4KEAA

Crystal structure of d196n mutant of monoglyceride lipase from bacillus sp. h257 in space group p212121
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
248
structure length
248
Chain Sequence
SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 94
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4keaA00
3V9AA 4EA6A 1YB7A 3DYVA 1WB5A 4H77A 1VLQA 3KOOA 1BN6A 5DLPA 5ALDA 1EB8A 2RGUA 3G0DA 1GPKA 1EH5A 2QUAA 7YASA 1DWQA 3OM8A 5DNUA 2YASA 4EY7A 1ORVA 1ZJ4A 5ALRA 1H2ZA 5JADA 4X92A 2WM2A 1UKBA 4CFSA 2XMSA 2OGZA 4G8DA 3P2MA 4INZA 1CUJA 3PDCA 2AJ8A 2R8BA 5LZ2A 4WDQA 2GZRA 3HRHA 1VXRA 5A7FA 3C8DA 3H18A 4F60A 4L3WA 2VJBA 5A62A 4W63A 4N8SA 1UOPA 4FLMA 4AB1A 1ODSA 1CUSA 2Z8XA 2CJPA 3D4LA 2UZ0A 3V1MA 2VSQA 1SCIA 2AJCA 5C7YA 3STUA 3S8YA 3DL7A 2X76A 5CH8A 2C4HA 4DMCA 4RE6A 4A23A 1A7UA 2XMGA 3IURA 2AJLI 5K3AA 2QMQA 1QIJA 3KWJA 3H2KA 1JFRA 2WHRA 2ZYRA 1DWOA 5AKJA 3WIOA 1CV2A 3AIMA 4Q3LA 1J07A 5ALWA 3WJ2A 3QPDA 3ESCA 5KWIA 4RGYA 5AK4A 1JI3A 4BVKA 4OCZA 5BWBA 3GELA 5AM1A 5AO9A 4G4JA 1MX9A 4FTWA 4WY5A 3ESBA 4G5XA 5JZ9A 3IULA 3DNMA 3C70A 1QIHA 4OB7A 5JARA 3H17A 4IH4A 4B85A 1UK7A 3LIPA 2GYUA 4GEGA 5CW2A 2XUFA 4PF1A 1E8MA 3D5EA 1X70A 2VA9A 1FFDA 3D0KA 4HXEB 5ALVA 4XX1A 2ZYHA 3DCNA 4FLFA 4Y2SA 1ISPA 1ACLA 4ZV7A 1MO2A 5T4HA 3BL8A 3QMMA 1EVEA 3F96A 5C81A 1CUAA 3ICWA 3BF7A 1K8QA 5SYNA 1ETHA 3QMWA 1UXOA 4Y2YA 4XIIA 3AJAA 2GYWA 5A6VA 1JJFA 1AURA 3FCXA 2WIFA 3EIOA 5JAUA 3WWCA 3KSRA 3ZLVA 3N2ZB 4BBZA 4HXGA 4Q3KA 3M81A 4J0HA 3AZOA 1Y7IA 5T4FA 3STVA 1MJ5A 3H2GA 1OCEA 2G63A 1H22A 3D2BA 3K2IA 2JGLA 4B0OA 1K63A 1AQLA 2BGRA 4D9JA 3RK4A 3WK4A 1E3QA 4BRSA 2WIJA 3FNBA 1ORWA 4V2IA 1X2BA 2XQJA 2CZQA 3O4GA 1R3DA 4BP8A 1AC5A 2Y6VA 4C6HA 2W22A 4DLNA 1ACJA 3O4JA 3VVLA 4G8CA 1XQWA 3CCCA 3KXPA 1AMNA 1LPMA 1XRMA 4J0DA 4KYVA 1J1IA 1SCKA 2PX6A 2OXEA 1WCYA 5LZ4A 4OPMA 2HA2A 1RYYA 5JD5A 1G66A 1ODCA 1DINA 3F9CA 1KEZA 5JATA 5K3EA 4BCCA 1KU6A 1QJ4A 1VZ2A 5HFNA 4AQDA 1LPAB 5CURA 2H7XA 3WL7A 2WKWA 4W9RA 1GPLA 2YYSA 5LZ9A 2I78A 4QWWA 3WL6A 1R4ZA 5AM5A 4G9GA 4KR0A 2WILA 4G4IA 3DOHA 4UBOA 3V1NA 2XMBA 5ALNA 3WKBA 3WIBA 2OAEA 2XQIA 1A8QA 5EI5A 2ORYA 1X2EA 4B9EA 3JWEA 1FFCA 5EHZA 1L7AA 3MVEA 2BJHA 2WFZA 1ODTC 4WDRA 5IVIA 1ZIYA 4B0PA 5ALPA 5JAHA 4AX4A 3FCYA 4JYMA 1GT6A 3WQHA 5DTJA 3WA7A 4CCYA 1VA4A 1IUOA 3F98A 5HZGA 1CUZA 4U2BA 3G0BA 5ALJA 1L7RA 4DTCA 1BU8A 3SK0A 5A71A 5AM4A 4LKOA 2OCGA 1QIDA 4G8BA 5JD6A 5FXMA 1USWA 4QNNA 5ALMA 3JW8A 1DQYA 1QONA 1B6GA 3VISA 1UK8A 5CMLA 5D7BA 3EQ7A 3HJUA 2OCLA 1UK9A 4LXGA 3UUEA 4X95A 1UKAA 4DMHA 4K5QA 4FBMA 1EXWA 2OAGA 5JIBA 4B9AA 1GGVA 4JH0A 4LYEA 5T4EA 2HHAA 3WI7A 3YASA 4GXNA 4ZGBA 1GZ7A 5CXUA 4PSCA 2Y2UA 5HQ3B 4K6KA 3IUQA 4ETWA 3LS2A 1YAJA 3HEAA 1ZI8A 2AJBA 1CUDA 2WUGA 2DHDA 5AM0A 2QJWA 3RARA 3PICA 3HI4A 1O6FA 5ALZA 1ZICA 1CUXA 4P93A 2VAXA 1S8OA 4GECA 1U4NA 4H7IA 3BWXA 3LP5A 4CG1A 1XZGA 2HL6A 4QZVA 4ZREA 5ALTA 5EHNA 4KRYA 2DCMA 1QIGA 2Y6UA 2QR5A 1CVLA 2WTNA 1R50A 1CUUA 5C8ZA 5KWJA 2B4KA 2WU3A 5C8VA 3VVMA 1XFDA 5E4JA 4FBLA 4DMKA 4IH1A 3HXKA 3CCBA 1WM1A 4HAIA 5LIPA 5EGNA 3N0TA 5FOQA 2V97A 2XUDA 4UBKA 3FVTA 2WFLA 1JJIA 5ESRA 3EBLA 4HRXA 3DD5A 4FHZA 4FFWA 4H7FA 2WIDA 3H1AA 3ZPXA 5K3CA 3C5VA 3AFIA 2XUOA 2HA5A 5LYYA 3STTA 3OOSA 2WUEA 3M83A 4YPVA 2WHPA 1UK6A 4IO0A 4KJXA 5YASA 3C87A 1UOQA 4W1PA 2WUFA 3HLKA 2B9VA 5DYTA 2QRUA 1EDEA 4FMPA 4CI9A 1MU0A 3AZPA 1XRQA 3KD2A 4C4XA 2ACKA 4GBGA 1WHSA 3WWDA 1F8UA 2OGTA 2HRRA 1MAHA 3GBSA 2PSEA 1TCCA 4FNMA 1MPXA 5D3KA 4EHBA 4JEIA 2XE4A 3C6YA 2BAGA 1Q0ZA 1R9NA 1QO9A 1HL7A 3WKDA 5FPPA 3FYUB 4BE4A 2ROQA 4EY8A 1CUCA 2C0QA 1UKCA 3AZQA 3MUNA 3DOIA 1XZMA 4KAAA 4P08A 3IUMA 4PW0A 4C89A 4CCWA 3IUJA 4W1RA 5HKBA 3W06A 5AI6A 4OB8A 3HZOA 2XUKA 4J0GA 2VJDA 5EHXA 3SWWA 1VE6A 5A7HA 4F21A 1HKHA 2O2HA 1THGA 3QMVA 4ARAA 2WJ3A 1FFAA 2VT6A 1J06A 1LBSA 2XMDA 5AKYA 3H19A 2VJCA 3WZLA 3WKAA 3L1HA 2XUAA 4BAZA 1XZCA 1W76A 4K6GA 3R3UA 6YASA 2WLSA 2V9ZA 3LLCA 2WSLA 4DIUA 2PSJA 2HIHA 5BV7A 2Q0XA 2WHPB 4B80A 3BIXA 4Y2RA 1WPRA 2ZYSA 2DHCA 3B12A 2X8BA 2G5PA 4E46A 3ZI7A 4EY6A 4Y2UA 4X94A 5AKGA 2ACEA 1QIIA 1XZLA 2C7BA 3ANTA 3SX4A 4E11A 1BROA 1XQXA 4QDZA 1QE3A 4UBLA 5FUMA 2XUQA 3CN7A 5EIAA 3G7NA 5ALEA 4NMWA 2BKLA 1TCAA 2I3DA 3WL5A 3V48A 1QFMA 4BATA 1EX9A 1DQZA 3A2NA 2JGJA 3LIIA 1L7QA 3QH4A 4QDUA 1DWPA 2J4FA 1U8EA 3V1LA 3U1TA 2XI4A 1TK3A 1XZJA 5I9IA 1U65A 1XLUA 4FLEA 3IIIA 3FSGD 5IVHA 3C45A 5DNWA 2BGNA 1YS2X 3TRDA 2O2IA 4NZZA 4B84A 3VJKA 1YASA 1ZJ5A 1N5MA 2I3ZA 1YA4A 4BTLA 5CT6A 2XB6A 4Q82A 3FYUC 3RKSA 2B61A 3A2MA 1W75A 1A8SA 1R1DA 3ESAA 2PU7A 1CUGA 2JGIA 2EDAA 1G42A 3DKRA 4ZI5A 4LHEA 3H2HA 2GBCA 2HADA 1VXOA 4J0JA 3I2HA 2RI6A 4K6HA 4TGLA 4DNPA 4A16A 2JGFA 2QXUA 1CQWA 3G9UA 4FDMA 1EA5A 1QFSA 5KBYA 4X7BA 5ISMA 1EI9A 2BFNA 4AN1A 1GKLA 3SC2A 4PSDA 1YSCA 4FWBA 2HA0A 4IH9A 3FSGA 2XT0A 3DL4A 3G0GA 4ZV9A 1MX1A 4PQEA 4RPCA 5AI0A 4QE3A 3EQ9A 4BDTA 4BE9A 4EY4A 5ALLA 4L9AA 3IA2A 2Z3ZA 4G9EA 2J3QA 4Y7DA 1WPXA 4J0IA 3WL8A 2VEOA 2PU5A 3V1KA 3DDUA 4UHEA 5AI9A 5AKHA 4HVTA 3WLAA 5FRDA 2IITA 2RONA 3EF3A 1FFBA 5K3FB 4LXHA 1BEZA 2HDWA 2VAVA 