3VX3A

Crystal structure of [nife] hydrogenase maturation protein hypb from thermococcus kodakarensis kod1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
235
Chain Sequence
b'IDPREIAINARLEGVKRIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPPTVHGIKFMTIAYYTTPLRGKEISDALIELLTITRWDELDYLVIDMPPGLGDQLLDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEEGHKVIGVVENMKLREKDVEKLAEEFGVPYLVGIPFYPDLDAKVGNVEELMKTEFAGKVRELAGRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase involved in chromosome partitioning, ParA/MinD family
publication title Identification and Structure of a Novel Archaeal HypB for [NiFe] Hydrogenase Maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Adp binding protein
total genus 79
structure length 235
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vx3A01
1J90A 4MRVA 2VP4A 1ZJ6A 1SZPA 4JS0A 2V1UA 3KTAB 3D6TB 2XZPA 4PXAA 4JBWA 1DAIA 2OFXA 2QGZA 4L4UA 4KSBA 1UPTA 1Z8FA 2E1RA 2VSFA 1MH1A 1DADA 4BFXA 1RZ3A 1G6OA 1F6BA 4XWAA 1EWRA 4KHZA 3THWB 4D0GA 4NZYA 3U44B 3I8XA 2H16A 1NKTA 3UPUA 3RYTC 2OUKA 1SXJB 4KFSA 5EP4A 4PC2A 1Q3HA 4S2EA 3TK1A 5FR2A 2FFBA 2ZRAA 5GJVC 3TQFA 2DY1A 4NCHA 3EW9A 2ZI5A 4ACBA 1R5BA 4IEIA 3LVQE 4ASUD 1SKYB 3K9HA 1PV4A 2KE5A 5JECA 4A92A 1F3OA 3CNLA 2O8BA 4CDGA 4PPFA 4TYQA 5FPKA 1I4TD 4G0NA 1IXZA 3IIKA 4ZDWA 1VTKA 4F92B 5HZHA 3FHTA 5FBQB 2FE4A 4TWZA 3VR5A 1BKDR 4RJLA 3RWOA 4DUGD 3KB2A 1JBKA 3KQKA 2FF7A 4PPGA 2WMOB 4B71A 1II8A 2BVNA 3EPHA 3GFTA 3R7WB 1E6CA 3IQWA 1KDOA 2R62A 4HLDA 3MRSA 4LUCA 3L0PA 1FFHA 1KDTA 4X8HA 4XD7D 1GSIA 3MJHA 3P26A 4A6XA 4LPSA 4EJSA 4K81B 4Q4JB 2YJTD 3TUJC 2J7KA 3GLHA 2IL1A 3WHLA 3LXXA 2ZSDA 1S1CA 4TZ0A 2O0JA 3SBDA 2IUTA 4ZV4A 2FNAA 3QKSA 1T5LA 4XSHA 2OCPA 5HE9A 1GIAA 2CHVA 2G6BA 3BB4A 2GXQA 1TUIA 1A82A 1TADA 3FE2A 3UWOA 3BFVA 5AUQA 5HTKA 4HUQB 2WPDA 3OF5A 1Z6AA 4IVRA 1OIXA 1CF4A 5D3QA 3W6OA 4RFSA 2PX3A 2QQ0A 1FQKA 2GWHA 2VL7A 1HH4A 5EQTA 1Q1QA 4BFVA 2O8EA 1DAHA 1XX6A 3CX8A 1KAGA 1NL3A 4B33A 1E1RD 2Z83A 1VIAA 2IYTA 2JJ2A 4U00A 4NKRA 5FPYA 2YHSA 3B13B 4MGYR 4GPTA 1CIPA 2WSMA 1XD8A 2VLIA 1CEEA 4JL5A 1OIVA 1E2GA 1QHGA 3ZD6A 2AXPA 4JYCA 1YE8A 2F3TA 1P73A 4A15A 2JDIA 1OFTA 4IDOA 2FFQA 1GKIA 3K09C 3C14C 1P61B 5FL7A 1OYWA 2VRWA 3PENA 2VTKA 1NN5A 1W5SA 3IGFA 2KJQA 2WSSD 4Q7KA 5F9HA 2HEIA 1U99A 2WOOA 2OCYC 3AF0A 2BWJA 3DVLA 1Z0KA 2PL3A 4KBGA 2RGGA 4HAUA 4XVRA 5G41A 4YMUA 3CM0A 2GAOA 2VSOA 3SJBA 3BORA 4OQFA 1SXJE 3Q72A 4QGGA 4BZPA 4HAXA 3A36A 5G40A 5EXXA 2C78A 2DCUA 2BBWA 4LV5B 3UG7A 2KWIA 2NO9A 2V54A 4IDNA 3LWNA 3TR5A 3GQBA 1SKYE 1W4AA 1XXHB 4PHGA 3SQXA 1US8B 1ZC3A 3GLIB 1EX6A 4D82A 3EPLA 3A1VA 2B92A 2VA8A 1E2MA 4C0AC 5JZVA 1O87A 2V6JA 2F43A 4TN1A 5BN3A 5AK0A 1E9DA 4LJ8A 1BOFA 5J40A 1YR9A 4MYCA 1M7BA 1OH5A 4MDFA 4P31A 1TX4B 3I32A 3W8RA 3L2OB 4LCBA 5AJXA 1H8EA 1CR4A 3VR1A 1P2SA 1IAQA 