5HZGA

The crystal structure of the strigolactone-induced atd14-d3-ask1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
262
structure length
257
Chain Sequence
NILEALNVRVVGTGDRILFLAHGFGTDQSAWHLILPYFTQNYRVVLYDLVCAGSVNPDYFDFNRYTTLDPYVDDLLNIVDSLGIQNCAYVGHSVSAMIGIIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLAVGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPTCVIQTAKASVAEYLRSHLGGDTTVETLKTEGHLPQLSAPAQLAQFLRRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DWARF14 is a non-canonical hormone receptor for strigolactone
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/signaling protein/protein binding
molecule keywords Strigolactone esterase D14
total genus 61
structure length 257
sequence length 262
chains with identical sequence E
ec nomenclature ec 3.1.-.-:
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hzgA00
3IVMA 5C8VA 1GQRA 1TIBA 1X2BA 4TPKA 4U2EA 5IVKA 2DQYA 4P08A 2XUHA 4EY4A 1VZ3A 3WYDA 3K9BA 3WL7A 2Y1KA 2XUAA 1GT6A 3AZOA 4YPVA 2OGTA 3DLTA 5D3ZA 1N5MA 2CBGA 3GUUA 1J2EA 4J0HA 5EGNA 3WK7A 4UUQA 1DU4A 5CT8A 3RARA 1WHSA 2XMRA 1XZBA 3O9VA 1EH5A 4BE9A 1OILA 4KRYA 1EXWA 1U2EA 1TK3A 3VISA 2XMDA 3IUNA 1P0MA 2J3DA 4ZGBA 2GYVA 4FBMA 1CUZA 2V98A 1Q83A 2XUKA 2WHPA 1J1IA 2H7XA 2XB6A 5ALRA 3PDCA 5EIAA 2QS9A 2XMSA 5ALZA 5E4TA 2E3JA 3G0GA 4DMHA 5JD5A 3CN7A 4P9NA 4UHCA 3FLBA 3STVA 3STTA 4ZXFA 5A7GA 5KWJA 2H9YA 4OUKX 4DYHA 4B9AA 2HA0A 3G0CA 5AJHA 4Y2RA 1I6WA 1UKCA 2RAUA 4P93A 4BC0A 2QKYA 1YASA 2XQKA 4U2DA 1G42A 2HADA 1SFRA 4B6GA 1IUPA 1UOQA 1CQWA 1EK2A 4J0CA 5AO9A 3FSGA 2FUKA 2VA9A 4F0JA 3I2GA 3A2NA 1N8SA 5T4EA 4DLNA 5AIAA 3CCBA 2QUAA 1UWCA 4YASA 2OGSA 3QMVA 4EA6A 4AB1A 3WJ2A 2BUAA 5K3FB 4QWMA 1QTRA 1DT3A 1EDBA 5DYTA 1XQWA 1KEZA 1FFEA 1AGYA 1ZGBA 2WIKA 4DIUA 2RIPA 2XUFA 3G0DA 1H2WA 5K3CA 2ZYIA 1WM1A 1L7RA 1XLVA 1M33A 4X71A 4Y2YA 1WPXA 4WY5A 1E66A 1THGA 3G9ZA 1XZKA 3E3AA 4HXEB 1YA8A 3C6XA 5LKAA 1PV1A 1UK7A 3S2ZA 1XZCA 2PUJA 2PL5A 3VKFA 4PSDA 2WFLB 1C7JA 4X6XA 3WIOA 4C01A 2WQZA 4QLOA 3HEAA 4LHEA 4F21A 1VLQA 5AM0A 5IVHA 2XLCA 3UUEA 2XUIA 3KOOA 1CQZA 4FDMA 4OB7A 1BE0A 2Z8ZA 1G4HA 5HF5A 4WY8A 1ZD3A 1AMNA 4FLEA 2DR0A 2UZ0A 3SWWA 3QBJA 3BJMA 3DOHA 4Z49A 5ALJA 2VT6A 3W9UA 2XMBA 1BEEA 3QZUA 1EK1A 1ISPA 2QZPA 3HLKA 5ALQA 4OU5A 3FCXA 1QLWA 4RE5A 3VDXA 3H18A 3BIXA 3G9XA 3T52A 5D6OA 4ZV9A 1TCBA 3D0KA 5AI0A 4FFVA 1XZGA 1WOMA 4FKBA 4DSZA 2O2IA 3AIMA 3AIKA 3R3XA 4Y2SA 2AJDA 4BP8A 4DNQA 3KWFA 3C45A 3I1IA 2ONCA 4PSUA 3M3DA 5CT9A 2XUPA 2GYUA 1BRTA 2XQIA 5AI8A 1LPOA 1QONA 2AJBA 2AJCA 1DINA 2ZYHA 3FYTA 4MWSA 5JALA 1JMYA 4Q82A 4X94A 1R50A 3D59A 2HIHA 4ETWA 2BUCA 2I03A 1N1MA 3WIBA 3RLIA 3HC7A 1UZAA 1DTEA 3BDIA 4JNCA 2BGRA 4BCBA 5AOBA 3FOBA 5I8PA 5A7HA 1EA5A 3AILA 5JAOA 5DYWA 4DM7A 4OU4A 2BCEA 1IUNA 1LBSA 3BJRA 2QRUA 3QM1A 5A71A 1MAHA 3W9BA 1ZD4A 4IH1A 1RWQA 2O2HA 1EHYA 5HKBA 3TGLA 2BGNA 5EFZA 1K63A 3QPDA 3OURA 3O0DA 4F60A 3QPAA 3OC0A 2YASA 3K6KA 4UBNA 4FMPA 3QMMA 3V1LA 2VEOA 1R88A 2PSEA 5JD6A 2GBGA 1WHTA 3WA7A 4X95A 2VTVA 4EY5A 4BAZA 2PBLA 5E4YA 2RHTA 1IVYA 1F6WA 4KAJA 2JGIA 5A6VA 4Q3KA 4B85A 4UHFA 3R3ZA 3WWDA 1NU6A 3D4LA 1FJ2A 3WK5A 1CUWA 4J0GA 1JU4A 2O7VA 4A23A 3HRHA 3G9TA 2CJPA 1DWPA 1HPLA 2C0QA 2PVSA 3AFIA 4IH4A 4XVCA 1EDDA 4G8DA 1F0PA 3RKSA 4B81A 3C87A 3WI7A 3N2ZB 1L7AA 4BE4A 2X8BA 4W1RA 1EVQA 1CUCA 3FYUB 1QFMA 4Y2TA 3WL6A 1YS2X 3WKCA 4W1PA 4BP9A 1UKBA 5FUMA 4BCCA 2D0DA 3GELA 2WTMA 3I2FA 4MEAA 3Q8WA 4MEBA 4YX9A 1SCIA 2WIFA 3W04A 1JU3A 4G8BA 4L72A 2XQGA 3AIOA 3PFBA 3FVTA 4K6KA 3WLAA 2C4HA 2H7YA 1CLEA 1TQHA 5H3HA 5SYMA 2BUBA 3PE6A 1Q0ZA 1GXSA 4FOLA 3OG9A 4IO0A 2BKLA 2YH2A 4KAFA 4TVKA 2J4FA 4G1FA 4EB0A 4J0KA 1Y37A 4OYYA 5LIPA 1CUVA 4CCYA 1IMJA 2ES4A 1E8NA 4ROTA 2H1IA 3GZJA 5HK9A 3ED1A 3WK4A 1ZJ4A 2WHQA 1B41A 5CH8A 3F9CA 2WM2A 4W1SA 1Q84A 2ORYA 4G8CA 3Q0TA 2O2GA 2Z3ZA 1E8DA 3QVMA 5HF8A 1CUFA 4G9GA 4FTWA 4UFOA 2JBWA 4J3JA 2HA3A 3D3NA 1XLUA 4CCYB 2BJHA 4H7JA 1BROA 2RHWA 4BBZA 4E11A 2HRQA 4J7AA 3H1BA 4XIIA 2Z5GA 3WK6A 1Q0RA 5AKHA 3W2TA 5CH5A 4X00A 4KE6A 4HAIA 4Q3LA 3I2KA 4ZREA 4MQLA 4BCDA 2HA7A 5AP9A 4B0PA 1R4ZA 2HA5A 1QIGA 3O9MA 3SK0A 1CUEA 4AZ3A 4GXNA 1JJFA 2WKWA 3OOSA 3FNBA 4B80A 4CIBA 3LP5A 4H7FA 4BC1A 1VKHA 5AI9A 1TKRA 3DEAA 2W6CX 2C5FA 2CMFA 1DQZA 5CT4A 3DS8A 1XRRA 3OM8A 5ALXA 4ITVA 4K6GA 5HFAA 1W52X 1R3DA 5LLSA 2VJAA 3O4GA 4U2CA 1QIFA 5ALMA 3IUJA 4EUSA 4Q1VA 4UHDA 1OCEA 1CVLA 1ORWA 1W76A 3R3UA 4UBOA 4KYVA 5BWBA 1GQSA 1MPXA 1O6FA 2DSNA 2DHDA 4IH9A 2OCIA 1E8MA 3O95A 4DMKA 1H2YA 1QIEA 3ANTA 2JGMA 2JIDA 5AICA 4H7DA 4QA9A 4H7KA 4UBMA 2PX6A 5K3FA 1MU0A 1VZ2A 2IX9A 4B83A 3WQHA 2Y6UA 1ZIYA 5FPPA 3VJLA 3W05A 5EHXA 4ARBA 4C88A 3O4IA 3H0CA 4FLFA 3QH4A 1LPAB 1SCKA 1VXOA 5HK8A 3H2IA 4OSEA 3PUIA 3KXPA 1P0IA 1WPRA 3WA6A 5HQ3A 2OQVA 4UBJA 4L3WA 1XZHA 3DKRA 5AK5A 4WDQA 4GW3A 2WFMA 1CUUA 5LZ4A 1QIJA 4I4CA 5ALNA 4BAGA 4PW0A 3IURA 1CUYA 4AO6A 5LZ2A 4QDOA 1UKAA 3QITA 2PKYX 4QEKA 5DNWA 5JD4A 3E0XA 4BRSA 4GLBA 3LCRA 4P92A 1ZGCA 3PICA 4H7IA 5CURA 3QYJA 4M0EA 1R9NA 1XZDA 5HQ3B 1CRLA 4JH0A 5IH7A 1HL7A 2ACKA 3STXA 5CBKA 4HZGA 4MWTA 4HVTA 1UFOA 2OAGA 5DNVA 2PSJA 3MUNA 2HU7A 1YB6A 1QIHA 2WUEA 