4KEAA

Crystal structure of d196n mutant of monoglyceride lipase from bacillus sp. h257 in space group p212121
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
248
structure length
248
Chain Sequence
SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 94
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4keaA00
3HSSA 4DLNA 3STWA 2LIPA 2HA4A 3WWCA 1QO9A 4X94A 2CZQA 1MX1A 3F8SA 1R50A 2HA5A 3GUUA 4TPKA 5SYNA 4UHHA 5LZ2A 3WA7A 5AKJA 3R40A 5EIHA 5HQ3A 2OPHA 3MUNA 3BJRA 4W63A 2ACKA 4KEAA 3ZLUA 1QZ3A 3OTQA 1DWPA 2PX6A 5ALFA 3VDXA 1CIJA 4FDMA 2WIDA 1VJ5A 4G9EA 2IITA 3CXUA 5AM3A 1JMKC 3L1IA 4B9AA 3JW8A 4FKBA 1XQYA 3WQHA 1U2EA 2RIPA 3KXPA 1TCBA 1ZGBA 3AIMA 2P8SA 4CFSA 4E11A 3I2IA 5AKHA 1BS9A 4HXGA 2JGMA 1UZAA 3QBJA 3FNBA 3RK4A 1E66A 4X00A 2WUGA 4B80A 1XRPA 3A2MA 4CG3A 2CB9A 4KAFA 4GDMA 2HA3A 4F0JA 3S2ZA 2XUGA 3RM3A 3K9BA 2BAGA 1IUOA 1Q0ZA 5AKIA 5A6VA 2XUIA 1DT5A 4JYMA 1N5MA 4E14A 3SK0A 1W4LA 4H77A 3HI4A 1JU4A 2QXTA 2I03A 1LPAB 2J4FA 3G8YA 3I6MA 2HA6A 2XUAA 5LLSA 4BCDA 2QUBA 1AC5A 4Y7DA 2ONCA 1VE6A 2PL5A 2WTMA 2ZVDA 3R3WA 4L0CA 3TGLA 1J2EA 2V97A 3D2BA 4Y2PA 2HRQA 4C87A 3SWWA 4C89A 2DHDA 4BC1A 3GZJA 1K6EA 4KRYA 5FRDA 3H19A 3H0CA 3IUQA 1WB6A 5CT4A 5AOAA 1DWQA 4AX4A 3EQ7A 2DSNA 1GKLA 3E3AA 4CG1A 3ED1A 2DFPA 2XMZA 1XFDA 3C5WP 3KWJA 1YA4A 2ZJFA 4M0MA 2VAVA 4QWMA 1UK6A 2VATA 5AKZA 1P0MA 4BAGA 4X7BA 2QUAA 1YB7A 5AKKA 3V1MA 3QMMA 1MTZA 5E4YA 1CUXA 4MQMA 1HBJA 4YK7A 4CIAA 1S8OA 2WFLB 5CRIA 2WHPA 2R8BA 5E4JA 5LYYA 3ICWA 4U2GA 2OCKA 5C8ZA 1QFMA 3G9UA 3FSGD 5F4ZA 4BZWA 1SOMA 2BGRA 5JYCA 2X76A 1XLUA 4FBMA 1MX9A 1XZDA 4F5ZA 5ALSA 4U2DA 4HTAA 3WL8A 3I6ZA 1A8UA 5AM0A 2HA7A 1R1DA 1ZI8A 4U2EA 2XE4A 4FHZA 1CUHA 2RHTA 3C6XA 5JATA 4X97A 4QWWA 1K5PA 1TAHA 1TIBA 3LP5A 4JH0A 1C7JA 3KDAA 5A71A 1FFCA 1XZJA 5DTIA 1K8QA 4K6KA 2XUJA 3ESDA 3V1NA 3ZLTA 5EI5A 4H18A 4G8DA 3DOHA 4ZV9A 1EVEA 5CH8A 3BF7A 4LXGA 4AN1A 1YR2A 1DQYA 1HPLA 1PFQA 4WFIA 5ALUA 4J7AA 1QIDA 1F8UA 3I6YA 3C6YA 1TK3A 3PICA 3O9VA 3DD5A 1TQHA 2XMGA 3W06A 3L1HA 5A7GA 1GQSA 1ZI9A 1BN6A 1CVLA 4X6XA 2CKMA 3BIWA 1QJ4A 4KE6A 3R3XA 1EVQA 2G63A 3G9ZA 3C6BA 3HEAA 2C58A 3H2KA 3WI7A 3D2AA 1CUGA 5SYMA 1BROA 2I78A 2ZYHA 1D07A 4BDSA 2XQIA 4B85A 4M0FA 2VSQA 3WWPA 2FJPA 2JGIA 5AI0A 1QIFA 1XZCA 4RNCA 1XZFA 1ORVA 3G0DA 5AM2A 5D3ZA 3W05A 3TRDA 1SC9A 4DNPA 2BUCA 2PSEA 1WOMA 3I2FA 3EBLA 3R3UA 2H7XA 2C4HA 4EBBA 2H7CA 4K5QA 4J0IA 5A7FA 2ZJ7A 3IBTA 3IUMA 1QONA 4FTWA 4OU4A 4TGLA 5D7BA 1TKRA 1BU8A 1UWCA 3KSRA 4I4CA 3W04A 3HRHA 3UUEA 3ZLVA 3HZOA 1MJ5A 4EB0A 3I1YA 4LYDA 3UMJA 5C8XA 2W6CX 2D5LA 1XZLA 3AUKA 1C4XA 3CCCA 1RYYA 1QTRA 2ES4A 4Y2QA 2X5XA 3D0KA 4QDTA 5CH3A 3HABA 3FYTA 2HL6A 4QLOA 3V1LA 5EIEA 3EQ9A 2VJBA 2XMRA 3IIIA 2FX5A 1XRQA 4MEAA 4KACA 1JT2A 2JBWA 5EHQA 4PW0A 2B61A 4MWTA 2HM7A 3I2KA 3WL7A 2RI6A 4G5XA 5EIAA 1LBTA 4UBOA 1CRLA 3D59A 3VVLA 2VTVA 4UHFA 3EF3A 3H18A 2HDWA 4IH4A 1BEZA 5LIPA 2OLEA 3KOOA 2VA9A 2EEPA 5HK8A 4B7ZA 1XZKA 5AKEA 1UT6A 5JADA 1XRMA 4P93A 1T2NA 1JMYA 1QLWA 2C0PA 4UFNA 3TEJA 2HA2A 4HZGA 2D0DA 1CV2A 2OQIA 2ACEA 1LNSA 1AQLA 5ALEA 3V9AA 5CT8A 2PUHA 3IULA 5DLPA 4B9EA 1SFRA 2VAXA 1TCAA 3QMVA 3QPDA 4G8BA 4AMYA 2WU4A 3H2JA 3BE8A 2XI4A 2XUPA 5ALZA 1YB6A 5EHZA 4OU5A 3E0XA 4M0EA 4I3FA 2DHCA 1L7AA 2GYUA 3WMRA 4U2BA 4Q3LA 3R3YA 1L7RA 3AZQA 4H0CA 1CUYA 1QO7A 4INZA 4W1SA 2XB6A 2Y6UA 4ZGBA 4Y9SA 3G7NA 1OILA 1A7UA 3STUA 3D4LA 2CUTA 3F96A 3O9MA 2PBLA 2ZYRA 3DL4A 5HF6A 3N0TA 4X85A 3DQZA 4Q82A 1LBSA 1UK9A 2PU5A 4WY8A 1ZOIA 1MO2A 1ODTC 3PFCA 3O4GA 4B0PA 2G5PA 5AO9A 3G0IA 2W22A 2J3QA 2DR0A 4DNQA 1IUPA 5LZ8A 1IMJA 2OAGA 4GEGA 4P9NA 2BFNA 5AIAA 1VLQA 4ZRDA 4ZREA 1U8EA 5LZ7A 2B9VA 1VA4A 1X2EA 1UKCA 4J03A 2E3JA 2HADA 3O95A 3W2TA 3S8YA 1DX4A 3VJLA 4BAUA 5DNWA 4EY4A 1DINA 1W75A 1AGYA 2JGKA 1PJAA 3R0VA 4UHEA 4GW3A 2OGSA 2AJCA 4NVRA 2BUBA 2VJCA 1BEEA 4UBLA 3FCXA 3BF8A 3X3HA 2XMSA 4B83A 5FUMA 4RE6A 3W9UA 1MT3A 2HFKA 4OB6A 1XLVA 3D3NA 5KBYA 4BTLA 1QFSA 5A62A 3OPMA 2QS9A 3HLKA 4AZ3A 4L3WA 4G4GA 1ACLA 4LHEA 5K5EA 5BV7A 1QOZA 4Y2VA 4HXEB 1CR6A 4AO7A 3WKEA 1XZIA 1LGYA 1WB5A 3CN9A 4MXDA 1XQVA 3HXKA 2ZYIA 5AI6A 2WFLA 4NS4A 4UBNA 4ARAA 1Z68A 3A2NA 4RE5A 3IB3A 4U2FA 3OC0A 3IURA 3BDVA 4IH9A 3HACA 3FYUB 3LIIA 3VKFA 2XDWA 1BCSA 2WIKA 4BZZA 3ZI7A 4FFVA 5EHXA 1CQZA 2WUFA 1EA5A 2OGZA 1JFRA 4HRYA 1XRNA 5LZ5A 3MVEA 2Z5GA 4J0GA 3DDUA 3OM8A 4GLBA 3OURA 1GPLA 5LKAA 1LPOA 5HF8A 3D7RA 4JYPA 3OOSA 5JD4A 4O08A 2AJLI 4UPDA 3FVRA 4N5IX 1NX9A 4KE7A 3TJMA 1LLFA 5JZ9A 3PDCA 2XLCA 3C87A 4BCBA 4J0HA 1JJIA 4TVKA 5IVKA 4Q1VA 2Y6VA 4DTCA 5AKLA 3BWXA 5JAHA 2OQVA 3AFIA 2WHRA 3I2HA 1EXWA 4X91A 4X95A 2GZSA 3F9CA 1B6GA 3EQ8A 4DNFA 1XZGA 5H3HA 5YASA 3EIOA 3U1TA 1MAHA 4GECA 3PUIA 4BVLA 1UK7A 4ROTA 5K3FA 2HU5A 2RAUA 2WTNA 2DQZA 2Q0XA 3NUZA 1W76A 1R88A 1F6WA 1U65A 2IIVA 3F98A 5CBKA 3WK4A 2QRUA 1UKBA 4BE9A 3E4DA 5AP9A 5DNUA 2WG1A 4Y2RA 3FOBA 2O7VA 1E8NA 2DHEA 5AOCA 3ESAA 2WG2A 1BE0A 5D3KA 4C4XA 2GBCA 1FSSA 1ZGCA 2WILA 5I7UA 1KEZA 2VT7A 3LLCA 3H17A 4BBZA 5HKAA 3FBWA 2WJ3A 3BIXA 1HDEA 1XZHA 5AJHA 5ALKA 1KU6A 4QZVA 2WHQA 2PKYX 1CUAA 3D5EA 1O6GA 