2YXBA

Crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
b'RRRYKVLVAKMGLDGHDRGAKVVARALRDAGFEVVYTGLRQTPEQVAMAAVQEDVDVIGVSILNGAHLHLMKRLMAKLRELGADDIPVVLGGTIPIPDLEPLRSLGIREIFLPGTSLGEIIEKVRKLAEEKRMREEAEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme B12-dependent mutase
publication title Crystal structure of the methylmalonyl-CoA mutase alpha-subunit from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
molecule tags Isomerase
total genus 39
structure length 139
sequence length 139
ec nomenclature ec 5.4.99.2: Methylmalonyl-CoA mutase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 2yxbA00
1Y80A 2I2XB 7REQA 7REQB 1ID8A 3IV9A 3KP1A 4HH3C 4HEHA 1FMFA 3BICA 1B1AA 3WHPA 6REQA 1CB7A 6REQB 2YXBA 4HH0A 1K7YA 4REQA 3KOZA 2XIQA 4REQB 2REQA 2REQB 3IVAA 3BULA 4JGIA 2XIJA 1XRSB 1REQA 1REQB 1BE1A 3EZXA 4HH1A 4Q37A 3REQA 3REQB 1K98A 5REQA 1I9CA 1CCWA 3KOWA 5REQB 3KOXA 1BMTA 1E1CA 1E1CB 5C8DA 4R3UC 3KOYA
chains in the Genus database with same CATH superfamily
4BNIA 1INLA 3A9CA 1MORA 1XD2A 1YJAA 3R3YA 3UKDA 2OAQ1 2GEFA 1QF6A 4FYJA 1M1YB 3U40A 1GNPA 5H02A 5K0LA 1NBIA 1WMFA 2KHZA 3M6UA 5DU2A 3I6ZA 3JQFA 3WE7A 1PUXA 3FN4A 2G80A 3GV0A 1TVKB 1MO5A 2UVQA 5DCLA 3SIPA 4KN8A 1KPGA 3UH1A 2CY0A 1IN5A 4HC4A 3AR3A 4B6RA 1EXWA 4OXNA 1J1UA 3NW9A 3S1AB 2FR8A 1PW7A 1QX3A 2WHXA 4TQUS 3KAQA 3R20A 3JAKA 1CFJA 5CNKA 1UWVA 1QKKA 4OA8A 1OGIA 1A95A 1G9TA 4YIKA 4AG5A 4BNYA 3OX3A 3RDPA 5LZ9A 4RTMA 3DW3X 3GCGA 2OCKA 4QRIA 2C58A 4C6TB 4L4SA 3SS9X 5G1NA 4IJKA 5KTPA 1AXGA 4LVUA 5CMLA 5EE5B 5EZ5A 2YR0A 1M6VA 3TQTA 5B4VA 5FPKA 1J9EA 3OWXA 3RK1A 1L9KA 4C4YA 4F6LA 4I8XA 1EG7A 1XVVA 1N5RA 1SQFA 1M5UA 2LKDA 2QQ0A 4FUQA 4Q7JB 1TKRA 5HMLA 3ZLTA 5HW0A 2BRUC 3QMPA 4Y6GB 5JCJA 1OA1A 1OFUX 4PLYA 1R0WA 3LZDA 4HYYA 2GVZC 4LF7B 2BZGA 3VSAA 1XEXB 4B71A 5LVAA 1E58A 2C2ZA 4TV9B 2AQIA 4MHTA 1DC4A 1D2NA 4CIVA 3L6RA 3OLQA 2H54A 5KSYA 3MWYW 1EEXB 1OZ0A 1P61B 5A5FA 4AZWA 2F1HA 4ZYUA 4TQGA 1OVMA 3EE6A 4FYHA 4I9FA 4MQBA 4UU7A 3U7EB 5C4MA 4OU4A 5K7SA 1Q1ZA 2BW0A 3N59A 4X93A 3R24A 4LI0A 1RYEA 3P20A 5K3DA 1F2UB 4HF7A 5EUQB 1E6EA 4P92A 4I6GA 1MB3A 1XP5A 4IDGA 1UOEA 4JQZA 1P2SA 3EXHA 5FOVA 3GUVA 4H15A 2J3JA 2PMCA 1TCAA 2XLCA 1DAKA 1L4MA 2C96A 4IXNA 3KZCA 3GO4A 4K6HA 4RF5A 4U6SA 1C7FA 2Z2XA 2ZS7A 4EHKA 4YJHB 2GXAA 2P1ZA 2ZRBA 4DUPA 2QXTA 5JTUA 4BMXA 1IZ8A 3FRJA 4JP3A 4R9NA 4N3NA 4A0QA 2ODEA 4X85A 2GDJA 4HBGA 1FOEB 2JHGA 1H2EA 5FAXA 3AG5A 1P62B 4A91A 1JDTA 1M9NA 4MGZR 3UCFA 2H59A 4G9BA 1ZAYA 1GUDA 5FI3A 4I4TA 4PONA 1CB7A 1EIZA 1GFSA 2IQIA 3H9JA 1I4LD 1YNOA 2XNDA 4TL6A 3DMRA 4ZT6A 4F4CA 4LDZA 5HTOA 2FHPA 2WSLA 3S6JA 1P7ZA 4K6FA 1OI3A 3OPXA 2GHQA 4JVMA 2W6JA 1S2NA 5TQJA 4E4TA 2BKLA 5JC8A 4F91B 5I8WA 2VK8A 1T1EA 1MB2A 2VP3A 1T4GA 1X13A 4ZEOA 3ZYCA 1IXSB 1RRPA 4JLBA 2FRXA 4H1HA 2HOQA 4Q9JA 5HNKA 5AJZA 4JVNA 1WPQA 3HWRA 1U8FO 3ES9A 1II8B 1RJ9B 4LJYA 4NFSA 4PGHA 4A26A 2YJTD 4A0RA 2C03A 1YONA 4HNUA 2C9MA 1QOPB 2FYTA 1E9RA 3LKZA 3HFJA 1HDIA 1HZJA 3IVRA 4H16A 2ODQA 4V0SA 2E6UX 4XWTA 4C4TA 3AM1A 2IYUA 4KXYA 2V6IA 2OCLA 3JQ8A 4Y67A 4AJ9A 2JG3A 4B76A 1JBEA 1JEYB 4INOA 4BP1A 1PQYA 2REOA 5C31A 3W5SA 5A0VA 3N07A 1LX7A 4LNHA 1TD1A 1ZMTA 1JPNA 4TT3A 3BMQB 4O63O 4F9TA 3QX3A 3FTDA 1HLFA 2AOTB 2G07A 4RVHA 5KDLA 2A14A 1SQSA 3N8DA 4A73A 3L7MA 4Z51A 1HSZA 2CD9A 3HKCB 2NQ2C 2B0JA 4KFUA 3BD8A 4EENA 1JG7A 3O8CA 5U4QA 4X54A 3DDCA 1LJ8A 2GK4A 1RLJA 3PJFA 5KCMA 3RF7A 3FOEC 3BB4A 2V6FA 2Y1DA 4URUR 3IEMA 3CN7A 3HYRA 3E9ZA 1UZLA 2O2IA 4KFTA 1CUUA 4I1UA 4TTAA 4FDAA 3L8MA 4J7AA 1Q44A 2FMXA 3KZVA 4YXWA 1IH8A 1TVMA 2HL6A 2AFHE 1KJZA 1XQ6A 4NMXB 5GOTA 3TCKA 1G21B 4G1FA 1PP4A 3STVA 1DKRA 1M0WA 1WY7A 1D2RA 5CB8A 1OJLA 3C7CB 4EPWA 2XCTB 4MWEA 4HVLA 2JFOA 1K6IA 3U4HA 1C50A 3L79A 3KJQA 1OA0A 3ABIA 3AJAA 3B1JA 3AKYA 1EDDA 3EAFA 2E5FA 3FNRA 4EI9A 4OQXA 3BD6A 1WKVA 4XRGA 1GXSB 5AKXA 3WNCA 1NBMD 1CR6A 3D6VA 4DBLC 4IOLA 4K9MA 3BGDA 3RFCA 1A5BB 4MUYA 2AMJA 3DT9A 3L6UA 3OX4A 1YVUA 3ZUPA 3ZI4A 3FJYA 1A88A 3H1GA 4JIGA 3ZI7A 4C4PA 5C7LO 1TQDA 2G67A 2B8WA 3QMVA 3PD1A 2WFMA 1WCIB 1XKTA 4W9NA 1MOZA 1SKYB 4C08A 2FDXA 4EJ6A 3OZWA 4G0PA 4B6JA 1U1FA 1PYGA 1DEKA 1SIUA 2PCLA 1YXMA 3GFGA 3CNQS 4X1KB 1RP1A 4L8YA 1L5HA 3UB2A 2NX2A 4TSFD 1K5PA 4U0KA 4GX2A 4IHQA 2PUDA 4KXLA 1FLVA 5E6UA 3LHDA 4BAUA 1EIWA 1S3SA 2PKQP 3TRIA 5J23A 1GDDA 4TLBA 3EXEA 3T7AA 2RI6A 3HKEB 3AHIA 3WK9A 1MRNA 3D7RA 3NASA 4HX2A 5LDGA 3ZJTA 2WB2A 2DFTA 1HE8B 3C85A 2CLCX 5E1MA 4PBSA 6LDHA 5I9BA 2YQ5A 3C5HA 2UUCB 1CJBA 3TPFA 4KMOA 1K3TA 5KTMA 3BQMB 3KJZA 1R2QA 3G6KA 2JFUA 1XWWA 2HA6A 3U31A 4ARBA 1SB8A 5FRDA 5BT9A 5FX2A 4C7KA 2YWRA 2O0MA 3N8NA 4OKNA 5D8DA 2BHSA 1S9HA 1HYHA 4HMPA 4J9UE 5E7JA 4PC1A 3LS2A 5CVVA 1EFPB 1D1SA 2XNKA 2O8CB 1DCFA 2B83A 2QX7A 1E7WA 2ERXA 3NONA 4UAUA 3E9MA 4G23A 3ZEAA 2M9MA 3HJRA 3MTGA 4TUYB 1JVNA 1A4RA 4JQOA 4DNQA 1JLLB 5J2TB 4HXFB 1USGA 2D1FA 4FHCA 1T91A 3RHFA 4FEEA 2JBWA 4JP2A 2HIGA 2QF7A 3OWHA 4V1CA 1S9DA 3FZYA 1W59A 1PDVA 3OLWA 4EL5A 1VI5A 5LBTA 3QXXA 2O8EB 2PBRA 2VHCA 5A1TA 3WA7A 5A6SA 3ZHSA 4FS3A 3NM5A 5H9WA 3AM5A 1E0SA 3QPWA 4Z49A 1MTOA 1GPWB 1YOVA 1SWWA 5I5GA 3H9BA 