2XT0A 3HI4A 4B84A 1EB9A 4NVRA 1AC5A 1XROA 4Q3OA 3X3HA 5ALWA 2WUDA 2FX5A 4BATA 1N5RA 5AOAA 2ACEA 2OCLA 3H1AA 1QJ4A 4M0FA 2OLEA 2HFKA 3L1JA 4OB8A 1GPLA 2PU5A 5AHXA 2HFJA 1TRHA 2WG2A 4RGYA 4HS9A 1XRPA 5C81A 1FFCA 5K3BA 3YASA 3EQ8A 4K6HA 4X90A 4AZ0A 5ALGA 3FCYA 2GBIA 4XX1A 2PUHA 1H22A 2WIGA 3DYIA 3G8YA 5ESRA 3A6ZA 4LKOA 4Q05A 1HQDA 4K2AA 4LIPD 4MYDA 5JASA 4X85A 2WG1A 4JEIA 2IIVA 4J0JA 5EI5A 4WFKA 5EHZA 3HABA 4EY7A 5AOCA 3G02A 3JYHA 5AM1A 4AMZA 3DQZA 1EB8A 1AKNA 3C5WP 5I7UA 3F8SA 3AZPA 3MGAA 3I1YA 4QZVA 3A70A 4GDMA 2XMGA 2XQFA 2PU7A 1BS9A 3DD5A 4W1QA 1YSCA 1UOPA 2H7CA 4FNGA 5FPQA 1A7UA 1GPKA 4UHHA 2ZSIA 4PSCA 4W63A 5AH0A 1QGED 5CXUA 1FFAA 3BE8A 2BAGA 4JYPA 2GBCA 4QDZA 1FFBA 1DX4A 1LBTA 1W4LA 1A88A 2LIPA 3PUHA 1Y7HA 3F67A 5ALLA 1WCYA 3G7NA 1T4MA 3D5EA 3SX4A 2HA4A 2XQJA 1EDEA 4GBGA 1Y7IA 5T4BA 5A62A 2VJCA 4AN0A 2ROQA 2XUDA 2WJ4A 3I2HA 1MO2A 4OPMA 1AX9A 3TRDA 4KE9A 1H2ZA 3KDAA 1ZD2P 5CTAA 4G4JA 2G63A 1JFRA 4CI9A 4X6UA 1TAHA 4Y2JA 2WJ6A 3LIPA 2VJDA 7YASA 4C87A 4AXBA 5KREA 4H7HA 1CUSA 1ODCA 5ALIA 2WJ3A 4Y2UA 1U8EA 4PNZA 1E5TA 1BN6A 3UUFA 1CUGA 2VT7A 4ZRDA 4U2BA 5JZ9A 1LZLA 5BOVA 1QIIA 3WYNA 4QDUA 3OPMA 4QLAA 1K4YA 1WB5A 3VJKA 4N8EA 4AMYA 3MVEA 2XUGA 1P0QA 3FYUC 1CV2A 4Y2PA 3WK9A 4RPCA 1XKLA 2FJPA 2RI6A 2WG0A 5DNUA 3C5VA 3D7RA 1BCRA 1XLWA 2Y6VA 5DWDA 2B61A 4ZV7A 5KWIA 2PSFA 4FBLA 5FRDA 1WB4A 4GHWA 5JAUA 5BWCA 1A8QA 1ZIXA 4OCZA 4IHAA 1ACJA 2GYWA 3GBSA 5JZBA 4BB0A 3V1NA 2ZYSA 5FLKA 4EZIA 3AINA 5C8ZA 4NS4A 1W75A 1XQYA 4H7EA 4QWWA 1KU6A 2XMQA 4BVJA 5AKXA 5LKRA 1VE6A 2PM8A 5HF9A 2HA6A 1XZMA 2JGJA 1J07A 2X76A 4BDTA 3H2KA 5ALKA 1OXMA 2C7BA 2OCKA 1ORVA 2QM0A 4M0MA 1TCCA 3WZLA 5CH3A 1DX6A 2JF0A 1LPSA 2CEKA 4BRZA 2XUJA 1VA4A 4UBLA 2I78A 3M82A 1BN7A 3R3VA 4IQ4A 2VSQA 1IZ7A 2HL6A 3E4DA 1CIJA 1Z68A 5AK4A 1MNAA 4MXDA 4X93A 3FWHA 1XZEA 2BFNA 3N0TA 3STUA 1QZ3A 3F96A 1THTA 2DHEA 1GKKA 2JGKA 3KSRA 5JZSA 3NGMA 4NZZA 5CXXA 3ZI7A 1T2NA 3ZLUA 1IZ8A 1ACLA 1QO7A 2OPHA 1SOMA 1ODTC 2HHAA 1UOOA 5JAPA 1ZOIA 3NWOA 2XMCA 4WCVA 4LXIA 3ESCA 4HXGA 1L7QA 1VE7A 5K5EA 2YXPX 4UFNA 1YA4A 3WK8A 4LXHA 5ALOA 3HSSA 1JT2A 2XDWA 1GKLA 1ZJ5A 4F5ZA 4YK7A 3VVMA 1EVEA 3DNMA 3O4HA 4G4IA 4Y7DA 4CG2A 1UXOA 1XZAA 2WILA 1QE3A 2B4KA 2G5TA 1MX5A 3GFFA 3R40A 5ALVA 5DJ5A 1VOTA 2WHPB 4DNFA 2OQIA 3IB3A 1YS1X 1A8SA 1CUBA 4KACA 4QNNA 4C4YA 3IULA 2HRRA 2V9ZA 4I19A 4Y2XA 2JGEA 1ZI8A 5F4ZA 4O08A 4N5HX 3M83A 2JEZA 3FAKA 1H23A 2QXUA 1UT6A 5T4HA 1DWOA 3B3QA 3RK4A 5I9IA 1YAHA 3H2HA 4UHBA 1R9MA 1TCAA 1QIKA 1MN6A 3GA7A 1W1IA 4LYEA 4EHBA 3KD2A 3C70A 2CKMA 4X6YA 1XZFA 3H17A 5LZ7A 2WLSA 5ALTA 1MX1A 5DYYA 3U1TA 2W22A 3EQ7A 4X7BA 2Y2VA 2QJRA 2WU3A 2WFZA 1UK6A 4G5XA 4X91A 3EQ9A 2ZJFA 1ZICA 4KE8A 1K5PA 1XRQA 4W9RA 4GECA 4Q34A 2AJLI 5AKJA 3FLEA 3BXPA 3K2IA 4QDTA 2I3DA 3IUMA 3UMJA 3VXKA 3R41A 2J3QA 2QXTA 2GBFA 2YYSA 2QR5A 3I6YA 3BL8A 1CUIA 5LP1A 3BIWA 5CMLA 4EY8A 2VF2A 4CFSA 4X92A 1K6EA 3A2MA 3IUQA 2R11A 2VQ6A 1ZD5A 4HRYA 5J3JA 3C8HA 5FOQA 4DMFA 1JJIA 2X5XA 4OD0A 1XQXA 1ODSA 3DJYA 2Q0XA 3DDUA 1LPMA 4CIAA 2QMQA 1W6RA 1RYYA 2VJBA 5YASA 1AURA 1GGVA 3G9UA 4LXGA 2QVBA 1DQYA 4FLMA 4UHEA 3T4UA 3ESAA 2QUBA 2ZJ7A 5AM3A 1B6GA 4INZA 5K3AA 3EIOA 1YCDA 1QO9A 1U4NA 2JGFA 4EY6A 1LPNA 4H77A 4WFJA 5ALPA 4BVKA 5E2IA 4K5QA 2Z3WA 5FKJA 2GZSA 5A7FA 3STYA 2JEYA 3G0IA 3C6BA 1P0PA 1K8QA 4WJLA 5ALHA 4X97A 2RGUA 2WIJA 1SCQA 3I28A 4KJXA 1JKMA 3I2JA 4X3CA 1YB7A 5AKEA 2XI4A 3D2AA 3V1KA 1XZJA 5AK6A 1BCSA 1XRLA 1XZIA 4KAAA 2ZVDA 3I2IA 3ZWQA 3L1IA 4H35A 4B82A 2O7RA 4QDXA 1D07A 3WWCA 3WKAA 4A5SA 1GPNA 3WJ1A 4G9EA 2DHCA 3ZV7A 3WZMA 5ALYA 1XFDA 3G0BA 2DFPA 3AUKA 1AQLA 1F0NA 3CCCA 4RE6A 3AZQA 5SYNA 5AI5A 4V2IA 1LZKA 4OYLA 5CT6A 2VAXA 3H2JA 3LIIA 1QTIA 3BF8A 2CUTA 5FV4A 1XZLA 1E89A 4BAUA 3WL5A 1F8UA 4BTLA 1LPBB 1FFDA 5JYCA 5AI4A 5KBYA 3TEJA 3ZLTA 1BU8A 4XJVA 5K3EA 4L9AA 2Z8XA 4AO7A 1EX9A 1QOZA 4E46A 3JW8A 4LYDA 4HRXA 4A16A 1G66A 4Y2VA 4BYMA 2GZRA 1PFQA 1USWA 1AZWA 3H2GA 5DLPA 4DSAA 3I6ZA 2HU5A 1E3QA 3B12A 2WUFA 1HBJA 1X2EA 2B20A 5ALSA 4XWGA 5HKAA 5BV7A 4AO8A 4N8SA 1VA5A 3P2MA 3L1HA 3F98A 5AM5A 2PSDA 3IA2A 3U0VA 1QIDA 1XQVA 2XE4A 1LGYA 1G5FA 1UK8A 2J4CA 1CUJA 4C4XA 3ESDA 2IITA 4GI1A 4BDSA 2WTNA 5EHNA 4CG3A 4S0XA 5EHQA 5JANA 1YAJA 5EIEA 2EDCA 4UPDA 3MUOA 4KE7A 3A2LA 2V96A 3D2CA 1WB6A 3WMRA 4E15A 1MAAA 2CZQA 4DMCA 2QOEA 4OB6A 4EBBA 4FFWA 5JARA 2ZYRA 1HKHA 1QFSA 3R0VA 3R3WA 4I3FA 4ZWNA 1HLGA 4Y9SA 3BF7A 2WIDA 5K3DA 4PQEA 3TJMA 1S8OA 5ALEA 2C0PA 3HYSA 1CPYA 3EF3A 4TGLA 5E4JA 3DL4A 4H0CA 1R1DA 3DYVA 3C43A 5A2GA 4GEGA 2RONA 5LZ5A 1CUHA 2G4LA 4G4GA 4U2GA 4BZWA 3H19A 2WFLA 2PSHA 2ZJ6A 3C6ZA 3O4JA 4MJ3A 2CB9A 3WKDA 1LLFA 5JIBA 2C58A 2XLBA 5DTJA 5IVIA 3WWPA 3PF8A 3ZPXA 2OGZA 2PPLA 3KWJA 5T4FA 4KRXA 3V1MA 5D3KA 2P8SA 3GROA 4E14A 3CN9A 1YR2A 1NU8A 1CR6A 3WKEA 2JGLA 3D2BA 4N8DA 3LS2A 5AK3A 4PO3X 4ARAA 4B7ZA 1X70A 3IDAA 2HDWA 3RM3A 3ANSA 3CXUA 1ZI9A 5FXMA 2OAEA 5CT5A 1H2XA 3WWEA 5CW2A 1RP1A 2OXEA 1XKTA 2AJ8A 2EDAA 2VATA 3LLCA 2ZSHA 3VJMA 3WL8A 2B9VA 3ICWA 1XRMA 3BDVA 5AM4A 5LZ9A 3BWXA 2FJ0A 1MTZA 3ICVA 5LYYA 2D5LA 3B5EA 3DCNA 1VXRA 2HA2A 3C6YA 4AQDA 3ESBA 3V9AA 4WDRA 3WWOA 4BZZA 2I3ZA 1O6GA 3HACA 2EEPA 