4DSUA

Small-molecule ligands bind to a distinct pocket in ras and inhibit sos-mediated nucleotide exchange activity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
180
structure length
177
Chain Sequence
STEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas, isoform 2B
publication title Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 177
sequence length 180
ec nomenclature ec 3.6.-.-:
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dsuA00
1QHNA 4HB2A 3X1ZA 4QGAA 3N5CA 3A1UA 3EZ6A 3CPHA 1SVIA 4M1KA 3VU9A 2A3RA 1ZNYA 1GZSA 1E94E 1LW7A 4DJTA 4EDHA 1COWA 1D9XA 2I4IA 4CEIA 5FTKA 4PAQA 2HJGA 2ZVPX 3CNLA 1JPJA 1Z2CA 2ZI3A 4RSGA 4WAUA 3BORA 3IIKA 3RABA 4GT1A 5J4LA 2ZRBA 4D4JA 2ODNA 2F1IA 4PZZA 1O3YA 1E2MA 4Q4JA 1QHSA 2GXUA 2NGRA 2OILA 1AN0A 1G20E 3TW4A 3KQUA 2RGXA 2JLRA 4LV8B 1HA3A 3L0OA 3HU1A 2P6NA 1RC8A 3OESA 1CLUA 2R8RA 2QSZA 2IW3A 1E4VA 1Z0IA 1Z08A 2ZJAA 2ZE8A 4NYJR 4L9SA 2R6CA 1WP9A 2QI9C 3QPUA 2OE2A 4MYCA 3NHBA 5DYGA 5K8LA 4AIIA 1YR6A 4Q47A 3ZVLA 4TSFD 1E2LA 2CLDX 2C99A 4PO1A 5JFGA 2OT3B 5FR2A 4DLXA 1LNZA 2ZRJA 3QG1A 2W83A 2QRZA 2O8FA 3U44B 3E2IA 3MWJA 3QXJA 3TBKA 4D82A 4DSTA 1E96A 4JZKA 1WBBA 4CW7A 1UKZA 2ZSDA 4L5BA 1R5NA 3BFVA 1VCNA 3K9HA 2GJ8A 4OHVA 4OI1A 1WQ1R 3ZJYA 1L7VC 1VKJA 2P3SA 4PZYA 3X2SA 2V7QA 2ZETA 2YINC 4F92B 2G3YA 1R5OA 1ZCAA 4TYYA 1KSJA 4HAXA 2QORA 3U60B 2RGEA 4O0MA 1DO2A 3LBNA 4C3ZA 4DC9A 5BWMA 3AVXA 2FH5B 2YOFA 3OFND 2QRNA 2H1LA 4TLBA 3CW2A 3V4FA 3X1YA 1EFHA 5AJZA 1FNNA 1N0VC 2OAQ1 1BMFA 1UBFA 3P20A 3K09C 3IEVA 3GFOA 3IHWA 4BPBA 1OIWA 4TTQA 1P7CA 1I4LD 3U4QA 1EG7A 1H8HD 2GXQA 2QM7A 3T1QA 1GAJA 1YQTA 4JYCA 3NBXX 2DFKB 4QM7A 3NDBB 1HE1C 4BLSA 4PXAA 3U5ZB 2FSIA 5DN6D 1V5WA 3NEJA 2QP9X 1H8HA 3U7EB 4NP6A 2CEAA 4D0LB 2V4ZA 3ZQJA 5ANRB 2CHGA 4LI0A 3K53A 1GSIA 2VEDA 2BKEA 4N3NA 4MYUA 4Q19A 3TVDA 1X8LA 1IY2A 4JMPA 1R0WA 1SKYB 1A4RA 2ODWA 1U2RA 1FUKA 2OCAA 4QBFA 2NOAA 4POAA 4Q4LA 2IWHA 3BE4A 4TYWA 3N2IA 2J1LA 4PR0A 3TSOA 2O0JA 2IXEA 2PJZA 4DLWA 1T8UA 5BXQC 2Y8EA 4W9MC 1E9AA 4KLZA 4JIMA 2A9KA 4EIWA 3RS2A 3EWAA 4C7OA 2QBYA 2CCKA 2QPOA 1KO1A 1W44A 2BWJA 5F98A 1XX6A 1JR3D 4IOMA 4RZ3A 4FMCF 2GHIA 1P75A 4OQLA 2PMDA 4Q9KA 1IHUA 3ZZ0A 3T1TA 1FX0B 1W7AA 3AP1A 3DO6A 3L0PA 1S9HA 2QENA 1JR3A 1PUJA 2WWXA 5JJLA 1YJ5A 1FFHA 1WCV1 1E0JA 1F5NA 2OUKA 3K0EA 4ERNA 4A8JC 1N5IA 3W34A 3EAQA 4RZXA 2O8DB 3VKWA 3QEJA 2OXRA 3VQTA 4F91B 4Q7LA 1N25A 3B13B 4UXJA 4M9QA 1XTSA 2ZYTX 3EASA 1VG8A 2FPKA 2HJVA 2IF0A 2J0UB 4PC1A 3LQQA 2HEIA 1C9KA 3D3QA 1M7BA 3LH5A 4IRUB 4DBLC 4JLNA 4LK2A 1AIPA 4LGMA 1XDBA 3MSXA 2AD5A 3GCGA 1ZJ6A 1KMHA 5LB4A 3RS7A 2PLFA 2QE7A 3PVSA 4KFUA 3AKEA 4QG7A 1G7TA 5DI3A 3CZPA 1FTNA 2HLDD 4DLSA 5FPKA 1GKYA 3M1IA 3A58B 2RCNA 4EPRA 3GP8A 2GCOB 3PUVA 2VL7A 4XJXA 1NRJB 3RNLA 3KDSE 2ONJA 3K0AA 3RANA 2GJSA 1KDTA 1N6RA 1QRAA 4AYWA 1K6MA 1MABA 1UDWA 2C77A 4GP7A 4ZIRB 1E2FA 2XNDD 4O2LA 3WMEA 4OJKA 1PV4A 2NZJA 1E9DA 4IXMA 5KUTA 2H8KA 4DT1A 3NKVA 2ODEA 2V8OA 5BW8A 1TL7C 2DFLA 1U0LA 4GNKA 1ZD9A 1KGDA 2OBNA 5KDDA 5AJWA 4DKXA 5FUWA 3CX7A 3SBEA 2WPDA 3LNCA 3QJYA 1W36D 1PVOA 1TU4A 1NIJA 2ZROA 2GKSA 4R2IA 2PT5A 2O0KA 2BIFA 2FF7A 1XEXA 4PFSA 3X1WA 5SZKB 2HF8A 1XF9A 4HDCA 5FUYA 4Q7MB 3EPJA 1U99A 1U9IA 4PPQA 1Z0KA 2JJ1D 2Q9BA 4MGKR 2ZJOA 3THXA 1UEIA 2J41A 3A36A 4CYMA 4MRVA 3K0CA 3IIMA 4PHTA 1OE0A 3U3KA 4M1TA 1KKMA 3NTUA 4JBYA 1P4SA 3FFAA 3RS5A 3EXAA 5HE9A 3VU9B 3VNVA 1KZ7B 2A5YB 1MR3F 1RVDA 3GJ3A 5H70A 4GBMA 5FTLA 2YNMA 2X2FA 4CEIB 2FV8A 3SHFA 3ZS8A 2P6RA 2WIBA 1R0ZA 3FPAA 4LV6A 3PEWA 3EIHA 4QC2A 1N0WA 2BKUA 1RIFA 2WVJA 4Q4JB 5FFMA 3FOZA 3R8CA 4MGZR 1CJKC 1RKBA 2OCPA 1W0JD 3GJ4A 2ATVA 3SJCA 5E7IA 1ZIPA 3MGCA 3B8HA 3RSLA 3QUSA 1X8JA 2QAJA 3QF7A 3SEAA 3B9PA 4OQNA 2P6UA 1BO6A 3BH7A 2WKPA 2VO1A 2ZTSA 4Q01A 5IK2D 4C0BA 3EA5A 4DDTA 4O2RA 1AS2A 1DE0A 4C0LA 1G1MA 5JBQA 1E99A 2GRJA 4DDVA 1IXZA 3Q8XB 2D7CA 3RS0A 4R98A 5FL7A 1L4YA 4TQAA 4MDEA 3OEHA 3W6OA 4NU0A 1W4RA 1N2CE 4OHYA 5HCIA 1KO7A 4DCSA 4WVFA 5EXSA 2ZQ5A 1GRRA 2VP2A 2XOKD 3R8FA 1YZLA 2Z4SA 3A8TA 3LV8A 4TYNA 4HUQA 4NCJA 2QEQA 3WP0A 1NKSA 4HLCA 2W6JA 3KTAA 1Q1BA 4IOKA 4EAQA 3HYRA 2IYZA 1HE8B 2HYDA 1D6JA 3I4LA 4HDQB 5JWHA 1G5TA 4H1UA 4BRUA 2ZJ5A 1E79A 2A7QA 3BIFA 4D2IA 1CRPA 2QP4A 1A2BA 4LYAA 2OCBA 2OM2A 3K70C 1G6HA 4OYHA 2H5EA 3RLFA 3TLXA 1AZTA 1ZM3A 2FA9A 3B7GA 2ORWA 2LKCA 2H7VA 3EARA 1HY3A 4QGFA 5CLLA 3W5JA 3JZMA 3P4YA 1CEEA 1CIPA 2CHQA 5CB8A 2D62A 1MH1A 1II0A 2WHXA 5FPTA 1D8TA 1SZPA 4MGYR 3LBHA 2IL1A 3X1XA 4MUBA 2ZAMA 3U4QB 3QXSA 4UXHA 4Y0AA 1UKVY 4GL2A 4IXNA 3FGNA 2GBLA 4OJQA 2OG2A 5KSPA 2DYKA 4M8NE 5EP3A 3LO5A 3C15C 4YDHB 1DS6A 4Q03A 2WAYA 4JT2A 3U3RA 3ZGXA 4QNRA 3O8RA 4OI4A 4P3YA 3THYA 3CLVA 1LB1B 1VMAA 4TYQA 1W46A 1PUIA 1VG1A 2EQBA 3NXSA 3JVVA 4DLTA 4OHWA 5E95A 1AK2A 1ZC3A 2QSYA 4B2LA 4C7OB 1P6XA 2QBYB 3M4YA 3UMFA 3WMGA 4A1FA 1YVDA 4A2QA 1E4YA 1OF1A 3P1JA 4JLJA 3EPKA 2VF8A 3HYTA 1KO8A 1VDZA 1S1MA 2E1RA 2YJTD 4LYHA 1Q1ZA 2ZREA 4UJ5A 1XEWX 3MJHA 1HURA 5B64A 1M7HA 2NTYC 3AVTA 4DSOA 1NL3A 4G5RA 3BWDD 4JJZA 4FW9A 4B48A 3UMRA 2JLWA 1LS1A 3L2OB 2JDIA 4P0TA 1US8A 2XB2A 4DB4A 1G3RA 