2YXBA

Crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
RRRYKVLVAKMGLDGHDRGAKVVARALRDAGFEVVYTGLRQTPEQVAMAAVQEDVDVIGVSILNGAHLHLMKRLMAKLRELGADDIPVVLGGTIPIPDLEPLRSLGIREIFLPGTSLGEIIEKVRKLAEEKRMREEAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme B12-dependent mutase
publication title Crystal structure of the methylmalonyl-CoA mutase alpha-subunit from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
molecule tags Isomerase
total genus 39
structure length 139
sequence length 139
ec nomenclature ec 5.4.99.2: Methylmalonyl-CoA mutase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 2yxbA00
3KP1A 2YXBA 1I9CA 1BMTA 3WHPA 3REQA 3BICA 1B1AA 4R3UC 4HEHA 4REQB 1REQB 1Y80A 4JGIA 6REQB 1CB7A 1E1CA 2REQB 2I2XB 5REQB 4Q37A 3KOXA 4HH1A 1K7YA 3IV9A 7REQB 3IVAA 1BE1A 3KOWA 1ID8A 3EZXA 1CCWA 1K98A 4HH0A 3REQB 4REQA 1REQA 1E1CB 1XRSB 2XIQA 6REQA 4HH3C 5C8DA 2REQA 3BULA 1FMFA 5REQA 3KOYA 2XIJA 3KOZA 7REQA
chains in the Genus database with same CATH superfamily
1G5TA 2ZBUA 2GAIA 5DZSA 5KYVA 2JAPA 4AY2A 3FUUA 2OA0A 3GLFA 3DLIA 1GTG1 1V8BA 2XCTB 1JR2A 4DZZA 2BFFA 1CLEA 3D43A 1J1UA 3PD1A 1ZH2A 1FFBA 1Y98A 2Z3ZA 3G13A 2B4RO 4RTPA 1E2IA 3WWYA 2Q1XA 4UOEA 1U9JA 4KP7A 3PPYA 4RD6A 1T8PA 3G2QA 3K9BA 2DSNA 4EF6A 3WR5A 4K6CA 2PFKA 3P94A 1ZK0A 3UWSA 2AN1A 4EL0A 2P8SA 1GFSA 3R3ZA 4Z8YA 5LQMA 4ZRNA 1RWWA 5MFPA 3PHHA 1T2VA 3P0IA 3R3XA 4H7JA 3ZVRA 4Z4GA 1ML4A 5BNTA 4J6FA 3DDNA 4LOLA 4YP1A 1UT5A 4P5EA 2JB9A 4M1ZA 4H3SA 3B1YA 4A8TA 4BC0A 1GGKA 2IY7A 4FOLA 1N2BA 4EJSB 2PS3A 2OGSA 1Z15A 3K16A 1CUFA 2WUVA 1SIUA 3WBKA 5I4IA 1X42A 4D9EA 2GEKA 1E4EB 2HQOA 1EMDA 3DFKA 4D9JA 2IEZA 2OHVA 2HREA 3AUYA 2I2BA 3D1JA 4QOIA 2FZGA 2ZTMA 2V7GA 2YWCA 2I6SA 1VTKA 1GAEO 2YQ5A 3F9CA 3QKTA 5FADA 4N7BA 5U1PA 4D99A 1BSVA 4ZICA 4MS1B 2BR3A 2Y27A 1XELA 4FQ7A 3F2IA 4JL5A 4BO9A 2CXQA 3QI7A 3WAGA 2NUPA 3CMCO 3H3JA 4FYXA 1UFVA 4DTIA 1EU1A 4UBIA 3G6KA 1AJEA 2XNDD 3WGOA 1QSGA 1V6CA 1M83A 3O8DA 3CG0A 3ZJYA 1CEXA 4G01B 2QQEA 4ZALA 4Q3DA 3IUNA 3G7SA 1TF5A 2P9QA 2CVFA 4QBKA 1KYYA 3H4MA 1G2OA 1L9KA 4AG5A 5CDYA 4DA0A 1DJLA 5JS7A 4TT3D 1A9TA 5ALGA 1NBMA 3ABZA 1UKBA 2O3TA 2XXBA 4O4LA 2VC2B 3QVVA 4QFMA 4E5KA 2DJIA 1ESMA 4IWNA 1GG9A 4RDCA 1VBMA 3CR8A 3VU9B 4EZIA 3F67A 1QRTA 1M0WA 3H5NA 1C4KA 1OJLA 2A86A 3OCWA 1M8GA 2VYND 2O0LA 2QR3A 2VDNB 3TJRA 3GARA 1CUBA 3L06A 1BKDR 3OMXA 4C04A 1VPVA 3I58A 4YP0A 3FZYA 3AI2A 1T5DX 4N8DA 4AJ9A 3FHLA 3DVSX 4QGAA 3WICA 3WIDA 5J2TF 4BGIA 5K8JB 3H5IA 4FDMA 1D5CA 2WSYB 3BWCA 2E4AA 2AG1A 2WJPA 4QDKA 1JMVA 4J0IA 4PTYA 4B6EA 3SMQA 4XWKA 5LL6P 4TXLA 4XWWA 5IZCA 1PBNA 4OQEA 4RPGA 4MVJF 1TIKA 2GTIA 1G9SA 4CMJA 4Y2GA 3U7QB 3WNQA 3WYEA 1O94A 1Z12A 1ZOPA 4ENSA 3QIVA 4ZEVA 5HGJA 4PAQA 2H3HA 4LCBA 4ZDWA 4KVAA 4MINA 3TPCA 1TMYA 1M9NA 2BZ1A 3DBHA 1QOQB 1CPYA 2BAGA 3X2EA 3V6LA 3C3XA 4I8IA 4M60A 4KOAA 3TQOA 4BPRA 4AB1A 3PICA 1P1RA 3DPUA 5JJIA 1LBSA 1JBEA 4BVGA 5REQA 2WZCA 1IDOA 2NO1A 3SKVA 3U9TA 3IVXA 1F2UB 4S1NA 4XM1A 5K6AC 4TRMA 1CZKA 2SKEA 3HZHA 2WFZA 3OY7A 2VYCA 4DSNA 4OJTA 3MB8A 5JNTA 1A71A 1TIBA 1OY1A 2QGZA 2QB5A 5JWOA 4JI0B 1O4WA 1TD9A 4U5XA 3N2IA 4P3YA 4C3VA 1P4AA 1NG1A 2BBTA 4C21A 4EDFA 3IH5A 2Q6VA 2FZVA 3I9NA 1NIJA 1R0BA 1H2YA 4MRSA 4A10A 2WWTA 2X42A 3TKYA 4EHIA 2FE1A 2X1VA 4LQ4A 1M72A 1J90A 4Q21A 2IDKA 4FZJA 4YUWA 1XDDA 4S1TA 3SYLA 3S28A 4DABA 1FNSA 4OFZA 3N0XA 1QHFA 2JBAA 3NO4A 2VT6A 2PSJA 4E2WA 2BOVA 1THGA 2HGZA 3AZPA 2ZTLA 4Q1FA 4B82A 1CS0A 4ZYVA 1NXXA 2MYPA 1YVPA 4DLWA 1KEZA 2RIRA 3H0EA 4LHSA 4OL9A 5EJ2A 4EO9A 621PA 3TIGA 3LXXA 3IQXA 5IC4A 1V1MB 2ODNA 1ZSYA 4KACA 5LUBA 4BLSA 1Z34A 4QPPA 3FYSA 1DIBA 2GPBA 2EG5A 5CVTA 5JIBA 2C8LA 4KHZA 1SIWA 2PV0A 2PUWA 1T13A 1PZMA 1E8DA 2HUNA 1TO2E 3L40A 3SHTA 1J0XO 1D7AA 4XIJA 4GM1A 3A6LA 2QSYA 3QTBA 3LL7A 5HPYB 1U0FA 2I6QA 4MS4A 4ZC1A 2QUBA 3KZNA 1FX0A 3SZUA 2B5OA 2IQIA 3ZHUA 1JR4A 2XF8A 3EY4A 2OC9A 3PSHA 3DE5X 4L76A 3TL6A 2GZ1A 2G3YA 2GKGA 5C8XA 2YN2A 3ESAA 5BWOA 1HT0A 1Y5LA 4JI6B 3FFWA 1ZCJA 2G9ZA 3USZA 1CIPA 1QHEA 4H3HB 4V0NA 1G6Q1 3I9V6 5HFJA 5KJFA 5L3SA 4MQFA 4MYTA 1LBHA 5GINE 5BSVA 1RIFA 2HHLA 3RQSA 4NPAA 1FDSA 1UDXA 2YOHA 2EX4A 2C5EA 1KETA 2PSFA 3CV3A 1G7TA 3OA0A 3ONNA 1XUOA 4JJZA 3VR6A 4MW0A 1Z5ZA 2REQA 3V7FA 1ZVKA 4ACAA 2WU1A 3RANA 3IUSA 3KK0A 4Q9KA 1VJDA 2J9GA 5LYJB 2Q9BA 5KTOA 4EKDA 1NJ1A 3KKNA 1T25A 4QE3A 5JATA 5JBIA 2PT6A 2HIGA 3B3FA 2ONKA 1K66A 1PHPA 2RGDA 4QYXA 1PS8A 5SICE 4EO7A 1WOYA 1T2NA 3PB3A 1ZK1A 4KPUA 4UUNA 3TIXB 4OSPA 4FBLA 1QCYA 2ZBDA 1NSTA 4F46A 2YHAA 2AE1A 1UK6A 3UJCA 4DLZA 5G41A 3M81A 3RJ5A 3BSWA 1HR0B 4LHYA 1J70A 4WY5A 1YHYA 2FWRA 1K4YA 5AMXA 4PF1A 2CJFA 3UMFA 3QUAA 4TM8A 3KOUA 3GROA 3WLRA 1M7GA 2VUIB 4DC1A 2D2IA 4EQZA 2V7EA 4UATA 5A7HA 3WGHA 3ZVLA 2G76A 3PTLA 4KFRA 3TFOA 3GWGA 1K97A 2HKIA 5H70A 3C7TA 4HDQB 1ABEA 4EG7A 2XUZA 1E2BA 1ES9A 1M0TA 2DH5A 2QRLA 5CD1A 3LZ6A 3MJSA 3VX3A 1VKRA 5HBRA 3GPDG 1JJVA 2AW5A 1KZGB 2GPSA 3LAWA 5ICGA 4ZDKA 1DTSA 2N1MA 3E3MA 3L7DA 3AEXA 1A2BA 1NWCA 4I4TF 4M86A 4DJFC 1JQJC 1EP9A 2HT1A 1TVMA 4UHFA 4ZV7A 2DQYA 3B13B 3IDFA 3T0FA 2M98A 4P4NA 2DX7A 2Q07A 3D2BA 3JQ9C 3O90A 4BRWA 1VM6A 1P3Y1 