4DMFA 4H7IA 5HFNA 3T4UA 4ETWA 1Q83A 4MYDA 2GBFA 1EHYA 1R9MA 3JWEA 3IUJA 5ALLA 2NW6A 1F0NA 4J0CA 4FNMA 1XZAA 3A70A 3FSGA 4BB0A 5HKBA 1QIHA 5ALMA 1VXOA 2JEYA 5CURA 1LPMA 3QH4A 3HJUA 4BC0A 4WDQA 1FFAA 5ALRA 4B82A 3BL8A 3H1BA 4KR0A 3DEAA 3R3ZA 1OCEA 1QE3A 3ICVA 3QVMA 1EI9A 5K3AA 3DJYA 4X71A 3T52A 4PSUA 4G9GA 2BJHA 5AI9A 1VXRA 1I6WA 4P92A 2Z3ZA 4BVKA 5DWDA 1YASA 1VZ3A 4JNCA 3LIPA 4UBKA 1A8SA 1Q84A 1CUEA 2XMBA 5AM1A 1HQDA 1JU3A 4OSEA 2FJ0A 1DQZA 2PSFA 1AZWA 2XQFA 4KAAA 2YXPX 4CIBA 1IZ8A 4N8EA 5DJ5A 5KREA 5CTAA 3ILSA 4HVTA 2C7BA 3QYJA 1ZJ4A 1L7QA 2G5TA 4C4YA 1ZI6A 1ZD3A 2XQKA 5JASA 1O6FA 2QM0A 1G5FA 1E5TA 1DT3A 1ZIYA 4KJXA 3FAKA 4OD0A 4QDXA 4C6HA 1PV1A 3WJ1A 4UUQA 2ZYSA 3BDIA 3G9TA 1LZKA 2UZ0A 4J0KA 1MN6A 3DCNA 2WJ6A 2I3DA 5AK5A 4EY6A 4PNZA 4FLMA 3A2LA 3O4HA 3JYHA 1XKTA 3WYNA 3DNMA 4H7HA 1NU6A 1SCIA 5LZ4A 2OG1A 1GT6A 7YASA 3WK6A 1ODCA 5ALYA 4Y2SA 2AJDA 3CCBA 1QIJA 4CCYA 5FXMA 2HU8A 2WU3A 4G1FA 1QIMA 4FBLA 2O2GA 1EDBA 4BYMA 4QEKA 1BRTA 4C4ZA 2B20A 2HFJA 2PUJA 4A23A 3M3DA 2Y2UA 2EDAA 4UHBA 3N2ZB 1GGVA 2XMDA 3DKKA 3FWHA 4DNOA 3SC2A 3STXA 5CW2A 2VT6A 1GQRA 4G4JA 2QMQA 2WIJA 3WWOA 1AMNA 1W6RA 4ZXFA 1MNAA 1RWQA 3GA7A 1FFBA 2C0QA 3NWOA 3P2MA 1VKHA 3LCRA 4Q34A 5ALTA 3F67A 2EDCA 3O4IA 3KWFA 1ZD4A 4XVCA 5AI8A 1LPNA 5DYWA 4A5SA 1AUOA 3VXKA 5D6OA 5ALVA 2GYWA 3G02A 4W9RA 5ALWA 5AHXA 5AOBA 3WK8A 3G9XA 3FLEA 4A16A 5AI4A 5K3FB 4HRXA 2XLBA 1OXMA 4B84A 5DYYA 1VOTA 3WZMA 4Q05A 2HRRA 1QIEA 1XZBA 4K2AA 4H7JA 1H2YA 4L72A 5HF5A 1CUJA 4KE9A 4FFWA 4FMPA 3WYDA 4BVJA 5CMLA 1K63A 5CH5A 2JF0A 2DQYA 1WCYA 2H9YA 3VJMA 2XMCA 5BOVA 4G4IA 1ZIXA 2H7YA 5FKJA 3RLIA 1UFOA 5JZSA 3OG9A 4I19A 4AMZA 3I2GA 2JGEA 3C6ZA 4LYEA 3DYIA 3ESCA 3PUHA 2ZSIA 3MGAA 4G8CA 1USWA 3AJAA 4MJ3A 2RGUA 4LXHA 4MQLA 5AK3A 3LS2A 1WPXA 1N1MA 1XQWA 5DNVA 3NOXA 4OYYA 3WJ2A 3O0DA 2VQ6A 2JGLA 3WWEA 4WY5A 2Y2VA 1J06A 3CN7A 3VJKA 2DCMA 4PQEA 5ALOA 1BN7A 1GZ7A 1ODSA 3B3QA 1WHTA 5I9IA 3DKRA 2GYVA 2OCGA 3D2CA 2CMFA 2BUAA 1UOPA 1JJBA 2YYSA 4FWBA 3WK9A 4KAJA 5JAPA 4B81A 4EY5A 5JANA 5IVHA 4AZ0A 1UXOA 4GBGA 1EH5A 1ORWA 5FOQA 1XROA 1ZD2P 1YAJA 1GKKA 3ESBA 3DS8A 2QTBA 3WA6A 2VF2A 4Q3OA 2XUOA 4UHDA 4DM7A 2GBIA 2XQGA 5KWIA 3ZV7A 4W1RA 5AI5A 2OCIA 4IHAA 4BE4A 3ANSA 2BKLA 4BRZA 1W1IA 3M82A 3WLAA 3IDAA 1EK1A 4EZIA 2QZPA 3PFBA 1CUWA 1DWOA 5ALXA 1ZJ5A 4EHBA 4EUSA 2ZSHA 3AIOA 3L1JA 4WCVA 4OPMA 4IH1A 3VISA 4KE8A 5HK9A 5CT6A 5HFAA 4QLAA 1THGA 2Z8ZA 4X6UA 1F0PA 4IO0A 5DTJA 3K2IA 5T4BA 1TRHA 5T4FA 5AICA 4OB7A 1UOQA 5BWBA 1EK2A 3FYUC 4BDTA 4HXFB 1Y37A 2CJPA 4GI1A 3DOIA 1AKNA 3B12A 3HC7A 4FLFA 3H2GA 4Q3KA 1EDEA 2VJDA 2HA0A 3H2IA 5DYTA 5JD6A 2J4CA 1FJ2A 4UBJA 4CCYB 5IH7A 2XQJA 2YH2A 3QZUA 1BCRA 2WFMA 4KRXA 3WKBA 1VA5A 2BCEA 1CQWA 1EINA 2WIFA 1N5RA 3QM1A 3R3VA 1XQXA 1CUUA 4MYSA 3AZPA 4PF1A 1P0PA 4OCZA 4HS9A 1WHSA 5J3JA 2C5GA 3H04A 3GBSA 1ZICA 3QMWA 1CUSA 5CXUA 5KWJA 2PSJA 2JEZA 5JD5A 4PV7A 5T4HA 1YCDA 4GWLA 5ALPA 1MU0A 5K3DA 1W52X 5A7HA 4N5HX 2QOEA 1E8MA 1LZLA 1VZ2A 1WM1A 3G0CA 5HZGA 2GZRA 3RKSA 2PPLA 2QR5A 2OXEA 1LPSA 3H2HA 2B4KA 3IUNA 1XLWA 3M83A 2WHPB 4DMHA 2PM8A 3C43A 3E1GA 1MPXA 2CEKA 1H2WA 2VJAA 1N8SA 2C5FA 2WQZA 1CFJA 4BCCA 3DL7A 5JARA 5LP1A 3AILA 5CT9A 1CUBA 2WIGA 4FLEA 3WIBA 5FV4A 1QTIA 1GPNA 1P0QA 4PSCA 1Y7HA 4QDZA 1Q0RA 1B41A 2O7RA 4RGYA 2HU7A 4X93A 3DYVA 4BTVA 4JEIA 1JI3A 4BP9A 3QPCA 4H7EA 1J1IA 3I28A 2QVBA 3C45A 1H23A 1IZ7A 3WKCA 3WL6A 5AK4A 3MUOA 3FCYA 4RPCA 2I3ZA 1G42A 5I8PA 1VE7A 4LIPD 5E4TA 2WSLA 1R4ZA 3UUFA 4YASA 5ALHA 5AM4A 3ZWQA 5EFZA 3BJMA 5FDFA 1H2XA 2ROQA 1SCKA 2XUKA 1CUIA 1WPRA 5JAUA 3PF8A 4CG2A 2XMQA 3AIKA 4QNNA 2FUKA 4IQ4A 3AINA 4UFOA 4WFKA 5AH0A 4EY8A 3WL5A 1YA8A 2O2HA 1E8DA 4YX9A 1T4MA 3IA2A 1IUNA 4XJVA 1A88A 2XUDA 4B0OA 1XRLA 3WIOA 1LPBB 5CXXA 5IKXA 4BRSA 1JJFA 4QA9A 1AX9A 1ETHA 2RONA 4J0JA 5AKYA 4GXNA 1FFEA 3DLTA 1FFDA 5ESRA 2G4LA 2HHAA 4QE3A 4BAZA 1U4NA 5A2GA 4Y2YA 4DGQA 2YASA 1EDDA 4CI9A 1GXSA 3PI6A 4MEBA 2O2IA 1XZMA 3WK5A 4B6GA 3FVTA 4UBMA 1XZEA 2JGFA 4K6GA 5T4EA 4FOLA 4H7KA 2K2QB 4X6YA 4LKOA 2WUDA 2AJBA 2WFZA 4AN0A 4F60A 1CPYA 5FLKA 3C70A 4AB1A 4LXIA 3R41A 4NZZA 3STTA 1CUFA 4AO6A 3C5VA 5ALQA 1H22A 4DIUA 4Y2XA 3V1KA 1HL7A 2PSHA 4QDOA 5ALNA 3A6ZA 5FP0A 4ZI5A 1QIGA 3Q0TA 3U0VA 5E2IA 3FLBA 5CT5A 3I1IA 4NMWA 3F97A 5IVIA 5AIBA 1K4YA 2Y1KA 4BATA 2XUHA 2ECFA 4C88A 2PSDA 1G66A 2WM2A 1WB4A 2X8BA 1CUCA 1YAHA 2PU7A 1R9NA 4DMCA 5JAOA 1QGED 2JGJA 1NU8A 3H1AA 3NGMA 4H7FA 5AKXA 5LKRA 4W1QA 5BWCA 2Z3WA 4MWSA 3B5EA 4X3CA 5HQ3B 2WUEA 1LPPA 2HIHA 1MNQA 4Y2JA 5AKGA 5FPPA 3FYUA 5AM5A 1C7IA 1DX6A 2QJRA 5ALDA 2ZJ6A 1G4HA 3STYA 4UFPA 5K3CA 2V9ZA 2XUQA 4PO3X 3SX4A 3FLAA 1MX5A 4U2CA 4EA6A 2VEOA 1HKHA 3C8DA 2OGTA 4AO8A 2H1IA 5ALJA 1YS2X 1M33A 3ANTA 4C01A 2QKYA 1Y7IA 4J3JA 4DMKA 5HCUA 2WG0A 4WDRA 1QIIA 2GBGA 4ARBA 3WWDA 4J0DA 6YASA 3VVMA 1R3DA 4Z49A 2ORYA 1YS1X 4H7DA 4WJLA 1XRRA 4ZWNA 5ISMA 5K3EA 1EB8A 4W1PA 1QIKA 4DYHA 1ISPA 4ITVA 3W9BA 1CLEA 1JKMA 3GELA 1AURA 3HYSA 1CUZA 4OB8A 2OCLA 1RP1A 1KU0A 3V48A 4K6HA 1P0IA 1YSCA 4QDUA 1E89A 1H2ZA 3PF9A 4YPVA 4L9AA 3GFFA 1A8QA 3WKDA 1CUVA 2BGNA 4UHCA 2OAEA 1TCCA 3WK7A 3GROA 3BXPA 3ZPXA 4AXBA 1EB9A 2AJ8A 4V2IA 2QJWA 4JUIA 1THTA 1EX9A 1ZD5A 1HLGA 4Y2TA 3K6KA 2J3DA 2RHWA 2XT0A 1IVYA 1E3QA 2PVSA 3I2JA 4OUKX 2IX9A 4UBIA 2CBGA 1UOOA 1CEXA 4CCWA 5HF9A 2V98A 4N8DA 5K3BA 5ALGA 4XIIA 4KYVA 2AXEA 3G0BA 5FPQA 5LZ9A 3IVMA 3C8HA 4E46A 4E15A 1CUDA 2JIDA 2QXUA 1J07A 2WLSA 3G0GA 4X90A 5IVDA 4X92A 4BP8A 5EGNA 4OYLA 3AZOA 3M81A 5ALIA 4EY7A 5JALA 2WJ4A 3YASA 3WKAA 2R11A 4ZV7A 4F21A 5C81A 4XWGA 3STVA 4WFJA 4D9JA 1X2BA 1UKAA 4AQDA 4S0XA 3QITA 1UK8A 2Z8XA 1GPKA 5JZBA 4PSDA 5C7YA 4DSZA 5AK6A 1SCQA 4XX1A 3KD2A 2QT9A 3RARA 5C8VA 4Y2UA 1DU4A 5EHNA 4HAIA 5JIBA 1MAAA 4GHWA 3Q8WA 1ACJA 3WZLA 4DSAA 2WKWA 2XUFA 4P08A 1XKLA 3QPAA 3PE6A 4N8SA 4H35A 3O4JA 2V96A 1DTEA 1X70A 4FNGA
