2YXBA

Crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
RRRYKVLVAKMGLDGHDRGAKVVARALRDAGFEVVYTGLRQTPEQVAMAAVQEDVDVIGVSILNGAHLHLMKRLMAKLRELGADDIPVVLGGTIPIPDLEPLRSLGIREIFLPGTSLGEIIEKVRKLAEEKRMREEAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Coenzyme B12-dependent mutase
publication title Crystal structure of the methylmalonyl-CoA mutase alpha-subunit from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
total genus 39
structure length 139
sequence length 139
ec nomenclature ec 5.4.99.2: Methylmalonyl-CoA mutase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 2yxbA00
3IV9A 4HH1A 3BICA 1FMFA 3KP1A 1K98A 2YXBA 1K7YA 4HH0A 3KOZA 4REQB 3REQB 3KOWA 1CB7A 1XRSB 5REQB 2XIJA 4REQA 2XIQA 3KOXA 5REQA 3REQA 3IVAA 2I2XB 6REQB 4Q37A 1I9CA 3BULA 6REQA 3KOYA 1Y80A 4HH3C 4HEHA 1B1AA 7REQB 1E1CB 3EZXA 7REQA 1REQB 1E1CA 1BE1A 3WHPA 5C8DA 2REQB 1REQA 1CCWA 4JGIA 2REQA 4R3UC 1ID8A 1BMTA
chains in the Genus database with same CATH superfamily
4B6PA 4GBGA 4UBIA 3A36A 3AERB 5F12A 4KLAA 2ZUFA 1Q95A 5KU7A 2H7VA 2CL5A 1ZUD1 2XBUA 1H8EA 1IK4A 4IEEA 3MK31 4FGSA 3NH6A 4HZUA 4KOEC 4Z2AA 1KXJA 5CJ2A 4Z4EA 2OCGA 5HIAA 3LXUX 4IV0A 1MJHA 2EU8A 3QKRB 1V1RA 2QD5A 2ZTSA 1XJ0A 5F7ZA 3AEYA 1YZHA 1JH8A 3K09C 3WFJA 2H0RA 5HWSA 2YWRA 4DCJA 3JQ8B 4WFIA 2O8EB 3OSZA 3W7VA 4CT0A 1YRQA 1AS2A 1NW9B 4D4JA 4EI2A 4ZEOA 1YR2A 2ANCA 3MPUA 4G41A 4L6AA 5FWXB 1N2ZA 3E4DA 5DNVA 5ABPA 3N86A 1SXJB 4JQYA 3LLSA 5BXYA 2E4XA 2ZJ8A 3EHEA 1RLOA 4M6WB 4BNNA 2BEWB 1SVSA 2YQ5A 2QT1A 2VWGA 2IYUA 1X7XB 4F2HA 5ALRA 3L1VA 4NOJA 1GL6A 1J39A 4HMOA 3DE5X 2AG8A 3CF0A 3R4CA 5KYXA 2DVMA 1RYBA 4KAAA 4MWSA 4N8EA 4BQNA 5CVEA 1FFDA 5KUTA 1RRKA 3C43A 4DDMA 2FW8A 4MITA 1XCMA 3PUZA 2CFSA 1SC6A 2OL4A 3AHIA 1PSWA 2EVWX 4FK8A 4S04A 4YRQA 3VVMA 2J6HA 3FHTA 2R5NA 4RHXA 3T9AA 2WKWA 3SE0A 1E3WB 3RRXA 1WL8A 3N2YA 3TG8A 1J25A 4DSUA 1MFZA 2EKZA 3BS4A 1QIFA 4ZMRA 5G40A 1R4MB 3W7BA 5EIEA 5GZ1A 4A3SA 1N9KA 1ZUNB 4O8CA 1XQ1A 5AKJA 2RG7A 4LRTB 3T12A 3V1NA 5J2UA 1E1QD 4ZYXA 4MYCA 4WRRA 4LXUA 3SI7A 1V7PC 3HI6A 5BW4A 3K6SA 3AR3A 3R6TA 3H5VA 1HUQA 2AEFA 1A7AA 2LKDA 2R8YA 1XLTC 2QNBA 2VT3A 1HA3A 2X13A 3LC7O 4KJZA 4TXMA 4YGYA 1YJBA 4I99A 1IDN1 2HJHA 4TWBA 4E30A 1KYIA 1GNSA 5EMKA 1SIOA 1H5QA 3FVQA 2FUG6 1TT5B 4G0NA 3RSGA 3GDGA 1POWA 2VJYA 4ZO9A 3ZTTA 3F6SA 4CM4B 3S3TA 1ETUA 1CZLA 2N9UA 4KH0A 2C58A 1ZK0A 2CB9A 3A4MA 4M1OA 3SHTA 4CN8A 1KORA 3WLIA 1P9LA 5HE9A 1KR5A 3QEJA 1QR2A 3IJRA 4YJKA 4X97A 1PLJA 4H7IA 2DFVA 4HK4A 4I5GA 1H4QA 1VJCA 5JS1A 3GWGA 4JSTA 1L5KA 2EZ4A 2H5IA 4MRPA 1QG4A 3KKKA 2WSBA 1RCFA 1YQ9A 3ZK9A 1NVDA 2OORC 4B47A 5JZSA 1QIJA 1CF4A 2QI9F 4KWHA 3WWYA 1OYOA 1WNFA 2C88A 2IKQA 3EZ7A 2ZKIA 1OILA 1Z7YA 1REQB 2WUDA 2PT5A 3R5KA 2VTDA 3LUAA 3NWBA 2R5FA 5ALYA 3KK0A 4JKOA 3PXAA 4WADA 3DHNA 2A0WA 3MM4A 5JMWA 1WEHA 3B85A 3MIIA 4GC9A 1Q7CA 1VJ0A 3CV3A 4MCJA 4RLHA 4TXHA 4ALLA 2NWQA 821PA 2XYRA 1SKMA 1B0PA 3KQNA 4O4IF 2HAEA 3WGHA 3VH2A 4LSZA 3C7DB 1NZDA 1XRSB 3GGGA 3OZSA 3SN6A 4B75A 1V48A 1B8OA 3PDHA 4QTZA 4ZVVA 4CF3A 1FYXA 1KI4A 3LLCA 3QLUC 1R4NA 2BFWA 5G3YA 1BOFA 3ZBUA 3WGYA 4EFLA 1U5BA 2P0YA 4L8WB 2CNNA 1WUHS 3FPCA 1M75A 3KPWA 3LSYA 4MW6A 4P8RA 4MR8A 2IXDA 5HOQA 2IYVA 2PUJA 1XWWA 4J75A 1CZHA 2CLMB 1Z73A 1RAGA 2I54A 3TQRA 1BG6A 5E0KB 3S7TA 1I30A 4X3OA 3JZAA 1Z29A 3BK1A 5EGSA 3TW0A 1KHHA 3AY0A 2YW2A 3W05A 3ZWWA 5JWRA 3A1WA 4WV3A 2X1LA 1WG8A 1ISPA 3ZJUA 3I2JA 2GETA 2HIHA 1BRTA 1EDDA 1PU2A 1Q7EA 1N33B 2R4QA 1JLLA 4JU8A 5M2QA 2IS1A 5JVDB 3O75A 2WJJA 1E1DA 1XD8A 4QOIA 3GPLA 4BNLA 1NG9A 2OBLA 4U63A 1HE8B 4WT7A 2GHQA 3AJ8A 5KYYB 1KMQA 4I2NA 2FFRA 3D8TA 3H1PA 2XF8A 5CM8B 1CUVA 1J49A 3GRKA 4GOLD 4QFCA 2O07A 1SEVA 3KE8A 1Y6ZA 3LCVB 3NB0A 4R8MA 2JIRA 4BMSA 3NHKA 3VYSB 2ZYUX 2ZI7A 4KQHA 5B55A 5J58A 2H4XA 2WB2A 2ZJYA 3EXEB 4URHA 4FZRA 2RHDA 4HH4A 4KWTA 4E4YA 4I3HA 3UMRA 1CRZA 3ZWPA 1B15A 2X3FA 1C41A 2HDWA 3DQPA 4WLOA 2AUMA 1EGHA 4IZOA 1HLPA 3BE6A 3AEQB 4EX7A 2I4LA 1LXCA 4QUHA 1CZNA 1M6EX 3AFMA 4WZBB 3V4PB 5ESRA 3UJCA 3WGTA 3DNPA 3N0WA 3QUCA 2XMZA 1DXOA 5FUQA 3PPYA 4RTOA 2WJWA 5L95A 2W8ZA 4XYLA 4RH3A 5IXJA 2VOEA 4HDOB 2QLTA 2WFLB 2YRXA 2CNDA 3OMLA 4HZGA 3DTYA 1OREA 4J1TC 2PANA 3DV0A 5A1TA 3K92A 3LX5A 1CHNA 3FTEA 3LJKA 4E5VA 2QTFA 4M1TA 4FGZA 3ZCVA 1ONPA 1LBIA 4XWTA 4MW7A 5EWMB 3HL4A 4P4TA 1I0IA 2B61A 3INGA 3ZDXB 1IRXA 4W5NA 4JN6B 4PLYA 3R41A 4UPVA 4F86A 4AJLA 3SJCA 3HO8A 3N7UA 1ODCA 1SWVA 4MVYA 1A9QA 4LTMA 4WKCA 2W2LD 4JR1A 4XUCA 2P0AA 1F8YA 4LMRA 2HNAA 5HJ2A 3WFIA 4EJ6A 4JI5B 4ZZ0A 4C5CA 2RBEA 2QRGA 4WCFA 3DO5A 3QJYA 2CNWD 3PF9A 4BCBA 3R7AA 3KKEA 2EKLA 4A91A 1P4SA 5B7QA 1FFEA 1H4VB 1NDUA 1PDVA 1LV8A 1G21E 1YFZA 2C4KA 4I08A 3K0AB 1CNMA 4P4SA 2QTBA 2AUTA 3D6FA 3T99A 1VSVA 4I46A 4BQQA 4EIWA 3JZIA 3MWEA 1KZHA 1E6KA 2HUNA 5BNWA 5B1HA 5DMXA 4YMIA 1GL7A 1BCRA 4EX6A 1XP8A 1KNXA 4KQIA 5CM9C 1W0KD 1TKAA 3AR8A 3I9FA 2XTAA 3OOHA 4M38A 4ZAFA 3UWSA 3E7FA 1DO2A 4GHWA 3HSSA 1H2AS 4OGGA 4WKOA 2DM6A 2WBLC 2FP4A 4XIJA 4BE4A 4CDMA 1ENPA 2ZRCA 3GG2A 2Z56A 4RULA 3IEUA 3TKAA 4QC2A 5FNVB 1DT3A 4DNQA 2RH4A 4RVHA 5HSGA 4G37A 3VAAA 1TLLA 1X7YA 2XMPA 3EVZA 2Q99A 