3L1VA

Crystal structure of gmhb from e. coli in complex with calcium and phosphate.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
182
structure length
182
Chain Sequence
SVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Structural and kinetic characterization of the LPS biosynthetic enzyme D-alpha,beta-D-heptose-1,7-bisphosphate phosphatase (GmhB) from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l1vA00
3AR7A 5AK6A 3AR4A 1Z4IA 1KYTA 1RC8A 2IYEA 2NYVA 3L0YA 4H1WA 3W5CA 3OCUA 3QGMA 4NAVA 4UM5A 2C8KA 2IA5A 5AKHA 1YNSA 3RFUA 1QYIA 1SU4A 1XP5A 2FPWA 4OFZA 4UMDA 5AIBA 3E81A 3ET5A 3QU4A 4DFDA 3L8EA 5AW6A 1U7PA 2W4MA 5AKZA 4UM7A 1WZCA 2JAWA 2NO4A 1F5SA 4CF4A 2I7DA 3A1DA 1RLMA 3KBBA 4RETA 2G09A 2BDEA 2RAVA 2GHQA 3S6JA 1ZRNA 1PW5A 5AKLA 3U7GA 1L8OA 5AI0A 4OCZA 3DNPA 1LVHA 3ED5A 4EX7A 4AS3A 2WF9A 2CFRA 4JDPA 3U7EB 2YJ3A 3PCTA 3ZTWA 3QUCA 4NV0A 5AKKA 3NUQA 5ALWA 2G07A 2O9JA 5AM5A 2FUCA 5AW4A 5AKIA 1Z5GA 2ZBFA 2RARA 5ALFA 3ZW7A 2D2VA 2ZBEA 5ALZA 5AI5A 2HEGA 3MN1A 3SMVA 2EARA 4HGOA 4I9GA 2MSNA 3B8EA 2I54A 4UAVA 1FEZA 4FE3A 3EPRA 4F71A 3W5AA 3U19A 5IT4A 2G1AA 2OYCA 1TA0A 5AW1A 1NF2A 5AM3A 3BWVA 4HGRA 2P27A 2Q5EA 3NANA 5ALJA 2W43A 4UARA 4YGYA 5ALQA 5ALLA 4GIBA 4Y2RA 2HCFA 2HDOA 4BEVA 3SD7A 3J7TA 4C4TA 4CF5A 1RMQA 3IB6A 3OPXA 1S2OA 4C4SA 1TJ5A 5AM0A 2YJ4A 3ZX5A 4RESA 4ZEWA 5AVYA 3NASA 1RQNA 3SKYA 3I28A 3KDPA 5ALHA 3P96A 3CZ4A 5IT0A 2BY4A 3HYCA 3HLTA 1XPJA 2G0AA 3W5BA 5IS2A 2B82A 3DAOA 3KC2A 4AS2A 3N1UA 1RKVA 3ZX4A 3QU5A 2AGVA 3U26A 2DQSA 3ZUPA 1RPZA 1EK2A 4Y2XA 2YJ6A 5AICA 5ALXA 3ZWKA 1L7OA 1YV9A 1MH9A 4HGQA 3N5KA 5ALIA 1ZD5A 3QX7A 3RF6A 2B1QA 3NALA 2PQ0A 3AR2A 2YMMA 4Y2QA 4F72A 2ZXEA 3PGVA 3IRUA 1J8DA 4BBJA 4XQ0A 2I33A 2B8EA 2QLTA 4YIKA 2R8ZA 4L57A 3ZTYA 3NIWA 1ZOLA 3KD3A 4XE5A 4MUMA 3OCVA 2P11A 4BYGA 5AHXA 4HGPA 4KNVA 2YMQA 3N8GA 4BNDA 2P9JA 2HSZA 3UMGA 5ALPA 5AVRA 2FEAA 4CF3A 1QQ6A 3ONNA 2C9MA 3KZXA 2HX1A 2ZBDA 4Y2TA 3CNHA 1RRCA 4G63A 1O08A 4BKMA 4KN8A 1LTQA 2AMYA 2Q4TA 3N28A 1VJRA 4G9BA 4KX3A 4UMVA 2JAUA 3A3YA 2Q4RA 4L6CA 3QNMA 1TE2A 2NO5A 1Z4JA 3KOOA 5JJBA 1Z5UA 3WK6A 2YFYA 3OTQA 2IOFK 5AKGA 1RMTA 1L7MA 3A1EA 3E58A 2R8EA 4Y2SA 2PKEA 3I6BA 2WM8A 3AR5A 4EZEA 1O03A 1ZJJA 2ZG6A 4UAUA 3I1YA 2QYHA 3EWIA 3L0BA 5ALMA 2YBDA 5AM2A 4Y2JA 3M1YA 4ZEXA 2O2XA 1Z4NA 3BA6A 4KYTA 3WKDA 2G08A 2YN4A 2GHTA 2R8XA 4FFDA 4YCNA 2GFHA 5AI4A 5AVZA 1J97A 4KX5A 1ZS9A 3R09A 4BX3A 3L8GA 4Y2VA 2B30A 2PR7A 5AI6A 5AESA 3ZU6A 1ZD3A 2C4NA 4EEKA 2GMWA 2RB5A 3SF0A 1WVIA 1YDFA 3PGLA 2CN1A 2FPUA 2R8YA 3DDHA 1U02A 2JAOA 3K1ZA 3OCZA 2BDUA 1T5SA 2HI0A 5ALUA 2RBKA 2YMLA 1TJ3A 1Z88A 5AW7A 1YJ5A 3I76A 3QU7A 3VAYA 4E88A 3UMCA 1N8NA 1SWVA 1TJ4A 3AR6A 4CNQA 3L5KA 3QU9A 2WF5A 4QJBA 5AM4A 2CFSA 2WF6A 1RMYA 4HAIA 5AW3A 3L1VA 2AUTA 1S8OA 1WPGA 2I34A 3OCWA 2GO7A 3M9LA 3E8MA 5AKEA 2JGAA 3B9RA 2WF7A 5AK5A 2WHEA 3ZVNA 3QUBA 3UM9A 1ZD4A 4NABA 3WKBA 4YH1A 3SHQA 3WK9A 5AKYA 1ZD2P 1RKUA 1U2TA 2B1RA 2YY6A 3L7YA 4J2TA 2JARA 5AI9A 3FZQA 5AW5A 2P69A 3FVVA 4GXTA 4UW9A 5ALSA 3QUTA 2FPXA 2OM6A 1K1EA 4UASA 2G80A 5ALGA 2I6XA 1U2SA 1RLTA 1IWOA 4B6JA 3UMBA 3OCXA 1Q92A 4O8CA 2ODAA 5ALRA 3ZVMA 1Z4KA 4HGNA 1NNLA 1T5TA 1X42A 2MU1A 4BEWA 1L7PA 4J03A 3U7FB 5AVSA 2HHLA 3R4CA 4YIHA 4Y3UA 5ALVA 1XVIA 4C4RA 2YMPA 5AK4A 4UU0A 2HF2A 2WFAA 1RLOA 4KNWA 3WKEA 5ALYA 2B0CA 3AR9A 3SLRA 3IJ5A 4XOUA 1EK1A 3B9BA 1CR6A 4FYPA 4PNHA 1N9KA 2YJ5A 2W11A 1YMQA 3QU2A 1Y8AA 5AVUA 3PDWA 3ET4A 1L7NA 3FM9A 3SKXA 3U13A 5ALTA 3QLEA 3WKCA 4EENA 2C8LA 3E84A 4YCMA 2FPSA 5AKXA 4MWOA 3WGVA 2OA0A 2FDRA 4EX6A 4I9FA 2HOQA 3NRJA 3FPBA 3L8FA 3WK7A 5AW8A 1Q91A 1L6RA 3N07A 1RQLA 5AW9A 3WGUA 5AVVA 2VKQA 3WK5A 4CE6A 1JUDA 5FP0A 2IOFA 3WK8A 4BNDB 5AM1A 2OBBA 1Z4PX 3MC1A 1YS9A 4L6AA 2EAUA 1WR8A 2FPRA 5ALEA 4NFLA 4OHFA 2G06A 5A3SA 3EF1A 2HO4A 5AVQA 2ZBGA 3L0CA 3F9RA 5ALKA 1AQ6A 2HF7A 3QYPA 4QQFA 1RKQA 3ESRA 3NAMA 4UMFA 5AKJA 3QUQA 4UATA 3OCYA 3W5DA 4UMEA 5AVXA 3DV9A 5AK3A 3FPSA 4IG4A 3AR3A 5AIAA 4BX0A 3GYGA 1RDFA 4UU1A 5A3QA 2I55A 5AVWA 2IOHA 5AI8A 4IFTA 3WK4A 1Z4OA 4ZEVA 5AW2A 2B8JA 4DCCA 5AW0A 2FUEA 1L8LA 2FI1A 5E0OA 3ZWDA 5A3RA 1Z4QA 3ZVLA 1QQ5A 1T9ZA 3TLMA 4HYTA 3MMZA 4NWIA 3A1CA 4YCLA 4XPZA 4EELA 3L1UA 1SWWA 1VJ5A 3MPOA 5AVTA 4Y2YA 4DW8A 1QH9A 3ESQA 4Y2UA 2ZOSA 2C88A 3ZI4A 3WKAA 1QQ7A 5ALOA 2AH5A 3FGOA 4BX2A 1Z4LA 3EF0A 1VFPA 3R9KA 5ALDA 1Z4MA 1U7OA 3QXGA 2WF8A 3U7HB 5T41A 3L8HA 3D6JA 2CFTA 1CQZA 4AP9A 2EATA 2X4DA 4JB3A 1ZRMA 1NRWA 3AR8A 4OD0A 4DWOA 5ALNA 4Y2PA
chains in the Genus database with same CATH superfamily
