5HZGA

The crystal structure of the strigolactone-induced atd14-d3-ask1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
262
structure length
257
Chain Sequence
NILEALNVRVVGTGDRILFLAHGFGTDQSAWHLILPYFTQNYRVVLYDLVCAGSVNPDYFDFNRYTTLDPYVDDLLNIVDSLGIQNCAYVGHSVSAMIGIIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLAVGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPTCVIQTAKASVAEYLRSHLGGDTTVETLKTEGHLPQLSAPAQLAQFLRRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/signaling protein/protein binding
molecule keywords Strigolactone esterase D14
publication title DWARF14 is a non-canonical hormone receptor for strigolactone
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 61
structure length 257
sequence length 262
chains with identical sequence E
ec nomenclature ec 3.1.-.-:
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hzgA00
4Y2YA 2WU4A 1QJ4A 5T4BA 5JARA 2VT7A 3C87A 3STUA 3R0VA 1FJ2A 2GBIA 3WK5A 3WWEA 5YASA 4U2GA 5CH3A 1KU6A 1XZLA 3FLEA 3I2IA 4JYPA 4BCDA 4B9AA 4QDOA 4LYDA 4UBLA 4Q1VA 4EA6A 5AJHA 5CH5A 1EVEA 2Z8ZA 4U2EA 3CN9A 4AMZA 3LIIA 3F98A 3Q0TA 2ZJFA 1UWCA 5IH7A 3QH4A 1ZJ5A 3CCBA 2RGUA 4BAUA 4E11A 3FCXA 2XQIA 4X6XA 4U2FA 1MJ5A 3IURA 2VSQA 1FSSA 4PSDA 4J0GA 1W4LA 2ZVDA 5LZ7A 4RE6A 1E66A 2WTNA 2PU7A 2XT0A 1QO9A 5LP1A 4LXGA 4IHAA 5HKAA 1CUVA 1SCKA 4PSUA 4MYDA 1GPLA 1DX4A 1UOOA 1RP1A 3MUOA 2C0QA 5CT5A 4DMHA 3FVRA 4LXIA 2HA5A 4C4ZA 2GBCA 4J0HA 3JYHA 3FSGD 4X94A 1XKTA 4G4IA 2E3JA 3KDAA 1HPLA 4N8EA 1MAHA 3QMWA 2HRQA 1AGYA 5CXUA 4PW0A 2JBWA 4N5HX 4QA9A 4QE3A 2FJPA 2JF0A 5E4TA 5AI8A 4O08A 2PSFA 1U2EA 4Y2VA 3KSRA 4UHDA 3V1MA 2ZSIA 4UBKA 5FPPA 2O7VA 4G9EA 1E8MA 1MNAA 4N5IX 2GBFA 1K5PA 2P8SA 2G4LA 5IVHA 4GXNA 4JEIA 2AJ8A 4B85A 3DL4A 3A70A 1JT2A 4B81A 3D4LA 3C6YA 4HZGA 4KRYA 2HM7A 1UZAA 5BOVA 2EDCA 1ACJA 1U4NA 2HU5A 4FKBA 2VJAA 4FNGA 1GGVA 4B0PA 2OPHA 1ETHA 3BXPA 4DIUA 4M0MA 3DS8A 1CUWA 3T4UA 1XRQA 2BUAA 1WB5A 4IH1A 4BTVA 3ZLTA 1N5MA 2Y2VA 3I1IA 4HTAA 1JFRA 5HF9A 4Y7DA 5AKIA 4C6HA 3EF3A 1HQDA 2OXEA 1ZIXA 4FDMA 4ZRDA 4F60A 5AM3A 1T2NA 5I7UA 4AO7A 5LKRA 4MJ3A 5EIHA 1XZBA 2C4HA 3G0DA 1AC5A 5HF8A 4EUSA 4E15A 2B61A 2VEOA 3O4HA 2BCEA 4UHEA 5DYYA 1W1IA 1BS9A 2PVSA 4H7DA 3KWFA 4FHZA 1IZ7A 4DTCA 7YASA 1EINA 4FTWA 2VJBA 2XQKA 2I03A 2RAUA 1QE3A 3FLAA 1DWQA 2J4FA 2XQFA 4GWLA 1W6RA 5ALJA 3GROA 3H2JA 3EQ9A 1JJFA 5AOBA 4BVJA 1VZ2A 5FPQA 4J0IA 4UFNA 4G4JA 5EHXA 3BJRA 1IVYA 2DQZA 5AOAA 4Y2TA 3VDXA 3VVLA 2ZJ7A 3BE8A 2XUAA 4FBMA 3DQZA 3FYUB 1LPSA 1HBJA 3E0XA 1O6GA 3W05A 1Q84A 1U8EA 2HDWA 2I3DA 1E3QA 4B84A 1Y7IA 4QDTA 4BP9A 5K3AA 3WL5A 5ALNA 1JMKC 1XQWA 1USWA 2ACEA 5C7YA 1ZJ4A 2C7BA 3IUNA 3I2FA 1QO7A 4QZVA 2OCIA 1AZWA 2C5GA 1VLQA 2GZSA 4UHCA 2WHRA 1P0PA 2XQGA 5ALIA 3DOIA 4J0DA 1L7RA 4YASA 2X76A 5AI4A 5A6VA 5AKZA 4ITVA 3HACA 1TKRA 1BRTA 3QPAA 1PV1A 2HA0A 2WFLB 1DINA 1XRNA 3RKSA 3O0DA 4EY5A 5A7FA 1YCDA 4P9NA 2HA4A 2WUGA 3U0VA 3CCCA 2BKLA 4X97A 5A62A 1K6EA 4K6GA 2XUJA 3ED1A 3R3ZA 4FFWA 4TPKA 5EHQA 4H35A 3WI7A 3K6KA 3WYNA 5JZBA 2JGFA 2FX5A 5ALMA 4GLBA 1UOPA 3R3WA 1GQRA 1QZ3A 1GKKA 1THGA 2PPLA 5HF6A 2XUPA 2BUBA 1WOMA 3UUFA 1K4YA 2QM0A 2VQ6A 1CUDA 3FVTA 5ALGA 1OXMA 4J3JA 4TGLA 2OGZA 1ZGCA 4WCVA 5AKEA 2WJ3A 4P08A 3RLIA 3C6BA 3BDVA 4DNFA 4GEGA 4L0CA 2J3DA 1VXRA 5IKXA 4EBBA 4I4CA 3QITA 1QIKA 2QVBA 4CG1A 3HRHA 5ALLA 1HLGA 1CUZA 3WWPA 4ZV7A 3GBSA 5C8VA 2OGTA 3C5VA 1WB6A 4BVKA 3WKDA 1ZICA 3AIOA 4JYMA 1XKLA 3C8HA 2XMDA 4OD0A 2DHDA 3VKFA 3KD2A 1ZGBA 4W1SA 4MYSA 2H7XA 5D3ZA 3DJYA 4CIAA 5HFNA 4DMCA 4E14A 4EY7A 4QEKA 4OU4A 4HRYA 1ACLA 4QWMA 4XJVA 4MWSA 4AZ0A 2QR5A 2V98A 4UBOA 2DCMA 1ZOIA 2H1IA 4Q3LA 4KAJA 3W04A 3AIMA 2R11A 3GFFA 3ILSA 3PICA 2QKYA 2WFMA 1A8SA 3FYUA 2ORYA 4BE9A 1FFEA 4UHBA 3K9BA 4BRSA 5K3CA 1C7IA 1GZ7A 4FMPA 2I78A 1EVQA 1EB8A 1JU3A 5HCUA 3IB3A 5FP0A 1CV2A 4DM7A 1BN6A 2XUHA 4L9AA 2ROQA 4UFOA 4RE5A 1HL7A 5CT6A 5A7HA 3SX4A 3W06A 4CG2A 3G02A 1EDEA 4AXBA 3WK9A 1A8QA 4H7JA 2EEPA 3GUUA 3SWWA 5DNWA 3X3HA 1T4MA 4M0EA 1CVLA 3BIXA 5CT4A 4GW3A 3HI4A 2BGRA 3D59A 3WZMA 1WPXA 4NZZA 5AH0A 5AKYA 5K5EA 1QONA 4GECA 3EBLA 5DLPA 1S8OA 2JGKA 3FNBA 5ALYA 4Y2SA 2RI6A 4YPVA 3WYDA 4IH9A 4Y2RA 4QLAA 4FLFA 5AI5A 3WIOA 3LIPA 4W1QA 4OPMA 2VT6A 5ALHA 3IVMA 3WJ1A 3WKCA 5ALEA 2AXEA 3H1AA 1NU6A 3VJKA 5AI9A 3ESBA 1CIJA 1LPAB 4KYVA 5AK6A 5IVKA 1DWPA 1BU8A 4C89A 3F8SA 4RPCA 4DSZA 4ETWA 2XMCA 2HU8A 4J0KA 4B80A 4EY8A 4MXDA 4UFPA 3UUEA 4BAZA 1IUOA 3KXPA 3VISA 5JATA 1PJAA 2RHTA 1LBTA 3TGLA 1CUHA 3DKRA 3NUZA 2JEYA 3FYUC 1E8NA 2ECFA 1ZI9A 1HKHA 1X2EA 3DDUA 1ZI6A 1SC9A 1E8DA 3IA2A 1YS1X 5K3FB 4G4GA 1UK9A 4EHBA 3P2MA 1MAAA 4IQ4A 4J0CA 1X2BA 2PSHA 1DU4A 1QGED 1VKHA 4MWTA 4P93A 1R9NA 4EY4A 1UKAA 1YA4A 3AUKA 1K63A 2ES4A 3G9TA 1ORVA 1JI3A 1X70A 1H2XA 4TVKA 3TRDA 1ODCA 5HZGA 4AN0A 5ALDA 1H2WA 4PNZA 5AI6A 4Q34A 1AX9A 5CURA 4M0FA 3HZOA 1B41A 3C70A 4FWBA 2Q0XA 4Q3OA 4H7IA 1CUEA 4OCZA 2G5PA 5ALUA 1RYYA 4AO8A 1UFOA 3CXUA 1XRRA 4UPDA 2GBGA 2K2QB 3G0CA 3DOHA 2PSEA 3WMRA 3WZLA 3HSSA 3ESAA 1XZGA 3L1HA 1XQXA 3IIIA 3WKAA 3FOBA 2WG2A 3PDCA 1XZAA 1ZD3A 3F9CA 2GYVA 3RARA 5JD6A 4BCBA 1CUIA 1WM1A 4GDMA 1A88A 1BEZA 1CUGA 3G0IA 3E1GA 4ARAA 