4DSUA

Small-molecule ligands bind to a distinct pocket in ras and inhibit sos-mediated nucleotide exchange activity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
180
structure length
177
Chain Sequence
STEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas, isoform 2B
total genus 67
structure length 177
sequence length 180
ec nomenclature ec 3.6.-.-:
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dsuA00
2ORVA 2HLDD 3U6BA 1FPMA 2DWQA 3TW4A 1U81A 1S8FA 1X86B 2VP0A 4KI0A 2ZRIA 2FPLA 3GLFE 4C30A 4ERNA 3U4QA 5FPTA 2RGBA 1PUIA 1LV7A 3BH6A 4HUQB 4U5XA 1XEWX 5SZJA 1U9IC 4FI3C 5BXQC 2CHGA 4E03A 1XCMA 3SQXA 3NXSA 4DDTA 1O87A 621PA 4F7WA 3C15C 2ZRLA 4BE7B 3QG1A 2AFHE 2IC5A 2AWNA 1GP2A 4CEHB 4W9MC 3K0SA 2KE5A 1YZKA 4XVRA 1U94A 3WBJA 1TUIA 5FOXA 2IF0A 1G7SA 2GCOA 2FMXA 2QUZA 1AK2A 4NONA 3HYTA 1KNQA 1RZ3A 4F4JA 2FE4A 3TQCA 2ZRFA 4IJMA 3QSYA 2C95A 1ZYUA 3EPLA 3ADCA 3NHAA 3QKTA 5AJWA 1Z08A 1W44A 2IYZA 1P2SA 3RWMB 1R0WA 1G3MA 1VHLA 4BEJA 4B47A 2JJ2D 4EQ6B 3NC1C 4CT5A 1KI6A 3EIEA 4QNMA 1NVXQ 1PJRA 1XMJA 2UVQA 3ADBA 3AM1A 1SULA 1R5NA 4BLTA 1E1RA 4QOSA 3CX6A 1YR9A 4UJ5A 1D9XA 3TGPA 1V43A 4Q1AA 2FSGA 2NMVA 4HYYA 4L9SA 1US8B 1FFHA 4M1TA 4IDHA 3OZXA 1SXJE 1YZNA 1J70A 4XSHA 3CPHA 3LRPA 4Z1MA 5DIFA 4GPTA 4EPTA 5L3QB 3DMDA 2J3EA 4TZ6A 2Q9AA 3LO5A 3PJRA 1JR3D 4IFBA 4JT4A 2WIBA 3OE7D 2ZSAA 2R6AA 2IYXA 2BV3A 2H18A 4OK3A 4WVFA 1OFIA 3T1QA 5FUVA 1XMSA 3SBDA 3VR6A 1MRSA 3KQLA 2IYYA 1JALA 1ELOA 3AVOA 3RS5A 3EPJA 3LWNA 1T9HA 2EQBA 2BC9A 3LNCA 2D7CA 3W6NA 1XD9A 4N0DA 5JRJA 4C4PA 3PR1A 1NP6A 2J59A 4S35A 2NZJA 1CRPA 1E2EA 2EYUA 3BWDD 4HUQA 2IXGA 2C96A 5BN5A 1KSJA 5DI3B 1DAMA 3QNUA 3VR5A 1SZPA 4YXWD 1G7RA 5FR2A 3ZJYA 4Q02A 2C9CA 2VRWA 4Q03A 2A5YB 4LY6A 4MITA 3VX3A 3KKOA 3QBVA 4MYUA 4B3BA 2XJ4A 4NU0A 4DZZA 1CP2A 2GWHA 3KXIA 3GFOA 1FMJA 2GNOA 4JMPA 5L3SA 1QHNA 5FL3A 1PUJA 4BLQA 4BGDA 2XX3A 5CJPA 1XF9A 1DO2A 5CB8A 4BECA 3PEWA 2PCJA 1TQDA 3GCGA 3IQXA 2GEUA 3K09A 4TQ9A 1K5DA 3OIUA 3DM9B 3HWSA 4CEIA 3L2OB 1WXQA 3FKQA 5J4LA 3QKRA 5TB5A 2ZVQX 4A82A 3B85A 3FMPB 5KNCA 2BBSA 3MAAC 2IUSA 1YU9A 1SKYE 3UANA 4GBMA 3IIKA 2JLYA 5EUQB 2QT0A 4QJ3A 2CLDX 2H92A 1MV5A 1XNJA 4PC7A 3I5XA 1E9FA 1G6HA 2OBNA 4LJYA 3TLXA 2O8FB 3D3QA 1G291 1MRNA 1GILA 1E94E 2KWIA 2CDNA 4DUGA 1UKYA 3U7FB 3FE2A 1FTNA 1TU3A 2EFHB 4URWR 1KO8A 1T3SA 5DHFA 4YXWA 1E4VA 4JBYA 4AYWA 1OIXA 2XTNA 4NTZA 4QHTA 2WSSA 4PC1A 4A0HA 1YR8A 2MSDB 2OAQ1 2QMUA 4BUJA 3KQNA 2QBYA 4TLDA 3GJ4A 1D2EA 3MWKA 2XXAA 1L4YA 2JLQA 2ASEA 2JLRA 2TMKA 3QJYA 2Q0HA 2GJ9A 1IXSB 1ZUNB 3ADDA 2VO1A 1R0ZA 2JLXA 1EFHA 5CIWA 5L8VA 4GZLA 1DO0A 1XX6A 2DWOA 3OIWA 3ZGXA 1HV8A 2J0VA 5L3VA 3H86A 1GUAA 5KU1A 5AR1A 2KBEA 3ZVNA 1P4SA 4PZLA 1IN6A 4GMXA 2E87A 3DEFA 4I1OA 4L4UA 4JL6A 4A92A 4TL7A 5EP3A 4AK9A 4TWZA 4DRZA 4DEXA 4XWKA 3LAWA 4QM7A 1UAAA 4C2TA 4PANA 2A5JA 2Z4RA 3U3JA 1QHSA 1YRAA 2PBRA 1UM8A 2QGZA 2PJZA 5JJLA 2H17A 2KJQA 2F1JA 1FQJA 1FUKA 3LW7A 4BFXA 3A1WA 2RH5A 1P7CA 4LPKA 4C7OB 1J8MF 4HDQB 2I3BA 3A36A 2ZQ5A 1NRJB 2ZE8A 1U0JA 5AUNB 3GJ6A 1Z28A 2OG2A 1ZNZA 3PUVA 2BBWA 1FNNA 1ZINA 121PA 4PQYA 3G5UA 4V0NA 3K09C 3T1OA 2ZJ2A 4MGYR 3U61B 1W0KD 2JLVA 4A1FA 5FBRB 2WPDD 2V55B 2ZYWX 1W0JD 4XIGS 2YYZA 1VECA 3HR8A 5LD2B 4A2WA 5BWMA 1GVNB 1RVDA 4XTRA 821PA 3EZFA 1KSFX 3I73A 4RD4A 2R6FA 2VHTA 1E9RA 1UADA 2V6IA 3RS0A 4DLXA 2IT1A 1E2DA 2CCJA 5C46F 3QVUA 1KKLA 3CRVA 4M4SA 2RGNC 1E3MA 1BYUA 1M7BA 2FX3A 1ZJ6A 2A3RA 3LLMA 1JECA 4BFTA 2XZOA 5KSZA 4YMWA 2HJVA 2QSZA 3NEJA 3ZH9B 4DDUA 2QBYB 4HLUA 4QHSA 2B6HA 4QGFA 2F55A 1GL9B 4XVQA 2EVWX 4DIDA 2GEDA 5KTYA 2J87A 2CHVA 3TUZC 2BOVA 2HF9A 2ZROA 1G20E 2HYDA 3QE0A 4QRHA 4XH9B 3ETLA 3O8RA 1CKEA 2NO6A 5FL7D 1ZU4A 2QT1A 4TMWA 1IBRA 1GRQA 3GLHB 3VR3A 4A8JC 3O8DA 1YVDA 1AS2A 4G5QA 4F4IA 1E32A 3AH8A 2P3SA 1HH4A 1M7GA 4E07A 2GAAA 3UPUA 1EWRA 1OT3A 3SJCA 5F98A 4NYJR 2GK7A 3H2YA 5CJ2A 3P20A 1G21E 4X8OA 1Q57A 3NWJA 2X2EA 3DDCA 4GOJA 3FMIA 4Q18A 4PZYA 2BJVA 4TMVA 1IJFA 2OEPA 2NO0A 4B33A 4R2IA 4B44A 3CNLA 1VDZA 4LC0A 1S96A 1QRAA 3U44A 3MSXA 5IHPA 3SHWA 3A1VA 2CE2X 2J1LA 2ZAOA 1UKEA 1GKUB 1NN1A 4E22A 2O8CA 1RKBA 4TL6A 4XJXA 5LD2C 1PV4A 4NKRA 1NLZA 2HT1A 4TMTA 3W6PA 2ZE6A 3GEIA 4EFMA 5H8WA 4ITRC 4B2IA 3U2QA 4XD7A 2AR7A 5FTLA 2O8CB 3B78A 2P6UA 4RCZA 2BEKA 4QL3A 4HZUA 1R5OA 4PC2A 4EDHA 5DN6D 4P33A 5K8UA 2CJWA 4WZBE 3IEUA 4PZZA 2OFWA 4B3GA 3R9WA 4J0QA 4GZMA 2XTMA 2YWEA 4G5GA 4PO1A 5FPYA 4TLAA 4BEBA 2JJ2A 4DLWA 4A2QA 3CRQA 3I1FA 1XTSA 4JLOA 4LYHA 2XZPA 3AP2A 2ZRJA 4Q7LA 2D3WA 1XFAA 2R9VA 2QAGA 1OPXA 5FR1A 4CIDA 3QPWA 4OL0A 1NJGA 1Q12A 4IRUB 1NY6A 3FHTA 3U7EB 1OIVA 3AVPA 3T06B 2RHDA 1TX4B 1NF3A 2QP9X 4URUR 1LS1A 4ILEA 1DAEA 1DOAA 5GVSA 1KI2A 2IYSA 2WV9A 1C4OA 5L3QA 4LJ9A 4RD3A 3GLGE 1ZUHA 2AXPA 1AS0A 2QU8A 3KQKA 2GXAA 4N3NA 4YDHB 5B64A 3GPLA 1EFTA 4NYMR 3DHWC 4V0KA 3W5JA 3BC1A 3RS2A 3W5IA 2AKAB 3F8TA 2Z83A 2FPKA 3WYFA 3C41J 1W2HA 1KSHA 2O0HA 4DEYA 3KQUA 4MRNA 4JLJA 5J4KA 4A6PA 2CHQA 1NVVQ 1ZD8A 1CULC 4PO8A 5K8TA 5HPYB 1S3SA 1JR3A 3JVUA 2WJGA 5JWHA 2P5TB 1OKKA 3THWB 3MWJA 4YMUA 1II0A 1PLKA 2JJ8A 2BKUA 3PUWA 2XNDA 4CEHA 1BS1A 