5JQGB 3WQHA 1ZP6A 3BE4A 3LXXA 4O3FA 5D3MA 3IXLA 5EIBD 1XPRA 5TT0A 4F60A 2VI5A 1P2TA 1JVSA 1NI4A 1NUAA 3QF4B 1BRTA 4FMPA 4BNZA 1ZSVA 1OXKB 2NU9B 2IA5A 4HN9A 3RSSA 1Y7IA 4Q4AB 1Z38A 3Q11A 3SC2B 4G89A 1QIHA 3SZRA 4L2IB 1MAVA 1SIBE 3QU4A 2FXVA 3M5PA 1XNJA 2J3KA 3V4SA 3ZV4A 5HKBA 4F97A 1EUQA 1BE6A 1F5SA 3I6ZA 5HBGA 5EHXA 1TPYA 4DJAA 3THYA 3CCFA 2C7RA 2G1UA 3H9CA 1FE8A 4IF6A 5DXFA 1DNPA 2GEBA 1P4AA 3RV3A 3ZZMA 4M89A 2XA2A 6REQA 3WBJA 2RH4A 4N4AA 1PDVA 3KO8A 4GYJA 4OSEA 5KJ6A 2MWMA 1XEXB 2JBAA 2C7QA 5HM8A 1E1YA 2VA8A 4G4GA 5FA6A 4RNCA 2YIMA 5IDYA 3ZE0B 2GEFA 5EWJA 3SIWA 4MDEA 3ZZ1A 2JLWA 2AG5A 2P4QA 2A88A 3FWPA 3RK1A 3K8YA 4IZHA 1YS1X 2E4XA 1T43A 3CH6A 3DBOB 2YR0A 3PCTA 4P0TA 2LDBA 4ID3A 4GHWA 2Q46A 4ND1A 3Q98A 1PJ4A 3NUQA 4WRRA 5ALWA 4M1MA 1QX4A 1THTA 3PPVA 2GAIA 3HKCB 1R6UA 3WLJA 5BUCA 2ZUCA 5JW6A 1P3DA 3HLYA 4M1KA 2IE0A 3UAXA 1K5HA 1GSAA 2LIPA 4IDDA 4GQBA 4QPCA 2RKWA 4XEHA 4W5RA 4R2JA 2ZULA 3LH5A 4C2BA 2X5OA 2CLOB 4GO1A 4WBNA 1XT6A 3IP1A 3WICA 2LNDA 3ANTA 4LHVA 1M2VA 1L8XA 3CX7A 3D4LA 4IRMA 4UXIA 4I6EA 4Y1RA 5FEMA 1W7AA 4XQEA 3JQAD 1XRPA 4HH4A 4E2FA 3SE7A 5IFKA 4MP6A 2AJTA 3JX9A 5LPNA 3DEFA 5BSVA 1NLYA 2W2TA 5H4HA 1SIOA 2PIAA 2H29A 2Y6VA 4EMTA 4JQYA 3RS7A 2LD4A 1YL7A 2J6HA 4AQDA 5A4AA 5JI3E 1EG2A 1XZGA 3I3OA 4QHSA 4I3FA 2HUPA 2Z30A 3CZCA 4R8SA 1SO8A 1FCJA 3WLOA 4F3CA 1NV9A 4HGRA 1SKYE 3TRKA 6ABPA 5CYGA 4E5NA 1IBKB 1XVAA 3QXXA 1L4GA 2P7IA 2PD4A 4EYEA 3C70A 3C3MA 2PZEA 4WOPA 5DMXA 4OVKA 3AWIA 5ALLA 1MGPA 3AP2A 1RHUA 4DQLA 1ORHA 2HDOA 3IC5A 1WNFA 3VAAA 1J22A 3FTCA 3I9FA 2ONJA 4D56A 1QUEA 3VHXA 2CNDA 1F0PA 4KPUA 1E4OA 4UBLA 4YCBA 3TRIA 4N9QA 5EIEA 4WCDA 2ZBRA 2E4UA 3ODGA 2QJOA 4CM4B 1RBQA 2IIPA 1PN3A 1C9YA 1YDEA 2WIAA 1S7GA 3DOUA 2OKGA 3NONA 1OI3A 3L0OA 4FMCF 1PR0A 5C8YB 2J09A 2RHBA 1IK4A 3S2YA 1XZ8A 5ALHA 4BKPA 1KY4A 4C01A 3CZ4A 4WOKA 2JLVA 2RH8A 5B3JA 2W6IA 4FB5A 1H0RA 3UH0A 3HYCA 3PNLA 4BAGA 4CEIB 4H0NA 3GVIA 3H5NA 3MBIA 1QF6A 2ETXA 1CB7A 4ZIRB 3PUWA 1W4BA 1Z2CA 4IIBA 2UYGA 3DAOA 3FWYA 4P6VF 4BO3A 2JG3A 4QHYA 4JLWA 1BEUB 3M4YA 2GWRA 3BHMA 1RXIA 2AQ8A 4I14A 4QBGB 4QDUA 3EWAA 1T36B 1U2GC 1I4TD 1YAHA 2OP1A 2FSSA 1ZIXA 2GN2A 2XADA 4O1HA 2WABA 3AERB 4UJ3A 4NRDA 2W6JD 1VPLA 3H4IA 4OAPA 3UPTA 3MAAC 5JD6A 4OHCA 4XX1A 1XVVA 5BW4A 1ESDA 1ZD5A 1WPQA 2PZ8A 3QKUA 3ZE9A 4K9RA 2VATA 1L5HA 3RF6A 2WT8A 2BFOA 4MV4A 3IPXA 4Q01A 3EQ8A 3RIEA 2DULA 4PPNA 2EZUA 1WM1A 4DBZA 5KWVA 5EXEA 1FYVA 4N54A 3M5CA 3QJ5A 1L5YA 4GP7A 2HNKA 4ZCQA 4UPVA 1L5GB 4D41A 5JZBA 2D59A 3E9RA 1AY0A 2MINA 3EYAA 1R4MA 3PFIA 4X0EA 3WYAA 5C0OE 4EI8A 3BYZA 3KHTA 3MT9A 4IJQA 4GI5A 4Q7EA 8MHTA 3MK31 3N2YA 4XR9A 5K51A 4HT3B 2BSAA 4Q5IA 1A9PA 1E1RD 1BO6A 2K7ZA 1WXWA 4P4SB 2R00C 4ONEA 1VYTA 5LQAA 4X54A 5BW5A 5L51A 1PUXA 1XQ6A 4IL5A 4Z0HO 3PRHA 3ZBTA 1SG6A 4JUAA 3HDGA 4YV1A 3EG9A 4FZJA 4YMSA 2OWEA 3PJRA 2OG2A 5FJJA 4FFLA 3GELA 3DL4A 4PRZA 3CR3C 1QGED 4WFKA 2DE0X 2W6PA 4P36A 3B60A 4G0ZA 3ROFA 3UK6A 4FS8A 3WHLA 2FNAA 3BL5A 3KAPA 1P4SA 2RGYA 4NARA 3HO1A 1N2CE 3EVEA 3QHQA 3EAQA 2OFFA 1N2CA 2O1EA 3RVLA 3B1FA 1W48A 1TUEA 1BJTA 1XJCA 4TLLB 1RW4A 4J49A 2LCQA 3WGQA 2F3RA 4Q9IA 1RPJA 3ZGVA 2E9SA 5IK2D 4D0LB 3VMFA 1JBKA 3V9PA 2BKEA 1GTRA 1E8MA 1UT5A 2C4UA 1NF8A 1YRHA 4EJFA 4F86A 1YMUA 2ZTUA 3RG8A 2B92A 4TLMB 5TQ0B 1PX2A 3IURA 3BORA 4M0EA 1KZ9A 5L4LA 4N47A 5DOVA 1FUEA 1T3SA 4M83A 1EFDN 4HNUA 1K7XB 1NZDA 2QZ4A 2R5NA 2IDKA 5HRAA 2EP8A 5FI3A 1J09A 4BO4A 4KYTA 4OJNA 3P97A 4XLLA 4DDVA 1M2WA 2GBIA 3CXRA 3HYLA 4FFDA 4XM0A 4BRWA 2IQ5A 3OMWA 4YCNA 1D4ZA 2O4UX 4OMUA 5K2MA 4AP6A 5DLPA 2EX0A 4CR7A 5HHTA 2X0IA 1UMBB 2VTBB 1B23P 4EYQA 2B98A 1Q16A 2PUAA 1V1MB 2JAQA 2ZSAA 3F4KA 3ITNA 1CC1S 3KJNA 4IKOA 2FSPA 3ZJYA 2FPPA 1E2DA 4Y9UA 2B4RO 4IUCS 5I9SA 2FWIA 4ZQBA 2YUTA 3HRHA 4R8RA 4ZVUA 4ZOAA 3PT9A 2XD9A 3NRBA 4W6ZA 5IHXA 5JNLA 5LBUA 4G4JA 2D1QA 2Y2VA 3PGLA 5MFPA 3TLEA 2XVAA 3I09A 3K9WA 4C29A 2H7XA 1XLVA 4AKTA 1VI6A 2KBEA 1EXDA 2V4UA 3DHWC 3TCNA 1TCCA 2OZVA 3IAXA 1XV5A 4NBLA 4P92A 2OV3A 2FOLA 2YMLA 4J91A 4GOJA 2ZROA 5TQJA 5E2AA 1EVKA 1PNVA 1CUSA 1QSGA 1RC1A 3SOPA 3ISVA 1QGAA 4U0JA 5KAMA 4MHTA 1ESMA 4Q93A 5EUBA 4ZV9A 2HHJA 1CULC 2A5YB 3X43A 3JRNA 5DGIA 1Y42X 4UQPA 1ZU4A 2V6IA 2J3IA 4LYJA 3VZCA 4X8MA 2A0XA 1P0QA 1JLSA 2X77A 3N2KB 2I9KA 1CS4C 1U2GA 3AY6A 3BQ9A 4UNNA 5HMMA 4I50F 4L07A 2PVPA 3IAEA 3O8CA 1S4QA 3TIFA 2AZTA 2E4AA 3FB4A 3N2ZB 3NI2A 4OHKA 2V45A 4PZUA 2C20A 4BP9A 3HVHA 4G56A 3D2AA 3NTRA 4BQEA 4KQJA 4UD2A 3DF7A 3RNOA 2V5VA 3DZIA 1H4TA 1LW7A 3VZBA 4F5ZA 1M1NB 2EKPA 4QLBA 4FQ7A 3AL0C 2NUTB 1Z25A 3B9QA 1KGSA 2GASA 3DTNA 3HA7A 2OPHA 4BQNA 1U5CA 2DPMA 2Q3EA 4G67A 1ACJA 1YVUA 1MEOA 4HYEA 1A5SB 5LKAA 4U0KA 3OPYA 1XCMA 4NBRA 3IQZA 1ZD4A 4LY6A 4UVHA 3RVDA 5HIAA 1AK2A 5EZSA 1U90A 2JI7A 2IP1A 1B4DA 1ZD1A 1XKQA 2IT1A 2WVJA 3O74A 3ZN2A 4BO0A 2X3FA 4EGAA 3GUZA 2JAXA 2JFPA 5KO2A 4MQ4A 3NTQA 3WRWA 2B2CA 3IIIA 1BDMA 2W00A 3AI3A 3FZNA 1N6IA 4ZEOA 2HJSA 4KLNA 1LK5A 3ES9A 2AEJA 2CUKA 2KX7A 4RH1A 3TQRA 5JCPA 1F2UB 2R00A 1XYVA 2ECKA 3Q0TA 2G80A 3RNLA 3RRZA 5I3CA 3K1TA 2FP4A 1YULA 4BNKA 5JROA 4Y1GA 6Q21A 2A3NA 4LSZA 3FTNA 5BNIA 1CNFA 2P6PA 2Y66A 3UPDA 1G6HA 4I4TF 3AVVA 4O4HB 1Q0PA 1OAOC 2NZVG 1EE9A 2TYSB 3HL0A 4NYMQ 4P4UA 3SS9X 1HETA 4B7ZA 1DP4A 3LRXA 3NCTA 3R4VA 5F9FA 5FLKA 4EG1A 3VOAA 1PT9A 2BFNA 2VT7A 1OWNA 1ULZA 5KSWB 3WIEA 3VYUB 4RTKA 2YIDA 1WO8A 4IKPA 1DIAA 1UJ4A 3BXEA 3CPJB 4ZVLA 2CLHB 4EKGA 1P1CA 1BDHA 2XZTA 3G2PA 3OZ7A 3RSZA 1FDRA 3MFQA 4HDKA 2X8AA 3FR8A 2AMLA 4W5WA 2CHQA 3CZAA 5BN5A 3C8MA 4OBXA 1OT3A 4CLXA 2Z5GA 4S0ZA 2WA1A 2PS3A 3ABZA 1W5EA 3SXUA 2JGNA 2J3EA 2QENA 1NLMA 2OZEA 2VHXA 4FT4A 3CNQS 1SC3A 4DNFA 5JAZA 2XDQA 