3FBWA 2WHRA 4UBKA 3FSGD 5C8XA 1QIMA 1MX9A 1JI3A 3PI6A 5JADA 5JAHA 1UK9A 2K2QB 3W06A 1MT3A 4Y2QA 1AUOA 3PFCA 2Y2UA 3IBTA 3OTQA 1JMKC 2R8BA 5ALFA 2XUOA 2C5GA 4B9EA 1CFJA 5AKLA 1CEXA 5AKKA 1CUAA 4KR0A 5AM2A 5AKIA 5HFNA 2WUGA 5AIBA 4JUIA 4DTCA 5HZGA 1MNQA 4MYSA 3NUZA 5ISMA 4DNPA 4FHZA 4BTVA 5FDFA 2DQZA 2QTBA 1DT5A 1SC9A 4MQMA 2AXEA 4CCWA 2XMZA 3V48A 4C89A 3JWEA 4J03A 3NOXA 3I6MA 1DWQA 1KU0A 2OCGA 3PF9A 4AX4A 4UFPA 3EBLA 4WFIA 3IIIA 3DL7A 5IKXA 2QT9A 4RNCA 3STWA 5AKGA 4FNMA 5C7YA 1MJ5A 2XUQA 1LPPA 4BVLA 3HZOA 4AN1A 3E1GA 4GWLA 4DNOA 1EINA 1LNSA 3AJAA 4D9JA 5ALUA 4J0DA 1U65A 3S8YA 4JYMA 4KEAA 2HU8A 5HCUA 1HDEA 4U2FA 4HXFB 5IVDA 1IUOA 1JJBA 4L0CA 4QE3A 4CG1A 5JATA 5AKYA 5DTIA 3QMWA 3WKBA 2ECFA 4N5IX 3F97A 1ETHA 1A8UA 3FVRA 2DCMA 1EI9A 4FWBA 2QJWA 6YASA 4C4ZA 1FSSA 4C6HA 1XRNA 5D7BA 3M81A 1NX9A 3QPCA 3ILSA 2WSLA 1BEZA 5EIHA 1PJAA 4HTAA 2VAVA 3FLAA 1VJ5A 2WU4A 2V97A 4UBIA 3FYUA 3R3YA 1J06A 2G5PA 4H18A 1ZI6A 5FP0A 5HF6A 5LZ8A 4J0IA 1C7IA 3SC2A 3HJUA 5CRIA 2OG1A 2HM7A 3DKKA 4B0OA 5AKZA 3ZLVA 4PF1A 4DGQA 1C4XA 3DOIA 5AI6A 3C8DA 3H04A 1CUDA 3HXKA 1CUXA 3VVLA 4PV7A 5ALDA 4NMWA 1GZ7A 4ZI5A 2NW6A
chains in the Genus database with same CATH superfamily
4TTPA 5C8VA 3P1JA 4G09A 4AZ0B 3NYRA 4INOA 2NVBA 3FUXA 3T7RA 2NXCA 1NTOA 1Y3FE 1P91A 3QU2A 2QU8A 4IS2A 4PLFA 2BFFB 4K81B 1WV1A 1P2DA 4MJ7A 1DOHA 2O59A 4MAMA 2QD4A 4WNYA 5CPBA 4D8YA 2DPXA 2F64A 3QFSA 5FBLB 4DGSA 1RI4A 3WL7A 4ZQHA 1TA4A 3B5IA 5E9AA 3Q9SA 2FGJA 3AZOA 2DERA 2BKVA 2P4UA 4IFIA 4YPVA 3IXLA 5DMHA 1QPGA 1YHNA 4KIWA 3R5HA 2IV7A 3U4DA 5BMVB 1ONNA 4DA7A 4Z9BA 3EPKA 1X3SA 1JHZA 3JQFC 4JBNA 3GI1A 4BGUA 2DMRA 1NASA 3IQHX 3RSHA 1UC4B 3WYBA 2OOSA 1RYZA 1U9CA 2J33A 5SICE 2EW2A 4XCQA 1HH4A 1U8CB 1IHUA 2HNBA 2OC9A 2QYHA 3CVJA 1IDOA 4XSGA 2EYUA 4AULA 5C18A 1O95C 3R5KA 1EXDA 4O33A 1DKPA 4Q1FA 3ER6A 4OM8A 3RARA 4LJRA 4KCGA 4C03A 3TH5A 3ICPA 4F7WA 1C3JA 4FHCA 3O9VA 3DE5X 1JF8A 1OBFO 1WDTA 3JVIA 2QPLA 1OILA 5A5EA 4JWTA 4KRYA 4P3NA 4B2YA 1U2EA 4JBXA 2VDLB 1Z4NA 2ATVA 3QKTA 2FW9A 1RKUA 3HB9A 4UQLA 3ECSA 3NOVA 2H5LA 5CHEA 1SUDA 3NRCA 2FUNB 3RTCA 2AFHA 3LX6A 3ZV5A 2WWWA 1R5BA 4DCJA 2XMDA 5CFQA 1JKFA 1JWBB 3MJSA 5G4KA 3IUNA 3EXEB 1EWKA 2AOVA 2RGAA 9LDBA 3AEUB 4JLAA 3D9QX 1E7MA 3VU0A 3AUYA 5JE8A 4AICA 4BP1A 2ZUFA 1M73E 4EUFA 2OCDA 3RFFA 2CCJA 4EF5A 1Z06A 2Q46A 2WHPA 3AWDA 3K73O 3R4CA 4FMDF 2OSBA 1ULBA 3UV3A 3V7NA 1Z0FA 1G291 3M8KA 2H7XA 2PMWB 3PC8C 1OXTA 4Q4HA 3G13A 1EZ4A 5ALRA 3V4LA 4IDAA 3R6WA 3TR5A 1RLMA 2JLVA 2XMSA 5IH3A 2V6IA 1Y6RA 4Y1RB 5ALZA 3NEYA 2HWXA 3FNRA 2VBIA 4MUHA 2C29D 3F5DA 5C53B 1K6JA 3D4OA 3LLUA 3KQNA 5JSZB 1FP1D 4EGQA 1JDSA 3G0GA 3QXHA 4ZU6X 2IEDA 4WZZA 5JD5A 1TVCA 4QGAA 1NNEA 3LT1A 3CN7A 4P9NA 3NTRA 1RU3A 1MOSA 5EC8A 2ODQA 2M6RA 1OUMA 2W2KA 5IT4A 4DKXA 5LPNA 1SCNE 4EGCB 3IPCA 3RJZA 4GIBA 2WZBA 3STVA 3U61B 3CLUC 1P7WA 3B6ZA 5ARDA 1RYHA 3LQ2A 4C5AA 1RC1A 2H9YA 4CLHA 1JR4A 2D3TA 2H0AA 4DYHA 2BDEA 7MDHA 1QLJA 1DNPA 2GRUA 1UC5B 2HA0A 3G0CA 5L3VA 1RQLA 1XLTC 4JJ4A 5E95A 5JOQA 1UKCA 1Z8HA 4DXAA 2R6AA 2WSMA 1M76A 6ABPA 3PIRA 4P93A 5IAKA 2X58A 3E84A 3N8GA 5JAQA 2DXIA 1PX0A 4GAEA 4DLBA 1M1ZA 2XQKA 1JVBA 2GZDA 2I2XB 3GMDA 4PQYA 3KEOA 4ZTZB 2YJ5A 3DDOA 3GLKA 4PYIA 1SBNE 2JLQA 4ER5A 3PEWA 2JJMA 3ETGA 4QU8A 2Q41A 4UTXA 4DWJA 3FCOA 3C3AA 3RREA 1GHTA 3TQSA 3ZLJA 1IUPA 2W2MA 1A4RA 4LQLA 3UAWA 3S1LA 3SD7A 3VTKA 3RBVA 1DRVA 3AR9A 3O8OB 2VDRB 1EK2A 3OT5A 4L0DA 4L9SA 4BO4A 2C7GA 1QRAA 5I3CA 4PGFA 2XHEA 3GDFA 1FTGA 1YU6A 2FUKA 3ONDA 4ONEA 3BMCA 1IHYA 2VA9A 3RUDA 1QCDA 3UB3A 6REQB 4AZWA 1DBVO 1FU4A 2TMDA 5LJIA 1T9GS 4X8HA 1RZVA 4NFLA 4PZCA 1AU9A 4B7UA 2VP4A 4JNKA 2XH8A 1JSRA 4E2ZA 2VHZA 4K9DA 4NEGA 3RD5A 3RGWS 2HO4A 2HRBA 3HO1A 3NKFA 2XJ9A 1M34B 2TECE 1ZSNA 3SFTA 1G2OA 1OTXA 2EKQA 2ZBEA 4OBXA 4UTRA 1TZMA 2QUAA 2VOEA 2VPYA 1OQAA 4M0DA 2O50A 4NQZA 4JJZA 3TSCA 2ZAMA 1N5OX 4R2KA 1LI4A 1KDTA 2OGSA 4KQHA 4R7GA 2PUBA 4NENA 1AO3A 3QVTA 2WT9A 1ZOOA 2BUAA 2ORED 3AEKB 3BSYA 4MIOA 3UHJA 3ROEA 3AF0A 1CK4A 5JC1A 5G0SA 3T0GA 4ZDWA 1LQ2A 2EW8A 5DYTA 2H17A 1JPUA 3RS3A 1KEZA 4JXKA 3AFHA 2C2OA 2QLJA 3G89A 4RK0A 4RELA 3UFXB 1IYZA 3F7MA 3HB7A 5EKUA 3O8CA 1AGYA 1KP3A 3L79A 3EGEA 3BD6A 1ZGBA 4PZ9A 2WIKA 3CG4A 4JOBA 4LN1A 2HMTA 1GV0A 1ODJA 4OJNA 2ZTSA 3RRJA 1HETA 3BICA 4ENPA 2R68A 4LHWA 4WJKB 4D3FA 1PQPA 3B70A 1RS0A 3T1VA 3QF4A 2ZYIA 2DKNA 1LKZA 2EWVA 3IHLA 4LFBB 3OJFA 2ZRNA 2PQ2A 1MB9A 3RVNA 2VDOB 1L7RA 4V0QA 3OHPA 4BV9A 3SE7A 1ELOA 2ODWA 5JJKA 2IPLA 1S3SA 2Y9MB 2ZYTX 3BKXA 4PO9A 5TMEA 4X71A 2VTBA 2R00A 3PC4A 1WPXA 2BMFA 2OM2A 4QL3A 1THGA 4LVUA 4WKGA 3PGMA 2CXSA 3B2NA 1B7GO 4Y0VA 3ELBA 4MI1A 1VBKA 1ZNXA 3KAPA 1A0OA 1NI4B 1Y4UA 2BZSA 3IEPA 4UEJA 3T99A 1ADBA 2Y0PA 2VBCA 1BX3A 3FMVA 3I01A 1XZCA 4YAEA 1SK9A 4F4UA 4RKFA 2YWDA 2H1SA 1RHJA 3T9EA 2PL5A 4RBNA 3ZYZA 1GNVA 5KYWB 1MABA 4PSDA 4EKIA 2NADA 2HNAA 4OJQA 3T6KA 2IYSA 4DR1B 3S8EA 1QTQA 2VI5A 1JILA 3WIOA 4RK6A 3GXOA 2D3WA 2C9BA 4E6EA 4HN9A 5EVCA 4RHCA 2ZYWX 1VLQA 2H3HA 2ZJBA 1YDGA 3D6TB 3E9YA 2BGUA 4IDEA 5K8CA 1XT6A 1Q7CA 1E79A 1WD5A 2HRDA 3KQYA 4TT8A 4O4IA 3OX1A 3OEEA 3NC0C 4Q9AA 5TJ9A 4HX2A 3Q9UA 1RAIA 3PYMA 3DB1A 3WRWA 4LAFA 