3KKNA 1N6NA 1XXHA 1KDOA 3CB4A 3RWOA 4C0JA 2REXB 2XITA 1GITA 1UBGA 1UFQA 1HT1E 4CZ2A 2YKGA 3KUCA 3T34A 3CW2A 3SC3A 1ZNXA 1QG2A 4G0NA 1XXHB 4OQLA 1Z2AA 1NMXA 1W4CA 2IA5A 2QMHA 3KXKA 4XTCS 4Q9IA 1OSNA 1CXZA 2NO1A 1C1YA 1P2UA 5H68A 4Q47A 3EXAA 3M0EA 1E0AA 3BB4A 4I81A 4R2HA 1E2LA 1GL7A 1LVGA 2YOHA 3GMTA 1AGPA 2YOGA 2WTUA 1G4UR 3ASZA 1XD2B 3DMNA 3QKSB 4JLMA 5CIQA 3A6PC 2IF2A 1G19A 4DT1B 4D4JA 2GAOA 2RGEA 3AVUA 1ZD9A 1Q0UA 2ZRDA 4HATA 4TZ0A 3W3AA 4Q5IA 1NBMD 4MH0R 3TVTA 4RZ3A 3ECCA 3IPYA 4JL5A 3EARA 2KB0A 3B1YA 1MKYA 2CL6X 2UZ3A 5JJIA 1TF7A 3CNOA 3BFVA 3LBNA 4KODA 1A5TA 2WPDA 4YMSA 3RABA 5J47A 2IYUA 1ZRHA 1MH1A 3BRWD 3I62A 2BCGY 3A1UA 1K8RA 2GCNA 1CJTC 1F2TA 1T3HA 1HEIA 2FSHA 2GBLC 2QTHA 2GHIA 3X1WA 2RGDA 3QKSA 4OK5A 1E0KA 3U6KA 2VH5R 4DUGD 4OJQA 3DPUA 4ZCMA 1E9EA 1MABB 3VKWA 4A15A 2QY9A 3MWLA 1JBKA 1O3YA 1UBCA 3ND9A 2Z6VA 2AK2A 3ADKA 5EJEA 4F92B 5LB2A 4YMTA 1G3IA 3KJGA 2EFCB 3ASYA 4DVGA 4IVRA 1NLYA 1ESNA 2OT3B 3HJNA 2JLSA 5FI0B 3AKDA 3RANA 2YC2C 3CF0A 1G5RA 4I1SA 1FX0B 5EXSA 4ARZA 5ELXA 2ZUCA 1RRPA 4M9SA 1VCMA 2Q6TA 1KO1A 3K0AA 3PENA 4N0EA 5EXXA 1GTVA 1R8QA 4M0LA 5TY0A 3RS4A 5KUTA 4QHYA 4JLAA 3VTKA 4TQAA 4DHEA 1DEKA 2OBMA 3OESA 1KOFA 4EJSB 2FZ4A 2X77A 4IFEA 3FMOB 2DB3A 3L0SA 4PPGA 3CF2A 4IDOA 3K0AB 3QG5A 2NO7A 4JLBA 4Q9KA 4DSOA 2BWJA 1JPJA 1FZQA 1JPNA 2VLIA 1N5LA 3R8CA 1OB2A 3QEJA 5DYGA 4IOJA 4B75A 4II7A 1IXZA 4MUBA 1XZQA 3MCAA 3IIJA 3Q7PA 3CWQA 3D6TB 2JDIA 4TTRA 5FOSA 3IHWA 1US8A 2D2FA 1VTKA 1U99A 1D5CA 2VEDA 3TJZA 2MSCB 4NE2A 2H8KA 4RVCA 3RYTC 1G16A 1W0JA 3CRRA 2EFEB 4P4SA 3A4MA 4ARZB 4HSEA 1XEFA 4M9XA 5EXPA 2QQEA 5JWOA 2FH5B 1X8LA 5HR5A 4WW0A 4PPFA 3AKYA 4FCVA 1OE0A 2EW1A 4KBGA 4YQFA 5JHGB 4POAA 4LYFA 4DJTA 3WMGA 2LCFA 4OHWA 1G6OA 2RCNA 4DXAA 3VFDA 4U7DA 1SVIA 2HEIA 3KTAA 3Q72A 1KO5A 2WAXA 4I99A 3HDTA 2D74A 2QTFA 4BFSA 2JEOA 3OF5A 1R0XA 2FSIA 1M74A 1N0WA 2CK3D 3AF0A 5CYPA 1YE8A 3B1ZA 4MDFA 3HR7A 4US1R 1J2JA 2O8FA 4OYHA 2UKDA 1C9KA 1XEXA 3IUYA 4LJ7A 3CPJB 4L16A 1TEVA 2ZRHA 5FOUA 1E1QA 3AVWA 2WWGA 1E1RD 1NL3A 1VCNA 3WYAA 4RFVA 5KSPA 1MO3A 4ON9A 4PHFA 4AKGA 3B82A 2NTYC 2FFBA 4YONB 4RFSB 1E79D 4H9GA 4IOLA 3SFVA 4LHWA 2JAQA 1LFDB 4D25A 2VSXA 2A78A 4IDQA 1U8YA 2IHBA 1U0HC 5B57C 1NKTA 4B48A 4IOKA 2DHRA 3VHLB 3VNUA 2ZTSA 1ZUIA 4FINA 4JYCA 4HDOB 2ZI3A 3D8BA 2F1RA 3X1DA 1U8AA 2G0TA 4DC9A 3IEVA 2E1RA 1H8ED 4B43A 2ZYTX 5DN6A 1G41A 5TVKA 4BWYA 1G7TA 5FPHA 4D4KA 2AFIE 2WOJA 1WP9A 3AUXA 3W9YA 2QN6A 5GJBA 1BO6A 4BZQA 1G7CA 2VHQA 3S1AA 3GEEA 3CONA 2X1VA 4LJ4A 4PAOA 1NMZA 1N0VC 1G17A 1UBEA 5EQTA 1EX6A 4C0HA 3I4LA 2MSEB 1KI4A 1ZM2A 1R0YA 2V1XA 4OJKA 1P2VA 2Q3FA 4DWJA 5G53C 4D0GA 2WKPA 4DLSA 1I4DD 2NPFA 3WYGA 4HB2A 2F43A 2Q3HA 1X8KA 1G8PA 2W0MA 2H16A 3ZZTA 4LYAA 4PQRA 4B6EA 1GRRA 1YKSA 2K5UA 4Q1DA 2CXXA 5SZIA 3VR4A 4GI7A 2OFOA 3GFTA 1Z3IX 1NI3A 2VQSA 1CR0A 4Q1FA 2OCPA 4AC9A 1G3RA 1N5IA 3THOA 1OFTA 2AXNA 4HLQB 2OZEA 1AZSC 5B2ZA 3R8FA 8OHMA 1S4QA 2QQ0A 3EWSA 3AF3A 1T8TA 4BFYA 2RHMA 2I1QA 3DZDA 4NBSA 3IGFA 3QEOA 2QPTA 3NHBA 3FKSD 4KSCA 1VCIA 5JI2E 1FTSA 4LJ8A 2F9MA 1IY0A 3CPEA 2RGAA 4V0OA 1II8B 4DCUA 2NIPA 2PLRA 4W5WA 1I2DA 2O8DA 2X2FA 1SXJA 3I5YA 1R6BX 2FF7A 2ZRAA 4FCWA 4KYUA 5BN4A 5GJCA 2WWYA 4Q4HB 4Z8XA 2PMDA 4JLVA 2P65A 2MMGA 4OQNA 1M6NA 3EC1A 4PAQA 1OB5A 3NEYA 4FCTA 3LX8A 2P67A 1IY2A 3AV0B 2R6CA 3EZ2A 4ZKDA 1AZTA 1E2MA 1JNYA 3CIOA 1NBME 4HAWA 2G0NA 1CU1A 4LHZA 3GLFB 2O0JA 2FGJA 1BKDR 4Q21A 4AD8A 3R9IA 1A82A 4ACAA 1KJWA 4EKDA 1JJ7A 2XZLA 5JS8A 5HTKA 3AVQA 1Z6AA 4C7OA 3C4JA 1GKYA 2HYIC 4Q48A 4AYTA 3OIYA 5FI1B 4MKFA 2DFNA 2VA8A 4E09A 1YZQA 3LFUA 1KZGB 3HU3A 1DG1G 1T6NA 3P4XA 3PCRB 1XD2A 1EFRD 3MWYW 1MR3F 2W58A 4GDFA 4MRSA 4Q00A 1B0UA 1P75A 3DOEA 1XTKA 4A0GA 1E2IA 5TARA 4Y0AA 2B92A 5DGXA 4HAXA 1G8HA 4EJSC 2ZU6A 5FUXA 1V5WA 2D7DA 3CX7A 2ATVA 3TSZA 4BLOA 3MMPA 1TU4A 3GLFA 1I2MA 1NMYA 2CJWB 2OFXA 3LXRA 4UXJA 4EPRA 4PHHA 4MRRA 5HKKD 3SNHA 2OLJA 1P62B 4B32A 2J7KA 4TMKA 2GZDA 3T5GA 2QMEA 3U5ZB 1PZNA 1E96A 1KO4A 1J7KA 1Z0IA 4V0MA 3PEYA 3WHLA 1WMSA 1E9CA 4RY2A 1P3JA 4GT1A 1Q1ZA 3BK7A 3EC2A 4JVNA 4PHGA 4NCHA 1OLOA 1J90A 2IEYA 2ZRMA 3B8HA 5KNBA 3BH0A 4B76A 2REBA 3MUFA 3ZS8A 5DNYB 1VG9B 2VYFA 5C2JB 1PLJA 2IWRA 2FU5C 3NBZC 5IT5A 1EFUA 2GCOB 4OQMA 3GP8A 1HT2E 3W6OA 2QRNA 2QORA 4IW3B 4OHZA 3A8TA 1RIFA 2ANCA 2VHJA 5E7IA 1F5NA 2FG5A 5FUWA 3GLHE 6Q21A 5L3SB 2ZI5A 1E2QA 2NZ8A 4KCGA 1W36D 3SFZA 2QL6A 2J0QA 5JHHB 4O2LA 1Z6XA 4HZUB 2AX4A 5J40A 3VAAA 3GLGB 1CS4C 3SZRA 3GJ5A 2GJAA 2FA9A 1CBUA 3CNNA 2HUPA 2WMNB 4MKGA 5FBQB 1GNPA 4K8OA 3U4QB 1SXJC 1AGRA 1ZM7A 2QNRA 3QKRB 1G18A 3C8UA 3QXXA 4GMDA 5IF9A 4V0LA 1KJZA 1W5TA 4L8GA 2DBYA 3QF4B 3IDQA 1W36B 4KSBA 3P1JA 5L3RA 4LHXA 2PX3A 2D06A 1SVSA 3TUJC 3AQ4A 1W2GA 1G4AE 4IDNA 1KAOA 1LY1A 2V7QD 3H84A 4JBWA 4KAXA 2N1BA 1FOEB 2XAUA 2GESA 4GP6A 4MYTA 4NPHA 3BERA 4KYIB 4NH0A 2BEJA 1GAJA 4X8MA 3THYA 3MJHA 3U3OA 3PITA 1UF9A 2F3RA 2QI9C 1OH6A 4CW7A 3TSOA 2ECKA 2ZJYA 4HB4A 4ZKEA 1CR4A 2J0UB 3NVAA 5BW8A 1HE1C 3AGQA 4ASUA 1X6VA 4PQFA 1IQPA 4JT2A 2W83A 2I1VB 4RZXA 3VHXA 4F93B 4DLTA 4PPQA 1R2QA 5JSZA 5CLQA 1XWIA 1AM4D 4TYQA 3SHFA 