3AY3A 3ZZMA 2IY9A 1HE5A 1Q84A 1WULS 5BNFA 4X45A 3QVMA 1II0A 1F0YA 1EYZA 1SR8A 4F6RB 3TSOA 2COKA 2DLDA 3IHLA 4RK1A 4S12A 5I9BA 3EZFA 1AO3A 1BOFA 1Z8HA 3AFGA 4DKXA 1CJBA 1EWYA 3AJAA 3G6WA 1UBRS 4LA4A 2CGEA 3CB2A 3AHHA 4ECAA 4LG1A 8OHMA 3BTOA 3LFUA 4U0JA 3UV7A 2GDJA 3B8HA 3QE3A 1XVVA 3VSDA 4DG5A 1LU9A 2GF2A 1LBIA 1SCUA 4TWIA 3RBZA 4BAGA 2HZBA 4ZGWA 4OKIA 3RC9A 3AC0A 1DS6A 5FEMA 3UFXA 2ZT5A 3C4VA 1H5UA 3KQQA 1IYZA 2NU8B 5J4HA 4UMFA 2Q6IA 1FDWA 4CLHA 4Q9DA 3UJHA 3TR0A 5EERA 1JB9A 4JI5B 3RVLA 4FHCA 4CR8A 1ECBA 4CQJA 4FMDB 2QXTA 4FD2A 1FSZA 4YUZA 3H1FA 2IYQA 5JSZB 3FYCA 3TL3A 4IUCS 4AG3A 2IV7A 3RWOA 2PUFA 2CXUA 4OLBA 2FLKA 5J2UB 1S96A 2E4ZA 1RR6A 3O4RA 1TB4A 2QN8A 5CM2Z 3GYBA 4DRXB 3EGIA 3CR3C 2XVMA 4Q3OA 3VVCA 1BKSB 4CT4B 3EG9A 4BPBA 4QBFA 3M1YA 1MJGA 3ZCQA 2VTDA 1KORA 1H3FA 1SU8A 3HKDB 2HJWA 5I5GA 1EJ2A 5D8DA 1G63A 4QU0A 3TRHA 5J47A 2IS2A 2O9JA 2CLOB 3OM0A 3AVTA 3UNXA 1H66A 1VRVA 2VXBA 3VM6A 5BNWA 2QX9A 2CMDA 5ALYA 4ESHA 3F6YA 5LP6F 2VYVA 3M3PA 3MWDA 5AW3A 2AJTA 2WC1A 4KYUA 4CPDA 3GH1A 4ZXPA 4HLCA 1P1FA 1TM2A 1DC6A 1E2FA 3IEUA 1CCWA 3MCVA 3P9YA 4G23A 4UTOA 1BEZA 5L4SA 3BWYA 4UEWA 1NRJB 2P91A 3WSTA 3QBDA 2O8EB 3KU1A 5JNLA 4H7KA 4KTVE 3WSVA 1DBWA 2WHEA 3IP5A 2A5DA 2PJDA 5F4ZA 3FVRA 1RWOA 3JQBA 1PSDA 5CVCA 3KFLA 3W3AH 2FUEA 1RXUA 4G9EA 1ANKA 1NSFA 3PXEA 4KEAA 4HWOA 1TAQA 2H4XA 3J7TA 4YI5A 1E1RD 1XTVA 5BR1A 3T3DA 1NT4A 1OXMA 4N47A 4EA8A 3VR5H 3ORYA 3Q5DA 1E2KA 2EW8A 2H07A 3DV2A 3LQRA 3QBTA 3R3SA 1I3MA 4L5BA 4YUVA 3TI9A 3V2GA 1Q7GA 4CDGA 5JMTA 3RYIB 3I9MA 5FNVB 4I4NA 3EPJA 1RYDA 3DE3X 5FTJA 3R5SA 4OHBA 5I9LA 4JXZA 1JA1A 2D2VA 1F4VA 1OT5A 1SK9A 1LEHA 5HQ3B 1PJBA 3D6UA 4REOA 4FS8A 1NBWB 3IL2A 2R1TB 3QUCA 1QNLA 1FXSA 1Y37A 2EL9A 5FTWA 3SG0A 1N3LA 3TLCA 4IJWA 4M38A 1P9WA 4OQDA 2C4HA 3F46A 2PX5A 2HI0A 2YJZA 1XCLA 2O07A 3E22A 4TTJA 4NBKA 4UZFA 5FHRA 5KJ6A 4GC9A 3R44A 1V37A 3K5WA 3MBOA 4RF3A 3C15C 4GPEA 4QX6A 4AQDA 5CFZA 3DO8A 4OCZA 5IC6A 1JIJA 4E5VA 4X6YA 3MPUA 2FY8A 3IV9A 1WB4A 2H4YA 4LXQA 3KVNA 1UKAA 4I1IA 2R6GA 1TM1E 5C80A 3P2JA 4GPZA 3SC3A 1ITZA 4CM9D 1KQGA 3RC8A 1CR2A 2HMVA 4LYHA 3MOGA 2OHJA 3P0FA 1F5SA 2I62A 1VLLA 2PS0A 4YALA 4CQMA 2OMKA 3K8YA 3H83A 1FJXA 1DEHA 5A02A 4ND5A 1TA0A 3PNKA 1J42A 4NICA 2YIJA 5FTNA 4N54A 1JSXA 1WMSA 1PJLA 3UOAB 4D8XA 4EO4A 1SZDA 3KR1A 3LD9A 4URFA 2R0QC 5EWMA 1I4TD 3TLMA 1SQ6A 2Z5VA 1LF5A 2B4KA 1UPUA 4JBGA 2B4QA 4CEIA 5AK5A 2AR0A 4ZCLA 4RV5A 4JV5B 4LPSA 1CB7A 4ENRA 1L5RA 5KVSA 3L0SA 4LF4B 1P1BA 5K0EA 4MO9A 3OUZA 4I9UA 2LRHA 1RYYA 1W35A 4UMDA 3AOEA 1QPGA 4AZ0A 3R7SA 4OHYA 1DAGA 2GEBA 3Q0EA 1THZA 3BWVA 1Y1PA 2HX1A 2AOVA 5FUYA 3N2GB 5DNEA 5E1DA 4NOJA 3RFXA 3W5VA 3E15A 3FSGD 4LJLA 4DV7B 1JLMA 1RI1A 2ORWA 4GBJA 4HQFA 1S9HA 1MJGM 2TMKA 3BXPA 1W5FA 1FYDA 3OHMA 3BL5A 4BP8A 4PU0A 2HQSA 2YN0A 1ZJYA 1M76A 4MQMA 1Z9BA 1G3IA 1UXHA 4P3PA 3UATA 4YYEA 2ZYHA 4UHHA 4F71A 4KO3S 5DXJA 2WAMA 2WJHA 5CU7A 5THQA 5BSWA 1FNCA 5JQGA 1GGNA 1Y8QB 4LISA 3K70D 1I1NA 2W7TA 1LKZA 1NF8A 4N9WA 1XQYA 1OIXA 2IYOA 2HSGA 3O73A 3U62A 2O2DA 3LT2A 3DM9B 1PZGA 1OT3A 2GK7A 3HM2A 1KJIA 3LVRE 3MK31 2H1SA 3VOBA 2ZTSA 1UK8A 3AH8A 1NLUA 4JP8A 2AMVA 1Z0JA 4POAA 2GWHA 1ISJA 1AGPA 2H59A 5F76A 2DFLA 3RARA 1C30A 2XNSA 3ANNA 2QTAA 4C43A 4HBZA 3BFKA 1YZHA 2YICA 4OLHA 3DV0B 4XJTA 4NFHA 4CF3A 4O25A 1EUDA 5TLSA 1L4KA 1KRWA 5J2TB 4LHEA 4KDCA 2DB3A 1NXTA 1SUDA 3V32A 2GN6A 4KE8A 4H0FA 3GLRA 3N70A 3TD6A 1YIAA 2XCUA 4JEIA 4JOQA 4X84A 3QLUA 4EHHA 3D2LA 4KAAA 4WY2A 2C5FA 3JQDA 1B4DA 3V8QA 4DANA 4Z7OB 4JI7B 3WIBA 1UXGA 1KEVA 1NN1A 1EXDA 1OI4A 1JECA 2BPOA 2DKNA 3JALB 3IR5A 3TSZA 2V6MA 2V7PA 3EUEA 2IYPA 3CSUA 4XYMA 4D9FA 4Z5XA 5IC5A 2BY4A 4P4SB 4WKCA 1TRKA 1GRQA 2PFGA 3X2FA 4YAWA 3QKRB 3AFNA 4F97A 3C43A 5GPBA 4DSTA 3E61A 1H0HA 4DWOA 2PT5A 3DT8A 1OXBB 5IPFA 4HXYA 1LI4A 1BEUB 1T2DA 3CNQS 1EGMB 3GZNB 3SX2A 3V3TA 4F12A 2ZSKA 1J25A 4B45A 3OZEA 3K09C 3MIZA 5DK4A 3WGZA 2VRBA 5AESA 1OUMA 3S27A 3EULA 2HCJB 3B1XA 3OT1A 1RVDA 4GUAA 2WDZA 1YL5A 3DO6A 3OZDA 3FCAA 2GH1A 3LX4A 3CLUC 4FE7A 1JHUA 1YC5A 2GXUA 4HYTA 5EKXA 1JFVA 2HGSA 3OWXA 3INGA 4KIGA 2HA7A 2XKJE 5F1YA 2GFHA 3N87A 5CAEB 2CKDA 3O4JA 3T1OA 3W6UA 4GMXA 5HDQA 3SWWA 1XJ0A 2E87A 3EZ9A 4Y3UA 3DE7X 5C1IA 1FFAA 1G3UA 4HO1X 1QHHB 1QKJA 3C3PA 3QLVC 4RSMA 4FYHA 2LVBA 1BN6A 3UG6A 2PX0A 2PUGA 1Y9AA 3VO1A 2LGJA 4J7XA 3C3KA 3CLKA 2YN4A 3GLIA 1Z0IA 5AM0A 3A8TA 3LA8A 3WMFA 1VMEA 4KR9A 4EPYA 2OBMA 3PDHA 4LHXA 3T7EA 1VE3A 4HNUA 3GRAA 2BBOA 4D9MA 1QPBA 3SBEA 3T5GA 1H4SA 1PK9A 2ZYVX 2UZ1B 3B9RA 5H68A 4LXGA 3AJ9A 4GMFA 5JR3A 2I80A 1N3IA 3BL6A 2RHLA 1ZLXA 4JBWA 3SHOA 2AVDA 3CPHA 4B4KA 3NTVA 4N5LA 2WHPA 2BGLA 2EFYA 2XQGA 3IKJA 1YZNA 3NOOA 3U4AA 1G5HA 3C97A 3IHWA 3OQ1A 2I1QA 4QICA 4ZO9A 4EITA 1CF2O 4JB2A 2BH9A 1IIRA 2BKEA 4CM9A 3ROKA 3GZ4A 221PA 4C4SA 3EEBA 3GLGA 1UBMS 1MQ8B 3IGFA 5L3VA 4EVRA 5B7GA 5KSWB 4Q66C 3K8OE 4IWYA 1DKUA 1RLUA 1S89A 1G2IA 1U3CA 1P9OA 4H1WA 2PMBA 1XD9A 3L0ZA 3W8NA 5AHWA 4QTZA 5F5LA 5THXA 3VHXB 5KQMA 3SVTA 1OH7A 3B6EA 4EX6A 1KBQA 1T5LA 4E07A 1PLJA 5AI5A 3E9MA 2G82A 3C41J 2E48A 1RE0A 3A4IA 1EJ0A 3FAKA 2HBQA 5LLTA 1SRRA 4M21A 3D4OA 4LXYA 2LIPA 2Z58A 