3L1VA

Crystal structure of gmhb from e. coli in complex with calcium and phosphate.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
182
structure length
182
Chain Sequence
SVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Structural and kinetic characterization of the LPS biosynthetic enzyme D-alpha,beta-D-heptose-1,7-bisphosphate phosphatase (GmhB) from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 61
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l1vA00
4B6JA 5AW1A 4Y2VA 5AM4A 4YIHA 3BWVA 3KZXA 2R8ZA 5AI8A 2GFHA 2YJ3A 5AVSA 2PKEA 4KNVA 1T9ZA 1ZOLA 2WHEA 3MPOA 5ALVA 3PDWA 2G09A 4HGOA 2YY6A 4Y2YA 5ALZA 3ZI4A 3U7EB 4IG4A 4UM5A 4CF5A 4ZEVA 1RKVA 2ZG6A 4XE5A 1ZD4A 4Y2QA 3QUQA 1QQ5A 2I6XA 1WZCA 3NANA 1TJ5A 4UATA 3WGVA 3L8GA 1Z4KA 3FM9A 2EAUA 3HYCA 2WF9A 1RKQA 2JAUA 4I9FA 5AVUA 2Q4RA 3IB6A 1FEZA 3EF0A 3NAMA 2ZOSA 4GIBA 1O08A 2FPRA 2C88A 5AW2A 1U7PA 4C4TA 5ALKA 2R8YA 1RPZA 3M9LA 2IOFA 4QJBA 1RMTA 2WFAA 5FP0A 4HGRA 2G0AA 3ZWDA 3B9BA 3QU2A 3F9RA 1VJRA 3J7TA 1T5TA 3ZVNA 5AKZA 5T41A 3SLRA 4JB3A 2AGVA 2FPUA 4E88A 3K1ZA 2YJ6A 5ALOA 3ZW7A 2HOQA 3ONNA 1LVHA 3FGOA 4KN8A 2B1QA 2AMYA 5A3QA 1Z4OA 4HYTA 4Y2XA 4XOUA 2CN1A 3ZWKA 4FYPA 3KBBA 1NF2A 2HHLA 2HI0A 3NIWA 2RAVA 4FFDA 1K1EA 5A3SA 2FDRA 5AKLA 4C4SA 3MN1A 4UMVA 2CFSA 3D6JA 2O2XA 3EPRA 5AI0A 1L7MA 1S2OA 2EATA 3FVVA 3CNHA 2YJ5A 1X42A 2PQ0A 3FPSA 3I1YA 5E0OA 2HX1A 3E84A 4F71A 1O03A 2ZXEA 4OD0A 3AR5A 1ZD2P 5ALPA 2EARA 3SHQA 1RLOA 2HEGA 4BYGA 2R8XA 4IFTA 3A1EA 3ZX4A 1TJ3A 1Z4MA 3QUCA 4UARA 5ALUA 2JAWA 3ZTYA 3AR4A 1XPJA 4KYTA 5AVWA 3QGMA 5AW7A 3QUTA 4NWIA 1RMQA 2WM8A 4UM7A 4Y2PA 3MC1A 1TE2A 1YNSA 3QYPA 3QXGA 4RETA 3BA6A 3E8MA 1QYIA 2IOHA 4NAVA 5ALNA 2JARA 3U13A 5AVXA 3QU9A 3L1VA 4QQFA 4JDPA 2FPWA 1JUDA 3L1UA 4OCZA 4CE6A 1ZD3A 4DWOA 4NFLA 4Y2SA 4YCMA 3M1YA 3EF1A 4YH1A 4HGPA 3TLMA 3AR6A 3WK9A 1RDFA 3IRUA 4GXTA 3QX7A 4BNDA 1L7NA 2VKQA 4UW9A 2B8JA 2G06A 4Y2RA 4OHFA 5AI9A 5AKEA 4HGQA 1U2TA 3AR8A 5AVRA 3WK8A 3WKAA 3WK5A 4L6CA 2P27A 4L6AA 3A1DA 1ZD5A 1ZRNA 2YFYA 3N5KA 5AHXA 2NO4A 2FUCA 2MU1A 2I33A 1RLMA 1SWVA 4BX2A 2ZBEA 3SKYA 1F5SA 3UMCA 3OPXA 1IWOA 3QUBA 3L8HA 1YDFA 5AKGA 5ALJA 5AW0A 1RMYA 1L8LA 4HAIA 3L7YA 3ESQA 4YCLA 3QU4A 1RC8A 2YJ4A 4CF3A 2P11A 5ALFA 1VJ5A 5ALLA 1QQ7A 2O9JA 2HSZA 1QH9A 4UAVA 2CFTA 3NRJA 5ALSA 5AW3A 3U19A 2G1AA 3FPBA 5ALGA 1Z5GA 1Z4IA 5AM0A 2FPSA 3U7HB 1Z4JA 3RF6A 2R8EA 2B0CA 5AK5A 3L0CA 5AM5A 3WKDA 4O8CA 1YMQA 5AKYA 2ZBFA 5AKJA 5ALTA 1Z4NA 3OCXA 4UMEA 4G63A 3WK6A 2YMLA 3ZVMA 4XPZA 2BDUA 3UM9A 1Z4QA 4PNHA 2FUEA 1L8OA 5AICA 1L6RA 2ZBGA 1WVIA 3N28A 5ALIA 2Q5EA 4DCCA 2X4DA 1RKUA 3AR3A 3KDPA 4DW8A 3UMGA 4G9BA 2Q4TA 3WK4A 2I34A 1SU4A 3PCTA 2HDOA 3W5AA 2NYVA 2WF6A 5ALYA 3WKCA 1SWWA 2C9MA 4BEWA 5IT4A 3ZVLA 3KD3A 1U2SA 1U7OA 4AP9A 4H1WA 2PR7A 1QQ6A 1PW5A 2GHQA 3QU5A 5AI6A 3OCVA 4CF4A 5ALRA 3B9RA 3ED5A 2C4NA 2AH5A 4KNWA 1Z88A 1WR8A 2JAOA 4BX0A 2NO5A 2FPXA 5AW8A 4C4RA 1LTQA 2B82A 3DDHA 1CR6A 4NABA 4UASA 2YMPA 5AW6A 4AS3A 3OCUA 4Y2UA 3N1UA 3PGLA 1NRWA 2B1RA 3N07A 4UAUA 3NUQA 5AVYA 3ZU6A 2QLTA 3E81A 5AW9A 5JJBA 3GYGA 5IT0A 3A1CA 4J03A 3RFUA 3OCYA 4Y2TA 3FZQA 3U7FB 2RB5A 4FE3A 3WGUA 4BX3A 5ALEA 4NV0A 4MUMA 1EK2A 4J2TA 2YMQA 4AS2A 5AVVA 2P69A 3NASA 2RBKA 5AW4A 4HGNA 5ALWA 3I76A 3QNMA 3P96A 5AKIA 3ET5A 3L0YA 3OTQA 3VAYA 1XP5A 2QYHA 4F72A 3U7GA 1CQZA 3B8EA 2IOFK 3L5KA 3SMVA 3AR7A 2OBBA 4L57A 5AKHA 4OFZA 4KX5A 5AKKA 1NNLA 2OA0A 4Y3UA 4YCNA 2HF2A 2RARA 3OCWA 1ZJJA 2G07A 3U26A 5AM2A 3I6BA 5AI4A 1MH9A 3AR2A 4UU1A 2ODAA 2AUTA 3ET4A 3NALA 2IA5A 3ZTWA 4EX6A 2YN4A 1Y8AA 2W43A 3L8FA 2BDEA 2YBDA 1RQLA 1J97A 2GO7A 2WF5A 4EEKA 5IS2A 2G80A 2IYEA 2HF7A 5AIAA 3SD7A 4EX7A 5AESA 2B30A 2I7DA 4DFDA 5AVTA 4EELA 3KOOA 3W5DA 3QU7A 4UMFA 4BEVA 1J8DA 2JGAA 2OM6A 5AI5A 3SKXA 2YMMA 1Z4LA 5AM1A 1YV9A 1EK1A 3W5CA 1RLTA 1T5SA 2FI1A 4MWOA 5AK4A 3WK7A 2OYCA 2C8KA 3EWIA 2W11A 2MSNA 3DV9A 2DQSA 1VFPA 2WF7A 3HLTA 2GMWA 4RESA 5ALMA 1S8OA 3AR9A 1YS9A 4YIKA 1TA0A 3QLEA 1WPGA 3SF0A 1YJ5A 2HO4A 3R4CA 2HCFA 1Z4PX 1ZS9A 5AIBA 1Q91A 4I9GA 1XVIA 2ZBDA 3ZX5A 1L7PA 3DNPA 4BBJA 3OCZA 5AM3A 2FEAA 1U02A 1ZRMA 3CZ4A 3L0BA 5AK6A 4EENA 1N9KA 1Q92A 3UMBA 2WF8A 3E58A 5AK3A 4ZEWA 1Z5UA 4BKMA 4UU0A 1KYTA 5AVZA 3W5BA 3R09A 2C8LA 3IJ5A 2BY4A 4BNDB 3A3YA 2I55A 1TJ4A 1N8NA 3DAOA 5ALQA 4UMDA 4KX3A 2G08A 1L7OA 2B8EA 2P9JA 2GHTA 2D2VA 4YGYA 5AVQA 5A3RA 1RRCA 1RQNA 5ALXA 5AKXA 2W4MA 3WKBA 2I54A 4EZEA 4XQ0A 4Y2JA 4CNQA 5AW5A 5ALDA 5ALHA 4ZEXA 3R9KA 3KC2A 1AQ6A 3L8EA 3PGVA 2CFRA 3MMZA 3S6JA 3ESRA 3WKEA 3N8GA 3I28A 3ZUPA
chains in the Genus database with same CATH superfamily