4MEAA 4NMWA 1LPBB 1O6FA 1M33A 2GYUA 4X71A 3IDAA 1AKNA 5AK4A 5ALOA 3STVA 1CUCA 1J2EA 1CUXA 3NWOA 5E4YA 1YAJA 5T4EA 4FLMA 4Y2QA 2HA7A 2WQZA 3AZQA 3LP5A 5DNVA 1JMYA 5AM0A 5I9IA 1TCAA 2XUQA 3IBTA 3M83A 4BDSA 5K3DA 4KE8A 1ZD2P 4X85A 5AO9A 3HXKA 5LLSA 5DYWA 4WDQA 2O2HA 5K3BA 4I19A 4BC1A 4NS4A 1QIFA 1QOZA 1P0MA 3TJMA 5ALXA 4BZZA 3H17A 1LGYA 2JGIA 2OQIA 5CH8A 5HF5A 5AIBA 1SOMA 2HU7A 1ZI8A 4K2AA 5F4ZA 1LBSA 1DX6A 5AP9A 2PM8A 5FXMA 3QBJA 3V1NA 5ALPA 3I6ZA 1KEZA 3WIBA 3FBWA 5JAOA 3D2CA 1XLWA 2QUAA 3BJMA 1F0NA 3BWXA 2XMBA 3B3QA 3IUMA 3FYTA 4YK7A 2QXUA 4HAIA 4WY8A 2WTMA 1EB9A 4OSEA 1EA5A 5K3FA 5AK5A 4Y2UA 4A23A 5CTAA 1WB4A 1XLVA 3DLTA 2IX9A 1XRLA 2DR0A 4OU5A 3EQ7A 1TRHA 4H7FA 1THTA 3STXA 3ICWA 3OOSA 5BWBA 3IUQA 1SCQA 3STWA 4C88A 4UUQA 4UHHA 5ALKA 3E4DA 1VXOA 2CKMA 5JAHA 5HQ3A 5JYCA 5KWJA 3RM3A 1G42A 4BZWA 1P0IA 4KE6A 3AINA 4C01A 3TEJA 4EZIA 5JD4A 5FKJA 3SK0A 2ONCA 4DMKA 4D9JA 2ZSHA 5C81A 1MX5A 4DGQA 3EIOA 3H2GA 4KE7A 3C8DA 2OCGA 1YR2A 2HFJA 1C7JA 1G66A 4UBIA 5SYMA 1XZDA 4J7AA 2QUBA 4PF1A 2RONA 1GKLA 2WIDA 1OCEA 1WCYA 1UT6A 2X8BA 4K6KA 4DLNA 4EB0A 1VJ5A 4NVRA 3R40A 4U2DA 4JNCA 3H1BA 3O4JA 3V48A 4A16A 4ZXFA 4L72A 1H22A 1XZFA 4QDXA 3W2TA 2Y1KA 4WFKA 4CI9A 4UHFA 2AJDA 4G8CA 4E46A 3QPCA 1R3DA 1VOTA 1UXOA 3AILA 4UBJA 3H2KA 2ZYHA 1P0QA 2WIFA 4F0JA 4U2CA 2PBLA 1Q0ZA 1CQWA 2HFKA 5EHNA 2G5TA 3PUHA 4J03A 2CUTA 5AOCA 1H2ZA 4JUIA 1VE7A 3H04A 4J0JA 1LLFA 4G1FA 3FCYA 1WHTA 4GI1A 1B6GA 2WG1A 5E4JA 4X90A 4AMYA 5A7GA 5AIAA 3D0KA 1MO2A 1YAHA 4AQDA 2CJPA 4WFJA 5C8XA 3G7NA 5CRIA 2PUJA 3H0CA 3B12A 3IUJA 4CFSA 1Z68A 1L7QA 5FUMA 3WWCA 4V2IA 3R3UA 3ZV7A 1VA5A 2XLCA 2R8BA 5D3KA 4U2BA 4W9RA 4PV7A 1XRPA 3R3YA 2D5LA 3D2AA 3IULA 4B0OA 4UBMA 1FFDA 2WUFA 2JGLA 1EK1A 3FSGA 4BATA 5JZSA 2OLEA 1BE0A 3H18A 5BWCA 2VAVA 3JW8A 3VJMA 3OURA 4KAAA 3WKEA 4JH0A 2B9VA 4ZREA 3A6ZA 4MEBA 2B4KA 1XQYA 2H7CA 4B9EA 2OCLA 4X3CA 2X5XA 5T4FA 1YS2X 5D7BA 2C58A 4CCYB 1XZJA 1MX9A 4H7HA 4KEAA 3PFBA 5JASA 5AKGA 1R50A 5KWIA 4XIIA 5ALZA 1E5TA 5LIPA 3M3DA 4MQLA 2UZ0A 5EFZA 4KRXA 2HA2A 5AM1A 4C4YA 5ALWA 1IZ8A 5T4HA 3ANTA 4FNMA 4LIPD 2WIJA 4BDTA 2DHEA 3OM8A 3C5WP 1RWQA 4G9GA 3R41A 3OC0A 2XMQA 2O2GA 5FOQA 1TAHA 5JADA 2D0DA 3WK6A 1VE6A 1IUNA 1CUUA 2CEKA 3BDIA 2RIPA 3F67A 3O9MA 5ALRA 2PU5A 1Y7HA 3C6XA 2Z5GA 2OGSA 4QNNA 4A5SA 3PE6A 4X6UA 4HXGA 3WJ2A 2O2IA 2C5FA 1FFCA 3STTA 2V97A 1KU0A 1CUBA 4HXEB 4BYMA 1N1MA 4KJXA 4Y2XA 2IIVA 4OB6A 4FFVA 3WWDA 3HYSA 4G5XA 4H77A 3R3VA 2PSDA 2WJ4A 2V9ZA 1HDEA 3ZLUA 1EH5A 2FJ0A 1QIDA 4BCCA 1MPXA 1YA8A 5JIBA 5J3JA 2EDAA 4BTLA 3N0TA 3ESDA 4HVTA 4CG3A 1QIJA 1IMJA 2I3ZA 3ZPXA 1CLEA 1LZKA 4RGYA 2WFZA 2WUEA 2GZRA 2QT9A 1I6WA 3I6YA 4BAGA 4BRZA 4PQEA 5KBYA 1MNQA 2YYSA 1QLWA 4Y2JA 4F5ZA 1EX9A 1QIIA 2XUKA 2XE4A 2BFNA 2BGNA 5EI5A 4CIBA 4WDRA 4OYLA 2HA6A 2ZYIA 5AKLA 5DNUA 1XZIA 4INZA 1SFRA 2WHPA 2PL5A 3DD5A 3I2JA 2W6CX 2HIHA 3I2HA 5AHXA 4FOLA 5JD5A 4I3FA 1R4ZA 3BIWA 3GZJA 1GQSA 5AM4A 5C8ZA 3PF8A 2DHCA 1G5FA 3MVEA 2XLBA 5DTJA 3AZPA 3QVMA 3DKKA 3WL7A 1EDDA 5CXXA 1ZIYA 4X91A 4AO6A 5LZ2A 3VVMA 3R3XA 1ISPA 1EI9A 2CZQA 5ALQA 1GPKA 3L1IA 4L3WA 2CMFA 1CQZA 1A8UA 3MGAA 5EIEA 3EQ8A 2PSJA 1CFJA 1F0PA 4CCYA 1QFSA 5H3HA 2XUFA 5JAUA 4PSCA 1XZMA 5HQ3B 2WSLA 4BB0A 1EXWA 3G0GA 4KACA 4AX4A 1SCIA 1A7UA 4HRXA 1N5RA 1DTEA 3WKBA 1CUFA 1UK7A 3K2IA 1K8QA 1YB7A 4Q82A 4ZV9A 3O4IA 4RNCA 2QJRA 1DT5A 4X00A 5CBKA 2VTVA 3I28A 1TK3A 3DCNA 1JJBA 3I2GA 5ALVA 1H23A 1BCSA 3N2ZB 2RHWA 3QYJA 3LLCA 3SC2A 1J06A 2O7RA 3A2LA 4K6HA 1DQYA 3DL7A 1YASA 4G8BA 3W9BA 3WK7A 1XRMA 2QJWA 3ZLVA 5JZ9A 2JGEA 5DJ5A 4ZI5A 3HEAA 2VATA 5ESRA 1QIEA 4BE4A 3S2ZA 1CUAA 3O4GA 4K5QA 5JALA 3H19A 1H2YA 4ZWNA 4FBLA 5DYTA 4ARBA 4X7BA 5LYYA 3GA7A 3DYVA 4H18A 1FFBA 1C4XA 2CBGA 1Y37A 3PUIA 1JKMA 3D5EA 1R9MA 3NOXA 4WJLA 1ORWA 1LPPA 2XUOA 2JGMA 4Q3KA 2Y2UA 1MT3A 3T52A 2XUIA 4WFIA 2CB9A 1AMNA 2Z8XA 3G9ZA 3PFCA 1Q0RA 4DSAA 3V1KA 3I1YA 3LCRA 4ZGBA 1F8UA 4YX9A 3BF7A 1BN7A 4PO3X 3BF8A 5HK8A 1BEEA 2WKWA 1YSCA 2QRUA 4LHEA 5JAPA 2BJHA 3C6ZA 2AJBA 4XX1A 2FUKA 3ANSA 3U1TA 4AZ3A 5DTIA 4LYEA 1ODSA 1GT6A 2ACKA 1N8SA 3JWEA 4DYHA 3DEAA 1QFMA 3WK8A 4HXFB 3OG9A 3HJUA 5BV7A 2GYWA 1QIGA 2XMGA 4DNPA 3S8YA 2PKYX 5AICA 2WG0A 4N8DA 5ALTA 4QDUA 5AKJA 5LZ4A 1JU4A 4H0CA 3VJLA 4Y9SA 3PF9A 2WIGA 2XUDA 1UKCA 1XZHA 4QDZA 4KAFA 4UBNA 2HADA 2QZPA 2ZYSA 4XVCA 1MTZA 3A2MA 5FRDA 2C0PA 2WLSA 4XWGA 1XROA 2WUDA 1WPRA 2B20A 3ESCA 3H2IA 5HFAA 2G63A 4BVLA 2J3QA 4H7KA 3QMMA 1UK6A 3WA7A 5AKHA 2VJDA 3D7RA 3L1JA 2YH2A 4KR0A 5CW2A 1OILA 5EIAA 1EHYA 3WL6A 3ZI7A 2AJLI 1IUPA 2HRRA 1NU8A 3AIKA 2XUGA 4X95A 1UK8A 4F21A 3RK4A 5AI0A 2XDWA 4HS9A 3WWOA 5DWDA 2WHQA 4OUKX 5ISMA 1TIBA 3QM1A 3NGMA 3STYA 4GHWA 1YB6A 5FDFA 5SYNA 5E2IA 1ODTC 3W9UA 1NX9A 4BP8A 1QTRA 2HHAA 3WLAA 4QWWA 2XB6A 2IITA 5JANA 5HK9A 3E3AA 2XI4A 1FFAA 1R88A 1WHSA 5HKBA 3O9VA 4G8DA 5ALFA 2QTBA 2VA9A 4W1RA 2WU3A 2NW6A 4OYYA 1LZLA 1TCCA 3KOOA 4IO0A 4WY5A 3WL8A 2PX6A 2VAXA 1CUSA 5D6OA 2DQYA 1VZ3A 5LKAA 2H9YA 1DWOA 4CCWA 2WHPB 5IVDA 4X92A 3LS2A 4Q05A 5EHZA 1J07A 3V1LA 3ZWQA 5IVIA 1GPNA 2AJCA 1CPYA 1L7AA 2HL6A 4MQMA 1XZCA 2ZYRA 2WJ6A 1AUOA 1J1IA 3FAKA 1E89A 3I6MA 1D07A 2VJCA 2OCKA 2OG1A 2QOEA 3F96A 