4EH1A 4RENA 1HDXA 3D2BA 2O5CA 5FBRB 1VPLA 3OIGA 3UA4A 1Q3TA 2C20A 3MT9A 3D5TA 1EFHA 3S2EA 3IEVA 3K5HA 2C7VA 2I4NA 4RKFA 5ICMA 2I6SA 4N3BA 4GMHA 3I12A 3G02A 4Z8XA 3TOCA 2QVBA 2E1RA 4MQFB 4YLGA 1EWVA 3NUZA 2O5RA 1CXZA 3R3SA 1ZMXA 2BBWA 3SFVA 1JFTA 4CODB 1JEOA 5U4XA 3SZMA 3FBGA 5J5VA 3OTHA 3MTEA 1ZJZA 4MVJE 1T4MA 4JP5A 3LRPA 2C9ZA 2XW6A 5CEJA 4B6RA 4QYIB 3R6LA 1GP2A 5EHNA 1SMKA 2Z8ZA 2I3ZA 2Y67A 2AFIA 1GXSB 2R65A 3LL7A 2F17A 3PQEA 4DA0A 5A5EA 3HJNA 2XRZA 3QTTA 3KT8A 4ZDKA 5EUQB 3I92A 2EARA 5IK2A 2V6IA 4EG3A 1Q1QA 1Z4LA 2VP2A 3NVDA 4D6XA 1MB4A 1M74A 4YPFA 3UJDA 3DTVA 3VDRA 4KU4A 4RHFA 4JROA 2NP6A 3D4BA 5B53A 5C8YA 1I36A 1P4AA 3GUCA 1CRWG 1V41E 3CEAA 4IJ5A 1ZDMA 3E3NA 5CNMA 3RU9A 5F1OA 4ARVA 4C0WA 5I9IA 1C1XB 5ALZA 3DOCA 3PNKA 1YJAA 1N7HA 4NCNA 3D8SA 2JK1A 3L0CA 4NMHA 2HBZA 1A50B 1OPXA 3CUWA 4HS9A 4KR9A 4J8PA 5ALSA 4EBBA 5A02A 5BURA 5DBIA 4L8YA 4IJ6A 5D01A 2B8TA 3WBBA 2YXDA 2IXTA 1I13A 1RQ2A 1TA9A 2JCVA 4CKZA 3QVGB 1HT3A 2JNWA 4BQFA 3WK4A 3DUFA 3ZV3A 1LBEA 3E2MA 2NTNA 3PD7A 4L76A 2DG2A 1RPNA 2OUIA 2P4QA 2V1XA 2MU1A 2XGMA 1HORA 2HIMA 2CL7X 2PL5A 5JCJA 3QNWA 4RYDA 2R6ZA 1OYVA 2Z2ZA 3U0VA 3T3NA 4O4HA 1RDFA 4IQ8A 3TZBA 2P3SA 4ON9A 3ZK7A 1L5SA 1RM5A 1TEXA 3Q3EA 4YCLA 2FXIA 1GPNA 1I1HA 4N01A 2XT9A 3CSSA 4XDZA 5TS2A 4H7KA 3RIGA 1R0YA 4R7TA 3OF3A 3IMCA 2P9FA 4ZU6X 2GZAA 4CUZA 1J6UA 1Y37A 3EVBA 3FTCA 5EERA 5IF9A 1K7FB 4YRCA 1J8MF 3I1IA 1PVVA 3R3WA 5AKLA 1BAPA 3CVWA 4EHIA 4QFDA 4F06A 2D62A 3JW8A 3RFFA 3OJXA 2F43A 1GA6A 1M2NA 1X38A 1EBUA 2B0JA 2PAFA 2B30A 4FBMA 4XCQA 3F3SA 2OD7A 4BNTA 4MV9A 4CDGA 4V1CB 1JGTA 1YQDA 2O0HA 1L8QA 2M6KA 1W94A 5FPKA 2JIZD 1FA9A 3QXSA 2AFRA 2BGLA 3FE2A 1ZPDA 3EXFB 1Z0SA 4LYHA 4UZEA 4YJ2B 1B0AA 5AO9A 3OC6A 3JSXA 3UF0A 1MAWA 2X6QA 4RTKA 4CIYA 1PFKA 4IKEA 1NXTA 3ZZ0A 4DPLA 1DINA 3OJFA 1NAIA 2ZUWA 4FCWA 2C2MA 3FFAA 3ZS8A 3ZVKA 1USUA 3IP1A 3NXSA 4KH1A 3ZD9A 2BGRA 2WSYB 3KHKA 4I4LA 2Q4RA 3WWZA 4HC4A 5M34A 3JR7A 2WEKA 1M2HA 1U98A 4A8JB 5AJHA 3IURA 5KYKA 1RLMA 1V2GA 4WXMA 2QGZA 2HFJA 4UTVA 2G1PA 3WIOA 1W6UA 5BRNA 4NZ9A 1HG0A 2YS7A 2IUEA 3IXLA 5AM5A 3KSMA 4XXHA 2CE7A 2W0MA 4HYTA 3OQHA 1G8SA 1W93A 3A32A 3OKAA 4AZ0B 1ZK4A 4KACA 2Y0BA 4K88A 3ZJVA 5AI4A 2B35A 1MU0A 1XQWA 1SIUA 5DHSA 3VYTB 4I3FA 4R9VA 3UANA 4ZT6A 4ZQCB 1E5TA 2VPIA 1P2DA 3MRVA 1ZW1A 3OBBA 4XAQA 1ISJA 3D6UA 6REQB 1Q0TA 4OL0A 3UEOA 5DX8A 5A6SB 1CY7A 3NOQA 4RTQA 2NAPA 4H0CA 2PH7A 5EJ8A 1IB6A 1ZK3A 2H2IA 4AIRA 1PGPA 4WK6A 4DQ0A 3EB9A 3SMQA 1Z4MA 1CY8A 3LBNA 1O2DA 3KTOA 5LOVB 2EYUA 2NXJA 1K06A 3EBOA 2BDEA 1M66A 3AKDA 3KKPA 1FMLA 3ZU2A 3LUKA 2W71A 1JKIA 2FWNA 2JJYA 2VFAA 2QV0A 3WWPA 1A9XB 2G4LA 2OHXA 2W6CX 1LBSA 3C1AA 1P9OA 1G3QA 1RC0A 4XB1A 4Y6OA 1KWGA 1H69A 3LDFA 3DDSA 5DF1A 4ZAVA 4DV7B 3UJBA 2BR4A 5G41A 3KT6A 4BO2A 3VO8A 4HQRA 4R1NA 2FGJA 1XZCA 4XGNA 3WXMA 4TLAA 1MA3A 1NMQA 4YJGA 2YYYA 1B26A 5D3QA 2CKDA 4GNRA 1OI3A 4MQEB 3TB6A 1TJ4A 2D5LA 2ODPA 3MMSA 4ZZ1A 4M83A 4ZCTA 2D13A 1B6SA 1JNXX 3ZLJA 4JV5B 1L5MA 1JAZA 1EFVA 2F90A 2FW6A 3C3XA 4G5OA 1ISHA 4XX0B 1AU9A 1UXHA 3CPHA 3V6LA 1UBNA 5EE9A 2EP8A 1TAGA 3I3SR 2NNLD 5J4LA 3NYWA 3F5QA 4R2IA 3EEIA 3HB5X 4WINA 5EUMA 3HBFA 3N6VA 4EA8A 3E6AA 2HJVA 5FL7A 1FDVA 1YL5A 3QY9A 3GLIA 1UBLS 1M33A 3BH0A 4AY6A 4HDKA 2YIJA 2B1QA 2L17A 1W4BA 2ZU6A 3NDRA 1U1GA 4HGQA 1HEIA 4UUNA 3WQRA 3Q7EA 4EY4A 5MFZA 4EAAA 4FZ5A 1BW9B 4FDLA 5TQ2A 1GLVA 1CC1S 2EGHA 3MS4A 1NC3A 1M2VA 3ZCXA 1K86A 4ONEA 5EPOA 1UBKS 4X1YA 4CKWA 5JJIA 3AO0B 3A9CA 2H4HA 1PJCA 3C98A 1A7KA 1XIVA 3BWCA 3FB1A 2C2BA 4M1WA 1VLQA 3EUEA 2O5EA 4URFA 1TF5A 4EHDA 4LWOA 5GAJA 2GZSA 4X9XA 3NC0C 2FY8A 1OX4A 1DRJA 3S4YA 1D1QA 1ONSA 1HE4A 3UV3A 4IOMA 3WGVA 2AGVA 1AGXA 2G6TA 1D6NA 5K01A 5J2TA 1QANA 1WSWA 2XTJA 4K6OA 3Q6IA 1V8BA 4EDHA 2NU8A 1GTMA 1EYZA 1Z7BA 2XQIA 3PRHA 3SEFA 1HSOA 4HJXA 5JXGA 2RC5A 1U2PA 3X2FA 1DO0A 2JFQA 4Q1FA 4DV1B 2CFIA 3TXXA 4HR7A 3EEOA 4J94A 2OHFA 2YC4C 3N74A 4TXLA 1UBOS 4V03A 3RVLA 4FUQA 3TSOA 4AZTA 1AKUA 4I4CA 2C78A 1YS6A 4KPUA 4ZVPA 4GOXA 4AJOA 3CLSC 5DIZA 5HKBA 4N3CA 4FX2A 1R8XA 2EDAA 1NNSA 1Q1ZA 4YT2A 2H4FA 1E2BA 1NWHA 3AUXA 4DLVA 1NJ6A 1PYOA 4HB0A 5E4JA 3TXAA 3BRWA 4RJKA 3RS0A 4JLKA 5AVQA 3OU6A 3WJ1A 5HQJA 1IOWA 2ZP1A 4X1OA 1R3UA 2XKAA 1BC5A 2ORVA 4RTRA 1YVUA 4FKBA 5ILOA 2GN1A 3M6AA 4QHSA 1EXWA 4TMTA 3RS8A 2G9RA 4I2VA 4QGGA 1ODTC 1IY0A 1UXJA 1YJQA 4MVJD 1UKCA 1XNHA 3EY9A 3FHOA 1AKYA 3BGDA 2NXCA 3SJ7A 2ZDHA 1A3CA 2JLWA 2WTNA 2IZZA 1L5RA 2OK8A 4IDAA 1IZYA 2P9GA 4NCIA 4O4IA 2PR7A 1EP1B 2BTOA 2W58A 3DDCA 3DE7X 4ZYUA 4IJUA 1L5HA 4PLTA 5E95A 1XXHA 1MVOA 2DBYA 2ODBA 3CR8A 1BYIA 3GW8A 3OLCX 3Q8XB 3HJFA 1ZC4A 1I94B 3OM1A 5AP9A 4XEHA 3COZA 1T0UA 3I9JA 4QODA 3EJ6A 1T8PA 4P36A 5BOSA 2ZYIA 3PR1A 4V1CI 1AZWA 4W5RA 1E1RD 2XVAA 4MEJA 5EIWA 3MNFA 3U4AA 4L9SA 4QKQA 1R1DA 3FOZA 3I9OA 1IATA 1UR5A 1ZWLA 4QDJA 4Z86A 5HEKA 3WL8A 4LSGA 4AU1A 1I4WA 2G3YA 4QUEA 1X7GA 4N1AA 1YU6A 2ZIXA 5DNUA 1CQWA 2B5OA 5ES3A 3ZV6A 4LF4B 4P81A 4JFRA 2PGOA 4MS3A 1S1MA 2CFRA 2IELA 2D8MA 4K5QA 1I5RA 1XO1A 2O8DB 2WT9A 2YW9A 1ZD3A 1M9NA 2OWEA 2B1GA 4D3FA 2BH2A 1AM4D 2CLHB 3EZNA 5DJ5A 1WU7A 4Z5XA 3RYCB 1K98A 4P3OA 2VH1A 3PQ6A 2A7QA 