5HZGA

The crystal structure of the strigolactone-induced atd14-d3-ask1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
262
structure length
257
Chain Sequence
NILEALNVRVVGTGDRILFLAHGFGTDQSAWHLILPYFTQNYRVVLYDLVCAGSVNPDYFDFNRYTTLDPYVDDLLNIVDSLGIQNCAYVGHSVSAMIGIIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLAVGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPTCVIQTAKASVAEYLRSHLGGDTTVETLKTEGHLPQLSAPAQLAQFLRRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Strigolactone esterase D14
publication title DWARF14 is a non-canonical hormone receptor for strigolactone
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/signaling protein/protein binding
total genus 61
structure length 257
sequence length 262
chains with identical sequence E
ec nomenclature ec 3.1.-.-:
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hzgA00
5AOCA 3HYSA 1XRLA 5AM0A 2XI4A 4IH4A 1H2ZA 3ZLUA 2WUGA 3STYA 5AKXA 4C6HA 5DLPA 2R8BA 3OM8A 4OB7A 2WFLB 3M82A 5DNUA 3E0XA 1NX9A 4N8EA 1XLVA 4D9JA 2WUDA 3H19A 1JKMA 2XMGA 4Z49A 4NZZA 2WUEA 3L1IA 5A7HA 4KRXA 1LZLA 4ARBA 2VTVA 3WA7A 4EUSA 5EHXA 3B3QA 4DMFA 4ZRDA 4M0EA 4EZIA 4PO3X 4ROTA 1B41A 4BP9A 3O0DA 2QMQA 3G0CA 2VEOA 5IVIA 5CURA 4MEBA 4CCYA 1OCEA 3STTA 3HRHA 4UHDA 2OXEA 3W06A 4J0HA 3JW8A 2JGIA 4BATA 2PL5A 4EY6A 2Y2UA 1KEZA 4BDTA 2X8BA 3E4DA 4KYVA 4FWBA 1DQYA 1ZI8A 4PSCA 4AZ0A 1W75A 3AILA 5ALLA 4X85A 1IUOA 3R3XA 4OB8A 1AKNA 5HK9A 3G0GA 4UBOA 4EBBA 5AK6A 5AKZA 1CEXA 5BWBA 3ZWQA 1H2XA 4BE9A 2HU7A 3WL5A 1QIFA 1DX6A 1LNSA 2ZJ6A 1SCKA 3H1AA 2K2QB 1UOQA 1GQRA 3FVRA 3ESCA 1XQYA 4AQDA 3MVEA 3W2TA 1QGED 5DNWA 3AZOA 2DSNA 5DNVA 4H0CA 3W9UA 4KEAA 1CUBA 2I3DA 1XLUA 5ALRA 5DTIA 3AUKA 5ALTA 1UK8A 4BTLA 3PI6A 4BCCA 3CN9A 4BCDA 3C43A 1E5TA 4UBIA 1TCCA 2WHQA 3FAKA 3QITA 4J7AA 2J4CA 1UXOA 5A62A 1VA5A 3IA2A 4DNFA 5DYYA 3WK7A 1F8UA 1VE6A 2VAVA 3Q0TA 1UFOA 2HA2A 3S8YA 1UOOA 5I8PA 5AKJA 4JH0A 3FYUB 5AKYA 2OGSA 1DT3A 4RGYA 4UHCA 3GELA 1QFMA 3AFIA 1QIHA 1T2NA 2XUOA 2XUKA 4Q05A 4X6XA 3EBLA 1AURA 2LIPA 4BCBA 3LIIA 4BDSA 3QZUA 3AINA 4X00A 1UWCA 1EVQA 4P93A 1ZD2P 1GZ7A 3ESAA 4CG3A 5A6VA 4K6KA 3WWOA 5ALKA 4DSAA 5FP0A 1YAJA 3WKEA 1W6RA 2WUFA 1CR6A 1AC5A 1VZ3A 4MQLA 4Y2TA 1R4ZA 2HA3A 2ZYIA 4B0PA 5LZ5A 1SCIA 3NGMA 1ACJA 5ALZA 5JANA 5AK5A 1UK9A 3WL8A 2BKLA 3QMVA 5K5EA 4H7HA 4N8SA 2WQZA 2QVBA 2JGEA 3ZI7A 3MGAA 2WG1A 2HA4A 2VJAA 1IMJA 3G9ZA 2WJ4A 2XMSA 1MX5A 4BRZA 3IURA 4AB1A 1LGYA 1QTIA 5AI4A 1JJFA 4V2IA 2JGMA 1W1IA 3R3ZA 3G9XA 5JATA 3BJMA 3WYNA 1HL7A 2O2GA 4FDMA 2FX5A 4PF1A 1XZBA 3DLTA 3WWCA 1ZIXA 1LPMA 1R9MA 3EF3A 2VSQA 4X93A 4WDRA 2B20A 3H1BA 4KR0A 1VJ5A 3DOIA 4H7KA 2QT9A 2BUBA 2BUCA 4S0XA 4LXHA 4AX4A 4WJLA 3O9VA 1XROA 3IUMA 2EEPA 4BAZA 1K4YA 4X95A 5JAHA 4F60A 3UUFA 1EK2A 4OD0A 5C8ZA 5K3CA 3IIIA 3WIBA 1N1MA 5BOVA 1CUUA 2VA9A 4K5QA 4IH9A 3C5VA 1L7RA 3ZV7A 4OUKX 2YH2A 4FOLA 3SWWA 3FSGD 2OGTA 5AKHA 2QM0A 2V98A 5LYYA 2EDCA 2XB6A 4MEAA 4RPCA 1TRHA 2GBFA 4PV7A 1TCAA 5ALIA 3H17A 2HIHA 1BEEA 3BXPA 1K8QA 3OG9A 4GBGA 5CMLA 1JU3A 4DMHA 5IVHA 2C0PA 4AZ3A 3WK4A 5FPQA 4B6GA 4F0JA 1K5PA 2XUFA 3WWDA 2PSJA 4DM7A 1MPXA 1QIDA 4WFIA 2V96A 3K2IA 5AK4A 1ZD3A 3F67A 2O2IA 3F8SA 2VQ6A 2OQVA 1Q0ZA 4MYDA 5AM1A 2CZQA 4LHEA 5ALEA 4BAGA 4WY5A 3IUNA 3W04A 3IUQA 4FLEA 2PM8A 4BAUA 5AKLA 4UFOA 5LIPA 1ZICA 2B4KA 5HFAA 4BRSA 5LKRA 3QMWA 5AM3A 5FRDA 5HK8A 4GWLA 3EIOA 5ALGA 3O4GA 4H7JA 3AJAA 4H35A 3TGLA 1UT6A 1VE7A 2HA6A 3PF8A 1EH5A 5AKEA 4AMZA 4E14A 3VJLA 1XRPA 1G5FA 3WK9A 5EIEA 4B80A 2HA0A 1LBTA 2QTBA 5JD6A 2XUIA 5KREA 3CCCA 1EA5A 5AICA 4CG1A 4FLFA 4HXEB 3VXKA 3FYUC 3L1HA 4Q82A 2DQYA 4HTAA 4PW0A 2Y6UA 1SC9A 4RE6A 1BEZA 4A16A 4DLNA 3BJRA 1P0PA 4G8DA 4QZVA 2Y1KA 3YASA 1G4HA 1BN6A 1VXOA 3NUZA 3VVMA 1UZAA 1PJAA 1MX9A 4UBMA 3G7NA 4WY8A 1DWPA 1XZMA 4Q3OA 1E89A 4HXFB 3BDVA 3C70A 4YX9A 3AIKA 2XUAA 3D3NA 4DMCA 2JEYA 2RGUA 5J3JA 4W63A 5DJ5A 4C4YA 5HFNA 1YAHA 2Z3ZA 5K3FA 3M3DA 1WB4A 1AMNA 5CH5A 4X97A 3ANSA 1LPOA 3STWA 5AIAA 1HQDA 5CXUA 1DU4A 4PNZA 3N2ZB 1IUPA 4QLAA 1R3DA 4YASA 2CB9A 3D0KA 5ALYA 2VJCA 3GA7A 4UHBA 2OLEA 3D59A 1FFEA 4Y2VA 5AI5A 1A7UA 4FFWA 3A2MA 1GGVA 1QIEA 1HLGA 1L7AA 4LIPD 3I2JA 1X2EA 2J4FA 5LZ9A 1ETHA 1R88A 4LXIA 2PVSA 4C88A 2HHAA 1BCRA 5LKAA 1MJ5A 3WZLA 3D7RA 4FHZA 5H3HA 1GPNA 3D2AA 5K3EA 1CUVA 4UHFA 2UZ0A 3X3HA 2XUGA 4BC1A 3O4IA 4HXGA 1USWA 2D5LA 2Z8ZA 1BU8A 1WB6A 2WIJA 3C6YA 4Y2YA 2OQIA 2W6CX 4B9AA 3KDAA 1A8SA 1E3QA 5JZ9A 3HI4A 4K6HA 3I2GA 3PFCA 1G42A 1SOMA 4TGLA 1HPLA 4GW3A 2I3ZA 4TPKA 2AJDA 5A7GA 3OC0A 3T52A 1CUGA 3HSSA 3O4JA 4JEIA 5IVKA 4BE4A 5JD4A 3VDXA 3DDUA 3TRDA 1MAHA 3ICWA 1Y7IA 1QJ4A 2B61A 3F97A 4BZWA 5CT5A 2IITA 1CUSA 1X2BA 3DS8A 3UUEA 5JZBA 2ACKA 3DYIA 1CFJA 2XUJA 1WHTA 3WYDA 1TKRA 4FBLA 3DNMA 2PUHA 3R3UA 4GHWA 1XZAA 2XMQA 1XQWA 3DD5A 2DHDA 1U65A 1JI3A 1Q0RA 1TAHA 5YASA 2QKYA 3N0TA 5E4JA 1QO7A 5D3ZA 3G9TA 1WPRA 5ALQA 4ZV7A 4C4ZA 1DT5A 2WM2A 1MU0A 4BB0A 3HJUA 2ORYA 5AOBA 3SK0A 1SCQA 4J03A 4KE9A 3I6YA 2OCKA 4CIBA 2QOEA 2YYSA 5CRIA 4W1RA 4RNCA 4QNNA 4B0OA 2O2HA 1ODSA 3LS2A 4J3JA 5FLKA 2WG2A 5FPPA 1GXSA 3VJMA 1AX9A 4X6YA 3ESBA 1ZJ4A 2HFJA 5DYTA 1EDDA 3I1IA 4U2BA 5IH7A 5E2IA 4INZA 