3KQSA 4G1CA 4ZCPA 3F5SA 3WL4A 2B69A 2G1JA 5AIBA 1SXJC 1I24A 1MC5A 1W4LA 2PYDA 3JATB 3ZY2A 2GCEA 3NAQA 1FSFA 2B7LA 1XTSA 1Q6ZA 1LLCA 4GD3Q 4BFZA 2PMCA 1B1CA 1FC0A 4P4LA 3T5CA 1JFFA 1BGVA 1XNGA 1OFGA 1JDVA 4X8HA 4A2WA 5ITZA 2OORA 1JG2A 3C3AA 4UVHA 5K2OA 2L69A 3FTQA 2D1YA 2WTNA 4N0EA 4KPFC 1WSAA 5DSTA 4EATA 4K9MA 1GR1A 1WXEA 3EWNA 1JDNA 4WZAA 3SKYA 3LGAA 3L6OO 5T3UA 3HKBB 4B3XA 3H8JA 4ZYXA 3MLEA 1MJNA 2ONZA 3JQ8A 1V0JA 3PNLA 4XWGA 3BEDA 4FBMA 4AKGA 1IPEA 1M6VA 2VWGA 1Z74A 2N42A 3BD6A 3VKHA 8ADHA 1KYVA 5AW6A 1R37A 4YACA 3DHYA 3HL0A 2Y6VA 1J7KA 3GCDA 4D96A 2OGWA 2SBTA 3RHFA 1RJDA 4M22A 1T9ZA 2WOJA 4CDNA 2LWIA 3G5MA 4ED9A 2I33A 4FIZA 4D4KA 2WAYA 4LSZA 5BYBA 4KR2A 3DSRA 2WP0A 3U0BA 2VH1A 3DT9A 4YR7A 1NRIA 1UJ2A 3KWJA 3ZHTA 1OIWA 1XSEA 1QP0A 1G98A 4D8WA 3B70A 4ATNA 3TO5A 1SA0B 2ZIVB 3ZIUA 4ZZ0A 4FKBA 2JS7A 2RI1A 4PLGA 3UICA 3GVIA 2NGRA 5AI9A 4J49A 2W2XA 4HH3C 5P21A 2HWWA 3NTUA 2K7FA 1AXEA 1S02A 2B7BA 2CCGA 2NVWA 4G8CA 1QE3A 2C2BA 4AN1A 1P3DA 2BCEA 1UINA 1AB5A 4UAUA 1G0NA 1T5BA 2OM2A 4B6OA 3ISJA 1Q1GA 1I6MA 5GGXA 2C7RA 4GMHA 4QTTB 1HE8B 4QBHA 4AP5A 1SUEA 2JIZD 5DLDA 4PN3A 3T1HB 2LCIA 3ZD9A 1KNQA 2A88A 3CYFA 5EJEA 5IWCA 2JZNA 2VAXA 4FWIB 1O94C 2J0SA 3ZWBA 3HDGA 1ZH0A 4DR7B 4BFSA 1EUYA 1IBKB 4XB1A 1ID1A 3PA6A 3GX1A 3ZGNA 1OLOA 2PEYA 4PCLA 1NMYA 3DDCA 3UC9A 4CMAA 1PJ2A 3CCCA 3CRW1 3Q7TA 4XM2A 5FBLB 4IG9A 2IPLA 1IN7A 2EU8A 2VCYA 4EKGA 5J59A 5EE5B 2UDPA 5IMBA 1N3YA 3DFIA 2WIFA 5ES4B 5KSZA 4JI4B 1B43A 1MRNA 3MRSA 2O7QA 2KI5A 2V0NA 2Z04A 3D9QX 3O9ZA 1RLJA 4WV3A 3VC2A 4BCCA 1XRJA 4CKCA 2XUQA 4L78A 2ZJ2A 1L1QA 1E79A 2PS1A 3NNNA 3SF0A 1KJZA 2IUSA 3OFVA 2H18A 5JCOA 2J7PD 3E8MA 4WOKA 2P77A 1CD5A 3IXLA 2VF7A 1Z37A 3RSQA 2AX3A 3I83A 3OZ7A 4AJHA 5EJ4A 5HHTA 1XJWA 2CKMA 4RIGA 1V8DA 1WR8A 2HRQA 2B37A 2Q0XA 3FX2A 4BEBA 4MWSA 4UBKA 3KJFA 2B21A 4PVDA 5ED4A 1RXYA 1B8VA 1SD5A 4MMYB 2ATVA 1Z5OA 2OV4A 4JR0A 3AKYA 5JVDA 1AQJA 3WB0A 5HK9A 2G6BA 2FPWA 1DKPA 4G8DA 1GITA 3ZTYA 2ZYIA 1ZCZA 3IMGA 1UFQA 4M9ZA 4RM3A 3D7NA 3UMJA 3F3MA 1Y6QA 3PFIA 1QBGA 2OAGA 4NE9A 2FMTA 3AR7A 7AT1A 2G9NA 2CXPA 5FWYB 1DLJA 3HN6A 4HQKA 2WNHA 3T9EA 3VI4B 4UW9A 3TTYA 5G0SA 2QD3A 2WLTA 1NXSA 5TQJA 1PT5A 1AGRA 3P20A 1CETA 3E9NA 1G2PA 4G24A 2H17A 4FOOA 5ALHA 1L8LA 2DTDA 1CIVA 3G0OA 3OH8A 1FP2A 3FLMA 4ND4A 3F9IA 4MGHA 2DEUA 4GL2A 5I8PA 4KAXA 3WL7A 3LVBA 3IEKA 3OCUA 1UOQA 4WAUA 2FJPA 2AJDA 1T4CA 1D5WA 3GJ8A 1IUPA 1U6KA 4IDFA 4KGDA 4TOIA 3GIWA 5FPTA 5A05A 4OQZA 3TUZC 4ID9A 4PYRA 3W4KA 2DP4E 3KSBC 3NG1A 4IIYA 2HJRA 4LZWA 2BM1A 5KYXA 4DV0B 4H1HA 4PLCA 4CNQA 3I64A 5DB4A 1XWWA 2F9MA 4AF6A 4BMCA 1M2VA 1FTGA 5FO1A 4CIVA 3NCHA 1KYTA 3LPDA 4DWJA 3KVRA 1UWLA 4Q16A 4UBLA 1T4BA 1ZM9A 1W4CA 3D3EA 5E2AA 3UA3A 1JJAA 1OLSB 1GYQA 1Z5VA 2ZWOA 3OX1A 1J8FA 3REOA 2HSZA 1NI4B 4MKXA 4YXFA 1OXXK 1NVDA 3IPYA 1C7FA 3DYBA 3KQKA 1NW8A 2CFRA 1XP5A 3S7TA 5CITA 5LKAA 5T67A 4FM9A 3K70B 2PH1A 1L5ZA 4BMPB 1U3GA 2EX0A 1GOTA 2HPAA 7YASA 1CQIB 3VSAA 3AW9A 1AUQA 1W88B 3LLUA 3WE7A 2AMYA 3SZMA 4Q3KA 3A36A 2QDKA 4BQRA 2DM6A 2ZUDA 3CUWA 4GR9A 3AIOA 5HDBB 5BSKA 2UVPA 1U8UA 3H3FA 4KE9A 4IXWA 3M6VA 4R2KA 5LQSA 2OILA 5AW0A 1N78A 4QVKA 1HFEL 5AJXA 2XMBA 1M2OA 2X0RA 4K46A 3RK0A 3GQBA 3WFJA 1T5TA 3CNEA 3K9CA 1C29B 4BX8A 4TT8A 1H2FA 1N6OA 4D74A 1CQXA 3I4FA 5EXXA 2C2XA 1X38A 4F1KA 5C1PA 5DM1A 5AQEA 1PG0A 3M4ZA 4Z4QA 1T5HX 2QYSA 4ZCQA 1P7VA 5LJLA 2X0JA 3F6BX 2WMYA 3JR7A 4UASA 4AXXA 4MGIR 4YO7A 1OH8A 1UT6A 1A50B 5IBQA 5KSOA 2Z4TA 2PLFA 3K5HA 4IZOA 1TM7E 4DV4B 3DHNA 4Y7CA 3AR8A 4AI6A 3WYGA 1Z2EA 1DV1A 2OECA 2R8RA 3H19A 5HS6A 1WKBA 3GDWA 4S0XA 4EHDA 1WDWB 4P4TA 3NP9A 2F90A 2UVDA 4M9UA 5ALUA 3GP8A 1J7JA 2B1JA 2PFSA 3F8TA 4YLEA 1P39A 5M3BA 2VXOA 4LYGA 1XTQA 1X2EA 2WJ3A 5BYJA 5BWNA 4YJDA 3DA8A 4IH1A 4K5QA 1KP2A 5KQSA 2QF7A 2YWHA 5ALDA 3NUGA 4JJEA 4Q7LA 3T1VA 2RDMA 3RUIA 2PE5A 1EK5A 4JFRA 4TV9B 4QGHA 1AS0A 1ENPA 1QXSA 3GFRA 4IZ6A 4P34A 1ZRHA 1DAEA 4R1OA 3EGWA 1B14A 2IYAA 3DBOB 3DFUA 3DVLA 3KJQA 1NVXQ 4KWTA 1Q0LA 2QT0A 4IMPA 5DT9A 4IMIB 1E6EA 1MO5A 1WM1A 4W7SA 4YASA 2Y1OA 2O1WA 4ARUA 3JY6A 1NR1A 3JTMA 3NGMA 1RM0A 5CLIA 4KBYA 4EB3A 3KUCA 3UH0A 5ITSA 5LQRA 5M5BA 3ND5A 3E9EA 3I5AA 5FWNA 1UPFA 1SCIA 2OZLB 3WBJA 1DUSA 4W6ZA 4BX9A 1CRWG 2Q5LA 1BHJA 3PFKA 4ZYUA 1DJQA 2C4KA 2O14A 3BE5A 3VR2A 3H2KA 2Z8ZA 1BRTA 1RXEA 2FI1A 1HQDA 2GA9A 2O59A 3GVCA 3WGNA 1M34E 3LL4A 5HKOA 2O3UA 1J4AA 3Q2KA 3H4TA 4N5IX 1G7SA 2HO5A 1JKIA 1A8PA 2Q7OE 5L53A 2WKPA 1H2WA 3G9ZA 4JC4A 5EJGA 3TAXA 3CN7A 3ROZA 1GUAA 2CMGA 3BKWA 2WTAA 4K6KA 4RQUA 3HA5A 4AKHA 3AF2A 5CTJA 5FX2A 3SYTA 2I6XA 1AUXA 2WLSA 1TM3E 1IN6A 2RH8A 1HYHA 2VXCA 3BB3A 1YUNA 1CK4A 2P78A 4GOLD 2H1FA 4IPTA 4I3GA 4LOIA 3MINA 1DJNA 3G8AA 4URZR 4GX2A 1K6JA 1E0JA 1H1DA 1K63A 2NV2B 3I2FA 3DE2X 1YB5A 2IU6A 3BF8A 4L3OA 4UZEA 3OIWA 4OP1A 1F1BA 1IZ7A 1V9SA 4Z9FA 5AVKA 1B16A 2ACVA 3HMQA 4FLFA 1B6SA 4WXEA 5E6RA 5FPYA 2F55A 3L4EA 2BLLA 3PHLA 2HBRA 5I8WA 4L8YA 1QRDA 1GSOA 1E6CA 3R23A 4NFSA 3O9VA 2EBWA 5TF0A 4X8LA 1V1RB 2FX5A 4AMBA 1EB9A 4LHZA 2BKLA 4MRMB 2XW6A 1XDWA 1Y8RB 3FMIA 5CW2A 5AKGA 1OPRA 1U4SA 1Z0AA 3HBFA 2C31A 3JQBC 2FXIA 4AS2A 1RYHA 4DIUA 