1WLSA 5JVDA 3ZBTA 3LLMA 4W5TA 2ZEJA 3A2LA 5A03A 3EZ9A 3JV7A 3I9KA 2OM2A 5EFOA 3BAZA 4HWTA 1NVKA 4GR5A 3GFTA 4PCUA 1VIDA 5DN6A 4D7AA 5AUNB 4E5MA 2JJMA 1R66A 4JOBA 3OURA 1KDTA 4V3BA 1ZCBA 2CLMB 2RGGA 3UW1A 3ABQB 5TV2A 3K5HA 4QWMA 2CNNA 5HFJA 1MVOA 3L6EA 2EGUA 3SZLA 3CIFA 5BN1A 2LCIA 1YS4A 1K7SN 3M6VA 3TI9A 4UJ3A 1YASA 4RTLA 3KR2A 4MP3A 1REQA 3A6GA 3K8YA 4LZLA 4JASB 4KXFB 1RI3A 2BMJA 2YICA 3N76A 4JDUA 4BIIA 5CAEA 4J29A 1R37A 1QMPA 4MVJD 1XN1A 2D5CA 1U3CA 2H16A 1V71A 3NEPX 1M2FA 4PFSA 5LQDA 4OM7A 5ADWA 5KPDA 2PMWB 3AQIA 4LHEA 2WM2A 3FOFC 1ODLA 5LCXA 1U3FA 4B33A 3O3CA 2GFQA 3PQ6A 4R1UA 3AKZA 1URPA 2R1TB 2RI0A 1CR2A 3SXUA 1T36A 1TRKA 4MUJA 3P32A 1Z4NA 2GBFA 2HGSA 3GUUA 5TPWB 4KREA 3JVUA 1HGXA 1NUQA 2WF7A 3AHJA 4FOOA 4WK6A 3H16A 4MVJM 5EN4A 5A7GA 4BIMA 2B6NA 2WAAA 1VHTA 2ODPA 5KWJA 1YDMA 1R0SA 4M55A 2OMEA 5TEVA 3VC3A 4BQPA 3H1EA 2VWHA 3K2BA 2ZRLA 1ADGA 3Q11A 1I7NA 5GGXA 4ZDJA 4JBGA 1A5AB 3GR6A 3N39C 3NCHA 3KJIA 1SNYA 4J0QA 4L8WB 1XSEA 4YROA 1PDOA 4YP9A 4JI7B 5EHXA 3VMMA 5GVSA 1MB4A 2GARA 1JR4A 5BSFA 3MWFA 1UBLS 3V4ZA 2MOKA 2WD9A 4KQHA 3ZV4A 5DHFA 1LLQA 4WXYB 4AS2A 3D8TA 3GCXA 3JD0A 3RRJA 3ZCRA 1N5JA 3TZQA 4YFYA 2XT6A 1XZEA 3DZ8A 4GE0A 3PQ2A 4EHBA 4PS1A 5AI8A 4UU8A 1KOLA 1Y7PA 1AKQA 3EQ7A 3KT6A 3QLUA 4NG5A 1LRLA 2A0FA 4JU8A 5AM5A 1CYDA 4ZGGA 2JA1A 5JSQA 1FUEA 4YRQA 3F67A 4BJHB 4DXHA 4UOEA 2IEZA 4XUCA 1U3DA 4INPA 5DM0A 1UM9B 4A5SA 1OXXK 1NA5A 4KDFA 5K0JA 1H65A 2IHUA 2VYVA 4G85A 4YECA 2DBVO 2BDTA 2G04A 5JH7F 1K75A 3ZWAA 2RE8A 3AVVA 1VSVA 2C8KA 3MWLA 2CJPA 5JANA 2HKIA 3NHZA 3OE4A 2IDJA 4G0YA 2IYTA 2ZDGA 3BXGA 4K5QA 4QKQA 3PPWA 1XCPA 2QM7A 2FY8A 3P2KA 2E4XA 2VJMA 4ZQEA 1GNLA 1KR2A 1QO0A 4OY3A 2G9VA 4CRWB 1FPQA 1IXYA 3EIQA 3QWBA 2QZZA 2DPXA 1FF9A 1W4CA 1AG9A 2WWRA 3B12A 3I04M 3G2LA 4P53A 1Z73A 2HZBA 1FDWA 3CISA 4YQZA 3IAXA 3KB8A 1VMAA 2A59A 3GPDG 3QENA 4ITVA 4HLQB 2Q4TA 4ZDIA 4C0KA 3JARA 1OZHA 1U5AA 4OHMA 1KYXA 3TW6A 3KQLA 4LF9B 4DGSA 1GPAA 1YZLA 1ZNYA 3G0BA 3LCMA 1YKSA 1X80B 3PJEA 4CMJA 3ND7A 3ZYZA 2XTZA 3UJ8A 3DOEA 4R16A 1Y7LA 5HVNA 3NHJA 3E53A 1YCHA 4CM4B 4XQGA 1EGVB 5T57A 3RSQA 3DE6X 3MMNA 4IJUA 5K0NA 1M0TA 2AKYA 5DOZA 1OILA 2F00A 4X7MA 3KX2A 1NW6A 2B8EA 4OB6A 4QGFA 1W73A 1U8AA 1DHTA 3KKKA 3OLZA 4WBNB 5KTKA 1MAUA 3PC3A 4PV7A 5BORA 3W04A 2XMZA 1PL6A 1C7ZA 2Q4BA 3L7IA 4MARA 1Z0SA 3C14C 3I2IA 4Q4HB 4EJSC 2O8DB 5B7GA 4Q34A 2F3UA 2MSCB 2OPBA 4OD0A 2FN8A 4TRNA 4ER5A 3T5AA 4LF4B 2B61A 4K6MA 4RD3A 4O4JA 3AIKA 3PXBA 4HH0A 3B53X 2CLFB 3G0IA 3L4EA 1P91A 3QVGB 2C29D 1SOWA 3B1FA 3IHLA 1QQ7A 1UK7A 3GLHE 1QFYA 2QMQA 3VR1A 2JD2A 2ECQA 2GDZA 3EPPA 1YZFA 1J5PA 1E3IA 1BD3A 1VL6A 4LC1A 4RLQA 2YW9A 3DDSA 1W4LA 5KQMA 4B43A 3AXSA 4JGBA 1ISIA 4YAOA 1DTWA 3CLRC 4HK4A 4DRXA 5CD9A 1T9GR 4TMKA 2NUBA 1QIHA 3GT7A 2P8SA 5K2MA 3UAGA 1JFFA 3M4NA 1DG9A 3GLVA 3M0EA 1CUCA 1I14A 3AHEA 4RA9B 1U04A 3RC9A 3ZNNA 1KAQA 1M1NB 1E7SA 1XKXA 2FETA 2R5WA 3SEZA 2L82A 4C0XA 3UAVA 4K0KB 4FIDA 4RFSB 3JWPA 5F2NA 2FEKA 4RF3A 5KQLA 2DWQA 2YMQA 1YA4A 4WVLA 1PG0A 4ZI2A 3WWPA 4MQMA 4G84A 4YHBA 5JS6A 5K0CA 1FUYB 4Y8VA 1DS6A 2HBQA 2FFRA 2HCJB 2RGNC 2X5KO 2VQ3A 1T3HA 2W2KA 1MJGM 1NSYA 3B5IA 3C3WA 4G2NA 4RPLA 3WYBA 3I8OA 2AZTA 4NC9A 4Z9XA 1IXKA 1PFYA 3ESDA 2R7KA 1LS6A 3B7PA 3RJ9A 2P4SA 1FTYA 2BRUA 2WJPA 4Y6LA 1JH8A 1GTRA 1SQ6A 4FZVA 2A67A 1F8YA 3K15A 3X43A 3BA6A 1Q84A 1SVKA 4H3VA 5DBIA 5LQKA 2F8TA 5DLEA 5G0UA 4FOSA 4O4LA 1A82A 2OXEA 1JDSA 2LZ0A 4K86A 4UQPA 4Z1MA 3H2GA 2WWWA 5PGMA 2Q7OE 3UUEA 4Z53A 3QW2A 5FI5A 2JLQA 4G0ZA 4N8SA 4OA5A 1M7BA 2O48X 5BSUA 1JXOA 1MAHA 3HB7A 4YT4A 5DM1A 2OGUA 1IONA 4KGDA 4EUSA 2VATA 3EN0A 5CXXA 1LPBB 1ZGJA 2Q5JA 1YKFA 1JHZA 3AFMA 5KZMB 2LDXA 4I1YA 4KNWA 2XCUA 5DF1A 3ML1A 3KOYA 4X44A 2JCBA 5K3CA 3T54A 5KVVA 8MHTA 1J24A 4RIEA 3R5KA 1GRNA 3QNMA 3NCTA 4I6EA 4DQLA 1DFGA 3DEAA 3OQIB 3RRBA 1B2LA 1USIA 1FMFA 3MWKA 2ZSEA 4QJ3A 1NBMA 2PTHA 3E3OA 3NUQA 4FUTA 4JKYA 4MV0A 1V8BA 1NJ2A 1C9DB 3F4LA 3IQHX 1L5QA 5BYJA 1XUOA 1FYEA 1MAAA 4W6QA 2G8NA 2FP4B 4HV4A 4HB0A 1OASA 1BJTA 3QQPA 1JL3A 2G63A 3O2NA 1G5QA 1V4VA 1VJGA 2ACKA 1J8QA 2D1SA 1JQEA 1H0HA 2QE7D 1L5OA 1ZITA 1YBVA 4FSXA 1LVHA 3TPCA 3VPCA 4CLOB 2VF7A 4IGKA 2OM6A 4HTAA 5HKOA 1V37A 4FGUA 1ULUA 4G97A 4C89A 3I1IA 1KZGB 4UMDA 1UKEA 4TSFA 3SMQA 3PKJA 3UJHA 4L57A 3UHOA 4KAJA 4EA8A 5I4CA 3UW3A 1E2QA 4F5DA 5C18A 4X1OA 3HXLA 3I5XA 3I09A 2HHHB 4YP5A 3HKDB 1QE0A 4QELA 4OSOA 4CFYA 2VQFB 1CIJA 3H05A 4KYTA 4BDTA 4PWYA 3S2ZA 5JJBA 4RXMA 3MD9A 3O8BA 2PH3A 2FEOA 5DKFA 1F4LA 2E0IA 3ZWQA 3B1WA 2J59A 2QN6A 4IZHA 2HXYA 4JMLA 5BQPA 3IAHA 2IXFA 4B79A 1QAMA 3CG4A 4NPCA 3WYNA 2OYCA 4ENSA 4RK4A 3EZXA 4FMCB 4HJXA 3PDIA 3OT1B 5F7ZA 3VZRA 3QBTA 1T3LA 3MUNA 4PE5B 2IZ0A 3ZDEA 2C7OA 2EWVA 5LMZA 4LC0A 3G0DA 4PAOA 1YI1A 3X3HA 4R1QA 1ZYUA 1SMKA 1XCLA 2NV2B 1YMUA 3H3FA 4XPIB 1ADJA 1RVDA 1WV1A 2VDRB 1BXGA 3KR0A 4JLKA 4WOCA 3EBPA 3TX6A 5BMVB 1HRDA 1SUPA 3C0KA 3K9QO 1XIVA 5E1OA 2PX6A 2PUFA 5I7HA 4MGHA 2O2EA 2YW2A 3WGVA 2QBYB 4D9BA 2IE0A 1E89A 4LV8B 1P2GA 3ROFA 1X14A 5CVCA 4UMVA 3GYBA 4OXIA 1Z28A 2Y0CA 3L46A 4OHRA 4DKXA 3LYLA 4LE0A 5ENDA 1U8ZA 4WGFA 4LECA 2X7JA 4L3VA 4G0OA 4MR7B 1YHNA 