3L1VA

Crystal structure of gmhb from e. coli in complex with calcium and phosphate.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
182
structure length
182
Chain Sequence
b'SVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
molecule tags Hydrolase
source organism Escherichia coli
publication title Structural and kinetic characterization of the LPS biosynthetic enzyme D-alpha,beta-D-heptose-1,7-bisphosphate phosphatase (GmhB) from Escherichia coli.
pubmed doi rcsb
total genus 61
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l1vA00
3AR9A 5ALHA 3U13A 5ALEA 1L7NA 3ZWKA 2CFTA 2HOQA 2R8YA 1L7PA 4NFLA 5ALNA 2OM6A 2C88A 3ZVLA 4QQFA 3I1YA 4XE5A 1RMQA 1Z4NA 4ZEXA 2ZBGA 2B30A 3A3YA 3ED5A 3E81A 2WF6A 3MC1A 4H1WA 3R09A 3U19A 3I6BA 3ZVNA 4RETA 2X4DA 3WGUA 5AVUA 2PQ0A 5AM3A 1RQLA 2C9MA 3QU5A 3DV9A 2WF9A 2OYCA 4NWIA 5AVRA 2PKEA 4BX2A 3ZWDA 2ZBEA 2AMYA 4HGQA 4YIKA 3QYPA 3AR8A 4KYTA 5AW7A 5ALKA 1RMTA 2I33A 4UW9A 1EK1A 3MMZA 3PCTA 3N5KA 1U2SA 4I9GA 5AW4A 4UM7A 2P27A 3ZX4A 5ALJA 4OD0A 4O8CA 4Y2TA 3NALA 1Z4LA 3ESQA 3AR5A 3ZVMA 3E84A 3WKBA 3UMBA 1ZS9A 1U7OA 3OPXA 3KC2A 4DFDA 3SF0A 4UMDA 2YMPA 4CF5A 4YCLA 3FZQA 2YMMA 4EZEA 3L5KA 3L8FA 2YBDA 3QUTA 3L8HA 2AGVA 3QNMA 1WZCA 2HO4A 5ALSA 2JARA 2OBBA 3WK4A 5AI5A 2YMLA 4J2TA 1WPGA 1L8LA 1RDFA 4EELA 4ZEVA 3M9LA 3UMGA 2G08A 2I34A 2WF8A 3R9KA 2HHLA 3L1VA 4DW8A 5ALZA 5JJBA 2DQSA 1SWVA 1RRCA 2RARA 1U2TA 4RESA 5A3RA 3QUBA 3WGVA 3U7FB 3NANA 3QU9A 1ZOLA 1RQNA 3IB6A 1YJ5A 3F9RA 3ET4A 2YJ5A 4BNDB 4CNQA 2QYHA 2FPRA 4OFZA 4KN8A 2VKQA 1L7MA 2HDOA 2R8EA 5AIAA 5AK4A 3SD7A 3VAYA 3HYCA 5AI4A 3N28A 1S8OA 4QJBA 2JGAA 2IOFK 1L7OA 2NO4A 2FPSA 3QUQA 3AR7A 2B0CA 3FPBA 5AM1A 1Z4PX 4Y2PA 5AW3A 3AR6A 3QU4A 1L6RA 2ZG6A 4BBJA 4FFDA 2QLTA 2B82A 5AKJA 2RB5A 3AR4A 1LVHA 2CFSA 4JDPA 3KBBA 2P69A 4UAVA 3RFUA 3EF1A 3QU2A 5AVWA 3I76A 2ZBFA 3HLTA 1IWOA 2ZBDA 5AK5A 2EARA 3A1DA 3WK6A 3CNHA 3U7EB 3I28A 5IS2A 3U7GA 2I6XA 2ODAA 3KOOA 4BEVA 1Q91A 1ZD4A 4BEWA 3IRUA 3M1YA 4BYGA 1T9ZA 1MH9A 3FGOA 5ALWA 1U02A 2YFYA 1QH9A 4FYPA 4C4SA 2C4NA 2CN1A 4KNVA 2WHEA 3W5AA 3B9RA 2BY4A 3WK7A 5AHXA 5ALGA 3SLRA 1ZRMA 2B8JA 2IYEA 3N8GA 3S6JA 5AESA 1U7PA 4UARA 2G06A 1J8DA 1YNSA 1RLMA 1RKQA 3GYGA 1FEZA 3U26A 1VJ5A 1YV9A 2JAOA 5AKHA 4YCNA 5AVYA 4AS3A 3EWIA 2GMWA 2FDRA 4I9FA 4IFTA 4BNDA 2GFHA 3OCXA 1ZJJA 1RKVA 2NO5A 3FM9A 3L1UA 3N07A 2D2VA 4DCCA 2EATA 4Y3UA 1NF2A 2O9JA 4HYTA 1Q92A 2HI0A 4EX6A 3J7TA 3ZU6A 1N9KA 3AR3A 3WKDA 2P11A 4GIBA 3QU7A 1NRWA 5AI8A 3E8MA 3KDPA 2HF7A 3DNPA 2BDUA 3BA6A 4Y2UA 3NUQA 1RLTA 5ALTA 3WK9A 2CFRA 4Y2VA 3B8EA 1JUDA 3QX7A 2G09A 4BX3A 5AM0A 3L8EA 4PNHA 2FUEA 3A1CA 3L0CA 4YGYA 1SU4A 5ALDA 2ZXEA 5AW1A 2W11A 1YMQA 1NNLA 3MPOA 5AIBA 1O08A 2IOFA 5AM5A 3L7YA 4UAUA 4EEKA 3N1UA 1RC8A 4C4RA 1K1EA 2YMQA 3PDWA 4Y2RA 1O03A 4OHFA 5AVXA 4C4TA 3ZUPA 4DWOA 3DAOA 5AKLA 1VJRA 4IG4A 4HGRA 1ZD2P 5ALVA 5AM2A 1Z4IA 4UMVA 4XOUA 2G80A 3UM9A 3OCVA 3W5DA 4NV0A 5AW9A 4GXTA 4L57A 5AW8A 1YS9A 3RF6A 4CE6A 1TE2A 4MWOA 1Z4QA 3ONNA 3QGMA 5ALXA 1ZD5A 3ET5A 2MU1A 4JB3A 4F71A 1X42A 5T41A 3UMCA 4UMEA 3EPRA 3WK5A 2YN4A 4XQ0A 2C8LA 3ZI4A 5AKKA 3E58A 3SKYA 2G07A 2G1AA 4MUMA 5E0OA 1Z4JA 1Z88A 2P9JA 4HAIA 5AKXA 2W4MA 1RMYA 1CR6A 3EF0A 5ALRA 4BX0A 4UATA 2AUTA 3KD3A 2IOHA 1TJ5A 2B1RA 2HCFA 1T5SA 3BWVA 1S2OA 2Q5EA 5IT0A 3U7HB 1XPJA 4L6CA 2I54A 4CF4A 2JAUA 3OCZA 4E88A 1LTQA 5ALFA 5AVQA 3L0YA 3OTQA 4HGNA 2W43A 3ESRA 5AK6A 5AI9A 3FPSA 2YY6A 5ALIA 1QQ6A 5AKZA 1Z4MA 5ALLA 1WR8A 5A3SA 2AH5A 2B1QA 3NIWA 1QQ7A 3NASA 4HGOA 4UM5A 3ZW7A 2OA0A 1XP5A 3L8GA 4NABA 3SKXA 3L0BA 5AI0A 2RAVA 4UMFA 3TLMA 2FEAA 4KNWA 5AK3A 2GHTA 2YJ4A 1VFPA 4EENA 1YDFA 2EAUA 1T5TA 3IJ5A 1Z5UA 5AICA 1RKUA 1WVIA 3OCWA 3WKAA 5AVVA 4EX7A 2JAWA 1TJ4A 4YIHA 5AKGA 2GO7A 2FUCA 4Y2YA 3KZXA 2MSNA 1RLOA 5ALOA 3MN1A 3SMVA 3WK8A 1N8NA 2HF2A 1F5SA 4G63A 3WKEA 3SHQA 4OCZA 2HX1A 4CF3A 2IA5A 5AW2A 4KX5A 4AP9A 1QYIA 3AR2A 4F72A 5AVZA 3CZ4A 5AVSA 3W5BA 5AVTA 1EK2A 3ZTYA 5ALQA 4FE3A 2NYVA 2FI1A 5AW5A 5AKIA 2YJ6A 3DDHA 2PR7A 4YH1A 1SWWA 1KYTA 3QUCA 4NAVA 5AI6A 5AW6A 1QQ5A 1Z4OA 4Y2SA 3OCUA 4KX3A 4AS2A 4L6AA 2ZOSA 4UASA 2BDEA 1ZRNA 2B8EA 5ALMA 5AM4A 5ALUA 3QXGA 4ZEWA 2YJ3A 4G9BA 4UU1A 2FPWA 3K1ZA 3QLEA 2HEGA 3WKCA 1ZD3A 3R4CA 1Z5GA 2Q4RA 3FVVA 4B6JA 1J97A 2WF5A 5AKEA 3ZTWA 3A1EA 5ALYA 1TJ3A 1AQ6A 2I7DA 1Z4KA 5IT4A 3ZX5A 4XPZA 4BKMA 2I55A 4YCMA 3B9BA 4Y2XA 4J03A 5FP0A 2WF7A 5ALPA 2FPXA 5AKYA 2C8KA 1XVIA 3PGVA 2RBKA 2O2XA 4Y2QA 3NRJA 2FPUA 1PW5A 4Y2JA 1CQZA 3NAMA 2WM8A 3OCYA 3PGLA 3P96A 2R8XA 4UU0A 3D6JA 2WFAA 5A3QA 2GHQA 2HSZA 5AW0A 1RPZA 1L8OA 2Q4TA 4HGPA 2R8ZA 2G0AA 1TA0A 3W5CA 1Y8AA
chains in the Genus database with same CATH superfamily
