4KEAA

Crystal structure of d196n mutant of monoglyceride lipase from bacillus sp. h257 in space group p212121
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
248
structure length
248
Chain Sequence
SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 94
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4keaA00
5K3EA 4WFJA 5AKEA 1N1MA 5FXMA 3TRDA 1W76A 5T4FA 4FOLA 1CUYA 4FTWA 3STWA 4FDMA 4D9JA 3F67A 3R3WA 1MO2A 5EIAA 4BAUA 3W04A 2HU8A 3MUOA 2ZJFA 5HF8A 3WZLA 4QDTA 4X6YA 4X6UA 4A5SA 2XUKA 3D2CA 1VZ3A 4B83A 5IVIA 2WKWA 2WFLA 1S8OA 3H1BA 2RONA 2ZSIA 3AZQA 1QLWA 3WIOA 2C5GA 4EZIA 2WU4A 4P08A 1R1DA 5AKZA 5LKRA 5I9IA 1BRTA 1GPLA 4DSZA 4Y2YA 1CIJA 1EINA 4KR0A 1EA5A 4OU4A 1CUCA 3DQZA 3C5WP 3WL7A 5HFAA 4N5IX 1CUZA 3H0CA 1CLEA 4Y2RA 1LGYA 1E66A 2XMGA 2JGKA 4Y2VA 3WKEA 5DNUA 1BN6A 2IITA 3X3HA 3RLIA 4G9GA 4HS9A 5A7GA 3FOBA 3WQHA 3D59A 3F97A 1WB4A 4UBLA 3DKKA 1MNQA 1O6GA 4AO7A 2X8BA 5C8ZA 2OCGA 3WZMA 2XQJA 4FLFA 3O9MA 4QLAA 3C6BA 5DTIA 5T4EA 1CQWA 2OGTA 1HQDA 1QO7A 4YASA 3QMVA 5ALWA 3FVTA 2B61A 3AIMA 4U2CA 3FBWA 4GW3A 4PSDA 1XQWA 3G8YA 2I03A 2OAGA 2WIKA 2PBLA 3NWOA 2Q0XA 2W6CX 1CUHA 2AJBA 2ZJ7A 1WPXA 1ZD5A 5SYNA 3PDCA 5AO9A 3G9XA 2C5FA 2QZPA 4QLOA 4OYYA 3EBLA 1CPYA 3S8YA 3BF7A 4J03A 1Y7HA 5ALDA 5EI5A 2ORYA 4A23A 2PL5A 1VLQA 2ZYSA 1YA4A 1CUGA 1LBTA 1N5MA 3DDUA 3WYDA 3G9ZA 2WJ6A 2PSFA 4BDSA 3DCNA 3G9TA 2XQIA 3U0VA 3VISA 2CUTA 4UHFA 4J0DA 1UXOA 1BEZA 3C70A 1F0NA 1UK7A 5CT6A 3SWWA 4BZWA 3DOIA 4AXBA 1CR6A 1ORWA 2BUCA 4KAFA 1UOPA 1CRLA 4F0JA 2QJWA 4EY4A 1MN6A 1PV1A 5CH5A 4L0CA 2VJDA 1YB6A 2BFNA 1CUUA 1YS2X 4ITVA 1QO9A 1MTZA 3W9UA 2ZVDA 1LPSA 4DYHA 4B6GA 3E4DA 3ZV7A 1U65A 1H2XA 1P0MA 2RGUA 3QPCA 5JD6A 4W9RA 1DX6A 1AMNA 1DT5A 5AM0A 1XQVA 1CUXA 1WB6A 2CJPA 2OG1A 2WU3A 3N2ZB 2RHWA 4W1QA 1E3QA 1QIEA 1CFJA 1E8NA 4DIUA 5JYCA 1WHTA 2H9YA 3FYUA 4QNNA 3PI6A 2WUFA 2XMRA 3UUFA 3Q0TA 1L7AA 5JD4A 2PUHA 3SK0A 1QFMA 1U8EA 5AI0A 4UHHA 1JJFA 5DNVA 4C4XA 1N8SA 1CUBA 4MEBA 1T4MA 3VJLA 3BF8A 3PF8A 4J0KA 1VE7A 3L1JA 4GDMA 3I2JA 3A2MA 2VTVA 4YX9A 1CUEA 1A8QA 2BJHA 4BYMA 3DL4A 5ALSA 3DNMA 4QDXA 1ZI9A 3DJYA 2HA3A 1UKBA 2XI4A 1QIFA 2XT0A 2WG1A 4FLMA 4JYPA 5I8PA 2XQKA 2HDWA 3IIIA 2X76A 2XUQA 3WL5A 1KU0A 2QR5A 3FAKA 4X85A 4CG3A 5EHQA 5HZGA 4IH9A 5BWBA 3AZOA 3HABA 4FFWA 5JAPA 2PSHA 3F98A 5ALPA 3WKBA 4AMZA 4G4GA 2ROQA 3FSGA 5LZ8A 2H7YA 1A8SA 2WG0A 4X7BA 4QA9A 2DR0A 3R3UA 3STUA 2Y2VA 3O4IA 5AM4A 2ZYHA 4MYSA 1MX5A 4W1PA 3U1TA 5ALUA 4OUKX 1SFRA 5AIBA 5EGNA 4DNPA 1RYYA 4B85A 4DSAA 4AZ0A 4UFNA 2J3QA 5E4JA 1MX1A 3LIPA 3STTA 1M33A 3O4HA 2HA4A 3WWOA 3D5EA 4INZA 1HL7A 3F8SA 5ALGA 1SCKA 1DQZA 5ALZA 1H22A 1X2BA 4BE4A 4WY8A 4B84A 2AJLI 1CUSA 1XZLA 4AZ3A 3MGAA 5LYYA 1DWQA 4UBNA 4X92A 4Q3OA 1VE6A 3VVLA 5KWJA 5CT9A 4Q82A 3LIIA 1LPAB 3HC7A 5LZ9A 3WWEA 2G4LA 4KRYA 1EX9A 3IDAA 1U4NA 4X3CA 3ICWA 2P8SA 2DFPA 5LZ7A 2QT9A 5AOAA 4ZGBA 5EHZA 2DHCA 1L7QA 5AK6A 1OXMA 4N8EA 1TCBA 3RK4A 3R0VA 3WK4A 2YASA 4JUIA 1ZGCA 4WCVA 2AJDA 2EEPA 1CV2A 1XLVA 2WHRA 4J3JA 4J0IA 4HRYA 4RE5A 4XWGA 1ZI6A 2AXEA 2HU7A 4L9AA 2GBIA 1AKNA 4B9EA 3VJMA 1DINA 4Q1VA 1RP1A 3LLCA 1H23A 2WFZA 3STYA 4WFIA 1QONA 2QM0A 3QPDA 4UHEA 2XUGA 3O0DA 4QDZA 1H2WA 3C8HA 2XDWA 1UKCA 2CZQA 3KWJA 3A70A 2Z3ZA 1A7UA 1QZ3A 3I1IA 3G0DA 1TCAA 3C87A 3R3ZA 2BUAA 1K6EA 4EA6A 4Y2PA 1EDBA 5ALQA 2OCLA 2XLBA 1SC9A 4G9EA 4OB7A 1B6GA 2VT6A 3FYUC 3ZPXA 2R11A 1MU0A 5CT8A 4H35A 1JI3A 1JFRA 3EQ8A 2RAUA 5CRIA 4E14A 4LHEA 3NUZA 2VATA 1GT6A 1H2YA 2GBGA 3QBJA 1QTRA 4OB6A 2QXUA 4P9NA 5JALA 1SCQA 4GBGA 4U2DA 3ICVA 1MJ5A 3FNBA 5HK8A 5LZ2A 2EDCA 4AO8A 1F8UA 4XJVA 4B82A 4EY7A 4WJLA 2PSDA 5A71A 5DJ5A 5AKHA 2GYVA 5ESRA 3H1AA 2CB9A 3WK8A 2XUPA 4H7EA 1YCDA 1Q0RA 3KDAA 4C01A 5AKKA 3VVMA 4MXDA 3WYNA 2VJAA 3EF3A 4N8DA 3LS2A 3NGMA 1G5FA 1VA4A 3HJUA 2QJRA 2HA5A 1LBSA 3V1NA 5AK4A 3DLTA 4B80A 2HL6A 2XUOA 3ILSA 3W05A 3BWXA 3D7RA 3F9CA 3FCYA 1CUJA 1XZHA 5K3BA 4X94A 5A7FA 3V1LA 3ZWQA 3C6XA 2RI6A 5IVHA 7YASA 3WK6A 1XRPA 4MQMA 5CXXA 1K63A 3WJ1A 2JEYA 5AKYA 4S0XA 1XROA 3B12A 2EDAA 1J2EA 3HSSA 3ZLTA 5ALRA 1GPKA 3KXPA 4RE6A 4E46A 5C8XA 1A8UA 2QMQA 1AGYA 4I19A 1Q0ZA 4DM7A 5EHNA 1XRQA 4H18A 5ALNA 5FPQA 2WSLA 4XVCA 4EBBA 4DNOA 3HRHA 3FVRA 4BC0A 1TAHA 3G02A 3E0XA 1IZ7A 2PSEA 4GI1A 3UUEA 3H2HA 3C43A 4WDQA 1LZKA 4UPDA 4AQDA 1ZICA 2HRRA 3P2MA 5LP1A 2H1IA 5E2IA 3VXKA 2QTBA 4KE6A 3CCCA 4Y2UA 4IO0A 1J06A 1K8QA 5ALTA 4G8CA 3WWCA 5AKJA 2QOEA 1YS1X 1YSCA 4BAZA 3I6MA 4TPKA 5JD5A 3H19A 4KRXA 3AUKA 2WFLB 1C7IA 4W63A 2AJCA 3FSGD 2H7XA 2C7BA 2ZYIA 1BCRA 4C89A 5IVDA 4MWTA 1WOMA 2DQZA 4ZXFA 1EH5A 2GZRA 3PFCA 4BP8A 3AJAA 2WHPA 1N5RA 1JJBA 5AH0A 2YYSA 3JWEA 2V9ZA 1AX9A 3WL8A 2PM8A 4ARAA 5ALKA 5HKBA 5FLKA 1VOTA 2VA9A 1ACJA 5CXUA 4WDRA 2HA0A 1K4YA 1UOOA 1HBJA 5ALVA 1EB9A 3DKRA 3O95A 4RNCA 4BTVA 1LPMA 1QGED 4GEGA 3O4GA 1UFOA 4UFPA 2GBCA 1Q83A 4U2FA 1QIMA 2OQIA 4NS4A 3KWFA 3I2KA 2GYWA 4O08A 2WUEA 2BCEA 3SX4A 1WCYA 4BBZA 5FDFA 2XMSA 1UK8A 2V97A 2LIPA 5BOVA 5DYYA 5DNWA 3AIKA 3C5VA 2XMZA 1CUIA 5AI8A 4KYVA 4E11A 5KBYA 3NOXA 3STXA 1HLGA 5FPPA 1WB5A 1XZKA 4OPMA 2PUJA 5DYWA 1IZ8A 2FJ0A 