5A71A 1BCSA 4AO7A 1CUCA 3ZPXA 4BBZA 3A6ZA 1XRMA 5FOQA 5DWDA 1CUAA 3WQHA 3R40A 3P2MA 3WLAA 1VZ2A 1XZIA 3E1GA 3GBSA 1FFDA 2ZSIA 1EVEA 4UHHA 4OYLA 5JASA 2XMCA 2ZYHA 4U2CA 1MTZA 1XKTA 4LYEA 1ZOIA 3TJMA 2HDWA 1C7JA 1B6GA 1YCDA 2ROQA 2WIKA 4E11A 4A23A 2WTMA 3I2KA 5HQ3A 1QIIA 3ICVA 4WFJA 5AKGA 6YASA 4G8BA 3HACA 2EDAA 4G4GA 5HZGA 5JALA 1N5MA 4IQ4A 1R9NA 5T4BA 2H7YA 3ESDA 4G4IA 5AKKA 2GYWA 1GPLA 4JYMA 5LZ7A 2PPLA 3O4HA 2AJCA 3H2GA 4W1SA 5ALFA 2BGRA 2ZJ7A 5EI5A 1EDBA 3JWEA 1J2EA 1BE0A 1XZGA 3H2KA 1OILA 3M81A 1P0QA 2GZSA 4L3WA 4W9RA 1YSCA 1I6WA 3C6XA 4X3CA 4LYDA 4P92A 5D7BA 1YB7A 3STUA 1H23A 1K63A 5JAOA 1ZIYA 5EIHA 2HA5A 2ZJFA 3I1YA 1GPKA 3V48A 1XRNA 1H2WA 4Y2RA 5C8XA 4GDMA 4F5ZA 3W9BA 3QMMA 3GZJA 5AM5A 1DWQA 5LZ8A 3F9CA 1U8EA 4HAIA 2ZVDA 4CI9A 3UMJA 1W52X 3WKAA 4EY8A 1DX4A 4EY7A 2XQJA 3G9UA 4F21A 2QXUA 5AI8A 2QUBA 1FSSA 3QPCA 3FVTA 4ZI5A 3V1NA 1XRRA 1XZKA 4P08A 1LPBB 1VKHA 1C7IA 1CQWA 1J06A 1YB6A 1XZHA 3DJYA 4OYYA 3WMRA 1MT3A 2B9VA 3RLIA 5IVDA 5K3BA 3AZPA 4C87A 4UHEA 4DNPA 2XUQA 5HF9A 4UFNA 1F0NA 3D2BA 4IH1A 5AP9A 2FJ0A 2WIDA 2WU4A 5A7FA 4MXDA 4K6GA 3IULA 4AN0A 1E8NA 3DCNA 4FNMA 5LZ2A 2BFNA 2RI6A 3W05A 4A5SA 4DYHA 2YXPX 4KE6A 4X7BA 1U2EA 5FV4A 3G02A 3SC2A 4OSEA 5ALSA 3DYVA 4KAJA 5F4ZA 4I4CA 5T4HA 3MUNA 3NWOA 5CW2A 3C6ZA 3BF7A 3ZLVA 4B85A 2HRQA 3WK8A 1NU8A 1TCBA 4DTCA 4WFKA 4L9AA 1L7QA 2QZPA 4QDXA 3WZMA 1Z68A 4E15A 4J0CA 5ALJA 4FBMA 1CUHA 3V1KA 4G4JA 2ZYSA 3K6KA 4B7ZA 2P8SA 2FJPA 1CUWA 1FFAA 4DSZA 2VATA 1UKBA 1GQSA 2H7CA 2DHCA 4FTWA 1R50A 2OCIA 3WA6A 3QYJA 2C58A 2JBWA 2H7XA 3S2ZA 2XQIA 4IHAA 1ACLA 2PSHA 5IKXA 4Y2SA 4QA9A 4IO0A 1N8SA 3VISA 4G8CA 2WFZA 5ESRA 3M83A 5JZSA 3C8DA 4QE3A 3GROA 3PE6A 1RWQA 4QEKA 4UPDA 1CUDA 1TIBA 1CUYA 1LLFA 3B12A 3IBTA 2WILA 2XUDA 4H18A 5E4YA 1CVLA 3FNBA 4UBKA 3V1MA 1XZDA 2HRRA 4XIIA 1D07A 4FFVA 3IB3A 1UKCA 3H18A 3STVA 1EB8A 3ED1A 4BTVA 5AI6A 3BDIA 5JD5A 1IUNA 2R11A 4PSUA 4N5IX 1WCYA 1C4XA 5T4EA 3RARA 3LIPA 1RP1A 1DTEA 2CJPA 4TVKA 3DKKA 1A8UA 4HZGA 2ONCA 5AM2A 5FKJA 4AN1A 1K6EA 1MNQA 2DCMA 3IUJA 2RIPA 2CEKA 5LZ4A 4K2AA 3KOOA 2IX9A 3WKCA 1W76A 5DYWA 3EQ8A 3AZQA 4FKBA 1THGA 3OTQA 4RE5A 5AI9A 1BS9A 4AO8A 3AIOA 1P0IA 2HM7A 3H2HA 3OOSA 2DR0A 2H9YA 1MX1A 1VXRA 5C8VA 2GYUA 5AI0A 4AMYA 2XUHA 4QDTA 4L0CA 5JIBA 1JU4A 3BIXA 3PUIA 1ZD4A 4B82A 4J0GA 4ARAA 4CFSA 1BROA 4ZGBA 3F98A 2WFLA 3DQZA 2WHPB 3FWHA 1QLWA 2HFKA 1XQVA 2E3JA 2WLSA 3CXUA 3I28A 2CKMA 3D2CA 4YK7A 5KWIA 2V97A 5BV7A 3C45A 4KAAA 3LLCA 1JFRA 3DKRA 4M0MA 5AOAA 2VAXA 4JNCA 2IIVA 5HF8A 2ECFA 3DL4A 1XZJA 3E3AA 1CV2A 2ZSHA 1Q83A 7YASA 1DINA 5JARA 3OURA 5I7UA 3H2IA 4XX1A 2C7BA 4BC0A 4OB6A 1JMYA 3ANTA 1HDEA 1E8MA 5D3KA 2YASA 2BUAA 2VT7A 1X70A 2XUPA 4AXBA 5K3FB 1WPXA 4B84A 4YPVA 5BWCA 4G5XA 1AQLA 4QDUA 4UBJA 5LP1A 1EK1A 1M33A 4KAFA 2JGLA 2PU7A 2OG1A 5KBYA 1UK7A 4H77A 2WSLA 1QE3A 2XQKA 4GEGA 1UK6A 3WL6A 2V9ZA 4KE7A 1DWOA 4KACA 3O95A 5CT8A 4GXNA 4UBLA 4I19A 2HADA 4O08A 4U2DA 1CPYA 1YA8A 1KU0A 2PSFA 4UBNA 5ALUA 2DHEA 2WHRA 1CQZA 1VOTA 1FFCA 1LPNA 3WI7A 3CCBA 4ZXFA 4H7DA 2D0DA 1ZI6A 2ACEA 3FOBA 3C87A 4EA6A 4BZZA 5I9IA 1WOMA 5ALMA 1H22A 3DOHA 3QM1A 1JT2A 3FYUA 4Y7DA 5EFZA 1QIJA 1VLQA 4B83A 1EINA 1XLWA 5JAUA 3PFBA 4J0DA 2GBCA 2WIGA 1EB9A 3T4UA 3I2FA 3RKSA 4KRYA 3V1LA 4B9EA 1XFDA 1EHYA 2G5PA 2OAGA 3JYHA 4CCYB 5ALXA 1BRTA 5CTAA 4X94A 1UOPA 2QJWA 4X6UA 3WL7A 3HZOA 4QLOA 5C81A 3RK4A 2C4HA 2J3QA 1IZ7A 1XZLA 3C6BA 1LZKA 2I03A 1Y7HA 2VT6A 5SYMA 5D6OA 4MJ3A 5ALVA 1CUIA 5A2GA 4OU4A 2AXEA 5CH8A 4Y2JA 3KD2A 4HVTA 3WKDA 1EI9A 1G66A 1YS1X 2QRUA 2RAUA 2BJHA 4PSDA 3D5EA 3NOXA 5EIAA 1Q84A 5FUMA 1ZGCA 2WIFA 3CN7A 3BL8A 4X92A 3LP5A 4BVJA 5AIBA 2VF2A 2JGKA 5LLSA 1YASA 3QBJA 2C5GA 4ETWA 5CH3A 4Q1VA 5SYNA 1W4LA 3STXA 2Y2VA 5JYCA 1XKLA 3EQ7A 3D4LA 1DQZA 3I2IA 4J0JA 1LPPA 4BVLA 5AH0A 1A8QA 3WWEA 4E46A 4GECA 2XQGA 4QDOA 2ZYRA 4W1QA 5FDFA 2JGJA 1AUOA 3LCRA 5ALNA 4U2GA 4QWWA 1NU6A 3H0CA 5ALWA 2GZRA 3G0BA 1EDEA 4G1FA 1HBJA 4WDQA 5AM4A 2PU5A 1QIGA 2XLBA 3QPDA 1CUJA 2DQZA 4BYMA 4N8DA 1LPAB 4EY5A 2I78A 1E8DA 4M0FA 1IVYA 1JJIA 3A70A 2Z3WA 4CG2A 1J1IA 1ODTC 3WK5A 2XT0A 5CXXA 1ZJ5A 2G5TA 2QR5A 3HEAA 3KSRA 5CT4A 1JJBA 1THTA 5CT9A 1QOZA 5ISMA 4H7EA 2XLCA 1YA4A 4C4XA 2H1IA 4Y2XA 3FLBA 3FYTA 5HCUA 2AJLI 4H7IA 1QIKA 1PFQA 4XWGA 4J0IA 4GLBA 2FUKA 4PQEA 4EHBA 4JUIA 5HQ3B 3F96A 3C5WP 3DL7A 4X90A 1ZGBA 2XMDA 3L1JA 2VJDA 3KWJA 4DMKA 2QXTA 4Q3LA 4KE8A 4Q34A 3WJ1A 1ORWA 4EB0A 2VJBA 1KU6A 4DIUA 2RHWA 4Q3KA 1LPSA 2BCEA 2CBGA 1RYYA 5K3DA 2PSDA 1CLEA 1J07A 1H2YA 1FJ2A 3A2NA 2XMRA 3I6ZA 4CCWA 2GYVA 3FCXA 3BIWA 1JMKC 2XMBA 1MNAA 4CIAA 2NW6A 2HL6A 5E4TA 2BGNA 2CMFA 1IZ8A 4KJXA 2GBGA 3H2JA 2WKWA 1ORVA 1QZ3A 3HXKA 2GBIA 3ILSA 5ALPA 3G0IA 1ZD5A 1CUXA 2JIDA 3IDAA 3BF8A 2PBLA 4DGQA 3QH4A 5AHXA 1GT6A 1WM1A 1XQXA 1ISPA 1VA4A 3R0VA 1N5RA 1MN6A 3GUUA 2OCLA 3ZLTA 1YR2A 2Y6VA 1QO9A 4DNOA 4I3FA 1MO2A 3PICA 2WFMA 1UKAA 3O9MA 2X5XA 1CRLA 3HABA 4QWMA 3FLAA 4ZV9A 5ALOA 2PX6A 2XQFA 5HF5A 1QONA 1YS2X 5ALHA 3PF9A 5C7YA 4FLMA 2DFPA 2X76A 3VVLA 4X91A 3A2LA 1WHSA 5FXMA 4HRYA 4MYSA 1CUFA 4GI1A 4BP8A 3EQ9A 4WCVA 3Q8WA 2G63A 1EXWA 5AK3A 4Y2QA 3GFFA 1QIMA 2HU5A 3MUOA 1QTRA 4HRXA 1GKLA 4MWTA 