4HEQA 4YT4A 4P3XA 1DQSA 3NT4A 1MOQA 4Y0NA 5KS2A 4NPAA 4ZK6A 4BY9E 3OQBA 4OQ4A 1XMOB 2ZRMA 2Q0HA 3HADA 4EDHA 2QXUA 2ZDHA 3OIFA 4WK4B 1D0IA 3FMPB 4C87A 3R5XA 5DT9A 2IQIA 1X38A 2L69A 2ZT7A 4I55F 4BFCA 4HK4A 4BNGA 3DOIA 3K0CC 3GR6A 5B4VA 2IXTA 1GV1A 1PQYA 3BUSA 3E2PA 2V1UA 2IU3A 3OBIA 3O2JA 1L4BA 4EW2A 3HYRA 2NYRA 4WE3A 2VP4A 1MTOA 1QPZA 5HCUA 1XRMA 3RVJA 1GRRA 2R2AA 4H9GA 4QU5A 1I4OA 3F6CA 1HE2A 5DWVA 5KB3A 5KNDD 1HYQA 1T25A 3H2ZA 1NBAA 4KQ1A 3T3EA 2IKSA 1NPDA 1QOQB 4MIYA 1OV6A 5JEDA 1XQ1A 1F0YA 2Q7XA 2UZ3A 3AUTA 3M1AA 3MUOA 1N0UA 4TUYB 5JH7A 3KXKA 3ND6A 3STVA 3TI7A 3OQOA 4J0EA 1D2EA 3K7EA 3VR1A 4CIYA 3TQOA 2P1RA 3N2EA 4UM8B 1R6AA 3LPDA 4G97A 4M0UA 5AHOA 4TVSA 5J2TF 3ER8A 1W93A 1GKIA 1YR1A 2OY0A 4JDUA 4NFLA 4RADA 5A0FA 4NK5A 4OKSA 3F47A 1X86B 4OMCA 4CT5A 2JJ2D 1XL0A 1B16A 2I71A 1SBIA 2N42A 3VHRA 3MNFA 1ZGZA 4AJNA 1LD3A 1CEQA 1JS1X 2C54A 2BEUA 3Q10A 5HPYB 2VDJA 1RKQA 3D4IA 3E4DA 2CY0A 3PIDA 3V6LA 4U6QA 1HO3A 1KYYA 1YFKA 5A1TA 4P4TA 1C3JA 3C1OA 3JZIA 4OFXA 1BAPA 2ASEA 1G17A 5KOJA 4HDMB 4PU0A 1W47A 3SQNA 2GZAA 1SMKA 1B2LA 2TMKA 3GMTA 3UWSA 5JBIA 3EGVA 2YOFA 1XZHA 3L82B 4A0QA 2VWGA 4P58A 2HW8A 3N2LA 4BQOA 1NNSA 4NSNA 2LPMA 3LO5A 3KZVA 3OO1A 1QPBA 4NNPA 1XP8A 4BLWA 1H1LA 2WP0A 4G0WA 2ZR0A 2RK3A 2EKZA 3HH8A 5D87A 3GW8A 4NECA 4PAOA 2WIFA 2H5IA 1ID1A 3K9QO 4EGFA 2Y0CA 5I3ZA 1V7PC 1T8UA 2VUIB 2X6QA 3HP4A 4DUGD 1KEEA 1SCDA 4NWIA 3FNRA 3JRWA 3KB6A 2CNLA 4TSFD 1O95A 2DAPA 3QYAA 4U2KA 1SC9A 3FRJA 1MQSA 2VZEA 4RDXA 4CF7A 2GCPA 1HFEL 2R5WA 3CW2A 1BDIA 1EDBA 4Y2UA 2VJCA 3NPAA 3GK3A 2O1SA 1E2FA 3OIDA 4NATA 5LDDC 1LH0A 3UAVA 3RC3A 3RUHA 4Z1MD 1NBIA 4U2BA 5MF6A 1OAOA 3RS2A 3BSFA 4LDQA 5EQDA 4EPXA 4U3JA 2J9YB 2QM3A 5TF4A 1P7VA 2P6UA 2R8BA 4P5EA 4JGGA 3HCCA 4B81A 2CXHA 5FUYA 1XQXA 1OFHA 4ZTZB 4PLWA 1G0OA 4DLWA 4I5FA 1JDSA 3MJRA 5L4SA 3F90A 3N2IA 5JNUA 1TMOA 2X5JO 3P2JA 5T41A 1JKXA 3ICPA 4E5DA 5D5QA 2CFTA 2DERA 4PAMA 5HIKA 1GA6A 2HA4A 1X80A 4X1YB 1U0NA 3GRUA 4YV7A 2IYQA 1R5OA 2DHCA 2Q3FA 2X4DA 2VPIA 2IIQA 1ZRMA 3GOQA 4ZAYA 1GPH1 3VXKA 3WYDA 1V96A 3E9MA 3L8DA 2TS1A 4P80A 5HS4A 1Y5NA 3EY9A 4K8OA 1BQEA 2X8BA 2GCEA 3CTMA 2GO1A 1KYTA 3GIWA 3Q9SA 3ZV5A 1C2YA 3NGXA 2R87A 4ZKEA 3VZRA 3GAZA 2E48A 5C5CA 2BM9A 4JJGA 2VYNA 1XEWY 4OB6A 2Q3JA 1VPVA 4II7A 3HHPA 1NJ1A 2IXEA 1UDBA 1NXWA 3RRXA 1LI7A 1JLRA 1OH7A 4TLEA 3MT7A 2PRSA 3K0CA 2ZYTX 3MGCA 3QKTA 4UCFA 1B93A 3QPAA 3TKYA 1N32B 3UV6A 3NXKA 2BELA 1H3FA 1U7PA 1NI5A 3H5VA 3H9GA 1KNXA 4DZTA 4KYIB 3VR2D 1RTTA 1SNYA 1JPNA 4YLEA 4R1SA 1YHNA 2VNAA 3MCVA 2GWHA 1R00A 4RPIA 3HK2A 3RWBA 2H48A 3IRVA 5B2ZA 2DPLA 2E82A 1YIOA 4C5BA 4HNQA 2ODTX 2W6QA 2XOXA 2YTZA 5E2BA 2RSLA 3DBLB 3LM8A 2XUFA 4PE5B 3R7WB 5JO9A 1KH2A 3P9NA 3DZFA 2F64A 1ANKA 2X1HA 3RGWS 3ED5A 7YASA 2CDAA 3AUKA 4MYTA 2D0PB 3Q3VA 5ADVA 4BTEA 3C16C 2ZW9A 1RAGA 4OHZA 4AX8A 2HYIC 1F6BA 4IJ6A 1ZSYA 4H1VA 4D3ZA 3L7OA 2IZOA 5HIMA 4OXNA 2UAGA 3HPRA 1D4OA 3TRHA 3D6AA 3THWB 1ISSA 2FPGB 3PNMA 3ZKAA 2H07A 3AXSA 2RAUA 3HGTA 2XAAA 4TQGA 3ZCUA 2B2NA 4LSGA 2DPYA 4K26A 3WS7A 2OP0A 5ELLA 3L1KA 5IKEA 2FUG6 3OP4A 2R97A 3GAAA 4OQEA 2FFAA 3JQ7A 3ILVA 4O33A 2J8ZA 1QGYA 3P0FA 5AKIA 5D2CA 821PA 9ATCA 1ZSNA 1Z75A 2OECA 4HNAB 4N3CA 3AFNA 3GJ5A 4M22A 4ITRC 5AI5A 1NYTA 4J0CA 1TZKA 1XK7A 2CF5A 1ZM7A 2BFCB 2J3LA 3QFHA 4HXGA 4MVJP 2A1UA 3PGKA 4AC9A 3SHTA 2REXB 1P17A 5BWMA 4H1UA 3UVEA 2FW8A 2PMBA 5JDIC 2R7KA 5CB4F 1OR8A 3F5DA 3WIBA 2FHPA 4FONA 3E9DA 3NBXX 4B4DA 2QVGA 2VNJA 4X65B 1YJCA 5KTPA 1Z56C 4FGKA 3CLTC 4UM9B 2HMAA 1P61B 3LHSA 1GCAA 1SUDA 3AVXA 2WKPA 1P75A 1XJWA 2D7CA 1MQAA 3HKDB 2A0YA 3EXIB 4XEUA 1R64A 4ZC1A 1SN7A 1XD2B 1SU7A 2W43A 5AP9A 4URZR 2NSLA 3ASYA 1GA1A 2N1BA 1GU7A 4MVCA 4JP8A 1N2HA 1FVFA 1O97C 1NJFA 1PZFA 1G3IA 3BIFA 4J43A 2WSSD 4LF4B 1UZLA 3RHSA 1MR3F 2ERXA 3RVMA 5KNDH 3PDIA 4J9UE 1BWQA 3C1UA 2PRZA 4BWFB 3LCCA 4QPDA 1GPBA 1OFTA 2VJYA 3PENA 1VLMA 3BWYA 1Z2PX 1DKPA 2W42A 2WIGA 4EFLA 5EJ8A 5TS2A 3W77A 3DDZX 5FO1A 1Y6FA 2BFFA 2A6PA 3KTDA 1H66A 4BCDA 5IJZA 4EECA 5KVQA 1V3QE 3QRWA 3I28A 1F4VA 3FTQA 3R7DA 1U8TA 4BNYA 3CF4G 3I30X 4LRSB 3UUGA 1M6EX 1GQOA 2Q3MA 4N01A 1S8AA 3CIOA 4M6WB 5JI2E 3K0SA 4H3KB 1JGTA 1RYBA 2B1JA 1G1AA 2G04A 1QCZA 1LI4A 3IS3A 4GM1A 4KUGA 3RT9A 4TZ0A 1Q19A 4OI2A 2C84A 1VKJA 4GUAA 1OHHD 2BSXA 4MS4B 3H5LA 3L0PA 2DTXA 3SYRA 5J4YA 3JASB 4ZCRA 3BMXA 5KSOA 3FVWA 2J9FB 3U4QA 2VXCA 1JMKC 3CLRD 3LUGA 4PLGA 2XHEA 4LI3X 3QU5A 4BZZA 3ZUPA 5HZHA 1QAQA 1NTOA 4XSHA 2PKRA 1HDGO 1QLWA 3ZWKA 1O6FA 3ZS9A 1EJ6A 5TMPA 4V0LA 3GUVA 3GFTA 5F5NA 4XVRA 3MGAA 5F4ZA 4RA9B 5DGTA 5LZ5A 1PT8A 4K9DA 2QMUA 2VBCA 3HDYA 5CNKA 4K2AA 5H59A 2OR3A 4IXDA 2VTEA 3H9UA 1US8A 2QIOA 3T5DA 5DW0A 1DU4A 2AVDA 5GGXA 4YRQA 4ALLA 4D57A 4BB0A 3LXUX 4DZRA 1PL0A 2XYGA 2PVSA 1OLUB 1CY8A 4R84A 2XE6A 3SSMA 4B73A 1LPSA 1E2LA 1EEHA 3T34A 1ISPA 5SYAA 1RI4A 3A9RA 1L5FA 4I66A 1PFQA 1OKKA 2O7SA 2ZYUX 3C39A 3PJFA 3QVWA 1DEAA 2ORYA 3DUFA 2QV7A 1QOPB 2JDID 4RAQA 5H8WA 3GZJA 3WV5A 3CVXA 3FSJX 2HD4A 1U7TA 3BM5A 3ZJTA 1BXRB 2E18A 3FZGA 4TYPA 5G0WA 1I2CA 3TW4A 3V6MA 1RRFA 2Q2WA 5BY2A 3HMKA 4JLMA 5JD4A 4ENRA 5JPDA 3IOBA 2BEKA 