4O0MA 4NU0A 2FN4A 5D3MB 1Q12A 3LO5A 3P20A 3U3MA 4FI3C 4Y0AA 2RGNC 3RS0A 5JWRA 3LQQA 1Q3TA 1KI7A 4Q03A 3TW4A 4CT5A 3ASYA 2WJGA 2XZLA 1NLYA 5EXPA 1KZ7B 2AWNA 2WIAA 1KIMA 1XCGB 3QPVA 2AXNA 3LAWA 3EA5A 3M6AA 2CCGA 2QI9C 4QXAA 4PC6A 5CLQA 4Z8XA 1KKMA 2ZRIA 1BMFD 4RKFA 1KI8A 3ETLA 3KKNA 2Q9CA 4HDOB 3K0CC 3O8RA 1D8TA 2JJ8A 2WAYA 4PQFA 1XTQA 2CL0X 4R2IA 2HCJB 4I1SA 1OIWA 1MO5A 4TTRA 4DDWA 1CP2A 3PFIA 4NHOA 1FMJA 2ZJAA 2D7DA 1ZNWA 2Z43A 1BIFA 3IHLA 3QKUA 3BH0A 2JLZA 4GDFA 2OAP1 5JS7A 4L15A 4LC1A 3NG1A 2HDNB 1GUAA 1U8ZA 1Z22A 2VYFA 1DE0A 2DFKB 4X8OA 1QHHA 1GRNA 4EAQA 3CRVA 5DN6D 1W0JA 2VH5R 4CEIB 1GNQA 2NMVA 1AN0A 3OEEA 5E7MA 2WKRA 1XEFA 5B64A 4ZIRA 3CUEF 3P4YA 4R7ZA 4BQSA 5JWHA 1SHZA 3NVAA 3KFXA 2V8OA 1U81A 2FA9A 1WQ1R 3AQ4A 2GCNA 3D31A 2YC4C 3R20A 1IN8A 3RABA 3T61A 1U94A 4PZYA 1DELA 4NCNA 2W6JD 2WOJA 2A5GA 1X86B 5L3RA 3WBKA 1S1MA 1VPLA 2ZI3A 3EZ6A 1XPRA 2HCBA 3HPQA 3UK6A 1W2GA 4QBIA 3RHFA 5KOYA 1UEJA 2PCJA 1G64A 2H92A 1XD2B 2GZHA 2R6AA 1W5TA 3MG9A 4KFTA 2WJHA 4YLGA 2HT1A 4HB2A 2FSHA 3Q7QA 4UXHA 1UKVY 1G8YA 3B5JA 1MKYA 4AIIA 2KBFA 2O8CB 1O3YA 2KSQA 2J0UA 2RMKA 2FV8A 4LHVA 2BC9A 1KKLA 4A2PA 4QC2A 2GK6A 2QORA 2P6RA 5L8VA 1QRAA 1XXHE 1RE0A 1XTSA 2A5YB 3K0AA 5KSPA 1JB1A 1RIFA 1VHTA 2Z5FA 1YJ5A 3GLIE 1YRBA 3ZD7A 2DR3A 3L0SA 1U8YA 4TLEA 3W34A 4U7DA 2JLWA 2IYLD 2GK7A 2O0HA 1G4AE 1HE1C 3BIFA 3KDSE 1MABA 3RANA 4A0RA 3L43A 3CIOA 4UNRA 2B7BA 2F1IA 1Q0UA 2AK2A 5AWFC 2ZJ2A 1ESNA 1SXJD 2REOA 4P4TA 4K8OA 3WBJA 1XTJA 3CLVA 1GRQA 2J5XA 3J81k 4HZIA 1KSGA 1W7AA 1E0JA 1MOZA 1U2RA 4JLNA 3UMRA 3PXGA 2ANCA 3G82C 3H84A 4EKDA 1KZGB 1NBME 3EPKA 1XBTA 2EFGA 4EPVA 3WP0A 1T8UA 3M4YA 4TT3A 4XD7A 4KU4A 5HCIA 3QKRB 4RY2A 2GCOA 4TYNA 1YZKA 1G9XA 2UZ3A 3ADDA 1RC8A 2C04A 3B1YA 1OE0A 4OL0A 1Z63A 1TMKA 1ZRHA 3HU3A 2XNDD 3T1OA 5IDVA 1W1WA 3KXIA 4KVAA 1E2EA 4LJAA 3BB1A 5GJWC 1G1MA 4MRPA 4P32A 3VAAA 3AV0B 5FPTA 3K0EA 2PJRA 2WKPA 1IY2A 5LD2B 2Q3HA 2WWXA 2YWGA 5CDFA 4JLVA 4LSGA 3VR4A 4E5UA 2RB4A 2FFAA 2MMCA 5K8IA 4URXR 1XTKA 4DC9A 1N5LA 2YV5A 4PSAA 2RGXA 4US0R 4CYMA 4QM6A 2GVZC 1TU3A 2CHQA 2ZSBA 4CZ2A 5KPDA 4Q48A 1GM5A 2GEVA 1DO0A 2QP9X 4HLUA 1DG3A 4MKGA 1ZM7A 4XWKA 2WTUA 2RGDA 3T34A 1S3SA 4PC3A 4B2IA 3K53A 1YZNA 2QY9A 4RD3A 5HKKA 2DB3A 4HYYA 3L82B 4ZCMA 4BFSA 3DOFA 4MA4A 1HV8A 1P75A 4DCSA 3FFBA 2RGAA 1P6XA 4FN5A 4C0LA 2PLFA 4WBSA 2QMEA 2ZI6A 3T35A 3U61B 4RD0A 3A1WA 4WIAA 1AS3A 1MR3F 2CE7A 3REGA 5SZIA 2GJKA 4PO1A 2WSSA 3GLGB 2ASEA 4O25A 2D74A 1ZNXA 4JT4A 1UEIA 3PUYA 3NKVA 1GL7A 5C4MA 4YDHB 1R6BX 4LJ6A 5AJVB 2GZDA 2DWPA 3BH6A 4ARZA 1XD9A 2ZRHA 1R8SA 1H8HA 3KX2A 3SYKA 1DPFA 4XIGS 2BBTA 4IFBA 2WKQA 3NBXX 1P5ZB 3T1QA 2NO0A 1G3RA 1G17A 2H1LA 5LBIA 1KO8A 3DKVA 3H0KA 1E0AA 1LNZA 5F2EA 2REXB 3N70A 5CB6A 1AKYA 2BJVA 5FTKA 3G5UA 2OAQ1 4A2QA 5BWMA 3SFVA 2HLDD 2FGKA 4WVFA 1NSTA 3AKEA 3LLMA 1JR3E 2I1VB 3BFKA 4TMXA 