3SI7A 1SUFA 4R01A 3V4LA 4CT4B 4WK4B 1NWHA 2B5OA 1N8KA 2JIZD 4TV9F 4WT7A 2PBZA 5AI9A 3RWMB 3HU3A 3T34A 4KQ2A 1BAPA 1MPTA 5TS3A 3VBCA 3RV3A 2DR3A 3RM3A 4C9BA 1ZC3A 5BVGB 5AKEA 4EQZA 2IXDA 4YRNA 3P71T 4ZVNA 1XTKA 1B3BA 2W8BB 1J8MF 3AW8A 3PHCA 4O5OA 2E9SA 4MWDA 4D3YA 2QDKA 4HQKA 1M2KA 5DM4A 1DJNA 4JLNA 4ER3A 4ZKDA 1S3IA 3L93A 4GRDA 4DR1B 1XMSA 2NU7B 1XQYA 1V8PA 4QEKA 1Z6GA 3C8ZA 5JFTA 1A9XA 4URZR 1NSTA 4EB8A 5K0FA 1J0CA 4K8OA 1MAWA 3ICOA 1MB9A 1G3IA 5KU7A 1PTJC 4P7JA 2BKUA 3EFBA 2AYYA 2QX4A 4HH4A 4UE2A 3L7AA 5B55A 4IDAA 2MHCA 1ZIXA 4K87A 1VHLA 4TQAA 2ZUVA 4FMDB 3ZWBA 1JAZA 1AC5A 2FUEA 2VEDA 4MRRA 4MAFA 1UBKS 3DDUA 3L0OA 3B9BA 3SZRA 5AHKA 1XXLA 1MMFB 1A2QA 1IHUA 2PJUA 5EA2A 4BFLA 3OIUA 2O3RA 3PPXA 1CUEA 5CIQA 4DGQA 1BKYA 3URMA 4ZP1A 3GBPA 4XARA 4EPXA 3M6WA 3UXMA 1E1NA 2W6MA 4Z8XA 3VR4H 3ZZ1A 1MDBA 1Z2CA 4I99A 3IPCA 4Y9TA 2HXSA 3WLHA 1FNCA 2CNOA 3HA5A 1UCFA 3S5UA 9LDTA 1JIXA 1MX3A 1XTBA 4WRRA 5DI9A 3VSEA 3HL4A 4L76A 1A2BA 5AVKA 1CB0A 4BNHA 1U2PA 1JQJC 2XODA 5ADVA 3QE2A 2RHHA 1JT9A 3BH6A 2FWNA 3CEMA 4MYSA 1I7QB 1TT5A 3MGGA 3CX8A 1XCGB 3D1VA 1J22A 4HMQA 3IV6A 5HP4A 4KXWA 3RYCB 1F1JA 2ZFUA 2QTHA 3DFKA 2FEXA 1WP4A 2ZBVA 3E4DA 4TSKA 1KJJA 3T9CA 2RKOA 2W6ZA 1X7DA 1BS1A 4HYEA 4JJGA 5HIJA 1R4MB 1WNTA 4RK0A 2ZJ8A 3P94A 2IEYA 2PWAA 3MWEA 3ROKA 4A7PA 1R6BX 1V5WA 3LCVB 4L5BA 1ZRHA 5JNRA 1I30A 4MO2A 4XM2A 1Y6JA 2NUTA 4JBLA 2J3MA 3IT3A 4QE3A 3IMCA 4LW8A 4KOAA 4LNUA 3DEYX 4YDRA 1EK2A 3L06A 4HAUA 821PA 5I8PA 4OI0A 3PIIA 2DWUA 2PAAA 4OMFG 3UMYA 3U44B 5EMMA 3DVAA 2ADFA 1SG6A 1TUIA 1SBYA 3ABSB 3BCUA 1GGMA 5CFQA 2ZYHA 5F3WB 1UT8A 2G25A 4DDHA 1TTHA 2VYQA 5J4KA 5AESA 2AW5A 2WTMA 4GWLA 2WQ7A 3IOEA 2PX8A 3RTAA 4BX0A 4CNBA 1UBCA 1IYZA 2C4NA 3NGMA 3Q1LA 4HB3A 1TM1E 4RD0A 1S4MA 1BDBA 1L7DA 4AVYA 4CQMA 4O4IB 1QFZA 5ALZA 1LRKA 3EYAA 4FVTA 1O6GA 2NXWA 4JYAB 2HD4A 3GLFE 4DJ5X 5AR1A 1FNBA 4DPLA 5KQRA 4PNEA 4W5NA 5KPJA 4ZXPA 4LNAA 3RR2A 3VR5A 2BGNA 2DJ5A 2RK4A 1V5IA 4GBGA 4UVGA 1RM3A 2ZJ4A 1I3OA 3WJ2A 1VJRA 1A7JA 5CB4A 4EW6A 5IX8A 1M73E 1WSDA 4DMKA 1GGVA 2A30A 3RSOA 1KFEB 2JJ8A 3MN1A 1HTWA 2Y99A 5CH8A 5HX7A 5DXAA 2XMDA 4JA2A 3OPNA 5AW4A 4O6VA 5YASA 1RJFA 2W2MA 3GUYA 4OB8A 5BV7A 2JRCA 2OFWA 4CLRA 3H18A 2IXAA 2XKJE 3LUPA 4HN2A 4ND6A 4R6XA 4FB4A 1UT5A 1U65A 3I6BA 1WU8A 2WJZB 1W9HA 2R5NA 3LNTA 1OXTA 2ZE7A 2X4IA 2A9FA 2QN9A 3Q7QA 1EUZA 5SYNA 4OLFA 4HVTA 4LUCA 4NLLA 3LC7O 3KQUA 1UXJA 4YT8A 2H08A 4OX9Y 5KJEA 2HW8A 1E7QA 4O29A 4MCHA 1PJAA 1XU7A 3LQYA 1XXHA 4HS9A 4RHFA 1IPFA 4KK4A 2O2JA 2B9EA 3GJRA 5JXGA 1PQ4A 1E3WA 4HDKA 4CNQA 4ASUD 3A28A 4O08A 4Y30A 1U7WA 1X92A 2EGHA 5JYCA 2Q7DA 3DD5A 1PZXA 2C88A 2ILVA 3K4PA 4EF5A 4O3FA 3BMOA 4WCFB 2VHJA 4IDEA 2G7MC 1A9RA 4H4CA 5EFZA 2IHNA 2GCEA 3QELB 5GV8A 2EVWX 5L7YA 1LKZA 2BTOA 1B6RA 2ATEA 1NVAA 1XZDA 1IOVA 3CLTC 2IU4A 5AYVA 1OX5A 1UPUA 4RK5A 1CCWA 1VZ3A 4FW8A 4GL2A 4LY6A 4Q18A 1QHXA 4TUYF 3W4IA 3DOJA 4YJ2B 1OKKD 3EF3A 3EGIA 4LE2A 4UCFA 4Z86A 5J2TF 3W2EA 1YE3A 4R51A 2X22A 1B8OA 2WPDD 3QLTA 4PZZA 5I7RA 5FNVB 2QL5A 2V7BA 3MTIA 2YXEA 2BFNA 1CG6A 2ZSJA 3MSXA 1QPZA 5FUBA 1PV1A 2B78A 1FC0A 5AUPB 4KRGA 3UA3A 4AC9A 4ZU6X 3C39A 3TH5A 1K7EB 3CEAA 1RPAA 2WHRA 3DYBA 2Y1FA 3IOBA 1FYWA 5HIAA 2EP5A 3NNNA 1P9NA 2WTNA 2V7TA 4G26A 2CE2X 4BMNA 2SCUA 2CFIA 2GRUA 4E14A 3DVLA 3IBSA 3ZOZA 2CVQA 2BEVA 3A4YA 2C2OA 3ZOKA 3IAS1 3STXA 4JB2A 1XD9A 1KO5A 4M0PA 5A4JA 1CEXA 5I5EA 3EDYA 1TCCA 3KEOA 1T3GA 4NJOA 1OXUA 2MR5A 4PQRA 4GMFA 4R1OA 4B73A 4KWHA 1SVNA 2XMRA 1BTOA 1MP0A 3MG9A 4OBBA 1NW3A 2ZYDA 5F7XA 3C5EA 5CFRA 2F8LA 4ES6A 5BN4A 3IE1A 3RQSA 3R4CA 3TF5A 3AV3A 4IXMA 3ASVA 1T9AA 1L1RA 2IYEA 4NJMA 3R09A 2IIQA 3RNOA 5L8VA 3D3NA 1Z45A 5DLYA 4DLLA 5ALDA 2OXFA 2WFLB 2YZ2A 4CG0A 1Q7TA 1A9TA 1K98A 3GVHA 4EGFA 2VQEB 1CP2A 4DV6B 3D7MA 3DHVA 4CG2A 2PANA 1AKRA 4US2R 4J6FA 3AF0A 3HFGA 2CLLB 1JTEA 4YHHB 1MBZA 3QOFA 4BLWA 1LLUA 1DV1A 1VP3A 1WDWB 4IGAA 4TZKA 4DB2A 3CXRA 1DBRA 4WXMA 4D4IA 1J2YA 4WFIA 1VG1A 3AP3A 2LE0A 5JAIA 4WNAB 1S8FA 1UINA 3WJAA 4WOBA 1JLSA 2FEPA 3HBFA 5I9SA 3L05A 2QG6A 1O6FA 1OLOA 2CVOA 4N0DA 1K0FA 2OE2A 2VLBA 1BA2A 2GAJA 1BYUA 3F46A 4D9HA 1RYZA 3C87A 1KY4A 3FUTA 1U0GA 3GJ3A 4KI7A 4YWJA 1E6CA 1LWOA 3VDNB 3S1SA 2WE8A 4OHFA 2WP8J 3HXKA 3JVDA 3N2ZB 3FGOA 1M1ZA 5ECGC 4GI7A 4MZXA 2ZRHA 4NFHA 1Z0IA 1PX2A 5BWOA 4X7BA 1SBTA 1I0LA 4K9LA 4MUXA 1IU9A 4HWKA 1H42A 1Z15A 1ZMOA 1U4OA 2HU5A 1PEKE 3OT4A 2A57A 1F3OA 4B1FA 3KSMA 6YASA 1B14A 3I5AA 4QDOA 5ALOA 2WIDA 4FGWA 4IWXA 4MULA 4I50B 1PNRA 2ZRDA 4QSMA 3GDFA 5H3LA 3WGHA 3G2KA 1ZDMA 2A9OA 3T5PA 2FSHA 3CYFA 4HG2A 4YAFA 4OAPA 4KW7A 3UK2A 4FK8A 1J0DA 5FOWA 3V48A 1L4HA 3ZU4A 2DHRA 2IHYA 1PU2A 5A4FS 4BNMA 2WVAA 1YRLA 1GPUA 2NUPA 2Q4OA 3EXFB 1B0UA 4RV5A 3VRHA 5AJTA 4C6RA 4OXKA 4QNMA 3TLJA 5F98A 4MTCA 2XB2A 4BY9E 4ZO4A 4EECA 5I4IA 4LA4A 1J09A 1DXHA 3EDCA 4KO4S 3HJBA 4UDNA 3ITEA 3PDHA 4WNCA 1LI7A 4KYVA 3O4FA 3ELDA 2RGNA 1KQFA 1BRTA 4YBRA 2JS7A 2R8ZA 1YGPA 5E9WA 5KNCD 1QG6A 2CLOB 1I1QB 2VC2B 3D5TA 1L6IA 3GJTA 4JJZA 4M46A 3SJ7A 4D9NA 4QT4A 2EFJA 3OHPA 3TXXA 2OCXA 4I0WB 2HPZA 3VDQA 2Q5OA 1K63A 1ZUIA 4NCXA 3TVYA 1XRPA 3R8CA 4EG7A 2ZB4A 4OHOA 1ZQ1A 2IUSA 