3A3PA 4R84A 4Z0NA 1KQFA 3RS3A 3OLVA 5ENVA 2V5AA 3AEKB 1ODIA 5DW3A 3GGDA 3KPYA 4MB0A 4BB5A 1RTTA 3H99A 1GRRA 4FR0A 4WJKB 4ZD6A 1WMEA 2VRWA 3GJ3A 3MWJA 4JLKA 5EVJA 1GRVA 3ACBA 3BIFA 3EZ7A 2E5WA 2FSVA 3OPNA 1L8OA 1Z6GA 2FW7A 2NU6B 2XI4A 1TYEB 2WV7A 1VA5A 2BF4A 1GQSA 5BV0A 1ECCA 1XEWY 4QUKA 4M6WA 3M82A 2WFMA 5KYUB 4DHEA 1Z47A 2XXAB 3QNUA 3M9WA 2B5WA 2FK7A 5B1EA 2OBYA 3KFXA 2RONA 1XZAA 3ZE9A 4U2GA 5BWBA 2HQ1A 4MKGA 2EEZA 1NXQA 4BO3A 3BMCB 3R4CA 2VUTA 4YAKA 1BCRB 2CXTA 1RXWA 3ONEA 3GG9A 5AXAA 2C57A 4PZAA 4HG2A 3U7HB 2H48A 1PQYA 4R6XA 3UAZA 1L6IA 3V1MA 4G1BA 4XIFA 2HSJA 4B3IA 5KWJA 1HFWA 2MMCA 3MLAA 1ADBA 3QU2A 5FTMA 3ZW7A 3IQWA 2WDPA 3LO8A 4KIWA 5B1DA 5K4AA 3ZKAA 3ZLJA 1K7CA 4GO1A 2JI7A 1Z4MA 5GOTA 2VBFA 4HB2A 1P33A 2O3JA 2AEMA 3WJAA 1QFSA 3TZQA 5IBPA 3VYSB 3L0PA 3LHKA 1N5JA 1ZC4A 3BGVA 3L6EA 1AZTA 4KOEC 2FNAA 3LBIA 3FSEA 3W3AA 3X1YA 3PJEA 3AYXB 4QGFA 1ZM4A 2CXSA 3ZY4A 4YV0A 4GM4A 2NVBA 2ZUTA 3SBOA 5EQDA 1KR5A 1KI2A 1U3WA 2PKXA 1XXHB 2VHEA 3LHIA 3V2IA 1WUTA 5CCBA 3IBCA 3VR5A 5AVWA 3LQ2A 3VH3A 1O97D 4J1QA 2HWUA 4EY7A 4WOJA 1D8TA 3VHRA 1Y4DE 1X14A 2IPXA 3AOEC 4DJ5X 4DS3A 1ST2A 1ATZA 2ZBGA 4GS5A 1IOZA 1CY6A 2GZHA 4MI9A 1W34A 2FR8A 1E6WA 4B4OA 3V1UA 3FPJA 5DN9A 5LNK1 1MH1A 3F74A 3RC7A 5HMMA 3UT5B 1B3RA 3I61A 1WP9A 2YVKA 5MN4A 4DV5B 1M2FA 1F2VA 3HFRA 5M2QA 3LVQE 1RADA 3W9SA 3PR1A 2DPXA 5A6VA 4DPKA 4BQPA 4DNFA 1ELOA 2QVLA 4Q9LA 4IGIA 4MJ3A 5JXJA 4FWTA 4TQGA 2I76A 2VYQA 3N2NA 4PXSA 1O8CA 4RK6A 3U09A 1FDTA 4PO1A 3L1JA 5DM2A 4IV8A 1SM4A 4BXOA 4KI0A 7ADHA 2R5NA 2J07A 2XKBA 3L07A 3SN6A 4MP8A 4DCMA 4J0DA 1BXGB 3OCJA 4CL8A 4CT0A 1ZGGA 2OCBA 4GNKA 2NU7B 4N01A 1BX0A 2BMDA 3VR4H 4AX8A 1G0OA 1BG6A 1ZFNA 4TMFA 5KNCH 1KBOA 1Y8CA 1P6UA 2AWNA 1H5QA 1ONSA 4Q4JB 1QLJA 4FSXA 4QPJC 3SY8A 9GPBA 4JBNA 2HA2A 4BX0A 4XQ9A 4RJKA 1E3MA 1GL9B 4KL8S 2Y2VA 3RCBA 1XALA 4KQFA 5BVHA 1B8PA 3I4LA 3R20A 1R6VA 2BELA 2C5LA 2YDXA 4BUZA 1X7XA 1SMKA 4N8EA 2UZAA 1VBKA 3EEFA 2FJUA 2X40A 4K9KA 1CFZA 2LTAA 4FK8A 4NZPA 1CUAA 2QRVB 4X3PA 5LZ5A 3TZKA 5C8ZA 4FR2A 1QZZA 2XKKA 3G7NA 5A5VA 4UE3S 4UHEA 3CRRA 4FYIA 3OCCA 4XUEA 4PQEA 2G7MC 4DADA 3LUBA 1FTQA 2GPJA 5EKTA 6LDHA 2GCGA 2BIFA 2X8JA 4KV9A 2WMDA 1NKTA 4UDXX 5A0FA 3ZYCA 1IDN1 4GBMA 3M5DA 3WYDA 1QAMA 4JQOA 1DRUA 4P80A 1TYAE 3BZWA 3JVDA 5CB4A 3A1SA 5L7WA 4WKOA 4Z51A 2LDXA 3T4XA 3HO1A 4KIFA 4D46A 1MCZA 4F8EA 1RQLA 1A7KA 1Y4UA 2I65A 2V6FA 3PWKA 1GNQA 2JLVA 3HDVA 3MB5A 1J8DA 4U2BA 1P1HA 5DT2A 3P9ZA 3LIPA 1I4EB 2V45A 1MGOA 4Q9AA 2ZVDA 4ROSA 1SXQA 3A2MA 3QYFA 1EFUA 4WBXC 4AF8A 3EGXB 1RCTE 4X6XA 5HF9A 4NMWA 1U2TA 2PJZA 1VL1A 3OA2A 2QKYA 4UHCA 5ESWA 2FAXA 1WXFA 1ADFA 3R7WA 4D02A 4EP1A 5C31A 5FBRB 2HEIA 4IEEA 1NXPA 4ZGGA 3M1IA 4G4SP 1NW6A 1COZA 5LUAA 2O57A 4MRVA 5COQA 4IIDA 1GPKA 2OXFA 4JCCA 1E5DA 1JHZA 2PWBA 1JHXA 5I3CA 4BBPA 1LPPA 3H5AA 5MF6A 1PZFA 4RK4A 5IUNC 2BGGA 2RGGA 4GQIA 4LTNA 1EGAA 4CT5A 2ET6A 3RAPR 3QZUA 3NLLA 5EMLA 1J22A 2WVAA 1A9XB 1G8HA 3UO8B 2IHVA 1EAYA 3OF3A 3DE6X 4YVFA 2DC1A 1WQ4A 3DLAA 3VFDA 5JZSA 2G63A 1E32A 4NU5A 4TL9A 5KYWA 1XPJA 4EY4A 1G20B 3ON5A 1F9AA 1WE2A 1A4RA 5ALKA 3HNPA 2CD9A 4HQOA 2JLZA 1YMUA 2YUIA 1T4DA 3HUUA 4Q1DA 2ZDHA 1L5LA 3ND7A 3DQZA 1QH0A 2ZIUB 3O95A 5L6MB 2XQVA 4JYZA 3OKCA 5CDTA 2OFXA 4FR5A 3I9JA 1CR1A 4GKVA 5LNK6 1RPAA 3SSOA 3IOYA 4I1PA 2BFEB 1DUVG 2DRIA 3V55A 2EG9A 2WT9A 2JFOA 4F7WA 1I5EA 3O8OA 2OT3B 3K1JA 1O6GA 3BXFA 2Y1KA 3RM3A 4BNTA 1LI7A 4IDBA 4IQ0A 5ALEA 2CXRA 2E85A 2R7MA 1SY7A 2CC2A 2ZTUA 1YRAA 3QQPA 3MS2A 4YMTA 4WMLA 5A4KA 4LHVA 1XMVA 2G08A 4QZVA 1K5DA 3DHVA 4XTCS 3UPDA 1ZL2A 1CR6A 1MXFA 3M2PA 2IZ6A 1ZZEA 1K68A 3TSYA 3U13A 4R8VA 5KIAA 1VE1A 1X3LA 4JSRA 3RIGA 5ARBA 1XEXB 1M8PA 1WXHA 3CNHA 5ILGA 2HSDA 3G2LA 3BUSA 2C58A 1NJ6A 3D0KA 4IGAA 4WA8A 4ER7A 2ACWA 1RWMA 5MGNA 4Q4CA 5HW0A 4M37A 4HOYA 4QSHA 4HMPA 2YCLA 1IZ8A 4M2LA 3BRWA 3VC7A 1LY1A 4BE7B 4ZQFA 1DKLA 2PSSA 1RAEA 3IP8A 1CXZA 3OICA 4ID3A 5EZ5A 3WNDA 3KYDA 3OOWA 2O0MA 3KQWA 3U1VA 1CZHA 2MWMA 1WCIA 2NXNA 4J7UA 4KUGA 1RWXA 1WP4A 1L5FA 1NMZA 3H75A 4FCVA 2RGXA 1XTKA 4PRKA 1LDGA 1P5FA 2AK2A 5AXDA 5TY0A 4E5SA 4LSGA 4BHTA 3ANXA 1GPAA 1WLSA 3NWEA 4H15A 1Q0UA 2XNJA 4L8WB 3T5MA 3QKSA 1TU3A 5A9TA 1KJWA 2YVAA 2PSDA 4QG7A 1DRKA 2BCJQ 3VOAA 1BXRA 2L19A 3G3EA 4LYAA 4II7A 2IX9A 1BD4A 3LTEA 5EIEA 4LAFA 2Q3JA 4CHGA 2ZROA 3AI3A 4ZK2A 1J5EB 2IW1A 2ZRMA 4QGSA 3NVMB 1I51A 3OLXA 1RPZA 3EB9A 4NZYA 4O0MA 2ZBRA 3D6VA 1DCTA 2QD1A 1LLDA 1PTKA 4G5GA 3BWDD 4JJKA 4MQEB 3NDRA 3P9IA 2NP7A 1PQ4A 3FPCA 1CJUC 1YB7A 4KMRA 2RK4A 2YZ7A 2YTZA 1J21A 5KAPA 1FDVA 2KQUA 3NR2A 1HTWA 2XJ4A 1B8OA 4PHGA 3V7NA 4DA6A 1JAYA 1KVRA 2D00A 4I3HA 1XVUA 2M32A 1QVVA 3INRA 3NTRA 2HK6A 1J9ZA 4Y6RA 1Q14A 2H4HA 1B73A 3ZZNA 4NYIQ 3GUVA 1FW6A 4RHYA 5JLAA 2C4NA 3QY0A 2YDYA 3DWGA 1XX6A 5LDHA 3KPVA 3SMVA 4PHTA 3AVVA 3OQIA 4OPMA 4D5GA 2J0UB 3WV5A 1C41A 4CTMA 3P71T 3CUTA 2ZSUA 1Z8FA 3FWHA 5KNDD 2JFPA 4DQUA 4BNNA 4X5OA 2I7CA 4QD3A 5TEVA 1EBUA 1IZ0A 3MNFA 4BWFB 2XUPA 5FJIA 2PG3A 2Q21A 2UZ0A 2DQZA 4BO4A 3H4IA 2R3SA 1Z6PA 3A7DA 3U3JA 2I1VB 1LLFA 4ZVQA 3S2GA 3ZBUA 1KC3A 4D57A 1IC6A 3DJYA 3HBNA 1IY1A 4MW9A 3DTVD 3B1WA 1FIUA 4R1LA 2PNFA 