4DSUA

Small-molecule ligands bind to a distinct pocket in ras and inhibit sos-mediated nucleotide exchange activity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
180
structure length
177
Chain Sequence
b'STEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas, isoform 2B
publication title Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 177
sequence length 180
ec nomenclature ec 3.6.-.-:
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dsuA00
2EYUA 4AKHA 4QNRA 4Q7MB 4A2WA 5CITA 2AKAB 5JI2E 1JAHA 5JHHB 1KI7A 1SVWA 1P3JA 1XJQA 2K5UA 2NQ2C 2FV8A 4TTPA 4ZPXA 4KAXA 2D06A 1E98A 3AF3A 4US1R 2LKCA 3QF4A 2GXQA 4MYUA 2JJ2D 3T5DA 2PT7A 1ELOA 3A58B 4IDQA 4YC7A 2R62A 4KV9A 4BASA 1G1MA 4RJLA 3KKQA 1OFUX 1KKLA 3CF6R 4QC2A 3DM5A 2ZYTX 2F9LA 3DPUA 4BFWA 4CT4B 4PC7A 4Z8XA 2O8EB 2WIBA 4B3GA 3D8BA 4MGYR 1WDTA 1R0YA 3NBZC 3W8RA 5GJBA 3BH0A 1KY2A 2FA9A 1F60A 2MMCA 2ZS7A 1T8TA 4L15A 5FPTA 4I1OA 3OHMA 1TUEA 2WVJA 2RGXA 3K70B 2JJ1A 1G3RA 4JZKA 4EQ6A 3WHKA 5HZHA 3PITA 1XMSA 3A1VA 2ZIAA 2VHUA 1FQJA 1LV7A 1M7BA 3BE4A 4NE2A 1HA3A 3OIWA 1QF9A 4KO8A 2W2VA 5FPYA 1NBMD 1YZQA 4PHFA 4QHYA 4TT3D 4XSGA 1BMFD 3EX7C 3U3OA 3JZAA 2Q9BA 3NHBA 2HXYA 2W6JD 2ZJ5A 3R20A 2QPAA 2VRWA 1JEEA 1NG9A 1W5SA 3U3MA 3CZPA 2JATA 3QBVA 2ZR0A 3U7HB 4UNSA 2GF0A 5DN6D 1W0JD 3K9GA 1ETUA 4L8GA 2J5XA 5DGXA 2G6BA 1H8HD 2OFWA 5E7JA 1DPFA 1DG3A 2WOOA 4EPTA 2H8KA 3AKEA 2R8RA 1RFLA 2OESA 4DEXA 4GP6A 1M34E 2BHRA 4DHEA 2UZIR 4HZUB 2JDID 3ZQJA 2FPMA 2O8DB 4Y0VA 5EZ6B 3CPHA 4ZI2A 2V4ZA 2GEDA 1E96A 4TYNA 4D2IA 4D4JA 3GLGB 2JLWA 2I3BA 4QGHA 3A36A 4Q4HA 2GJ8A 3U7EB 1W4BA 5B2ZA 4F91B 4LHVA 4IVQA 1CIPA 2LCFA 5BXQC 2ZE7A 3IBGA 3HYTA 4CEHA 5DI3B 1EXMA 621PA 4DDWA 1NF3A 1E99A 3MD0A 3PIRA 3RS5A 3T1OA 3TIFA 3ONWA 4AKGA 1BOFA 2YV5A 4A92A 3AQ4A 2YOHA 3CONA 2ZXUA 1AQYA 3IGFA 4LRWA 4ASUA 1A2BA 1EG7A 1UDWA 4A1FA 4Q9JA 3GLIB 4MA4A 3RVBA 1OXUA 1CU1A 1L7VC 2DWQA 3DDCA 2ZU0C 2O0HA 3TAUA 3IO5A 5L3VA 5EQTA 1E9AA 1JJVA 2A5JA 2O52A 1UBFA 1OF1A 5A4JA 1T8UA 1YZTA 1FFHA 1NN3A 1DAEA 1IY0A 1COWA 2PCLA 1Y63A 4YMSA 2DB3A 1TEXA 1OYWA 4PTLA 5H70A 3EASA 4KJZA 1FP6A 5K8TA 1C1YA 1G291 1U2RA 1CS4C 4F92B 3EZFA 3G5UA 5EJEA 4DXAA 4ZO4A 3K0FB 1LS1A 3MRSA 5ELXA 4XVQA 3N2EA 4P4SB 1Z0AA 3TW4A 4HATA 2WSSA 1MR3F 1IM2A 3UXMA 1E9FA 1TQ4A 2GEUA 4KLZA 1ZNZA 4S35A 3CB4A 5EXTA 3MG9A 1G5PA 2C03A 2HYDA 5KSPA 2A5GA 1H8ED 2HEIA 3DO6A 1NY6A 4Q00A 2EFDB 1ZM3A 1NG1A 1XBTA 2EFGA 4ZCLA 3TK1A 1WBDA 1AZSC 1R4AA 1Z29A 3HP1A 2JLZA 2F3RA 2WJGA 2XTNA 3Q72A 1EGAA 2J1LA 4JVLA 2ZI4A 3KDSE 4PO8A 4A15A 3MMPA 2RB4A 4MKHA 2QA5A 3KB1A 2ANBA 3HU2A 1E2PA 3SHFA 2WPDD 4OL0A 1AGPA 3AGPA 5GJVC 2JASA 1XPRA 1ZNYA 1EX6A 2ZRHA 3B85A 2C8VA 1KMHB 1GRNA 2AKYA 2GNOA 4OHVA 3DL0A 2H1LA 4M1TA 1Z83A 3DM9B 1P9RA 3QBTA 5H68A 5J4VA 4LCBA 4LYJA 3AF0A 1UDXA 1G21E 1NLFA 1P2TA 1LVGA 4TZ6A 3C8UA 4DCSA 5FH9A 3T1TA 1S3GA 3AKDA 1JR6A 2XX3A 4JLBA 1MABA 2QUZA 1DS6A 3UMFA 4TLCA 4TYWA 4PXAA 4NCNA 2ODEA 3TR5A 4I99A 2XXAB 5B30A 4D26A 1Z6AA 1FNMA 2Q6TA 1KO8A 2L0XA 4DLYA 1VECA 2CNWA 4LYFA 4OHXA 2YHSA 3WBKA 2R9VA 2GBLC 1Q0UA 4Q1BA 5FBQB 2ASEA 1XZQA 5DHFA 2SHKA 4C3ZA 3H86A 4HB3A 4Q4JB 4MKIA 4B3XA 2J87A 4L5BA 3BRWD 5C4MA 2V3CC 2IYQA 1J70A 2XAUA 2ZRNA 5DYGA 1WXQA 3SI7A 3HPQA 4DB4A 1P4SA 4PO9A 3W9YA 4CEJB 2YOGA 3HDTA 1W48A 1WP9A 3RDPA 5KSOA 2ZE5A 3SNHA 3AVXA 4PO1A 1X6VA 4EAQA 4RCYA 3NC0C 4RCZA 2BEJA 2PLRA 3K8YA 2NO9A 1OXXK 3K0CC 3MSXA 1W4AA 2ZI6A 1YRAA 3L0OA 3EIHA 2QT0A 3NBFA 2FSGA 4V0KA 4ERNA 4Z1MA 1OH8A 3GD7A 4DCVA 2BJVA 3F3YA 4D80A 1RJ9A 4CVNA 5EE5B 4MGZR 2QBYB 4OI0A 1XMVA 2W58A 3CBQA 2O8CB 1AK2A 3B7GA 3KUDA 3W6PA 3SS8A 2ERYA 4NYMR 1KI1A 2FZLA 2R2AA 1WB9A 4V02A 5DO9A 3UKDA 1NL3A 1NJGA 3CH4B 2ZYWX 2XOKD 3Q85A 1P62B 2GZHA 3QOFA 4JLDA 5G41A 3SC3A 5AUNB 3FYHA 5EP4A 3SJZA 2BIFA 2JIZA 2WZQA 4Q47A 2Q9AA 3OIYA 2PMKA 1IY2A 2CE7A 1QHIA 2V8OA 5L3SB 4B43A 4ACAA 3B82A 3AP1A 3IKJA 5CM9C 1S1CA 4II7A 4GL2A 3EWSA 1PLLA 1M74A 1PLKA 1ZU5A 4YXWA 4F4IA 1T0HB 2QQEA 1Q1ZA 4OQXA 1DAHA 2QM8A 3NXSA 3WMGA 2IS4A 4A8JC 4C2TA 4TLAA 5CM8B 1E9SA 1GP2A 4MDFA 2J0VA 4XJXA 1E9BA 4BPBA 5DHAA 2MSDB 1N0VC 1TTTA 3IHLA 1VKJA 3VQTA 4DLTA 3EWAA 2ZM5A 1MO5A 1SXJB 2E87A 2OXRA 2XITA 2QROA 3BH6A 4LJ6A 4NCKA 5DI9A 3VTKA 3CIOA 4B35A 1DEKA 5JWRA 1LF0A 3H2YA 1OB5A 1JI0A 1U8AA 1YR7A 3TSOA 4DLVA 3QXJA 5DSZA 1EFUA 2BCGY 5DNYB 2XB4A 4QGGA 4D82A 1VTKA 1XEXB 2RHDA 4MGKR 5FL7A 2OBMA 3SU8A 3VKGA 2FG5A 1QG4A 1L2TA 1DG1G 2EU8A 2IL1A 1ZMXA 5JJKA 1MV5A 2W0SA 4KCGA 3A6PC 2VP6A 2QAGA 2A7QA 4HZUA 1NVUQ 1QDEA 1SVLA 2RHMA 2O8DA 4IDHA 2WBLC 3BORA 1G9XA 3MWYW 5C2JB 1ZM4A 3QENA 2VHQA 2OV2A 5GVRA 2G1JA 4RD1A 3RABA 2IX3A 3MGCA 3K09A 2ONKA 1P9WA 1G8YA 3U7FB 4TLEA 2A2ZA 2ZJOA 4A6PA 4JL8A 4BLQA 5L3RA 3H1TA 5SZKB 3VR1A 3AF2A 3B60A 1JQJC 2ANCA 3PVSA 3I73A 4R98A 5KPJA 4A0HA 1NMYA 4FI3C 1U98A 5DI3A 3WY9A 5SZJA 3I62A 1AM4D 3HR7A 5EE1A 3SQXA 3KL4A 4LSGA 3THYB 3AB3A 4URWR 3BIFA 4HLDA 3JVVA 4BRUA 1VCNA 3FDIA 1GKYA 2YYZA 3GCGA 2ZU6A 2OZEA 3AF1A 5CJPA 3QXSA 2PZFA 1KI9A 3T06B 5B64A 3I92A 2AWNA 4TN1A 2QQ0A 4JSTA 1ESMA 3BB4A 3IO3A 4LI0A 5HKKA 2CHVA 1ZIOA 5LB2A 2YC4C 3BERA 