2AKAB 2CY0A 3EZ6A 4B3TB 1MB9A 1JVBA 3V7FA 1U3VA 4IVNA 5JNTA 2R44A 2R751 2QRKA 2VXOA 4BQNA 4C4AA 2W2QA 1DE0A 2R00C 1E18A 3ZGVA 4KDEA 3PNYA 2NZYA 1I5EA 1I2AA 1OFUA 2NIPA 2PKEA 1SCAA 3EZLA 4A92A 2QZSA 1CDEA 4X5OA 4OHXA 4EDFA 1RCTE 5CR9A 4UEKA 2XDQA 3M82A 5B30A 4RTNA 2JJQA 2NUBA 3FNBA 1PJZA 1QSGA 1CUGA 3NEYA 4IG4A 4CF5A 4IWNA 4D3FA 2W58A 3BDAA 4F2HA 3V1KA 2PKQP 1KRWA 3T9CA 2ZG6A 3VGJA 1WCIB 1KMCA 2UXDB 1T3LA 4BP8A 3NHLA 2G5GX 2LE0A 1Q2UA 3TR0A 1H1LB 4DQUA 4OX9Y 1N2CA 1TJ5A 1UZLA 4L0DA 1ULBA 5IJZA 1QTRA 3OZWA 1XMVA 1ZH8A 2J9XB 4PR3A 4YV0A 2YXEA 4EB6B 1GITA 3KEQA 3JD4A 3P9RA 1ORTA 4R2HA 3DZJA 1HOTA 1E60A 1LBEA 1TDJA 2OAP1 3H86A 3D6MA 3GVIA 2FPGA 3OVMA 2SKEA 2WFLA 1T9BA 2Q2WA 2ZYRA 3V7NA 3AMVA 2Y2VA 1OWMA 3Q4GA 4ZT5A 5ICGA 3G68A 4EW3A 1O77A 4E51A 4C4TA 1TIBA 3QKUA 5ALKA 1DC7A 1XBTA 3JZAA 3MS4A 4KREA 3A3NA 5D3QA 4DT1A 2ODWA 1RMTA 1RQGA 1UJMA 1YF3A 3LQ2A 4Q3LA 2BISA 2FSSA 4ACAA 2AG0A 2F9LA 2RGEA 1WEKA 3E9CA 3R3ZA 4GM1A 1RLIA 3ZY5A 3OQOA 2R8OA 4PFKA 4PCAA 4PZEA 5CJPA 2RGWA 2VF4X 1RC0A 4XDYA 3GB9A 4JB3A 3FYDA 3JQEA 5JAMA 5GTDA 3EUAA 1QZZA 3HTXA 1AKUA 2WTBA 1I1QB 2BRUC 2P41A 1G16A 3CPEA 4AUMA 4B3DA 4JQCA 1U9IC 4ECAA 4Q9LA 4FC7A 1OE0A 4ND2A 2ORWA 1W88A 1W73A 3DMTC 2WW8A 2VDOB 4TSFA 2GJAA 3H8JA 4ONEA 2UVPB 2RHLA 2XF8A 4MKRA 4ROSA 3CGGA 421PA 4RTRA 4D9EA 4EA8A 5BQPA 1O0BA 1KJ9A 3GCDA 1FDRA 3QMMA 3ZDBA 1OLXB 2FEMA 4ZRMA 3ZJ4A 1FNDA 3PVSA 3WLJA 2QL9A 1Y1TA 2JJ1A 2WHPB 1PK8A 3FYUC 1RJGA 3GT3A 2D0OB 1U3GA 1H5QA 1GZUA 1QYXA 3HA7A 1UM8A 1HEYA 1QE0A 5IVPA 2O5VA 3H3JA 4X6YA 3MN1A 1V3TA 1T8WA 3ZBUA 4RVUA 1I7PA 1NSFA 2GBCA 1AQUA 3FCAA 3BFXA 1C0LA 4B6EA 5KS2A 3GJXC 4ZCIA 2E5FA 1HYGA 1MX3A 3ONDA 5DTEA 3GZ4A 1K4YA 3V1YA 2GQ0A 1K8QA 2NU6A 2RCYA 4YWJA 3ZHCA 3FPSA 4P4GA 3PFNA 2VHWA 2X5KO 3MWFA 5CK4A 1QF7A 1NHGA 1S89A 1P3DA 2PUGA 3DKKA 1DS6A 3M6MD 2PL5A 4RXMA 1TU4A 1NI4A 2GVDC 4R01A 4KMSA 3O1JC 3RJZA 4BZXA 1M73E 5I7SA 1W5AA 4DANA 2A9JA 3QF4B 1R7RA 2JGLA 2PRKA 1ATIA 4PIMA 4PIVA 2XVYA 4XH9B 1WDKA 1P4HA 2ZSKA 1VG0B 2C4TA 4MA5A 5JPCA 3NTUA 3RAGA 4PC1A 1UDWA 4UTXA 5DW3A 1ZGAA 1WS6A 2ALJA 2LRHA 3GLHB 3H0EA 3KEOA 5ES3A 5FIUA 5BWLA 3LIPA 4R0NA 4RM3A 3FY4A 3AJ8A 3O1IC 1DAPA 1VP3A 5BSGA 5KYXB 4J0GA 3L2OB 4IGFA 1M6HA 3NWBA 2DLDA 4LIPD 3K0CC 4OB8A 4RW0A 2QVYX 2AOTB 4AZSA 5JTUA 1FX0B 2BFCA 3ORQA 4QUJA 4BO2A 2PJRA 2FSHA 1P2BA 1NW5A 3O73A 2H3HA 3LV8A 3OE7D 1MG0A 4DJEC 1PFKA 2Q99A 2JEOA 3GNTA 3N2LA 4GVLA 2QTWB 2JBAA 2P68A 2ZT7A 2AXEA 3DCJA 3HL0A 1V1JA 1U1IA 1D7AA 2IYAA 4WA7A 5MFZA 4M1SA 1Z75A 4R9VA 1FTNA 2C5GA 1FE8A 4P7FA 2EJTA 2WRZA 3L5OA 1HE8B 1SULA 1ZRSA 4JEHA 4OGLA 3VPFA 1W48A 5JT1A 4C29A 4LJ4A 3TLXA 1YASA 1JS1X 3H11A 2X7JA 4LYDA 3DYIA 3FIUA 4XSHA 1YC2A 1N8KA 3H1FA 3QVXA 1E8NA 3O94A 1CUEA 2XUOA 3N9IA 2ODQA 4CV0A 1V5GA 1ZH4A 5T4HA 3DZ8A 5K0TA 1KPHA 4YH1A 3EDRA 4B74A 1GUYA 3ZHXA 3CBGA 1BXGA 4MUIA 1NJFA 2VKQA 1E3EA 4H6XA 2OESA 2ZDQA 2DX7A 3D9QX 3O4JA 2G06A 4IEFB 1N6HA 1PU2A 4B3RB 4W7IA 3BWEA 3BWYA 3MWGA 4OK6A 2PM8A 5J9FA 1N6KA 5TMPA 4LKOA 4GPZA 1KH3A 1XX6A 3I8OA 1A72A 2YICA 1BN6A 3AY0A 3RK0A 4I1RA 1UL1X 1CUDA 2HQ1A 4E21A 3W3ZB 1XMSA 1A27A 4PU0A 1WZEA 4JC4A 1VB5A 3UWPA 4FQ7A 2EBUA 4PR0A 3QWBA 5B6PA 1YQQA 3I73A 2FP4B 4FGLA 3M7IA 2PRYA 2F1KA 3N8DA 3N2GB 3OPXA 1U0EA 2G36A 1UZAA 2R6ZA 3QUBA 3K9FC 4QHSA 5GJWC 1RMYA 3TLGB 1L8LA 2ECPA 3DONA 5K5EA 2PUFA 3Q87B 1EBBA 5DK6A 1G5TA 1UR5A 1W19A 3CMCO 1XXLA 2YUIA 3C3BA 3OEHA 2M1ZA 5D00A 4CN8A 1FYFA 4JJKA 2MWMA 2QD1A 3U9TA 3WNQA 3HVIA 4HEA1 3AIMA 1PWXA 5IZCA 3O0DA 2WTUA 2CFTA 1G42A 1JIIA 1IPEA 3ABIA 1EB8A 3TD9A 3BJIC 1E8MA 4NC9A 2JI9A 3A9TA 5CYOA 3HJNA 4FEAA 4AECA 1FTYA 5IASA 5BN1A 2HMWA 3CVXA 2A59A 2KBFA 4MMZB 5AK5A 1ZRHA 3G79A 1P5ZB 2YXLA 1STOA 4N0MA 4ZGGA 2QRHA 1C7EA 2ZBFA 6YASA 3AINA 5EN4A 5H02A 4HB0A 2JGRA 4NBTA 4JSTA 4TT3D 3D7NA 1Q0SA 4BKQA 2VHEA 2WG2A 4JJGA 1PT7A 1IZYA 3G0GA 4K6GA 5D6OA 5F21A 5K4GA 4RNCA 4BJHB 4OGKA 5I48A 5L3QB 4E2YA 1JG4A 2G1KA 4WGFA 2FTKE 2JF0A 4A1OA 3ZS8A 1MVOA 2ZJ2A 3AEUA 1R15A 5LA6A 2GYUA 4IX1A 3E9YA 2H2IA 2B7LA 4L28A 4FMBB 4B7CA 3IDQA 5F76A 4RQTA 2OQIA 2GN6A 3L77A 1Z13A 1OI7A 1QYRA 1S4MA 2AMFA 3PD1A 3S1LA 5FOWA 2ZUWA 2P7HA 1Q0LA 5GPBA 4CDMA 2JRCA 2A14A 5IU6A 1JIJA 1KL7A 3OKPA 5CH8A 3BMNB 3FG9A 2GSWA 4Q3EA 1MHPA 1NVEA 2C5SA 1X77A 2FW8A 2YHAA 4AWBA 4BL5A 5IT4A 1NJ5A 5BVHA 4EJ2A 2BKXA 1U2SA 2D3WA 2CZQA 1KYIA 1NVWQ 4HAVA 1KI2A 2ZXFA 4PHHA 3TOZA 3NHZA 3B70A 2ZYDA 5AXAA 4EA9A 4UVEA 2CVZA 1W2GA 4CF4A 5I5EA 1Y9AA 2CKMA 2HIHA 3PKZA 1Z0UA 5DP1A 1IN5A 5C9ZA 2IH4A 2VDUE 4URXR 2W7TA 4XEHA 1EX7A 4M9RA 1TZKA 1R16A 2GXQA 3BCUA 3EXG2 1LPMA 4HADA 1IBCA 3ZOKA 4RKYA 1I6LA 1SU8A 2A9VA 3PJFA 2I7XA 4QHYA 3RVSA 1NVXQ 2YMPA 4Z1OA 3OWXA 3VKVA 2VHQA 3OCUA 5DM2A 1L7QA 1QV6A 3AUFA 4WOKA 5BQOA 1TZ2A 2LNDA 1ECGA 3NTVA 1PWEA 4JBHA 1P7PA 3E82A 2C4HA 3F4BA 2QTBA 3CW2A 5BYJA 3EWSA 1RWXA 1TK3A 1BMFD 2ILVA 1JL3A 2J9RA 1G3MA 1QV9A 1GTVA 3OCYA 2OLEA 4JC5A 3D0OA 1NX9A 2O52A 4AXBA 5FNVA 5I51A 4EI9A 3WLNA 4C7BA 3C6KA 5EWJA 2O8EB 1VKJA 3QVWA 4FTWA 1QK5A 3ZN2A 1QH8B 1TAHA 3O3MB 5DHAA 2FETA 5JXHA 1JIVA 2GK4A 4DR1B 4HX5A 2OZLA 2Z57A 3CS3A 3DS8A 4ODIA 1QBKC 3QOFA 2YYZA 5KTKA 2VZ0A 1X39A 2RBKA 4IIEA 2PQ6A 3DG9A 4OHVA 4ZZIA 4JJ8A 3O90A 5KDDA 4PSKA 2AI3A 2B83A 4U0KA 3LKDA 5HUJA 1NXTA 1S2IA 2XKKA 5IANA 4D5GA 1CRZA 1P5FA 2O1SA 1XU9A 3V9PA 3AVXA 3B36A 3WQHA 4K28A 4OHBA 1RBZA 5J43A 3QKTA 2P4EA 2Q3LA 4GX2A 3ZIUA 4B75A 3OCWA 1N75A 3NUGA 1FC0A 4KRYA 4GOXA 3KU1A 1HO3A 3U26A 4DIKA 2DHEA 1PSWA 2PUHA 4GMHA 3RWMB 5AM2A 3U61B 3OEED 2M6KA 2V3VA 4BNWA 1LI5A 4PFQA 1U5CA 1X8XA 3UB3A 5HKLA 3VR4H 1EDBA 5JYDA 2FR1A 1HL3A 2QDXA 