chains in the Genus database with same CATH superfamily
1OZFA 1C3JA 3TFWA 4PIPA 2OV4A 2QMYA 2VJQA 1NMXA 5T64A 3GFVA 5IMBA 4XVHA 4F3YA 3STWA 2NVOA 5IKMA 1J2TA 2ZITA 5LYYA 3WWCA 1J09A 1KQPA 1QO9A 4N5MA 4X94A 3T5TA 4R41A 3PHBE 1YRQA 4HAOA 3WAKA 5EL0A 4LDJA 3RS7A 3BKXA 1MX1A 3NIWA 3FSEA 2CEAA 3KAPA 1H65A 1O6ZA 3CT4A 3X2FA 3ENKA 4ZQGA 1PDVA 4MV6A 4TS3A 5D85A 5IJ9B 2Q3JA 3FHTA 4TMWA 3I83A 4AZ0B 5KAPA 4BO5A 5LZ2A 3WA7A 4OQMA 2CL7X 2CXRA 1RBMA 2ZRCA 1ENPA 3AUFA 1HE1C 3MINA 4H0FA 1Q6YA 1RR6A 2JIQA 1YQQA 1RP7A 2AL7A 3MUNA 3DE5X 3M4XA 1PF7E 1U98A 1LBIA 2FCRA 3VPHA 2F55A 2H63A 4KQKA 1D2NA 1HA3A 3L9XA 5D1NA 3ZLUA 1FK8A 2GTPA 4EQ6B 3DLPX 3E58A 1SK8A 4RA6B 4YT5A 2ZTLA 1QHEA 1CIJA 4NYJQ 2P91A 1VJ5A 1J7JA 2WIDA 2Z9CA 4GPEA 1P7VA 2M6LA 2E2WA 5HSGA 1CQPA 3DVQX 4G0OA 3WLNA 2JFWA 5SY6A 1MFPA 3BWCA 4CNBA 2QUIA 2IHJA 1CJTC 3GUHA 3OEEA 1YRBA 3W6PA 2WKQA 1JMKC 1QHFA 5KPJA 5LR6A 2CHEA 3JW8A 1YA6A 1HNZB 2PMFA 1FTNA 1CY4A 1C3XA 3PGLA 4B3HA 4FKBA 1XQYA 5KKNB 1HSOA 2Q4EA 4NIMA 1K7EB 4FMCB 1WEHA 1RJFA 5K2OA 1PAUA 4D42A 2ZRMA 1EK6A 2GXQA 4G86A 5CLLA 3WDMA 4JOCA 1GVNB 3O8BA 4BNJA 1ODKA 2QTRA 1N7IA 1UMCA 1WSAA 2W90A 2FG7C 2QLTA 1ZY2A 3ES9A 1DAKA 1TGYA 3P19A 3QG5A 3FFWA 4UU1A 1Z6PA 2QNBA 4RLQA 4CIWA 2RGGA 3LQKA 4M37A 5CB4B 2EFEB 2QX6A 2Q5CA 3HGQA 4BMYA 2O23A 1KRHA 2FW8A 1ISGA 5HIAA 3IOBA 1P2UA 1P6XA 3QLUA 3W2GA 4LFBB 5FJIA 3II6X 4QM6A 2B35A 1E66A 1KOJA 1J9GA 2XGSA 1ZGJA 3REOA 3DEKA 3VO2A 1BCRB 5KTRA 3Q10A 3ZJVA 2FE1A 3JVEA 2FR8A 1D2MA 4FYVA 2QV7A 2WUGA 4ONEA 5JJLA 1XPUA 4IILA 3ML1A 4C1BA 4PGFA 3RT7A 4KNWA 4YQFA 2HCTA 1WW8A 3ZHZA 4U3JB 3ECCA 2E49A 1NOJA 1NFFA 1BXZA 5AXDA 3ZJ4A 5KU1A 4DARA 1TC2A 1G3MA 5B55A 2WR8A 3PIRA 1NWCA 1W0JD 4ND1A 4OFWA 4A9AA 3K9BA 5F7JA 3H7AA 5J2UF 2QR2A 4M9CA 4NU5A 4CEJB 4J07A 1EUCA 3NJ4A 4OLAA 3KTAA 4JL6A 2FW9A 5AKIA 3JZIA 2CBZA 1QHGA 4J6FA 1QF9A 5FX2A 3CKYA 2XUIA 4MICA 1HL3A 3EVZA 4F4FA 4NTZA 2IW1A 2EKLA 1U3VA 2SCUA 4CMEA 5KINB 4BFUA 4E14A 3GB9A 3RPEA 3HCNA 2ZI4A 4LJAA 1NBWB 2VI5A 3SK0A 4CRWB 1QG4A 1B8OA 1W4LA 2JIMA 3JQ9A 2EX0A 3MJCA 5IU6A 3GZNB 4M87A 1JU4A 3IALA 4DUGD 4W4TA 2I03A 1UDWA 2GB4A 2A0UA 1MC1A 2J4FA 2VHWA 4GOXA 2NU7B 2X0NA 1K89A 3L7NA 1NI4B 3U5ZB 4M98A 3E8XA 3IT2A 2HA6A 4W8OA 5LLSA 2Q3FA 5REQA 2NSYA 4JVSB 4BCDA 2BH9A 3BPSA 2PWBA 5IK2D 4DV6B 1VMAA 2PRJA 1NMYA 1R18A 4RSRA 1G18A 3H8JA 2WNSA 1VC2A 5IJWA 3R3WA 3A9CA 4BNUA 4OHPA 1W59A 3T0IA 1J2EA 1DOZA 1ZUHA 1ECLA 1QB8A 2AQIA 2QW1A 2V97A 4L15A 1GPBA 2D7CA 3TQQA 1RZRA 4K28A 4C87A 4JVMA 4QOJA 4C89A 4XFJA 4OI0A 2I71A 4XQEA 1V1MB 2VSOA 3GZJA 2CJWA 3NAQA 4I9HA 3TL6A 4LAFA 3V7NA 2DLDA 5FTNA 1O0CA 4KRYA 2A8YA 4FJ1A 5FL7D 3K0AA 3H84A 1KYZA 1JYEA 2QL6A 1WB6A 1XQ1A 3ZDXB 3TAXA 4ABTA 4RL6A 3E9NA 4I3GA 1OJLA 5DBIA 4ZT2A 3W7VA 4R6XA 1WKBA 1ML3A 2XNCA 1RWPA 2FMHA 3KHKA 5SY9A 1YR3A 4NBSA 1BWQA 2JLBA 4DA6A 3AY7A 4IUDS 2NO4A 3Q9SA 1EQ2A 3E3AA 1GPMA 2FJUA 4YRIA 5BQFA 3VOBA 3AUSA 3G88A 5JOQA 5CYGA 3RSHA 2FWAA 4EI8A 2HGSA 3IJPA 5KIAA 1VL2A 2XEXA 5J4VA 2X2EA 3UMMA 3BB3A 2VQEB 3NKFA 4DKJA 2XB8A 3C5WP 4OHFA 2FZ5A 3L93A 3P9NA 4BNGA 2Q62A 3BHJA 4E13A 4X1KB 1FY2A 1DC3A 2P6NA 3BYZA 2GCOA 4H3HB 3KWJA 4XCXA 6PFKA 3HDYA 5CLHA 5DI3B 3V2IA 3GLFA 3D6UA 3CY6A 3EIWA 3HWX1 1B6RA 1AUVA 3PX7A 2O05A 4N3CA 5I6DA 2R60A 3FPGA 5JW6A 1ACMA 1HZJA 1WTAA 4B3JA 5JZMA 3QYAA 5AKZA 5A6SA 3K70D 1P0MA 3E15A 2PLRA 3CRZA 4F2PA 2RHBA 4R83A 4X7BA 5T67A 1YB5A 3IKTA 2CFRA 3F73A 4C2BA 1B3BA 1YB7A 5FD8A 4JLOA 3DZIA 3D1JA 5COBA 3V1MA 2PR7A 4I6EA 3VR4D 1GFSA 3LFHA 2GXUA 3S27A 4Z4CA 4ALIA 2AOXA 1QGOA 5E4YA 4ECEA 1LXCA 2L82A 1TGVA 3QXJA 2C9MA 1T3GA 1P77A 5DISB 1PGOA 2J3HA 5CNIA 3UV3A 5B4TA 3HB9A 4Z53A 1RM3A 4WZZA 3B1VA 3DZHA 2WFLB 4Y67A 5I5GA 4YALA 4XWOA 3QKUA 2CLSA 3N0RA 2F00A 5LYJF 1P29A 5BW4A 4J16C 1XTUA 1C3LA 3KUKA 3TZKA 1Y9EA 5E4JA 1WCXA 3GPBA 2BCJQ 3BK2A 1PVVA 2G6BA 1L5ZA 4FS8A 4GM0A 4MVJI 4RX1A 1NRXA 3D3QA 3PRKE 3VC2A 3GNSA 3BTUA 4TKVB 3NBQA 5K0GA 3MTAA 3BTVA 3G5TA 1FTGA 3LXMA 4ZOLF 5F4ZA 5J40A 3LW8A 4O33A 4DCNA 5BXQC 1M8FA 4I9NA 5JXWA 1X80B 4DV7B 4DCCA 1IG0A 3R7BA 3W5BA 2A1TS 5SZKB 2F8SA 2QXYA 4HD8A 1VLLA 3SHWA 4HP8A 1PGPA 3CVWA 3AM4A 1DARA 2C9YA 2HJ9A 2HD4A 4KIJA 1N33B 1YWGO 2W2XA 1SY7A 3IRUA 4AXXA 5E2AA 2YV5A 4F5ZA 4M46A 4C6TA 3GD7A 3WL8A 5AM0A 1P2GA 1QRDA 4K6OA 4ND2A 3OHPA 5E6UA 4U7FA 2CL6X 4RZUA 1SKQA 1P4GA 1ZI8A 1GEEA 