4H4EA 5EG5A 2Y0PA 5H3LA 3AJDA 2P75A 1AGYA 1YB7A 3UMRA 4XYEA 1IUKA 5CUQA 3RRMA 1ZW6A 1NSTA 1A77A 4R1OA 1C2YA 2OK7A 1XQ6A 2Q8QA 3ANNA 5CA1F 4I3HA 1U9IC 2D13A 1JLKA 1YS6A 1ODCA 3IDQA 3GI1A 3ZH9B 5KPDA 4I5DA 1EJBA 3H17A 5C5DA 1PI3A 1QH1A 3B1YA 3T1YB 3MC1A 5DXAA 3TUJC 5L9AA 4AKEA 1ZLYA 3ZVNA 3M9WA 1J7JA 1SKAA 1UAYA 1O97D 3AWIA 3OTIA 4PX5A 3RAGA 5CM2Z 4MVJH 4BPRA 4POOA 3LK6A 2IE0A 4W9NC 4GOKA 1ACMA 4GMKA 4ZO7A 4YJ3F 4DQVA 5GONB 4IKPA 3UAOA 1G19A 1BKSB 2NQ8A 2WAMA 5IDQA 3FYHA 2DT5A 2JFFA 3H1GA 3PNMA 2GCEA 2H65A 2XMPA 5EXDA 2BEUB 3DC2A 3LA8A 3LOQA 5F4BA 5ADUS 5C8VA 2AMYA 2DYKA 2Z08A 2GFIA 1PS8A 4HGQA 3SNKA 1XMOB 2CNDA 3LFHA 1V0JA 1JA0A 3JQGA 3B1ZA 3H13A 3LV8A 3GGPA 2B1IA 5HKBA 3QVGA 1N5KA 4TLMB 2OV3A 4NMXB 3VISA 4DWVA 3EJ6A 4Q4JB 5L3VA 4LGMA 3GEEA 4MQBA 3V2UA 2OYSA 2VHTA 2PX8A 3MELA 4U2KA 4D9KA 2J0VA 3KTDA 4BVHA 3AUFA 4ND1A 4YDQA 2X2OA 4MROA 6REQB 3K6KA 1J33A 3ZHYA 8ABPA 4XSVA 1SUFA 4J0GA 2ZR7A 3E84A 3W34A 4OHPA 5FBLB 4K05A 1ZS9A 1DAOA 3U0VA 4DFDA 2B6NA 2H1FA 3LXMA 4JHLA 2B1JA 1R5NA 5IASA 2DBZA 3ZWWA 3WO0A 3G23A 3IBCA 3E82A 3PQFA 4GOXA 2YMMA 3NUZA 1ZR2A 1QH8A 3AUXA 4NBNA 4U5XA 3ZHOA 1B1CA 2F3QA 2GPSA 3QFCA 4EHFA 8ATCA 3U80A 5KNLA 3GUUA 4DMLA 1X74A 2WU4A 3N8HA 2XB8A 4LZAA 4LRTB 4DCNA 5BOSB 4DCJA 1PR5A 3VDXA 3HFJA 1OZFA 2QW8A 3VYUB 1SXJA 1WZCA 1PT9A 4HDNB 4FOOA 4XRRA 1AKRA 2OBBA 3T1QA 1YS7A 3NKLA 3L0IB 3MYYA 1R37A 1KJQA 2V8BA 4UZFA 1XGKA 3I4FA 4H27A 1RDFA 2R4TA 3EA0A 1EP3B 2XNHA 1HC7A 1QOZA 1W581 2F3TA 3R0XA 5IP5A 3VR4A 3R6GA 3FFWA 4OAQA 3O75A 1M7BA 2VAPA 1P17A 2RHMA 4HOYA 4KWTA 1D9XA 4XB1A 1T2VA 3QFFA 4RHCA 1JFFA 1G2PA 1SWVA 3GA7A 1MJGA 2ZJ1A 3GLHA 2B7LA 4R98A 5AMXA 3V7YA 5EP4A 1LI4A 2E4UA 1ZOLA 2QU7A 1PVOA 1S7GA 5IJWA 1T1SA 3MGBA 1UBRS 1J39A 2I5PO 2EBHX 4R2WA 4JHXA 3L1JA 4DUGA 2DULA 2GM5A 4BNDB 3ERCA 1C50A 2PYDA 1CS0B 4IVPA 3FKJA 2I2WA 3IDFA 3A31A 3QTTA 1SHTX 4ZAWA 3DLIA 3RH0A 3T7TA 3W7AA 5FFFA 3I39X 1FK8A 4LI3X 4RSRA 5FULA 5BNFA 3M70A 4BGIA 4DL9A 2NZYA 1B3BA 4BY9E 2FYTA 2HLDD 4KR6A 2PGIA 2O4UX 2H85A 1ISPA 1YZKA 2IOFK 5AW6A 4Q12A 2J30A 4QUDA 2AE2A 3CJQA 3NWBA 1RSZA 3AR7A 1VCHA 3QUQA 5E0KB 3V48A 3AI1A 5ILOA 2PCLA 3TW8A 1HY3A 4B6RA 1YL6A 1PN3A 3KNZA 2JS7A 4L5YA 3KK0A 1VPVA 2EFJA 2XNCA 1CIPA 5CCEA 3QLUC 2IT1A 4RSMA 4BQQA 2RI1A 4FDAA 4E0BA 2V0CA 3F6EX 3KT3A 3WGOA 2PKRA 4F21A 4HYEA 1UKBA 1QRRA 4OQZA 3HJTA 4A8HA 3L2OB 4L5JA 3CONA 2VEOA 3GROA 1SOAA 4MW5A 4QOHA 5C46F 5JCOC 2ZBFA 4QODA 3DZJA 2IWRA 1WEKA 2J6BA 3MTBA 4ZI3A 1G20B 4FWTA 3C0KA 3OETA 4ITUA 5LZ2A 1DT3A 3JWJA 1AY0A 1XKQA 2WSBA 4KR2A 1KC3A 1KMNA 3SSAA 3VOSA 3P0IA 4A7PA 4JIGA 2AG0A 4R1TA 3LT5A 4LWPA 4HDRB 3NIDB 4I46A 5JVDB 1SRRA 3KT8A 2LCQA 4ANFA 1UOPA 1EFRA 1N6OA 1QZZA 4WDRA 3UV3A 1XD2B 2ISSD 3VQTA 5IVPA 3FGOA 3ZW8A 5ALWA 1HO3A 4H3HB 3AB8A 4KE6A 5PNTA 1K7FB 1A2BA 3OIVA 4BJHB 1DARA 4ZEMA 2ONCA 2QM3A 4IJUA 4M8SA 1VZ3A 1J5XA 4H18A 4CJXA 3PP8A 1RZRA 3CKLA 2VK1A 2VNAA 3KZNA 4YMLA 3W5AA 4TQUS 3LX5A 4GSYA 4IGFA 3IAHA 4RJKA 1NLUA 2C2BA 2IYFA 3UPTA 3WXBA 2AOUB 3PGXA 3DXYA 4NYMQ 2UVPB 3G82C 3NWEA 5DM2A 4BC1A 1N57A 2PH3A 2ZAMA 2V7PA 2E5LB 4KDRA 3ZNPA 1BOFA 1FSSA 1LBHA 2J59A 1GUDA 2JZOA 1THGA 2M1XA 2QZZA 1OR8A 2X9NA 3PDIB 3Q11A 3ZN2A 4L0MA 4OLHA 1VJ5A 2W2OA 4LXIA 1F38A 2R66A 3KSBC 4TSRA 4HJRA 1Y5NA 3W2TA 3NTXA 2VSXA 1WA5A 5CPFA 3T4XA 4D6XA 4DLWA 2IH4A 4FYXA 3T3OA 3WTBA 3AEUA 1VCMA 1UAGA 2Q1XA 4EJSA 3D8NA 4DPKA 1SUAA 4YXFA 3N59A 1BMDA 2BFAA 1YCDA 1DEOA 5BOVA 3S55A 4JUBA 1U2PA 1KYQA 1VKJA 2VR1A 3R7AA 5F2OA 3EEBA 3WLOA 5I6DA 2DXIA 2REXB 1XXHE 1A76A 1SPBS 4XIIA 5EUQB 3SE0A 1JU3A 2R79A 2GETA 3SYLA 3MS2A 1XL0A 1OZHA 1J4AA 4HYTA 3IH5A 4RDIA 4HYYA 3TRIA 4MSUA 2LPMA 3SQWA 1RAHA 3HQ4O 4OIMA 2A14A 4E5UA 2CL0X 2JFHA 3MUFA 4L8WB 3Q8KA 1EIWA 3NH6A 1GL9B 4ZVPA 1NG9A 3BTSA 3KDPA 2W71A 3X1DA 2K2WA 1XVAA 1FQOA 3WK9A 2R97A 1D6MA 1SXJC 3U31A 2DWUA 4J1QA 3D8SA 1ZYUA 4TLBA 4NJEB 1ODIA 1YI8A 4BP9A 2W9XA 2HJWA 2FJ0A 4MQ4A 1BXGB 2HXSA 3M89A 4KXQA 3N7UA 3THYB 3PQ3A 7MDHA 2E5WA 4G0PA 2QLMA 5BV0A 3H2SA 3GLTA 2NV0A 2VVTA 4P7KA 1I3LA 3F5SA 3PIIA 4UDYX 5SICE 3JQ9C 4NICA 4Q4AA 2Q3FA 5C8YA 1RAFA 2X8BA 5T4BA 3WE7A 4BFCA 5FIUA 2O2JA 4MWTA 5DWVA 4C0JA 1N6PA 3B36A 4V2IA 4ZZ0A 5BSEA 4LZZA 2IOFA 5AJVB 5KJFA 4UAUA 3WJAA 2VWHA 4KR0A 4PSUA 5D3KA 4DG8A 4C4RA 3LP6A 2X0IA 1TPYA 2DFPA 1O03A 2EKLA 4DSUA 2C57A 2P3QA 1SXPA 1HURA 3WAJA 1QBGA 3I42A 1TDJA 3GJ6A 4ARVA 3Q9SA 3SZLA 2JIZA 4AY3A 4RV4A 1L4UA 4UMVA 1A7KA 1ZVMA 2G80A 3O2QB 4FZRA 4H0FA 4YJFB 1Y48E 5F76A 3VH3A 2BMDA 1JT2A 5A4DA 2W6NA 2G9ZA 2QNRA 3H2JA 4GXTA 4L57A 3OM1A 1I1QB 4UNRA 3HGQA 2WJJA 2OD2A 4PQYA 1I2MA 2R6AA 3I9JA 1CUCA 1V16A 1P62B 3FTNA 3LJKA 4E21A 1VSTA 5JOQA 3OJXA 1K88A 1DAEA 2NV6A 3ET5A 4KPFC 1NLFA 1X42A 5T41A 4EDHA 2PZ8A 4Q0MA 3WX0A 4YAUA 3OO0A 3RC1A 1GGHA 2GLTA 3HV2A 4HHEA 3PFCA 1PFQA 1R5OA 1ZCZA 8AT1A 2REQA 1TM2A 2YIDA 5AKKA 1ZJ5A 1LZKA 1RPAA 4KO8A 1H0KA 2MYNA 2K2QB 3HH8A 3ZUGA 4CM3A 1E4VA 3UWOA 2ZCUA 5LOVF 1CETA 1G8KA 3KR9A 4HZUA 4JBYA 3NEYA 2VJBA 2AI3A 2FN4A 4LYGA 1C1DB 3RS7A 1IEQA 3M5WA 4H60A 1Q17A 2MSWA 1IJEA 1K68A 3B13B 4WTOA 1DO0A 4N03A 5EINA 4AJLA 3K9CA 1K75A 3TVTA 5G3ZA 3ICEA 3HKCB 5EIHA 1R5JA 1C7IA 1S89A 3EWNA 1MOQA 4MO2A 1QOQB 5U9CA 5EMHA 1IM8A 1NW5A 1HH4A 1L5RA 3PEFA 4MKFA 4PGAA 4MQFB 1RIIA 1RBZA 5BSTA 3RYHA 3K70D 5EIFA 4Q3AA 2RMKA 3DMTC 4XVHA 4RVNA 2E6UX 4IUBS 4P0QB 1T29A 2W6IA 5IT0A 4OHWA 3JYQA 4DLUA 4I4TA 3OU7A 1VE5A 2J6HA 1Z2CA 2CNOA 2OB1A 1HF3A 3EGOA 1BWSA 2IYLD 4QBFA 1ONNA 4YRZA 4KYVA 1O6CA 4OPMA 4G1MB 4IIDA 1KAOA 3HXOA 3SAJA 3OT4A 4JI6B 3EQ6A 1U8FO 2XD9A 