2RHHA 4KQ9A 1RRMA 4N9QA 4WECA 1Y8AA 1AN9A 3PDUA 1TEZA 3DEYX 5J2UA 2FHPA 4F4FA 3NWJA 2MOKA 2ICAA 4NDZA 1SIUA 3JQAA 4QT0A 1SB9A 4DA7A 3P8ZA 3LUHA 1Q22A 2ZYIA 3IPAA 1BHSA 2QJOA 1GKUB 2Z8YA 2HF7A 4BWFB 3ZLTA 4X6LA 1ZU5A 4Q21A 4MPPA 1Y37A 2ZIGA 3KKMA 4RZXA 4BEVA 1N9GB 1Z4LA 4C2UA 4PZUA 4AIIA 2I2AA 3TLAA 1QQBA 2HLPA 3EEBA 3B1FA 2L19A 1HDIA 4CCYB 1F3LA 1FYVA 2GPWA 4P54A 4M3NA 4OAPA 3A6KA 5FJJA 2HREA 2GMWA 3TUIC 2GN2A 2XVZA 1PP4A 2QGNA 1JE1A 1RBMA 2C5EA 4YBZA 1M1YB 1T2NA 1UUFA 3TZ6A 4D7AA 3QA3E 2W00A 1G4UR 4QPCA 1REQB 4QO7A 1U5BA 3DEFA 3HXPA 4EF6A 3DTVD 3V1TC 1CG6A 3HZRA 3KFVA 4I55A 4IOLA 4OHWA 5AVJA 4I9GA 4I4LA 4YX9A 1JP7A 2X4LA 1CY4A 2QRGA 1X7WA 4KC0A 5GONA 2VJDA 3DSRA 2QQFA 1QYDA 1L7PA 4O4HA 3SEZA 5E8JA 3E70C 4ZQEA 2W6JD 5AM3A 1DFIA 3KUDA 1EUZA 3B3QA 4PYIA 4DY4A 2EF1A 1UAGA 2INGX 4Y9SA 3CZ4A 1ES9A 4NG5A 4P7GA 2BKLA 3DFZA 4OXRA 1IB6A 2O7QA 1J9EA 1KSHA 2GAFA 4ZOLB 4WY5A 3FOFC 1PDOA 5DH9A 2NU7B 2HA3A 2K87A 3KOMA 4RY9A 2FSVA 1EP3B 2GERA 3SG0A 2IBTA 3NTLA 5FTJA 2BY4A 1P9RA 5D85A 4M1OA 3QOWA 1MG5A 1Q3HA 2E89A 4I50A 4LJYA 4HYQA 1ZZEA 1DOHA 2AIRA 3FCSB 3Q12A 4UMDA 2WVJA 4XTCS 5K3FA 2XGSA 3WL8A 3L46A 3C5WP 4Q6WA 4WT7A 3S40A 4E11A 3WBJA 1QK4A 2WSSD 5BYAA 1KEWA 5AJTA 4HEJA 5EHNA 1DCMA 1EVEA 1F6DA 3G7SA 4FI3F 1O94A 1P3Y1 3AI3A 5EMLA 2MT9A 5EJGA 3VC7A 3WHPA 1RRCA 3DLAA 1O95C 3TECE 4B3JA 3E1KA 4Z7NB 4JLVA 1P74A 3JQBA 1OPXA 1KKLA 1TD1A 3LPNA 4HDSB 3UJNA 1N5LA 2JD2A 5HKOA 3WKBA 1JDBC 4BFVA 5F7XA 3CVYA 2YV3A 1S2DA 1UK7A 4C06A 1MU0A 3BE4A 4U8GA 5LYJF 2GAIA 2QJRA 4LMPA 2Q49A 1A50B 1X1BA 3CU5A 3D64A 4EG7A 3L7CA 4K2HA 4U02A 5TLSA 3FDFA 4YAWA 3FDZA 4EJSC 2VYVD 5KNCH 3GVCA 3ILHA 4FFOA 3RFVA 1N2CE 4ZJYA 2IGBA 3MS2A 1ZQ9A 3K73O 3IE0A 1GU7A 3IP5A 1P5HA 4RPIA 1UK8A 2GILA 3KKEA 3L1JA 3TG2A 1H4QA 4IRXA 3HVRA 2H54A 1GAEO 1R74A 1RACA 2OOKA 1ZC3A 3KQOA 4UVIA 3JPYA 1F38A 1M7GA 3O4IA 4MYDA 4B6JA 2PUAA 3T3DA 3MQFA 3PD0A 3PUYA 3RM3A 2C1ZA 2YXNA 3SICE 3KTAA 3TXYA 4YIHA 1TPYA 2NVBA 5F64A 5K8UA 4YMHA 4Q1VA 3NHWA 1ZUIA 5KOJB 4BO7A 1R6UA 2PWPA 4NZOA 2PLFA 1A5BB 2ID4A 2I78A 3ILXA 2X0DA 4EDHA 3NT5A 3EQZA 4IGAA 4UFOA 2B94A 2FZ4A 1V4BA 4MS1B 1E2HA 3IX7A 4OJYA 4RGQA 1HORA 4UUAA 5IYZA 4EG6A 3E3NA 1YU6A 1XEFA 9GPBA 1JMVA 4MHTA 3BGVA 1NC3A 1G2PA 2CLHB 5ALZA 4NKRA 5JJ5A 1T2DA 5KAMA 3EPKA 2JGKA 2R6GA 4IBOA 4OREX 4TV9A 3Q3JB 1JHPA 1L7RA 4YVFA 2ZWMA 5IMBA 3CLKA 3IEVA 3INRA 1CUYA 1R6AA 2WZQA 1WV1A 3OZCA 1W1UA 3BH6A 4MV8A 4LC9A 2WKSA 1ZX1A 5IX8A 1Y5LA 3PGA1 2VOEA 3IDSA 1H05A 4DLSA 3QE3A 1QS0A 1NVAA 2WM3A 3HU3A 2JFOA 1AZWA 2G1PA 5LQJA 3KJFA 1RKQA 3QSGA 4BLTA 3LUFA 2ENUA 4M1KA 1LPSA 1X9GA 2VRCA 4IIDA 4XLLA 3M4JA 3N8HA 4R1TA 2MINB 1U7DA 3TXAA 1Z0KA 3BXXA 1RJEA 1FPMA 1QOZA 2E3JA 2FW0A 3AWIA 3NAMA 4Y9TA 1UFKA 1OYVA 1QONA 3LA6A 1O08A 3B2EA 4GUDA 2IXGA 2WOJA 3GGPA 1GA1A 3OHSX 4EYKA 3L6UA 4JR1A 1MO2A 4RK0A 4GKAA 1T8TA 4NDNE 2I1WA 1VE7A 2PNJA 3MOSA 2ZRQA 1XCLA 3HU5A 4G9EA 3R7AA 1T6YA 4HGRA 3WLSA 4S0XA 4YAKA 3OD1A 1X13A 4BNUA 7REQA 3GJZA 1YCDA 5EXDA 4E4YA 5T41A 1ZNWA 4R8MA 3VDXA 2JIRA 1L4BA 3UH1A 2GTHA 1RQRA 4KXVA 1V8DA 1Z15A 4OKIA 3WXBA 1ENYA 3Q1LA 2CK3A 1V26A 2NADA 2Q6KA 3BG5A 1M2KA 4IWXA 4MQ5A 3U0VA 5BOSA 4DABA 3QEBZ 3X1ZA 4ABTA 2R96A 2KPOA 4HYTA 5GMOA 1F4PA 2A9OA 2Q6TA 2YINC 2QQGA 3L4SO 4MKFA 2GBLC 4HSGA 3IEUA 4D80A 1PHPA 5F7JA 3EODA 4H2DA 3T3EA 3LVQE 4ZRDA 4LEIA 2QGZA 2VPQA 3VUFA 3AM5A 4H1HA 2J9YB 2PJZA 4RTOA 1CWUA 1GWNA 4KYUA 3PDIA 3QXSA 3IXQA 1IBRA 5FTKA 1ABFA 3RJ5A 1ZJZA 5BQXA 1G8AA 1HLFA 1NU8A 1QMGA 2I66A 1YRAA 1CVIA 4PZLA 4BVKA 3L4BC 3LQQA 1HA3A 4N47A 4YP7A 2ONYA 4EYOA 2DF8A 4K9QA 3ZY4A 1AMNA 2YXDA 2R7NA 1X2BA 2V74B 3CX8A 4DIBA 4CWAA 2BSAA 3W6UA 3GMTA 1Q0QA 3LQRA 4DZRA 2QVCA 2UXBB 1EDDA 3Q8LA 1LDMA 5K3SA 4W5TA 1DZIA 4BQEA 4U7FA 1DJQA 4R81A 4YV1A 1JLHA 3P4UA 2PD3A 3N3BC 4B46A 3LYLA 4MP6A 4D8TA 7ABPA 3C7KA 4MXDA 4I4TB 2JPDA 5JVDF 1AN0A 4G5SA 4INJA 4HH3C 1YXMA 1QHXA 3KZVA 5G0VA 2P40A 5LBUA 4RNDB 4XGIA 2FK7A 1I30A 4MMYB 3P0FA 3H3FA 5A3JA 1Q77A 1BJTA 4DR6B 1WMFA 3GFSA 5ALPA 3I3SR 1I5OA 3DOIA 3CINA 3NHBA 5KQLA 1AUOA 2WMYA 4O2BA 2MSWA 4PNEA 3FDJA 3GLQA 5AOBA 1H2ZA 4EHKA 3IOBA 3MWEA 3S2EA 3BIWA 2OO7A 1MB2A 3DV0B 1ZNXA 3WTCA 4B3SB 3H2KA 2VJKA 5JNRA 3WYFA 3RYHB 1SIOA 1K88A 5D86A 1YR8A 1MC5A 4Y9DA 4C4ZA 3BTOA 5M2QA 2HAEA 2HW8A 4PLHA 4GDMA 5CLIA 2GDZA 4EGSA 1C7ZA 1EFPB 2BFFA 4S1VA 5DFAA 3U3MA 3W6NA 5L6MB 2FR0A 2OXEA 1PEYA 2AX4A 3BXHA 3H6HA 1YU9A 2C9DA 4O29A 2XA2A 4Q7KA 2D7DA 3P52A 3VQTA 4BGIA 1TF7A 3D2LA 3V2HA 5HQTA 5TGTA 4M0PA 4ALNA 4C6TA 2OV8A 3AHEA 1NUUA 2JARA 2QV0A 2Z1NA 2HSDA 1O3YA 1KYWA 4TWIA 4DV2B 1XQ9A 5HRCA 5IN4A 4XPIA 4QJ5A 1OJ7A 3KVRA 3QU9A 4RHEA 3PGJA 4NU6A 1NJ6A 1DDGA 2VK2A 2Z9CA 3KJIA 3NDPA 4MV7A 3RFFA 1GGJA 4E5DA 1U1DA 3VH3A 3E3LA 4EL0A 4N1AA 3EULA 1VLMA 4HNAB 1B43A 2IV3A 1WQ4A 3LK6A 2FSFA 2EQAA 4F3KA 3DDSA 4L8FA 2HJGA 4IIUA 4ZO6A 3V4RA 5KSPA 4LDQA 3FBWA 2GK3A 2LCFA 2UZ3A 1KDVA 3UJ6A 1UWVA 2V0GA 3WA7A 3O1LA 3DO6A 1FDWA 3DUWA 3LW7A 4H3VA 1NW4A 5EZYA 2QMEA 3FMGA 2P2NA 2VDQB 2BFPA 2TYSB 1KO7A 2RK6A 1NAHA 3AP2A 1PT5A 5AI9A 5AWFC 3W6OA 2VI5A 1RXIA 4UM8B 2H1WA 1G21A 4QOIA 4RPCA 