BWNA 4BNNA 4OI0A 2J9ZB 3GJ6A 1RABA 3NRCA 3EEIA 4RVNA 4TWIA 4TM8A 4XJTA 5D7BA 3TMYA 2W4QA 1JVBA 3QX8A 5HILA 2FW6A 1TECE 1M1UA 2F64A 2P4HX 3H5TA 5FJJA 2Q3FA 3BXPA 5JAUA 1Z13A 2LIPA 3R0XA 3HY3A 1J4AA 4EL5A 1KYTA 3VHRA 2GCNA 4MWDA 1A9PA 3ESXA 4XX1A 5KQMA 4F84A 3LYHA 2CUTA 1AK1A 3ZV7A 2ZB3A 1DEXA 4JBNA 3JARB 2HCBA 2EHDA 2W58A 3OT1A 1RMQA 3UJ9A 2YV5A 5KC9A 2FQYA 1Z5WA 4LXIA 2NTEA 2OSBA 4OHYA 1Z6TA 2ZXUA 3Q3GE 1WTCA 3SYLA 4I3GA 1Y5LA 3SYRA 3V1KA 2JGAA 5KYUA 3ZKWB 2EJTA 3COWA 2PD4A 2WJJA 4D8WA 5COBA 1Q12A 2ZB2A 1L6RA 3UGJA 2JDIA 4OQXA 4OQMA 3HP4A 3OECA 4XIJA 1DU4A 4G07A 2CLKB 4WLEA 5ITSA 3MT7A 3I6YA 3DWIA 4QPJC 2IQ5A 1JRLA 2Q5EA 1A72A 2VHTA 3HB9A 3Q7RA 2GXUA 1D1PA 1MA0A 4CI9A 1XMJA 5TGDA 3TTUA 3RB8A 2HA2A 4J0EA 3GLIB 1JSZA 1VKZA 4A36A 1M1XB 4DNFA 4YBRA 3DGEC 1ZC4A 5K0TA 1L5HB 1VJDA 1L6IA 4UHCA 2IF0A 3GJ4A 1XK7A 1XTRA 3K0HA 4JGIA 4PLVA 3FKSA 1BXGA 1T0JB 1XD2B 2BKEA 5KKCA 2IZ5A 3KNZA 4NEHB 4BNFA 1SC3A 2ZR7A 3EWAA 2ZM6B 1RXVA 2VJLA 1DMRA 2RH8A 1HWYA 2ILVA 1PR6A 1LXCA 7AT1A 3DFFA 2BGRA 5F9MA 1QRTA 1WUIS 1D9ZA 3ZJ5A 1MB2A 1J8YF 2GKOA 3WTBA 1KJJA 2WU4A 3VSCA 5DZSA 4B4VA 4GUDA 4GRAA 4URFA 1M1YE 4GF5A 3I04M 3WWEA 4K9OA 3U17A 5ECYA 5I7UA 2RHRA 4BV9A 3ODGA 4F1KA 4W5QA 5A9SB 3PX7A 1U2DA 3ZWCA 4DC0A 1RBMA 4D5EA 1L5VA 3COSA 2A67A 2Q27A 4ZYTA 4BNDA 2WPDA 1DKOA 2GBPA 4DIDA 1NSTA 1ZGGA 2FPPA 3LP5A 3EULA 4L8FA 5C8ZA 3K0AB 4MIYA 1TAHA 4DIBA 3OCZA 1YRHA 4IUDS 4UATA 1JH9A 5JLAA 1K5GA 4TMXA 2EP7A 2HREA 2X9VA 3H65A 2I62A 4G84A 4QJBA 3K9HA 2VHWA 1H6DA 3B7PA 4TV8A 4WOCA 1YI1A 1XMSA 2IXTA 4GMKA 3WS7A 4CHTA 3G9XA 3HRHA 3IPCA 1ISPA 2A9JA 2DTXA 3L7IA 3KQPA 4HYQA 2PBRA 4I9GA 5DOZA 3WFJA 1O9HA 2W90A 4KR7A 2RKBA 3KLOA 1E1KA 3C8UA 2LCQA 2R1TB 3Q0IA 5ALGA 5DMXA 1YB1A 2XB9A 3AEKA 2W8BA 5BQFA 3IAFA 3A9CA 1NOKA 2HQOA 2OK8A 3QLVC 5FFFA 3RYTC 