3BDVA 1XQYA 2K2QB 5CBKA 2W6CX 3W04A 1LPOA 3T52A 4DYHA 1SOMA 4OU4A 5AK3A 1H23A 3WWPA 3W2TA 2IX9A 4FOLA 2XQGA 5F4ZA 4H35A 2XQFA 2HU8A 1YS1X 3WYDA 3FLEA 4OSEA 2O2GA 3DJYA 1Q84A 3RM3A 4CG2A 1EINA 3GA7A 2XDWA 4MYSA 4QWMA 4QLOA 1A8UA 5HFAA 1CEXA 1EHYA 1BRTA 4FKBA 4X71A 1QTRA 2ZJ7A 3FWHA 2CB9A 1PJAA 2JIDA 1BE0A 1UZAA 3QVMA 2QUBA 4CIAA 3WA6A 1MNQA 3UMJA 3B3QA 3G8YA 5JANA 3A6ZA 4I3FA 2BUAA 3NOXA 1GQRA 4GWLA 5EIHA 1EK2A 1XRPA 1RWQA 5EFZA 1G4HA 1QIFA 2VJAA 1XZBA 1FJ2A 1ZD2P 3MGAA 2PVSA 2ES4A 3A2LA 4B82A 2RHWA 2XMZA 2BUBA 1CUVA 4GI1A 2QS9A 4N5IX 4ROTA 5AM3A 3FYTA 2XMQA 3G9XA 3X3HA 1N5RA 1GQSA 4FNGA 2QVBA 5JZSA 1Y37A 1CR6A 4HRYA 2WG0A 1GPNA 1T2NA 1D07A 2GBFA 2QT9A 2WFMA 3W9BA 4UPDA 4N5HX 3R3YA 3H2JA 3DEAA 4P9NA 4PV7A 4B81A 3FOBA 1P0QA 1XKTA 4U2EA 1IMJA 3GFFA 3PF8A 3D59A 1J2EA 1NU8A 4QLAA 1QLWA 3R41A 4C88A 1SCQA 2NW6A 4H7KA 2ONCA 3WMRA 5AOAA 4BCDA 3IB3A 5ALSA 1CUWA 2H9YA 2OGSA 4OYYA 2OQIA 1YA8A 5AIBA 4UFPA 1XZIA 2HFJA 4PO3X 1LGYA 3OTQA 5A7GA 1C7JA 4BVLA 3AIKA 3IDAA 5AKIA 4H7DA 1CIJA 3QITA 1LLFA 1DX4A 4U2CA 1HLGA 3PUIA 4IQ4A 2RHTA 1OXMA 5ALQA 4MQMA 3BJRA 4KE8A 1JU4A 1YAHA 4NS4A 5ALYA 3I28A 3O4HA 5AKEA 4BC0A 4OUKX 1YCDA 1SFRA 4KAJA 1IUNA 5AKLA 3H0CA 3O4IA 4KE6A 5ALIA 1XZEA 2Z3WA 4AO6A 2RIPA 2WUDA 4BAGA 4W1QA 2QZPA 1XZAA 3F97A 1U2EA 3D7RA 4EUSA 1EB9A 5HCUA 1M33A 2WU4A 4C4ZA 2HM7A 1CUBA 3NWOA 2Y2VA 1HDEA 3O95A 1P0IA 2H1IA 3KDAA 3ZLUA 2XQKA 4DSAA 5EHQA 4Y2XA 4XVCA 5BOVA 2QOEA 5AI4A 3H2IA 1GXSA 3O9MA 1EDDA 3PFCA 1AUOA 4BDSA 5I7UA 5J3JA 3E4DA 2CBGA 5ALGA 5AK6A 1Q0RA 3I2FA 4KAFA 1EVQA 1CUFA 5FP0A 3DLTA 3AUKA 4UHBA 1C4XA 3M3DA 1XRNA 3G9ZA 2WJ6A 2WIGA 2WFLB 1MT3A 3PE6A 1W4LA 3STWA 5D3ZA 4QEKA 5T4BA 2WQZA 1XZHA 1ZIXA 1JU3A 4B7ZA 1BCRA 4F0JA 4BB0A 5HF5A 4H7EA 3VKFA 4UFNA 3WK9A 5K3DA 1TKRA 1HQDA 3I2GA 4U2GA 4AO8A 1AZWA 3L1IA 1F0NA 1VKHA 4J7AA 3K9BA 5AK5A 3OPMA 4PSUA 1QOZA 5D6OA 3DKKA 5HQ3A 2DR0A 1PFQA 5CTAA 2R11A 3QZUA 1YB6A 2HA3A 4P92A 3DYIA 4X90A 4TPKA 5LZ8A 1LPSA 1QIKA 1CQZA 1SC9A 2GBGA 3AILA 1IUPA 1PV1A 1ZI9A 5K5EA 3C5WP 4AMYA 2QKYA 1NU6A 1YR2A 4QA9A 2DQZA 1I6WA 1RP1A 4QDOA 4DGQA 1H2WA 2FJPA 2O7RA 4Q05A 4J0KA 1MAAA 1JKMA 4ARBA 3DQZA 2DSNA 4GW3A 4MWTA 2DQYA 3QM1A 4AN0A 4DNOA 4BP9A 4M0MA 3STXA 4JUIA 4Q3OA 4DSZA 5CH3A 1DX6A 5KREA 3S2ZA 2GBIA 1LPNA 3IUNA 1ZD3A 4WJLA 2ZJFA 1E8NA 3ILSA 2WHQA 3KWFA 3JYHA 1UWCA 1AGYA 5FDFA 1IZ7A 1W52X 2HU5A 1R88A 2H7YA 2EEPA 2VTVA 2OPHA 1VZ3A 4CG3A 4HTAA 5AKZA 3FLAA 5FKJA 3GUUA 3C6XA 1QO7A 4IHAA 1TQHA 2O7VA 4CCYB 4EB0A 4NVRA 1JJBA 2JGMA 4H0CA 1N8SA 5JD4A 4U2DA 5BWCA 1CPYA 2HFKA 3QYJA 2OLEA 1W6RA 4Z49A 2JGKA 1BN7A 5K3FA 4LYDA 4OU5A 4MXDA 1XKLA 5DNVA 3H1BA 2AJDA 1G5FA 3R0VA 1MNAA 2IIVA 5JYCA 3WYNA 4GLBA 2WG1A 3CN9A 5DJ5A 5HK8A 3HYSA 3QPAA 4QDTA 3HC7A 3U0VA 5C8XA 3WJ1A 3PFBA 1F0PA 1XZDA 1LBTA 3STYA 3FVRA 1WHTA 2VT7A 2J3DA 5FV4A 2G5TA 5DYYA 4H7HA 2X5XA 5ALUA 3GZJA 2DFPA 2Y1KA 3ICVA 1AX9A 4MEBA 3M82A 1QIEA 2YH2A 2V98A 3WK6A 1BEEA 3H04A 2HA4A 1P0MA 3QBJA 4J03A 4ZXFA 3PI6A 4Y2TA 2G4LA 4J0CA 1OILA 5CRIA 3I2IA 3A70A 2OCKA 2XMRA 5CXXA 2XUHA 4X91A 4M0FA 1KU0A 2LIPA 2CEKA 3FLBA 4C4YA 4UHFA 4UBMA 4X00A 5JALA 3ANSA 1TCBA 2D5LA 4X85A 1CFJA 4HXFB 3WK8A 2XLBA 3D2CA 3VJLA 1E5TA 3PUHA 4XWGA 2JGEA 1XQVA 1LPPA 4I4CA 2XUPA 5LKAA 2OCIA 3ESDA 3FAKA 4E14A 5AI8A 5JZBA 4AXBA 3E0XA 5AIAA 3HSSA 4S0XA 5CH5A 4JYPA 4C01A 4Y2JA 1CUIA 3O0DA 4I19A 4AZ3A 3F67A 1K4YA 1ZD5A 4X6YA 3I1IA 4X3CA 4H7JA 1N1MA 2I03A 3Q0TA 4KACA 5CT8A 2OQVA 5K3BA 1QGED 2ZYIA 4YK7A 4K2AA 4OB6A 3TJMA 4TVKA 3BF8A 3C6ZA 2HA7A 1ZD4A 2PKYX 2GYVA 3NUZA 3L1JA 2FX5A 4UHDA 4HS9A 4X93A 5H3HA 1ZI6A 1HPLA 2P8SA 2WTMA 5AM2A 4KEAA 5LZ5A 4AO7A 2XUIA 1WOMA 4B83A 2EDCA 5AP9A 5HK9A 3WK5A 1E66A 4KRXA 1FSSA 1ZGBA 3QPCA 3OC0A 4BZWA 2ECFA 5DYWA 1Q83A 3WKCA 2PSFA 3DS8A 4WFIA 2QTBA 5DTIA 4BCBA 2ZVDA 2HA6A 3CXUA 5HKAA 4DMFA 5CT4A 4OYLA 3Q8WA 1GKKA 1XRRA 3BJMA 4BAUA 4BTVA 5JAOA 1WB6A 4O08A 3I6ZA 5ALOA 4DNQA 3ZV7A 5AOBA 2C58A 5CT5A 3UUFA 4UHCA 4DNFA 3BIWA 3AINA 3NGMA 3I1YA 3G0CA 3R3WA 1DU4A 4WY8A 4A5SA 4X97A 4ZWNA 3AIOA 5ALXA 2PL5A 3VJMA 3G0IA 4RNCA 1VOTA 1IVYA 3HACA 1H2YA 4FFVA 3I6YA 4X6UA 4HZGA 2JEYA 4OD0A 4C87A 4GHWA 1ZOIA 5DWDA 5JAPA 4LXIA 3BXPA 5AI5A 5AJHA 2PUJA 1QIMA 4Y2PA 2XUJA 5EIEA 3PF9A 1TRHA 3HABA 2CMFA 4JNCA 2ZSIA 4L0CA 1MX5A 3MUOA 3D2AA 2E3JA 1C7IA 4H18A 1TAHA 5IVKA 2PSDA 1TIBA 2BUCA 4XJVA 5CT9A 1XLVA 4GDMA 1LNSA 1WB4A 3VXKA 4BVJA 1BCSA 2XUGA 3W9UA 1T4MA 1THTA 2DHEA 1XZFA 4YX9A 3RLIA 4N8DA 3BE8A 3ZLTA 1UT6A 1F6WA 3EQ8A 2VF2A 4Q34A 4UUQA 2C5GA 2C0PA 3R40A 5IVDA 2HRQA 2WJ4A 4DM7A 5LKRA 1DT3A 3TEJA 3D3NA 2CUTA 4KE7A 2QM0A 2XLCA 1EDBA 4AZ0A 1JT2A 1Z68A 3I2JA 3IVMA 3R3ZA 3G02A 4L72A 3BDIA 1R9MA 4MQLA 3F8SA 1W1IA 3O9VA 4UBJA 5ALHA 2J4CA 3G9TA 1CUEA 5AICA 2RAUA 2Z8ZA 4Y9SA 2BCEA 4ZRDA 1QZ3A 3I2KA 4QDXA 2HU7A 4WCVA 2PM8A 1XLWA 4LIPD 2QXTA 2JEZA 4G1FA 1K6EA 1DT5A 1XRLA 3E1GA 3VDXA 2JBWA 3I6MA 2D0DA 2PBLA 1ZGCA 5LP1A 5SYMA 4W1SA 2B20A 4J3JA 4MWSA 5LLSA 4Q1VA 3IBTA 4N8EA 1NX9A 1E89A 1XROA 5ALKA 3WWOA 1O6GA 3LCRA 5FPQA 1B41A 4G4GA 5HF6A 4BRZA 3WWEA 4EY5A 5IH7A 2C5FA 5AHXA 2JF0A 2VATA 1FFEA 4EZIA 5A2GA 2H7CA 2OG1A 4UFOA 3WKEA 3ED1A 4MJ3A 1DTEA 5HF9A 3WK7A 1QTIA 1HBJA 2FJ0A 1CRLA 5HF8A 1EK1A 4UBIA 1CUYA 3R3XA 4BC1A 5LZ7A 3GROA 1LPBB 4F5ZA 3K6KA 1CUHA 1A88A 1VE7A 5E4TA 5I8PA 1JMKC 3FYUA 2V96A 4M0EA 1XZKA 4WFKA 2PUHA 3ZWQA 1UFOA 1JMYA 2QJRA 1BS9A 1VA5A 2VQ6A 4EBBA 2YXPX 4MEAA 2FUKA 5AH0A 2ZJ6A 3C43A 4CIBA 1Y7HA 2CKMA 3R3VA 2Z5GA 4E15A 1AKNA 1P0PA 3W05A 4ITVA 5FLKA 1K5PA 2PSHA 1LZLA 1LZKA 4MYDA 3OG9A 4PNZA 2AXEA 4BZZA 3WZMA 5JASA 4BYMA 1H2XA 1IZ8A 4UBNA 3T4UA 4U2FA 5E2IA 2GZSA 4WFJA 5IKXA 3FBWA 3E3AA 4Y2VA 5E4YA 5AOCA 4UHHA 2XMCA 1MTZA 4X6XA 4YASA 1MN6A 5AKKA 1UOOA 4B6GA 3C8HA 1VJ5A 4RE5A 3C6BA 1E8DA 5ALFA 2WIKA 3TGLA 2ZSHA 3B5EA 4KE9A 4Y2QA 5AKXA 1CLEA 3OURA 2PPLA 4AMZA 2WG2A