4KBGA 2OK7A 2QL5A 1GNRA 1PUIA 1R2QA 1A7AA 1CF9A 1N6PA 2BEVB 4TTRA 3PICA 4BKRA 5U4QA 2P8SA 3A1DA 1OVMA 4D99A 2COKA 3OLQA 3VZRA 5BV0A 3ZCPA 4E5KA 1F51E 1QHEA 4RQAA 2ZTUA 4RO0A 4K6OA 1RLMA 4PTZA 4X41A 2ZBEA 4LVNA 5LJIA 2NU8B 3SI7A 4I4CA 4LV6A 3EASA 1VSUA 2NM0A 2WAMA 3RBZA 1SUIA 1M5UA 1Y9DA 1EK5A 2G1UA 1S8NA 4WN3A 3AVTA 3THWA 5FTMA 3EY4A 4A0SA 2XMCA 2CL6X 3ZZUA 2ZS7A 1VKNA 3WBBA 5CDFA 1RABA 2QR3A 4JL8A 1JZQA 3KXLA 1I80A 4P82A 5AW3A 4BXOA 2WUFA 1XDDA 4W4TA 4LAFA 4BQPA 5ALGA 1XZBA 2IF0A 4KLNA 2PLAA 4B43A 4YAJA 1V5WA 3HBAA 1COZA 3QVLA 4J76A 1ODIA 3RS2A 3N86A 1PGNA 5AKYA 3CRNA 4YAOA 5LNK6 3C3CA 3DBRA 2OB2A 4QIHA 4GGOA 3BTVA 3WJAA 3WL6A 5BVGA 3T1NA 1GLNA 4QDUA 1T8YA 4JP5A 5DXJA 4UHJA 5HE9A 4TL9A 2WVHA 2FN4A 2WAAA 3JRWA 4DJJA 1UJ4A 2CCGA 1M0TA 2FZWA 4G37A 1JFVA 4RDXA 3K0AB 1NY5A 1TX4B 2B35A 1SC1A 2X6RA 3L8CA 1OWOA 3OFNA 1ORVA 3KHSA 3UHOA 2GBPA 3UYLA 2O19A 3PNLA 3T1VA 3ROZA 1Z2NX 3C6YA 5JARA 1KEVA 4JHXA 4MQEA 5FPSA 4Q24A 5H5JA 1Y3HA 3ROXA 3VPXA 4BNMA 5CFQA 1MT0A 4JI8B 3VNVA 1SUDA 2ZRJA 1AKQA 5D51S 4Z8XA 2CYAA 5JWHA 5JCZA 1H93A 4WZ6A 1JNXX 3QENA 4KK4A 2NYVA 1T2VA 5FFNA 3VBEA 4JB8A 5EJ6A 2IPXA 3IUNA 5TSDA 2UYOA 2QLNA 3TO5A 4K9NA 3SBEA 4I19A 5KWVA 4JI4B 3BL6A 3JQ7A 1LK7A 4WCFA 1TT5A 4EKIA 1MAUA 2PR7A 2PUDA 5FPHA 3IPXA 1IM8A 3HWX1 3K8QA 1PNTA 4LHSA 3B3FA 4HLQB 3ED5A 1DBIA 1OCEA 1AGNA 3OAAD 1SGWA 4YA6A 5DSTA 3VNAA 3ZHQA 2O8DB 3GGOA 3C8ZA 2JB9A 5ER9A 3VU9A 3W5JA 3QMVA 3OIGA 3ANYB 4XWTA 2OQVA 3E7XA 3CR8A 3RSGA 1F5NA 3RT7A 2OO3A 3BL5A 3T8YA 4J1TA 4ZC1A 3RW9A 4AJ1A 2GWRA 2PJDA 3ZWCA 2ZQ5A 2HMAA 1AO0A 3TEMA 4ZT2A 3M2TA 2H9AA 3SR0A 4IP0A 1UBOS 1MA0A 5G02A 3RSLA 1FMTA 2R4UA 1F1BA 2HHJA 3OLCX 3AETB 4BVFA 1Z7EA 1KK2A 2LDBA 3A6JA 2H31A 4OQYA 3WZ2A 5CHEA 4YUZA 2NTNA 5IBQA 1TUBB 3KB6A 4NU5A 1WPXA 3EPHA 5C3UA 4YCSA 1GXSA 1MGOA 1EXDA 3D7SA 5JSUA 3FTNA 1KK0A 1DV2A 1XG5A 2W37A 4Y2TA 5KHLB 1N92A 2ADMA 4Q37A 2BGGA 1XAHA 5K03A 2VHUA 1J09A 2QTVB 4AG3A 1I7SB 4BX3A 5KJCA 3OM8A 4M6WB 1WM1A 2WU1A 2NTJA 5CD9A 3O9MA 2H1SA 5AT1A 5C32A 3D8NA 3VPCA 4V0OA 1WMSA 1ZN9A 1MTZA 2PX2A 2UYCA 1JLSA 4OB6A 1AXEA 3G5LA 3N70A 4ZOQI 3W2GA 1X1RA 1JYSA 3BGIA 1SRRA 2WJZB 1TU3A 2QG9A 3MAAC 4G3XA 5G40A 4ENWA 4ENPA 5I8PA 1BDBA 4MW1A 5I8ZA 4AMVA 5J4HA 1C7IA 3AJAA 3ZJYA 2Y9PB 1CEEA 4DIUA 3PDHA 2VWGA 3SR3A 1GZ7A 2G07A 2VDKB 1U2PA 3I6BA 2GNPA 1MH9A 2YVAA 5AI4A 2VQSA 4IZIA 5L7WA 3CZ9A 1A96A 4UU1A 3WSWA 1RPTA 2I1VB 3GWZA 3LRTA 1EFDN 2G9QA 2R60A 5FWDA 1N5MA 4MVJH 1R18A 1QVRA 1G6OA 3ADKA 2OGWA 2WA1A 4OMFG 3OE4A 3IO5A 2FUG6 2PUJA 2Z6VA 4X24A 3RV4A 3KT6A 3I32A 4OGGA 3HCRA 2B61A 4H15A 3DT8A 2G80A 5AUOB 1A1SA 4LS3A 1ZR4A 3SD7A 1EA5A 1HURA 1TCCA 2H0RA 2Z30A 1L4FA 2D2XA 1B0PA 1ZIYA 4R69A 3B20A 4IJ5A 4B3FX 4JQYA 4GOOD 1P2GA 1SXJA 2ZPUA 3MVEA 4WACA 3TGWA 3OPNA 5KNBD 3RSOA 5AJZA 5B12A 1HYBA 1Z2AA 5HBGA 2HRRA 5B7QA 4NJEA 5KDLA 3DOJA 2F1OA 3G2KA 3V4VB 8GPBA 3VKFA 3WGNA 3JWIA 5DSXA 4OYLA 5ALMA 2BD0A 3KKPA 2Z98A 1KPIA 3GEPA 1D5CA 4JLNA 4XX0B 3FMVA 4EUEA 4DYVA 3O84A 4HWRA 4BY9E 2Q1TA 1OTHA 1U2RA 4L1KA 5HF6A 3QELB 5BSFA 4FFNA 5IZ4A 1N5RA 1Y4DE 1Z4PX 4ZJUA 1WZNA 1PF7E 1W4AA 2GEBA 2JJMA 4PVDA 4X66B 1KYVA 4FYXA 1NQAO 4DBLE 1B8PA 2H0QA 4LJ9A 4O2RA 5ELMA 1TO6A 3GK3A 3JVVA 2PAAA 4YC7A 2J08A 1DXHA 4OGFA 1TJPB 3ENZA 3ZXXA 3OFSA 2CV2A 2PMCA 3B8HA 2MR5A 3WYBA 1GQRA 4F6RB 1VECA 4ZVPA 5JIBA 1RE1A 3NT2A 1O2DA 3IO3A 4QU0A 5CJJA 2C00A 3O3OB 1KH1A 4Q1EA 5EUCA 2YVLA 2YTZA 1KJWA 1UBTS 1EJBA 3GHHA 4HX2A 1L8AA 1TPZA 4GI2A 4PLYA 2Y77A 2PR2A 4DLAA 1WXQA 1Z34A 2JD1A 3QVKA 5HZHA 3NIGB 5G41A 4RJKA 1BMTA 3LBHA 1MEJA 2P65A 4XJVA 3RC7A 3D4OA 1ZCJA 3W5BA 2I8LA 4IO0A 3L4JA 4GM4A 2FFRA 4R1OA 4ZODA 4ZD6A 3DW3X 3RQIA 2XWJI 3IT3A 3AONB 4TXHA 3W4KA 1NLYA 2I9KA 2JK0A 1U0SY 1D6JA 1GT6A 1JKIA 1K7FB 2OHFA 1XZQA 1DLIA 4PGFA 1P6QA 4BHTA 3DA8A 3K71B 3THOA 3FXAA 3TBKA 1E3IA 1QLJA 3E9RA 3ZU5A 1ZH2A 2IS4A 2JFYA 2QN6A 4YR9A 5EWLB 1KS2A 1AF4A 5AKXA 5CA0B 1Q19A 1L5HA 3ZE9A 4RTQA 3ESDA 4QGBA 3VAAA 3R6TA 3K70C 2GJSA 2V7QD 3GFBA 4IDPA 1PVVA 3ODGA 3PSAA 3BXFA 4RVGA 5HF8A 3RU7A 4CKBB 4NCIA 4XM2A 4D4GA 4QT4A 3ROGA 4YYEA 2CXPA 2R6HA 4O1IA 2B69A 1NYQA 2Z8XA 1AE1A 2ZYWX 2PIAA 1QR2A 3ENNA 3A05A 3NB0A 1GZ4A 4EI8A 3T6KA 4YT2A 3WKEA 4KVAA 4ARSA 2XXAA 3H1AA 1N6RA 3GFFA 3VJMA 2CYCA 2SKDA 2W2LA 4ADSG 4X6UA 5EZSA 4BAUA 4F5YA 4BLQA 2CFOA 2BTEA 4Q0MA 2P1DA 3AYXB 4HJRA 3NHJA 5T67A 2QW1A 4EM6A 8OHMA 6Q21A 2Z09A 3ETLA 2X5XA 3N7AA 2IZ0A 3KQUA 1JE0A 5K4AA 4JT9A 2OY0A 1V8ZA 2XOKA 4JP2A 2AUMA 4D41A 1EM8A 2CLEB 4R5MA 4YRSA 2XBMA 3QHAA 1RD4A 3U56A 1T2AA 3D6FA 4MCHA 2WUWE 3ZWPA 1OHHA 3EGOA 4H59A 1I24A 2QR5A 2DGDA 1XSEA 1NBMD 2XNHA 1XNJA 3HJRA 2NU9B 3UK0A 1TM7E 4EFLA 4Y2QA 3QUQA 2ZVJA 2ZRMA 1M33A 5K2MA 5DYGA 4BAGA 1KY4A 5C7LO 2P3QA 1ETUA 5I7VA 2HBYA 1NQ5A 3WGVA 2XUIA 4D97A 5KMGB 1UFQA 2A67A 4IHAA 3MB5A 4MS4B 5ECDA 4CEIB 2EAUA 1BYUA 2F3RA 2ZQYA 4N49A 3USZA 4DY6A 1P4SA 5WRFA 1JVNA 3R3VA 1G98A 1PBTA 2GRAA 3BERA 5HW0A 2HADA 4TKZA 5KSOA 1DU4A 1IEWA 5TGDA 1Z2PX 3HN7A 5JCJD 1W76A 3B51X 1K4MA 1BFUA 3I5AA 4S05A 4UXHA 2X3FA 5DBEX 2Z95A 2VK1A 1K7YA 2BHSA 1LU9A 2BMFA 1E2DA 4GIBA 4L5CA 5EIBC 1KOLA 