1WZEA 4HB3A 4OB7A 1XDBA 1O8BA 1BE0A 5DBEX 4Z0PA 4G3XA 1G4HA 1PW5A 4XE5A 1AMNA 5EINA 1KQOA 5K03A 1DI0A 2DR0A 4UQOA 5B4VA 4GPZA 3RUPA 4I55A 3DOHA 1VGQA 3HCPA 3TDKA 1V16B 1Y81A 3L6RA 3OZBA 4ZT2A 4NATA 2D13A 3JQGB 2WFAA 4Z2AA 2PWYA 1U0HC 5ALJA 5B64A 3T9BA 1DMRA 4LI0A 4RV9A 2O57A 3MUFA 4R1SA 1PL7A 4RKEA 1BEEA 4XPZA 3WX0A 4MWZA 5JYEA 1OX4A 4LJ9A 4Z99A 3JSAA 3U9TA 3ZQ4A 4QDKA 1KEPA 3Q7RA 3QZUA 4YDRA 3FLMA 2VWGA 3V4SA 4KN6A 2H0RA 2HLPA 5J5CA 1DLIA 1TVKA 1JEDA 2JFZA 1SHTX 1ZA2A 2JIMA 2GSWA 3DO5A 3IQFA 1IBRA 1KC1A 1U8TA 4QSMA 1XGKA 2GXUA 5B7QA 4RE5A 1OV4A 5D5QA 3X1XA 2P3SA 3FPKA 4L5IA 4BRUA 4D0SA 4C3VA 4EUKA 3G9XA 2SKCA 4HNQA 5B55A 5BSEA 1G5TA 1WVGA 1V39A 4FOSA 4ZV9A 2OZPA 1PSWA 1TADA 3LUHA 1Q95A 3V4PB 4J1TC 3L7OA 4U2KA 3N2LA 1X1SA 1T0BA 4JCCA 1A9XA 4J1SA 3GJQA 2YN0A 3U7EB 3HMKA 3JAKA 4RETA 1M2KA 1OLOA 1L5QA 5EERA 5F33A 4R1UA 1EFVB 1T34A 3O7MA 3PJRA 1DKNA 1E2EA 1YBAA 1JAZA 1DIGA 4Y2SA 5K2OA 2X2OA 3HB1A 1XD2B 3C45A 1J8VA 5IK2A 4YCAA 3JQPA 1XU9A 4UREA 1V25A 1HTWA 1MJHA 1RM4A 4HMOA 3M3DA 1KOGA 4ER6A 1BXGA 4B4WA 2HGSA 2XUPA 3ABOB 1VLHA 4GI5A 4Y1EA 3VO9A 4W5NA 2ZT8A 3IP6A 4H4CA 4IQFA 1FTWA 4EEKA 3IAEA 4IJUA 4OIFA 4PE5B 4XVQA 4AT1A 1XDGA 2R8OA 3MWLA 3T1QA 1R12A 5REQA 3LGSA 3VHRA 2H4XA 3RVLA 4HDNA 2GBLC 2HB6A 3TVTA 2W2PA 1V1RA 3ZHZA 4UPVA 3U81A 5JALA 4O3MA 1CCWA 1JMYA 1VHWA 3B51X 3JS5A 3IC5A 3KWMA 2H31A 3H1FA 4DCSA 2H0QA 4HX9A 1M1YE 2CUKA 1QDLB 3I3OA 4RPGA 4W5WA 2QSYA 2I03A 3UHAA 4AUMA 2VDKB 3GMTA 2R62A 3OM9A 4PX9A 3WIBA 3BD8A 3UAOA 4CUZA 4F4FA 4W6QA 3SQMA 1UZAA 1MB0A 3IHTA 5LP6C 2RGWA 2BGRA 2ZVPX 5I9SA 2GCEA 1JHUA 3I45A 4PO8A 3L05A 5KHAA 3ZWAA 1OBOA 2JPDA 1MBZA 13PKA 1QYCA 3DZ8A 3LJKA 5FBHA 3UMBA 3JD1A 2AC2A 1OAAA 5A7HA 2H07A 4CG3A 2HK7A 2WIAA 5CJPA 1XPOA 2P1ZA 4KO1S 3OBBA 3WLPA 5DYWA 4OY3A 4UNRA 1TNDA 3IERA 4OU4A 4ZP1A 1IUNA 2IZZA 4JQOA 3KUXA 3NWJA 4NYMR 3SBDA 1B0UA 4DPKA 4F3TA 3T0IA 1DAHA 4E33A 1LBSA 1V6AA 2QRUA 4BFTA 1UMDA 5ELXA 2Z58A 1H05A 2OMKA 3K1YA 1QGDA 1IEWA 4MGHA 4RMGA 3BULA 1DELA 1XA4A 5T6MA 2OUKA 1EHYA 5HKBA 1NMXA 1O0SA 5CPFA 5LJLA 2OBYA 1GA6A 4XSHA 2FP4A 1TX4B 4ZT7A 3A7DA 4HRAA 5AVSA 2O8CA 4HUQA 2J9RA 2ZB3A 3TQRA 4G56A 3B3FA 3SC6A 1LLUA 4IVPA 2NT3A 1NSYA 3EW9A 4FFMA 4YJ2A 5LM3A 2Q49A 4U9HS 4UBNA 1OZFA 2RHHA 3EWSA 2WWRA 2PTHA 4PFQA 2AKEA 3SQXA 5DE3A 4R68A 4KR6A 3RTEA 4IXDA 1R00A 1YOBA 4FINA 2GBGA 4KH0A 4NQRA 3ELUA 4TVOA 3KU1A 4IDBA 3S5UA 2FR1A 4PAGA 3BL5A 4G65A 3QE0A 1L3IA 3R77A 1GGKA 4YPFA 4BAZA 2P6PA 1DQSA 2BEVB 2EKLA 1G4UR 1YZKA 3LUGA 5E4YA 4UM8B 2WD7B 4J2HA 5LDHA 4MR9B 3AR7A 4OQEA 4EW1A 1HV8A 3N58A 1MAUA 4JU8A 1ZRNA 4N48A 3KQUA 4CM3A 4Q3KA 3GCWA 3H9GA 4UHFA 3R3ZA 4EWLA 4GBED 1KZYC 5KDDA 2ZRPA 3IO3A 5FO0A 3PC6A 4G0VA 4JLWA 3SDBA 3D4LA 1GA1A 2CJWA 2WT4A 4KZPA 4MQBA 4PS1A 1CUWA 4GOXA 4J0GA 5LN1A 3EZFA 3DV0A 1A4XA 1AGNA 2QR2A 3G9TA 1PUJA 3HRHA 1YWGO 4R9RA 4X7RA 5E6RB 5K99A 2ZUTA 4G5GA 4NNPA 4G4SP 5L9AA 4MDYA 3TI9A 3ILHA 2PVSA 5F64A 4ZIRB 2OO5C 2JAQA 3HS3A 3O3MB 4HL6A 4XVCA 1N2ZA 2AHRA 2P9TA 4NXMB 3GBVA 2B34A 5L8VA 1Y89A 2ZWPA 1CFZA 2EWMA 2XA1A 3RKSA 3SYTA 2GFQA 4ID9A 1HURA 1YQ9A 4KVZA 4EJSB 5EJ8A 4BLOA 3M1LA 4JQYA 1Q7BA 3HNRA 1L7AA 2ZCVA 4F3RA 5DGHA 4N6GA 1J2UA 3DP7A 3Q0IA 2YIDA 4LRYA 4P3YA 4DCCA 2V3WA 1YB4A 1XHLA 1R37A 1T0IA 4CF4A 3D3WB 4LGVA 1JECA 4ARZB 3F7TA 2QTRA 1F1BA 4K26A 1P2TA 1ND6A 3D1LA 2AUNA 1HR0B 3M89A 3RB8A 1QFMA 3DBRB 4M1QA 4XARA 4P0PB 2R5WA 3A1TA 1FVFA 2WSBA 4EPVA 5IJZA 1XPRA 1ETUA 5PNTA 4DQUA 2M9MA 4CQMB 4MV9A 3L6DA 3VPGA 4NBRA 3KALA 3U16A 1ENPA 4NOJA 2HEGA 4WN3A 2PD3A 4XLTA 1SK8A 3IMFA 4BNYA 1NJ1A 4DJJA 5TC4A 5BWLA 4EFDA 3DMHA 3NNNA 4G2TA 1UJ2A 3TBFA 4BCCA 3GBPA 1M2HA 1ZH8A 2IW1A 1Z3CA 1GGHA 1UBMS 1GVHA 3A1SA 2O3SA 3A9WA 3FJYA 1Z4KA 1N2SA 3L7NA 1OE0A 1LRLA 1Q21A 3S1SA 2Q4DA 1LBHA 2JIBA 3HUTA 4MRVA 4BYGA 3HHPA 4KPUA 1J7JA 3WLIA 4L2IA 2C20A 3DVRX 5C7LO 3E7DA 5TMDA 1L7BA 1SCIA 2OB2A 2VT3A 2XRYA 3OIUA 3VOSA 2DFKB 1CEYA 4QARA 4EG5A 2F3QA 1JU3A 3S2YA 3T1YB 2ILTA 3CTMA 1K27A 4JA2A 1CD5A 1XTPA 1Z7EA 3EVCA 1T3HA 1KSHA 3LTEA 1NX6A 2R60A 3AIOA 3IOYA 1IFXA 4FCTA 4MW6A 1ZGJA 3MRVA 1XJ5A 2WYWA 1A7AA 3EFOA 3ZD9A 3H5NA 3RODA 3SC2B 3WV5A 3ZK7A 4A6XA 3WLAA 2QX7A 2OCPA 2A0FA 4JUFA 4CGZA 4V3CA 3FTEA 4CM8A 3RS8A 1PLLA 2GD0A 2JKZA 2Y0BA 3WLLA 1OWOA 2IV2X 5KOHA 4EG6A 5H3HA 3SICE 1AKRA 1DL5A 5HS6A 5I51A 3NHYA 4K6CA 3TOCA 1QZUA 3AF5A 4UD2A 4EPYA 3ZHSA 1Z08A 1LDEA 5KHOC 3OF3A 2HPZA 4JLNA 1SCUB 3AESA 5TGTA 4EX7A 5C37A 4IO0A 4FOPA 2MSWA 1IATA 2W6MA 2I29A 4RDIA 4KXXA 3VI4B 2QI9C 4LTDA 1QVWA 4HF7A 4TVKA 3ZBQA 4DIKA 1EWTA 4EB0A 3T5DA 1A97A 4OYYA 1SVOA 5KIAA 4Q37A 3NCTA 5CCDA 4F2WA 2ODPA 3GHYA 1OIXA 3GMSA 3H8VA 1V6CA 1W4RA 2WA1A 1IMJA 1R6AA 3ELDA 4G5FA 4GMKA 1NY5A 4HAWA 2X3YA 3T7SA 3HNPA 4UOQA 4EFMA 1G3UA 3IEMA 1IWBB 3D3EA 3GZJA 4Z3DA 1ARZA 3KOUA 5CX1A 4BMPB 1VGVA 3IE1A 2IH2A 3HFJA 3PHHA 4X1YA 3WRYC 4IV5A 3ZXSA 1B41A 4CEJA 4P98A 2Q7DA 4BO9A 2QX6A 1FK8A 1NUSA 4JIGA 2IUTA 1UBGA 4BGDA 4NTZA 1RWMA 3H5LA 3DUFA 3IRVA 4ISCA 1MA3A 1SGWA 3C98A 5DOVA 1IBLB 1SUFA 4KR9A 2BYTA 5JC8A 3L0IB 2QE6A 4Q4JA 5B58C 2W2LA 1ZONA 1EE1A 4ZAFA 1MJGM 2RH4A 2RIRA 1Q84A 2ORYA 3FIUA 2UZIR 2ZSUA 3O8LA 4G8CA 4PWZA 