1GGHA 1PWZA 2C95A 4F2WA 5K0JA 4NY1A 5DOZA 2NZUG 4I5EA 5AMXA 1VA5A 3D7SA 5L9AA 1SG9A 2PLAA 3L6CA 1E6MA 4ZEMA 5KEIA 2OAGA 3CY6A 3ELYA 4GVPA 4W1PA 3TMAA 3V8EA 2E89A 2PZGA 4ETWA 1K6EA 3HCBA 1CS0A 1GPUA 1NUTA 3IAAA 4L08A 5EUBA 1ZJ6A 2JANA 2YZMA 1V16A 1OLOA 5E7IA 1XF9A 1XVVA 2RKBA 4OA5A 1O6FA 3LUGA 4C3UA 5JAIA 3ED1A 2K2QB 3HB0A 4IXNA 4AJ4A 3HKCB 4TTQA 3KLOA 3OF5A 4JUFA 4K9OA 3G23A 4JSRA 3IR5A 3FF4A 2OXIA 4BV2A 3EGEA 1FXSA 2VTEA 3OE7D 3IFSA 4M53A 1DWQA 4URVR 4F5EA 1D2AA 2KB0A 2OEPA 4ZOCA 3X1XA 3NVAA 4MLCA 3T06B 2LWIA 1BGWA 1N0IA 3K8OE 4Y67A 2E87A 4LYDA 4EL0A 3MJVA 4YWHA 1ISSA 2DAPA 3MMZA 3FOBA 1U8EA 5IJ0A 2REQB 4TLMB 3T94A 1J09A 1CIVA 1LK5A 1U2GA 2YHIA 5A7HA 4V0NA 3F7TA 1ZH6A 2JEYA 3MLBA 5EMMA 1GTSA 1FUIA 2B8JA 2VP4A 4M1QA 4HQNA 3AVOA 1K0UA 2KX7A 1MOQA 1PNVA 4I55B 3LYHA 3BJIC 3SJAA 1I7PA 1DJLA 5REQB 4YAKA 2PH5A 3ECCA 2OM6A 1IRIA 3DL2A 3F2VA 3EGWA 3EOBI 3FYSA 5AI6A 4GS5A 4CKEA 5JNLA 4E5DA 2P6NA 4AECA 4EO9A 5JD5A 2QVZX 2Q2NA 3EH2A 4FIZA 1RMYA 2BP7A 1Z5NA 3EOZA 3OTWA 4LI0A 3LYLA 2XTNA 3TLMA 5BUCA 4S24A 3BH7A 1JIUA 3B1ZA 5AKEA 1X14A 1YAHA 3IS3A 2FEMA 3VSCA 1Z8DA 1GL9B 1X7DA 1KOLA 4L4UA 4F3YA 4HD8A 3SR4A 1ULHA 1Z6ZA 5K7SA 1FSZA 1FYEA 1NI5A 4GKKB 2YNMC 3K3PA 4ES6A 2XUOA 1ZUIA 2Q50A 4CQNA 1G5IA 1QFSA 1SXJE 2CF6A 2CVQA 2O0KA 3HA2A 3ER6A 5FKJA 4XW2A 3EIOA 4GLBA 3EEBA 4HX5A 4RF5A 5IZ4A 1IE3A 9ATCA 4YJ3F 2PQ0A 5DT2A 1PV2A 1DC5A 1M6WA 1W2WB 4ZEWA 2IHKA 5IDQA 4CLEA 1Q5PA 5K3BA 4CZ2A 2ZAIA 3C3WA 3VTZA 2Z6QA 3N07A 5EFZA 3UIEA 4ZOQI 3A6PC 5HZGA 5TVKA 2D0IA 3IH5A 4YAWA 3RHTA 3VOAA 5TPWB 5KWEA 2X41A 2AYXA 1T6YA 2I2BA 3ZZ1A 3BDIA 1KJ9A 4DMUB 3V8BA 1N78A 2HA6A 1Z34A 4YYEA 5K8UA 4M9ZA 5K0BA 1L5ZA 1XGKA 4DJAA 5FUYA 1KBZA 3N8DA 2VXYA 3ORQA 3V97A 5C8VA 1IXYA 1UT5A 1E5DA 1VCOA 2PRYA 1JSXA 4PXAA 4AMUA 4C21A 2AZMA 1GY8A 4IWYA 3AVVA 1ZIXA 4JYAB 5E3IA 2O3JA 5LNK1 5LA6B 2QZ4A 2VK4A 4I1OA 1TF2A 5ENDA 3VDQA 4OO3A 2QBYB 4MGKR 1NVVQ 1V37A 4XQ9A 4NNPA 5MN6A 4PINA 5FF9A 4WJZA 5JS8A 5FORA 4QUGA 5HJEA 4AAYA 3DEAA 1N8TA 1JR4A 1V9CA 1Z83A 2ZS8A 3OJEA 1L5GB 4DUYB 2H1HA 2FZKA 4D5GA 2YV2A 4RMGA 2QMOA 2VP3A 1CUAA 2Q41A 3O82A 1A27A 4A27A 1SAYA 1OLXA 3UFBA 3DEHA 4D02A 5A4FS 5K0GA 1EX1A 1U8ZA 3NHFA 2F59A 4XUDA 1PQYA 4NESA 5JG7A 1J20A 2O8VA 2ZQ5A 4EFMA 2IZ1A 2XGSA 1XRPA 3DWIA 4BNFA 8ADHA 3F9RA 5K0SA 3RJ5A 1WVGA 3WLSA 4DG5A 3J80A 5A0TA 4L4RA 1XQXA 2WW8A 4WJLA 4BVGA 3AKCA 2HK8A 2V0GA 1U2RA 1CR4A 2VF2A 5FPTA 5A1JA 1G6HA 1TTHA 3FDZA 3AHHA 4ID9A 5BUQA 1KDOA 3CE6A 1S2IA 4LC9A 3LXMA 3TEJA 2JL1A 3ZY6A 5A3VA 2X5NA 3KSDO 4W8OA 3V8VA 2JFNA 3DHYA 3L8GA 3CUTA 4AT1A 2QX7A 4PAGA 5JT1A 2YIMA 3MTDA 2GESA 2YBEA 1Y8RA 2F1HA 3GJTA 3CVOA 3VH4A 2C7QA 3RSCA 4QUIA 3FCSB 3EWSA 5CCDA 3E7DA 4RPCA 1BXGB 2AV6A 2I29A 3CVXA 2YJGA 2NXWA 3FTQA 4PYNA 5HRUA 1PGJA 3CLSD 1GTJ1 3TTTA 1QHNA 4TTIA 3L7IA 1FUKA 4V2IA 3MINB 2GN0A 4F3KA 2C92A 2AQ8A 5B2FA 5EJ9A 3FVWA 3VV3A 5JRZA 2HLHA 4A0FA 3JD2A 3IB6A 2H51A 4F8YA 3L8HA 2QT9A 3GMIA 3C6MA 5K0NA 3BWBA 4KVFA 4JT9A 4E70A 1QG0A 5TNXA 1YOVA 3DZKA 4OH7A 4IIJF 2R7KA 1BGVA 1PWHA 1PVDA 1RI1A 2Y2VA 4KIUA 5F3RA 3TX2A 3EF0A 1N25A 1R6XA 1ZGJA 2BDUA 2HK6A 2JG3A 4JJAA 2HHAA 4OQPA 3GZNA 3ZGLA 1R3DA 1KS2A 1ZHHA 3HBMA 4D80A 5CX4A 4Q00A 2Q5HA 1Q7GA 3QKUA 1CS4C 3G79A 4GX2A 4PBRA 3RABA 4P58A 1GFWA 2ZB7A 2C0CA 2A4MA 1OIWA 3H2IA 4OQMA 4UDOA 4Y7DA 5FO0A 3PENA 1N7GA 2J3HA 4LOKA 5BR8B 3DYBA 2WUVA 1NVUQ 1CJCA 1WRBA 2OHJA 3B1FA 3B36A 4FJ0A 2GI4A 4EW6A 3G82C 2C77A 1DIRA 1F9EA 4LDAA 2OPHA 16PKA 4GRIA 2OESA 3KZVA 4ZREA 3SS7X 4B6FA 1WUKS 5H02A 3NHMA 1TZJA 5D51S 2XITA 2C3MA 3V1YA 1K2VN 2GEVA 2YJNA 4GR9A 2G67A 2ZI6A 5EE3A 2WG0A 1OY1A 5JALA 4ZXFA 3HVRA 1UK7A 4W6QA 3ZXUB 1QOQB 5F7JA 2CT8A 4N47A 1OXUA 2O5VA 1O4VA 3ORHA 1USVA 4HNTA 2OZVA 1IBKB 4PVDA 4MWDA 1HBJA 4N5MA 4D4KA 3R24A 3UMYA 3M1YA 4C87A 4JXJA 4UMEA 3ZHUA 3QYJA 3NHRA 3HRIA 3OIUA 2IYLD 2Q9UA 4WZBE 4N12A 3V2IA 2ZXFA 1NJGA 2LTAA 4JA0A 4Z9FA 4RTSA 3ITNA 2OA0A 4KYVA 3FRJA 3B53X 1SULA 4MV1A 1DBPA 4HNSA 3NNDA 2J7PD 2D5BA 2O20A 1VPTA 3DO8A 2JGRA 2CFOA 2A0UA 1VKZA 4AMVA 2WT8A 4NZZA 2ATEA 2YYAA 3K4QA 1DWPA 4KW7A 3P5BA 4OI4A 1STOA 4H1TA 5ARDA 4E6PA 2F55A 2ENUA 2H2FA 3UCEA 5KYWB 1IULA 3GUZA 1IVYA 3JASA 3OTIA 4UREA 3BGVA 3UXHA 4B79A 4DQKA 1P1FA 3PWTA 3SZGA 1YUNA 4AXBA 4BMXA 3IESA 5KX5F 1CETA 3FF1A 2XD4A 3WMXA 2IHVA 1HE5A 1NBMD 3O3NB 3CONA 2QQGA 1L8OA 1SPBS 4OYLA 4AL4A 5TRTA 1Z0DA 2WSSA 5CBPB 2ZK7A 4RV4A 4ZOLB 3H7IA 3OPXA 4P32A 4I4TB 2Q1WA 3LKDA 4QDOA 2PBZA 4KXYA 1RC1A 3RARA 4KRYA 1VP3A 1HKUA 1N2OA 5H9VA 4EOGA 4N7JA 3T34A 2O2XA 4PSUA 2O14A 3NIDB 1GGVA 1P7WA 2BD0A 2XDYA 3FGNA 1R0WA 3WMEA 1BKYA 1XZKA 4ILEA 2QUIA 2D1FA 1P0MA 1ZLYA 4JJIA 5E7MA 4GKVA 1I7SB 4NS1A 2EQBA 5F9HA 4HWTA 1EX9A 1WABA 1Y1TA 3EZGA 1GLNA 1KH1A 3AR4A 2AMVA 3NORA 5EYPB 5BW6B 3VU9A 2BMAA 1HFEL 2XHZA 3IKVA 4YTEA 3TB4A 5ELLA 1Q1EA 4Z9BA 7GPBA 1KEEB 1E1NA 5CFNA 3KWJA 4XCVA 3T7IA 1RFGE 3UV6A 4OHRA 1ND6A 2J4CA 3NTRA 4EW1A 2TMYA 1MOZA 1QYXA 4FGUA 1KMCA 2C9DA 3KE9A 2Y93A 2V58A 2Z9DA 3PFGA 1C3VA 3AXTA 1U7XA 5EZ5A 2AC7A 3H6GA 3KAJA 5LQKA 3WYFA 3K32A 2IZ5A 3L8YA 2WWTA 3LY5A 4IQFA 4HZIA 3TR5A 2YNMD 3WYDA 3O8QB 4TVBA 4HVTA 