1KJZA 4M1YA 4TLCA 4XH9B 5EQTA 5TV2A 2ZSFA 1N5JA 1Y3AA 2NO9A 1KZGB 2PZFA 2B8TA 3LLMA 2BM0A 1M7GA 1AS3A 1SVSA 3ADCA 1IY0A 1ZVQA 2IYTA 3QKRA 1JB1A 1XTJA 5G40A 4LYFA 3VR6A 5SZHB 5P21A 3FKQA 1YKSA 2BCGY 4QJ4A 2O8CA 1ZMXA 1KMHB 4GRAA 5L3RA 1CRQA 1IBRA 4TN1A 1YR9A 1VPLA 5JS7A 1BH2A 3KJGA 5D3QA 1D2EA 2BOVA 2CJWA 4A9AA 4X8HA 5DI3B 5DNYB 2O52A 5DGXA 3OE7A 3GLGA 1Z0AA 1FMJA 4JYBA 4Q1CA 1II8A 4V03A 4ASUA 1IN4A 3K0AB 5G3YA 1KAGA 4AKIA 3LXXA 5L8VA 1KSFX 1Z06A 1OYWA 3FHCB 1MABB 4RKEA 5KNCA 3AKCA 1ZU4A 1DVRA 3NEYA 1Z6TA 2IF2A 1R0YA 4G1UC 5IT5A 2VP6A 3L0SA 4PC7A 3WBKA 4DT1B 2BBSA 3RRYA 4RFSA 4B44A 1OXTA 2J0SA 3QVVA 5DYIA 4LHWA 3PUWA 1OKKA 4LC0A 3TKLA 1E0KA 1N6KA 4QKQA 1Z6GA 2CLCX 4B73A 2O8BA 2CHVA 4D26A 2E9SA 1P72A 1SGWA 4PZLA 3DM9B 2DY1A 3R9WA 2HT6A 5CIWA 1IOZA 1UBEA 3QOFA 1G17A 1NIPA 3EA0A 1NP6A 4ZV4A 1XEXB 3KFVA 3QY0A 4YMWA 2BMFA 1FP6A 2FSFA 2RGCA 1SVOA 1WXQA 4DLRA 1PLLA 2GF0A 1ZUIA 1NMXA 3THXB 4Q48A 1NI3A 3TQCA 5EZ6B 2X77A 2F1RA 2XITA 4JT4A 3U3OA 3U7HB 5AJXA 1XPOA 1X3SA 2QM8A 4LOAA 5A4JA 1JBKA 3F3YA 4P4UA 3VX4A 1P60A 1NVUQ 3I61A 5B2ZA 1KY2A 1FP7A 4MH0R 3VR5A 4PHHA 4U5XA 3B85A 4JLAA 1U98A 2AXPA 3THWA 4MDFA 2XZLA 2IYUA 4MGIR 3KQHA 1H8EA 2BEKA 4LYJA 2JLZA 1N6PA 5H68A 4QBIA 4RD4A 4G01B 3KQNA 5JCPA 1UADA 2QG6A 3DZ8A 5A5GA 1UBCA 1J8YF 3EWSA 5JSZA 2YWHA 3ASYA 3SDZA 1G8FA 2ZUCA 3CRW1 2ZPTX 4BLOA 1OH8A 1G5RA 3B5JA 1XRJA 3TIFA 4TWZA 4V0LA 4B3XA 4KVAA 4KSBA 4KSCA 3PG5A 1IN6A 1Y63A 1B0UA 2JEOA 4HAWA 2P5SA 4BFYA 3P26A 4OHXA 1GILA 1ZUNB 1G3IA 2YOGA 4ZO4A 2Q9AA 1Z0JA 2QT1A 4RCYA 2PEYA 5JHGB 3T12A 1XZPA 3E5HA 3MFYA 4ILEA 4V0MA 1P9RA 4C0QC 1DOAA 2W00A 3QSYA 4RZUA 2DPXA 1WE2A 1LFDB 1KO5A 2ZITA 2P65A 4DCUA 1Q57A 3I5YA 1TNDA 4HAVA 5FOWA 4JSYA 2ORVA 3IHLA 1SXJA 3KX2A 1CJVC 4JL6A 1E9FA 3TSWA 3OIYA 1NNEA 1NVWQ 2CL7X 3KTAB 1Z63A 1NY6A 1OHHD 4TLDA 3B1WA 1Q12A 5C4MA 4KCGA 2FPLA 4ZPXA 2FNAA 4M1SA 4BFUA 5FI1B 2V55B 4EJSA 1GL9B 2GETA 4YC7A 4Q02A 1E1QA 4IDPA 5BQ5A 5FI0B 1LY1A 4QGGA 4IVQA 5EE9A 3RS3A 3I62A 1Z2AA 1NLFA 1TQ2A 1E1RA 1KTVA 1W1WA 1OFUX 1BYIA 1GRQA 2D4HA 2QMEA 3GLHA 4M1OA 4B74A 2RAPA 1OLOA 4AWXA 5H1YA 1F2TA 2WJIA 2XTNA 3GEHA 3GMTA 5TMPA 5AWFC 5DE3A 2GNOA 3HP1A 1NG1A 5JWOA 1KI3A 3OIVA 4IVRA 5TXGA 1G41A 3LX5A 3T5GA 3H1TA 2ZYVX 4URWR 4BZXA 3KFXA 5EXPA 3TRFA 1XNJA 2H18A 2IWRA 4E5UA 3GEEA 2NO1A 4LV5B 4TMVA 1E2QA 3KKOA 4FMDB 4B3CA 1R4AA 3A4MA 1JEDA 3W6NA 3KQKA 2Z0MA 3GJ6A 4LUCA 2CCGA 5M04A 3SU8A 2EFCB 3C4JA 3CNNA 1G5PA 3THYB 2FGKA 5LDDC 2QMOA 4EQ6A 2G6BA 1FNMA 2D7DA 2HT1A 3EC1A 2VSOA 2XZPA 1R6BX 4LWZA 1EFRD 5B58C 2HF9A 1G7CA 1E2KA 3D7MA 2J45A 4D80A 5E7MA 1XCPA 2NPFA 5EUQB 2OAP1 1AQYA 4LPSA 4OI0A 4JL8A 4XD7D 3WHLA 4XTCS 4B47A 4MQBA 4RY2A 4BGDA 3NIBA 5HR5A 1G291 3CWQA 4FMCB 3HR8A 1QF9A 4PAOA 1I2MA 3SR0A 1IAQA 5EXTA 2AFHE 1BIFA 1VCIA 1WMSA 1GNRA 1IN7A 2OEPA 3LX8A 4F4JA 1OXSC 1XTRA 1N5LA 2QP3A 3KXIA 3NHAA 4WBSA 5LD2C 3NDPA 3WNBA 2CVHA 3CB4A 1SKQA 3DPUA 2IC5A 4DCTA 3T1VA 1XTQA 3WP1B 4U02A 4AG6A 1US8B 2C2HA 2PEZA 3AVPA 2NPIA 5JCZA 1XCMA 1J8MF 5A0FA 2W0SA 3HPRA 2DCUA 1W5TA 4Q18A 4LHZA 2J59A 1Q20A 4DIEA 1XXHA 2GCNA 3QKRB 4D81A 3DL0A 4OQMA 3DEFA 4GDFA 4TSFA 4G5SA 2O8CB 1KK1A 1XEFA 3KKMA 3ZQ6A 4FD2A 2OLJA 3GJ5A 5FOUA 1LV7A 3W3AA 2ZVQX 3C41J 5DSZA 3WXMA 1GM5A 2CJWB 4EUNA 5G3ZA 2J7KA 2HV8A 2FZ4A 3GLGB 3DM5A 1II8B 2F1JA 2AN9A 1S4QA 4AURA 4L8GA 4EKDA 2H17A 3OAAD 3QVUA 2IYXA 1CJMA 4G5QA 4Q1BA 1X6VA 3ETLA 2F43A 2WJHA 2XSZD 4MYHA 1X1SA 2GEVA 4PPGA 2NO7A 1JR6A 1QBKC 2PT7A 5UKDA 4DLZA 3AVQA 1OXUA 4C30A 4RFSB 3RWOA 3EIEA 3SNHA 4JBWA 2P0EA 2ZSAA 2QGZA 2NMVA 4HLUA 4AK9A 3H0KA 2Z6VA 4Z51A 2AR7A 4WOPA 2O8BB 1DBSA 4WXRA 3OFNA 1GL7A 1U0JA 2C78A 3LDAA 2QPAA 5SZJA 4RZ2A 5EP4A 1ZM7A 2CVFA 3SC3A 3GLIA 1EGAA 2G0TA 2NIPA 2ZR0A 3GJ7A 1UPTA 4JLBA 1UM8A 4LJ7A 2BM1A 3EZ7A 1YHNA 4W7SA 1KNQA 4FINA 1XMVA 2IEZA 2JJ2D 4OKSA 2VLIA 1RJ9A 4FMDF 4HUTA 3MLEA 3W9YA 3VR4A 3WMFA 5GJVC 4OI2A 4GOXA 3PUYA 3B2EA 5L3VA 3I3SR 3LY5A 5DN6A 1P3JA 4BEBA 1OH5A 4BFXA 4GOJA 1NF3A 2WOOA 4QOSA 4WIAA 3WNCA 3ICQB 1T0HB 1KKLA 2ANCA 2JJ8A 1RYHA 2W6ID 4KO8A 2WJJA 3BBPA 3SJAA 5F9FA 4BECA 1ANKA 4RFVA 5EUMA 4M9ZA 3THWB 4JJKA 4KHZA 4URUR 3U6KA 1KY3A 2WWHA 5K8IA 2RHDA 4HLDA 4P4TA 4K46A 1II9A 1FQKA 4UNQA 2OCYC 5CITA 5DISB 1PLKA 2LWIA 3IO3A 2D74A 4B2IA 4A2PA 1U9IC 3DKPA 5JSZB 1ZIOA 3K9GA 4NL4H 3R20A 2IYRA 3AH8A 3CH5A 2XB4A 3U3MA 1JAHA 1L2TA 1QZXA 3NC0C 1GFIA 4ESHA 1WBDA 1FOEB 2WWIA 1NLYA 3K0FA 3KB1A 2BCJQ 4XSHA 5H8WA 4I99A 1XD8A 2QN6A 2R65A 4TZ0A 3VNUA 4AD8A 3DKVA 1IJFA 1TEXA 1E2EA 3Q5EA 2E87A 3ZZUA 5FBWB 3R7WA 2OFXA 3F5FA 2Z83A 3ZD7A 3EPHA 3FKSD 2VA8A 2G88A 2MMGA 1CR2A 4XIGS 3ZIAD 4CEHA 2CLSA 2CNWD 1GTVA 2AX4A 5EE1A 3AF3A 1QHIA 3RDPA 3MD0A 1HV8A 1SXJB 4IJMA 1NY5A 721PA 5KPDA 4FWTA 2DWQA 2F9LA 1CR1A 2NO0A 5J47A 2CNWA 2DR3A 4TLAA 1S0UA 3SFVA 2JASA 2ZJZA 1CJUC 3TUJC 3NG1A 3BOSA 1P2UA 4Q1FA 3IILA 3ZS9A 4HB4A 5DIFA 2HLDA 2QPTA 3AF1A 1JAIA 4YLGA 2C03A 4KJZA 2FX3A 2IYWA 2OSBA 1G4AE 2BMJA 1CS4C 3K09A 3GLHB 1KI8A 3AUXA 1E9EA 1I4TD 1F2TB 3LAWA 2XNDA 2C98A 4UNRA 1TTTA 4XTRA 2FFBA 1U8ZA 1YR8A 3B1ZA 5KOYA 4BZPA 1JNYA 3LD9A 2ZEJA 4GPTA 2N42A 3IKJA 