3AILA 5C7YA 1GXSA 2HA6A 3I2HA 4KJXA 4HZGA 2VJCA 4ZREA 1XQYA 1KU6A 1VKHA 4WFKA 2G63A 3D3NA 1LPNA 1LZLA 4CIBA 3OTQA 3WIBA 3HEAA 4ZV7A 2CBGA 2OGSA 3W06A 1QE3A 2QXTA 5EIEA 2V96A 1F0PA 3QPAA 2PKYX 1BEEA 2XUFA 3G0BA 3QYJA 3C6ZA 4PF1A 3H2IA 2JEZA 4LYEA 1X70A 3L1IA 3H2KA 3I6ZA 4Y2QA 2O7RA 5D6OA 5CT5A 5C81A 3BDVA 3WKCA 4Y9SA 4OCZA 4J0GA 5ALLA 4B0PA 4B9AA 5JADA 1B41A 1XKLA 4AN1A 4Z49A 4KAAA 2BUBA 3DS8A 1CUFA 2ZYRA 4PSCA 3C8DA 1JJIA 1PFQA 1EVQA 1FFBA 1R9MA 4FFVA 5JZBA 4CG1A 1THGA 3IUJA 2O2IA 2XUJA 3W2TA 2HFKA 2YXPX 2B4KA 2WFMA 3WMRA 2QKYA 1DTEA 1F6WA 4MYDA 4UFOA 5JASA 1EHYA 2QRUA 4HXGA 3I1YA 1VXRA 1ZGBA 1EDEA 3BIWA 2VJBA 2OCIA 3MUNA 4C88A 5I7UA 4NVRA 5ALFA 5KREA 3R3XA 1AZWA 3OM8A 2ECFA 2JIDA 3WWPA 2XUDA 5AM1A 5AKIA 4IQ4A 1XRLA 1JMKC 2FUKA 2UZ0A 1ZIXA 5AKLA 2HIHA 4KE8A 4KAJA 1QJ4A 4FLEA 4BVJA 1GQSA 4PQEA 4W1RA 3QMMA 3GROA 4ZI5A 1MAHA 2C0QA 5IH7A 2Y6VA 2DCMA 1EXWA 4E15A 5HF5A 5AOCA 1LNSA 1XZMA 4N8SA 4TGLA 4BRZA 2XQGA 1DWOA 4MEAA 3H17A 1BCSA 1P0PA 3FLAA 4FMPA 3T52A 2HADA 5HCUA 4BZZA 1CEXA 4J7AA 3IB3A 4DNQA 1C4XA 5CBKA 2JF0A 1HPLA 4H7HA 1IVYA 4B81A 3I6YA 1ORVA 5ALMA 4G4IA 4F21A 3PUHA 1FFDA 2Z8ZA 2QS9A 3KD2A 3BXPA 2PVSA 4Y2TA 4UUQA 4OU5A 4M0EA 5LKAA 3EIOA 3R3YA 1R9NA 3ESCA 1XRRA 1UZAA 2JGMA 2Z5GA 2XMCA 2G5PA 3B3QA 4LXHA 1AURA 3I2IA 1NU8A 1LPPA 1DWPA 2D5LA 1TIBA 2WHPB 1IUNA 4X95A 5H3HA 5CT4A 4PSUA 1W1IA 5AKGA 1CVLA 4B0OA 2I3DA 2WG2A 2WJ3A 5AJHA 2GYUA 1G42A 5JANA 4AO6A 4H77A 2Y6UA 2O2HA 4G5XA 4UBIA 1XZAA 4YK7A 5AICA 1XZBA 4IH4A 1P0QA 3WL6A 1IMJA 1TCCA 2WTMA 4ZWNA 5AI5A 5HF6A 4HTAA 5IVKA 4DTCA 2WUDA 5JAOA 1MT3A 3AZPA 4BVLA 4V2IA 5FOQA 5EHXA 4GWLA 4WY5A 3ZI7A 3H2GA 3QZUA 1AC5A 2BKLA 3A2NA 4X97A 3N0TA 2Z3WA 2BGNA 2O2GA 4EHBA 4OSEA 1ZD3A 3L1HA 2I78A 4QWMA 5K3FA 1XZGA 2WIGA 4Y7DA 3QMWA 4H0CA 1SOMA 4ROTA 3M83A 5BWCA 1XLUA 3O4JA 4U2EA 1USWA 4JNCA 1GZ7A 5JZ9A 5LIPA 5IKXA 5A7HA 2ES4A 5HF9A 5AHXA 3GELA 4TVKA 5HFNA 2JGLA 4FWBA 1WPRA 4I3FA 4DNFA 2JGEA 2C4HA 1OCEA 1YA8A 5FP0A 2XB6A 2XUAA 1R3DA 4ZV9A 4BATA 2WUGA 2I3ZA 1HDEA 2O7VA 2HU5A 1CUDA 4EY5A 2WQZA 3DYIA 5AIAA 3IURA 3VKFA 5HQ3A 4GLBA 2QUBA 1H2ZA 5C8VA 2DQYA 2H7CA 4EY6A 1EI9A 5K5EA 1QIDA 3FLBA 4JEIA 1UK6A 3S2ZA 3H04A 1ODSA 3G9UA 4BTLA 3D2AA 2VQ6A 3ANSA 4Y2JA 4IHAA 3IUNA 1AQLA 1MAAA 3HLKA 5ALHA 1XKTA 4BE9A 5E4TA 5ALXA 1J1IA 3A6ZA 3DD5A 2XMDA 2WHQA 2Z8XA 3BJRA 1K5PA 2ZJ6A 2W22A 4QDOA 4Y2XA 4BCBA 3JYHA 1YASA 3HZOA 1AUOA 5K3CA 4UBMA 3DEAA 2WTNA 4PV7A 3SC2A 2GZSA 4QE3A 1Y37A 4HXEB 4KEAA 5AOBA 3ED1A 1C7JA 4DMCA 1DQYA 5ISMA 3G7NA 1QFSA 3WK5A 1MPXA 5JATA 5AI6A 4G8BA 4F60A 3TJMA 1TQHA 1ODTC 4C87A 4AMYA 3OC0A 2WILA 4BVKA 3DOHA 1R88A 3BIXA 2HRQA 3D0KA 4DLNA 1U2EA 2HA7A 3FYTA 1OILA 1EK1A 1R4ZA 1NU6A 3I2FA 3IVMA 4YPVA 3HXKA 1ZD2P 1CQZA 1YR2A 3D2BA 2ONCA 2G5TA 4QWWA 1NX9A 2VSQA 1UKAA 4H7KA 2B9VA 1TRHA 4J0CA 1GGVA 3IUQA 2JGIA 1ZJ4A 2OCKA 4QDUA 2DSNA 5ALOA 1WHSA 5DWDA 1UT6A 1XQXA 4DMFA 5CW2A 3DYVA 2E3JA 3HACA 5FV4A 4K5QA 4BB0A 1D07A 2YH2A 5FKJA 5J3JA 4BCCA 1FFEA 1LPOA 3RKSA 4LYDA 4FBMA 3QH4A 5AM5A 2C0PA 4N5HX 4J0HA 5CH3A 1UWCA 3WK9A 4XX1A 2FJPA 3KSRA 5JIBA 1QOZA 4G4JA 1ZI8A 3K2IA 4NZZA 1QIHA 4PNZA 4OYLA 1BROA 1VJ5A 1Q84A 4Q05A 3GA7A 3W9BA 3CCBA 4CG2A 3GZJA 1QIJA 3I28A 2ACEA 4K6HA 1A88A 5A6VA 4J0JA 1JT2A 5DLPA 4I4CA 4OD0A 1XRNA 3R3VA 5K3AA 1FFCA 1ZJ5A 4CI9A 1G66A 6YASA 5AM2A 1UK9A 5CURA 4MJ3A 1CUWA 1O6FA 1J07A 5HQ3B 5K3FB 4XIIA 4LIPD 4X00A 5BV7A 1XZIA 5K3DA 1UOQA 2WLSA 3FCXA 2AJ8A 4FBLA 1KEZA 4F5ZA 1ZD4A 2BGRA 3TEJA 1JU3A 4BAGA 5EIHA 4H7IA 4AN0A 4UHCA 2QVBA 1YAJA 1CUVA 1Y7IA 4RPCA 5A62A 1EB8A 3F96A 1QIKA 3V1MA 2CMFA 4K2AA 5AK5A 3OG9A 2OGZA 2Y1KA 4UBOA 3IBTA 5ALIA 4HAIA 1BE0A 3VJKA 4ZRDA 2QUAA 2WIJA 1DU4A 3QM1A 4HRXA 5JZSA 1LPBB 2HA2A 3HYSA 1GQRA 4OB8A 2OQVA 2B20A 1XLWA 1E8DA 1YB7A 3R41A 2RHTA 4BDTA 4DMKA 2OXEA 3G0CA 4X71A 3H18A 2XUIA 3R40A 3I2GA 3FYUB 4QEKA 4UHDA 1RWQA 2JBWA 3PFBA 5DTJA 3AINA 4JH0A 4MQLA 1BU8A 4UHBA 4UBKA 3IULA 1XZFA 4KE9A 2XUHA 2DHDA 2WIDA 3ESAA 4BC1A 3G0GA 4X93A 4W1SA 5AP9A 4EY8A 4GHWA 1ZIYA 3V9AA 4AX4A 2XE4A 1QIGA 2C58A 1XFDA 3H2JA 4RGYA 4JYMA 2VAVA 4DMHA 3B5EA 3WA7A 3RM3A 4IH1A 2CEKA 2PPLA 3ZLUA 4DGQA 2OAEA 4HXFB 5KWIA 1HKHA 3M82A 4EUSA 4ETWA 3ESDA 3V48A 2DHEA 1CUAA 1T2NA 3LCRA 5A2GA 5AI4A 2JGFA 4Q3LA 2K2QB 4U2BA 3C6YA 5YASA 5ALEA 2XQFA 3KOOA 1JMYA 1ISPA 1XRMA 1JKMA 5AK3A 3E3AA 5D3KA 1ZOIA 3K6KA 2WIFA 4CCWA 2XMQA 3FLEA 4KE7A 3IUMA 5CMLA 5LZ4A 2VAXA 1GKLA 2PU7A 4K6KA 4B7ZA 3GUUA 1QIIA 1MNAA 5E4YA 1W52X 1IUPA 5AI9A 1DX4A 3GBSA 3LP5A 3WJ2A 4Q34A 3STVA 3WK7A 3QITA 2ZSHA 3JW8A 1E8MA 1TK3A 4H7DA 1ODCA 1LLFA 3ESBA 4QZVA 1EVEA 2HFJA 1XZEA 1EDDA 5AM3A 3BJMA 2HHAA 1ACLA 3UMJA 4CFSA 4LXGA 3WKDA 5HK9A 2WJ4A 5JAHA 5LLSA 4FNMA 1ETHA 2BAGA 2XLCA 4BP9A 2CKMA 1X2EA 3WKAA 2J4FA 1JU4A 4GXNA 3E1GA 3Q8WA 5F4ZA 5EFZA 3AIOA 3BL8A 2IX9A 4C4ZA 4FKBA 3RARA 1QTIA 2GBFA 1GPNA 3PE6A 2XMBA 1THTA 5FUMA 3CN7A 5T4HA 3ANTA 2PU5A 2PX6A 1DT3A 2PSJA 4P93A 5JAUA 3PUIA 1I6WA 4LKOA 1FJ2A 4NMWA 1FFAA 2Y2UA 4A16A 4H7JA 2R8BA 1XZJA 2NW6A 4MWSA 4BCDA 3OOSA 4C6HA 2JGJA 5D3ZA 1YAHA 1VA5A 2HM7A 3BE8A 4BRSA 4ARBA 5SYMA 1XZDA 3V1KA 4M0MA 3D4LA 3PF9A 4CIAA 4X90A 3WWDA 1R50A 4PO3X 5LZ5A 3EQ9A 1TKRA 3HI4A 1PJAA 2X5XA 3PICA 2VT7A 3WA6A 4M0FA 1WM1A 1W75A 3ZLVA 5JARA 4G1FA 4LXIA 3AFIA 3FWHA 5FRDA 3GFFA 3A2LA 3O9VA 3CXUA 4L72A 4PW0A 4CCYA 4Q3KA 1VZ2A 3QVMA 4GECA 1GKKA 2VF2A 1FSSA 1P0IA 1SCIA 4C4YA 2IIVA 5ALJA 2V98A 5DYTA 2J3DA 4AB1A 2WM2A 3VDXA 1E5TA 2OLEA 5T4BA 1Z68A 3YASA 2FX5A 3TGLA 4X6XA 2ACKA 1VXOA 3DL7A 3T4UA 2RIPA 4K6GA 2D0DA 4FNGA 1IUOA 2J4CA 5CTAA 3IA2A 4Y2SA 3EQ7A 4H7FA 4U2GA 1W6RA 4EB0A 3WLAA 1E89A 4FHZA 3OPMA 4X91A 4L3WA 1XZCA 4KACA 4UBJA 5ALYA 2VEOA 3WI7A 3BDIA 1L7RA 1BN7A 4G8DA 3M3DA 5CH8A 5HKAA 1G4HA 3CN9A 1EK2A 5AKXA 3OURA 3K9BA 5D7BA 1W4LA 3M81A 3G0IA 2OPHA 4HVTA 4P92A 1BS9A 3C45A 4CCYB 3MVEA 1MX9A