1EDZA 1S3FA 5AKZA 3AV0B 4S3MA 4AU1A 3IVCA 2YOHA 2EOAA 1NTRA 4X6UA 2A9QA 5LSAA 1GUYA 2QRGA 1PQUA 2VN8A 4C7BA 4GKVA 2GNPA 2OCLA 4JFRA 1U0EA 1E1CA 1NVDA 1MXFA 5GOTA 3DF7A 4AP5A 2FPOA 1Z3IX 5J5AA 4X7MA 4FYVA 3FCOA 1Z7YA 4LBYA 3SKXA 3WLQA 4ARBA 5AD1A 2QOEA 4O4HF 1FXUA 3BBLA 3FWKA 4YMSA 3CIFA 4BO2A 5LZ5A 4EATA 1CTQA 1AF7A 4V38A 4XD7A 121PA 4URUR 4JYZA 5ICCA 3AILA 3HN6A 3R5SA 3TB6A 2CFCA 4PNZA 3MWJA 5I7OA 2QLJA 1HDIA 4FFOA 1SN7A 1M6NA 1Y6ZA 4RLFA 4JI5B 5LWQA 1P5HA 4UNQA 4Y6LA 5IEJA 5DISB 3NIGB 1XQYA 5IKOA 4HAOA 2VFAA 1AX9A 2EFDB 2WAYA 2WWFA 2Y2UA 2VRCD 1VPEA 3AI2A 3TAUA 4BDTA 4S0XA 3L1HA 1E9CA 4LJ8A 3R7BA 1UKYA 1QDUA 3LKZA 1WNTA 1LS1A 1K89A 1V7QA 2VJNA 3V9AA 4YAFA 3O3MB 1MAVA 2O3TA 3LGXA 5SZIA 3RS8A 3SMVA 3P9NA 3DHNA 4WXHA 4B4VA 1KFEB 1KEEA 4AQ7A 1LWOA 3L6DA 2J8ZA 4JYBA 3KPJA 5LNK6 4H7PA 4EHLA 1LBSA 4JNCA 1FMLA 3EDYA 4R3NA 1PG0A 1YA8A 3IEMA 1NBAA 2BTQA 1VE7A 1VE6A 2FOXA 3RU9A 3DEIA 2VF8A 1J49A 1RRFA 4JYMA 2I91A 4G0XA 1ZZGA 2A57A 2YWDA 3VHLB 3QYAA 3SJZA 4GGPA 1JFTA 2F2TA 5KQRA 1I6MA 1OC2A 4IYRA 5JPDA 1T3SA 1CHDA 1AIPA 2GBCA 4NFYA 2HYDA 4IFIA 1SWWA 3ICWA 3HXTA 3I5XA 4JR1A 1GCUA 2W42A 2HADA 1CQPA 3PLNA 4G37A 4Z9BA 4YS6A 4ZV9A 4WNCA 3QI7A 4G41A 4C3ZA 1N36B 4GEGA 1AN0A 3FNHA 4LF6B 5LXTA 4GZLA 2PZMA 1MORA 4IWXA 2IXAA 4CBVA 3U37A 5K3DA 1Q11A 2DHDA 2PX3A 3FVQA 3IAFA 4TM7A 3BMOB 2IV7A 3GPDG 4HNRA 2X2PA 3CZRA 3D1VA 2A67A 1P0CA 4PCAA 4C08A 4REMA 2QN2A 2R86A 2G5GX 3FNBA 1TD9A 1TKCA 2C2YA 4UU1A 5CR9A 2D74A 2AVNA 5L40A 1IE3A 2CEKA 4D3FA 3AESB 3TGPA 1PJRA 1QKJA 2NT3A 1GVHA 2ATCA 2DBVO 2Y8EA 4G5HA 3A1EA 1U0LA 4ZO6A 1XWFA 1IHOA 1HKHA 2I1WA 3ENQA 4LNUB 5EIAA 9LDBA 4KH1A 1EAYA 1LV7A 4W4TA 4CEHA 2BMEA 2Y1CA 4C7JA 1FJXA 2KI5A 3BFJA 1DELA 2RKOA 4FN5A 3DZFA 2IL1A 1BVYF 1ETHA 4LX0A 1ECFA 3U81A 2WVJA 1P72A 2GJ8A 3KSMA 3L18A 3A36A 3MERA 3THWA 1HRKA 4KDFA 2C7OA 1T5OA 4KU4A 2JGEA 4BZZA 5I7VA 1U28A 4LXUA 4TUYF 1QTNA 1IN7A 4Y2JA 3I1IA 5DBGA 4QPCA 4EYOA 2WJ6A 1VTKA 4WCVA 1UFQA 4C21A 4N4AA 5DWDA 2QDXA 4Q03A 4O1HA 4XVQA 4DLVA 3F9CA 3JYOA 2I7TA 1AHIA 4UHKA 5B53A 1NATA 3N2ZB 3OLVA 2EC5A 1XB2A 4E32A 3TBFA 1YVEI 1BDJA 1G7RA 2Z9CA 1TYBE 1IOWA 5F3DA 8MHTA 4BNLA 1XROA 2O4CA 4G89A 3CUTA 3UMVA 3W1WA 2H54A 4WKCA 2VQ3A 4GMFA 4HPWA 2FE4A 3LUFA 3THOA 5CXXA 1RJGA 3MBKA 4F45A 4TTVA 5ITSA 1LRKA 5L6LB 2PL5A 1GWNA 2CUKA 3BXPA 5I3CA 3G2MA 5ICMA 2I99A 3DJFA 4QFCA 3GK3A 2WYUA 2Z6UA 4O1IA 3K0KA 2QW1A 4F86A 1N5MA 3FOEC 3EFBA 1Z8NA 5HZKA 1WOYA 1T2UA 5JXWA 3PQDA 2Y4NA 3AF5A 4HX5A 1D2MA 1DKOA 1DDGA 1E32A 1N2JA 3WGGA 2FN8A 2XZTA 3TRFA 4JSYA 4QGGA 3NDPA 1X39A 3H5IA 3JYPA 2BYTA 4MS1A 3JVDA 5K2OA 1J9ZA 4KXUA 1HNZB 1SUSA 5FD8A 4Z0TA 1CEQA 3WRWA 1ISHA 1Y1KE 3KD2A 2DBQA 4CR8A 4XA8A 3UFXB 2PO5A 1OI2A 2AJ8A 1M54A 3AC0A 4LKOA 4YPOA 1GR1A 3R7DA 2VF5X 3OO1A 4O5OA 1S4QA 2AEMA 2KS6A 1B14A 1JDUA 4I55B 5CVCA 2YW2A 2HMWA 3G89A 3OHMA 4EZIA 3G8YA 2GPYA 3SBXA 5EJ5A 3ZK9A 4WGFA 1X1CA 4L22A 3UICA 4P0TA 3JVVA 4GPZA 4EWLA 5J1SB 1HEUA 2WNIA 1I13A 3FB1A 5CT5A 4D0SA 2PT5A 1A7UA 3BEDA 5IW8A 1FJGB 5IEBA 2BMJA 1ZM9A 2CVFA 2FMIA 1A2QA 2OP0A 2QSYA 5FNVA 1XDUA 3KPVA 4HB3A 1V1MB 2UYCA 1J24A 4O4HB 1R0ZA 4J3JA 1V47A 3AY7A 3IXQA 5LZ4A 2JAHA 4Q01A 4OXQA 3OF3A 1DXHA 5FOSA 1YJQA 3I8OA 1K08A 4I81A 4YR9A 3GT7A 3JQ7A 2AGVA 3IP1A 4IJVA 3U09A 1U2QA 2Q6IA 1WCXA 2H1CA 4H6VA 1WETA 4H17A 3AEZA 1PR1A 1I0IA 5AI5A 3VZBA 1NW8A 4FS3A 3DKIA 4D3YA 5T4HA 2OQIA 1L8LA 1WXHA 5BSGA 1U2DA 4A6DA 3BM5A 5FL3A 4EJSC 4JXXA 1P1KA 1DOAA 5MGNA 5B1HA 1LSJA 1G8FA 5BN1A 3P0EA 1VQ1A 1LTHR 1QIKA 1YOVA 2M6KA 1FPMA 4LC9A 3VKUA 1KK0A 2DQSA 2QRZA 3FDJA 2FZVA 4U5QA 2ODEA 2FR0A 2HK6A 4K40A 3UA4A 4IUCS 2OEPA 1WZIA 4ZFNA 2H57A 2D7DA 2EGUA 3V97A 4Y1RB 4E22A 3LOPA 2XRZA 3G59A 3DKKA 2I76A 1L9XA 2YJ5A 3MTDA 2V55B 3PQCA 1Y3BE 4O02B 1JLLB 1SU8A 4OAPA 5JCZA 3EVCA 5EE9A 4E1AA 4EI8A 5IKPA 3WNQA 4H7DA 4I3FA 3DOOA 3QWHA 2Y1DA 3ZY2A 1BS9A 1KYIA 5B6JA 3W4JA 2ATVA 1CVLA 3IP6A 5DX8A 2DSTA 5LU8A 3MXOA 1S8OA 2C61A 1J5PA 1VSBA 2WWTA 4JJKA 2NO4A 2GF9A 4R1QA 3ZJTA 4FCCA 5BN3A 1F1BA 1TKRA 1AQYA 2HIGA 3STYA 1LFAA 1XLUA 3O4VA 3TKAA 2X0FA 3FLBA 3FSRA 1DE0A 4KHZA 2GZ1A 4DCGA 2LKCA 1QJ4A 1DFIA 1P5ZB 2WIDA 4H1TA 5BSMA 2WNSA 5LBTA 3M83A 2CE7A 2YV4A 1DWUA 1LVHA 3HPQA 3EW9A 4XXHA 1E1QD 4I8XA 3RFUA 3WIEA 4BRSA 3EF1A 4AB1A 5CA1A 4NF2A 3U61B 3C39A 2VUUA 3VTFA 4YCCA 4CQMA 4MR8B 3D6VA 1CCWA 1EFCA 3DKVA 4JLDA 4OHUA 5EPUA 3DUFA 1IWOA 3WL3A 3DXFA 5DNEA 3ESYA 4D44A 4EJMA 4DSOA 2EARA 1GGJA 4FIZA 2N1MA 2FF7A 3EGXA 2XI4A 3R5XA 2FN9A 1NLYA 4ZYTA 4TLDA 1H6BA 3CR3C 2W2LA 4OF4A 3FNGA 5HFNA 1ZZEA 3THXB 1YFJA 1Q91A 1UBCA 1XTBA 2QRPA 3DLAA 4HQOA 3M1YA 3V4SA 3A9CA 5EJ7A 3MXTA 1ZSYA 2GXAA 3ZC3A 4EKYA 3SHTA 2QG6A 4FYPA 2XTZA 2V98A 3ZJVA 2CVQA 3IPRA 6ADHA 4FGKA 3UAXA 1Y8RB 2V74B 4WVFA 4B83A 5IC4A 1CDZA 4E46A 2Q8PA 1A69A 2FZ5A 3FTPA 1ZHOA 3D8UA 3C3WA 2WFMA 1SKQA 4N9QA 1TW3A 5NULA 4BCBA 1QO0A 2JGFA 2Y71A 4NCXA 1RXCA 5IF3A 1D6SA 1E98A 1NQTA 1NRIA 2WU3A 5E7IA 2ZP1A 1SG0A 3WK7A 2PZBA 2QHXA 3ZIAD 2ZZNA 1NBHA 4ZHQA 2GYUA 4L27A 1PR6A 3FPKA 1A4IA 3Q1LA 4YJKA 4D8YA 4HDRA 1W73A 4CV2A 1PNRA 2XITA 1W52X 2G06A 4MWGA 4OBEA 2M1ZA 4PFQA 2I2FA 