2RHTA 3VKFA 3R3WA 2QJRA 4FMPA 4ITVA 1E66A 3FLEA 2XMZA 1EX9A 3IVMA 3KXPA 4DNQA 4HS9A 4LXGA 4OPMA 2ES4A 5DTJA 3I2HA 3WJ2A 4C89A 3FSGA 1SFRA 2BAGA 5EHNA 4H7FA 3WWPA 3R41A 4AO6A 3PDCA 1TK3A 2JGFA 4U2FA 3V9AA 2C5FA 5KWJA 4JYPA 1ZI9A 3HC7A 2G4LA 2XE4A 4BVKA 3WK6A 1AZWA 2WU3A 1O6GA 1OXMA 2HU8A 4Y2PA 1HKHA 2OGZA 3I6MA 3RM3A 4MQMA 1GKKA 1CUZA 2WHPA 5HKBA 1R1DA 5EGNA 3R3YA 3U0VA 4NVRA 4MWSA 2JEZA 3VJKA 2QS9A 1F0PA 2WJ3A 4LKOA 4OU5A 5EHQA 3FCYA 1U4NA 1XZFA 3WKBA 3WIOA 2PKYX 3R3VA 3K9BA 2PSEA 4W1PA 1P0MA 2O7VA 4N5HX 2J3DA 4L72A 4U2EA 5JAPA 1AGYA 3AIMA 4UUQA 4XVCA 1FFBA 2CUTA 2Z5GA 4XJVA 1PV1A 3H04A 2OCGA 4FNGA 3QVMA 1WB5A 3BE8A 4NS4A 2OPHA 4EY4A 3SX4A 2PUJA 4J0KA 5JADA 1ODCA 4NMWA 1BN7A 5CT6A 1CIJA 1F6WA 1TQHA 2AJBA 2OAEA 3G8YA 5EHZA 3HLKA 3C8HA 4UFPA 4Y9SA 1XRQA 4G9EA 4Y2UA 3FBWA 2W22A 3QPAA 4B81A 1QFSA 5AKIA 5ALDA 4C01A 2WG0A 2WTNA 4ZREA 5AO9A 3B5EA 2Z8XA 1T4MA 2AJ8A 2Q0XA 3U1TA 2RONA 4X71A 2C0QA 2HA7A 5HF6A 2WJ6A 4OCZA 3PUHA 4G9GA 2JF0A 1LBSA 2XDWA 5HKAA 3KWFA 5K3AA 5T4FA 3TEJA 4P9NA 3OPMA 4QDZA 5AJHA 3BWXA 1S8OA 5CBKA 2QUAA 1XZEA 3G0DA 4ZWNA 1Y37A 2O7RA 1A88A 1MAAA 1XZCA 3DEAA 1O6FA 1CUEA
chains in the Genus database with same CATH superfamily
1RKBA 5A4FS 1UJCA 1G5QA 3IERA 1YZNA 2IF0A 4IH4A 5JJCA 3ZE2B 4NWIA 4X1KA 4CLRA 3LHIA 3S2IA 1AHIA 4OQQA 1ECBA 1A2OA 3EGDA 4NK4A 2PRYA 3AEXA 4O4JA 5DLPA 1WR8A 2XE7A 3OQ1A 4Q9DA 4B44A 4CM8A 1O03A 1K97A 4RZ2A 1LBEA 2Z1NA 3PC8C 1A97A 4TV8A 2PVCA 1YH3A 2WFLB 5HILA 2LBPA 3OZAA 4PR3A 3H4VA 3EEIA 3LF2A 4Q3EA 5BR8B 1W85B 3B6JA 2IGTA 5DNUA 4IDNA 3PEWA 4KO3S 2V5UA 3W6NA 1B0PA 1JXQA 2WUDA 4NP6A 3UT6A 3ZEIA 7MHTA 1JKMA 2JAHA 2XNSA 4EABA 2GKSA 3PNVA 4KQMA 4P82A 2AFIB 2WUEA 1INLA 2D1QA 3FROA 5ERYA 5G0TA 1XCBA 5THQA 3K70B 4KRXA 2ZROA 1PR4A 2O3RA 3RNLA 2HPHA 3UT0A 1SCUA 2BH2A 3VR3A 2H4FA 4EAQA 4BLSA 1V48A 3DXYA 4H1VA 2O1EA 3RW9A 1XL1A 4DMFA 1SXGA 2FSIA 4GPD1 1SK8A 1LDEA 3PDIA 4WCFB 3DEKA 3U3OA 4YIHA 1QCDA 1B41A 3V4SA 1FNNA 3FN4A 3MJRA 4ZOLB 4NNOA 3OBIA 2OA0A 3ECCA 4N0QA 3AHFA 4XZ3A 4EGSA 1B23P 4V0RA 1QPZA 1T1SA 3HJBA 1WSAA 2ZUEA 1QRAA 3NETA 4Y98A 5DTQA 2NU6B 1U90A 2OBBA 2UYQA 3SS8A 5C2JB 3ZHQA 3H2SA 3CZQA 1DQPA 3ZCRA 2LCQA 3W2EA 1T15A 3BSWA 1AK1A 1UMDA 4LE1A 5JZVA 4YP5A 2W2LD 4UHDA 2X22A 4NENB 4TYPA 4IF4A 4DDTA 3ZI0A 2BI4A 1B2RA 4J0HA 3PK0A 2JD1A 2JGIA 5K45A 4BATA 1X1EA 4PU0A 5LBTA 3MWLA 3ZDQA 1YL7A 2VF8A 2H65A 3EWNA 3LDAA 4YJGB 1EHCA 1KEZA 4B2LA 4LZNA 3E4DA 4OO3A 1WDMA 4GNRA 5ICCA 1H8EA 2EFGA 4JJ6A 3KDSE 2WKQA 1HWYA 3A6HA 3E8XA 3GJ6A 3I09A 5ADVA 1YFZA 2BEKA 3MMNA 1NV8A 4J90A 1HEYA 1WKCA 4PSCA 4FFBB 2O6LA 2VK2A 3V8QA 1D09A 3JAKB 5HA5A 3ZN2A 4YAGA 4N41A 2QTRA 4X85A 4HRVA 3E7DA 3F5FA 4BWYA 2Q8PA 2XDYA 4PYJA 5EJ7A 3UXHA 5KYGA 4OFZA 4CL2A 3RS8A 5FBRB 4B17A 1QK4A 5MN4A 5BSGA 4QBIA 2DBVO 4NECA 3G0GA 1PJRA 3GJXC 4EG4A 2VHXA 3BFPA 3OTIA 3BQ9A 2EQBA 5JFTA 1KEKA 1QCZA 3JQBC 3ELYA 1CEXA 1OC2A 5TJHA 2HR1A 2GEJA 2OO3A 2W00A 3PC4A 2NVUB 3ZWQA 1OAKA 3WL5A 1QIFA 1BWRA 2EKPA 2P62A 5HJ2A 2ZJ6A 3HYTA 1I4OA 3H1AA 4H3HB 4AQDA 2YWFA 3IAM1 5JFOA 2EIXA 2ZRPA 1TGYA 3IV7A 5DNWA 1OASA 2BFFA 4HSEA 2C5EA 2YWRA 4MQEB 2OV1A 2BFAA 1M2OB 2RKOA 1SC4A 4H0CA 4C06A 5TS2A 3OUZA 2AZDA 3IRUA 3QUTA 1QMPA 5FBVB 4TKVA 1SBHA 4WCDA 1CUBA 3UTCA 2QN1A 3EDYA 4WKGA 1XLUA 2IF2A 3G6WA 4TXJA 1OYYA 1L5VA 4MS4B 2TMKA 3EZ9A 4GOND 4GBJA 4QXOA 4S12A 4AP9A 4B34A 2BONA 4ON9A 4U4AA 3KUUA 1UK8A 4C6RA 2Q1XA 3PI6A 1NW5A 4CMKA 2W4IA 4BCDA 2DVMA 1EP2B 3P5BA 3V3TA 3TIXB 3H83A 1MRSA 3PVZA 3ISVA 2ZI9A 3OAAD 4HY3A 5CM8B 1Z8HA 2CDCA 1YE3A 1F2UA 1FYVA 3QITA 4J7AA 1TM1E 2GM4A 1ID1A 2GK6A 2J0VA 4IRUB 3ZKWA 2PD4A 2Z0MA 1YTLA 3F5MA 2B1GA 4AG6A 2K2WA 3N5KA 5AW3A 4V38A 1GR1A 1XOIA 3WV5A 3M4JA 1ZVQA 1Z35A 1XDWA 2AD5A 5JJ5A 2QLTA 4HH3C 5REQB 4WECA 1TQ8A 4URWR 4F96A 3IP6A 3WQSB 1E2DA 3OCJA 4HWPA 1WSBA 2R7MA 1EA7A 2FGJA 2R85A 3FE2A 3QXHA 4LY6A 4W8GA 1UKVY 5JSYA 4URYR 3RT1A 3SHOA 4BIMA 4EPXA 4M1WA 2VBCA 3B2NA 2XRMA 3QU5A 3T9AA 1G3IA 3IQXA 4Z0PA 3X1MA 3KT6A 1FYFA 3K0BA 2FW0A 2C1XA 3FYUB 4ECAA 5HRUA 1KZGB 1VMKA 3TLGB 5K4HA 5C7OO 3OIDA 3DW1X 1WRBA 2X8JA 5TLSA 1OLSB 2QUZA 4B6JA 4GP6A 4RGYA 1ZQ1A 3A2KA 2OENG 1E2HA 3EGXA 3A7EA 1YZQA 4WRRA 3ZY6A 1QFMA 2QUJA 1JUDA 3AFIA 3QE3A 2PQMA 4HYQA 1ZJYA 4BNFA 3C7TA 2XUZA 2XUKA 1WZ2A 1Z6XA 5LLTA 4X6XA 3GGPA 1KMIY 1KJNA 1XF9A 2O8DA 1GFIA 3A1EA 3FCUB 2V03A 1HXHA 2LIPA 3KSZO 4RJTA 1FVHA 3T9BA 4CIXA 4BDSA 3DBHB 3AP3A 4HGQA 5BW8A 3IDZA 3CS3A 4X00A 3E58A 1EVQA 3KTAB 3VC2A 5KU7A 5CYPA 2YV1A 1H4SA 4M9SA 2OOSA 5E7IA 4ALLA 1H2FA 3R6TA 3CVYA 4LCEA 4V0QA 1TO6A 5DHSA 1L2TA 2BM8A 2X5KO 3TW8A 3K20A 2XXBA 3C1OA 1RP7A 5GJWC 1CR6A 1AC5A 1GPUA 4EL0A 1DKUA 3O3CA 3QF4B 4LK3A 1KPIA 1OJ7A 4XQCA 4OA5A 1QP8A 2HA3A 4B0PA 3OQOA 5CX1A 4IQFA 5EMLA 1QVWA 4BUCA 3HFRA 5C8DA 5CPBA 4W5WA 3CJTA 1OWPA 5G0WA 3BILA 4RA9A 3OJWA 4U7TB 5A0FA 3V1TC 4BQFA 2X9GA 4Z4IA 2FSVA 1ACJA 1RXYA 1I7PA 3GJZA 1Z45A 3I5UA 1GGEA 4DQLA 1UK9A 1H6DA 3MMXA 2P8JA 1GPAA 2RBEA 1JQAA 4MR7B 1A2KC 3WNCA 3UT5A 3QMVA 2H4HA 5K5EA 4FKZA 5KX5A 1HX7A 3AX6A 3DZKA 2FZVA 3ROQA 3HKDB 2XBLA 4WSOA 5I7EA 3TSWA 3T7DA 1RR6A 1EWVA 2RHMA 4HDSA 1WULS 4L4ZA 4UU8A 2RCYA 3WP1B 5IJWA 4XIGS 