3HMQA 2PT7A 2ZCUA 4FDVA 2HFKA 4XFJA 4DJJA 2QRHA 1V4NA 2TMKA 2XQGA 2OXFA 1KEWA 1XMIA 3CZCA 3OJCA 5LMNB 4Q4DA 4D0RA 3DFKA 2I55A 4ILKA 4L02A 2PX4A 4BC1A 1G20A 2AJLI 1LWOA 3MGKA 1F1BA 2XNKA 1VFPA 5E6SB 5G0TA 4YAUA 4TS4A 5KMGA 1I4TD 1PQPA 3K8YA 5BYJA 1L8LA 3AJEA 3QSGA 4ZJZA 1C3OB 3QVMA 3BFKA 4YP7A 3S2ZA 1YUMA 3DE2X 1XXLA 5IFKA 5BUSA 5IUNC 4EY3A 2F4VB 4KXUA 2AC4A 4LC1A 4ICIA 2W2KB 4Y2GA 4CCAA 3SU8A 2JDID 2QIOA 1LZLA 4ZANA 4ZT3A 1AUQA 1U2DC 4R8RA 4UMFA 1WS6A 3U19A 5T4HA 4MOWA 4G4JA 3CZQA 1N6LA 2I7TA 3L7LA 3FFXA 3O2SB 1JB1A 3CX7A 4GPBA 5LQRA 1HFWA 3HGMA 1YVPA 4DLPA 1AJEA 3BD7A 1TB4A 3HSYA 1N9ZA 2NYRA 3H1GA 5TF0A 3QFHA 1V11A 1C4XA 2WE8A 5BSHA 1KR2A 2PQ6A 4DAEA 2LR0A 4FSXA 3VPFA 3GLHE 2YX1A 1Y5IA 2Q9BA 1BCSB 3KVNA 3LFTA 5AHWA 1D4AA 2C4VA 3N5CA 5F1KA 1XRRA 3WKDA 3T9EA 2R66A 1DG1G 3I28A 3PTLA 4FYJA 4HI0E 2O57A 3UT5A 3DFUA 4TT3D 2WHRA 3UZUA 2A35A 5IN5A 2FUKA 5FI1B 3M6WA 4MQLA 1Z6AA 5FA5A 2JGAA 1BDHA 3UCFA 4H6PA 3DOUA 4EQ6A 1J97A 2Y1KA 3UJ7A 5BRJA 1JJVA 2WB4A 1UK9A 1WXFA 4YRNA 3U7RA 2MIIA 2J46A 3RBAA 3SYNA 2QD4A 2ZJAA 3ML1A 1GQSA 3G59A 3IAS1 3PLRA 2QTRA 5DWDA 2A0KA 1RBZA 4DZTA 5F3WB 2AEJA 2WICA 3H9CA 1Q74A 3AGQA 4PG6A 2IYFA 1ULUA 3ESRA 2NVUA 1BTOA 3I39X 1QH8A 2EZTA 1GQFA 4YUYA 4ZMSA 5FUMA 1N1GA 1T9HA 1SG6A 2P9CA 1P0CA 4ND5A 4QGBA 5C53B 1JHYA 4HNRA 4RK7A 5JQWA 1FS5A 2ACEA 1MIOB 2OC4A 3DE1X 2X14A 1QO0D 2DBRA 3MYRA 1GTG1 1I6KA 4HGRA 4QVKA 1SFRA 2O8CA 2QJWA 2M1ZA 2W2TA 4GR4A 1E6CA 4OQYA 5FAKA 2SICE 1T2NA 1XR3A 4C1NA 1YVRA 3DL4A 4UPEA 2VCYA 3OZIA 4YV7A 3D0KA 4D26A 1BQEA 2AQIA 4MO9A 1EK0A 5JH7B 2BUBA 5D3MA 4MVJF 2XCLA 1U0RA 4XVHA 4DC9A 3ZHQA 5DTMA 2Y92A 1T8SA 1YWGO 4A15A 4B0OA 5KZMB 4E51A 1Q0HA 5JYEA 4YAEA 3TF5A 1KAMA 3AYXB 2H65A 3NFYA 1OX6A 3T5AA 3DVQX 4AG6A 4F38A 3KZXA 3DWFA 5AW6A 1C9NA 4NPCA 1N2HA 4KUEA 3QF4A 3WB2A 2DFNA 4DC1A 3WK6A 2PZKA 2XOKA 3O4RA 3UMGA 4OHYA 2ZR0A 1IXRC 4NMWA 1SUAA 3UHOA 3N59A 3A4TA 4J2HA 2VYVD 5EIOA 4KFSA 2H8GA 3Q9NA 4NBNA 5BQ3A 4R1QA 3HH8A 3UT0A 2VQFB 4ZYZA 1SQ6A 2PUVA 5F98A 3DGFC 2C2WA 2AFHA 1X7HA 4AO8A 1ZL0A 2J5BA 4B6GA 3V8NA 4RK1A 4JJGA 3WLOA 4NXNB 3HBNA 3L04A 4IDPA 1X1CA 3EG9B 4AFNA 4UU0A 1FB5A 2DFKB 1BSVA 3KVRA 5FLEX 1Q21A 5JANA 2R11A 4NPAA 2ZJZA 1N0HA 2O1WA 1F8FA 1GARA 2P4SA 4IDCA 3BK7A 4S1VA 5JWOA 4S05A 3CX3A 1NNEA 2B3DA 1CJBA 3Q3VA 2X42A 3S55A 3HR4A 1EGQA 3IJEB 1Z0JA 4IIEA 2V7EA 3MJRA 4HTFB 4RFVA 1JNYA 3PGVA 4YJ3A 4OM8A 1JEEA 3WLQA 1SHUX 1XJCA 4KAFA 1WB5A 1VIYA 2RGAA 4NYJQ 3WDLA 1Z36A 2WLSA 1E7QA 5M5BA 1SHKA 4WLNA 1DLJA 3OQMA 1PWXA 1OBVA 3L0ZA 3VGPA 1VTKA 2F8MA 4MVCA 1PFGA 2QN1A 1N5IA 3HKEB 4NG5A 2XNCA 4HV4A 2YV1A 1LRKA 2AJBA 3OETA 4UOEA 3REGA 4R8LA 2EWVA 4DILA 4R6XA 1Y8ZA 5B1DA 3BFXA 4R9NA 3UHAA 2XRMA 3DVSX 3FOCA 1I3KA 1RQNA 3BXHA 2R6R1 3H2ZA 4FEEA 2LVBA 5IANA 1WV1A 2WKSA 2AJDA 1V6AA 2XCQA 5FYDA 2BBSA 3IDZA 4CEIB 2EWWA 3HXMA 2BISA 1NF2A 3KG2A 4L0MA 3VR0A 1U9JA 1SB9A 1HM5A 1QHHB 1UOQA 1NDQA 3KFVA 2HGSA 1K5PA 3LD9A 2I1QA 4JC0A 4JX9A 4BXOA 1V5WA 2N75A 3GHHA 4A36A 2NPFA 3EW7A 1A97A 4L95C 4RJ2A 2ZIFA 4AUEA 1MTOA 4TYQA 3Q98A 1LS1A 5BMVB 1IY1A 1P72A 4UNRA 2R8BA 3PFFA 3NUGA 3KJFA 3JR3A 3DMTC 2DT5A 4WY5A 1YIDA 2R8RA 2CNWA 2YZKA 1JSZA 3OTGA 1J00A 3GEHA 1TVMA 1RE1A 3HFGA 1DRUA 4HT3B 1RXYA 4ZV9A 4X45A 3AM4A 1Q0ZA 4AG5A 4MUBA 3U5TA 5F5XA 2GAIA 1A98A 1DOZA 2AN3A 3VPSA 2ZS9A 4XUEA 1MHTA 4QRDA 1BMTA 3FIJA 2I6XA 4I36A 1VG9B 3JVEA 2GM4A 4DZZA 1CF9A 4MRMB 5IP5A 2F9FA 2E2WA 3NAZA 3T9DA 4NBLA 2P69A 2I4RA 2JPDA 5KTRA 2IPLA 2R6DA 1D4FA 1W19A 3LPMA 3SOPA 1IZ9A 1FDRA 2A1TR 2GAAA 5DHUA 3UO8B 1F0NA 3KKZA 4P3XA 1B3RA 3CVYA 1E8NA 4A26A 1GEEA 3PB3A 3PHLA 3PEWA 2GJSA 1JQKA 4TTRA 3JVIA 2QX4A 3KQLA 2B83A 5TF4A 1P4GA 4P4LA 2G71A 4H59A 4EG1A 5JI2E 3MILA 2HCJB 2RGDA 4MHOA 4L9WA 4C7VA 5THKA 5A4JA 4DANA 2VDMB 4MCHA 3QOWA 5FTLA 1WKVA 3E8MA 5SZHB 5C5IA 5FOXA 1AK9A 1P5RA 1QCYA 1GAXA 1FNMA 4Q21A 3ZU4A 4CCYA 3GIDA 4GVXA 2WA1A 3TSZA 3AVTA 4NENA 4OX9Y 2IYYA 4KWEA 4Q4HB 4N03A 5JI3E 1U1DA 1UMCA 1CZRA 1T26A 4HNAB 3N1UA 4LMAA 1N2BA 4PXYA 4EFNA 4Z7OB 5B3LA 1GSOA 3AMVA 1O9BA 3HTXA 5TPZD 1AB6A 2NNWB 3WNZA 4DS3A 4CLHA 4F6CA 3R7BA 1GG9A 1XUOA 1BE1A 5CA0A 2V59A 5L45A 2ZYVX 3T5GA 3UK1A 5DEIA 4LE0A 3EDMA 4QYTA 3DD1A 1NU8A 4MWOA 2WI8A 1NLMA 3X1DA 2BTQB 5D8DA 1KMMA 1DG3A 1M8JA 1ZEJA 3MCWA 1U0OC 4C88A 4D8WA 3M70A 4FI3F 4X95A 3AVXA 2YZ2A 3OU2A 5FWYA 4I66A 1E0DA 2Z30A 3TWOA 3CQ9A 3ONNA 3COPA 3MJ4A 3FFWA 4P83A 3HKDA 1L7NA 2Y0EA 4R1PA 1TYDE 4RD2A 4YBZA 3DEJA 2PKQP 1EQ2A 1HI9A 4LTDA 1P9NA 3LCCA 3GRUA 1GA4A 3KOYA 1Y9JA 5CDTA 2H0QA 3G0GA 4B3IA 4YO7A 3E3AA 4TQUS 3X1JA 2QSUA 3KCNA 1M83A 4AJHA 3FI9A 5KTOA 2IYPA 3CRZA 2JCYA 5CH3A 4QT4A 5EIAA 1M73E 3KJNA 1GIAA 2JGDA 3U26A 2GVZC 3NRCA 4G5GA 3ZE0B 1G8PA 5TS3A 3BMQA 1G8YA 2LCQA 5HDBB 4HDRB 1PQ4A 3WWDA 3PCXA 2RFLA 5C34B 4IEFB 1ZIYA 2E1PA 2NVBA 1QPGA 2ATVA 2AG6A 1JTFA 3EGXB 4IDOA 2GEFA 1H9CA 1FS4A 5KINB 4HNHA 4JNCA 4KR6A 4ZAGA 5JNSA 1X92A 2O0LA 5BSGA 4JC4A 5ISMA 2IU4A 2HPAA 5LZ7A 4I1VA 4AJ2A 2O7NA 2OORA 1GKKA 3FMOB 3VXKA 4QUDA 4U6QA 4UEJA 3V2GA 2D59A 2GCNA 1EFKA 2EF1A 4JJ6A 1TYBE 2V96A 3C5WP 4K9NA 2ZRPA 5JYCA 2IOYA 2XMCA 2WVHA 3EFOA 3U62A 3A0RB 1Y7HA 