4D9CA 1YU9A 3ZHCA 4YTEA 4DB2A 1ZDMA 3J81A 1RRCA 1WHSA 2G25A 3I2FA 4HLCA 4N18A 2GFIA 2ICAA 1IHXA 3GJYA 1VCHA 3OCJA 1T8RA 1JBEA 4R8VA 4D9BA 3TOZA 3LF2A 3DLBA 5CVEA 1OH5A 1EFRA 2OBXA 4E6PA 3B85A 4PNPA 3D5EA 4WNIA 4Y9RA 2O3TA 3W8NA 3N86A 3NETA 4KV9A 1BXGB 4MYDA 5FB3A 5ARBA 5JDIA 5JYEA 1GPWB 4EUKA 4JROA 7ADHA 1GQFA 4R05A 4AICA 2ZZNA 3CRMA 3OVMA 2FZLA 1EAMA 1EFUA 2OBNA 3IEPA 3K0AA 2Y99A 4PX3A 1L1FA 4LYDA 2HL6A 2V3WA 1PQUA 1DPGA 2PWZA 4NENA 1TO2E 2GILA 1E2QA 4IXTA 4PAWA 5DXAA 4RULA 1PJ2A 1ZVMA 2O8FB 3V2UA 2QYHA 4WXYB 3MWEB 5BR8B 2WIBA 3BJIC 4G8BA 4NFYA 4INAA 1CJBA 2H1VA 4CDGA 1GTMA 1O57A 2Q6LA 3PFGA 3S2SA 5IF3A 1Y4AE 1OVGA 4BNJA 1YBVA 3IIKA 2GFHA 5LQKA 4YCJA 2ZSKA 5C52B 1FFAA 3GLTA 1BMQA 4L9AA 4MW2A 1RYEA 1F8GA 2EHJA 2ZSUA 4F6RA 5DX0A 4RD4A 1FC0A 4FCTA 1F8YA 1K2WA 1KXJA 4KL8S 1SZDA 1XZNA 1EP2B 1LPOA 5JU6A 3FNEA 3AHHA 3T12A 1IY8A 4B32A 1EK0A 2GMWA 1PTKA 2OXEA 3SF0A 4EEKA 4EI7A 5CDGA 2P3LA 1WVIA 3OM1A 3PQEA 1PZHA 5EKDA 2B9EA 2QLLA 1ZH2A 4E07A 5KYUA 2B99A 1DB3A 2NU8B 1EFVB 3OCZA 1S9HA 2IWRA 1DTSA 5BSHA 1Y7PA 5IKOA 3SPXA 4OUDB 1IXYA 5EE1A 4ESHA 1IEVA 3JAKA 3Q4GA 3P0JA 2BHNA 4ARCA 3A2KA 4LFBB 1EPUA 3NEYA 4DC0A 2CK3D 2JI4A 3UMCA 1SWVA 2FMUA 2YXDA 3FKSD 5TNXA 2B8WA 4OI0A 3A9WA 1A1SA 3AH8A 2QN9A 4WLVA 2X0NA 3GEEA 1DXQA 3UWPA 3GDHA 5JFTA 1GJRA 3RC2A 5CT4A 1WB9A 1Y5IA 3LU1A 4Y6GB 2TSYB 4G23A 1IMOA 1U81A 4HAIA 1DC4A 3SY8A 3CRW1 3LYAA 5CBKA 3W6NA 1ZGBA 2D2XA 3A4NA 4OQYA 4TWZA 2XUPA 4W4TA 1GYPA 4EUSA 1JLMA 4IDQA 1S8OA 2C7GA 3NYRA 4GYYA 1G16A 1P1BA 2J9XB 3C3DA 4PGHA 2ZWAA 1YKGA 1R27A 1WPGA 1IEWA 1J99A 4HBGA 2ODEA 3ZY5A 1QRAA 2NZUG 2CLDX 3P9XA 1QH8A 1KH3A 4R83A 2WHEA 5LQSA 3U37A 2HRBA 3L92A 5CH8A 3ZKWB 1AKTA 2FPIA 3IQHX 3N0WA 3E3LA 4HAWA 4YRDA 4AECA 1KI8A 1Q0SA 5AKYA 4FQ5A 2R6HA 2P90A 2WSMA 3LE8A 4KR7A 3O9VA 4D4LA 3GX1A 1XDDA 3E22B 5K1ZA 1SCBA 3GN2A 1U3WA 1NXOA 5DI3A 3W7AA 4TWIA 5KINB 1T9KA 3T1NA 2B37A 2A0FA 4Y2HA 5DBIA 2ZR9A 4ENSA 2KLHA 1E6CA 4GEKA 1E4YA 1K1EA 2W7TA 1X7WA 1V71A 4MYUA 4EMBA 5HQ3A 2VJBA 4BBPA 2WLSA 1FUIA 1Y1RA 3TDMA 4NZYA 4EF4A 4ZN6A 3EA5A 3OCXA 4WL0A 4LWOA 1NF3A 4OLJA 3QOXA 1OREA 4GAEA 5B3AA 1AM4D 1VRCA 1UOPA 2ZJ6A 3UC5A 4AUMA 4BIIA 1K86A 4WOCA 5FAXA 3RIMA 4R5MA 4AYTA 1QFYA 2ZETA 3GWZA 4K6OA 3D4PA 1Z68A 2WJHA 3EMKA 2IUUA 3AZQA 3HV2A 3PUJA 1L7BA 4KZPA 1NBMD 2QNBA 4B17A 4ZJYA 1RCUA 5IKMA 1W1IA 5F2NA 3HZRA 1ZVKA 5IEJA 3GRZA 4ZOLB 3VKUA 3VGPA 3CVYA 1OXXK 4RE6A 3ENQA 3IGFA 2AKYA 2I29A 2YN2A 4KI7A 1TPZA 2R11A 1HYEA 1TRHA 4NV3A 5IAAA 3PR3A 3AR9A 1CJKC 1S89A 1UKBA 2BKXA 2G6BA 2I2DA 3OX2A 5CM2Z 2FWMX 3DDUA 1NJGA 2VPZA 3FFWA 1A72A 4WOBA 4ZAVA 1Q7RA 4EKDA 4EUEA 4LJRA 2OCDA 1T2NA 1K7FB 1N9KA 4UUQA 1NU8A 1AC5A 2PAAA 3H5AA 4FHDA 4PWYA 1E2JA 1RJ9B 2VHWA 2YDXA 3EMDA 1PJLA 3FJ1A 1V9CA 3HXTA 3P9YA 3QP9A 1GOTA 5BNZA 1ENYA 1U7ZA 2JGLA 3OZFA 4TTRA 5CGZA 4X66B 1YZUA 4RTRA 1PJ3A 1ZN8A 3S0JA 3B8HA 4J2HA 3TXAA 5CVCA 1DCMA 1XXHE 3WIOA 1BS9A 2VHTA 2O20A 2HA2A 3S28A 4XIFA 4DV0B 4OI4A 1LBEA 5LQCA 4MV3A 3LPAA 5HUHA 1C7RA 4XVCA 2PMCA 2FWBA 4M1QA 1SC4A 4ZT4A 4ZV4A 5IH7A 3M7IA 1VCMA 4I4TA 4XGRA 3PR2B 4XWTA 3WK7A 4E14A 3FCUB 1JIQA 1JXQA 3H05A 1L5KA 2RI1A 1ST3A 1TB4A 1PEDA 2PIDA 3BCUA 4NR0A 4ALNA 4HAOA 3F3YA 3NJ8A 3PQ7A 5B12A 4C14A 4D25A 4QHTA 3D8UA 3KFLA 2A59A 4NVRA 1G8GA 4X6UA 2OGUA 2ID8A 4BMVA 4F7DA 4BNDB 2IBSA 1X7ZB 2YN0A 2CSUA 3VU0A 4DMMA 3NYQA 2JLZA 1YS9A 3BXFA 1ND6A 1LRKA 2XUOA 4DIEA 1UBCA 1WX1A 3LLVA 4QGFA 3L5OA 5K8UA 2PUDA 3IP7A 3C4JA 3V8BA 4O8ZA 4PTLA 3V9AA 1ZO8A 1WD5A 3TSCA 1V11B 2AXQA 5E4TA 3TNYA 4S1OA 3KSUA 3DMRA 4J07A 9ABPA 4RFVA 1I4EB 4CV0A 4QDXA 5LUBA 1FYFA 2DTEA 1FMLA 4PWZA 3QG1A 5FUXA 3SLGA 2OV2A 1ZINA 3FPSA 1YUMA 2H3EA 1WNTA 2V7QD 3EIHA 4L9SA 1LUAA 1J49A 1X8LA 1ABBA 2FW7A 2GNPA 5EZYF 4FW8A 1EVZA 2IHTA 4ZYZA 2X5XA 3LHDA 1BQ3A 4QD3A 4ZCPA 3M3DA 3B6KA 4N5IX 4G4IA 1WULS 1OX4B 1OV4A 3IPAA 3C6MA 4OGFA 1H6AA 1Y33E 2ZQZA 3B20A 1YR9A 3ZLTA 2H0QA 4D9MA 1BU5A 4HLNA 1F9EA 2PE5A 2BTEA 1E1QD 4BNMA 1JSLA 1KEPA 4B3RB 1IXSB 1F0KA 4FLFA 4P35A 1T9ZA 3WP1B 5KYXB 1P72A 3MMZA 3ABIA 1KO8A 2IEYA 1VKZA 3SQLA 3ZY2A 3D6UA 4JC8A 2QIPA 4IXNA 2AFIB 2C61A 2G0NA 2Z08A 3CXUA 1M9NA 3BD9A 4X8OA 2H85A 5TQVA 5JIBA 1D4FA 1FMCA 1EXVA 5J2TA 3MWLA 1II8A 2IC5A 4U8GA 1C29B 1ORVA 3I9V6 4Y9SA 3IDOA 5EKXA 2B4YA 3WL6A 3ZWAA 2XMSA 4M54A 1BHJA 3NTUA 4JWTA 2E4YA 3EVDA 1DBSA 5LCXA 2E0IA 3ST7A 4ARVA 4GVLA 1RP1A 2D54A 4EJSC 1S3SA 1ZBQA 1DQZA 2Q5CA 3G79A 5E1DA 3WDSA 1YR6A 4A4DA 5FBKA 3B1XA 4LGMA 5FWNA 4D74A 3RB8A 4AKEA 4MK4A 2RONA 1DXHA 1E9BA 1SCNE 2W2VA 1JR2A 1U3VA 4YCDA 4I1SA 1DBQA 3Q15C 1E9FA 1I01A 2A35A 3V8MA 4FGUA 4FQ8A 2ZATA 3R5TA 4ALMA 1JE1A 5T6BA 2ACEA 1CTQA 2EATA 3OZRA 1H9CA 2W93A 4KXUA 2LP4Y 1ZKMA 3WL5A 3RBVA 4Q66C 4IG9A 4M36A 3TR5A 1JIUA 4CLDA 4QKQA 4RWZA 1N9GB 5JAHA 5LXTB 4JJZA 2QU7A 3AR4A 2F8TA 2AK3A 3AB8A 5E6SA 1GYQA 1P0PA 3DWIA 3EZYA 4GDMA 4MITA 2EKDA 2NYVA 5FR1A 3A10A 3CURA 2B1GA 3JVDA 4NAVA 4KC0A 3MWFA 3THSA 2I91A 2YV5A 3MYRA 1F51E 1RM0A 4HBZA 2D8MA 4RMGA 4ZQEA 3WMXA 1II0A 3P9QA 3LQQA 3NC4A 1UPFA 3O1LA 2Q5QA 4CQMA 2PXCA 3JQPA 4P2GA 5JOQA 4GT1A 4FOTA 4CLRA 1GGNA 1ULHA 