4NCIA 3LW7A 3V00A 1GIAA 2V6IA 2Q21A 3B6EA 1IXRC 2QA5A 2AXNA 5CB6A 1OFHA 3IUYA 3QIAA 1XD9A 1DPFA 1T91A 5CYPA 4RD6A 4PSKA 3I32A 1QHGA 3BH0A 2GAOA 3I72A 4QXAA 1R2QA 4LJ9A 1Q21A 2RKOA 2CL6X 1ZM4A 3CKLA 4LBZA 1G6OA 4TL8A 1OJLA 3W8RA 4IOLA 1KDPA 4EQ6B 5KNDA 5JHHB 3QF4A 3B1YA 2ANBA 3KKQA 4MRPA 4B3FX 4DHEA 1M34E 3ZZTA 3UWKA 2JJ1A 5L3SA 4CDGA 1KDOA 4Q5IA 4F7WA 4QJ5A 2ORIA 4D0NA 4TMXA 1K5DA 1OFIA 3EG5A 4MRNA 3ND8A 4NKRA 3JZAA 3RSOA 2N1BA 2IBMA 1W2GA 1ZW6A 2OFOA 1G4UR 1IN8A 5DO9A 3SZRA 1A5TA 3SFZA 4BRWA 5FR1A 2JCSA 1WRBA 3EZ2A 1M74A 4QHSA 4A8JA 3VX3A 2R9VA 2DWOA 1EFUA 1VHTA 4DRZA 1XMJA 1CR4A 2X8AA 3EW9A 4OBEA 4NCKA 1W0JA 4N0DA 2CE7A 2XJ9A 2EFHB 2OBMA 1DADA 2A5FA 4I4LA 4DCVA 2QGNA 3ADDA 1NN5A 5FBVB 1GITA 2BEJA 4JLVA 2FN4A 3IPXA 3S1AA 5JMTA 5L3QA 1RRCA 3PEUA 1P61B 1TEVA 3LRPA 4D4LA 1VCMA 2A30A 1XXHB 5FTMA 5IK2A 3HDTA 4EPWA 4OK6A 5KHOC 4KFRA 1Q1EA 2XTZA 1ZAKA 3WRXC 4NTZA 1H65A 2O8FB 4GSYA 1KOFA 3BC1A 2IUTA 5FH9A 2CCJA 2VYFA 1XD2A 2ZSBA 3C5HA 4JKIA 3BERA 3IQWA 4FIDA 1G9XA 4HAZA 4CRWB 2FU5C 1LS6A 1EESA 1LF0A 5CK4A 4PC6A 2AHOA 2EFEB 1WA5A 2OLKA 4HDOB 2QAGA 3W90A 3CRQA 4CF7A 2F6RA 5TARA 3RS4A 1T9HA 2VHCA 2XOKA 4B33A 4DXAA 3T1OA 2OESA 1E69A 1MOZA 2F43B 5C46F 3BK7A 4LJ4A 3RRNA 5C4GB 2VRWA 3QKTA 3AP2A 5IDVA 2W2XA 3ONWA 5KDOA 3CX8A 3LVRE 2CL0X 3AQ4A 3VHLB 2PCJA 5KU1A 2QQ0A 2BC9A 3B1VA 1S3GA 1MT0A 5IHPA 2EFDB 2ZS8A 5FOVA 5FTNA 3ZVMA 4WZ6A 4B2PA 5JJKA 4DDUA 4IFEA 2IS2A 2IXFA 4V0KA 3GLIB 1AM4D 3B1XA 4EFNA 3CBQA 5JZVA 4A15A 2IUUA 4KODA 4PC2A 1T4GA 1XFAA 2ZSEA 3BB1A 4II7A 4LBYA 4TLEA 5HZHA 2GJKA 3KUCA 2QMUA 3M0EA 3AKDA 3C7KA 2FDCA 2IYYA 2ZRMA 5GJWC 1N6HA 5J4HA 4ZDJA 1RJ9B 1P2SA 3UXMA 3GJ8A 1RPZA 1SVKA 2JIZD 4Q00A 3QKUA 4B35A 1DAIA 1G64A 2CK3D 2DHRA 3KXKA 2A2ZA 4KBFA 4TMZA 4NBSA 4TMKA 1R5BA 1BOFA 2DWPA 3TAHA 2B92A 1VG9B 1XJ0A 1KIMA 1OSNA 2P67A 4Q4AA 4BZQA 2JIZA 1TPZA 2ZI5A 1E0SA 2K5UA 1NBME 3SYKA 3U2QA 4LC1A 4HAUA 3T06B 2Q9CA 1E2HA 5FPHA 4TL7A 2IK8A 3O8BA 3THOA 3RYTC 2GDJA 4Q7KA 2QQEA 4LJYA 4LX0A 4X8LA 2PX3A 2FGJA 2WMNB 2AWOA 4BWYA 1PJRA 3B78A 5J5CA 1G8HA 3U7FB 1HT2E 4DLUA 5AR1A 3ZVNA 1R8SA 3L82B 2VHQA 4KAXA 1S96A 3U61B 1KJYA 1EFCA 821PA 4JLKA 1OB2A 2IS1A 2BBTA 1T5LA 3K0FB 3K0SA 1WDTA 2FFHA 5AJVB 4ACBA 4CGZA 1J70A 4D25A 3UMSA 2W2VA 3X1DA 1D5CA 5FBRB 2WKRA 1P73A 2H57A 1KI6A 3SYLA 1F48A 5FUXA 4ZDIA 1W2HA 4BASA 3R7WB 1M6NA 3LVQE 3RWMB 3SS8A 3QBVA 1MKYA 2FFQA 4D0GA 1MO5A 2J9RA 4BLPA 3LBIA 1T3LA 2WZQA 2SHKA 4Q1EA 3QG5A 3GLFE 1ZM9A 4CEHB 3FVQA 5BN3A 4TL9A 2PL3A 2VSXA 4A0GA 4PPNA 4W5JA 3IBYA 4B76A 2C9YA 1R0XA 3TUIC 1ZC4A 3K70D 1S2MA 1TF5A 1Z47A 2ZS7A 4IDNA 3V4RA 4K81B 2VIIA 4U00A 1FW6A 2ZJ2A 1LF5A 2XAUA 4ON9A 1YU9A 2IXGA 4LJ8A 3KKPA 1E2DA 2ZXUA 1Z83A 3A37A 4B6FA 3I8XA 1W4AA 4I1OA 1XMIA 1YZNA 1AA9A 4LSGA 1TF7A 1S1CA 1R10A 2Z5FA 3KUDA 3K9NA 4ZDWA 3R9IA 2RHMA 1UKEA 1JPNA 3WNDA 5HZKA 1TADA 3CPJB 4IW3B 1UF9A 4F93B 2WICA 1SXJC 3I5XA 2V1UA 1NKTA 3RRMA 1HYQA 1ZM2A 1T8TA 2LCFA 4JLDA 2FZLA 4PSAA 4MRRA 3WYGA 3TGPA 3DZDA 1UFQA 2W0MA 2AK3A 2ZRFA 1IM2A 2KWIA 2ZRKA 3LW8A 1D9ZA 5GJCA 3Q72A 3ZVRA 4UQOA 3Q9LA 4HAYA 4LCBA 2P2LA 1W36B 221PA 3QNUA 4R71A 2C96A 2EYQA 1E0AA 1HQCA 1OW3B 1YZQA 2F3RA 4URZR 4YQFA 4AKGA 2RGNC 5LB2A 4NYIR 3OF5A 5J4VA 1DAEA 3GLGE 2G0NA 3WY9A 5E4FA 4Q4HA 1F2UA 4DSUA 4A82A 3QF4B 1KK0A 1XCGB 1FQJA 1N3BA 1KI2A 5ELXA 4MKHA 1C1YA 5L3SB 1ETUA 3FYHA 2O5VA 3DOEA 4A0HA 4QJ3A 4PAMA 4X8OA 3PIRA 4LZZA 2CBZA 4OK5A 3AM1A 2ZI4A 4IKEA 5HKKD 1XMSA 4HB0A 1YE8A 4NYIQ 5TDHA 3UKDA 4BFSA 2P5TB 1DO0A 1A2KC 1T0JB 1JI0A 3AUYA 1E6CA 3PEVA 4A8JB 4WZBE 1CR0A 3BJIC 3IDQA 1T5IA 4B71A 5D3MA 5AUNB 3E70C 4RKFA 3W8NA 1E2NA 1OXXK 2RGAA 1NVXQ 4Q1AA 2UKDA 2Q3HA 4BE7B 1OYYA 1ZNWA 1EX7A 3J81k 1RW4A 1ZUHA 1Q22A 3FMPB 4HEJA 2QNRA 4UJ3A 1RZ3A 5JECA 1ZYUA 5L3QB 2GAAA 4PQYA 3S1AB 3O47A 4GP6A 3QXCA 2AFIE 4ZCIA 2FJUA 4PO8A 1AGRA 2Z4RA 3KB2A 3SHWA 5C1BA 3AVWA 5CDFA 4KYIB 1SKYE 2WIAA 1XD2B 3EZFA 2I1QA 2O8EA 5DH9A 3A6PC 2VQSA 4JBXA 2JLUA 4WZAE 1JQLB 1VCOA 4QBGB 4UNPA 3EZ9A 4EFLA 4HUQB 1X86B 2V54A 4M53A 2IYLD 1GOTA 1BYUA 1SHZA 2B8WA 2QAGB 5JEEA 3ZD6A 2ZRGA 3F8TA 2PZGA 4AKHA 2ZRAA 4DCNA 3P27A 1ONBA 1S9DA 2ZI7A 1P9NA 1SULA 2YOHA 1GVNB 4I1SA 1ZD8A 4QHTA 1JQJC 2QY9A 4G5GA 1ZRHA 4A2WA 1OHHA 1XP8A 1BKDR 2MSCB 1OIVA 1DEKA 1I2DA 1YZUA 3JVUA 3BB4A 3OEED 1D2MA 1OXVA 4Q66C 4EPXA 3PENA 1UBGA 2OZEA 5FOXA 2QMHA 2AD1A 2G83A 2ZRDA 4IOJA 2QTVB 4E09A 2YHSA 3TQFA 3TAUA 5BYKA 2XZOA 4JL5A 4YMSA 3PUZA 4LRWA 2FMXA 5C2JB 2ZIAA 2JLVA 1PZNA 2BVNA 4TTRA 4A6XA 3BRWD 1SXJE 1XBTA 3PCRB 3A1SA 3LQRA 3EX7C 3CF6R 4A92A 4BLTA 2HCBA 1NMYA 3AVUA 3NWJA 3ZH9B 1T6NA 2R44A 1ZINA 1CXZA 5KPJA 2D3WA 2IHBA 4MKIA 4URYR 1RRGA 1KHTA 4Q4AB 3K1JA 3ECCA 4HYYA 2XXAA 4PHGA 3RC3A 1LVGA 2YC4C 2PCLA 3RC8A 2NO6A 4C0JA 1Q1QA 5B57C 1TF2A 4DUGD 3NVAA 1CBUA 2LKDA 3GLHE 4P33A 2GVDC 3KL4A 1P2VA 1E9CA 1EFRA 2KBFA 5J40A 4AC9A 5KSOA 1MRSA 3CNOA 2FEOA 4Y0VA 4URVR 5E3HA 1GKIA 4Q7JB 2ZI9A 4V0NA 2GK6A 4DUGA 2ATXA 5K8UA 1FTSA 2MMCA 4C0AC 4D4MA 4XD7A 3PR1A 3TH5A 2CMKA 3LFUA 4EFMA 1FPMA 1GP2A 5EJEA 2AL7A 1SVMA 1XJCA 2VP0A 2R6DA 1VIYA 4GMDA 3Q85A 4GOKA 4B3GA 3H2YA 4NDZA 