3B51X 1Y8QA 4EGQA 3T3PB 1DJQA 1MGOA 2R1TA 5KX5A 4FYMA 2X8JB 5ARBA 2XXAB 3AZQA 1CY6A 2PY6A 1BJKA 4FOSA 4EMBA 1FXWF 1ULZA 3TIFA 2IF0A 3IPXA 5JU6A 2HA2A 5BXQC 2DEUA 5KYUA 1IEQA 4RZUA 3T7KA 2V8BA 3WG9A 2HMTA 1F2TA 2PU7A 3F78A 4ZCSA 3ZDQA 1URPA 2IZOA 1E2GA 1P3JA 3QLUA 2VH5R 3U7IA 4ALNA 4BVJA 5BP7A 3EAQA 4KR3A 3E5NA 3KB2A 1BXRB 1QP8A 2EZ9A 2YHUA 1RAIA 2WSMA 1ZRSA 2PMKA 3CN7A 3CO0S 1JKFA 3D3NA 4KQEA 4Y2YA 2F00A 3ANNA 2W2PA 4BO3A 1PF7E 4MARA 4NKRA 4D79A 3TMKA 3AUTA 5D6OA 1H2WA 3TCXB 2XECA 2FPOA 3ASVA 2EGUA 2E4AA 3G2IA 3BPSA 3U4GA 3LQRA 2W2QA 4L9AA 1FNSA 5HRAA 3JX9A 1DJNA 2OLEA 3OP4A 3UB2A 3V00A 5EZ6B 2ZJ5A 4DA6A 2DU8A 5EIFA 2Q1XA 5IEJA 2QN6A 5TT0A 4LY0A 4QGFA 3RYIB 1KWKA 2UYYA 3HABA 4ZRNA 4HDAA 3U81A 1SA0B 4EL5A 1EM8A 3UENA 3ETEA 4B5LA 3RGGA 1OJLA 4D43A 1EVQA 2CLFB 3BMCA 3CISA 1LA2A 4HCJA 3JY6A 2WP0A 5DVZA 4EY6A 2Q9AA 3EQZA 4DL9A 5FDFA 3D5EA 1LZKA 1IK6A 1JIVA 1NV9A 3EF1A 1OPRA 2PUCA 1XSEA 3JQBC 4K7JA 3L1KA 1DJMA 1RLIA 4LECA 2BGNA 3H75A 3QUSA 4P31A 4BFVA 2UXDB 1V7ZA 3DEYX 3WMRA 1B4DA 2Q4TA 3D8NA 1F4VA 1HT1E 2ECOA 2X9GA 3KQOA 4GOMD 3WMWA 1O9HA 1G55A 3N9IA 3DMDA 1ODFA 2AR7A 2LCIA 2QGFA 2Q29A 3GVPA 2BFDA 1QBGA 1TQ6A 4X7BA 2QMHA 5DSZA 3UH1A 1MA0A 4YP5A 4C0BA 2HSEA 3THOA 3QOXA 3K73O 3HY3A 4NSNA 1DC8A 3JARA 2WYIA 4J1TA 1NX6A 3F2IA 4KQ6A 2IKSA 5F2NA 2FZWA 1QWOA 2ZIAA 3AHEA 4OIMA 4EGFA 4DA7A 5IN4A 5ALUA 3K53A 5JPCA 1ZICA 5JEDA 4B3SB 5DTJA 5HDQA 4FJ1A 4JKIA 4NC9A 1PHPA 3IBYA 1P74A 4IGIA 1G3MA 3ZHZA 1Z6XA 3PXGA 4HJRA 2WAXA 2QSJA 3ZE9A 3ET5A 3FTDA 4HH3C 2QP3A 3TSYA 3DDZX 3BIWA 4KE7A 1HTWA 2JCXA 3CSUA 4C0XA 1ZESA 1C2TA 2ZI3A 4WZZA 5F4BA 1G21A 1SKAA 3Q9UA 4YT8A 4YV1A 1OB5A 3A9TA 1TUBA 1WP4A 2CD9A 2XVMA 4I3GA 4KMRA 4C4XA 5FH9A 2ZRNA 3ZBQA 5CDUA 1YZFA 3JYHA 3GJ7A 4HTAA 4PLGA 3GAZA 3H2KA 4ZCRA 5L4NA 4KXMA 1XTVA 2J41A 2IV7A 3PNYA 3O8DA 3ZVLA 3NANA 3X1MA 4RFLA 3LT2A 3TFOA 3OCWA 5JNWA 1FFAA 4KP7A 4DXDA 1MABA 4EPTA 4LUCA 1FX0B 4X92A 4Q9AA 2B4RO 1NVWQ 2R00C 5A9SA 1GTRA 2PD3A 1FU7A 3P9QA 1IWBB 4I50B 4LHSA 1TEHA 1ZOOA 4LN1A 3RVOA 4HGNA 1G5TA 1QGOA 3TS1A 3HR8A 4NAHA 3KYJB 4RCZA 1T0BA 4EJMA 4WBSA 3DWGA 5I4IA 3PGKA 1Z6TA 1KYVA 3LDAA 1LUAA 3UJ6A 1QB7A 1JR6A 1T4GA 2W83A 4Y98A 3PS9A 1S2LA 4U4AA 3LWZA 4WNYA 1U04A 3G8DA 1A5SB 1XJQA 2DPXA 2XT0A 1PG5A 3N2LA 4JBYA 4R7ZA 1VSQA 4EPVA 3MFQA 3HLKA 1C9MA 1UAYA 5CCBA 4O33A 4L7QA 4YCCA 3I2HA 1GHTA 4TMVA 1YA8A 4MVJA 3H4VA 4G4SO 4M88A 3VU1A 4YMLA 1A88A 3I30X 3LSTA 3QKTA 9ABPA 4XWAA 4XLTA 1HY3A 1D6MA 4LY9A 1LSJA 2DBZA 4DM4A 4HEHA 4Q1CA 4HDNA 1ZAKA 5IJAA 5SY6A 4MIKA 3L0OA 3LT0A 5HK8A 2RI6A 3CBQA 5IMBA 1DFGA 2NPOA 5FI5A 3JVUA 2SCUB 2PWYA 5JRJA 1K7EB 3N53A 4Z0TA 4JZYA 4ARSA 1WA5A 4F84A 4KX3A 1G17A 5HCUA 1EHCA 3CB4A 3AF4A 5KBYA 3I04A 3A6ZA 3I1FA 4PZYA 2BKXA 1YAJA 2EX1A 2IDMA 2R1VB 3T1TA 3I2YX 4DYVA 2UXBB 3RYHA 1UM9A 2VYND 1JT2A 1P1RA 1N1EA 1E1RA 1Q2XA 3G8BA 4G1FA 3HO6A 3QLEA 4L3OA 4RA6A 1V1RB 2LP4Y 4Y6PA 4BNIA 2C5LA 3OQVA 3ICOA 4IHJB 4WTOA 3R1IA 1D3AA 4JL6A 1VKOA 2QWXA 1ZY2A 2G88A 4H6WA 1PZXA 2LBPA 5IBQA 3C6KA 5H68A 2H2AA 4CMAA 3Q2KA 4KVGA 5EXDA 2CXTA 2HD4A 3EGDA 4WASA 1GSAA 1RWOA 4Q9DA 2OXRA 3L8FA 3RSFA 4DSAA 1XKXA 3K1AB 3LC1O 1N92A 3NWJA 1GZ7A 4P84A 1WZUA 3DULA 4U5XA 3JPYA 3GT3A 4PS1A 2X7XA 2X22A 3CNOA 3PL5A 3PIDA 5LM3A 1Z0AA 4U2DA 3ZU5A 5LN1A 2F62A 2GBIA 3VZPA 4RHCA 4GI7A 2BZSA 4EJFA 2CLKB 2PSJA 4QOHA 1D03A 4BMDA 2H29A 1DAPA 1NYTA 1EG7A 2BEVA 1TW2A 5CT4A 4Z4IA 1GGKA 2JFWA 1H94A 1FJHA 2M32A 3PHJA 4FHEA 1UBCA 4LXXA 1U0SY 4R69A 4U02A 3SXUA 3ZEAA 3H04A 4YDQA 5AOCA 4LFBB 4R2XA 2Z5GA 1UBRS 1O7JA 2CJYA 4NNJA 2VUUA 1FTYA 2OBYA 2DX7A 3C3BA 1R5BA 3NZEA 4H4EA 4HQ6A 4M60A 4HYYA 5FNZA 3RJZA 1VIDA 1GDHA 2R87A 3ZLVA 3OZTA 5EQTA 4CKBA 2A2ZA 3LPDA 4OHUA 3SMVA 3CBGA 3W8EA 2EHJA 3ETHA 4ZYLA 1SXQA 3PX7A 4GUDA 5JV5A 4X7RA 1EFCA 5KSPA 2AR0A 1F14A 3OE7A 4QNNA 2Z2YA 3UOGA 3AZPA 1N2CE 3DBLA 1RJ9A 5J2UB 3CX4A 3A1TA 4PGHA 5E6UA 2X9LA 3VQTA 2OG1A 3BA1A 2ZB3A 3TXYA 2COEA 2INGX 1NLUA 4ND1A 2ZVPX 1DJPA 5A3QA 4UMVA 4QX6A 1VL1A 4YBRA 1OGIA 4JI0B 3TDMA 3ADPA 5D84A 1GWNA 1Y9AA 2W8BB 4FWBA 5EPUA 2QMQA 3KTFA 3RRZA 4EK9A 2NV0A 1M0TA 3L7BA 3QBVA 3AY3A 1UC4B 5EQDA 3WRYC 3TJMA 5AVZA 2I9KA 3OZCA 4XH9B 1B2LA 1O08A 4GE3A 4P0TA 4LF9B 1J23A 3I73A 1S8NA 3FX2A 4F56A 7ADHA 1U6IA 3B8EA 3JYQA 4RQTA 1CDDA 4IGFA 4YJHA 2H8KA 1POXA 1E9BA 4W9MC 3FMVA 1ABBA 3DT9A 3JQAB 4NJOA 4KBYA 3RDPA 3RVRA 4A2QA 4UZSA 3R3XA 2V7VA 3I01A 3UQYS 2ATCA 4OL9A 1UM8A 3NAQA 1XZAA 1UT6A 2X4LA 3HHPA 1CUCA 2CDNA 4TSKA 4UE2A 5DE3A 1ISFA 4GXRA 4WK2B 2BFBA 3E48A 2OMEA 3W6NA 2YRWA 5JADA 5BWMA 1U5AA 3A3PA 3W5HA 1ODSA 5F21A 3CUUA 1ZA1A 1KJYA 1QBKC 4L4ZA 1XD2B 3A1EA 1JXOA 4RABA 2CLCX 3NYQA 4M1SA 4IUDS 4UDXX 3VHRA 3FNGA 1HPLA 4IWNA 1A8PA 3IMFA 4AYTA 4L2IB 1GV0A 1K3FA 2JA2A 3KJXA 3AFNA 1DQRA 4R8SA 5AQEA 4LJRA 2Y76A 4PG5A 4RAOA 3COVA 4BATA 4BV9A 1U5BB 3VR5A 3S8EA 3C15C 1QIHA 4CF6A 5C8XA 4Y9TA 1VPEA 1EDZA 5CT6A 3WNQA 2EFCB 3H2YA 3R3VA 1NQ5A 3FHCB 3MWLA 5DYYA 4EG0A 1PT7A 2X0RA 2I3GA 3I6QA 1YDGA 3P7MA 3PCTA 4GPTA 1JR3E 2GBFA 3S29A 1WCYA 3WIDA 1AOXA 2Z1NA 4PNHA 4WBNF 1VG8A 4FKMA 3W4IA 2XADA 1DO8A 3MB8A 1UDBA 1JPVA 3L1UA 2XVYA 4MKHA 