2ZWMA 2HRBA 3DWFA 4IQGA 3TWOA 5FOSA 3X1DA 4B80A 1ZWLA 5LL6P 5E4FA 2EJTA 3OC6A 1B16A 2KBFA 3P0JA 4OIFA 2DUMA 3ZGVA 2XA2A 1DFHA 3GC6A 5KTRA 4NJEB 3HA7A 3WQHA 3QKTA 4QD3A 4HN9A 4EHAA 3WVNA 1LQUA 1MFPA 2G8LA 2AFHA 4IX1A 3SG0A 2ADMA 2G0AA 3GRZA 1LC3A 2J7PD 2Q5FA 3I23A 3L18A 3T7TA 2QT0A 3PXEA 4P0PB 5DHQA 4C4OA 1OTXA 3HY4A 1K8ZB 2JAOA 3OQ6A 2OZPA 3LW8A 5KOYA 1GRVA 3FWPA 4HAYA 4CL0A 3TIIA 4H17A 4XGRA 4TLMB 3WWDA 4ENPA 2QD4A 5CFOA 3HWX1 5IKXA 3DFFA 4WBNF 1G66A 1V6CA 3M5DA 4U02A 5IEBA 1R8YA 2JBAA 5BP7A 1BVRA 5CDTA 5EIEA 3EGCA 4GDMA 5F5XA 1EFKA 2YJ5A 5DNVA 1FTQA 3WQRA 1V1RA 1XX6A 1E8DA 1K9VF 1M8KA 4JC8A 1CERA 4K81B 4URYR 5LYYA 4ATNA 3AFGA 4ZZ0A 1ZK2A 3MD0A 3FMPB 4HWGA 3ZN2A 1OU4A 4PAGA 5I7OA 3D2BA 4RSHA 1FFDA 1LK5A 1U4SA 2VNIA 4BFTA 4YRGA 3QVVA 4F4FA 3HTXA 3R6TA 4JBHA 1ECJA 2GCOA 2V6JA 2HBYA 2OC4A 2XIJA 2A6PA 4DLUA 3G0GA 1V6SA 2QUBA 3RAPR 2FLVA 2ECPA 2J6HA 3R6DA 5A4AA 3FWKA 3RF6A 3GFBA 4DLPA 1UOPA 3P0RA 3ESXA 5DN9A 1WHSB 1S3GA 3E8SA 3FOCA 1Z06A 1OZAA 1YB5A 3GAZA 1W0JD 4RMJA 1NVMB 3ND5A 1SRQA 3ZWCA 1J8DA 3FE2A 1WPRA 2L2QA 3CBQA 3TVDA 3C3JA 4Z2AA 3WIOA 5C8YB 5KX5B 3HL0A 3WBBA 4D26A 1R6VA 5KDDA 4GKVA 2H5EA 3NDBB 1WL8A 3SQDA 1LBTA 1KQNA 3W78A 1PZFA 2HF9A 2ZRPA 4G8CA 5IMBA 1W25A 3TGWA 3WNDA 3A6FA 2HY7A 3UMRA 1ISJA 1GCIA 1Q20A 3Q7TA 3LXXA 4GD3Q 1SCNE 1RI2A 4Y9SA 3SU8A 3IAUA 2ST1A 3LUFA 4OQFA 1XLVA 1ZR4A 1UM8A 3DYIA 1A97A 3F96A 3U4MA 4Y2YA 1FFHA 1AUOA 1RBQA 2BGTA 2BMVA 2X5OA 2V1XA 3KOWA 4JLMA 4Z4GA 5K4AA 2PMKA 1ISFA 1HBJA 3MC1A 2B1QA 3HKBA 5MN4A 2UU9B 4NE2A 4H31A 1Y80A 2CYBA 1JJAA 1MJFA 1E4EB 2F1OA 1KFBB 2WWIA 3STYA 1W88B 4MS3B 4KWCA 1PFKA 4J2TA 1C30A 4EY5A 2GPTA 5HRAA 2UXCB 1FRNA 2OV6A 1B1AA 2WWGA 2DG2A 2X0RA 3UGTA 1NI4A 3BFKA 5IFKA 3WGKA 1HEYA 4BBAA 4RIFA 3FNQA 3HP1A 4Y6QA 3QVJA 3QEMB 3BXXA 2O4CA 3DF9A 3DT8A 4A36A 2OZLA 2RCYA 2F8MA 3KWLA 3QPCA 1JIVA 2GLUA 1W49A 2XUQA 1BN7A 1FS4A 1L7VC 1G3QA 5DM2A 4F2DA 2OK8A 4TKUA 1GNRA 1QC5A 4D6XA 5B4UA 3DMGA 3EARA 4MUGA 1IY0A 5FO0A 4F1WA 5BRAA 5ITVA 3L2OB 5KSOA 3FXAA 3WIBA 3JQGA 4OL0A 2MIIA 1DCMA 3L0DA 2E21A 1IUNA 2VHEA 3FIUA 4RDHA 5TEWA 3W5IA 3X1WA 2BEKA 1N3IA 4IDCA 4DOMA 4R1NA 1C7RA 2WJ4A 4Z0NA 4X8HA 3QEJA 1YZGA 4O4HA 4D42A 2ZUEA 4RMNA 1CK4A 4NH0A 4EHIA 4G5SA 3H42B 4BVGA 2V5AA 1C7EA 1XRSB 2AN5A 1GGNA 5DGHA 5F5NA 2ZSHA 2ZVJA 4N54A 1SOUA 4MKHA 5BUSA 2H2FA 2RHWA 2V74B 3O1JC 1P31A 1XK6A 4KQMA 4EPTA 4XCQA 4F6RA 2WVHA 1L6RA 5JLJA 2N75A 3NIGB 3AILA 3MBOA 3GH1A 4WK0B 3TR5A 2BZ1A 5D85A 4DSAA 1JYSA 2HF7A 4U0JA 4CHGA 5ESWA 3AVXA 1P44A 2O1WA 1PNVA 1RHUA 1UJMA 2C0QA 3A9VA 3ZI0A 5M3BA 3TLAA 2XTAA 1XYVA 5AK6A 1T10A 1K88A 4ESVA 2EEZA 4ASUA 1KORA 1TVCA 3OJFA 4HX5A 3DV2A 4A27A 2HC9A 5AM3A 1HE4A 4AZSA 3GNQA 1BYIA 4OUDA 1TA0A 3E9QA 4FMCF 2H8GA 5L6MB 2SICE 3R7DA 2TMKA 1YTLA 2CE7A 3KV3O 1ZK3A 2CMFA 5D86A 4LGMA 3DM5A 4CN8A 3OZGA 5KREA 3MHTA 1L8LA 2GFIA 4DCTA 4TWRA 4Y2GA 3QA3E 1EGQA 1HTBA 4B3CA 5HPYB 3E2IA 2HWWA 3VKUA 1CF4A 2CBZA 4XFDA 1ZRSA 1VPLA 5BMVF 2IW1A 1XMJA 5E1DA 5H5JA 4WBXC 3B48A 1HOTA 3ZBPA 1XZNA 1U90A 2IGBA 3FWYA 1DBSA 3K6JA 3Q3HA 1RLMA 2J5BA 3QY9A 2PVSA 2Q9AA 5K9ZA 4M9RA 9MHTA 1DTEA 1B00A 4N7RA 2R1UA 2NZVG 5JSUA 1JJ7A 3ED5A 3OQMA 1H05A 5DTIA 1HNZB 1FXWF 1TZJA 2OILA 2R1VA 1T8SA 1UBUS 1GY8A 1V5FA 2BFFB 3BZBA 1BE6A 1E2JA 3AH8A 3P45A 1NXQA 1N6KA 4TMZA 2R96A 4MUAA 5EPEA 1K92A 2B8NA 1ONBA 1XDGA 3V4FA 1K7CA 1RCFA 2YH2A 4H7IA 4PAQA 3ZLUA 4WLOA 5EIWA 4JXXA 3S44A 2D06A 5KYUB 2P9EA 3A2NA 3HBAA 3BTVA 1H94A 1N2OA 1W0CA 4YRFA 3WHKA 1G63A 5MHTA 4QHTA 4B4OA 1YI8A 2ZK7A 1NKTA 1KA9H 2HQOA 2Q5CA 1QP7A 1I01A 2Y4NA 2J07A 3A3KA 1CUFA 3ZQKA 3ZK8A 3EDMA 1E92A 1H1LB 3NYQA 4PFKA 3PUZA 1J5EB 3Q40A 1K3UB 2BTQA 1XDDA 1UBFA 4H7JA 2HHJA 4IIFA 1T24A 1TAQA 2FPPB 1HNNA 2RCNA 4KTTE 5EMJA 4BB9A 2XYHA 5KWIA 3D8SA 1FLNA 1VRWA 4TLDA 1YDGA 5EQDA 4ZOQI 2CN1A 2FSVC 4FMDF 2HRCA 5EJ7A 1E9VA 3PRJA 3N2IA 1BWSA 4B84A 1V9SA 3MBIA 3ZU5A 4BZZA 4RQUA 1FFSA 4COOA 2ZGVA 3E9NA 4ZCRA 1QLWA 2GPNA 1UEJA 4E3ZA 4CL2A 4UTVA 3VVCA 2YOFA 1ZJ6A 2II6A 3BORA 3MCUA 2O2XA 1Y63A 2IZ7A 2NXNA 2A9KA 3WDMA 2D0PB 2IIBA 5DYYA 3CRRA 4OQMA 2WKWA 3F6PA 3VH2A 1U6KA 4L9SA 3RT7A 3M6LA 1GO2A 5FL7A 2VJYA 3OZEA 1PK8A 1U0HC 2BH9A 2XHZA 5DTEA 3QEBZ 2IH4A 4HTFB 4IZ6A 4HVAA 4NU5A 4ER7A 2QD2A 3K1TA 4OAOA 3FSEA 2MINB 3FSJX 4LMRA 4JB3A 3RG8A 1FRZA 2NNWB 3GPBA 5KVAA 1M7HA 2Y2VA 5JMPA 4PHGA 1UKZA 5CT9A 4LXQA 3ZWYA 1FUKA 1WDKA 3WS7A 1NJ5A 2NSLA 4MAAA 3GLHA 4EGJA 2GN8A 2JVIA 4LCBA 1OBCA 3BK1A 4BQIA 2WILA 1KOFA 4LTMA 3G82C 4QU0A 3CA8A 4PYKA 1KEKA 3CO0S 2P0YA 3EPLA 4TWIA 4DFDA 2GS9A 3EFOA 5JHGB 3DT6A 4NICA 4REQB 5JPDA 3MCTA 5IT4A 4UJ5A 1PDWA 5M7EA 2V9CA 1QFMA 4M6WB 1QLJA 2QUJA 3AOGA 3SQOA 2NO1A 2H17A 4P2BA 4XJXA 3BSFA 4ETWA 4J7CA 3IHWA 1FXUA 1EX9A 1GHTA 2QAGB 1Z5GA 1OE0A 1ZVKA 5HQ3B 1LEHA 1RRFA 4GRIA 3WKAA 1OI7A 4NARA 3FM9A 3WB9A 3H9CA 4E7OA 3T7EA 2MYUA 4CCYB 1P5RA 2CK3D 5SYMA 5FOXA 4RD6A 4YJFA 3PI6A 3D4OA 4ZAGA 4TTQA 2OZVA 2FEAA 3BK2A 6CHYA 1U7OA 5HZHA 1JNXX 3AW9A 1Y82A 3CZAA 2PUJA 4G37A 5EPUA 5ES4B 2QJOA 3Q2IA 3GCDA 4IGFA 2XWJI 1KYZA 5KNCA 1VG0B 1Q0ZA 3A70A 4ZGBA 1X7XB 4RY0A 2BDUA 2BCGY 3UV3A 1YR6A 3W5JA 3FDFA 5ED4A 2BI7A 