1TAQA 4CJXA 2ZIFA 5ESRA 2X8BA 4NE9A 2GH1A 1LV8A 4TROA 1XOIA 3MINA 5DNEA 4BZWA 1Y3CE 1IZ8A 3ONEA 1XDWA 1M2OA 3M6WA 4ON9A 3DKRA 4MW2A 4Z54A 3DB2A 3I6IA 4QM7A 3TDMA 2G0AA 4EFDA 3B9BA 3RV3A 1UKAA 3MCUA 1CDZA 2Y6UA 4TUYA 3U4IA 4N5DA 3A7DA 5CGZA 3SIWA 3TSOA 5HGXA 4UBIA 1SD5A 4XJSA 3U49A 3ZNQA 2Q8PA 1E6KA 1RYZA 1CR2A 3K1ZA 4ZCRA 1UDAA 2O8CB 1NGSA 1PG0A 1HSZA 3TTSA 4DRXA 4MR8A 3ZW7A 3A37A 3OJFA 4JP1A 5DEIA 1AH2A 5EXTA 2FLVA 2F1HA 4QM6A 1E98A 5F9MA 1KZ4A 4EO9A 4W8OA 5A3QA 4A03A 4INOA 4J90A 2JW5A 1WETA 4W1QA 3HNOA 3LBFA 2WIBA 1DQZA 1P8AA 5CMLA 3REGA 5F1PA 3NDJA 1ZMOA 3FNEA 2GZAA 2LIPA 3L7KA 1GG9A 1P80A 2Q5OA 4FCWA 3G0IA 4AFNA 1VQ1A 1Y42X 2LKDA 5JQGA 3AO0B 4CQNA 1U2GA 3VR6A 5DN6D 4KU4A 2WTXA 3PUIA 2ZJ0A 3SCZA 3COYA 3WWPA 3AVOA 1JIQA 1K1EA 4NEGA 1JSLA 3C8MA 3SBXA 3U9SA 3KOUA 3LF1A 3M34A 4YK7A 3R7SA 4NF2A 4EG4A 3J80A 4TZ0A 3O8DA 3SYMA 1NT2A 1ABEA 4HDAA 4HRAA 4DRZA 4HYEA 1R3UA 1BX1A 1QCDA 1FDOA 1UMCA 4PTLA 3DEHA 2WWGA 3LYHA 3K16A 1JW9B 4BMNA 5KVQA 1AMUA 1CZKA 4WTOA 1SUEA 2AJCA 4BB0A 4PG7A 4CR6A 4FDTA 2PWAA 2ZZKA 1ADYA 2XE8A 3KCNA 4MYTA 4PN7A 5IF3A 1ZYUA 3ACDA 3UTCA 5EIBD 3TW6A 1MKYA 1Y9JA 5IVKA 2O23A 3HCEA 2RGCA 4LE2A 4QU5A 4MW4A 4RFSA 3DZGA 1W0JD 3KZCA 3UW3A 1NQOA 3QTTA 1AGYA 5F9HA 1TLTA 2JIOA 3MOIA 2OXCA 1JDSA 1KDPA 3C85A 3W79A 1GR1A 2OENG 1ZCFA 1P2FA 1NG1A 2NQTA 2GCIA 2PZJA 3DWEX 3I9NA 4IGKA 5LWHA 3EIQA 2AF4C 2WJIA 5KYYA 3R20A 3EFHA 3ZX4A 4WERA 4DSUA 1YJAA 3DL2A 3HKDB 4JEMA 1ZEJA 5KKAA 1YZTA 1QVAA 2CNWD 2C0CA 2CJWA 2ZK7A 3N6VA 5J5CA 3S5JA 5LQUA 1PUJA 3ESAA 3T1QA 3QOYA 5LZ7A 2G25A 4ZHSA 1D2CA 1QKIA 4AQYB 5E8RA 3EZYA 1G21E 3M6VA 5A9RA 2CF6A 1MXFA 4FINA 2PXAA 3AW8A 4Y2PA 5ECYA 1YAHA 3KCQA 4FBLA 3C15C 1C2TA 1O96B 1YNSA 1XJ0A 3ABRB 4QDXA 1DMSA 5KNDA 5A4KA 3SVZA 1XMPA 3QXXA 4C89A 3SE7A 3DMRA 2G04A 1ENPA 1YONA 4U7GA 4Y6OA 2NUPB 2BP7B 3G8DA 3QPDA 4IO1A 2FVXA 1QTIA 5JPIA 3UXHA 1KOFA 3HKBA 2BZSA 5FBHA 1C29B 3RVKA 2FG7C 3BAZA 1S2MA 3LBIA 4JJ7A 1M34B 4MPTA 3W7VA 4XFDA 1DIRA 1YZQA 3B1JA 1F4LA 3D31A 4EMSA 3EK2A 2FPWA 3C97A 1PZMA 1PO7A 1XMQB 4K5QA 3OMWA 1GN8A 1MVLA 5LZ4A 1WUKS 3L8YA 5CDFE 4FNMA 2HRBA 4F21A 1K27A 4NESA 3FKJA 3U1TA 2HMUA 3JRXA 1A7UA 3HDTA 1BE1A 3EXEA 4MLZA 1G5IA 3H2IA 4XR9A 3KQHA 3GA0A 5AVOA 4DV7B 4LHEA 4JNKA 1M6VA 2RAPA 2HK7A 2HV9A 4M37A 2HK8A 3LL4A 1SBIA 4D26A 1WG8A 3L1HA 3R0XA 3WNVA 2REOA 4K3UA 2I91A 3OF3A 4A5SA 4ZK2A 1BDJA 1MX5A 1F2TB 1P1IA 1YS2X 1N0UA 3NBZC 4N18A 4YHHB 5JAZA 2PL9A 2YZNA 3X1KA 1PJRA 1X7YA 2FEXA 2NSYA 1G60A 2PZBA 4W7HA 4Y9RA 4B35A 1TTTA 1SOMA 4ZI7A 3WGHA 2MU1A 4CUKA 1U0RA 4BX2A 1BDMA 4US1R 1L4UA 5ICFA 4XIGS 3BD9A 4DDTA 2ZRBA 5T4FA 1WXWA 1VKOA 4RS3A 3UOGA 1AKRA 4ZTZB 1OA1A 2GPAA 3Q7SA 2O0HA 2FKAA 5HF5A 4ANFA 4B8WA 1PJQA 2AL7A 2EXXA 2QX6A 2QZ4A 3SJUA 4NYMR 4PLZA 3BGSA 6REQA 3NIBA 4L16A 4WLVA 1R9GA 2OLKA 4G01B 3LPLA 3MTIA 2D8MA 4TMVA 4NZYA 4D9KA 5FI0B 1QHGA 3OZDA 4MQBA 4XGRA 1JBQA 5EE0A 1EFAA 4FVTA 2W71A 2M98A 3PQ8A 3OURA 1JU4A 3BTUA 4AO6A 4AVYA 1KZ6A 1OWNA 5TIIA 3JQ9C 1S9DA 2FG5A 3HJBA 5DO9A 4Z4EA 3LT1A 4LX0A 5KPDA 4AF7A 1DOAA 3G02A 4EHLA 3IUMA 2QIPA 4WK2B 3GX1A 2C7GA 4F6CA 5AJXA 3WYGA 2HWKA 3O7MA 5LKAA 2P3SA 3N28A 1PEAA 4W5OA 3V8BA 5JBQA 2PMFA 1XZHA 1PR2A 4LDNA 1LVGA 3HBMA 1XNHA 3B78A 3C5CA 1TMOA 1PJTA 3O8LA 4QLAA 4RHUA 5A9SB 2XSZA 1SU4A 2IXDA 4FM9A 1VA4A 1BQ4A 2O14A 1EG2A 3OZAA 3SK0A 1U8YA 2PUVA 4OG2A 3WLKX 1N1GA 4UREA 3ZK8A 3FPCA 3P9QA 3GRFA 2C9MA 3FMIA 2OG1A 1UFOA 1VYUA 3GEBA 4M1YA 5CNMA 5DCLA 4AP5A 3QLVC 4FONA 2BVNA 1B6TA 4AP9A 4EFMA 5EMKA 5C5DA 5JCOC 1X1AA 4FK8A 2DUWA 2AJ8A 3FUXA 4N8DA 4UTRA 2GDJA 3NRBA 2OAEA 2IOYA 2ODEA 1PFWA 2WPDD 2Z8YM 3CH4B 5AD1A 4BZQA 5JRDS 2RONA 4JYMA 4F45A 4BTEA 2BEJA 2QLLA 3M5PA 2WLTA 4MRRA 5I4KA 1XKLA 2GNAA 3NT4A 3EPJA 2O8BB 3QI7A 3TOCA 3NGMA 4KKXB 5BNWA 3DUFA 5J40A 4C4RA 1U7HA 2IE0A 2PRSA 1XD2A 3B6JA 4C4OA 4YQFA 1C50A 3DDHA 4AKHA 1GGHA 4H4DA 5IVDA 1N3YA 2JAXA 2QWXA 2XJ4A 3OJOA 4BPBA 3UV6A 5DTRA 3KQNA 4CGZA 2NP6A 3UC9A 4AQDA 2B1RA 2OILA 2O5RA 2QMOA 3CF6R 1JR4A 4B7AA 5JBNA 5J3JA 3ZU6A 1VKHA 5HIJA 3TLYA 3CHYA 4Q4DA 2CCKA 3GEMA 3IKLA 3C6MA 1US8A 3KYIB 2VPZA 3LIIA 1JQKA 4J6EA 5L45A 2EWVA 1P39A 4O59O 4FMCF 2YOFA 2WDPA 1XLWA 2R8BA 3C5HA 5JV5A 2CHEA 4YGXB 2R6AA 5LL6P 1J9ZA 4MEJA 4RA9A 1ZM7A 2G6BA 1SXJE 2G71A 1G7SA 2PXXA 3OMXA 1K7SN 4H0CA 4GP9A 4NV0A 4NYJQ 4C08A 1V45E 1WXDA 1Y7HA 5FQNA 3NASA 2CGEA 2P4QA 5DX8A 3TM4A 5CLHA 1IHXA 5BV1A 5EP3A 2XZLA 4ZYVA 1T4CA 2G83A 2B92A 2SICE 4MR7B 1E79D 3GD7A 5H4HA 3BMQA 4FYWA 2FPMA 1GPWB 3BRSA 4E7PA 3I52A 3NKFA 4ITVA 3S68A 4CETA 5JS7A 5JSZA 4OMDA 2H1VA 5LP6B 1BXRA 4AC9A 4A10A 3CLHA 4L57A 2FRVA 3SN6A 4W82A 3H1GA 4D0NA 1GGNA 3TE7A 3S55A 2C7QA 2BGWA 1L5LA 2QK4A 3NHUA 3GDFA 1PS0A 2UVDA 5DISB 4GD3Q 1ICIA 4ZC8A 2IA5A 2H29A 1UBFA 3ZOZA 5REQA 2QIOA 2ZRIA 3TWOA 4JYAB 4HATA 3M0EA 3TFQA 4PO9A 2DZDA 2HGSA 2QRZA 3I23A 2COUA 2EZ9A 4I2NA 3Q85A 1NYLA 3L8ZA 2OQRA 1T3HA 5JMWA 3OLZA 2XXBA 2WF5A 4QOHA 3TINA 2CMGA 4YRQA 3HQ4O 3CXUA 1HDXA 4NARA 3IOYA 3WLOA 4DUPA 2XTZA 3DMPA 3MRSA 4DFDA 5I45A 1P7WA 3RS8A 1GAWA 1ZL2A 1A4UA 2XB9A 4HX9A 1VL1A 3VHLB 4AJNA 4CHTA 1OI2A 3R5KA 1W5EA 