1JR2A 2CLEB 4FI3C 2PIAA 2R8EA 4LJYA 1R8XA 4C7VA 4K0KB 2PKQO 6AT1A 1WXIA 2DT8A 3T5CA 4BNUA 4MRRA 4Q02A 1I3NA 3G9ZA 4KODA 3HN2A 2ZR9A 2M6KA 2XMSA 1VM6A 5B12A 2PBZA 1USKA 2A3RA 3PE4A 4ZYVA 3PGVA 1SG9A 3X2SA 1I0LA 5JNRA 1XL0A 2HSJA 1X92A 2D1YA 3IAM6 2E7ZA 1JJFA 5EJEA 1TE2A 1U5CA 1W1IA 1RBZA 3N0WA 1TD9A 5LXTA 1NJ6A 3QG1A 2D1FA 5DXAA 3WGOA 4OV6B 1L8OA 4H1HA 1DKLA 1HL7A 1K68A 1L4GA 1N7HA 2QAGA 3CNNA 1QZXA 3KQMA 2AD1A 2X3UA 5ARBA 3VTKA 1GZVA 4LYHA 3W2GA 4YRAA 1E60A 2FA9A 2X19A 1ZIXA 1JI0A 1LPMA 3FXAA 3UAGA 1M34A 1VG0B 3AQIA 4YECA 4ICIA 1X7WA 1T0JB 3KLOA 1YS4A 5JDCA 4NH0A 4PX3A 3EF3A 1QGYA 2R6GA 4A92A 5B57C 2VSQA 4JIGA 5DBOA 5K6TA 1B4DA 2B20A 4BY9E 4M9ZA 2YQZA 4DSOA 1WWKA 1M7HA 1N25A 2Y1OA 3F1KA 2QV0A 1A9OA 3G1TA 3KPJA 3DOIA 5IF9A 2H07A 1K9VF 1PTKA 3PDHA 4YQEA 2Y1XA 4I8IA 4KVGA 3E9ZA 4PYRA 4P80A 1GO2A 4C3UA 1BTOA 3D6FA 1XROA 3F9IA 1NKSA 2EEPA 4LW8A 5AVJA 3RFTA 5JAHA 1I3LA 1JDUA 5DRYA 3WL3A 1JDVA 3UUFA 2IY9A 2GCIA 1YBFA 3EVCA 3WRXA 1AF7A 1YJ5A 3CT4A 5F7JA 10MHA 4L07A 1D03A 3MMSA 4ETMA 3KYCB 3OE1A 2EARA 3JZAA 4J2TA 4K5QA 2CLOB 4KQKA 1C29B 1NI4B 3OE7A 5A3QA 4HLNA 3C5VA 5F3RA 5FL3A 4WN9B 1E3DA 3D6HA 5CB4A 1B8VA 2YH2A 2M6SA 3QMPA 1ZD9A 4N6GA 1E3JA 2HHJA 2CKDA 3AP1A 3WLIA 3SAJA 2HT1A 2QG4A 1WZIA 1ENPA 2PMEA 2HYDA 2YVLA 4JOCA 2ZBEA 1TTQB 1YQDA 4REQA 4UEWA 2JZCA 2YL2A 4HCJA 1XELA 4YR9A 4I4IA 5CEEA 5JDIC 1VHJA 3O21A 1EJ6A 1QG0A 1YB5A 3CF4G 3IVAA 2BE7A 3ZHOA 2ODTX 2C98A 4HB0A 3WADA 5KTYA 3A05A 4LZOA 2GJ8A 2WY2D 1CZLA 1E2FA 5CW1A 4TT3D 4EJMA 1TRKA 2E5FA 2ENWA 2O06A 2VTDA 3OH8A 1FQOA 2CHEA 3IQWA 3MTAA 4L4YA 2QGNA 3MFYA 4UOQA 3U3KA 3U3MA 4QUEA 2HMTA 4ODIA 3FUTA 3K09C 4PV7A 1R9GA 3T7KA 3AMVA 1GQFA 4MWBA 2E5LB 1Y1PA 3NCHA 2WD7B 1NG1A 2VOEA 4GG1A 1D4AA 3ORQA 2CHUA 4JSYA 5FQOA 2HIHA 1EYZA 4RMJA 2AX3A 1J2YA 2G1UA 5FH9A 3SLGA 4IILA 4IZ6A 4B09A 3U19A 4CEIA 4HF7A 1K8QA 1DJNA 3K4QA 4OJKA 1VLJA 1GPWB 2X77A 5CMLA 1VPDA 3KFLA 3AVXA 1U9IC 4LVCA 3PRYA 1TJYA 1JU3A 1ZC4A 4KXXA 3LL4A 3UHFA 1VBMA 4YTEA 1PT7A 2CLKB 5LD2B 1KZYC 2EW2A 4ISBA 4NZYA 4CKBB 4IIDA 4DLWA 3LXUX 5A04A 1A8HA 3LLVA 3FRHA 1OYWA 2LCIA 4EPRA 4GLOA 1OLUB 4GX0A 5KOIA 1GZ3A 1IN1A 1KFCB 1Z7EA 2EZ4A 3RJ5A 2G08A 4KN9S 4B3GA 3QKWA 3FHLA 2V96A 5DSTA 3QPVA 3QUBA 5K0BA 3K2IA 4MLDA 4X63A 1IB0A 2F7SA 3LYHA 5AK4A 3KZOA 2O2IA 2B8JA 1II8B 4FJ2A 5JSUA 1DV1A 1UEXC 4HFJA 2OQVA 5C5EA 1S0UA 4F6LA 4TOIA 4NPAA 1C8KA 2FWRA 3BMQB 2W2TA 2HDHA 4FFLA 4YP6A 2PXAA 4QFDA 4ZZ0A 4K7JA 4R9NA 4OP1A 1SHKA 3KG2A 1E6UA 3VMFA 4CF3A 4UMEA 1KSGA 1YBAA 5AM1A 1C2TA 4E5PA 2P35A 4WINA 3BKXA 5ALEA 3NBMA 4MYUA 1JH8A 4FFDA 1GADO 2VSNA 4WKBA 4XJTA 4WY5A 1CF2O 4ZO4A 3L7JA 3RFUA 1CY1A 2JFQA 3VAAA 2CNWD 3C5EA 3H4MA 3BEOA 4D4GA 2N42A 4YO7A 2AFRA 3IOEA 3GDFA 3IKTA 1WX1A 2ZUTA 4GDFA 2FPOA 2PN1A 1DTWB 4R1MA 3EX7C 4UFOA 1QHSA 3LGSA 2CXXA 4KSCA 5K0LA 3A11A 1ZICA 2XX3A 3FCEA 4QO8A 3TNJA 4COKA 4LTMA 4NXMB 4UNSA 5DGHA 2XQVA 3SEZA 2X6QA 3OLVA 4BRSA 1E3WA 5I7VA 5LKRA 1W0KA 4LY0A 4JQOA 5AM3A 2AXNA 2FSHA 3LZDA 5EXXA 3LD9A 3AKZA 5JUWA 2O0MA 3EIOA 4P4UA 3ETDA 4ZQEA 4FB4A 2FEOA 2R5WA 4IJUA 5HRCA 4Z53A 1A50B 3SM3A 4IQ0A 1L7OA 1T1JA 4RY9A 1LTQA 2VHCA 4B6RA 2MYTA 3MG9A 1KTIA 2ZRNA 3AEKB 3UK1A 1DAIA 3P9RA 1IQRA 3GJ0A 2G40A 5FYQA 4MW1A 3ZIUA 2HA6A 4ZYWA 3LVQE 1VG9B 3HLYA 2GRAA 4E14A 3GMDA 3UUGA 5I7WA 1L1QA 2BFCB 2PQ0A 1G8KA 1K8XB 1OZAA 1XRPA 2HF2A 2PGJA 2J5QA 1JVBA 2MYPA 5EXPA 3ZWKA 4CT5A 5A4MS 2WWIA 3MQFA 4JIMA 5JSZA 1KJQA 1VJ0A 2I55A 4RHYA 3WK9A 4B80A 4DRZA 5EIEA 4MW5A 1QH0A 1ZCJA 2ZW9A 2Q5OA 1LBTA 3ASUA 2H2DA 2P2DA 3TCXB 4QVKA 4CG1A 4H3VA 2FE4A 2OV3A 1K8ZB 2VJMA 5AW1A 1W4ZA 2Q6OA 5LYJB 1Q74A 1ISJA 2ON6A 1TVKA 1U28C 5FL7D 2C2YA 4KFSA 3AB7A 3GPIA 2Y6UA 2XMPA 1SC9A 2F59A 2HMUA 4DF3A 3CLRC 1MFPA 1SXIA 3HBFA 5HWSA 3DTTA 4L08A 3HDQA 3QV2A 8GPBA 1KVTA 3AUAA 3RYCB 1QFYA 2PXHA 2UXBB 1IXKA 1YC5A 2E6KA 4R6WA 1P0PA 1KORA 3PQ3A 4Q00A 2Y93A 4ZD6A 3T1OA 2O3TA 3HCRA 3H5VA 4X20A 5LQKA 1DMSA 2IOFK 4I1YA 4LCJA 4JA2A 1KC3A 3G2PA 4C7KA 4X8HA 4PLWA 5E3HA 1YFLA 2FR1A 1WHSB 2SCUB 4XWKA 5EWJB 2BMWA 2L19A 3DZFA 3UMSA 1ADBA 2DFKB 3MS4A 3VC3A 1Q7TA 2FKNA 2XCIA 1BGWA 3P9XA 3D8RA 3SICE 4EK9A 5BSFA 5LQDA 4YAKA 1J0AA 1ZN7A 3VVMA 2W2PA 1TKAA 1LW7A 1VGVA 3G2KA 3N76A 1XB2A 4Q5IA 4UBMA 3G7NA 1SVSA 1V2GA 3EXFB 1ZA1A 4FHEA 4R2MA 1O96B 1G4AE 3LL7A 4LSZA 3DQPA 1DKMA 3RLFA 3VPGA 1D4OA 4FEEA 4LTNA 4Q3OA 1ZDMA 2P79A 1NW4A 4HNRA 5HIIA 3SJAA 3E3OA 3WB9A 2QQEA 1VE9A 4KR3A 2EP8A 3HVIA 4DABA 4F4JA 1D2EA 2QD1A 3ELUA 5FNVA 5ERXA 3LMKA 4BNGA 1VI5A 1XX6A 5IMSA 1QK5A 2BGIA 2IHBA 2W6JA 3TOCA 4PLZA 3ETCA 5IT9A 1BXGA 3TQIA 5K8UA 2BFEB 2JEYA 2YOHA 3NWEA 2GD1O 3IP5A 3LUAA 4JQSA 1NVXQ 1YONA 1B26A 1ZGZA 2PL9A 2QRLA 3DEFA 3GUZA 2ASVA 4TL7A 4YACA 3RUAA 1QFJA 1EXMA 4F92B 5DJ5A 2OZLB 2PWZA 4J0FA 3BMOA 2H9AA 4BFLA 1RJEA 4P38A 3G2QA 1ZSNA 2NO6A 4C30A 1C5KA 4J9UE 3G7SA 3OZRA 3N07A 5IBPA 3T06B 3HB7A 2J0UA 5H7XA 1PGJA 5HRAA 4O2BF 5FBZA 2A9OA 5FWXB 4RFLA 1JTEA 5EVJA 3S2SA 5CLFA 3ZZ1A 3EA4A 1FMJA 1HQDA 4NYJR 1H9BA 4FYHA 2OHHA 2QEQA 4MVJH 1DSSG 4PNZA 2CLHB 1VECA 5LQRA 4POOA 1YKSA 2MTBA 2FZGA 3N2ZB 3N7TA 4QLAA 4QYIB 3OHSX 3RJTA 5F35A 1ZS9A 2PJZA 3L7IA 4JBYA 1QF6A 4FE4A 3N2EA 