2WIKA 4X6YA 2Y6VA 3VXKA 1CEXA 1U65A 5LZ9A 3KWJA 1MU0A 4LXHA 3C43A 1XZEA 3A2NA 2XMSA 1ZD5A 5CT8A 6YASA 5LZ5A 4BC0A 3G9XA 5AKXA 4B83A 3WK4A 2WM2A 2QMQA 4DMFA 1DT3A 1DQZA 3ICVA 3D3NA 2XMZA 1EDBA 1XLUA 3YASA 5CT9A 1TCBA 2LIPA 2OQVA 2OAGA 2PUHA 1W52X 5LZ8A 1CRLA 1LNSA 4N8SA 3DYIA 3I2KA 1ZD4A 2JGJA 3UMJA 2BUCA 4P92A 2YASA 1VA4A 4LKOA 4B7ZA 1UKBA 1MX1A 3H2HA 4IH4A 1Q83A 1EK2A 2DSNA 3HABA 4W63A 4C4XA 1W76A 3WA6A 4QLOA 5K3EA 4B6GA 2ZJ6A 1QIHA 4AN1A 4AB1A 2YXPX 1JJIA 2XMRA 1AQLA 4X93A 3AFIA 4GBGA 2J4CA 3F97A 1XFDA 2BAGA 2Z3ZA 5A2GA 4KE9A 1LPOA 1TQHA 3G0BA 3BL8A 4Z49A 3MUNA 2Y6UA 2OAEA 5CMLA 2QS9A 5AM2A 5I8PA 2Z3WA 1F6WA 5ALSA 5FV4A 3GELA 5KREA 3AJAA 3AZOA 3HC7A 1UOQA 4C87A 1LPNA 4S0XA 5AK3A 3FWHA 1XQVA 3M82A 4OB7A 5AM5A 3O95A 5A71A 4ROTA 4OB8A 1AURA 3Q8WA 2WFLA 1QIMA 3QPDA 3DNMA 1CUYA 2VF2A 5AKKA 3QMVA 1GXSA 4DNOA 3OPMA 2V96A 1R1DA 3WQHA 1LPMA 5EGNA 3D2BA 4BBZA 3G8YA 3CN7A 1PFQA 3HLKA 4Y2PA 2JIDA 1CUJA 1BCRA 2XQJA 3QZUA 3FLBA 1MN6A 1W75A 4EY6A 2JEZA 3C45A 4B82A 2WILA 2W22A 1CR6A 2DFPA 4H7EA 2HA3A 1G4HA 3V9AA 4FLEA 3OTQA 2QXTA 4DNQA 3M81A 1XZKA 1BROA 4W1PA 3PI6A 2H7YA 5FLKA 1QTIA 3B5EA 3G9UA
chains in the Genus database with same CATH superfamily
4MYUA 1O57A 2PMFA 1QJ4A 1JAZA 4OF4A 1D04A 2NXCA 4ZAZA 2FK7A 1YJQA 3NIDB 3QYFA 1A7AA 3TIFA 2F4NA 3C87A 2EOAA 4LC1A 4O4JB 1LLUA 4KR3A 1FJ2A 3O2SB 5K8CA 3B6JA 3WWEA 2CLCX 4MVJH 1E3JA 4V38A 4Y1RA 2A0KA 2DHRA 4U2GA 1NT4A 1T2AA 2QN1A 4L9WA 3C8MA 3MFQA 1W48A 2PGNA 5BN3B 1U04A 2Y0DA 3DTYA 1P3DA 4HQ6A 4NCXA 4LRWA 1ORIA 1XYVA 4IW3B 4PVDA 4QO7A 1C4OA 3ELBA 3I2IA 3IHKA 1KGDA 3JASA 3EULA 3IAS1 3QF7A 3ZW7A 4B9AA 4GYYA 2FR8A 4XPZA 3DT6A 3IVRA 1Q22A 4PLYA 4Q1VA 4C5BA 2BM9A 1NBIA 3RG8A 3Q1KA 1JKIA 1ZCJA 4Q3AA 2ZWIA 1EVEA 3KKMA 3M1YA 1MXFA 1YRYE 2BGWA 1PZEA 1BGVA 3KEOA 5DNCA 2FSUA 1EBFA 4BP1A 2HC9A 4O4IF 4ZYLA 4EFKA 4BNZA 13PKA 1YV9A 3DQPA 4MRVA 1VIYA 1OI7A 1ULUA 3EVCA 3T9BA 1GADO 1HG1A 3T7RA 2QSZA 4BQSA 3LT1A 4Q6BA 1ZM2A 3KB1A 3SQLA 3HZZA 3BA1A 1YU6A 4AUNA 4YJFA 1DAMA 2V8BA 4XPIA 1P1BA 3UOGA 2CXOA 4CCAA 2V9PA 2ZSDA 4QVKA 1J4AA 2EAUA 1NVAA 3OSUA 1RFLA 4Y6SA 3PD7A 5DV9A 3U9LA 2GZ1A 1O9HA 2EEZA 4NNOA 1WUIS 5GWXA 4GE0A 4RETA 1XB2A 1CR1A 1D8TA 3B6ZA 4GC5A 5E7IA 2D1RA 4K8OA 3R9WA 2WTNA 5I7HA 3FZNA 4GKVA 2PU7A 3ZHBA 1KY4A 5K8VA 1PYGA 3D3EA 5LP1A 5FNVB 3KTFA 4LXGA 1RFGE 4NE7A 4OFXA 4KR9A 1SIWA 3AM4A 2L19A 3UJ6A 4C14A 1Y4ZA 1P19A 4QOSA 3QUCA 1E1CA 1OX5A 2W83A 1GO2A 1Z63A 2C3UA 3UTDA 2IT1A 4Q4CA 1FJGB 4MV6A 4MWBA 3ZTTA 1WRBA 2QAGA 3N5CA 5HRAA 4GEKA 5IHXA 2P4HX 4OXKA 1DEAA 3ZX5A 5KHLB 3DLIA 1WPQA 3PDHA 3SJBA 2BLNA 3C3XA 1NASA 3AKCA 4CM4A 2HJWA 1KVSA 3UXYA 2ZRBA 4BNMA 2C0QA 1PQUA 5JSHA 5JFGA 3DP7A 2A92A 5FPHA 2K2WA 5I8ZA 2PRIA 4DMHA 4KN6A 1Z0JA 2J5RA 4FHCA 4OSPA 1Z6PA 2BMAA 2D54A 4YQEA 1XBTA 4ZEWA 1DJPA 2QTTA 4KWTA 4MV0A 2V55B 3PHGA 3QBEA 4NOLA 5D5PA 2EU8A 3T3HA 3FY4A 2IV2X 5CB4B 1IM8A 1Z4QA 3OCCA 5ILQA 5JMPA 2C7GA 2QAJA 4Q7QA 3G85A 4G4IA 2E3JA 2Q3MA 4PX2A 4BB5A 4RYLA 1QFYA 4G0OA 3NIGB 5E7MA 3ROEA 1KYVA 3ZCTA 3GPCA 4E4RA 2AE1A 5DLDA 1M9NA 3UA3A 2HREA 5L4SA 1FDVA 4ZAVA 1HLFA 1FNSA 3GUCA 5J2TA 5KYTA 3WGNA 4GR9A 2JI8A 1A7KA 3Q3JB 1YMVA 1Y9DA 3REFA 3DHNA 1XJ0A 1HQYE 1I0IA 3ZWXA 2VHWA 2XQVA 3PZRA 4ZOLB 5B53A 3HFRA 3TIGA 5FBVB 1Q7EA 4KV9A 3NM5A 4DW8A 2PBZA 2ZWOA 2XF8A 3BULA 5GIOE 1QFXA 4ZANA 1U2EA 3AR7A 3U3DA 4BMYA 2FEKA 1TUBB 4MOWA 3GT3A 1W0CA 4YMSA 4EJSA 1J99A 4LUCA 1ILEA 1YZVA 3FPCA 1F2TA 3L8HA 4UBKA 2ODQA 3W90A 5FPPA 1GGEA 1E8MA 1GG5A 1MNAA 3BGIA 1JEAA 3D43A 3KOYA 1Q7GA 4KIJA 4MR8A 2IU4A 3KEMA 2JZNA 4KYTA 3JZMA 1K5PA 5GPBA 3E5MA 3VU1A 3OLWA 3T95A 4IMJB 3W9YA 4D41A 3DR3A 2V03A 3ZJVA 3DC2A 3L7IA 3SCZA 3WHIA 1FFXB 4GXNA 5DW3A 5LD2B 3FKSD 3BWBA 4PLPA 3PXXA 1OKKA 4FKMA 3KR2A 2ZW9A 3DL4A 1TLLA 4EARA 1HNWB 1ENYA 1YE5A 1T2UA 1TMYA 4KBGA 3I83A 5LBUA 2HZBA 5DHUA 1ZLYA 5CDGA 4GZ5A 1KMCA 4QG7A 2EGUA 2NPOA 4KWIA 2ZE5A 4UPVA 4E30A 3C6YA 2NQ2C 2Z6AA 2QPLA 2H8KA 2GPBA 3MJFA 3T54A 1KWGA 4RKWA 1QC5B 3H4MA 3C7TA 2GM5A 3FH0A 1ANKA 4IMRA 1UZAA 1OTYA 4YRGA 1C1YA 4QXRA 5L40A 2ZZKA 3K0EA 3ZHSA 4AP9A 4FNGA 2ZJ8A 2KW5A 5K4HA 4G5OA 4G41A 4YUZA 3MTGA 3ZBTA 3RTAA 2JCBA 3BXPA 3QEMB 2A9OA 1G291 1P77A 4GQIA 4OH1A 3ESXA 1WF6A 1QRAA 1ZWKA 1Z6XA 4X3OA 1XRQA 2AT1A 4LV8B 5HG0A 1AKUA 2AS0A 1RACA 4R51A 2CDRA 1JKXA 3PG5A 3QLVA 4F3YA 2L69A 1JLLB 2BKVA 1OX4A 3LQRA 4JVSB 5K03A 4HP8A 3QLEA 1K92A 3I1IA 1KE2A 1JFRA 5ADHA 2PG3A 4Y7DA 1PJLA 5JVDB 8GPBA 4X60A 1MZPA 1FYWA 4E7PA 3R6WA 5K0ZA 4KC0A 4F60A 4KQ1A 5EMJA 5JXWA 4AKGA 4O4JA 1LDEA 1XR3A 4M7OA 1M0TA 2A9KA 4BQQA 5CLJA 3LBIA 1MG5A 5DX8A 5LYJF 1E6CA 4MJ3A 4I2VA 2C8KA 3AP3A 1JWAB 3JQ6A 3W79A 1RZ3A 1XZBA 3Q6IA 4FDLA 2H57A 5FX2A 1V6AA 2WTUA 4PZYA 2ZR9A 2FUG1 4EUSA 3LMKA 5TIIA 2VEOA 1XAIA 4KBFA 2PZEA 4DCOA 1WDKA 3MD0A 1O58A 4NPCA 5K7SA 2FPLA 3L49A 5EE3A 1QVWA 2PVSA 1GJRA 2Q8NA 3UK2A 4E94A 1JIXA 3RIHA 4FHZA 1IZ7A 5LCXA 5KJCA 2QRPA 1CY4A 2HR1A 3CUEF 3KKPA 4WT7A 2DTXA 2QGFA 1KY2A 1MBZA 2RGBA 3OIVA 5IASA 1BAPA 3M6LA 4LZZA 2ZJAA 1Y7PA 3AY0A 2Z2IA 4N5NA 3P9PA 1U0SY 4DIOA 1Z0FA 2IXEA 1UBSB 2JVIA 3ZGXA 1QE3A 2ATXA 3FLAA 4FN5A 2J4FA 3AJDA 2DPXA 4Q16A 5GM1A 3TFWA 2RKOA 3D4BA 