5DNYB 2H18A 3TH5A 3THYB 1P60A 4U02A 5K8UA 3FTQA 3SFZA 3DM5A 4US2R 5EZ6B 2W6ID 3FB4A 4NMMA 1P9RA 2ZS7A 1X3SA 4RCZA 1N2CE 3KUCA 4LJYA 3SOPA 821PA 5FL3A 2O0KA 2TMKA 3VKGA 3PEVA 4C0KA 2ATVA 1L8QA 1VCIA 4CEJA 3SYNA 1FUKA 2DFLA 4C0HA 3THXB 2J0QA 2QNRA 1COWA 3AUXA 4TTPA 2C8VA 2ECKA 1XF9A 1BMFA 4Q9HA 5CIQA 4BLOA 1N6OA 1YR7A 1KI6A 3BE4A 4M1SA 3T1TA 4DSOA 3P1JA 2HXSA 1HQYE 2R2AA 4B3DA 2ZRJA 2V1XA 3QVUA 1A2BA 3RRYA 4JYBA 3AB3A 3PJRA 2AX4A 3T15A 1JALA 1KO5A 3KQUA 4G5RA 4LHYA 3THOA 4JVSB 3VX4A 4B3XA 2OE2A 4DWJA 1LW7A 3GEIA 5IK2D 2ZXUA 4JKYA 3GJ7A 1FP6A 2VP0A 3B6EA 1W2HA 4GOKA 2JLSA 3TE6A 4Z54A 3ZVMA 4W5WA 2ZRKA 2HV8A 3SQWA 1GNPA 4FCVA 3S1AA 3N5CA 4C0BA 3WYFA 2CLDX 4EFNA 3QE0A 2H5EA 3A1TA 3KJEA 1L4UA 1E9CA 3Q8XB 2HJVA 4XJXA 5FBLB 3E1SA 2BMEA 2J45A 3T06B 1N0WA 3QXJA 3B1WA 2ZS9A 5E7JA 1Z6GA 3X1WA 2UKDA 4V0KA 1QVRA 2CCJA 2HJGA 3SN6A 2IW3A 2QMHA 1FUUA 3VTKA 3IIMA 1Q1BA 1QHSA 1TPZA 4KBFA 3RNLA 1CKEA 2V7QA 1SKQA 2G88A 3VR6A 4D80A 1TU4A 2QBYA 2XZOA 1IONA 2W6JA 2ZETA 2CEAA 4JIMA 4B2PA 3QEOA 4PHFA 2GILA 2EWVA 3QF4B 1AGRA 4MRRA 3BWDD 1T8TA 2A78A 3GLGE 2OFWA 1OXVA 4M21A 1CLUA 4BZQA 5HPYB 1NNEA 4Q1CA 1VG1A 1WP9A 2BKUA 3FKSD 1P72A 1DAGA 3AVPA 4Q4HB 2EYUA 5EP3A 5G3ZA 3B2EA 2QAGC 3QKTA 1YZGA 2C77A 1UM8A 4IOMA 4JMPA 4B3CA 1GL6A 4M0LA 4OHWA 1WE2A 3QOFA 4QJ4A 1IQPA 4PX9A 5EE1A 4G5SA 1C9KA 3RDPA 1I2MA 2J46A 1EFUA 2XSZA 3TNFA 3EZFA 2EFCB 5F98A 3KTAA 3ZQ6A 2XX3A 1TEVA 1G8HA 1PVOA 2JLUA 1ZVQA 2GBLC 1XNJA 4AK9A 1P2VA 5KO2A 2ODBA 1K8RA 4BFTA 1E1QD 3PEUA 2JCSA 4C2TA 4NP6A 1D9XA 3AF3A 4QOSA 2CMKA 4C7OB 2FJUA 1OFIA 4FXPA 4JL6A 1QG2A 4LGMA 4GZLA 3TVTA 4TYWA 3U44A 2X8AA 2IS4A 3K8YA 4B3BA 5M04A 5JHHB 3BB3A 1RRCA 1ESMA 3TRFA 1ZP6A 1S96A 2BMDA 4YQFA 3CO5A 2QGNA 3DL0A 1AS0A 2FX3A 5A4JA 2W2XA 2L0XA 3QVVA 2O5VA 3F5FA 4M1KA 1NVWQ 3F8TA 4GOJA 4RZXA 2ZRCA 1X1RA 1JR3D 2WJYA 4IDHA 3QG5A 1M74A 4BLSA 3HR7A 5AUNB 4GP7A 4JJKA 5KTYA 1J2JA 5FR1A 4N0EA 1X8JA 1T91A 1Z3IX 1R4AA 3ZS8A 1U0LA 2ZVPX 3U7EB 4LOAA 4DSTA 3EXAA 3FDIA 3GFPA 2W83A 3U4QB 1AJEA 1UJ2A 5FI0B 3KQHA 4YMWA 1HT2E 3C5HA 4CT4B 2CJWB 2WMNB 4LPKA 3RAPR 1U0HC 4D0NA 2CE2X 2J9RA 2AL7A 4YMSA 1W49A 4Q4JA 2FFHA 2X2FA 2JGNA 2OZEA 3JZMA 3RRMA 2G9NA 3NDPA 1ELOA 1CR1A 2HT6A 5E4FA 1T3LA 2IS2A 2X19A 3QXHA 3B7GA 1EFRD 1D2EA 4DCUA 3P4XA 1XEXA 2BIFA 2BJWA 1NP6A 1AQYA 1YR6A 3GJ8A 4TL6A 3GFOA 4NE2A 1AQUA 4V0NA 5KPJA 2MSCB 1NMYA 1T5IA 1U9IA 1HYQA 2WWHA 4HUQA 3K9LA 3LH5A 4Q4AB 4Q1EA 3LY5A 1L2TA 4MGZR 3VR2A 4B47A 1XTIA 2CLCX 1LF5A 4N1AA 4R71A 4F4CA 5JCZA 5JSZB 1P2UA 1R0WA 1GG2A 1II9A 1WBDA 3A6PC 1WXQA 2A9KA 3SZRA 1Z08A 5F9FA 5EUMA 4LK2A 1OJLA 4OJQA 5EE3A 1C4OA 4M1YA 3U3OA 5B57C 4ZPXA 3BK7A 5TMPA 2D7CA 4Q9LA 2FPKA 3TVDA 4A2WA 2PBRA 3ONWA 3JVVA 2ZAOA 4HUTA 3KQLA 2F9MA 4RVCA 4GZMA 1XPUA 2ZE8A 1TQ2A 1KO7A 1CBUA 5HE8A 1HEIA 1YZTA 1SVWA 1ZUNB 2WJIA 1R0YA 3GEEA 4PHTA 1F60A 