3WBJA 5HNKA 5A6SB 1AUOA 5JC1A 3EEOA 3ICCA 3AEKB 4M7OA 2Z58A 3TECE 3KHKA 1KIAA 1QLWA 3HDJA 3JW8A 1TL7C 2X9QA 2Q50A 3P9CA 3Q3HA 4YRBA 3R6LA 1Y7PA 3RSQA 2OC4A 3THSA 4M8LA 2VQFB 5I9TA 3VI4B 2CLLB 2FWJA 3M9XA 3CSDA 1YJAA 3ADKA 3CZ5A 4ENUA 4B3GA 4GI7A 2CXOA 3BCHA 1IATA 3L8YA 4GOLD 4LAFA 4FHEA 4Q9JA 3NWOA 5T8KC 2GMWA 4Q34A 3UH0A 4H59A 1N3IA 1HWYA 4R41A 2JGMA 2PBZA 4ZGWA 1FSGA 3C3EA 1D1TA 2W4QA 2GQ0A 2VXCA 4ZCMA 5G3YA 5FA8A 3F6YA 2G71A 5IFLA 2DY0A 1I8TA 5E6UA 5AHRA 2Q5HA 1QHXA 4MEBA 1FLDA 5TQ2A 1YVRA 2X58A 1NE2A 1QK3A 3WNVA 3E03A 1Q0HA 1H2YA 1JVBA 3A8TA 4BLPA 4C2BA 5JZSA 2BGWA 1KXJA 4HAXA 3RTEA 1Z13A 1PFGA 4OAOA 4YQFA 1U7DA 2HCJB 3WKDA 1G21B 2J9RA 4LRWA 5I9LA 3R3VA 3KVVA 5FEMA 2P3OA 3OZSA 1WTAA 2ZRNA 1PFKA 2PT6A 1M2OA 1KQOA 3IESA 2DY1A 1GCGA 3A1UA 3T5CA 5KYNA 3VPCA 3W8NA 3TM5A 4AKTA 4CCWA 1BQ4A 1I33A 1RI2A 1YFZA 4M9QA 3DVRX 2R6DA 3LXXA 5C9ZA 5DCUA 2B0JA 5AM0A 1WNFA 1BYUA 3S1AA 1DMSA 4ENSA 2QAGA 3A1CA 5A02A 1E5LA 4XM2A 3T0IA 3SNHA 5JY6A 5C5CA 1SU4A 3LHDA 4IEIA 2B5OA 4NZZA 3WLPA 1N3LA 3GVXA 2F90A 3OZBA 4X62B 2I67A 4Y6PA 2CF5A 2I3BA 4OXRA 1V4NA 3MPOA 3S27A 1E5XA 3UO8B 3W77A 4YUXA 1GDHA 3ZD7A 3L7YA 4LTMA 4PC1A 2OLKA 2Q5QA 4LZNA 4HT3B 1XN1A 2WTEA 3T1VA 1D2GA 4BB6A 1GTG1 3BORA 1DAFA 3UT5B 3ELYA 3I32A 4YQYA 2I6FA 1ZXXA 2L0XA 2PU7A 3NW9A 3VNSA 4DTIA 2VHUA 2VYFA 5HYVA 2VYCA 4O29A 4GWLA 1KO8A 1UMDB 4IOLA 4I2NA 4XARA 3W05A 5DHUA 5K6TA 1YRQA 3OH8A 2OZEA 4KR9A 3FTFA 3G9UA 3RVOA 4D4JA 3ANLA 5AVOA 1EUZA 4G8BA 1A27A 1NDHA 2QB5A 1OPXA 3JD0A 5EOVA 1OKKA 5AW8A 3RSZA 3NB0A 4PLVA 3FUCA 5CMLA 3VHXA 4KUHA 4HNUA 1Y6QA 1Z4QA 3BK2A 4BKRA 4F8JA 5IVKA 3K0AA 5ALXA 1IUNA 1IJKA 4F71A 2WNHA 2XB6A 2XIJA 3ISTA 1IDOA 4JLSA 1MIHA 4RFSA 3ZQKA 4C0KA 4F3NA 2G4LA 1YDGA 3A9WA 3QBJA 4JP8A 4K26A 5CM8B 1E18A 4TTQA 4B3IA 1HDRA 2J07A 1XEXA 4TVOA 3RRBA 3VPHA 4OGFA 1O9GA 4OMUA 2ZANA 1Q83A 1QHFA 1NVKA 4ENQA 1TTHA 1WXIA 2H16A 2HA2A 4N6NA 3UMJA 4G0QA 1Z4JA 4UTPA 2MTBA 5F98A 4XQCA 2PVSA 2Z04A 3UB4A 3H9BA 5F7XA 4W9MC 2FVXA 4DBVO 2ZE8A 1Q77A 2DF8A 5IULC 1LTKA 2V1XA 1AJEA 4X3CA 3IV9A 3ZDFA 3B8HA 2HPZA 1ESNA 1ZSVA 3FMGA 3PA8A 4PR0A 5ERGB 5GWXA 3RTGA 3JALA 4F11A 1RWKA 1Z45A 3PUZA 4CV3A 5MGBA 4KVGA 4TRNA 1RVDA 2CL7X 4UATA 2WUEA 2XECA 1C7RA 4P5EA 4UNIA 2QVXX 1IB6A 3CVOA 5AOCA 3V46A 2FGKA 1L7AA 3NOVA 2XTJA 3KQSA 4WLVA 1W1WA 1PT6A 1X92A 3GUZA 1YR2A 4NU6A 3BGOS 3BIOA 3H7AA 2ZRIA 1ODSA 1XDGA 5ALFA 5DTEA 2WY2D 4GWGA 3OZFA 3NORA 3DFZA 2YS6A 3NYIA 4M60A 3OM0A 3U3OA 4R54A 1JSZA 4G8JA 3CVUA 1U99A 1UIMA 2ZUSA 1KAEA 1XD9A 3GOQA 1LNQA 3IB3A 4TRMA 4PZPA 4MVYA 3MS7A 4ZT3A 3ZBQA 4LVOA 2OUIA 2YYZA 1ENZA 2AH5A 2P9BA 5JEEA 1BVHA 3FKSD 4R81A 1KK2A 1JQLB 2LNDA 2WOOA 4KR3A 2OVBA 3CF0A 1R0YA 1M0WA 2ADOA 1E62A 2C4WA 3QPCA 4ZVVA 1IH8A 1OGJA 2PNFA 3O74A 3H0CA 3IHTA 4UAJA 1AUVA 3EPPA 3L8DA 4UHHA 2BHSA 3Q85A 2F3RA 2OGZA 1JH8A 5FBRB 3QW2A 1BWQA 2BE7A 5HA5A 3IHWA 3IT2A 1UXGA 3WGKA 4ALIA 3T61A 4YC7A 4EO7A 3WLIA 5K8UA 1JZSA 1PJBA 2OAGA 5ITZB 5AK3A 4RM2A 2VBIA 2UYOA 1T5TA 4I5IA 1E2QA 3GEIA 1W9MA 2SCUA 4FZ5A 2GA9A 1T36B 2NVUA 4HGYA 2GK4A 3R5FA 5FQNA 7MHTA 4MRAA 2HDWA 1C7ZA 1WO8A 1XQWA 2BLLA 2GM3A 2I65A 2Z2JA 3D1JA 2AE1A 4FFRA 4DRXB 2H7VA 1GV0A 1GL7A 3C3CA 5A4KA 4CKEB 2ZI5A 3MJEA 4BWGA 2Q45A 4KI7A 4HI0E 3R3WA 3MN1A 3AL2A 1LNSA 3OQ6A 2JANA 3AIMA 4MW4A 1WZEA 4BLQA 4LRQA 4OK3A 3CH5A 2VHVA 4HNHA 4DGQA 5TF4A 1NV8A 1AMUA 3OIFA 3IKJA 1VC2A 3KJQA 1G20A 4JBHA 1BDIA 2HFKA 5F77A 1RTKA 4L4ZA 5CDSA 5K3AA 4AROA 1VIAA 1BU8A 1WY5A 2CNBA 3CE6A 3H8JA 2AJCA 5DTMA 3UYLA 4R84A 4XKJA 2WB2A 2ZDQA 3P5SA 1HL3A 1K5PA 3RU3A 5CHEA 10MHA 2HWYA 4WWHA 5AUQA 1D5CA 3KR0A 4PLFA 5A9SA 6ABPA 3RCBA 2CMFA 3WRXC 3PQ5A 3IV6A 1WZNA 1PDOA 3LY8A 4DAEA 1L7RA 5C7LO 4HN9A 3FAKA 1T8PA 5JRZA 4JQYA 4YRLA 4BB0A 4DLXA 2GR9A 2VHWA 1NZJA 4IVNA 3RTDA 1YH3A 2CJWB 1L8AA 2R68A 1D09A 2BM8A 1Q1BA 5L95A 5GZ6A 1OWOA 1P2DA 3IJRA 2V7VA 4R0NA 4X97A 4GL2A 1HTBA 5KWIA 2IYQA 1M0EA 3GUCA 1QQAA 1DEXA 4LGCA 4D7AA 4DILA 2D0DA 3ILHA 1Q84A 4OGKA 3DOIA 2ZRCA 3GYBA 2X5XA 3FVVA 4R51A 1E3LA 2P2DA 5TDHA 5K6RA 1GPYA 1GR0A 2GJSA 5DLQC 3ZTWA 5ERXA 3HN2A 2P9HA 5EIBD 2NP6A 1GCIA 1K3TA 3AU8A 3VOTA 2D0IA 1H8HD 1VHWA 3B1FA 2FUKA 4WFJA 1WMEA 3DWFA 4XPZA 2BBWA 1I3OA 1MHPA 3K4QA 3OFJA 4FYJA 4Q9AA 4RA6A 5DEIA 2V96A 3SYTA 2OCDA 1FS5A 1HNXB 2VPIA 4XR9A 3U3KA 4CVNA 3MA0A 1W5SA 1MF7A 4AW9A 4P38A 3O6VA 4I5EA 3UUGA 1XVIA 3VV2A 4PZYA 2XE7A 3BUSA 4YCSA 4EM6A 4R40A 1CE8B 2RHCA 3L43A 4ZCQA 2NXEA 1OFHA 1EX6A 1V1RB 5FBKA 3VNAA 5L7TA 1TVCA 1CQZA 1NVBA 3GL9A 2CVOA 3DFIA 1I7LA 3L0DA 3P96A 5JDCA 1Y4UA 4ESHA 2XWPA 3BC1A 3IKLA 2JFGA 4IMPA 4JLUA 2GHQA 1K6EA 4JEHA 3IMCA 4OUDA 3ZGXA 4B9EA 4B71A 4D79A 4HBZA 3FDZA 3BGSA 2IKSA 5LP6C 2OYRA 3K0SA 2OBMA 1Z82A 2I22A 3CW8X 4JP5A 1W93A 2QA5A 4Q02A 4Q3DA 3C5HA 2PBRA 3VFDA 3AR9A 4AICA 1QE3A 2I2CA 1E5TA 4FR0A 1FNNA 3L4JA 1SEPA 3M1LA 3ZCPA 2PYZA 1JEJA 1KH2A 1TTPB 4OQQA 1HLFA 2JBHA 1FUIA 1L5HB 1ZRSA 2IXFA 1TCVA 1J09A 3H8VA 4QE3A 5IUKC 2C88A 4KXNA 4EUEA 5CB6A 1QPBA 1N5OX 4N40A 4YRCA 4F4DA 3E9DA 3UK2A 2B30A 4K2AA 1PAUA 1UBUS 1H1LB 4OUKX 4TRJA 5F7OA 4G97A 2IBMA 3L7BA 2G1JA 3U19A 4HTAA 1ZUHA 4FZ3A 4DIEA 