4G3XA 3OA0A 4PBSA 4DLZA 1JA1A 3CH4B 3DMRA 1K0FA 4NYJR 3NHBA 1NHWA 1DJLA 2N1BA 3EQ9A 3L0SA 3LUPA 4J76A 4MUGA 4AZ0B 4FE3A 1VZ2A 5HEKA 1W1WA 5MFPA 2NO1A 3VYRB 1EFPB 4Z9BA 421PA 1JE0A 3RT9A 3RYFA 4UFNA 4QD3A 3FROA 4OI4A 4G4JA 4GU5A 1IAVA 3BJRA 1U1IA 2DWQA 3GVPA 2CFCA 4PN7A 3COYA 3BE6A 2PWZA 3K2QA 3ORHA 2KYRA 1VBNA 3V46A 1NQAO 1JHMA 3UV3A 4IFTA 3ZVLA 1LTHR 2RAPA 4MV5A 2G17A 4NMXB 1RYBA 3OE4A 1E7SA 1N2EA 3BE8A 4H1TA 2XUAA 4Q7JB 5FNVA 1G5QA 2VOJA 4D43A 5BN5B 1NIJA 2UDPA 3CWCA 1C3VA 1EAMA 1H69A 3I6BA 1BW9B 1EJ6A 1XDGA 2NO0A 3K0FB 4HB4A 4NMHA 4RVCA 5BSMA 4HFJA 3R0JA 1IY8A 5C0OE 1NHGA 3RGWS 2IFTA 3IEKA 3VMFA 3ID6C 2YBDA 4RXTA 3U9TA 3W05A 2JAPA 5B1YA 2HDWA 1PJRA 2PMBA 1HEIA 2HK6A 2FPMA 5EA2A 4M2LA 1T3SA 3PQ5A 1Y7IA 4DIKA 1Z74A 4B43A 3BSWA 4P5PA 1PQPA 3RSHA 4BP9A 1S2DA 2YZ2A 2B1GA 2GFIA 5HQJA 3EAQA 5ALNA 2AI3A 5EPEA 5CJPA 3SSOA 4RZIA 1C30B 2P35A 4EK9A 2ACEA 5FLXA 3UMSA 3K16A 4HDKA 5HKKD 1YKSA 4B47A 3F4BA 4C6SA 5FB3A 3PITA 2E49A 5ABPA 1K89A 3MLBA 1EFRD 2OCIA 2V6GA 5AJXA 5B3LA 5CB4A 3O0TA 2DBYA 4URUR 1CC1S 1DBRA 1DE0A 2CMKA 3BJEA 1SXHA 4UHCA 2XQGA 5ALIA 3OTHA 1T9HA 5KYNA 3D3KA 4J0DA 4O5OA 1X6VA 4O02B 4JOBA 1TADA 1JYSA 3CNLA 1TPZA 1YR8A 2SNIE 3FB1A 1BVUA 3IXLA 3JARB 2BI8A 2QG6A 4ITVA 4YRLA 1XD2A 1MB0A 1LF5A 2TYSB 1JFVA 5BP7A 2OAQ1 2HYDA 4MV8A 4CUKA 4A27A 1GR0A 3I12A 1ZD1A 2J9GA 4RF4A 2VSOA 1RRCA 4PRLA 1CY8A 4C4OA 1S1CA 2HA0A 3OCVA 4J75A 4LF6B 4IKOA 3C97A 5L95A 4NFHA 5FBRB 4DZZA 2O8DB 1GU1A 1LBHA 1K2WA 2D1QA 3HBMA 2P1ZA 5IBQA 1VIAA 3ZCPA 4EY5A 4C9BA 3RANA 5A7FA 5DN6D 2H5JA 2O23A 2R6CA 3I6IA 3K0BA 4ZQEA 3VR5H 2HA4A 4UU0A 3KQTA 1XHFA 2WUGA 1BVYF 3OESA 4RUKA 1B76A 3E5NA 3U0VA 5A5VA 5JC8A 2OHGA 1KP9A 2BBSA 2GB4A 3D8HA 4PSVA 3SZ3A 3EF1A 3HCRA 2OC4A 4U6QA 1A9SA 1NMSA 1UBCA 2AR9A 1CNMA 1A71A 1H6BA 1TGVA 2ORED 2RCYA 3QBTA 2X1LA 4WOBA 5DYGA 1XXHA 2N46A 2XUJA 2LUOA 2Q2OA 4H35A 3LOQA 4GPIB 5DKFA 3WYAA 1EBBA 1I3OA 4WPGA 3WYNA 4XQGA 1F9EA 2KBEA 3CYFA 4PPFA 3W0LB 1OVMA 1UBFA 2D3WA 2EGGA 4ZQFA 2VTEA 1J8QA 4M37A 1TA4A 4D5EA 3CX4A 2A9PA 2GD6A 2G1KA 1JGTA 1WZNA 3IELA 5HCIA 2XCSB 3C1UA 3RSOA 1PR9A 1HT2E 2C00A 1UOPA 2IEYA 2Y93A 3CLRD 3HKEA 3NYQA 4E0BA 1GQRA 1QC5A 2QRZA 4BLTA 4OMCA 3BGVA 3AWIA 1IHXA 1OWLA 1YVDA 3GJXC 1BD4A 1R2QA 4RTSA 5DT9A 4MDFA 1S96A 2Q50A 5HF6A 3V4OA 2BKXA 2XUPA 3EG9B 4NR0A 1E1RD 1VYVA 3DVQX 2HPVA 2QI9F 3TAUA 4LQDA 2VQ6A 4ND1A 4TMFA 1XEFA 1CUDA 1RYNA 2C8JA 3RNLA 1G2PA 1O9GA 1MTOA 4WSOA 5ALGA 4UZSA 3QHAA 3FMFA 5KYYB 2PT5A 3R8XA 5IABA 2GCEA 2FE4A 4TGLA 1JLLA 4YLGA 2D1YA 3HDGA 2ZCUA 3TTXA 3ZZ0A 1GLNA 2O8CB 3PJGA 5AVWA 3RLIA 2GN1A 2VPPA 5JVDA 2AOVA 3BDVA 4XQ0A 3AR9A 4V3BA 3NIWA 4KQCA 1S4QA 3LDFA 1J0XO 2ZIFA 1BXRB 1WZCA 4O4IB 4MWZA 2JS7A 4BS9A 2C3OA 3BRCA 1M1YE 5KYUB 4JB3A 2ECQA 3CZCA 1QIKA 2QVBA 4WJKB 5ALLA 1MQAA 3TQRA 2CNDA 3EVAA 3Q5DA 2VQFB 3FVQA 3PGKA 1L5OA 2OXFA 1CUZA 3AVOA 2ZDQA 1RXIA 3WWPA 5LOVF 3DVLA 4YP6A 4A6XA 2C78A 4ZV7A 2J0UA 4AJEA 1XA0A 4IFEA 3SLKA 3C5VA 4TVBA 1WB6A 2YY7A 5FUYA 1N8KA 1XVIA 1ZIPA 3BEDA 3DJFA 2IWHA 1QQAA 2QNRA 3AIOA 3SQMA 4RY9A 4WESB 4AJLA 3EUAA 4BMZA 1C0IA 2REXB 2ECPA 2WJGA 3NJ4A 5FORA 5I7FA 1JR3E 2Y0EA 4YRZA 3QEBZ 1ZVJA 4BZXA 3SBDA 1UDBA 3I05A 4GGOA 1PN3A 3FNQA 4HNAB 3VKFA 3L84A 1R5NA 4MYSA 1PNRA 1I2DA 1T2FA 4CTNA 1DFIA 1EUDA 5CHYA 1YS9A 4L5IA 5LB4A 5HFNA 4FNAA 4M7PA 5HJ5A 1BHJA 2FFAA 4ZI2A 1UAYA 2Q5JA 4K9DA 4OU4A 3BQNB 4YFYA 4YONB 1U4SA 4C08A 4PE5B 4QWMA 5CGQB 3HMQA 4XJVA 8MHTA 5CEFA 4BJHB 3GQBA 5DDIP 1IXKA 2ZUTA 2I1VB 2CLSA 3EIFA 2FXVA 1HQCA 2VDWB 3FJ1A 3QEKA 4FU0A 4FX2A 5CFMA 1BYUA 1FP6A 4IQFA 1W5BA 4H9GA 4MUXA 4UBOA 4I9NA 2H1IA 3E1KA 1J00A 1JWBB 4KAJA 4JENA 3ZV4A 1BMQA 2ORIA 1YDMA 1J25A 1SU7A 4YR9A 2JLWA 2XNJA 4ZZ2A 2JKVA 4LSWA 4UVDA 4EG3A 1IN1A 3F90A 4A36A 2HJ9A 3V8QA 3PICA 3J7TA 4ILEA 5A3JA 5BN5A 4OUDA 3GWZA 3K0FA 1BW9A 1IM5A 5I7WA 2Y0CA 2WFMA 3PQDA 3TTSA 2ST1A 2HHHB 4W6QA 5K0CA 2OP1A 1V1MA 3ZWBA 1KEUA 2ZZNA 3K9BA 4UVEA 2X9QA 1VRWA 1WJGA 2CVFA 1KMMA 4HLUC 2DEUA 3R20A 3OQHA 3TEFA 1DS6A 1MQ9A 1R0XA 3I72A 1NKTA 1U0GA 1XTZA 3CNBA 3CKKA 1DKOA 4LRYA 2YJ3A 1XP8A 4ZQHA 4RCVA 5C1BA 1EFLA 1GPUA 2YXEA 2I7CA 2ERYA 1XDWA 5E1MA 5JMWA 4RQTA 4DC1A 2WWWA 3DLBA 4PTZA 2ABWA 2XUHA 3D6MA 4HDMB 3K32A 1UM9B 3DDZX 1JZTA 4WACA 4L9AA 4ZVPA 1DBSA 1L7BA 2P2SA 3Q1LA 1G59A 4DR7B 4BWYA 3QOXA 3GG9A 3DDWA 4IVRA 4OGKA 1W2HA 2YZKA 1GGHA 3FUCA 3QK7A 2C1EA 2Q6VA 1O6BA 1OHHD 1Z6TA 3RE1A 1KSGA 3ZGYA 3ZY4A 5C5EA 5JC1A 1EDEA 1KQ3A 2XCOA 3OI7A 3D7SA 1EG2A 4NQRA 3JTMA 2VK8A 1JFFB 3W5JA 4BJ5A 3NDRA 1OYYA 3CEJA 2UV8A 3HA2A 3KQWA 3O3CA 3R0IA 1KJIA 4MCIA 5CPFA 5DHAA 5FYDA 2LXNA 3ILVA 3SWWA 1DELA 1T4MA 4K6OA 2DQKA 3MJCA 1CVLA 2NWQA 4GSLA 1UBMS 3U49A 1ISSA 1P2BA 3UJ3X 3ZDDA 5NLLA 2XSZD 5CT4A 3EXEB 5BOSB 5EIFA 3WS7A 1GTVA 2ZULA 4OLBA 1M8PA 1X0XA 2BFEB 3L2OB 3NALA 3GZNB 4JKYA 3UW3A 5HZKA 1TF5A 2UVDA 4GOND 4IOJA 5AH0A 4B6RA 1BQ4A 3CG4A 2NU9B 2Z08A 5K3SA 3RRNA 1K6JA 4C7JA 5IJ0A 5AW0A 1A76A 3CVUA 5K0NA 3EBLA 3ESZA 1S8OA 2Z9DA 3GG2A 3GLRA 5DLPA 3RUFA 3SHOA 4DDKA 4JP5A 1QDLB 2LNDA 4M60A 3MHTA 4JT2A 4DCSA 4RJLA 1IZZA 5ALYA 1PJ4A 3H8JA 1U8XX 2RI6A 4HWGA 4IZOA 4KQHA 2TS1A 4YPVA 5DHRA 1G3RA 1U9IC 1VCOA 2YZMA 