2DWOA 2IXGA 3FFAA 4IOJA 3C41J 1J99A 4P4SA 3UXMA 3TUZC 2MSEB 2AR7A 3VU9B 5LB2A 1D9ZA 3MLEA 4B43A 1OH6A 4R2HA 1E69A 1FTSA 4OQMA 2QQEA 1W36C 2D62A 3DZDA 1K5DA 1WRBA 3IBYA 4M2LA 4M1MA 4KCGA 1G8FA 3HYTA 4OI4A 4DLVA 4Z1MD 1AS2A 2NO6A 2VHUA 4CGZA 4NCJA 3HPRA 2YWFA 3DZ8A 3GLIA 4G1UC 5AJZA 2DBYA 3FWYA 1KO1A 2WWGA 2ERYA 3IDQA 1GVNB 4QHYA 4Q1AA 5EE5B 4FW9A 2WVJA 1NG9A 2XNSA 3A37A 2WICA 4Z51A 3IO3A 3KQNA 2AKYA 1BO6A 1KI9A 1V43A 3FVQA 5JEEA 2RGEA 1N6NA 1QBKC 5FFMA 2F1RA 1F2TB 1G5RA 2A2ZA 2BOVA 5G3YA 4C3ZA 5JMTA 4PAOA 5D3MA 1KAOA 2PX0A 1EG7A 3BOSA 3DEFA 1N5IA 1QDEA 1JNYA 4TMWA 4Q01A 3B78A 4B74A 2XJ9A 3I1FA 3IPXA 4CF7A 4KODA 5IK2A 2ZR0A 3LX5A 1NBMA 4G5QA 5C1BA 3TAUA 4BFZA 2VEDA 4AD8A 1CJVC 2Q9AA 4ZCLA 2ZSEA 5BYKA 1EFCA 3Q85A 1G3QA 2OBLA 2PJZA 4M1WA 3WYAA 2XOKD 3C4JA 4V03A 3M0EA 1FL9A 3L0OA 2GESA 3OE7D 1YVDA 4GFDA 1OKKD 1I4DD 2Z4RA 2F6RA 4DCNA 2P6NA 4ZI3A 3DOEA 2WV9A 5CYOA 1P9NA 5HCNA 1YKSA 1H65A 4H9GA 4URWR 4JBYA 3SJCA 2ZYUX 2ZJOA 1ONBA 2OT3B 3KJIA 1XCPA 4LJ4A 2C03A 4UNNA 4JL8A 1KI3A 3EARA 1U0JA 1QHYA 4US1R 4LWZA 1EESA 3A8TA 1CXZA 1YHNA 1KDPA 1NI3A 1Z2CA 1JEDA 1P62B 1Z6XA 2W2TA 4P0TA 2QL6A 1RJ9A 5B30A 4L16A 1S8FA 3HJNA 1GWNA 3AVTA 3V4RA 3D7MA 2P2LA 1KNXA 4LV8B 3I62A 2GA8A 5CYPA 5J4VA 3ADKA 3U6BA 1SVOA 5DIFA 5GADl 1LV7A 3L0IB 2ZE7A 1EXMA 2O52A 1P4SA 4URYR 3FMPB 2CVFA 5FUYA 3BBPA 3R9WA 3PUVA 1ZW6A 1QHXA 2AD1A 1U98A 4YXWD 5FOTA 1W0KD 3CF2A 3CRQA 4TYPA 2IS1A 2F1HA 4OK5A 1VG9B 4HZUB 3SHWA 4HSEA 2IWHA 5L3QB 4TSFA 1E79D 2F55A 1A5TA 4AKEA 4HAZA 1OFHA 3PR1A 5E7IA 4LV6A 4TMKA 2A30A 3DKPA 3IO5A 1XD2A 1N5KA 1HA3A 1JJVA 1F48A 4RD2A 1JI0A 2Z6VA 3EC1A 2JLXA 3H2YA 1ZUHA 3AP1A 3WY9A 5KNBA 2O8CA 3VFDA 3CX6A 5K8LA 3BGWA 1FP7A 1G4UR 4Q02A 1JQLB 3MGCA 3TR0A 3EIHA 2LCFA 1UAAA 5CJ2A 2JIZA 2H7VA 4IOLA 2MSDB 4TL9A 3TGPA 2GHIA 3A58B 2OXRA 3U3JA 2RGBA 5DH9A 4EDHA 2BEKA 2QTFA 2J0SA 3EX7C 3M1IA 1NRJB 2Y8EA 4EIWA 1KHTA 1MO3A 2K5UA 2R65A 4PO8A 2P5SA 4W5JA 3NHBA 4R9UC 4IRUB 1II8B 3I3SR 1IXRC 5FUWA 4M53A 4PPNA 4PAQA 1TNDA 2CXXA 1YR8A 2ZRGA 3QJYA 4RZ2A 3UMSA 2G3YA 4CW7A 3W90A 2CK3A 1JR3A 1MO4A 4TLCA 1CS4C 2GEDA 1FNMA 1N6LA 3LVRE 3EC2A 3QEJA 4D4JA 2ZROA 4J0QA 1E32A 4OHVA 2IWRA 1E0SA 2X2EA 5AUPB 4V0LA 5KDOA 5JEDA 2Z0MA 2YWHA 4F4IA 4KJZA 1M34E 4LY6A 1QG4A 4NONA 2WIBA 5FOSA 3WP1B 4KV9A 4A8JC 4ZO4A 2IYWA 3VNUA 3QKRA 4LHWA 4POAA 2IF0A 4QM7A 4MUAA 5ANRB 1VYVA 4DEXA 1XP8A 4XTCS 3R9IA 2C2HA 1Z0DA 2W0SA 4BUJA 4OHYA 4V0OA 1D2MA 4NYJQ 4F91B 1ZM4A 4RFSB 1YQTA 2QTHA 5E3HA 1G5TA 5DI3B 3GJ5A 4HB3A 3L8YA 1CRQA 4PR0A 1EFRA 4PSKA 5LB4A 5JWOA 1YZUA 3SJAA 2G83A 3Q9LA 2B21A 4N0DA 3VMFA 4KITB 5A0FA 2OLJA 2J1LA 1LS1A 1SVLA 2VQSA 4B2LA 721PA 3TQCA 2CNWA 1OB5A 1UBGA 2EQBA 4URZR 4Q9IA 2E87A 1M6NA 3RRZA 2QN6A 3B1ZA 4M1OA 5BYJA 3ZS9A 1TEXA 1R5NA 3AKCA 1MO6A 4KFRA 2ZUCA 3AGPA 2NPIA 1FOEB 1S3GA 2Q6TA 2QT1A 5F3WB 2IUSA 3SC3A 