3F6RA 2CE2X 4FCVA 3CF0A 4GI5A 4CM6A 4OXNA 1GKYA 1CF4A 1M76A 4NI5A 1VHTA 3IV7A 5DE3A 5AK4A 4AG5A 2A86A 2ZSUA 5DF1A 4ZHQB 3GIWA 5FJIA 1ZI9A 3H9QA 2P78A 4LCEA 1VFPA 2ZUUA 3A28A 3BBLA 2OMKA 3OKAA 4MVXA 1H3NA 1R6DA 4ER5A 4NX2A 1R0KA 1J7KA 4WVFA 4Y6RA 3QLEA 1HDCA 1N5IA 3D0RA 3NH6A 3IFSA 2HCFA 2VQ6A 3KQSA 1GPH1 1VRCA 5E9QA 2XZPA 3L0OA 4TN1A 1T0HB 2MSCB 2QVLA 4NQRA 4UZSA 3KDAA 4LOIA 4E5YA 2QVGA 1ZM9A 1P9NA 1YRQA 1VYHA 2R00A 3FPHA 2ESRA 3TSYA 2QRPA 3UA3A 1LKZA 4QDOA 3UGJA 2NMVA 4TYWA 2QSZA 1G8KA 1KJQA 2PYDA 4IF6A 4MEAA 3UA4A 1YE3A 2FEAA 3EXIA 5BQFA 2Z6AA 3TLKA 4W1PA 2QD2A 1SU7A 4OKNA 3O5AA 3QVOA 1QFYA 4KVZA 1SA0B 2B2CA 2P2DA 2QQ5A 1P1HA 2YJNA 4YR7A 1MZVA 5JWRA 3DKIA 4RMGA 2HA7A 4P7JA 1B2LA 4YRJA 5CGQB 1X0XA 3NLLA 4PE5B 2J6BA 4RZ3A 1XZEA 1JHQA 4CG0A 3EISA 2AR0A 3K0FA 3HH8A 3Q7RA 4PPQA 1RAFA 3C5VA 3GUCA 1AA6A 2DBZA 1Y6FA 1UADA 2YXPX 2MMCA 2I4TA 2G08A 4G81A 2B8EA 1M6EX 4FLFA 4A36A 4B2PA 1L8XA 1AKWA 1SC4A 1Y48E 4EPVA 4Z5XA 5JFTA 2BOVA 5DHPA 1PT9A 3OF5A 4RAOA 4X85A 1R88A 2FW6A 5DX0A 3UTDA 2Y93A 3GJTA 1MAWA 1C7FA 5IWCA 5KZMB 1RQNA 3RYCB 4WBNF 4ZDWA 1E0SA 1GSOA 5LB4A 3HWWA 4C7OB 5CT9A 3GMIA 2YNMA 2ZT8A 4IUBS 4LXXA 1Y89A 5FPTA 4YJGA 1KY2A 4HD8A 4Q7QA 1J33A 2WYHA 4Z8YA 1AQ6A 4C01A 1FXWA 3SZ3A 1QORA 1NN3A 4FUQA 4MP8A 1BWPA 4F0JA 1SXQA 1WD5A 2V9PA 5P8WA 4MKXA 3RR2A 2IU0A 2HA4A 2HK9A 4TSRA 5CFLA 5LPNA 5A6SB 2H5JA 4LWQA 1WE2A 4DHEA 4Y2VA 1Q17A 3FVQA 1FRQA 4WNCA 1KI9A 2H17A 1X1TA 1PL7A 3AESB 3EUFA 3HEBA 5FUYA 1UAAA 3CX4A 2XCIA 3FFXA 4C6RA 4RU1A 3KUXA 3RS7A 1Q7BA 5A6VA 4J8PA 5L9AA 2JL1A 1KQGA 1SBYA 3M33A 2GZMA 1QHHA 3OP1A 1L6IA 3PP8A 3CBQA 1IUNA 4RZUA 1GO2A 1J5PA 2IXBA 2MMGA 2FR8C 2VCEA 2J6CA 1II0A 1KTVA 2O0LA 3KTDA 3QEJA 2AFIA 1Z26A 5EIXA 4PSCA 3SIXA 3FYUA 5HKAA 4ZCQA 1WF6A 5M04A 1L1RA 5CITA 1N3BA 1UAYA 4ZJZA 1P4JA 2PLRA 3F6SA 4MW9A 3TQSA 1V1MA 3EY9A 4MTLA 3FW1A 3EBPA 4XR4A 1NBOA 5ESXA 4KAAA 1FFEA 5HKBA 2OXRA 2GXAA 1KI6A 3EVFA 3RGGA 3NATA 4OTZA 1M2JA 2H4JA 4CPDA 1P1CA 1RYNA 1LFAA 3WNZA 2JFWA 2XMSA 4YAIA 5CB8A 1L3IA 1RXWA 4KO3S 4EI7A 3PXAA 3RIHA 3LWBA 3N0VA 4KIUA 2YWJA 4ZEOA 1KEPA 2BYTA 3WLHA 3SKVA 3U5TA 3AF2A 2VR1A 4E4TA 2Z2ZA 4DJTA 3ZD9A 2OCPA 2YY7A 3EHDA 4JEIA 5B58C 1OWLA 2AC4A 2HGZA 2G63A 4B6QA 1NPYA 1LBTA 2DFPA 2BH2A 1X1SA 4F1WA 5JO0A 1BJRE 1FS5A 2POQX 1GV1A 1IJEA 1SC3A 2XUPA 4HZGA 4A27A 2C88A 5HRUA 3WLFA 3U3RA 1E5DA 5FA5A 3RIEA 4LFCB 2QBYB 1RPZA 2VN8A 4UQOA 2WQ6A 2PKRA 1KFKB 2IYTA 1ZH6A 2JZNA 3F96A 3JV7A 3DC2A 1IVYA 1RI3A 1EE9A 1ZW1A 1XTPA 3ESBA 1SURA 2W2KB 1UMDB 3W4IA 5KOHB 3EXFA 2F55A 1VJRA 4G4IA 3W5HA 3BD8A 3LGSA 3WQRA 4UOZA 3FF1A 1WB9A 1N8SA 4O4JA 4IFBA 1QHFA 4JXJA 1A4XA 3HJAA 2PZEA 2NNWB 1YIDA 2H18A 4MS3A 4V3BA 1Q74A 1XZ8A 4HXEB 2CV1A 4WBXC 1EXNA 3EUEA 1ZJWA 2B1QA 2C2YA 1J22A 3BWDD 3EDCA 5BSEA 1Z06A 2AMYA 5T64A 2X0EA 1I0IA 2PH5A 2PMBA 3DE6X 1J2UA 2R1ZA 2HA0A 4GWKA 1GCIA 5EMNA 4LF6B 3HC7A 5ICEA 1A7KA 4R98A 4Y6QA 2P2CA 3FB1A 3ZCXA 2B2NA 3C5EA 1R5BA 2BPOA 4WFQA 4DVGA 4KO1S 1E4OA 1LEHA 2XWQA 4MUKA 4WESB 3OJXA 3W0LB 2QRVB 5EUMA 4K8RB 3EVGA 2OV3A 2FU5C 1BOOA 3DMNA 3GUVA 4DSAA 2JLBA 2X3YA 3MERA 4UKDA 1H2AS 2HYIC 4C4SA 4CN9A 1HNWB 3CZRA 2HFJA 2ZSJA 2VG8A 3EVBA 4V0LA 4UMVA 4RV5A 1YCFA 3FSGD 2F90A 4KLCA 1Y3FE 1K6XA 3RO7A 4JWTA 1I4OA 2P9GA 4X1OA 3TNYA 1GPAA 1PTJC 2VYND 4RIFA 2O2SA 3V9AA 3PFWO 4MB6A 4QOJA 1GZ5A 4IMJB 1XZAA 1QGYA 3PNMA 5CA1F 5PGMA 4BB6A 4AMZA 1UJCA 1QZXA 1GARA 3SX2A 1BH2A 3AB3A 1DFHA 2NPOA 3ERCA 1Y8CA 1LS1A 4DYDA 4QGHA 4RENA 1Y6QA 1JG1A 3O03A 4QBHA 1G66A 2DBVO 4IHJF 4URVR 4EJ6A 4MUHA 4PWZA 2CV0A 3BB1A 1B76A 4QWWA 1YACA 1OILA 2YOHA 4L4ZA 2I2WA 3HXMA 2JLCA 3VO2A 2PL1A 4K1LA 3U3OA 3QP9A 2DG2A 3W9YA 1JHVA 4BRWA 5T5QA 4IFTA 1GNTA 5IBPA 4LE1A 1UM9A 3M83A 1A9XA 3G2OA 5CLJA 3LW8A 2BFDA 3DFFA 3EDYA 2JAWA 3PR3A 4TKVB 3BUSA 3ZY6A 3CZ5A 5E1MA 2GKSA 5ARDA 1TVKA 1ZD1A 3ZKWA 3G5AA 1ZINA 4D81A 4B17A 1D2RA 1KJNA 2BM8A 3EAGA 2ZB4A 2Z3VA 3BMCA 3BMXA 5IVHA 1MIHA 3CJQA 3AQIA 3GPLA 1ABBA 4J7CA 4RGYA 1FYDA 3CO5A 5HZMA 1AURA 4R0VA 1GSAA 2OZKA 1II9A 1TCVA 4I5IA 4BMSA 5M29A 2PQ2A 4RHCA 1BMFA 1JFLA 4HLNA 2I22A 2VQ3A 4TWRA 1MC4A 3QV1A 4MO2A 3SFTA 4PC2A 2FLKA 4DJ5X 3WIOA 1T3SA 3F97A 4KO8A 4MWSA 4R1UA 4YJDA 1FU8A 2XNDD 4L5BA 5IARA 4CG2A 3LGXA 2K7FA 2ZUDA 3FPGA 3TDNA 1IOWA 3U37A 1C9NA 2OVBA 4ARZB 2CEKA 5I01A 3IA2A 1N5JA 2WWFA 1CUHA 1Y1LA 1QR6A 1J99A 3MJRA 3L07A 1FIUA 5IW8A 4LISA 3KSRA 4BQIA 3K2IA 5D2CA 1D3AA 5IC4A 4WMLA 5EP1A 4TZ6A 1L4YA 1DBVO 2J41A 2HBZA 2JGJA 4H7DA 3RVQA 4BV2A 3R24A 4DG8A 4OXQA 4WZBA 4F60A 4GE0A 1ECFA 3GFQA 3HYNA 1TC1A 1Y82A 4GKKB 1SG9A 2JFBA 2AN9A 1IXZA 3K1AB 2D59A 1TM2A 3BHIA 3OEEA 3TIXB 2PGIA 4K9KA 2C3UA 1FFXB 1JQAA 1P0MA 1GT91 1JYFA 4X1KB 5TRTA 4EY7A 3GLGA 3WMWA 1TGYA 3BJRA 3FHOA 3EZ2A 3KB1A 3GBSA 4JBYA 4PZDA 4BVEA 4EVIA 3CZAA 2OZEA 3LU1A 4J9UE 4JBNA 4Q3CA 3ER8A 4FWBA 3RTEA 1JGTA 3MCAA 8AT1A 1GZDA 4QBFA 3WQBA 4C1BA 4EZIA 1YA8A 3OT1B 3U44A 1AQLA 2C2KA 2EJVA 4HLDA 1C8KA 3SJBA 1SEPA 3UXMA 2VDPB 2H92A 2YJ4A 4TMYA 4CF3A 2O7NA 1NXWA 4RGVA 1YKFA 5E95A 4C0LA 1P9OA 1GUDA 5FYDA 4WN9A 2BW0A 2WE8A 2HCBA 4RVFA 4YMSA 5ADWA 1X1EA 5J59A 1O5OA 4H27A 3ANTA 