4FX2A 3ZDCA 4IKOA 3PLRA 4RVGA 2BEUA 2VJCA 1PK8A 3GLIE 1Q7EA 3ETJA 4OGWA 4PS1A 5K2MA 5EWLB 5TGTA 2P1RA 2WDZA 1QBKC 1I10A 3NO4A 1ODIA 2OCDA 4KL8S 2YHBA 1HQKA 2YW2A 4C4TA 2WR8A 4FFWA 3ONFA 5F2NA 3IPXA 5BMVA 3SIRA 2YS6A 5BVHA 2EJTA 3I2JA 4L74A 1XQ9A 3ZD9A 5LZ9A 2X0RA 1ETHA 3DPIA 1OPRA 1FQKA 1QPGA 1GQOA 1NAIA 3CRVA 3DL0A 3C3WA 4MV4A 2NXWA 3EOAI 1Y5RA 3I45A 3HDTA 4B8ZA 2OAP1 4RGQA 1Q6ZA 2JCXA 3DC2A 2XBUA 3GNSA 4PLYA 2C57A 2FMTA 1QRRA 1M8PA 2H1OA 5LKAA 1AIPA 3KQSA 3D7RA 3RWMB 3T9CA 3R0ZA 1CW2B 3AVUA 4XTRA 1DBPA 2NAFA 1XA0A 2EWVA 2C97A 2WVHA 4U02A 2HEIA 2VHYA 5H3HA 3WWZA 2ZYUX 4Q4JB 1GPNA 2X42A 1JTVA 5KHAA 4A0FA 1LK5A 4OHKA 3TPZA 4CM9A 5I8WA 1RQLA 4EB6B 3UGJA 1PO7A 4DCOA 2Z6UA 5DXFA 5ADUS 3GFSA 2XUGA 4N3GA 4LOKA 3IVGA 1NVMB 3BKWA 4M0DA 1KBQA 1BFDA 4QIHA 5DHPA 4C4PA 2XR1A 4L6IA 1USWA 4CQLA 4BMOB 1YO6A 2BM0A 2Z8ZA 3K0FA 1XFAA 1M9NA 4QBFA 2G04A 1JQLB 2WIJA 4R3UC 1ABBA 1U2DA 1Y6ZA 2OE2A 3C6YA 4RLQA 4Y2YA 1PKXA 2BBWA 1C9NA 2BFDB 1GFWA 2OQIA 2W6CX 3EIUA 3HNOA 3JQFA 4C7MA 3Q8MA 4ADSG 1JLMA 1ZKMA 3VFDA 4AJ9A 1GCOA 4YT8A 4HNVA 1A8SA 2V0NA 2CMKA 2O4CA 1T1EA 2W6ID 3PFCA 1G42A 2FWJA 2I71A 5TJ9A 1WF3A 3B1FA 4WLFA 1TEHA 3H9JA 1M8JA 2WFAA 1FTYA 1HPLA 2X2EA 3QLVC 4ZT4A 3TAUA 3R7NA 2I3ZA 1CR2A 3TX2A 3GFTA 5EZ6B 2GMWA 3IOCA 2AJDA 3KOYA 4BX9A 4B4UA 1BH2A 3EMDA 1ECJA 1SU4A 3T52A 3K6SA 2L42A 3MNFA 3TXXA 3ORSA 2WWXA 5IT4A 3VH1A 3SR0A 1FUKA 3CVOA 4G1UC 3OEHA 5IVKA 1NN3A 1QS0B 2JFXA 3CSUA 2QE7A 2VEDA 3RYTC 4BKMA 4RTJA 5D5PA 5LC1A 1O87A 2ZRGA 3DT9A 3ASZA 5KYYB 2B9EA 3B1WA 4MV6A 1XMVA 4LK2A 4V2UA 1L6IA 3M1YA 2PS3A 5K9ZA 1QQ7A 4MQ4A 2HJ9A 1Y7IA 1ZG3A 4EQ6B 5IM4F 2Z2IA 3ZGNA 5JNSA 2G06A 1TYZA 1FU8A 5CXSA 2VRBA 4AKEA 4BJ6A 4FE7A 3PHLA 3K0AB 1CVRA 4JVOA 1HI9A 1I4TD 4KRGA 3BIOA 4RD0A 2AWOA 2D13A 3RUIA 4BZWA 5MDHA 2IYSA 5IAOA 4QL3A 5F9HA 1DMRA 4IV8A 5CUQA 3MWFA 1RAIA 3Q40A 3ISTA 4O4HA 1VL1A 3IQHX 4A6EA 2Z1DA 3Q7IA 2JIBA 2IH4A 4IXMA 1ZGGA 3FPAA 4ZAWA 3DS8A 3E3NA 3IBFA 3TOZA 4EI2A 5F3DA 3UTDA 2DTEA 2JIZA 3IXQA 4UUBA 3QWHA 3A4VA 1KQGA 3ABSB 3FDFA 2XUJA 3DP9A 4K6FA 1WHTA 3RBZA 3C85A 5CNIA 2B34A 3KEQA 3FHOA 4KUHA 1DFIA 2PBFA 1GZSA 4M1EA 3WYDA 2X4DA 4F85A 4OYHA 2PUHA 1QHHB 4TLCA 1RM5A 3AH8A 4XR9A 4CTOA 3A1UA 3I4FA 1X0VA 1CNMA 3D4PA 4GHWA 1T2EA 3PQDA 1R4MB 3H9BA 1NXWA 2CEAA 1T8YA 1U8XX 3T4XA 4AYWA 4YYZA 4LGYA 3KV3O 4R1LA 2E18A 4FVTA 2QG6A 3DE5X 5D3ZA 4GP9A 1GUFA 2IUEA 3A7DA 3TI9A 2A5FA 1S02A 3NH6A 1C3OA 4XOUA 1DT5A 3CNBA 3O84A 2OCXA 4TMYA 1MU0A 3H0EA 3KTFA 3TZ6A 4E03A 5FEUA 1JH9A 2ORYA 4JJZA 4HNAA 1HFJA 2RGWA 2ZAIA 3BX1A 3PUZA 1LC3A 2WHYA 3AR9A 4JGBA 5F7XA 3RYIA 2ZT5A 2CHVA 3IIEA 1NQ5A 4LNAA 1YKGA 3CX3A 3JQ7A 1TMYA 2XV1A 4L8WB 2RHRA 5E3JA 3H8JA 1SXJC 1JXMA 3NANA 3O8OA 3WGHA 2O2HA 3IAUA 2WHEA 3WMEA 3GZNA 4TMWA 1E9CA 3KZXA 1Z3IX 4HNGA 3CIOA 3H75A 4FGKA 1ODSA 2H1RA 3HKCB 4JP3A 5KO2A 3LUHA 2KE5A 3T1TA 3ZH9B 4CVNA 5FPPA 1GXSA 1M0TA 1S1CA 3E23A 2GDZA 4WLOA 1UBOS 3SKYA 3STHA 2BE9A 2QYTA 3LXMA 1PVOA 2YC4C 2W6OA 3M6XA 5AVRA 4GI5A 1IJFA 4X6YA 4L5JA 4XXHA 4FX5A 3SYMA 2A1TS 1ZJ4A 3IILA 4RJJA 3FCOA 4GMFA 5JE8A 2NTNA 3G8BA 4NMXB 5I4CA 4L1KA 1EDDA 2C9BA 1KARA 1NDUA 2DQ4A 3OMXA 2EATA 1PN3A 5EQFA 4C22A 5GADl 1KRWA 1TZKA 4U2BA 1Z0DA 3K5PA 2W4MA 3LLMA 4QPZA 3ZYCA 4INZA 3BE5A 1EVKA 1FP1D 1HE8B 2ZIUB 2K87A 4XFKA 3SC6A 3JAWA 3T3IA 5CLJA 3OJXA 1Y4DE 1BCSA 2O2XA 5TS3A 4L76A 4JHLA 1L5GB 4UM7A 2TMGA 4TTSA 4KLRA 4D5EA 4KPYA 4ZGGA 1CUCA 1B6TA 3BFKA 5A0TA 4UE6A 2YZ7A 1WBBA 1N32B 2NG1A 2AC7A 4LDAA 2HBZA 1LY1A 4NV1A 3LNCA 1RQXA 4HQ6A 2O48X 4MS3B 2Z08A 4H16A 4QYWA 1VJTA 3GYGA 3LVRE 5EP1A 1NFQA 3KJNA 3RRYA 3VOAA 2RH5A 2RJ3A 4J0EA 3R40A 3H87A 2N1BA 4K0RA 4Z9XA 2PBRA 2FEWB 4N3AA 4Q9NA 4AIRA 1OXSC 1VZ2A 1UPTA 2O3SA 1FFDA 2HCFA 1EVEA 2P2NA 3GBSA 1QYRA 4IMRA 2HSWA 4OYLA 4A7PA 3MAJA 3NR2A 2ZUUA 1CETA 3BZWA 2ZYHA 4HDMA 2VDOB 3B13B 3VNSA 4RIEA 4YYEA 4Z99A 1DQRA 2HY7A 4WH0A 4A4DA 2D2IA 5FX2A 1IM5A 5E9JA 5HYVA 5CLGA 1GARA 1E0SA 2WB4A 3RS0A 4CL8A 3RWBA 1HUQA 1II0A 2GJSA 4M9UA 1CHDA 4DCVA 1U7HA 1GAEO 1T9ZA 2PA0A 3GW8A 3LU1A 4LYEA 1T9DA 2NXEA 2VK4A 3B82A 3BD8A 2ODNA 4CWAA 1C7JA 1OAOC 1IN7A 2ROQA 2WIKA 1WEHA 4BO3A 4E11A 2R9VA 4UAGA 3AFHA 2LRHA 1AZTA 1FFYA 3I2KA 4UQPA 1L5OA 1LDNA 1DZIA 3KHKA 5HQ3A 1QIIA 1IK4A 1KNQA 3RCBA 3SHQA 2EERA 1XVUA 1Y8RB 1N6KA 1ECGA 1OXTA 3IOBA 1OLOA 2RK6A 4YDRA 3HACA 3T1VA 4G0WA 3G5AA 5TF4A 4C4AA 3FR8A 1Q50A 4DS3A 4QJIA 4DV3B 5HZGA 2RHHA 4L27A 5JALA 4LJ7A 3WFZA 1N5MA 3NATA 4IQ4A 1XMOB 3A31A 2H31A 5T4BA 4BX3A 4LXUA 1VIDA 4HXYA 3CF4A 3WLQA 4RGBA 1GPLA 3QA9A 2F3UA 3I01M 2POCA 4MV8A 1UC4B 1Q1ZA 4L0MA 2ZYDA 4Q47A 1ZCAA 2PPLA 4G63A 3CLSC 3O4HA 1TEXA 1XXHB 3PLNA 3R0JA 4W1SA 1PFWA 1Q20A 3AEZA 3H9QA 1RPAA 3K2QA 3T7AA 1KQNA 1KP3A 5H4GA 2ZJ7A 5DCUA 1AUVA 3RGWS 3R23A 3CLTC 3JVIA 2EW1A 3LO5A 1XVLA 5EI5A 5T8KC 4F04A 2GS9A 3CE6A 2YS7A 4NHOA 4K9LA 1VLLA 4NMMA 4AMUA 3H2KA 1XIVA 2G09A 2LD4A 1O08A 3M81A 3K9WA 4JU9A 1MT0A 4L3WA 4Q01A 4RA6B 5C32A 3IFSA 4JUBA 2QUHA 1YSCA 1I6WA 2GPJA 3DONA 2MCFA 3GT4A 4AU1A 4GC5A 1N5LA 1E2LA 4LYDA 4OHPA 1UDRA 3WGLA 3EZNA 1V41E 2ZG6A 2OZPA 3AW9A 4INOA 3E8SA 1ZVKA 3WMXA 1V47A 4XWWA 1ABEA 2JKVA 4NJEB 2HH9A 4GOOD 4D5GA 1Y8AA 