1YIDA 2J3JA 2FHSA 2NO4A 3NNDA 3RC1A 2BFEA 2J6BA 2PQ6A 3ANYB 4RMIA 2XJ9A 4BDSA 1NVXQ 2ZYWX 3M4XA 3PXDA 3AM1A 1ZQ1A 3A1DA 1WXHA 3KR2A 1JYEA 1S5PA 4Q16A 1FTYA 4MLPA 5MDHA 2PGXA 3LCUA 1L8OA 1M83A 1GEEA 1I80A 2REBA 1FY2A 2NZ2A 5KOHB 1EFKA 3MHTA 4IM7A 1OZHA 3SE0A 4IEFB 4Q9LA 1VPWA 2UZ1B 3OKPA 4X95A 5FV7A 1N6KA 3RKSA 4QVKA 1JG3A 3C1AA 2Q4DA 1B74A 2H31A 4A26A 1D6MA 2GK7A 1S0UA 2Y9MB 5DDIP 4GECA 4F6LA 5HKLA 2J31A 1VLJA 3LUDA 5AWFC 1DO8A 3K94A 3OLQA 4QOJA 3M1LA 4JB2A 1N9ZA 2WSIA 1PIWA 4EF6A 3ZEIA 2C78A 3G9ZA 1TXGA 1HORA 3F0TA 4GVXA 3C0KA 2XZOA 5B2EA 3W3ZB 2C9OA 3LCVB 1X15A 5ALFA 5LJLA 2O8BA 5JC8A 2VNHA 1KJQA 1SGWA 2GXAA 4P53A 4PANA 4AZ0B 3B1YA 4HVTA 2X5NA 2BI8A 4MKRA 5KYWB 1I14A 3U5TA 2XODA 1YB7A 3ILYA 2I76A 2OGZA 3GRRA 3PNYA 1Q6ZA 1W9MA 4GL4A 4KP7A 4LWPA 4BEJA 4Z4CA 1QVZA 4I8IA 3MD0A 1W4AA 4I9GA 1OYVA 4AY6A 1C0PA 1LFAA 1CJVC 1THZA 4ML3A 2CHVA 1XDZA 4BZWA 2Z57A 3REOA 4F71A 3KOYA 5DRTA 2OYCA 2VN8A 3BILA 2NT3A 1B7GO 2R1VB 1DCFA 3R3XA 5KWJA 4DCVA 1ZNZA 4EL5A 3Q5GA 4DLLA 4UVGA 2NO7A 4KAJA 1Y63A 2LGJA 5IWAB 4IIVA 3VNAA 4CTNA 1B42A 4UNIA 1VI5A 3IEUA 3UWDA 1Z83A 1K75A 3NANA 3R7AA 3PJDA 1KI6A 2VG8A 4IGKA 2ZRCA 4Z4QA 4RL4A 1I3KA 1XTVA 4FT2A 4J1QA 3H2GA 4BP8A 4IWYA 3KQSA 1V2GA 3GRFA 3O3MB 2QL5A 8ADHA 1QKJA 3C5WP 1NNI1 4TSKA 4BWGA 1PSZA 4N39A 4DKXA 4FHCA 3KHKA 4JENA 3ZPXA 2DFLA 3I9OA 3UHJA 3GZTB 3STUA 1USKA 4MULA 4UNPA 1QVWA 1QO7A 1Z22A 3GJ0A 1JQJC 3NAGA 3KSDO 3DFZA 3QI2A 2Q1TA 2VH5R 2CLLB 4MUEA 2JKYA 3O2QB 1D2HA 4IDHA 3BSWA 4ZVNA 4QJ3A 1LBTA 2PJUA 1U3DA 1IM5A 4GI1A 1G5RA 4S24A 4CN9A 2RG1A 4DJFC 1MC4A 5KCZA 3P96A 5AOAA 4Q4JA 5SYMA 1LLQA 3I39X 4RHTA 3VAZA 3ITDA 1W9HA 2BEVB 5F23A 1IOVA 3AFGA 4BB5A 4DTIA 2CT8A 2VDVE 1EX6A 1E1KA 1I10A 2ZIWB 1IAQA 1WKVA 5CB4A 5HF9A 1M1ZA 4R6WA 2I2CA 4AS2A 1TW2A 4Z4HA 3AZOA 4M7WA 2GBLC 1RKVA 1TQ6A 1KC1A 4YN3A 3L9XA 4B76A 1AGXA 4OJYA 4ZZ1A 4CR8A 4CMIB 1HDIA 2QRVB 2YJ6A 4LZWA 1IN4A 2FW9A 5BWBA 1L7OA 2VHQA 3AG6A 2NU7B 4PQYA 2QZSA 5TF0A 3K96A 4ZQHA 5KHAA 1A7KA 1POWA 3O8QB 1E3EA 3VFDA 1JHQA 2AYXA 3C3JA 3FR7A 3DR5A 1RJGA 2FRXA 4N7RA 5F5LA 3LCMA 5H3HA 1VBMA 3TPZA 4JYZA 3S81A 4DUYB 2I6FA 1J8DA 2EWVA 1USUA 5DVZA 3HL4A 4AAYA 3BMOA 3SN6A 2B8EA 1URPA 1AS2A 4ETIA 1JP7A 2R8ZA 2A1TS 4R9NA 1XHFA 4BE4A 1T34A 2E49A 4LVUA 5FA8A 4YAKA 5A6SA 1J21A 1SVNA 3MSXA 4NJOA 4DBLC 1I2BA 1UM8A 2XSZD 3P32A 3LZ6A 3BEOA 2XMRA 3RVSA 2F8SA 4BFTA 1V1JA 3WLMA 1C7JA 1E61A 3DE3X 4OF4A 2FMXA 3AIOA 3LQ1A 2CFCA 1PR3A 5TGZA 4UZSA 4LBZA 4R81A 4DDTA 3OTOB 4W1PA 1EFLA 2ENWA 4EHJA 5DBEX 2AI3A 4B6PA 4AL4A 4L73A 2GB4A 3DOOA 2NO9A 1GSOA 3JWGA 3TM5A 4DSOA 1B0ZA 1QVVA 1SXJC 3FVTA 4IIFA 3AETA 1ADFA 1Z6ZA 2O2IA 4P8RA 4F1JA 4TKVB 2QZPA 3B2NA 3VYRB 2B4QA 3AM4A 2QL6A 2ZWIA 3HKEB 3PP8A 5A9SB 1Y8RB 4N3NA 4Q6BA 4A10A 4DNQA 4MR7A 2NADA 1LTQA 3R41A 5DM4A 2GZHA 4N6NA 4HWSA 1HEIA 3PUIA 4AD8A 4UMVA 4WX2B 1QRUA 4MRAA 2V6FA 4FNGA 1N5LA 4AUKA 3ZQ4A 2IEGA 5AUQA 3RBZA 2JVJA 4GX1A 3CVVA 5FPHA 5FLEX 1N2EA 1TVMA 3UB4A 3VJLA 5I4KA 1R3UA 3HB5X 2O5EA 2QMHA 3BZUA 4RF3A 2HN9A 5IMBA 4YRKA 2PKEA 1T5IA 2ZB4A 4O2BB 2QM0A 3A1VA 3AR5A 3EZNA 1O03A 2R5FA 1R37A 1R9GA 1UBFA 3IESA 4D0SA 3K71B 4U39A 3FF1A 2YYSA 4PFQA 3DYVA 3RLFA 3IOMA 3SU8A 3VBCA 1IN6A 3GLUA 5IDWA 2YVUA 4JUCA 2WYWA 3B51X 4XARA 2OCKA 1KWKA 1ADBA 1SBYA 3ELWA 1S3FA 2HBZA 4QDOA 2Y6UA 2XAUA 4PX9A 4TWRA 1WETA 3G8DA 1VE7A 3R09A 4PZCA 1GLNA 2JLRA 2X13A 3I01M 5DMHA 4DJTA 1J0CA 4PPQA 1KEUA 1DOHA 3RTBA 1DX4A 3ZHSA 4ZHQB 1PJQA 4RXTA 4RZ3A 2PGDA 3WLHA 1V45E 2ZTSA 3LC7O 1JSCA 2VYVD 1M3SA 3HDJA 2ZIVB 2V7GA 2ZRJA 4YQYA 4OM8A 3A06A 3DE6X 3V1KA 1C8LA 2DC1A 4MUBA 1G2QA 1D09A 1W88A 1E3WA 2F3PA 2IXGA 3C98A 5LYYA 3OZEA 1MT0A 2BP7A 4Q02A 1PD0A 2WHXA 3Q1KA 4NULA 5BN4B 1UPUA 5B36A 2AN1A 1COZA 2GCNA 1DDGA 1YQWA 2EJVA 4LMBA 5F1KA 2UXBB 2KLBA 4KDFA 3RC9A 1ZJWA 3QU7A 2ZVQX 5JCOA 2OBMA 2VSNA 1OLXA 1C0LA 4M87A 4MYCA 3ZDYB 3CX4A 3RYIA 4EI2A 4BLSA 4QT4A 2HWYA 4MVJI 4GKBA 2VK4A 1K7SN 4M76B 1CKEA 1O89A 4QJBA 5L9AA 4F3KA 1D04A 4L8GA 4MDFA 1ODFA 2ZSFA 1Z2OX 2GCOB 3V8RA 1AQLA 3SFVA 1SD2A 4GG1A 4FZ5A 1A96A 2GNAA 2QD5A 4LE1A 3Q85A 1NVVR 4JXJA 3NAZA 4LRWA 1NUTA 4RTMA 4NZPA 2GAOA 2GFQA 4ZCMA 3ZEAA 5K8IA 4F56A 2Z9DA 1JG2A 4JXKA 3L4JA 3OUTA 2XCUA 5DNDA 3IBFA 3IUJA 1SVWA 1OAKA 1SCQA 3IE0A 3P2IA 2OXFA 4UVDA 1LDNA 4MINA 1OSNA 4OHBA 2BKUA 4MA5A 4C08A 1J2YA 5CT6A 4DBLE 2I6UA 2OQIA 1MN6A 2ZIUB 5HUQA 2KWIA 4GPTA 2WR8A 5J4KA 5HRUA 2HMTA 1BVUA 4M9UA 2P69A 1C1DA 3HFRA 3T7DA 1PJTA 1I5OA 1X7YB 2CLMB 1VHTA 2O8NA 2P0AA 1YB4A 4GC5A 3QUTA 4LYYA 2AJBA 1WKBA 4EY7A 1N1GA 3NHMA 4P38A 5BNFA 1UC4B 3PFCA 4RKQA 4B6JA 3V1LA 4QXAA 1Q92A 1OPRA 1SXJE 1SXJA 4DVJA 5BRAA 5AQEA 3FMVA 2DT8A 1KHHA 4P3NA 1KF0A 2O4CA 3A6KA 4NBWA 3C3CA 4RKWA 4H7EA 3G85A 4AB1A 4E6EA 1XUOA 2HSEA 3T61A 3DWGA 3P2OA 4JVNA 1DRUA 5BP7A 3L8CA 4A0FA 3U6BA 2L2QA 2W6ID 4ER6A 3AY7A 3GPIA 2MR5A 1ABFA 2WWFA 4ZQFA 2NT4A 1P2GA 5FWYB 4DLXA 2ARKA 3D8SA 3NQ41 2QRHA 1MB4A 1DKUA 5EE0A 4MW1A 3LBIA 1EKXA 1VJ1A 4EG3A 2P5SA 1M2GA 2B0CA 2JASA 4WZAB 1KQGA 3MHPA 3I6MA 4QA9A 2GZMA 3W5IA 4PG7A 4D8TA 2QQEA 4OM7A 1QG2A 2PS0A 3I2JA 4PNHA 4ZANA 1E59A 3DP7A 