5JWHA 1MR3F 2ZJYA 3R77A 3U80A 3K6KA 4HZUB 5KJCA 1NW4A 3D4PA 3R9XA 2CCKA 1PT7A 4IP0A 2QU7A 1R0LA 1VE1A 3K9GA 4MXDA 3IEVA 1DRVA 4OP3A 4UBMA 5EP4A 3AINA 3DL7A 4G5GA 3G88A 1PEAA 1Z0ZA 2HQ1A 3SBEA 3HY3A 3O73A 1T4MA 3V4PB 7AT1A 2GN0A 2FDRA 1Z5NA 3TLMA 2BEWB 1Z4MA 1MW9X 3FDIA 4D92A 4IHAA 2QQFA 3R0IA 5BNIA 5JH7A 2J7PA 4I8DA 1OFIA 3DXZA 2Z8YA 1T5BA 3EYWA 2X5XA 1VJ5A 4N5IX 4GP7A 1X1CA 4QECA 4PNHA 1SULA 1N5LA 4ARAA 4NBTA 1B73A 3HFRA 5BVHA 1R4NA 2C9ZA 3NALA 4UNSA 1CNEA 1JQKA 4WXEA 3D8UA 2OLKA 3PNMA 5F78A 3IAFA 2PIAA 2C82A 3VOSA 1E1MA 1G2IA 4ECAA 1Z5WA 3F3YA 5DJ5A 4R05A 1QG4A 3GWGA 3IOMA 3OE7A 4MKFA 1VC2A 3JZDA 1L5KA 3VAAA 2CVHA 1JHXA 1C3EA 3UG6A 5CDYA 3EPKA 1F4PA 5CDSA 3WMFA 1T26A 4EUNA 5CCXA 1E9BA 1OV6A 4PW0A 3TBHA 4RDXA 2QXUA 3AEXA 3D8NA 2CHVA 2JEYA 2SECE 5T8KC 1BX0A 3G2PA 5KVQA 3IVAA 1C5KA 2ZAOA 1GL9B 5KVSA 1KAHA 1W47A 4PSDA 4P5DA 5JBNA 4L4UA 2XT9A 4P3KA 3PVSA 2AI3A 1NL3A 1RFGE 2DLNA 4LV5B 4D9FA 5IUNC 4GPBA 1QO7A 1EP1B 3FVWA 3DO6A 3P9ZA 4YJ2F 3TZCA 1C0IA 3KQPA 3U4CA 3ZW8A 4BKRA 1N5IA 3L92A 3NG1A 3ZU3A 1K1EA 2J3QA 3NC1C 1I3MA 3JYNA 2F43B 3Q5DA 8ABPA 5FNVF 2XADA 5HE8A 1TLTA 3IXQA 1T1IA 5AXCA 3DVQX 5CDUA 3U6BA 4UNQA 5JAOA 4CMHA 2IKQA 5HFAA 4I1RA 5BURA 3GJ8A 2CFTA 3SR4A 2PSEA 3HR8A 1J1ZA 1X1BA 1Y1PA 1Y98A 4OGFA 1J0AA 2BL4A 3B1XA 4Q24A 5LBUA 2DTXA 4C7JA 1XPRA 4P0QB 1ZCJA 4H3HB 3SHOA 3EA0A 3MAJA 2ZATA 1OAKA 3CZ9A 3D6HA 5TF0A 4N3GA 1T2CA 3KKOA 1UBTS 2D5AA 3TAXA 3MHPA 4OHVA 1WQ1R 1FSGA 1ULTA 4ESOA 3LJKA 5KWSA 4D5EA 3ISTA 1YKGA 3EIWA 1ZONA 2W6ID 1RYMA 4YMIA 5ABPA 1SHJA 2BISA 3HO8A 2QIPA 3KTAB 3K9WA 3GI1A 1BCSB 5FWDA 5H81A 2UYQA 1C3OA 3KSUA 2MSEB 3V7WA 4K9DA 1XTIA 2H92A 4RKFA 5AKHA 1QE5A 3CZRA 5DYGA 1CNMA 4YALA 2Q6VA 1TNDA 3KQMA 2I33A 1N8SA 3I6MA 2JH9A 2Q6IA 1H1TA 5HGJA 4Q4DA 2P41A 4EX6A 2G88A 1OVGA 4L6CA 4FGSA 3TUIC 3AEZA 1F6BA 3ZR4B 4NYJQ 2ZANA 2G72A 2UUPA 3ZJUA 2TECE 3HEBA 4I81A 2KM1A 3LAWA 3F3SA 3R0XA 2XDWA 3C8UA 4YUYA 3WXBA 3DMYA 4MGYR 2ZBGA 3M3HA 1N9GA 2FFHA 3K0FB 5ECYA 3NTLA 4ZHSA 4DCUA 3U1VA 2YVAA 2PS1A 4NECA 1UR5A 4AJ2A 1U98A 2DH5A 2GEJA 4ZALA 3DB1A 3EULA 2Y76A 2E3JA 2WD8A 3QVXA 3WJ7A 1F2TA 3D0OA 2QN3A 3UTCA 2AMVA 1PSZA 4GC5A 4ZI5A 3WISA 1K97A 4YCCA 3KJFA 3RPEA 3NDJA 3AF5A 5HXAA 3IQXA 1XZPA 4G5FA 3ZKAA 4KQWA 3UJ3X 4JUDX 4DADA 4HDRA 4DIMA 5CX4A 1RBMA 4WOPA 4PXSA 2EYUA 4NVRA 5DULA 5J59A 1ZOSA 1C0LA 2M1XA 2ZRGA 5GIOE 1BMDA 1E60A 1Z6YA 1FFXB 1WRBA 4KKXB 3ZEIA 2OBLA 1V95A 2Z5VA 2P75A 4MITA 3R5FA 4I50F 5GJWC 2YQZA 1P7PA 1FRQA 3DCIA 3MPUA 1CS4C 2CHQA 5JASA 1G4HA 1N3YA 3R4VA 4TYYA 1K7YA 3ZD6A 3D8BA 1TLFA 4XH9B 1O94D 1XPUA 1LBIA 3N7TA 3LLVA 4JL6A 3PNQA 1QIGA 3IAAA 5CFMA 1NYLA 4MV3A 4A1FA 1K6XA 1Q91A 5K51A 3WLAA 5ICFA 3RV4A 4Q4AB 3KWMA 1YMQA 3LC0A 4AB1A 4EB6B 4MW6A 5BRJA 1M1YA 2FSUA 2QRNA 3IQGX 3QKUA 4OCZA 3FWNA 3O3MB 3VTKA 2I87A 3MQ2A 3OFKA 4PQEA 2A0UA 1RYBA 3KDAA 4MR9B 3CVOA 3ZXUB 5BOVA 4C76A 4ZJYA 4BEVA 5CTAA 4ZANA 1U2RA 1FFEA 5LIRA 3U4GA 2QY9A 2YYYA 1L1FA 1WG8A 5LUAA 5IBRA 1EQUA 4BECA 1ONSA 1KDOA 2XD4A 1P5HA 2HXGA 2UVDA 3E0XA 3BD9A 5AM0A 5DYTA 3WLQA 3HZHA 4U9UA 1Q0UA 3QVSA 4X00A 4EYGA 2QWXA 1KY3A 1WZUA 4RS3A 1ZIYA 3U3JA 2ZIWB 1V9CA 1CSEE 1EBUA 3LO8A 3KXPA 1BWQA 4MA4A 5FWAA 3HCAA 4C6TA 1QX4A 2YBDA 5CVTA 1DZIA 4BL5A 1EFCA 5FULA 2PD3A 3LFHA 3SYLA 9GPBA 4UBOA 1LI4A 3EFEA 4BLQA 4B2YA 1JDNA 2LD4A 4B3FX 1TYBE 1QIIA 2GKSA 5FTJA 4RV4A 3BOSA 4PLHA 4J16C 1P29A 2QGFA 5EUBA 4D4KA 3TGLA 2QZ4A 2CLEB 3PBKA 2CLDX 1K8XB 2QRMA 3A31A 4BNFA 2YKGA 4MDEA 3G0HA 1K06A 1NPDA 4D9KA 3T3MB 1JKFA 1P74A 4RE5A 1Q92A 1I4EB 4D3SA 4XASA 2YMMA 1FP1D 3ZBQA 4TGLA 1F1BA 5EGSA 2OV1A 3BSWA 1GIAA 4PS0A 5BV8A 3OZVA 3UOWA 2XNCA 5EZ6B 1UBSB 3EF1A 4RVOA 2WHEA 3K0KA 3ZH2A 4I36A 3GZNB 1GKIA 4BNNA 3U26A 2G1UA 2FPUA 1F2UA 1JHPA 1B2RA 3QY0A 3P0HA 3U3OA 5A6VA 2GD0A 2PZFA 4IHKA 4EO9A 4N4AA 3UT5B 1JG6A 3RRZA 1N2CB 4DVJA 1RXSA 3G9TA 3KSDO 1LTKA 4B3BA 4GR4A 4KR6A 3VPFA 2GCPA 4RLSA 2FMTA 4RABA 1PUJA 4RD2A 1Z2DA 3V1TC 2V7EA 1TIKA 2P9BA 2YC4C 4B2PA 2C1XA 1W19A 4L9AA 4KDCA 3T9AA 5ALWA 1ODCA 3F7MA 3ZHUA 1Q95A 4ND7A 4PHFA 3PRHA 3LBFA 4UUOA 3MT0A 1KNXA 2NQTA 1SU7A 3CO5A 5C8YF 1J0EA 1MQ9A 1RWVA 1Y3DE 5KX5F 1UJ4A 2ZDQA 7REQB 4PO9A 1SCQA 1TJ3A 3L6CA 1HQYE 4FXOA 2XYQA 3DAHA 3OZFA 2Q28A 4UTXA 3AVTA 4PIVA 2WG2A 1FNDA 2VAXA 2AYZA 2I71A 4BN4A 3GLIE 2FSIA 2NZ8A 4C07A 5CVEA 4ETNA 2FW6A 4FGKA 3EWSA 1AX9A 1H2BA 3U7QA 4AUMA 3AI3A 4H77A 3C7TA 3EY4A 3SKYA 5C7IO 4RTQA 5E9QA 5LNK6 3KJHA 1W44A 3KKLA 2KS6A 2B0CA 1Y7HA 4M87A 2OBYA 4NBVA 3VU3A 4W63A 3QPDA 5DLQC 1GL3A 4PINA 3TCXB 3QLVA 1RJ9A 2ZULA 3O74A 3RCBA 4BV9A 4N5NA 2XSZD 3GQBB 4G07A 5G1PA 2JLWA 3LCCA 1N33B 3IV9A 1ORVA 1EUYA 4G0XA 4NZYA 4RPJA 2CK3A 1QYXA 4P31A 1OPRA 3WNBA 1CHDA 1O4WA 3PQ5A 3PYLA 2Y8EA 5A3VA 2YZGA 2XVXA 3GF4A 1CEQA 4L6AA 4RGBA 4YWHA 5TGTA 5GONB 3EH1A 3IBFA 3WLIA 1AUPA 4B7ZA 4ZVKA 3AI2A 4M7PA 3W0LB 2QROA 1EUCB 4OF4A 8LDHA 1RLOA 1ZMBA 3HDQA 3QE4A 5DIFA 5IK2D 1IHPA 2AE2A 3I32A 1KHHA 2B94A 3NRJA 3NGXA 1Y34E 3T3GA 4F46A 2QRPA 5IZ4A 1GA6A 1NQ5A 1NR7A 3BTOA 5TMEA 2FOLA 1Q15A 3FNFA 4WWHA 2Z08A 2QTAA 2DOKA 4IM7A 3R76A 4NE9A 3IDOA 3IAM6 5A9SB 5IXSA 1BNCA 1QV6A 2I5PO 2Q8PA 5KYGA 