2CJWB 1W36C 1XP8A 1XPOA 1XDBA 3QY0A 4A0RA 2WMNB 2GCNA 1XTRA 2F55A 1SVMA 4L9SA 2CL0X 3CRVA 4A2PA 2OM2A 3GFTA 4NKRA 1VG1A 1F2UB 6Q21A 5CDFE 4DUGD 1XB2A 2ZS9A 3RWOA 1E4VA 3K0FA 1CTQA 4URUR 3U2QA 4P4SA 2V54A 4YDHB 2A78A 3LXXA 1G4UR 1E1RA 4NDZA 3UMSA 1H65A 2WKPA 5TXGA 1OFHA 2YOFA 4QGFA 1E2GA 4LBYA 4PHGA 1ONBA 2WOJA 1JXMA 2J7KA 1NNEA 1NN5A 1Z6GA 1RC8A 4HI0E 3P32A 1O87A 1A7JA 5K8IA 2AD5A 2FFBA 1OXVA 2ODWA 3C4JA 4H9GA 2PEZA 4IOJA 1E9CA 2W2XA 4TWZA 1G3IA 5JI3E 3NVAA 4HLQB 3H84A 1G3MA 3U3JA 1PJRA 1XD9A 2VP5A 1VG9B 4G0NA 4OKSA 2G9NA 1XTSA 3O8RA 3I61A 1P7CA 4ARZB 3BK7A 4HDCA 1M8PA 4NYJQ 3U61B 5J4YA 2WAXA 1ZCAA 3WRXC 4LJ9A 3HYRA 1G5RA 1OHHA 2ATXA 1QHXA 4UNRA 3IEVA 2YVUA 2A5YB 2VTKA 1N6LA 5G3ZA 5JBQA 4B3CA 3UG6A 2P3SA 3THXB 1UBCA 1I4LD 3CX6A 3ADBA 1T3HA 5FUVA 4WIAA 3K9LA 3NEYA 2QI9C 3HU1A 4MQBA 1FNNA 2ECKA 3CH5A 5IT5A 2HJGA 2QZ4A 3ASZA 1RRFA 3HPRA 3WYGA 2QTFA 2DWOA 3IEUA 2GXSA 4PQRA 3FMIA 2J0UB 1VCOA 5IF9A 2XXAA 4AURA 2QENA 4QHSA 2YWFA 4BFVA 3E5HA 3LRPA 3T34A 5JRZA 2WJHA 1W36D 3K1JA 4Q7LA 4RZUA 4WZ6A 4A0GA 4DDUA 3TGPA 4MYTA 2CLCX 3UATA 2FFHA 1US8B 1FUUA 1A4RA 3PR1A 4KU4A 1SKQA 2JJ8A 4N0EA 3SJCA 2BWJA 2ZRCA 3A4MA 3C5HA 4Q4AA 1SXJE 5LD2B 4B47A 3RC8A 2HCBA 1W0KA 3ZVNA 4KHZA 3U7GA 4A9AA 1Z06A 1WRBA 1TPZA 2RCNA 3QG1A 2ORIA 5TARA 1UKZA 2VF7A 1YZUA 5LPNA 1NVVQ 5CDFA 1OKKA 4QJ4A 4X8OA 3SN6A 1M7GA 4Q9IA 1E79A 2ZR7A 1NVXQ 4E09A 2R6AA 4D0GA 4MUAA 3BC1A 4LJ7A 2R6FA 4FCTA 5CLQA 1HTWA 1J7KA 4I81A 5JSZB 2NZJA 2RMKA 2ZE6A 4HAYA 3LD9A 2XNDA 1PLJA 3Q5DA 4I1VA 1N6RA 3TW8B 2F1IA 1OIVA 5FTJA 4JVNA 3AM1A 3GQBA 3AF4A 4I1SA 4DZZA 1XEWY 4NONA 5H1YA 3GJ0A 4TYYA 3X1DA 2F43A 3DHWC 4M9QA 2E9SA 2Q0HA 5DE3A 3GP8A 2GAAA 5AUQA 1Z47A 2H92A 2BMEA 2GTPA 3RHFA 1R5OA 2UZ3A 1G4AE 1ZUNB 3RRMA 1X1SA 3FTQA 3KB2A 4ZIRA 2X19A 2BMJA 3GJXC 4IOMA 3S1AB 4Q18A 5LBIA 4NCJA 1ZVQA 4IEEA 5L3SA 1II9A 2IHBA 1ZW6A 1MT0A 1FP7A 2P0EA 2VF8A 3C7KA 1SHZA 4FMBB 1G8PA 1N6HA 4BZQA 4B71A 4EPRA 4DT1B 4W5JA 3TE6A 1W4CA 2IW3A 1AQUA 4IDNA 1T3LA 2CK3D 2J7PD 2G77B 1TNDA 3P27A 1AZTA 1G6HA 5KDOA 1XRJA 1CKEA 3B78A 2VHCA 4KXFB 4URYR 2DY1A 1KDRA 2OLJA 4F38A 1ZC4A 2CCKA 1G8FA 2G3YA 2IYZA 5IK2A 4TSFD 3REGA 1WMSA 4DRZA 3CX8A 3KJHA 3FB4A 5KO2A 2VP2A 4Q1CA 3LA6A 5C46F 3X1ZA 2VYFA 2C77A 1GG2A 1BO6A 1GVNB 3VR3A 1SXJA 1YU9A 3SE0A 1SULA 4HUQA 3KTAB 3QQ5A 5B57C 4JKYA 3EIEA 2CCJA 3AP3A 3G82C 2XSZA 1T0JB 4XTRA 4BFTA 1IAQA 1Q20A 3AVTA 4IEIA 3OEEA 1P61B 4EJSB 5LDDC 5AJVB 4CDGA 1LTQA 4DVGA 1XZPA 2J41A 3ZDQA 4EPYA 2QU8A 2IYXA 3FGNA 3BWDD 4TZ0A 3VKWA 1E0AA 2BBWA 1WF3A 2FJUA 3EXAA 1S3SA 1HYQA 1W49A 3F5FA 4WZBE 1TAGA 4FWIB 1YR9A 4D4KA 1E4YA 3PXGA 1JR3D 2OCAA 1NIJA 3DKVA 4PC2A 4JT2A 1PUIA 4C0AC 1OJLA 4M22A 4U02A 1E94E 2PZEA 3QPUA 1NMXA 2RGBA 3BFVA 3VU9B 1XCMA 4A2QA 1TF5A 2KSQA 3SQWA 4D4LA 3AGQA 3DMDA 4FXPA 4WXPA 5KPDA 3QEJA 3X1YA 2OHFA 5AJXA 3TBKA 1U90A 2WMOB 1KAGA 1ZYUA 1WCV1 2FGKA 2FMXA 4PC3A 3PUXA 5EXSA 4LY6A 2F1RA 4NBSA 4OQNA 1NI3A 4DLZA 4NHOA 4B2LA 4KI0A 1DELA 1S0UA 3VR2A 4HEJA 3QUSA 1E1QA 1HE8B 1RIFA 3ECCA 1RYFA 2C98A 2UKDA 3QKRA 4XTCS 1DAFA 2HF8A 4NP6A 2XJ4A 1PZNA 2AXPA 2GJAA 4AG5A 2PBRA 1XTIA 3ZIAA 1D2NA 2PL3A 1IOZA 4C30A 3PUYA 3OESA 4F93B 2CJWA 1W44A 1J8YF 2GILA 4FMCF 5F3WB 2VQSA 1CULC 3NDPA 2PX3A 1FUKA 3CR8A 5JEEA 3LDAA 3ADKA 1VYVA 5JEDA 4RSGA 5AJYA 4JLNA 4OBEA 4ZI3A 1V43A 1IN5A 3R9XA 4LHXA 3QPVA 2ZJBA 2ZRLA 4WOPA 5A0FA 3QVUA 2WWYA 4GT1A 2DFKB 2Q3HA 1M1YE 4HB4A 4EUNA 4R2IA 1KK3A 4OI2A 4M53A 1IY1A 4D6PA 4G5GA 1R0WA 4DWJA 1E2EA 3RRZA 4CW7A 3K70C 4BLRA 2F1JA 2BM0A 4FWTA 3FVQA 4B33A 4JL6A 1XTJA 2X2FA 3CNOA 3R9IA 4DSUA 3LH5A 1SVKA 1FTSA 2OSBA 3FKSD 1Z63A 3NBYC 1EFRD 1FMLA 4PPFA 2NO6A 4ARZA 4PSVA 3DZDA 5C18A 1S1MA 1KAOA 5HE8A 1DAIA 5TV2A 3ICEA 3ZZTA 2J46A 3ZGXA 4E5UA 2Q3MA 3SR0A 3THXA 4ON9A 3CF0A 4HLUA 2EFEB 2ZRFA 4Y0AA 3OFND 3QJYA 4YDSA 2XZLA 3B1VA 1CLUA 1EFHA 2C99A 3AVQA 3A1TA 2G0NA 3MAAC 3U6KA 1DO2A 1SQ5A 4GSYA 4YMTA 2IYTA 1GIAA 2QAGC 3DZ8A 4OHWA 3IQXA 3LAWA 1N25A 3SYLA 1E2KA 4B44A 4FN5A 1Y3AA 4CGZA 2IF0A 3OAAD 4IXNA 3GJ3A 2GVZC 3NWJA 4FMDF 3WHLA 2JLVA 1U9IA 2IYRA 4GNKA 2B21A 4URZR 4B73A 4RZ3A 3K09C 1ZUHA 3QXCA 2DYKA 3MJRA 2P6RA 2B92A 3RS4A 4MKFA 1TQDA 3BOSA 1B23P 4GPTA 4DB2A 1F2TB 2ZI9A 1CRQA 3WP1B 2ZUBA 2XJ9A 5HZKA 1KDPA 4LDJA 1UJ2A 2J45A 1FMJA 4FIDA 4OQMA 1P72A 1SKYB 5JSZA 2ZPTX 1T9HA 4Q1AA 2YNMA 2O0KA 4DKXA 2WWIA 1PVOA 3IDQA 3UWOA 4JLOA 5EUMA 2HCJB 2ZAMA 1W4RA 3GEIA 2C78A 3QE0A 3DOEA 1W5TA 1QG2A 1XU4A 3D7MA 5FBRB 1D2EA 1IN6A 4CF7A 4NCIA 3Q3JB 4LV8B 2CXXA 4TMXA 1IBRA 2VLIA 3RLFA 3U4QA 4KVGA 4X8HA 2Z4SA 3LBIA 1W2HA 3NG1A 4BZPA 4KSBA 3LVRE 3SBEA 4HAZA 3S1AA 1GFIA 2W6IA 4Z51A 4HAUA 4NCHA 1T5IA 1X8JA 3AVVA 1TEVA 4U7DA 3NTUA 1AS3A 3QXHA 3PEVA 2P5TB 3EZ9A 4G3XA 2Z43A 4KBFA 4DT1A 1OYYA 2NZ8A 1NBME 4DLRA 3K0AA 4LBWA 3WYFA 3ADCA 3M1IA 1CP2A 1S2MA 3L8ZA 2FDCA 2KBFA 1J8MF 2VSFA 3LV8A 1W46A 1Z07A 4XD7D 1YR6A 4DLWA 4B32A 1E6CA 2ZSBA 1L8QA 2D2FA 3W8NA 4CT5A 4KVAA 1YZKA 3L2OB 4BRWA 2IT1A 2WWXA 4GOJA 2RGAA 2FSFA 1KI6B 1Z0KA 3LX8A 4ZDJA 1XF9A 2GK7A 1XX6A 1ZJ6A 2HXSA 4QJ5A 2V7QA 3KTAA 3SYKA 4AWXA 4Q5IA 1ZM9A 1ZNWA 3A4LA 3ZYCA 4BLTA 