3F49S 3DNFA 5KOYA 4NQZA 4Q37A 1V4NA 1EVEA 1T24A 4BNUA 3PDWA 3I6QA 3ZYCA 1TF5A 5ALTA 1OC2A 1SKQA 1YZYA 3QWIA 5LD2B 2FPSA 3N8IA 3S5JA 4OXQA 1VM6A 5JHHB 3PC8C 1M6HA 2ZXFA 4G2NA 3WYNA 1WVMA 2B21A 2IS6A 3SGLA 1SUBA 2NVUB 2IV3A 2FSVC 1V7QA 3OZTA 4CFZA 1F9AA 1SUEA 2ZRKA 4HMPA 3P4UA 5TMDA 3TRFA 3T7SA 1ODIA 3NRJA 4EJ0A 3A1FA 3FZEA 1L5QA 2C07A 2KJQA 5L3SB 2Y1CA 1Z5VA 3BK2A 3LXMA 3L7AA 1UMDA 4U6NA 4RDHA 3GJ8A 5KPJA 2O1XA 1GZHB 3V4FA 3WRYC 1SHLA 4XX0B 1PD1A 1F2TB 2VEOA 4CE6A 2FWJA 4P32A 5CVJA 3UC9A 1MNQA 3D4NA 3DE4X 3HGQA 5ENDA 4X61A 4X90A 4QUGA 2IBTA 5DCLA 1ZM9A 3QELB 3GT7A 2JI8A 1VJGA 3IT2A 3UB3A 1WEHA 5BUQA 5B5SA 5I01A 3EJWA 4L1KA 4TTTS 2OHVA 3HR7A 4H0CA 4UQLA 3I9JA 1PVOA 2R44A 3NHYA 3PQDA 3RTCA 3F9RA 4DMCA 2OEPA 1EIZA 1PG5A 4YRRA 4C0JA 1B8OA 1ZCBA 5AD1A 5FEUA 1UPAA 2RHGB 3ESXA 4IG4A 5HMLA 1ZCFA 4B0OA 1IIBA 1LVGA 3D64A 2BFDB 4MPJA 3ZG6A 1HQDA 3GGSA 4YAWA 1C0EA 4M1EA 3H9QA 4PYNA 3AUFA 4WXPA 4EI9A 3KSRA 1MG5A 5A1JA 1I7DA 2FN4A 1P80A 2XTZA 3OU2A 4AY3A 3MBKA 1TZ2A 1ECBA 1QH1B 1NQ5A 4GSKA 1XMJA 2ZSHA 4KMOA 5D6OA 4GYKA 3UBMA 2QG9A 1GL6A 1KVTA 1VG8A 2B8TA 3DVAB 4P81A 3EGEA 4MS3A 4IV0A 3IEIA 1XDGA 3QJGA 4MVYA 4EVQA 2H4FA 4QOHA 1MDFA 4HNSA 4I2NA 3B3JA 4UUOA 1FLVA 2OHXA 2NNLD 3ZHXA 5JS6A 3AHFA 4Z0TA 1ABEA 1JQ3A 1CU1A 5G0SA 4B4VA 3OT5A 4LDPA 3PRYA 4BLRA 1W5AA 2PFSA 3IAS1 4M1WA 3TAHA 3TB4A 4JJ7A 4UHEA 3Q87B 4TT8A 4MVJE 3KL2A 2XWQA 3OLVA 2GOYA 3WQSB 2VXYA 3W6PA 3K16A 1J90A 2H2FA 3T6KA 4U5QA 2ZJ0A 1THGA 3TECE 3G59A 1RVV1 5EKSA 2D2FA 1F3LA 1P9LA 3T5CA 4OLBA 1P5ZB 3NW9A 1XN4A 2F3TA 4ZYLA 1V6AA 3L7CA 3U7HB 2VPWA 1O3YA 2I4RA 4MJXA 4WVLA 3H16A 1RIIA 5EZYA 1Z28A 2ZRPA 3OHSX 4J0IA 1JHAA 5KQPA 3CVWA 2IX9A 3ZHUA 3IKLA 5I9BA 5LBTA 1NKTA 4QUDA 2JCSA 3RYHA 1XTIA 1TUIA 1UC5B 3ZCQA 3JARB 3MTIA 1GG9A 3N0TA 4K2HA 1T3LA 3AR7A 2HPZA 3KKOA 3UICA 1CR2A 4EY6A 2MHCA 1NJ6A 4KH1A 1EZ1A 3OY2A 4DLPA 4E4YA 4PRYA 3JQRA 5G0VA 5JV5A 1SQFA 2YVLA 3CR7A 4H1WA 3EVCA 2PPVA 4GVPA 4JIMA 3GLHB 1U1IA 4EB0A 3BT7A 1OXTA 3ND9A 4Q19A 3K72B 4JX8A 1YNSA 4JASB 3AEQA 4HRAA 2DHDA 4CV2A 3C85A 4G2TA 3VKFA 4GFDA 4FHEA 1EUCA 2PYZA 3PC8A 4TRRA 5E95A 4NOKA 4AZTA 1TF7A 3D3NA 3FFAA 3ZW9A 1C1XA 3LPLA 3DLIA 1LU9A 1WZIA 3TBFA 2NX2A 4UM7A 3SZMA 1QTQA 1Y1KE 2FSVA 1DAFA 1SUAA 3X2SA 2V96A 4I9HA 1QAMA 4CF4A 1JU9A 4GKJB 3FUWA 4YAEA 1YRWA 4BATA 4OHPA 1NW8A 1RWMA 1UWLA 3EULA 1RLMA 2GSWA 3PGXA 3UAWA 1W5SA 1F20A 3H87A 2C2GA 2RAVA 3LZCA 3K70C 3E9QA 3FNQA 2Q9AA 3MJEA 2IDZA 3TK1A 5LUAA 1BW9B 4IMJB 3DEHA 3RT7A 3WRYA 1I2DA 5K0FA 1E0AA 3RV4A 3DH0A 3ENKA 3P2KA 3WSWA 2HRZA 2QW1A 3U44A 2YXBA 5JJ5A 4TYYA 2BI7A 1BHSA 2CLCX 1QG0A 4CCAA 2WF9A 4JYMA 4ZI7F 4J0KA 4L4XA 4LTMA 3IOCA 5JSHA 3TG8A 3OCCA 4RZUA 4R3WA 1FFBA 3GV0A 3QG5A 1MV5A 1BCSB 4U5XA 1TO1E 1KI4A 1M1YA 1E2BA 4RD1A 3R9XB 3IFSA 3PQFA 3PX3A 1JXOA 1GNPA 1W49A 1WW2A 2I3BA 2RBGA 2P30A 5A5EA 5KYYB 2FFJA 4L0CA 2FUCA 5TPZD 3K1AA 3HWRA 3QKRA 4LJ5A 2UZ4A 1PFWA 2JK0A 2N0SA 3I72A 1Z5GA 1GPAA 1K5GA 1YB2A 2AQHA 1YH3A 2KBFA 3T7JA 3DPUA 2MT9A 3CLKA 3EFEA 4B6SA 1YDWA 3DAFA 5B7NA 13PKA 3MN1A 3NT2A 1E1CB 4ESOA 2O7RA 2R4TA 4CKWA 2PXHA 3KVOA 2ACWA 2QG6A 2I54A 5JPCA 1FEZA 4FE3A 1IHPA 4G09A 1UPCA 4KO2S 4X3PA 4ZC8A 4YJGA 3NDIA 4B46A 3UHFA 2P8JA 4DLRA 1LDYA 1JYFA 4PTYA 3L6EA 3RRYA 3TDKA 4X7PA 4MWSA 2W4QA 5KNBD 2FR0A 3ZGLA 5A3JA 1XTJA 5AW1A 5CK4A 4RLQA 3AEKB 1E3SA 2C29D 2HCBA 3SZLA 2NV0A 4ERNA 2GZRA 5B57C 1K06A 3DXFA 1AF7A 4DAOA 2JGMA 1V3TA 1WBJB 2JNWA 4H16A 4PNEA 5KHLB 2CKMA 2QN8A 1GQSA 4JQCA 1RSZA 1U0TA 2QE7D 3KJZA 4LKOA 3AWDA 1C8KA 3JWHA 4IOLA 3AB3A 1VBKA 3PL1A 3ZDFA 4YGYA 3ICOA 5ITVA 4RTJA 1G4HA 5REQA 3N75A 3EUFA 3LQYA 1T9BA 4UU7A 2CDCA 1SD1A 3DT6A 2WQ6A 3VVMA 1BOOA 4F92B 2RDMA 1C7QA 2I6QA 4C4SA 2BEWB 4FN4A 1TJ5A 4H0FA 5CBPB 4IHAA 1NG1A 4BQQA 2ZCJA 2LWIA 2ZJ8A 2REQA 3BGOS 5IXSA 2P78A 5BV1A 4FSHA 4WXMA 5DHRA 4BBZA 3UAZA 4QQRA 4CKBA 4R0VA 2PO5A 3MF4A 2X3YA 3NWBA 1J24A 1CQJA 3ROGA 1KJIA 2NV6A 1UJ5A 4B3SB 4C6TA 3IVCA 3SSNA 3AKCA 4EJ2A 2J46A 4EP1A 5JRZA 4PLTA 2A5FA 1MIOB 3RADC 2PX2A 1X0VA 4NS1A 1XMVA 5FWAA 3MRTA 4ADSG 4ALIA 5BWCA 5JYDA 2ONYA 3ORSA 5IS2A 4YROA 3REGA 2IYWA 2B78A 1GUYA 5A06A 2H63A 5CXXA 3C4VA 1K8RA 3MLEA 3HG7A 3VO8A 3IKVA 1XZBA 3NB0A 2D4HA 1YS7A 2WTNA 3A70A 4GE3A 4Q7KA 5DYGA 4EA9A 5JZSA 1VQ1A 2ZJ7A 1IEXA 2VQ3A 1HSOA 3JZFA 4JR2A 1RPZA 1VYUA 4RLFA 4LOHA 2PLFA 2AG6A 4MMYB 5GONB 3RIGA 4BUZA 2ZUFA 1XPUA 1J7KA 2ILVA 3IP8A 5IDVA 4BMDA 4O59O 3T7CA 5ALIA 2BFPA 3FB1A 3O0DA 5IEBA 2PK3A 1Y6GA 3CB2A 3IPLA 5FBQB 5ANRB 2GD0A 2RK6A 4B5LA 1GFWA 3AR2A 4BKQA 1FFWA 1VPEA 3DVRX 2O0LA 3PGVA 1CY2A 3TEMA 3GDFA 3JWJA 4XQ0A 2I65A 1SKUA 2VXOA 1CERA 2Y1EA 1AMOA 4Y0AA 5KYYA 5THKA 1YRLA 2DWQA 1EE2A 3BXHA 3T99A 3KTAB 1V26A 1KKUA 3BXOA 4QG3A 2VF2A 3MW8A 4EMUA 1CVLA 1NW7A 1QS0A 4L57A 1TM2A 2Q3DA 2ZTVA 4UC0A 4ZOBA 1P1JA 3GA5A 2H9IA 1FVXA 1T5BA 4L8WB 4MB2A 4AG3A 3U31A 4P3YA 5I8WA 4DR4B 1RKBA 2EFDB 4F85A 2RI0A 3EOBI 1XKXA 4AMVA 2IYZA 2BCGY 1W6UA 1E2PA 2F1IA 1RM4A 4ZVOA 5ALPA 1N57A 4V1CB 1ZGAA 3I83A 4D8WA 16PKA 3O4HA 4CF3A 4K6FA 1DAEA 4U6SA 4FHZA 2PNJA 2XXAB 4BN4A 1E3JA 3COWA 3UWOA 3TFWA 1YSCA 3G2MA 3W9YA 