1Z7YA 1QLHA 2IYZA 1DS6A 2HA5A 2ZJFA 5CDUA 1T35A 3AB8A 3L4BC 5DHQA 3VO8A 1X8LA 5BNWA 1X9GA 2XCTB 4MQFB 1A7AA 4HB3A 3PGKA 1IM2A 4FZVA 4PBSA 4LF7B 1JG4A 1I36A 1HY3A 3BA6A 3G9QA 4JBGA 4DZTA 4GLJA 5JEDA 3MC1A 3GZJA 1MW8X 5BN5A 1DWQA 1V3VA 3BE4A 5HW0A 3MB5A 2IV7A 1MB2A 1UMBB 1ZL2A 3X1KA 4HAIA 3V6MA 5T41A 1W52X 2C92A 1NVKA 5ERGB 1GITA 4B3HA 2W9XA 5I6DA 1I8TA 1DUVG 4KOAA 3SXPA 3AVVA 1ZBDA 2JPDA 2XQJA 3G9UA 3R44A 3NASA 3DVSX 3FZGA 4JHXA 4RVCA 1USIA 2PWAA 3ODGA 2R60A 3KLNA 2VP4A 3QPCA 4N01A 4OJYA 1G6OA 2L17A 4D4KA 3IPRA 1YDEA 2EX4A 2IHKA 3LY7A 4K8RB 2J33A 2VHZA 4XWAA 5GJVC 5BT9A 4EFKA 4Z2AA 1K5HA 3MJVA 1X9IA 1PSZA 1T4CB 1Q1QA 3ZVLA 4TKMA 4FJ0A 4DDVA 1Y8QA 1EM8B 1WUJS 1H5QA 1LPBB 2VHUA 1SG0A 2ZU6A 3NT5A 1M1YE 4LXXA 3W34A 3ZDDA 1SWVA 3NPMA 1C7IA 1CQWA 1GIAA 2H29A 5BYKA 3KQKA 1J06A 4BQOA 3X0DA 2JBAA 3KPUA 2OV2A 1GNQA 1NLZA 1T8UA 4HWKA 3QJGA 3FWKA 3DJYA 1A69A 4CQMD 5JWRA 4G5FA 1T8RA 4UTOA 3UN1A 3V7YA 1KYQA 2BRUC 1ZONA 4WOPA 1MT3A 3PGXA 4TV9A 3PTZA 5L6MB 1JHPA 1PS9A 5IVDA 3NBYC 3IEMA 2G1PA 3SXJA 3LRTA 4C87A 4NZOA 1CBUA 1CQJA 2QD4A 3ZXSA 4EUEA 1SK9A 4UFNA 1NDHA 2HPAA 1ESCA 3CONA 4U39A 1CP2A 5SY4A 2PRZA 3AOGA 5DGDA 1NVAA 5KTNA 1TU0A 4OL9A 1C7RA 3KQWA 4L57A 3I9KA 2FJ0A 1WUTA 2WIDA 2WU4A 4IAOA 1J1ZA 1NFRA 3GP5A 3JR7A 4EKDA 3IULA 4WXEA 4B3MB 1I5EA 3DCNA 4UVDA 4XGQA 2V7XA 2QMHA 2VP0A 4FNMA 5ILQA 1AGPA 4B3TB 1E2QA 1AT1A 1T3GA 2BFNA 2RI6A 2VP2A 3HCNA 5D5QA 3ANMA 1KDPA 4A5SA 1U5BB 2DH6A 2YXPX 4KE6A 3H7IA 4B7AA 1AA6A 1FDVA 1U2EA 4QU0A 3L0YA 1KPGA 1P0FA 1DEKA 3E53A 4PRYA 3S8MA 3SC2A 3Q3JB 2O2ZA 4UVHA 2HXSA 1JLRA 2AK2A 5ALSA 1L5FA 1WZEA 3DM5A 2ENUA 3OJCA 2IP1A 3PD0A 3V4FA 5T4HA 1MABA 3P9CA 2ALJA 1JR3D 3MUNA 1FQWA 1ZWLA 5EL0A 4UDXX 1WPGA 2I7VA 4FDUA 3L6EA 4XH9B 3B8HA 3LV8A 2AFHE 2GB4A 3MD0A 2CFIA 3GLHE 4MS1A 4IVQA 4PWYA 5KNBA 2PUGA 1KZ4A 3KUKA 1RBMA 3ZK8A 1NU8A 3ICPA 1TCBA 1V16A 3PWSA 1VMIA 4Y9DA 4L9AA 4ZVRA 1MENA 2ST1A 1Z3CA 1NVFA 2G25A 5HJEA 3NKLA 3SF0A 1CT9A 4UUNA 5K51A 4NOMA 3CTPA 1WMEA 3I58A 4DWOA 5JH7F 1JDSA 3EGWA 4LNHA 1Z68A 3HH8A 5BWMA 4Y67A 2ZSFA 2XJ4A 1KDTA 3V1KA 4AF8A 4G4JA 2DUWA 1WZUA 2ZYSA 3K6KA 2H2HA 2POQX 5KTOA 1O5OA 2LNDA 3CEAA 3CSSA 3TWOA 4PHFA 5CB8A 3LY5A 4U3JB 4B3BA 4O59O 1N2IA 3OPYA 1YZUA 1QG2A 2VATA 3ZNNA 2OVBA 1RC1A 3TQSA 2J5RA 3RC1A 1GQSA 3W5DA 4DR7B 1KNXA 4QRHA 2BHTA 3P19A 4NBRA 1GZHB 3L8MA 1KOGA 2BZGA 2XOKA 2Q3LA 2W11A 1IPEA 3SC3A 2FI1A 2IY7A 5SYAA 3EFOB 1AA9A 4TRNA 3VR6D 1Z4QA 4AJNA 2WIAA 3LPAA 4BEWA 4F4IA 2FN9A 3HKEB 2DBYA 3GLTA 3AF3A 2XQIA 4RHTA 5TC4A 1ZNQO 3F49S 3JD4A 2JK1A 5IKXA 4WERA 1X74A 4UJ3A 2WYWA 4DVGA 3VZCA 5A5DA 3CRNA 1OX4A 1GUAA 3VISA 3C3MA 5HM8A 5KVSA 2P9JA 4IKEA 4J3FA 2CSXA 1EFKA 2I4IA 1W0CA 4RZSA 2D54A 5D1NA 5ESRA 5D87A 3SBEA 1CZOA 1ZA2A 2M1XA 4LY3A 4D56A 4EUSA 3QVGA 1SQ0A 1V8PA 1SKYE 2WKRA 3VH2A 1B0AA 1QP0A 1DOHA 1RWQA 4GPZA 3W1VA 3PFFA 1UFKA 4QEKA 4UZEA 1CUDA 1ESNA 1ZZEA 3GRRA 4UUAA 3VO2A 1I9GA 2WF5A 3FVWA 1GTMA 3KTOA 1JHXA 1LLFA 3PXAA 4RKYA 4E88A 1I7SB 3BXHA 4FHFA 3VAYA 3ZCTA 4BO1A 4GL2A 1ULZA 3AT1A 1CDEA 2W0MA 2XUDA 2YICA 3EMVA 2O2DA 3MGBA 2BGGA 4AZ3B 4QJ3A 4PRZA 1RADA 3S2EA 2OV4A 3V1MA 1JQJC 1Y81A 5J2TA 1EIZA 2COKA 1OQAA 2HRRA 3I6BA 3QE2A 4F3KA 5BN3A 1QTQA 3BULA 4K87A 1IOLA 1F0KA 3IB3A 2L0XA 3OHMA 3M9WA 3LWDA 3SNHA 4UCQA 4AJOA 2FPGA 1EB8A 3I04M 1GUBA 1KVRA 4KHZA 3AESA 3S55A 1XDSA 2QYOA 1GEGA 4YBRA 5JD5A 2BR3A 2R11A 4JB8A 1Q22A 4PSUA 4W8OA 5LQNA 3GAFA 2H1VA 3I04A 1T5SA 3PEYA 1G8AA 1GNLA 1WCYA 2J48A 2AK3A 5T4EA 1X6VA 3BHMA 3NBUA 4TT3A 1N9KA 1N7IA 5C7LO 5AW8A 4EYKA 3KQVA 4F46A 2CJPA 2G9QA 1KBZA 3EHDA 3B2EA 2V65A 1A8UA 3RVNA 5IKPA 1W29A 2Q0SA 2QVGA 3EB9A 5AM2A 3GEEA 1QJCA 4K28A 2V7BA 2IW3A 2PCLA 2HN9A 1K6JA 1MNQA 3H6KA 4HDCA 3RS3A 3WLMA 5CCEA 2FW8A 1XDGA 3HPRA 1OBCA 1ZLXA 2IPAB 3AR7A 4QYTA 3IV9A 1MVLA 5G0SA 1QZTA 2NO4A 2VIIA 5EIXA 1A82A 4CE6A 1U7ZA 5B53A 3GLIA 2ZWOA 4BNHA 1P9LA 1T91A 2YFYA 1K98A 2FMHA 1Z6AA 3NI2A 1J42A 4AS2A 1IRXA 3G82C 1LBIA 5LWQA 1P9NA 1MB0A 3W79A 4RQAA 3KOOA 2IX9A 4JI7B 1QF9A 3LGXA 1W76A 2FN3A 3B6EA 5DYWA 2QJTA 1DV2A 2BKXA 4R98A 3HR8A 4P7KA 3MZ0A 4DJ5X 2QLBA 3M9LA 4HQKA 3I3OA 6ADHA 3MPOA 4RE5A 3Q8KA 1NZFA 4R2HA 4RJIA 1IJEA 2WT4A 3OLXA 4AO8A 2OB2A 4XLTA 3VDNB 2EWWA 2XRYA 4ZCSA 3RSZA 3DPUA 5LUBA 5I7FA 4RQTA 1P0IA 2F17A 4LWQA 4UZFA 3SE7A 3OOSA 5IT0A 3SR4A 5DHUA 3CH5A 1Z73A 2MSWA 3OQPA 2J85A 3ND9A 4H1UA 1X7DA 1T0HB 2PVPA 1J22A 3RIEA 3SF8B 4G0YA 1MX1A 1T5HX 1U6JA 1VG8A 1G8SA 1N2ZA 2GAIA 4QUGA 1AB6A 1YFJA 1G3MA 4AMYA 2XUHA 3P96A 2ZE8A 3E22B 1FQJA 4LVOA 1E9EA 5JIBA 1JHVA 5JS1A 4G56A 1FNBA 1X80A 1WCWA 4GLLA 3WGKA 3R5JA 1I14A 3L8YA 3VM6A 3WNBA 1E4VA 4JLMA 4FGLA 1UT5A 4GZ5A 1T3LA 4CFSA 4D0GA 4X62B 1O8CA 2C77A 1BU5A 3WOHA 2G82A 1TIPA 3FWHA 1QV9A 4JJAA 1O57A 3M1LA 1U3WA 2WLSA 3I28A 2RH9B 1UWVA 4JLJA 4IYJA 1EGAA 5ELXA 1FS6A 1JR3E 2H2IA 3B70A 3C45A 3IV6A 4KAAA 1NXQA 4EJFA 3LLCA 3HJGA 1JFRA 3KVNA 4RH3A 1H4TA 1N57A 3KKOA 5EAIA 5JISA 4KFCA 3CRW1 1PJCA 2G80A 1E18A 2GM3A 3HI6A 3Q8XB 4LISA 3LX4A 4Z8YA 5EKDA 3SIXA 3GEMA 5KJFA 3O8RA 5KOHA 2A8YA 2IHYA 3MAAC 3QVUA 4BEVA 2FNAA 3L1VA 2EZ8A 5JY6A 2C5AA 5IHPA 2B1QA 3QY0A 2V5VA 3DL4A 3EXHB 4G1MB 1XZJA 3RBAA 1CEEA 