3W8RA 4XVUA 2OSBA 2WKRA 4OHVA 2B8WA 3I8SA 4HZIA 1N6IA 1MOZA 4GSYA 5TV2A 2I4IA 1II9A 1XTRA 4RZUA 2OE2A 3KUDA 1S9HA 1QVRA 3BD9A 1DAIA 3Q85A 1DELA 1XPOA 2PEYA 3DM5A 4Q9LA 4AIIA 5A5GA 2V3CC 2FFAA 4C3ZA 4Z51A 3DZ8A 1SHKA 5KO2A 4CF7A 2YNMA 4P3YA 4A4DA 3GQBA 3P32A 4PC6A 5HZHA 5P21A 2P0EA 4MGIR 4BQSA 4Q7KA 2BM0A 3IO5A 5FOVA 4NCIA 3CUEF 4KFTA 4DLVA 2PX0A 3X1ZA 2QEQA 2GXQA 3SN6A 2WJYA 3WRYC 1TUEA 1HE8B 3AP1A 1PVOA 5HCNA 2A9KA 5AJZA 2X8AA 4WBSA 4A6XA 4A9AA 2A5GA 2CK3A 5KSYA 2GRJA 1I4LD 3IHLA 2KSQA 3K0EA 5BYKA 1DE0A 1JQLB 1Z2CA 2BM1A 1VCOA 3T15A 4B35A 1DAHA 2ZR7A 3LV8A 5CDFE 2IX3A 2VBCA 1HY3A 2DYKA 4NCKA 4AI6A 2GEVA 1OHHD 4UXHA 1NNEA 2LKDA 3J81k 5ANRB 4BFZA 1Z0JA 2ODWA 3SYNA 2PZEA 2NPIA 2ODBA 2OM2A 4FXPA 1CJUC 3OFND 4FIDA 2XOKA 1T4GA 3M1IA 4YDSA 4PSVA 4RKEA 4GFDA 1M34E 4JVMA 2IYQA 2HF8A 5H1YA 2EFGA 2WAYA 4KU4A 5KOYA 5HZKA 1WCV1 4AG5A 1S9DA 3QQ5A 3KQHA 1KIMA 3C7KA 1WQ1R 1W7AA 2BJWA 3B1XA 3R20A 3Q3JB 2AD5A 3RVBA 3K53A 1E2PA 2F7SA 1FUUA 4WZAE 4TYPA 1W1WA 3B9PA 2ZRNA 1L2TA 3BJIC 1S1MA 4A0FA 4DB2A 2HXYA 2IUTA 3M4YA 4TTPA 4BZPA 3B9QA 4FD2A 4EFLA 4HLDA 3PV0A 4D0NA 5CM8B 4C0AC 4MRVA 2IW3A 4Q4AB 2J7PD 4OQFA 1OJLA 1KY3A 5IK2A 5FBVB 4N1AA 2WJJA 1VHTA 5E7MA 2WWFA 4MQBA 4HLCA 5JECA 4Q7JB 2G9NA 4EAQA 2PLFA 1XTQA 2ZS9A 1U0LA 3KKMA 2W2VA 1WF3A 1GL6A 5LPNA 1OXVA 5IK2D 2O0KA 2VSFA 2YV5A 3O47A 4PR0A 3U3KA 1QHHA 4KVAA 5F9HA 1YZLA 1G8YA 1QDEA 4PX9A 2AD1A 1P2TA 3LXXA 3AF2A 2QAGC 3KKPA 4PO9A 2QRZA 2ZRKA 4DSTA 2ZETA 4PTLA 3EPKA 2WWIA 1W46A 1W5SA 1Z22A 3SU8A 5G3YA 2P6RA 2V6JA 3K9GA 4Q9JA 3U60B 1AJEA 3DO6A 4FMDF 1KK1A 1T0JB 2A7QA 2CVFA 4UXIA 5FBLB 3W34A 2CVHA 4TLBA 4C2UA 1E69A 1D2NA 1W47A 3PUYA 4X8HA 4C0QC 2JJ1A 2RGXA 2O8EB 3SJZA 4JLDA 4GP7A 1D6JA 3IBGA 2G3YA 1QG4A 3K9HA 3B7GA 4NYIR 5FOWA 4B6FA 1Z0DA 1ZU5A 4URVR 4O2RA 4OK6A 2PEZA 3HPRA 4JVLA 2IS4A 2BBTA 1D8TA 2YWFA 2XB2A 4QFMA 2P2LA 4ZPXA 1U2RA 4CYMA 4IEEA 3T61A 3VQTA 2R8RA 1AN0A 4I4LA 5JCPA 4TLCA 2C99A 4JKYA 4IXNA 5TDHA 1UEIA 2VP4A 2VIIA 2CLSA 2F6RA 4AURA 2J46A 2WSSD 4HB0A 4TL8A 3D7MA 2MMCA 4RCYA 3D31A 3ZQJA 2PZGA 2VPPA 1KK2A 3CH5A 4D4LA 1E2HA 3GLHA 3NBXX 3Q5EA 2J41A 2QE7A 2QSYA 4D82A 1Q1EA 3K0CC 4OKSA 1EGAA 4LC1A 1E0SA 4LJ6A 1XPUA 5FTNA 5JZVA 4A8JA 4TYWA 1NN5A 2IBMA 1KDTA 3ICQB 2FN4A 1CRQA 4FW9A 4PPNA 1G1MA 1MO6A 1GIAA 2FPMA 2ZSFA 4C0KA 3KFXA 1XB2A 1Z6GA 2G1JA 3LQQA 4R9UC 3QOFA 5FOTA 3IIMA 4A8JB 3NBYC 4KFRA 2WJVA 3CBQA 4Q4HA 4D2IA 2XNDD 3N2IA 1IN4A 3L0IB 4G5SA 1JAHA 2OO7A 1KI1A 1EXMA 2ZYVX 2ERYA 4UNNA 3T1TA 5EE1A 2Z0MA 3GJ7A 1OFHA 3CR8A 3TQFA 3L43A 2ZXUA 3CZPA 3NKVA 2HDNB 4RJLA 5JLJA 1AS3A 2H1LA 4GOXA 3KDSE 3K0FB 5TMPA 1UDXA 3IPXA 2JGNA 2CBZA 4DCSA 2OBLA 4NP6A 4K46A 1IM2A 4FMBB 4LZZA 1F48A 4QBHA 1AA9A 5BN3A 4HAVA 3O8CA 3AVTA 3UG6A 2JIZA 4ZCLA 5F9FA 1OW3B 2R2AA 2RAPA 5D3QA 2QM7A 4BRUA 4EPYA 2QP3A 4D80A 3WNBA 2D4HA 1N6PA 3TR0A 3N5CA 3UMRA 1Z8FA 4KLNA 1EG7A 2C5LA 3F5FA 3HU2A 2GVZC 4V02A 4TYYA 1CEEA 1EK0A 421PA 4O25A 4RZ2A 3TKLA 4ASUD 2XTZA 3KL4A 5AUQA 2XJ9A 5BQ5A 3GFPA 2WWXA 2R6DA 4KO8A 4ESHA 1F2TB 1RRFA 2Z5FA 1VPLA 1R8SA 2G6BA 2RGNA 2V1UA 1XP8A 3IO3A 3LX5A 1G9XA 2AWOA 3R9XA 1VG8A 4LRWA 4QGAA 4B2LA 5JI3E 2QA5A 2O5VA 4MKHA 1ODFA 3KJEA 1KHTA 4UNSA 2G1KA 5CM9C 2NGRA 2WWWA 1WBDA 3RDPA 1HURA 5CLLA 1GWNA 4XOIA 1BH2A 3N70A 4H1VA 3F0TA 1SVLA 4B71A 5SZHB 3O8BA 3QVVA 5GJVC 2GF0A 3GD7A 3H1TA 3PQCA 2ORIA 4DBLC 2YOFA 1FP6A 3E2IA 3T12A 3TAUA 2FV8A 1U90A 1SVOA 1Q3TA 2ONKA 3C5CA 5G40A 1TQ2A 2OXRA 4DB4A 3B1WA 1ZMXA 4PHTA 4QNRA 3EX7C 1XTJA 1VYVA 2A2ZA 3OEHD 5FL7A 3Q8XB 4FMDB 1M8PA 3PUZA 2YC4C 3KJHA 3X2SA 3EW9A 4EPWA 4Z1MD 2Z4SA 2OLKA 4Y0VA 2J5XA 3C14C 3I8XA 3GLIA 1ZC4A 3PEVA 2ZJ8A 4TT3D 4XWOA 4D81A 4TN1A 4OI0A 3ZD6A 2HCBA 4KVGA 2ONJA 5KNDA 5DSZA 1KI6B 2JATA 4JBXA 1E6CA 2HV8A 3FHOA 2ZPTX 4URZR 1G3QA 4LV5B 1GKIA 1TEXA 2XSZD 5GVRA 2DY1A 1WDTA 1NIJA 1M2OB 1I4TD 4I1VA 4LHVA 5G41A 1K5GA 2QAGB 3A58B 3P26A 1LF0A 4JSTA 1P9NA 3EZ6A 4JL8A 3G0HA 2HCJB 3R7WB 1RYFA 3AVYA 3CF6R 1VYTA 1NBMA 4MRPA 4TLEA 4ZDIA 1XU4A 4Q4JA 4LPSA 3WNDA 3OEHA 1IXRC 1XBTA 4HI0E 1WE2A 3AEZA 3QPUA 1BIFA 3E70C 3VU9A 3R7WA 4DCVA 2CCKA 2G88A 1XXHE 4HAUA 4Q4JB 3FYHA 4BZXA 1OHHA 4DT1A 1XTIA 2RMKA 3QY0A 1RPZA 1E0JA 1D2MA 2W0SA 3CKLA 4JLPA 3ZZUA 1TADA 2Q9BA 3B6EA 5H70A 4LGMA 1JR3E 2ZJOA 4A36A 4BFWA 3BBPA 4W5JA 5F2EA 1M7HA 2VHUA 5G3ZA 1W4BA 1SGWA 3EAQA 3ZVRA 2A30A 3T5DA 3LH5A 3IKJA 1TTTA 4QJ4A 4Q4AA 1W49A 2F9LA 2VTKA 3VR2A 3GLIE 4G5RA 4CT4B 1OYYA 3AB3A 221PA 1DG3A 1G8FA 2QENA 2NQ2C 3UATA 2ZI9A 2H57A 2LWIA 5FH9A 4AKHA 2W2TA 1G3UA 3LBHA 1QHGA 2E9SA 2ODNA 1QHHB 1ZNYA 3QF4A 4GOKA 5FUYA 4QGHA 1SHZA 5BYJA 1FMLA 1X1SA 2ZVPX 3SBEA 4NYMQ 3C5HA 2QG6A 4LSGA 1UJ2A 4KV9A 4C0BA 4TSFA 3ICEA 2B21A 4QXAA 4TL9A 2IHYA 2CL7X 4ZDWA 1TQ6A 3S1AB 4IVQA 3K1JA 1ETUA 1DS6A 4NL4H 4JSYA 1OXSC 3ZLJA 4NCJA 4ZO4A 2FEMA 1JXOA 5KDDA 1NJFA 4LHYA 3QBTA 1A7JA 2J0UA 1S1CA 2ORWA 1J99A 3L0PA 2ZRBA 3A4LA 2PT7A 4LOAA 3KKQA 2ZSDA 2G77B 5E4FA 2QAJA 5JSZB 3CRW1 2GCPA 5TXGA 2ZI6A 1Z0AA 2IYRA 1OKKD 1NVVR 4Q1BA 4Z54A 2IYLD 2J7PA 2ZREA 1HA3A 1OF1A 2X19A 4MA4A 4AYXA 3AF4A 4EIWA 1KZ7B 1KMHB 3EIHA 2GJSA 3P27A 3PEUA 1DTSA 