1FRQA 4FI3C 4IH9A 4QLAA 5D84A 2VYNA 4DQVA 2MSEB 3DE5X 3LPMA 1DC3A 4QHYA 4L78A 1JIUA 4K2HA 5JLJA 3HPRA 1O89A 3EIHA 2UYCA 1P0CA 1ZK0A 2FTKE 5BWOA 2WJPA 1QQ5A 5TLSA 1U7DA 4PZAA 1GITA 4LJ7A 3UKJA 4PIPA 5LXTA 2W90A 4C7MA 4P4LA 3G5MA 5FTNA 2AXEA 1Y7TA 2HPAA 1N2OA 3X1MA 1IBRA 4IHKA 3T9CA 1KI8A 1ZEMA 3RUHA 1GPMA 3OPNA 2YW9A 3DOEA 3LBNA 4H2DA 2XXAA 3HR4A 4KYVA 3GAFA 4WKPA 3SX0A 3USCS 5KYXB 5IVKA 1SBTA 4NBLA 3I52A 1X86B 4HATA 2WWGA 4DBZA 5M3BA 5A4AA 5LYJB 5TMPA 1AGRA 1ZEJA 3O6VA 4C89A 5KC9A 4PZZA 4BMNA 4NOMA 4X8OA 4N41A 4U0KA 1V9SA 1E92A 3EG9A 4E21A 2VNJA 1W5FA 1VKJA 3Q98A 2YINC 4J0KA 4B80A 2EZ4A 1W85B 4A26A 3Q3EA 4H3KB 4I6GA 1TCUA 4X6LA 1HUQA 1IUOA 1GNLA 3EWIA 4RPGA 3KXPA 3L6RA 5KYYA 1N5DA 1NJ6A 1LY1A 1PGNA 2OENG 4G67A 2RHTA 4RADA 1LBTA 1A9OA 1FYVA 5JH7F 1G20B 1SB9A 1U5AA 3ENZA 5EIBD 1Y3HA 1A4XA 2JEYA 3IAFA 4FCTA 3GW8A 2DLNA 4YJ2A 1NW6A 2ECFA 3UPDA 1HKHA 1RAIA 1L7OA 3KHKA 2DHQA 2PIAA 1XMQB 1A9XA 1M66A 1EFRA 3L8MA 1E8DA 4JQYA 2ZK7A 1Y8QA 2Y27A 5K3FB 4H6WA 2PYDA 2YZNA 2MTBA 3FR8A 1Q77A 2LPMA 4IILA 4XDHA 5B6JA 1JH8A 4EHBA 1N6RA 2C04A 2I99A 3IQWA 1L6RA 1Z7YA 2Q5CA 2M1XA 4TMYA 1VKHA 3R1IA 4MWTA 4RY0A 1JJ7A 2AUTA 4P93A 121PA 1XU4A 1UKAA 3RC2A 2Q9UA 2WSSA 4DMGA 4HN4B 3QG5A 1XNQB 3HYTA 4WESA 1Y33E 3VX4A 4NH4A 2E4VA 1FS6A 1IXZA 3JYQA 4DSTA 5LNK1 3EW9A 3TRDA 1Q3HA 1VMAA 4KMSA 4DA0A 4MAMA 1T1RA 1TTHA 5L9AA 3IBGA 1AXRA 1U7UA 1E5QA 1H2WA 1V9LA 2DWUA 3OCWA 4XVHA 4PNZA 1U99A 3GOHA 2MYUA 5DN6A 1GTMA 3FCCA 4MUIA 5KNCH 1F5SA 5AI6A 3PRYA 3A3OA 3Q87B 2O5CA 1FNMA 4AJ1A 3PR2B 1M54A 2CYBA 1B4DA 1RWVA 3V1YA 2X6RA 1KHTA 5B36A 3PXBA 4M8LA 4QRIA 5F7ZA 4KMOA 4QKQA 5K8TA 2I7XA 1N7GA 5GAJA 1YGYA 1ND6A 1VQ1A 4NDNE 1PHPA 4Q9HA 4GSKA 1HSOA 5IAAA 5EHIA 4JIMA 4Q3OA 2IC5A 1W47A 3EUFA 1PDVA 3ICPA 1CUEA 3RAGA 5JDCC 3RAPR 4C7BA 3WRXA 4GKJB 1L8XA 2NADA 3DMFA 2F3TA 3HCEA 2WT4A 4ZT2A 4AO8A 3IKTA 4BLSA 2WA2A 3CXUA 3MCVA 5E0KB 2IUUA 3QLUC 2WJJA 2GWRA 1CP3A 1YZGA 2GBGA 3K9HA 4HNVA 4DLXA 2DPGA 2ZT5A 5TQVA 2GMWA 3PDIA 3SR4A 3OKAA 3G0CA 1AUQA 4EP1A 2A67A 2WWIA 5HX7A 1K7XB 1LSOA 4OHVA 1WPGA 4E5DA 1N0HA 5LBTA 5HKKA 1U0LA 1EWTA 4HDAA 1U4OA 1FQJA 1K88A 5CIYA 4H27A 4MTCA 1QP8A 2WB4A 4YCJA 4XQCA 4NCJA 1Q0QA 2FN7A 4Z0NA 4HNUA 3ZNNA 2EERA 2COKA 2GYVA 3M6WA 4DUGD 5K0JA 1CUIA 1WIWA 3AEYA 2YIMA 4HDMA 1J5EB 1UM9A 3VRHA 2WW8A 2FPRA 1XAJA 3D1VA 4HRVA 1USKA 5D5HA 1A88A 3HCPA 3IT1A 2X0DA 2RHDA 3RSZA 3TXXA 3U4CA 4ZHQF 2PX3A 1NONA 2C95A 5FBHA 3LCMA 4I9GA 1P60A 2JFWA 5EJEA 5J4LA 4QRHA 3UUWA 2CHFA 1M73E 1FRFS 4YWJA 3ZVMA 3I92A 1FU4A 1O6FA 2YX1A 1DXQA 2AD5A 3ZX4A 4WWHA 1JFFA 3HVIA 2XA2A 5ALOA 2C5SA 4KQJA 3BXEA 2D2VA 4CBVA 1D1QA 3WMXA 4LF4B 4LK3A 1RI1A 3LZCA 4GBMA 3A1UA 4W8OA 4HN9A 5B64A 1U9YA 3LVRE 1KNQA 3VTFA 3NWOA 1A1VA 1RIFA 1THZA 5T4EA 4R83A 1K6MA 4FLMA 2Q3CA 2O4CA 5BOSA 5FD8A 1LDNA 2CUNA 3ZC3A 2WQZA 1Q0UA 2LE0A 4HYQA 3GA0A 4EENA 4KREA 1QWOA 3ZWMA 1NURA 5KS2A 3G79A 1M10A 4PRKA 1NW8A 5AM0A 3R9KA 2FFRA 5JRDS 5KAPA 1TCAA 2FV8A 3OFNA 2FQQA 3AHEA 3BCHA 4K9LA 4DQKA 4M99A 3N2GB 3C1AA 1EMDA 1GL7A 1GUAA 2UUBB 1DCTA 1AF7A 1P2UA 5DW0A 4ARCA 1VB3A 1RWOA 3BZBA 3II6X 4S12A 4TYQA 4FD3A 2HNAA 2B3DA 5DN9A 4MVJF 4Q00A 5DYWA 5B1DA 3OFSA 5H9WA 4JJ4A 1YTUA 2IELA 1A1SA 2GZHA 4ISBA 4BC1A 3ZXUB 1FJHA 2I54A 1KZYC 1N7IA 3U3RA 4F2DA 3OJFA 4GVXA 1P0MA 2IEZA 3TJMA 4RS3A 4XYMA 5KSWB 1XRSB 4DDVA 1DZ3A 3GA5A 3LX5A 1YDFA 4PTLA 1JEJA 5EZSA 1WHTB 4ZCSA 4HNTA 2C7PA 3O7WA 4IP0A 1KYTA 2I8AA 3KQYA 1A9YA 1ZI8A 4KVZA 4X61A 5K2OA 5KYXA 5BSRA 1GPYA 4BNVA 4W7HA 5IUNC 5LSAA 2VKQA 2E82A 2IHJA 2VUSA 3HO8A 5JXHA 2WMDA 3GHYA 4DIEA 4HYEA 2FMFA 2AZTA 1YMQA 1YQXA 1X19A 4NV1A 3UAZA 2ZBFA 1WQ4A 3TLGB 2G3YA 2JJMA 3WWYA 2R87A 4CDRA 4DA7A 5LOVB 2IOFA 4G25A 4MYRA 5C7OO 3GPLA 2AK3A 5A5GA 4DCVA 3FBWA 5DCWA 4V0LA 1MDBA 3BE4A 2YFYA 3AOEA 4QPDA 2VP3A 4Q9IA 2PAAA 1RAEA 4ZTBA 3VPCA 4JAVC 1LVHA 3HH8A 1F0NA 3MAJA 1L2TA 5LR6A 2XMBA 4O1IA 1F0YA 1GGNA 3AC0A 1G20A 5F52A 4F7DA 2NYUA 3IUMA 2FN3A 3OJXA 5AUOB 3FYTA 3WRYA 2GPYA 3ENKA 2D06A 2QXUA 1TC1A 3EK2A 3V2UA 3A04A 3NIFB 1GPAA 4HAIA 4WLNA 2E1PA 4WY8A 1GTL1 1T8TA 1YRLA 2H9AA 2WTMA 1EB9A 3T5BA 4BVBA 5JBIA 4UHJA 1Z0AA 3KYDB 5AJTA 3TQQA 3COJA 5K3FA 4OQFA 2W6JD 3EH1A 1OHHA 3LT5A 3PLRA 5AK5A 4C5AA 5HUQA 5I6DA 4IHJA 4Y2UA 2F3RA 1TZKA 5HGJA 3REQA 5CTAA 1KY3A 1S2LA 2R00A 3DE7X 5BWMA 4W5WA 1A9TA 2NNWB 2IX9A 1JQ3A 1XVUA 2H2IA 2DR0A 1JWLA 3T4EA 2PL1A 1WSWA 3HY3A 1VTKA 4EKDA 1ABFA 2R6GA 4ID9A 4FFOA 1GM5A 1KH1A 3V32A 3H9JA 1E0KA 3SF0A 5HRCA 1M2HA 2J5BA 1H1LB 1U6KA 4YO7A 3EZFA 2FMUA 3O3NB 4N01A 4PO9A 1WAMA 4B4DA 3VSCA 4FZ3A 2OV4A 3IUQA 5FOTA 3WLIA 3EVGA 2GI4A 3NEJA 3PIRA 1A5SB 3ACDA 3AJEA 4IOLA 2YUIA 8AT1A 1H2HA 1IEQA 2F8SA 1TYBE 4M1YA 4O2RA 2IS4A 4Z3KA 3OY2A 2ZWVA 2X0KA 5AXCA 3R7AA 4JI2B 4IG4A 1YOBA 3FE2A 4WK4B 3H0EA 2B8TA 3WGKA 2XKJE 4ZHSA 2WU8A 2VSXA 4D45A 1RVDA 2IOHA 3FFBA 5TS3A 3WYGA 1JSCA 4RGBA 3NHYA 4CKCA 3WAGA 4Q9DA 3FFAA 1TEZA 3GCWA 2G06A 3W7VA 1ZCFA 2YVAA 1EJ0A 1H65A 3HRKA 1P0IA 3AHGA 1NTRA 3VPDA 4EVSA 2JFOA 4WKOA 5F3WB 4DL9A 2FSGA 4RPJA 4C01A 4G5HA 5BR4A 4TQGA 4QOFA 5KYVA 1ZAYA 3P7MA 3GNLA 2CD7A 1P9RA 2D8AA 4FS3A 4J16A 4OTZA 4Q19A 2ONCA 5FKJA 1KC3A 3UO8B 3L02A 