1KQPA 1RHJA 2BFMA 2PLFA 1Y8QA 2ZAGA 2ZW9A 3U39A 4D9CA 2PQ0A 3LY7A 1ZH0A 4TWBA 1R4AA 4NH0A 2RJOA 5K99A 2OV1A 3NFYA 1GG2A 4M9ZA 4LDNA 2P30A 4N0MA 5KYXA 1W5FA 3JQ6A 4IIUA 5K4HA 4E5VA 4LVUA 1AS0A 2NU9A 2BL4A 4FCTA 3W8EA 2P9FA 3INYA 3BMQB 1E66A 2VP4A 4DA6A 5E2BA 1N7HA 1VZ2A 4P54A 3LYLA 2I4MA 1SXJD 1TJPB 1G8SA 4HWKA 2Y0DA 3A0RB 3HC7A 3LC2O 3B7GA 4F92B 1UC5B 1KPHA 2WZQA 4NULA 2ST1A 3I0MA 3JZAA 5G2OA 1BX1A 4WBNB 1T4CA 3EG9A 1H23A 3EXHA 4IMRA 4U2BA 4UM9B 1JG2A 3FI9A 4FDLA 3AI7A 3N2IA 3LDGA 3UKJA 2FPIB 4ODIA 3R20A 5A62A 1PEAA 5IMSA 2I6UA 4LDRA 3W90A 2R96A 4UTOA 1IONA 4WESA 3L3BA 3ZVMA 1Z4LA 3IMEA 1P2UA 4RORA 3RS9A 5KQLA 4LHZA 4U0KA 1AV7A 3PYMA 4G0NA 1T9KA 2W2MA 1IU9A 2XGOA 4M1KA 3SF0A 4DLTA 2RHDA 3HCCA 5HQJA 3OCCA 4JB8A 1AZTA 1D2AA 2BFDB 2K6GA 4PANA 1ZRHA 3AHJA 1AN9A 5EJEA 5TQ0B 4FGSA 4DA4A 16PKA 1C9EA 1QHHB 2AYXA 2FRDA 2HCRA 1GZHB 1ZGCA 3NTQA 4ZOEA 1F17A 2HTFA 2VP9A 1DIGA 3LQQA 2D2IA 2PS9A 2FHPA 4OSOA 4TL6A 4NOJA 4TV8B 1JAHA 2FFJA 1KHTA 3KKQA 4LYAA 1BKYA 5FBHA 1UPCA 1WW3A 1YQEA 2A78A 4KZKA 3OECA 5ARCA 3USCS 4CKBA 4Z9YA 3TXXA 1O95D 4C6HA 1LPAB 1SK9A 1HL7A 2I34A 2ZJBA 2D1FA 1GA1A 1EWKA 1VB5A 2VDUE 3GRZA 3RWBA 1LDNA 1WZ2A 4L85A 4MIYA 2HW8A 1O95C 2QT1A 3LQ2A 4TPKA 2RI6A 2F55A 1U2TA 4KWEA 3S1LA 5KKCA 1KIMA 2PHZA 2AHOA 1Z2PX 2R60A 3BB3A 3KB8A 3LM8A 1I1OA 4D4GA 4JNKA 2H52A 2DE0X 3GCDA 4I55F 3ET4A 3PPWA 3RIYA 4CCSA 2XOEA 4OFZA 4BFWA 3DVLA 2XJ4A 4I14A 1OI7A 3IGFA 1CJVC 2QTVB 1ECJA 5G4LA 4CLDA 4EUSA 5L8VA 4QULA 5D51S 4DWWA 1ADFA 4G0UA 4E4RA 1S5PA 1T26A 2FZWA 3ASZA 5DHQA 3MUEA 4G5RA 5B6IA 2ZBQA 1NVFA 5A5FA 1WUYA 2GTIA 3FYUA 5EE5B 3SHWA 3WYBA 5K8VA 3BWYA 2ATIA 3B1WA 4JVMA 3ETNA 1XNQB 1OLXA 2CFIA 5GONA 3WNCA 3S5UA 2Y1XA 4YREA 1WX1A 4DCPA 1KA9H 3T12A 1B8VA 5AJXA 4EK9A 4KO4S 2Z2XA 1JLLA 2HMYB 2J7PD 3DF9A 1G5PA 3O0DA 4M9RA 3WGTA 2CFSA 4CDNA 4R71A 1XVUA 4KAJA 3RSLA 4HBGA 1PT7A 5IK2D 4L4YA 2B4QA 1EHCA 5J58A 4RTOA 1V3TA 3UHOA 1PEDA 5HOEA 4BRZA 4RDHA 3HP4A 5H4GA 1YZFA 4J7UA 3SFVA 1ZONA 3C85A 3GFSA 3GH1A 3IUEA 1M2VA 4J0EA 3T54A 3PU6A 3V33A 2XMZA 3K16A 2L17A 3AY3A 3HJFA 2HBQA 1E9BA 1JDJA 3BJIC 5C4GB 2Z4RA 4UVGA 5JO0A 4PVCA 2VXBA 3SG0A 3DPSA 1ZD4A 2RFLA 2VTDA 2CHVA 1DWQA 1W9HA 2XVAA 1VL2A 3X1JA 1KEEB 2GSWA 4BLRA 1F2UA 1NN1A 3RRJA 4HFJA 3DWIA 1NR5A 1WVMA 2BUBA 3ZGLA 2YZ7A 5H7XA 4HNVA 1OCEA 2BY4A 3FYUC 4Z1MA 4QUHA 4UOEA 4MCJA 4UXHA 4GDFA 2ON6A 4ABTA 4KXYA 3RARA 1I3KA 2VDWA 1B8OA 3Q88A 3GJ8A 4CMHA 2EG5A 4JI0B 3H04A 3WQRA 1BEEA 2ERCA 3HRHA 1N9GB 4IV8A 1YXMA 2VBCA 4FGUA 4X8HA 1TC1A 3UJHA 5LIPA 4I9UA 1XZDA 5C4IA 2GO1A 5DTQA 2AR9A 3JATA 4IIVA 4YRTA 1KAHA 5E1DA 4KIGA 1P4HA 2QPLA 3QEOA 5F33A 3DG9A 2DG2A 1JFFB 1M1ZA 4DB2A 4Q1CA 4AS3A 5HW0A 2XTNA 3EWIA 1A8SA 4Z5XA 3ZLTA 1HSZA 1Y1SA 2RGRA 3B52X 1KI9A 5ER6A 1EZ4A 2C7RA 3FFBA 3WBFA 3HCDA 4BMZA 1UMBA 4BNDA 1N0VC 3IP7A 5TEWA 4D3XA 3PFBA 4LDJA 4S0ZA 3TCXB 2GBIA 4F4UA 1NUUA 3U7QA 4FGZA 1Z17A 1MEJA 2XVXA 2YFHA 3K9NA 3KDAA 2BFPA 4LC1A 2DFNA 5FV7A 1GSIA 1SXQA 1QP4A 2HH9A 1JAXA 3ZD8A 4HNSA 1PR4A 2WV9A 1JSXA 1FU8A 2QTAA 4G01B 3OAAA 3VO8A 1SBIA 1NF9A 1FXSA 2ZTSA 4J4TA 4JROA 4NZ9A 4AMBA 1N34B 4J29A 1C9YA 2GVDC 5AHKA 3UK6A 3MJSA 2I0FA 1I2CA 4MCHA 1IWBB 4CKCA 1LXCA 5DNAA 3K32A 1X2BA 3DYBA 3OLZA 3F96A 2W2TA 1OX4A 4FE7A 2PMDA 4U4AA 1G8PA 4K6FA 4TS4A 4OBBA 3A1NA 3TQRA 1ARZA 4FYYA 4D4MA 4PHTA 3IMGA 1PDWA 1N77A 2DQZA 5IZCC 2H9YA 4YY3B 3RK1A 1MO6A 4G5FA 3WB0A 4BASA 1GLGA 4GNKA 4FR2A 1XAIA 4K87A 3WL6A 3OIGA 1LF5A 1IULA 3LP5A 4B84A 1VPDA 3J80A 5JY1A 5A3JA 5DM70 2ERXA 1LKZA 2WD7B 3HI6A 3GUYA 4P5PA 4EHNA 3ETCA 3ZIDA 4A1OA 1OH8A 2NTNA 2JBAB 1L5NA 2Q0HA 1TMYA 1PX2A 4MQLA 4D25A 2IYSA 4JBGA 4Q9NA 1OU4A 3HJBA 2X22A 3L02A 1VJRA 1Z33A 4KRYA 4RIFA 2ISQA 4GYWA 4MKGA 2IOYA 3H97A 5GGXA 4AK9A 1VHLA 5A5VA 5FPHA 3LLUA 4CTKA 4MGEA 1XLTC 4IV5A 4WNIA 1Y8CA 2NXNA 5IRCD 3K70B 3ZDXB 1R3DA 2QYTA 4FBMA 3VDRA 3C4QA 3KXLA 4AKSA 3PXCX 5CYOA 3LECA 4IH1A 1X7YB 4PX3A 5JTTA 2VJMB 1XNGA 2FMUA 1PGOA 1G2IA 3AX6A 3OBBA 4GI1A 4NK5A 3W0LB 5BWNA 4PZEA 2XYQA 5DO9A 2MU1A 3OFNA 3TRHA 3FPGA 3DXXA 4JLWA 4YWJA 1DI0A 3CEPB 1L7QA 3TFOA 4ARCA 1NFRA 4WY5A 5BR4A 1TM5E 4OOFA 5JAQA 3ST7A 2LDBA 4S24A 4OO3A 2CBXA 1NM5C 5KMGA 2JW5A 4F2DA 3RLIA 4H7KA 1V7ZA 3UFXA 3FTCA 4D96A 5FWNA 2PCJA 2RG7A 2JEYA 4IDPA 3OU6A 1H8HA 4RMIA 3SLKA 3ZS9A 2QMHA 1WHSB 3FZGA 4MINA 4QUKA 4XLTA 1NJ6A 1QVAA 4AKGA 3DEZA 2HQOA 2GAJA 4JCCA 4Q4AB 4TXHA 3B85A 2ZKIA 2G7MC 4EY5A 4UC0A 3JQAB 3K0AB 4LSZA 5DHFA 1NVGA 5CBPB 2B4AA 4RJTA 4KBFA 2XUAA 4HH3C 3RD5A 2SECE 3IP5A 4HMPA 4RTQA 2BM0A 2ZI9A 2J0UA 3GPLA 2XEXA 1JFRA 3IA7A 5IM4F 2G8NA 4P4SB 2Q5EA 2BFBB 3D1LA 3VH2A 4XUEA 1VBFA 1Y5RA 1CUGA 1RR6A 1AKEA 2R87A 1UJMA 2ZVQX 1I01A 5IAEA 4CF4A 2ZUBA 1T9DA 1PQ4A 4XX0B 1P9RA 2VT2A 2GTPA 2UVQA 3BBPA 1K06A 2C4VA 4KP7A 3LF1A 3ZDEA 3DMFA 3EVGA 4PZLA 2FMTA 5E1BA 3H11B 2X5JO 3W06A 1OAOC 2KLBA 3NBYC 4PO8A 2LKDA 2IW1A 2NLOA 5MHTA 1RM0A 1NAHA 3ESXA 5LM3A 5KC9A 1GRVA 4KLCA 4LJLA 5H81A 2ODQA 1E3MA 1EJ6A 5ALLA 3KEFA 3M6AA 2QSJA 3NT5A 4KFUA 3FDXA 2IWHA 3R44A 3JV7A 1JBQA 1ORRA 1U4SA 3TM4A 5C53B 3H5WA 2ZUEA 3VTKA 4O08A 1QF9A 1T5LA 1GZVA 2YNMC 3RC7A 4NCAA 4AJNA 