2GDJA 3BOSA 1TF5A 1JI0A 1DPFA 4OI4A 3ZIAD 3VNVA 1HQCA 1ONBA 1S3GA 2ZS7A 1MO5A 2V4ZA 2VP9A 4D6PA 1SKQA 1N6RA 4LV6A 1GSIA 1EWQA 4KFSA 1KI8A 4M21A 1MO4A 1ZAKA 1H65A 1JJVA 3DKVA 5JEEA 1Z07A 1RC8A 3SJBA 1P6XA 3KB1A 4JZKA 4OHXA 1ZIOA 3H0KA 3TUIC 1NN0A 1SXJB 3CR7A 4ZCIA 3VX4A 4JJKA 4XWAA 4B3DA 4O0MA 1MABA 2AN9A 4Q1CA 2CLCX 3RRNA 1IHUA 1H8HA 4KHZA 2XGJA 4UNRA 4DSNA 3AGPA 2F3TA 4LV8B 3OEEA 2ZE5A 4DKXA 2H7VA 4PFSA 1OFUX 3QI2A 3QENA 4NHOA 4Q19A 4E5UA 4TSFD 4EPXA 1MT0A 3EWAA 1KNXA 1NSFA 2P6NA 3BXZA 1F3OA 1Z47A 3BORA 3CZQA 4BFVA 3TMKA 3FMFA 4QM6A 3K9LA 3LDAA 1CF4A 2ZU0C 1AQUA 4L9WA 3K9NA 4A2PA 4D4MA 4M1MA 1L4UA 3RHFA 1SVMA 4LI0A 1AKEA 1KK3A 1PLLA 5JRZA 3AUYA 4FMCF 4EFNA 1OIWA 2ZJ5A 3I72A 3IILA 3Q7QA 2V54A 4EUNA 4P4UA 1E9BA 1DARA 3OAAA 2J9RA 1YR7A 3LD9A 3QXSA 5KPJA 1U8ZA 2GF9A 1ZNWA 2IL1A 1D9ZA 1ZIPA 2Q21A 1X8JA 5DE3A 4ZI2A 3P4YA 3HU1A 4CEIB 2QE7D 2O8EA 2JLUA 1H8HD 1ZC3A 1ZW6A 2BCJQ 4JLKA 3NIBA 1KAGA 1M1YE 5FBWB 3AVXA 1UDWA 3Q5DA 4LYJA 2A5FA 4B3XA 5FPSA 4K81B 4TMZA 5LDDC 4QJ5A 1A1VA 1UKZA 1ANKA 1DBSA 2HLDA 1CJKC 1E79A 2CL0X 2FWRA 5LBIA 3LA6A 2SHKA 2WJHA 3LLUA 3TAHA 3V4FA 3K70B 1YHNA 3FVQA 1AKYA 3GJ0A 3B1VA 4CGZA 4P4SB 4Q01A 1KDPA 2QROA 2ZI7A 5JBQA 2BDTA 2GETA 3QXHA 3MG9A 2IYTA 1YQTA 5DH9A 1B23P 1X1RA 2CCGA 2CNWD 4LJAA 1QHYA 4QGGA 1JXMA 1S0UA 3RAPR 4B3CA 2Z43A 1LNZA 2FOLA 1P5ZB 3LVRE 5HCIA 1VIYA 4GRAA 3VMFA 3DOFA 2DR3A 4LDJA 2ZRCA 1T0HB 4MGKR 3K0CA 2BIFA 4OBEA 3SEAA 2ZJBA 5AUPB 4CVNA 3QKUA 2XEXA 3FTQA 2BKEA 2ZRPA 3SDZA 5E95A 1OH5A 2ZUDA 4M1KA 4ESVA 1E1QD 2IK8A 1XD8A 2Q9CA 5DISB 2W6JA 3WRXC 1COWD 5J4YA 4D26A 3UMFA 4BLSA 3A37A 1EX7A 4IKEA 4XD7D 2YVUA 5D3MB 4IEIA 3DVLA 4URYR 3GLGA 1TAGA 1RE0A 3K8YA 1VMAA 1VIAA 3BAFA 3TSWA 5D3MA 1II8A 4PSAA 1ZM3A 4M9ZA 3AKCA 1KJYA 1Z06A 2EWVA 3A1SA 1E98A 4WA7A 3ZVMA 3GJ3A 5EE9A 1Q3HA 2XB4A 3EIQA 3ZZ0A 1N6KA 2WJIA 2AK3A 3OFNA 4IHQA 4NDZA 1WRBA 3QXCA 3KX2A 2UZIR 1Q1BA 1QF9A 2VP5A 1GNRA 4PSKA 1UKVY 3TR5A 1FL9A 5KYKA 4UKDA 4BLRA 1IOZA 3K70C 4OHYA 2CNWA 1R10A 2W2XA 4U02A 3GEHA 2C78A 2PZFA 2GZHA 1OH8A 1YZUA 2DPXA 2LKCA 4ZI3A 1KMQA 4RSGA 3BFXA 1E2NA 5C4GB 1Y3AA 2F43B 2RGGA 3WXMA 3AF1A 2ERXA 4HLUC 1A4RA 2N46A 3U7GA 4JKIA 3KFVA 4NZYA 4LBZA 3ZVLA 1OXTA 3MJRA 1Z5ZA 4IOMA 5C18A 2V8OA 4M1WA 3W3ZB 2FDCA 2AHOA 4DDVA 1XDBA 1GDDA 1KDRA 2GJKA 4GL2A 4LJ5A 1F2UB 3BGWA 4KFUA 4C9BA 1W4AA 3AKEA 4WXPA 3KZ1E 4LBVA 4KXFB 4MYCA 3L8YA 3CX8A 3FPAA 4C0LA 2O8BA 2BBOA 4WOPA 2ZEJA 3FHCB 1K6MA 1P61B 2C03A 2WWHA 1N5KA 2ZIAA 4KBFA 3WP0A 4LCBA 2G83A 5UKDA 3X1YA 5B30A 2DFLA 3MD0A 4AG6A 4B2PA 3THWA 1RYHA 5EXTA 1P9WA 3ONWA 2C77A 2GVDC 1IAQA 3WMEA 5JFGA 2XOKD 4IXMA 4X8LA 3JZMA 1P60A 4LX0A 5AJVB 1SXJD 3WY9A 4JIMA 3QXJA 3L82B 2C9YA 3K0FA 4H1UA 4DLRA 2EFDB 4WXRA 3TIFA 1UBFA 3RRYA 1HQYE 3WNCA 3AVVA 5IDVA 4HEJA 2WOOA 5C1BA 3FDIA 1GZSA 3B5JA 3FKSA 2OV2A 1CR1A 4R7ZA 4U00A 4M9QA 5AJXA 4WZ6A 4L15A 1N6HA 4QKQA 4F4CA 5KHOC 4AY2A 3PVSA 4LUCA 1N6LA 2RGCA 1KY2A 3LVQE 2QM8A 3UWKA 2ZE7A 3EZ9A 3CRMA 1TMKA 2OAP1 4G3XA 2WM9B 5EE3A 3LBIA 3I3SR 2V7QA 4UJ3A 3W8NA 3V9PA 3OEED 2IXFA 3BFKA 3IBYA 2WZQA 4KJZA 3PG5A 2AKYA 3VU9B 1XJCA 1NLFA 1Z83A 5DHAA 2IYVA 1N2CE 3M6AA 1DAGA 4NYIQ 2XNSA 4C0SA 1XJ0A 1YZGA 1IN8A 4IDPA 2IS6A 1XPRA 2ZM5A 4OQXA 4AKIA 4DLZA 2VF7A 2JASA 2DFTA 3UMSA 1NY5A 3ZYCA 5EZ6B 2FJUA 2IYWA 2IEZA 5EZ5A 1Q1QA 1TPZA 3E1SA 4RD2A 4O3MA 2ZSEA 1RJ9A 3Q9LA 4I1UA 1AQYA 3KJIA 4B73A 1FX0A 4FN5A 3LW8A 4KLZA 1KI9A 2PJRA 1OV4A 2V9PA 4B74A 5K8LA 1RJ9B 4ACBA 3ZS9A 2PH1A 3HP1A 1E2KA 2O52A 4EPVA 1W48A 4EJSA 3LQRA 4Q9HA 2OUKA 2HT6A 4D0LB 2IXEA 1ZM4A 4M8NE 2CMKA 4BLPA 2VHCA 2DWPA 4Z8YA 5CK4A 2D62A 4CRWB 1E2FA 1GOTA 4ZIRB 1A2KC 3ZIAA 3NTUA 5A4JA 3SJAA 3FB4A 5EUMA 1RRCA 1NSTA 1KKMA 2ZITA 4M1YA 4ZDJA 4ZV4A 4B34A 2PCLA 3VKGA 2ZI4A 3TW8B 5GJWC 3TNFA 2HJGA 4BRWA 1LW7A 4QBGB 2GKSA 3ZD7A 3BH7A 3TE6A 4P32A 4UNQA 2IUUA 4B3FX 4M2LA 2F1IA 2FFHA 5KPDA 2GXUA 3CLVA 1IJEA 1WBBA 1DADA 3K70D 1S2MA 5FTMA 4V0ME 5AWFC 1EFCA 4RKFA 3WBKA 3A4NA 3RS3A 1FW6A 2ANBA 5CITA 1W4RA 1KO7A 3KTAB 1R5BA 3BB3A 3V00A 5DYIA 3GLIB 2WIAA 4US2R 3FGNA 3SOPA 2FNAA 5JCZA 2FEOA 4Q7MB 3B60A 4M53A 1E9DA 3NG1A 4TTQA 1CJVC 3BE4A 1NG1A 1ZD1A 1JB1A 1KK0A 1DVRA 2GILA 1XEXB 5DLQC 2JLWA 1Q44A 3MFYA 3THYB 2KBFA 4G5OA 4XSGA 3B13B 3EZ7A 4DLUA 1E4YA 1QVAA 3PIRA 3E5HA 5JWRA 5FTJA 3QPVA 3NC0C 1T91A 2JDID 1QBKC 1KMHA 1R4AA 1VYUA 4FWIB 4DCNA 1N6OA 4MDEA 4F38A 2ZAMA 2W6IA 1SVKA 2KI5A 5AUOB 3F3YA 4G01B 3VKHA 3EA0A 2QTVB 3FFBA 2QP4A 1FQKA 1XCPA 1CJMA 2BMEA 4HAYA 1JAIA 3IQWA 4AWXA 4F91B 4ZDKA 2GXSA 4RD1A 1IN5A 1BMFD 2XSZA 2EWWA 5FTKA 2BMFA 2XXAB 4L5BA 4RD0A 3SR0A 1SKYB 3EPHA 1EESA 1YJ5A 5EP4A 4Q4LA 2A5DA 4M1SA 2WKQA 4ZIRA 1HTWA 1ESMA 1IONA 3GJXC 2NO9A 4OI1A 3A1TA 2WICA 2H5EA 3SS8A 1RW4A 3NDPA 1Z0KA 3FOZA 2EU8A 1HYQA 1KYIA 3PFIA 5J4VA 5KDOA 3EG5A 2FGKA 5DI3A 2ZSBA 3UIEA 3RNLA 1OXUA 4R98A 1L7VC 2C8VA 1SVWA 5E3HA 1LTQA 3EASA 2YWGA 2WMOB 3BIFA 4YLGA 3HYRA 2ZS8A 4MYHA 2B7CA 4WIAA 1TQ4A 1N5JA 3WHKA 4JYBA 1XJQA 1DAKA 1Q22A 3G82C 4LWZA 4PAMA 521PA 4Q1EA 3SYLA 2C2HA 1KI3A 5KSOA 1YZTA 2ZJAA 1BMFA 5J5CA 2W6JD 2VP6A 1OXXK 2ZJZA 1LF5A 4W7SA 4LBWA 5AJYA 