2FX3A 1JAIA 1HUQA 3PEUA 2V1XA 2NO7A 5KNCA 2QEQA 4M4SA 3OEHA 4M2LA 1DO0A 4TL7A 5FTNA 4EJSA 3ZD6A 3K53A 3VMFA 1AGRA 2KI5A 3U3RA 1XJCA 1KZ7B 1MOZA 1HT2E 1CF4A 2I1VB 4ACBA 4QG7A 2VSXA 2ZUCA 1NMZA 2KB0A 4QBGB 4UNNA 5J5CA 3FHCB 4BWYA 3PUVA 4U00A 4C0JA 2RGGA 2JJ2A 2ORWA 3FFAA 4GZLA 4PHTA 1IXZA 4Q66C 3UMRA 2BDTA 4KITB 1IJFA 4MITA 4TTQA 3QG5A 1A82A 2P65A 3BBPA 2V6JA 2JLXA 3VU9A 2NO1A 3EPHA 4WBSA 1II8B 3AKYA 2PLFA 1G20E 4JBXA 3U60B 2XTZA 2JLSA 4X8MA 3IIMA 1Q12A 4DCTA 1D8TA 1QRAA 2GJSA 4XH9B 1D2MA 3AEZA 1GSIA 3BFXA 4KFTA 5HE9A 5KUTA 4UNPA 1OFIA 4RZ2A 821PA 4YQFA 3KJEA 3WNBA 1G16A 3W5IA 1KSHA 2PJZA 4TMTA 1CR1A 4TMWA 1NBMA 4E22A 4TT3A 2EWVA 2HUPA 1OT3A 5FL3A 4ZV4A 2WM9B 1BMFA 4V0OA 3ADDA 3SZRA 5L8VA 1E2NA 4IRUB 5IDVA 3GLGE 1M7HA 4LJ5A 4KFSA 4N1AA 5ANRB 3KZ1E 4CIDA 2WSMA 1GUAA 2PMDA 2FOLA 2QORA 1KDTA 5E7MA 2RKOA 3KQHA 1SVIA 1G8HA 1W0JA 2CVFA 1N5KA 5DN6A 5EUQB 3W3ZB 1DAGA 3PCRB 3WBJA 1OW3B 1AS2A 1H8HA 2YJTD 1KO5A 5FI0B 4RVCA 4D0LB 1VPLA 1NKSA 2FPLA 1NIPA 2C95A 1HE1C 3T12A 2IEYA 4C0KA 2JDIA 2O8EA 1XD8A 3WYAA 4UXHA 2XB2A 5A5GA 3GLIE 1SKYE 4IXMA 4V0NA 3ND8A 1FTNA 5JS7A 5JMTA 2BV3A 1XCGB 1OIXA 2Z5FA 4NU0A 4M1MA 3B6EA 2FFQA 3CRMA 4C2UA 4WXRA 3NIBA 2VA8A 3KFXA 1CJMA 5EP3A 3P26A 3O47A 1Z2CA 4OK5A 3O8CA 2OO7A 2IUUA 2GHIA 4LBZA 1RVDA 2A30A 3MUFA 5M04A 3ND9A 3I5YA 2AK2A 2REBA 3KJIA 3LLUA 4TYQA 1F3OA 4PSKA 1R8QA 4PX9A 5SZHB 4HSEA 4LK2A 2OCBA 4PHHA 1X8KA 3E70C 5KHOC 3KQNA 4JLVA 1XEWX 4LZZA 1WE2A 2IS1A 3RAPR 1MKYA 1KI2A 5AR1A 1UM8A 4LPKA 3V00A 5FPKA 1G7SA 1G19A 1VCMA 3P1JA 2IS6A 3KQUA 3IILA 3KKOA 4QM6A 2GEVA 2HLDD 4XIGS 1Q1QA 3SDZA 4NMMA 3KXIA 1ZP6A 2VEDA 3EZ6A 4ITRC 3IIJA 4PZZA 5BWMA 2ZI7A 1GL9B 3FHTA 3CX7A 4MRNA 5GJCA 4MYCA 2RGNA 4OJQA 1YRBA 4XOIA 3I4LA 4AC9A 4NYIQ 4Q1EA 2QRZA 1TADA 2X1VA 2ODNA 3GLGA 3KKPA 3U5ZB 2CE2X 4TMKA 3DKPA 2FEOA 4LJ8A 3IPXA 1JB1A 3CUEF 1RW4A 4KFRA 4JLPA 5KTYA 3VR6A 4XWAA 1L4UA 2DFNA 4JIMA 1H8EA 5CB6A 2DCUA 3QIAA 4P0TA 1YR8A 4JBYA 1R8SA 4WAUA 3SFVA 4AIIA 1CR0A 3B8HA 3O8DA 3TKLA 1VG8A 2I1QA 2ZI3A 2GAOA 1K8RA 5CIWA 3VAAA 3K0EA 4HAWA 1KO4A 2FU5C 3T35A 2BM1A 1N6PA 1P6XA 1X3SA 1EX7A 4M1OA 4DC9A 4DSOA 2PZGA 2EFHB 2WPDA 4QGAA 3W6NA 2Q3FA 3GLIA 2GXAA 1KSGA 3LLMA 2Z4RA 1YKSA 2P6UA 3B5JA 3VR4A 3ZJYA 1AJEA 3QSYA 4XSHA 4ZCIA 1N6KA 3MJHA 1JEDA 3X2SA 2EFCB 3HU3A 4Q03A 4TQUS 2AXNA 5B58C 3R7WB 5EXXA 3OE7D 2B8TA 2O8FB 1XEFA 2IA5A 2LWIA 2QE7D 1YZLA 3P4YA 4LPSA 2D4HA 4NPHA 3THWB 1VMAA 4GMDA 2ZETA 5C4GB 1Q22A 1E2JA 2ZSFA 3NHAA 2EWWA 4AYWA 2ZRGA 1T3SA 3QKSB 5TDHA 2QMHA 5FBVB 2X8AA 4G1UC 3B1YA 4IVPA 1T91A 1W36B 3NEJA 3AUXA 221PA 1ZC3A 2AD1A 2BKUA 4FW9A 1NLYA 5FTKA 4A82A 5FTLA 3DVLA 2O8BA 4LHYA 2AR7A 3BB3A 4BFSA 1LY1A 1XD2B 2WKQA 4AKIA 4D4MA 5FFMA 2C9CA 4B34A 2AL7A 2ZREA 2R65A 2C04A 2QGZA 1T5LA 2Z83A 4NYJR 4KYUA 3MWJA 4Q21A 3SEAA 4RKFA 1UBGA 4LJAA 3C41J 4IJMA 4LBVA 1VIYA 4MRVA 3CRRA 5EXPA 2EQBA 4C7OB 1KMHA 3M0EA 3AVWA 3TMKA 4MGIR 1GDDA 4C0HA 3C16C 3EAQA 1KK1A 5FUYA 3ZH9B 4WA7A 3TVTA 3WNDA 1LNZA 3R8FA 1YHNA 2W00A 1TF2A 2IXFA 3CRW1 2AFIE 2AK3A 1JNYA 3K9HA 2WJVA 4M1KA 4R2HA 1LS6A 2GVDC 4YMWA 1OIWA 1ZD9A 2XZOA 3MFYA 3L0IB 4KBGA 2R6CA 2WWFA 1JJ7A 3JZMA 3KKNA 4S2EA 4EPXA 2XOKA 3LBNA 1QHHB 4YMUA 4Q4JA 2CVHA 2CBZA 4IDOA 5KOYA 1OSNA 1NVVR 2O5VA 5HPYB 3CZQA 2REXB 3QNUA 1NLZA 5CK4A 4GOXA 3WXMA 3LQRA 2D74A 2NG1A 3E1SA 4G5RA 4LHWA 1Q3TA 4ZCMA 4CEJA 5BN4A 3ZD7A 5TY0A 4EDHA 1BIFA 1KYIA 3FMPB 2AN9A 1T6NA 3MLEA 4Z54A 5JFGA 4AYXA 1IXRC 1BYUA 3N5CA 4EPVA 1ZU4A 1TL7C 2ZITA 1S8FA 5JWHA 2JJ1D 4JSYA 5FBLB 2Z0MA 3CLVA 1VIAA 2F9MA 3N70A 2JLYA 3R8CA 2BCJQ 3CO5A 4Q7JB 3PEYA 1Z8FA 3PEWA 1JXOA 4CEHB 2BKEA 4OHZA 1NKTA 3TNFA 3DOFA 2V6IA 3L8YA 2QBYA 4JKIA 5DISB 2O8CA 5FR2A 1R5NA 5J4LA 2CMKA 3B13B 3W5JA 2FSHA 2GDJA 5DH9A 4KYIB 2RH5A 4LGMA 5JZVA 5KYKA 1R7RA 5CIQA 1ZD1A 4PZLA 1E3MA 2GCOB 5BYKA 5FOVA 5JS8A 3FWYA 1DOAA 4BLPA 2RGDA 1G7TA 5J4KA 3VFDA 4E03A 1Q1BA 1N2CE 1I4DD 4RD3A 4B2PA 1GNQA 4RD2A 3BH7A 3AKCA 3BB1A 3LFUA 3IQWA 4DEYA 1XFAA 3CRQA 4M9XA 4C4PA 3U44B 4GRAA 4ZDKA 1UAAA 3C15C 2CCGA 2QTVB 4AKEA 4QFMA 4IDPA 5CK5A 2VBCA 3TUZC 2ZRAA 1KO7A 2LKDA 4AI6A 1IN7A 2ZRIA 1CJVC 4PR0A 4TL8A 3CR7A 2J0QA 4RY2A 1HY3A 1KOFA 2MSCB 1Q3HA 2D2EA 1E2HA 4Q02A 2AFHE 5CYOA 1XWIA 4FMCB 4TL6A 4KODA 2ATVA 4GFDA 4ASUD 1W7AA 1X1RA 2ZTSA 1XTQA 3T5GA 4R71A 2IYWA 2QL6A 3CM0A 1P75A 2DPXA 2QP3A 2VL7A 3EZ2A 3N2IA 4P32A 3SOPA 5FI1B 1XEXA 2HJVA 3M6AA 1N6NA 1TU4A 1MH1A 1UEJA 4EJSC 5FR1A 2FSIA 4B3FX 2P2LA 4P4UA 1E0JA 1K6MA 4C0QC 1Z6YA 4IVRA 1Z0JA 3T61A 5EZ5A 2YINC 1COWD 4C0LA 2VP4A 1OE0A 4IFEA 4UNQA 3W6OA 3CWQA 5KNDA 1KKMA 1VDZA 5KDLA 3I1FA 2D7CA 2F7SA 4DUGA 4DLSA 1EFTA 4GP7A 1AA9A 2ZSAA 4HLCA 2WSSD 4DJTA 1ODFA 4IOLA 1XMIA 2QSYA 4LX0A 3K0SA 3RS0A 1A2KC 2VHTA 3GLHB 4QBHA 2ZRBA 1MO4A 2ZS8A 1EESA 2KJQA 3IUYA 3TQFA 2V1UA 5F9FA 2HT6A 1Z2AA 2OBLA 3REFA 4BUJA 1NY5A 1D6JA 1CJKC 3B9QA 5BYJA 2W83A 1Q44A 1RRGA 4AK9A 4HUTA 2DBYA 4NTZA 2PJRA 2RGEA 1E2DA 5EE3A 1NN0A 1NSFA 4FINA 4DDVA 1CBUA 3Q7QA 3V4FA 8OHMA 1ZNXA 3L0SA 4PPGA 3SBDA 1P2VA 2UVQA 5FPHA 1UF9A 3FOZA 1OFTA 2F1HA 2FF7A 2WKRA 4HB0A 4JLJA 4ZDWA 2H18A 2D3WA 5KSYA 2OEPA 4PQYA 