2EX1A 2I4TA 3AEQA 1OLSA 2IGBA 2WOJA 3AWDA 1KI2A 1TL7C 1UMKA 3D2LA 3FDZB 3NMUF 4CFZA 2ALJA 5ITZB 2HMVA 4PHHA 3C6XA 4RVOA 2ECOA 2R9VA 1R6VA 3S29A 1FJXA 3MN1A 4KVGA 4P36A 4GYJA 4DCOA 1FXWF 1M6VB 1UL1X 2ZYUX 1V11A 4REMA 5DBFA 4II2A 1VDMA 4PLCA 3SHFA 3QV1A 3G2MA 4LF8B 1ZP6A 1AO3A 5K4AA 4C03A 4H4DA 5DZSA 2Z58A 1C7JA 3EAGA 3RUCA 3S40A 3MCTA 5HCNA 4NU6A 1H5QA 2PO5A 1DRKA 1ANKA 3IV7A 3TZHA 1W36C 3F4BA 1XZJA 2QRVA 3R5KA 1KMCA 2ZDQA 4FZJA 1GRVA 5DTIA 1NBMD 1VSTA 5KNBD 4YV1A 4LRYA 2FMTA 2QSUA 4FDAA 4P31A 5KJEA 2BELA 5HFJA 4Z9YA 3KOZA 2PL1A 3OLVA 1YT5A 4OGWA 2EYQA 2IYLD 1JHAA 3HNOA 4H18A 1E0JA 4G8DA 5EE0A 5EI5A 1P91A 4IJQA 2O59A 1OROA 4C0XA 5F12A 4AK9A 3DOHA 1WUTA 3DFMA 1NVXQ 2HJHA 3W5SA 1Y5LA 5CH8A 3GEDA 1Z4MA 5I01A 5EP2A 4CU5A 1N6KA 3QU4A 1NSYA 3KJIA 4WFIA 5ALUA 4J7AA 4ZGGA 2YV2A 2IXBA 2FZCA 4TXMA 1QIDA 2A33A 4AQYB 4HNVA 1F8UA 1XU9A 3IVXA 3KQMA 3DMRA 1EUZA 3IT1A 2WHYA 5JVDB 2C5BA 1U7HA 4NFYA 2RCNA 3ELBA 3UCXA 3ZIDA 1KMNA 1I80A 5A7GA 1NN5A 2VDLB 3W6OA 3HFGA 5H5JA 2BPOA 1WP4A 3GFRA 1NN3A 2O57A 3PUJA 4P80A 1SRQA 1CRZA 1XJQA 3HR4A 4JJ8A 4MVJH 3RJ5A 3OMXA 4DV3B 3H5VA 5JNUA 1E9DA 1TIPA 3WJ7A 1A8IA 4RIGA 3A9RA 2Y1FA 2VDOB 3DTTA 4GU5A 3WLKX 3MJDA 3NPAA 4GX2A 4V0SA 4G0ZA 4P3OA 1D2RA 1DHRA 2G63A 3TLMA 1SVIA 1TTQB 1U0JA 1TD9A 4RV4A 2V7QD 2AFHE 3OCVA 4TMTA 4XLLA 1TPYA 3UJ8A 2E4ZA 4ZDKA 3GIDA 4Q15A 2QN6A 1A82A 2GHQA 3AYXB 4CETA 2ZWOA 2ZYHA 3AR3A 1D07A 3JWJA 2Q07A 4A8TA 4RORA 5KQGA 4ESVA 1GYRA 2JCGA 1REQB 2C7RA 1SUCA 1RU3A 4BDSA 5I4KA 2XQIA 2SKCA 4HPJB 4Q1BA 4NCIA 2WAXA 4YAKA 1L5OA 2BR5A 3KXKA 1WSWA 4Q19A 2BF7A 3GW8A 4LJ7A 4YR9A 1YZ3A 1NRJB 2EP5A 1QIFA 1F4PA 3EW7A 2OORC 3RABA 3KKOA 1XZCA 2Y1DA 4RNCA 1TCVA 1MP0A 1XZFA 1ORVA 1PO7A 2EZ8A 2VRCA 3G2KA 3M6WA 4LN1A 5D3ZA 4ZMRA 5KPDA 2OMEA 4QUHA 4NNOA 3OFKA 3MBKA 4XIJA 2JEOA 2CMGA 2BUCA 2PSEA 2BEWB 1WOMA 3SIPA 3HI6A 1BTOA 3LLUA 1M7HA 5AJTA 3I2FA 5JC1A 3ZWXA 5COAA 1EYZA 5GPBA 2FDXA 1M74A 1CD5A 3PQ5A 3C4VA 2H7XA 4R0NA 4DMGA 1X7ZB 1MOZA 5AHWA 1IU9A 3KKMA 3D02A 1RXCA 4XCQA 4KX3A 3DWFA 3DMDA 2FRDA 5H82A 1TZMA 4CUZA 1NY5A 1EJ0A 1OBOA 3KJNA 2I0FA 3MTEA 3MOIA 2SECE 4J0IA 2FMFA 1K66A 3E82A 3K4HA 5E0OA 1IJFA 3X1ZA 1BVHA 3H5TA 4JNKA 1U1DA 2I3GA 1T8PA 4CIXA 3DKVA 3BSSA 1V8OA 4G1CA 2BW0A 4FTWA 2H1FA 2WAYA 2Z30A 4U2KA 1IIBA 4TGLA 3E22B 2XYRA 3S70A 5J2UB 1UWCA 4RLHA 3O21A 2GJ4A 2WYUA 3K30A 2CJWB 2QZZA 3UUEA 1I2ZA 3CX7A 3MCWA 4YRZA 4NY1A 4ENUA 2Q5QA 4OMUA 4XQ0A 4EVRA 3UMJA 3LVRE 3R6DA 1ZGZA 2JH9A 3KZNA 4FINA 4J9VA 1L7PA 2C4TA 4OP1A 2QZ4A 2D5LA 1YB4A 4PGMA 4UD2A 3AF2A 2W7TA 2G7ZA 4BRUA 2NP6A 1C4XA 3CCCA 3A36A 3AXTA 1RYYA 1QTRA 3QVKA 4H59A 1EJBA 3A6GA 4B40A 2X5XA 4H4EA 3AGPA 3IKMB 1RPTA 4MA0A 5CH3A 5AW1A 3FPBA 4MVWA 3WG9A 1USUA 3FYTA 2O0LA 2Z4SA 1BJRE 1EX6A 1E3WB 1W49A 4XOIA 3HL0A 3ROGA 3V1LA 3VMMA 3W2EA 3ZY4A 5EIEA 5FPSA 2JLSA 3M33A 3ELYA 1DKPA 2OHVA 3A6DA 5K8IA 3KQWA 4D4KA 4NMMA 2VP2A 1Q44A 5HJ2A 2OD9A 3GNTA 3SJZA 4KACA 3UWPA 4CV3A 2PQ0A 1WL8A 4YJ2B 1U7DA 2VSYA 4PW0A 2ONJA 4BWVA 9ATCA 4Q7LA 4MWTA 3JWIA 4ZO4A 2COEA 1L4YA 2DUNA 3CGGA 3LBFA 3ROMA 3WL7A 5KTOA 2CD7A 3ZIAD 1QV9A 3KAKA 1YXMA 3WIDA 1LBTA 3L4EA 4GZLA 3EPLA 2AN5A 4DE5A 4F04A 4HDCA 4UBOA 3V8QA 4D45A 2F9FA 3JQFA 3QEJA 3DE7X 2C1ZA 5IAEA 3CLTD 3HU2A 2MT9A 2ZS7A 4UTOA 1C14A 2ZQYA 4KTTE 4RXMA 3UJ9A 1RAFA 1R9JA 4G85A 3F5QA 2C88A 1YQDA 1BEZA 3NBYC 4HT3B 3H05A 2IZ7A 4P54A 4QUKA 4W9MC 5LBUA 3WGKA 2XGOA 2EEPA 4MJLA 1JNYA 4WLFA 5LA6A 2JKZA 5CA0F 4F91B 3K9NA 4G0WA 5EMKA 1D2CA 1XZKA 2BZSA 5AKEA 2YWHA 3A28A 3DONA 3KSDO 3Q2KA 3TRKA 2N3ZA 3WLHA 4EAAA 4XQGA 3Q7SA 1L5FA 1Q7GA 4N49A 5C7LO 2B4RO 5G53C 2D1RA 3NOQA 2JJ2A 1QLWA 4NOMA 3TCXB 4RHXA 4IIEA 4DV0B 4IXMA 1ISHA 3BWDD 4UFNA 3TEJA 1JIVA 3A0UA 3K16A 3OU2A 1NJFA 3MLBA 3V1UA 1VL0A 1QPBA 1V43A 5D8DA 3EHDA 3E22A 4NZMA 1LNSA 2DULA 3RFUA 3IQHX 1ZN8A 2O2JA 1KMMA 4M1MA 4UD6A 5NULA 1B7GO 3V33A 2Q8NA 3EIFA 3EN0A 2PUHA 4QG7A 5TRTA 1HMPA 1D0SA 3WLRA 1IBRA 3QEAZ 3AG5A 2AMFA 3EMBA 4BB6A 4CLEA 1GPWB 3QPDA 3MT8A 3ESYA 1S2MA 3KR2A 2DBRA 1WDTA 2Z2ZA 1H2FA 3DNFA 2WU4A 3G23A 3H2JA 3PXBA 4G63A 3HCDA 2VCHA 3MJRA 5GZ1A 1JEEA 9MHTA 1PRYA 2WKRA 2VF8A 2FWJA 2QZJA 4IFTA 1PK8A 5LP6A 5AVQA 3LXRA 1E3EA 3N3BC 5E3JA 1DKOA 3PZBA 3DE4X 3QUQA 1M67A 4ZC1A 1A5TA 4RVUA 3K9FC 1UXJA 3QXGA 1YB6A 1FDWA 4WNAA 5EMNA 4KXXA 4OU5A 3UTDA 2F17A 2O07A 3KUCA 2SBTA 1KAGA 5DV9A 3A1TA 4P86A 1BKSB 4XYGA 1R0LA 3TLEA 2VQFB 2O8FB 5EE9A 4HADA 4UHJA 1ARZA 1T5TA 4FEGA 4HNUA 3DUFB 2FN3A 2Z98A 1CF4A 1ESMA 4G0XA 2DOKA 3QUSA 2GVNA 1UJ2A 4HEA6 5EXXA 2RARA 3QSYA 5G0UA 1LK0A 4CM8A 4F4IA 2IZOA 3MAJA 3OECA 1TMKA 4XI9A 2GF9A 2OHHA 1Y89A 2W2PA 4PAMA 2P2LA 1IZYA 4M8SA 5BUSA 4UUPA 1QO7A 3O8RA 3KELA 3NBXX 5CYPA 2QX7A 2N1MA 2X0KA 3TCKA 2Y6UA 4KXNA 2XWQA 3V46A 5K8CA 1GPYA 4GE3A 2PLWA 5TR9A 3JZFA 1A7UA 2BE9A 5HKOA 1KP3A 5K20A 3LQFA 3D4LA 3QEOA 2B1JA 1XD9A 2OVBA 3MMXA 5C8YF 3PTZA 4OH7A 3SDSA 3D3WA 5EPEA 1BDHA 1PZFA 2CUTA 1QHYA 4HX5A 4MITA 3PFHA 5LQAA 1RKUA 1SC6A 3MF4A 3Q5EA 5DYGA 2C61A 3IVRA 2Q7XA 2VIIA 4WZBA 1M1NA 1OIWA 3BFKA 3M2TA 1KH3A 3R0JA 2B78A 3CF4G 3IR6A 3Q15C 5HUHA 2PKEA 1NDQA 