chains in the Genus database with same CATH superfamily
4EA7A 1FMFA 3DFUA 4WFJA 5AKEA 2X3YA 4RULA 1SH7A 2YFHA 3SFTA 4FX5A 3WQRA 1N1MA 5FXMA 4HSEA 4ZT7A 3DZBA 1D0VA 4RDHA 4GXQA 5T4FA 4P34A 3KEMA 3PDIB 1CUYA 1V43A 2AXPA 4ACBA 1I7PA 3FDFA 1RI2A 2IQIA 2A5LA 3STWA 2RB4A 4FDMA 1TOAA 1OJLA 1PZGA 1R12A 1W5FA 2NXJA 1KORA 3WSWA 3NPAA 1NT2A 1BX1A 1UPBA 5CFOA 2G0TA 1YVEI 5EIAA 3MUOA 4I3GA 2IV3A 2ADOA 1Y7PA 4XFKA 2PQMA 4FSXA 4TSFA 1Z5ZA 3R1IA 1PEDA 3LQ2A 4X60A 1XMSA 4WKCA 2R68A 1JHQA 1QRTA 3D2CA 2ZS7A 3PA8A 3DTVD 4ILEA 6Q21A 2Y93A 3IX7A 1Z5WA 4F2PA 3EGDA 2IEIA 3MJDA 1XDSA 4H3HB 4BPRA 1LRLA 2PAAA 2ZSJA 1P7VA 4IAOA 1QM5A 4B83A 4LQLA 3VR2A 3G8DA 4P4UA 4WZAE 1TYEB 2WFLA 3LBAA 1E4YA 4NNJA 4C0JA 2Y05A 4MWEA 1A5TA 4DCJA 4M0PA 5IHPA 1JDPA 2ZSIA 3A0UA 4BV9A 4C7BA 1WZ2A 3TFQA 5D85A 3RRXA 2C5GA 2J08A 5A3JA 3TI9A 3P9QA 2B99A 5AKZA 1JG1A 2XIQA 5H1YA 1IE3A 2P6UA 1Z2PX 3QKWA 4G23A 2JLZA 2P9ZA 1GAEO 3DEJA 2C7GA 3L7IA 4JUBA 3A4YA 3SX2A 2QZ9A 3OO0A 1Y1RA 2QV7A 4DT1B 4Y2YA 4EW6A 4FZ5A 3SSOA 3DZCA 1L1RA 3MIZA 5HZMA 1PT8A 4MW4A 4FFRA 2VYFA 4M0UA 3KSZO 4EYGA 2A5JA 1E58A 2OORA 3ODGA 1CUCA 1UC5B 4P1ZA 1JXAA 2H5JA 2QRMA 3GK3A 1I01A 5J1SB 1G4UR 4G86A 1NM5A 4EL0A 5H8WA 3HKDB 1VMIA 3F8TA 1B3BA 4R2JA 3D1VA 5HFAA 3ZGVA 5IANA 4DF3A 3BFKA 3G8CA 4UZSA 2DETA 3L1UA 4BQRA 1LGYA 1T8TA 4YQZA 1E66A 3UIEA 2FEPA 1OYYA 1A3CA 1NY5A 1RC1A 2JGKA 1E1LA 1Z3IX 2VQDA 3ELUA 4QFBA 1XMPA 3CNLA 3J81A 4TZ0A 4KODA 4RLFA 1EFHA 5CDFA 3PGA1 3HLTA 4AM8A 1OWPA 4DWJA 5DNUA 1APBA 1BN6A 1QH1A 3QHPA 2IITA 1H3FA 2P6OA 3X1JA 3BGIA 4CV0A 3WGHA 3HB4X 5A7GA 1K0UA 4Y9UA 1GRVA 1II8A 3FOBA 3MCZA 2P9BA 4JROA 3D59A 3NNNA 5LNK6 2Q5CA 3LFHA 2ZS8A 4KKVA 1Z4LA 3RVJA 3DAYA 4UM9B 3DKKA 4A73A 2GLTA 4GVPA 3QLVC 1JPVA 1KBZA 1P45A 2IXFA 1H65A 2X8BA 3C3KA 3KUKA 3E22A 1P5RA 4JL6A 5CBPB 5L7WA 4GKKB 4KNWA 2AOVA 1T9DA 1J0XO 3I0MA 1IN1A 4I1OA 1WKVA 1ISMA 2Q3JA 1E98A 3CFYA 4C20A 3KM0A 5HIJA 4B2LA 2WJVA 1QAOA 3BD9A 1SVNA 1YUMA 1CQWA 1SC1A 5LIRA 3OZTA 1USVA 3INTA 5CB4B 3TUJC 2VS1A 3OOYA 2PTHA 5J58A 2IZOA 5ALWA 2AKEA 2JL1A 3CSUA 3FVTA 4IF4A 4O25A 3JQQA 4GW3A 4Q18A 5KNCH 3RADC 3GJQA 1XQWA 3WIVA 3G8YA 2CK3A 3GJ5A 5BUQA 2W2VA 2I91A 1SQ6A 2OENG 2WIKA 2AWNA 3NVAA 3QJ5A 3GT3A 1RC0A 4S05A 1E3MA 1QO0A 3F7MA 5FUQA 1BE6A 1NMXA 4DDUA 2AJBA 2FPGB 5FPTA 2DPGA 1HG1A 2XYVA 3WB9A 5I9LA 2HREA 1WPXA 4MCHA 1WIWA 3G9XA 1WNTA 2IP2A 3OEHA 4CZ2A 721PA 3R9WA 4FMBB 4MPJA 1CY8A 2A1UB 3WISA 5L9AA 1KQFA 1WEHA 4PVDA 4QXQA 3GUHA 1TIPA 1VIAA 2R47A 1RABA 3FXAA 5CFRA 3IL2A 1BEUB 2QP3A 2IZ5A 5FWAA 1H4QA 4J03A 4PZ9A 4H6XA 4NJEA 2ORYA 5ER9A 4W5OA 3PS9A 3A36A 5FI0B 1T5OA 5IHXA 3UPUA 1YZHA 2A14A 2Q3BA 5H4HA 3WC4A 4DMRA 5LDHA 3S3TA 1YA4A 2EX4A 1W47A 2CVQA 3G2IA 4IUDS 4MPTA 4NBTA 3I1FA 2QA5A 1CUGA 1LBTA 5ECWA 1R6VA 2P6PA 2ZB4A 5AJZA 4II7A 4DA7A 4ECAA 2HCRA 2QVZX 5DHRA 3WYDA 1QCCA 2YWXA 3UK6A 3W1VA 1ZITA 4ZEMA 4Z5XA 1VG0B 3N7AA 5L4NA 1OBHA 1JLKA 1XMOB 1XX6A 4BJ1A 2O8CA 3LVBA 2W6NA 1N2SA 3P9XA 3AFNA 3BGSA 1W0KA 3DCNA 4GGPA 4PWYA 4PQYA 1E2IA 2FWRA 2XQIA 4L5AA 4MQEB 3RUFA 3U0VA 4A6DA 4XRGA 2XIJA 2CUTA 1NHGA 4CFZA 3L8GA 2C7RA 1P4JA 4WN9A 1D5CA 4EY3A 1D3AA 1KETA 1YZKA 1ZMRA 2UZ1A 2G06A 4U63A 3T9BA 1ID8A 3IXLA 4ZO8A 2AR9A 1GNRA 2FQ1A 2VWHA 3G2OA 5LDDC 4FD2A 4BKPA 2PGAA 3GLHB 4PM4A 3DOIA 2GEVA 1CR6A 1V71A 4AXBA 4ZQFA 2E1PA 3DHNA 3E1SA 3PBKA 1GCAA 3LFUA 5HRCA 5KJCA 1KDZA 2O4CA 4G4SO 4MGEA 4KAFA 5HE8A 3VU9B 4POAA 2GA8A 2GJ8A 3GZNB 2X42A 4IJMA 3X44A 5BWOA 3ODPA 3PHHA 3AKZA 4L6CA 1HEYA 1DX9A 3WMXA 3PQ7A 1HMPA 4P53A 5AHRA 4E2FA 5CH5A 2A5FA 2VWGA 2ZANA 3VR6H 4BFLA 5BSKA 2PUGA 4N3NA 3LWDA 4WNAB 1YB6A 2HBYA 2VUTA 3FPCA 3AMVA 4LF9B 1YS2X 2ZT8A 5HZHA 3IIMA 2ZVDA 1XMVA 3W9UA 5JROA 3G2QA 1GDDA 4NE2A 4KQJA 1NJ5A 4MOWA 4RK4A 1PL8A 3E4DA 4DG8A 5TEVA 2XVMA 1C7ZA 2RGUA 3DMTC 3QPCA 2DPYA 2GEUA 3QVOA 3QYAA 1NPTO 1DEKA 3GGPA 4KK4A 4Q1DA 4CKEA 3FB1A 5IJZA 4D8YA 4B6EA 1T0JB 4CLDA 2AN1A 3EMBA 1DT5A 5KC8A 1KIMA 1JALA 1D8AA 2GFHA 2VH5R 2RHGB 4WERA 5A7HA 1DEXA 1BO6A 1JWBB 1ADJA 1Z2NX 4XYBA 2QF7A 1JQBA 4ALMA 3U7FB 2J3KA 3RF7A 3L18A 2JC3A 3BAFA 4ZQEA 4Z0TA 2R48A 2RHWA 4IRXA 4MA0A 4ENTA 1E3QA 4BQSA 2ATCA 3RS2A 4UQOA 1OB2A 3LQFA 2WKPA 3CB4A 3MW8A 4QBTA 4WGGA 5C5DA 3LHKA 5JYCA 3CSSA 2F8TA 1Q3KA 5C4MA 3IUEA 4PO9A 1K27A 1AGXA 2JFHA 2BGKA 2UZ1B 2BW0A 2QW0X 4OO3A 5JPIA 1EZZA 2XMRA 3UUFA 1U4OA 2IYQA 