2Z3ZA 3MNFA 4ZVRA 1LRKA 4BE7B 1DZ3A 4REQA 1EVLA 2QN2A 3Q3IA 4OHKA 5DK4A 1CUFA 4AZTA 2OAP1 4ZKEA 1IWOA 2L19A 4MW9A 4N82A 4FTWA 3HA3A 5LU8A 3IILA 2JBWA 3DMRA 3PT9A 3OEYA 3D3NA 4DIDA 2O6LA 3OF5A 2ZXFA 2D06A 3RC8A 2BJHA 3T5PA 2ZR8A 2H18A 2YHUA 2IEZA 4RSMA 1IM2A 3CZ9A 2FW8A 2RHWA 3IS3A 4BBZA 1M2VB 1P1KA 2VH2A 3BMOA 2P6NA 4HWPA 4NL4H 5F3WB 2IU4A 3HN7A 2HRQA 2W93A 4YP1A 1IXSB 4CKCA 4JITA 3KKMA 3KZVA 3PA6A 3T1HB 3LK6A 2M1ZA 3DE3X 2Z5GA 1GEGA 4Y18A 3NRJA 4XAQA 1Q0RA 3FDZA 1R5OA 1NULA 3EPLA 3ITNA 1A8HA 4DWVA 4TMYA 3FPFA 1QG4A 2CNNA 2IP2A 4POAA 2ISSD 3I2KA 1QRDA 4ZREA 2IPMA 4RHYA 1JUDA 2WY2D 2ZRBA 4ZO8A 4UVGA 5K3FB 3JWPA 3RIYA 3LWDA 5BNZA 4WNAA 4WACA 3SYNA 4PR3A 3NPMA 4IGEA 2HA5A 1NDUA 3O9MA 2OVFA 1Q6ZA 1CUEA 2FPRA 4PICA 3WLMA 3FCUB 4GF5A 4MKXA 4R8LA 4XB2A 2ACWA 5LXTA 2XTAA 4Q1DA 4B80A 2JBHA 1Z4IA 3OQNA 3LP5A 2NSDA 4TKMA 2ZRCA 4E5MA 1ESDA 2C8LA 1AK1A 3L5OA 4BC1A 1N0IA 1YV9A 1T1RA 2OTCA 1XN1A 4LGYA 4PPGA 3UWKA 4C7OA 1G8KA 2WWIA 1XDSA 2ZBFA 1NE2A 1TKRA 3PLNA 2KBEA 4JFAA 2C5FA 2G1AA 3UYLA 3W4KA 1DCMA 2AIRA 1GNQA 2BM8A 3OEHD 3P4UA 3KQSA 5ALXA 3RUEA 4LF5B 3ZQUA 3OT1B 4E4YA 3CIFA 1C1HA 2NV2B 3MUEA 2HRCA 4K6GA 5HFAA 1W52X 2ZAOA 3MLAA 1KGSA 3VR6H 1FJHA 5LLSA 1ZUWA 2B4AA 3JRXA 4HPXB 3B1YA 2XZPA 3HP4A 1W48A 3X1YA 1Z56C 2LPMA 1HFJA 3BQNB 1VL5A 4L28A 1KARA 4MPJA 5DGIA 1OCEA 2ZYGA 2WDZA 1VE9A 3IP5A 1CVLA 3TKAA 3FHTA 2ZUVA 3L8HA 1X7WB 3E7FA 1IDN1 2YJ6A 1W73A 4HAXA 5KTMA 4KYVA 3AQIA 1Q15A 2R8EA 5FI3A 1TD9A 1MPXA 2DSNA 1KEEA 2NVWA 3H42B 4IH9A 2OCIA 1YZFA 1G8JA 3C4JA 3DM5A 4FFNA 3NC4A 4RTQA 2P41A 4DMKA 1QIEA 1SVSA 4QOSA 4G5OA 2GZMA 3ANTA 1EQ2A 2VJQA 4IQ0A 5J5VA 5CCXA 3HVKA 1XA3A 4DM3A 3QU4A 3GP8A 3DAYA 4L4XA 4UBMA 3OAAA 5ENDA 5K3FA 2HT6A 1GPAA 4P38A 3RSOA 3F4LA 3DE4X 1XCJA 4JI7B 1MU0A 1VZ2A 2GX6A 4W5JA 4FFRA 3T5TA 3TG8A 1II9A 3WQHA 5EXPA 2CJFA 2UUBB 2AX4A 1Y6ZA 1OYVA 4MVJG 4KQJA 4OXRA 4C0HA 4RD3A 3KEMA 3BB3A 3PPWA 2GK4A 4F84A 3AF2A 2AXQA 3F5QA 2XCTB 2GCPA 3VJLA 1S2NA 3NHKA 1G21E 1Q1NA 1S5PA 1HWYA 2O2DA 2W7TA 1O87A 2XCUA 3FWZA 1A71A 1FQJA 2ASVA 1KZHA 3V5NA 1XDDA 5JT1A 4X8MA 2GDZA 4HPWA 1M34A 1PL8A 1VXOA 4RZQA 2G08A 2KMLA 3ZDDA 3LT4A 2CMDA 3TWOA 3UUGA 3UG7A 4IP0A 3UJHA 4O0MA 1N3YA 4OSEA 3PUIA 2JJYA 3INTA 2XJ4A 4JP5A 1UJCA 2ZIWB 3VVBA 3KSBC 4PM4A 1Z17A 1CZHA 5KTSA 1L7NA 1PJCA 4JBHA 2NG1A 4KBYA 3GFSA 1Z15A 4KQIA 2ZIVB 2LP4Y 2BKUA 2RHDA 2JIZD 4J6FA 4WDQA 4XD2A 5HIMA 3VGJA 2G6TA 5LZ4A 1QIJA 5T64A 2BFDB 1Y1RA 3QXJA 2OHOA 4TKVA 1W7AA 4PW0A 3HGMA 1UPCA 3CURA 1UAYA 1SU6A 5HIJA 5D6NA 3V8NA 4N03A 3MILA 2YIJA 3OPNA 2CHVA 3AOGA 3KDPA 3QNUA 4D1YA 2FHPA 3V55A 4QAJA 2OXCA 2R4TA 2P1RA 2YWXA 4OQNA 3OZSA 3ZDZB 4TTSA 4YUWA 5LZ2A 3U3KA 4E5KA 1E9RA 4US2R 3PXGA 1PT7A 3MLBA 1DAPA 3QUAA 1ZY2A 2VTBB 3LC1O 3J81A 4NHEA 4F2PA 1CLUA 1H8EA 3E0XA 4B87A 1U04A 2GEKA 4ROSA 4BNJA 2YV3A 3IEKA 3LCRA 4GLBA 3OBIA 1ZVMA 4P92A 4YEDA 3A4LA 1P19A 3LMKA 1QWSA 1V3VA 2PX0A 1UBSB 2XKBA 4KXLA 4D42A 3PICA 5LP6B 3KELA 2CLHB 3FD8A 1EU1A 3OSZA 3IP1A 4IFBA 1I6MA 4M89A 3UMFA 1JDUA 3GLFA 3TM5A 4ZHSA 4RZ3A 1OWMA 4RXTA 4MQEA 1XZDA 1Z4OA 2HEIA 3NASA 1QRSA 3UHOA 4IRMA 4OA5A 2FDCA 4HAZA 2LDBA 1CRLA 2YHIA 3I53A 3R3SA 4JH0A 4PTYA 5IH7A 3L7JA 2G9NA 3QFRA 2Q62A 2H92A 1AQNA 5CBKA 1KKUA 4GI3A 3D64A 3DAHA 1MG5A 2J85A 2OAGA 2VDUE 1WPQA 3TXAA 4IJ6A 3A1VA 1BVYF 1UMBB 3TLCA 5KTTA 1A9YA 4DMRA 1QH0A 4XDHA 1BAPA 1KMMA 1YB6A 4MQ4A 3W8EA 1UEXC 2A94A 3LW8A 4OAOA 5HX7A 1OGYA 2XT0A 2J7PD 1AB5A 4O2RA 4N54A 1ZQ9A 4MYTA 4LDQA 2IPXA 4ZO7A 3KQLA 1AC5A 1XROA 2A0WA 3EFBA 5A0TA 4ZI2A 3CZQA 3FCSB 2FMIA 1TEZA 4N7MA 1KVRA 2JLSA 3S7TA 2FX3A 1YQEA 2R1VA 4EL0A 2FX5A 3VGPA 4DUGD 1VKRA 1EXVA 3GAFA 1PU2A 1TE2A 3QXCA 4FCVA 3V7YA 4ZYWA 5JG7A 2XVMA 4QXQA 3H1AA 2HFKA 4ZCQA 3AHJA 5EKSA 1W4BA 1XXHA 2HFJA 3K94A 3WNQA 2IS2A 5AT1A 2H29A 3NHRA 1EVYA 1TRHA 4FWIB 1SKQA 1PSDA 1WZIA 1XRPA 3O82A 3E3MA 5K3BA 1M1NA 1VECA 3K9NA 3L7CA 5FFMA 3YASA 2ZETA 1R4MA 2OA0A 4X90A 2A5YB 1RZ3A 1HUQA 1QHSA 2KJQA 1G9XA 1M5UA 2I4NA 1NJSA 3EDRA 1RQRA 5JFTA 1GRRA 3EUEA 1JPVA 1XEWX 3JQFA 3R0JA 3D31A 3FCYA 2X23A 1NJ8A 2GBIA 1SVLA 4R1NA 3IBFA 1ZH6A 3SR4A 1BGXT 2O2ZA 2X0NA 3ORQA 2JGDA 2A7QA 3UK6A 2AOTA 5D85A 2FWRA 3DYIA 5F2KA 2X8JB 1LLCA 5JAIA 3A6ZA 4MICA 1R6TA 1V5FA 1Z0IA 3V4RA 5JWHA 4Q05A 1X7XA 2C0CA 5TXGA 4D8XA 3X1KA 5IDYA 1RHMA 2Q3JA 1NPTO 2I6QA 3IA7A 4M8LA 1LK5A 2Q2WA 1TPZA 4TXNA 3I9NA 1S6YA 1F5NA 3L6EA 4P4TA 4RQTA 4IV0A 3NX4A 2JKVA 4CHTA 3KAJA 5JASA 2QA5A 2XWBF 3UJCA 3ZWOA 3FNFA 4HH4A 2PV7A 4IDCA 4L0MA 4MVJP 4BVHA 5JAZA 4WCFA 4ETNA 1Q0SA 2IIVA 3D0OA 4WFKA 4XGIA 2HJGA 4V0SA 1M7BA 3IJEB 4F71A 3PVSA 5AOCA 5I9MA 1Y33E 4FFBA 3JYHA 1FLAA 4HGNA 3DMGA 4LDAA 3RE1A 2LD4A 1U0RA 2Q1WA 2RHCA 3AP1A 3ANYB 3C5WP 4ZVTA 5BORA 2GQ0A 3DPIA 1L8OA 2C4UA 3WGJA 4GDMA 3THYB 4F3CA 4CNQA 1SKMA 3TZ6A 1PFKA 1E5LA 1T5HX 1J22A 3C7TA 4LBYA 5B1HA 1FUUA 2I9KA 3U0BA 1EESA 1BS9A 1RKXA 4TXJA 3AEUA 1HSZA 4TQ9A 3PGA1 3SIPA 2WJYA 2WDPA 4A36A 2QY6A 4FHGA 5AJXA 3T3OA 3G3EA 5BR1A 1QH8A 1DQPA 4KHZA 5KOJA 1AMUA 3A11A 2Q3DA 3WL3A 3W9YA 4DIOA 3LUCA 3ZCSA 2PRKA 4JQCA 5E0KB 4WZAB 4GBJA 3AVUA 1G8FA 3K9FC 3IOBA 1GPKA 4TQAA 3VZBA 5LXTF 2P62A 1QRTA 3C7DB 3CF4A 1L8AA 2ZSIA 