3ZZ0A 3MS2A 3GMDA 4KH1A 4E88A 3PI6A 4UQPA 2B99A 4RD0A 5ALVA 1II9A 3SJZA 1GZ6A 1Y1LA 1JJVA 3QELA 5AP9A 5CEFA 1FVXA 3AI7A 3HE3A 2XXAA 3UJ6A 3ZWAA 2X9LA 4GQAA 4F04A 1Q1EA 3L8CA 2OG1A 3A2LA 4K88A 4DKJA 1A88A 2XUHA 2H00A 3T3MB 3KG2A 1PWZA 1SD2A 2CUNA 2IF2A 2WTBA 5I51A 4GWKA 4TXNA 5F1YA 1A8SA 3PBKA 5G3ZA 4GM1A 2PGOA 4FONA 5BN4A 1OKKD 1KJ9A 2RIRA 1NBIA 3HSYA 1YA6A 1TUBA 3HCBA 4JP3A 5DHFA 5BYBA 3IKJA 3OJXA 3HYNA 2ZQ5A 1PZMA 5G3YA 4EF4A 2RKOA 1Z2OX 3ORRA 4LBYA 5FOVA 3WLEA 4Z1MD 4B3XA 3IXMA 3W90A 4FOTA 2MYUA 3FDJA 1Z37A 2EU8A 2IGTA 4H4CA 1JPUA 4QYWA 3WLSA 3IDSA 5J3JA 4PNPA 4MWTA 5CP8A 1NVTA 3SWWA 1ZAYA 3DQQA 1XNQB 1N7HA 3Q9LA 4NL4H 3KAJA 5I8WA 2AFHB 4BKUA 1JEDA 1E2KA 2ZYTX 3KWMA 4BKRA 5TGTA 4LBZA 2LUOA 4XVRA 3VAZA 1K7XB 1PSZA 3E9RA 1U0GA 4J6EA 1I7LA 5LYYA 1DKUA 2P3LA 1P7WA 4YRTA 4C0KA 2QJTA 2B2XA 2HMAA 3F5QA 1EVIA 2CJXA 3DFZA 2PGXA 2X23A 3HU1A 3JAKB 4RPKA 3AP2A 1E7WA 1JSRA 2NSHA 1QP7A 5AJWA 3OHSX 3UXHA 1O97C 3AF5A 4BPBA 3ZJUA 2APJA 1NPYA 4TTVA 1IPHA 3CRW1 3VV2A 5JIBA 3P96A 3NTLA 3M33A 3PFKA 3R0QA 4ED9A 1V41E 4HEA1 2FH5B 3PR3A 2HUNA 3LUCA 3H13A 1SQFA 1QGAA 2WHEA 1PLLA 3K09A 4BQEA 2PX3A 3SIWA 4L8WB 3ISVA 4IR7A 1PV2A 3NRJA 4KODA 3K2IA 3S8YA 2O5RA 1DDOA 1NBMD 1SVWA 4JA0A 2VI5A 2Q8QA 4TL8A 3LF2A 3MIZA 3W9BA 5IABA 2RGNC 4EUNA 1JIVA 3IIEA 1LK0A 4LXHA 1C0IA 4DG9A 5K03A 1N77A 3NHSA 5T6MA 4XWGA 2VPIA 1W4CA 3WQQA 1M5RA 1RAAA 1KZ6A 2HNAA 1A76A 1WMAA 1OBVA 2GOYA 1BDIA 4OI1A 3M6IA 1T4MA 1LK7A 3IH5A 1TPZA 1U6JA 4L22A 2INGX 3ZVMA 1FQOA 1QO7A 4FGWA 2OOKA 2Q5IA 2PJZA 4HZGA 5AYVA 5BSMA 1Z7GA 4U9UA 4IG9A 5I8ZA 3ICQB 1LLCA 1PS8A 3VHLB 1ECLA 2V65A 3FUCA 3O7MA 5E1OA 4BP1A 4Y7CA 3WNCA 4KK4A 1UKVY 4K5QA 3ZD7A 1P0MA 2QBYB 4LRWA 3IAEA 4TT3D 2V8OA 3LUPA 3Q8WA 4HR7A 4C4PA 2QMEA 3GRUA 3MS4A 1GGFA 4MS1B 4IILA 5JO9A 3TIVA 5FV4A 2V3CC 4Z7JA 