5TMDA 1HE3A 2ZPTX 2YN2A 4UU7A 3GP5A 4IEFB 2Q4EA 5AI0A 1X0XA 4HAZA 5DNVA 2XR1A 3PXUA 3HR8A 1N8SA 1P9WA 3C97A 2JFZA 3I32A 2HDOA 3P45A 2OZKA 1LD3A 3OZCA 1ZL2A 4MEBA 4RS4A 2QLMA 4F5YA 4LK2A 2R6DA 1ZQ9A 1Z0IA 4J6EA 1UMDA 1DPGA 2CXQA 2BL4A 4JC5A 3I2JA 5KJFA 5I4BA 3QVXA 1RZUA 1M3SA 2O50A 3GVPA 3T3MB 2P5UA 5K0ZA 4KXYA 3UFXB 1PJ3A 3U4IA 3DNMA 4FCWA 3WG9A 4C3OB 1JG3A 1YJ8A 4JOSA 2JIZA 2KBFA 1QIFA 4FX2A 5SZKB 3GD5A 1T9HA 1THZA 2A9VA 5CDFE 4A15A 2QUZA 2IPXA 4JYPA 3IR5A 3JQ7A 4UJ5A 2HDWA 1HE4A 2O3UA 1UKZA 2RC6A 1NNUA 1J39A 1J42A 1FRFS 1OXKB 3PIDA 2Q41A 3HRKA 2WICA 1P8AA 3CYFA 4WESB 4F3YA 2X76A 1NM5C 4HDQB 3BRSA 3UXYA 2XUQA 1Y4ZA 1HG0A 3GJTA 1CKEA 2DAPA 3JQDA 3WL5A 2EJVA 3DQQA 3ELYA 1M2EA 3CRNA 1KU0A 4OAQA 4DWOA 5IUNC 4OQLA 4TLDA 1ETUA 4R1PA 1RWOA 5EKUA 1VE1A 2XX3A 2CWDA 2C9CA 3PPYA 4L8YA 3RU9A 3KQKA 1DIBA 4IH9A 3A37A 3NANA 3RTAA 5BWBA 4CMIA 1F2UB 1N4AA 3AZOA 1J56A 1RKQA 4C78A 2JRCA 1NG1A 4FFWA 1ORRA 5E7JA 1JTFA 3RBAA 2PWZA 1JAIA 5FAKA 1QC5B 2ZKLA 3JQ9C 4R2WA 4RVHA 2WV9A 4WCFA 1X1EA 3RS8A 1HFKA 4I5IA 4G67A 4I5EA 3ISVA 5K8IA 3IEPA 3F74A 4KV9A 4WBXC 5LZ8A 5T64A 4Y3UA 3UOAB 4RDXA 1SZDA 3ACCA 1IY1A 4S1WA 4DLWA 1WRBA 5F33A 2EP7A 2YFQA 2NQTA 3ASUA 3D7NA 5FJJA 3A0RB 2BJWA 3IAM1 1AKTA 2P11A 2C3PA 2VNAA 3R3UA 4OK6A 3SEAA 3ZNOA 1BZYA 2G0NA 3OT4A 2ZYHA 4MYSA 2F3TA 4HLUA 3LO5A 3DB1A 5ALUA 5KDOA 4OUKX 5I45A 3FRIA 4TVSA 3VR0A 3OMXA 2M6LA 1P7ZA 1U8ZA 2J9YB 1SC4A 1E9RA 3HYLA 4K9KA 1XU4A 821PA 1RYDA 2IXDA 3EEQA 5IW8A 1LRKA 1SBHA 3FTFA 2AXNA 4J1TA 4GR4A 1VPEA 1WV0A 4LI3X 4QC2A 4AZ0A 4BNIA 4JT2A 5IABA 4ZICA 3DAGA 3GRPA 1MABA 3RFVA 5E4JA 1OV4A 3MWFA 2AB0A 2R5NA 4RVSA 3ETEA 1M33A 3O4HA 3ORYA 4P58A 2C04A 1U2DC 4HB4A 5AQEA 3TBFA 5A4DA 1DO0A 3D5EA 4M9RA 4ZVSA 1XNJA 1QYWA 5AW4A 5JNSA 4BNJA 3JD2A 1RLIA 3GIDA 3MLAA 3HA5A 3QLJA 3TOCA 1CZLA 1SCKA 2BFOA 1Z2CA 2FPUA 4KWTA 4EKYA 1H22A 4MUMA 4G0PA 4AY6A 3L8DA 4Y67A 4EGCB 4HBZA 4BE4A 3DDWA 4PTZA 3DAOA 2VDLB 3NASA 4AZ3A 3BWDD 4BY9E 4LBWA 3WGTA 3AY6A 3A04A 4Q3OA 1VE6A 3QEAZ 4GKJB 3FKQA 1OXBB 1MB3A 4L7VA 4LX8A 5KWJA 4MLDA 4DBZA 2VDNB 5BV8A 3FRHA 1MIOB 2J0UB 5BYBA 3VR5D 1D9ZA 1VHQA 3M70A 1GNLA 2D8AA 4LVUA 3ROPA 3DCYA 3TLZA 1I2ZA 2AUNA 4IW3B 5LZ9A 1T5SA 4QEDA 1IATA 5KVAA 1QAQA 4QBFA 3E6AA 4MS4A 4BNWA 5HE9A 2O14A 1YL6A 1IPEA 5C1DA 4D9BA 1U0TA 4N01A 3FWPA 1T5HX 4D99A 4D0LB 4L7QA 1NVEA 4FEEA 2NT3A 4WACA 4C5CA 4ZCTA 5CLHA 5LZ7A 3QNUA 2AN4A 5JSKA 5AOAA 3RW9A 2CEAA 1XJ0A 4MVXA 5DP1A 4QGSA 5AD1A 4DQLA 5AVVA 5KVCA 4REQA 4G85A 4LSGA 4KPEC 3D31A 5EJAA 3DD1A 3SM9A 1KO7A 2GCEA 2ZIZA 4YP7A 5AK6A 3K9LA 2O2XA 4N6GA 1OXMA 3NDIA 5DISB 1LDEA 5L7YA 3VPCA 1TCBA 2FQWA 4PLPA 3RK4A 1QX3A 1E1KA 4QUDA 1W96A 3EXHC 5EMMA 3V6LA 5CTJA 2AIRA 1G7RA 3AI1A 5E7IA 1LDNA 4RTRA 4L4ZA 1E9AA 2QM8A 2X5OA 1RXEA 3FHOA 1ZGCA 1LC0A 1URPA 4UNNA 3DWFA 3JSAA 4WCVA 4RZ3A 3GDGA 5LB4A 3VA7A 3RB8A 3K0BA 2NUBA 4HRYA 3R8XA 4RE5A 4Y6SA 4A82A 1JIVA 2VHJA 3AY7A 4JOCA 1T4DA 1ZM3A 2GN9A 1GPH1 3S40A 4BMSA 2FAXA 2SHKA 3LBNA 4KKXB 4ZAZA 2JBHA 3GA0A 4ZO9A 4B9EA 3MYRA 3D3KA 5DWVA 1Y8CA 2C7PA 3VJMA 5FYQA 1ZO8A 5D87A 1YMQA 1FP1D 1RP1A 2QU7A 3OJFA 4BLPA 1M6EX 4UNQA 3DPSA 3TLMA 5TEWA 2ZSEA 2PZEA 4ZAGA 3V4FA 5CA1F 1HE2A 1NLMA 1FFYA 3OX3A 3H99A 1Q0HA 5KYUA 1AKQA 1A7KA 4RCVA 2B83A 3STYA 4F8YA 2PZMA 1BWRA 2ON6A 3NWEA 2Y1DA 1MJGM 1QONA 3CBQA 1AN0A 1QH0A 2WDPA 3FSEA 3LOPA 4Q1AA 4B35A 1UKCA 1JQEA 3A70A 4XM2A 1T3HA 5LBUA 2Z3ZA 3HH8A 1EBBA 4YAEA 5EOVA 4EKEA 3G0DA 3VO1A 2Z9CA 1PCXA 2ZITA 3D1LA 3IKMB 5IXSA 4CKCB 3R3ZA 2C42A 2BUAA 3C7CB 4LDNA 4EA6A 3DWEX 1U5AA 1KJWA 2B8WA 3ONDA 4PZLA 3UMRA 4YCLA 1UODA 1Q7EA 3NIBA 4JR2A 2ZUSA 1W87A 3B3AA 4K1LA 1BKDR 3BE4A 1CQJA 4J75A 4N0MA 1U9IA 3ER9A 2OCLA 4G9EA 1AS3A 1B6GA 2WSYB 2JD2A 3ESZA 2EBUA 2OB2A 2VXOA 3P9CA 3PEEA 1SKUA 4NK5A 3FX2A 4A8TA 1GN9A 3FPBA 3KOUA 3RPEA 1YCHA 5CT8A 5C8DA 4I08A 4WLOA 1ADFA 1B0ZA 1FDTA 1EXMA 1YS9A 2B69A 3EQ8A 4LOJA 4O02B 3MJFA 4LHEA 5COBA 5CRIA 5G4KA 4E14A 3T1QA 3UT6A 5IAOA 3NUZA 3FA2A 2VATA 1WUKS 1K9SA 1OTXA 1VL2A 2WAMA 5K8JB 1P2FA 4AQYB 1X7XA 3WJ7A 1CEEA 2GAAA 4RCYA 4ITUA 3TZQA 3TIXB 1V5EA 3L4SO 1TC2A 3QBJA 3T38A 4Q03A 4P9NA 5EXPA 5G3ZA 1SCQA 1AS0A 1DMRA 4CMEC 4DJDC 4EGFA 3RABA 1KK3A 1VSUA 2Y1EA 4JT4A 1IM5A 3NHPA 4BP1A 1P18A 1JP7A 2DH5A 1KQ3A 1JHYA 1TADA 3BE5A 3BGVA 3FNBA 3PWZA 2GBLA 2OKGA 1RJFA 2XZOA 2JKZA 2VT3A 4UCWA 1JN0A 1I1NA 1U28C 3NCTA 4XB6B 4YBRA 1SG9A 3TQFA 1S2IA 2VJQA 2ZBQA 4AO8A 2GVZC 1KI2A 4M1OA 1PYGA 2V03A 1ICIA 4NIMA 1XPJA 2IOQA 4XUDA 5GGYA 2IYOA 4ER3A 5A71A 2A6PA 2I29A 3OVMA 3SSMA 4EG6A 2GYVA 3EXEA 1I0LA 3KFLA 3OBIA 2ALJA 3KXLA 3OA2A 3ZZNA 4ENQA 4IQFA 2PE5A 5J5CA 3DMTA 4FYHA 4OQDA 3WYBA 1SK8A 2XUPA 2I0FA 3O3CA 4Z9FA 1YCDA 5LUAA 1KVRA 1Q0RA 3SJ7A 3JRNA 1WW8A 1TXGA 3DBRB 2FB9A 3TAXA 1L5ZA 1F7UA 3VVMA 3UANA 5KNLA 4TOIA 3IEVA 3LCMA 4PIPA 2WWVD 3WYNA 1YZUA 2YVAA 4KTTE 3NV7A 5C9ZA 1AGNA 3LS2A 3BJZA 2B7BA 4EECA 3W1EA 1EDZA 2JCVA 2FSSA 3ASYA 3VAZA 4L73A 2P9QA 1LLQA 1VA4A 1TA4A 4OAOA 2QJRA 3AR7A 3TQOA 1PGQA 2OZLA 4TS1A 3FZGA 4J3FA 3UB2A 1Y6ZA 4IXDA 5AK4A 3IBFA 1BQ3A 1KYZA 3DLTA 1PG0A 2QVXX 2XUOA 4YN3A 3T41A 