4IF4A 1S6YA 4G1VA 5DW0A 4KOEC 3JAWA 2XXAA 5EUQB 3GCZA 4GOLD 1A27A 2Q3DA 3S55A 3PUKA 1XE3A 1Y7TA 1WJGA 1SQ0A 2GCEA 5FOSA 1Y5IA 1E0DA 1ZMOA 2FWIA 2GK3A 2J3QA 2OV3A 4GZ6A 2J31A 1SHZA 4LXQA 3TAHA 3ZWNA 3E35A 2H6EA 3H75A 2H11A 5AJUA 4Z7QB 1R0KA 4CUKA 1JEOA 4A0RA 2MR6A 5JI2E 4P9NA 1NI4A 3UGKA 1VLQA 1YI0A 1ZOOA 3EVTA 3OZUA 4I7EA 4Z2YA 4Q37A 5JSHA 1ZG3A 1ZNZA 2B9VA 1WCIA 1OGYA 2PRKA 2PT6A 3LC7O 1DQRA 4KTVE 1N78A 1UKCA 4MW4A 4COOA 4MIOA 2QTGA 2ABWA 2YS6A 3PFIA 5DCWA 1NT4A 3RUEA 1W19A 3H11A 2Q2NA 1AF4A 3FHCB 2YIDA 3ZGNA 4C76A 1BQ4A 1GR0A 1T5DX 4O1IA 2ZBDA 3IEUA 3T94A 2FZVA 3PEEA 1WVIA 3RTCA 3GJZA 2OB2A 3PSHA 4OHBA 2OYCA 4F84A 3K92A 3IO5A 3A1SA 3K5PA 1QGUB 3NH6A 4UTXA 1X7DA 2QK4A 3RJZA 2JI7A 1MCZA 3HDJA 4GX1A 1PJAA 4RD3A 3LD9A 2C07A 1CZRA 3HZZA 1K8RA 1T1EA 4REQA 4QPDA 5EIWA 1Z6QA 3U4MA 2TYSB 4NVRA 5HIKA 3H87A 5AVYA 3I30X 1U28A 1LW6E 3VR4H 4UBLA 4CIDA 5FI5A 3WC4A 5F98A 3GDWA 3FCXA 3OZBA 4YWHA 2JCXA 1CR2A 2ACVA 4B83A 5FUMA 5J5VA 3W9UA 2I34A 4JP2A 4EF6A 4ND7A 1T36A 1DAIA 1N0UA 4BTLA 4AMBA 4II7A 2VPPA 2BI4A 2D1FA 2IHTA 1QFSA 2KB0A 3B7PA 1CKEA 3ETDA 3IOCA 4KHPB 1DXQA 1K5HA 1KK0A 4KXLA 4R81A 1BMFA 1FLNA 5AT1A 4BJ5A 1J23A 4LHEA 3VHRA 4FD2A 4UUBA 1N5DA 4UPEA 2MSWA 1NPTO 3V8VA 4XD2A 3NIBA 3H13A 1P44A 4BKOA 1RRPA 1YOVA 4KYIB 3O93A 4L51A 3W9YA 2HXGA 2XBLA 4KDCA 4MRMB 3PDWA 2A14A 1OA0A 3U56A 3GEPA 1I1NA 1O97C 4AECA 1N2GA 3KSUA 1XQVA 5B53A 3U80A 2IPLA 3C7TA 5BMVA 4AMGA 5EKSA 1VKOA 4FFRA 1D3AA 1UPBA 5K8UA 2X8WA 3AFOA 4LE2A 4LNUA 2VJYA 4UBNA 4I6JA 3CT6A 4R2JA 2ARKA 2VUTA 4ARAA 2QYTA 2OAP1 2P4HX 1WCWA 1JQDA 1Z68A 2PH5A 5AUOB 2EBWA 3TXAA 2ZPUA 4ND8A 1OBVA 4PBSA 3TDMA 3CNOA 3LRPA 2WT8A 1E61A 1I4EB 2BFEA 4E30A 1SK9A 1SU8A 2K7ZA 3KT6A 2IUSA 3HACA 4OQQA 2F64A 1O94C 4QNMA 4TLDA 1SULA 4C4AA 3OCUA 4ZAXA 3IBSA 1QKKA 2DHQA 1E32A 1QH9A 4OI2A 3MAGA 3MUFA 1NVWQ 3I9MA 3VKFA 5CDTA 1N2HA 2WIKA 5IHPA 4FGZA 1G9SA 1JG7A 4MIKA 3ZI7A 1OH7A 2E48A 2GA9A 8ABPA 4R1LA 3IOYA 2CCGA 3NRJA 3Q6IA 2YFQA 3TTSA 1Z3CA 5E9JA 1F60A 4M21A 3C1TA 2WUFA 3KZ1E 2DY1A 2F7SA 3MEQA 4LXXA 4EG6A 1Y8CA 1ZIDA 1KE2A 2O5VA 2XZDA 5C18A 2WINI 2FSFA 4Z0HO 7MHTA 5FV7A 2UZ1B 2DXIA 3T38A 1DL5A 4RKQA 3WRYC 1JFRA 1L9KA 3DVAA 1VE5A 2V8OA 3OTHA 1NYTA 5CA1F 1QP0A 4K86A 3QBEA 3R5SA 1NASA 5BO5A 1HFWA 1TJ3A 2VNAA 4UQLA 1GD1O 1OYYA 3EC2A 3MVEA 2WFAA 3ZXYA 1GZHB 2PS1A 2Z5GA 3PCTA 4OKNA 2RHJA 3QTBA 1DUIA 2KQUA 4P4GA 1NQWA 4GLBA 5D84A 3ZDEA 3IODA 3ENZA 2HAEA 2Q8QA 3JWPA 3GGGA 3BWMA 1EQUA 3LA8A 1ZX1A 4MB2A 1W9MA 4EDFA 1UWVA 4PLPA 1HK7A 2DFNA 4ZTZB 5AVSA 2B82A 5IT9A 1NKVA 2H2IA 3SYRA 1R15A 3E3LA 2IHKA 3FKJA 3ODGA 2ZBGA 4HN2A 3EMVA 5C4IA 4O08A 1Y1RA 4MQEA 2XOEA 2OXIA 5CB0A 4M7PA 1GQOA 3QP9A 4ESHA 4W5NA 2B69A 3IR5A 1X39A 4L50A 1MIHA 3IT3A 3HGMA 3O3NB 3ETEA 2ENUA 3LUCA 1EX7A 1L5KA 5C5CA 5IN4A 1MMFB 2CVHA 4G1UC 2NWQA 3GGOA 1TJPB 3OJXA 3PDCA 2XX3A 5DDIP 1KO1A 2NP7A 3AJ8A 2VDJA 3LPDA 1EGMB 3FUCA 2ZTUA 5ES4B 1QVWA 3AW8A 1JJIA 1T4DA 2FK8A 3SEAA 4FHFA 3O91A 3PNOA 3BAFA 4L16A 1IN4A 2FG5A 2V4ZA 1RKVA 3CR7A 4KXMA 4GDFA 2D6FA 3LOPA 4PX9A 2IODA 3HSYA 1N2BA 5CJJA 2QTTA 4DTCA 3N58A 4WASA 1RLUA 4ARUA 1BNCA 5I4CA 4IS2A 5JAHA 1M2FA 4OAQA 3ZG6A 1T6XA 4PAOA 3M3PA 4A73A 2LWIA 3KT3A 2C2MA 3ONNA 3OPYI 1T1IA 4XM0A 4OX9Y 3KTAB 2WI8A 5AUPB 3CBGA 1O94D 2R6R1 1CJBA 3I01A 1G9XA 3IL2A 2FOIA 5BYJA 3F9CA 3HA5A 4KKVA 3EQ8A 3FTCA 1QMGA 3HWSA 1XZGA 3OM9A 2PX3A 3OZSA 4IJMA 5JZOA 1WD7A 5YASA 4EX6A 1MAHA 2OENG 2UAGA 3A04A 5TT1A 2I6SA 1EFHA 3UH0A 3V2HA 3HP7A 3GPCA 3GP8A 2H57A 3PUIA 3AEKA 3GEMA 1P7PA 2QROA 3OU7A 2HU5A 3V8MA 5F7XA 4MARA 3C1AA 4IJKA 3R5HA 2DQZA 4DR4B 5BV2P 1OV4A 4UXIA 3FCUB 3U3RA 1H42A 3VPSA 3NUZA 1V7PC 2PUWA 1F6WA 3EZ6A 1YC5A 3FXAA 1U65A 2R1TB 3GJ8A 1YKGA 2IIVA 3CVYA 4XGKA 4GQBA 3CO5A 1LI7A 1M1YB 3HMKA 3W6UA 5T57A 4BE9A 4IDCA 1G5QA 2R1VB 4D9EA 3ZWMA 5B2FA 2E7ZA 4RTPA 2YYYA 1ZXLA 3SQWA 3E4DA 3EYAA 3VR5H 4LTDA 4TRNA 1T2EA 4M0CA 1WP9A 2GARA 1OLUA 4Y2RA 3MJ4A 1W0CA 1RNLA 3M5WA 2BTQA 4IO1A 5IXSA 4EPVA 1GQFA 5IFLA 3H3JA 4IIVA 1MB0A 3BSYA 3K1JA 2FETA 1J4AA 5BR8B 3VH4A 3EOZA 4IIYA 3UEOA 4DMMA 1JKFA 4P33A 4ZIRA 2AQ8A 8GPBA 3V5NA 1QU3A 3N9IA 2H3HA 1L5WA 2HHCA 2WYOA 2JFNA 2WVAA 3DP7A 3L7OA 1MZPA 2YTZA 2B5OA 5IT0A 3LWDA 6ABPA 5L6LB 1ZGCA 4LZOA 2JZNA 2WM3A 3KV3O 5BVHB 1AM4D 4LPSA 1MJFA 1GPJA 2VT7A 3LLCA 3O8DA 1W2HA 3H17A 4MKZA 5HKAA 4UDYX 2OCPA 1V3TA 1OI7A 2XTMA 5C8YB 3FFBA 3C5HA 3BIXA 4D3DA 5BVGA 1VJGA 1AF7A 4IKEA 4EEZA 1KBZA 4CCSA 1HT3A 1KY4A 2YBEA 1QH1A 3DHYA 1XZHA 3CF0A 4LK3A 1F2VA 1S1CA 1IHUA 4GMKA 4OTZA 5ALKA 1XVAA 1AGXA 2WVGA 4D9CA 5BNWA 3IEPA 2NV6A 3WNCA 1QO0D 3LT1A 4YQEA 4L5YA 3E7PA 4J9UE 5DWQA 4X7RA 3CVJA 3JXEA 3PLNA 1JH8A 2H5LA 4TZTA 5BSVA 5LCXA 2WWYA 5TC4A 1U0LA 3HHEA 2GKSA 1YKSA 2ZAMA 4RZSA 1YIOA 2QM7A 1REQA 4RZHA 1D6MA 4DHWA 4XM1A 1TRKA 3D0RA 3BMCB 4BKRA 4B2IA 3W5AA 1IG3A 5BR7A 3CXRA 2AB0A 1PHRA 2IS2A 2CZCA 1Q1NA 3KR1A 5H7XA 2C95A 3IQXA 5F1KA 3BM5A 4YQYA 1FLDA 2WB2A 3RU3A 3A70A 5KC9A 4M1EA 4PC2A 1NVVR 4BB0A 2B8NA 4EG5A 1M0SA 4M53A 1JEJA 1JAYA 2GASA 1B93A 4G0NA 1EFPA 1JR3D 1KYIA 4I50B 4B2PA 2ZWPA 5CG1A 2CFTA 1GSAA 3K8YA 