3DMNA 3P4XA 2ZVPX 2OILA 4FMDB 4RD4A 1XNJA 3A1UA 5DIFA 1OV4A 2TMKA 4ESHA 2QSZA 4O25A 2H57A 4Q01A 5EE0A 2IYUA 1F2UA 3SFZA 3THWA 2IHYA 4UXIA 4HDQB 1X8LA 2CDNA 3GEEA 3GEHA 3VHXA 5HR5A 3T1QA 4GDFA 4DCUA 4RFSB 3QKSA 4JL5A 3TH5A 2CNWD 1QBKC 1TMKA 3VKHA 1P60A 2ZANA 1XJ0A 1MO6A 1E2QA 1O3YA 4JJKA 5JRJA 2GKSA 1KK0A 1KSFX 1WQ1R 1XD2A 4QHTA 4R7ZA 3QI2A 1W2GA 2IUSA 1GITA 1OLOA 4EPWA 2QMEA 3FKQA 1CXZA 1ZIPA 3ZQ6A 1SVOA 3TR0A 1BH2A 3LNCA 1MRNA 3CW2A 2OFOA 3U6BA 1CRPA 4OQLA 1E9EA 4OI1A 4URXR 4CZ2A 3UPUA 5JHGB 2XTMA 2QMOA 3NH9A 1AKYA 5JCZA 2YKGA 4C7OA 2PEYA 4Q7KA 3UIEA 1KNXA 4PFSA 4OHYA 4BECA 1GRRA 4V0LA 4AD8A 4L9WA 2WV9A 1AN0A 1Z28A 1A5TA 1P2UA 4Z1MD 1XMJA 3GJ6A 1HQYE 5FTMA 2GZDA 3EIQA 1OB2A 3ZLJA 1TX4B 4ZDIA 3PJRA 2QPOA 1JR3E 2GXUA 2J0UA 3RANA 1KK2A 1CR4A 1N6OA 2J59A 2ZE8A 1E9DA 1HQCA 2VSOA 4WW0A 1RRCA 2E1RA 1IQPA 1G6OA 4BFYA 5CLLA 1ZBDA 4TMVA 4DIEA 1CR2A 2WICA 2ZRMA 1L4YA 3HR8A 3I72A 1US8A 3L0PA 1GNPA 2RGNC 3F0TA 4TL9A 1IHUA 4B6FA 2AWOA 1HV8A 1QHHA 2JIZD 4CYMA 4LOAA 4K8OA 3PV0A 4ZKDA 4DCNA 3TVDA 2B6HA 1TUIA 1PUJA 2G83A 2ODBA 2QAGB 4P3YA 4IOKA 4PSAA 5BN5A 4YXWD 4MRRA 2BEKA 1ZM2A 4BFUA 3OIVA 2GJKA 2CK3A 1G7CA 2J7PA 2ORVA 1DARA 4QL3A 1NN1A 1U99A 1E2MA 2IF2A 4RKEA 2OT3B 4XVRA 1FZQA 3K70D 2OG2A 2ZI5A 1VCIA 4PANA 5J4HA 1S96A 2ZJZA 2JA1A 4TSFA 3ZVRA 1KSJA 3RYTC 1V5WA 4LYAA 1CJUC 2NGRA 1W47A 5TB5A 3EC2A 2OFXA 3W34A 2D7DA 2IS2A 1NRJB 5G3YA 1XCPA 2O0JA 4US2R 3G0HA 4Z8YA 3H0KA 4JJZA 4TLBA 1QHNA 2C96A 3BGWA 2ONJA 3O8BA 4JLMA 2ZYVX 2QMUA 3KKMA 3W3AA 3Q8XB 2OLKA 2NOAA 4NL4H 4NH0A 4JYBA 4HYYA 4DLUA 5FL7D 2J0SA 5IHPA 1E2LA 4LC0A 3GLHE 3QKUA 2GCOA 2GWHA 3WMEA 2O8BB 2FFAA 2BOVA 2VP0A 1K5GA 4ILEA 5UKDA 2N42A 5KNBA 4OI4A 2GETA 4OK6A 3THOA 1DTSA 1FL9A 3C14C 1NVWQ 3U3KA 3I32A 1R2QA 5LB4A 5EE9A 3HJNA 2AHOA 4QJ3A 2P67A 4B3BA 5F9HA 4U5XA 3NBXX 4PAMA 2EYQA 1FX0B 2ZJAA 3IPYA 3NKVA 1DAMA 5BN3A 5L3QB 3U44A 5FOSA 3X1WA 1JR3A 3THYA 1G3UA 4C9BA 1P73A 2G1KA 2ZEJA 3K9NA 4B48A 4D0NA 4GZMA 2NO0A 2R6GA 1U0JA 1SVSA 1EWRA 1QZXA 4JT4A 2ZR9A 2WWWA 4OYHA 3KQLA 2YWGA 1N3BA 1Z22A 2P5SA 3J81k 1B0UA 2WTUA 1FOEB 4L4UA 2GESA 4CEIB 4RFVA 1GL6A 1KO1A 3WMFA 4PZYA 1HEIA 4H1UA 421PA 1RKBA 2C9YA 4BZXA 1JBKA 1MRSA 3CPJB 3LWNA 4PQFA 2CLDX 3ZVMA 5AK0A 2QT1A 2IBMA 4TTRA 3T1VA 3AP2A 2QPTA 4QXAA 1KZGB 2X2EA 3FMOB 1ZD8A 4IHQA 2XNSA 4AYTA 5KDDA 5HKKD 1YJ5A 4O2RA 1U81A 1N0WA 3B2EA 4EIWA 2FPKA 2WHXA 2OXCA 1BYIA 1QHSA 2KWIA 1E0SA 2VHJA 5FOXA 1E2FA 4JLKA 1KI4A 2QM7A 3AVOA 1HURA 4RZXA 3RSLA 3UANA 1E0KA 4GI7A 3CKLA 1W1WA 3I8SA 3GFOA 1DVRA 4P33A 5FOWA 3X1XA 1E2IA 4OJKA 3IBYA 3AH8A 2QN6A 1I4TD 1E1RD 5DYIA 1AS0A 3OF5A 1GKUB 2WAYA 1AIPA 2I4IA 5J47A 3V4RA 3GLHA 1RPZA 2KE5A 1LF5A 1IXSB 4GMXA 2NPIA 3LBHA 4Q4AB 1EWQA 3WNCA 4PC6A 1KJZA 1RYHA 4V0ME 4MYHA 1A1VA 4CRWB 4JMPA 3R9WA 2XZPA 1Q57A 1K5DA 4Q19A 2CHQA 1GNRA 1F6BA 3SHWA 1Q21A 4M21A 2QG6A 3TSWA 4BEBA 2EW1A 5D3MB 3UG7A 1R5BA 2G0TA 3CWZA 3AUYA 1EFRA 1S4QA 3FKSA 4TLDA 4Q9LA 5KSZA 1UKVY 3Q7PA 2W6JA 1NJFA 3ICQB 4HZIA 2QTHA 3VNVA 1OHHD 2IXGA 4JS0A 5E95A 3AV0B 3LW8A 3JVUA 3VX3A 1G18A 3B1XA 4MUBA 1GOTA 2IEZA 2VIIA 3OFNA 3PQCA 3QEOA 4OQFA 1TQ2A 1QVAA 1U0LA 1R0XA 4KFUA 3RS3A 3GJ8A 5SZIA 3GLFB 3HWSA 1XPUA 1TQ6A 2F43B 2B7BA 2A5FA 4LUCA 3ZS9A 1C4OA 4W7SA 4BGDA 4RFSA 3LQQA 3OAAA 4LV6A 3RNLA 1Z08A 3EARA 2ZROA 721PA 4ZKEA 2QRNA 1R0ZA 2QGNA 4IFBA 1G3QA 5C1BA 3EG5A 4W9MC 2BC9A 4NYMQ 4P4TA 2OUKA 4ZIRB 1I2DA 1R10A 4TYPA 1JQLB 1NSTA 2JLRA 5JLJA 1W0KD 3A1SA 2ZSEA 2YC2C 4P31A 3PENA 5FOTA 5K8LA 3OZXA 4JVSB 1VYTA 4JLAA 1HH4A 1TU3A 4XWKA 4DDTA 2ERXA 1OXSC 3NDBB 1N0UA 1GZSA 3KX2A 1FQKA 2GJ9A 1SXJC 3TUIC 1OKKD 1XXHB 2J9RA 4FCVA 1ZUIA 3TLXA 5TMPA 4FCWA 2R6DA 4XWOA 1E79D 2FGJA 1Z0FA 4A8JB 3AVUA 2FN4A 4DSNA 3MCAA 4NZYA 4UXJA 4C0SA 4DBLC 4AY2A 4YONB 1UFQA 1ZAKA 2XNDD 3D6TB 4AG6A 2RGCA 4B2IA 4E07A 2EVWX 1M6NA 5FOUA 3TQCA 3BD9A 1N5JA 3VHLB 4YMVA 3RRNA 4MH0R 2JCSA 1KTVA 4UQOA 3RC3A 1KHTA 4HUQB 1LFDB 4V0MA 5DLQC 2NTYC 3LO5A 4PPNA 2PX0A 1KMQA 5P21A 1KNQA 2NMVA 2MMGA 4NYIR 3AVYA 2ZRDA 3ZVLA 3VR5A 4JYCA 5JJLA 1G64A 3EPLA 3M4YA 4LV5B 2YWHA 3BAFA 3FFBA 1J99A 2CL7X 2IUTA 2IYSA 3QF7A 4K81B 5FUXA 2WWHA 1FPMA 3IIKA 5FUWA 1GTVA 4R9UC 2PCJA 2IYLD 2WJIA 5GADl 4ESVA 3QKTA 4HAXA 1J90A 1F2TA 1NP6A 1X86B 2YZ2A 4I1UA 4Q1FA 3E2IA 4K46A 3B9PA 3Q9LA 4LJ4A 3ASYA 1Z6XA 3EA0A 3QXXA 4B3DA 3I8XA 2IWRA 3A4NA 2C2HA 4F7WA 4F4CA 4V03A 3FE2A 4O2LA 3KFVA 5K8UA 2Z6VA 1U8YA 3PUWA 2B7CA 3F8TA 4DSTA 2JEOA 3AVPA 4MDEA 4M0LA 2IWHA 1ZM7A 2C5LA 4XD7A 4A0FA 5IK2D 1T4GA 2ZJ2A 5E7IA 3EPKA 1VG0B 4RD6A 2ZAOA 1G17A 1Z3IX 4MKGA 2DHRA 3IHWA 1DE0A 1SXJD 1Z6TA 1D5CA 3LY5A 4EFLA 1KIMA 1Q1EA 3VNUA 2V55B 2Q21A 1EK0A 3KXKA 3V9PA 2FH5B 1R6BX 1U0HC 2XSZD 3EW9A 4EKDA 3L82B 1YZNA 3I3SR 3D3QA 3OEED 2OE2A 2ZVQX 1D9XA 2WWGA 3C5CA 1F48A 2BBOA 3TSZA 3CNLA 4IW3B 2YWEA 3UK6A 3QKRB 2IXEA 4YLGA 2OCYC 3EPJA 3KUCA 1UADA 4MRSA 5G40A 2J3EA 1GL7A 3D31A 121PA 3RSOA 4D81A 3QF4B 2OAP1 5EP2A 3RS2A 4XVUA 5E3HA 3PG5A 4KSCA 4TQ9A 4QKQA 1UKYA 1BKDR 4BEJA 1TF7A 3DEFA 1IN4A 1YZGA 1FX0A 2NIPA 5L3QA 5G53C 3KXLA 2D62A 2FE4A 4L16A 4QNMA 3ZS8A 1P2SA 3FHOA 5BW8A 3GPLA 1DAKA 