1ILWA 4AROA 3L4JA 2J48A 4JVMA 4AJ2A 3PHGA 4MUIA 2DTXA 1R4ZA 1LTHR 4HN9A 2FEPA 2VJYA 5C18A 3I2GA 4UE6A 1QORA 3FKSD 3D6AA 3E4DA 2LUOA 1EK6A 1EZ4A 2AN5A 3BN3A 3AUFA 1OBHA 2JKZA 4OHRA 5DYGA 5F1OA 3DEAA 3ZV4A 4JI3B 1YZYA 1VIDA 5EVCA 2P67A 4QAQA 1UKZA 3LWDA 2VJDA 5EIHA 1R8YA 1QGUB 2I4RA 2Q5CA 2X6RA 4FMCF 5LQJA 1X8JA 2Y3IA 2FWBA 2CJPA 1NY5A 4Y9DA 4JB8A 3ZXUB 1ZMRA 5K3FB 1IUNA 4LZNA 3ZGZA 4HGQA 3M4NA 3T5DA 5F35A 1WD5A 4BAUA 2OBBA 1M5UA 2UUPA 4NABA 4GP9A 3U37A 1SOWA 1P4HA 4P2GA 4DMMA 4OHCA 2X5KO 3JWJA 4US0R 5C8YF 3P45A 3U7GA 4CLRA 1NQUA 2W00A 5DCWA 4OOFA 1QQTA 2XZDA 3LLCA 3H13A 2AOTA 3F98A 3PEWA 1WHSA 3CCBA 2AZDA 1WAMA 2IXAA 4LMBA 3K1AA 3ONDA 5I9SA 2YXNA 3HG7A 1IM5A 5A4IS 2UU9B 2CHUA 4KU4A 3IA2A 1YSCA 2J9ZB 4UCFA 4MA5A 2DVMA 1AKNA 1HPLA 1ZMTA 3ABSB 5LQUA 3AKCA 4AP9A 2HWYA 4DN6A 3KR2A 1LWNA 2V6JA 3C5HA 2AOXA 2X14A 3CBQA 4TV8B 2AFHE 1U7OA 4IIVA 4MCHA 4ITRC 4W99A 5FJJA 4C4OA 5L45A 3CXRA 3EPKA 2ATCA 1FUEA 2PD4A 4KRXA 4OBEA 4D82A 3RU7A 4BNVA 3ITNA 1R0KA 4AMYA 4C08A 4X41A 1E1KA 4WGGA 1KXJA 4GKAA 3BWEA 1U8EA 1X7YB 4J03A 2ZXFA 3FNHA 2JDID 5DI3A 2PYIA 1Y9ZA 3CF4G 1RCUA 1DIGA 4K9QA 1WZCA 3FBTA 3EZLA 3E1GA 4XYGA 2CFTA 4U3JA 2WQZA 3MAAC 1IN4A 5E1OA 4R8KA 3RTBA 1SVOA 3I8SA 1E20A 4LDRA 1JIIA 5F5NA 1UQUA 1Q2XA 3OI7A 4FZ3A 5SZIA 3VUEA 5H7XA 3DHWC 1LPBB 1EDDA 2D59A 1C3EA 2D1FA 2I71A 1RYZA 2C98A 2IPNA 4OHPA 3W05A 4BUJA 2G7ZA 2P79A 2WQ6A 1PJQA 1ZIDA 2P6PA 4YCCA 2IYFA 3R6TA 2W6ZA 2BEKA 3N3AC 3I6QA 3U4HA 4CLEA 5K01A 4YUAA 4JXJA 1A27A 1C2YA 2P2ZA 5MDHA 3K71B 1Y7LA 4FSHA 2QYOA 4PBRA 3OP4A 3ACCA 4UD2A 3OQNA 1OQAA 1PSWA 5I7EA 1ZAKA 2APJA 2D5CA 3KOXA 2EZ4A 5IXJA 4KPGA 4RKEA 1AGYA 1S1MA 1KMHB 1NUPA 2XYVA 3DFMA 2A67A 3HNOA 1O3YA 1HDRA 1XRMA 3ZY6A 3IKMB 4EQ6A 1UAYA 4X24A 2Q50A 3DMDA 2ANBA 4NRDA 2W5UA 4MUJA 4CDRA 1AUOA 3BBPA 4Y2RA 4KAFA 2CV1A 3COVA 2OCKA 1YBFA 3DAYA 4JA2A 3R7LA 1UIRA 4YAUA 3CNOA 4AUEA 1FPMA 4M7RA 2GBLA 3IUEA 4BTLA 1VKJA 1X7HA 2M1ZA 1RD4A 1WMFA 3GD7A 1DAIA 3NOQA 4ZQGA 4G4JA 2XTJA 2X5XA 5AXCA 4R81A 4B4DA 4ZT6A 421PA 4KLNA 5LOVF 4Y2SA 1RI5A 1X7WB 3ZWYA 2YV3A 2F8LA 2JHAA 4QQNA 4QXRA 1D09A 4DJAA 4LYJA 1QG4A 3LH5A 4UDNA 3D5TA 2P9FA 4UNSA 2LKCA 3S2EA 3RO7A 3IAAA 3QYAA 3GHYA 4ESEA 5IZ4A 5IK2D 3AESB 3X1WA 1GDTA 3H1EA 1HEYA 2X23A 4B75A 6AT1A 2R6DA 3KQNA 3PUWA 3PX3A 4JUCA 2NUTA 3P9NA 2FRDA 1H2ZA 2H9IA 3CZPA 3RYFB 2XZOA 3U44B 4RJ2A 1YIDA 3K0HA 4FLMA 3TSWA 4FYVA 5K0BA 3PF9A 2GUGA 3PQ7A 2JAUA 3UHOA 1MENA 1ECJA 4BKMA 4FNGA 1YKSA 4HEJA 2WJVA 2R1VA 2C29D 4D3DA 1MQAA 1LPOA 1Q7TA 3H2BA 4JJAA 1E3SA 2KWIA 1TC1A 4L28A 2X9LA 5EWLB 2IYXA 2PX3A 3EC7A 3OPYI 2LBPA 5A03A 2YWRA 3U4MA 5U9CA 2PIDA 1DMRA 1DWQA 4QM7A 2C9OA 2NO6A 5T8KA 1EBBA 1RC0A 2WW8A 3AFHA 3M4XA 1OGIA 4L07A 3P5BA 4A8JB 4DV2B 2MCFA 4FFNA 3HMKA 2EJVA 1UM9B 2BM9A 2DPGA 2JH8A 4MUXA 4P58A 5AW4A 4KSBA 3SVZA 1K1EA 5IFKA 4OQNA 4EJ2A 1GTMA 1XXHE 2B34A 3E5RA 1W581 3H5LA 4HQNA 3SNKA 3TGPA 3WLLA 4F72A 1XNJA 3ZWAA 2NM0A 4MR9B 1QMGA 4BO8A 4DCTA 1FMLA 5C5DA 1XMJA 2IIBA 2X76A 5GY7A 4PLHA 3SQMA 4PZDA 4O8CA 1ISPA 1XLUA 2QYHA 5DM60 4JZYA 4CKEA 2O23A 1BQ4A 4EA7A 5B55A 4KQMA 4O3MA 3ZK8A 3O74A 1R66A 1IRXA 3BSFA 1W25A 3L79A 4JHLA 1N2GA 5EY5B 2CVZA 1MIHA 4BVLA 4H1TA 1YRHA 2XE6A 2OE2A 1BROA 3PKIA 4GRIA 1VG1A 2CV0A 1PJAA 1IRIA 1EVJA 2Z8YM 4OH7A 3B3GA 4QXPA 2ZYTX 3IURA 4O5AA 3VPGA 2YC2C 2B35A 2XYRA 3UK1A 5KYKA 1BO6A 4BJ3A 4G63A 2FQXA 4FBGA 4JNCA 1DQNA 1YCDA 4BRUA 3FFXA 1TT5B 2BL4A 4X71A 1EX1A 2FP4B 3EC2A 4PICA 5TS2A 3RVDA 3ZU6A 1PSZA 1X6VA 1U5BB 1Y5IA 1RABA 3USCS 1K9VF 1Q57A 4ARZB 1ZD2P 4D3FA 1NW5A 3NBUA 1JFRA 5KYYA 1K8XB 1Y6GA 2LDBA 4EZBA 1E1LA 1OTHA 2ERYA 3G9QA 1R27A 4ZI2A 1N5IA 1PR0A 2CLFB 4UNQA 4Z99A 3V46A 1U8TA 4P7GA 4PO9A 1HZZA 1IOWA 4II3A 1N6NA 3B6KA 4TTTS 2PUVA 1Z68A 2C4UA 2QORA 3D7KA 2C88A 3C1OA 4KGVA 4BECA 3W8RA 2HYIC 3O3OB 4YMLA 4BVKA 2FP3A 2NTJA 1SWVA 3ZDBA 1M1YE 1FLDA 1DCFA 3H7IA 4FOTA 4DMHA 3H5RA 2IYSA 1MB9A 1GSIA 4E6EA 1XEFA 5K20A 1S2LA 4TYWA 3VHQA 4KXXA 1GRCA 1XTRA 2Q7XA 3KJXA 3PFHA 2BSQA 1QF7A 5AJTA 4TZ0A 2VDWA 1CUSA 3A3NA 3P9QA 4Y6SA 1OROA 3RUEA 2PZJA 3GCXA 4PANA 3NHZA 2O5EA 4KXNA 1A9QA 2B36A 2OD7A 3A6FA 3JCZA 2HU5A 9ATCA 3A4TA 1BFUA 4YH1A 5SZKB 1HDCA 2C20A 2PVCA 1O95A 3OFNA 3UAGA 1XZDA 4C6TB 3O7WA 2IHBA 1EDZA 1YVDA 2WK1A 1ESNA 3FFBA 3KZ1E 4QBGB 4GVPA 2KJQA 3K5IA 4MI1A 3NHRA 3EMDA 4GSKA 3QVGB 1R0RE 1XMPA 2EATA 3OZUA 4P7BA 1IQPA 4W5HA 3CPEA 3L8MA 4LRYA 4BUCA 1SFRA 1UMDB 2FZ4A 1W73A 4DLKA 1KIFA 2I6TA 2PMWB 5LIPA 2OZEA 2WG1A 2Y67A 2WSLA 4B0PA 2WA1A 4LEIA 2YKGA 4WK0B 5D5HA 3ZVKA 3BHNA 4QELA 1J0BA 1HDGO 1QGAA 2P5YA 3MWGA 5J58A 2BGRA 5JALA 3V8MA 2N3ZA 3V1TC 4EHAA 1LBEA 1MDFA 4Q3AA 4BLPA 2YHIA 1CVLA 1EZ1A 5DSXA 1R4MA 3KZCA 2AX4A 3A0RB 3CRQA 4V24A 1TM5E 5E7IA 3PEUA 2I3BA 4D41A 1P8AA 1W30A 1Y4ZA 5BOSA 3GLGB 5H02A 1DRJA 1M6WA 4A91A 2NW6A 2QMEA 3TK1A 1BXZA 1KH2A 2BI8A 4KI7A 4DA4A 2JRLA 1SUAA 2PRIA 3DEFA 3TXAA 2FR8C 2P4UA 4ZVSA 3I5YA 1JHMA 4TLAA 5D01A 3ZIAA 5TT1A 1MFZA 4NX2A 4KQXA 3DTVB 3EZNA 1J2YA 3KQOA 4F93B 3ADCA 3JD0A 3PGMA 4I6GA 3LCUA 1CQJA 1FXWF 3DM5A 4N39A 4U2DA 2YFKA 1QG2A 1KMCA 3O93A 3UXYA 1WHTA 3NB0A 1M0SA 2OENG 1DC4A 4L9RA 4R1NA 5DYTA 