4RVNA 3BD6A 5H80A 3KVRA 2GAIA 3L7MA 3LQRA 2WV9A 4KX5A 5DLQC 1P5FA 5ALRA 5EQTA 1KS2A 3BDAA 3H1BA 4KR0A 1SPBS 4TTPA 1OCEA 3NANA 4IOJA 3PX3A 1Y4AE 3IV9A 4V02A 3LCVB 4Y8VA 4EMSA 2ZRAA 2J0QA 3A1VA 4PCAA 5K3AA 1MORA 4X71A 4FDVA 4PSUA 1TQ6A 3LUKA 1NLZA 3ONEA 3RRFA 2IGTA 1VXRA 2ZBEA 4WN3A 1XAIA 1RI1A 2DKOA 2XTAA 3D6NB 3NH9A 1NNUA 4X44A 4D25A 2BZ0A 2R47A 4ZK2A 3ICPA 1G8AA 2ZIFA 2ECKA 3WWZA 2PUCA 1M72A 2GEDA 1KI6B 1PJZA 2XNDD 1F7VA 1U1IA 3BGIA 4M1ZA 4U7PB 5DWDA 1YASA 1L7OA 2OUIA 4JLNA 4WZAA 3LIPA 4UBKA 3OE5A 4F3CA 2QN3A 3X43A 5K45A 3AF0A 1HQDA 2NZYA 5T41A 3ZBTA 3UBTA 1EUYA 1JQEA 4DAOA 1LVHA 2ZTVA 1UBOS 4CDRA 2CXNA 1IZ8A 3E23A 4N8EA 2C8VA 5M7EA 4EB3A 5CTAA 1MOPA 5KREA 1BDIA 3ILSA 1ISIA 5DE3A 4HDSA 2QTCA 3TNFA 3QYJA 3GAZA 2ZATA 3IJRA 3TLKA 1FPMA 1L7QA 3ASUA 4HXYA 2MSCB 1ZD3A 1SVSA 4XSHA 5EIFA 2GH1A 3WMWA 4BP3A 1O6FA 1P2SA 1G5FA 2QM0A 4MS4B 2YWDA 4XTRA 1MQAA 3G2JA 3MCUA 3QW2A 3H5LA 4F2DA 1VKNA 4AKGA 2TRSB 4QOHA 2O4CA 2NU7A 1HT1E 2OLJA 5TE9A 1GQQA 3DWGA 4J94A 2OBMA 3DG9A 4PHFA 3V4FA 4UUQA 4RDCA 3MD9A 3ROPA 1FTSA 2ZYSA 3U5TA 6REQA 2X40A 2DRIA 3GC6A 3OD5A 1Y3FE 2OECA 4BQFA 2APJA 3IXMA 2UZ0A 3HBLA 3R6GA 5A03A 1MN6A 4IXNA 2WJ6A 3WJAA 3I52A 3CRQA 3R8FA 3RBAA 1EP9A 2A5JA 3D8BA 1BHJA 5G1NA 1DELA 5I8ZA 1UMBB 1E5XA 4PNZA 4YIHA 1EU1A 2QN9A 3UB4A 1VJDA 3DULA 3O4HA 3WGNA 5LPNA 3UAVA 2HDHA 3MCVA 4IF6A 4CQMD 1YFJA 2HLNA 4YUYA 1XKTA 3OU6A 4M0LA 5BSTA 4R71A 3FDZA 5I3CA 5EZYF 3Q3EA 1J5EB 1UBUS 1EXMA 1XMVA 3GCWA 2ZIVB 5K0LA 3PR1A 5KSPA 2DH6A 3ZQ4A 3ZE9A 1GT6A 2VHCA 1Z6XA 3Q11A 7YASA 3WK6A 5BORA 2BYTA 1NJSA 2O0MA 3Q40A 4J75A 4C6TB 3CCBA 5IAOA 4RTMA 4JBHA 3E4CA 1UC5B 2HU8A 2WTEA 3NCTA 2IYFA 1FUEA 1LTQA 5DOVA 4OYHA 1E2EA 1LUAA 4LSWA 1ISMA 1NW3A 1I5OA 4PO9A 1EDBA 2Q6LA 1JFSA 1TTHA 4TWIA 1Q14A 4I4TF 1BRTA 1YZTA 2W4IA 1TJ4A 3BB1A 3KPVA 3L8YA 5AHKA 3KKZA 4A23A 2AZ4A 1G9TA 3S81A 4RM2A 121PA 2WU0A 3T12A 1P31A 2FPIA 4KFTA 3C3EA 1XL0A 2C7GA 4O29A 4TV9A 2NUAB 3UMCA 4MVJM 4DSOA 2EDAA 2HJRA 3N2ZB 4YMWA 1ZJJA 2W6QA 4A1OA 1JSCA 3STXA 3VR1A 4HGOA 4WBNF 2QMQA 4W5QA 2WIJA 1AMNA 2DT5A 1KSGA 1FXWA 3QKSB 1W6RA 2ZR0A 1ZH0A 4JBXA 3T61A 3X2EA 3LT4A 2HMSA 3W9SA 5LJIA 2ZSKA 1O7JA 2W93A 2ZRGA 4TYWA 2Q4DA 3L0BA 3NASA 2P9TA 2PZEA 3ER8A 1JVBA 2NYAA 2LD4A 4JR0A 2X0IA 4MUXA 3PCRB 3UICA 1QS0A 3CPJB 2BFDB 4BP1A 1LFDB 4KWHA 4BNVA 5MN6A 3NWOA 2W2QA 3ZXUB 1YMUA 5CCDA 1E9CA 1QAMA 1VKHA 3LCRA 4EJFA 4TYMA 1YBAA 1KYWA 2PZJA 3PNQA 1HNXB 2PKQP 4I55A 1JL3A 3RHZA 1WXXA 3F9IA 5AWFC 2J9FB 2WTUA 2ZUFA 2OD2A 4LDPA 5AW0A 2PGNA 4CKEB 2NSLA 4YMLA 5LM3A 1RXVA 1XIVA 1V5EA 5ENZA 1JLMA 4JJ7A 3TYXA 5D5QA 4BEVA 1XK6A 5FBRB 1MIOA 4F60A 1PVDA 3TSZA 4A5SA 2R65A 1RABA 1NDUA 2Y3IA 2DTDA 2FE4A 3BORA 3MJVA 2GJAA 1YI8A 1DADA 2QQEA 1OW3B 4Q4AB 4YXFA 5C5IA 4OBWA 5AJYA 3G02A 3UAWA 4YJGB 1AXEA 2WSSD 2DT8A 2J30A 3KU1A 3G9XA 3FLEA 2P9FA 4FEAA 3X1DA 1SCUA 3RHFA 3EVFA 1ZUNB 1KFJB 4A16A 1V2HE 3DYBA 4MTLA 3U4GA 1F1BA 5LB2A 1WZEA 2AYZA 2IWRA 5C51B 1NP7A 1NQVA 2XB4A 2XCIA 4JUDX 1GG2A 3SKYA 2V3VA 4A8PA 1TOAA 1M5TA 2CJFA 4Z8XA 3A1DA 1Y1QA 5CVTA 1K68A 3ZX4A 1JDUA 1EE2A 1PGQA 2Q5JA 3RIEA 4GR5A 3AVWA 4B84A 3T95A 4N6NA 1J8FA 3W8EA 4NH0A 1KZHA 4YT4A 4AJ2A 2FKNA 1W5SA 3BXXA 1V16B 1WZIA 1X7HA 2HRRA 2NSJA 2W9XA 3VTKA 4R9RA 1QIEA 1XZBA 1L5HA 2QMZA 2OFFA 4F8YA 4WA8A 4ZVSA 3ETGA 2EKPA 3VH2A 3G8CA 4KXVA 4Y6GB 3NBZC 4L72A 2R8XA 4TKUB 1V6AA 2HTEA 5LBIA 3B6JA 1DKMA 4KE9A 4Y9TA 5HXAA 2ODTX 1RRCA 2ZYDA 2IX3A 4FFWA 2QB5A 3RFCA 1ZHOA 1PUXA 2P7IA 4OQEA 1Z16A 4ARZB 3ZDBA 3EQ2A 4RPJA 3CVVA 2QUJA 3WP1B 1NXQA 2P9ZA 2TMYA 2YMPA 3PQ3A 4LY3A 3CH6A 2IU0A 2JIRA 5CMLA 5B3KA 1IN6A 1XCJA 5REQB 5T6MA 3S1SA 1LVUA 1YCHA 1SOWA 3EF0A 3H6HA 2G70A 3GEIA 3MIIA 4L76A 1QV6A 1RZ3A 4N03A 1FUYB 1WCYA 5JQGF 3EH1A 2CLOB 1C2YA 3EVEA 2VAPA 4G4IA 5BOVA 1NKTA 3OJLA 4X6LA 2YIVX 3EBPA 4ZVUA 2DBZA 3CUSA 3L0IB 3WGZA 2P75A 4IDAA 2SCUB 5LQNA 4KGXA 3U81A 4HLUC 4FFSA 5F2EA 3A4NA 3MIZA 3BHNA 3EJWA 4F93B 4NCBA 4NDNE 5DM60 3HB1A 3I2GA 5DBEX 1TM5E 3MB8A 1TO2E 4F3RA 3DYIA 3MWDA 3KKPA 4TRJA 3ET5A 3MJSA 3PUHA 1LDEA 3CBQA 5TF4A 2ZSIA 4RHUA 2C9ZA 5D5PA 4LFCB 3SOPA 1KKMA 2JFFA 2MYTA 1ULUA 4G8CA 5TEVA 5TPWB 5JBQA 4NYIR 3FTFA 1NFRA 4LKRA 2G3YA 3P9SA 1O6BA 1USWA 3RIXA 2R6ZA 1GTZA 3FPSA 1IXYA 5DGTA 1Q1EA 1F8GA 4U4AA 1K8XB 4MQLA 4V1CI 3VU1A 4FFBB 3EAFA 4GGPA 3ONWA 2ZANA 5IYZF 1JYFA 1BWRA 2FN7A 4C04A 3GGDA 3JZDA 2AVDA 1JSLA 2X8LA 4BUCA 3RODA 5DNVA 4OYYA 5F7OA 1RQPA 4QOEA 3O2QB 4RZ2A 2VQ6A 1NHGA 2E5LB 1BWSA 3BE6A 1SNYA 4P3YA 3JQ9C 1R7RA 3MGGA 6LDHA 2PS0A 4L75A 1J06A 4RIHA 2CXQA 4DLSA 4QHTA 2WIAA 1FRNA 1XNQB 3D7NA 4TV8B 2BZGA 4PQEA 4MIYA 5ALOA 3AHGA 2JI9A 4IZ6A 3ZDZB 1FYEA 1GZ7A 1ODSA 1LBHA 3M6MD 3OKFA 4YP1A 1F3LA 4UUOA 1XC7A 3LPNA 3CVOA 1O8CA 1J20A 3GT4A 3ROKA 3JSAA 3MB5A 1W73A 3OLWA 5EEHA 3D2CA 2JGNA 3GHHA 4X20B 1QAOA 3ER6A 1JFTA 3PTAA 2IOQA 3JQQA 2BUAA 2J3KA 3QG1A 4Q7MB 5EP1A 5F2KA 4X62B 1T8SA 4FWBA 1P9LA 3ZE2B 2I6TA 4LXYA 4B81A 1YVEI 2NVBA 1MPTA 3AU8A 1XTPA 4EY5A 2G8NA 1FRVA 4TOIA 5JANA 1XDSA 2QY9A 3DCIA 5K0SA 3B9PA 2OO5A 5LP6B 3CA8A 1B43A 1UXOA 3AB8A 1L5MA 3PNYA 1EGVB 2YC4C 4GBGA 1ORWA 