2XVMA 3RKRA 2W6ID 1DQYA 1PG2A 3OFVA 4A8JC 4D98A 2AQIA 5J5VA 4YRNA 5EZYB 3AUUA 1CZHA 1VKHA 2FOIA 4YI3A 1W0CA 4PYNA 2D2EA 3D4NA 1J8MF 2L69A 2VNSA 4X8MA 3HCPA 3O31A 3S44A 2OBXA 3LD9A 1KJJA 3ZWCA 2YL2A 4MZXA 3TKLA 2WJGA 4KW7A 5TVGA 1VFPA 3ESAA 4EENA 4FNGA 1YDFA 3NHJA 7ADHA 1U8TA 4B76A 5JNLA 4JOCA 1ZUWA 4YAWA 3CH6A 1VG1A 1A4RA 3WGMA 4UDXX 5K0CA 3RVRA 3QPUA 2GPBA 1OYOA 2NUBA 1HQKA 4C7KA 3HBAA 2OO7A 3WGNA 1FFXB 1LJLA 1YBFA 3D2CA 1A50B 4CIAA 1KEVA 1HOTA 1ZCFA 4I4LA 3W5VA 1ESCA 2PWZA 3TAXA 1EHIA 4UPDA 5F2EA 1A5TA 4HPXB 1FYVA 4NL4H 1FTGA 2NSHA 3KALA 4N6GA 1Z62A 2UU9B 4RVSA 3VZPA 3RRFA 3R2JA 1XRRA 4HLCA 2DKOA 1Z0AA 2F1HA 2GK6A 1E60A 1V5EA 2QTTA 2ID9A 1B15A 2P3LA 2Q3MA 3IKTA 3OHSX 4JYPA 3TQTA 2WFZA 3X2EA 1H9AA 5JSQA 3WA7A 2JL1A 1CUFA 4QNRA 1RIFA 1U80A 2ORED 2HEIA 5ECGC 1M2NA 1RQ2A 1EXNA 1ORDA 2W5UA 3HVHA 3O21A 2LD4A 3G0GA 2BD0A 4YDSA 1LV8A 5LOVB 2V9CA 1K63A 1K9VF 1F3OA 1U6KA 1W35A 4GSLA 3AF2A 2A1TR 3UQYS 5HJ7A 1PWYE 1OGIA 2QQ0A 1P8JA 1TI7A 2Y4OA 3PGMA 2FW6A 4CYMA 2B21A 1FDSA 1T9CA 1ML4A 3H5VA 4MDYA 4MVJE 2NMVA 1O0BA 5D8DA 1N1MA 3GLSA 4EKDA 1E4EB 1NJ1A 1C3JA 2ZJZA 1ZHHA 2HWUA 3COPA 4Y1GA 4DMKA 5BUSA 2G88A 1ZRNA 3BGDA 1ZJ4A 2JIOA 2R5NA 4US1R 1O58A 3JAKA 3T5TA 4FGJA 3RJZA 2YV1A 2ZYAA 2Q2OA 4AT1A 5ALUA 3HI4A 1FRNA 4FHDA 4K9OA 3KWMA 2VF7A 4TMWA 5H59A 3N7AA 4UBJA 3O84A 1NIPA 3F6SA 4RKYA 3RTAA 2P9GA 3PHLA 4KWIA 4EIWA 1BG6A 4U2GA 4JQCA 1AK2A 1FMJA 1JQKA 1YAHA 2PU5A 3C1UA 5DM0A 4XWKA 4AJOA 1P1CA 2WRZA 1WMBA 3LHFA 3WP1B 3EBOA 2W2KA 3CNLA 3NCTA 3D5QA 3KYDA 4JASB 5IT4A 2R1ZA 6PFKA 3KQLA 1A0OA 2ZYHA 3C3PA 3MTIA 3ITEA 1VFNA 3RAEC 1SVLA 3TSOA 5ABPA 1T6ZA 1H42A 3MRXA 3QWAA 2C4HA 2OK8A 4YLYA 3H3XA 4H7HA 1DBIA 1GG9A 5LWHA 1N33B 2DFVA 2I6TA 4MRVA 2O2XA 4WZAE 3B60A 2OZPA 3R41A 2VS1A 2YJTD 2O8EB 5I45A 2AG5A 2YVKA 1YUBA 2QN9A 4ZVSA 2ZJ8A 3WZMA 2FUG1 3R23A 2A92A 5EXSA 4NE9A 4ZALA 2QUJA 3BJMA 2H17A 3ENZA 1BGWA 3GJQA 3E2PA 2UZAA 3U7JA 3SQXA 4B3TB 1KYWA 4UD2A 4O2AF 5CT6A 1Q0LA 3JYLA 1I4TD 2DHCA 4GPD1 4BVJA 3BFVA 3CQ9A 1ZIYA 3HACA 4OA5A 4QUAA 2IOQA 2DVMA 3VO9A 2OTCA 1XI2A 1O0CA 2IS4A 4AZ3B 1GKUB 5CLIA 4P7GA 4INPA 5T67A 5CEJA 3GFBA 3S2IA 3NXKA 4FBLA 4LDPA 5BXYA 4E94A 2H29A 3LU1A 3ONDA 1E9FA 4MI9A 2CVPA 4IX1A 4O2AB 2IYAA 1EINA 1ZC3A 1HFJA 1E9DA 1ZKMA 2MYPA 4K8OA 2CVHA 3GH3A 2K7FA 4JLJA 4LRUA 2P9ZA 1JN0A 1Z06A 1NN5A 2AG6A 2QI9F 2ZT7A 3EE6A 4FHZA 4N8DA 4ETMA 1D07A 1VYHA 2JJ8A 3NHYA 2X4DA 3ITKA 4ZU6X 4ZYWA 2AL7A 5LYJA 2ORYA 1TQ8A 2OR3A 4F7WA 1I3NA 1RWOA 3AZQA 1NOJA 2C3PA 1RZRD 3DJYA 4PZAA 3ISJA 4RPKA 5THQA 4L76A 3GQBB 1COWD 4MVCA 1R0RE 1ND5A 5K0SA 1E2GA 4X0EA 1ZGHA 2PKEA 4BN4A 2RGWA 1OA0A 2QTFA 1DU4A 2CJFA 1Q1ZA 1ZH8A 2R751 1VIVA 1PZEA 3HUDA 3NYRA 4P35A 4YIKA 3T34A 4KQMA 4F93B 1W5AA 1OFIA 5JQGF 2Q9BA 2C4MA 2HQBA 3ICPA 4MOWA 221PA 3LBNA 4CKZA 1W4CA 4ZO9A 4DTCA 1NP6A 2BFOA 4XDYA 4N0EA 5LMUB 2XDQB 2XCRB 1FSZA 3GJ4A 4MHSA 1Y6FA 4DARA 2KQUA 3HABA 4Y2HA 2Z98A 5LMCA 1EEXB 4EKEA 1JKFA 2HJHA 2BKXA 4MQ5A 2QR5A 2V6IA 2F9FA 1QSGA 3NTUA 3WKBA 4LJSA 1II9A 4OQXA 1MH1A 1R6AA 2WIJA 4NARA 4YCDA 4F38A 4QT4A 2ZATA 4UBOA 3W3AA 3G3EA 4U7JA 1LLUA 2YIVX 4IVQA 5EZYF 1FP6A 3TXAA 4UCWA 2XJ9A 5COQA 3R9WA 3G68A 1YE8A 3OI7A 3LRXA 2HY7A 1FIUA 3ELBA 3V4ZA 4D74A 1IJFA 1GRQA 1T1RA 3I92A 4JX9A 5KYUA 1I6WA 3TD9A 1YRLA 1PR9A 1UF9A 1U8UA 1RJEA 3MJCA 2GNOA 3VZRA 4DXDA 1JEDA 5E6SB 3L93A 2Q1SA 4M7WA 4R0MA 2Y77A 1SHZA 3C7CB 1L1RA 2ZLBA 1UCFA 2O57A 2PFGA 1VPLA 3I6MA 2FVYA 4XGKA 5EQFA 4K0RA 1NQXA 2G08A 3MMSA 4HCJA 3KOZA 4CT4B 1OWPA 2F3PA 2YICA 4Q1VA 2H5IA 3ICQB 3HADA 5C8YB 1XDWA 4HWRA 1Y4SA 3ACDA 2C99A 3QUBA 3QU9A 4YRPA 5KQGA 3ANXA 2GYYA 1EFVA 1OUMA 4EB8A 4MQMA 3D8RA 1RCFA 4H35A 3VR4D 4XWOA 1C9NA 5KVAA 1XTIA 4AF6A 2M6RA 1M1YA 2QN6A 3FMPB 3U0BA 1FE8A 2HDOA 3P9RA 3O1HB 3E35A 4Z8XA 3WY9A 1QG4A 3SD7A 1LVUA 3IE0A 4X3OA 4QJ5A 4DIDA 1F60A 4GPTA 2VPWA 3O9MA 3UB3A 3NM4A 5ELMA 3CZMA 5EPOA 4CM9A 1PLLA 3JAMA 1Y89A 3UJ7A 2FFBA 1JYFA 2B0CA 5LVAA 5BMVA 1KL7A 3H1EA 5CIWA 1J0AA 2JJ1D 1A2KC 4GNRA 1SKMA 4LRXA 2OMEA 1R0SA 5CB4A 1L2TA 1UBEA 1N75A 1O77A 1TU3A 2HA5A 2GUWA 2CXTA 2WHPB 3M4XA 4DA9A 1MPXA 4NSNA 4PYMA 2IPNA 4TMXA 4V0SA 5IJXA 5P8WA 1DXYA 3R76A 1ZD9A 1R6UA 2GERA 4CLEA 4KQJA 1QTQA 4QFBA 2E49A 3C8UA 1FDIA 3FBGA 5B55A 4DJFC 4JLMA 4I8IA 1BE8A 4NENB 2Z95A 1QH1B 4HDOB 1T6XA 4OH7A 4R7ZA 4FOTA 5K6AA 3R5KA 4DNPA 5HQ3A 4B40A 3CLTD 1R8SA 2KLHA 3JZDA 4Q4HB 1VL5A 2E4VA 4H3KB 1J00A 2I6XA 2VUTA 5I48A 3K6SB 1BDHA 2RK3A 3DMNA 4UVIA 1H3EA 4RD0A 1A9OA 2QXTA 2CXXA 3MPUA 1U31A 4Y9TA 1MH9A 3R8XA 3TTSA 4ZCSA 5FAKA 1CLEA 1Q0SA 1NQUA 1HNNA 3C15C 2NVOA 3T9DA 5J2TB 1KQ3A 3DW3X 1DS6A 1XJQA 4ZQEA 4ZRNA 3OA0A 5FI3A 3K15A 3FOCA 5EJGA 5F3RA 3V7UA 3HK2A 1TKBA 2YQ4A 4HDKB 4JN6B 3SC4A 4MYHA 2GCPA 4UBIA 3Q7PA 2CSXA 3Q7RA 1MP0A 3KTOA 3UCXA 1K8ZB 5DNUA 3LT2A 1ZRMA 1JI3A 2QDKA 3ANMA 4GBMA 5HJEA 1GM5A 2ZB3A 3E22A 3HR4A 3ILXA 2DBRA 1HOXA 1QIHA 1XQVA 3B70A 1MKYA 1T3LA 4O4JA 4KQFA 1QF7A 2V3VA 4RQAA 2C98A 5I5EA 3N8GA 1C7EA 4URHA 5ESRA 3K5IA 4QREA 1FSFA 4RTKA 3GYGA 1L4GA 4AY2A 2HIAA 3CNNA 1KOGA 2IITA 4TV9B 3EZXA 5TLSA 2NU8B 1RQPA 4MRRA 1PYGA 3LMKA 1SC4A 4LWQA 4V0LA 2AWNA 