chains in the Genus database with same CATH superfamily
1ZS9A 1GAXA 4JITA 4RTOA 2GKSA 2W9XA 5K45A 2PX2A 4PGAA 5L3SB 3ASUA 3R77A 1YB7A 4O2RA 3KT8A 4Y6PA 1J1ZA 5L3VA 1GN8A 2QENA 4I4TB 3AV3A 1XAJA 2EHJA 2XTNA 4IDFA 3KSAC 2ZJYA 1N7IA 3DT8A 4JVOA 1OWLA 4N0EA 1GGEA 1N2OA 2IELA 3KUUA 5EIWA 4JT9A 4ZI3A 4TROA 5F35A 1LTQA 2E0IA 3FDJA 1LDGA 3EVEA 3TQOA 5ALDA 1HDZA 5LDGA 3C3PA 1N8TA 1UBKS 3IAHA 2WWHA 4EEZA 4UQPA 5HCNA 4B79A 1LX6A 3TOVA 1E2KA 1MZVA 2QUAA 2VZEA 1RQLA 3EW9A 3LECA 1ZA2A 3MWFA 2EFYA 3UT5A 2C9DA 1L7BA 3SZ3A 1JPUA 1TQ2A 2PBRA 2UUBB 1WZIA 4K9DA 5H70A 4EY7A 2XYRA 2RHJA 5DGDA 2EJWA 4CHTA 1NJ1A 1G41A 1ORVA 1ZJ4A 5ALRA 4CF3A 4C21A 1KAHA 1H2ZA 4H59A 5DBIA 3EZXA 3NV7A 5M29A 3WBKA 4PHGA 5CFMA 1I33A 3JQGA 4X92A 5HCIA 3ANXA 4HGQA 4JASB 5BVHB 1SUDA 1FLDA 1YDGA 2OGZA 3G88A 3TTSA 1ST2A 4TKLA 4XLLA 4P4NA 1PHRA 3WNDA 5BNTA 1HE8B 4YV2A 2Y0DA 1ZO8A 3RIGA 1LRJA 4K0RA 2XV1A 1TJNA 3TNYA 1G17A 2GN1A 2PGXA 3QU7A 4LGYA 4WDQA 1KO4A 4ZO8A 4D9HA 4F8EA 2V0GA 2HBZA 4NICA 1U4OA 2V6BA 4N7JA 4ND6A 4DY4A 1G6KA 3Q6NA 4E12A 4ZYZA 1VXRA 1PGQA 4FOOA 4RHYA 3N58A 4N0PA 4Q5IA 3ZJUA 3I5UA 4R3NA 3C8DA 3BGDA 3HYCA 5ULLA 3CRQA 4ZHQB 2AUMA 5KVQA 1O97C 5DGXA 4DNXA 3CH5A 1J2RA 1V16A 2QW0X 4FSHA 4GGOA 3UATA 4CM6A 3N28A 4I5DA 5DHPA 4DCMA 1M6HA 5EXSA 5A62A 3LQYA 1I24A 1MJGM 4W63A 2I6TA 4KIJA 4N8SA 2F1JA 1C14A 3ZJYA 5LP6B 1QHHB 1DC3A 3KLMX 4AB1A 3GEDA 1YA6A 1VCHA 1VIMA 2SKDA 1JB9A 3D4LA 3MG9A 4JN6B 1GVHA 4HNSA 4JP3A 4C4RA 1I4DD 1W4BA 5L3QB 2XVXA 4AWAA 1Y1LA 3NR2A 4WOPA 2A8YA 3QUSA 2AJCA 3IMGA 3KCQA 4WK0B 4CDRA 2QL5A 3SFZA 1TYAE 3OE7A 1DFGA 3AHCA 5E4FA 3QF4B 1T2EA 4GMHA 4N5LA 2NO1A 1LRKA 2I3GA 1VKRA 4AKEA 1D04A 1UWKA 3UH0A 3M1YA 4A1OA 1UJCA 4C20A 2RHCA 3CH7A 1DWOA 4L7VA 1U7TA 2PKWA 3GYGA 1X8KA 3PHJA 4HX2A 6ABPA 2HJGA 4RELA 4JP2A 2G9QA 2J30A 3ZU4A 5DNAA 3LC2O 3WJ2A 2AYYA 1U9JA 4W5HA 5HGXA 5HZKA 1RZVA 5KWIA 2FPIB 5AK4A 1ZCFA 2R97A 3CUYA 3IPCA 1AGPA 4RH0A 4TVOA 3MRTA 4ABYA 4BVKA 4E5KA 1GKYA 4I2VA 2AKYA 5HW0A 5EZ6B 4HJRA 4V0LA 1XQ9A 4W9MC 4AS1A 4NC9A 1J8FA 1R4MB 1Y6GA 3JRWA 3RAPR 5BWBA 2LKDA 4N6GA 1ZN7A 3OFJA 2NZVG 4IQ8A 4E6PA 1VSQA 4BX2A 4WY5A 3Q3VA 3W8DA 1TF2A 3PC4A 1D9XA 2HF7A 3WMGA 1IEQA 3T7RA 4LJSA 3CTMA 4KIGA 3FN4A 4DQLA 1UAGA 1L5GB 5KYVA 5GY7A 2CJWB 3TIFA 1QIHA 2W6NA 1PJCA 3AONB 2ECPA 3J81k 3IA7A 2BE7A 4M1MA 1QQ7A 4HQ6A 3AETA 4HDQB 3C4VA 1CS4C 3L4BC 4HZUB 4LHSA 4IH4A 1UK7A 3LIPA 4G2TA 5B58T 4BWYA 3AR7A 3LBNA 3OZ7A 1GRRA 4PF1A 1PD1A 1PQUA 2FFJA 1QHSA 2HJVA 2H59A 3K09A 3BTVA 4BMSA 4ND3A 2P2SA 1JVBA 1NXPA 3KT3A 4Z4HA 2D4HA 2GEVA 1Y82A 2NQTA 2WVJA 5EVCA 3WB0A 3EFEA 3SQXA 1DDIA 3BXXA 2EKZA 3HCPA 2IEDA 2XHZA 1TECE 1JUDA 1B3BA 1MDFA 3W5VA 4D57A 4PC6A 1E1DA 3TBHA 5ALVA 3GFSA 2RD2A 2DBQA 2PS1A 3KZNA 1IBRA 3A11A 4XX1A 2VPZA 4W5TA 3PL5A 3BMNA 4E5PA 4IQGA 4OGFA 3ABRB 1SCDA 4UVIA 1ACLA 1P1FA 1JEOA 1VCOA 4ZV7A 5T4HA 4QXQA 2F8LA 3IBSA 3GUZA 1PV4A 4QYXA 2R8PA 4JEMA 1FSPA 4CEHA 3T3MB 2FR0A 4IXMA 3BG5A 1O95C 3DMDA 2YHUA 4ZT3A 1CUAA 3EEQA 5I47A 4FKMA 4IDPA 1II0A 1PJ2A 2DYKA 2WSSD 3R7SA 1K8QA 2A88A 1YONA 1XO1A 2C1ZA 1L5HA 2CJYA 1Q2XA 4C6TA 1UXOA 4HBGA 4QREA 4RFSB 4XIIA 3IQHX 3AJAA 4I3HA 3ENQA 4AYTA 5ARCA 1J09A 2BW0A 1HFEL 3HGTA 4RAQA 1N6RA 4NI5A 1UODA 3W6PA 2Z0MA 2CL7X 3B1FA 3DBIA 1KTVA 2PJDA 3BHNA 4IMRA 2Q5QA 4MH0R 3WWCA 4IILA 2JJ2D 5EKXA 2I34A 3SQLA 2FSUA 3KSRA 1AJEA 5BSMA 1S9HA 2AIRA 1VFNA 1P2VA 3AEKB 4Q3KA 1OYYA 3V8MA 2XIJA 4I1OA 4IIJA 3BGOS 4J0HA 3WB1A 2IYPA 2NO7A 3AZOA 5T4FA 2FB9A 2WB4A 1DELA 1VJTA 3D6VA 2P78A 1E0DA 4X1IA 1VG0B 2NN3C 2VYCA 4DCNA 5MGNA 3HRKA 1OCEA 4UOQA 5G0UA 4QYIA 3CKLA 4RPLA 2R7KA 5DLYA 4KPUA 2GMWA 1JHAA 3K2IA 2NUPB 1EDZA 1I30A 2JGLA 4UCWA 2ZT6A 3U1VA 3DWEX 3VR3D 4CM7A 1DV2A 1N2XA 4JYZA 1EGHA 4D9MA 1JAXA 3DF7A 1KMHB 3H6GA 2IIBA 2ONJA 1P18A 2ZR9A 9ABPA 1DG9A 1IXZA 2CZQA 3GQBB 3UZUA 3V2IA 1KQFA 3ZHBA 2GDJA 3D3KA 2Y6VA 3LC0A 4MKZA 4OFWA 3CZMA 3E03A 5JY1A 3LP6A 2VK8A 4IHQA 4QXRA 2CEAA 2BC9A 2KX7A 1T91A 4G8CA 4HDNB 2AW3A 1T9DA 2OBMA 4IIJF 2J9FB 4MVJE 4U02A 3TCNA 1TM3E 1Z82A 3CCCA 4MDHA 3W6ZA 5BN5A 1E1KA 4GUAA 3RT7A 1VL1A 1JWAB 2GZDA 4QAJA 1Q15A 4Q4HA 4PFSA 1C1HA 3LGAA 7REQB 4KYVA 2ZCUA 3OBIA 4JJKA 4R51A 4KLCA 2D2IA 4ZJPA 3UTDA 2JK0A 2N75A 3E3MA 1IG0A 2AG5A 5TRTA 4D8YA 4ATNA 1QRTA 5M04A 1NN0A 1YZVA 2IPMA 2CE2X 2FDXA 2YRWA 3P2OA 4HCJA 4P84A 4WXRA 1F4LA 2BI7A 1WCYA 