3PR3A 3R5KA 4HH4A 3OEHD 4RLSA 1RHKA 2BTOA 1T1SA 4LXIA 2ZUWA 2ORED 3ZNOA 3TNLA 2P9BA 2D1SA 2Q49A 4KZKA 1Y7IA 4HB4A 1U6JA 5BT9A 1ZXBA 4NAUA 1GZ3A 5A9SA 3N0RA 1H05A 1Y1LA 1V7CA 1L7DA 3GT7A 3HA3A 4MWEA 5CXQA 2H9YA 2R4TA 2IV3A 4Q7QA 5CX1A 3ZEIA 4GGMX 3N8KA 4C0SA 1F48A 3LYUA 2WKRA 3IJ5A 4HWPA 1JE0A 5CDFA 2RJ3A 3ZI7A 3ZWKA 3KJNA 1UC8A 5F1KA 5KMGB 3NALA 4DJTA 2EIXA 3BJIC 4DARA 3DLTA 4H17A 4I55A 4P38A 5BN5A 5KCMA 2B5VA 3INTA 1K2WA 3FGZA 3AYZB 1UMBA 4LDPA 3G2KA 3FNGA 1ZNYA 4INZA 5JQWA 1MNAA 1L8XA 2CXXA 3IVMA 5GM1A 1UF9A 2WFLB 4RS3A 1SUWA 1OBOA 2ZRBA 1MVLA 1NMSA 1COWA 2NSLA 1KMQA 2P6MA 3S2UA 2R85A 2IEDA 3F97A 3FOWA 4WDQA 4OHZA 5B36A 1BFKA 5K4GA 3WMEA 5G1PA 3B20A 3IUBA 1OXUA 1D2CA 1NUUA 3EEQA 4RD1A 5EJ7A 1P6QA 3PDWA 4MYRA 2EJTA 2Q4DA 3AR6A 3PQ3A 5GIPE 2BMFA 2XMSA 4FCTA 4IOMA 1G16A 3K35A 4K8OA 5SZHB 3SQOA 3STVA 3D54D 5AJYA 3TM5A 3LG2A 1VYTA 4DUZB 1L4UA 1TJ3A 2IY8A 2MYNA 3DCJA 1EGHA 1YOVA 4XCVA 4DT1B 6ABPA 1W36D 2ZRCA 3L93A 4OXKA 4FMCB 1VI2A 4IJVA 2ZPUA 1ZR4A 5KOJA 4NV3A 4OI1A 1M2NA 1CY1A 5T4FA 4EI2A 2ZWPA 2GA8A 4G1UC 3EDMA 3VR4A 5CDSA 3A32A 5JANA 2P9YA 3ES9A 3FNRA 5KNCA 2NSYA 2V7TA 3WKCA 1PWYE 4UVDA 3HC7A 3CH7A 1MB4A 1QUEA 2O2XA 2J5XA 4URWR 4WXYB 4BLRA 4D7AA 3UCXA 1L5QA 2R8YA 3QELB 5B3JA 4EG6A 2FDXA 4HDKB 4DNOA 2JLCA 2W2LA 2ORVA 4RABA 4MO2A 5LQDA 1X1EA 2YJ4A 3WL6A 4GKKB 2GN8A 2W6JD 4KJXA 5D00A 3R8CA 2UXDB 2HF8A 3QWIA 3STXA 3Q85A 2WMOB 4DCUA 5JROA 1Y9DA 5IKXA 3D3WA 3NHLA 4OX9B 2BEVA 5K3AA 4RS4A 3UUWA 3STTA 3FLAA 1YUMA 4BNXA 4HAUA 2X9GA 1O57A 1R4NA 3P96A 2VKTA 1KHTA 2YASA 4ENQA 2F62A 3QEKA 1WPRA 4FGUA 2HNAA 3NHKA 3OM1A 3WLAA 4G8JA 3IMCA 3K6RA 2Y4NA 4KDRA 4O4JA 2X9VA 1FTYA 1M34A 3LO5A 1E2DA 4DMKA 5JXGA 3N7UA 5BW5A 2ECFA 2R7LA 2V8BA 4YRNA 2QM3A 5CVEA 5CJJA 1Q0QA 3IDAA 1NXOA 1P2UA 3OX4A 3FDJA 5DHUA 3U1BA 13PKA 4R9NA 4B74A 1CWUA 3R24A 4M8LA 3OIUA 3T9CA 5H4HA 2IITA 3AERB 2FF5A 3FVWA 4KWEA 4NYJR 3BXHA 1DAFA 2VSQA 4LOHA 3SC2B 3IIEA 2GM9A 3K0AA 1Z83A 3QXCA 1NVGA 4O4LF 5DF1A 5DTRA 3FY4A 4R1UA 1OWLA 1WCXA 1MAAA 1Y3HA 3FUXA 2EYUA 3EW7A 4G1EB 3GNLA 4QDUA 4UCWA 3TYXA 3R2JA 4F1JA 1X8KA 2G9VA 4LQDA 3SQLA 1KJJA 2RGEA 3CNBA 4DR3B 3LCRA 4NU8X 1GTRA 3HB9A 1LNSA 4CKZA 2FQYA 3SZOA 2DBQA 2G06A 3PC8A 4ZARA 3EXEB 1BVYF 4CL0A 2OWDA 3D3JA 5BYKA 4GP6A 3DVQX 3OPQA 3EG5A 1L3IA 3AR3A 3LIIA 4EYKA 4K87A 3IT3A 5L3ZA 4CGZA 4Q4AB 3BMXA 2PKRA 3ADPA 1E92A 4UTZA 1UBHS 1US8A 3TQHA 1RSZA 3KM0A 1C1DA 2FMFA 2BZ0A 3LWBA 2JL1A 1GPUA 4I1VA 1A5SB 1D2HA 1NLYA 5LOVB 3E18A 4H60A 1KTVA 4ETIA 4PR3A 2YY5A 3RS0A 3ROTA 1YQWA 4A7PA 4C2TA 3FCSB 2FZWA 3A14A 2RB4A 1CQWA 3DPSA 3BFPA 3QWBA 5T4EA 4MW1A 3ER6A 5DFAA 3T8YA 3TQTA 4RD2A 3COZA 1H65A 3CXUA 1NR7A 4NG5A 3CNNA 3IB3A 1VLZA 4FGLA 2PH7A 3T3OA 4ECEA 1JBQA 5ESXA 4ZJPA 1GO2A 4RZHA 4F5DA 2XB4A 4R2WA 1BQ3A 3NRCA 4UNPA 4UUBA 3RVNA 3ZDRA 4MHSA 5BYAA 1NBMD 1HG0A 1IQRA 2HLDA 1E9EA 2WNIA 3O3NB 5B2ZA 4V38A 3ET5A 1WIWA 1PNOA 3D2AA 3IRUA 4O2BA 4PAWA 3UJDA 2FWAA 1PL7A 3IT2A 5CDGA 2YIVX 3NGLA 2VSNA 1FQKA 2I7XA 1E1QA 4J8PA 1FNMA 3VGJA 1Q91A 3WL3A 4BKPA 4F45A 4NDNE 5EEGA 1DQRA 4XH9B 4OB7A 5LBTA 1UEJA 5B6JA 5GMOA 1EP2B 3N0WA 2ZBEA 3CX8A 3HDYA 4R16A 2BFNA 3LDHA 4M88A 4U9UA 5IAGA 2M6KA 4C0KA 1R5JA 3SSMA 1HSOA 5E7JA 3TI7A 1G3QA 2AOUB 3AKZA 1A4XA 2BF7A 1HT3A 4KQ9A 1JT2A 2ES4A 3KXKA 4RLHA 1OYYA 4TMXA 1EIZA 1ORDA 4BNZA 2DAPA 2GZAA 3GDFA 2JI4A 3K30A 1SHLA 2B20A 1OMOA 2PLAA 2ZJ4A 1M2HA 1O94D 2ZOSA 3JQ7B 3GD5A 4ZMRA 5LU8A 5K3EA 1TCBA 2IZ5A 1QGDA 3G82C 3IV7A 1TKAA 2DFVA 4D43A 5K8TA 5CVVA 1P6XA 3ZW8A 3IAS6 5AI4A 3LQKA 3DMPA 4NE2A 1QHNA 4LZPA 4GH5A 3GMDA 4N7RA 1K9SA 4YREA 4E33A 4INPA 1DMSA 2BDUA 3BSYA 3CUVA 3LBFA 2YHSA 3DGFC 4QOEA 4TTIA 2WIJA 4XPIB 4IGFA 1DKNA 2MR6A 3KCNA 3OJ0A 3G0DA 4KRGA 5C4GB 2BTQB 3FE2A 2VZ9A 4EF4A 1OLUA 2RI0A 4XVQA 2D2FA 3C7CB 1NAHA 1H1LA 1SBYA 1WQ1R 4R9SA 4EG5A 4RHFA 5TPZA 2GM3A 8AT1A 5J63A 3H42B 1FLVA 2RH4A 4W63A 2PO5A 1OA0A 1XTIA 4QL3A 5EJFA 2O8BB 4ZT4A 2CFSA 2CYCA 4I2VA 3WLPA 3EPLA 2PR2A 4D9BA 4U2FA 4CCAA 4UD6A 5M04A 3E53A 1BWSA 2ADMA 2V58A 1PWXA 2OQ2A 3CRMA 1GG8A 4UNNA 1H2AS 5B1IA 1P18A 2IUUA 4I99A 1SU6A 4DBLE 2ZM6B 4ZT5A 3EUFA 2BFDA 2JFUA 4U1RA 1F9EA 4Y2PA 5L3QA 1K6EA 3PKZA 1Z5GA 3K0FA 3PXAA 4TYNA 1GA4A 3QWHA 3FYUC 1RPTA 2DFNA 3RVJA 1QIEA 3N7AA 2ZYSA 1VSQA 3PIDA 2F43A 1YK0A 4RPKA 5AOVA 5FL3A 3JVUA 4Y2UA 3FRJA 1MJ5A 2BGJA 1E6MA 3L8YA 1V11A 4WINA 4BNYA 1XVTA 4ZOLA 3RJZA 4LBZA 1J2RA 3KD2A 1EEXB 3ND8A 1EHCA 1AZSC 1PJ3A 2AJLI 3ILVA 5ALLA 2ZCJA 3PUZA 4RESA 1QAOA 3UK7A 5LQKA 4DR1B 1MO4A 1DE0A 3WQSB 3F3SA 1KAOA 5DVZA 4IIHA 1D2MA 1XT6A 3ROGA 2D2XA 3RIXA 3LT4A 3RUAA 1PYGA 5I7AA 4B31A 5BSEA 3EZ2A 5ESDA 1ZUIA 4P54A 2W8BA 3HP1A 2IPAB 3B38A 4DM4A 2YXPX 4YT8A 2IH2A 2Y0PA 1SCDA 4GXRA 1RU3A 2PEZA 2OTCA 1V8PA 4DCVA 3QWAA 3U31A 4JQSA 2JFYA 4KQJA 1CUDA 1YU9A 3TW8A 2OBFA 1E66A 3WK8A 1JDZA 1SKUA 2H7CA 2F4VB 3HBAA 1VE7A 2H31A 3NOVA 5IF9A 1E7WA 4HUJA 1U7WA 5HE8A 3JQAA 5IEJA 1PNTA 2IVFA 4OHVA 4UVGA 4QATA 3ROFA 4Q03A 1AMNA 1CU1A 3O4VA 4ZAVA 1T6BY 2A9KA 2W48A 5FBVB 4Y1EA 4Z8XA 1KGSA 1QVAA 2H5EA 1DKOA 3A58B 3QV1A 2V9PA 3OX2A 3TNYA 1UZNA 1C80A 4E7PA 2IH5A 4MUKA 3VR6D 3FUCA 2HF9A 4TUYA 4RHXA 