1E1RA 3NH6A 5FOWA 1M1NB 3WL4A 2ZBEA 4MIEA 3G89A 4FHCA 4IF6A 3PT5A 3T7TA 3OOYA 3RABA 3WK8A 4QGFA 1VRCA 1WU8A 3ABSB 1BRTA 4LWOA 4RFSB 4C76A 3R7SA 3ESCA 3I9NA 4M7OA 3TK1A 2QJWA 1R4MB 1RAIA 2F4NA 1UPUA 3PEUA 3WHLA 4XYGA 5FOTA 2DR3A 1AN0A 1P1JA 2AOTA 4QO8A 3DLIA 1US8B 1PYGA 4Y2TA 4N6NA 2YJNA 1Z68A 2I4OA 3UK2A 1PJ3A 4CL0A 7ADHA 3D8TA 1BX3A 3DZ8A 1RHMA 1YS6A 3K8ZA 1W8IA 2D06A 4Y6OA 4DV5B 2GD1O 3OEWA 4M22A 2JD2A 3SZUA 3GBPA 1GPAA 3CFYA 3EK2A 4D4MA 1N6KA 3V1YA 2JW5A 3VH4A 1JUDA 2GK3A 4KVFA 4I1OA 1EQUA 3DOJA 2NGRA 4YPOA 2P2NA 1M1YA 4BCDA 3A2KA 4RAQA 3OIDA 3PNKA 1Q19A 3JYPA 3JY6A 4MYCA 4LNHA 4S3MA 4XLLA 2FE1A 1ODJA 2H1WA 2R7KA 4KRYA 1VXOA 2QLFA 3H1BA 3QTBA 1AF7A 3D8RA 2B9EA 3FRJA 4EEXA 5K3EA 2D7JA 4BFCA 4DMKA 5A2GA 2JLAA 5IF9A 3R75A 1KMIY 1RLOA 5AFSA 1RQ2A 2HF8A 2NV2B 3ZIAA 3TBKA 4CGYA 1XAGA 2C4MA 2HSEA 5FPPA 2EDCA 2KM1A 3LQ4A 4EHLA 1YB7A 4XWWA 4EARA 1GYRA 1GQYA 3HJAA 3IQZA 3CEHA 1E4EA 2WM2A 4ARBA 5K0JA 3ILXA 1DUSA 1O5IA 1G8KA 4J0IA 4Q1CA 4TV9F 5IJ9B 3A9SA 4OXQA 4EQ6B 2O8CB 3GLKA 2ZUFA 1JKIA 3P45A 1ZVKA 1YU9A 2JFXA 2KBFA 3K92A 4J0KA 4NZNA 3GVIA 4PYLA 4F9FA 5K8VA 4JXKA 4DC1A 4UTVA 1PSWA 1WMDA 3E35A 1R9GA 1ZK1A 1UODA 3GNTA 5IANA 3KQWA 5AJXA 3O4RA 4L5IA 2UXBB 2PUCA 4FYPA 2NZWA 2X1HA 2D54A 4HN4B 2Z2JA 1XF9A 3AJRA 3RPEA 1HT1E 4LJ4A 5BSGA 4JX8A 1ZH2A 1B0PA 1O1YA 2D1TA 4R8LA 1C30B 1RQGA 3BULA 1LF5A 1KO4A 3HUTA 1V96A 2RHWA 4JASB 2A5FA 1MX9A 2GO7A 4CLRB 3UXYA 4ZTUB 2BKLA 4OHVA 4O4HB 3Q8XB 3FNFA 3GRZA 1YZNA 2WA1A 4TM7A 1G21B 4UUBA 3OTOB 2XUZA 4PZAA 2C2MA 3FOWA 2QJOA 2IOYA 4NENA 3BIWA 3HKCB 4UVIA 4QODA 1Q15A 2V59A 3KEMA 4S1TA 4O0MA 1I7SB 1ZNWA 1ZC3A 3B9QA 3BTOA 5J4KA 4BUZA 4CEIA 1HQYE 2VL7A 3K1JA 4Q01A 3VV3A 2HRZA 1PJAA 3EVZA 5TJ9A 3ZQUA 1J97A 4P32A 4BP8A 4D8XA 3TFOA 1UOEA 3LYUA 4UEQA 2J9RA 1E9FA 4R83A 3S27A 1QFYA 5C7YA 5FFNA 