1KK2A 2R6GA 4IVQA 3GJ3A 5JCPA 2QAGB 4KLZA 5FBVB 1RYFA 5FOWA 2R6DA 3ZGXA 4TLDA 3QPUA 3O47A 4TQUS 4C9BA 4B3GA 3GEHA 4YC7A 4AKHA 2IS6A 2ATXA 4MUBA 1OXXK 3RLFA 1X6VA 1ZYUA 4OQNA 4DEYA 1N25A 4HB0A 4ZI2A 3N2IA 1FTNA 1JXOA 1TAGA 1GKUB 1R5OA 1VG0B 2J87A 3NC0C 2C99A 5HZKA 2O8FB 1VYTA 4DLUA 2FSGA 2C5LA 3VNVA 4C30A 4ASUA 5EE9A 4JLPA 3CKLA 1E2JA 3MJRA 3MWJA 1UKEA 1XJ0A 5H70A 5JJLA 4EQ6B 2GDJA 1KTVA 4Q9JA 2EFDB 2ZRBA 1ZINA 1ZUIA 1J7KA 2OG2A 1JECA 4A1FA 3GD7A 4JSYA 4Z1MA 2ZS8A 5JJKA 4MH0R 1ZMXA 4DUGA 2A5FA 2H8KA 1BS1A 3EG5A 4GI7A 2ONKA 1FW6A 1XMVA 3E70C 4Q1DA 2VP2A 3QXXA 4A0GA 2MMGA 4I1OA 5FTLA 3CF0A 4M4SA 1E2HA 1GNRA 1OH7A 5LPNA 3THYA 4BWYA 1E2DA 1W48A 5HR5A 3HU2A 4ZKEA 3SBEA 4JBXA 2OHFA 2XTMA 5KDLA 2FZ4A 5SZKB 3U6KA 2PZEA 3K1JA 3OAAD 4CEHB 5FTNA 2EW1A 3FMFA 5EP1A 3CF6R 5DSZA 3O8CA 3C5CA 1NLFA 4GT1A 1WDTA 3MD0A 3THXA 2PMKA 2FSIA 4IJMA 3AF4A 5JJIA 4OHZA 2ZVQX 3KKQA 4QNMA 1DAEA 4TMVA 1M1YE 2ZRLA 4D2IA 1NVVR 5FOVA 1G18A 5GVRA 2P5TB 2JEOA 3GLFB 2XOKA 1NVVQ 3PUWA 4CRWB 2QU8A 5BXQC 2EFHB 1NIPA 4RCYA 1TF5A 2P6UA 2F1JA 1E1RA 1YZLA 5GJBA 2R9VA 2O8DA 2ZU0C 1Z0FA 3RSOA 4D26A 2WBLC 2N1BA 4FMCF 2ZE6A 3ZYCA 3ICEA 1R10A 2ZANA 2IEZA 2LKDA 2ODWA 3O8DA 4IHQA 4DJTA 4G5OA 3R8FA 1G20E 4DSUA 2GJ8A 2IK8A 4P3YA 3ZH9B 2KI5A 2EU8A 3BH7A 4AI6A 1N5JA 2D2FA 4KAXA 4EPWA 4Y0VA 2IUUA 1E2NA 1R7RA 1Z0JA 3VHXA 1BYIA 4D0LB 2XXAB 3B85A 1QZXA 1E2QA 3TUIC 3U3RA 2F3RA 2BDTA 4K46A 2JJ1D 4YDSA 2NOAA 2XB2A 4DCTA 2BHRA 3E2IA 3AVYA 1CU1A 3MWYW 1KY2A 2IYYA 4OBEA 5FOUA 1S9DA 1W44A 3K09A 4ACAA 4DDVA 1KI1A 1XMJA 4MQBA 4TMTA 3QSYA 4HB4A 2NTYC 3CNNA 3U7HB 2FMXA 2I4IA 4B6EA 3FGNA 3QF4A 2BCGY 4TQAA 2OBMA 1KK1A 2YZ2A 3HWSA 5AR1A 1E9BA 4BEBA 4KVGA 4A9AA 1SGWA 1CJUC 3RVBA 5IT5A 1ANKA 1E79A 2XB4A 3X1DA 2ZRFA 3VX3A 4JVLA 4LC0A 2OCAA 1NLZA 1ZM2A 1IJEA 3T5GA 3MMPA 4Q4HA 1W36B 3V9PA 3LW8A 2BMFA 1JPJA 1Y3AA 3X1YA 4DLRA 1G5PA 2RGCA 2IYUA 3DPUA 4LI0A 3GP8A 2OLKA 1AM4D 1Z6TA 4LBWA 2E9SA 4TL7A 4O2LA 521PA 3SEAA 3FPAA 4DLZA 2VHTA 4AKIA 2H57A 1A7JA 1JAIA 1UKYA 4TLBA 5TARA 4DDTA 1F2UA 5L3SB 3I61A 3LNCA 3EZ9A 2NG1A 3RC3A 4TL8A 3FKQA 2GVDC 1SVKA 1JJ7A 3BD9A 4C7OA 4LJ7A 4LHZA 2C9CA 5CB8A 1R0ZA 2V9PA 4MRNA 3U2QA 3ZLJA 2QRZA 4UNSA 1N6IA 2P67A 4BPBA 1RW4A 1RFLA 3H1TA 2QE7D 1M7GA 3I4LA 3P27A 1DARA 2AFHE 2RGNA 2PZGA 2YNMA 3RS7A 1DTSA 3SHFA 1NMXA 4NBSA 4OHXA 1KY3A 1XTRA 4QBFA 4EJSC 3PEWA 5CJPA 1Z07A 3NBYC 3GJ0A 3C15C 2P3SA 1AZTA 2ONJA 3OIYA 4A0HA 1P7CA 2ZYVX 3K0CA 4B73A 3GLFE 3PV0A 1HTWA 4JVNA 4RD4A 3NEJA 1G3UA 2OESA 3VR3A 1ZM9A 4DBLC 3K9GA 1T3SA 2Q21A 1FX0A 3AF2A 3OHMA 2XTZA 1E9AA 4BASA 5DN6A 4AYXA 2GF9A 3W5IA 3KFVA 1IXSB 2FWRA 2ZU6A 3RS4A 4B44A 3U4QA 3KUDA 4M8NE 3KB1A 3TSWA 1GZSA 1L7VC 1NG1A 2CJWA 4QJ3A 1EWQA 3TSZA 3WMEA 2CDNA 4LRWA 3TIFA 5H1YA 4U5XA 5P21A 1K6MA 4UXIA 4LYAA 4WAUA 2WPDD 1I2DA 4Q00A 2IYXA 4WW0A 1VDZA 2QM7A 1S2MA 1CJTC 4QHSA 