3B2EA 1HUQA 3OHMA 3QF7A 1N3BA 2OCBA 2OXCA 1VKJA 4MUAA 2ODEA 4US0R 5EP1A 2YHSA 4TT3A 3OAAD 3SQWA 1LS6A 4Q66C 3T35A 5JMTA 1VG1A 3REGA 3I61A 5F3WB 4NCNA 1XCGB 4QBIA 2VSOA 3SI7A 4HAZA 2DFKB 4DDWA 3TRFA 2ZR0A 4M22A 2RKOA 1GG2A 2PMKA 1NN3A 4HUTA 1CLUA 1QZXA 4LK2A 1NKSA 3THXA 2OCYC 3T1VA 3WMFA 3ZQ6A 1R7RA 4URXR 5HE8A 1Y63A 1W36C 4FMCB 5JEDA 2REOA 1WB9A 1Q21A 1UPTA 1F2UA 1H8EA 1U98A 1E2JA 1YR6A 3PXGA 4P4TA 5A0FA 1FP7A 2CEAA 3NH9A 1L8QA 4MKIA 4QG7A 4QBFA 3QUSA 3TK1A 1Z29A 5JS7A 3RLFA 4YC7A 3TVDA 3U44B 5E7JA 2NOAA 4CDGA 2NG1A 4TMXA 5CDFA 2GK6A 3W90A 3JVVA 4ABYA 1P73A 3UG7A 4FWTA 3N2EA 3V4RA 1E2GA 3SE0A 2GBLA 3U7HB 1XRJA 2WVJA 2ZYUX 5GADl 2D2EA 2GJ8A 3THXB 1XMIA 4NMMA 2AL7A 1GM5A 1NG9A 1GNQA 1FNMA 2WBLC 2O8DB 1TNDA 1ZVQA 3H4MA 1GFIA 1JQJC 2C9OA 4P31A 2QPOA 1N25A 1QHXA 4V03A 1RRGA 3RS7A 1OH7A 3JZAA 4RFSA 1ZP6A 2OILA 2VF8A 3CM0A 2OCAA 2PT5A 1G5PA 2ZRGA 3UWOA 2R65A 3QIAA 2VL7A 1IY1A 2ZUBA 2J45A 1BOFA 2PL3A 4QC2A 1CTQA 1T5LA 2VP2A 3UK6A 1ZCAA 2R62A 5CYOA 5C4MA 2JA1A 3ZDQA 5JJKA 1QHIA 2BVNA 2JIZD 1JEDA 1ZCBA 3AP3A 1N0UA 2Y8EA 4S2EA 4TQUS 3VR1A 5DI9A 5EE5B 3RC3A 3RC8A 1NVWQ 2DCUA 1IN7A 3RRZA 2JJ1D 3FWYA 5J4HA 1CIPA 1E9AA 3OIVA 1OYWA 4IVPA 1XEWY 1Z63A 1F6BA 1Z6TA 3GJ8A 1T8UA 4YMVA 3DKPA 1KSGA 721PA 4JVSB 2FFQA 2IS2A 2Q3MA 4P0TA 3MRSA 5AK0A 3OE7A 3UKDA 3PUXA 1G64A 1U9IA 3I32A 3C16C 5DO9A 5FFMA 3TH5A 2ATXA 3BS4A 4TYNA 2B8TA 1GRNA 3DL0A 3ND8A 3U3RA 4LBYA 2F1HA 1E99A 1NIPA 1G5TA 4GNKA 1YRBA 2O8BB 1P9RA 3EA5A 2ZR9A 1UEJA 1JEEA 1A2BA 1G8GA 2QZ4A 4NYJQ 2EYQA 2IWHA 5KDLA 5HKKA 4BPBA 2B7BA 2RB4A 2N42A 3KB2A 3KXLA 2IS1A 1F60A 1AIPA 4W5HA 2FZLA 3MGCA 2C98A 3CO5A 4A0RA 4JS0A 4HB3A 2OESA 1Z0FA 4DIEA 5HE9A 2J0SA 4DCTA 5CK5A 3UXMA 3LY5A 4HDCA 4M1OA 2BMJA 1WA5A 1DAFA 2QMOA 1COWA 4BASA 4BFUA 3CWZA 5M04A 4UQOA 2YJTD 4PXAA 2R6GA 1Q20A 1TL7C 5SZKB 4OI2A 2YINC 2W00A 1KGDA 2L0XA 2GA8A 1BYIA 1E9SA 4JJZA 5B58C 3NDBB 1RFLA 5LB4A 1SQ5A 2ZANA 1CR2A 1Z6YA 2GTPA 3U3MA 1KI7A 1LB1B 2OHFA 2JLZA 3RRMA 3WP1B 1X3SA 2CE7A 1EFRA 1XMVA 2FSFA 3L8ZA 3FFAA 4CEJB 4R71A 2P5SA 2WSMA 3TBKA 3REFA 4EQ6A 1VG0B 3NH6A 4JLNA 3SYKA 4WAUA 4DSUA 1P72A 1ZBDA 2BHRA 2JCSA 2GZAA 1ZM9A 1J8YF 4UNPA 2R44A 4CEJA 2YWHA 1NVUQ 3RSOA 1T3LA 3MLEA 3NBFA 2C04A 5EE0A 5K8IA 4KITB 4RD6A 2QPAA 3CH4B 5IRCD 2WHXA 3X1XA 3HPQA 2YZ2A 3I92A 4G1UC 2QGNA 1KTVA 3RSLA 5FPKA 1T5IA 1W0KA 1XZPA 4DLYA 1JR6A 5EP2A 3BB1A 4AKEA 1TF2A 4PC3A 2HXSA 2BMDA 5CB6A 4MGZR 2W6ID 3L0OA
chains in the Genus database with same CATH superfamily
2OCIA 1PDWA 3T7CA 3U6BA 1UBHS 1FPMA 2DWQA 2O0LA 4LSMA 1ENZA 3HRHA 1X86B 4QD3A 4M60A 2VP0A 1CZRA 1DIRA 3JU3A 4FFOA 1L5KA 4ERNA 5LDGA 5I9BA 4O29A 2RGBA 1FS5A 2YTZA 5F9MA 2X0IA 5KQMA 3I2IA 3GLVA 2F17A 1CUWA 2JI4A 2OBYA 1J25A 1J5PA 1GY8A 2CHGA 3L07A 5AHRA 5BXQC 1ZWLA 4BE9A 4DDTA 2A88A 5IAGA 621PA 1SQGA 3IMCA 2ZRLA 3WYCA 4B8YA 4M38A 5BW5A 2AWNA 2Y2VA 4R9NA 2PWPA 1R6TA 2Y99A 1EX1A 3PWZA 2X3FA 2GK4A 5E2AA 4BZZA 1YL7A 1AUVA 1ADJA 2H52A 2Q4OA 2WHRA 3AR7A 2VDPB 3P97A 4YRJA 5I7FA 2M6SA 1AK2A 3TCXB 2R3SA 3HYTA 1FA9A 3BIXA 3I23A 1AXGA 3D2LA 3QSYA 2C95A 4WOCA 4QT4A 4Z4HA 4JJ6A 1GD1O 2UYYA 4WKNA 3SHVA 3KE8A 3NHAA 3K32A 3QKTA 1Z08A 1X9GA 2Q0XA 4J4TA 4Q3BA 1JL3A 1KZYC 4CR6A 5KOHB 2JFNA 5BYBA 2O2EA 4KDRA 1WTAA 3GZJA 3HBAA 1M1NA 1ODLA 2NYRA 1EJ0A 2D1FA 5DEOA 5CFZA 1Z45A 3G5AA 3NC1C 4CT5A 3NHWA 4DIKA 1PJRA 2UVQA 2ONYA 1O94A 5CT8A 4Q3KA 1XKQA 2HMAA 4GOOD 2C7QA 4BLTA 3TGPA 1YR9A 2VKQA 3HN7A 1R4NA 1JG7A 4L9SA 1US8B 1UT8A 4IDHA 2KLHA 1ULZA 3AM4A 1U3CA 3KT3A 3O38A 3D1LA 3GWGA 4KIUA 1CDDA 4YS6A 3R5JA 4GPTA 5L3QB 2NZ2A 2J3DA 4N6GA 2DR2A 4HVAA 2Q5EA 4EGFA 1BNCA 2J3EA 5CM2Z 4JI4B 4R7TA 4TZ6A 2Q9AA 3NX4A 3TSCA 2P3QA 4DANA 3EQ8A 2NSHA 4M46A 3OURA 3PGJA 1BHO1 4OA8A 5BW6B 2WIBA 3WV4A 2ZSAA 2O05A 1D2CA 1WUHS 2BV3A 4Y3UA 3ZK9A 5JROA 1XMSA 2LV8A 4FSXA 1MRSA 4GMKA 2ZBPA 1JALA 1ELOA 3M5CA 4WLEA 1W29A 3RYCB 1T9HA 1DCFA 5F1PA 2QTAA 5FBKA 3MT8A 3LIPA 2D7CA 4R9VA 5CYFA 1XD9A 3U49A 4CCYB 3DR3A 3MN1A 4LMBA 1CB7A 1L5YA 2W2LD 1FDWA 4NZZA 1C7FA 4C4PA 2GEFA 3E22A 2J59A 1K6JA 2NZJA 3OA0A 1KH3A 3OJXA 1E2EA 1ONSA 4J43A 2EYUA 4Y2SA 4D5EA 2RHLA 3BWDD 2C61A 2H2IA 3EDMA 3VC2A 5A04A 2GQ0A 2H2DA 4JI6B 4KLRA 5B12A 3V34A 4LE2A 4NV3A 1NATA 4X7PA 3VR5A 3CLSD 3PLNA 1OGIA 1Y4UA 4XUGB 1PNRA 4Q02A 4Q03A 3O90A 4B3BA 4LY6A 3WBFA 4C2TA 4DZZA 1OGJA 5I51A 3DMFA 3H16A 1PVDA 3G7UA 4JMPA 4HNAB 2QVGA 5BR7A 1QFJA 4CV0A 4RK5A 1QHNA 5FADA 4UREA 3VR5D 3PJEA 2XX3A 2CUNA 2GCGA 2P2NA 3O4IA 3T5TA 1NV9A 1XMQB 3A6ZA 4M0KA 3RSFA 1KQFA 3SVLA 3HWX1 4RGQA 1W5BA 2GEUA 2RI0A 3L41A 2F62A 4L75A 1Z4JA 4AXBA 3VO2A 3OIUA 3DM9B 3HWSA 1ZRMA 3L2OB 4PLPA 1WXQA 3P8ZA 3FKQA 2H4JA 4IQ8A 3QKRA 4JC8A 1UXOA 5H4GA 3FMPB 1R6UA 1XN4A 5SYAA 3BULA 1Z7GA 2Z5LA 3V4OA 3PKZA 2X4GA 3LX4A 5EUQB 4FGUA 4KE6A 3CZRA 1MV5A 1EGHA 2X7HA 3I04A 5KWEA 3KU4A 4JI7B 3KYBA 3TZ6A 4I36A 3O3MB 1E1YA 3TLXA 2O8FB 3I1IA 4M54A 1MJGM 2QNIA 1MRNA 2GERA 3KXDA 3WMRA 1V1MB 4ZN6A 1IWOA 1PR0A 2CDNA 2KWIA 1UKYA 3U7FB 3DLHA 3OCXA 1TU3A 3CBGA 2CKDA 4B0PA 3ONDA 4R9RA 1ULUA 4UFOA 1VQ1A 2AN1A 5DJ5A 3T3DA 3TWOA 3H04A 4B8WA 5BQ3A 1S5PA 2X2PA 