3ANXA 2UXBB 3U16A 1VIVA 3Q7PA 3L4KA 2ODAA 5B4VA 4YI5A 3VAYA 5C81A 3HWRA 5A0VA 2ZRNA 5J5AA 2E5FA 2VJQA 3IO3A 2GCIA 2IHUA 3EIOA 1T8RA 3C8DA 3I37X 5EKXA 1KWKA 4O5AA 3DPSA 3W4KA 1EUZA 1XV5A 5FJIA 2ZRCA 1AGPA 4QGSA 5CDYA 1XMXA 3T1VA 1O96A 2AHRA 4CVNA 3E3LA 2WYIA 2QUBA 4LSZA 5GONF 2RONA 2WIDA 3FDXA 3LFUA 2JC3A 3HCFA 1Z7GA 3AF4A 3B1ZA 3R40A 5DYIA 1T13A 1AT1A 1ESZA 1XELA 2QT1A 4OUDB 3QVVA 1NAHA 2X7HA 3PL5A 1PO7A 1VI2A 3H1BA 4S05A 3HUFA 2YNMA 4PGFA 2BR4A 4A16A 4R6WA 4AZTA 1X7XA 2B92A 1M7HA 2GHQA 2WWYA 4BWGA 2Q5OA 1GIAA 4ZGWA 1FLNA 1W88B 1M1NA 1YB1A 2DAPA 2PLNA 2R5NA 5ALZA 1Q0LA 1KZHA 2GSDA 3KZXA 4CI9A 3FJYA 3QI2A 5F5NA 4WXYB 2AJDA 3B6MA 2Z09A 2W2QA 3F3KA 3QI7A 2QU8A 2VN8A 3GMIA 3GLIE 3EVZA 4DM3A 1FUUA 4E46A 3O8CA 2V7VA 2QX6A 4RXMA 3KJZA 4D8WA 1SK8A 3JQRA 5FF9A 1ZMXA 4DIBA 4N3AA 3M6XA 1VOTA 3IKVA 1GFIA 1UP6A 2H16A 2Q1YA 4ND3A 1LJLA 1RTTA 1DHRA 3W5HA 3PPWA 5K2MA 4CCSA 3CISA 2BELA 2WIBA 3ZE1B 2QD5A 4GNRA 1P1FA 3DE6X 2EL7A 1HMYA 1P0QA 4HJRA 3IVXA 4A0SA 3HVUA 3DR5A 5TV2A 3N2GA 4U2CA 2OGUA 3RC1A 4F12A 1JHAA 4CL3A 3G1UA 1UPXA 5E2BA 1Q0ZA 4EEZA 4YIHA 3RSLA 2CD9A 2V74B 3BTSA 4KV7A 1RRMA 3WLMA 1E96A 1OFTA 3ZI4A 1OFHA 1FX0A 5IKPA 2G5TA 3LBHA 5JAZA 1CY1A 5FI5A 1T29A 4KFRA 3M9LA 4JLWA 2P3QA 3RYCB 2ADFA 4NJOA 1YTLA 1UPFA 2QG4A 2B1JA 3MCZA 3CZ5A 4BJ1A 4DCGA 2CUTA 5CDFA 1H2ZA 1NF3A 3DV2A 2GETA 4H3SA 3R74A 2D2EA 4BFYA 4HQRA 1JIQA 3KVNA 2HNBA 4HH0A 2PY6A 1LLFA 5DM0A 2Z58A 1QHHB 4G1FA 2AR7A 5DCUA 3NANA 1WHTA 5I7RA 2C2YA 3A7EA 4EB3A 3ZWNA 1MJGA 3ITEA 3VU0A 3RUPA 1E2EA 1YBVA 2WG1A 3CLTC 2OFWA 3GZ4A 3TJZA 4ZA2A 4AMYA 3AM1A 3IQHX 1SH7A 1NA5A 2WM3A 1KA9H 2X3UA 1DLIA 3NH9A 5D5QA 5A7GA 3U17A 4E5VA 1YAHA 4BGIA 1IJEA 4AQDA 1MKYA 2XCUA 1LC3A 4WFJA 1UBHS 3DTVB 3N2EA 4FS8A 2Q3EA 3I45A 3PPIA 1YZHA 5SICE 3ORSA 4NCAA 1H4TA 3GJ4A 3W6UA 2MSLA 3TLGA 2BFCA 2W2KB 5LOVA 3NVMB 5KVAA 5LPNA 2JGAA 3L7LA 3R4VA 1J8MF 3UJBA 2HLDD 4FFLA 4IDNA 4NAHA 4O8CA 5FNZA 4CNQA 3LYHA 4F1WA 2R86A 1YJAA 1R4NB 1IDOA 4L9SA 1VA5A 4QBTA 4A2WA 3EOAI 3CBGA 3I9V1 1NVVQ 1Q15A 3GJ0A 1MGPA 1NZJA 2C3YA 2RGAA 4L8LA 4RTNA 4FM9A 4N82A 1HDYA 4PS0A 1NMZA 3WO1A 4DWWA 1N2CE 1SURA 3CZRA 2W6ID 2HWKA 4DUGA 1CB7A 3SYTA 4DQXA 2MINB 4C4PA 3OEYA 4TTVA 1VJCA 4FOPA 1G63A 3AOGA 2PS3A 1OH6A 2IBTA 3MS7A 3PXDA 1XRPA 4FDTA 2H1OA 3R3YA 5EQFA 4O3MA 1DJQA 3D2AA 3QVJA 1QGAA 1VLHA 3ZV3A 3TB4A 4B0OA 4DMRA 4KPYA 4UBMA 4HN2A 1DUSA 2C9YA 2HK9A 4JB0A 1EK1A 3FSGA 1G0OA 4A0GA 4CHGA 4F45A 3M34A 4M7RA 1XQ9A 3ZWWA 2YOHA 1YXMA 2OLEA 1U2GC 3X1XA 3TOXA 1QH0A 2QNIA 2RAFA 1UZNA 3OURA 4KAAA 3W5DA 2BSQA 5DNEA 3WKEA 3ER9A 4BWFB 1Z34A 2B9VA 2V45A 4PX5A 2DFTA 1U2SA 1PJBA 1NRJB 1RLIA 4JJIA 4LEIA 1KO8A 4AFNA 4DLNA 1H1LA 3FSEA 1CYEA 3TRHA 2IL1A 2OCLA 4V0SA 4D8TA 1G21E 3B1WA 4IXWA 2ISSD 1L4HA 2FVYA 2C2XA 2I33A 2HJHA 4LHZA 4RTJA 3HPQA 3VTZA 1P4HA 1J9GA 1P45A 4O59O 1BGWA 2I2DA 1YQWA 4D96A 4HB3A 4ZJYA 3UGJA 3ETGA 3KU4A 3MUEA 4JLUA 3HU2A 3AR2A 5EC8A 4BLUA 1MX9A 1DC6A 2JFXA 3FMOB 4H1VA 4G86A 1L1RA 5B3JA 3RSSA 3WBJA 4YUYA 1AZTA 3HN2A 1OZHA 3PFBA 3BK1A 4U00A 4WZ6A 1CDEA 3GJ6A 3TQTA 5JASA 2WVAA 1IEVA 2VBFA 2LCQA 3M2TA 4DQDA 2X86A 4JI1B 3F2IA 2C4TA 1YU9A 5LIPA 1Z06A 2W5UA 4I0WB 3UWPA 3C5HA 3LKBA 1B6RA 4KIUA 4URZR 4GVPA 3G5UA 5EXDA 1GWNA 1A5AB 2NZJA 4OQ4A 4PTYA 5ALWA 3SP1A 5T4HA 3ILHA 5AW7A 1A96A 5EJ6A 3OLYA 3DV0B 1SD5A 3BH6A 1NRWA 1IPFA 1QFJA 2WIJA 1NXXA 5E3IA 1HG0A 4ZOCA 4BDTA 4ZHQB 1CZRA 5I4IA 3EDYA 4CLOB 5T64A 3C5WP 3TSWA 1JDUA 2FFHA 4Z7JA 2YR0A 4G9GA 3EMVA 4RTKA 3PB3A 3E7DA 4YRTA 2H1SA 1RLUA 4ZZ3A 4P6VF 3H4IA 3NAMA 3ODGA 4BVEA 1TW3A 2ZYUX 1E1YA 3V1UA 3DHEA 5K0TA 1ACMA 3ZXXA 1OAOA 2MT9A 1B14A 4QU8A 2P9GA 2XB2A 4L0MA 5TARA 5IX8A 3OFVA 1IQPA 1ECLA 1NW5A 3HNPA 3ZWKA 1ZK1A 1YL7A 2CB0A 4ZU6X 4M38A 1CUUA 1WS6A 2AYYA 3BDIA 1M6YA 1NOJA 4QNRA 4DQUA 1E5LA 2G7MC 1KBOA 2Q3DA 4QEZA 2WM9B 3T94A 3F67A 1SQSA 1WCWA 3B1JA 1OI3A 4R16A 4YAWA 3AUAA 2WTEA 4P4UA 2NU7B 1O3YA 4RKEA 3V1TC 4J1QA 5ALRA 1I2BA 2ZUDA 1HLDA 2GD1O 5CNIA 3UJCA 5JTUA 1KMHB 3C6XA 2AL7A 2Z5GA 3CH5A 1P9NA 1MENA 4Z99A 2RKBA 3UYKA 2BEWB 4ZJZA 1RYHA 2IZZA 2YJZA 4DXAA 1P4RA 3IA7A 1F17A 2QTHA 1W88A 4J1NA 4XM0A 5DZSA 1FP7A 1HNXB 4HXGA 3K30A 3RUDA 2QV0A 2Y9PB 4C30A 3TDNA 3SFTA 3MMSA 4C0KA 1A2BA 3TBKA 1II8A 4OAPA 3HEBA 4DPKA 5JCJD 4WXHA 2A5JA 4L75A 3H2SA 4CNBA 2V97A 4G0WA 1ELOA 4KJXA 3PC3A 3SPXA 2HF2A 3UCFA 4I9FA 4UTVA 1UKVY 2WMOB 2IUYA 4TS9A 1FYEA 4DR2B 5I5GA 4H77A 3L8ZA 4P3NA 2AA3A 3K3PA 2CFOA 1UJ4A 2V9ZA 4RA9B 3ZE6A 2B4YA 3FI9A 2O1EA 3OQ1A 3DEZA 2WAOA 1EH5A 1XCLA 2ZI7A 1OE0A 3R6TA 3W6OA 4B40A 2UUPA 4MW5A 3K1AA 1MPXA 1YA8A 3QFHA 1RRGA 4QDKA 3DEFA 5E8RA 4D0RA 2BBTA 3R5FA 5CLGA 5JIBA 5J3JA 4LF5B 1L5YA 1H5NA 4JGGA 2WRZA 4QXOA 4EVIA 1HK7A 3KZMA 1BHSA 3USES 4XX0B 1E9RA 1FDTA 1CNFA 3IDFA 3N0TA 1O8CA 3ESDA 1DC7A 3VHXB 4BTLA 5HZHA 4N7RA 5IZ4A 3I62A 1P3JA 1EFTA 2EP7A 4HVTA 1IMJA 3RIXA 4CG3A 3T1YB 2I3ZA 1QF7A 4J2TA 2W2PA 4TL6A 1QHHA 2Z30A 4NRDA 1XZQA 4R1UA 4GC9A 1CLEA 9GPBA 5JH7A 5LQJA 1QR2A 2FGKA 5BSHA 4JCOA 2QT9A 4WCDA 3EIXA 2FHPA 3D6VA 4G4SP 4LC0A 4C7OB 5DBEX 1GFWA 4JBHA 3LX4A 1L1EA 3A6JA 4FQ7A 4LMPA 4MVCA 4UQOA 3EXHC 2EZTA 2XD4A 3S27A 5G1NA 4ZAWA 1CHDA 4N12A 4Y2JA 5K8IA 