2NQ2C 2OV2A 2CDNA 3VHXA 4C9BA 1T3SA 3FDIA 3V9PA 1KI6B 1Z28A 3CRVA 3DMDA 1TQ4A 3DVLA 1AS0A 2W58A 3A1TA 1KJWA 5LBIA 3FWYA 2ZRCA 2ERYA 4A6PA 4YMUA 4DDWA 3NBFA 5G41A 1JEEA 4GFDA 1OB5A 121PA 3FMIA 4OL0A 4LJ5A 3CM0A 4ZCLA 2ZUDA 6Q21A 3CR7A 2R6GA 1CU1A 2QTFA 4XSGA 3NH6A 2FPMA 3QE0A 3HR7A 3A4LA 4L9WA 2ZU0C 3SN6A 3W6PA 4D4KA 2JA1A 2AK2A 2CXXA 1YZGA 2AWNA 4FXPA 4LY6A 3SOPA 1JXOA 1NN1A 3GJXC 3HU2A 1G16A 1NJGA 4S35A 4Q9HA 3K70B 3CF2A 4UKDA 3SJZA 4O3MA 3ADBA 4Q9IA 5BN5A 2V7QD 3CR8A 1KSHA 4PQRA 4E22A 4NYJQ 2JLSA 1I4DD 3OAAA 4PPFA 1G3QA 2F3TA 4GMXA 4XWKA 4LBVA 2X1VA 2ZU6A 3SQXA 2XSZA 3GJ0A 1EWRA 4B3BA 4F4IA 2ZE6A 2KE5A 2JATA 2GWHA 4I81A 3T15A 1DAMA 3OIUA 1XXHE 1AKEA 3AEZA 5CJ2A 2RB4A 1NN0A 3T34A 4JVNA 1E9SA 1E9BA 1BMFD 2UVQA 1GDDA 3MJRA 2ZS9A 1KYIA 4I1VA 3VR2A 1VYTA 2J3EA 2JLQA 1KI1A 1Z3IX 3EPLA 4EPTA 2WJYA 2J7PD 3BXZA 1HT1E 1GNPA 5B30A 3U6BA 1RYFA 3VFDA 2ONKA 1SVWA 5AUOB 4OQFA 1IONA 5HCNA 4Q4HB 1F2UB 4X8MA 2JJ2A 4LPKA 3AF4A 2J7PA 2VHUA 1DAKA 3RVBA 1CTQA 1VTKA 2OFWA 1AKYA 1G19A 4D6PA 5FBLB 3MUFA 4PTLA 3SE0A 2DBYA 4RD1A 1K5GA 2REOA 2IT1A 1X8KA 2ZE7A 3QXHA 2GJAA 4GZLA 3C16C 5CIQA 3TUZC 2VTKA 2X19A 5JWRA 2PJRA 3B60A 4NPHA 4BLRA 2AKYA 4M1MA 1NJFA 1W36C 2R2AA 3FE2A 1P2TA 1TUEA 2W6IA 2ZR7A 3NBYC 4IFBA 2IUSA 1P9WA 5KDLA 2XGJA 3KJIA 4ZDKA 2H16A 2REBA 3GLIE 1E2JA 3TJZA 3BFKA 3K0CC 4QHYA 1XEWY 2ZJYA 1CJTC 3H4MA 3IIJA 4WA7A 5D3MB 4OQXA 2F9MA 3M6AA 1VYVA 3P4XA 4MRSA 1U8AA 5C18A 4BLQA 2C8VA 621PA 5HE8A 4CEJA 4QGHA 4US0R 3AVOA 2MSDB 3I8SA 3WRYC 2IYSA 3GEIA 3D6TB 2L0XA 1Z0DA 1ZD1A 1Z6YA 3L43A 3MCAA 4KFSA 1E2GA 1FMLA 1KAOA 1YRBA 2GJ9A 1HTWA 1QHHA 421PA 4PQFA 5F2EA 1MO6A 1IQPA 4Z8XA 4L15A 5EP2A 2D06A 5AUQA 2HYIC 1QVRA 4AG5A 2PMKA 3TSZA 3F0TA 3QPWA 2GXAA 4PO9A 2O8EB 2WSSD 4XVQA 4EPYA 1JALA 4IDQA 4JVMA 3O8DA 2EWVA 1XJQA 1OH7A 4JKYA 3VR1A 2ZRPA 3FKSA 4XVRA 4US2R 2ZI6A 5GJBA 2DB3A 3ZIAA 3VAAA 1KDRA 3G0HA 2Q0HA 2WWWA 2V6JA 2WSSA 4ZKDA 1Z6XA 4NYMR 3LA6A 2QTHA 2J0QA 521PA 2GK7A 1N6LA 2QE7D 4M1WA 3SJBA 2J87A 1KO4A 4QBHA 1JR3E 1ZCBA 4EJSB 1N6NA 2C5LA 1ESNA 4NHOA 1IXSB 2YYZA 5TVKA 5KO2A 1EX6A 3I73A 4M0LA 3H86A 1W0KD 3Q3JB 3E1SA 3NBZC 5K8TA 2KB0A 2VBCA 1TQDA 1V43A 2GZAA 1IJEA 1GUAA 4KU4A 3PITA 1KNXA 5DHAA 1G8PA 3GFTA 4NYMQ 1Q3HA 3ZYCA 1FZQA 1W0KA 2JLYA 3AV0B 4CZ2A 2ZJ8A 5LPNA 1RRPA 4M9XA 4B6EA 2QAGC 2BV3A 1EFTA 2WMOB 4O25A 2EFGA 2YV5A 2ZYUX 4JVSB 1TQ6A 4KXFB 4E07A 1F60A 4FCVA 4Z54A 2WPDD 2KI5A 4KFTA 1OFTA 4CT4B 3WBJA 4KITB 2WV9A 2HUPA 1W48A 3UIEA 5G53C 3DOFA 4MITA 1KI9A 3BAFA 3B9QA 3FMOB 4OK3A 4CT5A 1XPRA 1R8QA 2RGBA 3DMNA 4ESVA 2ZUBA 4PX9A 3UG7A 1SHKA 2OHFA 3FHOA 4YMVA 1G21E 2XXAB 1HH4A 2C9OA 2I1VB 1XB2A 4OHZA 3CRMA 3IEUA 1A1VA 1ZNXA 4Q21A 5F3WB 4FCWA 3T35A 2GBLC 2ZRHA 2IYQA 1MO3A 5FOTA 3AVYA 2EWWA 2ZE5A 4ABYA 3VKHA 4P4SA 3ZLJA 4RD3A 2C04A 4R9UC 4UNSA 1G18A 3FMFA 1G7RA 2ZAOA 3W5IA 2PLRA 1G3UA 4ZKEA 4NONA 4JSTA 2PH1A 2Q3FA 1ZNZA 4JLMA 2FSGA 4LJ6A 4GI7A 2RGGA 5F9HA 4E03A 2IX3A 1IN5A 1VYUA 1JJVA 4HZUA 2F55A 3AGQA 5DHFA 1OPXA 3PJRA 3TMKA 3MAAC 1E2IA 4C0SA 1KI7A 4ARZA 5KSYA 3UATA 1QG4A 1UKYA 1FL9A 1J7KA 1FUUA 1UAAA 2G1KA 1P5ZB 3QEOA 4KYUA 5AUPB 1Q3TA 1N6IA 3W3ZB 2PX0A 3ASZA 5BN4A 2VPPA 4RD2A 1NN3A 2GILA 2YC2C 2EVWX 1SQ5A 2KSQA 4AI6A 4NMMA 5FL7D 3TR0A 3WYFA 4L4UA 4HLQB 1K8RA 1RFLA 2FWRA 3OEHD 3RHFA 2V3CC 4ZI3A 3QKSA 1PLJA 8OHMA 5CYOA 2QU8A 1VECA 2XNSA 4NH0A 3FTQA 5JI3E 2A5DA 1DG1G 2B21A 2EYUA 1E32A 1W5SA 1OIXA 2WBLC 1S8FA 1TU3A 3CO5A 4M21A 5FPSA 1W4CA 2BDTA 1AQUA 1VIAA 2NG1A 3N2EA 3D8BA 1MV5A 2QUZA 2TMKA 2W2TA 3GFPA 4IDHA 2ZM5A 4C2UA 4A4DA 2HDNB 1Z6AA 3T61A 2OO7A 2UZ3A 2W6JD 1U90A 3NC1C 3TW8B 4JS0A 1UDXA 2H92A 1M1YE 1UEJA 1Z5ZA 3C5CA 4DSNA 1HUQA 4TQ9A 1E79D 1NBMD 4QM6A 4C0HA 4A0RA 4Z8YA 1QHYA 3WHKA 2WWYA 1QVAA 1M2OB 1ESMA 1YRAA 5JRJA 2GVZC 3OZXA 2FG5A 3BD9A 1AZSC 3CH4B 2R62A 5GVSA 1XU4A 3U7GA 3R9XA 1E3MA 3TR5A 2WJVA 1NBMA 3MG9A 4DWJA 1NSFA 1Z29A 1F3OA 4G3XA 4YONB 5DI9A 3VR3A 5EE3A 4DZZA 2VF7A 1G8YA 2WAXA 1Z8FA 3ZDQA 3EC2A 5EE5B 4G5OA 3BS4A 4RCZA 5JRZA 3LWNA 1U81A 4UXIA 4I1UA 5JI2E 2FFAA 3MWKA 2GZHA 1EXMA 5SZIA 1DELA 2ZRLA 4Q1DA 2IEYA 2V1XA 3IQXA 3BH6A 2CK3A 1W47A 4LHXA 4DEXA 1U0HC 2WWGA 3I92A 2O0HA 3VMFA 3ADKA 3G82C 5CLQA 4TL6A 3SYNA 4AYTA 2F7SA 4AKEA 4RJLA 4Z1MD 4XWOA 2Q3MA 1JECA 2J5XA 4BFVA 1CULC 2QZ4A 5LD2B 2IYVA 3KKNA 4HI0E 2WM9B 3REFA 4TT3D 1RRFA 2B7CA 4US1R 3N70A 4GZMA 4M2LA 4TYPA 3QBTA 5TY0A 3GLFA 4DVGA 1KI4A 3AB3A 4Z1MA 4P32A 1CF4A 1CP2A 4C0KA 3T5DA 4TMTA 1XTIA 1WF3A 2WSMA 3H84A 2J0VA 3L8ZA 4M9SA 4MUAA 4TZ6A 3C8UA 4CEJB 2XTMA 3QQ5A 3UG6A 4N1AA 3LLUA 3REGA 4TT3A 2EW1A 2JAQA 2XJ4A 1TAGA 3UK6A 1YZTA 1MO4A 4K8OA 2FEMA 4DLVA 4JLOA 3CUEF 1OV4A 1QHHB 5CM9C 4ITRC 5EXXA 2VH5R 2Q6TA 2OBLA 1NG9A 3CRRA 3Q7PA 1E9RA 1GRNA 2ERXA 4IEIA 2JDID 5KNBA 2I3BA 4LHYA 1BS1A 3AF0A 2YWGA 1RE0A 5JS8A 4W5HA 4H1VA 3EIQA 1HEIA 2QROA 3KJHA 3RAPR 3SQWA 2RH5A 2A78A 3HU3A 5HTKA 1QG2A 1W49A 5FPYA 4QRHA 2YWFA 4UNNA 4MKGA 2N46A 4MA4A 5CK5A 2NZ8A 4M22A 4PANA 3OHMA 2VHJA 2WJGA 3MRSA 4IDOA 4C4PA 2ECKA 4LHVA 2GTPA 2X2EA 4ZCMA 1DARA 1Q44A 2FE4A 2FOLA 5KSZA 3AF2A 1GKUB 1N0UA 1TUIA 2MSEB 3Q5DA 1DTSA 