3DE2X 4PPYA 2IHYA 1RI2A 1XROA 4I1PA 2FA9A 1GCOA 1OAOC 1KJZA 4U63A 2Q4TA 4GIBA 4R6WA 2D0PB 4TTAA 1R8YA 3L1KA 1GU0A 3THOA 3ZV3A 3E9YA 2IHNA 2OYRA 1XA3A 1J90A 4N41A 3CHYA 3O5AA 2BGIA 3BA1A 3D7SA 3W3ZB 2ADOA 2ZRLA 4JXJA 3WY9A 3MFQA 5LMCA 4YLGA 4ZO9A 3HXMA 2XQGA 2PQ6A 4XCVA 2YNMC 3QWBA 3TDNA 1NUPA 5MDHA 3AHFA 1U1EA 4B3TB 1I2DA 1LS1A 4W1RA 3RVBA 4Q4JB 1NULA 2MTBA 4TTQA 5JHHB 5AI5A 4AVYA 5I51A 5TIIA 3SMVA 3IVCA 3OETA 3ACDA 2E0IA 4L9SA 2C42A 5CDUA 3INGA 4QSMA 3IH5A 3M9WA 1MIOB 5E7IA 3TEMA 4BX0A 4LOKA 3V8NA 5IYZA 1W1IA 2FPXA 3M82A 2AD5A 2EBUA 3KD3A 1EK1A 2JK0A 3C2QA 6GPBA 1XO1A 1UBCA 1E1KA 4BLUA 1X7ZA 5LDHA 2ZVQX 1XVIA 4RMIA 3M6IA 3N2KA 3X0DA 5ALXA 3TW8B 1W8DA 3VNSA 4EHBA 1N1DA 4BYGA 5D5HA 4DV2B 1AG9A 2PAAA 2IIBA 2JFBA 5KNCD 2DWCA 2QAIA 2QRHA 1UM9B 2ZWIA 4FU0A 1O08A 4MHSA 3VISA 4KE8A 2JD1A 4H1VA 5L4SA 3NTRA 3SYMA 3DNPA 2AQKA 1G19A 3OOJA 1HNWB 3PQCA 3LGSA 4XDGA 3VHXA 3DFKA 4AP5A 1JHZA 3BRQA 2ZCUA 5IN5A 4IO0A 1NJGA 1T4GA 2P4QA 2NYVA 4JLUA 5AICA 3PUXA 5MFPA 2QPAA 2RHHA 4JIMA 5I7VA 1UOQA 1JG4A 1N2CA 5BWBA 4TRRA 3FYUC 3PC4A 2OFOA 1CY8A 4B47A 4HXFB 1Y37A 3UMRA 3MLAA 1CTQA 1RWMA 2A86A 1BGXT 3PNSA 3ROXA 3ZDCA 1XP5A 4R8KA 2FX2A 4AKIA 3H2IA 2PMDA 2OCYC 2HT6A 3BUSA 3U39A 4ZRMA 1GIAA 5SY4A 3LY7A 2X22A 1EZ4A 4KO8A 1ADJA 1R10A 3HCRA 4WESB 3ZDQA 4E11A 3TOZA 2BHTA 3GEBA 2CXSA 2Q9CA 2JAWA 4ER3A 2D13A 2YH2A 4JS0A 3ZYCA 4AJPA 1DGQA 1BCRA 4FFLA 5JNTA 5L7YA 4X1YB 2BFOA 2HO5A 1VA5A 4TVBA 3ACBA 4FMBB 1EINA 3R3VA 3OPYA 5T5QA 3U48A 4JUFA 1AN9A 1JHXA 4MYSA 3X1XA 2H1OA 4PF1A 2YIJA 4G67A 3WDLA 5KJCA 4LS3A 5H3CA 5KQMA 4JGGA 3DOOA 3OMWA 1IK4A 4OCZA 3P71T 3PQFA 3H5WA 1QC5A 4OXNA 4NRDA 4P81A 4TMYA 2VTKA 3G17A 3P8ZA 5JCZA 2E5FA 4KRGA 3RQSA 2P77A 4CL0A 5J3JA 1P3JA 3HCOA 3IQZA 3L8CA 5L4LA 1S4MA 3GDOA 3KOWA 5SZJA 4MKHA 2X0EA 2PS3A 3RF7A 3W79A 3HK2A 4KI7A 5JSZA 3PNPA 3GY0A 4EGCB 8LDHA 2PUBA 3JY6A 4YV2A 1RRFA 1Z3IX 3HKCB 5EC8A 4DQKA 5CXSA 2B0JA 3RR2A 5LNK6 3HVUA 4OQXA 4HTFB 4IYJA 1E3WA 1PT7A 3PUYA 4H1HA 4J0EA 4QRIA 2IV3A 1DMSA 2HKIA 1HFKA 4WFQA 3WGYA 3PHHA 4H6XA 4JLWA 2B1GA 3T5PA 3IP8A 3IEMA 2PFSA 2ZJ8A 5A9TA 2R6HA 1ZOLA 1YCDA 2VYNA 3JARB 1X1EA 4XB6B 3GP3A 5ALPA 2IPMA 4E2ZA 1OXXK 1J2JA 5CNMA 5DVZA 2UUBB 3LF1A 4BNWA 1Z26A 5K0EA 3WL3A 1PDOA 2H1CA 3QIAA 2NACA 4I4LA 4N5HX 2IYTA 4HWKA 3ZZMA 2ZI9A 2FEAA 1E8MA 1OJ7A 3I4FA 3WV5A 3TTWA 3ZOKA 1NQUA 4B45A 4EYEA 2BEVB 4OJKA 3G0CA 1QE5A 1A2KC 1FC0A 4PC3A 5H83A 1NRWA 4NEGA 3V8PA 1DDOA 1HI9A 2PPLA 4PHGA 1E6WA 2ILVA 3VDMA 2W2LD 1V4BA 4O3FA 4EYKA 3D8NA 1SG0A 1K8ZB 2C4UA 2B4KA 3IUNA 2YVAA 4NOKA 4KXFB 1BC5A 4J29A 3AKZA 1WQ4A 3E3NA 1L7BA 1I8TA 3ONFA 1FUUA 5CA0A 2EP8A 2FPKA 2GF2A 1NQOA 4NC9A 2RGNC 3CB4A 3HFSA 1OMOA 3AOGA 3RRBA 1YBHA 2PM8A 1DDIA 2LP4Y 1MPXA 3ILHA 3JD4A 3BJEA 4KN9S 4QBGB 4RPLA 4A10A 1H2WA 1VPDA 2XW6A 5E1BA 5LQSA 4CF5A 4ICIA 2C5FA 4N54A 1MHPA 3BWEA 4TN1A 3SE0A 5KYYA 2GJSA 2O20A 2ZUVA 2O8EB 3DL7A 2G82A 3UJCA 4HFNA 4DIKA 3C3CA 1ZVMA 1NURA 4Y1EA 4Y9UA 5DCLA 1ESNA 1Q7RA 1F6BA 1XRJA 4QARA 2IUFA 3WIBA 2HN9A 1L4KA 4A0HA 2GESA 1QTIA 4M0KA 2HLDA 1WXWA 1GPNA 2WW8A 5DYNA 3ADBA 3IE1A 1WTCA 1IOWA 4LSZA 1AA9A 4O0LA 1KDPA 1Y7HA 3C3JA 3UXEA 5MN5A 4IG4A 1XG5A 1NNSA 2I33A 2RH5A 3B9QA 1DAMA 1T6YA 5ENDA 2ZJYA 3LX6A 4NPHA 3NOVA 3DYVA 4R54A 4JEIA 3MM4A 1O9GA 4TLLB 3QXXA 3LOUA 2K2WA 2PKQO 4B76A 4WBXC 3ET4A 5B7QA 3VOAA 1GV0A 1US8A 4N0PA 1MO6A 3J81k 3WX0A 1WBBA 3BFXA 3FZQA 1WF3A 3GOQA 3I28A 4ZO8A 4B8YA 1CZOA 3L7BA 1NMEA 3I39X 3VMFA 2QE7A 1UPTA 4TS4A 3NFYA 1ENZA 1IZ7A 1NI5A 1JKIA 1HT0A 1P39A 1CZUA 2A57A 2P6UA 3KC2A 4S1PA 3ASYA 3TL2A 3WKCA 2P1DA 4PLGA 1U63A 3AY0A 3MUOA 2H5EA 3GLIE 1OPXA 3V9PA 4RPCA 5C32A 2E87A 2OCXA 2QVYX 3SIRA 1RJEA 4B4WA 2UYHA 4PSVA 4RULA 4NBTA 2RE8A 4KZPA 4QYTA 4UM9B 1NW4A 1SKAA 2DFDA 2WMDA 4LCJA 2WSLA 1R4ZA 3COYA 5E4TA 5EXPA 3UUFA 1HTTA 1IEQA 4IP0A 3W5HA 5JVDA 1VPLA 3U3KA 4BNDA 2ZUEA 2EKZA 3GCDA 4GPAA 1F2TB 2WJZB 4WX2B 4YJFB 4L4RA 4ZAYA 1J5XA 2P2SA 4I36A 5JECA 1IDOA 3GK3A 2F3QA 1CZKA 1GDDA 4G5SA 4KI0A 1DEOA 1N34B 3K0EA 4MV3A 2ZUDA 2X4LA 1N2OA 1CUIA 3ECAA 1WPRA 4OHOA 5LA6B 4AWAA 3OEHD 4JJAA 1JDPA 3U7IA 1IY2A 1IHXA 2COUA 1PKXA 3PF8A 4CG2A 4CNQA 4HEJA 1EFDN 4K9LA 1OR8A 4UFOA 5AH0A 4C43A 3PHIA 4E2WA 3T1VA 4YAWA 1U6JA 2VDMB 4URZR 4PX5A 3EK2A 1G3IA 3DF9A 4Q1DA 5FUVA 5HILA 2Q6TA 1O8BA 2DH5A 4ZT4A 4CTNA 3MSCA 1LLQA 3OF5A 1QANA 3BAZA 3MMSA 4C2AA 5EG5A 1IUNA 1SZJG 2JIZD 4DNQA 3EGCA 1A88A 1EHCA 4DZZA 5IT5A 5CXXA 5JG7A 4WMLA 1QQAA 1UZUA 2D2FA 5ES3A 2XCSB 2JFUA 3IAS6 3THWB 4LDAA 2YYAA 4Q3DA 1X1RA 1CWUA 2F1HA 2PO7A 2J7KA 5B1SA 2CLMB 5AKYA 3I23A 1QYDA 2AXNA 3OZCA 2COKA 4TTSA 4OX9B 1X7XB 2HCFA 1N2EA 2HC9A 2VP6A 3FVWA 3M6UA 4FE4A 5E7QA 5KSWB 1FFDA 2EZUA 3O73A 4L4SA 4PFSA 2HHAA 1H3FA 1QG0A 1G8MA 2RGBA 3SIXA 3U7GA 1JR2A 4Y18A 1VKJA 1G3RA 3KFLA 3PUVA 4RXTA 3ZTTA 1CBUA 2AN9A 4BAZA 2PZFA 5A2GA 1VFPA 2PMCA 2BMDA 5D6NA 4XGQA 2R8ZA 3CF2A 5FTMA 4FT4A 1M6NA 3ZD7A 3ESQA 1EBBA 3EMDA 3IPLA 5BV8A 1FSPA 3AGQA 4AJLA 1ULHA 4GXRA 3LQ2A 1EDDA 2WOOA 4I5IA 4MEBA 1YFLA 1XPOA 3CEHA 3LX4A 3PP8A 4QL3A 2BJVA 2C5HA 3FVTA 1KYQA 1ZLXA 4U02A 2VTBB 1XZEA 