2EVWX 2AN9A 4PO9A 1MRNA 4B76A 4LYHA 1ZIPA 2ZI4A 1OF1A 3SYLA 2C95A 2IHYA 4PTLA 1VHLA 2C96A 2IC5A 3AKDA 2BBSA 2NQ2C 4FMCB 3VKHA 1KGDA 2FSFA 2XGJA 1Z0IA 2ZJ5A 2ZTSA 3B82A 4IDPA 3ZIAD 4AG6A 4YMVA 2IXEA 3QXCA 4QRHA 1SVIA 2UZIR 2GNOA 4DRZA 5JSZA 3KKMA 3F0TA 2GF0A 2NGRA 3A4NA 3NH9A 5FL7D 2HYIC 3UG6A 4TTQA 2FG5A 1HURA 2DPXA 3X2SA 1TF7A 4GOXA 3JVUA 5EZ5A 4I99A 2N42A 2BCJQ 1ZD9A 1G8PA 5JLJA 1RRPA 3SJZA 3SNHA 1HY3A 1XZPA 1W46A 1IN6A 2ZRMA 2CVHA 4I1UA 1XRJA 2VSXA 2KBEA 3THWA 4BLQA 1X8LA 1KI2A 5KU1A 2V6IA 2ZE5A 3ICQB 4L5BA 1KSFX 2QTVB 1SXJA 4GSYA 2BKEA 5DLQC 1PLJA 2ZR9A 2OFOA 5JFGA 1E2FA 4I81A 1NN1A 4C4PA 5DHFA 3VQTA 2WJVA 1LY1A 3DHWC 1X8KA 2VHCA 2QPAA 3IHWA 5J4LA 3WHKA 3VU9A 3ADCA 3NTUA 3N2EA 3TKLA 4M1TA 3BAFA 1KMQA 1OHHD 2QSYA 1XU4A 2QA5A 4QG7A 2ZJYA 1GFIA 1ZCBA 2DFNA 3OIVA 4HATA 4HI0E 4DIEA 5JHGB 1BH2A 1PUIA 2AKAB 4CVNA 2H17A 4JKIA 4DB2A 2ZJBA 5EE0A 3WNDA 2C9YA 4IW3B 4JLOA 1H8ED 1KI6B 3B1XA 3ND9A 2ERXA 4LBYA 4UJ3A 4ZDIA 3KKPA 5A5GA 4QGHA 4OQLA 3B1VA 4M9SA 1HT1E 2IXFA 4HLCA 4NCKA 3NBFA 4OK3A 4A8JB 2FDCA 2OSBA 3CR7A 2ODNA 5AUOB 1OT3A 2XEXA 3R7WA 4M9XA 1DG1G 5EUQB 2XNDA 4D4MA 3WXMA 1TQDA 4HAWA 2IYSA 5CDFE 2BEJA 1VCOA 5KSYA 1F2TA 4IFEA 4DT1B 4HDCA 2PEYA 3W5JA 3QG1A 4OI0A 1OXSC 5KDDA 3K9NA 3OZXA 1IM2A 1OH8A 4FWIB 1I4LD 3WNCA 3IUYA 5AJWA 2AWOA 2G1KA 4O2RA 1JXMA 1M7HA 1XEWX 4MGKR 5J47A 1LTQA 3K70C 3AEZA 2PMDA 4ESVA 4ESHA 2QEQA 1P2TA 1S4QA 2YINC 4QGFA 3TW8B 4OJKA 4GBMA 4LJ5A 1AIPA 1T4GA 1KO4A 3ZJYA 1B23P 3UIEA 4IVPA 1Z0AA 2ZR7A 4NYMR 3LD9A 1W0JD 5C18A 1E2IA 3OEED 4QKQA 3LLUA 4C0QC 3K70D 1AKEA 4NYMQ 4PPQA 5C2JB 3QIAA 1KK3A 2JJ1A 4L8GA 3HR8A 4DHEA 3R8CA 5B2ZA 1E4VA 1T0HB 5DGXA 1NJFA 1HUQA 5DYIA 2GTPA 3DMDA 1E9EA 2FEOA 2JATA 2RAPA 3GMTA 1KNQA 3REFA 3KKOA 2Q3MA 3MSXA 4KI0A 3DDCA 3W6PA 3W6NA 1SHKA 3DO6A 3V4FA 1B0UA 3I72A 1D5CA 1AGPA 4GP6A 1FQJA 5CM9C 4BLRA 3HYRA 4B48A 4W9MC 2B7CA 4UQOA 1XDBA 3CRW1 2FH5B 1KYIA 4MKIA 2QROA 4FMDF 1Q20A 4C0JA 4EFLA 3SI7A 2GXSA 5FUVA 4NYIR 1V5WA 1ZNZA 4KYIB 2N46A 4NYIQ 2HLDA 2PCLA 3EWSA 3MWLA 2C9OA 5DO9A 3PUZA 3O8BA 3CH5A 1E9FA 4EPXA 2GZAA 3CNOA 3U7FB 5FUXA 4HZUA 1QHIA 4E07A 3NXSA 5L3QA 4Q7LA 1UBEA 1X1SA 3RS5A 3PG5A 4DLTA 2QP3A 3Q5EA 3GPLA 4BGDA 3DM9B 2W6IA 1NY5A 1IHUA 5KUTA 1XXHA 1US8A 4ZCIA 4W7SA 1W36D 6Q21A 2QM8A 1XFAA 1HE8B 3WRXC 5KSZA 4F7WA 2WM9B 2HYDA 4V02A 3OFND 4MKFA 3EIQA 1IY1A 2WWYA 1G8GA 4JLBA 2IF2A 5FOXA 2QE7A 3DMNA 1PUJA 5EXSA 3UWKA 1R0XA 2WWIA 1N3BA 1Q1EA 1RYHA 5LDDC 1LF0A 3AF1A 1D6JA 2VP6A 4MYUA 4QNRA 4KSCA 5KNCA 2CHGA 2OV2A 2GJAA 1NVXQ 4LX0A 2OEPA 1GTVA 3H86A 2PH1A 3FMOB 4XTRA 3IIJA 4URUR 1VMAA 1XMIA 2P65A 4G5GA 2ODEA 4TT3D 2ZUDA 1OFUX 4WXPA 4QL3A 3TLXA 5GVSA 3LBHA 1E98A 4H1UA 2BBOA 1UADA 4JSTA 1IJFA 3K0FB 1EGAA 3UATA 4DLSA 4IEEA 3FOZA 1E99A 1FNNA 2WHXA 3UKDA 1NVUQ 3PVSA 1SVMA 3W8NA 1XEXB 4D25A 4DLYA 4EPRA 1KMHB 3RS2A 3UMFA 