4O1IA 4B80A 4AJ2A 4Y98A 4FYVA 2H0QA 3GUCA 4FYKA 5E4FA 1LW6E 4LV8B 3F9CA 2D1QA 4HKTA 1VBMA 1T8PA 4JBXA 4HH0A 3QTTA 2CC2A 4QUGA 3IAFA 3T7SA 2WM9B 4OUDB 3ZXXA 1OTHA 2UUBB 1KP9A 1TMGE 3NHSA 4TVOA 4YTEA 5EXDA 1Z4QA 3P2JA 3TSAA 4CDRA 3WLMA 4BLTA 4E3ZA 4CR8A 2H1CA 3ROZA 5JS2A 3ZWQA 3DGFC 3C6XA 3FY4A 1VLJA 3BXFA 3ONVA 1WCIA 2P5YA 2W7TA 4HWGA 3WK6A 5SYAA 5EWLB 4E2ZA 3I53A 3O4FA 4NULA 4BVEA 1WX1A 3IQXA 1OUMA 3CKLA 1YDWA 4U7DA 6CHYA 4JDPA 3WXBA 4BO9A 1QR6A 3CMCO 4XD7A 2HQSA 1FNCA 2BEVA 4DCTA 1JTEA 1OVGA 1SKQA 3ML1A 1J2EA 4DC0A 3GP8A 3F8WA 1WDWB 1U5CA 3R7AA 3IAHA 3LCJA 4DA4A 4E09A 4JVOA 4Q9NA 2NO0A 3V8QA 4AKTA 2C4UA 2BFBA 1KDTA 3ZLTA 5JW6A 2DM6A 2LPMA 4W4TA 2Q28A 3PIIA 1NWCA 1UF9A 1PS9A 1M2GA 3RSHA 4OA5A 4E46A 3UCEA 4LF6B 1A8UA 1NYLA 5MGBA 1ZHFA 1QLHA 4I19A 1Q0ZA 3HVUA 3B1YA 4JHLA 4JLPA 4WEQA 4GKVA 1CLUA 1VSBA 1ZA2A 5F73A 1XRQA 1Q7CA 4H18A 1EIWA 3GI1A 1Z5VA 4D80A 2IYVA 5FPQA 3EFHA 4EG1A 3D3WB 4IIHA 4UHJA 1ZM9A 3CNHA 4XVCA 2GZ1A 5JQGA 1WQ3A 1ONPA 1NL3A 2B4YA 2IPMA 4NS1A 4OGLA 4PG5A 5JVDA 2QMHA 2RAVA 3CX6A 2SKDA 2ZJ5A 2GOYA 2PSEA 4JYCA 3L7NA 3HUEA 2XA2A 3PXDA 3SF8A 3KXDA 3H2HA 5LL6P 5KYKA 5ITWA 2PZGA 3WLJA 4X63A 4RZHA 1Q12A 3T34A 1RRMA 3TINA 5K7SA 3TQTA 3MGGA 2J07A 2J32A 3OF3A 3ID6C 1X8KA 1Y98A 1IN8A 4HAOA 1UXKA 2DTDA 2FA9A 2H92A 2UYYA 3GWGA 1MG5A 1TCUA 1VE9A 3WMFA 1RAHA 2H48A 3VSCA 4UXHA 1R4MB 3IUSA 4XA8A 2VBCA 1P72A 4KO8A 3P2MA 3TQQA 3CLTD 3ZBUA 1DBSA 1LBHA 1UWLA 3G7UA 2QTBA 1VLZA 4KE6A 4Y2UA 1BS2A 2Q4BA 1DRVA 3EPRA 4I55F 4IO0A 4N0QA 3HG7A 1WXIA 4AS2A 1BKSB 1OXVA 2H11A 4B3CA 3HJFA 3W5SA 4OQZA 1ZGZA 4E33A 3UOWA 1Z29A 2D1SA 2D7JA 3IODA 3OZ7A 2VPXA 4PPYA 5ALTA 3T5BA 3R20A 4I8DA 4JLSA 1TO6A 4W5NA 2A57A 4M8LA 4NE9A 1YSCA 4TS3A 3HR7A 3MBIA 1LB1B 4RIEA 4URHA 5DHFA 3T7RA 3O3MB 4DLYA 4WI1A 2B1GA 2YHAA 3H19A 4UCFA 4B2YA 4XTRA 1C3OB 1I36A 3S0JA 2PRZA 3TR6A 5KCZA 2VKQA 4M98A 3RQSA 2Q1TA 1M5RA 1KY5A 4W63A 3JWIA 3BRCA 3FSGD 2NZWA 1DWUA 2XGMA 2C7BA 2EIHA 1SR8A 3P2YA 4C30A 4QLBA 1LTQA 5DT2A 4PHGA 5IVDA 2JCYA 3VKWA 1G8HA 2HJSA 4ZXFA 4ZOLB 3TUZC 3N0WA 2XB8A 4YJFB 1EWQA 2EW2A 4BP8A 1KI3A 3AJAA 1U0GA 1PEAA 4TV8F 3MRVA 3SVLA 3FYHA 5G2OA 4K9SA 1PJZA 2YYSA 5JEDA 3CLUC 1QTQA 2ONZA 3IELA 4FSHA 1E2GA 1QP4A 4X7RA 4NAVA 4LJ5A 1KHTA 4A6EA 4EHDA 4MAAA 4DE5A 3K0EA 4LY0A 4B6SA 1IM2A 4K9LA 4ARAA 4LXUA 1NQXA 2OORC 4LBVA 4HF7A 2J1LA 3IKJA 3KVOA 3TM4A 5FLKA 4CV2A 5DYGA 1STOA 3NBUA 2VA9A 3A1UA 1ACJA 4WDRA 1X7YB 3CY6A 1A50B 1OBOA 2C4MA 1V2HE 3IHWA 4XXHA 3PV0A 5ALVA 5T7BA 3PXBA 1V5FA 3NDRA 1EB9A 4NOKA 2PKWA 4BTVA 4C06A 1RJEA 1RWBA 1XP8A 1SURA 2O57A 2Q1SA 4RHCA 2HCFA 2QMYA 3ZKAA 4DGQA 4PYLA 2XT6A 4QSHA 2IYLD 2RJOA 3I9V6 4MGHA 3MB5A 1US8A 2F8LA 4Q7LA 4U2FA 4YJGB 3DAFA 4CM4B 4MKIA 2A0UA 4NS4A 1HFJA 3I2KA 2HQ1A 2OV2A 2PJZA 3DT9A 4QNRA 5DHUA 5J4LA 4OJYA 2KW5A 3K7EA 5IM4A 1M0SA 5EKSA 4EHKA 1FMLA 1NDUA 2B4QA 3GLKA 4RZIA 4Y2HA 2OSVA 4XDZA 3W5UA 5T57A 4TV9B 2WUEA 3R8FA 2ZR9A 1U8FO 2BCEA 4GYKA 2PH3A 4XFJA 1FYEA 3WDLA 3Q0IA 5CLJA 3ZWKA 2AOTB 1SQFA 1NBEA 1YIAA 4R9VA 1AQJA 2V97A 3H5NA 2PGNA 2AQIA 3H9CA 2NSJA 4GQIA 4EI9A 4WGFA 2HT1A 2W6ID 3HJGA 3NTRA 2Y1WA 4UAGA 2Y3IA 5EP1A 1ZUIA 3T99A 5A06A 4I1UA 2W8BA 1R66A 2B7LA 4RQBA 1J4AA 4NTZA 1YH3A 3P26A 3DMHA 4E11A 2CLEB 2X40A 1CNFA 3NOXA 5G40A 4A0QA 1JBEA 3WGYA 2R0QC 4ZO7A 4QJ4A 2HSGA 1HLFA 1GSAA 1USIA 2W2LA 5DYWA 3ZU6A 2TMKA 2Y0CA 3F2VA 4ODIA 4Q9DA 3TZ6A 1DJPA 1QOPB 1ABFA 1EFKA 1SXJA 2FJ0A 3WFZA 2JIOA 1YNOA 3BZBA 3R7LA 1XEFA 2FWNA 4WADA 1AOXA 4NXNB 2Q3FA 1RAEA 2Q0QA 3I2HA 4ZU6X 1SBZA 1ZVQA 3HBAA 5EXTA 2NVUB 2JRLA 4D9EA 4YRSA 2OD9A 1HTBA 3H3JA 1G6HA 2WV7A 4M3NA 1FXWF 5IBPA 4AJLA 3DOUA 3KKNA 3PGKA 1WVIA 4TTSA 4ZREA 1ZN2A 1NAHA 2EF0A 2VH1A 5KQLA 1VKHA 4PLZA 5MGNA 1N33B 2AF4C 3EWAA 3BYZA 4I2VA 5FJIA 1WJGA 3D3NA 4UEJA 4W8OA 4CIBA 5HX7A 1Y7LA 1QVVA 4F2WA 4GH5A 2YJ6A 4D7AA 4MUKA 1P74A 4KTVE 1JQ5A 1D2HA 1M1YE 2W6JD 1A8PA 2DU8A 2EFDB 4KB5A 1ZBQA 4F3TA 1UCFA 2QR2A 5EIEA 3AW9A 4RF5A 2O54A 2I2WA 1NBWB 1IHXA 4FSDA 1D2MA 1TM4E 1YZYA 1IJEA 2C92A 2QX6A 3CNBA 4LTNA 1XAIA 1L6RA 3CO5A 4IOMA 4ZO4A 5KMGA 2ZRHA 1LUAA 1P3JA 1B00A 3IQDB 1IXRC 5K4HA 1F2DA 3GPIA 1V8PA 3AYZB 3OEHD 4EEZA 4JU9A 3F0TA 4R7TA 1RWPA 2DR3A 2JIZD 3BJEA 4V1CB 1I3OA 3C15C 5EZ6B 4U7PB 3HNRA 3U44A 1C8VB 1SUPA 4YJ3A 1N6IA 1RYNA 2PZAA 2YJNA 4X1YA 4P3YA 1XF1A 1UIRA 1AD2A 4MUAA 4MZDA 2H3HA 2ST1A 2H52A 2ZYTX 3QPWA 4RF3A 4EG8A 3L40A 4YI3A 4ZGWA 4HH1A 3RYFB 3IQIX 3TVTA 4PFQA 1G2QA 4URUR 1SXQA 4EJFA 1QC5A 2CDBA 2W37A 4QU9A 4F1KA 3CX7A 1SA0B 1XZNA 2NAFA 3BXGA 2JKVA 3T5DA 3EZFA 1E96A 3WNZA 2P9CA 4ZOEA 3Q0EA 1CW2B 1N5LA 1C0LA 1E6LA 3EDQA 1D4OA 4K9MA 1S2OA 1RQLA 4WZBA 4ZHQA 4AN1A 4F1JA 4D96A 3JYOA 4D43A 4Z49A 5E9WA 5DYIA 4F2DA 4KAAA 2BUBA 1S2LA 3R2JA 5TC4A 3M3HA 3ENNA 1IXZA 3DS8A 4QBIA 4OSPA 1UEXC 3EDOA 3ZWCA 4EYQA 1YHZA 5IFLA 4GQAA 1KEEA 1J1ZA 2VPQA 4HMQA 4MW6A 3OWHA 4DNXA 2OQ2A 1K6IA 1HLPA 1OFIA 4MH0R 2IE8A 4OXQA 2YFYA 5FA5A 4DR4B 1GUBA 3RVMA 3A2KA 3GH3A 1W1UA 3C8DA 1JJIA 3QFRA 2PFSA 4GOLD 5GV7A 4GLJA 3MHPA 1HWYA 3K20A 4ZAYA 3WV5A 1KYWA 2GILA 3OAAA 5E6RA 4ARVA 1R9MA 1MG0A 4MJXA 6ADHA 