3INRA 5AH0A 1QGED 1YK1A 3V46A 5CXUA 4J1NA 3U3DA 1GZ4A 3INYA 5C46F 2GVZC 3K4HA 4LX8A 3CJQA 3EVBA 4QDZA 4MMXB 3PUHA 3LVFO 1A88A 4CT5A 5ALLA 5D01A 2PVPA 3DR3A 3KUKA 4MUAA 3D5EA 1N9ZA 3DAGA 3E9NA 3SX4A 2ZBUA 3FJ1A 3DLPX 2DQSA 1THMA 3E5MA 3BEDA 3SQLA 5FA5A 2WMYA 4TXMA 3TAUA 1R7RA 3NBYC 5FF9A 5AW0A 5JFGA 2YFQA 2O8CB 5T4BA 1JLMA 1FYWA 2W6ZA 1Z8NA 3H9EO 2Y76A 4E70A 3SR3A 3KHTA 4WLNA 4RIIA 5DM2A 4YJ2B 3AHHA 2V6JA 3TAXA 4P53A 1CR4A 2OHXA 1L6RA 4JKOA 1E9DA 1I4TD 2OZKA 2OT3B 1H0HA 2WZCA 3TRDA 1BHO1 2OR3A 4QPJC 3IUPA 4XUCA 1DTWB 1YR8A 3T5BA 2XECA 3DMTA 1ZD2P 4U0KA 3DFFA 4G4JA 4PYOA 1GPYA 1KJZA 1D7AA 1ZM7A 2FX2A 3H75A 2H11A 2Y93A 3N8NA 4HAUA 4NSNA 1JFRA 3ZGYA 5JCXA 1ICIA 1N2GA 3THWB 3KXDA 3NC1C 1W9MA 1Y1SA 3LIPA 1AKQA 1NI3A 1VG9B 3BXGA 3DC2A 1IB0A 1T36B 2NUBA 1TK2A 2HBRA 2PLAA 2W6ID 3EQ6A 2H9IA 5AJUA 3WYFA 5L53A 1SNYA 1ODCA 3N70A 3RYCA 3EH2A 3RNOA 2V5VA 1UODA 3R9IA 1NV8A 3MS7A 2V6GA 3LQ4A 2ZR7A 3QMPA 1SN7A 5CVCA 2GN8A 4ER3A 1EWVA 2G88A 3BH6A 2VZ8A 4K9MA 5AVKA 4Z4CA 4YT8A 3NT4A 2DEUA 4CEHA 1CUGA 3C85A 1F2UA 2G0NA 1WX1A 2FFAA 3I34X 4FW9A 4QYIB 4D3YA 5JCPA 5KWVA 5HQJA 3CKLA 2QVCA 4RKYA 1EP2B 3TGWA 2NO0A 3LECA 1LZLA 3ENKA 1IE3A 4DB4A 4WXYB 1HRKA 2PZGA 1USGA 4ZO4A 2WUWE 2FSHA 4MCIA 2WJGA 1ZN7A 4HYYA 4NCXA 2NU7B 2D5AA 4HNAB 4KQKA 4B6SA 4OYHA 1Z0DA 3B3JA 3EBOA 4P4LA 4ZOLB 5BUSA 1GTZA 3FTFA 5BN3A 4NCKA 4Y6SA 3VJKA 4XVUA 5C4IA 2MSDB 3BWCA 3KRTA 3SY8A 5BR8B 2EKBA 3K1AA 5JS7A 3N0XA 4NV0A 3V2GA 4HAOA 4MW4A 2EZ8A 4OQPA 4TV9B 2TRSB 5DNUA 2PJZA 1SZPA 1OWPA 1U7WA 2BJWA 2Z5LA 3DCJA 4LXXA 4YRFA 5C1IA 4YRNA 2O52A 1KY5A 2QD5A 3KTAA 2DH5A 1DIAA 1GPJA 1UADA 1P18A 2FR8C 3QF4B 3PX7A 5C4MA 3F1LA 2CSXA 1LJLA 4JC5A 4E6PA 4GHWA 4UU8A 2NU6B 5FFNA 3REQA 1ORIA 1VBNA 3OIWA 1P6QA 2BP7A 3GQBB 3B89A 3TUIC 2EKDA 5BWCA 5JAUA 5K0EA 4HBZA 5MFPA 1V26A 3D1JA 2CLSA 3H11A 3CMCO 3KSDO 1VL2A 2AMFA 1VDMA 1HFEL 2GWHA 4HDQB 3CX3A 4EJFA 1OLXA 4MS1B 2WMOB 2CZCA 4YP6A 1GIAA 3I58A 5FLKA 4EZIA 5KQPA 1OZHA 3U5ZB 3K05A 8LDHA 2V7TA 4KRFA 1P2SA 3KR9A 5FUYA 2E4XA 3CZPA 4GE0A 5AXAA 1O0CA 3V4OA 5AKXA 3FXAA 1F60A 2P9CA 1KGDA 2I6XA 4JVNA 2WF6A 1KA9H 1VE6A 3RV3A 3U3XA 2ZU0C 5J2UF 2GBLA 1LS6A 3G2MA 1EWYA 2AI1A 2B4RO 1XZMA 1A3CA 5DLEA 3ZQKA 1WMEA 3WNZA 2X76A 4U1RA 3T3NA 1H69A 2GEJA 4PC6A 2YICA 3PCXA 5I3ZA 1OXMA 3B2QA 2F3RA 4W6ZA 3G1UA 3QY0A 1NVBA 1YJAA 2A78A 2PS9A 4GE3A 4R1QA 3WB9A 3U1BA 1ORVA 2QEQA 4UAUA 2IUSA 4NBNA 5K8LA 3E3OA 3S2UA 2GJKA 2VNSA 4D0GA 1HY3A 1WDMA 1DX6A 2XXJA 2JF0A 4K6OA 3KK0A 2CEKA 3J80A 2W70A 4BX3A 2RGXA 3A4YA 4BFYA 1ILWA 2QAGC 3E7XA 2XUJA 2OMEA 3NU1A 4D6XA 2HYIC 1RJFA 1ZRSA 1S7CA 2W58A 3R3VA 1IQUA 4GH5A 3RVJA 3JQ9C 3BGDA 5HUHA 5K0FA 3FFXA 3DXZA 2VSQA 1OH5A 4XTCS 1EX1A 4J91A 3ZHRA 1U0GA 2AMYA 1CNFA 4PGAA 5CB4A 2X3UA 4ARIA 2BN4A 3AVOA 3V32A 1SXJA 2F1HA 1H5UA 3RK0A 1R8XA 3NAGA 5B1YA 2ZRIA 1NVMB 4IUYA 1J21A 3BRWA 4L6CA 4MXDA 1ZJYA 4RA6A 5HE9A 2RK3A 4TTAA 4LC0A 2AG8A 1NNSA 3FCCA 3AU9A 3VSAA 4BN0A 4CMJA 1FVHA 2BFNA 4R1OA 4XRRA 1VLVA 3GPBA 3B3GA 1NVAA 2HCJB 3CF4G 2IY8A 4I4TA 3RIEA 5JSHA 5IKXA 3LA8A 1YCHA 5JXHA 3IXMA 3L0YA 2GETA 2NTYC 2B7BA 3KSRA 4LOLA 4QODA 4EFKA 1W30A 5A4IS 2XRMA 3SVTA 4XQEA 1O08A 1JN0A 3ETCA 1T2NA 2I1WA 1YQWA 3OU2A 4NJMA 2GCGA 3PDJA 3RS0A 3H8SA 2NYUA 3PNYA 5F73A 4F6RB 1T5OA 1VIVA 2ECPA 4NDAA 3HKEA 1EXMA 2R7LA 2EHDA 2SKEA 3FOAA 3GFBA 1ORTA 2OPHA 1QH9A 1L5LA 3PXEA 1Y1QA 4BVGA 1IOZA 4PYMA 5JAPA 4IWNA 1OBHA 4JJIA 4AZ3B 1H1LA 1YNOA 1ZSVA 1UDAA 2VDJA 3NWOA 5I7OA 1M2VA 1X38A 3GJ0A 4HGOA 3WYCA 2EBWA 2QTHA 2OORA 4AJEA 3WOHA 4CM4B 2C61A 3TQIA 1P1BA 3EEOA 1Z7YA 1L7QA 2RI0A 1O9HA 2OV6A 4BZPA 4M53A 5CCBA 4RANA 1YA4A 4MMZB 3HYLA 4LXHA 2QDKA 3VNQA 3Q9NA 1RDFA 4J29A 4ZRNA 3SDSA 1JEEA 1YKFA 4BGIA 4LVCA 4EPWA 1T24A 3CGGA 1JP7A 1X8LA 1GKLA 4F3NA 1ZJ5A 4LC1A 1G5HA 1U4OA 1WXGA 4YXWA 4UOZA 2D54A 1HMYA 1HE4A 2PJUA 4O4HF 1UZLA 4A2WA 2WM9B 1C0KA 2G07A 3DNMA 3O4HA 1CJUC 1IVSA 4HD8A 4HZUA 4II7A 4Q19A 3AR2A 2E4AA 5HMMA 1UXOA 2Z57A 3LL7A 5CLHA 2G9RA 2WILA 1BJKA 4DCUA 2PX2A 2V0NA 3OCUA 5LDGA 3R40A 1M2WA 5ALVA 1V45E 1WXDA 3DPSA 5DI3A 3SKYA 1OXXK 5TIIA 2IH4A 4Q4HB 2Y1LA 3PLAE 1R8QA 1V37A 3HR4A 5C1OA 2PD6A 1FFHA 4MRSA 4ZYTA 2QTWB 3HVIA 2IU6A 3A3YA 3RQSA 1E3MA 4BEWA 4ZAYA 2FN4A 2HRRA 2EKPA 2F9MA 4LOKA 1RBQA 1OLSA 2V9ZA 2XBUA 2OBBA 4RVFA 4Y2XA 1JBQA 1UKVY 1VBMA 4GKKB 4FGUA 4YAJA 1DJPA 3UA3A 1ZI8A 2ZTLA 4DJEC 2D1TA 2HO5A 4IUCS 1E4EB 2IT1A 3LHFA 3P9ZA 1F51E 3HVJA 5K4GA 1NF3A 4GPEA 1P4RA 2AC4A 4L1KA 4O08A 2OV2A 1DRWA 2JEZA 1S4MA 4RZUA 5HJ5A 2I9PA 1U0OC 2ODBA 1D2GA 5FI0B 1L5OA 3M34A 4MYUA 4V02A 1JLLA 2QTTA 1N1DA 3DVAB 4PNPA 4Z0TA 5T4HA 3EXHB 2OV1A 4C7KA 5BN4A 1SKYE 3DDNA 1SKYB 1H85A 2HI0A 3IOCA 4Q9KA 3O8BA 5I9IA 2KSQA 3IB6A 1T9AA 2ZOSA 3H2HA 4OH7A 5D5HA 4ZHQF 5CDSA 3QEBZ 1P39A 3UGQA 3ZDRA 2QP9X 4UHBA 3TPFA 2UAGA 2AR0A 1TCAA 3GA7A 1EEXB 1O0BA 1SOUA 4CM9D 1PK9A 4HTFA 1W0JA 3BD9A 2RKBA 4PYQA 5F1YA 3SHWA 1ABBA 3G7SA 1NXSA 1IN6A 3HL4A 3KD2A 3PPXA 4E4TA 7YASA 2QW0X 1UMCB 4L50A 2ZRAA 4GGPA 4YUAA 1JALA 4LHVA 1QP4A 5IKEA 4YJDA 1NF9A 2BH9A 1T2AA 4KQ6A 3GRPA 4X6YA 3SHTA 1R8YA 1U4SA 2PKEA 1UQUA 3O8RA 4NABA 4YJHA 5DYYA 3U1TA 1XUOA 2PZLA 3JWIA 2W22A 5FWXB 1BFKA 1H2FA 