2G76A 5LZ4A 4ENSA 1YR7A 3HDYA 4F2WA 2AC2A 1EUCB 2P2NA 1WMFA 4LVUA 4B1FA 1GNVA 3F2IA 1Q1AA 5BMVA 3QLTA 4Z3KA 5JD5A 1G66A 2NIPA 2V7QA 1E3TA 1G3QA 1OKKA 4CMEA 4NJOA 1GGHA 1JLSA 3WGVA 3K70C 2W8BB 4CMJA 4TSRA 4E33A 2IEGA 4G6ZA 1HLFA 1ZK2A 1PYDA 1VSUA 2ECKA 4MROA 1PG5A 4WI1A 1KY5A 1ENPA 1VZ2A 1IQRA 2AB0A 1T0PA 3MPOA 2O2CA 4Q03A 3SY8A 4DTIA 1ZW1A 5AW1A 1JE0A 4FOTA 4MVJM 3VR6H 3R24A 3B51X 3WL7A 4ZK2A 4W9RA 2IW1A 4P3OA 5HS6A 3ROPA 2YYSA 4MQ4A 4IJWA 4Q9LA 4YAKA 1O94C 3KR2A 5JBQA 5LZ9A 4A7PA 1EXVA 1U0TA 1Y7TA 1R4ZA 3OX2A 5KNDD 5DHSA 5AM5A 4AJEA 3AFMA 2SICE 5JCJD 1AVTA 1WBJB 1XNHA 1XTVA 3IEUA 3SG0A 3FNRA 3M70A 1K7YA 3O1HB 5B2FA 2P6OA 1KYIA 2CN1A 2FFQA 3GLFA 3JQRA 3AI3A 5ALNA 4KQ9A 1MRNA 5GIPE 2ZBVA 4FI3F 3R20A 2OAEA 4DIMA 5GONA 5K6TA 1YZHA 4MRSA 2XQIA 4MHTA 2CMDA 4MVJF 3VOSA 2QE6A 2VP3A 1L3BA 4O8CA 1R10A 2WV7A 3JD1A 4OAQA 1WMDA 1GZVA 4B9EA 1PVOA 4LOAA 5DH9A 3QEOA 3QFCA 1FVFA 2ZIVB 3VR4A 4CLDA 2BDTA 1U8YA 3ZYCA 3OSZA 4P5DA 2V7PA 2ARKA 2XTJA 3MJCA 4MV9A 1BD3A 3LMKA 1N6OA 5IBRA 3R9IA 3GL9A 3ZHYA 1YQXA 2ZVQX 4V0SA 3ZDDA 3PUZA 3EZ9A 3IODA 3VO8A 3MVEA 2BJHA 2WFZA 4O5AA 4ZOCA 3SBOA 1YRAA 1QTNA 2X41A 3WOVA 5CFLA 2QPOA 5AW2A 4WDRA 3CUWA 2GM3A 4FHCA 5C32A 4X66B 5ALPA 1P2FA 4EUEA 1EK5A 1TVCA 4WLFA 4AX4A 5LNK6 4QXMA 4DSOA 4JYMA 1NNEA 1NKSA 2ACWA 2CVFA 3I09A 3D5QA 2IUUA 3W77A 3WQHA 4EVRA 5DTJA 1A5ZA 4A91A 1OKKD 3NGXA 2QRHA 1UBLS 3JQ9C 1DQSA 3E15A 4NENA 2HHHB 1USIA 1IN1A 4ZVVA 1Y3HA 3F98A 5LP6F 5HZGA 2PYDA 2WWXA 2Q1WA 3ETEA 1I5EA 3G0BA 2R8EA 4J3FA 1D2MA 2ZR8A 4P3NA 1Z4PX 4LJ9A 5JQGA 4G5SA 4TYQA 3R7DA 1ZN2A 1P44A 5EJ9A 3T06B 1KHTA 3VNRA 5A71A 1FIUA 2I7DA 3KOMA 2OPBA 6REQA 1M1XB 3HCOA 1FVHA 2V7WA 3G9QA 4IAOA 1GYPA 2V03A 1G21E 2IY7A 4DM4A 3C85A 4QUDA 2ODTX 5L6LB 3TB4A 3WLLA 1BRMA 3A9WA 4Y6QA 1KO7A 4QNNA 4TYNA 5HZMA 1MXFA 2MSDB 4US2R 4FR5A 2DTDA 1F2DA 3JASA 3S8MA 4YRGA 3JW8A 4D92A 2O14A 1Z2OX 2MSCB 3GT3A 2FPRA 1DG1G 4JYCA 5CVVA 3P0EA 3NHLA 2YWXA 1M73E 1HE2A 3JPYA 1B6GA 4FUTA 2CNNA 3JVUA 4WOBA 4KMRA 1LK5A 3RREA 4NONA 1TT5B 1NURA 2Q6IA 4JJ4A 3QHAA 4K7JA 5I8WA 5FNVF 5KJCA 3EQ7A 4J2OA 2AFHB 3P9QA 1UK9A 2IL1A 4IXDA 1GPH1 1KNQA 2ZEJA 4CL0A 3NP7A 1H0HA 1TU3A 4M1QA 2IYNA 3UGJA 4DMHA 5ES4B 2BVNA 5I01A 2VJYA 1SXJC 2DPLA 5JIBA 4LE1A 3KV3O 3DMTA 4ZGWA 1J0AA 2XT9A 4EVIA 3U7GA 1O03A 4MULA 4Z4GA 4ZI7A 3JATA 1R6UA 2C04A 3ZBQA 4A0GA 3UH1A 4WACA 2W0MA 4EFLA 1F4PA 1RWXA 3B13B 4J3NA 3SOZA 4AU1A 4F93B 1V16B 1L7PA 4PYMA 1BCSB 4TT8A 3T0GA 4B47A 4E2WA 3RQIA 3NT2A 3OX4A 2OFWA 3FF1A 1T5SA 3OWHA 3V8PA 4ZGBA 3N6RA 2RI0A 5CXUA 2GPTA 2GTIA 4L6IA 3B70A 2Y2UA 2ZE7A 2NOAA 2R4UA 3BFPA 3NM6B 3QU9A 3IUQA 4K6KA 4Z4CA 1NUPA 1VHLA 2B4TO 1H69A 2B6HA 1GP2A 2E9SA 3WNBA 5KO2A 3HEAA 2C29D 4MJ7A 3GRUA 2P1DA 2BM9A 4K3VA 2AJBA 4WZBE 1GDDA 3TPFA 4I50A 3PHBE 3R6TA 4M49A 3RARA 4BO4A 3MLBA 5F1OA 3E48A 4WRRA 2K7ZA 1QGZA 3IP1A 5EE1A 1A9XA 2IE0A 4WBNF 3ODPA 3TINA 1S8OA 4GECA 4CNQA 4FFBA 1L5SA 1U4NA 1A76A 4H7IA 3BWXA 4Q00A 4CG1A 1KWKA 3DXZA 2E4YA 2GASA 2IBMA 2XYQA 3HB4X 4ZREA 3UJ6A 1BWSA 4JLOA 4DV6B 2GCOA 5ALTA 1JHQA 5HR5A 2R8OA 2A7XA 1P4HA 1WO8A 1F6BA 2C88A 2OORA 1PL8A 2DCMA 1RBMA 3IOYA 2ZSUA 1XN4A 2JK1A 5E0KB 5FYQA 1HKUA 1DAIA 4DUPA 4EI8A 4DLRA 1CVLA 1HZZC 3PTLA 5DRTA 1TUIA 1QZXA 5KU1A 4RMIA 1R15A 1JTFA 1A9SA 3KTAB 5JXIA 2A1UA 4D25A 5MF6A 2WMNB 3VPFA 3W79A 1RZRA 3H42B 2WU3A 4YPFA 5E4JA 4UNSA 2VWGA 1Q6ZA 1ILEA 1VG8A 3U7QA 4FBLA 4DMKA 4IH1A 1RBZA 3E70C 3HXKA 1WM1A 3B9QA 2R25B 4HL6A 3THOA 1Z5UA 3MRXA 3PNOA 5BRNA 3OUUA 4IJQA 1WVIA 3V1UA 3N0TA 1E63A 3W2GA 5K0BA 5LQCA 1UBHS 3OESA 1XYGA 1YMVA 1GNRA 2ZJAA 4UBKA 4JBGA 4EPVA 2PO5A 1U9YA 3ELBA 3D3QA 2P5TB 5D84A 2P27A 2HDNB 3HV0A 3AF0A 5ESRA 1E2GA 3ON5A 3PYXA 5CYFA 1DBRA 2ILTA 3TVTA 3GJTA 7ABPA 4MI6A 1TZMA 1TM2A 4NXMB 4FYJA 4OG2A 3REQB 3ZPXA 4F7DA 3H11B 5JMPA 1QV9A 3DV9A 4KVFA 2FP4B 3EXHC 4CIWA 1ES9A 3N1UA 5HJ2A 3ZV6A 3AFIA 2XUOA 2CE7A 4MYUA 3TE7A 3CVVA 3KFXA 4I14A 3V42A 1P19A 3CVXA 4YMSA 1R18A 2WZCA 3OOSA 3N2NA 3BFXA 5KDLA 1EGAA 4PYRA 3FUVA 1DEAA 3M83A 2DH6A 3ELYA 3ABSB 4IO0A 4YPVA 4XWWA 1YVEI 4H1HA 1J0CA 2Q41A 3D4IA 3UXHA 3MMNA 4DSTA 2Q2QA 3U7RA 2JLAA 3GMIA 4P5PA 4DA7A 2UU9B 3H75A 1HUQA 4A0SA 1R5JA 1BHJA 3B8HA 1NAHA 3D7LA 2OAQ1 3L0CA 4IIGA 2YQZA 5TMPA 3C97A 4QT4A 1EDEA 4CI9A 1GL3A 1U7HA 2IYWA 4N03A 1B4DA 3TNLA 4ENPA 1OXUA 2WHXA 4R81A 4ZC8A 1PK7A 3IKJA 1XRQA 4TV9B 1CNEA 1XALA 2C9CA 3GVCA 3NHZA 1LUAA 1BFUA 5FAKA 2IH2A 4K3UA 4DB2A 3KD2A 3TTVA 3D6FA 2QUHA 1O08A 2ACKA 4M9RA 5JCXA 4GBGA 1G8YA 4NDNE 3QBEA 3ROFA 1F8UA 4R5MA 1UEXC 3AXTA 4R2JA 2PGAA 3VU1A 1MAHA 4A73A 1Z34A 3QNMA 1ZINA 4XM1A 2C7OA 1YVPA 2AX4A 2VBCA 3VZPA 4BNDA 1DDOA 4O4LB 3ZXSA 4DRYA 4WKGA 2PAFA 3FBGA 4LDQA 3VVBA 1O0BA 1G4UR 4NH4A 3OQNA 2FUCA 2PWBA 2XE4A 4JEIA 4LRTB 4EHBA 3I52A 3ZGVA 1VBKA 4CLRA 5JD3A 2FWPA 1URPA 3W2FA 2BAGA 4E30A 4HUQA 4IIEA 1BQ3A 1JQLB 2XAAA 3QF7A 3FYSA 3MJEA 5HWSA 1ELOA 4JD5A 1IJFA 2PMEA 5ENDA 4TTVA 5TIIA 1GRQA 1OZGA 3AEUA 2PFGA 1E7RA 1M1NA 3MWDB 2C0QA 4EJSC 3FZQA 1W0CA 3HDHA 2O1EA 1BS2A 1GGFA 2JLBA 1RHKA 4YN3A 3KHUA 1O97D 4NWIA 4DYDA 1UBOS 1IOWA 3HJNA 2HDHA 4M8LA 