3CPEA 4HB3A 1G3MA 1S3SA 2IS4A 2DFTA 2HXYA 2AKAB 1XZQA 3RRZA 2FSHA 1NLZA 3U44A 1MRNA 3OE7D 1CKEA 3AP3A 5EP1A 4R7ZA 4ASUD 1WB9A 1J2JA 2GCPA 4C2TA 4NZYA 4YDSA 1L4UA 3QXXA 1ZU5A 3PV0A 3G5UA 3FHTA 4A36A 1F6BA 4BEJA 1NMZA 1U8YA 2RGDA 3MMPA 4DEYA 2B7BA 1EWQA 3UPUA 2YKGA 4KI0A 4BFZA 1NVVR 3TNFA 2WWFA 2JGNA 2REXB 4M4SA 1W4BA 4KV9A 3VKGA 4G0NA 4WXPA 1JXMA 3ICEA 3KJEA 2RMKA 2GZDA 4HZIA 1OKKD 4JVLA 2BBOA 4MKFA 1AGPA 4B43A 2BMDA 3Q7QA 4EJSC 2KJQA 1UJ2A 5GADl 4TTPA 3TK1A 3DDCA 3WYAA 1TMKA 5FTJA 4LBWA 2VP5A 4V0OA 3TVTA 2WKQA 1Z07A 2IHYA 1J90A 2HXSA 1JJ7A 1J99A 3MWLA 3P32A 4DIDA 2C95A 1KSGA 1NVVQ 1G7SA 4BQSA 1KMQA 2GXSA 3CZQA 3CWZA 2VHTA 2B6HA 1DAFA 3A1WA 1ELOA 4YXWD 4H9GA 4FMBB 1HQYE 4PC3A 2BJWA 3HJNA 1A82A 2ZRIA 3O8CA 4URXR 5EE0A 3CONA 3GQBA 4HSEA 4R2HA 4IHQA 2BMEA 4LDJA 2R6FA 2IA5A 1E98A 1E2PA 1LTQA 4AY2A 4YXWA 4F38A 1ODFA 2CE2X 5FL3A 4P4SB 1N6OA 2A5GA 2GA8A 4QFMA 4B32A 5TB5A 5AK0A 2C9CA 3U3JA 3IO5A 3KQLA 2A5JA 4BUJA 5JJIA 1Q0UA 2KBEA 1D2NA 3HWSA 3VTKA 5HKKA 3QI2A 5FUVA 5KYKA 1H8ED 3B82A 2UZIR 4HZUB 3DHWC 2G77B 4BFWA 1VHLA 2YWEA 1YZKA 3PFIA 3FB4A 2VP9A 3TE6A 3OIWA 4ARZB 1Z22A 5E7JA 3QENA 4B3DA 5J4YA 3L0IB 2IS6A 4YMTA 3A1VA 3CX6A 4LJAA 3K9LA 3ND9A 1FX0A 5HPYB 4QNMA 5JEDA 2G1JA 2EU8A 1C4OA 1ZP6A 2ZJBA 2ASEA 3QPVA 4FWIB 2D2FA 4RVCA 4S2EA 4L16A 5FOSA 2QL6A 3MWYW 4ACAA 1AJEA 2Z43A 4IVPA 2F1HA 2O8DA 3PXGA 2ODBA 1NSTA 1KK3A 3SI7A 3QKSB 2BBWA 2YVUA 2GEUA 3HPQA 5FBQB 1YR7A 4NCHA 4TQUS 4XOIA 2BHRA 5KTYA 5CM8B 3GD7A 3PUXA 4A0FA 2VP4A 1KK2A 1X1RA 2XX3A 2J0UA 2YZ2A 2R6AA 4Q9JA 4DLYA 1EK0A 3KZ1E 5IF9A 2QT0A 1SXJD 1O87A 4FCTA 4XWAA 4P31A 1DAGA 2GEDA 4W5WA 4MYTA 3IGFA 4J0QA 2VSFA 3GPLA 4FI3C 4N0EA 1P62B 1GG2A 4CVNA 2GF9A 1R7RA 2WOJA 4PHFA 5IRCD 2V9PA 1M8PA 2J46A 2XEXA 1VG0B 1G8GA 2ZYWX 3I1FA 1DG3A 2PZEA 1E1QD 5J4KA 2HCJB 2GCOA 3D31A 3L8YA 4FN5A 3AVVA 4V0ME 1E1RD 5CDFE 4XVUA 3OEEA 3IPYA 4HATA 1N5KA 1U94A 2PBRA 3A4NA 4ZIRA 1L8QA 3KXLA 3CIOA 4NE2A 4CIDA 1T3HA 4TMWA 1QHXA 5JLJA 2RGNA 5BYJA 3BFXA 3PEYA 2ZR9A 2D2EA 4KVGA 1Z0FA 4QL3A 3AKYA 4EPVA 4B34A 4F4CA 1ZBDA 4KLNA 3PQCA 3BB3A 5EZ5A 3BGWA 3AGPA 4Q9LA 4B75A 4HLUC 4IEEA 3LXRA 2DFNA 5DLQC 3SBDA 2JLXA 1XTKA 2G9NA 4AYXA 1OT3A 3C14C 1SVLA 3NH9A 1GL6A 4JLPA 4RD0A 3FFBA 1OH6A 2OXCA 4PSVA 4DB2A 2BJVA 1XWIA 2ZRNA 3IBGA 5AJYA 4KBGA 1B23P 5GVRA 4BFTA 2ZANA 4ZI2A 4WW0A 1GWNA 1A7JA 3UANA 1QDEA 1DAHA 1XPUA 2GESA 3UWOA 2WTUA 5CJPA 4V02A 1IY1A 4NCNA 4U7DA 1COWD 3K8YA 3GLFB 3CF0A 1TX4B 1GNQA
chains in the Genus database with same CATH superfamily
5ALJA 2X6RA 1J7JA 4C29A 2AHRA 5EJ4A 5IC4A 3VU9A 1SVIA 1SHLA 5EWMB 1XNHA 2BMVA 3MS4A 5T4HA 1M3SA 3L18A 1PGQA 2A3NA 3AY6A 4B7XA 4KOAA 4LTDA 1T34A 5ICEA 4RSGA 1Z2CA 5F35A 4DCPA 4FFRA 4UBNA 3IIKA 9ABPA 2IH5A 4RESA 2MOKA 2ODNA 3VPAA 1RKXA 2WIGA 2HZ7A 1WP4A 3P71T 4Q4JA 5ALEA 2NGRA 4UEQA 3RU9A 1ZD4A 4OKIA 1I51A 2H1WA 5BV0A 4X3CA 2O2HA 1MC4A 3L0OA 4Y98A 1EFVA 3C3WA 5KVSA 3TTYA 2BZSA 3JQCA 5ALXA 1ENOA 3V55A 1MAWA 16PKA 4P84A 4EF5A 4CU2A 1KMNA 3GHYA 3OJOA 2R6CA 1X1EA 4UAUA 4R3UC 1Y3DE 5HS4A 3JASB 2YW2A 5G0WA 4AIIA 2WSLA 1YR6A 4AROA 4JZYA 1QF7A 3GEDA 1NX9A 1UM9B 1LPOA 5JFGA 5F7JA 4JITA 2OT3B 1H6CA 4DLXA 4WE3A 3AO0B 2ZRJA 3UJ3X 3ZOKA 4LVCA 1GNLA 4CXMA 3DUFB 3GV0A 3CIFA 3NIWA 4IDGA 3UPDA 4ZEVA 3C7TA 4F5YA 3B52X 3QLJA 2EF1A 3QXJA 4UHKA 3TBKA 4DV7B 3PPXA 2BEUA 3GT0A 1K0UA 4WQMA 1XN4A 1E96A 3GRYA 2VNAA 4HRVA 3H3JA 4JZKA 4CW7A 4RZIA 2ZSDA 4ZVQA 1R5NA 5HILA 1F3LA 4DQXA 3ZCUA 1K66A 1VKJA 4PZYA 5HFAA 3VJKA 3HXLA 1A3CA 2BM9A 2Q4OA 2V3VA 3RKRA 1SRQA 5FBZA 1QIGA 2FQQA 1B7GO 2B83A 2PGNA 1KSJA 1OPRA 2PJDA 2BGTA 3PWTA 1CY1A 3K30A 1JDBC 3E2PA 4O0MA 3GLQA 5BWMA 3AVXA 2FH5B 3M89A 3R7NA 5ES4B 4J4TA 4E5KA 1PJCA 1LLFA 4Y2HA 2WHRA 2XUDA 2Z3VA 1EFHA 5CBKA 1N0VC 1BMFA 3CVUA 3QUQA 1L6RA 2Z5VA 5KTNA 1PJQA 3IEVA 1M2FA 1UKBA 3IHWA 4BPBA 3U4IA 5JYCA 4U1RA 3VSDA 3K4QA 2I33A 1P7CA 4IGIA 1I4LD 1T0BA 2AOWA 3KHSA 3N7UA 4U6QA 4WZBB 3T9AA 1XT6A 4Q3LA 1MXFA 2BEWA 1HQDA 1ZZEA 2QM7A 3N1UA 2IE8A 3BIOA 2AXQA 3NBXX 2DFKB 1FRQA 3T9FA 2ZZNA 1L5HB 2C3OA 4IIVA 1ECBA 5IJAA 5JS1A 5B3LA 4BMYA 3NEJA 1V2HE 4TOIA 2QP9X 1JB9A 5LMUB 3KPWA 1Z34A 2CEAA 3BSSA 2XAAA 3OQBA 5HRCA 5ANRB 2OB1A 3EQ6A 2CHGA 3MOSA 4LJKA 1TZCA 4YAWA 4MYUA 4NBUA 4OHMA 1CFJA 1X8LA 4PQGA 5D5HA 1R0WA 2PKQP 1GN8A 4WY2A 4QBFA 4QYMA 1GPNA 2XWQA 2NOAA 2J3MA 4HRYA 2IWHA 4IQ8A 3AY0A 4WEQA 1Y1QA 3LWZA 2JFHA 4W9MC 3VGPA 3RBZA 2O3SA 1E9AA 4ZVMA 3OIDA 1A5AB 1C8KA 4GYWA 1FFXA 1N2EA 4JIMA 4B6SA 2Q1WA 3DZJA 1XOIA 3IKLA 4N3GA 2QBYA 4A16A 3OSZA 1R12A 4HVLA 2ZWPA 3TN7A 9MHTA 5BVGA 2FPGB 1XX6A 1JR3D 1YOBA 2V97A 4G0ZA 2I22A 5HF8A 5F98A 4BEWA 4BZZA 2W42A 5TEWA 4FMCF 2B36A 1J25A 4H7EA 3ZZ0A 3AX6A 4MGHA 3QUAA 4PLCA 2BELA 1FX0B 1UMKA 3JQBA 1U6KA 1VE1A 1XZLA 2WU1A 3DO6A 3T7SA 3HJBA 1NHWA 4KXYA 3RBVA 1YJ5A 4PM4A 1T9AA 1WCV1 2WE8A 3L1IA 1E0JA 3NU1A 2OUKA 3ON5A 3N3BC 3TLZA 1LW6E 2BKXA 2DJIA 4A8JC 4AMYA 4ERNA 1NNUA 3F4KA 3EAQA 3W34A 2E3JA 4MMXB 3WBFA 4QODA 4P34A 3ZI0A 3NGLA 3AY3A 2XXBA 5C7OO 4Q7LA 3MMNA 2VAMA 4M9QA 4O1MA 1XTSA 4CUJA 4L78A 3R0QA 4BAZA 4W9RA 4LNUB 1VG8A 4JP2A 2JGRA 5BSVA 4KVFA 3R6WA 3BVPA 