2QGNA 2X8WA 3M3DA 5J2UB 5CITA 5IM4F 2QOEA 4C7BA 2BLLA 1UMDB 4HKTA 2AOVA 5H16A 5T67A 3LCUA 2YY7A 4EW1A 3K0SA 3ROEA 4ZGWA 2HTFA 3E3NA 1KSFX 1E32A 4JELA 3RRFA 1HWYA 3JY6A 2ESRA 4HLUC 4P2GA 1P1CA 1ITZA 3LY5A 4OHXA 5H59A 2XRZA 4FR0A 3IIEA 3AUXA 2PZJA 3HYLA 1H5QA 2CVZA 2P9YA 2V96A 3D4BA 2QD3A 5AT1A 4M7OA 1P7CA 5I9MA 2ODTX 2VRNA 1TF5A 2PLNA 4GMGA 4KIWA 1QVVA 3FAKA 1F4VA 3PGVA 1L4LA 3ZHVA 1FU4A 4DDUA 3M5CA 5KYWB 4B7CA 2V4ZA 4ZOLB 1AIPA 1EK5A 1GXSA 4JCOA 4XM1A 3CT6A 4ZYYA 4BB0A 4GOOD 5HCUA 5JUWA 2WIGA 2XQFA 2QVXX 1DJQA 1E8NA 2IC5A 4ZZ2A 2G4VA 2G08A 3OJWA 5AVJA 3ONEA 2WSYB 4M38A 2LGJA 2X1MA 4OH1A 1HMYA 2H0AA 4FZRA 3UICA 3X2SA 2HNKA 1O87A 1TQ8A 5K0TA 1F38A 1RC1A 3IUSA 2GXSA 2IYFA 3MJTA 4RH0A 1SJ9A 4KVAA 4B6GA 5G0SA 3TQFA 4WERA 2HQBA 4AICA 5HWSA 5IPFA 1SHZA 2D1QA 1B6SA 2NPFA 3ELYA 4AMGA 4NCHA 1NUHA 4AKTA 4LRSB 3ENQA 4BEWA 3I3SR 4OYYA 3DSRA 3SZOA 3PI7A 1E2GA 1ZH6A 1ZN2A 2H4JA 4L72A 1PR2A 1ACJA 3G2HA 1SFRA 2EFYA 3GDGA 2CWWA 3IO3A 5HKAA 5DSXA 1HURA 3AQ4A 3ZWNA 1SKBA 3LCJA 1PJ4A 3GJ0A 4O3MA 2YOGA 2CSUA 5A5GA 5ARBA 4UREA 3SVTA 4QM7A 4IDDA 1O4VA 1Z6AA 5HCNA 4JJ8A 2NVWA 1CUBA 1O8BA 3BH0A 2G6TA 2FAXA 2Z9DA 2AOWA 4MRAA 4PAWA 3U13A 2IPAB 4C7VA 5DYIA 4BO3A 1EFPA 1QYRA 2WYHA 4PLCA 3R7SA 2JHFA 1RE1A 3D0QA 2WHPB 2B2CA 1G7TA 2J0UB 1BMFD 1KAMA 2IOYA 2Q27A 2R6CA 1JLLA 3M83A 4MV9A 1KZ1A 2W6IA 3Q2OA 4WEQA 4WASA 4R7GA 4F3RA 2Y0BA 2FPIB 5ALNA 3GVCA 1ISSA 2V7WA 5K4GA 3NT4A 4B7AA 2WUDA 1BH2A 5L3ZA 4GVPA 1CWUA 1SC9A 3UV6A 1D03A 2ZU6A 3N05A 3GA5A 4HNHA 1X87A 3TQSA 1VJ0A 1AHHA 1W34A 1D0SA 4KGZA 4W9RA 3ESYA 3TIGA 5DM60 1XJCA 4DRYA 4LF8B 4IYRA 1P2VA 2DVMA 3OZXA 4HQLA 3OCWA 4O5AA 2W5UA 2Z2ZA 4IO0A 4Q9IA 2NZWA 2OXTA 2REXB 4B3XA 1E3LA 1GT6A 2R7MA 1EM8A 2JIMA 1CDOA 4WL0A 3R7FA 4GDFA 4CEHA 1ESNA 1KOJA 3ADOA 2IOFA 3ABOB 4RC9A 2RAVA 2YMPA 4V0NA 1G2PA 4NG4A 3JQ9A 4MWOA 4NZNA 1QK5A 4K1LA 1PR1A 1U2DA 2X5JO 1C7JA 4RKEA 4CMBA 2CXHA 2QZJA 4YONB 3KVVA 1WW3A 1ZVJA 1RMQA 2FE4A 1XRMA 5KKCA 1GCUA 3O8OA 1WDMA 1VA4A 5K3SA 5DE3A 4LRWA 1T0PA 4JJIA 4HGQA 3KZKA 3TTTA 1JHOA 2QR3A 4NZZA 3JD3A 2E4VA 4ZRNA 5I9LA 3PTLA 1MNQA 1N34B 5JSKA 3QU2A 4KBGA 3DZIA 4NONA 3UFXA 4EY4A 1W4ZA 3FNEA 5B3LA 1RYFA 1Z37A 4J3NA 1DKQA 5DHSA 1PBNA 1YJ8A 1RAAA 4X20A 4CGZA 2Y1OA 1NDHA 2QU8A 4XR9A 1JDBB 1X2BA 1DKOA 2X0KA 4Z99A 4A6PA 3OQPA 5T8KA 1IWOA 3L77A 4D0LB 3QF7A 3T1OA 1FA9A 4JP5A 3X1KA 2KLHA 3LX5A 2R1TA 4GPIB 4GSLA 2XYPA 2YC2C 3SF0A 3QTTA 1YB7A 3VKHA 2WTXA 2W11A 1LK7A 2OB2A 5EIOA 1B8NA 3A11A 3PC4A 3LC1O 4ZVPA 4EK9A 5BNFA 4KACA 1EX6A 3V8BA 3VC2A 1USUA 1JHAA 4EG1A 4UTZA 2CXNA 2WWXA 1UWLA 2Y0PA 4FBMA 3M89A 2I62A 5DI3A 5G1OA 3LW7A 2CSXA 4HT3B 4AX4A 5JNLA 3OOSA 1OB5A 3L5KA 2FQQA 4JEHA 1K6MA 3ZCVA 1LZLA 1NDUA 1RKXA 2NWQA 1VPVA 4WCFC 2ZCJA 1Y9JA 3VPSA 1GL7A 1QGZA 1PJQA 1XD2B 1E8MA 1TGYA 1YV9A 2BIFA 2R1ZA 4MRVA 4XX0A 3BFJA 4Z0PA 1XDBA 1EE2A 5LB4A 4C21A 4LY3A 4K05A 1E69A 2P6RA 1KPHA 3OKCA 2C57A 1U5BA 1GLGA 4EATA 1E18A 3GK3A 2D6FA 3HCEA 1T15A 2F17A 3VR0A 3SLGA 2LBPA 4KIJA 2J9YB 1E2PA 3F5QA 1NQVA 1S8NA 4R40A 3TRJA 1R0YA 4AYWA 2PR7A 5AK4A 3CX3A 1KK1A 2I3DA 3KDSE 4E2WA 3GGGA 1OT3A 4OATA 4YACA 4FDUA 1ZP6A 3N28A 4DDTA 2H1IA 3KFVA 1Y4AE 2L69A 1JIUA 5CM8B 1MVNA 4H7FA 1U0SY 2YINC 1EGAA 1JFLA 2NU8A 2O07A 2WIAA 4MTLA 2PPVA 4ALIA 4AJIA 5IH7A 1D5WA 2WJ6A 1AMNA 1XT6A 3HB1A 4D9MA 2VQSA 2PA0A 3PC8C 4GZMA 2V3WA 4HGOA 3KPJA 4FZ5A 5H4HA 4RS4A 5CT4A 3G13A 4IINA 4H1VA 3FETA 3LDUA 2X8JA 1UPFA 3F7NA 3TLKA 4BNZA 3EVBA 3ITDA 4IUBS 3ADPA 3ELWA 4FCCA 3TK1A 1GVNB 2P8JA 1BG6A 4WFKA 5AK3A 3MRSA 3QYFA 4M36A 5DX8A 5TGZA 3V2HA 3SNHA 2MSDB 4AWBA 1YS9A 1YCGA 3ZUGA 1H3NA 2GX6A 1VHWA 3QRWA 2GVDC 4XYLA 3HHEA 2WMOB 2QR2A 1U9IA 3LOUA 2TRSB 3O4JA 1JSZA 1QDEA 2AXQA 2OA0A 5CHYA 2YASA 4UOZA 4EG4A 5JNUA 4CM1A 3FNGA 4F04A 3O5AA 3UAWA 4PO8A 2XGJA 1UZMA 3HY6A 4TMTA 1X80A 4E4YA 4L0MA 2XQJA 2L18A 1FP4A 3A9UA 3I9V1 4LGCA 1XVAA 2JJ1A 4MLCA 3SD7A 4PVDA 4EZIA 1JWLA 3UWSA 2DT5A 1WA5A 3UMSA 3SLKA 4M0EA 2GM5A 3K0AA 3EXHB 4CM4A 2A9VA 2VXBA 3INTA 2W4QA 3U7RA 4CTKA 2WVGA 2EGGA 3ZW9A 4ZTZB 2NOAA 3H1FA 4RTPA 2JDID 3REFA 1Q6ZA 1UF9A 3YASA 4OHUA 1C9EA 3C48A 3IPRA 3BMNA 4GBED 3K96A 3TL2A 1ML3A 1O97C 1G6OA 1HMPA 1J49A 4WUVA 1TM4E 3H1BA 1X0VA 2PKEA 4Q4HA 1R1DA 3DMNA 3DKIA 5JNWA 10MHA 4NU6A 2K7ZA 1M2GA 4F06A 3PLRA 1I0ZA 3Q1KA 1YRBA 3OQHA 5AP9A 1CQZA 3RU7A 2IYRA 3CNOA 4TYQA 1WSAA 1D4AA 2CLIB 2UYHA 2ETXA 3WIEA 3OY2A 2I3AA 3WMRA 4B4DA 2G76A 1BDMA 4U2CA 1PQWA 4PYIA 5JALA 3A58B 2FW7A 4REOA 3KYDB 1ORWA 5AVOA 4YRSA 4U2BA 1UFQA 1A72A 2VDJA 1CUJA 5HBRA 2YXPX 3RK0A 5M2QA 3KJEA 2NT4A 5BSKA 4KR2A 3VPBA 1O95C 3JWJA 3A1DA 3SCZA 3PXDA 2B9VA 4E32A 5FUQA 4FC7A 4M49A 4MPDA 3N2YA 2RBKA 4IIGA 3ZY3A 2H2DA 1T1GA 3CLUC 4LK2A 1P3DA 4DLXA 4LXHA 1Q7CA 2DR2A 1HYGA 3PA6A 1W581 4UUAA 2GT1A 3H99A 5B3KA 1YVRA 1QB8A 5LZ2A 3O1IC 2NXJA 4JLJA 3FKSD 1H3EA 1RNLA 5ECDA 1R00A 3L7OA 5CM9C 1N4AA 2RHOA 2X3YA 1THMA 1YUNA 621PA 4B3SB 1W1IA 1V3VA 1YJBA 2QNRA 4P54A 5FBQB 5FUWA 4P4NA 1PK7A 4U9IS 2BSAA 4Z3OA 3ONVA 3NTRA 1EH5A 1GN9A 1V9LA 4PZEA 3HDHA 5T3YA 3WYFA 4IICA 4S1NA 2R25B 4J16A 1PZGA 2AJTA 4Z7OB 1POWA 4JD5A 4C4ZA 4F5EA 1J21A 4A2QA 3C3KA 4M0MA 