5IRCD 5E4FA 4I4LA 5F2EA 2DFLA 3BJIC 4BFZA 2ZRJA 2HV8A 1QVRA 2F6RA 3EZ7A 1G5TA 4GBMA 5HCNA 2Q9CA 2N1BA 4HB2A 4M1WA 2ZQ5A 1PV4A 3GJ4A 1G41A 4BE7B 1KI6A 2VPPA 4CEIA 3P20A 2IK8A 2RAPA 1E32A 1YE8A 2BVNA 3SJAA 2NPFA 4MRPA 4EQ6B 1ZCBA 4B75A 1IN8A 3GLFE 1RZ3A 4HLUC 3EA5A 3FMFA 1IONA 1OXTA 4UJ5A 1SGWA 1E9RA 4W5WA 2CL6X 1N5LA 1JPJA 3PFIA 5CYPA 1E1QD 2Y8EA 2XEXA 3OIUA 1LW7A 4HAVA 5AJWA 4BQSA 4QRHA 3WP0A 1ANKA 3BS4A 3ZIAD 1VYUA 2MSEB 4LWZA 3ZZ0A 4M8NE 2H7VA 4Q48A 2OCPA 1CJTC 2OAQ1 4G5QA 1U9IC 2B8WA 2GK6A 3L43A 3KJGA 4O3MA 3SJBA 4A4DA 2PT5A 1ESNA 3EC1A 1I2MA 2BJWA 1AKEA 3UWKA 2REOA 1DBSA 4LJYA 5LD2C 3VX4A 4URVR 1XXHE 1WBBA 5AUOB 1KY3A 3MWLA 2QAJA 2FWRA 2QY9A 3A37A 3CF2A 3MWKA 4N3NA 2HF9A 5KU1A 3NH6A 4PPQA 3CPEA 1II8A 2GBLA 2IYVA 4WVFA 4LYHA 3GJ5A 4LC1A 2CEAA 3B1ZA 1S9DA 1JPNA 4Q4HB 4DLXA 4QM7A 5D3QA 1HT1E 2ZJ8A 4TMZA 5GJWC 5AUPB 5BQ5A 4QBFA 1D9ZA 2CHGA 2ZSDA 3KQKA 2JLUA 4UKDA 1OH6A 3QPWA 3LW7A 4PC1A 3RS7A 3I5XA 1FW6A 1C9KA 4H1VA 5H8WA 1N5IA 2BBSA 5D3MA 1ZINA 2GA8A 2A9KA 3CNNA 2WJJA 4W5HA 1WA5A 3TAHA 2ZUDA 3WRYC 1E69A 2C9OA 1P9NA 4WZAE 5AWFC 1Z5ZA 2H17A 3K0CA 4PAQA 3A1WA 3ETLA 4QBIA 4TQAA 3B1WA 4US0R 2BBTA 3PUZA 1QHYA 2BMFA 3NC1C 5J40A 1GWNA 4A36A 5JCPA 2FZ4A 1EFCA 1KGDA 3GLFA 2HYIC 3RWMB 2HLDA 2KBEA 1II0A 1KJWA 3GFPA 3GMTA 4M9SA 4N0DA 2XGJA 3U4QB 2A5DA 4D25A 1KJYA 4ABYA 1UPTA 4BFXA 2VO1A 4FD2A 4J0QA 1Z0DA 2DFTA 3BFKA 4GOKA 1VHLA 5CB8A 3H4MA 2QNRA 1DADA 1GILA 1GRQA 2GF9A 4Q1DA 4G5OA 5GVSA 5JWOA 1CEEA 2WJYA 1KDOA 2VP9A 3QVVA 4JVMA 3SYNA 1G7RA 2DWPA 5CJ2A 1XXHA 3K0AB 4OK3A 2W0MA 1KI8A 3TJZA 4B76A 4A8JA 3LX5A 2FNAA 2V9PA 2CLSA 1JECA 4EFNA 1VHTA 3T15A 2GZAA 4Q4LA 1GKIA 5FPSA 3TRFA 1GM5A 4UJ3A 2IYYA 4JBWA 2AX4A 2JLQA 4EFMA 2GRJA 4O0MA 1IJEA 3GJ7A 4G01B 2A3RA 3OE7A 3A8TA 1S9HA 1U8ZA 3ZZUA 2QE7A 1U94A 1XTKA 4G5SA 1MABB 1MO3A 2BMDA 1P5ZB 5F98A 1J2JA 3LXRA 4POAA 4Q9HA 4Q9KA 1G8GA 1LB1B 2WIAA 3Q5EA 5JECA 4A6XA 1OPXA 4HDOB 5AJZA 2W6ID 2ZRKA 1YQTA 1OH7A 1UBEA 3BXZA 4B6EA 4M1YA 4RD0A 2F3TA 2JGNA 1RE0A 2ZJYA 1GAJA 2DR3A 2HDNB 2OBNA 1F5NA 2G88A 1SZPA 2H5EA 2GCPA 4KLNA 4BLOA 2X77A 2ZYUX 4IKEA 4LHZA 5TVKA 1Z0IA 2QP4A 2HT1A 5HTKA 5HCIA 4BLSA 2FEMA 2R44A 2H16A 4F4JA 4QOSA 3RRYA 3LVQE 521PA 2VH5R 4PAOA 5EP1A 1UEIA 4M1SA 4M9ZA 1OH5A 1JALA 5JJIA 3TUJC 4X8LA 4C0BA 5FBWB 1YVDA 1N6IA 1QHGA 1BS1A 3W90A 1UKEA 2N46A 4B74A 2V7QD 2P6NA 1RRPA 2IC5A 3FPAA 3R7WA 2JAQA 2QP9X 1KI3A 2W2TA 2O8FA 4DIDA 2PH1A 1ZRHA 1M2OB 3OEHD 1SHKA 1RJ9B 2ZRPA
chains in the Genus database with same CATH superfamily
2EYUA 3UB4A 4PO3X 4BNVA 4D98A 4AKHA 2CDRA 4PWYA 2QK4A 1PIWA 3OSZA 5CITA 1X38A 1DEOA 4C89A 4CU2A 5JHHB 4JC5A 3TRJA 4MVYA 4TLMB 4ZZ2A 3QX7A 1U2ZA 1YCGA 1NW8A 1Y9JA 4NXNB 2C7VA 3H18A 1N4DA 2NQ2C 4TTPA 4KAXA 2D06A 3AF3A 1P4GA 2LKCA 1RWMA 3DVSX 3GG2A 4QDTA 5EJ4A 5DMXA 2VF5X 1E3DA 3JQ6A 4XKJA 1ELOA 1RJGA 2ZWMA 2ECFA 4YC7A 1AURA 4E70A 3KC2A 5F35A 1JQKA 2CF6A 4P86A 4UTVA 3PU6A 1PFKA 4N18A 1DO8A 4L4YA 4QC2A 5JXHA 1IXYA 4LF6B 3EC7A 3IOBA 2WIDA 3C4QA 5EIWA 1YJBA 5DHTA 3D2AA 2WIBA 2BFFA 4MLZA 4OTZA 1WDTA 1R0YA 1KFKB 4LQDA 1CS0A 2VPTA 4B1FA 1IY8A 3TNYA 2OGUA 2MMCA 2ZS7A 4CMEA 1E1NA 3B5EA 3OHMA 4I1OA 3SZMA 1OI2A 4ZGBA 5AQ1A 4GKBA 2FW1A 5K8JB 3GARA 1TYBE 2CLKB 2PAAA 2WVJA 1C9YA 1YI8A 4BMZA 4ZVPA 5I8WA 4QFDA 2YN2A 4JIGA 4TWBA 3MUOA 1XVLA 3Q8KA 3BE4A 3CUTA 1I7PA 4WOCA 4DA4A 1DKNA 5FPYA 2W2VA 2AG8A 3OC6A 3TD2A 2HW8A 3BF8A 4PHFA 2C07A 2RH4A 2M6LA 4ZZIA 2YXNA 1G63A 5BWBA 5K0JA 3QE3A 3U3OA 1UKCA 1C2YA 2Q9BA 5FLXA 3LDHA 4ZOLB 3WRXA 2VA9A 1E1CB 3O93A 2QPAA 3ZUPA 2VRWA 1SG9A 1W5SA 3V1NA 3CZPA 2I71A 2JATA 3P9SA 4GMGA 2XOXA 2ZR0A 4LDNA 4NXMB 5AW1A 1DJQA 5KWVA 4AZTA 3JR7A 3L7KA 5DN6D 2CXPA 3H16A 3KZNA 2RGRA 1J5XA 1VJTA 1BXGB 2AOUB 2AIRA 2J5XA 4BQRA 2OENG 1YBHA 5DCLA 3A6FA 2PKXA 1UQRA 1R4ZA 1EGQA 4GP6A 2C00A 1ZJ5A 3C8HA 3G2JA 2NU8A 2JDID 1JLLB 3LOQA 4KIWA 3S2ZA 1LBEA 4QBTA 3W79A 2O8DB 4Y0VA 4PYLA 3DP9A 4ZI2A 1RAGA 5AO9A 5EJ9A 1S4MA 3ZLTA 2GEDA 2XDAA 1E96A 4TYNA 3KR0A 2P2SA 5KQRA 3TI7A 4ZVUA 4U39A 4Q4HA 4RHTA 2GJ8A 1UJ6A 3BGSA 3N07A 5B2ZA 1DX4A 4OFWA 2CB0A 5U4XA 2CV2A 2EAUA 4UE6A 1NKVA 3HYTA 1QDUA 4R51A 4CEHA 3BFJA 3QBEA 4NNJA 1XHFA 3TIFA 2HR1A 3BCRA 1CEXA 3DGEC 1UJ5A 2G7MC 5D7BA 2NUAB 1XG5A 3BXOA 4RLFA 4LQ4A 4J0GA 2ZXUA 2J8ZA 4MKXA 5F21A 3GOQA 1ONOA 4LRWA 4ENQA 3H1EA 4KK3A 1UDWA 2Q5LA 1QFXA 1YBAA 4NBUA 2R4QA 3GUZA 1YR2A 2P30A 4MA4A 5K05A 4O4HA 4NICA 2CXTA 4ZWNA 1PL6A 3RVBA 3QX8A 1CU1A 1L7VC 2DWQA 2OD2A 3DDCA 3NHKA 1X0XA 3VDRA 4FBGA 2ZU0C 5TEVA 1PNQA 4GX1A 3TAUA 3FVTA 4B6SA 5A2QA 3E5NA 4KGZA 4YIKA 3RRJA 1H3FA 5DBOA 3JQCA 1UBFA 1OF1A 1CRZA 1L7XA 1IIBA 5EWMB 3NFYA 1K08A 1WVMA 1DAEA 1IY0A 3JVIA 3PWSA 3M9XA 4A26A 2I3AA 3TXYA 2NV6A 5K2MA 3C43A 4PTLA 5H70A 1CUVA 1AG9A 3EASA 4AZSA 1FP6A 1C3XA 1C1YA 1G291 1RXSA 2F3QA 3BMNB 2XWSA 2NQTA 1HE4A 3KT0A 4A5SA 4DXAA 1QFMA 4MW6A 4LWPA 4P4SB 1QB7A 1Z0AA 3MJSA 2WVHA 3LP8A 1IM2A 4RZIA 3UXMA 4DPKA 3RYHB 1VSQA 1ZNZA 3OE4A 3CB4A 4HADA 3MG9A 4FFRA 4OSEA 2VJBA 2ECOA 4RTOA 1LQTA 1H8ED 1NY6A 1NRXA 4ZCLA 1ZM3A 2EFGA 5F4BA 3UQZA 1J6UA 3CUSA 4JP8A 1Z29A 2Q6OA 4BNHA 1ORIA 1L6IA 2XTNA 