5J2UF 2XWJI 3AZQA 1FP7A 3MUNA 4KN5A 3VYUB 3CXRA 1MV8A 1NV8A 1XJCA 3N2YA 1QRAA 1E3WA 1OFTA 3KB8A 2C5SA 3X1XA 5J4LA 5KKCA 1XDDA 3IUJA 4W1RA 3TAHA 5HKBA 2Y67A 3W06A 1FUIA 5AW7A 5KNBH 1J0XO 3HL0A 1P2SA 2ZRPA 5G1NA 2XUKA 3CE9A 1NTOA 4G0WA 5EHXA 3SWWA 2FG7C 3EEIA 4FMDF 1UDWA 2QUIA 3NEAA 5B57C 4DABA 2GPNA 4YBZA 3SQOA 4F4IA 4F21A 5IF9A 4XRRA 4XVHA 2F4VB 2ZIUB 2TSYB 2VXYA 1THGA 1QZZA 2D7JA 4WLEA 3SVTA 5AJZA 4CEIB 1PVDA 2P9FA 3K9LA 1LS1A 1PTJA 2X2EA 4R0NA 3ROZA 2WJ3A 4DV5B 1EUCA 4V3CA 2UZIR 2EFCB 2XMDA 1N1EA 3ONWA 3EFOB 4M1ZA 1C4OA 4QRDA 4YLEA 5E3JA 3HNRA 4OHUA 4QU8A 5DF1A 1KERA 4H7PA 5E7JA 5HVNA 5DXFA 3IL2A 1WKBA 1RWMA 2JC3A 2NXWA 3LHIA 4JLVA 3VO9A 2DVMA 2Y93A 3ZNNA 1KEKA 2WJVA 2JBAA 4LC9A 3DOOA 2ZUDA 3FDXA 1G64A 3GWZA 3GRPA 3OOJA 4K6GA 4Q24A 4WHMA 5IKPA 3AJDA 3W7BA 4TS3A 5IBPA 2WLSA 2V9ZA 5KHAA 4D97A 3LLCA 2WSLA 1WEKA 3NDJA 1E7WA 4HQ0A 4YUVA 2HWYA 1YKSA 3K5WA 4QUGA 3C1OA 1P6XA 4MVJD 5BV7A 2GK6A 3L49A 4D2IA 3VHXB 2F4NA 3U7IA 1QH1A 1BFDA 1PBTA 1Y48E 1CY4A 2ALJA 3GQVA 3K72B 1L7XA 1CF9A 4P36A 2IV2X 2NAFA 3BM5A 4DUGA 1G7TA 1GU7A 1N33B 4U8GA 4NZMA 1I01A 2CDNA 2BGIA 2FF7A 1BXZA 2B8TA 3M1IA 1ZJJA 1LVUA 5I3CA 1IM8A 3MS4A 1G8HA 2JAWA 3LUBA 5FCDA 4CIDA 2FV8A 2Z5LA 3BD9A 1FNNA 4EY6A 1H1DA 3EGXB 4G5QA 3DCYA 1VBFA 1UKZA 2HK7A 4QO7A 5A9SB 3X1JA 1WP9A 1HQYE 1DC7A 5GONB 2IHJA 3H8VA 2DFTA 2E6UX 3EE6A 3EQZA 5KAMA 2J4DA 4YV1A 2JKZA 2ACEA 1S3FA 4TVBA 2C92A 1OVMA 3MWEB 3OD1A 1XZLA 1JDBB 3AUYA 4ZCQA 1B0ZA 2GJKA 2Y1DA 2EFHB 5FUMA 3MN1A 2FPKA 5L3SA 3ZOZA 1DCTA 2FEPA 2VHWA 4U7GA 1ESZA 3KQWA 2ZZMA 5F2OA 2HX1A 2Q5FA 3IX7A 3EGCA 3ZCQA 1K6JA 2Z3VA 3EDQA 5FUBA 4DZRA 1N3IA 1WXHA 5BMOA 3KWMA 5IZCC 4V1CB 2CZGA 4X20B 5GZ6A 4ZVQA 3GDHA 4ZXPA 3WL5A 1WA5A 3TEFA 2I2WA 3K9WA 2AOXA 3ZW9A 2OOSA 1EX9A 4CWAA 2ZI3A 4BYGA 2YJ4A 4OJYA 5CDFE 2HDOA 2G88A 1DQPA 4YJ3B 2AOTB 1QGDA 1L7QA 1X8LA 1E0AA 3CZ4A 2ONYA 2OT3B 4GOXA 3UKJA 1QG6A 4DIOA 2MCFA 4QGHA 3A6HA 1C5KA 2YIDA 1V0JA 2WV9A 1BE8A 2VNAA 3PXDA 2VWQA 4BU0A 1TK3A 3F73A 5SYAA 3PWSA 2BEJA 1DEHA 3RRFA 5C80A 2HQBA 3T1OA 5A3JA 1XZJA 4PGGA 3R9XA 1DAPA 3V33A 1XLUA 2BGGA 5EINA 5AYVA 5IVHA 4MDYA 3HMQA 2RHLA 2BGNA 1KFKB 3AP2A 3GWGA 4BN0A 1ATZA 1A50B 2VPIA 1UKEA 3W3ZB 3COJA 4UU8A 1JYSA 1JB1A 2ATCA 4BZQA 3LX4A 2AN1A 1L5FA 2B2NA 4Y0VA 5KYXA 1ZJ5A 2ZBDA 1N5MA 3HBFA 1SIWA 2I3ZA 4TUYA 5LBIA 3TTWA 3N3AC 4IXNA 2H4JA 1TT5A 3L7JA 3AHEA 5AJUA 1H6DA 4QGAA 3NJ4A 5LWHA 4EYSA 5GOTA 2Z6QA 3S55A 4KQGA 4B3HA 5J4VA 5JQGF 1MHPA 1CC1S 1UIRA 2C5HA 4EB8A 4FD3A 2WF8A 2YVQA 2O2YA 2VJQA 5CFZA 1P4AA 3RKSA 4DZTA 3L4BA 1YI0A 1C7QA 2C2KA 2HSEA 3K9GA 2GH1A 3N7AA 4PLGA 1FNMA 3T1VA 4L02A 2Z6AA 3QJGA 4WA8A 3IJ5A 4HNTA 4MSUA 1N77A 5C81A 5CLLA 1Z38A 1AM4D 1HEUA 2HJHA 3MAGA 2V7XA 3QE0A 5DI9A 2QQGA 2DUWA 3OF2A 4MR9B 2LCQA 1JT9A 2IS2A 4HS4A 1CUGA 1OD6A 3HYLA 5K1ZA 4PYJA 2JGIA 3LUDA 1OW3B 3NX4A 1KY3A 1WVGA 5COBA 2VQFB 5AVXA 3P96A 1G42A 1K6XA 1NVTA 3B6JA 2DFLA 3DKRA 3V2GA 2FEMA 1W8IA 1YK1A 1MGPA 1D2GA 2O8BA 2UVPA 4WXMA 2O54A 1O96B 1UMCB 3CKMA 3BE4A 3UOAB 2ZSFA 5C7IO 2FWJA 3M34A 4AJNA 5CB6A 2C00A 2MYTA 2WJPA 4MIYA 4QX6A 4CTKA 2HIMA 2IY9A 4B45A 3WDMA 1TPZA 1F2UB 4K6HA 1LS6A 4TGLA 3JQGB 4WXYB 1ESEA 4B46A 4C5BA 5K0JA 1JHYA 2EBWA 5IHPA 1M8JA 2CXQA 1SG0A 3QFTA 5DHAA 2XZDA 3FZGA 5C7LO 3R5TA 1H4VB 2EJVA 3QXHA 2ODQA 4MQ6A 4X7BA 2BFNA 4EUFA 2P3QA 1IJEA 4ENQA 3T94A 1R9JA 4C04A 4KFSA 4OHOA 4UAUA 5IN4A 4OGKA 4JZKA 2JL1A 3ML1A 4HGOA 1CY6A 2Q8NA 2HA0A 2PKEA 4B33A 3CT6A 1QCDA 4R31A 5DCYA 2GCOB 4PX2A 1IB6A 2XQVA 4IF4A 2X2PA 2NZYA 4QRIA 4HH1A 3EQ9A 4BDTA 3M8KA 5JNSA 2XKJE 1DJPA 1T3ZA 3D4PA 1WVMA 4HRAA 1OFHA 4KJZA 4TL9A 1ZY2A 1T8WA 1EEHA 1VGQA 4Z7NB 4MK4A 1J25A 5JVDB 4JL5A 4ZANA 2QJOA 3EPRA 5T6BA 4L9AA 1QBGA 3SE0A 4RY9A 4WFQA 3GCGA 2PLRA 3KJXA 4OMDA 2X8JB 1XVUA 1VYTA 1ZN9A 2NZXA 2J3QA 2R6DA 2J3IA 2Z3ZA 4G9EA 3CLSD 4I55B 4Y7DA 3THSA 4B3BA 1NUUA 5K0ZA 4IM7A 4GGMX 3TX2A 1PUJA 2VEOA 3GA5A 2PH1A 4JUDX 1PZMA 1YUMA 2ISQA 2FZLA 2GF0A 5BSFA 1NNI1 1T8SA 1ZH0A 2IUYA 2XY4A 1PJ3A 1UDXA 1W6UA 3ORYA 3UV7A 2A0UA 2BFEB 3BZUA 4Y67A 4E5UA 4H6PA 3W2EA 4EZBA 3ULKA 4BFXA 1QHIA 4YJ2B 3WLAA 2IITA 1GCGA 3EF3A 2X22A 3L3BA 4HPXB 4JOQA 1V41E 4XSGA 1F9EA 1FFBA 3QF4A 4UU1A 4A15A 3HTXA 1N5IA 3SR3A 4UJ3A 3Q5DA 1M7BA 3GPCA 3MJHA 4MP8A 3QE3A 4BKRA 5KDOA 3BDVA 1KJ9A 2B94A 4ZARA 4WK4B 4KUGA 4ED9A 4GG1A 1KZGB 2W6CX 5ICEA 3U26A 1LPOA 4M7WA 1FSGA 1HE4A 2FWAA 2NVUB 4KSYA 3LQ4A 1NT4A 1O54A 4OU4A 3WWPA 1TM5E 3COZA 1G8AA 4P86A 4DJFC 4DR7B 3CR8A 1G20E 2PRYA 1JPNA 1SRQA 5KNDH 1RP7A 2YNMD 4W8HA 1S7CA 4XQ9A 2CLEB 1OTXA 1DZIA 1I1NA 1H2FA 1WDTA 2GD0A 4PFKA 4QQNA 1ZCJA 3UK1A 1QF6A 3WNZA 4YUAA 4KXUA 5IK2D 3LHSA 3TDKA 4IV8A 1JEDA 2PGIA 4PQRA 2NP7A 2Q5IA 1I3CA 4OHXA 1KMMA 3FLEA 4RPGA 2NVOA 2ZR7A 4OSEA 1TT7A 4ZMSA 3WBJA 2O0KA 3BWDD 4N18A 4D6YA 4P32A 1R8YA 2O2GA 3DJYA 2B98A 2LTAA 3Q72A 4LVNA 3TVYA 3RM3A 4PZAA 4TQAA 5JCZA 4CG2A 2Z5VA 1H1TA 3L0SA 4RWEA 2ZM6B 3U7HB 3G2QA 3SBXA 3TSAA 2ZGVA 3UW3A 1XEWX 2G28A 1Q0SA 3JZMA 1BDHA 2VIIA 2P9EA 1XI2A 3GA7A 4UAJA 3HCCA 1A8UA 3LHKA 5HFAA 2QD3A 3BMOA 3OY7A 5CDSA 1YU9A 1EHYA 5FQOA 3EY9A 1KDPA 