4QHTA 3NPAA 2AI3A 2WSSA 1Z88A 3KQNA 2JGIA 3EIUA 4X1IB 3VHXB 4KR9A 1C8LA 1F20A 3PFKA 3TM4A 2PWBA 3GRAA 2XXAA 3L4BC 3MWKA 3N7AA 3LWDA 5DLYA 2TMKA 4GKVA 1P4JA 4XQ0A 4ARBA 4PN7A 3P2JA 3ADDA 2OHJA 4XWTA 2VO1A 4ZOCA 1R0ZA 3NM6B 2WHEA 5DNWA 3RR2A 1UPAA 4EAAA 2GSWA 1GSOA 3AUTA 3I53A 3PXCX 5F5LA 1Y82A 4BX8A 5K0GA 1NFRA 2DWOA 3BE8A 3VISA 3IT0A 1UJCA 4F45A 5JYCA 4DG5A 3ZIDA 2AH5A 2CGEA 2W8ZA 5IUNC 1GUAA 4BO8A 4BO7A 1P4SA 3EQZA 4W7HA 1NWHA 1FTQA 1ZOIA 3KU1A 4GMXA 5F73A 3OY7A 3GRRA 4D0SA 3F6PA 3E4DA 3DZGA 4DEXA 2UDPA 3AXSA 1SBHA 3ROZA 4PANA 3BRQA 1DBVO 3R7FA 2QRHA 2A5JA 4GWLA 2FLVA 1D7AA 3M1YA 4G0OA 5ULLA 2EV9A 3U3JA 3D54D 3AL0C 1UM8A 5ABPA 5H83A 1EE9A 1K7YA 2W6MA 3ADPA 1YDWA 2EGHA 2H17A 4FJ0A 4FVTA 4MV6A 1ENPA 5FOTA 1FQJA 5C5DA 1PGQA 2G40A 3HDJA 3LW7A 2WAAA 1ONPA 5DZSA 1VLHA 4UMFA 4MS4B 1DFHA 2OG2A 3V8EA 3ENZA 2A86A 4J7UA 2BBWA 3DNMA 5IP5A 2Q2WA 3IELA 1K7CA 4TXLA 1OBFO 4J3JA 4ROSA 3KRTA 2E6KA 4ENVA 1FNNA 1ZINA 3DF7A 4H3KB 3G5UA 1PK7A 4V0NA 3WKDA 4Z4CA 3T1OA 4PM4A 3TEMA 3U61B 2O9JA 4H4CA 1HDIA 4RORA 1RBMA 1E2UA 4D7AA 4DMFA 4XIGS 1NBHA 3IKMB 4GI1A 3ZH2A 1N3YA 1NMQA 3ROKA 3WRVA 3R74A 5J59A 1NPTO 3GZ4A 2PZJA 2H9YA 4G37A 1RVDA 821PA 2VA9A 3C1TA 1A8IA 2OD2A 1MJNA 1J9GA 1UDRA 4MW2A 2GKGA 3UV7A 2B1GA 1ZD2P 3RS0A 1E9RA 2V6IA 4WN9B 2IT1A 4ZEXA 4KX3A 1KKLA 3FDZA 1M6WA 4K3UA 5BSMA 3UYKA 2GD6A 1BYUA 2FX3A 3OQIB 1ZJ6A 1B15A 4L2IA 3TNYA 4YMWA 2HJVA 3H2HA 1EDEA 3VC3A 4DREA 4LMRA 2DQ4A 4FHFA 2A3NA 4DC0A 3AY3A 2H4HA 3RTGA 1N78A 2R1TA 4R1NA 2DHCA 3W05A 4U9UA 1BC5A 4UTZA 5BN4B 1PG5A 5JCXA 5K9ZA 5K6TA 5A05A 1DQSA 3CE9A 3T3NA 2QLJA 1MW9X 3BA6A 1FYXA 2G4LA 1ZCFA 2BOVA 2ZROA 1UBOS 3ANTA 3QK7A 4URUR 4XAQA 3SMQA 1ORDA 2HYDA 2J5BA 3TB4A 2ACWA 2RGWA 1ZG3A 7MDHA 2Q50A 2WU8A 4TMWA 3C43A 2E2WA 3GLHB 3ZHXA 3GHYA 4H1TA 2JFVA 1T25A 2FP4B 2FEPA 3G2NA 4HWKA 3DWEX 1M0EA 3OTHA 1E32A 3AH8A 3KC2A 1ECBA 4RMGA 2GM9A 2GAAA 4E07A 2VK1A 1H2YA 1NYRA 2JGMA 2WG2A 3KSDO 3L8GA 3NP7A 3E3AA 4OB6A 4Q12A 4QQRA 4ZTUB 5F98A 4ZI5A 3M6FA 2FCRA 2BGIA 1T6YA 2AZDA 2X2EA 3A10A 4GOJA 4YRDA 3HJCA 1IULA 4Q18A 2BJVA 4J2HA 4TKLA 2XV1A 4B33A 4R2IA 4RHUA 1VDZA 3ONFA 4LC0A 4RPIA 9ATCA 1SWVA 5M34A 4IPTA 2DLDA 5DTJA 3A1VA 5JS2A 5B4VA 2V3WA 2ZAOA 4I0WB 1GKUB 4FFLA 2QE6A 3QLVA 1PFVA 1PV4A 1V2HE 5CCBA 1E59A 1T9KA 5E1DA 2HT1A 4TMTA 4LZLA 1O4WA 3LC0A 5H7XA 3IBFA 4AB1A 4CM9D 2GTIA 3EFOA 3FR8A 3PGVA 4WERA 2FN3A 4B2IA 1XZAA 4LF9B 2O8CB 1VMEA 3NGLA 4HN9A 1I4OA 4RCZA 2P9TA 3UW3A 3I9LA 1N34B 3U4IA 3TI9A 1TA9A 3DC7A 3PUHA 5DN6D 3WB2A 5AW6A 2C20A 4TYMA 4PZZA 4WACA 1P33A 4ETMA 4B3GA 3R9WA 5HF6A 4GZMA 4NK5A 3OOEA 3VHQA 4G5GA 4PO1A 3IKLA 1PS8A 3AO0B 2OB2A 3B70A 3EGDB 4K03A 4R7GA 4HGPA 4E1AA 4TWJA 2GBIA 2ZGVA 2QRMA 4AVYA 3L7JA 2D3WA 4I5FA 4Z49A 1P2FA 5EJ6A 1WCWA 2QAGA 1OPXA 3RU7A 3V97A 3I9V6 2HR1A 1DGQA 1R8XA 1QCDA 1CY4A 4IRUB 2YIVX 3L46A 4KKVA 2Y66A 4OXQA 3U7EB 3T06B 2A59A 3IAFA 2O3SA 3RVNA 1HSOA 3ZVKA 1U0FA 2I8LA 2A92A 1Q0QA 2XQIA 4JEHA 2OO3A 1F17A 3DL4A 1KERA 2BCEA 3PICA 3PHGA 5CDSA 3KTDA 1UMDA 1PQUA 4LSWA 4BWGA 1N8NA 5T67A 4AUMA 1BXZA 1UBTS 1COZA 4B7CA 2GI4A 3BUSA 5L3QA 1Z34A 1UWCA 4MPTA 4MI1A 4ZP1A 4LJ9A 5E4TA 1N2JA 1ZOSA 2DF8A 3A06A 1Z7EA 1SC4A 2VYQA 4HX9A 4C7VA 4F5ZA 4HNVA 2Q5HA 5F7XA 5KIAA 2VPQA 1Q11A 3RO7A 3P9KA 3B9RA 1RTTA 4YDHB 1M2HA 2FETA 2X76A 4RHXA 1EFTA 2VOJA 4NYMR 5CD1A 3DHWC 1FFEA 2R84A 1LGYA 3PGA1 4LWOA 4Z2YA 4DUPA 1QGUB 2JAWA 1GPWB 3BC1A 4XX0B 4QDZA 4UOEA 3J80A 5KVSA 4INZA 4MW9A 1W2HA 1WXEA 2O0HA 4PCAA 4DEYA 1IZZA 3KQUA 4MRNA 4JLJA 3F96A 1GQYA 2IJGX 2CHQA 1NW8A 2E1PA 3DEIA 1TKBA 2HQSA 3DNPA 1Y5IA 1S3SA 1JR3A 2HIMA 2OOSA 2WM3A 4IEFB 3WKEA 5BMOA 2WJGA 5JWHA 5EIBC 4EECA 4KPUB 1E62A 3PJFA 3AU9A 1EIWA 1OU4A 5AI0A 4YCBA 4YI5A 1ZN8A 2JJ8A 3P9QA 1DJLA 1H6AA 1TKRA 4B79A 3MFQA 2ZJFA 4CN8A 1XXHA 1KDOA 4NNOA 4H0CA 3CB4A 1SK8A 3VKUA 1TZ2A 1GITA 2E85A 2QYOA 2XITA 5BQXA 1SG6A 1UFQA 2X8JB 1TT5A 3KUCA 2BTOA 3JATB 1QGOA 3NM5A 4JLUA 2FQQA 4NPAA 2HC9A 2IA5A 5HM8A 4XTCS 1J6UA 3C8DA 4I19A 4JP1A 1P2UA 4G1VA 1JKJA 4GRDA 4Q47A 5LVAA 4JGIA 1Z62A 3EXAA 3M0EA 3SZMA 1C7ZA 4FK8A 4Z3OA 2YV4A 2FW0A 5ITVA 1ZX1A 1CQZA 1GL7A 4Y6SA 5EOVA 3S7ZA 2AV6A 1B8NA 3FPEA 3NTLA 1LDNA 2CVQA 3GMTA 1QQBA 1FFSA 3LL7A 5D7BA 4UVHA 3A6PC 2WTAA 3QKSB 4P5PA 6NULA 2IF2A 4MWGA 4DAEA 4E2XA 2GAOA 2I2DA 1T15A 3IDAA 2BLNA 1JSXA 4HATA 4TZ0A 1VJDA 4FUQA 4H6XA 4EB3A 1WUTA 1IG0A 4AZSA 5KNCH 3PGMA 3SC4A 1FRVA 3ECCA 4CKCB 3O8NA 3EARA 5AVTA 3NVMB 3D0KA 3B1YA 4IH9A 3O9ZA 3UVEA 2UZ3A 2W37A 1ILWA 1V7CA 2Q3EA 4GPBA 5J47A 5HIKA 3S8EA 3CJRA 3D5EA 1MH1A 3H3XA 4AP5A 5ESWA 5AIBA 3QPDA 5KBYA 4JI0B 2BF4A 2FSHA 5BORA 3C6ZA 5ENDA 3ZBTA 5KJCA 6CHYA 5LNK6 2QR5A 3WK5A 4OK5A 5AW2A 4DUGD 5ED4A 4OJQA 3C39A 1QZZA 3O8OB 3DPUA 3F78A 3O74A 4UMVA 1C3VA 2RAUA 5EG5A 1SU4A 5F2KA 1CVRA 2GN6A 3DDSA 4X5OA 1NU6A 2CWWA 1LNQA 2I2BA 1JBKA 3KR9A 3LRTA 4PAGA 1UBCA 4DRYA 2E4YA 1G42A 1OXMA 1ZXBA 3LSTA 3AR2A 3WR5A 3BRWA 4H18A 1ZI8A 2REQA 2PZAA 4IVRA 4LDRA 2H4XA 4RPJA 2OT3B 2D00A 2OZLB 1B6RA 3AKDA 2P2SA 3U7JA 3ZTTA 3CF0A 4I1SA 5FTMA 4MHTA 1E5XA 5CEEA 1JZQA 1ZRSA 3DV0B 5A0VA 1JIIA 1I4EB 1WQ3A 2FZVA 3OCJA 