2R79A 3QA3E 4EKEA 1MQAA 2YWXA 1NQVA 5JYDA 2QZ4A 3GZTB 1CUVA 3V46A 1XEWX 2AN4A 4U6NA 2VQDA 5I9NA 5ALLA 2AD5A 3KTOA 3FWHA 3PC6A 2VVTA 3MCWA 1M2FA 2XRYA 3ZI7A 1GNQA 4RF5A 1U5CA 2IY9A 1G7TA 4GPZA 4E1VA 5E2IA 4AYXA 3IQIX 3ZY2A 1UBJS 3QUQA 2DTDA 3EXG2 5HR5A 2K2QB 2QD4A 4ZYLA 3MJTA 1WDKA 1TF2A 1U3VA 3JQ8A 3AU9A 4WQMA 4MRNA 1WSAA 2A1TS 3PQCA 1YL5A 1IY1A 4ROSA 1H0RA 1EFRA 2OEPA 2P3QA 4PCAA 4YJGA 1MV8A 4YRKA 5C35A 2VTBB 1N33B 2ZI6A 2ZXEA 5J58A 1U7TA 4KFTA 3O8OA 1B1AA 4KO3S 2FCAA 2AI3A 1HMYA 2O06A 3DTVD 4UHJA 3K1AB 4CM9A 4PYOA 1SKBA 2E3JA 2YICA 3OQNA 4W5NA 4KE7A 5HJEA 3F6SA 4YMIA 4CQJA 1SELA 1B15A 1YQQA 1LPSA 2F3QA 2P0YA 3TTWA 4NAHA 1W2WB 1LPMA 3P0EA 4TQAA 3ZWVA 4DARA 5IULC 4F92B 5B3LA 1QBKC 1VCNA 2E55A 2CK3A 1TJNA 2ARKA 2HJWA 3HBLA 3FUUA 3JQ6A 3NBAA 4G65A 4P22A 4QFDA 4CM4B 5J2TB 4J75A 1GG2A 3WLOA 5FEMA 3C3CA 1WUYA 1L7BA 2QTTA 4HGYA 2VPTA 1WY7A 2IUSA 1J2RA 4IZHA 4G5HA 4JVOA 2XUOA 3ZWXA 2Q7OE 5HVNA 3JYNA 4RYDA 4EMTA 4BO4A 4ZDIA 2DETA 5AI6A 1K75A 2QTNA 3CF0A 3JPWA 3LQQA 2VQFB 1KYQA 2E21A 3BERA 2OYRA 2PZBA 3D3WB 5FUMA 4MW2A 3SNHA 1RYHA 2PGIA 3UT5B 4G4GA 2ADFA 3OQJA 3G1TA 4R1LA 4M36A 2B61A 4FS8A 1V4BA 4QXMA 1BWQA 2FX3A 1VMIA 2G8LA 3N0RA 4C7MA 3ENNA 3O5AA 3H19A 4Z9AA 3OPYA 4AW9A 4C5CA 5HZHA 3DB1A 1HDGO 2HZ7A 4B80A 3GUVA 5KSPA 2IEAA 3E3NA 3WG9A 3SBXA 2B1IA 1Z5UA 4G1FA 3T0IA 3V8VA 3L0YA 3VO2A 1PD1A 2IOFA 5JVDA 2DUJA 3L4BC 1EXWA 2CMKA 4H59A 1UC9A 5LXTA 4KFCA 3LC7O 4RLQA 1MHPA 1E69A 1YZGA 2W71A 1PNOA 4RJIA 4BO7A 3EEOA 1TLLA 1N75A 1QP4A 4M1TA 1B6SA 3RF7A 3OTWA 4HB0A 2Q2NA 5EWJA 2ZWMA 1A4UA 4HX9A 4E2WA 1MFPA 4TYYA 1CNFA 3WOVA 4J16A 1UDAA 5CH3A 4DJTA 4TTQA 1NJ2A 1GCOA 1ULHA 2A1UB 3E22B 4GMXA 5EP1A 2GRUA 2I1LA 1EP3B 2JIPA 2QYHA 3SGLA 3CVUA 1MPXA 2Z3ZA 4JWKA 2Q3MA 2VNAA 3AV3A 1E2QA 2JKYA 2JIBA 4I1UA 5TB5A 2XIQA 3E9QA 1XQ1A 