4CMJA 1QV7A 1NNI1 2JBHA 5TEVA 2NUTB 1VJGA 3LTNC 4X61A 1Z5WA 1QK3A 1CY0A 1Y63A 4A82A 4BNNA 3CWZA 1ZOPA 4AUNA 2Y27A 2JJ8A 3WHLA 2VJMB 5EHIA 3NDBB 3AUUA 1QGUB 3INYA 4WX2B 5DM1A 2AZXA 1TQHA 4XGNA 3FGZA 1FMCA 2PGOA 2UUCB 4CV3A 3D8RA 2TECE 1U2QA 3WX0A 4XPZA 4EQ6B 3EEFA 2BZGA 5CW1A 2RG7A 1I2BA 3PENA 2NV6A 3P0HA 1NXQA 2BDUA 4ZVQA 4HRXA 5FEUA 2JVIA 3ASUA 3P2KA 4V0KA 3UM9A 5JEEA 1ODCA 2H2HA 4WLOA 2XD9A 4DV1B 1L6RA 2C04A 1NXVA 2Y67A 3AK4A 2ZBGA 3LI2A 3R3YA 3R7NA 4C21A 1XQ1A 2H5IA 2P9CA 3PEEA 3SOZA 5ERYA 5GV7A 1WCIA 2PMKA 3ZV7A 4E03A 3E1SA 1N3IA 3CNEA 1U04A 5GGYA 5TC4A 1H1LA 1N78A 5A3VA 2P9YA 1ZI8A 3KDSE 4HH4A 4PCUA 4WOBA 1AGXA 5DRTA 5BWNA 4EB6A 2QRNA 2ZEJA 2HD4A 2WF6A 2W93A 4JLBA 4CKWB 4JWKA 4EPXA 2ZKLA 1X80B 1EGHA 5CT4A 3VPAA 3LQ4A 4YEDA 4Z0NA 1Y7IA 4LTNA 2CJYA 5C8DA 4MUAA 1YI1A 2CDCA 1H3FA 1Q0PA 4HS9A 1DC4A 1NVBA 1WDTA 3AZQA 4KGZA 4L72A 2EF0A 3I2JA 1MO5A 1EJ6A 1KYXA 3SC6A 1IY8A 2ZJFA 3AEQB 3NYIA 2AH5A 4JT4A 2ZBPA 1OGIA 2ID7A 2JH8A 3VH1A 3KG2A 2IUUA 4QOGA 1LJUA 5TE9A 3EVNA 2V0CA 2VJQA 3ML1A 4UVHA 4BP9A 1XHFA 3REOA 4YECA 4JR2A 1OASA 2YOGA 3MWYW 4Z6KA 1LZLA 2J46A 5KB3A 2AK3A 1J4AA 3MCWA 3ILVA 1WY5A 3G8AA 4JYZA 4LW8A 1PG5A 2Z43A 5L7TA 4RMJA 4ZARA 4CTJA 3GF4A 1EGQA 2VWQA 2HNAA 1SKQA 1UPAA 2VATA 3IP6A 2IKQA 3UKOA 2ISCA 5AJYA 3HVJA 3O93A 4R2WA 1MFZA 4RLSA 3SF8B 1OH5A 3A1CA 3TLBA 2RH5A 1KS9A 1JEEA 1FP6A 3OF2A 5LIRA 1ZBDA 2UVPA 1JI0A 5G0WA 3OFKA 1B4DA 2PV0A 3VTFA 3U7FB 3IQZA 2Y0DA 2CLLB 1J8MF 4JLJA 2Q5JA 4FDVA 2OHVA 5HE8A 1OLXA 1PYGA 3C39A 1UFVA 1E4EB 3SMQA 2O1XA 4OFWA 2WHPA 1GQSA 1V9LA 2V6GA 2ZRLA 2QU8A 2I4MA 3EZFA 2LXNA 3PNSA 1W30A 4EG1A 1OIWA 1U7UA 2YYYA 1C14A 2IXAA 3L0YA 1AB6A 1UXOA 4F72A 5TMDA 1AMOA 3DMYA 3FVRA 3JD2A 3ETDA 3I45A 4YACA 3AR7A 4ZVNA 2J85A 1OGYA 3M6UA 3F3MA 1XO1A 1DEXA 2VSQA 3H42B 4OHYA 3D6HA 1V8OA 3MT0A 4DIOA 3VSDA 2BKEA 3TTXA 1VYTA 2XMBA 1GKKA 2AE2A 3NALA 3QX9A 1IQ0A 1SIBE 3RVLA 1LCIA 2W4IA 1C1XB 3DL0A 1FVXA 2VIIA 3B6KA 4GM0A 1GOTA 4WKBA 1R50A 1QAMA 3M8KA 4AUEA 1JWBB 4CLHA 5LXTA 3O2QB 3QF4A 1RQLA 1J97A 3GLFA 1E2LA 1QIGA 4EYQA 5MDHA 4DCMA 3K9GA 1OLOA 3BCRA 1CT9A 2IYEA 1UPCA 3COZA 4RK4A 2WSIA 4IUDS 4J4BA 1Z2EA 4Y98A 1L5KA 4F9FA 1P4AA 4FKBA 1ZM2A 1CR0A 2ZS9A 3D5QA 3FYSA 4EARA 1TQ8A 2VZLA 3GLHA 4LMRA 4Y67A 1ST2A 2Y0PA 4OGWA 3GLIA 1L7XA 2VP0A 3W5CA 3FNIA 2FI1A 3B53X 1O6CA 3L43A 3GDGA 5KYXA 2CLMB 3MLEA 3SHWA 4EHAA 2XUFA 5FOXA 3T12A 2AOTA 1FX0A 8LDHA 5DN9A 1YCGA 3QVGB 2QN2A 1N34B 5JNSA 1S8OA 2Z2KA 1TQ4A 4YIKA 4G07A 1QM5A 4KN9S 3S27A 3X0DA 3TRKA 1YDHA 2RHJA 4EHFA 4B6FA 1YZFA 1P44A 3AOEC 1PZFA 4Y6SA 1PSZA 4NL4H 1BA3A 3GEHA 4A8HA 5AH0A 3ZBQA 1I4DD 4MR9B 4BFLA 3BT7A 3LG2A 5G3ZA 2VBFA 4NMWA 1DJLA 3QJ5A 4UCFA 4MARA 3ZHSA 1NF3A 1Q0UA 3EGXB 1ZJ6A 2BBSA 2D1SA 4REMA 4G2NA 4EY3A 4TYNA 2K2QB 1VZ2A 2V3WA 4D56A 4W9NA 4QTZA 1NFRA 4HN2A 2EFJA 4H18A 4H7FA 2WSBA 4GOMD 1UMBB 1GNVA 5CFPA 1A8PA 1OSNA 3TQHA 3PC8A 4FT4A 4LTMA 3BPSA 2KS6A 3GG2A 3DCNA 4LZLA 3IMEA 3SJ7A 2I3ZA 3C1TA 5EE3A 5AVZA 4ZICA 4RY8A 4E0BA 1N2BA 1KQOA 2ETXA 4BNDB 3FR7A 3IP7A 2FSUA 1BROA 4KWCA 2C77A 4WNAA 3P32A 5J5AA 2JEZA 1LWOA 4PX9A 2A4MA 2V6IA 3F2IA 3FCXA 2CVHA 1WTCA 5KSZA 1JFTA 1GG5A 3LPDA 2FF5A 3KTOA 2EYUA 1RAHA 3PNPA 1U31A 3EVEA 4RKFA 3S28A 3FNGA 5BN3B 1NQUA 1V71A 2N9UA 2AFIE 3QVUA 3GJRA 4PIPA 2QX9A 3UK1A 4A0GA 1AIPA 1R8SA 4F8YA 5KNCD 3STXA 2FP4A 4S1OA 2QTZA 4MOWA 1LSOA 2I54A 3F1LA 2AYXA 4IJQA 4UHBA 2JKVA 3N2GA 1UP7A 4Y2JA 3SC4A 4K0KB 2G72A 1CUAA 4NBRA 3AUJB 4U2EA 5AW5A 2EX1A 4G0OA 3TLGA 3TD6A 4AJIA 3K92A 4P22A 2OKCA 1ZXLA 4NCXA 4BVBA 2W6OA 4ZXFA 1QGDA 3NWOA 3PGVA 1M0WA 3MMZA 1X3LA 1MNAA 4RK5A 3OOHA 5DLYA 3V8VA 3VOAA 3C1UA 2PD4A 4GX0A 4HNSA 3I2IA 4KLZA 3ROPA 3B9PA 1T26A 3VZBA 2B1JA 1L5OA 3Q9NA 5LQSA 3UHFA 4BLUA 4D9NA 4YRGA 4F2PA 2IX3A 2A0YA 1YQUA 1RAIA 1K8RA 2HU2A 2OYRA 1IQUA 4KL8S 2DJIA 2VJAA 2VDRB 1K9SA 3IUJA 4OQ4A 4K6MA 2UUBB 1UCFA 2C96A 2HU8A 3M4NA 2IOQA 4S2EA 1UF9A 4XCQA 1WQ1R 4LGCA 4ZCMA 3PNQA 2GBLA 5DJ5A 2B1IA 3HN6A 3IE1A 3T7KA 1T9ZA 1I1NA 2JHFA 4NNPA 3U80A 3DQQA 3I6MA 3OHPA 5L3QA 2GTPA 3R0ZA 1AGRA 1T3TA 4P3KA 3IGFA 4XLTA 3VV3A 2AEJA 4MLDA 5JS6A 5A5FA 2VXYA 4C7VA 3LFUA 3GNSA 4BUZA 1OH8A 4P08A 1O97D 5EMJA 5KYWB 5JLAA 1LPOA 4G5XA 3TTVA 3C4QA 5J4YA 1P1RA 1I4EB 4L7VA 4OBXA 5CLFA 1EB9A 4BRUA 2R8PA 3F5DA 4I6JA 2X2FA 4NBNA 1S4QA 2FFAA 4PBSA 4EJ0A 1GLVA 4DXAA 1UJ5A 2GWHA 3BMNA 1HOXA 1N2HA 1ZN8A 4O02B 3P94A 2ZFUA 1RQ2A 2VCYA 4URZR 2Q2QA 4F5EA 1U1FA 2C3YA 3DZDA 2ADOA 4GKVA 1U7XA 1W9MA 1EGVB 1E64A 2P6OA 4HOYA 3GJ8A 5I6DA 3VPGA 3QOXA 4G86A 3SR4A 4HQOA 4Q03A 2ZRPA 3PKIA 1MP0A 1T8SA 3DTTA 4HAOA 4L22A 2A0XA 3RE1A 4HNVA 5C7OO 1QHSA 4C4PA 3S2UA 3CRW1 2M1XA 3ICCA 4QUAA 4MLCA 4EVSA 1OD6A 4NBUA 2IYVA 2QA5A 4TS9A 4D0SA 2Z83A 3CCCA 2K4MA 5A0VA 1H0HA 4YRZA 3PUZA 5AW2A 2DKNA 5IT9A 4KQCA 5IDXA 3ON5A 3SVTA 4QOSA 4QUKA 3ZE6A 1M72A 2J3LA 3ZXUB 2IHZA 3FMPB 1FJXA 1ZJ5A 5BSVA 1DUIA 4MQLA 4C0WA 1PZHA 2FEOA 3RBVA 1CW2B 4JSYA 5DTMA 4K40A 1E2QA 2I99A 3VVLA 3T3GA 5JZ9A 4A8JC 4N0PA 2QUJA 3J81A 1I7DA 1LLUA 5HMLA 4RPHA 4DPLA 2BMJA 3MEQA 1T5IA 3BFJA 4X63A 3K53A 3CLTC 2I3GA 3FD8A 4L8WB 4IZHA 4BWGA 5IBCA 