1W0CA 3RYIB 2C3YA 4KNYA 3RC1A 4KREA 5JZBA 2WAXA 3UT5B 5JS6A 1SD5A 1F5SA 3ICCA 4HY3A 3SSNA 3TSOA 1KI8A 1XALA 5M5BA 1HYGA 3CLVA 2XA1A 5LOVA 1TLTA 3EXHA 5HR5A 1KZ4A 4BMYA 2AFVA 2QORA 2ODAA 1OGYA 3COSA 3W4KA 2B6HA 2HFKA 2Q1WA 4RTSA 2YXPX 4J7XA 3VKGA 2PLRA 2Y1LA 3CX3A 3PCTA 4Y7CA 3U37A 2VP2A 4MYDA 1N1EA 3EEBA 1I2DA 5BNIA 4Q4DA 3RIGA 1EHYA 1QG2A 2WF7A 4X3PA 2QRUA 3E61A 1LI7A 2Z1MA 4IXTA 1H5NA 2H5EA 2HJHA 3R5HA 4BO7A 3THYB 3HYTA 1N6RA 1LY1A 4P4NA 3W9YA 1G3IA 1G21E 3IOCA 4DXHA 1P4RA 4B6JA 4D57A 4DMLA 1D6MA 4MP8A 1RMTA 3ELWA 2YY5A 4C7OA 1UPXA 3DE4X 3ZK9A 4B2IA 4PXSA 5MFPA 1K06A 1KSHA 2H85A 3PG5A 2R1ZA 4RH3A 4NVRA 1KAHA 4JI5B 1C1XB 5CHYA 3CTPA 3UJCA 4PPFA 3VSDA 3ZCTA 3KLOA 4A26A 1JG2A 3SYMA 3JZIA 3D6JA 3OLWA 3TB4A 3E9QA 2OLKA 2PT7A 2ZRGA 1UC8A 1SHJA 5IAGA 2GH1A 2OCPA 1GNTA 1GNVA 2E21A 3K9HA 3WWPA 4CKEB 4DJ5X 2XUDA 1K7FB 2QK4A 1AY0A 1TTQB 2ZJBA 4KW7A 3ADBA 1I10A 4OOEA 5AKIA 2H18A 3ZVNA 1XRLA 1JMKC 1PUIA 4H7PA 3WLTA 5KWVA 1ZIXA 3LCUA 2E6UX 1WVMA 1R4MA 4YDRA 4RK0A 2V3WA 4W1RA 1E9BA 3GOHA 3LNTA 4B44A 1O5OA 1MAHA 4ZI5A 4FS8A 3RSZA 2LCQA 4R2KA 3DMNA 1WKBA 1KDYA 4ES6A 3MA0A 3AL3A 2NO1A 4BVFA 1YZLA 4EGJA 1GLGA 4YMVA 1E6KA 3PQDA 1ZJYA 1K7XB 2FLWA 2VJOA 1E77A 1OC4A 1UDAA 2ZQYA 3K4HA 3JARA 4O4LB 4CHTA 4E15A 1RRFA 1C1DA 3H84A 5HF5A 2D00A 1OREA 5AOCA 1LNSA 2KB0A 1XZMA 1FSGA 2L0XA 3VPGA 1ZN8A 3VU9A 3QU5A 4ZCIA 2H54A 1MLDA 3ON5A 3UHFA 2O8BB 2Q5HA 2XQGA 3W3ZB 4C0WA 1V11B 4OJKA 3NUGA 4YC7A 4MEAA 2YW9A 4LS3A 4MK4A 4YCBA 4Q9KA 3HSKA 4ZCPA 1IY9A 1YXMA 1E61A 1P0PA 4FIZA 4PYMA 1ESDA 1GL3A 5DYNA 4IDBA 3T52A 4JLNA 1PVOA 4EGSA 4J7AA 1NRWA 4D9HA 5CD1A 2C95A 3D7SA 4YQFA 1MOQA 4D0SA 3NBQA 4WL0A 4DNQA 3AUYA 1FP4A 1GL7A 1SPXA 4FNOA 3EXHB 3TTVA 4LUCA 3NYRA 4UMVA 4OKNA 4FMCB 4B81A 5EMLA 4G0VA 3UN1A 2D06A 3GO4A 3EPKA 4YPFA 3AF6A 3TS1A 2IHZA 3F3MA 1B8PA 3BRWA 3VTFA 4BMCA 3RREA 4DREA 1RPZA 1H6BA 4DEYA 4ZALA 1LWNA 4I9UA 5DM0A 2FYTA 2YZKA 1N9GB 3TOXA 4FNAA 1CZNA 2QS9A 3KU1A 3P8ZA 2D5CA 2NQ8A 5E6UA 1N0IA 3IALA 3ZU3A 1NA5A 2F9MA 2VK2A 3BXPA 4BBJA 4Z6KA 5IPFA 1SKYE 4E5DA 1EJ6A 2QVLA 3QIAA 4KXVA 1P9OA 4MKFA 5CJ2A 1CP2A 4B73A 5CITA 1TO2E 4UDNA 2PX4A 3AL2A 2GM3A 1L7BA 2YQ4A 4PAOA 3COPA 3VPDA 2EV9A 3GCXA 5TB5A 4LWQA 4AICA 4C2AA 3R3YA 4E5MA 3GMSA 1XCPA 1YMUA 3ZI0A 2WIAA 2NUTB 2PA0A 4C0LA 4EQ6A 1V8OA 3LUAA 2ARKA 4UREA 2FPGA 1ADYA 4ZEOA 4DR5B 5BPFA 1SA0A 3KELA 4RXMA 1SCJA 4CV1A 4EKNB 3TRJA 3O47A 3OFKA 4A2PA 3L82B 1LQTA 4DA9A 2JGMA 4RPLA 4MLCA 4DXAA 5FTLA 5EMNA 2YCBA 1I4DD 1MDFA 1TF7A 3JXEA 4TYYA 3B3QA 3PXEA 1ZU4A 2AF3C 1X74A 2Q50A 2NSDA 3IOBA 2B2CA 1H85A 2OR3A 4RPKA 1NU8A 4B46A 4DEVA 5JHHB 1PLLA 1LPPA 2XDYA 5C3MA 3AG5A 2NYAA 4JEHA 5JPCA 3EUEA 5CHEA 2ZUWA 1DAKA 2FW7A 4X95A 2PIDA 5H3HA 4CKCA 4U9UA 5CT4A 3I62A 1G7CA 3OE7D 1JHAA 2HZBA 7MDHA 5AKGA 3RJTA 2OV3A 2JHFA 3G2HA 1G3MA 4YNBA 1GARA 2JG3A 4E08A 4URVR 5BN5A 2WJ3A 1C3JA 5ENDA 1G63A 1DCTA 1TVCA 1OAAA 2EZTA 2AX4A 3P9IA 2Q6IA 1ESZA 2JEOA 1RIFA 4C5BA 4DCCA 4JUFA 5EPOA 1ZK3A 4Q7EA 2OAP1 3H5RA 2G76A 3C5EA 3AVTA 4WNYA 1FQKA 2BC9A 3MRTA 1RNLA 1XVLA 4ZVKA 3NYIA 2NPFA 4DIBA 5BQXA 4NU5A 3NP7A 2ZWMA 2VHCA 2C9MA 3GJRA 2QT0A 3GOQA 4HAXA 4HUQA 2WQ7A 3GVCA 4KXUA 4EM6A 1XZBA 4HOYA 5DHQA 1L5RA 4KXMA 4XVQA 1J8VA 3D0OA 1IMJA 1A77A 1WUTA 5EJ6A 4EKIA 2FFQA 5CA1B 3BHNA 2B4RO 2Q7XA 4ZWNA 4B8WA 1A9XB 2GR9A 1JS1X 2XXBA 1N8KA 1O3YA 5HF6A 3V3KA 3VNSA 4HTAA 4JJEA 4HEQA 1QQAA 1DDIA 4M89A 5IVKA 1DC4A 4KP7A 4FE3A 1U9CA 1G8MA 2G07A 3OF5A 1L2TA 2WPDA 4FEGA 3ADOA 2PUEA 3O38A 4O6VA 2BEWB 1MT3A 2W2NA 3DR3A 5FOQA 4NYIR 5GP1A 4DR6B 4LYAA 4F6CA 2PJDA 1MA3A 3TYXA 3V4ZA 4REQB 1O77A 4HDOB 1OZHA 5I4KA 4ZVOA 4OI0A 1YKFA 1R8SA 4Q48A 1XAGA 2D74A 3A2NA 3ZBPA 4L57A 5I6DA 3TCXB 4D81A 3V4LA 4MZXA 2BGNA 2FZ5A 4QPCA 1RACA 2ZFUA 4M9SA 2HBRA 4JI0B 2OXFA 1T5LA 3UJAA 3ND5A 3G82C 3EF0A 3F1LA 1SPBS 2P2CA 2CVPA 1L4NA 1XZGA 4RTKA 2R2GA 2X0NA 2XBLA 5JAMA 2WIGA 1DPFA 4KWEA 1FDVA 4JGGA 2FX3A 2R9VA 3EAQA 2YIMA 4JELA 4L9WA 1E7YA 1HF3A 5KVVA 1XLUA 2RD2A 1ZMOA 4HWSA 4QQFA 5CYPA 5I7EA 3IIJA 3JY6A 3NIGB 4FUTA 2IBSA 4H4CA 4Y6QA 2XVYA 3RTBA 1RJDA 2XWJI 4IX9A 1FTYA 2ZZKA 3ESRA 4JITA 2HSWA 2BEUB 3E5RA 2CSXA 2ZDQA 1SUWA 2EJBA 4NQRA 4NABA 5AHXA 3GELA 5GPBA 4YB8A 4TVKA 3A4MA 3TKLA 3U81A 1UJBA 1GM5A 3VNVA 4PLTA 4ZRNA 3K0CC 2JGLA 2WVGA 3B36A 5J40A 3ZHOA 3L5KA 4I3FA 1UBLS 1BJKA 3R7FA 5LPNA 1N32B 2Z57A 1A82A 4JK3A 3UWDA 1OCEA 1YA8A 3WDKA 1RS0A 3PB3A 1E59A 2IYTA 1O8BA 1E2HA 1PZFA 2C03A 4RK6A 3RS9A 1TKCA 2OCBA 1BOFA 2Y1OA 4K86A 4NI5A 2TSYB 3RS4A 2GBLC 5FBWB 5EP3A 1XD2B 4JJZA 4CEIA 3N86A 2AMLA 2CGEA 4FR5A 3P9ZA 2Q29A 4Q3AA 4BTEA 2QTMA 3WGQA 4EITA 4HQ6A 4KPGA 4JUDX 3MJ4A 4ZV9A 4AMVA 3Q8LA 1HY3A 3DXXA 3II6X 3NDJA 1HDEA 1J24A 2O7VA 3QE3A 4GXRA 4YECA 3OU7A 4CT0A 2D3TA 4QBGB 4EABA 1GZ4A 1CUDA 1U31A 1KJYA 1OY1A 2PBFA 1SCDA 1M2HA 1I2MA 2H9AA 1JRLA 2Q3MA 2WQZA 4H2DA 4J7CA 3IURA 4OA8A 2ORVA 4RMJA 5AJVB 3VKFA 2LP4Y 2GN1A 4GLBA 5JNLA 2JJ2A 3N7TA 1NXTA 5HG0A 3UENA 3ZY4A 3ZQJA 5C8VA 3WGIA 1C3OA 1P44A 1T0BA 4FXPA 3G6WA 4PXAA 3TW8A 4NBUA 4CCAA 2IY7A 1JE0A 4DCUA 1QIDA 4JJ7A 1NFRA 4GDFA 5DW0A 4JEIA 2OYCA 1Z6GA 