1US8A 1V3VA 3HCFA 5CH8A 3GX1A 4S1VA 4YJGA 1XOIA 4CI9A 2GX6A 2NO9A 3DDZX 3NVKI 1JEQA 1TYDE 4DQDA 3F0TA 4J0FA 1KDRA 2PXXA 1TAUA 3BFPA 2P7IA 1QV7A 2GM9A 3ILSA 5AVKA 3SYMA 2R11A 4JJ4A 1J2JA 1CZOA 2EP8A 1ZMOA 2PR2A 2Y68A 3FIJA 4B3FX 4EYKA 1Y6JA 4D0NA 5J4VA 3EQZA 3NOQA 2OE2A 1ZD1A 3WB1A 1RNLA 5F1KA 1EBBA 3I61A 2WKWA 2O3RA 4RSGA 4B82A 5A9TA 1L7DA 3E9RA 3GXBA 3LBIA 4P53A 1W5EA 4FOPA 4ZI7B 5LIRA 5EIWA 1A4UA 3GN2A 1PU2A 2XOKA 4EX6A 3S2YA 3TTYA 2ZYTX 1N9KA 3G2LA 3JARB 1ISIA 3D4OA 1X87A 2PSSA 3BS4A 4RA6B 1KDOA 2OBFA 5EMJA 3E8MA 4MA5A 1MX3A 2R6GA 2VYVA 4XIYA 1YIDA 4N18A 1GAQA 2MINA 4CU2A 2JJ2D 1KPIA 3A9RA 4RLQA 3TL6A 4Q7JB 3B12A 1AGPA 5DGTA 4HRVA 1NPTO 1Y37A 3PYLA 2J4DA 2VPQA 4MMXB 2L42A 1V7PC 1P18A 3AUYA 3B5JA 1Z7WA 5CRIA 4A6EA 1NBOA 3LFUA 3SC6A 1A9XA 2ZWMA 3UJ8A 1AGRA 1PFVA 3EC1A 2FE1A 3Q6NA 4FLEA 2Z1NA 1GPMA 5AHOA 1JKJB 1YMQA 5KCMA 1OXUA 3PFNA 4HSGA 1CG6A 4YXWA 3UJCA 3D4PA 3A4LA 4RVCA 1RC8A 3HE3A 4X1KA 1JS1X 2VYNA 2WICA 1TT5A 5TPZD 4OHFA 4DA0A 3U6BA 4C4TA 2J5KA 2ILTA 1T9HA 4J3NA 4MA0A 1EFPB 1OFGA 1P73A 1M2FA 2CNWD 2X8WA 3KHSA 1PNTA 2BBTA 4X1YB 3VR0A 5KU1A 2SKEA 3JWHA 2VQ6A 3PWTA 1SA0B 2H0RA 4TS3A 5DASA 4B7ZA 3AHFA 4BNVA 1CF9A 4KREA 3DTVB 1EFLA 2W6MA 1H1LA 1H66A 4BS9A 3OCVA 3NP9A 2DKNA 1H05A 4ZIRA 3K2IA 4HJXA 5TMPA 2OESA 1E7YA 2QRJA 3TIFA 1YS9A 3ER6A 3M6UA 1GZUA 5K4GA 2RC6A 1Q1GA 3B78A 3MG9A 4ACAA 1FYDA 4FTWA 4NBVA 4UU7A 4XWTA 1O0SA 4AMGA 4JB3A 1OWMA 4Q7EA 4Q1EA 3D0RA 2E3JA 4LYDA 2E55A 4PWYA 4F6CA 2QZPA 3GPCA 3F73A 3K1TA 4JC4A 5F1OA 1EGAA 3CM0A 3WK5A 2D4AA 5CDYA 1AK1A 2IYVA 4B3JA 5D5PA 5ISMA 4K9QA 2AFIA 4RK4A 4CR6A 1UODA 5EPEA 4A5SA 4ZN6A 4FM9A 1ULHA 2VHXA 4EVIA 1X8XA 3N2KB 2PH7A 1CYEA 1KMIY 3C3DA 3TQCA 1Z88A 2HT6A 1WP9A 2ZSAA 4ZVLA 4GXNA 3EIQA 3SOPA 1S2GA 3UA3A 2PXAA 4HDMB 1J1IA 4FK8A 1V6CA 4U6SA 1CF2O 1RMYA 1X80A 5BWCA 3TTUA 5C8XA 4F5YA 5KJEA 3WVNA 3C3BA 1SUPA 1N6NA 3HDGA 2QUZA 4KQHA 4BX0A 4ADSG 3TMYA 4YV2A 1WOMA 2HU8A 3KIPA 1KEWA 4PPFA 1NR1A 3HS3A 2RGNC 4CHGA 4A0QA 4Q6WA 4U7FA 3G2PA 3WMRA 1RRPA 1S8NA 1USWA 3AK4A 1MV5A 3EVFA 1RFGE 5ICSA 2HO5A 1VCNA 1A8UA 2ZWIA 3KT6A 1BN7A 3I1FA 4WNAB 3GAFA 3B1JA 3IPCA 1AK9A 4NZPA 4KZPA 1WHTA 4X20B 5HIIA 4EJSB 1H8EA 4GQIA 3QX8A 4RKRA 4TT3A 4DZRA 5AK6A 3WAKA 2BTEA 5HIJA 5TF0A 4DUYB 1QVRA 1W36C 1FZQA 4WKOA 1ZICA 2GAFA 2WZBA 1Z6GA 2ZE7A 1KZ4A 3ZU2A 2FPLA 2RG1A 3DOUA 4QIHA 1ZC4A 1H4TA 4BV8A 2WE7A 4V1CA 1Z25A 3AVUA 2FZKA 5EQJB 3PNYA 5KNDH 4J9VA 3U44A 3G0CA 5TNXA 4LVNA 3W9UA 3FETA 3RHSA 2IY8A 4RH3A 3CSUA 4Z7OB 3GRVA 4FHGA 4C7OA 2VP3A 2XNDA 1VBNA 2VPYA 3O82A 4W1QA 4W7IA 5JCJA 1N2GA 1CUUA 2QT9A 4ZAYA 1CIVA 2ZJ3A 3CC8A 4QNMA 4H7EA 1R6TA 4R16A 3V7NA 3WICA 4NABA 4JLKA 1K6JA 4CIBA 1F4VA 1Z3CA 2EYQA 2JFQA 2FWMX 1KDVA 2VK4A 4EPVA 2RAVA 1YJ8A 2AOVA 4UTVA 4DDTA 2O20A 3IMFA 3SF8A 4L8GA 4PBRA 4DDHA 3V8QA 4AQYB 1VLQA 1VBKA 4ZGGA 2O8NA 3ES9A 4OJTA 2X0DA 3GLGA 4I1IA 1RYBA 3ZGNA 5JMPA 5TQJA 3UJBA 1Q7GA 2EAUA 1SCDA 3PICA 1OY1A 5IVDA 4RTPA 3IAS6 1VMAA 5HF5A 1EWYA 3FYUB 3U40A 2H51A 4KQWA 2FP4B 1CQWA 2O0JA 5AKGA 3ZY4A 4RTNA 2C3YA 4B48A 2FUCA 2C58A 4OQFA 1Z39A 3V00A 2AD1A 2D1QA 2J67A 1X9GA 4YO8A 1T0UA 3S3TA 3MD9A 4JI2B 2ZIEA 1I36A 4KUGA 3V2GA 4C7MA 1JL3A 2DQYA 1XCMA 5DBEX 2B98A 2Q7OE 1GTZA 4TQAA 3V9PA 4DEVA 7GPBA 2NUTA 3C3JA 3CR7A 2W8ZA 3DAGA 1XCJA 3AB3A 3MOGA 1P9OA 1NGSA 2DTEA 3LI2A 2HX1A 3K8YA 3IKMB 3B48A 3QH4A 4HVAA 5JFTA 5M5BA 5H1YA 4BUCA 1TAGA 2DHRA 1ONSA 3M1AA 4KX5A 1RCTE 3PDJA 4ND6A 4P2GA 1G8MA 2BGJA 3PNPA 4XYBA 3TJRA 2P4UA 1YUNA 3GLIB 1KZ1A 1P2SA 2A7QA 4FQ7A 2Q99A 3ASUA 2PX2A 1SZJG 3ZW9A 3URMA 4KUEA 3PVZA 4TUYA 1XMIA 2R6HA 2GZSA 4MWSA 5U4XA 1JGTA 4G0VA 4OI0A 3FGZA 1GZ5A 2YJ6A 3ZHCA 1IBKB 1L4MA 4QL3A 5KSWB 2V59A 4RHFA 5L53A 3VTZA 1SY7A 3EDQA 4WLOA 2W6JA 2FWAA 5ILGA 2A35A 3ZWXA 3U9TA 4YRMA 5KYYB 1CJUC 3CUEF 1UIRA 4KX3A 3ISVA 3MCVA 4TWJA 1Z0JA 1S2LA 1WQ3A 4OHYA 2BMFA 1NE7A 3W6PA 4L02A 2FPGB 2NO1A 1G42A 1VP3A 2ET6A 3NNSA 1CDDA 3QWIA 5JLAA 4IQGA 3C98A 3Q3CA 4WW0A 4YMIA 1W7AA 2D5CA 3JASA 3QLVA 2DHQA 5KTMA 1M6WA 3DFMA 3HL4A 4L0QA 4LJ4A 5DMXA 1DC6A 1VIYA 1XJCA 3N53A 3ML1A 2MSLA 3GG9A 3MSXA 5GV7A 3UUEA 4A03A 4E11A 1D6NA 4MARA 3TLEA 3PIDA 5WRFA 2I7DA 3FMOB 1M74A 4UOZA 1G21E 2P6UA 1VM6A 3Q7EA 1ZIPA 1O94A 1UWLA 4YCMA 2I55A 4DC1A 3R6TA 3CY6A 3ANYB 2HQRA 1YONA 1B8UA 4ZKEA 2VDRB 4DNFA 3QG1A 5AKYA 2VC2B 3AF0A 5BP7A 3TI9A 3KKMA 1Y5IA 3I53A 3RREA 4WZBB 4D9IA 3GP5A 1BCSB 1PW5A 3C5WP 3HKBB 1BCRA 3I12A 1WB5A 3QE9Y 2DTDA 4LBWA 4Q21A 1YULA 4TM8A 2LBPA 3V4FA 2RGYA 3CX4A 4WKNA 2IHTA 2EF0A 1EE9A 4NI5A 1KJWA 1YQXA 1HFEL 1LPOA 3VNQA 2G9QA 5C32A 1W47A 2DUNA 4UJ3A 4AXXA 3JD2A 1UDWA 1FNCA 2Z5LA 4IUDS 1Z2DA 2H1SA 1TGYA 2I4RA 2OLEA 4QRDA 4E33A 1L7NA 4OREX 1U3DA 1WV0A 2H3EA 4R2JA 3K8OE 2XMDA 4PRYA 3U9SA 3IIEA 3VC2A 5EE0A 3ZVRA 1IBSA 1EDEA 5BW6B 3CB2A 2B83A 3OQ1A 1OJ7A 2A33A 2GZAA 1ZVVA 3HR8A 9LDTA 3MW8A 4JBIA 1TZMA 2V8OA 2DR0A 4HTFB 1ODTC 1B00A 4EVRA 3O73A 3D3WB 4D2IA 3J7AC 3O0TA 3I2IA 2XSZD 3LF2A 3C5EA 4AO8A 1MC8A 1IG0A 3H84A 1JR6A 2WUGA 4TKZA 5E2AA 3VI3B 3CJRA 3DDSA 4OQEA 4JR2A 4K9LA 2V6MA 2GPNA 3DV0A 4N6OA 2ZCVA 5FAXA 4YUWA 5CFRA 1VJ0A 1F9EA 1IXYA 2BHNA 