4LG1A 3TCXB 2QE6A 3ED1A 3KDSE 5L40A 3UOGA 5ESXA 1QXSA 2W2KA 3LCCA 5AM2A 2CZQA 5DBHX 3VO1A 3RIYA 1QX4A 4CHTA 1NW3A 2EZ8A 1ZNYA 3CLSC 3NETA 4WJZA 1QGDA 4J1NA 2Q5OA 2VQ6A 1LRKA 2OCGA 3TTSA 2C8VA 3DSRA 1KMHB 5KQGA 3BVPA 4MINA 3QI7A 4WMLA 4OHVA 5K0CA 3OTOB 3F73A 1P9RA 5H68A 1SQ0A 3EGDA 4LCBA 2V45A 3AF0A 3OLZA 1UDXA 1G21E 3WLSA 1XNQB 1LVGA 2YDYA 4GOND 4A7PA 5FH9A 4G41A 1S3GA 1TZJA 3T1TA 4DIKA 1GR0A 1JR6A 3AERA 3R09A 4G56A 4BX9A 3P9ZA 4F11A 4JLBA 1LSOA 3Q41A 4F5ZA 5A1TA 3LF1A 1DS6A 3QU7A 2CFSA 2JHCA 4TLCA 4B6OA 1V0JA 1WIWA 4PXAA 1DC4A 1PKEA 3C7AA 3H9UA 3TR5A 2XXAB 3S8YA 1Z34A 3M82A 3NAGA 1TT7A 1DFGA 3RM3A 4EEZA 4D26A 4DEVA 2ACVA 2JIOA 3GRVA 2L0XA 4OQEA 4BXOA 5AVYA 3MGAA 2GBLC 2VQFB 1M9NA 3FCXA 2WUVA 1CDDA 1HGXA 2EJVA 4OQZA 2GASA 4F5EA 4Z3KA 1C7ZA 2ASEA 3UWMA 3ZOZA 1DQZA 3C85A 1KVSA 3FPFA 4ND6A 4Q4JB 4PV7A 1V71A 1E3IA 3D3JA 5E2AA 4CKBA 1M6VB 4JODA 4XWTA 5CVVA 4L5BA 1OBFO 3IBFA 3NONA 4ZK2A 4OGKA 2IYQA 5C4MA 2QD5A 2ZRNA 5DYGA 1WXQA 4EQZA 3HPQA 3IALA 2ON6A 4BGEA 3AYZB 3FGPA 2Z2JA 3HDTA 4WJKB 4WCVA 3K6JA 4XLZA 1W5AA 1NUHA 1W48A 2WHPB 3DTVB 3IYLW 3KPUA 1XYGA 5G0VA 4KR7A 2IEIA 1WP9A 1WG8A 5AXDA 2R47A 5IAAA 3DEHA 4XPZA 1JX6A 3P0RA 4Z9YA 3CIFA 3L5KA 3Q3VA 4PO1A 5HFAA 3CMCO 1KS9A 3IAXA 5U1PA 1QC5B 1P8AA 1LEHA 1KZ4A 1RXYA 2NO9A 3ME5A 5IKOA 4KXNA 4EVRA 4TS4A 3QE9Y 2ZUUA 5DXAA 4YO7A 2FSGA 3DFZA 4GS5A 1UC4B 3GD7A 1AA6A 2JF0A 4CVNA 1JR4A 1MEJA 5EE5B 4BNLA 4BEVA 4B0PA 4OI0A 4KUGA 3E6AA 3ZWVA 1XMVA 2G5TA 2GLUA 4MHTA 3JD4A 3KUDA 2O8CB 3SS8A 2JBWA 4IIFA 2FZLA 2R2AA 3EBPA 2X5XA 4JP2A 4WWHA 3DE2X 5AHXA 5DO9A 4DA8A 5E9AA 3ZDYB 4YV1A 3OPMA 1C9NA 4HDRA 4YCSA 1NJGA 1NUUA 1PK7A 3GUYA 2GZ2A 1DIGA 4TUYF 4AUMA 1CW2B 4KTVE 3HA3A 3QV1A 16PKA 3QOFA 5E38A 5FQNA 4BVGA 5AUNB 1EEXB 2BFPA 2C8LA 2Q4DA 4KLCA 2JIZA 2VF4X 1N3YA 3SJZA 4UCQA 1Q11A 2C5GA 2Q9AA 2PMKA 1QHIA 4RETA 2DFDA 2X4DA 3IKJA 3WMXA 2F17A 1HNZB 3UT5B 3EGWA 2X0FA 4YRIA 4GL2A 1BD3A 1M74A 1ZU5A 3FI9A 3O9MA 2WF7A 3LPLA 4FW8A 5D3ZA 4YXWA 3RNOA 3H9GA 5DWVA 2G71A 2WYOA 2Q4BA 1DAHA 3T9AA 1JBEA 1BX0A 3KYDA 4NMWA 2IS4A 3LWBA 4EGJA 4IGEA 4TLAA 3NNNA 5CM8B 2A4KA 2BEUA 1ORDA 3VISA 1YJAA 4MDFA 4XJXA 2LXNA 3NOOA 4H2DA 2ZR8A 4NJEB 2Z5GA 5KJ1A 1FFCA 4DLTA 2WI8A 5CW2A 4NENA 3EWAA 3LUDA 4DPLA 1SXJB 1MA3A 2J48A 3BH6A 4MB2A 3VTKA 3T3NA 5DI9A 2VNHA 1K89A 2BUBA 1GPBA 2FW0A 3TR6A 2QTMA 1FYVA 3WRVA 1U0TA 3H2KA 3TSOA 4ZOLA 1NQXA 2ZB7A 2ZB2A 4GSLA 3T5AA 1CK4A 4G0VA 3E23A 5C80A 3K5HA 3RO7A 1XEXB 1TO1E 1Z4QA 4NEQA 3WLAA 4CMIB 3AEUB 4GAEA 4WINA 4DWOA 4RK7A 3RS9A 2XHEA 1EDBA 4D56A 1VI2A 4KL8S 1TJNA 1QG4A 2AOUA 2GM5A 3RVNA 4E11A 5JJKA 5EMLA 1Q19A 2ZUWA 1GT91 3H17A 1OAAA 4QECA 4AECA 4ECAA 5KSWB 1M0TA 3LM8A 3MOGA 1L1RA 5J2UF 4KPUB 2A7QA 1NLUA 3DVAB 4MQLA 3X1MA 8MHTA 2O8DA 4WKCA 3FAZA 4IDHA 2VJOA 1G9XA 5I7UA 4CF3A 2YMMA 1EXNA 1ZM4A 1QS0A 2PV7A 3NOVA 3O9ZA 3QENA 1T2UA 2OV2A 2WUEA 5CCBA 2ZDQA 3DONA 3ZGYA 3HCNA 4W6QA 4NZOA 5EPEA 4CE6A 3DOIA 1JU4A 3HH8A 3TL6A 1C50A 3K09A 1I1QB 1VLMA 3CSUA 4UUMA 4XM1A 4RQUA 2JS7A 5BMVB 1ZGJA 4MS1A 3WLLA 1GLGA 3FKJA 2YQ5A 4IICA 3RK4A 3ZHTA 4E2XA 4G81A 2P7HA 2FOIA 5SZKB 1QZTA 3PVSA 4EH1A 4F1KA 1XVUA 4R98A 4XFJA 2FEKA 4A0HA 1U98A 4RMIA 2I0FA 2I65A 3I62A 1IG0A 5EE1A 2QT9A 1ZONA 2QVCA 2YICA 2PLNA 3KG2A 5MFZA 1Z5VA 3LMKA 1DCTA 3RD5A 2D00A 4EECA 1AUVA 3NUGA 3D0RA 3GLSA 1GXSA 1NXOA 1VCNA 3A10A 3BHMA 4O1MA 4CV1A 1A9QA 1GKYA 2YYZA 3GCGA 3R5HA 1NDHA 2AMFA 1Z0ZA 4U7TB 4NQRA 4WXHA 1OBOA 5CJPA 3H4IA 4Z9FA 1KI9A 1T5SA 2F3UA 3T06B 3FHJA 4ZEMA 2NU6B 3ZDEA 5BSFA 2AWNA 3WB0A 4FYXA 3BB4A 4LI0A 3AFOA 4QWWA 5JFTA 2YC4C 3RHTA 1B0AA 3FFTA 5E9WA 3BERA 2CJWB 3DS8A 1XP8A 3QY0A 5AM0A 1L4NA 2B9VA 2WMNB 3Q3GE 3UJNA 3KTDA 1DKPA 1SVMA 4ZO9A 2CL0X 2PZJA 4U2GA 3KQSA 4A0SA 4A2PA 5KNDD 4JWKA 3W7BA 2Y0CA 4FHGA 1VI5A 2GUGA 4DUGD 3DWIA 1PO7A 1MB3A 4IFIA 3RWOA 1X7YB 3U2QA 3R9XB 2ZYIA 4P4SA 4YDHB 5DJ5A 4IIDA 2P40A 4CMKA 2A78A 1SIWA 4CQJA 3WQHA 1E1RA 2YYSA 3MRTA 5DCUA 3RYHA 1H65A 5TXGA 4RADA 3S55A 3JQEA 3VPAA 2YOFA 3D2LA 4H59A 1ONBA 5JNRA 1DWPA 4M0KA 4IIVA 4HS9A 4OJTA 2AUMA 2PZ8A 3TIGA 3K4HA 5GZ6A 1BFDA 2B4KA 2J7KA 4EX6A 1XVVA 1NN5A 2HA3A 1RC8A 1F0PA 1Z82A 4FGSA 4G5FA 4B7XA 5F77A 5SY9A 3SE7A 5DEIA 3X43A 5ADVA 5KPJA 2FFBA 3SICE 2H29A 4KNWA 3CISA 4MRMB 3IBTA 3WV4A 4HKTA 2GK3A 3M6MD 2CHFA 4TWZA 2Z2XA 4WZBB 4XB1A 5AQEA 5DW3A 1H5UA 3QVJA 1VHDA 4YWJA 5B2FA 2CDAA 5C34B 1G3MA 1KPHA 2VP5A 4G0NA 1VG9B 4IRMA 3DTTA 5DMHA 5A9RA 1P7CA 4BNNA 5LZ8A 3U81A 3GC6A 2WAXA 1ZCAA 1QIDA 3TTYA 1GV1A 1TVCA 3L8GA 1AE1A 1FYFA 1OHHA 4KIJA 5H16A 1QHXA 1Z17A 4LYYA 3GFFA 4UNRA 2A5YB 3ZPXA 5JBQA 4JU9A 1HTTA 3UG6A 3EMVA 5C31A 1UBCA 1A8UA 1QKKA 1NP3A 4G1EB 3ZK7A 5FUVA 1XP5A 5JQGB 3UHFA 1GQQA 5HRAA 3CZRA 3PDUA 3HG7A 1DC6A 3ROXA 1P7YA 2ECKA 3E22B 3O8LA 4IJ6A 3A11A 4NEGA 2C3YA 1AV6A 2B25A 2DWOA 2YZKA 2GXSA 4PQRA 5TVGA 1QG0A 1VCOA 3FYTA 3N8HA 2XXAA 1LD3A 1JQEA 4R16A 1F4PA 5BWLA 5EKXA 4WZZA 1VHQA 3T34A 2IIBA 2WJHA 3F5SA 5ILGA 5C7IO 1CSEE 3CVXA 4DDUA 1B8PA 4RO0A 3HADA 3UATA 4R2LA 2PUWA 2ZAYA 3PR1A 4KU4A 4N0EA 3D81A 3GUCA 4WOKA 5FB3A 3DTNA 4E33A 2XD9A 4E51A 3MELA 3CLHA 4X44A 4ZTBA 2ACWA 1DPGA 