1BRTA 1M2GA 3RSGA 1IBCA 2Q3CA 3CLTC 3KQYA 3W5SA 3WYCA 4KQEA 4ZD6A 2ZJ7A 1DRJA 1IOZA 1I3MA 3GNSA 1P77A 1PJAA 1VHJA 5AVZA 3I58A 3I45A 4D4KA 1XJWA 5L95A 2EATA 3FOWA 2CYBA 3MJRA 4WCDA 4KAXA 1II8B 1I8TA 1ZUWA 2PMWB 3WA6A 1GZ6A 2NQ2C 2V7BA 3D8RA 1MNQA 4EQ6A 6ADHA 3AF2A 1SCAA 3E9YA 4LFBB 4ZZ0A 3M5CA 4ETIA 1ZJWA 3O73A 3IALA 3B3QA 3ZOKA 1O0CA 2HF8A 4MGYR 2B8WA 1KZ6A 4GZ5A 5JANA 1EFRA 4OBBA 4J4TA 3S44A 2ZRKA 2BUAA 1H2EA 3OIWA 5E7QA 2GTPA 2LNDA 5IN5A 1J0EA 1HMPA 5GJCA 3KCNA 4ZYYA 2CHFA 4O4IA 5EAIA 2V8OA 2XGMA 5EIHA 1U90A 3SX0A 4I1IA 3JQAB 2NTYC 4EB3A 3JSXA 4TYYA 1ARZA 3GUHA 2D1TA 3NHBA 3PHGA 3DFIA 2XDYA 1WQ1R 1ZD2P 3MGAA 1P31A 4N5NA 1V45E 2PH5A 2OK7A 2B5WA 1L5NA 5I7WA 1V5IA 2SCUA 4QBKA 2C8LA 5TQVA 1M6YA 5FI3A 2CFRA 1JGTA 1TZCA 3ASVA 3CEPB 3S4YA 2BBOA 4B82A 3WAGA 1X7WA 3DVSX 1CD5A 3I5XA 3VU3A 1BX0A 5ED0A 2QG6A 2PNJA 5M34A 4KO8A 2GD2A 5B4TA 3RUFA 3S8EA 2WE8A 1MGOA 2O0LA 4ZEXA 3LT0A 1PUXA 2ON6A 5E1DA 1W36C 2OBBA 4QYWA 2F9LA 4YRBA 2A9FA 4YCMA 5AVWA 1ZJ6A 1NUAA 3HMKA 1J2TA 4TYWA 3F8WA 3U62A 1L5KA 2JANA 3H7AA 4NCNA 1JE1A 3QX9A 4PPGA 4Q4AB 5DIFA 4A8TA 5LJIA 4G1MB 3Q7QA 4CLXA 4EEKA 3GEEA 1YMQA 2PUTA 4DADA 2XT6A 1JTEA 1Y37A 3FMIA 5I9NA 1SBHA 2QQFA 5I7EA 2KHZA 3C6MA 2CJFA 2ORWA 2OC9A 5FTLA 3AF4A 821PA 2J9FA 2Q0SA 1Z0UA 3BE6A 2BRUC 2OV6A 1KEVA 5H81A 1JH8A 4A6DA 3E3OA 4UOEA 4HB4A 1FRVA 1L5QA 3L1KA 1U7UA 3R3YA 4GFDA 1V43A 3EUEA 3H2JA 3U7JA 2FN7A 4PV7A 2HF2A 2Q5OA 4B81A 1G1AA 4WKCA 5IMBA 2V3CC 3FOBA 4U2EA 1XKTA 3PF8A 1M2NA 4MKXA 3BK1A 4RV9A 4OLBA 3O7WA 1FCJA 4G0OA 4PFJA 1Z28A 3SLGA 5AW6A 3LQKA 4RKRA 3OT4A 1X1CA 3PIRA 1WUYA 2ZYAA 3FCAA 3KEFA 2PWYA 1DIOB 2BELA 1AKTA 1JEYB 2A5JA 3QYPA 2W6JA 3KJQA 1X7YA 4FONA 2NW6A 4DQDA 3JWHA 1TUGA 3D7MA 2IOFA 1P60A 4G5FA 1AKQA 5LQRA 4CU5A 4QPDA 4CL2A 2RHRA 3N6XA 1NJ5A 1TJYA 1GJRA 4PTYA 1Z6YA 2QGZA 1PG2A 2DULA 3PNBA 4BCDA 3M3PA 3S2FA 4EW6A 4PZCA 5BUSA 4CMIA 2GAFA 4RH3A 1SQ5A 1W2WB 4JBYA 1PDWA 5K0FA 1E3SA 4XJSA 2ZSAA 3T1HB 4BO3A 3TXAA 1FU4A 3HXMA 1E9FA 3WLEA 1L4NA 2PX4A 1W36B 4ZK6A 4EHAA 3IDAA 4XYMA 4D8UA 3OMWA 2FYTA 4ARZA 2Z2YA 2H00A 3QITA 5FFMA 3ZV3A 1DX4A 2Q4EA 1HLGA 4BS9A 1G7CA 4NU5A 2RHTA 3UVEA 4HDOB 1SXIA 3QE2A 3DTYA 1R4AA 2ZJ1A 3O6VA 1H1LB 2I1LA 4BC0A 1WJGA 5TGZA 1H5UA 4OUKX 2UZ1A 4DKJA 3DVAB 1FXSA 1YCDA 521PA 4YRPA 2PNFA 4DLSA 4RIHA 3MCZA 3TX6A 5EXDA 1T5DX 1M7GA 1U9IA 2A86A 4KE6A 1DB3A 3C3AA 3SJBA 3T5TA 5BSRA 5HKKA 2R60A 2VJNA 1KMCA 1ZEMA 2XKBA 1WMEA 4B3SB 1N1GA 1X87A 3ZTTA 1HFWA 1QG4A 4CMBA 1EE2A 3R09A 4C29A 4MWEA 1Z7WA 3OOEA 2QZPA 4RS4A 4P1ZA 4P80A 5EA2A 1NFQA 2EHDA 1U2EA 3F7OA 3GJZA 1I3OA 1P6UA 4U6SA 1IHOA 5JSHA 2P2CA 4OLAA 4MUKA 1ZZEA 1X19A 4Y6LA 1PZHA 3IJRA 1QLJA 2BMWA 3KT6A 2BFMA 4ZJZA 1Q1NA 3L9XA 2ZSBA 2ZZKA 4NU6A 2GEFA 1HDEA 3EQ6A 5ECDA 5F7JA 1L4GA 1P0IA 1VE5A 5IJ9B 1CR0A 2W6JD 3ELWA 2H1IA 4M0CA 4D3XA 4C4SA 1C8KA 3ZLUA 3B1KA 4DSAA 3LYLA 1H8ED 3HCDA 4NARA 5K2OA 4D9BA 4ZHSA 4DVJA 4PSVA 2GZ2A 5EHQA 4HT3B 4CM5A 1HWYA 4M2LA 2QOEA 4I6GA 3KPWA 4A8PA 5TLSA 1JA1A 3F9IA 3U4DA 2BMJA 1EDDA 3U4CA 1SCUB 2R5FA 3M0EA 4GPBA 4DT1A 2E4UA 4HNQA 1G5TA 5C35A 2Z30A 2WSBA 3EDOA 3PGLA 3H8JA 5F9MA 3ETHA 1B16A 4GKKB 3C3XA 2ZBPA 4MQUA 1MFPA 2GF2A 4KVZA 4EK9A 1OAKA 2AFVA 2PUFA 5CK5A 4RLQA 5AJTA 5A4IS 4KAFA 5JPCA 2RAVA 1ZSVA 4JX8A 3V8NA 2CWWA 4IDGA 1C3XA 1CHDA 2YYYA 2DXIA 1B93A 2AF3C 1MRSA 1Y8RA 4PYLA 5CB8A 1FMCA 3IDSA 2ZSJA 3ZY2A 2IBSA 4TWIA 1XRNA 2VNHA 1TEXA 2C3YA 2WJ6A 2ZKIA 1NFRA 4C0KA 4HVLA 2XNDD 4GEKA 1MT3A 1IXSB 3F6CA 4JUFA 1F06A 3KB1A 1W4LA 3T1YB 1QDUA 1QCYA 2CKDA 1KJYA 4M0LA 3STWA 2GJ8A 3WMEA 2RSLA 3LX5A 4GF5A 4RY8A 3UFBA 4BJ3A 4EJ6A 3T1TA 2WQZA 2OP1A 2CMGA 3WFIA 1POXA 1Z5PA 1HQKA 1NW5A 2QLLA 3U3ZA 4B7ZA 2V54A 3A4VA 1BCRA 4RM2A 5D87A 3B3FA 3E7FA 3VVCA 5DM2A 1T5HX 3P9NA 4INOA 4EX7A 3LTNC 4ZC1A 4YA6A 4PRLA 5HF5A 3W1WA 4H7EA 1NQUA 3VKFA 3WK9A 4LHZA 3S99A 5CJJA 4F6RA 4OHWA 4B2YA 1HQDA 1EK0A 1BGWA 1Z17A 2H85A 4FB5A 3QTTA 4UZSA 1A8IA 1ISMA 4G4SO 3WBBA 2O3JA 1NW6A 1N0WA 1OLUB 2JAOA 2PZKA 3I2YX 4OATA 4AO8A 3UC9A 3L1IA 2G1AA 4G1CA 4G5OA 4AIRA 4BNMA 4FDUA 2HPVA 5CNJA 2OEPA 3HB5X 4J7AA 4YLGA 3UCEA 4PSUA 1D1QA 3ECSA 1KI4A 4TMWA 4D1YA 4PZEA 1H8EA 2ZIXA 5IDXA 5JNTA 1NBOA 3TDNA 4FGLA 1PFQA 4DIEA 4A36A 4GXTA 3VNSA 2NM0A 1H66A 5DNEA 4V24A 3MT8A 5EYPB 1JQDA 1UDCA 2C9OA 4JR2A 4TQGA 5EPUA 5G0WA 3S7TA 3WIVA 3SEQA 5KTOA 4PFQA 2OB2A 4KQJA 4P92A 4X90A 4V02A 5TARA 4Q4DA 1A5AB 1WRBA 3OCCA 3TLKA 4COKA 1E2BA 4EJSA 3FRHA 3PV0A 1NR5A 4UTNA 1DL5A 4NIMA 1IL0A 2A94A 4BFWA 1XZQA 3Q2IA 4TL7A 2Q07A 1H9AA 5DN6D 4HGPA 1NJSA 2Z2XA 3T9FA 5MN6A 3WOHA 1NU6A 2QEQA 2A9QA 2PH7A 1RWWA 1T2AA 2G1UA 2QROA 4BKPA 1RE0A 1SKYE 1P4RA 5F23A 2PX3A 3OLYA 3KELA 4G63A 3WGYA 2C57A 2NVUA 2YV4A 5F2NA 5F98A 1VQ1A 2NO9A 4FYKA 2X4DA 4UVGA 1LWOA 2XNDA 5BYAA 2FJPA 2JJ1A 1U7OA 3SIWA 2O7RA 4Q05A 2ZAGA 1JI0A 4KREA 4Y9DA 4B6RA 4CRWB 4TV9A 2VPYA 3NS7A 1E1MA 1T6XA 2A1UB 3ESZA 4HAYA 4HDMA 1H3NA 4J29A 1MVLA 2PGNA 4U0JA 2PZ8A 5H16A 2J5BA 3C3KA 3PHHA 5FNVB 3U31A 4CKBA 1YBFA 1J97A 3PHCA 4CM8A 3BFJA 1Y9DA 3K0CC 2IHUA 3PDIB 3SHWA 3OZDA 4BP9A 3DDWA 4JLPA 10MHA 1SZPA 1UFVA 1DPGA 4NBWA 