3E3AA 3JWJA 4KLCA 3D3KA 4BN5A 1AOXA 1Y1LA 2ZI6A 1IE3A 3FNFA 4C4SA 2K7ZA 4MARA 3CH7A 2H1HA 4RELA 5SZHB 5EIFA 3D4NA 1E1RA 1NY5A 4FC7A 2HNBA 5LOVB 3SU8A 5AYVA 4IW3B 4UAVA 4L75A 5KKNB 2W37A 4HQNA 2FMKA 2OTCA 1R8QA 3ANTA 4OB6A 2CJWB 2NU8A 3RRXA 1E8MA 3ND8A 1ORRA 4YQFA 4NEHB 2ONJA 4ILKA 1MB3A 5DGCA 4KB5A 3UENA 5BWLA 5I7OA 2GASA 2VJKA 4TS4A 4KHPB 3ZH2A 2VT7A 3N28A 1JJAA 1XYYA 3P26A 1RVV1 5JS2A 2VF5X 3ED5A 3FPJA 4FB5A 2Q6LA 2CLSA 2J46A 1JEOA 1E2IA 4FCCA 1BS1A 2IRWA 2X2OA 1DAPA 1N4DA 4AXBA 3ER6A 2VF7A 2D5AA 4NJMB 2P11A 5EJ6A 3BIJA 2PD6A 1ZISA 4KYTA 3ZCSA 3UV6A 4EEZA 4E5KA 3H2ZA 5FTNA 3QUQA 4G2NA 4ZVLA 2YIMA 3FNHA 3O93A 2Z57A 1P5HA 4BRUA 5H59A 1Z28A 3F5SA 2BGLA 4KQEA 1YQXA 5FLXA 4OI0A 2E0IA 3U5TA 4P4TA 3ZUPA 2YXLA 4MUNA 1CEYA 2PU7A 3EDQA 2W7TA 2WHXA 1CE8A 13PKA 1B43A 1IXYA 4OHVA 4UCFA 4E5SA 3LQRA 4MMZB 3ZHUA 4KDRA 1DC4A 3PR3A 5K0JA 2P6MA 4LJ4A 4UDNA 3OE4A 2NZ2A 2GNPA 3FH0A 1A1SA 2I62A 4M88A 5KQGA 5GONF 1SA0B 5BVGB 1ELOA 1PR0A 1WLSA 2XQKA 1W4CA 1T36B 3K1JA 3F6BX 4TZTA 2CD9A 1NZDA 2YHUA 3F3KA 1NXOA 1W581 2QAGC 4I4TA 4GEGA 3TCKA 3LPMA 4HEJA 1VHQA 3I9LA 2GZDA 5K1ZA 2V9ZA 1EFAA 4QGHA 3UB2A 1DWOA 3M49A 4AX8A 4KACA 5GQSA 2D2VA 4KWTA 4IFEA 3ZDEA 4LC1A 2OFFA 3S29A 4MAFA 1AN0A 3G0OA 5ARCA 3WL4A 5IAAA 1H42A 4PANA 5BW6B 1C7EA 4Q7KA 4GXNA 4TL6A 3LCCA 3JXEA 3MWEA 4F45A 2HADA 4O08A 1N7JA 2PXCA 1BCRB 1OA0A 2O0KA 2AOVA 2WAYA 3K7EA 4K05A 3UC9A 1KU0A 3II6X 2QL6A 4OHZA 1YE5A 3EZ2A 1EM6A 3OQVA 2C9MA 3G2OA 4KXWA 1ZM7A 1I5RA 1UPCA 3R5KA 1ZPDA 2W2OA 1Z7GA 2F3PA 1KVQA 5EEHA 3BGOS 3BZBA 3DDHA 2ANBA 2IBMA 2NV2B 1UJ6A 1ESEA 1OZFA 2VA8A 4H7DA 3DF9A 3WRXC 3UHOA 5LMZA 4M60A 4CW7A 3AR6A 3A3OA 4G5RA 1E1YA 3A9RA 1K06A 1WSDA 2RAFA 2EV9A 3BHJA 3D6NB 5LFAA 1QNLA 2MSCB 1W0JD 2CFTA 1JZTA 2R1TB 3ROPA 3VPBA 3DNFA 2QQ5A 4M8NE 1EGVB 5G1OA 1E6CA 1M83A 1XP8A 3EVFA 4F1JA 2DLCX 1IAQA 2WJJA 4YAOA 5I9IA 3MHPA 4CCSA 3MUEA 4MGKR 1RYEA 1WKBA 5CEJA 2NSLA 4TV8B 5ALMA 3U4HA 2IXDA 4JFRA 2X4IA 3WYEA 5ABPA 2ODAA 3FZNA 3QM1A 3TG8A 1HE5A 2YYZA 4IHKA 1ISSA 4HMPA 1MAVA 2Y77A 2ABWA 3HL4A 3N8DA 4ZTBA 2VPWA 1OXXK 1R6XA 2F1RA 1KVSA 4UTVA 2X1HA 5A1JA 2MT9A 2OB1A 1OY1A 2GBCA 2WIGA 4IHJA 4KWHA 3U7EB 1UJMA 1L7MA 2JLCA 2E9SA 4TYNA 3T4UA 2FPMA 2VDJA 3I2FA 3UUWA 4XUGB 4AL4A 4TMTA 4ZO6A 2JCVA 2ZUDA 3RKSA 3R9XA 3PDIB 3HHPA 3V1LA 1KFJB 3MWKA 3THSA 1LLQA 5L4NA 1JALA 1KMHA 1YOVB 1EHYA 2CVQA 4QUDA 4G0XA 4RADA 4TXNA 5TGZA 4A8TA 1EFRD 1P1CA 2X1MA 2E55A 2GEDA 1M2JA 2P5SA 2F1KA 1MOZA 2MR5A 3FUUA 1V1MB 4FR0A 4NAUA 1JEDA 3V97A 3VYTB 4YEDA 1KDOA 3JATB 3TTXA 5LL6P 3HUFA 5TMBA 3NFYA 2G70A 3EPRA 2J59A 3OTGA 5ALXA 5CTAA 1BVYF 3QXSA 2QTGA 3T34A 5LZ2A 4TYYA 4MB0A 2PYZA 3CWQA 1Q1BA 4FC6A 1NA5A 3H3JA 4BNVA 2IPOA 2WICA 2C8LA 4GZ6A 4Z86A 2CXNA 2HT6A 3BFXA 3T4EA 2OO5A 3ENQA 1BS2A 3I0MA 3AHGA 3L05A 5M2QA 5AXBA 4BO9A 3CPSA 2J3QA 1IZ7A 1U9JA 2QDKA 4X1YA 1P2DA 4X9XA 4MMXB 3UGKA 3TDNA 5BY2A 4J6EA 4UKDA 1UXJA 1VMDA 4KC0A 1UFQA 3B1VA 1Y7HA 1CJCA 2JGDA 3E8MA 3T38A 3UAVA 3V00A 1O94D 4ECEA 5A9SA 4W5JA 5IWCA 4HB4A 3ZBQA 4Q7QA 1UPBA 1T0BA 3HXPA 2HHHB 2CBZA 3CUUA 3SZUA 3V1UA 2BV3A 5A2GA 1OFHA 3MWDB 2VHTA 2AXEA 5E4FA 5EHIA 1NMQA 3ZGLA 1E4YA 1MF7A 1AQIA 3UICA 5K20A 3TVYA 4C0QC 2ONZA 4M1QA 3ZY2A 3F74A 2J6HA 4XQEA 3VU8A 1KKMA 1WXGA 2C82A 1FTNA 4ARSA 4EJ0A 4YMUA 1TK9A 1ZM4A 4QOFA 3BTSA 1XP5A 2BJHA 2RAUA 2W2KB 4IJVA 3SNKA 5LVAA 1DVRA 2A3NA 1M2HA 3C6KA 4CTKA 2A92A 1TKCA 4DY6A 4Q4CA 5KSWB 1YD7A 5EMHA 3KKEA 4G41A 1HF3A 4GPIB 1GG8A 1HSZA 3DE4X 3N05A 3ZJYA 5FUMA 4C08A 4R1OA 1N3YA 4HJRA 3LP5A 4YROA 3T7CA 2QNIA 2B0JA 4NAVA 1XO1A 4N3BA 1HG1A 2OR3A 3TE7A 2JGKA 3CFYA 2QM3A 1T4GA 2C5GA 1P6UA 5K8IA 3EG5A 4I46A 2Y71A 4OXIA 4BVEA 3IE1A 1MEJA 1U3CA 3UFXB 3ZQ6A 2Y66A 3ND6A 3TNLA 1T0UA 2CFOA 3LK7A 3STXA 4BNMA 1F9AA 4V1CB 5IU6A 2Y2VA 4NQZA 3EWIA 1Q1AA 2REQB 5CJJA 3VSBA 3L1UA 4PCLA 2AQ8A 4ZMSA 3LUFA 2CCGA 5AOVA 2XWJI 4KNWA 5KQSA 5EC8A 3VVCA 1LPPA 3ESZA 3O26A 1A8QA 3RS7A 1YVPA 2H18A 3EGCA 3N8IA 1OPXA 1PS8A 2C5SA 1Y4AE 3I0NA 3HA7A 5B58T 2C9YA 4E46A 4K81B 5G4KA 3NT2A 1BO6A 1NR1A 2LP4Y 1AQJA 3GXBA 1TFRA 4CDGA 3L6CA 4FYJA 3FWZA 1P33A 1X38A 1SEVA 1J4AA 3O0TA 3QX8A 2ZYRA 4I5EA 1ZUIA 3AONB 4KVZA 4QDOA 5HCNA 4Q3AA 1GGJA 1N92A 1PZHA 1TJNA 2JGJA 3DMPA 1AUOA 3F6PA 2HJSA 4R1TA 4QWWA 3PPVA 4U2GA 1TJ3A 3GQBA 1I3OA 3GLGE 4PG7A 4EG1A 2XCOA 4QQNA 2P3LA 2VDNB 1W48A 1HBJA 4KXVA 3UVEA 4WDQA 5F51A 2WM3A 4DGSA 4DKXA 3EIEA 3GAMA 1VCMA 2P3SA 2XLBA 2JAQA 4E12A 3DGEC 4BYMA 4Q1AA 4RHUA 1JRLA 1LPAB 2DLNA 4WXYB 5U4QA 2J3IA 3RFCA 4IGFA 5B1SA 3EXIA 4LOHA 1JQEA 1KEUA 1PTJA 1L5YA 1SUEA 3EYWA 2RAPA 2I66A 4PNEA 2C2HA 2GJKA 3OT5A 2QR5A 4ARCA 2AZ4A 4I6EA 1DDIA 1JJBA 2MYNA 4KWIA 5JCJA 3U80A 2NV6A 3NBKA 1OI4A 4KK4A 4RKRA 5CT9A 1E0AA 3BWYA 1GUYA 2CLCX 2HIGA 3E9RA 4RTQA 8MHTA 4DR2B 2XLCA 3FNGA 3NHRA 3D7LA 4DA9A 5ESWA 2LE0A 1X8KA 2O8DB 4Y2XA 1GKIA 3AL3A 1L4KA 5TV2A 3SQLA 1SXPA 5HCUA 1Y1KE 2ZZMA 4H7IA 2PZKA 1QIKA 4XWGA 2DFLA 3VUEA 3E7FA 1HL3A 1NFFA 2C20A 3R5HA 4K6CA 1F1BA 4FYXA 3ZNOA 5GM2A 2NZVG 5H70A 5BYBA 2XECA 4R84A 4ABTA 1VKOA 3HKBA 4MIYA 5HTOA 3ER8A 2AFVA 4LDRA 1H0HA 3DBLA 1OC4A 2K6GA 5A5EA 1WP4A 4ZU3A 3H4IA 5DXJA 4F86A 3P97A 4WBNA 1GNPA 2DB3A 