2BCJQ 4XGQA 3HDHA 5HCIA 3TLXA 1KU0A 4MICA 5CG1A 1W49A 5LXTF 1VI2A 2H1WA 1T1GA 3ZWDA 1BW9B 3N2YA 4IIYA 2FEXA 3LYHA 1GGEA 5JC8A 5KS2A 1GITA 4IZ6A 4OHXA 3AR8A 3MBIA 5GJVC 1UEIA 3N9IA 3WWZA 3RAFC 4AS1A 2N75A 2PEZA 1NNSA 3DTYA 4F4FA 1BS2A 1NI4B 3SXPA 5C8DA 3PCTA 3CGGA 3REOA 3WLRA 4B2IA 2HJSA 4AUEA 4DMFA 2QY9A 1S9HA 4I9GA 3VKHA 1DG3A 4QYTA 2ONKA 2FFRA 5LL6P 1K5GA 1CUVA 1OLOA 2GZ3A 3QENA 3EY4A 3OQMA 2OXIA 2I9KA 2J1LA 4REQA 5JXGA 3G8AA 1NUSA 4HGZA 5IWAB 4P31A 4NYJQ 4RTJA 1VL8A 2JLXA 1GSHA 3T4EA 1KS9A 3PJRA 3I2KA 1ABEA 3TEMA 1Y6GA 2ZE6A 3AH8A 3R3JA 4RCZA 4ZD6A 3RVMA 1ZN9A 3F97A 2ZT5A 1WB9A 4G2TA 2GAOA 3EZFA 3QNMA 3SE7A 1E99A 2YVQA 4R5HA 1AVTA 1UDRA 2GLUA 3FPHA 4R8MA 5EUBA 3ZQUA 2G8LA 4Q1BA 4YT4A 3H9CA 1RP1A 2HD4A 3HY3A 5DYNA 3ZKWA 1W34A 2YHIB 5TX7A 3DPUA 2X8JB 2HSGA 2V97A 2ZJAA 3Q8XB 1ES9A 3CO5A 3MSCA 2Q1WA 1VPTA 2QRVB 4G5YA 3IQZA 3DT6A 4H6XA 4N5IX 4NEHB 4DN6A 5KQMA 3QEBZ 4L95C 1XCGB 3SX0A 2PE5A 4MV3A 3R5HA 4PYIA 1OX6A 1Z5VA 4YJ3B 3V1NA 1T43A 1Z7GA 4G67A 3LX6A 3WL7A 1ZN2A 4A2QA 4EPWA 3M1IA 4R1SA 3ZZNA 1SOWA 1TXGA 2FFHA 2HRDA 1IOLA 2ZIZA 1RBQA 4NJMB 4F8YA 3EXHB 1KJ8A 1R50A 3IEKA 4C20A 4J75A 4TKVB 4P7BA 3P19A 1B16A 1C0LA 4FMPA 5CA0A 1NXSA 2FLWA 2FR8A 4KN8A 4XM0A 1JLRA 1YA6A 3PHHA 2JFXA 2X6TA 3FNEA 4BBAA 1GKLA 3IAM1 4LRYA 3T7JA 1NVXQ 1DPGA 3WIVA 3YASA 1I1NA 2GS9A 2H06A 4C43A 3QXXA 1O57A 1NLZA 3U3JA 4IF4A 4GT1A 3KAJA 2B20A 2C82A 2NZXA 4DREA 4F3TA 1XZBA 1MNQA 1WPRA 3CVJA 3LUKA 4GC5A 4GPBA 2C7BA 2NXJA 3Q6IA 4ZYZA 4WASA 2GD6A 1UXKA 1KSHA 2FSVC 1WE2A 2VHCA 5AM1A 4ZAGA 1QS0B 4Y2PA 5I4CA 2UZ0A 4JP2A 4YBRA 4MNTA 1B93A 3LKVA 4KGXA 4L8FA 4C2AA 1JTEA 1BD3A 2NYAA 3MRSA 2R1TA 1BD4A 2Q1TA 3O1JC 1UINA 5L3SB 3G1WA 4B3RB 3R0JA 4N0QA 3QXHA 1DEAA 1FVFA 1ULZA 4ENVA 1PZHA 1FP7A 3GA5A 3AXTA 3PEWA 4OP3A 5CTAA 3GIDA 1CP2A 3D8BA 2FWRA 3GFVA 3AJEA 3NC4A 3OLYA 3RFTA 1I2DA 2NU7B 2JLWA 1OLUB 4IJ6A 9MHTA 1UPAA 1SULA 1SUCA 4D43A 2WTNA 3KOUA 3LKBA 4IIJA 3RAJA 1S2IA 5LZ9A 4BKOA 2N1BA 3DNFA 1PJCA 3GFOA 1Z5NA 3MS4A 4IWNA 4PPNA 1Q7TA 2ZSEA 3IUSA 1U02A 4PU0A 4B79A 1KQFA 4GX2A 3L4BA 3LS2A 4CM8B 1DAMA 1QVVA 2PQ2A 4OM7A 2B5VA 5KTPA 3HDVA 4IDGA 1I7NA 1Y4ZA 4RGBA 4EB6A 2JFBA 3DSRA 1P77A 2G1KA 3IVGA 1YHYA 3SLGA 1Z35A 1D2CA 3L0OA 5TQ0A 4Q3EA 2DWCA 3B2QA 3VU3A 3TZHA 2GKOA 4E30A 3KTAA 1GYPA 4M21A 1DX9A 4NECA 3SICE 2VPXA 4CFZA 2BFCB 1OAAA 3Q7IA 3U4QB 1Y5LA 2HXYA 2JRLA 1G1MA 1KVUA 1ELOA 1YNSA 2NNLD 3LX8A 1L8QA 1X7XA 3PEVA 2ZYDA 3I9KA 2OORC 4MVJF 2P68A 2DX7A 1N8TA 2ZB4A 1U0HC 1PJLA 2FXIA 3HCWA 3D5TA 4UXIA 4N3NA 2IGTA 3INTA 3CLRC 3NLLA 3ER8A 1E7MA 2JAOA 1J06A 4MV5A 4WHMA 1DUIA 1T4BA 4HDKA 3TPZA 3SZOA 1JKMA 3D3NA 3HHEA 3QHQA 3UAGA 1KO1A 3CJTA 2V7WA 1E59A 1WDLA 3BMNA 3TZBA 5JI2E 3QSYA 5JDIC 1Z08A 3JRWA 1CUEA 1DHRA 5CFZA 2AZDA 3V42A 1SKYE 4EF5A 1UFVA 1SU7A 4PTZA 3G02A 4Y1FA 1ICEA 3IULA 4U39A 3AVQA 1XLVA 5C34B 4DCCA 5JNWA 5DIZA 3H5AA 1W19A 4A73A 3TAHA 4ETIA 2Z09A 1NF2A 1VL1A 4R9NA 2O9JA 4QOJA 4R1PA 1PL8A 1T36A 3F1KA 5E3IA 5EJ9A 4RL6A 5ELXA 3ELWA 4ITVA 3N58A 3DWEX 1CQJA 1TQ6A 1WBJB 3PC7A 4E12A 2FZCA 4RELA 3LHIA 3QU7A 1G9SA 1TZBA 3SBEA 1RXVA 2HSJA 2RJNA 3VVMA 1QXSA 3OIDA 4JGBA 1RLTA 4BLWA 2PDAA 3FPJA 2C0QA 4XAQA 1WSAA 4YRJA 2WIAA 3P9PA 3RRYA 4CDGA 3TR6A 3QX7A 4X5OA 5FTWA 4BX3A 2QLNA 1P75A 3DUWA 2OT3B 2Q41A 3BICA 4CIVA 4JB0A 1SCAA 4D57A 4KN5A 4XUGB 3I9V6 1RWBA 4U7HA 3D9QX 4FUTA 1R0BA 3EZ7A 1GU7A 1YVDA 4N5MA 4DMMA 3DCNA 4TTTS 5HF6A 5F3WB 2C96A 1RQGA 4NZYA 1FW6A 1KI1A 2W11A 5EHGA 2WJHA 4ZK6A 4O3FA 1JSRA 1NDQA 3I58A 4LV8B 5AH0A 4K6HA 4EEKA 3IOBA 4HQLA 1QGYA 4YUYA 1NUAA 3BGWA 3WV5A 5AKLA 5JLJA 1LX6A 5KDOA 3SC2A 3CT6A 1YZ3A 1ADJA 4GICA 4H15A 3PVCA 4RZ3A 3WLHA 5LMNB 4TROA 2UZ4A 2NTYC 3CLRD 4NZOA 4UD6A 1P1IA 2JGIA 4C4PA 4QU9A 1NYLA 4NCKA 1R7RA 3W5DA 1MGOA 4NV0A 4BUZA 3O90A 1PCXA 3JQDA 3F3SA 3RF6A 3SQOA 1K6IA 1KIFA 3QE2A 4L51A 1JTFA 4C3OB 4MWOA 5ADHA 5L7WA 5LQJA 3QW4B 4JL8A 1W6UA 2QK4A 1GARA 3QJGA 3BDIA 1P2FA 4CWAA 2V03A 1NBMA 5CGZA 4RFLA 4UMEA 2OAQ1 4HQ6A 3WTCA 2V7EA 2RH8A 4HLDA 3EPRA 1Z07A 5FL7A 5TGDA 2YN4A 5JU6A 4Q7KA 4CQJA 4RABA 5E2IA 1S9DA 4MB2A 3ZXSA 1K0UA 4J43A 1TLTA 2OQVA 3PWKA 3PPVA 4AF7A 4DA8A 4DSNA 1JNYA 1G18A 4PXSA 3KXPA 3PC4A 1GRCA 4P3YA 4F5EA 2HIMA 2QD3A 3Q3IA 1U63A 4NNJA 2HK7A 4HMOA 3VMFA 1NTOA 1ULUA 2FN7A 5LCXA 4QVIA 2F8TA 2JI6A 3EISA 2JAPA 3OPYA 2ZWPA 2BEUA 4ZODA 4BNMA 3K1AB 3L8ZA 1P61B 2OO3A 2XRYA 2A0UA 1QP8A 5FI0B 4EGAA 6YASA 1V1RA 3BB4A 4DWJA 4CM4B 2GB4A 1VE3A 2ZDHA 4UTRA 2IYYA 1CJCA 4XASA 4A0SA 2PSJA 3T7CA 4ZI5A 4ERNA 4RTLA 2VP0A 4PC3A 1LNZA 1U0RA 1JSLA 3SDZA 4ABYA 1ZR4A 2WVGA 4JLBA 4JCOA 3KZOA 4E51A 1NUPA 4RY2A 3A2MA 2H00A 2PV7A 3UGKA 3ETGA 4A92A 4ARZB 1E69A 3WL4A 1TU0A 3NONA 2HHJA 3K4PA 2BJVA 4WKGA 3FTQA 2Q0XA 3ND7A 1SBCA 2O8CB 1SVUA 3VNUA 2OHXA 1CY1A 4FFVA 1NP3A 2B7BA 4K46A 3PE3A 1F06A 2ZSJA 1AKTA 1SG9A 1L5HA 3RNLA 2CHUA 4KB5A 5FLXA 4W5JA 1JILA 4KQ6A 1M6YA 4ZEOA 1GN8A 5AUPB 1FYXA 2VRNA 3TKYA 3UVEA 1DOZA 4HWGA 2R00C 2VSQA 1XR3A 1Q7BA 3VX3A 3KSUA 2HLNA 2RAPA 2EZ8A 3FZEA 2ORIA 2WUDA 1PE0A 3FNRA 3ORSA 4GR5A 2ZGVA 3A14A 1QQ7A 1A7AA 4LK2A 1GU1A 2F00A 2OBLA 3AV3A 3JAWA 2XB4A 1MOZA 3TJZ<