1QH1A 3FOCA 3OKAA 1G6KA 4AKTA 1SHZA 1FLNA 2AYXA 4LJ6A 4WLEA 3L02A 4G0YA 1N9KA 4HUQB 3C3EA 1KI8A 4N49A 4Y2TA 2WYHA 4ASUA 1AGNA 3BD9A 1IXRC 2ZRHA 3RKSA 5EUCA 1KI6A 5CIQA 4BQQA 2YXDA 1NVVR 5DM0A 4Z9YA 2ERXA 3DULA 3DE0X 4XEUA 1RLMA 4FJ2A 4RGYA 4XA8A 2BDTA 4DJDC 1SBQA 3LPAA 2K2WA 2J5QA 4LRSB 5LDGA 4K9NA 5TQ2A 1OAKA 3RH0A 5FUBA 1OFHA 4NBVA 3UTDA 1U7ZA 2FZLA 3LY7A 3PRHA 5KAMA 5AW7A 4RO0A 2V3VA 4G0WA 3BHIA 5B64A 5JMOA 1E2EA 3E3LA 4UOZA 4ZI7A 1E3WB 3AEUA 3HHPA 4YRCA 1YNOA 2I9KA 4C0XA 2N47A 1Q22A 3UA4A 1LJ8A 1C7EA 1E58A 3L92A 2G1AA 4AZ3B 3K1YA 1W36B 3NVAA 3UBTA 3P2MA 1XZHA 3PQ6A 4JS0A 1VYVA 3WDKA 5K0SA 3KPJA 3U7RA 4QOHA 2OBLA 4I46A 4P0PB 4G5QA 4FFSA 4D6YA 2JCBA 3IXMA 3IMKA 4PNZA 1IY0A 2BEJA 2X6QA 4NJEA 3ZX5A 1BE0A 1OGJA 1DV2A 5TQ0A 4RV9A 5DWDA 2AS0A 3LMKA 3PDJA 2O7NA 1FFXB 4GFDA 5JADA 3MMSA 4F4IA 2CMKA 1MRZA 4KV7A 4U8GA 2EBHX 3LOQA 3VU3A 5DLYA 3E8SA 2WMNB 4GOKA 1E6UA 3Q6MA 4Q47A 4YT4A 4LDNA 4M9CA 3ORQA 1A8UA 1L5WA 2QJFA 4R9UC 5NULA 3CS3A 4L9SA 1YFLA 3GRCA 1JL3A 2FUG1 4R2LA 1CY7A 4DMRA 3DZ8A 3D3QA 3WLMA 3MLBA 3K9FC 5H80A 3THSA 4KW7A 3D59A 4W9NC 3EVEA 2JGJA 3RAJA 3GRZA 3EXIA 1FFCA 3K15A 3SQNA 4ER6A 2DY1A 2FETA 1SO8A 3G0BA 4BRSA 5BUZA 3OLWA 2C4TA 1V3VA 3A4NA 3ZXSA 4JLUA 4XVRA 5AW1A 1E9SA 4HS9A 4KLRA 2QGFA 4S05A 2YR0A 1TZCA 1JDUA 1YZVA 1Z7EA 1XQXA 2TSYB 4L95C 2QE6A 1U8AA 3S2FA 1NNSA 2ODBA 2Z56A 2ZI6A 3DF7A 1I01A 3VSEA 2AEJA 3B6JA 1N8SA 2J08A 3A6DA 4XB6B 1N9GB 5A06A 3IAM1 3TIFA 5LMZA 4B6PA 2E1RA 4H4DA 5IAOA 1W93A 2V7WA 4TMVA 2GJKA 4DWVA 1LW7A 1QFYA 3NONA 2RGRA 4MVYA 4CIWA 2ZIAA 3G8YA 3I1IA 4FJ0A 1U5AA 5LKRA 1LRKA 4YJFB 4V1CA 4Y1GA 2B3TA 3H5WA 3IELA 4OXIA 1V4NA 4C7JA 4DVJA 4UFPA 2GAFA 1IBCA 3OLZA 2PUDA 2GYWA 4OXQA 2PX8A 2VYVD 3TFQA 2DKOA 1IEVA 3GLFB 1NW3A 4YGXB 1NPTO 2IOFK 2Q3EA 4U7HA 1ZVVA 2BFFB 5AJVB 5IKOA 2EYQA 2ZIGA 1TOAA 3DG9A 3R3VA 1JDBC 4FYKA 4JA0A 1T3HA 3O31A 1NWHA 1Z4NA 1AKMA 3BF7A 2ZB2A 1PR4A 1ZESA 5JC1A 2GAAA 2HC9A 3EBLA 5D85A 1UEIA 4QWMA 3L8ZA 1HZJA 1U0TA 3LY5A 3ZHSA 4LFCB 1IOVA 1VXRA 2O1XA 3C8MA 4KQ6A 4YPFA 5JBNA 2IS4A 3F5DA 4E4TA 2PWPA 4KYIB 2F48A 5C1DA 1EGVB 2RGAA 1YU6A 3KDSE 1YJQA 4E2ZA 2P5TB 3BDAA 3GN1A 2GF0A 1U0EA 4MIOA 5C0OE 5JFOA 2X9NA 2Y6UA 4QUJA 2MSWA 5DWQA 2K2QB 3A9SA 3KTDA 4UOQA 2FZEA 1WZ2A 4DLLA 1TFUA 4EG1A 3BPSA 3PEFA 4DR4B 4E31A 1OU4A 1W4AA 2AKAB 3RAGA 2NN3C 2EDCA 3OTHA 4R2JA 4US1R 3SU8A 2FMHA 4JX9A 4ZAGA 2Q28A 3KQUA 1CZOA 3KV1A 3T35A 3TX6A 1N34B 3RUCA 5A5EA 4EUHA 3N5KA 3DXYA 1OD6A 1M1XB 1P80A 2NUPB 3NHFA 5EZ6B 4E5UA 4F3RA 1O95C 4K9LA 5B7PA 1OZ0A 1FVHA 4HTAA 1EB8A 4D25A 3MERA 1W47A 1OXTA 4A23A 4UXJA 1RPNA 1XU7A 1GTZA 2XCQA 3H9CA 2ZQ5A 1YE8A 2J5BA 5JQGF 3KZVA 2HSEA 1OILA 1O77A 2IHTA 3I6ZA 4HMQA 2QK4A 3GMIA 4O4LB 4FNMA 3S6JA 4PEVA 3SF8A 4A0SA 2GWRA 4YV1A 2Y2UA 4G0ZA 4XX1A 1ZMXA 4RK7A 3OQHA 5IASA 4CQMD 1ZOOA 1W5TA 1TO1E 4MI6A 5IUKC 3I01A 1ZU5A 2GCPA 4GECA 4X63A 3VDMA 3A11A 2GHIA 1HDEA 3ILSA 4YEDA 1G64A 2VNHA 1THMA 5JXIA 1J9GA 1IZZA 2RGWA 3NBZC 1D07A 4A27A 1U63A 3DOOA 1SB9A 2EFDB 2GF9A 5JG7A 3ZE7A 1UT8A 3AY7A 4GT1A 4RX1A 1WMDA 4HNQA 1DT5A 4XSHA 4AJLA 2IHKA 4W5JA 2V6IA 2WEKA 3K9NA 5CLHA 3NBMA 1ESEA 1HT1E 2YZMA 3WLIA 1IG3A 5C5EA 1JU9A 1NW7A 4HX5A 4JKYA 2AFHA 3M1LA 1FTWA 3OY2A 4C5BA 3DOJA 3R4VA 1WWKA 1WSDA 1QDUA 2EKPA 3DBHB 4RDHA 4HRVA 1A1VA 3W7AA 1G5RA 3PQ8A 4PR0A 4R9RA 2DUMA 2PZAA 4RORA 4BNFA 2ODTX 3IAXA 1U80A 4L0MA 3O8CA 1YZ3A 7ABPA 5REQB 1W9MA 5ICFA 4KAJA 4Q39A 3DMTA 1MV8A 4JJ6A 1RYMA 4BV2A 2J3QA 1Z6YA 1HYGA 4WBNA 2I4IA 1ZJ6A 4PLVA 1U3VA 2AK3A 1T6XA 3WYCA 3DAFA 2IE0A 4H6WA 1Q6YA 3AP2A 5CW1A 5DV9A 4EYQA 2W2VA 4MGKR 2EXXA 4MKHA 3AM5A 3LRXA 1SNYA 3SEZA 1WEHA 3CZ4A 1P1CA 3UJAA 4FEAA 1ZK4A 2BCGY 5IEBA 3ND9A 2A94A 2I2CA 4FW8A 3OUUA 4OJNA 2BMJA 4PQYA 4XIIA 3U3XA 1J1ZA 1ZIYA 1D2GA 2QYTA 2VP0A 3KJHA 5K2MA 1E2LA 3E3OA 1JPNA 2FHPA 2NT3A 3CGWA 3MS4A 1EDBA 2J87A 3OQBA 2X0FA 1AKVA 2JBAB 5E9JA 3UB4A 4Z3KA 4CEHA 3ECSA 4JMPA 3DQPA 2WJ4A 2JIMA 1CS0B 1E2JA 4MR7A 4K0KB 1I3CA 4AUKA 4ARBA 2X1MA 1V47A 4E7OA 3V8NA 1ZICA 1U0SY 2WU4A 3R41A 2IC5A 4M0PA 5LD2C 1YD7A 1IB0A 5JV5A 2RHMA 5A7FA 1ZBQA 4IEIA 4UHJA 3KJIA 4PWZA 1CY2A 3QJYA 4TYYA 2QRZA 3C8HA 4EEKA 2W43A 4I9FA 1ZVMA 4KK3A 4QTUB 2BP7A 5BR8B 1J5PA 1I30A 3W2IA 5T6BA 5I01A 1PFQA 1JWLA 2NUAA 1TTPB 4AURA 4RZIA 1RZRA 4HTFA 3HI6A 5CT8A 4IV0A 5C4IA 4MS4B 5FYQA 1FX0B 3WLFA 1HLGA 3LGXA 3KT6A 3ZCVA 3SZLA 2YZ2A 5JAHA 2PRYA 1PT6A 3KDPA 3VYUB 2JFGA 5F23A 1JDTA 3FI0A 2R8ZA 5JJ5A 3MQFA 3KHTA 2ZI3A 1BW9A 1H23A 5BWCA 2QT9A 3H8VA 3INYA 3P8ZA 4LE1A 1REQA 3W1VA 3WYBA 4DUGD 1GAXA 2QXUA 3I01M 4TRJA 1BS2A 5B3JC 4U7GA 4YWHA 1D2NA 1C0IA 5I7UA 5L3SB 2H7VA 4MQFB 1EX9A 5FP0A 5AI0A 3FHCB 4L7VA 3L7YA 1FTNA 2G9UA 3V3KA 4E94A 2LCQA 4R3UC 1N57A 3CJRA 1KPHA 1XZQA 2ZITA 2REQB 3ESRA 4C4PA 2FA9A 2P3SA 1YASA 5FUXA 4I08A 1RQXA 1JHVA 1KKLA 3NPMA 4CLDA 1JT9A 3UYKA 4MQUA 2FG6C 3LBAA 4YJGA 4KQCA 1BN7A 1PJSA 4OU5A 2FZKA 1YR3A 2WD8A 4R0VA 4XYBA 2GEJA 3ZHVA 2GD0A 4KPUB 2BGKA 3D3NA 3ZU2A 4LBVA 2WYUA 3L0DA 4HDSA 2IHJA 1TKCA 4A4DA 4HLUA 3YASA 2D0IA 2DHEA 1DX4A 3AVPA 2VAMA 2XLCA 2ZJ5A 3QM1A 4GPTA 4K86A 2Z2YA 1U4NA 4UDOA 1GL3A 1J00A 3CWQA 4YK7A 2I91A 3FLEA 