2I2FA 3LQQA 1J0EA 1AQ6A 5CRIA 1CNFA 1ODSA 4LSZA 5FRDA 5CX1B 3D3QA 4YN3A 4BNIA 5TGDA 1M7BA 4BVJA 5HIMA 4IRUB 5ERYA 4JLNA 1GDHA 2XH8A 2X9VA 1AIPA 3EXIA 4RIEA 3MSXA 2AD5A 3VKVA 5HZMA 1KMHA 3E4DA 3NBMA 2QE7A 4LHSA 3NPAA 3PVSA 5CTAA 3D2LA 1WCWA 2SECE 3O82A 4J0GA 3AKEA 1JF8A 1TM3E 2XTAA 4QG7A 2W70A 3CZPA 1KPHA 4OJTA 2LE0A 5DHRA 5FPKA 1PR3A 1VL1A 2HMAA 1IVYA 2RCNA 3PUVA 2VL7A 1JLKA 2ONJA 1G8KA 4ZOCA 1NBEA 4Q9AA 5BUSA 2GJSA 2RONA 2UYYA 2A8YA 1E6KA 1QRAA 4LXQA 1YACA 5JZMA 1YB7A 2C77A 3T5MA 5B7PA 2XNDD 3FFXA 5SYNA 1UDRA 2C2ZA 2P9EA 1VSQA 3C3XA 1VE9A 3D4OA 4LXUA 1ODCA 1Z35A 1L7DA 2H8KA 2ID7A 2XCOA 2DQZA 3AWDA 3HFSA 3NWBA 3VU8A 3U16A 2CXRA 2P68A 4DKXA 4Y6OA 1IWPB 3CX7A 3SBEA 1ZI9A 2F3SA 1QQ6A 1U8CB 4MB0A 3W4IA 3M6IA 4JNKA 3CYFA 2PT5A 5K3FB 1T5HX 5LU9A 4L5IA 1NPTO 1IE3A 2ZAGA 4FOPA 1LBEA 3MRXA 1N34B 1GLNA 4C0WA 2GS9A 4XEUA 1YE3A 1CPYA 4TTSA 4D02A 1SIBE 1T9GS 4FGUA 5AI5A 4G24A 3UKJA 4C87A 4DSAA 4F85A 1NI5A 4FUTA 4Q7MB 3LDGA 1PQUA 3PNBA 5IYZF 3CPSA 3ET4A 2W4IA 1U9IA 3VDNB 3IRUA 4PPQA 2HWKA 3D6NB 4OHPA 4HMOA 4RAOA 3THXA 4CYMA 1PO7A 4TWIA 4JWKA 4PHTA 5CT4A 5DLYA 1E1NA 4BJ3A 4LDPA 1KKMA 3EQZA 1P4SA 3H18A 5HUJA 5IJ0A 3RS5A 2R8ZA 3WRYA 1G5IA 3B6JA 4AZ0A 3VU9B 5BWNA 4Q3CA 4WX2B 4UTOA 3GJ3A 4GBMA 4X3OA 2YNMA 5DHQA 1QYXA 1NXXA 1IEXA 5LZ8A 4F3YA 3ZZ1A 1JIKA 3SHFA 1R0ZA 1IZ8A 3FPAA 1ZVVA 2FEKA 3EIHA 4L0QA 5DNAA 1N0WA 2WAAA 3Q0TA 4DIOA 3FPGA 4Q4JB 5F78A 3R8CA 1LVHA 1ZVMA 3H7IA 3ENKA 5JCOA 1W0JD 1JW9B 2C59A 3GJ4A 2ATVA 5LUAA 3RSLA 1EFVB 3MIZA 3QF7A 4M7OA 3SEAA 4BC1A 4LYDA 4N6GA 2ZIUB 1X0VA 3S40A 4DMFA 4J8PA 2HR1A 3BH7A 2VO1A 1VE5A 2ZTSA 3MTJA 2QQ5A 5IK2D 3A32A 4C0BA 4LWPA 4O02B 4A5SA 4O2RA 3HCOA 2Z4TA 2ZRQA 2G9RA 5HJ5A 1E99A 2GRJA 2WP8J 2JAWA 3W7VA 3WLHA 1V3TA 3Q8XB 1HFKA 2D7CA 4PXYA 3IJPA 5EQJB 1ARZA 1I3LA 3KVYA 2C8KA 4JX9A 2FLWA 3OEHA 2Q49A 1P2GA 3QTLA 5IPFA 4ZTZB 2GPBA 5DSXA 1M2KA 1RQLA 1SC6A 1B0ZA 1W4RA 1JLSA 1T2UA 3FSGA 1VCHA 1YBAA 2H4HA 3A3NA 3H2SA 5HCIA 2JFGA 2XNCA 2BEUB 3AZQA 1XCJA 4FYHA 4HPWA 4BZWA 5HQ3A 3HM9A 1QFMA 4S1WA 2ZQ5A 3NYRA 3ZXIA 2QTTA 4OOFA 1OI2A 3H4VA 4EJ6A 3C6XA 1DXYA 3M4XA 5CB4A 4DMLA 3VA7A 1TEHA 1YI0A 3UFXA 3K8OE 2W9XA 4NCJA 3WP0A 3DHVA 3ZWKA 3LK6A 3PTAA 1NKSA 4S1TA 4BO0A 3WAGA 2QR2A 3IDZA 5GM2A 1OFUA 4KLRA 4E3WA 4IY1A 1D6JA 1L7PA 2FKAA 4XXHA 3TAXA 5BNTA 5HXAA 1G5TA 5EIOA 2Q4DA 1P39A 2CXOA 2FWIA 1MAAA 2RG1A 2ZJ5A 5EKDA 3KE8A 4K9MA 4ZZ1A 4B81A 1FJXA 3ORRA 2HDWA 1P1RA 1DV2A 1UJ5A 2OCIA 2QP4A 2QRQA 1Y5NA 3E5NA 1ID1A 4P3OA 3RYHA 3AYXB 1LUAA 1GA6A 4BO9A 1HTBA 3A1EA 1P4JA 1H0HA 1ZM3A 3KU1A 4QGFA 2ORWA 1GL3A 4ZVUA 3HBMA 2EBHX 4KGDA 1CIPA 4HT3B 2VPXA 1TFRA 2J5BA 4XDGA 5EJIA 3A25A 3TCKA 4JB3A 1GR1A 1MH1A 5AIAA 1D8TA 4RF5A 1U65A 4RY8A 3V8VA 1I32A 1IUNA 2DRIA 2JI8A 5BR1A 2BEWB 3I2JA 1UC4B 3IT2A 3P96A 4R83A 4NHEA 4AZVA 3C4QA 3TVYA 1IZ0A 1SHUX 2FW7A 3TNJA 1TYDE 5FEMA 4ZTUB 1A71A 1FRZA 1KJJA 5J43A 5K0GA 3Q2OA 3FYUC 4M8NE 4FGZA 4MCHA 1M6VA 3BD7A 3LO5A 4ZZIA 1S4MA 3ETNA 2ATEA 4Q03A 4I8IA 5DHPA 3RSQA 5LDHA 5CXSA 3Q7IA 2J5KA 3OKCA 4OXNA 3U3RA 1U4NA 4GLFA 3J7AC 5TX7A 3KPUA 3H9BA 2XCRB 1J8DA 4KIUA 3UT5A 4DLNA 5HKBA 4Z4EA 1NWHA 5CURA 4DMRA 1TRHA 3THYA 2NYAA 3PYXA 1VMAA 1W96A 5EMKA 1W46A 1PHRA 3HCNA 5HOEA 1PUIA 4KIGA 2A59A 2CN1A 3NXSA 4OQ4A 3D3EA 2R79A 2X2OA 4YRPA 3EXEA 2ACWA 2W8ZA 4MLCA 2ZYRA 3ANLA 2OXTA 1AU9A 4EGQA 1SG0A 3QVJA 1FFXB 3R1IA 3RJZA 3OLQA 4XGNA 4B2LA 1P6XA 3M5CA 5KYTA 2QBYB 3FI9A 3B70A 3NNSA 4KLCA 5F1KA 5BVGB 4A1FA 3QPAA 1C7FA 1YVDA 5JT1A 2P7IA 1E4YA 2GKOA 2XMGA 3IAS1 3P1JA 3LP5A 3PHGA 4IDEA 4A8HA 3HYTA 1RMQA 3WL5A 2EKBA 2CVPA 4LMAA 2E1RA 1ZJWA 4LYHA 3HVKA 2VPIA 1XEWX 1HURA 1GPKA 5FYQA 4ZA2A 1M7HA 3AVTA 4DSOA 2PKQO 1NDHA 4HNAA 4I2NA 4E32A 4FT2A 4FW9A 4Y6GB 1KEZA 4KGXA 4B48A 4JYPA 4BIIA 3MHTA 2JLWA 1VZ2A 2KQUA 3QFFA 4D25A 1J9EA 3PC6A 1UPXA 1A5ZA 3TRIA 3IP7A 2JL1A 3EEQA 2HMSA 3LUFA 2C7BA 5BV2P 1UC9A 3A4IA 4RPCA 1R0CA 4M46A 4YRZA 2OOKA 1YVRA 1KZGB 2PZFA 2BM0A 3M7IA 3BXOA 2PX2A 3S68A 1DJMA 1IY0A 3IAEA 2QB5A 3ZTTA 4BS9A 3DZGA 1WLYA 4KMRA 2WP0A 4Y9RA 4EJ2A 5P21A 2NUAA 2W6PA 3EXIB 1IYZA 1ORHA 1SOWA 4QJ4A 1YFZA 1KMHB 2QNIA 4GRAA 5E6RA 5L3RA 5B5SA 5JANA 2QVXX 1PK9A 4TN1A 3PX7A 5JS7A 4BB9A 2BFPA 2YWJA 3AJ9A 4A9AA 2CJWA 4X63A 5G1PA 3F6EX 4FGSA 5B1EA 2QSJA 2H4YA 4M36A 1JG6A 3G68A 3OY7A 4L72A 1K8QA 2Q1SA 2X5KO 3CISA 4TRJA 2RDMA 1FMJA 1R0BA 1ZY2A 1II8A 1Q0HA 1Z8HA 4JYBA 5JDIC 2OGTA 5IT0A 5G3YA 2DH5A 4W6QA 1MOSA 3LXXA 4M98A 2X4DA 3WLJA 2TMYA 5I9LA 3V2GA 5KNCA 4B3RB 3F4LA 2HQOA 1DVRA 3R2JA 2B8NA 3ESYA 4ZODA 1LU9A 2D59A 3I39X 1PR1A 2JHGA 4GG1A 1CUCA 3L0SA 4PC7A 3KP1A 4NBLA 3RRYA 3CZMA 3PE3A 5KTSA 4YRSA 3I8OA 3QVVA 1KJQA 4BAUA 4K9DA 5JAIA 3PUWA 3ESZA 4G5HA 5DYWA 3RJ9A 3TKLA 4FHDA 2H8GA 3VOBA 2OPBA 2P3OA 3RAJA 4B73A 2O8BA 3HKDA 3U13A 2FUCA 5BWLA 3W5DA 2E9SA 2WHYA 1SGWA 3IEIA 3IUEA 4WDRA 1C8VB 2FPWA 5F64A 2IVZA 4MUFA 4J1TC 1QE3A 3VZBA 1LBHA 3H11A 3FSRA 2HT6A 3DKKA 1IOZA 4YGYA 3T41A 4IKOA 4TWBA 3QPDA 3LTNC 3HZOA 3WGKA 3NHZA 3O1JC 2QZ9A 1ZN2A 3JZDA 4RYLA 4MULA 1FP6A 3GO4A 2RGCA 1GG9A 1VL5A 1KS2A 3QMMA 5CPFA 2LP4Y 3PP8A 3ISVA 2GF0A 1N32B 2VDRB 4ZC8A 