3KTFA 4FNOA 3QX7A 3N1UA 1G20B 4N0EA 1LK0A 3NHFA 4JSRA 4X1OA 3RS4A 4YR7A 1NXPA 4TQAA 3DZFA 1NLUA 1DEKA 2UV8A 5I7OA 1EUYA 1UBNA 3OESA 2HW8A 1HDZA 4NJMB 2Y05A 4EMBA 3FMOB 1I1QB 1M5UA 4XQEA 3RS8A 3T7KA 4UDOA 5J2UF 2BWJA 4EWLA 3K05A 4N5DA 1JKFA 3NHUA 5CGQB 4ENRA 1A8SA 4KXMA 4V1CI 4LXHA 1RYBA 2YIMA 2EX0A 4IOJA 3TBFA 2B34A 3ABIA 1XZQA 1Q50A 1YS7A 4MUBA 4NEHB 3IIJA 1WM1A 2NV0A 4L8YA 2I4LA 4Y8VA 1M8JA 4RBNA 1PFQA 4M9UA 5CCEA 3S2SA 1D5CA 1F8UA 1LWNA 4NE2A 2FUNB 1P44A 4Y2JA 4U4AA 5G1NA 3RYTC 1W0JA 5AD1A 2HCTA 1E8NA 1K89A 4HSEA 3K8QA 2V96A 3HBMA 2FPGB 3A27A 4O4LA 1ZJYA 1B0AA 2BGUA 2OQVA 2FH5B 1X8LA 3V7YA 2EZ4A 3I76A 4OMCA 4KBGA 2IOFK 3S2UA 1YL5A 2Z9DA 2CSUA 4QULA 5HP4A 1FEZA 3FH0A 1ACJA 3JQFC 3L92A 2AXQA 2YVQA 5CR9A 1DAPA 1M67A 2LCFA 4OHWA 4CCYA 4HR7A 1NSYA 4YH1A 3ZHVA 4U7DA 1NUPA 4HMQA 3BK1A 3ZCRA 1KO5A 1U7WA 3ZJ5A 2ECFA 1BWQA 2I2AA 2NZWA 2D74A 1ZGBA 4JYMA 7AT1A 4LI3X 2FSIA 2VNKA 4I4TB 3G0IA 5K6AC 2OHIA 1HE5A 1WUIS 2AVNA 3AF0A 1J0AA 2V7GA 3GLUA 3QEKA 1WQ4A 3B1ZA 3TXYA 3HR7A 3ROEA 4F6RB 1LZLA 1CS0B 3B5IA 2UKDA 1SG0A 3IUYA 4IDDA 4OYHA 4UQPA 4B87A 4EBBA 1VDMA 3DE7X 3O95A 5HIAA 1TEVA 2ZRHA 1SVNA 1YU6A 4WT7A 2VYVA 5TT0A 2GVNA 4P54A 2JF0A 1NL3A 5SICE 5H02A 4XJVA 1MO3A 2UU9B 2RG7A 4XZ3A 5K51A 5EPEA 3LA8A 4OB8A 4N47A 5IMBA 1YNSA 5EJ9A 4J7AA 1LDBA 2FFBA 3S81A 3Q40A 2NSYA 1QZ3A 2CXOA 4O08A 4KUEA 2IUYA 1HC7A 4LE0A 1GTJ1 2JAQA 2VSXA 2BGKA 1U0HC 3ZU2A 2BFFB 1EWVA 1YCHA 2R6R1 2CDBA 1PG0A 1ETHA 3DB1A 4FINA 4HDOB 1Y5MA 1BAPA 4KPFC 2GDZA 4EVSA 2KM1A 1P4HA 3X1DA 1KJ9A 2OAGA 1VSQA 3S29A 4JJEA 3G8CA 5D6OA 5EZYF 5DPMA 1BG6A 4LRUA 5TVKA 2A67A 3R0ZA 2ZXEA 4X1KA 3X0DA 3TSAA 5GJBA 5HKOA 1BO6A 2LNDA 3KJZA 4U3JB 4MUXA 6ABPA 3R7AA 5BVHB 3FI0A 3RB8A 2AC7A 1HMYA 2DUMA 3GEEA 2HCFA 3V7UA 2X1VA 4LJ4A 2YZ7A 1JEQB 1SQSA 1N5DA 1G17A 2NUTB 2WINI 3G2JA 3KL2A 3U3DA 1Y3HA 2MSEB 2V1XA 3RM3A 5FV4A 2BR5A 3IP6A 1HFWA 4YO8A 5G53C 4GIBA 1GRCA 1KYZA 1OZAA 2G6TA 2IDKA 3HNOA 1X8KA 2VI5A 1RPJA 1H2FA 1KMIY 3E81A 4RY0A 3LYLA 3AB8A 4PQRA 3DV2A 4E5VA 2QMYA 2UYHA 3JALA 1OFGA 4NE9A 5FLKA 3ZI4A 2C82A 4O1HA 2IKQA 3UF0A 4GI7A 3EDYA 1UODA 2BDUA 3VSDA 4NFYA 4LOKA 5D51S 1G3RA 3QVWA 4IUCS 4MS3A 5B2ZA 2WT9A 3R8FA 3AESB 1L5WA 3RUAA 3RVQA 2XMDA 2W2LA 4WE3A 3AHFA 3K6SA 4HC4A 4JUFA 3DFMA 4BFYA 2P75A 3UOAB 3E9YA 4NH4A 3D8NA 3QEOA 2YJ4A 3NHBA 1YUMA 3ICWA 4CXMA 3P2OA 3X3HA 1IY0A 2O1WA 1CY0A 3VR3D 1XUOA 4BNUA 2GX6A 1LBTA 2W4IA 3QFHA 3C2QA 5AHWA 4WKGA 1II8B 2NIPA 2LDXA 1UPUA 2PLRA 4W5WA 4RLQA 5J2TA 2X2FA 3L7OA 2C57A 2IVZA 1T9BA 3I5YA 3EOAI 1OBVA 2ZRAA 4BJHB 3ZNNA 4Z7QB 5KWIA 3W2TA 5JNUA 3B6IA 3AHIA 4QTYA 4R2JA 3OJEA 3MF4A 2IPOA 2BI8A 4ENWA 4EG1A 3EC1A 1OB5A 3NU1A 4GGOA 1PX2A 1K63A 1ZVJA 2CNOA 2Y68A 3UGQA 1GPH1 2QYTA 1IY2A 3AV0B 4FKMA 4FYWA 2XWPA 2GR9A 1N1DA 2VZ9A 1OX4A 3JQ9C 1YL6A 1YR1A 3CIOA 3EPPA 4LHZA 2G0NA 4HS9A 1UZLA 2SBTA 3CZMA 4EHKA 3GLFB 1BKDR 1G2QA 4Q21A 4AD8A 2VVTA 4LXGA 2PZMA 3P71T 4UM9D 2HSJA 1NFFA 2O5EA 5KEIA 4ZK2A 4GNRA 1B1AA 4K28A 1IQ0A 3OQJA 4EKDA 1ICIA 2IBSA 3PGKA 2XZLA 2NQ8A 8AT1A 1UBSB 1GKYA 2ZYRA 1UBMS 4IV8A 4IJ6A 2G8LA 1NR5A 3CX4A 5TMDA 5LQDA 4MS1B 3OIYA 1YA4A 4AYTA 1Z0UA 2DFNA 2C7PA 2B25A 4P3OA 4FP9A 4G0WA 1KZGB 1Q17A 3LGSA 5KAMA 1VL2A 3I5AA 4MRSA 2AFIA 1P75A 3DOEA 3EOZA 3F74A 3IBTA 3OD5A 1KMNA 4G0XA 4X20B 5TARA 4Y0AA 1PR1A 1LDEA 3K5PA 2Q28A 4P93A 3VU0A 2Q6KA 4LZWA 2X6RA 4YV7A 2ZU6A 5JSKA 1V5WA 1TO6A 1ZMTA 4OQZA 2ATVA 4ZZ0A 3EXFB 6LDHA 2GWRA 4X63A 1TU4A 1EMDA 1PGPA 1BSVA 1I2MA 2CJWB 3LXRA 3NHJA 1P5HA 1RYYA 2R00A 3P52A 3WQSB 3UWPA 1L7AA 1OI2A 5DGIA 3HLKA 3OFKA 2J7KA 4Q9NA 4EOGA 3HL0A 1JR4A 2C4VA 3E9MA 5BUQA 2VTBA 4YCLA 1OY1A 2PGAA 2QRLA 3BHJA 3L7YA 2GCIA 1GV0A 4NG5A 5ICFA 4CTNA 3PEYA 2CD9A 1E9CA 2G4CA 3QYJA 4GT1A 1UQUA 5ALWA 1V71A 4JVNA 4F4HA 1AN9A 3QW4B 4NCHA 4ALKA 3AERA 1OLOA 4AJLA 3TW8A 4RAQA 3AYXB 3BH0A 3UFBA 2DQKA 2ENUA 2REBA 3MUFA 3RFFA 4DABA 2VYFA 2B61A 3F7NA 2G5TA 4MGHA 1TJYA 1LSJA 1ZMOA 4JROA 3NBZC 4DYHA 5IT5A 5CXUA 4FR0A 2Y76A 3EF0A 2C5SA 2XWSA 4FZ3A 1T9GR 2XYQA 4IW3B 4XCXA 3UMGA 2ANCA 5E7IA 5BN1A 1A72A 1LFAA 2MCFA 1NE7A 3GLHE 4BNTA 3M9WA 5L3SB 1W36D 1K6EA 4ZQGA 3TZQA 3LKDA 4IKOA 5I7WA 5DNEA 2J0QA 1GQQA 2AX4A 3IUPA 5K3EA 3K71B 1RVV1 3LUFA 2NVUA 3SZRA 4FEEA 2CSXA 2CUTA 3A6EA 3BL6A 2XI4A 2HUPA 1JDPA 4MKGA 3DYIA 4K8OA 2WR8A 3DBRB 4JDUA 3RSGA 2QJFA 1AGRA 3QKRB 4JR0A 3ROGA 2NUPA 2WW8A 1WY7A 3DZIA 1KJZA 4OV6B 3R8XA 2DJIA 2GFIA 3OECA 3QF4B 4L8GA 4F46A 4F72A 2QL5A 3IDQA 2NVWA 3ZV3A 4KQ2A 3LKVA 3CF4A 4TUYF 3AQ4A 1E7SA 4IDNA 1MAAA 1LY1A 3MILA 4FE4A 4HQNA 1DIGA 3N53A 4DPKA 4JBWA 4MWDA 1ZISA 2VYNA 3ELWA 4KAXA 1XLUA 4CHGA 1OILA 2QT9A 5J5AA 1FOEB 2I65A 4RUKA 2YCBA 4WX2B 4BVJA 1RAHA 4F3CA 1YS2X 4M7PA 2IUFA 4ECEA 3BF7A 1KEEB 3KVOA 2YZKA 1GAJA 1YDEA 2IPLA 3AHEA 1EXVA 4C7BA 2Y92A 1BQEA 3T0GA 1OH6A 3ITEA 5E0KB 3IP8A 4F8EA 5JXJA 2XMCA 4YJHA 3NVAA 1ODTC 5K8CA 4WNAA 1D8AA 5K3BA 5LFAA 4KGVA 3I34X 3MINB 3E0XA 1IQPA 2R25B 3O84A 3CCBA 3IVRA 4PFQA 3V8QA 3AOGA 3MA0A 4DLTA 4H6VA 1KTIA 4AG3A 1R2QA 5JSZA 1R6AA 2GBGA 1M73E 2B4QA 3MAJA 4GZ3A 1PW5A 1U9JA 2O1SA 2X9VA 3QNMA 1F9AA 3G49A 4GHWA 3H9GA 