2HT6A 3C1AA 1EGHA 4Z51A 1IRXA 3SEFA 4WH0A 2XZPA 3S2GA 4ISCA 3OTGA 5SV2A 4N76A 3RIYA 3VC1A 5HUJA 1UKVY 3A3PA 4Z86A 3CR7A 4XB2A 6LDHA 2OBXA 1NVVR 1LV7A 2GDJA 2YVKA 2FUG6 4RF4A 4J3NA 3U9LA 4IHAA 4MQFA 4P5DA 3IUNA 4XEUA 2GVNA 1MAAA 3JQGB 2EF1A 1XKTA 3V2GA 4AMGA 2PX0A 1BHSA 1YB5A 3M5WA 4TWZA 1T5TA 3DD5A 4R8MA 1XELA 4EJSA 2XMDA 1EQAA 4EL5A 3A06A 2BFPA 2B2NA 4KR7A 1SIUA 3VO9A 2WSMA 4WESA 4REOA 1W581 3NS7A 1DKUA 2CN1A 2I8LA 2VJMB 3K5IA 2ZJ6A 3R5TA 4MKZA 4Y1RA 1M7BA 4GI3A 4BLVA 2EJUA 3JWGA 4QDOA 4Y2XA 4OH7A 4K7JA 1D2CA 4S35A 4B4WA 4MLZA 4UTPA 3EOBI 4K6OA 2HJGA 1UJMA 3FGOA 3V5NA 1P5FA 3QX9A 4A0GA 2GERA 4D4KA 1EVLA 1W7AA 1KZ9A 2DX7A 4FB4A 1ODKA 2B1IA 2NADA 4KVGA 3ER8A 4YIHA 1FVFA 1JKJB 3GUZA 1KMHB 2WWGA 4L07A 4TLMB 2X6QA 2AQ8A 3CEJA 1U1GA 1IEXA 1YJQA 4QE3A 1IVSA 1M34A 3W90A 3PD1A 1XA4A 3A6FA 5F76A 3NATA 3EB9A 3ED1A 3NALA 1L4UA 3B9PA 2J0VA 4R9NA 1XEXB 1CU1A 4OF4A 1FY2A 1E5DA 2W6MA 3BG5A 3DLAA 2DFNA 4OATA 4F60A 4LECA 3EIWA 2VJKA 3IJRA 3U5TA 4DR2B 4G5QA 3JYNA 1DRKA 3PDJA 3ZDYB 5EQFA 5ADUS 2H29A 2ZSAA 2J9FB 1G59A 4AQ7A 3DOHA 1Z4IA 2ADFA 3BIXA 1U2EA 1NFQA 4JXZA 4D6PA 2BSAA 4EVIA 1CR4A 1DKMA 1X86B 1OILA 3FFTA 4QULA 3ZWYA 1XQ9A 1L7OA 1T1EA 3NNSA 3SD7A 2X0RA 3TG8A 3KQUA 5IM4F 5IJAA 3I2FA 5F52A 2Y1XA 3IVMA 3HXKA 1I30A 1ZD2P 4ZOBA 3S68A 3HM9A 1QPZA 1V1JA 2C20A 3NBZC 5FT9A 4CL8A 5BORA 4O3FA 3M4YA 4HEA6 3ZXYA 2O6LA 5IT0A 4CLEA 4DV2B 2BH2A 1XVAA 3NNDA 3KTAA 3LY9A 3KFXA 2O9JA 4N9QA 1HQCA 1NT4A 3H9BA 5EKXA 3DVSX 4LRXA 5IM5A 3DOJA 4EGQA 2MSLA 3A10A 1HQKA 1PRYA 2O3TA 3KJXA 3IPRA 4WAUA 1MVNA 1JYSA 1GGNA 1RXCA 2EGUA 1V39A 4AMBA 5H02A 5CCXA 2EG9A 3K96A 3OM1A 2JAOA 3IUQA 1KNXA 4AD8A 2D1FA 4DKXA 2Y0EA 4HLQB 4LJ8A 3ORSA 1JLMA 5ALOA 1VL1A 2EATA 4I46A 5HIIA 2XYHA 3Q9UA 4CM8A 4TL9A 2H59A 2AHOA 1EG7A 3AUSA 2IYRA 2JLAA 4P3KA 1PGOA 1T2UA 2RAFA 4JLAA 4O4JF 2OBMA 2QTAA 1RR6A 4YLGA 5CW2A 4URXR 3CURA 2IK8A 4GBJA 4JJ6A 1QDEA 3BQMB 1RVDA 1SZJG 3M9LA 3TIFA 1SVLA 1LA2A 1CJKC 4V3CA 3SGLA 3OD5A 2R3SA 3BEOA 3PI7A 4CGYA 2YH2A 1USGA 3QSGA 2I2BA 3SJZA 3HBMA 2G83A 4L8GA 2QLBA 3R5FA 4L51A 5J3JA 3ZGZA 4BCCA 5C53B 4RD4A 1GUDA 3USCS 4JBYA 3RRFA 1GGEA 1SIWA 2P40A 3RKSA 3H9EO 1GRNA 2G1PA 2PZFA 4LGCA 2P2YA 4EPTA 1X1RA 3PC6A 3QH4A 2CNKA 5EYPA 1LVGA 4KQKA 4KVZA 1A2KC 4JBGA 1Z06A 1OKKA 1CJMA 1UZNA 3AJ8A 5A9SA 4AIIA 2FZEA 2P67A 3O6VA 1JIQA 1JDVA 2LBPA 2PRKA 3BPSA 1EFPB 2FJPA 4XX1A 1HNZB 1GGJA 3PYMA 5I7SA 1GSHA 5LLTA 4FOTA 5SICE 2XXJA 2F67A 4G0XA 5FNVB 4YV0A 1JAZA 3K8OE 4F3CA 2L19A 3I39X 5E6SB 3WQBA 4M49A 5CPFA 1Y81A 3JQCA 4R2IA 3W3AD 4WK0B 5C1PA 4PNZA 3U3RA 1QE5A 1IK4A 1ZK0A 1WBDA 4BX0A 1L3BA 1LI4A 1HR0B 3B6EA 1LJLA 2EYUA 1KR2A 5FYDA 1NC3A 1OPRA 3B9BA 3W9BA 1CR0A 3CCBA 1E5VA 1H3NA 3NTOA 1II9A 4TRJA 1SQ0A 4G0NA 3UM9A 1YJAA 1MRNA 2BHSA 3D4IA 3H9GA 5CFNA 3B6MA 3HCCA 3TXXA 5A6VA 2J59A 1DEAA 2BMDA 4QAJA 2QTNA 4XDYA 1JT2A 3OUZA 3NOOA 1PG2A 1FS4A 5DLPA 3D54D 5JLJA 1XVVA 3U61B 1T1GA 5F51A 1XV5A 1E1DA 5BR1A 2BLLA 1I6KA 1XDDA 2BISA 4E5UA 4Z4EA 3FRJA 2GT1A 2VK4A 1FFCA 4UAVA 1WZEA 2OV8A 3TF5A 2ZLBA 1Q21A 3ES9A 3MAGA 3T7KA 2BHRA 3AR4A 1ODFA 2AE1A 4REMA 4ZKDA 4MMZB 4AKHA 1IN6A 1H8ED 2C98A 4LPSA 2D7CA 4X8HA 2BFFB 2F17A 5BNFA 3U7EB 4AN4A 2AOUA 1ZOPA 4LXQA 1GL9B 4S04A 1O6FA 3OZUA 5BRNA 4TS4A 2R6CA 3P5BA 4LIPD 1PJRA 4X00A 1ZCBA 5BN4B 1XZIA 5CDUA 5K3DA 1H6AA 1UOQA 4IFIA 3N6RA 1HL3A 4F71A 3CH7A 2ZVQX 3KXKA 4L5YA 3THWB 1KIFA 1R6XA 4QTXA 1PJ4A 2BTQA 2I2XB 4P83A 3C6QA 3OJ0A 4QTYA 1NLYA 1ZD4A 1CY2A 2UYQA 5ARDA 3PEUA 4YAKA 2VQEB 1R5JA 1ISSA 3PWTA 4LJKA 4D9NA 2YYZA 5KSWB 3JD4A 3MBOA 4I1RA 3OX4A 2BGRA 2HHHB 2GHTA 1YQQA 4R9SA 4EENA 3HFRA 2IYNA 5IDWA 4TZ6A 4JB8A 4H7IA 1B8OA 3EDYA 5KDDA 3CJTA 1KQOA 1OT5A 4AN0A 1IOZA 3COZA 2IH5A 1ZWKA 4NJEB 5IXYA 1U80A 2QVBA 2REXB 5F77A 1NKTA 3GLVA 4DLVA 1Z37A 1XYGA 3WQSB 1SULA 2BKEA 2C77A 2WHYA 3BE6A 3RVNA 1CUVA 5JXJA 1EB8A 2AG6A 2OO5A 5B2EA 3RYCA 2PNJA 3U62A 5AVRA 2FR8C 5AW7A 4DPLA 2YIJA 2FP3A 3KQHA 2HEIA 3V1MA 1ZY2A 2CMFA 5FBVB 2A1IA 4K2AA 1XYYA 1HSOA 2FMHA 1SBIA 2C57A 3OG9A 2I6FA 4K81B 4XQ9A 2EJTA 2PVCA 3DEHA 4FD3A 2OGZA 2O0HA 1TA0A 4R05A 3FTQA 1KEEB 2HD4A 4UBOA 4DLBA 3IBTA 4P2GA 4WKGA 2ZRDA 3ORFA 2XY4A 4FZ3A 1NX6A 3UQYS 1OD6A 2L42A 4WZAB 1QP7A 3K9GA 3N2KB 3QOWA 2DWQA 4GO1A 4U02A 4B6PA 4LMBA 4ZP1A 2IDZA 1QZUA 2J3JA 2OK7A 1M6NA 2IIPA 4TLAA 2WIJA 3UNXA 4GM0A 2DJ5A 4KR3A 1WZCA 1R5OA 2NU9B 1Q6YA 4N7MA 3A6PC 4DABA 3VO2A 1Q3HA 3FLMA 1B4DA 2HA2A 1FTQA 1U99A 2IC5A 2O2ZA 4QG7A 4OB8A 3GXBA 4TWAA 5JSUA 1YB7A 4LISA 1SUAA 4YRRA 2RHTA 1NQWA 4DLAA 5KTYA 3C7AA 1E6CA 2NU9A 4KC0A 2C5HA 3G0CA 4X84A 2P9YA 2FI1A 3OTHA 1GNQA 3TW8B 2JFXA 5EJ5A 5H59A 1J20A 4GI7A 3V8VA 2AW3A 2R7AA 4D0NA 5EIBC 4KQXA 5CG1A 2AJTA 4IJVA 3R40A 1T3LA 3W4JA 4JI1B 1BRMA 4ZJYA 4QEKA 4UHDA 4ZMSA 3NYQA 2FV8A 2A9FA 2FN4A 1EU1A 1GZDA 1WTCA 3HGQA 3ICPA 1JDTA 2W58A 2GZDA 1NRXA 2PYZA 1YIOA 4JH0A 3RUEA 3LKBA 1CJSA 1CNMA 1GFSA 1IAQA 1NWHA 3H5WA 5IJXA 1DTSA 1N75A 2WIDA 4LF8B 2OC9A 3G0GA 4X93A 5D84A 5F35A 3E3OA 3AEZA 2HPZA 3K0HA 1N2CE 1TF5A 5ERYA 4CM8B 2RMKA 3NVDA 3V9AA 1DELA 2YZ7A 2QLFA 4KDFA 4FCTA 2UUOA 3L8EA 4Y6PA 