3N2NA 1ZH6A 4B47A 1P6QA 3W8FA 1VL2A 1ZWLA 3C45A 1M6VA 4IJQA 4LE2A 3ZVNA 3U7GA 1DSSG 4KAFA 1PD0A 2RCNA 2RH8A 1I1NA 3QG1A 4B8ZA 1UKZA 4HJRA 4Q39A 1YZUA 5BT8A 1NVVQ 3HN6A 1OKKA 2CXNA 4AXBA 1SK9A 2WHPA 3DTVA 2IHVA 1E79A 1QR6A 3COVA 3T9CA 4BTLA 3F49S 4D0GA 4E09A 4FE3A 2R6FA 3TEJA 1EIWA 4O5OA 4XUGB 5HS4A 1KRWA 2VUUA 4E08A 3W2IA 3EE6A 1G60A 5JSZB 2NZJA 3WQRA 1QC5A 5IYZB 1VIMA 1M8GA 2I5PO 3G9XA 1I3NA 3NM6B 4B4VA 1IOLA 1H2WA 3KQPA 1MDBA 3IVRA 2D59A 1N6RA 4ALIA 3OKFA 4XI9A 1BSVA 4H4EA 3E5RA 2QKYA 3L8EA 2GPSA 2NSLA 3O74A 2BHSA 2QM0A 1W1IA 1HT3A 5H1YA 1WUKS 4UVDA 1O54A 1JDBB 3ML1A 3WKBA 2JFWA 3DAGA 2DC1A 1X7HA 3W78A 3OU7A 4MW9A 3WQQA 3A1CA 5AUQA 1Z47A 1PAUA 1YDEA 1BVHA 4YAOA 2GTPA 3RHFA 4BQPA 4OJYA 5FQOA 5BWMA 1R5OA 1LDBA 1U9JA 1X7XA 2UZ3A 3ST7A 3HCWA 1UKAA 3GP5A 2QXTA 3DUWA 3C3PA 3KB2A 3S1AB 1NUTA 5LBIA 2ZWPA 3V4SA 2YW2A 5MFPA 2Q6KA 2XUJA 1SPBS 4YBZA 4Z5XA 5I51A 2AT1A 2BAGA 1V8FA 1V5EA 2I87A 1V1RB 3C7KA 3DAPA 1G8PA 3E9DA 1A4XA 3PUJA 4FMBB 4EB8A 5DYTA 4EPRA 3T7TA 2QXUA 3A7DA 3BPSA 3IAAA 4QOJA 4B4WA 1FMCA 3IDAA 4XB6B 1HO3A 1AZTA 1O8CA 1TCAA 1G6HA 3PQFA 4LVOA 1AXGA 1Y8CA 2GSDA 3L41A 5KDOA 5KREA 4C5AA 4IHJA 4KXFB 1T9GS 4CR6A 4WX2B 2DY1A 1KDRA 2OLJA 3CEJA 4P5DA 4DEYA 1T34A 1BMTA 2H7CA 4YFVA 5JROA 2EDCA 4KQEA 4ZTZB 1RWBA 4Q1CA 2D0DA 3PUHA 4BNWA 4DLAA 1SBTA 1GVNB 1GQ2A 3R0ZA 4GD3Q 1RP7A 1SXJA 3SE0A 3AZQA 5L9AA 3JYPA 1KC3A 1AQLA 1ODJA 2BELA 4G2NA 5DXFA 3KELA 4OHCA 3VSEA 3RAFC 3AP3A 2XSZA 4DFDA 4XTRA 2VSYA 3MIIA 3LTNC 1IAQA 2AQKA 1WU8A 3RUHA 4BFLA 3CLUC 5IDQA 4AJ4A 2QVXX 5A9SB 1OD6A 1G8MA 5ALNA 4CMIA 3HUDA 2QUJA 1ZK1A 1ST3A 1R0CA 4GX5A 5AJVB 5HHTA 2BGNA 1AO0A 1JEOA 3G8AA 4DVGA 2YWDA 3JQRA 2J09A 3EN0A 1O6FA 2VI5A 3BWDD 3KHSA 2WYVA 2C0PA 5GGYA 1FUIA 2VAPA 2XUGA 5ISMA 3DLAA 1E0AA 1WF3A 4YACA 3T7EA 1S3SA 4KPUA 3DMRA 1RYBA 5D3KA 3S3TA 2O0MA 2WDZA 1RKXA 3F5FA 4S2UA 4A0QA 3DW3X 1PBNA 1UZLA 2O8NA 5LQJA 2P77A 3O31A 3OQMA 1E4YA 4C2AA 2OCAA 1NIJA 3P7MA 3KLPX 3SHTA 3V8BA 5EJIA 1NI4B 3ELUA 1PUIA 3GK3A 1OJLA 3E3NA 3IOMA 1A9ZA 1L4KA 3K8QA 4JT2A 1U3CA 2K7ZA 2PUJA 3HKCB 1J5EB 5BMVA 1XCMA 3OQJA 3FSEA 4A2QA 1DI0A 1TF5A 3E7DA 4LECA 4D4LA 3AGQA 1DKQA 3SQWA 5ALGA 3KRTA 1SFRA 3MGKA 1JIKA 5JSYA 4WXPA 3T99A 3WGKA 3X1YA 2PUTA 4YUZA 2CLOB 4X7MA 1EFPA 1U1FA 1FRQA 2O2DA 1ODCA 4RPLA 3STHA 2QZZA 4DNFA 1RKVA 1NE2A 3PUXA 2Q4TA 4R9NA 4ZRNA 5DSXA 4G1BA 2XB6A 4F45A 5KBYA 3V8PA 3VR2A 2AJBA 2NLOA 1H1LB 1UBNA 4PRLA 3CH7A 3QUSA 4NE9A 1RIFA 2ZT5A 3IP7A 3GV0A 2NU6A 2X3FA 2CD9A 1KRHA 2XJ4A 4MI3A 1P0CA 5JH7B 4QZVA 4LFBB 3W3AH 2CVOA 3KEOA 3G2LA 3QFCA 1L1FA 3PUYA 2CJWA 2CHEA 3PR3A 4R8RA 1J8YF 1E5VA 4W9RA 2A92A 1XI2A 5HJ5A 3Q7TA 3DBOB 3NOQA 2JD0A 2BSQA 4IMIB 1Y4UA 3WGVA 1M10A 2HBZA 3D4PA 2B1IA 5JEEA 4OB7A 3ADKA 4WFIA 2PIDA 1DXOA 4MUKA 1C3OA 4W4TA 2CNBA 3LP6A 2DGDA 3BXEA 4HEA6 4JLNA 1B14A 4U9UA 5AXBA 4MUXA 3H5LA 1X7YA 1H2AS 4ZI3A 3R9XA 2I66A 4C1BA 3B6KA 4BO1A 4ZCRA 3RHZA 3QVUA 4RHXA 1HQDA 2H31A 2V7EA 2WIJA 1TJYA 3EZLA 1T43A 1NUAA 3NU1A 3O1IC 4GT1A 3QFFA 1E4OA 4RTLA 4C21A 4DC0A 1U7UA 4FFLA 4QYWA 1M1YE 4HB4A 1LVUA 4BMYA 1PTJA 4YGYA 4ZEVA 4G5GA 2Q8QA 1C3EA 3L1HA 2DSNA 5IJZA 4HR7A 5HEKA 1V16B 5FLEX 5JT1A 1CY1A 3QOYA 3L3BA 4MRMA 1PS0A 2WNSA 3DD5A 5TIIA 4FC7A 5J2TA 3WB9A 2DQZA 4FWTA 3K35A 3ZD8A 1ENOA 4WZBA 3I58A 3R9IA 3LH5A 3HLKA 1Z63A 3FKSD 2E3JA 2YZGA 3CN7A 1HORA 2NO6A 5C18A 5LFAA 1SBHA 1S1MA 4HLNA 1BEZA 5E8RA 1PJTA 1DAIA 1PJSA 1WDLA 3IKVA 3ICEA 4BO0A 2JHFA 4UHBA 2QU7A 3CLRD 3ZZTA 2JFVA 3THXA 4AY3A 2QRQA 2NXWA 4ON9A 4FTWA 2J9FB 5JQGA 2EFEB 4JOCA 3QJYA 1RQXA 4MCAA 3ULKA 3AR4A 4G4SP 1CLUA 1RI5A 3LLVA 3AVQA 1R8XA 3AJAA 1R3UA 1K6IA 3B8EA 1DO2A 3O5AA 3JS5A 5ALDA 5TMEA 4DNOA 5AYVA 4FLEA 1LRJA 2EIXA 2GWRA 2QAGC 4HY3A 4OHWA 5JSKA 2WWVD 3SYLA 1DDOA 1GNVA 3L18A 3RSHA 2IF0A 3UFXA 3TW6A 3TLAA 5F7JA 5LP1A 3UPTA 4OXKA 2JFUA 3L6CA 3DCIA 4RABA 2O2ZA 4XIIA 3UCEA 3R0IA 4TSRA 3OP4A 4C4RA 4BEWA 4Y1FA 5G1NA 5AW5A 2P9TA 3H7IA 3JTMA 1ZUHA 4LOHA 4J1TA 3UT6A 2EZ9A 4U7FA 2IV3A 1NPYA 2F1KA 1MX1A 3QLTA 4H27A 4MKFA 3WAJA 1P1CA 2YVQA 4Z9BA 1THGA 2GERA 4N5NA 1KQFA 4DB2A 3O8QB 4MS4A 1UJCA 4EA8A 1DAPA 3TTXA 2ZUBA 1JWLA 4OU5A 2A58A 2XJ9A 5HZKA 1QWOA 1YKGA 2ADFA 3C5VA 4Q4DA 4EUKA 5JMOA 3WG9A 5K20A 4Z7JA 1CZKA 1KERA 1UPFA 2E1PA 4HNQA 4N49A 5HF5A 4RZQA 3RVKA 4QEZA 3NHYA 1FMJA 4JOSA 1GTJ1 4UDNA 2UDPA 3ICCA 5B3AA 1GAEO 2H1IA 5JD5A 2ZOSA 4HAIA 4TYMA 2C4VA 3UHAA 4OQMA 2HGZA 1P72A 2R2GA 3BCHA 2FG7C 3LY7A 3I30X 3NGMA 4J2TA 2WQZA 4OCZA 5JSZA 2D0OB 1UDCA 3I04A 4GQIA 3CVJA 4ZTUB 1P39A 1GPJA 3O1HB 3FTEA 3TN7A 1IZ8A 1T9HA 2G76A 4PNEA 5GAJA 4EYQA 1O4VA 4X90A 2R5FA 3BHNA 1JP7A 3OPNA 4E2WA 1PVOA 2ZULA 1Q7RA 4JD5A 3UWOA 1N2SA 4H1TA 4JLOA 1W75A 3GA5A 1Z7GA 4WA8A 3E7FA 2X6TA 3GO4A 1E1YA 2ZQYA 1V6SA 5C4IA 3U56A 1W5TA 2QYSA 1KEWA 2VJNA 3WL7A 2B4AA 4ALJA 3H2HA 2CXXA 4V3CA 4GXQA 5CX1A 2RK4A 3RK0A 1QP4A 2Q6LA 3R3ZA 3OU6A 4X8HA 2Z4SA 3NAQA 4OQDA 4BZPA 2PH3A 1VRCA 4AS1A 2PD3A 4HUJA 3LOPA 1KEPA 1RHQA 2KX7A 4GLFA 5F2OA 2PWYA 1KETA 3S1AA 3OSUA 1PHPA 4Z51A 1EGVB 1NW9B 4UVGA 5DW0A 1X8JA 1U3GA 2YY5A 4EMTA 3QXHA 4L73A 3NIWA 3PEVA 1V1RA 2P5TB 3KQTA 5KOJB 