4IIJF 1ZUNA 2WKRA 3INNA 1XAHA 4GR9A 2B8WA 4F2DA 1QQTA 1N6IA 3IQHX 3L05A 3P0EA 3ESCA 4O4JA 5CJJA 4DQKA 1YCDA 3PHJA 2I4IA 4YV1A 2GOYA 3HJBA 3NCTA 4P22A 4UC0A 3TLBA 4DC1A 3N8DA 4H27A 2I34A 4Q9DA 3PL5A 1ZOOA 2OE2A 1YC2A 2Q8PA 4AJIA 4BO4A 5LR6A 3FNHA 1DELA 1NQ5A 4YV2A 5CDGA 1XPOA 4MUKA 2V9CA 2NYVA 3K6RA 4D3XA 2VPTA 3IEPA 1ZH2A 1ZGCA 2YHIA 1L1FA 1L5RA 4KTTE 2Z9BA 2P0EA 3KB6A 2O2IA 4KXXA 3ZGOA 2ZWVA 3OT4A 4Q7KA 4EI2A 1KQGA 3NUQA 4WCFC 4V3BA 1MIHA 3IMGA 4LVOA 5FIUA 4KFTA 3SC6A 4YI3A 4G9GA 5CBPB 4MQMA 4DLVA 2PX0A 3SSMA 2GXQA 1G38A 2XUQA 1AUXA 1QVWA 3TG8A 3WRYC 4DQXA 2XB8A 4P84A 3RVOA 1UR5A 1GRVA 3JZDA 3S2ZA 3GYGA 3OF2A 4AY6A 2OP0A 4LRYA 4E51A 2BSAA 1BWPA 2CK3A 1MC8A 2JD1A 4PHCA 4PLVA 2FCAA 3R7DA 1DE0A 1JQLB 1Z2CA 3DHEA 2HCRA 2P2ZA 3KOXA 4PRKA 4OKNA 3FCCA 4P1ZA 1XZBA 3B36A 1HR0B 2YH2A 5BSWA 3QKIA 3LV8A 4L07A 4PNHA 2V7EA 2IX3A 1QKKA 4G81A 3B7WA 4YCCA 3AQIA 2GEVA 3HYNA 5A5EA 1NNEA 3R3YA 1LPSA 4BFZA 2YS7A 2LIVA 4I50B 2PZEA 3PYMA 2LCQA 4N01A 4FXPA 4J0EA 4U9HS 3HN6A 5AVYA 5IM4F 4RPCA 1V5EA 3IIIA 5CB4F 4RPKA 1UKBA 4YDSA 3V1LA 3NGMA 4E33A 4GFDA 4D3SA 3G88A 4KPGA 4ZVPA 4B6SA 1JIVA 3WNVA 3TB6A 2HF8A 4YJDA 2EFGA 4KQIA 2XWJI 4CQMB 1ULTA 2WAYA 4L0QA 2PVCA 5HZKA 2B8JA 1A0OA 4HEQA 1S9DA 1EK6A 2C7BA 5BR4A 1VKHA 1V11A 5GOTA 2VJOA 1NULA 1REQA 3GJZA 2P0YA 4PCVA 4EA6A 3BQ9A 3R20A 4OATA 5EJ8A 1G5HA 4NDNE 3V7WA 3Q3JB 4RS4A 1YJCA 1QO0A 1RJFA 2QJWA 5JANA 2XTJA 3S3TA 4BAZA 2O7SA 4BC1A 3GUHA 1JIQA 1T43A 3AZPA 2ESRA 3BJIC 1E1CA 2HXYA 4YJ2B 3H5IA 3TDNA 1IWBB 2MHCA 2IUTA 2PN1A 2I6QA 3DDHA 3DE1X 4FD2A 3UWDA 2ZQZA 5E1MA 3STYA 4D0NA 2FK7A 1X3LA 2OD9A 2IW3A 5E1BA 2HIGA 2J7PD 3OMXA 3QMWA 4OQFA 1JDBB 1KY3A 4WEOA 3GAZA 1J8FA 1VHTA 4NABA 3NRCA 2B37A 4HLCA 4MQBA 1VB5A 1P0QA 2COKA 3X44A 5BXYA 4FYMA 4JGGA 2V58A 3VO8A 3G2LA 3RTDA 1XN1A 2XVZA 1UFKA 1GL6A 3GFBA 2VNIA 2YV5A 4PR0A 4BTVA 5JQGF 3OLVA 4KVAA 2UYGA 4KO2S 1XZFA 1YZLA 5GZ1A 2CD7A 1XLTA 1A1SA 3DLBA 1Y5NA 4GE3A 3TJRA 5IKOA 5HRCA 3R1IA 4LYYA 3OQ6A 5C7YA 4PO9A 1NFQA 1CK4A 3AONB 1HT0A 2WWIA 3DTVD 5EC8A 1WZCA 4BJ6A 1NZJA 5G3YA 1KP2A 5JPIA 3TNJA 4EZEA 2NSLA 4Q9JA 1A95A 3LQFA 2OA0A 4ME6A 4NZMA 1T0JB 1FRNA 1GL3A 2EZUA 3MOGA 1E3QA 3RT9A 3HB5X 3LZCA 3RHSA 5C7LO 4Y1EA 4DF3A 2AFHA 1IZ9A 4W5QA 4C2UA 4C4AA 2R0QC 1KETA 2XBLA 2JJ1A 2JGFA 3GH3A 4JLDA 4W9NC 5EWLB 5BVHA 2GD2A 3D2CA 4F8JA 1D2AA 2H2AA 4PZ0A 3B7GA 1FDVA 3KD2A 1RABA 2VT3A 4B6FA 1Z0DA 2EDCA 2Q6OA 2X41A 1BX1A 4UUBA 2ZYAA 4O2RA 4LMPA 4URVR 4JVLA 5IAOA 3ER8A 4EHLA 3FTFA 1J22A 2BBTA 3A31A 1S2LA 3GMDA 3MJFA 4K9NA 2ATCA 4QICA 2H1SA 3LC1O 4QATA 1VHJA 2P2LA 4QFMA 1U2RA 1HPLA 3EXFA 4IEEA 4JP3A 3D4LA 1XALA 4JQYA 5J5VA 3TTWA 3RVPA 4MJ3A 5LBUA 4YUYA 5JCPA 1UZMA 2C99A 3FA2A 3GLKA 5EZYB 5TDHA 2VP4A 2WB4A 2F6RA 1OXBB 4KQ6A 4TL8A 4MQEB 3IXLA 4FEYA 3H1PA 2I67A 2C5GA 1CLEA 4RCYA 5C8DA 3MHTA 4BNDB 1MJGA 1RXUA 2BFPA 3A3KA 4R4JA 1EVLA 3V9AA 1X7DA 5IULC 3DQZA 4LC1A 2YW2A 2Z2ZA 1Q0TA 3H97A 5IJWA 1OZFA 2WUFA 4OKIA 9MHTA 1RBYA 4A8JA 4LHSA 4TYWA 2I66A 2IBMA 3M1LA 4IAOA 4D97A 4Z0NA 2GD1O 2P1RA 2I0FA 5CH5A 2FPMA 3V1NA 3H3FA 4MVJA 1JRLA 3LQQA 2G1JA 1CS0A 3T7EA 3LPDA 4CTKA 1DBPA 3CZAA 2DGDA 4YJFB 4C14A 3A6FA 4JXXA 2WJVA 2RFLA 2XR1A 4DQVA 1TW2A 2IELA 1IVNA 2GCEA 1IN4A 2FWMX 3A05A 3L0IB 3N2IA 4QDXA 3O2QB 1LLCA 2OO7A 1U80A 3DDUA 4WKBA 2EBWA 4DG8A 5KYGA 5AM5A 5B3AA 4QXOA 4C3OB 5C32A 3ZX4A 3H13A 1FJXA 5KINB 1N8TA 1ODIA 3BDVA 1UXJA 3GN1A 2OK8A 4IY1A 4XYEA 2HDNB 3AT1A 3ZDBA 5I9LA 5DOZA 2AT1A 3O8QA 2G08A 3JARA 3DEHA 1MOPA 1T5TA 3OVMA 5FO0A 1SU6A 4GOXA 2NZUG 4RDHA 3EUFA 4LYDA 3RJZA 1U2GC 3KDSE 5AW8A 1VE6A 4BKPA 3GDFA 2DE0X 1SC9A 1QGAA 4MV8A 1OWOA 1SD5A 3V8VA 4CLRB 3KHTA 4DNXA 5IF3A 1NUAA 1IM2A 1XFDA 2XCOA 1RZVA 3CH7A 3SICE 4LKRA 1PHRA 3Q2OA 2Q45A 1CUHA 1AA9A 4QBHA 3V33A 4BE4A 5BN3A 4HAVA 2K2WA 2FEAA 3OLWA 2MSKA 5C81A 1CUCA 2J09A 4L0DA 4V24A 4CFYA 2P2CA 2JKZA 4QWWA 4U3JA 2HFKA 2PU5A 2R2AA 1EI9A 3QU5A 4DG9A 4FM9A 4D80A 1DXQA 3PA6A 2UUAB 1H4SA 4B82A 1AB5A 2VTDA 3KSUA 3CG4A 3QH4A 4X6UA 2VCEA 3UMBA 3TTUA 4OLAA 3UMRA 1ZAYA 1EG7A 3F5FA 3HU2A 1USWA 2GVZC 3K9QO 4D1YA 1H1LB 3LF2A 2H08A 1UMBA 2C29D 2X0JA 4Q6WA 1STOA 3L9WA 4RZ2A 1CF9A 4IIBA 1IWPB 4ASUD 5AUQA 4QQKA 4BNJA 3A4TA 1JHAA 5BQ5A 3AEYA 4C08A 4XASA 1RLOA 4ALNA 3NV9A 2ORYA 1O89A 2R6DA 4KO8A 4ZGGA 1P5RA 1WSDA 5DHRA 2RGNA 4EENA 2V1UA 1AB6A 4YTEA 1XP8A 1XVTA 1L5SA 1G9XA 4CMCA 4QGAA 3IV9A 5ERGB 5JI3E 5GINE 2QA5A 3KALA 4CKZA 4QPZA 2WHPA 3KJEA 4UBJA 2Q5CA 1CNMA 2VHWA 4IJ5A 3CXUA 3K6SB 4RVSA 3S28A 3U40A 3S6JA 2R8PA 5EHGA 2NXNA 3N70A 1O94D 1K7SN 4J4BA 3IAUA 4YRRA 1CJBA 3O4FA 4HGZA 2HMYB 2ORIA 3LWZA 4YIKA 1ZBQA 3PTLA 3E2IA 4R1SA 5EIEA 3KYCA 4JEMA 1I1OA 1RFGE 2FV8A 2YJ3A 1U90A 3RRJA 1W5EA 2ONKA 2JL1A 1TQ2A 3EYAA 1PYGA 1N2OA 2JG3A 1M8KA 4QQFA 3UTDA 3OQVA 4QNRA 3PFCA 3RGWS 3EX7C 1JV2B 1UINA 1XTJA 1VYVA 1A69A 2KMLA 2A2ZA 2ZJ0A 3OEHD 3R3WA 5FL7A 1E20A 2NU8A 4LKOA 3PUZA 3DOUA 5CA1B 2YC4C 3X2SA 1A7UA 3EG9A 2J9FA 4GZ5A 3MD9A 2OLKA 4ZYUA 3K96A 3I8XA 1UK9A 1U3VA 2ZJ8A 4XWYA 1K4MA 1RC0A 1QQ5A 2D2VA 4J1SA 3BSYA 1UMKA 3UFXB 3WMWA 2OCGA 5CRIA 4CODB 3LHDA 3A9SA 4DZTA 3FHOA 3NS7A 1Z4LA