5EIOA 4FILA 3N6XA 3A9TA 2RG1A 2VDPB 3TPZA 4RHUA 3UW3A 4QXPA 3PFGA 2C3UA 3ZLJA 2QUIA 5EEHA 2C58A 5A9RA 1JG7A 3IRUA 2IUSA 3FPKA 4R2XA 5D3MB 3TNFA 3LXUX 3PDIA 3ASZA 4WKOA 1M8KA 3DBVO 4QGBA 4JYMA 4INOA 4O0LA 4JASB 3RLFA 4IJWA 4LZOA 4NEGA 4UU0A 1L4BA 3AEKA 3HS3A 3MOGA 1RE0A 3GNLA 3NT5A 4EEKA 5BY2A 5EINA 1NZJA 4YO8A 2TRSB 1JLHA 1PR2A 2EARA 4MVJE 4KZPA 3A4NA 2X23A 4O4LF 3RRMA 3TE7A 4IQ0A 1QYIA 3EDCA 4INJA 5K0SA 5KTTA 2ZJ0A 3ZLUA 3BMOB 3I5XA 1Z7GA 4HXFB 1UUFA 4U1RA 4CN8A 2VAWA 3SKVA 1SVOA 4E12A 1XDUA 3OZWA 7GPBA 1TYAE 1F2UA 3KUXA 2X8AA 1Y7TA 2NYVA 3O8QB 3SYRA 1PW5A 5JO9A 1DUSA 1CZRA 3REQB 3I9MA 1ZVMA 3LCRA 3FWNA 3HFGA 4XE5A 3JWHA 2IZZA 2EKLA 3E5MA 4URWR 3I2YX 3EN0A 3VX4A 5TPZA 2FSPA 2HN9A 2XA9A 2ICAA 2ZVPX 1T8YA 4D3XA 3O90A 4B45A 5ALEA 1VJRA 1A1VA 5H0IA 3JQ7B 4RV9A 4X44A 3ZDFA 1JKMA 1SQSA 3PWSA 2C2KA 3CTMA 3NHZA 1JHRA 1KMCA 3LVQE 3MN1A 4JN6B 1UZUA 4XIJA 2X19A 4R71A 2WIFA 2BGUA 4XDGA 1GSIA 4YMIA 4MDHA 1Z2OX 2R6FA 3QXGA 4RU1A 2VAXA 1CD5A 3DFIA 5IT9A 3GGJA 1ODIA 2UAGA 4MP3A 1BIFA 1HT1E 2FWAA 5B3AA 1JJ7A 1AUPA 4PRZA 4DDWA 1QIIA 5HNKA 2AUMA 4EF5A 1CJTC 5E4YA 2VPIA 4A6PA 1IUPA 3OMLA 5B1EA 1D4FA 5E6SA 4QKQA 2O2EA 3ROMA 3WLSA 1RYEA 5C37A 4P38A 4N03A 3EWSA 4G5YA 2W9XA 4WUVA 3P2OA 4HQLA 4KI0A 2UZ3A 5CAEB 1FLAA 2PQ6A 5EP2A 1EPUA 3HKCB 4PO1A 1IEWA 3I0ZA 2EVWX 4WE3A 1EWYA 2J5BA 2GN0A 3MINB 2IKQA 4AZVA 2PXAA 2HK7A 4CU2A 5HJ2A 3FHTA 1O6BA 1YDHA 1IHUA 3EFOA 4CJXA 2QENA 3Q3GE 2NQ2C 1XUOA 3HCWA 3RUAA 5MHTA 1T1RA 4QNMA 2J3IA 2W6PA 1FVHA 2QD5A 3MS4A 3NO4A 5CNMA 3DE7X 3T0IA 1XL1A 1DJMA 3QKSA 4OX9B 4DAEA 2UXCB 3S28A 1XZEA 2IEGA 2YUIA 3U4CA 5J9FA 3ZDAA 4XM0A 5FV7A 8ABPA 5IC5A 2DQSA 4XGRA 1VYHA 1ZN9A 2O8EA 2N3ZA 2VPYA 1ACLA 2PL9A 4OAPA 4ARZB 3WYEA 2P2ZA 4F04A 2H4HA 4FNMA 2I65A 3Q41A 3IVCA 3QVGA 1F4VA 4E1VA 2ZRPA 5BMOA 4F4CA 2YXLA 4XSGA 3H5TA 3TW6A 2GZAA 4BP9A 5IX8A 3QJYA 1ZNXA 2CKMA 2G72A 4DV0B 3RVSA 2YOFA 3KKMA 2AFHE 4PZYA 4ZANA 1FXUA 1ZXXA 2NUTA 1MC1A 4DJTA 5F4ZA 3IVGA 3U40A 1MHTA 4C4ZA 4YRZA 1KFBB 1SKAA 3ADPA 1Z0SA 1J9EA 3MGCA 1AZLA 2XD4A 1Z5OA 1U0RA 4FDVA 1ZN7A 3OSZA 3B78A 4KBYA 1SC6A 5AOVA 3G88A 1UC9A 4ARSA 1CRWG 4KDCA 2PU5A 3V4OA 1RT9A 3T9AA 3U4GA 5AVWA 4Q9AA 4KBGA 1HZJA 1TT7A 1SU7A 2GBPA 4NBNA 1S2GA 3LF1A 4H1TA 4IG9A 4E6PA 1GTVA 2OBFA 1P91A 2ZOSA 1SY7A 3A1DA 4P93A 3U3XA 3UMMA 1ZC3A 5JBQA 2ZJ2A 3OLQA 2JHGA 1AT1A 2IFTA 2WTBA 1CERA 3BZUA 4RETA 1M2VB 3A3NA 4YRLA 4RVUA 4LKOA 4DRYA 4MR7B 1EUQA 1IY0A 3LUDA 3UT0A 3GPCA 1RM5A 4N12A 1H4SA 4UM7A 1CBUA 1FFAA 5EE0A 1TNDA 1RVV1 2F6RA 1Z5GA 2R8BA 3QKRB 3P97A 4LQ4A 3F5QA 1IN5A 4RUKA 1TECE 3N2YA 5I7VA 1EUYA 4B3RB 9MHTA 4CI0B 2UDPA 3WB0A 3HB9A 4MWSA 3ADKA 3KYCB 2FDRA 4E88A 3AWDA 4UVHA 3OOSA 1M34B 2VYND 2VZEA 4H16A 2CFSA 2PRSA 1VGQA 1VA5A 1CRQA 2HM7A 4F72A 4CEHB 3G2NA 3SNHA 4BRSA 4AK9A 1Z63A 1C80A 2O3SA 2KHZA 5J59A 5SYMA 1G19A 2IW1A 4E2WA 1YR1A 2I3BA 5U4QA 2FGJA 2ASEA 2E4UA 4L5JA 1NXOA 4M0MA 1AHHA 1HRDA 3FFBA 4GPEA 4JJKA 4KQMA 3PFWO 5E1OA 5FI5A 3U3ZA 3WWDA 4GL2A 5BV0A 4IWXA 3FF1A 1DIAA 4I9GA 3KLPX 3LECA 4PO3X 1EUZA 3D4NA 3HI4A 3ZKWA 1R6UA 3GXOA 1GYPA 3KNZA 1DNPA 2NO7A 2QYTA 4KXQA 1BHQ1 3U1VA 3P4XA 3AETA 3JRWA 2X5XA 4CCSA 3BK2A 4OXXA 1A5ZA 5DT9A 3WA6A 4Z4HA 1I5RA 5REQA 4JBLA 1WM1A 2BM0A 5H68A 1MC8A 5JYBA 4PZZA 2JATA 3TOSA 4WZBB 5B1HA 4O2AA 4D4GA 4ZHQB 1CB7A 2PTGA 1XK6A 3AFIA 1FX0B 5JARA 2F55A 3C4VA 2AZ4A 2CL5A 5FUBA 1LV8A 2Y4NA 1JDBC 4IV8A 5A3SA 4BB9A 2RGDA 1ZK2A 4DA8A 4YMUA 3FPHA 1NC1A 1HDZA 2E37A 3EIXA 1E18A 4MIKA 1R0KA 3A2LA 1WCWA 2VOJA 4J1QA 3H0KA 4JKOA 3RF6A 3O9VA 3U9SA 3SLKA 4NQZA 1FYWA 5B4TA 2J5KA 2RGXA 3IOEA 3S8MA 1UJCA 3UYKA 5CU7A 3ELBA 1QGUA 1M66A 2XNJA 5A3VA 4CTOA 3CZCA 1VZ2A 3U4AA 5JVDF 2V6MA 2RH5A 2O59A 3IAAA 4HLCA 4B71A 1NNLA 1S2MA 3E9ZA 2JVKA 1FMTA 2GN8A 2AOXA 1L7NA 1T3TA 1P0IA 3I0NA 5C31A 4IILA 1KBOA 4C4YA 4BFZA 2HRZA 2XWPA 3ITNA 1DRJA 2REQB 2BOVA 3D4OA 1N78A 3OU2A 2ANBA 3AFOA 2QTVA 3NXKA 4N0PA 1EKXA 3ECCA 5JHGB 3RUIA 2XZDA 2F3PA 5ALJA 4ZYUA 1N4DA 3VKVA 3QU7A 3GEIA 1BE8A 4AB1A 3S2EA 1W2GA 1E5TA 4ENSA 1W36D 3RGWS 1B2LA 1VB5A 2DT8A 2YJZA 4BQPA 5C8YB 2HRCA 5NULA 1A9SA 3YASA 4ZYTA 4AT1A 4U7HA 2Q7DA 4OQEA 3EVTA 5BURA 4CE6A 1KI6B 1YJBA 2N46A 1JSZA 1OLUA 3TFWA 2NN3C 4X6XA 4A8JA 1W5AA 3CX4A 2CL6X 1GCOA 2AHRA 5LQCA 1TUEA 2WJZB 1GA6A 2WHXA 5DTMA 1V45E 5DX8A 1VIDA 3KEOA 3LPMA 3RSGA 1QF9A 1IIBA 5B2ZA 1Z38A 4D5GA 3FYCA 1Y9ZA 3PTZA 4JSRA 1MC5A 2YIDA 5LC1A 3DNFA 3Q2KA 1PZXA 3BUSA 3VO8A 2FRXA 1IUOA 2YN4A 1PJLA 2C00A 4GPAA 3EQ7A 3QFHA 2FUNB 1OHHA 3WIEA 3FNGA 3ZZTA 4GGOA 4RZSA 1W6RA 4EB0A 3AY0A 3K8ZA 1E89A 1TPZA 4F96A 1NTOA 3MERA 4D97A 3AM3A 1G3UA 3EGXA 3OPMA 1GR0A 5FWYB 4R7GA 1XDZA 3IKTA 2PQ2A 1NE2A 1I4LD 3QEMB 3C3XA 3LWZA 4WOKA 4KACA 2CKDA 5F2KA 5CGZA 1VL0A 1FXSA 1MQ9A 1YBHA 4BVGA 3ZJ5A 1GTMA 4XDHA 5B4VA 3C48A 4N3GA 3WGVA 2PEZA 2HWKA 2RGNC 1MAVA 4JI4B 3RCBA 2D59A 4M1EA 1H2EA 3VC3A 1ECCA 3DMGA 3ABZA 2I34A 1R7RA 3RFTA 3O8RA 2YWHA 3EARA 3NMUF 1V3QE 2QTVB 2QT1A 2WE8A 3MCVA 1UFQA 2FQQA 1L8QA 4OBXA 2HX1A 3VZPA 4M8KA 3WRYC 5EXEA 5BW5A 3ZDCA 1T8SA 4ARIA 3H0EA 2BFCB 4MV4A 3KQNA 1W46A 3K9BA 3ZE0B 1QKIA