1YD7A 4JHLA 2ZFUA 4PIPA 3LNTA 3TLJA 1U2GC 3E0QA 4CR7A 1X74A 4LBWA 5IJXA 3HCAA 3M1IA 1FFSA 5H80A 3RFUA 3N58A 1LZLA 1INLA 2JCYA 2VAWA 2VDQB 2XMSA 3LT4A 3LV8A 4M7RA 4PYOA 5LR6A 5T3UA 1E6CA 1Q2UA 3K96A 4Y6LA 4YP7A 1JDNA 4GR9A 3WKEA 4KVAA 3I2FA 1QUEA 1GUZA 1CB0A 2H2WA 1N1MA 2FSFA 4JAVC 4L08A 3VGJA 4ZDJA 4OP3A 4DMUB 2GK7A 3L7JA 5THXA 4PLHA 4N47A 1A9OA 3EMDA 4QJ5A 5KTTA 1KP2A 2TS1A 2YRXA 3KLNA 4Q82A 2ZYHA 2Z9CA 3FUXA 1JAIA 3AUAA 3PEUA 3WWZA 1QNLA 2NO7A 1EU1A 2V1XA 3PXXA 3OEHA 4M4SA 4J6EA 4YP1A 5KNCA 5A9SA 4TL7A 5FTNA 5I4BA 3VMFA 1AGRA 2A0XA 3AEXA 2ECQA 2WJWA 3NM4A 2LCQA 2PL9A 1KZ7B 1MOZA 4UM9D 1T1GA 1K6EA 5EPOA 2V6GA 4DN6A 2HFJA 4Q1VA 3RR2A 3C3BA 2IH5A 2AQ8A 2BGUA 2IOQA 3JXEA 3T54A 4XJTA 4BNDB 5BV0A 3BRSA 4X20B 2A9VA 5BR4A 4EHLA 4KITB 2XRZA 4YRFA 3G68A 3VJMA 4D1YA 4MITA 4TTQA 3OQVA 3S0JA 2PRKA 3QVWA 1FQWA 1CEQA 2DQSA 3EQ6A 5LU9A 5LWHA 2EXXA 2FKNA 4WXYB 3DW1X 3KPJA 3DE6X 1VOTA 4GDMA 2X6RA 1XR3A 4RE6A 4RAQA 1KQGA 1NPTO 3F97A 3KLBA 4O29A 4JI5B 3LS2A 3U60B 2JLSA 4CMCA 3B3JA 4BMXA 2QLBA 3RKSA 3TLKA 2RBKA 3DDSA 3TSYA 5IUNC 4FYVA 4H0NA 2HL6A 4BNJA 1X1TA 2GJSA 3LC0A 4YS6A 3X2FA 5HW0A 1NBWB 2X8LA 3O38A 4JJ6A 3RTEA 5ILOA 1RQ7A 2FWPA 5HE9A 3RE1A 3WB1A 4P84A 1OFIA 1ZA2A 1LWOA 2ZWOA 4IO0A 1RHMA 2H4FA 3KJEA 4RZ2A 5AHOA 2BGKA 2UUOA 4Z4QA 2WF5A 1GQOA 1VSVA 2PJZA 2WLSA 3KWLA 2B3DA 4TMWA 3VR0A 5BWOA 1J0EA 3RUEA 2NACA 2HUPA 5FL3A 1EVEA 3II6X 2P9FA 2B82A 3EGCA 1J25A 2VVTA 4FOSA 4KMRA 5EESA 5EZYA 2ZXFA 2HHCA 2ZIUB 2MYUA 2R79A 5JH7A 4LXHA 3DB1A 3EPRA 4LJ5A 3IJRA 4N1AA 4Y98A 5ANRB 4AJPA 1GUAA 2WJZB 4ZP1A 4XEUA 1X39A 2HZ7A 4FEAA 3WJ1A 2FOLA 4IYRA 4KKXB 3RKUA 3ZV6A 1G8HA 2CVFA 4YAJA 2Y93A 1SK8A 3AL3A 1MFPA 3DLPX 4I5DA 3PCRB 3WBJA 4CCYB 1NV9A 1H8HA 2YJTD 3PR2B 5CD9A 3COJA 4F71A 1SC6A 1SU8A 2EJWA 2HCTA 4OXXA 2PZMA 2FPLA 1NIPA 4LC9A 1EH5A 1L6RA 3CC8A 3TPFA 4CGYA 5I9BA 2ORYA 1LK5A 3P9PA 4KRXA 3ZE7A 2H1CA 3HCFA 2ETVA 4AU1A 1XAIA 1FYWA 4K9NA 2P68A 2ZZMA 3WSVA 3QUQA 4V0NA 5SV2A 3P0HA 2A35A 3F6RA 4G1VA 3SZLA 4HNHA 5JMTA 4PYQA 5DGIA 1N1DA 1I4WA 5A3QA 1N32B 4TKVB 3QM1A 4B81A 3K30A 2Q4RA 3LZ6A 1V16A 3R5TA 5DKFA 3MINB 1GG9A 2VA8A 1QK5A 1H6BA 4XGQA 4JI3B 2E6UX 3GNTA 4H3SA 1VE1A 1YRHA 2ZB4A 2OO7A 4PLCA 1R3DA 6REQA 3RJTA 4FNMA 2QZSA 3VOBA 2QNBA 1MVLA 2A9OA 3UA4A 4F5DA 3KQQA 4G25A 5LBUA 3ZW8A 5KS2A 3ZV7A 2YMQA 1L4LA 4D6XA 1QYWA 1W5BA 5F2KA 3ROFA 4F06A 2H52A 4HSEA 4URHA 2LNDA 5K03A 3VZSA 3VZRA 3IMEA 3UXYA 1PT9A 1QOQB 3E70C 3LECA 3AF5A 1GCUA 2I1LA 3UFBA 1D0VA 5KTNA 1XEWX 1DEHA 2ZYGA 3IBSA 3PGA1 4LZZA 3DFUA 4O2BB 1MKYA 2C9MA 4A6EA 1KI2A 2GBCA 2NU7B 5AR1A 1QYXA 1Z6PA 3NTQA 5FPKA 4U2DA 4NX2A 1EFLA 4CUJA 1SPXA 4DGSA 4UUOA 4WKOA 3ZWPA 3SQMA 3KCQA 3ICPA 3OZTA 4L07A 4B31A 5I9LA 5KOJA 2XZDA 2C2GA 5JZOA 1OTXA 4ITRC 1D2HA 3HACA 1PT7A 2WZDA 3CX7A 5CNKA 2P9BA 1VBKA 3WTCA 5CB6A 2D7JA 3ZCRA 1DIAA 4LZLA 4RJTA 2ZM6B 3F8WA 2QRZA 4EHHA 5CT8A 1TAQA 3GLGA 1Y6FA 3A3YA 1T10A 4KQCA 2VWGA 2ZSKA 3TQRA 1KE1A 5FPPA 2QXYA 3ZWXA 1Q6YA 4AICA 2FZWA 2XVXA 3VR6A 3O8QA 3JQFA 3I1IA 3K2IA 3TLMA 5B1IA 2VTEA 3OQHA 5LIRA 4X7PA 1G2IA 2Y05A 4OQQA 2XCOA 3TKLA 1USVA 1NC1A 2HQRA 2W11A 3I6QA 3NPAA 5ICSA 2P62A 2Z3VA 1OXKB 3BEDA 2GAOA 4M1ZA 4R2MA 4YAKA 4DYVA 1P6XA 1J2YA 3ON5A 4DC9A 4QGAA 4Y9UA 3L4BC 4UTRA 4IIEA 4G9EA 1KSGA 1NVTA 3T7RA 5CVTA 1BDIA 1YKSA 4QOEA 2A6PA 1RPTA 4PIVA 4G8CA 5LYYA 3ZJYA 4D4GA 1L4GA 2FI1A 2Q4OA 1Y5LA 4EYKA 2OG1A 1HE2A 1PK9A 3HXQA 4B7CA 2WILA 2HBRA 2EFCB 5KTOA 5IJ0B 1XLWA 2AXNA 3UQYS 1WY7A 4EBFA 1XHLA 4RVHA 1XEFA 3BF7A 2HJ9A 3C8DA 2E48A 2D4HA 3M5CA 3P4YA 4IHJF 4R6XA 4RJIA 3T52A 4GMDA 4B0OA 2ZETA 5A04A 1AK1A 3EY9A 5H9VA 5ALUA 3PC8C 3HQ4O 4GYWA 1ZN2A 4ZQBA 5ERXA 1TM3E 1FUYB 2G6TA 1T3SA 3VV3A 2QMHA 5FBVB 3A6KA 1W36B 1JI3A 2YQZA 1AQJA 2C31A 3AUXA 3FHLA 2BKUA 2AD1A 2VYNA 2WFAA 1YRLA 3E15A 4EVSA 1ECPA 2O07A 1WMEA 5KOHB 2FPPB 2O8BA 2BGLA 2AR7A 3BB3A 3MT8A 1ZS9A 4GC5A 2VDVE 3K9WA 4BFSA 1CQWA 4HG2A 3U7RA 1WPRA 1XD2B 4TZKA 3ZBQA 4LKOA 4BKQA 4EAAA 2YZMA 3LC1O 3QUTA 5FFFA 2C9CA 4NBRA 5FFMA 4B34A 4D4MA 2ZREA 2Z1NA 5CG1A 3W2EA 3BRWA 1GYRA 2Z83A 3CZ9A 3N2KA 5AW4A 4MPDA 3UAZA 4AL4A 4Y2UA 3GRRA 2VP3A 2HLNA 5ICMA 4Q21A 1ISJA 2X9LA 3SEAA 4RKFA 4S04A 3OFVA 2FRXA 1SUIA 4LBVA 3SR3A 1ZOSA 2RBGA 1JDPA 2YFKA 3E8XA 2GH1A 4FFDA 4MRVA 4GLLA 1XTZA 1Z7BA 2UYHA 3T3PB 4BNZA 1C1XA 3KTFA 3M0EA 1Z8HA 3G6KA 3TMKA 4MGIR 2Y68A 1NLMA 3LCVB 1I01A 5TGZA 4C08A 2HQSA 3DEIA 2AZMA 2OYSA 4I9NA 2JHGA 3GAMA 1IY9A 5K8VA 3C16C 1J20A 3CR3C 1GZ5A 1RM5A 3I9V6 4CQLB 2QUKA 1TJ4A 5FUYA 3ZH9B 1SCIA 5C8VA 4TVSA 3TVTA 5C51B 3WNDA 3WLIA 2GN0A 1TZBA 2D4AA 1FCJA 1PI3A 2OCDA 5FOQA 1R9MA 1YHNA 1FRVA 1LFAA 2GFIA 5TPZA 3K9HA 1OT5A 3R0VA 3ERCA 1R16A 5EC8A 1UC8A 3UY4A 2P4SA 1LPNA 2I2BA 3IOCA 2QQGA 4HQ0A 5CJJA 4G23A 4P4NA 3WWOA 3MCTA 1NTOA 2OBYA 3L7BA 1CZLA 1W4ZA 1KJNA 1H9BA 1TCUA 2VAXA 5GV8A 5JBNA 2D1SA 1SC3A 2DRIA 3E1KA 3R6GA 4P38A 4BNDA 3MYYA 5IT4A 2AOXA 1GNSA 4OQPA 9ABPA 5JDIC 3PD7A 2XOKA 1T8SA 4EPXA 3IQHX 2HF2A 4IDOA 2J3LA 3K1YA 5HPYB 5CK4A 3ZDCA 4CTJA 3X44A 2DUUA 3BJZA 2GHTA 1VMEA 4I1IA 2B69A 2D74A 2Z8YA 1H2EA 1Q3TA 4H4DA 3GWGA 4CEJA 5TY0A 2HJHA 3QPCA 1W88B