3Q98A 2I65A 5KHOC 3HCFA 3X43A 4NS1A 3CNNA 3D8SA 1K6JA 1W1WA 5EYPB 1BVRA 5LZ8A 3RSFA 3HXQA 2I6FA 2WHXA 2O8EA 4F9EA 3ENQA 3Q0IA 4EHBA 1XQXA 5CLGA 3TZLA 4UOEA 4RELA 5IXJA 1QH8A 1IB0A 3AKDA 1U4NA 2WD7B 3DEIA 4ZT4A 5C34B 4YMUA 2FN3A 5L4SA 3D7MA 3UC5A 4CMBA 1NSTA 1Z28A 4IF4A 5H82A 2H2GA 4O4IF 5CU7A 2VLIA 1EFCA 4LQCA 1EIWA 1K97A 2HHLA 2PGNA 3BJMA 3TAUA 1KBZA 2YY5A 2EHDA 2VAPA 3CE9A 4JGGA 3BICA 4FHGA 4YYZA 5ECGC 4CL3A 2H57A 2B5OA 2AC2A 3SOPA 3U3XA 1TK9A 2O2JA 4AY3A 4OLJA 1X7ZB 2VT3A 3V2GA 5L3VA 1X42A 2X8WA 4F9GA 4FWIB 4UAGA 4QGFA 1O7JA 4KQXA 3BE8A 1NKVA 2GPSA 2ZE6A 4Z1MA 2QTRA 1LQUA 3SVLA 1YVUA 3NHPA 1USUA 4PZAA 3CA8A 4ZAYA 2DFTA 1BXKA 4MGHA 4FN4A 1E6CA 3A9CA 4HWTA 4UBOA 5AOAA 5K99A 3EIEA 3CFYA 2QRMA 1EWYA 1LBHA 3FX2A 4QXOA 1P77A 3WNCA 2EQBA 3WVNA 3K9NA 4WXPA 4RWEA 1J39A 2OQ2A 3U3ZA 2WAXA 4CTOA 2BFOA 3DJYA 1N9GA 3P5SA 4IXMA 3NV7A 5DXFA 4KJXA 4D9CA 3X2FA 2O7RA 4DCSA 5C1BA 3ELUA 1FNBA 2IODA 3ZZNA 5I7UA 2A35A 1ECCA 2NT3A 3CLTD 3CN7A 3PPVA 3QUCA 4G84A 4MTCA 2GESA 4BDTA 4EYEA 4JH0A 3HVHA 3OAAA 3UBTA 3TW0A 2AKEA 2IHYA 4UCWA 5E4FA 5AW7A 2JLZA 2RE8A 1XUOA 2YDXA 3E15A 4NZPA 4R9NA 1REQA 3O7WA 2KLHA 2VDLB 4UHCA 1WF3A 3ZKAA 2OV1A 4DXDA 3PQ2A 2RKWA 1VLLA 4G23A 4IIXA 4AJEA 2XT6A 5DVZA 1QX3A 1XV5A 1RNLA 2CHGA 3HR4A 1TVCA 3I53A 1RBYA 2W5UA 3GLGE 2Z9DA 3AY7A 3ISTA 3E9ZA 1RAAA 1UODA 1A0OA 1R37A 1W85B 2ZPAA 4IHQA 4KRXA 2WYVA 4Q3NA 3Q7PA 5DZSA 3TNLA 1K6MA 1HETA 4EABA 2OHIA 4EWLA 5CCBA 1A69A 2VEOA 4PZ0A 4QQFA 1RADA 3VZSA 1LTKA 5B6IA 5LB2A 1NVFA 3SX4A 3TRHA 4C30A 5FLYA 2XYGA 1XJQA 1IK6A 5JR3A 4WH0A 4ZOLA 2Q0XA 4BP3A 1C1DB 5JYEA 5CUQA 1VIDA 2NU7A 3AKYA 1RWPA 4EY8A 5EMHA 1NXOA 2VSNA 3U7IA 4MKHA 4D8YA 1YTUA 1SBTA 1D4FA 5K01A 4KZKA 4MB0A 3BD6A 1JFRA 4XJXA 2ZJ3A 4AYXA 4RMHA 2EL7A 4NSNA 4XQGA 2Z6QA 4IYJA 1FQKA 5CB4F 1CUWA 3A4MA 4DHWA 3P26A 2DQ4A 4OHFA 4TM8A 2OVFA 3I72A 4Y2RA 5T4EA 4HGYA 5CCDA 3AV0B 3HZHA 1HQCA 1QOPB 1ZUWA 4IV0A 1GUBA 3PDJA 2DJ5A 4QEZA 3M4ZA 3WIUA 4RHFA 5IWAB 3A2KA 3RS9A 2C57A 4ZVOA 2ISSD 3WK5A 1GPJA 4MPJA 4HDSA 2OCAA 1Q95A 3I04A 1ZD5A 5IK2A 1I9GA 2HQBA 5GV8A 5CVDA 4D4IA 2C7OA 5IBRA 1CQJB 3E61A 2VK8A 5JWOA 3TZHA 4QOEA 1B6RA 1JX6A 1SCQA 2OGZA 4GBMA 2BFAA 1QP4A 3D3NA 3RRNA 3AVWA 1R6XA 1VBNA 3KHTA 1G2OA 3JY6A 3EAFA 2MYNA 3IBGA 3QIVA 5E7IA 4LWPA 3R5TA 2ZATA 5EJ9A 4KFUA 4LFAB 2ZROA 2IW1A 3IILA 3HFRA 3AF1A 3T7DA 2C5FA 3ACBA 2C2XA 4P4UA 4AN1A 2FQ1A 5KNBA 4D4HA 4BKOA 1SQSA 4HTFB 1JKMA 3ND6A 3NRJA 3ST7A 3H2SA 1QFJA 4BWVA 4R6XA 1YR1A 3KFLA 4JY7A 4BBZA 1DXYA 4NEHB 4CGYA 2WT9A 5JAOA 2PZAA 3U7HB 3FPLA 1PQ4A 2J7KA 3FF4A 4ZOCA 2OCDA 1QGZA 5KOJA 3PNOA 4E6EA 4PO1A 4BPRA 3P2MA 1T6BY 4P5EA 2J59A 4LY6A 2DH6A 3E23A 3ETHA 3F6BX 4MS1A 2EKBA 4ALJA 3EEQA 3H2GA 1IEQA 1J25A 4UNPA 4MZXA 1JA0A 1YH3A 3DZKA 3E7WA 1KFBB 4N7BA 1Z07A 1ECPA 4WL0A 1WW2A 1SQGA 2QUAA 4FR0A 1RBQA 1T1RA 3CT6A 2C9CA 2X19A 2XECA 1XZLA 1L3CA 1F4VA 2E4WA 3MBOA 4KFRA 3EFOB 4Z3DA 1OYOA 4E09A 1BEEA 2BI7A 5HOEA 4R8LA 1CUUA 3AJDA 2HBQA 2W6ID 1CKEA 1E2NA 3HR7A 3BREA 2C92A 3D4LA 3Q0TA 2J0EA 2Q4TA 4LJAA 4LI3X 4MRAA 3REFA 2B6NA 2HDOA 3RHTA 1INLA 2WTNA 4HPXB 4NCNA 4GI1A 5AO9A 4B3HA 4CU5A 1WDWB 2BHNA 2QI9F 1ANKA 4E2WA 1C30B 1SZPA 2OHGA 4BEWA 1JECA 1VG1A 2AG8A 2DR2A 2MINA 3CWQA 1WOMA 2ANBA 1ISRA 1FBTA 1GPBA 1VL6A 1E69A 3FWHA 4HNHA 1P4GA 5GGXA 3VO1A 4ER6A 1Z38A 5AI6A 1JDVA 3EOZA 3B9RA 3MF4A 1TVMA 1IHUA 2V6JA 1Z88A 2PX4A 3RSQA 1WXGA 1HT0A 2YWXA 4YP5A 3SNKA 4B3MB 3K70B 1PQUA 1K8ZB 4NJMB 1BMQA 2A9KA 2QT9A 3D7LA 3M89A 5AW8A 3R7BA 1RT9A 2QSYA 3T15A 3I83A 2B82A 3GFOA 5IKMA 1GR0A 2JI4A 1QAOA 3PZRA 2Q6OA 1R0CA 1CZNA 5DP2A 2Q5HA 1SVWA 2ACVA 2V7QA 2ZLBA 3E2PA 3GZTB 1YZHA 4JN6B 1XCGB 5H83A 5GIPE 3GJ4A 1V3UA 2XQVA 4UAUA 2GBGA 2RGXA 4KMOA 4EITA 3NHMA 2C4WA 3R41A 3IERA 3SFVA 2QW8A 4U3JB 3KYDB 2OFOA 3L7JA 3PXDA 4KIFA 4R40A 5EUBA 1VB3A 4ND8B 2P6UA 3OPYI 5JSHA 1N33B 2YHSA 1EQAA 4IFIA 1RJ9B 2E1RA 3G9UA 4JB2A 4CIVA 4LY3A 4UBMA 3ZV5A 4E5MA 1X15A 4MUMA 3EGEA 2CXSA 4G8BA 4JVMA 4J2TA 4ML3A 2CVQA 1RC1A 3OZBA 3DZHA 1SBCA 3KYJB 3L0SA 4GPIB 4KXNA 4PYQA 4MGEA 3F6YA 5CNJA 3QKRB 4B2LA 3NWPA 3P96A 3A4NA 3PRJA 4IDCA 5AKIA 5F9FA 1EVLA 2GZDA 3PWTA 2BM0A 1HFKA 3U7GA 2BJWA 3DKPA 2C54A 2QLFA 3NJ8A 1E7WA 4NK4A 2ZVPX 2EG9A 3AGQA 3L5KA 3NG1A 2HBRA 4Z3KA 3QNWA 1H2FA 1YB2A 1RSZA 4MVJD 4KPUB 1CETA 1FJGB 13PKA 3UO8B 1D6NA 1NPDA 1CE8B 5EJ7A 1NBMA 5G0UA 4I6GA 1LV7A 3OZEA 4I4TA 4C0XA 1SOUA 2OBYA 4ZFNA 5JADA 1X7XB 4ZQFA 3VYVA 1JDZA 1DGQA 2YN4A 4OV6B 2XUQA 2IYZA 4G97A 2JLAA 4L9AA 4N12A 5ADHA 3AHCA 2J07A 1E1YA 2C5BA 4LOAA 1K3TA 3EC2A 5LVAA 4U7HA 3ELWA 5AYVA 3M6XA 2A58A 5IS2A 2QPTA 2Z2XA 1I94B 2YWHA 1DBQA 4OHZA 1AUQA 4QNMA 1JBKA 3DHVA 5BSKA 3ENVA 5CNIA 2VJLA 1NBHA 1FFHA 5JCJA 4CDGA 4TQ9A 4HQKA 2AG5A 3DV0A 3LCCA 4UU7A 1CEYA 4MWOA 2HLDA 3ORHA 4RPLA 3IBCA 3RYHA 4PSUA 2W11A 5TPZD 2NPFA 3WGOA 1U0HC 4EUNA 2Q5QA 3RAEC 3WBKA 2ZRAA 2VHCA 1RXCA 1ORRA 5EP2A 1EFPA 1CRQA 3P9IA 3X1YA 4DXHA 1ULHA 2GEDA 2B7BA 3KAKA 1Q7EA 4HEHA 4WV3A 5FBRB 2KI5A 4AJPA 1LSJA 4E1VA 3EDQA 4WZAE 3EGIA 2A9PA 1ADCA 3RF7A 2WC1A 3L02A 2CLCX 4JFRA 1Q91A 1SMKA 3MT7A 1QP8A 4YAFA 2IDZA 5CM2Z 1K7EB 2J6HA 5JDIC