3OZGA 2GN4A 2R79A 3WYGA 1IZ0A 2P9ZA 3UFBA 1YZLA 2JLQA 2WJJA 3O73A 1D2RA 2JFWA 2MJLA 2YV1A 4IIJB 4XUGB 3Q7SA 2A33A 2Q4TA 3LQ4A 4JOQA 2JCGA 4N65A 5D00A 5EIXA 1ELOA 5DF1A 4H1TA 1IVNA 3GP5A 1FDTA 5CITA 1TK3A 2JFUA 1YMVA 3NIGB 4L6CA 4D81A 5KUTA 4BPBA 1PEKE 3RHZA 1FTQA 3I2HA 5JATA 4ZI2A 4GLBA 1MJNA 1V5EA 1P4HA 1RAFA 4UBKA 1JB1A 3KOXA 1AUQA 4KO1S 1OFGA 2OT3B 2FZ5A 3DTYA 4GZ6A 4HQ0A 4ZVKA 4ZD6A 2PUJA 3FOZA 4EZEA 5CB6A 2DKNA 4EVRA 1PGJA 1NI4B 2HGZA 3EUWA 1C0IA 3ZDRA 1LLCA 1R4AA 1JR3E 2WD8A 4CG2A 5AM2A 2BW0A 2AXNA 2ZSEA 4JLPA 3PIRA 4E3ZA 1TU3A 3LBFA 3TTYA 3RSQA 2VUTA 1RWQA 4QUAA 1E6LA 5C2JB 3IYLW 4HZUB 4XIYA 3ZHVA 4YJKA 4IIEA 4G8DA 5FOWA 4MICA 1WXIA 3H1BA 3KG2A 2CLEB 4NK4A 5L45A 4TKZA 4Y8VA 2QGZA 4UNSA 3AJDA 4AWAA 2DPXA 3KS9A 5EC8A 5CA1A 3K8OE 5TSDA 5CX1B 3DEZA 2IZ7A 3I0MA 4RIGA 1FLNA 1XMXA 5FLYA 4LCJA 3COZA 4ITUA 4NCNA 2JBAB 3DDHA 3BF8A 4IPTA 2QAIA 3FN4A 1SXIA 2JAOA 3UJ7A 3EPLA 3GPBA 1TTPB 4PQEA 1OZAA 4XD7D 5JSUA 3Q7RA 5LMUB 2HR1A 4WAUA 3WGJA 2VPYA 3BIJA 3NVMB 2G1PA 1JKFA 5LDGA 1WW8A 3QHAA 5EIOA 4D9EA 1AHNA 1MJGM 1O87A 1EFAA 3FMOB 2WHQA 1NTRA 5A9TA 1ESEA 2Q4OA 3L5KA 1L4MA 4CCSA 1LBIA 1ECPA 1J1UA 2PFKA 2CFSA 1IUOA 3CE9A 4BJHB 1PQ4A 2GLUA 2HWUA 3CH4B 2UYCA 1FQWA 4EAAA 1YC2A 3K2IA 3RU9A 4ZAZA 2Q2OA 4KZKA 4LZPA 2PT7A 1M2VB 4QQNA 1NMQA 3PDCA 4ECAA 1UBLS 3MG9A 2I34A 3OCWA 1MO2A 1GYRA 4B3BA 3TG2A 3WE7A 4BAZA 3M9LA 4WN9A 1N7IA 1E6MA 5AKEA 3B9RA 1E92A 2WF7A 4HH1A 4KQKA 2RIPA 4X6LA 4C2AA 4AS1A 4FW9A 5KNBH 3F96A 3EZGA 1NBOA 3PI6A 3QTLA 2XUAA 2FZCA 4FNAA 5DO9A 4NABA 4BGEA 4ZYVA 4OBWA 2PL5A 3EG5A 3RM3A 3EXAA 1EWRA 3C3XA 3WGOA 4NICA 4W5HA 1A9TA 2YY6A 3IP5A 3P7MA 4NMMA 3HUEA 1QZTA 5DTQA 1A7JA 3WWEA 1VL2A 2QX4A 3MAGA 4UDXX 3CQ9A 4XPIA 5JFOA 2C7PA 1TJPB 2JRLA 1SKYB 4KWHA 3BZWA 4KITB 3O93A 4N9WA 2C7BA 1GITA 4IP0A 2IPLA 5IXYA 1ADJA 1V1RA 3UKOA 5LNK1 4XVQA 1EQAA 4K46A 4KW7A 1MABA 3COVA 4MJLA 3WI7A 2FFQA 4M9CA 3LYHA 4OG2A 1EZZA 5HOQA 1NPYA 3HUUA 3HDVA 6AT1A 3AJEA 4HGNA 4KPUB 4S1NA 1DDOA 1FP4B 4HAYA 1IMJA 4PR0A 5ECYA 5JSQA 3L4KA 3H18A 5CURA 5EMMA 3GLFA 4MQMA 1RHQA 1XWWA 2ES4A 3RU3A 1LDEA 3GFPA 1VLZA 2ZT5A 1Z2NX 1RJWA 1CY6A 4XCQA 5EHIA 3U7FB 2MSKA 1L4NA 4DN6A 1Y9JA 3DCIA 3EPJA 3R77A 1XVIA 2IUFA 2QWXA 3LQ2A 4YHBA 2IH2A 3D0OA 4KSBA 4WNAA 1TLTA 5EINA 4KRYA 3MWKA 1I7PA 3QWBA 2N9UA 4YP1A 3EH2A 1AXEA 1JJBA 3I45A 3DG9A 4G1EB 4A6PA 4AROA 5EJIA 1EXNA 3L07A 2RJOA 4M1OA 3O7MA 2B1IA 3NIDB 5A2GA 2HC9A 1CG6A 3LDUA 2NUAB 3U7QA 1CT9A 2QPAA 2ZITA 3KELA 4AVYA 1KOFA 2O2SA 4V2IA 2QYSA 4UOEA 4RY8A 4AWXA 3R40A 3SHOA 1KC3A 3QA3E 3NUZA 4RDIA 2PUGA 1RYYA 5D01A 3NEAA 1Y3FE 2CJFA 2CXQA 3D2CA 1K9VF 4KO8A 5CYPA 3TLJA 4ALJA 3T3DA 4XWKA 1KAMA 1EM8A 3UK1A 2AOUA 4BCCA 4A2PA 2N1MA 4JYBA 4KXXA 1XDBA 3BHNA 3ROZA 3F1LA 3L4EA 1X7XA 2DZDA 1ZICA 1LDBA 3GCGA 3K6JA 3LLSA 4MQEB 5IJ9B 3O4IA 2B5OA 3OAAA 3T3PB 2GD2A 1RWWA 1JIKA 3DB2A 4QGSA 4KE9A 1P45A 2LZ0A 4D9GA 1XZJA 3K6SA 3GUYA 3HJAA 2HRCA 4D80A 2F1HA 5GZ6A 1STOA 3MB8A 1P2BA 4NMLA 2LV8A 1IDN1 2ZP1A 2NVOA 4HUQB 4MQFA 1MHTA 2OWDA 1ZITA 4P54A 4M88A 4F38A 3FUXA 1NR1A 4NU5A 2FPRA 4TVBA 1LJLA 2EBFX 3NATA 2D5IA 1MO4A 1QF9A 1GTJ1 3HY4A 1RI1A 3Q5DA 2GEJA 2GTHA 4R1TA 5KWIA 3EG9B 1LPNA 2N75A 2JFXA 1KBZA 4RVUA 2WOJA 1Q15A 4K9KA 3LA6A 4AJ9A 4QU0A 3KQUA 1MVNA 3QPBA 4EPRA 4DLYA 1JKJA 3HZZA 4O4JB 2WPDA 4QQFA 5J63A 1S01A 5E0KB 3QUQA 3ZJ5A 3OCYA 3CE6A 4LE2A 4MPDA 2R48A 4H7HA 4AZVA 4J0FA 3TNLA 1N2CB 5DN6A 5T4EA 3AFMA 2OOKA 3PQ8A 5B64A 1QHEA 3COSA 3GJRA 2IDJA 4YWJA 2W0SA 4YO7A 4QDJA 3EIOA 1VE5A 2FV8A 4EG0A 4MPRA 1SAYA 1WQ3A 4DSAA 1QHHB 2AUNA 1Y5RA 2AX4A 2QP4A 4I9UA 5CLHA 3FY4A 1Z17A 1FYWA 2IY7A 3GOHA 1R5BA 3E5HA 1KJZA 1MJ5A 4F9FA 3BS4A 3IAUA 3PD7A 2XWJI 1SQ6A 2R1TA 3KLPX 3S2GA 3CC8A 4J7CA 4C2UA 1Z26A 2PZAA 4OBBA 1B0PA 2C9BA 3DOJA 3RVQA 4OTZA 1YBAA 1T1SA 3L1UA 4A91A 4ENUA 1YOBA 1DV1A 2F62A 3N2GA 2CJPA 3LDAA 2H00A 4HYYA 2PUHA 5AVTA 4X85A 4YXWD 3LYLA 4ES6A 5DE3A 4IIYA 5B7GA 5H83A 4IDCA 3WAGA 4ED9A 5L6LB 1QYDA 1E66A 4I46A 1IEQA 4F9TA 2ZM5A 1NJSA 1U2DA 2AH5A 1L7EA 4K8RB 1T2EA 4O4IB 5IT9A 3KALA 4MPTA 5COBA 2ZS9A 4MV7A 1ETHA 4JBYA 4D4MA 1ZJZA 4OAOA 1JLKA 3A25A 4KACA 1E5LA 1GDDA 3LDGA 3PLNA 5F5XA 1Q12A 2O2GA 1BGWA 3BGSA 3EASA 5IUJC 1X87A 2A5GA 4ENWA 4H3SA 2AZXA 3OE1A 4WD3A 3TJZA 1ZLYA 4R9RA 4YO8A 3QE9Y 3NS7A 4LKRA 2HTEA 3EX7C 4DANA 3AVTA 3W04A 1RWOA 4FP9A 2JFHA 3KOZA 3OP1A 3PC2A 3PWZA 5EIBC 2XGMA 3E48A 3WYCA 3DQQA 4DWOA 5ALNA 3JD0A 4Y2PA 1T3GA 5DIZA 4MV5A 4G37A 2AR9A 1H1DA 1VE9A 1FTSA 2JIBA 1F8FA 1XZEA 5DHQA 3ZXUB 4AY5A 2V8OA 1MG0A 2PYIA 3AI1A 3ED1A 3AHGA 1EE1A 1C3XA 1M1XB 3A6ZA 2HHCA 2QUBA 3L6DA 4PXSA 2OM2A 1WTCA 4RU1A 4IH9A 4J4BA 1ZR2A 4LNHA 4OK5A 4Q3AA 4FX5A 3VYVA 1QTIA 1V7ZA 2MMCA 2QB5A 4TS3A 4OXKA 3OEHA 3TTVA 4G0UA 3E81A 3WGTA 1ZJ5A 3ONWA 4QBKA 3MERA 1G8FA 3E1SA 3NV9A 4UTNA 1KQOA 2ISCA 4PLCA 4R1PA 1LDMA 2JC3A 1U65A 4LDJA 3B3GA 3LBAA 3OPYB 1XCGB 1OFVA 4U8HA 4NH4A 721PA 2B8NA 3ENWA 4YACA 2I7DA 5JFGA 4QXRA 1VB5A 4JL8A 4Y30A 4GOLD 4YRGA 4P7JA 1KE1A 4RETA 1ONSA 2H1LA 3QPCA 5L3ZA 1N6RA 1QV7A 1MW8X 5CJJA 1PW5A 4PCVA 3A0UA 1SU6A 4JJFA 5FWXA 1I5EA 4M0CA 1LVHA 2PU7A 4OL0A 