3PL5A 1NN5A 3DV0B 2C2KA 3VPFA 5D87A 1B93A 2ACVA 4RK5A 1C8KA 1PYDA 3A1WA 5COBA 2J32A 1PCXA 2P69A 5HXAA 1RPAA 1IQ0A 2O4CA 2BCGY 2YJTD 3K8QA 1UWKA 3BERA 4QBKA 4CKWA 2RJ3A 1S02A 1UPAA 1E6UA 3LD9A 3QLEA 3LZ6A 1BXRA 3MGBA 3CRW1 4NZMA 4U7GA 1I5OA 2IYUA 2LW7A 4A0QA 2JA1A 4WEOA 1LDYA 2KPOA 2VJPA 4PG6A 4TV8B 4YJ3B 2M6LA 4RH3A 4W9RA 4BMXA 2RB4A 2XDQB 4O3FA 3UHFA 3KFXA 1I01A 4O2BA 1PEDA 1JX6A 3VV3A 1FIUA 1LH0A 3T95A 2J5XA 2PJDA 1RFLA 4NDNE 2BFDA 2HW8A 3E9RA 1UPXA 2WTEA 3C41J 4JLJA 5DGCA 4W8HA 5E3HA 4PN7A 2AMLA 4ARZA 2CN1A 3K2IA 3IUMA 1O94D 3R7BA 3ECCA 4B74A 4ERXA 3DBRA 1A9TA 1OGJA 2QXTA 3R41A 4C7JA 5T3UA 3RW9A 2PKRA 1ZZEA 3EFEA 3MMXA 5BW8A 1GPMA 2PFGA 4H27A 3I6YA 1A5AB 1I13A 2AZDA 1A04A 4I5DA 4F9GA 1M0SA 2D0OB 2YCLA 3BIWA 2AZMA 3NLLA 4A82A 5LP1A 2CCKA 5FORA 5FBZA 4EY8A 3T34A 4IGIA 4YO8A 3GRKA 3SMQA 1E3JA 3MWDA 2R44A 2I7DA 3B6KA 3COWA 1MAWA 4M9ZA 3GZNB 4ND7A 3TRFA 4WBNA 1GA4A 3R7FA 1GTSA 2EJVA 3NKLA 2ON6A 2QMHA 3T1TA 3V6MA 1W8DA 2ONZA 5B36A 2XE6A 4HRYA 4Z7QB 1NW9B 1UXHA 2JFUA 3PHGA 4BO6A 4DLTA 3O1HB 2XRZA 2QBYA 1NUPA 3B6EA 4UDNA 5FOQA 2I6GA 4M99A 5EE0A 3KOWA 4Y6QA 1DKUA 2PTGA 2YXEA 4OD0A 5EUCA 4BZQA 2AC7A 2CVQA 3EAFA 4AYXA 5DHAA 3Q8KA 1Q50A 2NZWA 3T7DA 1ODSA 1JHAA 1T35A 3FYHA 4W8GA 3DWEX 1FP4B 1NVWQ 3UYKA 3Q3VA 5FLXA 3D6HA 1H1TA 1FRNA 2VJBA 3GF4A 4QXOA 1GCGA 2YMPA 3H4IA 4W82A 1UFQA 1D04A 3SKVA 4D9GA 4HCJA 1L8LA 5DP2A 4XM1A 2PFKA 3EC1A 2EGGA 3AL2A 3IE2A 2FW1A 2YWGA 1DQYA 3FYDA 2JLUA 4FLMA 2JARA 4YQZA 1GR1A 4ZU3A 5LU9A 5JO9A 1GTRA 1UQRA 2PT6A 4Z1MD 3WFZA 3F6RA 1L7MA 2F1KA 4E5NA 4GMDA 1FTYA 1E2HA 2RKOA 2OQ2A 4C22A 5JRZA 1Z4JA 1Z75A 1F6DA 4L15A 3BL6A 2H3EA 4XYBA 4PLWA 4AJNA 2NPFA 1NQAO 3ND6A 5AWFC 4NC9A 1DBRA 1RQGA 3HY6A 4TT3D 3WO0A 1Y9DA 3KKNA 1C3VA 1QAMA 4EEZA 2J87A 1LPNA 3ND5A 4JJEA 1XCPA 4I55B 2GAIA 3UM9A 3VNUA 1PJ3A 4YB8A 3AERA 5FYDA 1V16A 2QIPA 2VYQA 3O9ZA 5E2IA 4EZEA 4HQKA 2PZJA 2MSCB 4KIUA 4RDHA 4BASA 2B0CA 1E61A 3IAS6 4EHJA 4MVJI 5DB4A 3LPMA 1MJNA 4URXR 5KKAA 1UEJA 1JA1A 1T25A 1AZTA 4OL9A 5EYPA 2Q1XA 1O6ZA 2C5SA 3E58A 1TFUA 3EC7A 3GAZA 3LBIA 3QEMA 4MV4A 2RAFA 3LC0A 3SR0A 2W90A 4IOMA 3W6ZA 3R6LA 3SKXA 2VLBA 3U37A 3HDJA 4DJDC 4PLYA 3DUFB 3V1TC 3DKIA 1DADA 5EZSA 2VYNA 3DO8A 4X97A 1T9GR 1XEXB 2WIJA 1O95D 4RVUA 2SBTA 1U1EA 1IOVA 3COYA 4GPBA 5FNVA 2AG0A 3TXYA 4MDFA 2Q07A 4EBFA 1E3EA 2RHOA 4L4YA 1DC6A 4WNCA 2PLRA 5AKEA 3AF4A 3ZDYB 3D2AA 4K88A 1Y8CA 1EWRA 4DG5A 1NG9A 3I52A 1Q0QA 1XZJA 3W4IA 2QK4A 5KYXB 1AXGA 4IVQA 3FTDA 1LTHR 5TMBA 2JG3A 1KL7A 3WQSB 1N2XA 3BWDD 2Q8NA 1E2JA 3JVEA 2F9FA 4KAAA 3ZWQA 3HCBA 1E20A 2VL7A 3L1IA 1EE9A 4BQEA 4H35A 4B82A 3AXTA 5BV8A 4QDXA 1J24A 5C2JB 1D07A 4KGVA 3WWCA 4DT1A 5CXQA 4XEHA 3PQ5A 3V8QA 2VK1A 4BX9A 1XU7A 4C0QC 1GZ3A 2PIAA 3DXFA 3WLQA 3ZK8A 3SCZA 2OENG 4R2HA 3ZV7A 3NB0A 2B9EA 1JLKA 1YBMA 3WXBA 5LMNB 1KVTA 3E22A 3U4QA 5A4MS 3R0IA 3AUKA 3KETA 1NBEA 3CCCA 3ZWDA 2VT2A 4RE6A 4DCVA 4DCMA 4HV4A 2K7FA 2CD9A 1Y8RB 3AZQA 2Z04A 4JL8A 4WVFA 4YROA 1ZP6A 5C1DA 1RIFA 4EVQA 3A9RA 1N92A 4KWEA 4QICA 2Q9BA 2AE1A 1KI4A 3O7WA 4UEOA 4BQNA 1PZMA 2BBTA 4FE4A 4C3OB 1FYXA 1TK9A 4IEIA 1GKYA 2JD0A 4PTLA 2ZS9A 3H2JA 2AQHA 2AFHB 2Y0CA 1EGQA 1GUFA 3LIIA 1C4KA 5LA6A 5HR5A 4JOQA 2WE8A 2BR3A 4WW0A 1JAIA 2FWMX 5KOJB 4M46A 4C3UA 3WL5A 2O48X 4H4EA 4GZLA 1LPBB 1FFDA 1VJCA 1C14A 3F1KA 2ZI9A 1H6BA 4FQ5A 4I4TF 4KOEC 4DLPA 1CDZA 5KBYA 5ITZB 3TEJA 4PLHA 3PXUA 4IDGA 4RMIA 1QU2A 4EITA 2XZTA 1CEQA 4MIYA 4NONA 5ENZA 3K2QA 3ORFA 1A7JA 1CWUA 3L4BA 3ZWVA 3L8EA 3THXA 1NXOA 5CR9A 2G0AA 2GR9A 4L9AA 3NALA 3PQ3A 3IPXA 3O93A 2CNKA 3SEAA 3W5DA 2I80A 4QVGA 4YP0A 2BMVA 1XTQA 1OFGA 3GHHA 2EG9A 1FSFA 3II6X 3P2KA 4TT3A 3JW8A 2BFMA 3A4IA 4HRXA 3IR7A 2I8CA 3OIGA 3ZE6A 2A3NA 2WF5A 4L95C 2BC9A 1O4VA 1ZMRA 5FEUA 4YJGB 3ESQA 2X41A 4NDZA 3USCS 1GPUA 2Z43A 4EI7A 3V1LA 2N46A 1BZYA 3U31A 2BF7A 3C3JA 5EIFA 4CFYA 1WTAA 1U9IA 1Z5NA 2ZITA 3G5TA 4FGKA 4LF7B 2NZVG 1FZTA 1UCFA 1P5FA 2BONA 4Z8YA 3H2GA 2Z3VA 4KIGA 4KO8A 4DWOA 3QPWA 4M6WA 3I6ZA 4UDOA 2HU5A 2I3GA 3ORRA 4FZRA 4HFNA 1H8HA 2OZEA 2P77A 2F67A 1TEHA 3AHEA 2BMEA 1TB4A 5CA1F 5HIAA 2B20A 1DQRA 2NPOA 4TV9F 4XWGA 3PUYA 1YZNA 3L9WA 4M1YA 2ZJ0A 3JZIA 4YQEA 3ADPA 3GCDA 3OQIB 3GT7A 1HSOA 4QUHA 4F3KA 2RSLA 3E70C 3NHPA 2PRZA 3K70B 4OP2A 4BQPA 1JV2B 4B7AA 4DREA 1FDRA 4N8SA 4OVKA 3DBLB 2YQ4A 3RKUA 4LHYA 1M74A 4ZI7F 4FXPA 1D0IA 4IDPA 4MR9A 4U6QA 5IC6A 4BO0A 1R16A 3LX4A 4NK5A 3TCNA 2VYVD 3IX7A 2C83A 4AMUA 3ZCTA 4ZK2A 1UWLA 5IK2D 5KO2A 4IWXA 4WHMA 2V7GA 1EPUA 3G2LA 4CMCA 2C8JA 3O8OA 4YMIA 3O2JA 4DYDA 1IXYA 1XJCA 2OVBA 1RPNA 3AR6A 3UB2A 1DJNA 1PD0A 3WISA 2J4CA 4G0UA 3SYMA 3EPJA 2R4UA 4MNTA 5AW4A 2UXBB 1ENOA 3LU1A 5FOSA 2I8AA 4YO7A 3L6BA 4QXMA 1HC7A 2AZ4A 3AHIA 1PDOA 4LE1A 4F2DA 3R7DA 4ZQFA 5J43A 4B6RA 1T8YA 3X2FA 2ADFA 4MJLA 3AJEA 1YAJA 4Q39A 3M4ZA 4OHMA 4DLKA 2ZE6A 1JFSA 3OEWA 5DVZA 3OQ6A 1CBUA 3LQQA 2RGCA 3MM4A 4UPDA 2HLNA 4RF3A 1D6MA 4LWQA 4KE7A 4DLYA 3T38A 1SMKA 4X41A 3PQDA 1U63A 2V96A 3LKBA 3D2CA 3PEYA 1MMFB 5B53A 5K0BA 3I5YA 3HXTA 1MAAA 2CZQA 5D7NA 5IZ4A 2FMXA 3B6MA 2ST1A 3KTFA 3THYA 4KK3A 1QYWA 4N6OA 2IA5A 3TZEA 4EBBA 2J3JA 2VZEA 4TOIA 721PA 1Z4QA 1ORDA 1PLKA 3I6BA 2DUWA 4LGCA 