3A06A 3BSWA 3H6KA 4Q3OA 5A5EA 3LKVA 1XAGA 2VK1A 1DX6A 3K0FB 3GRYA 3S2ZA 1LPNA 2ZJ0A 3AHDA 5TX7A 2CY0A 1QGUB 2C2WA 5C31A 2GGSA 3EUAA 3A6GA 2PJRA 4TM8A 4YMIA 3M4JA 1AV7A 1NP6A 3K96A 2Y1WA 4HUQB 4BNWA 3AX6A 2HLPA 2PXAA 2NSYA 3O2QB 1CJSA 5JAQA 4V0RA 1S0UA 2C82A 1XF9A 2WW8A 2GK7A 3I53A 5EE0A 4V39A 2IDKA 2WHQA 2PT9A 1RI3A 2JAUA 3JYHA 1MEEA 1UWCA 3BFVA 3KWFA 3NJ8A 4OQXA 1E6LA 3TIGA 3TKAA 4OM7A 1IZ7A 1TMGE 1W52X 1M1NB 4MS3B 1R88A 3H4VA 2H7YA 1WV0A 2R1TB 1JBKA 4A26A 5L53A 1FQOA 1OT5A 1KQ3A 2VTVA 4BFCA 4NV3A 3JQFC 3X1DA 4J94A 3R1IA 3PJFA 5FBHA 3HR8A 1HE1C 2WDZA 2X4IA 2O3SA 4JX9A 3VDNB 5FWAA 1VZ3A 4C9BA 3A6JA 3PPWA 2FUG6 5DI3A 5KYUA 4RKFA 3FLAA 1FXWF 1N5LA 3NIDB 1NF9A 1L3IA 2H52A 2LRHA 5FKJA 1GADO 3T5BA 3ORQA 4U39A 5DN6A 1Q7RA 4OQ4A 5K4GA 1QWOA 1CNFA 1D09A 2B37A 3BFKA 1TQHA 1C30A 2VQEB 4HTFA 3SQMA 1PZNA 1CRPA 5K05A 1H9BA 1P7ZA 1TNDA 4CKZA 3O4FA 5H7XA 5AVJA 4EA8A 2HMVA 1I14A 4LA4A 1QG0A 3QWAA 2QTNA 2I66A 1JJBA 1JALA 3HLTA 4O2BF 1V71A 5NLLA 3T3NA 2UXDB 1Y3DE 1TYCA 3PQ8A 4HWRA 3CW2A 4R1QA 4GBJA 4L4RA 4Q66C 4XW2A 5HTOA 3FNFA 4K28A 2HFKA 4JI7B 2VJLA 4JJ6A 4Q3EA 4BGVA 5HX7A 1W6RA 2GA9A 1E1QD 4LJ6A 2RK6A 1TYDE 2IZ5A 1EP2B 5K3FA 1EHIA 5B53A 5CFQA 2HSWA 5I45A 3VNVA 4HOYA 3UY4A 2EERA 1A7AA 2NXEA 4TN1A 2RGCA 4DUZB 1IOVA 3ZVRA 3LYAA 4HGNA 1JFSA 2X2OA 1JDVA 1NVMB 1P73A 3IC5A 3T3GA 5LN1A 1M0EA 1P45A 2QYSA 1RQPA 2ZR0A 1D2EA 1XVIA 3AR8A 1YQTA 4RW0A 2VP5A 2WG1A 1N6IA 4RD2A 3CN9A 1K68A 2YS7A 1QH0A 2EKQA 5DJ5A 2IYFA 5IJ0A 2A1TR 5DEOA 4MCHA 1Q12A 4LF8B 4Z0NA 3QPAA 5HMLA 2YUTA 4JL8A 2G08A 3OM1A 1FDVA 2IZ1A 1VGVA 1PHPA 2AMLA 2EWVA 3A6LA 5B3LA 1M66A 4LGVA 3TFQA 5MN5A 3T35A 1U7WA 5C8XA 2J31A 3WJ1A 4WKOA 4LZAA 4G0PA 2ATVA 1FFGA 2H1VA 1AK9A 3H9UA 1LBTA 4ILEA 3FVRA 3FJYA 1I36A 1SH7A 4K6FA 1Q7CA 1ZCZA 4NFYA 5LC1A 2VT7A 2J3DA 2YS6A 3MWEA 4ARVA 1EXDA 3R7FA 5TJHA 5CB4B 5FV4A 4EPYA 2VAMA 4GBED 3QOWA 1D7OA 3KEOA 3HXTA 3OD5A 3QJYA 4UNIA 1TL7C 3I1FA 1MAUA 1ULZA 5DYYA 4H7HA 1NSFA 4GNKA 3AF6A 4AJ4A 5A2QA 4PZUA 3WTCA 2EKDA 5HK9A 1U11A 5B3KA 1JHRA 3K5PA 2DFPA 1GNPA 1R3UA 4EG8A 1AX9A 4RADA 1E2LA 5DOZA 3JYLA 3WGNA 3M82A 5FI1B 4UEQA 1TADA 4YONB 3KUDA 4HAXA 1BW9B 1E1QA 2Q1YA 3OIFA 1BEEA 4DWJA 1NYRA 4AJ2A 2ORED 2PLWA 3KL4A 2WZDA 2EGUA 1N6KA 3ICCA 2O59A 3RPEA 3QBJA 4D41A 4ZOLF 5ADWA 4LAFA 5HA5A 4Z51A 2FFAA 3JZFA 5ECGC 3KHKA 1QS0A 3I5AA 1KJ8A 4F86A 5AJWA 4R0MA 3G0HA 1YQQA 3JVDA 4GI5A 3WLIA 1Y4AE 4XQEA 2VSFA 1ABFA 1OBHA 2EJBA 3A3OA 1OILA 3GDOA 1R0YA 3UANA 1OXTA 2ZI9A 2GF9A 1TE2A 1YJAA 2W90A 5HIMA 1DQRA 3ZQ6A 3H2YA 4ZMBA 1FMFA 1CQPA 5IM4F 2O6HA 2XUHA 4NYJR 5EJGA 1AQ6A 4M1YA 2B8JA 3LUCA 1DKOA 3H5RA 4J8PA 4OIMA 3TPZA 4DBZA 1CQIA 2CEKA 4F85A 2AR0A 4AZVA 1GL7A 4UBMA 5CDTA 3M6LA 5JALA 5CD1A 4O3FA 2BZSA 3R0IA 3RAGA 2LPMA 1TCBA 1NSYA 1PFUA 4YJHB 1CFJA 4HXFB 5EZQA 3C3MA 3PG5A 2NO6A 1JSXA 3U44A 2MYNA 2XW6A 3R6WA 3QUTA 2XLBA 1UMKA 1ULBA 4P5EA 3VJLA 1JA9A 2XVYA 2VRNA 1DHRA 4HH4A 1GZHB 3PUHA 4NQZA 3EDMA 4XWGA 2YY7A 5L45A 4WMLA 2IQIA 5TEVA 1F51E 1DKUA 1SUIA 2J0UA 3OZUA 3Q1KA 4LHVA 1E2UA 3PBKA 5I9SA 2HSDA 3RU7A 1UBCA 4DPLA 4MIKA 1HDRA 3FAKA 5L7YA 2AF4C 4E14A 5IASA 3S2YA 2WSMA 4MIEA 3PXUA 4Q9DA 4AXBA 2JLVA 1U0SY 2F43B 5FWXB 3BMQA 2CHGA 4JODA 3KYJB 3CZ5A 3RB8A 5AIAA 3R44A 1UXKA 2Q5JA 1T1SA 3ET5A 4J7XA 4NY1A 2GN6A 4OHRA 4FZ5A 5CH5A 5LB4A 4XEUA 1QSGA 4CTOA 2PX5A 2VC2B 2W2TA 1OT3A 1MJGA 2Z9CA 4HQKA 2XD9A 3OOWA 1F8GA 4C01A 4ZFNA 5AVQA 1R0RE 1IK6A 2AR9A 2H54A 1KYTA 3IP6A 3O0DA 4DY6A 3OKAA 1OF1A 3ER9A 2BONA 4RJ2A 3F67A 3PL1A 1K4YA 4NNJA 1PFYA 3FBTA 4QXOA 3UMVA 3I61A 2UYHA 3I1IA 1JSZA 3UT6A 4D6PA 2X3YA 4ZRNA 2GAIA 4KACA 4GXRA 3RYCB 3QTBA 1FRFS 4RF3A 2OHXA 1SUEA 3DPUA 3EUWA 1E0SA 4KFTA 4PINA 3ITEA 2BFFB 3ZR4B 4MRAA 2X0NA 3MTGA 1TEHA 4I81A 1RPJA 2XKAA 3NRBA 1A2KC 1PGPA 2QPAA 3KYIB 1P7YA 1JN0A 4TVKA 1UCFA 3HJAA 1CZKA 3UG6A 1UZMA 1UT5A 2VDPB 2YINC 3EZYA 3H83A 3TLXA 4CM4A 3BHJA 3WLTA 1I80A 4UUOA 1MB2A 1EQAA 2R6FA 4E22A 5C4GB 3L1JA 2FX5A 1VLZA 3CBGA 4HS9A 2QGNA 5FJJA 2YWGA 4PONA 3GLGE 2B25A 4KEAA 4NBKA 4N39A 4RD3A 1YHYA 2Q21A 4RZQA 5LZ5A 4AO7A 3H7IA 2CVPA 3L7YA 1XTTA 2PVCA 3NH9A 1V95A 2IYUA 3G5UA 3QKWA 1NAIA 4IJMA 3Q11A 2P9HA 2XUIA 5IDVA 4WY2A 4D9EA 1WOMA 1Z6QA 4B83A 3TI7A 1P5JA 3IUEA 3COVA 5AP9A 3SJCA 4XWKA 2VOJA 1I4EB 1IQ0A 3NWBA 1RPZA 4IGEA 2ZQZA 4CFYA 4E4RA 2PWPA 4XGIA 5I4IA 2CXOA 2QTCA 4D4IA 1PBNA 1GKUB 5DYWA 3NTLA 2OXIA 1ZM7A 3WKCA 5CA0F 4UUAA 5CBPA 1PLKA 8ATCA 4HI0E 4GP9A 3DPSA 4K9PA 4A0HA 1QE0A 2FMUA 2GDZA 4AQ7A 3NBQA 1QMGA 4EMTA 3O0TA 1TA4A 4XR9A 3KAKA 2BI4A 4M0PA 3TH5A 4EKIA 5KB3A 1E77A 1RI4A 5EKSA 1SHJA 4CLEA 5HKAA 2WINI 3I8OA 4YWHA 2F3QA 4XOIA 1OLSB 3C41J 3I0MA 2NTEA 1DWUA 3JZAA 1G9XA 4LHWA 4FDTA 3B9BA 4OQPA 1ORHA 4QAQA 4X64B 4BAUA 1OZ0A 1OWMA 1WB6A 3EG9B 5KYTA 4O08A 1JBEA 1A4XA 3I6ZA 2CLOB 1GG9A 2FSGA 3WQSB 3EEOA 4HUJA 3WL4A 1FFSA 2ATXA 5TEWA 3NBAA 4DNQA 1NP3A 2EP7A 3EFHA 3KQKA 3O03A 4DREA 2MR5A 3MTAA 3D8BA 3KKEA 2I4NA 3UUFA 4RVFA 4JBLA 3IQWA 3QELA 1YR3A 3DKVA 4BPBA 2JFNA 5IZ4A 1VMKA 4ZAZA 3TUZC 2BGLA 3I1YA 3OZBA 3UFXA 4R2WA 3THYA 1DAMA 4L78A 4OHYA 4Q7MB 4JXXA 4URVR 3D3JA 