4Y9DA 4FT2A 2KBFA 1V9SA 5FNVB 3LT5A 4DR2B 4G0QA 3BRWD 4K6GA 1RLIA 4ZYXA 5B7NA 1PZEA 3A14A 1BVUA 3FYHA 3GPDG 5C1PA 2RD2A 4FOLA 1IL0A 3P4XA 1CJSA 5BUZA 1DJMA 4LKOA 2WUDA 2AJBA 3BMOB 3LU1A 4X66B 4J0QA 1JJ7A 1D04A 4JELA 3OCJA 2PNJA 2JA2A 1TQ4A 4N1AA 5FLKA 2QUKA 2X4GA 1RHUA 4FWTA 4P4UA 1M54A 5KMGB 1L7MA 3R41A 4NOLA 3RSLA 4N3GA 2DAPA 2IV2X 2X5OA 3KPUA 5JCOA 3O8QA 5C34B 3R7LA 3ONVA 5K6AA 4PZCA 1EMDA 2QTZA 2SICE 3ZQ6A 1Q0LA 4PC7A 5NLLA 1HL7A 2H0AA 3D8SA 3HCPA 3VTFA 2YIMA 1KQOA 3HVKA 3AVTA 2C83A 4HX2A 2GWHA 1H85A 3A6ZA 3A37A 2Q45A 3A32A 1IZZA 3SBOA 3CV3A 3GP5A 1W8IA 1NE7A 3CR8A 1PJQA 3DCJA 1XZNA 1EBFA 3OZXA 5F3DA 1NLUA 1N1EA 1XCOA 1KBOA 1GKYA 1V0JA 3DGFC 5HS6A 2VVTA 2V0GA 1AQYA 4HEQA 4NMWA 1NMZA 4E7OA 1YQWA 4R8MA 2WSYB 5IVIA 2W6PA 4CBVA 1K4YA 3AESA 2RGNA 1ADFA 4QPPA 4OLJA 2ZK7A 4C7JA 4DPLA 3TQHA 3H6GA 2XUHA 2D1YA 4H31A 1G5PA 1QV7A 2JDID 1ZJZA 1G66A 2GEJA 4X8OA 5TVKA 5HTOA 1OYWA 5B12A 4PG4A 1J8QA 4HPXB 3CX8A 3AEUA 1XQ9A 4TV8F 5EXEA 4AC9A 1GAQA 2ECQA 2JGJA 3L82B 2NVUB 2CLIB 2X15A 4YRKA 4MW7A 1XF9A 3H1AA 1BZYA 3JAMA 1OWLA 3FSRA 1VL1A 3KVOA 1ZYUA 3DOCA 2ID7A 4RH0A 1T29A 2C97A 2POCA 2QTLA 4W1QA 5AR1A 2P5TB 5JQGA 5BWCA 1TU3A 2IXTA 1J0XO 3PFKA 1ZIOA 4TQAA 4EPRA 1WD5A 3NVDA 1FFXB 3PYXA 1YRWA 2VQSA 4FN5A 1RYNA 1Y48E 1LPPA 1FFXA 2HIHA 3UHOA 4DCMA 2BF4A 5AHOA 2I4RA 4HNTA 2PYDA 5HQTA 3L43A 2XOKD 1PX0A 3DBOB 2OHIA 4JP8A 4OM7A 2PBFA 4JU8A 3M4ZA 3IX7A 4LQLA 4ND6A 4Y2JA 2IOFK 3NALA 4X9XA 2OWDA 1X9HA 3QIVA 4GLOA 1L5NA 4CKEA 4L7QA 3FYUA 4HUQB 1MO5A 1FEZA 1O96B 3DUWA 2ON6A 2XGGA 1EUDB 4OIFA 4YH1A 4EB6A 1C7IA 4U0JA 2V3CC 2QJRA 1Z7BA 4K9SA 1TT7A 5A3VA 3RYHB 4C4PA 1HDZA 2ZJ6A 3P97A 4ZVRA 4ZOQI 5JJ5A 4KQIA 4PBRA 1NUHA 3DDZX 4MP3A 4QDJA 7REQA 1MFZA 5JSKA 4DA8A 1NJ1A 2MYNA 2A1UA 1BGWA 2Y8EA 2QI9F 3SF0A 4Y1GA 4E09A 2VEOA 2NTJA 3N6RA 4XGNA 5K03A 2CDAA 3ROFA 3BIJA 3GO4A 5KNDA 2OGTA 4NMLA 2G88A 4GL4A 1L4EA 2H5IA 2YYZA 3OOYA 5ALJA 2BTQB 4N39A 3G1WA 1M33A 4AKSA 2J9XB 5P21A 3ANTA 2ISCA 5KC8A 4GP7A 2C4VA 4DR6B 4FC6A 4C01A 2QKYA 2H59A 2H54A 3RANA 4HNAB 2V1UA 4BQOA 2JS7A 5CX4A 2ZEJA 4UVGA 4I5DA 5CIQA 4DMKA 5C1IA 2RFLA 4J1QA 3RWOA 1J8YF 4IIUA 3LTNC 2O2EA 4WDRA 5TJHA 3I9FA 2I6GA 3SBXA 2J33A 1B16A 4ARBA 3UV7A 5HDBB 3ZVNA 4QXQA 3WYBA 4J0DA 5BRNA 4FHGA 1CQXA 1MRSA 1OLSB 2R3SA 1R3DA 4ZYVA 3A7EA 4MHTA 2JAUA 4IIJB 2CNKA 1L4BA 2EFJA 4IDPA 1YS1X 2BD0A 2A9PA 1SIBE 2BEUA 4H1TA 1XRRA 1A96A 1GCUA 3NTOA 1C29B 3FNFA 4AAYA 5KSZA 1T36B 2F8LA 2W0MA 5BV1A 2I1WA 5L8VA 2F3PA 1X8LA 2DG2A 1EB8A 2NQTA 3E03A 4W1PA 1G6KA 1HG1A 5M29A 1ESEA 4MUHA 4DF3A 1IWPB 3DEJA 2WNIA 4MOWA 1KARA 1W93A 5B2ZA 4MCIA 4XX0B 4OA8A 3HDTA 3OQIA 1Y6GA 2C92A 2WKSA 3D6MA 3DPUA 3ZX5A 1TNDA 1JKMA 2RDMA 3RUAA 4FIZA 4M0UA 1UKEA 3UC5A 3ADCA 4B3RB 2AEEA 1XDUA 1CUZA 3QY9A 3SICE 1HLPA 1DQNA 4ARVA 3JQ7A 1TVCA 1P75A 4RZQA 1U2DC 4KWIA 3V48A 3EIXA 3INNA 3B1FA 3EPKA 4QDUA 1Z8HA 2HMUA 2V3WA 4EUNA 2JHGA 3DMYA 2I2FA 1UBKS 3HU3A 4P5DA 3K09A 4P4SA 3E9QA 4I46A 3SOZA 4L9AA 3DHVA 3E70C 4HV4A 1SUIA 2QL7A 2OKCA 1I2MA 1PTJA 3HMQA 1PK9A 1CUVA 4UHCA 1E9EA 2ZIUB 4ZC8A 5H3LA 1J8VA 3SLRA 3T41A 3ZHBA 4B3FX 3SC4A 3RO7A 3PJFA 5ARDA 5AW5A 1NDHA 3FX2A 1P5RA 3MZ0A 4YJ2F 3FPEA 3ZPXA 1EB9A 4JLSA 3G59A 2QJWA 3IKJA 3BZWA 4MVCA 2O52A 3RS4A 3WLMA 3CPSA 3DTYA 5EJGA 1EX9A 5E0KB 4QQFA 2ZBRA 1QWSA 1OZ0A 1T3TA 3CLUC 2LUOA 5G2OA 4CQLB 1UBRS 2HSWA 4LE0A 1ZK2A 4Q16A 4Y2TA 3TR0A 3ZU2A 1B0UA 1KOGA 1V1RA 1E5DA 1E3QA 1YJBA 3I2YX 2PVSA 3ZDAA 1KTVA 1PJSA 2CWWA 3F5FA 3I2JA 4JCCA 4CZ2A 1SM4A 4KYTA 2DUWA 4QULA 4BNIA 4OUKX 2O6HA 5IEBA 3DV0A 4X65B 2CBGA 4WCDA 1HZZC 3N7AA 4R9NA 3EA4A 3RUIA 1CT9A 1VPWA 3VR3A 4ZN6A 2A4MA 2OMKA 3ITNA 3B5JA 2Q1UA 4FOTA 2BEJA 4TLMB 4QVIA 3AI3A 2PNFA 4YAEA 1K7SN 1IUKA 4N8DA 4Y0VA 5K3BA 4JMLA 4A92A 5JCXA 5JDCC 3TQFA 1ZNXA 1W4RA 3CNBA 1ODJA 5ALGA 2HXYA 4DDTA 1GYPA 2VJLA 1PR9A 3WRXC 5ILOA 5DMHA 3TGPA 3AY3A 1ZH4A 5HMLA 3UO8B 3I32A 1OU4A 5AK0A 4PCVA 4X5OA 1J49A 3C98A 5FPQA 4ZZ2A 5LZ9A 3H1EA 2HV9A 3AU9A 3UATA 3GLSA 4N3BA 3IVMA 2O0JA 3C8HA 3KEGA 3GUZA 1XN1A 4E46A 1MGOA 4C14A 4E15A 4C3VA 2BFFA 3G2LA 4IJ5A 3T15A 1OXUA 1NC1A 4TTIA 1AXRA 1OBCA 2Q0SA 2WLSA 3ZJ5A 1YCGA 3COJA 4X92A 5GINE 4CMAA 2V6GA 4L2IA 1Z37A 2IWHA 4FR2A 4BP8A 3I34X 2DM6A 2J9FA 2R0QC 1LSUA 4J4HA 1RXUA 3ZV4A 2H2HA 1T1JA 2PX5A 3BEDA 3C4JA 3PZRA 1II8A 2W2VA 4OBXA 4ACBA 4EY7A 4ZHQB 1CJMA 2WJ4A 1DIAA 3IIKA 4BMXA 3OCCA 2RC6A 5D3MB 3RSGA 4F21A 3FTEA 3NG1A 4WFJA 5CP8A 3FWYA 1ZRSA 2ATXA 3H5IA 3WLJA 1X2BA 3HJGA 4QGGA 1UKAA 5EOVA 3JR3A 1WZUA 2SNIE 3PXDA 4KU4A 3QITA 1GPKA 1UPAA 5F5NA 2QD3A 3RKRA 4BO6A 4ER7A 2A0KA 1DOAA 2NTYC 1NKSA 2XY4A 2BV3A 4MRRA 5CFZA 1E0KA 2EAUA 4UQPA 3WSTA 2KE5A 2D4AA 1FCJA 2FMIA 4RVSA 1VI2A 1T26A 1X7WB 1I10A 3AF4A 2ZLBA 4XX1A 3ZTYA 4CLOB 4E21A 2PBZA 2QW0X 5GVRA 1HDIA 1XCLA 1F48A 2Y67A 1BVYF 3IPRA 1XV5A 2OKGA 3JASA 4PCLA 5LSAA 1HM5A 3IELA 1RBZA 1MVLA 1Y9AA 4BFVA 1P9RA 2ZZMA 2WF7A 1VJTA 2HZ7A 4KO1S 4MK4A 4PWZA 4URYR 3UXYA 3GRZA 4FEYA 4FNOA 1E69A 3LXUX 3AL2A 5IK2A 3C1OA 1WXHA 3U3MA 1TM4E 2R6JA 4F2HA 1SZCA 1DHTA 2FFRA 2GX6A 2O8DB 1AHNA 3AFGA 1SOAA 3FCAA 2GRUA 2EW2A