3AP3A 1D2NA 5UKDA 4HLUC 4PHHA 3V00A 3BERA 5CK5A 2PT7A 4YMTA 4PZZA 2R6FA 3SU8A 4CEIA 3T1VA 5DI3A 3KL4A 3IEUA 3CRMA 2D06A 2GAAA 4BECA 1A4RA 1GAJA 3ZZTA 3LX8A 1CJMA 1F5NA 3P32A 3FKSA 4ILEA 1JR6A 4MRSA 4FINA 2AD5A 4L9WA 5HKKD 1NN3A 4EPTA 2ZAMA 3ZIAA 2ZM5A 1A1VA 2AHOA 1UKZA 3VKWA 4V0ME 3WYGA 2J7PD 1DO2A 2VP5A 5IF9A 1G3MA 1DS6A 1XEWY 1NN0A 4BFUA 4FCWA 3U60B 4FWTA 2G0TA 421PA 1GITA 2EWWA 3CWQA 4AYWA 1RPZA 3ZZ0A 4LBZA 2QAGA 3A4MA 2A7QA 2ZEJA 1PZNA 3PIRA 3JZAA 4MKHA 4E03A 4MDEA 4GRAA 1E1QA 4P4SB 3KJGA 5JS8A 1G3IA 3I5XA 2A5DA 1E2PA 1G7CA 3PCRB 5J5CA 4KYUA 5EJEA 2PT5A 2O8BB 1NMZA 5FTMA 1RRFA 3CB4A 1H8HD 4PAMA 2IEYA 5CIWA 3MCAA 2Q3FA 5H8WA 2GBLA 3SS8A 4RD6A 2O8FA 4C2UA 3PUXA 3NBZC 4EUNA 3FHCB 5EP2A 2XJ4A 4FMDB 2XAUA 5DI9A 1MT0A 1UFQA 2RH5A 3HU1A 2BM0A 4L9SA 3I92A 4ERNA 2G1JA 4BZXA 1ZC4A 1R8QA 2ZRNA 4RSGA 1OHHA 3AP2A 1XCMA 1II0A 4EQ6A 5L3VA 3ECCA 4XVQA 4KO8A 1CTQA 2VF8A 4ITRC 1CR0A 2LWIA 2WWWA 4EJSB 1E96A 3TBKA 1E2KA 2SHKA 3GLHB 2I1QA 2IYRA 3NHAA 1CJKC 2V55B 4C0SA 2WZQA 5C4GB 1WBBA 1AA9A 2A3RA 2ZUBA 3C16C 3SE0A 2NIPA 3AVOA 4PANA 3QKSB 1P9WA 3CBQA 1WCV1 1COWD 3CWZA 2QAJA 1E3MA 5BN4A 4IKEA 4NYJR 2DFTA 1Y63A 2RHMA 4UNPA 4OI2A 5FPSA 3W3AA 3T12A 1MV5A 1NSFA 3RSLA 4DLXA 4CEHA 3QI2A 1E0KA 4TYYA 4NTZA 3QENA 2JLVA 2O8EB 1JAHA 2QMUA 3KXKA 3Q5DA 1RKBA 2ZJZA 3TSOA 4Q18A 1J8MF 3AH8A 3MWKA 4RZUA 2D4HA 4M9QA 2NPFA 4PQYA 3EA0A 4QBHA 5JI3E 3GLFA 1Z6YA 4W5HA 3I5YA 1GDDA 1LS6A 2ORVA 1RJ9B 3UANA 5JBQA 2PEZA 2Z4SA 2LKCA 5IRCD 1M2OB 3AVWA 2QENA 3GJ4A 4QGAA 2CLSA 2J0VA 3F3YA 4D4KA 5KYKA 2QG6A 5J4YA 1EK0A 2BM1A 5CITA 2OBNA 4MITA 2QMOA 1N6KA 2F7SA 3E5HA 4JVMA 4URVR 3QXSA 3CX7A 4GNKA 4JLMA 3W3ZB 2BMJA 5FTJA 1OW3B 1GL9B 5G53C 1XMSA 2YOHA 2V7QD 4LYFA 4XSGA 4PC7A 2BV3A 3CZQA 3MUFA 4BLPA 3WNBA 4E09A 2VIIA 3PQCA 2XXAA 2B6HA 4FD2A 3ND8A 3EASA 3U3KA 4B35A 3RC8A 3BRWD 3ZQJA 3WMGA 2JASA 2ORIA 3CPJB 1U8AA 4NPHA 3LRPA 3OESA 4WZ6A 3AVQA 3GLGA 1TQ4A 3B9QA 2G0NA 4DB4A 4Q1BA 2NZJA 3OEHD 3G0HA 3RWMB 2G77B 1U90A 2HUPA 2ZRPA 4OK6A 2GXAA 1TUEA 2F43B 2YYZA 1E2LA 3X1XA 3LFUA 4TQ9A 2R8RA 4HEJA 1NJGA 1XJQA 2XSZD 4QHTA 4A4DA 4ABYA 3WMFA 1VCNA 1SXJC 2RKOA 3FMIA 1T6NA 3QBTA 1DEKA 2RCNA 1IOZA 1W4BA 5JRJA 3OFNA 5K8TA 2D3WA 2GEUA 2ZJ8A 3GLHE 4DVGA 4HLQB 5DISB 2QP4A 5TY0A 4Q5IA 2ZREA 3X1ZA 5L3SA 1Z5ZA 2IYQA 3ZVNA 2IBMA 4G3XA 4MYHA 4IOKA 2GJSA 3EPJA 1KOFA 2DYKA 3QPWA 1RVDA 4P33A 2QUZA 1UBCA 1Z83A 4Q19A 1CR2A 1SULA 2EYQA 2GRJA 2WJJA 1TF2A 3HP1A 4DDUA 3CR8A 2YC2C 1XZQA 1WMSA 3CZPA 4X8MA 4EPYA 1PJRA 3LA6A 1S9HA 4P4UA 4DCVA 1EX7A 2QZ4A 1NY6A 1QHHB 3OE7A 3LXRA 1OKKA 5B58C 1IN5A 2Q9BA 4Q4LA 4TMZA 3ZVRA 2OO7A 3K70B 1TTTA 2IHBA 4OI1A 4TZ6A 4AYTA 4RFVA 1N6PA 4OKSA 4ZIRB 1G7RA 5J4KA 1TQ6A 2ANBA 3AM1A 2W00A 1HQCA 2WWFA 4BFYA 5CM8B 1L4YA 2OM2A 5TDHA 1EFHA 3ZVLA 1WB9A 1YRAA 2NZ8A 2QPTA 4Q9KA 4H1VA 5H68A 2I3BA 4BEJA 4BE7B 1AZSC 4JLAA 