1ELOA 4RZ2A 4YCDA 5PNTA 3VJKA 3VV3A 3AIOA 5LMCA 3IS3A 5ES3A 1XDWA 3HACA 3LM8A 5LYJF 1KOGA 1Z2AA 3K92A 2XJ4A 1XHFA 4QUBA 5CR9A 2PM8A 4ERNA 5JS7A 4TS4A 1OCEA 4IMPA 5DX1A 2F3PA 1WZCA 1JU9A 3DFIA 4TRMA 5TB5A 4AY2A 1ENOA 5DIZA 1KE1A 2WJHA 1TEZA 1NXXA 2GUWA 2BE7A 4E31A 1Z2OX 3VHQA 2OORA 4LK3A 5TXGA 3SVLA 2HSEA 3AR5A 3F6BX 3R0JA 1GQRA 3ROZA 1I2ZA 1TF2A 1XZ8A 1P0QA 3H0KA 4PANA 4WQMA 4CL8A 1E5TA 1DMSA 3FSRA 3KS9A 4P86A 2NACA 1HE1C 4Q15A 5AKJA 4MW7A 4QTYA 5H82A 4XIFA 3KG2A 4TVBA 3EZYA 4C1BA 4IDFA 4LMPA 3LKBA 2PK3A 4KR9A 2ZREA 1OX6A 3NORA 4FDVA 2HV8A 4BVKA 4DYDA 3G1WA 4HGNA 1RT9A 2HWKA 2FP4A 4DREA 5IT9A 4U8GA 1M34E 2EKDA 3OEHD 3LCRA 1A7UA 1T8RA 3KD2A 1CZHA 1V45E 1V39A 2VTKA 2RG7A 1E9AA 1MG5A 3D2CA 5SY6A 5T6BA 1VKNA 4CLOA 5ICMA 3I83A 3B3GA 2BFPA 2XMGA 4FEYA 3CLSD 1CJVC 3GEBA 5LSAA 4HDSB 5FDFA 2ZIFA 2NMVA 4B6SA 5FBKA 1R6XA 2WJYA 1X1DA 3IB3A 1TYCA 1V43A 4HXEB 4MZDA 2DWOA 1T5HX 4S0XA 5EIFA 3M49A 5C8VA 2QPOA 5EGNA 2F9LA 1T8UA 2POCA 3EXEB 3G02A 5BPFA 1R6TA 1G8AA 1IMOA 3VTAA 1MJNA 4IY1A 4BN5A 4UM7A 2P1RA 4QGBA 4L7VA 1R5JA 1NTRA 2XEXA 3PGJA 1A77A 4WJKB 2PT7A 4AG3A 3EZ2A 5F7OA 2IA5A 3WFIA 4LBZA 3ILHA 1Z29A 3WGZA 5IJZA 3WP1B 3HVKA 3QX9A 5J43A 1LW6E 4DJDC 3NANA 4GWKA 4X3OA 4YUXA 3U7HB 4BDSA 2EJVA 1O0CA 5KHAA 1JGTA 1DP4A 1FDUA 4GU5A 3CUVA 4TL8A 5J63A 5LUBA 3W8NA 3SE0A 4P35A 5HS6A 4C7MA 1GCGA 1WP9A 1BMFA 1WMAA 2X40A 4XPIA 2EZUA 3SLRA 3FCAA 4XIJA 3X1MA 5LOVA 3S8YA 3FPLA 1AB5A 1MA0A 3QBEA 1LDEA 3ZS8A 1OIXA 1PJ2A 2B3DA 2E4YA 3C5VA 1GG8A 1KJIA 1N0VC 2FVYA 3CX6A 1X6VA 4X84A 2VK4A 2QBYA 3I62A 1E63A 3P9NA 2CXRA 1X74A 2GJ8A 3COVA 1N5OX 1ND5A 3H2KA 2XIQA 1MCZA 2PXHA 4LDNA 4B31A 1WXDA 1YBMA 2OP0A 2RH8A 3IYLW 3KZ1E 3MTAA 1LBEA 4Q19A 4WKOA 3SXPA 3SN6A 1GPJA 1XZKA 3DTVD 2XMPA 5JVDB 3UCXA 1ORHA 3WSTA 1NPTO 2PT5A 3F5FA 2ZUSA 3F8TA 4OVKA 4UAGA 2X0EA 5B30A 5BVGA 2X2PA 4D5GA 1PWXA 3T3PB 4DDMA 5E6SB 3UMBA 4CDMA 2Z58A 5TE9A 3UKOA 1MUUA 3ULKA 4KAXA 4K26A 2Z3ZA 5JC1A 5B6PA 3RC2A 1EP3B 4K9QA 4Q1DA 5TMDA 4HAXA 3UPDA 5JCPA 4RETA 2FRVA 4NRDA 1E9DA 3EUEA 3PFWO 2V5UA 2IS2A 4C0LA 2Z6AA 3ER6A 1SU8A 3NBFA 3ZLBA 3RJTA 2ZXEA 3WK6A 4GOJA 2AFIE 4ILEA 1OROA 3K0BA 3O9MA 4Z7JA 2IWRA 1XAHA 2Q50A 1LNQA 4WESA 5SY4A 5EP3A 1ZK1A 2GN9A 3ESQA 1KVUA 1REQB 4OB7A 4GSYA 5J5CA 4ND3A 1OI4A 5CAEB 2JCXA 5TPZD 2XD9A 2IYWA 5IBPA 3QE9Y 1H2YA 3LVBA 3ETCA 1IMJA 5ADUS 1GG9A 1SEVA 1CXZA 2IVFA 1OLUB 2ECOA 4LKRA 4QU8A 1M5TA 2TMGA 3H6GA 1TCVA 3L7YA 2EBUA 2XECA 3CC8A 3KXIA 4IVQA 2IEIA 4BKMA 2ZWAA 4DQVA 2NU9B 4KO1S 2HX1A 1RM0A 3A7DA 1ZA2A 3M6IA 2WE7A 5KCZA 2G82A 2GSWA 4OSPA 5LFAA 1OWMA 4RACA 2DE0X 3N1UA 1TZCA 3L04A 5AW5A 2NW6A 3H87A 4DLWA 2JHAA 5H4GA 1JIQA 1CD5A 1FLDA 1MIOA 1QANA 1JI3A 4F1KA 2DHCA 4IKOA 4OU5A 2JCVA 3SHFA 4AKEA 4A2WA 1UANA 1X7HA 2FWMX 3OU6A 5G0WA 5IVDA 5JDCC 3W9YA 1D4OA 5C4IA 4QVKA 2GBIA 4GMKA 3L1JA 1T2AA 3QTLA 2VWQA 1XP8A 2B35A 3D02A 4Q01A 3T4PA 4KWIA 5DW3A 2CJYA 1ZVMA 2XYGA 1DX6A 1TFRA 4QUIA 2WWFA 3RUCA 2C99A 5BV2P 5CGQB 2C5SA 4JROA 2OPHA 4C01A 1N32B 4P32A 3W5UA 1UIRA 2ZS8A 3DCNA 4NCBA 3NEJA 4CW7A 3EC1A 4MH0R 1HM5A 3BICA 3P26A 5U9CA 2PJRA 1QH1A 3L8ZA 5GONF 1I6LA 2AEJA 4JJAA 1G21E 4IBOA 4Q00A 2GKGA 3RVNA 1IC6A 2OBXA 2A3RA 1QH0A 3BWEA 2VDUE 3F49S 3KJXA 4CI0B 2X14A 4IXTA 2R60A 2Z98A 4JNCA 5E0KB 1VXOA 1U7HA 1T5DX 3EVFA 3GGCA 3SKVA 2EX4A 2EXXA 3WFZA 1WS6A 3OM1A 4BNTA 1J25A 2NYAA 1XLTC 3ESRA 5BW4A 4PC6A 4YCSA 2JK0A 4MA0A 1E3MA 1H2ZA 2CVPA 5J2UF 4YUAA 1A69A 2VT7A 1ISGA 3KNZA 3QOWA 3C3YA 3TRHA 4A6DA 1BGVA 2YV4A 3MGBA 2RBEA 4M53A 2DMRA 3H9GA 4XFKA 5EEGA 3U9LA 4I9NA 4CUJA 4YV0A 1KR5A 2XGOA 4YYZA 1FDTA 3OEED 4FINA 2XXJA 1E3QA 4GM4A 3VR4D 4DJFC 1KGSA 2NGRA 4O4IA 3F7TA 3U4IA 3AK4A 3W6UA 1LQ2A 3IUEA 3K2EA 4KQKA 4P4TA 2X0IA 3PZBA 2VBGA 3W2GA 1P7VA 4CEJA 4C5BA 3EWNA 2JIRA 4CQJA 1C7IA 1DARA 2PMBA 2VJMB 2WRZA 4PG5A 2J08A 2IK8A 4DA4A 2AF4C 3FPJA 3D0RA 4ND2A 3DOCA 5CLIA 9LDBA 3K6RA 3QYPA 1IB6A 1M6YA 2D2XA 2P27A 4ZOLF 3RC1A 3L8GA 3RTGA 5I4KA 1DXYA 2XMBA 2CB0A 1AVTA 3GJ4A 2V7QA 3IUYA 4FYWA 3JARB 1PT6A 1NXOA 2H1HA 3T7KA 2O3JA 4D8VA 1H0SA 2JGDB 5CBKA 3LP8A 1YA8A 3PL1A 1G41A 4PYMA 5KYXA 2X0DA 3IE2A 2JHPA 1TW2A 4CG3A 1SC4A 2FN3A 2HIHA 2A78A 3AI7A 1D1TA 5I9TA 4EEZA 2R2AA 2VSOA 3L5OA 2I4OA 2YDYA 5JMTA 5FPQA 5LQAA 4O59O 1G8HA 1LDYA 1RAEA 2Y92A 5DCWA 1NN5A 3ESBA 3GB9A 1JVSA 3IXLA 5CUQA 1DMRA 3QEOA 3DS8A 5AXBA 3LQQA 3HU5A 1D9ZA 1QV7A 2P4EA 4WY5A 1YZUA 2XQKA 5D7BA 4R68A 2F4VB 2XMQA 2PD4A 3UJ7A 1S96A 2FG5A 4L0QA 3FFBA 2YWXA 2DAPA 2AG1A 3KYBA 1YE5A 4PPYA 1EBBA 3HMKA 4WCFA 2J0VA 4JJ7A 3T4UA 4WFJA 3VO8A 5J1TB 2ZTHA 1TC2A 1KAOA 4WIAA 1X39A 4EIWA 3SMVA 3MYRA 4D56A 4YMTA 1P9RA 3Q7SA 2J0EA 3R40A 4CLDA 2VUUA 3F4BA 1YS7A 1CQIA 1E7YA 1OIWA 4G86A 4DTIA 1FTGA 1U2TA 2ZBDA 3BFVA 1ATZA 3ZTWA 5IF3A 1DTWB 1NJSA 1VHDA 4GL4A 4JFRA 2Z0MA 1BVYF 1RABA 3HDVA 3GHYA 1NRXA 1C4WA 3FA2A 2H00A 1JFFB 2FN7A 1BH6A 3W3AH 2CGEA 1NY6A 5B7PA 2GZ2A 3AY7A 3FKSA 5B37A 3RH0A 4IYJA 1W0KD 2IOQA 3NWPA 3TQHA 1ZJWA 1L5LA 4Q5IA 4QGGA 4Z7NB 3EDQA 4XIYA 1T5IA 3R5SA 3OIVA 4K9SA 5AW9A 2P62A 4QBFA 4IV0A 1D6SA 1YR1A 2SNIE 3CT4A 4Y1RA 5GAJA 4B6PA 3PC8A 4HVCA 5EIBC 2DZDA 1UJ6A 2IW3A 2J5KA 2W2KB 