3WOHA 1QE3A 4HEJA 2YQ5A 2JIQA 4B7AA 3OOWA 1UL1X 1Z36A 1EQUA 1DQPA 1PGOA 3H1GA 3N2NA 3OE5A 1WB5A 4B6GA 3AF5A 3S40A 1R0LA 1VIYA 4POOA 2F48A 2VDPB 4YQEA 5JCXA 1QP8A 1DJMA 3ELUA 4W99A 4PV7A 5DBOA 1G8YA 1JR4A 2BMJA 1B14A 4Y0VA 3Q6IA 4RD2A 3RJMA 2O9JA 5CAEA 5ESWA 1IATA 1IOLA 1FJ2A 3A05A 1Z73A 2CNBA 2IVZA 2Y1OA 3NOOA 2IPXA 4K9LA 5GPBA 5K3AA 1PGQA 4JI5B 2G63A 3NDJA 1LNQA 2CLFB 2GTIA 2Q9UA 3AUJB 5BXYA 2QBYA 1NUHA 3IVMA 4TXJA 2GEVA 5TPWB 1X9IA 1FVOA 2XYHA 2HSJA 1VJCA 4N3BA 5I6DA 1SXQA 4OKNA 1JIIA 2HGSA 4BFSA 5FNVF 1FLAA 1SG0A 1W6RA 1I33A 5BXQC 1NN3A 2H1OA 1BH2A 3VISA 5JAQA 1KMNA 3QKSA 3BIWA 4EB6A 2XDQB 3FRHA 1JALA 1J7JA 2ZS8A 1D03A 4TMYA 1B3RA 2Q5LA 1I32A 2P2LA 3GA0A 2RH5A 1MZPA 2ISQA 2AXEA 3K0FA 1P2DA 1XXLA 1EVJA 3ACCA 4LCEA 2VPTA 4RK0A 4P7KA 1J8QA 4XGNA 5GJVC 4BN5A 1T6XA 4EBBA 4N5DA 3EB9A 2R751 1C8VB 4RF5A 2BTQA 5B58T 3X1ZA 4ZI7A 1MVOA 2VQSA 5LIRA 4Q3DA 1NXVA 4YYZA 1USWA 5AYVA 2HLDD 4BTVA 4D9KA 3VOBA 3Q9UA 1LXCA 1BH6A 1P9NA 3CLVA 3OQJA 4YGXB 5AO9A 4E5VA 5LNK6 3AP1A 2CMHA 4ND5A 3TZHA 1YRBA 2MYNA 2QMYA 3DUWA 3IB6A 1ZXBA 4WESB 3NWPA 4P3OA 3WBKA 3A9SA 1F06A 3GROA 2V7BA 4OQDA 3ZX5A 4ASUD 4WFJA 5JH7B 1E3MA 4YBRA 5T57A 3P9RA 2DBZA 2W2NA 1JWBB 5FHRA 2DHEA 3EDYA 4K03A 5K3DA 2WLTA 3QEBZ 1D6SA 4BVJA 3KQYA 4CDNA 1XAIA 1C3OB 4CYMA 1R74A 1WP4A 4Q47A 2XKBA 1FSFA 2BR3A 1C5KA 2M6SA 3IIMA 4MWEA 4P5DA 2BBWA 2GPYA 1NVWQ 2XNSA 3RBAA 1XPJA 3OIUA 1SBZA 3IALA 2W70A 1ZR4A 2Q45A 1YA6A 1ZMOA 1AGNA 4L9WA 1RM3A 4P34A 1JJIA 1SVLA 3DOHA 3FH0A 4JLBA 3HFJA 2DXIA 3VR4D 5C3MA 4S2EA 2NO6A 4IILA 5DNCA 2DQ4A 4BFVA 1AK9A 3BHJA 4O0MA 4RQTA 3S8EA 4DA8A 3KK0A 1QTNA 3GGOA 5FI1B 2OYRA 3TLBA 4RPKA 3ONEA 4BMZA 3IUNA 2JBWA 3BOSA 1E99A 3DULA 3LV8A 3MS2A 3N5KA 4KMMA 4EHIA 2I3AA 2XQFA 2QUIA 3RSHA 1SC6A 1WUHS 4KVFA 2PX0A 5DNEA 4AQ7A 1OB2A 4JZYA 3J80A 2EQBA 1TA4A 5ULLA 3T15A 2V3CC 1H1LB 3LWBA 3QFSA 1O94C 2O0MA 3QLTA 3SJAA 4FU0A 1OTYA 3IRUA 3RIYA 4MYRA 3V4LA 2WVGA 3VC3A 5E8RA 3RRMA 4H2DA 3LS2A 3VDXA 4DC9A 1II9A 1QH0A 1C3VA 2OFXA 4CLOB 1ZMBA 4OK3A 3RRFA 2PWPA 2FEPA 4HTFB 1QHNA 1ZOLA 3IHWA 2IEBA 1NY5A 3R5HA 1FYEA 2PLAA 5DB4A 5JRDS 2YV4A 3SJBA 3DYIA 1HPLA 3C6ZA 1X9HA 3OD1A 4BLUA 3T7RA 5GY7A 5ITZA 4ZAGA 3E3NA 1IOWA 1SPXA 3MGBA 5K4GA 5B4UA 7MHTA 1GTZA 2HPHA 1WP9A 1VMIA 3R5SA 3IV6A 2HNBA 2JIRA 4MSUA 4YCAA 4ZJZA 3BULA 4U3JB 1VSUA 1Z7YA 1JDPA 2QUAA 3C87A 5AHWA 4Q7QA 1HNWB 1SUSA 2OV1A 3GL9A 1DDIA 1U8YA 1X1BA 2OD7A 3DMNA 3Q7EA 1O08A 3DEIA 2Q5IA 3WWYA 3B82A 1HT0A 1I3MA 2A9PA 3T7EA 1VJRA 3H1FA 3KFVA 4JLJA 1E7WA 3EQZA 1VJ0A 3MA0A 5HRCA 1R9NA 4M4SA 5C53B 3IO5A 2VBFA 2J0UA 4MKFA 3G0BA 4LRXA 2VXBA 4RACA 1IBLB 2PX5A 2AE1A 2JJ1D 3FWHA 3I04A 3CVOA 3GARA 5AT1A 2P5YA 3DOEA 3ETNA 4S0XA 2ZG6A 3WWDA 1CWUA 2A1IA 4DSUA 4V24A 3FHJA 2JZNA 3DVLA 5JT1A 2BHTA 1Z33A 1NV8A 4JC4A 4XW2A 3STWA 3NZEA 2PRJA 2YKGA 1ESCA 2C4KA 3O5AA 2IWHA 1J5XA 1CHDA 4TKUB 3KQHA 1NE7A 3AVUA 3PHCA 1UMCA 1GU1A 1PZXA 4ZRMA 4X00A 2YWGA 1WMFA 2BJHA 2I7TA 2VO1A 3G9UA 3L6OO 3KQLA 1UIMA 3AONB 2ONCA 3O8NA 3I5YA 2ODPA 4WH0A 4Y2VA 1J9GA 3PUZA 4RMJA 5LKRA 3UENA 5CLQA 2FFHA 3AQIA 1Y9AA 2WY2D 2QRGA 2Q6OA 2RB5A 1HV8A 2BM8A 4BO6A 1TMKA 3VC1A 3V00A 1WV0A 2DBRA 2E21A 1GARA 3DF9A 5J59A 3VNSA 2I4IA 2XQGA 4DGQA 2XUHA 2FK8A 1ZVJA 1QHYA 2WV9A 3EGDB 3G1TA 1R0WA 5B7PA 3WP0A 3A36A 1U6IA 5CLGA 3BWEA 4Q4LA 4N3GA 5ALUA 3TPCA 2B34A 1SQ5A 4O29A 1KH1A 5BUSA 5CIYA 1Z88A 1YU6A 3OZIA 3QBDA 3WIVA 2Z4TA 3ND5A 1ENPA 1U9YA 2PQMA 1QU2A 2I78A 5JCJA 3QY0A 5KNLA 3HN2A 1IZZA 4LRQA 4UTRA 2W6JA 2VHVA 1XTPA 1TVEA 1YOVA 1GVHA 1PJRA 2V6GA 1X1DA 2EFGA 3TTTA 1ZGJA 3EVFA 4CGYA 5JNWA 5D85A 1GRNA 1V16A 2C3PA 2R6AA 3CM0A 4QVIA 3ESAA 5FULA 2W6ZA 5JTUA 3OIVA 3RVNA 4AJKA 1GAXA 4BV9A 2DECA 4ILKA 2ETVA 2XPCA 1LY1A 4WKNA 1AE1A 4KXLA 4ZARA 4EY5A 1D3AA 2FMTA 1CRLA 2O3SA 3IMCA 3T9EA 2W2OA 5T4FA 2HDNB 3F9IA 4LY3A 3MWDA 4OMDA 3AFHA 1K5DA 1ZA2A 3OLYA 4XQGA 4AZ3A 3GU3A 4H7KA 4OAQA 2R4QA 5IULC 2OZLA 3H3XA 1HMPA 2VAXA 2CCKA 3SI7A 4FKBA 3ZY3A 4EFKA 2G9NA 1NWHA 5KVCA 3DW1X 1PV1A 2ORIA 2GN0A 4LGYA 3WKBA 4BGVA 1FYXA 1E1RA 3ZK7A 2EFJA 4KXVA 2XDAA 4RGBA 1D7AA 2AL7A 1DLJA 1QE0A 1XRSB 2DR0A 4FKZA 4G5QA 5DPMA 4QEZA 3FWNA 1O6BA 4MAMA 4FS3A 1KYVA 2HDHA 3Q8MA 2D5CA 2P1ZA 2WNHA 2YJGA 3QWHA 4XB6B 1ZXXA 2POQX 3HJCA 4NU6A 2VRBA 3N8NA 3EAGA 2OM6A 4WCFC 5DYTA 3DQZA 2VBGA 3QEJA 1V39A 3WQRA 5A6VA 2H0AA 4YR7A 1IG0A 1QVAA 5AVKA 4A0HA 3WFIA 2QN3A 2ODAA 3PDIB 4KK3A 4GE0A 3RANA 2CNWD 3Q40A 2O7NA 4L4UA 3AMVA 1E63A 2ECOA 3NHKA 1NVBA 1Z7WA 2OCAA 4JLUA 4KCGA 5P21A 4FXOA 3G2JA 4UUMA 1Y82A 1UDAA 4V3BA 1BDBA 5ESRA 3NFYA 4BB9A 2L17A 2Z98A 3MEQA 4DJJA 3USZA 2WYVA 2D3WA 2VP5A 4MXDA 3OZUA 1YZKA 2G70A 5IK2A 2X0EA 4AFNA 2RHTA 4DMKA 4E09A 2XYRA 2Y93A 1CRWG 1HF3A 2WFAA 3RBXA 1YVEI 4GOKA 1VI2A 2L0XA 1BKSB 1E3TA 3E18A 1P0CA 1EP3B 3WKEA 2OFOA 1U0JA 3IJ5A 2VUHB 1VSQA 4JBWA 3VR4H 2M32A 1L4YA 1NFFA 3NAQA 3IIEA 3KYJB 5LMZA 5LP1A 2ZE7A 3QVGA 3ZHZA 3HXOA 3U4QB 3CNBA 4E0BA 2FW6A 4BDTA 2D0DA 4RVGA 5BQPA 3QU2A 2IH4A 2CHFA 4DMUB 1T6BY 4NDZA 3OX1A 4N7BA 5AOCA 2EVWX 5IABA 1C4XA 1OTXA 3H84A 3ET4A 2ZCUA 1M8FA 2WK1A 4YAJA 3DJYA 4P4GA 4DUPA 2M6LA 2C8LA