1MLDA 4QJ5A 3DTVA 1DBWA 1FMFA 4DOMA 3M4XA 1T9DA 3WLPA 3HL4A 1YS6A 4M0PA 1JEQA 4GBED 5DIFA 1YHYA 3T0IA 2XVXA 2ID8A 1XJCA 3PBKA 1XDBA 2QQGA 1MUUA 5EJFA 1G2QA 3VR2D 3H5AA 2O8NA 3O90A 4BN0A 5C32A 5DNUA 1KKLA 1YRQA 2Z4TA 1XZIA 1W36B 4LHYA 1EGAA 4R05A 4DJFC 1NRXA 4E5UA 4NFLA 3PEUA 1R64A 3HE3A 4OHKA 3NQ41 1G38A 3GBVA 1FMCA 4JT4A 4OHXA 3OKPA 2W6CX 2XDQB 4EHFA 4DB4A 1JPVA 4WW0A 2OYSA 3GPIA 2YV3A 3IEPA 3RCBA 1U63A 1DXYA 4JIGA 2XDYA 3V2GA 3W2EA 2R1TB 2V0GA 4EIWA 1G3IA 3EA4A 5AT1A 3LDUA 1WP4A 4YDQA 1JLRA 1UT8A 5JD5A 4I3FA 1R00A 1R4ZA 2YHBA 3DZKA 4UQPA 2EBFX 2ONYA 3FYDA 4LCJA 4B1FA 3PF8A 1G5FA 3E2MA 3KKNA 2PYZA 2XLBA 5CCDA 1TI7A 1UM8A 5DTJA 4AMVA 3AZPA 3LFTA 3I32A 4UCQA 5FAKA 4AYTA 4D9BA 3QVMA 2Y67A 2JFFA 3AM3A 1I4TD 2VEDA 3NYWA 3TZCA 2J6HA 2I91A 2P9TA 4JSYA 4L6AA 1R66A 1Z8NA 2PIDA 2TMKA 4Y7CA 3SICE 1D2EA 1CJUC 2GK4A 2F8LA 4TSKA 3GLFA 4I1OA 5TPWA 1C1XB 2XX3A 2V7WA 3W5SA 4M1ZA 5HIKA 1KGSA 4XUDA 5CXXA 4BNKA 4ZI7F 5BSFA 3KQLA 3C1TA 1TF2A 3ZI0A 4AO6A 5LZ2A 1M74A 1G18A 1JR6A 4Q0MA 1EP2B 1Z2OX 3GRRA 2ZBQA 1FLDA 3GXBA 3SHFA 1O6ZA 1OXKB 2B35A 1U2QA 2P9QA 2PGIA 1DRWA 2CMFA 4HFRA 4HPJB 4J1TA 2WFAA 4M1EA 5PGMA 3UWKA 4HQ0A 3DLCA 1UDAA 4NLLA 5EIEA 3SIRA 3L9WA 1YRAA 4L27A 2MYNA 1NBOA 4F71A 4Q5IA 1UL1X 1CFJA 1F0PA 3JQFA 4GH5A 1R0RE 5FIUA 3DBLA 5H83A 5P21A 3CB2A 3N3BC 3DBOB 5DEIA 4A91A 5GZ3A 1J8FA 1TUEA 1V26A 4G6ZA 1IOZA 5H3HA 3U4AA 1HR0B 1WVIA 3KP1A 2XUFA 3D5TA 5T6BA 2ZIXA 1L5KA 2J85A 2NLOA 5K45A 1XZMA 3ZKAA 1NY5A 2QENA 1Y63A 1O87A 1NUUA 2GJ4A 2B1RA 2WSLA 3PI7A 5EXSA 1M2EA 1OBFO 3U7IA 1EXWA 2IYQA 1XVAA 1ADJA 3G0GA 4PXSA 2UZ1B 2CXRA 3N0RA 1VHWA 1PEAA 2J9RA 3R5JA 1QPBA 4I55A 5GONB 5JY6A 3OT4A 3M5CA 2HQOA 3GLHB 1ZXLA 1VLZA 1F5NA 2WR8A 5EIWA 1DTEA 3DD1A 3NRBA 3BGOS 3LDAA 3WKBA 1UEXC 4PS1A 2YWCA 3QXJA 4G01B 4OI1A 3JQ7B 4YJHA 3HLTA 3L0OA 4CLOA 4D9GA 3DKPA 1PCXA 3CZ9A 2O7NA 4LJSA 5I9LA 3B82A 4Q93A 1ZW1A 3K2IA 4AVYA 3LPDA 2IA5A 2V3VA 1UT5A 1SUAA 5HBRA 4PWZA 4UPEA 3WYCA 4LYFA 3WMEA 4ZV9A 4X0EA 1E9AA 4NL4H 1IRIA 2QJRA 2EJCA 3JWHA 1ZH6A 5LDGA 2IEBA 3FWYA 4UXHA 4AUMA 2IH2A 4UDXX 3AHHA 1SKAA 4DEVA 3DCNA 2HLDA 3L77A 4NJMB 1GCOA 2W48A 2OXRA 4OMDA 1AS2A 4CV3A 1NT2A 5TQ2A 4JR0A 2WZDA 4B31A 1U9JA 1UBRS 3BTVA 1RPJA 1MMFB 3SC2A 1C3OA 2W6IA 1J06A 4F3CA 3F4LA 1DHTA 2XRZA 2BEKA 1Z5UA 4BNXA 4JVMA 1QGZA 1KMHA 1AQIA 3UWSA 4LZOA 2C2KA 2RCNA 3A2LA 4MX8A 1DQYA 5BVHA 2XRMA 5J4HA 3BGSA 1YASA 5FL3A 1FX1A 2J9XB 2XZLA 1U8UA 1XRMA 3VZRA 2IS2A 3SS7X 3CEHA 3V3TA 3ZLVA 4AZWA 4H1UA 1ZUNB 1TZBA 3RYIB 3OQOA 1Z4JA 3VR0A 4EYKA 5D3MB 1OXUA 3V42A 1VKOA 4QTXA 4ZI5A 5KTSA 1AXGA 2VATA 1QIEA 3GFQA 2BTQB 4BE4A 1SCDA 3FPEA 4DIUA 1K06A 2H3HA 3JVEA 2OZPA 4KUGA 1Y1QA 4OHPA 4OLHA 1RM3A 2WZQA 1U1FA 2ZJZA 3UB4A 4LV6A 4YGYA 3ZGOA 1ATIA 4D6YA 4GUDA 2C88A 4YR7A 1SKMA 2HMYB 2PWBA 2WF7A 5JCZA 2QUKA 3MXOA 5IC5A 4Z53A 1C3JA 1W2GA 2EZ8A 2ZBPA 1H2YA 5I9SA 4RA9A 3AWDA 5DM1A 1ZNWA 4U63A 3PEWA 3B53X 2Z43A 4ZTUB 1TQDA 2A9VA 2ZBRA 4FYKA 4ZC8A 4W5RA 4NC9A 5THKA 4ARBA 2RE8A 2X41A 2ZB2A 3GA7A 4WK2B 1XJWA 3G0OA 3WSVA 1G19A 1AGXA 4YN3A 1P6XA 3FRHA 5CVUA 3TZBA 4JLSA 2XZOA 3IMEA 3X43A 4S1TA 1C4XA 1YKFA 2C2BA 2Z57A 2ZS7A 3NWBA 4BFVA 1JALA 4XX0A 2FZLA 1RCUA 1ZNQO 2EWMA 3PUIA 4RZ2A 5K01A 4YHHB 1A04A 4UJ5A 4M1KA 2VP4A 4JYZA 2CV2A 1AKYA 1B26A 3Q72A 2FWJA 1E4EB 4FCCA 3M6AA 5CVEA 4BO2A 2GJ9A 4WJLA 7AT1A 1IK4A 3KJIA 2XYGA 4JDPA 4CF7A 4OGGA 4CF6A 2C96A 1JT9A 1PUXA 3PRKE 1Y5NA 2ZRLA 3M70A 4WBNA 2IXTA 2JRCA 4U7PB 2XUIA 3C4VA 621PA 2OCBA 1E2QA 4MNTA 4FWIB 4C7OA 3N2IA 3R0QA 3G9ZA 1ADBA 2QL6A 4GZMA 3VR6H 1XNRB 3WGQA 3QHQA 4DLBA 1B00A 2K5UA 3I1YA 5DTQA 1AK1A 2P9ZA 4EY3A 4ARVA 1NNSA 3N2KA 5CG2A 4EYEA 2GPSA 1ZS9A 4E2ZA 4M0UA 3AL3A 4QFCA 1HRKA 1TZ2A 4I14A 2BR3A 4PZPA 2LWIA 2X6QA 5K3OA 1DDIA 2WKWA 5EJ7A 1LW6E 1QM5A 3F49S 5EUBA 1AN0A 1F1BA 2B99A 5IJ9B 2QEQA 1CJVC 3BMNA 3R0XA 1I51A 3VPAA 5KVCA 5HOQA 3OEWA 1S1MA 5GTDA 2Z1NA 4XW2A 3C6ZA 2Y92A 5JUWA 2FHSA 2QX7A 2BKUA 3MJTA 4BU0A 3K0HA 2CDNA 1ZR4A 3P2JA 3TB6A 3UGTA 3DULA 5J2UF 2P2CA 1C7EA 5LN1A 1P1CA 4JR1A 4XIFA 1F7VA 2YWEA 3N1UA 3PHLA 2FETA 1PJZA 2BWJA 2FPSA 1WZEA 3TUIC 3SBOA 5L4LA 2ACKA 4MS4A 3TM5A 1VSQA 3DM5A 2B7CA 3EJWA 3LECA 3DEAA 5HM6A 4XD7D 1SG9A 3IJRA 4HXFB 3IIMA 1JXMA 3ZOZA 4ENRA 2A88A 2RKWA 3DNPA 3MD9A 4M9RA 3MTEA 3PVSA 1MW9X 4FXPA 4XTRA 3KOZA 2B0CA 2RK6A 4I5EA 3GEBA 2WUWE 4M0CA 2XMGA 2YUTA 5EPOA 4DNPA 3O94A 2AEJA 3QIAA 2W2LD 3R3HA 4GI7A 2Y0PA 4C6TA 3GLGE 3G68A 2X5NA 1G8PA 1G8FA 1AE1A 1WSBA 4DWOA 5J1SB 3ZDEA 1JIKA 1IIRA 4JJKA 1L9KA 1TC2A 2ZTMA 2QYOA 4UKDA 4HEJA 3EPHA 3LC2O 4N8DA 5ALTA 3SZUA 4QDUA 1KOJA 3BAZA 1RKUA 3NKVA 3ZDZB 4H0CA 3VJLA 4KDCA 3IALA 5AYVA 1O5OA 4Y9SA 4K3UA 4FZRA 3FTQA 4B7XA 3WFIA 4GOLD 3BE5A 1HTTA 3W1VA 1DDOA 3I6QA 5LJIA 4HEQA 2GN6A 3S2GA 2RGYA 1KJJA 3Q85A 2R5FA 2QZSA 2RAVA 3GFBA 1XZHA 5IXYA 3RS8A 2SKDA 2J5KA 2JIRA 4UBNA 2Y1EA 3TZQA 2C9MA 1CB0A 1QK5A 4L1KA 4YCAA 3KRTA 3RAEC 1YB2A 2UZ1A 3FDFA 2QZPA 2VT2A 5GONA 4XVCA 2G5CA 2ZUVA 3PUWA 1J2TA 3GLHA 1TGYA 4GPTA 1G4AE 4AU1A 4EPYA 5HYVA 2P2DA 2C0PA 4J9UE 1U3VA 3T9EA 2C98A 2YMLA 3WYFA 2WLSA 5KQLA 1M1ZA 1F20A 1NQUA 2B5OA 3N8NA 4LBZA 2X22A 3TO5A 5JO9A 3JQ7A 3KO8A 4DS3A 1E6EA 