1LPBB 4BQEA 3THXB 3COJA 3E8MA 4Q48A 1NI3A 1DRJA 3KE9A 2QLTA 5EZ6B 3UAOA 3ZE9A 2F1RA 2XITA 1V96A 2OXFA 4MV4A 3U7HB 1AQLA 5AJXA 4U2BA 4FNGA 1R64A 2QZJA 3OFVA 1QH0A 2B35A 5A4JA 1EA5A 5IJ0B 3ZQKA 3EPRA 4AZ0B 2XUKA 3PGA1 1KY2A 2CXTA 4EG6A 4R31A 1FP7A 4BX9A 4MH0R 3C8HA 1R37A 2Q8NA 2YHIA 1BHO1 1X3LA 2W6NA 4PHHA 5LQMA 3RAFC 1GKLA 4IX1A 2YRWA 2DCMA 5A04A 5KNCH 3THWA 4PFJA 4JOQA 3F9IA 3V4PB 2BEKA 3OCWA 2JLZA 1N6PA 1VSTA 1SQ0A 3MW8A 2O2CA 1KVTA 4IDFA 3M5DA 2ZUUA 4G01B 1RKVA 4RD4A 5JCPA 3KQNA 4RTKA 1XLUA 1WUJS 1Y8QA 4R69A 3ASVA 1BWSA 1XK6A 1Z0SA 3IDSA 2XGGA 4ISBA 2MU1A 1G8FA 4UDOA 1NYTA 3P7MA 3CRW1 3IQHX 3SDZA 3JYOA 5F2NA 3KEGA 2X7HA 2R6ZA 1PR9A 4YBZA 3F9RA 2B0JA 4PLFA 3HB7A 3K1TA 4YH1A 5JJCA 3TIFA 3I64A 6YASA 3EK2A 2Z98A 4B3XA 2SCUA 4KSCA 4TUYA 1J2TA 4TXJA 3AB8A 1MJNA 3ZCXA 4OHXA 1UPAA 4GIBA 4MWTA 5CX4A 1G3IA 2YOGA 3NT5A 3P9PA 4ZO4A 1IUPA 1GAQA 1Z0JA 2OV6A 2ZIZA 2PEYA 2WJ3A 4ZTBA 5IDQA 2FCRA 2I6XA 4FHFA 2VQEB 1QRUA 5JDCC 1CYDA 4K03A 3MFYA 4F3TA 3WK7A 4C0QC 2IXDA 5D00A 1Q0RA 3EIXA 3QSYA 3KOYA 1F17A 2PGJA 1LFDB 1KO5A 2WF7A 3PD0A 1PCXA 4XB6B 1Z6QA 5FA8A 1SUBA 1CUFA 3NDIA 3BGIA 3H5WA 1TNDA 3OIFA 5FOWA 1S3IA 3I5YA 4S0ZA 2ORVA 4GGOA 3U48A 3E18A 2GFHA 3L7IA 3ROQA 1ODTC 3K16A 3IHLA 2P5YA 5CB4B 1W52X 3K5HA 4OHBA 5LA6A 5INTA 5BYAA 1KHHA 3UFXB 3TSWA 2NADA 3UWDA 1NVWQ 4DWOA 2BFDA 3E1GA 1RJGA 3EVBA 3RUFA 3D3NA 3FPBA 3PNQA 4HVCA 2WIFA 1GTRA 3E2MA 2RJOA 4FFSA 4G0YA 4QTUB 4YTEA 1NZFA 2H2AA 2V4UA 1O77A 2YHAA 4M60A 4C7JA 1NBAA 4RPHA 5FI1B 1Y98A 3K8QA 2OCLA 5B2FA 4RX1A 4YC7A 2H1OA 1E1QA 4IDPA 4LVUA 4II3A 3IAM1 1LY1A 4BNGA 4KN6A 3MB8A 1BD3A 3EGXA 2QYHA 4RMNA 4RJKA 1E1RA 1KTVA 1ZJJA 3L1UA 4D4IA 1EZ1A 4XYGA 2FN8A 4NOKA 6REQA 3P2MA 5C8YB 2F3PA 1OLOA 2BD0A 3V3TA 1H0SA 5H1YA 1HDOA 1D1TA 1SU6A 1DC5A 1EQUA 1SELA 4YI5A 3MOGA 1MQAA 1GYRA 5DE3A 5AWFC 2GNOA 4Q3OA 3HP1A 1NG1A 2Q2OA 3OZAA 2C9DA 3B5IA 5FD8A 1B6SA 1KI3A 3OIVA 4BBZA 4JJ7A 1G41A 3LPDA 3H6HA 1ACJA 3HB0A 4JB2A 2QRJA 2DKOA 1M6VB 4CCAA 3DFKA 1MC5A 1XNJA 2H18A 4E5UA 2BSQA 3JZIA 1UBJS 1RQGA 4LV5B 1I3KA 4L4XA 5D85A 1C80A 1PV2A 3DQQA 3GEBA 3TEFA 4EHKA 4RTNA 3KKOA 4GMHA 3A4MA 4QVKA 3KQKA 2E7ZA 3C7AA 5CCBA 2CCGA 5M04A 3QQPA 3KSDO 1GNVA 3UT5B 3GEPA 1XZKA 3COYA 3E3NA 1WMDA 4E7OA 1JIQA 3THYB 2FE1A 3ZX4A 3RF7A 2Z5LA 2QMOA 4Y9DA 3RUEA 1G20A 4RULA 2G6BA 4A91A 4XYLA 3ERCA 2F1KA 3BRQA 3EXEB 3EC1A 3CLTC 3QVOA 5HS6A 3AR6A 5DBOA 3TR6A 1UBOS 3VUEA 1AUOA 1CJSA 4L3WA 2HF9A 5LXTA 1G7CA 4Y9SA 2PBLA 1WHTA 5E7MA 1YCDA 3NYWA 1A95A 1AQYA 4LPSA 4OI0A 2OVFA 3PL5A 2GAJA 4AS3A 4XD7D 4E51A 1P5RA 1SU4A 1MHPA 3N9IA 4E7PA 3CWQA 2A1UA 3WLOA 1V5FA 3SR0A 1FUEA 5EXTA 3EHDA 4MTLA 4XYMA 4DYVA 5CR9A 4XCXA 4CM3A 1VCIA 8ADHA 3I3OA 4F5EA 1IN7A 3DZCA 2OEPA 4F4JA 1OXSC 2PUTA 4QEZA 3NHAA 4HNAB 1JG4A 4UAVA 1U2QA 4I3HA 2CVHA 4Q1VA 3VAYA 3VJLA 4YT8A 3LOUA 4XW2A 3ZW9A 3I53A 2BL4A 3ZXXA 3GLRA 3T1VA 1T13A 1V4NA 2C4UA 4CG0A 2PEZA 3N0TA 3G9ZA 1CERA 3GG9A 2OCXA 3MWFA 4OXQA 4C5CA 1XCMA 2A6PA 2I80A 2GHRA 2O48X 4L5CA 1ZONA 1ML4A 2Z9BA 3T4PA 3W2FA 1C1XA 3MJTA 5CLFA 1F8FA 2J6BA 2Z3WA 3EVCA 3HPRA 3NRJA 4W99A 4EZEA 5TE9A 5A3SA 4ER0A 1E62A 1X1DA 2CXNA 4LHZA 4W7IA 3LO8A 1H6AA 3VO9A 1WPGA 2O5RA 3RNOA 2WLSA 3KLBA 3FOBA 2NUAB 4AO7A 1NXQA 4G5SA 1KK1A 3E23A 1RQPA 5E6RB 5JAZA 3FN4A 1J1UA 2O4CA 1CY6A 3I34X 5FOUA 3E9ZA 2AEEA 1LV7A 5CB4F 1R16A 2CJWB 2ILVA 2CJPA 5B1YA 1JT2A 1QMGA 2E48A 1JL3A 3AG5A 1CUBA 2FZ4A 4KXUA 2XUIA 3DZFA 1II8B 4G0VA 1FFDA 4M8IA 4LWOA 3OAAD 3QVUA 1Q7BA 4G5QA 4HXGA 1CUYA 1X6VA 4Q1BA 5ICSA 1T5DX 1MENA 3ETLA 2XSZD 1PYGA 1O4VA 1R8YA 2GEVA 3S70A 2NO7A 3V46A 4UREA 3FYCA 3UAGA 3ZIDA 3G2OA 4DLZA 1JSRA 1NASA 4C30A 5I8WA 2W2QA 3VYUB 3M3HA 1JUDA 1NYLA 5DU2A 2QGZA 1KVUA 4A7PA 4HLUA 4AK9A 1N2ZA 1NTOA 1PJ8A 3LIPA 4WOPA 3HKDB 2O8BB 5A7GA 2R5WA 2NSYA 2VDVE 4RVFA 2M6LA 1TE2A 4OMDA 1L5OA 3OECA 4MWSA 4CG1A 1CHDA 4NZZA 3H11B 4KTTE 4CM1A 4D8TA 1UPTA 2B98A 2PD4A 1GCAA 4W7SA 1KNQA 4DILA 4DR1B 1ZICA 1ILWA 4FINA 1UDBA 4EJFA 2IEZA 4QVIA 4K0RA 1LLQA 1BTOA 3K6JA 4KQCA 4H6XA 4L0DA 4MOWA 4UPVA 1JFSA 2HF7A 1MDBA 1GGHA 5JNLA 5E1DA 5GJVC 1YVUA 2EF0A 2VPYA 4OI2A 1J2EA 1MG5A 3VV3A 2DR0A 5L3VA 3E5RA 3I3SR 1FNCA 1M6YA 4BEBA 1B8OA 4RTQA 1LWOA 2N9UA 2BFEA 4WIAA 3PTLA 3TBFA 3WYNA 3GLTA 3J81A 2QTWB 1KKLA 2IY7A 2QD3A 1YF3A 2RC6A 2JJ8A 1IBLB 2YHIB 2XMDA 2Z2ZA 1ANKA 3DD5A 2BH9A 4HFJA 4BGVA 1SA0A 3WK4A 2V6BA 3ENWA 4O2BB 3THWB 1KOGA 2YFYA 1KY3A 3TSYA 2RHDA 4HLDA 1II9A 2HSGA 3GN2A 3ZY6A 4ZVRA 4YV2A 1PLKA 3IO3A 2I71A 4B2IA 1M8FA 5KOJA 1Y8QB 3AM3A 4FHCA 3AUFA 5JTTA 1SR8A 3IODA 5IEBA 1IB6A 3TOZA 4NL4H 4FLEA 4FW8A 1ZH8A 4U9HS 3T0FA 5C53B 3WOHA 2HNKA 2XB4A 1JAHA 1L2TA 3L05A 3DL4A 1FOEB 3NTVA 5HRAA 3DQPA 2NU8A 1AHHA 1RP7A 5CD1A 2H4FA 1P4RA 4O1HA 1K8ZB 2SCUB 4TUYB 1NSYA 4JC8A 2JBWA 2AQHA 4F3NA 2RHGB 2YBEA 4FB4A 1XD8A 1MC1A 2GBCA 3MGAA 1USVA 5EPOA 5FO1A 3R7SA 3Q5EA 1E4EA 1Y3IA 2R84A 2QLBA 2Q5QA 2F62A 2WJ6A 3A9CA 3NQ41 4QDKA 4K9NA 2Z83A 3ZD7A 5I8ZA 4OCZA 5C80A 3HLTA 2C8JA 4U7TB 1T9CA 2CNWD 2FWNA 2YHBA 3TZBA 2J4CA 2JZNA 5EJ6A 2PUWA 1B00A 3E48A 3OCXA 2FXVA 4JP5A 2IW1A 2I6GA 4H77A 2Y0CA 4IG4A 1HV8A 3Q7TA 3KQSA 