1LI5A 1WABA 2J8ZA 2VUUA 1RWWA 3D8NA 4MUMA 5C1IA 1LW6E 4A91A 1U0HC 1BMFA 3OM0A 4BMXA 3A37A 3HPQA 2QXTA 3DCIA 3MCVA 3O1HB 3WJ1A 3BTOA 1W1WA 1Z2OX 2ZR7A 5T57A 5F1PA 2VH5R 1ORWA 5E6RB 4K26A 3SYRA 4JI3B 2J3JA 1U7TA 3HU5A 4GZLA 1SUFA 3HFSA 2BCEA 2V6IA 3COPA 3R8CA 1RYYA 3NEPX 3RVJA 5K3DA 2WABA 4EVRA 4LYGA 1V5WA 2ZCUA 3UT5B 2YKGA 3AI1A 1G6Q1 3JZFA 1NQAO 1DRVA 3GLHA 5E7MA 1FJ2A 2TECE 4HYYA 1ZJZA 1YI0A 1V5EA 1HGXA 2XMRA 4JCOA 2C7VA 4C4OA 2B3DA 3TNDA 3ZIAA 3I1FA 3FCXA 3ND5A 3OQMA 1G18A 2VUIB 2XWQA 2Q6TA 4RV4A 3E6AA 3PD1A 4AZTA 1QRSA 3UEOA 1BKDR 3Q3IA 5C4GB 4XTCS 4QU5A 2BGNA 1FLAA 1C8LA 3TGWA 2EJUA 3F7OA 2WKWA 1ND6A 5MGBA 4CKCA 2QN6A 4P3OA 3KKMA 1NJ1A 3D8UA 1PK7A 3ILSA 1EAMA 1LX6A 5ALPA 1VG1A 3SFTA 4XB2A 3AHDA 2J07A 3KXIA 4O02B 1E62A 3LQYA 4UE2A 4ALKA 1P2BA 2QA5A 1ZC3A 4X84A 4YRGA 1IBLB 3CH6A 3JSAA 5LXTB 2A5LA 1ZH8A 2HGSA 3FHTA 2JIDA 2GZ1A 4Z1MD 2YXEA 3QSYA 1X1TA 4BMSA 3K5WA 2V4ZA 2NYUA 1NQVA 1Y9JA 5FOXA 5B1IA 4Q0MA 2PJUA 4O2BA 3BB4A 1WM1A 1ISPA 3R0VA 3IAS1 4QEDA 4YWHA 4D4JA 3Q8LA 3HO1A 3VU9A 1Z7WA 5EYPA 4CF5A 4C0HA 4WTOA 5FJIA 1Y5LA 3FOWA 1MN6A 3GUUA 3LVBA 5TVGA 2GJ4A 2AG0A 1K7CA 5JLJA 1GAXA 3EEQA 3DOJA 3ORHA 1YR2A 3PIDA 4CHTA 4LSMA 1Z8FA 2Z4RA 3Q2OA 1WUKS 1O6CA 1R0RE 3OZ7A 4MR9A 2FWBA 2NADA 4E31A 4I3FA 4Z7QB 1Z08A 1T26A 2DY0A 1LBQA 3FFAA 4DIFA 1Q17A 3Q12A 2C95A 4JL5A 1DBRA 4KIWA 3DTYA 3AJ9A 4ATNA 5J4KA 3E1KA 1HEIA 1RNLA 2CL0X 2EJCA 1M75A 3AUFA 3HABA 5D7NA 5H3CA 2CZCA 3SZLA 3VZQA 3ZGXA 3C14C 4QWMA 4EHDA 1MORA 3UH0A 4NNPA 1YQUA 5ALOA 4XM0A 2PX6A 2V54A 5HX7A 4DPLA 2V6JA 4H1TA 5K2OA 3TQCA 9ATCA 5I4BA 1NW7A 2QI9F 3ESQA 3SEQA 2J45A 5G1PA 5JMPA 4IINA 5CB4B 5A02A 5BSEA 1Q44A 3N59A 3RJZA 5AW2A 1NVDA 2M6LA 3QX3A 3LYUA 2P67A 4ALMA 5C7YA 1OI7A 2I22A 1FDWA 4MV3A 3GFOA 2DFPA 4FLMA 2KSQA 4EHAA 2FDXA 1C1XB 1T6BY 1K7FB 2R25B 1QHGA 4PS0A 2R8ZA 2BEJA 4QOEA 4REQB 1RKQA 4YCSA 2GN2A 1FX0B 3KHTA 1FE8A 2RKWA 3B1YA 3BRSA 4J07A 4KV9A 3VVLA 5JYBA 1W6UA 3A2LA 1RXIA 3F4KA 4PXAA 1LJUA 3F6EX 5IZCA 1WPQA 2ZTSA 3PZBA 1Y3DE 4S1PA 4G26A 2PZLA 1CUFA 4UPEA 3TFOA 2QIPA 4BP8A 2QRQA 2Y1WA 3CSDA 4L3VA 2OWDA 2FPPA 1EXWA 3R0XA 3QEMA 4WAUA 5CFOA 1PI3A 1MQ9A 3KKNA 4Y2QA 1TCVA 2VDLB 2FQYA 4Z0HO 2PAFA 2HU5A 2ZS9A 1QTRA 2D7CA 1NSFA 4HRXA 4BV2A 1HZJA 5CDSA 1NPDA 1D3AA 5D3MB 1WXXA 3R3WA 1FDUA 1MJNA 1YT5A 3EVEA 1I33A 3AUUA 1OREA 1KK0A 3BTUA 4HEA1 2EHDA 1ST3A 3HE3A 2ESRA 3THXA 3KB1A 2WAOA 2YQ5A 2GETA 1P4SA 1E66A 3LG2A 3IQEA 3QVKA 2QRGA 3UJ3X 4E6EA 1KEPA 4D4MA 1GCIA 3RTAA 3UJ6A 2ZITA 4DC9A 4RV5A 5C34B 2XAAA 4PZ0A 1P1IA 1SD2A 3S2UA 4DIKA 2WYOA 3N2GB 4LXGA 3NVMB 4HAWA 1RBQA 1TJPB 1Y4ZA 2ZBVA 5K09A 2BTEA 3FSGA 1Q21A 2WINI 1CS0A 4F8EA 1I7QB 3KZNA 4O3MA 2EC5A 4LXYA 3T54A 4US1R 3QRWA 2DPHA 4IXWA 4BB6A 1WETA 1VLMA 1C7FA 4RXTA 2YVUA 1RI4A 4AO6A 1TA4A 1PUIA 4KUEA 4XYBA 4U2FA 2DTDA 2O2SA 4BQSA 2XWBF 4JI2B 4RJ2A 4AJHA 2H08A 3LSYA 1TVCA 4NMHA 5NLLA 4C6TA 1VP9A 2FG5A 3AF5A 3AOEC 3D3EA 5K8TA 3W4KA 1NN0A 1R6AA 4LV5B 4A0SA 1VIYA 3GR6A 5KWJA 3HK2A 1ZK0A 2G4LA 2XE4A 4BVKA 4KPUA 5JTUA 3WE7A 3R8XA 3GEPA 5I7HA 2B7BA 1N33B 4Q24A 3VVBA 4P22A 4RU1A 5IULC 4IUCS 3B7WA 3UJ7A 1ZOPA 3FGZA 1OXMA 4BJ5A 1P4JA 1TYEB 1ZH2A 2G1KA 2QTVA 4G23A 1WVMA 4Y2PA 3BRWD 1UBJS 2OGZA 3F3SA 1FRFS 4IOLA 4JLBA 1PFKA 4PLFA 3WWYA 2OFWA 3P8ZA 1P74A 5HKBA 3H1TA 1ZBQA 1H5NA 3UMVA 1R1DA 2R79A 4II7A 5A4DA 3U4IA 3R3YA 4W6QA 5TQ2B 1XCJA 3NOOA 3WYFA 1NTRA 3N8NA 1JR3A 2O1WA 2PKWA 3K3PA 4FFRA 1F0PA 1OFUA 2A0WA 4YONB 5DLEA 4P3PA 4ZOCA 1U11A 1SBIA 2YNMD 5E7QA 5JAIA 5EHQA 1Z75A 1JFVA 1G8FA 1PW7A 3F2IA 1YJQA 4H9GA 1ZGAA 3GV0A 1XKXA 4FHDA 2PKYX 4NULA 3ONVA 2RHOA 2OCAA 2R751 1QHEA 3HCBA 4JI8B 2CL5A 2PSEA 2LV8A 3N0RA 1P0MA 2V8OA 4FQ8A 2ZK7A 3ZY4A 4EKGA 3HJCA 1IHYA 2Q2WA 5E6SB 5KNBH 4LC0A 1Q11A 1UBLS 1UXKA 2BSXA 3KBOA 3ZGZA 1LSOA 3PS9A 3DXFA 1E1MA 1W9MA 1EUDB 4GR9A 3MS2A 3DJFA 5JAPA 3TLEA 4CM1A 4P7BA 2PGLA 1BDHA 5CGZA 2OESA 2O8FB 2FHPA 3CURA 3N3BC 4ER5A 3IE2A 1FP2A 1Z4OA 1FFBA 1JVNA 5FEMA 5JSZB 1GLNA 4F2WA 2X0IA 4L0DA 1JJVA 3AQ4A 2W2NA 3D6UA 3EG9A 3QUSA 3S2YA 4MV7A 4TMFA 1DJLA 2OCGA 2YZNA 4LF8B 4BQQA 4OQXA 1ADFA 2NT3A 1XR3A 2O50A 4NCXA 4F8YA 4JYZA 1FTQA 1Z12A 2AYYA 1BW9A 2GTPA 1J90A 2D06A 4ND1A 2FZWA 2OT3B 1LSSA 3BE8A 3GC6A 4K9OA 1Q1NA 2MSKA 4OMUA 3RSHA 1TVKB 4HGNA 1WF6A 5TPZA 1KS2A 1NONA 2VFAA 3ZE0B 4EY4A 2BHSA 2DT5A 1SUBA 4LRWA 5JADA 4MZXA 1XCLA 5AUOB 4F6CA 2H5IA 1AG9A 1E1QA 5CFQA 1CIJA 2B4AA 1LNQA 4F72A 2IZ0A 4E5DA 3B6MA 2OAEA 3G8YA 5MF6A 3LOQA 4LZAA 1DJQA 3M5WA 3IESA 1P1BA 2EJWA 4AY4A 4AFNA 4OQ4A 2IEIA 4HK4A 3RRMA 1A71A 4L4XA 4G9EA 3PSHA 4WACA 3FBWA 3V1YA 3QPAA 4B81A 2UUBB 2QSYA 4TTVA 4YR7A 5EE1A 5CHYA 2D6FA 3K31A 1KEEB 3W3AA 1ATIA 5HIMA 3MSXA 5LUAA 2JASA 3EAGA 4KNVA 1LDBA 2R6ZA 4KNYA 3L04A 1RTTA 5DOVA 4PAMA 2YYAA 2M98A 1YZ3A 2NT4A 1T4MA 2Q0XA 3U1TA 5I7RA 2WQ6A 2FXIA 2AN3A 3SFVA 1VP3A 3S68A 1G8JA 2RONA 1L4MA 2QK4A 3EMKA 2HJWA 4LRXA 5BQPA 4ESOA 1MFZA 4MUIA 4EITA 5K4AA 3Q7EA 1T9HA 1J0XO 2UZAA 4DZRA 1WUYA 3O4RA 3HWX1 2HA7A 1HRKA 3CC8A 4PNHA 2JLXA 3HNRA 2R00A 2WJ6A 2Z30A 3PUHA 3QBDA 4G9GA 1VI6A 4C7OA 1CLUA 1J0BA 3V5NA 3CLRD 3KWFA 5KTKA 1LF0A 2ZIGA 1S96A 4FHCA 5T4FA 3VR4D 4WNCA 4NQRA 4P9NA 4LXQA