1V8PA 2J3EA 3MJEA 4ENSA 3AJAA 2H1WA 1NVTA 1AX9A 4TS1A 1CUIA 1FUYB 2DWPA 5TX7A 7ABPA 4W99A 4XX1A 2H7YA 2GN2A 2RH8A 4KV9A 4LDJA 2XT6A 5EAIA 1FNNA 3RK0A 4B4WA 5I47A 1FQKA 3KV1A 3JZDA 4HAWA 1LLQA 4XQGA 1P2TA 5TGTA 2XOXA 4UUAA 1YSCA 2I2DA 3T5PA 1TMGE 2W90A 4IKPA 3OX2A 1Y3IA 2VIIA 1JAIA 4PX3A 2VS1A 1N5LA 3A1SA 3M34A 1C9KA 1E1CA 4ARCA 4EJSB 4AB1A 1I8TA 3HDJA 1NOIA 1XL1A 1ZH0A 3H1BA 3EGIA 3G5LA 5ESDA 3WMGA 1WXXA 4NLLA 5AM0A 5FNVF 1OFHA 4A73A 4BP1A 2WJ6A 1TUIA 1FDWA 3WAKA 3ZCRA 3CO5A 2AOVA 3NBZC 2KMLA 5BSRA 4BN0A 4JB3A 4BLPA 3ILXA 4R9SA 2EWMA 2VNIA 1BNCA 3BCRA 3IDFA 4ROTA 1OFUA 1WQ4A 2GPYA 1BFDA 2P7HA 4P7JA 1V43A 2J3QA 1GGFA 3KB6A 2DC1A 4L28A 4NX2A 3L46A 5H9WA 1L5YA 1SUPA 1T0HB 1Y6RA 3H5NA 4JMLA 4PLCA 3P5SA 4Q7LA 5FR2A 3CPJB 4LBVA 1EK5A 2CZGA 4J0EA 3TQQA 1QK4A 1AQ6A 3LFHA 4QBFA 1B1AA 2YJ6A 3EIFA 3OZXA 4RETA 5K0TA 5FUWA 3Q12A 5DULA 1GO2A 1Q1AA 3AHFA 5KTPA 1KZYC 2YFYA 1SHZA 3RLFA 4Z53A 1QIIA 4OI0A 3DVRX 3E81A 3EIWA 1TD9A 5CG1A 1EPUA 1EZ4A 1SBQA 4WDQA 4WLFA 5F52A 3OLVA 4DRYA 1VPVA 1U94A 4N54A 3U3RA 3CW2A 3QTLA 1T3HA 2F9MA 4LOHA 4OSOA 1GADO 4TMZA 2P2GA 1Z74A 5CT5A 4W5JA 2VRNA 4ER6A 3ZHVA 1NQWA 5ES4B 3ZZTA 4GC5A 1CY2A 2PRZA 4OB7A 4WCFB 3T4PA 4H4CA 1JG1A 5ERXA 2VAVA 4E31A 2Z04A 4F9TA 1Q7RA 3OZ7A 4QDZA 1A9TA 1VMIA 4I14A 2HMUA 4P4SB 1VYTA 1EBBA 2B4TO 3ZHCA 2PR2A 1V6CA 2AB0A 3VNUA 5FO1A 4BFZA 2X0KA 3QLJA 2HCRA 1FXWA 1OBFO 2J9FB 1QKJA 1TQHA 5BW8A 2PFKA 1Q3KA 3W8NA 2VPPA 4GDMA 3PUXA 1VP9A 4UXHA 2QL7A 2B4KA 1BCRB 4KBFA 3K9HA 3VH1A 4HUTA 1JEYB 3ZS9A 1E6UA 4Q24A 3A70A 2RHTA 3EIXA 4YASA 1KAHA 4W5QA 3PYXA 2YDYA 3EGOA 2YRFA 4QJBA 5K8TA 1CD5A 1S2MA 3RSHA 1QIDA 3T9BA 1J24A 5JFTA 3C45A 1TJ3A 4B3CA 5EGNA 2CE2X 4QBIA 1X70A 2PWBA 4PZPA 3N6XA 5HQ3A 4QPDA 1FYFA 4DVGA 4R2JA 4H0NA 5IYZB 2WTEA 1D4OA 1UZUA 4H1WA 1LDBA 5A6VA 4XWKA 4DV3B 4R9RA 1H2BA 1MKYA 1UMBA 2JBWA 3PNLA 4AMBA 4BQPA 1KI2A 2JLXA 4LGVA 4BFTA 2RGNC 2ONJA 1MAVA 2I66A 2OB2A 1SRRA 3DVAB 3EF3A 2O2EA 1T9AA 2V9ZA 3QEMA 3RFCA 3ZXSA 4BEBA 1BVHA 1C4OA 1E9SA 4D5EA 1WY5A 1DKUA 4HMQA 1XHLA 3MTJA 1QFXA 1CDOA 2V8OA 3KLNA 3LX6A 1IU9A 1VE9A 2HCBA 1J2TA 4R5HA 4J16A 5DI3A 4CE6A 3CRVA 3LT5A 4PQGA 2D4AA 1QONA 4H27A 2UZ1A 4ZD6A 5EIBC 1T5IA 2YCLA 1HQKA 1M6NA 5T4EA 2G7ZA 3VOTA 3B6EA 1XA4A 1ZH4A 2XMSA 3NBMA 1V7CA 4FNMA 3ZXYA 3D3KA 4H77A 4M9CA 4C0AC 3SJUA 1BN7A 1KJQA 2PXAA 4PE5B 3U3JA 1IQUA 5K0EA 3PVZA 3R7SA 1OC2A 1DAIA 3W5CA 1SXIA 1R7RA 2HF2A 4NMMA 3BTVA 4C5AA 4KPEC 4NAUA 1BQ3A 4XGRA 4HDMA 2IWRA 3MQFA 4G1MB 2HZBA 2ONYA 1Z2CA 3KS9A 4IJWA 4H17A 4DCUA 3DD5A 3I3OA 3DWEX 5F3DA 2XYPA 1UBJS 2KSQA 2W5UA 4GI5A 3H0CA 1YRAA 4DJTA 2VTVA 4L5CA 1DUVG 2ZB4A 4OK6A 3GCDA 3NWPA 4MS1A 5LU9A 2VJKA 1V3UA 2IHBA 1QIGA 3DUFB 1T4DA 2GCIA 4N6GA 1B93A 1E0JA 2W2XA 2YWXA 3LZDA 5BYKA 3M6IA 3UOWA 3B9RA 3GFRA 1WMSA 5EQFA 3EW9A 4OGKA 4EG4A 3OQIB 4C78A 1QJ4A 1R37A 4KRFA 1IH8A 5IVKA 1R9MA 3IQHX 3PNBA 2ZR9A 4L16A 3MBIA 1YBMA 3WGMA 1E2KA 3OIFA 3OM8A 5JZVA 5K4HA 4DR2B 1EUDA 3DONA 4F93B 1OWNA 3AERA 2NU7B 3IAM6 4RORA 2Q8NA 5G0VA 5LOVF 4PSAA 3GOHA 1RNLA 3H8WA 3RUCA 5GQSA 3F5MA 3W6UA 2Q27A 2BGJA 3K4PA 5KSOA 4MQ5A 5HMLA 1OH8A 3A6FA 4E13A 1GUBA 1HLFA 1RQ7A 2FW7A 4PC3A 4EGCB 1JG2A 1OFGA 2JJ8A 3TOVA 3IP7A 3BXFA 4D9NA 3JQ8A 3SSOA 4MUEA 5LBUA 5FFNA 3EA5A 1MRNA 3PNQA 4B73A 5JSYA 3N8HA 4L75A 1R50A 4RXUA 1RYZA 2CBZA 1SHTX 1USGA 2VSOA 3PFIA 1COZA 4KHZA 1XAJA 4Q39A 1GPKA 5FWXA 3K9LA 4AN4A 5JZMA 2X77A 1NN3A 4TL6A 2DXIA 1HSZA 1SXJA 2TECE 1SPXA 3H1TA 2W2MA 3Q4GA 3MJSA 4P3PA 3ZJTA 2JFXA 1SZPA 4V3CA 3WDMA 2QTVA 1TRKA 3GF4A 5AI0A 1X7XA 4CM7A 4R8KA 2C61A 4YWJA 1JEAA 1VHJA 3WGOA 4YNBA 4BO9A 3E70C 4K05A 3D8RA 5F5NA 4BGDA 5JBNA 3I5AA 2VOJA 1E2MA 2LCFA 3RS7A 2UUCB 4MVWA 1XCPA 1KJNA 3WTBA 4OBBA 3GC6A 4LOAA 3WLNA 1FCJA 3OJWA 3QGMA 3W8RA 4CV3A 4LNAA 5CPFA 3LQFA 4QQFA 3BGOS 1U3WA 3SC6A 1GAEO 4FEYA 4QRIA 3DLPX 1JR3D 1SBIA 1TNDA 2PRKA 3QVSA 4U7WA 1U0HC 4UAJA 4X24A 5ESXA 1E3WA 3SHWA 1VECA 3M3HA 1XEWX 4CL2A 3R7LA 3GJ8A 1R0RE 2CZCA 1R4MA 2VJNA 4TTAA 2JDIA 1NSYA 1PT9A 4G1BA 4DR6B 1BA2A 3PQ3A 4MZXA 4CETA 3EHDA 4FE3A 1JEDA 3DKRA 4DUPA 2HW8A 4DIMA 1P5HA 3O93A 4M9UA 4ZO7A 4C03A 2R7NA 3HVJA 4NFYA 3SQLA 3HCRA 3A0UA 4B8ZA 1UWLA 2HXSA 1DOHA 4EYGA 1Y4ZA 5AJWA 1NPTO 1QTQA 4W5WA 5CA0B 3LBAA 4YI5A 5CRIA 4INPA 3RT1A 3WLTA 1TT5A 5JSFA 1W36B 3GY0A 1V45E 1JDVA 4L22A 2OV8A 4ND6A 3I9V6 3VO2A 4CM4A 1JHVA 1R16A 1DZ3A 1GITA 4EG6A 2D0OB 2VDJA 4EPYA 2AIRA 3SYMA 3BRCA 1N8KA 2RBKA 3SR0A 3DOEA 3TX6A 3U80A 4E5PA 3C7TA 2HZ7A 2LZ0A 2VYQA 2NZXA 3T5BA 4CM3A 3ZLBA 4IVPA 3O1LA 5E9QA 1XFAA 3SVLA 2Q6LA 4KITB 1ZN8A 4KGDA 4EI7A 1B43A 1L3CA 2FPLA 2VAPA 1PR9A 2OAEA 3GJ6A 3F8SA 4P7KA 4YJGB 1GU0A 3ZTYA 2JS7A 4J0IA 3ZV5A 5KQGA 4N65A 3RVNA 3R3UA 3RJMA 1IZZA 1RWNA 3D1LA 2EAUA 5U1PA 2L18A 4C30A 4B2LA 2BEUA 1W34A 4FBGA 1UPTA 3T7AA 3UK7A 2FSIA 1UJ6A 1YGYA 2Q3FA 4DRZA 5DM1A 4W7HA 3GZJA 2I67A 2VJQA 4OXQA 1YQQA 2Y1EA 4JR0A 1H9AA 4BO7A 5AESA 3PRYA 1D8TA 2M6SA 1GR0A 3RSQA 2WF7A 4HADA 3PICA 2J30A 4LJ4A 4ML3A 1XTRA 2GFQA 2EFEB 2QRJA 5CA1B 3P71T 3O1HB 4V0SA 4Q3KA 1JDJA 1WUTA 2R25B 1QO0A 1W4AA 1XPJA 2RHCA 5IJZA 2YXEA 3B20A 4R05A 1D07A 3P27A 1F3LA 3KYIB 1VDMA 3PGMA 