4HNVA 3MTBA 3MWJA 2X40A 5KJEA 2A9VA 1GTSA 3B1ZA 5J2UF 4AY6A 3LBAA 1HZZA 3MTDA 1XN1A 3FF1A 1L3BA 2IHYA 3L84A 3WNQA 1PEYA 4MVJM 3GGOA 5HRUA 1MJHA 2OGWA 2R6FA 4OHPA 1JECA 1G8JA 1GUZA 4OUKX 2VRCD 4AZ3A 5TMBA 4EPYA 4DMGA 3PDCA 4YCAA 2K7FA 3P8ZA 4HDNA 3F2IA 4M1EA 1FY2A 1W75A 1PNQA 5JAZA 4A15A 3ROXA 1X1SA 1Y8RB 2J9XB 4BEWA 1MENA 4HWGA 2XCRB 2DECA 3G5LA 3OLWA 4HAUA 4CV0A 1NW6A 5TVGA 3ZNPA 2X7XA 1TCBA 1EQAA 1XF1A 1ZXLA 1U04A 2ZBPA 4D9FA 2LIVA 1QB8A 3D8BA 3I45A 3IAHA 3O91A 4N3AA 5C7LO 2FUG1 2MSLA 1OLUB 3UO8B 2P2ZA 4WGFA 3EQ9A 1HMPA 3TRIA 4TLDA 4JEMA 2BDTA 3EGVA 5I9MA 4EBBA 3I2IA 5I7AA 3OIGA 1E5TA 2EQ5A 1J9GA 1OZGA 3BWVA 4M9CA 1QE3A 3N6RA 4XXHA 3VU0A 3KZCA 4R1NA 5HF8A 2FFRA 1GV1A 5K45A 1ONNA 1BGXT 1YR9A 4HF7A 1MT0A 2XWPA 2IZ0A 4BMSA 1Y6GA 2IS1A 3V8NA 1FDOA 3LTEA 3GQBA 3LTNC 1SIOA 2PD6A 4ZODA 1NP6A 2I91A 1XAJA 2WI8A 4CCYB 1J6UA 1ECFA 3MQ2A 1U1FA 4J3JA 3RODA 4XUEA 1E1QA 1JJ7A 5AMXA 4ZI5A 2OP0A 1GUAA 1ULBA 2ZSHA 3VNAA 1N3YA 5DNEA 5JQGB 5JY1A 4GHWA 5LYJB 4B46A 1Y89A 1ORTA 4U1RA 4COOA 2R6R1 5IVKA 3LX8A 5LCXA 4XGQA 2JGIA 1JILA 4MWBA 3G02A 2C4KA 4UASA 1BXKA 2FSHA 2PSFA 1WR8A 3OPQA 1L5NA 4MGEA 3UF0A 1E9RA 2C4NA 4HWTA 2G88A 1WXGA 1X74A 5EQDA 3GXOA 3EYWA 2H11A 2OV8A 5FTKA 1DRWA 2H0RA 4MV0A 2H59A 4JYBA 2PU7A 3DBIA 3A1SA 1YZHA 1ADBA 2XYVA 2AYZA 2C5SA 2AX4A 2H16A 3QEOA 3R1IA 3RGGA 1E32A 5LDDC 2JAUA 3D6NB 3ZG6A 1XJCA 3VPCA 4H1UA 2CYCA 1T0UA 2DHEA 3E70C 1E7YA 2P79A 4KVAA 4EMUA 1EFAA 3DDUA 2Q4OA 3KJNA 4EWLA 3ETJA 2Q46A 1SOUA 4TUYF 2OFFA 3DFMA 2ZRKA 1U80A 2PLAA 1JDPA 1PTJA 1PS9A 3T1VA 1VPDA 1BN6A 3FBWA 3HA5A 4Y0VA 1GGNA 1U3UA 3A0UA 5EWMA 4AG3A 3EH2A 4BVAA 1NVEA 3FSGD 4FR0A 2WG1A 1XHFA 4KX5A 4LZAA 3MTAA 2I03A 4LDRA 3SZLA 1PQ4A 4EJ6A 1VHDA 1L7AA 1DXOA 2JFQA 4EYEA 4ZXFA 4P4SB 5KVCA 1FQWA 2DHQA 5JLJA 3ND6A 2GAOA 1VTKA 3RIEA 1BC5A