1JG7A 1NUPA 2VCYA 4MHTA 4N6NA 2DF8A 5IYZF 3BRSA 3E81A 4CTKA 2A5YB 4UATA 2G25A 2WKSA 2JAQA 2JCGA 1GSOA 3DHWC 3DZGA 5DHPA 3SMVA 1VLVA 2Q1SA 2RGGA 3T3PB 2XR1A 4FEGA 1X87A 2AFIE 3JQCA 5CCEA 4ALLA 3A4MA 3WA7A 5AKHA 2FWPA 1D5CA 2HW8A 1D09A 3EC2A 4R8KA 4ZOBA 2VJDA 3IMCA 3PSAA 1DXHA 4JP8A 3WGZA 4KPEC 4REOA 1R5JA 4E51A 3B9BA 4ZC1A 4C78A 1G9TA 4AG5A 2G1JA 2A3NA 3KZNA 3S2IA 4NJMA 1KK1A 2BD0A 5CVJA 3K70B 2PH3A 4RPHA 4R4JA 3H3XA 5CW2A 2X77A 5EIAA 3MJVA 3QF4A 2PZGA 5EP4A 1XTTA 1PWXA 3A25A 2W70A 1UDCA 4AS3A 5J4YA 4E1VA 2XTMA 3RVKA 1HX7A 1HYBA 1C8VB 1S2NA 4XCVA 3TDKA 5TEWA 1OZAA 4LOAA 4A8JC 5ADUS 2Z9CA 5B57C 5JYEA 2WAMA 1ZR2A 2QD1A 3UMRA 1TF7A 1T4GA 2WE8A 2O14A 2J3JA 3H7IA 3C98A 2GPJA 1ZGGA 1LFDB 2XRFA 1J42A 1NU8A 2QA5A 1WD5A 3CUUA 4HDSB 5COBA 5IWAB 1FS5A 2XUGA 4DLAA 3SSAA 1WMAA 1HDXA 4XUEA 3EDQA 2Q1XA 2ZWAA 1C7QA 4CU5A 3OAAD 2OFXA 3L05A 3SD7A 3TTWA 1E2BA 3WQQA 4QPCA 2XDWA 2FWIA 3HG7A 3IKJA 3RYIA 3KAKA 1DRUA 4JDUA 3UWMA 3PJRA 3ZHCA 4JSRA 4BO3A 4WZAB 3TQSA 1ZA2A 2BN4A 2J08A 4AJ2A 3GN1A 2WK1A 5ISMA 3U4IA 4DRXB 2CE7A 1EIZA 3BH7A 5BQ5A 2NU8B 3H1TA 3MCWA 5JTTA 3V6LA 1YB6A 3T38A 3A4TA 1SCBA 1L7MA 4NMMA 4YAUA 2OQRA 3W9UA 1WU8A 1E2PA 2O6LA 3OZ7A 3AMVA 1B0AA 3SEAA 3AQ4A 4YQYA 4JA0A 1PS0A 1YHNA 2JH9A 4OXYA 4ZZIA 1DG9A 1TB4A 2X4GA 1JLMA 2XNCA 2XB6A 4JBXA 4EKNB 1G8JA 1SKBA 1P1JA 2Q6LA 1T36A 3O4FA 4J7XA 3QSYA 1IPEA 2DFVA 1QGUB 4WADA 3ZGVA 3E3AA 1N1DA 3AT1A 3RKUA 3RVRA 1L5QA 4MA4A 4MYHA 4ZICA 4LA4A 1K66A 4PFSA 4YV2A 1E2FA 1W93A 4JHXA 3U7FB 2XWSA 4M54A 2C5BA 1PS9A 1VL8A 4Q3BA 3UMCA 5HKBA 1N6IA 2D5AA 4S2UA 4JHLA 4G24A 1GZUA 4US1R 3ZHQA 1ZDMA 4FR0A 5K4AA 4ZCLA 2G9ZA 4MGKR 1ZBQA 3OF5A 4X20A 4Q48A 2NW6A 2ZI6A 4MV3A 3N05A 2O5EA 1M6EX 2BBWA 1XCPA 4I1RA 3VSAA 4MRMA 4KIWA 1K7CA 2ZB3A 4WOKA 2PX6A 1P7YA 1Y82A 3LBYA 2XWBF 5AVZA 4JI7B 3HGQA 4C0XA 1T6NA 4PPYA 1Z62A 4GRAA 2ZITA 4ZYXA 4IIJA 1ECGA 4RO0A 2H9YA 3EZLA 3F46A 5IJ9A 2R2GA 2VHEA 2ONZA 1E1NA 1EFVB 3BQ9A 3OX4A 3CF4G 3FZEA 3PENA 2WU1A 3W8FA 4HB0A 1RS0A 4LGMA 3WLJA 3A31A 3ELWA 3UK7A 1SUWA 1UDWA 3UZUA 3QOYA 1J8DA 2FF5A 4WIAA 5EHZA 6REQB 3ITNA 4F96A 4PG8A 2JFQA 1D5WA 4CZ2A 1CPYA 2XNDD 4LJYA 1JSXA 2HBQA 5CVVA 3ZY2A 1L7AA 4A6PA 4B8ZA 4F04A 3LLVA 4M6WB 5B1EA 4PZCA 1XZCA 3WGTA 1V6SA 1HE3A 3OH8A 1UXKA 2WJ6A 3VSEA 5B30A 1J1IA 1X7YB 1RJGA 3BTUA 1E89A 1Q0HA 2W2OA 4RVHA 3AUJB 1QG0A 3G5TA 4KO4S 3F96A 4M83A 2CVPA 1WZIA 2WIKA 4DLLA 4LJ4A 3FCSB 5KKCA 1XIVA 2Y3IA 4MIYA 4PGGA 2AN4A 2QN8A 4OATA 3VXKA 3TSCA 3UWDA 1H3FA 1SOAA 3VUEA 2GZDA 3K9WA 3KELA 2QT0A 3KJQA 3GGJA 1ZGAA 4AT1A 4DR6B 2NQTA 1MU0A 2PJUA 821PA 1EDOA 2OPBA 4Q4AB 3A2NA 3ZBQA 1CS0B 4R0NA 3P9KA 3E9CA 4C3UA 2FJUA 2G1AA 3JD0A 1CZOA 2JNWA 3Q15C 1X80A 3ZH2A 4BC0A 3G9XA 4V03A 1FSFA 5EMKA 2XNKA 3E2IA 4F92B 4NS1A 1FXWA 1KYYA 1N57A 1ZO8A 1UAGA 1TK9A 3EEIA 2WM8A 2VLIA 1ATZA 1KI6B 4AQYB 2BM8A 4KO1S 4UQLA 1DT3A 3ONEA 3OOYA 4JN6B 5FWNA 3IV9A 4GE3A 1PD1A 2HRDA 2B6NA 2LIPA 4OLJA 1Z4NA 4WNIA 3H9GA 2EIHA 2VJLA 3I01M 4KQWA 1ORTA 2PUHA 2EW2A 1U3TA 4U7HA 1BOOA 1YIOA 4MRSA 2AFHA 3WO0A 1P75A 1QJCA 3I3SR 1ORHA 3BMCB 1PHRA 2IPNA 3UMJA 4P4NA 2BUCA 3W77A 1O5TA 4KHZA 1MJNA 1PZHA 2YASA 1A9QA 3FMVA 1I7DA 1IU9A 3RYHA 3QPUA 3TSYA 3QE9Y 4XARA 1N2GA 4B7ZA 1T5OA 2L18A 4EYSA 3W5BA 1URPA 3KALA 1Z75A 3B20A 4TT3D 3X2FA 1DAKA 1B1AA 3OSZA 1Z82A 3AG6A 1VI5A 4MI6A 1XTRA 1OOEA 3H2HA 2I1WA 2WA1A 4IH4A 4ML3A 3DTNA 1BE6A 1QDEA 4TL9A 2RJNA 3L8YA 3G23A 5D86A 4JB8A 1JU9A 4XB6B 5I4CA 2O1WA 3P0EA 1I3CA 2DH5A 4HR7A 2IYLD 4Z4QA 1U0FA 4XWYA 1BJRE 1JILA 2HJSA 4C4XA 1K3UB 1W9HA 2C82A 3PNMA 1IBMB 3STHA 4DIMA 4HPWA 3T5DA 5A9RA 1KJQA 1VJTA 1QIHA 3CTPA 3L43A 1IWBB 4MWCA 3R6DA 1ZUIA 1KYQA 2E4AA 2P2NA 2NVBA 1BCSB 3QXGA 4AN1A 2Y4OA 3KPUA 4AB1A 2HMUA 5BXQC 2RMKA 1JJIA 2ZIUB 2XMRA 3HLYA 4GBGA 1OZFA 4ARZB 2J4CA 3DFKA 2DFDA 1XFDA 3C15C 3PQ4A 2GAIA 1U2PA 4IJMA 4R2KA 2HRZA 4AJJA 1OPRA 3S7TA 2M9MA 4BLRA 4MB6A 4RORA 2QLJA 4NE9A 1LH0A 3DHYA 5E9JA 3G0BA 3UBTA 1AK2A 1G60A 1MIHA 2GAAA 3BL8A 3CONA 4YVFA 3SJUA 4XD7A 1ISJA 4LJ9A 1YVRA 3MUNA 5ERGB 2V6JA 4XJSA 1Q12A 1T9GS 3HXPA 2P9FA 1ISGA 1MOSA 4YAOA 4RAQA 4WZAA 1KK2A 4FZJA 4B7AA 3IKMB 4IV5A 4TYPA 2ZATA 1AKQA 4BB6A 2W2LA 3D8NA 4PFQA 1V5WA 2G40A 5DTMA 4DRXA 3S1SA 1F3LA 1UJ5A 4R41A 4PANA 2IZ7A 1EGQA 1G64A 1UOQA 3BICA 4LMRA 4Z9YA 2NU8A 2VDNB 3MUFA 2VF8A 2BVNA 3AG5A 4LNUB 5KU7A 1LPNA 1WVMA 2BCGY 3OQVA 4ENSA 3ZHVA 4EQZA 4S0XA 4UOZA 1Y3DE 1XSEA 4XASA 2BT4A 5JSYA 2CV1A 3A0UA 5A6SB 1U2TA 4OB7A 3ISJA 3E61A 2G5GX 4KUHA 1KZ1A 5G3ZA 4IDOA 3CVVA 5TT0A 5EZQA 4OB8A 5JXIA 4TKMA 1V7QA 3A9SA 1QGUA 4LDZA 4MS3B 4X1YB 3DZDA 1Q57A 2VNKA 4QU5A 2JKYA 4Y6LA 4AC9A 1KDTA 2PK3A 3DNMA 1R8QA 1TM5E 3G1WA 3O8BA 3QPDA 1TECE 4N0DA 3SNHA 1E1MA 4KMRA 3CEMA 3AY3A 3PPXA 4XB2A 4BJ6A 3OQBA 4R2HA 4ZJPA 4LJRA 2YRWA 5JDCA 2VPTA 3QMVA 2J33A 3EGXB 5J2UB 1QCDA 4DLYA 4Y0VA 2C4NA 4UD6A 2V96A 4DJEC 4MP3A 4UM9D 3HZRA 4QNMA 1L7DA 1ZCBA 1JFTA 2OR3A 4UUMA 1YFZA 1I3NA 4JU8A 2W2XA 2MSDB 3J7AC 1L7VC 4FZ5A 4K6MA 2VI5A 3PFFA 2JJ1D 1T24A 4FILA 1JDZA 5FTJA 4BBZA 2NUPA 3HLKA 1ES9A 4Y2PA 2DUWA 2PQ0A 3LU1A 4MWGA 2O8EB 2JD2A 2GD2A 2O3SA 4AMUA 5IPFA 4LXTA 5G4KB 3C45A 1N0WA 4X5OA 2OY0A 1PKXA 4ZI7A 4WCFB <