5H16A 1BDBA 3KSUA 2EFHB 4I9GA 2WOOA 2OQIA 1J5EB 5D7BA 4LF8B 3P4UA 3HC7A 4TVKA 4DV6B 3M2TA 1K1EA 3OCCA 1U1FA 1XZHA 1CB0A 1DAKA 1VSBA 2IY7A 2P3LA 4NEQA 1XC7A 5CJPA 2ONZA 4YRZA 5C4IA 3IUMA 1DG9A 4BVHA 3VPAA 5J2TB 4MYSA 3RS2A 3B38A 2VUIB 3R0VA 2BFOA 4UE6A 4BWFB 3UV7A 4CFZA 4CG0A 5AOBA 1CUZA 2NU8B 3UJAA 4DQXA 2C9YA 2FVXA 4KQGA 3OMWA 1CQIA 2OBFA 5HUHA 1JH9A 3IQDB 4ZQFA 4GE0A 3OOYA 2D5AA 3P52A 4WK4B 4LFCB 4YCDA 2GLXA 2VRCD 2V6MA 4MDYA 3H9JA 2CUZA 4MRSA 4WOKA 5EA2A 1SQFA 1U8CB 4H1HA 5FAXA 3QX3A 3PEVA 4XA8A 5I01A 2VYVA 4OGLA 5DFAA 3D6JA 1L1QA 2V5AA 3Q0TA 3RC7A 1LX7A 3GV0A 2BHRA 2NLOA 2YN2A 3SDSA 5AW1A 2E4VA 3QEKA 3HFRA 4BOYA 5AXAA 2KBFA 1NSFA 4OP1A 5B3KA 8AT1A 1YZYA 2ZANA 2LW7A 5AM1A 3NCHA 3GGDA 1GVNB 4F3TA 1RRMA 4G84A 4D9GA 3EXEA 2ZB2A 2DUUA 1DIOB 4L78A 2YVUA 4YX9A 1YFLA 2ZYHA 5E1MA 5CDFE 4HY3A 1J2EA 2A1UB 3ICVA 2DZDA 3AU8A 2HJSA 2VK2A 1UH5A 3ASZA 4QTTB 2C4TA 1CYEA 4BE9A 1CVIA 3VJRA 3C16C 1KIFA 2ZVDA 4M8NE 1P4HA 3ETGA 2C03A 4BBZA 5KS2A 3P2JA 4WZBA 1KY3A 1MIHA 1J9GA 3JVDA 4REMA 3R3HA 4TL9A 4V2UA 4O4IB 2G7MC 3QFSA 5EIBD 4CEJA 1CUBA 2AH5A 4WNIA 2WAOA 2GM9A 2K7ZA 4UTZA 5I7OA 5DXJA 1XXHB 1OZ0A 4FHFA 4PPFA 1ZXLA 2WZCA 3ONDA 1UL1X 3KHSA 1TTQB 4LISA 2X8LA 1DC4A 1K6XA 2UYQA 1HFJA 2WV9A 2X4IA 3PUWA 4LRUA 4H6XA 1XTSA 5EWMA 5LXTB 1R6BX 1S6YA 4FS8A 1Z2NX 2HOQA 3V1TC 2O8BB 2JCGA 1IIBA 1ECFA 1J33A 2C2HA 1RJEA 4YCAA 3TIGA 4MB6A 4WY8A 1DCMA 3UY4A 1QU2A 3CT4A 4N3AA 5AVKA 5K6RA 1TUEA 3Q2IA 3B70A 4GEKA 4M8LA 1ZU4A 5EUCA 3WHKA 5KYYA 4WBNA 3KUDA 3TINA 4DAOA 1Y80A 5DM2A 2ZYAA 1RABA 3VDMA 5LJIA 2IHNA 1CP2A 1QH9A 3IQXA 3IAFA 5THQA 2IX9A 3ZDZB 2FPXA 4ZYVA 3RC2A 3D4NA 2O2GA 1M0SA 1T6NA 1W0CA 2MYUA 1HL3A 4O3FA 4EWLA 2BCJQ 3MEQA 1XE3A 3IPRA 3LI2A 2LRHA 3I42A 3IIIA 1N3YA 2R7MA 4BTEA 5L8VA 4PLHA 2P77A 2PZLA 4MUMA 2EIXA 2FP3A 2GF0A 2QVYX 1Y7LA 3WOVA 3MHPA 3F6PA 2VNHA 2Q5FA 4CRWB 2PKEA 1GKLA 4MYUA 2HL6A 5L3QB 4TSRA 4N41A 1Q0UA 2OO7A 3DBRB 3QF7A 3JYNA 3A4LA 1E61A 4JBXA 3R5TA 1CUWA 1CS0B 1OKKA 3A1FA 3JYLA 1XG5A 5E4YA 1TIPA 3L0PA 3QE4A 2Q4BA 5FNVA 5BSTA 4ZKDA 5AM4A 4KI0A 2FG6C 2Q5OA 3K1TA 3UHJA 4CL3A 1EZZA 4QQRA 5KHLB 5KJ1A 4PAQA 3MAJA 2VQSA 3SG0A 3WV5A 4PO9A 3OM9A 2O48X 3CIFA 3OFNA 2QVLA 4MIOA 3OPYB 4K9SA 2IIVA 3RYFB 1W5AA 3W2FA 3ESDA 4FB4A 3SQWA 1VJTA 1W46A 2QUJA 3QG5A 3RANA 3UPDA 1PTJC 1UQRA 3FPLA 2GXUA 4KTTE 3VYWA 4CDRA 3RFUA 5K9ZA 1VE7A 4JWKA 1F5SA 2WWYA 2HUPA 2QDKA 4ZVLA 2YHAA 3R5JA 4F5WA 2ID9A 1FP4A 2B8NA 3JATB 3NKVA 4H3VA 1YZQA 1BMDA 1Z17A 3L3BA 2GF9A 4V0QA 2BSAA 5C32A 4IVRA 2PRJA 3G2NA 2WNHA 3AUSA 5LA6F 4F4DA 1E2UA 2LDXA 3EC7A 2EOAA 2P4UA 4GYYA 4IUYA 3MERA 4PPGA 1TO1E 4MR9A 2GH1A 2Y1CA 1I1NA 3ESYA 3U3XA 2W6ZA 5BSFA 4KN6A 1R9GA 4G97A 1GXSA 3ZIDA 4TYWA 3N3BC 5CD1A 2FDCA 2Y99A 4Y2VA 2IPAB 2BN4A 2K4MA 2MSLA 2PKXA 3IPAA 4KMSA 4AZSA 1EH5A 1NUSA 4X62B 3EVFA 4QEKA 5A71A 3TLKA 4DLAA 3NWOA 3QVJA 3G2QA 4EUEA 2E3JA 2EX4A 4LBZA 5CVUA 3RO7A 3WL6A 4Z3OA 3GYGA 1LY1A 2BP7B 3DGEC 3DXZA 2IW1A 4WEOA 5ER9A 4L8FA 1A4UA 3P1JA 3DMYA 4LK3A 3RVBA 3SHFA 1RJDA 3DFZA 1RXCA 1XU9A 4JODA 1UBMS 3ROGA 1M3SA 3UMJA 1PJ2A 4CIDA 3EZXA 4EHHA 3QVGA 1VL0A 4PWZA 4CQLB 1W5SA 2C29D 4ZQIA 2DFPA 2FPMA 2CXQA 3CKMA 3G85A 4C5BA 1ONOA 2OZLB 4Y2RA 5E6RB 3GLHA 3IJ5A 1DCTA 1YF3A 4LHZA 3ZWAA 2C3YA 4FFDA 1E79A 3DHEA 4AY3A 4DR1B 2Z98A 4QHYA 5BMOA 2XZPA 1T2CA 4Q4AA 1MB2A 3RFTA 4N9QA 2FR8C 1G2QA 2EQ5A 3GEGA 5I7WA 3ISJA 4LZZA 4EECA 1QKKA 2WTMA 4ZVMA 5FLYA 1JZTA 4GXNA 4O4JB 4U7TB 2IYNA 5ADUS 4XJVA 3IBFA 3E53A 1KQPA 4WX2B 3UBTA 2IUUA 1PUJA 1U0NA 2BGKA 1E9AA 2GN4A 3LY9A 3MCZA 1L4HA 2GO7A 4GMGA 4ZWNA 1QIEA 4K9DA 5AUOB 3Q8MA 2QZ9A 4COKA 3H1FA 1GZDA 1NLFA 2WPDD 5KOYA 1TK2A 3TZKA 3VKGA 1NP3A 1XTTA 4JLUA 1EXMA 1UFQA 3PKIA 1MW9X 5ADVA 4D45A 3EXFA 5LVAA 1P4RA 1DARA 2OSBA 3P9KA 4OF4A 3TD9A 1GUFA 3CF6R 5EPEA 1ILEA 3WAJA 3CRQA 3KYDB 1G42A 4I1YA 4OU4A 1NU6A 3SAJA 5C18A 5KNBA 2DR0A 3SQXA 1SBYA 1WD7A 4CLRA 5FI3A 3AHCA 5CXQA 1IQRA 1OLXB 3S2IA 4E5KA 1M34B 2PG3A 1C8KA 4UVDA 3CXRA 5D3ZA 3TEFA 3PWKA 3FHJA 4A8JA 2EL9A 3KD2A 1UUFA 4N5IX 5BNZA 1KNQA 1RRGA 4FLMA 1SOAA 2ZE8A 2ECQA 1CUFA 1VLVA 2C07A 2KWIA 3CKKA 4FMPA 4FZJA 5B37A 3AY6A 4E1VA 3NVMB 5E3HA 2IUFA 4AZ0A 1YK0A 4YIKA 3STVA 1E98A 2A1IA 1LSSA 4B09A 4ZDIA 2EJUA 4LS3A 5KTTA 5AVYA 1DE0A 1VKHA 3H3JA 1VIVA 2BFCA 2H1RA 4UZFA 2IC5A 2DLCX 1AKRA 4NU5A 1QYIA 1HX7A 5AVRA 3ODGA 3S2UA 2CBXA 3HGQA 1QXSA 4JJKA 1KP3A 1RKVA 4B71A 5A6SA 1K8YB 2Q07A 1I5EA 1RWKA 2QY9A 3NV9A 4KC0A 4EENA 1XZQA 3KKMA 3DPSA 3LT4A 2FXVA 1JW9B 4YT5A 5FJJA 5C5CA 1W4RA 1I1OA 1I3CA 3S7ZA 1LC0A 4RTNA 1YZVA 4PHFA 3RC3A 1QFJA 3QWFA 5LOVA 3OM0A 5J5AA 3MJTA 4WFJA 1DL5A 4O02B 3HEAA 3FPSA 2ERCA 2AYYA 4YFVA 2ZIEA 4WN9B 3WHLA 4K6HA 3IV7A 1T4BA 3JRXA 1Z35A 4UVHA 2X1MA 1U0LA 4NJEB 4PHTA 3W06A 1TFRA 2OZKA 2QQEA 3PDJA 2FPGB 3OCXA 4IKOA 4L5BA 4X93A 1N7IA 1TM3E 1Z4QA 3C6BA 1DV2A 2QTGA 1NRJB 1Y3CE 4QXRA 3M6XA 4IDDA 2QPOA 1PFWA 5IDYA 1II0A 1DBRA 5FTNA 4BJ1A 4QDUA 4MQEA 4MW5A 5LD2C 1YC5A 1EFPB 2VXBA 4LPSA 2B36A 4KFUA 4XX0A 2IEZA 5DDIP 3TLJA 5ECYA 1E96A 4ZCQA 4DJ5X 5JSHA 2ZZNA 3O4GA 4M3NA 1NF8A 2A9QA 5DLDA 5DYTA 4ASUD 3BK2A 4UE3S 3O8CA 2I5PO 1I2CA 4W63A 4XYGA 