2M32A 2PZBA 4LDJA 4RQBA 4X61A 3KZOA 4DLSA 3C97A 5JNTA 1CEEA 1YAJA 1GV1A 3P4YA 1N78A 5E7MA 4LYGA 4ZCIA 4PZAA 1OX4A 1UFVA 4OQZA 1U2SA 1CQXA 2ZJZA 4V0ME 1JKXA 2RGBA 2P3OA 1AQLA 1BKSB 3H8VA 3HFSA 3B6KA 1VG9B 2OOKA 3ZGNA 4I1PA 2CDBA 2UZ3A 4BRWA 3AEKA 1TEVA 3NBXX 2C42A 3IUQA 1OZFA 2ROQA 2VJBA 4J0HA 4MQEA 2ZB7A 4KCGA 4KR0A 3MAAC 4EA9A 1GPLA 3C1AA 4V0KA 1D04A 1U3VA 2OLJA 3CN9A 1AS3A 3THRA 3ZCSA 1SELA 4X91A 1H3FA 1QNLA 5ESDA 3NJ4A 3R41A 5JDIA 3C3CA 5FBLB 4DG5A 1SCUA 3EX7C 4OYLA 8ADHA 1B8UA 1KYQA 4P84A 4MROA 1UFKA 4ISBA 4N1AA 4X1IB 4ZAXA 1G59A 2IVZA 1GGJA 1KEUA 3GH3A 5HOQA 2F8SA 3OTIA 4N6GA 1Q16A 4G4SO 1JEQB 4NESA 5HGXA 5K8CA 2XWQA 4DMHA 4ABTA 2EJUA 3ZGLA 1MO6A 1QH9A 3PGMA 2BJHA 5A3RA 3M3PA 3NWJA 2V7UA 4BATA 1YFZA 5FPHA 2ZJ6A 4U7GA 1KIAA 1SXJE 3ETJA 3OEHA 3BZUA 4OK6A 4YUVA 4E5KA 1CU1A 3WGLA 4KMSA 2IYPA 4NHEA 2RB4A 4N41A 4IOJA 1J0XO 2JAUA 2C2HA 2COKA 4BZQA 5AJXA 3GLIA 4I2VA 4OJTA 2BM9A 3QQ5A 3CVWA 3I9NA 3P9KA 1Y8ZA 1OLXB 3IUBA 1JQBA 1F2DA 1A5TA 1PJZA 3L4SO 3OFND 4XJSA 1RQLA 1T2FA 2XOXA 4KIFA 5CVDA 4L74A 4MR8A 1SC6A 4E03A 1CDDA 2AMYA 1Y4DE 3WLKX 4KUEA 4LQLA 4BGDA 4HZGA 5FL3A 1O95A 3PUKA 2YRFA 1YD7A 1JUDA 1Z6PA 4K1XA 2ZI5A 2PRYA 1C8LA 2J3IA 2WOOA 1YB2A 3OF3A 1PQUA 3LZCA 1SU4A 4CCSA 3TECE 1DBIA 1UH5A 2QI9F 4E12A 4B40A 1IN7A 3CLHA 4KVGA 3TSOA 1HDOA 4NK4A 3T15A 1YQEA 4CDGA 3BHNA 1BFUA 5E7IA 2YNMD 1M8PA 4DAOA 3EXFA 3AP1A 3VUFA 2F62A 1C7QA 2YWHA 2QT9A 3FLBA 3G5LA 1G7CA 1GYPA 3T7IA 2QX8A 2R11A 4XQ0A 5G41A 3ENVA 3FZQA 4GECA 5KKNB 3WAGA 5JY1A 1E5QA 2XITA 4OSEA 4DLNA 1W4AA 3CFYA 1CY4A 3GEPA 2G70A 1Z3CA 1BXGB 3HV2A 4E2YA 3AM4A 1GSAA 1N5KA 4L5JA 4EAAA 4UATA 1X19A 2IYXA 4FX5A 1L1EA 3ROPA 1IZ0A 2B7LA 2PUAA 4GOXA 1FSPA 4CF6A 4P3NA 4MI3A 5CW1A 1SUCA 3G17A 4QRHA 2G1AA 2GJ9A 4FIZA 3O75A 4ZAWA 2NSDA 1CFZA 3ZD7A 3DZDA 3GNTA 4WZZA 4YAJA 3V55A 4DILA 2I7DA 3DTVA 3HZRA 4F3YA 5LJLA 4DUZB 1G4AE 1TADA 1SO8A 3GELA 5C8ZA 2VDWB 4YQFA 1MU0A 2O06A 4NJEA 2C9DA 2OG2A 1C2YA 1C8KA 3PHIA 1T3SA 5DTQA 2ZPAA 1YS1X 4U7FA 2RHTA 4ZYTA 3ZV5A 2IEBA 4FJ2A 3OE1A 1WCWA 1E1KA 1NAIA 2PYZA 4O2BB 4EG8A 2WICA 1NVTA 2FZWA 2BP7A 4L50A 4PYOA 1GDHA 1ORRA 4IEIA 4LJ7A 4OI4A 3T9BA 4ZZ1A 2OQRA 2BGUA 3ZY6A 4MO9A 5I51A 1WF3A 3HGTA 1Z0JA 4GVLA 4LBYA 1SBQA 1A9XB 4US1R 4A1OA 5ELMA 5IT5A 2Y0DA 3NHRA 2VUSA 3AB7A 3TIVA 2RGRA 4JI4B 4QO7A 4QGAA 1EVYA 2BFOA 3BRWA 3OY7A 3ANTA 4N49A 5KNDH 3HB5X 3C6ZA 4NMHA 3K0CC 1UBMS 2Y27A 3QMWA 4TTPA 5ESRA 4RD1A 5TPZA 2P9GA 3H2JA 1Y5RA 3HYNA 1W2GA 1JWBB 1XMIA 2G5GX 3M4JA 3L7BA 3Q5EA 5JD3A 4C30A 3SX4A 2C3MA 3VGPA 1XCJA 3QPUA 4MQLA 3F5SA 3CQ9A 2JVJA 3AL2A 1TA4A 2W98A 3G8CA 1BQ4A 1H2RS 2HRQA 3IJPA 4LX0A 3TMAA 1V1MA 2TYSB 1GGFA 2XUDA 3LF1A 3FPEA 2B20A 1KKLA 2ISCA 5CFLA 3A4VA 1NY5A 1SC1A 3PD7A 3RRMA 3N70A 1UIMA 1EFDN 1PBTA 2OHFA 2XUGA 1T35A 2H3HA 1Y4UA 4HJRA 2D8AA 2Y66A 4ZT7A 3I42A 4LDAA 4XM0A 2QVBA 1DAFA 3LI2A 1HI9A 4L7QA 4LRUA 3SOPA 2FSGA 2JJ2D 4L02A 1SURA 1R15A 1WHSA 4DUGA 3NHSA 4RXUA 4YI3A 5TARA 1F8GA 3JQEA 4PIMA 4AN1A 4NCJA 1GG5A 4G36A 2EV9A 3A3NA 2WI8A 3W9UA 1VHJA 1TT5B 2GEBA 5EKSA 5C8YA 3IC5A 1E5DA 4I19A 4X5OA 3WLPA 2Q46A 2BD0A 4R5HA 4EFLA 4EJ0A 3CEPB 4CMIB 4WJZA 2FMHA 2I1VB 2XVZA 2ZITA 4DAEA 1G3UA 2ZUCA 2AX4A 3KOUA 4FBGA 2DQZA 4G1EB 4YMUA 5LMUB 3ZU2A 4B3RB 1NQWA 3MWEB 1ZCZA 4D4GA 4REMA 1PYDA 3K20A 2QG4A 2NUTB 1YBFA 3GBVA 3D0KA 4LNUB 3BB3A 4CUZA 4ZJUA 5A0TA 2CV1A 1Q21A 4R3UC 1PS8A 5P21A 3MTEA 1N75A 5AOCA 5HFNA 1E4EA 1IQRA 1QFSA 3L0CA 2F7SA 3DVAB 2C8JA 1W88A 3KFLA 4W1PA 2PY6A 1GAQA 3G59A 2R00C 4WN9B 3C1OA 1UZAA 4EX7A 1I24A 5JTTA 3ZDRA 5GADl 5F33A 4AY3A 2FRDC 4LMBA 3TBKA 4U5QA 2QUAA 3DDHA 1YHZA 3HGQA 4XGNA 3ITKA 5D5PA 1O89A 3CURA 3DKVA 1O8CA 3DEKA 3OEEA 6Q21A 4EMUA 3KEGA 4Q66C 3A3OA 4X92A 1WUYA 2Q3HA 3PU6A 4H7HA 4YJGA 3UZUA 2HYIC 4DA6A 4DIDA 5FT9A 3U2QA 4DMUB 3ADCA 2FX3A 2XHEA 2RJ3A 3MIIA 5ANRB 1J2JA 3RSLA 3UK1A 3UXYA 4LRXA 2B7BA 4J0DA 3C7DB 5E6RA 1QG0A 5CHEA 1J4AA 1HDZA 5EMKA 3AF4A 3VSDA 2CCJA 3DO8A 3GRYA 4A03A 1PFUA 5CB4B 3J7AC 3K9HA 2GJAA 3DLCA 3WIDA 4XCVA 1T2UA 2YHSA 3BERA 3VPDA 3GEHA 4QXAA 1JA1A 4WZ6A 2ZT7A 4O2AA 1FDIA 2J3DA 1V2GA 4F21A 2XA1A 3ZJVA 4CM7A 1RWOA 1A0OA 2YS6A 3N8KA 3EVTA 4CLRB 4I1VA 4EHJA 1PT5A 5HJ5A 3X0DA 4AMVA 3QFSA 1FYVA 1G38A 3WTBA 1BROA 1RXUA 1NMQA 4HH1A 3C98A 1NMSA 3ED1A 3RHTA 3M34A 3C3MA 5E3JA 5CH5A 2PLAA 2UYGA 3TTVA 1XAIA 2O1SA 3Q6MA 5ITSA 2ZZNA 1DQNA 2Z2YA 5THXA 3VR6D 5I4BA 4KO8A 4Z54A 2BVNA 2YXLA 1CRWG 1Y3BE 4ME6A 2H9YA 2YZKA 4HEJA 4YMWA 5T4EA 4FE4A 4TTRA 3R3HA 421PA 1E77A 2PJDA 2YWDA 3WB1A 5KAMA 5JDCA 1P33A 2QJFA 1EK0A 1SUSA 4JOSA 1K3FA 1JSXA 1XQXA 4PZUA 5T5QA 3UAZA 3K9NA 3GPLA 4CIDA 1PVOA 4NATA 1RJGA 1R4ZA 1HL3A 1YHYA 3A26A 2JGIA 2CUKA 3VJMA 1PWYE 1YO6A 3UJDA 5EY5B 2JANA 3GG2A 5BV0A 3QX7A 3WOVA 2R66A 2WTBA 2XR1A 4LX8A 2EHJA 4B44A 3OF2A 5BW8A 3QNUA 3T1VA 1P60A 1MEEA 4V0QA 3V2IA 4G5YA 1ZZGA 3BGIA 3UG7A 4DZRA 3IVCA 4G4GA 1WE2A 4GP6A 1IXZA 3H8JA 4UUNA 4EYQA 3FB1A 1D5CA 2E55A 1FVHA 2RJOA 2V4MA 1H4QA 2I8AA 1VQ1A 4UEKA 1S0UA 3AMVA 3FBGA 4OI1A 2O6LA 2CXPA 4RIHA 2VLIA 2VHUA 4Q3NA 5IN4A 4KFSA 1DO2A 2HDNB 4JBYA 2H7CA 2BFFA 1K68A 3LOPA 2WT4A 1F6DA 2XOEA 1P1JA 4HRXA 3ZE1B