4ZMRA 5LA6B 1P29A 1QG6A 2NU7A 3IQFA 4QLAA 3R5KA 4RNCA 3RIEA 3BHNA 3NIGB 5K6RA 1TCUA 3HR4A 2GTIA 2IXAA 4KZPA 5IX8A 3SFVA 4REMA 2BFDB 4CKEA 2YXLA 3P0IA 3FRIA 1OWMA 3HXOA 1KBOA 3B9RA 1KQOA 3OJ0A 1SCKA 3BOSA 3FYSA 3PQEA 4AJPA 1OLXA 2X4IA 5CDSA 1HEUA 3HL0A 3H9QA 4QYSA 2I29A 3ZS9A 3TQOA 5DIFA 3SIPA 4BVEA 2QPTA 1JHRA 3JRWA 4X60A 4YLGA 2BFNA 4OQDA 3VYSB 5ADUS 2CV0A 4DM3A 1SHJA 1ZITA 4NCBA 3EGXB 2PD6A 1QORA 3HCEA 1Z13A 4FBMA 2C4NA 1KI8A 4EY4A 3B2NA 6REQB 5IWAB 4JLWA 3I2GA 1KVQA 1I4TD 1GRCA 3ZNQA 4KRFA 2F48A 3LAWA 2XNDA 1XHEA 3K96A 2ETVA 1U5AA 1U8ZA 4KDRA 3RVMA 1OTHA 1RMTA 5ES3A 4BZPA 1QO7A 1F1JA 4JEHA 2ZEJA 5C1IA 3IKJA 3MJSA 4HDRA 2BKVA 3OKPA 1JILA 3B6EA 3EC7A 2QA5A 3NS7A 5EQFA 3HO8A 1OFHA 3PIIA 1S2LA 2PXXA 1XD9A 4XIIA 3NVKI 1YQ9A 3ETHA 4YIKA 2WNIA 3ZJ4A 1XELA 4DMUB 4ZT5A 1UBTS 3KQPA 4WCDA 2G70A 1OAOA 4B4OA 1QLJA 1RLJA 1XUOA 1GZ6A 1EGQA 1QHGA 3BH0A 3MJCA 4GWKA 4AS2A 4RF2A 3CXUA 3KPJA 2E4WA 2O2GA 4A10A 3MGKA 4K6KA 2R25B 3T54A 1SU7A 1ZM4A 1BJRE 1G20B 4DF3A 3H8VA 4RQAA 5KNDA 3QOXA 4K2HA 2LTAA 2YJ5A 1IQ0A 3BTUA 5KVVA 2YZKA 4K9KA 1GQSA 1JLHA 4Z1OA 4CIWA 1JDVA 1YTLA 1E6MA 3PPYA 4MUYA 2IY8A 1K86A 2FQWA 5LXTB 3QMWA 1FVOA 1RE1A 1WHTB 4MKRA 2R7NA 3E7DA 2GZ1A 3LKVA 4D0NA 4AMZA 1ZHOA 4OUDA 3G59A 2J9FA 1H5QA 1HE4A 4B87A 3VPDA 1QU3A 2HSWA 1RYDA 1WL8A 4PXSA 1T2AA 4GOLD 4ZQCB 1MZVA 1W2GA 1XP5A 5HK8A 2WYUA 2A1UB 4JEIA 3V5NA 3GN1A 2FDXA 4PIVA 4GX2A 2X9GA 2JCSA 1E5QA 2VT6A 2OK8A 3VX3A 4GD3Q 4CDRA 1N0HA 3SHOA 2MWMA 3PZRA 3UJBA 3E53A 3NAQA 3W7AA 3JVEA 2AN4A 3KU4A 2B2XA 3ZV3A 4NCKA 5D86A 1W0JA 1TA9A 2EFHB 3QEMA 1BG6A 3NC4A 3RC9A 1ZGGA 3TECE 4A27A 4C43A 4RHCA 1C1XB 3KOZA 4JLVA 4K3VA 5F1OA 5FBVB 2NSJA 3S1AA 3U4GA 3PEUA 1GGMA 5I5EA 3UPTA 1TEVA 2A9OA 2HJWA 4D4LA 1VCMA 1Z4OA 5IK2A 2BDEA 3LA8A 1J9ZA 2W6CX 2XTZA 2IU4A 4F11A 4Q3KA 4BU1A 1ISIA 1GCOA 2IP1A 1BZYA 4GSYA 1KOFA 1RYMA 3BC1A 2CDBA 3JR3A 3U31A 2VYFA 1ZRMA 2Z1DA 3HCBA 2CYCA 4X1YA 1R0RE 1JIJA 3P0FA 3WJ2A 5KNDH 1HDEA 4JKIA 2HCFA 3G2QA 4EKYA 1I14A 3T9EA 1UODA 3P97A 4CRWB 4DUZB 2D0IA 1EESA 1USKA 5CK4A 1K2VN 1E2UA 1NOKA 2O20A 4BVKA 2FW0A 4IHJB 2OLKA 4HDOB 3W90A 4HN2A 1L6IA 3CRQA 2F6RA 1L0BA 3F5DA 3WYBA 3K5PA 4G81A 2DY0A 4B33A 5F23A 3GCZA 5F52A 1JBEA 4LJ4A 5DXFA 1VJDA 2YFQA 4KOEC 1KR2A 1KBQA 3RRNA 2LW7A 5C4GB 1S7GA 1C4WA 5IDVA 2JIBA 3TLYA 5FWYA 3CX8A 3G2IA 4KDFA 1TGVA 1FXUA 4KHPB 5ALMA 3AIOA 3B1VA 3FZYA 4H4CA 4MQLA 2O57A 4GR5A 1GY8A 2EFDB 2GB4A 2QLJA 1TZJA 4H6WA 4WKGA 5FOVA 4V3CA 2QTVA 3GIDA 3DCJA 2OR3A 4E4TA 4WXHA 1KRWA 5JROA 4IQ4A 1HLGA 4CTJA 5LLTA 3OM0A 5IC5A 4PC2A 5A9TA 4NE7A 4C04A 3BB1A 1JHMA 1XFAA 4WGGA 5DM2A 3LPAA 1JU3A 1ZH0A 1Y33E 5B1DA 5JAUA 2JG3A 2QMUA 3TEMA 4YUWA 3PFKA 4IHKA 4KREA 5KCZA 1ZX1A 1RJFA 5MFZA 4CDMA 2PV0A 5I7VA 5TNXA 3MOIA 3GJ8A 4FBLA 2ECPA 1RPZA 1W34A 4Q00A 3WZLA 2HHCA 2O0LA 3QKUA 1J21A 2CK3D 5DGTA 2VT2A 3EW7A 3EQ7A 3KBOA 1RFGE 4NBSA 4UCFA 5ALNA 1OBHA 2I6QA 5I48A 5T8KA 3SSNA 2BFEB 3AJDA 2BI8A 1A5SB 1AV7A 1YKGA 2Q5OA 4M37A 3P9KA 4PN7A 4YWHA 5LQAA 2ZPAA 3U2QA 5LXTF 1RM0A 1VPDA 4M8KA 1LTHR 4PZCA 2BTEA 1ULBA 5FPHA 3W4KA 4TL7A 3GFQA 3OLWA 1SA0B 5H9VA 1Q0LA 4EHIA 3D8HA 4DADA 1QFZA 4R0VA 4RHUA 5JY6A 4R0MA 3AL3A 5AI4A 3D9QX 1JFFA 3B78A 3HA7A 3MCUA 4R9VA 2RGUA 3A04A 5IMBA 3GRFA 2EGUA 3HNPA 3OZBA 3PT9A 4ETWA 5CA0F 5JYEA 5KOJB 1PJZA 1IZ7A 1DRWA 1ZIXA 1TQ8A 4KQJA 3S3TA 1N33B 1R8SA 5L95A 3JQEA 4GAEA 2ZIEA 3G9UA 4L57A 4G4GA 4U2FA 821PA 4WCFA 2BF4A 1WAMA 1ZESA 4JLKA 1J0AA 2NU8B 4UPDA 1T5LA 3C6YA 3D1VA 3K0SA 5AJVB 3DXZA 3JYQA 4LZWA 4LVOA 1GQOA 1RLTA 3ND5A 3UB2A 1XZDA 1E4EB 4IH9A 3EY4A 4PS1A 1GJRA 3SYLA 4ZDIA 3UW1A 3OE1A 3QU5A 3AB7A 3S0JA 4YJGA 3WA7A 1YJAA 2J9RA 1WQ4A 1YS1X 4QLOA 2WZQA 4KNYA 4Q1EA 1ZM9A 2PL1A 2QL5A 4K7JA 2YASA 4RE5A 5CG1A 2FSVA 4ZJUA 1K6XA 5BN3A 4KQ1A 1H4QA 2PLWA 4PPNA 1FJHA 4JYAB 3HUEA 2HSZA 4B76A 2VLBA 3JQDA 3COWA 1OBCA 3RFXA 1C3OA 3CKYA 3TZKA 2NU7B 2B37A 1H5UA 4Q9NA 3IP1A 2Q99A 4CKEB 4INJA 1K6IA 1AG9A 3MWDA 5AHOA 4LGVA 1Q7TA 3V3KA 2XAUA 4XKJA 2Y05A 1HG0A 1OLXB 1T6YA 2GN2A 1RLUA 1IDOA 4RSRA 2FZ5A 1EZZA 1E2DA 3T1NA 2ZXUA 2DBVO 4HLNA 5EKSA 4JJGA 4HAIA 3AXTA 4TYMA 4I1OA 3GVHA 1EFKA 1J8FA 3Q6MA 1YZNA 3N59A 2CC2A 1PNOA 3EDRA 1O6GA 1I24A 3L41A 4KRXA 3KUDA 4ZDWA 3OCVA 2CLMB 3R9IA 4HEHA 3WNDA 4MEJA 4ES6A 1TADA 2CEKA 4I36A 2WHQA 4Y2YA 4F93B 2QRMA 2WICA 4DMKA 2V1UA 1NKTA 3QPBA 1EX1A 2P1DA 1SRRA 3DTTA 1J42A 2FLKA 1NURA 1ZM2A 1ODKA 1T8RA 4R6WA 5HKLA 3TMAA 3MTEA 3WYGA 5JAPA 1D0VA 2PD3A 3D02A 4KNWA 1NAIA 1DU4A 3DZDA 4HDRB 4MO2A 5EINA 2HCRA 5SYAA 3OMLA 4HAOA 2ST1A 3MT8A 3PUHA 1E7WA 3LW8A 2JNWA 4HBGA 4UQOA 3ANMA 5LDGA 2CV2A 221PA 3QNUA 3SXUA 2EYQA 4RGVA 5KC8A 1N77A 2HWYA 1OW3B 5FH9A 2F3RA 5I7AA 4CM4A 4YQFA 1O7JA 5MGBA 1VI2A 1UWCA 1Q77A 2F17A 3GLGE 1GZ4A 3H9CA 2AI1A 3L7CA 4M89A 4P83A 5E4FA 2VKQA 3STUA 3WY9A 1RWKA 8AT1A 3GJQA 4IGFA 1ORTA 5CGZA 3NJ8A 2XOXA 1JHYA 5LIPA 1KI2A 5ELXA 3BT7A 3L79A 1A50B 1NVAA 1PFVA 2O5VA 3HCDA 2IYEA 4ND4A 4A0HA 3C3CA 4WK0B 4C20A 4J16C 4OUDB 1M5RA 2J9FB 1B73A 3FA2A 1PSDA 4X8OA 4CV3A 2GZ3A 2WM8A 4IKEA 2X0EA 4UBLA 4YAIA 4DJ5X 3GBVA 1KU6A 1VIVA 1ZKDA 5LP6A 4MVJD 2I65A 1JSLA 3UJ7A