1H3EA 5I9LA 2OESA 4QT4A 5BPHA 3KAKA 4Y9SA 4ZWNA 3F73A 2P7HA 3OUZA 2C2GA 2PQ6A 3E05A 4RDCA 4XIFA 4BN4A 2VNAA 4COKA 3PEFA 1QLHA 4OXYA 3PDWA 5DBFA 4TZKA 3ADBA 1EIWA 1ZKMA 1AKVA 1WW3A 4AY2A 3EULA 3B13B 3MYRA 5HCIA 5G40A 3L4JA 4PC2A 1M6NA 4C5CA 3HYSA 2IRWA 2ECKA 2QXYA 3A9SA 4IKEA 3P45A 4XGQA 4YYZA 3OMLA 2XOXA 3K0CC 1M2FA 3OIYA 1SBTA 1PR6A 4TGLA 3GLFB 4RM3A 1B74A 4Q4AA 3W7AA 4H0CA 1UDXA 3I9LA 4RJJA 2I7CA 3LOQA 4YV7A 1USVA 2SCUA 3EIUA 5IDWA 5LZ5A 4DDHA 1AGPA 3N53A 4KZKA 5FHRA 2AGVA 3IDFA 4I6JA 2G4LA 2WYHA 5AMXA 3RT1A 3U2QA 1TMOA 4DCNA 3HUUA 4UULA 2ZM6B 1N75A 1WVMA 1A4IA 4P35A 4U2GA 4WXMA 5C7IO 1XMOB 4KGDA 2PSHA 2ZJ6A 2J5BA 4DR7B 3K0BA 3AG5A 1ZESA 2CB9A 3KLNA 3Q0EA 1TJ3A 3UK2A 1WEHA 2FZ4A 4FMCF 4WOKA 4NJEA 5TQJA 2XAUA 3B7PA 1PJ8A 1HE2A 3IHWA 4Z0NA 1KF0A 3V33A 2C8VA 2C58A 2C3UA 3I37X 3ML1A 3GOQA 4KUHA 3SXPA 3UT6A 2CE7A 3UPDA 2LKDA 1F7VA 1RXUA 3EF1A 2AVNA 4WKPA 1EJ0A 1ZIPA 3VYSB 2B1JA 3AJDA 2ZAGA 3OLCX 2VPQA 3FF1A 1EVKA 1G6HA 3PZRA 3V1MA 4E7OA 5HOEA 5KX5B 3ZGLA 5BXQC 4IGKA 5G1OA 3GROA 4E14A 5CB4B 5J1SB 1KYIA 3G82C 2H2DA 1KIFA 2IKSA 5CD1A 2RGRA 4CQNA 2X9GA 4UARA 1N25A 1WS6A 3LVQE 4K0RA 3TOVA 4YC7A 4Z4GA 4YIHA 3HLYA 3F71A 4EW2A 2QUJA 3DKPA 1FZQA 1VPLA 1XR3A 2RHMA 1H6DA 3LS2A 3OX3A 4NMXB 4C2BA 4OHYA 2CYAA 1E7YA 1K7SN 4MHSA 1YKSA 4BO1A 4P0QB 1ISGA 4S1OA 4CLOB 5KSOA 4KDFA 3MOIA 4G67A 4XDGA 3GCXA 3ANSA 4I1SA 3AUAA 2J09A 4I4TB 4WEQA 3W1EA 2DWPA 3NZEA 4E21A 4EYQA 4QIHA 3TF5A 5IM5A 1QZZA 1U9JA 4KFSA 1ZI9A 5E6UA 3KOZA 3PJGA 5FXMA 5CK4A 2D6FA 1ORHA 4NYJR 5CDTA 4NNOA 3TMKA 4NOMA 1E62A 5CW2A 1RP1A 1UT8A 2Q9CA 2OXEA 2WM3A 2Z2YA 4UUMA 3RYIB 1FNNA 3FB4A 3P9KA 3ONFA 4I4IA 3OUUA 1ZDMA 2A1TR 4TTVA 2GN0A 3WNBA 2P68A 3R6DA 4HMPA 1RHKA 2EDAA 3IAUA 3MTIA 4R3WA 5EJ2A 5HG0A 2GCOB 3FZEA 2ZSHA 3FTCA 4Q93A 1SQFA 4LJLA 4MOWA 2CBXA 3BYZA 3CEMA 4M7WA 4OG2A 4XYLA 3F4BA 2G40A 2WSYB 5KVCA 5LYJB 2ZM5A 1ZK3A 3D7NA 3CW9A 4R1PA 1DBSA 3D8SA 3OY7A 2HZBA 1SCJA 2FEXA 4L8YA 4RPKA 4UU0A 5BO5A 3GA5A 1P4JA 1J49A 1I2CA 2QSZA 1XHEA 4JELA 4C7VA 3C16C 1YQDA 3EXAA 4D8UA 3OQPA 2Y68A 2CFSA 2FMFA 3B5EA 3DCNA 1OREA 4GZMA 5TQ2B 3X44A 4REOA 4DC9A 1SIWA 1IQRA 1VXRA 3PQ2A 1KVSA 3H5RA 3ONEA 3IAFA 1QOPB 1N5DA 2HA2A 3AR8A 3C6YA 4HHEA 4PSKA 4RL6A 3SF8A 4AQDA 4LV8B 4XWTA 3O73A 3ESBA 1XD2A 1E4OA 3TPCA 4RPLA 4C2AA 3DM9B 3WWOA 1N5LA 4FFLA 4J7CA 2I3ZA 2XXAB 1O6GA 4AF8A 1C1YA 5BQ5A 1HK7A 1M1XB 2EEPA 4Q3BA 1U90A 2J3KA 3LW7A 4RV5A 1ODIA 3IKTA 2HMYB 4WUTA 2WE7A 2LUOA 5DHFA 4P31A 1DKQA 4QGSA 3J81k 4H3SA 1NJFA 2M6SA 1RJDA 5CHYA 5C8XA 2QT0A 4L3VA 5I9NA 3OP1A 3JQAB 4B6OA 1YE5A 4QGBA 3WLFA 3WSTA 4TVSA 1DCTA 2FUCA 3GVHA 1JI3A 2A92A 4P33A 5BRAA 1OI7A 3PI6A 3MIIA 1ZXXA 4ZV4A 1XDUA 4YCJA 3VH3A 5EGSA 1QH8B 2Q5EA 3PQCA 1N8TA 3VR4H 3MTJA 1DPFA 2YHBA 2K2QB 5DEOA 5DM60 1KHTA 3KUUA 1Z63A 1QQAA 3DTVB 5JBIA 2WVGA 4I2NA 2IEYA 3SSOA 3PFCA 2I8LA 4TWZA 4JMLA 3SZOA 3GT3A 1XAHA 2Y2UA 3VR6D 3FOCA 3P97A 1W29A 1LV7A 2C4MA 4MV3A 2R8BA 3U80A 2JFPA 3UGTA 2DJIA 2CF6A 4BQRA 3H5VA 3WDMA 3TTUA 4D5EA 3KWLA 4ON9A 2GTPA 2HLDA 5BSGA 1BQ4A 3SF8B 6PFKA 5IVPA 1THZA 3L43A 1TW3A 1JEAA 3VDMA 1R0BA 1VLJA 2W4IA 3ZIDA 3I9MA 2F8MA 2XOKA 5AKIA 4QUGA 5AVYA 1S3IA 1VHQA 4RY2A 3PCRB 3BE5A 4MPTA 5HZGA 1SCAA 3EX7C 1TRKA 1EUQA 2WQ6A 2FFQA 2AI2A 3DYBA 2YDYA 2ZEJA 1XCLA 3NUZA 3QX3A 1SB9A 1SUIA 3Q88A 4K46A 3WLKX 3ANLA 1SVKA 1Z0AA 4ZICA 5ISMA 3G17A 5FNVF 3F7NA 4BBJA 1TEXA 1LUAA 1XF1A 1V5WA 4P4NA 5CYOA 5DX8A 1ULAA 5GQSA 2YN2A 3HTXA 4LEIA 4Q7EA 4X8OA 2XMZA 4OHVA 3V48A 4B6FA 2ZRFA 3K5WA 4C89A 2QG6A 4ZQBA 5L3ZA 2JHAA 4HEA1 3AJ9A 4AF7A 4J03A 4AL4A 3CYFA 3FSJX 3AI7A 3GA0A 3NPAA 3QX8A 4LOHA 4G26A 3WNCA 4CGYA 5B4UA 1N7JA 4A8JB 2GHIA 2R48A 2CKDA 4Q12A 1E5VA 3ROFA 4IJWA 2B99A 4AUKA 1L1FA 1CE8B 2VF5X 2BH2A 1W0KD 4QU9A 1EMDA 2FE1A 1RPTA 2ODAA 1G8HA 2WD7A 3OQVA 4FXOA 4YJHB 4WFIA 4JVMA 4U63A 2E37A 4E0BA 1T8WA 4UUNA 2YY6A 2QGZA 3WGKA 2QT9A 5LNK6 4CKXA 1G20B 2FA9A 5C51B 5LMCA 2R7KA 3I92A 4URFA 1JFFA 2XUQA 2G4CA 1O54A 3DXXA 3GLRA 4PCLA 1YI8A 4EG0A 1OMOA 1UJMA 3ITEA 1DBWA 1MVNA 1EVZA 4CKWB 1W36D 3E1GA 3SP1A 2CNWD 1Z36A 1E3SA 2Y1GA 3MT9A 3U7GA 3JZAA 3BIOA 1HL3A 5E6RA 3AJAA 3ONNA 3Q15C 5IZCC 1QZTA 1SVUA 2Q6OA 1O9BA 2IYYA 4HQ6A 1KE1A 3D3JA 4UM9D 5KS2A 4YHHB 2L17A 1OZAA 5DNEA 3KM0A 1SHZA 3FY4A 1WOYA 3HBNA 1KFCB 3EBPA 3VNBA 4HQOA 1N2IA 1G38A 3HN6A 2D4HA 5T6BA 5TVKA 2C57A 2PRJA 3R6TA 2FWAA 1YMVA 4YMLA 2OYRA 5LMZA 2UYQA 1IZZA 2ZYAA 1T5SA 3KJGA 3KFLA 2Z2IA 2MYUA 2MIIA 5CDUA 3H9UA 1SKBA 3FTNA 3D3WA 3UT0A 2POQX 4ZFNA 1ADYA 3LVBA 3OZTA 5AKYA 5BSTA 1WABA 1JIIA 3KE9A 4ZVOA 1KZGB 5JPDA 1QGYA 4JSTA 4FZJA 4KXYA 4CR8A 2NOAA 1E9VA 1T10A 3QMWA 4QTUB 1BMTA 2ECFA 1TCUA 1D9XA 3E1KA 1BVUA 3GJRA 3IALA 3OE4A 3A04A 3KTAB 3KVYA 3ZE2B 2NQ2C 4RJIA 1X94A 3LRTA 3MWDB 5FBQB 4DABA 1XP5A 4E5PA 2QAGB 1U7HA 3IJRA 3J7TA 4JI5B 4YLYA 2OHGA 3EEIA 5HUQA 1VHTA 1EI9A 1TM3E 3P9PA 1HT3A 3ZWYA 4B76A 4FWBA 1DAIA 2NUAA 3AUUA 3HFSA 4CTMA 1R8SA 1G8GA 3M81A 2B2CA 1P2UA 4S1WA 3ILSA 3OLQA 4XX0A 4HEHA 3WP1B 4Y6RA 1PNRA 4DSNA 1GNPA 3ABZA 4J9VA 2FSVA 4XXHA 2WU4A 4H31A 4BO8A 4D98A 4DPLA 5HZMA 4LE0A 1YJ5A 3IFSA 2DQKA 1D4FA 2Z1DA 2Y1CA 4M36A 4RQUA 4B3JA 4YRSA 5KWEA 1WF3A 4BU1A