2GILA 3GZNB 3L4EA 4I6GA 5TC4A 4L4YA 2BFAA 2XCUA 5EQJB 5FEMA 4K3VA 2RB5A 1GQRA 3QE2A 4JCOA 3EUWA 4MVJM 4OEHA 5KKAA 4I4TF 4ECAA 2W2OA 4IMIB 2ZR7A 3YASA 5EJ6A 5A5FA 2W42A 4JENA 2E4ZA 3OPYI 2GEKA 2J1LA 3BFJA 4TS9A 1NY5A 2AEMA 4KGVA 1LQ2A 3II6X 5AIBA 5LQAA 1EJ2A 1VBFA 4DWOA 2VDQB 1NG1A 3HMKA 2H2HA 4CI0B 3L05A 3Q3IA 1HO3A 1U7HA 4CF5A 2QMYA 4ND4A 3HYRA 3SSMA 3TNLA 1HDOA 5J4YA 1OFVA 3CCBA 3W9SA 3ITDA 5DTIA 3P96A 5GZ6A 4GD3Q 3K96A 3ZKAA 3I04M 1YCDA 1U90A 4WZ6A 2Y4NA 1S8AA 3B1KA 5JZ9A 3K0SA 4P7BA 1X8JA 3X1YA 4LCBA 3RHZA 1UXGA 4JLJA 4WGGA 1NW5A 4CR8A 1BA3A 1B0ZA 4PX9A 5A9RA 4POAA 1WDTA 1KQGA 1QU3A 3PFWO 4BO4A 5FCDA 2CV0A 3WL3A 1F6BA 3K71B 4WWHA 3HO1A 1LS6A 2I3AA 5AW9A 1HTBA 5EHQA 1BKDR 4LY3A 1Z7EA 3WGZA 2OVBA 3DBHB 3VZQA 1C1DB 2FEWB 4IJVA 1C7IA 2ONKA 2Q2VA 1QP7A 3ZNPA 4UEQA 1YCFA 2VJAA 5KC8A 2WQZA 3EMDA 3GU3A 1DWUA 2FRVA 2PA3A 4FT4A 5EWJB 4F1KA 3JQRA 5TIIA 3HPQA 3V9AA 3QSYA 1B6TA 3HRKA 4TS3A 5BSMA 2PS0A 1HXHA 3LVBA 4V24A 3RVQA 2EJVA 2WUEA 1NI3A 4MGYR 3D4OA 1KSHA 1U63A 4Z4GA 4DM7A 1T2AA 2C9MA 4OGFA 3H9EO 4WCFC 1RMQA 4EAQA 2PX6A 1CERA 3BG5A 1SCDA 3W9BA 3WIVA 3VRHA 3T3DA 2PE5A 2FH5B 4HO1X 3HWSA 3GFVA 1G4UR 3SZUA 3LRXA 1Y7PA 4Q82A 3IEMA 4W9NA 1ZN9A 4MA4A 1BHQ1 4YUXA 4TRRA 4ALKA 2AN1A 3LO8A 5TXGA 4C2AA 5MGBA 4JUBA 1G2PA 4RHEA 4D9FA 1Q17A 4KXWA 3ZD7A 1FSPA 3H0KA 4C43A 1NQVA 1QYCA 1W9MA 2RK3A 1E5LA 4A6XA 1ICIA 4GG1A 4RF2A 5TGDA 5I9NA 1TCUA 1DAHA 5IM5A 1XVLA 1U1IA 3WGIA 4MR7A 5DYWA 1EXDA 5BSUA 1H8ED 3IT2A 1D2NA 5C3MA 5GIOE 2Z58A 4LYJA 2IHZA 4ZZIA 1ZN7A 5IYZF 3OZVA 1KEPA 3EGVA 5CGZA 1XVIA 1RBMA 2PL9A 3I37X 1W4ZA 2ZVJA 4PZ0A 1ZZGA 2QM3A 5LLTA 2OLJA 3PG5A 5COBA 1IONA 1E9EA 5ERYA 3TLZA 1IHUA 1IVSA 1F5NA 4ZQHA 4BQIA 5K6AA 1KXZA 2Z5VA 3DO6A 2XTMA 5FPPA 3EVCA 5HNKA 1EHYA 2AK3A 1H85A 1ECLA 2GK7A 3D2LA 1ZEMA 1FVXA 3R6GA 3WHPA 5TLSA 4PLWA 2I4OA 1QK3A 2EC5A 4RPIA 3O31A 2QQFA 4H3SA 2O8DA 5JCXA 2CFCA 2PGLA 2YQZA 3PHHA 5JJLA 1EQAA 3RYCA 2V0NA 5E1DA 2PX5A 3PK0A 5BSWA 2VYNA 4FSHA 3BYZA 5A04A 1JMKC 1THGA 1M1NB 3BTSA 3I01M 3MCUA 2E49A 3K70B 2UKDA 5FWAA 1NVBA 3QXXA 4R2WA 5IBRA 1G20B 3LMKA 4OHWA 2J5RA 5ELMA 5K4GA 1TU4A 2F48A 2G40A 2YVLA 1E1KA 3B8HA 4DSOA 2HRDA 3JZFA 2O19A 3GGCA 4YRRA 3DXFA 1BDIA 3QEOA 1DBVO 1RADA 3L6OO 4N5LA 2NSYA 3HKCA 5KSYA 2A3NA 4LQDA 3REOA 3AL2A 4MVXA 4RD6A 5DNDA 2JVKA 2LIPA 3AWIA 2HWWA 4UEWA 4U1RA 1GL3A 2MCFA 3RIMA 4BLQA 4CTJA 4CV1A 2ZETA 3G8YA 5EJAA 5K03A 1R10A 4AW9A 1E6LA 3FZYA 3QBTA 2H4ZA 2QXTA 2ZSKA 2PUFA 1L5FA 3TR6A 4FLFA 3EA0A 4HWGA 3S68A 1QFMA 4TTPA 2O54A 5LL6P 1FFWA 2VJMA 3JQ7B 3QUAA 3KQTA 1U0JA 5TR9A 3GJZA 3HM2A 1V11B 4LV8B 2HY7A 5IKEA 4C0LA 2BYTA 2I78A 1P2UA 1CWUA 2I8AA 4YFYA 1N6OA 2JFUA 3Q5GA 3UFXA 4ZHQB 3ESXA 3FJOA 1RHQA 5FX2A 1KJZA 3MOGA 5C1OA 1Y33E 2C9BA 3AEUB 4XDHA 2J3KA 1EP2B 2VNSA 3ZDCA 4FONA 1TA4A 3EDOA 3ZX4A 4F11A 3IKTA 1J90A 5ALTA 2JKVA 1WLYA 2OR3A 4LRXA 1FFYA 4C29A 1XAHA 1OGJA 1OZAA 2ERXA 2PLWA 3FVVA 3OZRA 4OREX 1L5VA 1MB3A 1ESCA 1PR2A 5REQA 4EQ6B 3ZWMA 3K5WA 1QHFA 1K08A 1IUOA 4PSVA 2PLRA 3NAGA 3ZXIA 1A2BA 2BMJA 3TZ6A 1A8UA 1YDFA 2QN7A 3BRQA 5G0WA 4OQEA 3JQAD 4BBJA 4D41A 4TN5A 1Z47A 3ABSB 1JLMA 1HYBA 4IWXA 3C39A 1H2FA 2FEAA 1TYAE 2XMBA 1L4FA 1WVMA 4WQMA 5DYGA 2GNPA 2NVUB 4A5OA 2IBSA 4NABA 3S2SA 4BVFA 4BKRA 3ESQA 3PC3A 4V0RA 2OV6A 4TGLA 4BLRA 4X3PA 1J0BA 1JA1A 2AC2A 5BN3B 4ZCIA 2HYDA 3PR2B 3CR3C 2O06A 2I1VB 3IGFA 3SIPA 5B6PA 3FUCA 1L9XA 5F35A 2Q3MA 2WJYA 1WXWA 1D7OA 1U7UA 2HQOA 2RAPA 2VDVE 3F1KA 4MLPA 3ROPA 1N6NA 1O89A 3UKDA 3UWOA 3SR3A 2AVNA 3A1NA 5TPWA 1MB0A 2FW9A 3A2MA 4P80A 3BFPA 5CNIA 4XCXA 7YASA 2JK0A 2VHXA 1XEAA 1KBQA 4HWSA 4MDHA 1Y98A 4U2FA 4JJZA 2O6LA 2YTZA 4AX4A 5AJTA 4HEA6 4N3GA 1S01A 4BMYA 4KJXA 4B40A 5LA6A 5TJHA 1Q92A 1WDMA 1GFIA 4WE3A 4D6PA 1SUDA 3AI1A 1KZ9A 3KXLA 4MGEA 1BWPA 5H5JA 1WPGA 4UBMA 3NTVA 3FGPA 4J0QA 1PGNA 2RGUA 4TV8B 2WYOA 3JQBA 3OHMA 4WY2A 5EE1A 1SOVA 4HXFB 3T3HA 2DH6A 4LYAA 3OJ0A 3HU3A 5LIPA 2XUQA 2X6RA 1W36C 1Z6GA 2PUAA 1ID1A 4GIBA 1JSCA 1XZ8A 5BMVF 2ESRA 1DIHA 2OFWA 2HDHA 2QTNA 3PUIA 4X0EA 1ORVA 2JIBA 5KVQA 4YRIA 1WXHA 3D6VA 3TAUA 2BGUA 4R41A 2XD9A 5DNYB 5F2KA 3A06A 1CDZA 2FTKE 4O1MA 1INLA 4QJ3A 4HYQA 3F4LA 2RB4A 3OY7A 4QG3A 4JI7B 3ROMA 3PC2A 4XVCA 3O94A 3HM9A 2IEIA 4PR0A 1C7JA 3C6XA 4GX5A 4RPGA 5A5DA 2BT4A 2HSGA 3QIAA 3BSYA 3G6WA 1O03A 2YXPX 4GSKA 2JI4A 4BJHB 1BMQA 3O4VA 4QYWA 3V3TA 1XCLA 1Y4DE 1RKUA 1EFLA 1LPPA 2A0FA 2PQ2A 4H7PA 4J6EA 3ZY4A 1BMFA 1E32A 1R74A 1PRYA 5KSWB 3E27A 4BL5A 1H0KA 1GCGA 4O3MA 4YK7A 3SIXA 2FN7A 4EVQA 2B34A 1WB4A 1L2TA 2VTKA 1BXGA 1DQNA 1NI4A 2A5LA 2J4DA 2UYGA 4LX0A 1RHJA 4M1EA 4Y2SA 4BECA 4DCSA 3RC8A 1N32B 3GPCA 2FF7A 3H13A 5TVGA 3CTPA 3OLQA 5ANRB 3SZRA 4BV8A 3DUWA 5KQPA 1E3IA 4CIAA 4BLWA 1U8YA 3MINA 2J5KA 3D0QA 5K1ZA 2X0FA 1NW4A 4HRAA 3WQBA 2XEXA 1ONBA 5HMMA 4HPXB 4R5MA 3FSGA 3ZE7A 5KREA 1AKNA 2EL7A 4JYMA 4DABA 2Y1LA 3QUTA 1AQLA 1W8IA 3AVUA 1AK1A 2NU9B 3O21A 3C70A 1E9RA 1CVRA 1JDUA 3L1JA 1ZWKA 3QG1A 3INNA 3EBPA 3CEHA 4JJEA 2WUWE 4RIGA 2J32A 1OFTA 2SHKA 5F33A 4EFKA 2FHSA 3I64A 1XQYA 1UAAA 1CUGA 4BXOB 1Q11A 1YULA 2RHHA 4F45A 3PVCA 4IBOA 1F8UA 4KWIA 1QHGA 3TVTA 1BH2A 2OPBA 4MJ7A 3U31A