4EG7A 2FDRA 1Z06A 2P6UA 5D7NA 3R7NA 2J3JA 4HX5A 1BH2A 1W35A 4XCXA 3LDAA 4LZJA 2PL5A 3VJMA 3OCYA 3H9QA 4Y98A 1PR9A 2XXBA 3AOGA 2ZUCA 3BRQA 4FOSA 4CTJA 1W94A 1J2YA 2XSZD 3BBLA 3VAAA 1TF7A 3HEMA 4HV4A 3MGBA 4Z5XA 1H94A 1H2YA 1R6VA 2ZWVA 4MDEA 4IUBS 2FK8A 3EW7A 3EWNA 1G21A 1M2EA 3OZSA 3SMQA 4ZQEA 3SZUA 3BMOB 1VPVA 5HJ5A 2QPLA 2MDTA 4DEVA 3UIEA 4GSLA 4OD0A 2QP4A 4C87A 2ZRCA 1DC4A 3J7AC 1I7SB 1FFWA 1ZOIA 4JY7A 3NASA 2AI2A 3E5MA 3S7ZA 1WXXA 2PCJA 4ESEA 4GDFA 3GGSA 2IZ0A 4Y2PA 2XUJA 4NG4A 2VZ8A 3PF9A 4UPVA 1V1MA 2ORIA 1Y81A 2D1SA 1E1NA 3P7MA 4JNCA 4FHEA 3TTXA 2J6HA 3U37A 2DPXA 4F12A 4QT0A 4U7HA 3B1VA 1EE1A 3OKFA 5E0OA 1O6CA 3UHJA 2GLUA 4BWGA 4UQLA 4L0CA 3T9AA 3ZKAA 4CIVA 3CPJB 4I4TF 3Q7SA 1DC8A 3D2AA 1KAOA 1HI9A 2JFZA 1CIVA 2C0CA 4MPPA 1PR2A 3AR5A 3FTNA 2EL9A 1TAHA 1A5BB 3EGDA 5CK4A 4TQUS 4X1KA 4MVJH 2O1XA 1PQYA 2PSDA 4JYAB 4LYGA 4CR7A 3GMTA 4FW8A 2BTQA 5CT9A 3EMBA 1KKLA 5BV2P 1C41A 1W47A 4EVQA 5C4MA 4M76B 4B3RB 3OZIA 5H3CA 4DLBA 5CIWA 4LSMA 5I4KA 1QRDA 2WYIA 3HDGA 3EMKA 4DRXA 1ZAKA 1IHPA 4RFSA 1T2VA 4HSEA 1M2KA 3AG6A 2EZ8A 4BB9A 2Z09A 4JU8A 1SOWA 1Q17A 1HR0B 1ZD8A 2DHEA 4NZPA 3N74A 1UF9A 2ZTUA 3M4YA 3OWOA 4N4AA 2J45A 1UJMA 3N87A 2EF0A 3ZX4A 4BV2A 3QWFA 3W7AA 4A2CA 4YX9A 1E99A 1KIAA 1CRZA 1LNQA 2A9RA 2YOHA 2FETA 3BE8A 2P35A 3BXGA 3CX8A 4LS3A 3RC3A 3SR4A 4OV6B 3TN7A 1WLYA 3NFRA 4KQ6A 1MT0A 5CLGA 1IN7A 4AROA 1D6JA 3DHEA 4G1EB 5HEKA 4M1WA 3VX3A 4BLTA 3CEJA 4M38A 1WP4A 1Q0TA 3TTYA 1F0YA 3CH4B 2CUZA 3O75A 3OMXA 4LSGA 1GL6A 2RMKA 2WRZA 4KLRA 4NHEA 4PX3A 4EL5A 3ZGXA 1NV9A 3R40A 5IVDA 2HRQA 3A0RB 1NLZA 2DBRA 3ZBTA 4DIFA 3SKXA 5IABA 1A9OA 2JI7A 3NDRA 3GUVA 5LKRA 4WIAA 1X3LA 3R5HA 3RS4A 5TS2A 3GB9A 4CHGA 4JLBA 1I3KA 5CXQA 3NM4A 2WF6A 3N2LA 3N0WA 5IXSA 4GYWA 1IE3A 2WWYA 3PJDA 1EDBA 5H3LA 1TTHA 3E9MA 1XTBA 2YZMA 3SHVA 1JT2A 3A4MA 1GPJA 1K97A 1AXRA 1I4OA 1F17A 2Y1OA 3FNGA 1JHXA 3IVMA 4U4AA 4QFBA 5BWMA 1QNFA 1W0KA 3AEYA 1QGAA 1REQB 3G02A 4O3MA 3ABQB 4U6QA 3BDIA 3CINA 3WY9A 4MQLA 1RADA 4RM3A 4X45A 3F8SA 3SC3A 1QYDA 3KQVA 4YRZA 1XXHB 2OCYC 4XR4A 4QBIA 2IU4A 3D8NA 4IG9A 3EF0A 3QX7A 2O8DA 4DAOA 1T2FA 5KPDA 1GYRA 2J4CA 3G9TA 1CUEA 5AICA 2YRXA 5LWQA 5HQJA 1R6DA 1X7WB 1ISIA 4Z6KA 3K6JA 3A27A 2BCEA 2GZHA 4F5EA 1I6MA 5EJ2A 1QZ3A 4QDXA 1FLVA 2H16A 1U9ZA 1AK1A 4HH3C 2HU7A 4WCVA 3MMPA 2OENG 1RC0A 1VJDA 4N48A 1XLWA 1G8FA 2E87A 4G1FA 1BW9A 1Z5ZA 5A4AA 1XRLA 1N9GA 1W5EA 4RDXA 4LZLA 2Z2ZA 5DDIP 3SD7A 4XGKA 1YS6A 3VDXA 1RYZA 2G3YA 3DCIA 5J1SB 2N9UA 2ZBGA 1IBMB 4P4UA 5FEMA 4NJEA 2CFSA 4D9IA 1RLJA 2B20A 3N53A 4MWSA 4W1SA 5LLSA 3AVVA 4DAEA 5DBFA 1J21A 2J3LA 3IBTA 5AVUA 4KR7A 4N8EA 4BBAA 4C0SA 1YQUA 3P8ZA 2PUEA 4MA5A 5JNLA 1XROA 4EA9A 1O6GA 1HY3A 4M21A 1B41A 1HG0A 1T9AA 4Y0NA 4ZV4A 3RAEC 3OT1B 3GLUA 4B3CA 3GHHA 4HQOA 4OTZA 3UA4A 2VSXA 5AHXA 2B9EA 5J2UB 1T2DA 3N2EA 2ZT5A 1FJHA 3PQ4A 5EIFA 2GR9A 2GVNA 4B6JA 1I6LA 2C98A 3CJRA 2CLIB 3CLRC 4FILA 4JGBA 1SC4A 2LGJA 4FZVA 2D3TA 1GU0A 1IHXA 1OX5A 2F1KA 1U2SA 2HEGA 4EZIA 3Q6MA 5A2GA 2OG1A 4UFOA 5KQSA 2G77B 5BSHA 3ED1A 3Q7RA 3LFUA 2H4WA 3BQNB 3X2FA 1SPXA 2ACVA 5FORA 4YDSA 1O1YA 3T12A 2QLJA 3PKZA 2FJ0A 2R48A 4GICA 3IUSA 4UTPA 2Q2OA 3BRWA 4YRNA 3D0OA 1VB5A 1PLLA 3KKKA 1EK1A 2B1JA 3S5UA 4CF7A 1EEXB 2TRSB 1MOSA 3DONA 1QHYA 1CUYA 5DM0A 4IZIA 3RRYA 3AI7A 3LVBA 1WUJS 2NU8B 3B8EA 4TTRA 2VYNA 3N2GB 1JIJA 1LPBB 3TW8A 4WE3A 1FFHA 1M2JA 3EDRA 3DNPA 3T5MA 3SN6A 4RNDB 2WMDA 3K6KA 1OY1A 1VSVA 1X74A 1MB9A 1LF0A 3AY3A 3RTGA 2X6RA 5C0OE 4ICIA 4DT1B 1QCCA 1XMIA 1W1UA 4LNHA 1NQWA 3NC0C 1VE7A 1IBLB 4MO9A 3EISA 4TV9F 5E4TA 4UEWA 5I8PA 1JMKC 4CLOA 1JPVA 1RYDA 2N46A 1P9WA 2V96A 5ADVA 2D2VA 3LHDA 2P9YA 4ZCSA 3RJ5A 1E3LA 1SELA 1Q3TA 2IV3A 3A4LA 5KMGA 2G06A 4GKBA 4CQJA 4WFKA 1ZOOA 2X0IA 2HIGA 1HYQA 3IIEA 1NF2A 1SUWA 4KPFC 1UFOA 3THWA 4LVOA 5H82A 4JUCA 2NVBA 2BKUA 1E2QA 4L1KA 2G1PA 3MPUA 3IT0A 4R68A 5EIXA 3IAAA 2AZTA 4MA4A 4I46A 4NYIR 4EBBA 1CZHA 1OASA 2JGNA 2OHOA 3LDHA 3MW8A 2DWQA 3PLAE 2QY6A 2NSLA 2MINB 2YXPX 3WO1A 1UJ4A 4J75A 4FDAA 4K81B 4XA8A 3NTVA 4TZTA 1L5LA 3TZQA 5L51A 5DYGA 1NVGA 4ZYVA 2G6TA 5BN1A 4QJ5A 2OSVA 4DA9A 4IO1A 3A8TA 3BZBA 4QASA 3K1YA 3VSAA 4LDZA 4TWJA 2EJTA 1PR4A 3HDVA 5B7GA 1TK9A 3ENKA 3IVRA 3FTEA 5LVAA 3LRPA 1O5IA 3OOHA 5BN4B 4JB0A 1AKNA 3BK2A 1DIAA 3ZY4A 5FULA 5IUNC 5C53B 3GLIB 1E7YA 1Z33A 3JQ7B 2JA2A 1E9RA 2A6PA 2YC2C 5JHHB 4YRAA 1OWOA 5C1BA 4E5NA 2UKDA 5AVYA 3FW1A 1FU7A 4PSAA 1P81A 2RE8A 1Y1KE 3L6UA 4HJXA 4L5CA 2ASVA 4PYOA 1DS6A 4S1OA 4QG3A 5L4LA 5J1TB 1IZ8A 3E2IA 3T4UA 1IUKA 2HY7A 1Z6PA 1YOBA 5HHTA 5G02A 4PBSA 4BFUA 2GZSA 5KVVA 1VL0A 2FSFA 1Z7YA 2O2ZA 2RGGA 5EYPA 5KJ1A 4H15A 3ZNOA 4CTMA 1W30A 1T35A 1XTUA 1TEZA 2I1VB 3OTGA 4ZI2A 3LT5A 5CBPB 3JV7A 4ISCA 4HADA 4MPDA 5L3ZA 4IDEA 4N3AA 3RSOA 4UE6A 3ST7A 4BN4A 3ZDFA 1IH8A 4X54A 4AJHA 7MHTA 1Q74A 1T36B 4X6XA 1EZ4A 3KTOA 4Q21A 2COKA 5G53C 5EP2A 3OFVA 5AW4A 2W48A 5GIOE 3R5FA 1VPEA 4D4GA 3RADC 3AG5A 2RJNA 1NMXA 3BSYA 2HI0A 3C8HA 2OFOA 4RE5A 3TQHA 3N2IA 1E8DA 1Z2AA 2C9YA 3IVAA 2J07A 3OZXA 1CY2A 2O52A 4D8TA 4YMVA 2JCGA 3TGLA 3EOAI 1UJ2A 2R3SA 4ND8A 5AKXA 2C7VA 1BYIA