1T6ZA 2WSMA 2A5JA 2H2IA 3P9XA 2Q27A 3AL2A 4M1EA 2PZGA 1YFKA 2ZS8A 3A4YA 3OIYA 4G36A 1KZ1A 4AZSA 3VRHA 4PX2A 1OREA 2DBZA 1C8LA 1WUYA 3N2KA 4H2DA 3C8DA 2HQRA 1FF9A 1HO3A 4BC1A 2H1WA 3HVRA 4BO5A 3VU8A 1FCJA 1VLMA 5IVIA 3RRMA 4UM5A 3FDFA 1WX1A 2G0TA 1HY3A 2WUDA 3V6MA 5LZ4A 1L4MA 4XLLA 3TKLA 2NO4A 2ZSJA 1KKMA 3IUMA 1EFHA 1MW9X 2QR5A 4E1AA 2YNMA 3LC0A 2XKAA 3KVVA 2XGGA 4FN5A 1GPWB 2XT6A 1JAHA 1FMTA 3L1IA 2NP6A 1IZYA 3UPUA 3TZHA 3NDPA 3PNPA 4YHBA 4XGIA 4YJ2A 3GEDA 3CH6A 3RFVA 3FPKA 4HDMA 5BN1A 1A4UA 1AXRA 1E1MA 2EKQA 2GLUA 2RHBA 2Y93A 3GFBA 3P9SA 4D1YA 1W5BA 1SCUB 3Q0IA 4FNOA 5I7VA 2XQFA 4F3TA 3RVQA 4EUSA 2BUAA 3UFXB 2M6LA 1KOFA 2H65A 4RIHA 1RKQA 3N5CA 1FJ2A 1SG6A 2G5CA 2YJGA 2YQ4A 2P6UA 3IIKA 3M5WA 4RSRA 5AT1A 4DV6B 4MCIA 5CJPA 1WS6A 3NT5A 4CQLA 2PKYX 4RTOA 5BR4A 1T35A 1UDRA 3G5TA 1IQUA 1QNFA 1W87A 2X19A 2XDQA 2OHHA 3HO6A 2EZ9A 4J16A 3K0EA 1M1YA 1N6HA 1UKEA 3G17A 4F8JA 3FWPA 1PL8A 3DZCA 1T4MA 5IJZA 1L7XA 1AK1A 1DFGA 2QTVA 5JU6A 1EVKA 1V2HE 3GT0A 4JODA 4RU1A 1POWA 3WV4A 4TL7A 1XCBA 2FEXA 5EQFA 3WIEA 2I4MA 2JIOA 3EG9B 4DCSA 1ABFA 3PX2A 1PO7A 1A2OA 4LNUA 4RZSA 2IOHA 1VE5A 3CE9A 5EPOA 5T4BA 3L1HA 1GZ5A 4J76A 4KK4A 3LE8A 4Q00A 4LFAB 1W7AA 4TSKA 3M1AA 3R6GA 1RKXA 2KLBA 1W19A 1GAQA 4IHKA 4IOJA 5CNJA 3MWDB 4E12A 5JCJD 5JVDF 4OHOA 2V74B 1Z07A 4CCYA 2QIOA 3CIOA 4AY3A 3LV8A 1XZ8A 3KHUA 4MGEA 4RE5A 3UWPA 2JLWA 3EFHA 1UBLS 3C2QA 2WFAA 3KQVA 3MSXA 1DAPA 5HA5A 1QONA 2OFWA 4FKMA 2W4MA 4Y0VA 1STOA 3FHTA 1F06A 3OECA 3FYHA 1ORIA 3OIGA 4WNIA 1BZYA 2OKCA 2E1PA 2IOQA 2JD0A 4KR7A 1N5OX 1JW9B 1V8FA 2FGKA 3NWJA 4HQRA 4LJ5A 5FOWA 4B5KA 4W7HA 2XZPA 4NMHA 2HXSA 1NZJA 1UMKA 3JAMA 4LRWA 4QFCA 4KZPA 4G56A 1Z73A 1FYFA 1T3SA 4WIAA 4DIBA 4RZ2A 1Z2NX 2GHRA 3QFFA 2WIKA 1WXIA 1T1JA 2CHQA 4J2TA 5K8CA 1AUVA 2ZKLA 5BSUA 4BP1A 1Q20A 2OXIA 1A4IA 5EE3A 2VJNA 3S70A 3UXHA 1E79D 1O6BA 2BEUA 4C0QC 2QRJA 3KSRA 5FPSA 3M6XA 1F20A 1U11A 3KZOA 3SAJA 1RAHA 1Z2OX 3ICCA 3O2NA 4JMLA 2FDCA 2IT1A 4M0MA 1E9BA 4R8MA 5B57C 3E22B 1O0SA 1SRQA 2R6FA 3H17A 4BJ5A 3G68A 4UJ3A 3HV0A 5ECWA 4MS3A 1NBEA 2ZSEA 3TQFA 4F5WA 1J56A 1T0UA 1Y7HA 1ULBA 1W8IA 2ZJYA 4RZXA 3VTZA 2VTBA 1TQDA 3IB6A 4K9DA 4KR0A 4NBLA 1I2AA 4PE5B 4OY3A 3ZDCA 2PN1A 4Q6WA 1V3QE 2FWNA 4D6PA 1J2EA 1JSZA 4CQMB 2GN2A 4ML3A 2Q4RA 5E9WA 1USVA 2A7XA 4BNDA 1A04A 3ICVA 4RF2A 1DCKA 5H83A 4DR2B 4W5TA 1TYBE 4ZZ3A 5DHAA 4G0UA 5BSTA 5KYGA 2Q1UA 4PFKA 1KZHA 1ACMA 5EWMB 4IXDA 2IHUA 3HJUA 3KAPA 5IRCD 1H94A 5M29A 1CJTC 5FRDA 4CEIB 3KR0A 1I7NA 1XA0A 1UBSB 3K20A 5CGQB 1RJEA 4MVJH 1A5AB 2R00C 4TXJA 1JG1A 4DDHA 1S7GA 4HNHA 6REQA 5KB3A 2F1JA 3R9WA 5T41A 4MCAA 2PVSA 3PFNA 4BZPA 4AZ0B 5BW8A 3EBPA 3OLQA 3PI6A 4X54A 4JGBA 4TMWA 1XZBA 2QI9C 3NVDA 1K5HA 3NFYA 3UWKA 3HR8A 3PUJA 4GL4A 3Q41A 2JLRA 1IVSA 1SN7A 1P0IA 1RACA 1D4AA 2VPZA 5E0KB 4GMGA 1KGDA 4R1MA 4EGQA 4L5JA 1YB1A 1HL3A 4WE3A 5FLEX 2HF2A 1GU0A 3U81A 3WGVA 4EA6A 4FI3C 1UKVY 1NL3A 1ZUD1 3DZGA 2YRFA 3RS8A 1Q3TA 5JQGB 4M8KA 3O4HA 1KDZA 3PJGA 3VX4A 1SUIA 3AETA 1KKUA 5CXUA 1WMBA 5GZ6A 3VU1A 1NYRA 4IZIA 3TPZA 2WU8A 1O2DA 1NMXA 2H1CA 1V6AA 1FDOA 2Z2ZA 2ZQZA 4AN0A 3RS5A 5CVJA 3GLFE 1ST3A 2QLMA 3AGQA 2XOKA 1BCSA 3MAJA 3GJXC 5EE0A 4GOOD 4HYYA 3ZWCA 1DJMA 3ZH2A 2J3HA 1E5QA 1C30B 1XVLA 2G4CA 2V9CA 2BLNA 1NI3A 3AQ4A 5FQNA 4EL5A 2LW7A 2C9MA 5D3MA 1A69A 4HCJA 1BVUA 4RKRA 3VO9A 2WWYA 1EUDB 3BREA 4HAWA 4TYQA 5AVXA 1FS4A 3QYPA 5AI8A 4BQNA 2AUMA 1SXJE 4O4IA 2C0CA 3K6SA 2F1KA 3KEMA 1LSJA 4HGZA 4BAZA 1I4DD 3TGLA 2O5VA 2P9EA 1GZUA 1OI2A 3CZQA 4U6SA 1ZEMA 2O2HA 4D0LB 4DG8A 4DL9A 1QWOA 1DIAA 1JGTA 1GZVA 2CVQA 2XUIA 4W1QA 4TKZA 4HVCA 4L74A 3IPRA 1ZUNA 3UJ8A 3ASZA 4DLBA 3DT6A 3E1KA 4PVCA 2B1IA 1J0EA 4YS6A 3S7ZA 4P0TA 4YRTA 5CPFA 6Q21A 3OURA 5ECYA 1TKRA 4AU1A 4EH1A 1NUHA 1M8JA 3H2JA 2RKOA 1TVCA 4B46A 2KB0A 3TR6A 3GT3A 2Z98A 3LUHA 1U2ZA 3LX6A 1ATIA 1VSVA 2DULA 1EXMA 2GUWA 3HFSA 3E48A 4OF4A 4CM1A 5C35A 4DCCA 1GCOA 5IJ9A 1KOLA 3VV2A 1ZN9A 5FPHA 1W0CA 1K6IA 3WP0A 1U2GA 4OK5A 1FUIA 1LBTA 1ULSA 3P0EA 4MV3A 4F9TA 5HM8A 3OT1B 1KI1A 2R751 3C0KA 5AKXA 3DAGA 5A3RA 3KSAC 1KXZA 3MT8A 2H1IA 3HRKA 3JQCA 1WBJB 4BO2A 5BSFA 3IQFA 4K6MA 1V16A 1IJEA 1JWBB 5JAZA 1T6NA 3L84A 4IYRA 3HP4A 2I4LA 3AONB 3D4LA 4MAFA 3G2IA 4S2UA 3VPAA 3OPYA 1E9CA 3DXFA 3W6PA 4B9AA 4QJ3A 1H3NA 3CF6R 3M34A 5AHKA 5HOEA 1NFRA 4DQVA 3EGOA 2Z3VA 3GLIB 2NZ8A 5KKAA 2JFBA 3KU4A 1VLJA 1FFDA 4NBRA 2ZS9A 4TLMB 2Q6TA 3K2EA 3VR2D 4D4IA 3KLBA 5B6PA 1IUKA 1SCBA 2HV9A 1JUDA 3F6EX 2DPMA 5K4HA 1RP1A 3OD5A 5CM8B 5BURA 2W71A 2DR3A 2ZRLA 3LA6A 3RIYA 3SDSA 4LC0A 3UQYS 2YXBA 1VP3A 2VA9A 1YFZA 3CX4A 3KQYA 4U8HA 4ZO7A 4GQAA 5LQNA 4RVHA 4UPEA 2PS9A 3DOUA 3WK5A 3ASVA 3DLPX 2GDZA 1RRPA 1PJ8A 2WHPB 3PHCA 2OBXA 2QAGA 2VDMB 3T94A 3ZGVA 2YMMA 4JVSB 1U7DA 1RYFA 3G59A 1NPYA 4LRXA 5D7BA 3DZDA 4NLLA 4ZQEA 2QL6A 1J9EA 2YH2A 4NZ9A 4OFBA 3N0VA 5ALPA 5FTKA 3WRWA 5C9ZA 2I67A 4MIEA 5JBQA 3LDUA 1WU8A 2CL7X 3FNFA 3K8ZA 1IN5A 3O8QA 3Q7PA 3F7NA 3E9CA 3UQZA 3DEHA 3QW4B 1E96A 3LNTA 5JMWA 4QODA 1JSLA 3K94A 2QQFA 3U19A 5DDIP 2HYDA 4PPGA 4ZVMA 1EVYA 1Q11A 2B8WA 1MORA 2FEWB 2LV8A 2AXPA 2QEQA 1JG4A 3AT1A 1HDYA 3IP7A 3L18A 5IBRA 5H3HA 1Q7CA 1VPEA <