2XITA 5C46F 2OXCA 1QF9A 2AK3A 4PQRA 1U9IC 3QNUA 3W9YA 3QBVA 4KLNA 3CPEA 1ZAKA 1NIJA 1GOTA 5BN5A 4A6PA 3IILA 4S35A 2JLQA 4BRWA 1OYYA 2JLYA 3TMKA 4BFWA 3QF7A 1ZU5A 4ZKDA 4EFMA 4FCTA 5KNDA 3K0SA 1LB1B 4YXWA 1W0KA 2J7PA 5FH9A 4LHXA 2ZQ5A 2B8WA 1ZBDA 2J0UB 3RS3A 4DIDA 2X77A 3H4MA 5JRZA 4AKGA 1W47A 4Q47A 4AY2A 1FPMA 1TL7C 4GMDA 3AVVA 3MAAC 4XH9B 1N6RA 2ZITA 3A1UA 1T3HA 3K0AB 3QUSA 4DXAA 4WZAE 2NO7A 1N0UA 221PA 4F4JA 3EZ2A 4B75A 4D81A 3R9XA 3CONA 3GJXC 1SVSA 2GCPA 3ADBA 4JLJA 5ELXA 2JAQA 5KSOA 1KJZA 4JLKA 621PA 1MABB 1XWIA 3LW7A 1KJYA 1T9HA 4JZKA 5KHOC 4I4LA 5TXGA 2AFIE 3EWAA 5BQ5A 4B32A 2CL6X 3KZ1E 1GRRA 4IXNA 3U5ZB 3GCGA 2FEMA 3CH4B 2HXYA 3LDAA 4D6PA 2F9LA 1GKYA 2YOGA 3BS4A 3BXZA 1BYUA 4MYTA 4JJZA 5DE3A 1GILA 4ZDJA 5CK4A 4RZ3A 4UKDA 4AWXA 5TV2A 4A0FA 1ZM3A 1FMLA 3NEYA 1GP2A 4IXMA 2QPOA 2IYZA 1G41A 2Q0HA 1AK2A 2J41A 3C8UA 1CRPA 1VG8A 1W4RA 4GMXA 1EFTA 2GCOB 1E94E 3LQRA 4B34A 3AVUA 3LV8A 4DZZA 121PA 5J4HA 2FZLA 1IN4A 1UBFA 1LFDB 4PSVA 1DAFA 2J3EA 1QHNA 1XPOA 2PZFA 4F93B 1N6HA 1Z2AA 2PLRA 4WXRA 1DBSA 4AC9A 2QSZA 2ZSFA 1OSNA 3NIBA 4XVUA 5DHAA 4FMBB 1NF3A 1PLLA 3LBNA 1MRSA 2XTNA 4WZBE 2FU5C 1S0UA 2DHRA 1UDXA 1G6HA 4G01B 3SR0A 4UXJA 1E4YA 4LBVA 3Q3JB 1QVAA 3FHOA 4BLTA 4OYHA 5FI1B 1OPXA 2FPLA 2YOFA 4A8JA 2VPPA 5SZJA 4TLAA 2W58A 4OQXA 1J8YF 2O8DB 1ZD1A 1JPNA 1NBMD 2GXUA 1G19A 2FPMA 2HF8A 4E22A 1XB2A 3NH6A 1FZQA 2ZI9A 1KDRA 1CULC 4LYJA 4QJ5A 8OHMA 4DT1A 2J59A 3PEYA 1Q21A 5SZHB 3Q7PA 4Q7JB 2W2VA 1ZU4A 2D2EA 2ZYTX 4LJ9A 4PZLA 1DAKA 2GETA 2IA5A 2KB0A 3U7GA 1VYUA 2RHDA 1YZQA 3T5DA 2JJ2D 2VHJA 1Z47A 1Z28A 4YONB 3ZDQA 3AVXA 1JEEA 2VHQA 4B6FA 4Q66C 1A2KC 3IPYA 2YKGA 1UF9A 4NCIA 4Q4AA 3OIUA 1UDWA 4R98A 4D4LA 4M9ZA 2JDID 5BW8A 4WOPA 4ARZB 2VO1A 2WAXA 3QQ5A 4RKEA 5E95A 3A4LA 3KXLA 3QY0A 1K5GA 2IYVA 1DOAA 4KFUA 1E9SA 2QRNA 3A1SA 1IY0A 3HDTA 4LZZA 4QFMA 4UJ5A 4BRUA 4A36A 4NDZA 1ETUA 4IDQA 3PITA 1Q44A 4Q7MB 4HDQB 2V3CC 4NL4H 4DSNA 4M22A 3ZZUA 3EIEA 3OEHA 3GJ6A 5FPHA 1KJWA 1KI4A 1YU9A 1W4CA 4HAVA 2EFEB 4CIDA 2JLRA 4V0MA 3NDBB 1VCMA 2GJ9A 4AG5A 2ZYWX 4TSFD 5FBWB 3IQXA 1OXTA 2R44A 1WF3A 3CPHA 2YWEA 2IT1A 1F2UB 2YVUA 3KJHA 1OB2A 4II7A 3CW2A 2ZRDA 4RD1A 4PFSA 3TJZA 2VF7A 1G7TA 1Q57A 4CEJB 4DLWA 4Q1FA 1DVRA 5CLLA 1KSJA 4MGIR 2CL7X 4ON9A 2QT0A 3EZ7A 1T0JB 3AUYA 1OLOA 1ZIOA 2JIZD 3D8BA 3EAQA 2NO1A 3OIWA 1JQJC 1OV4A 1SQ5A 2A5JA 4N3NA 3SDZA 4ZDKA 3OAAA 2CBZA 2FOLA 3BJIC 1G16A 1IBRA 2C98A 4DKXA 4PC1A 5IHPA 2CCKA 5TVKA 2V4ZA 2ZI7A 5DYGA 2X1VA 3I73A 2UVQA 1Z29A 3D3QA 2CK3D 4AURA 2VBCA 5AJYA 3TAHA 5TB5A 1G21E 3S1AB 1FX0B 3NC1C 2FGJA 1C1YA 1ZCAA 4JT2A 5JI2E 1ZD8A 1N0VC 4QBGB 1P3JA 2ZSAA 3BC1A 4A82A 4NH0A 4B3FX 1VKJA 1VECA 4Q21A 2ORWA 3AGQA 2ZIAA 2R6CA 4FIDA 2HF9A 3C7KA 4GL2A 2REBA 2B8TA 1Z06A 2ZPTX 1NKSA 4F38A 2P0EA 3IEVA 1ZNYA 4WA7A 1R2QA 3B8HA 3IBGA 4XWOA 4JLDA 3LBIA 2W0MA 3K0FA 1J70A 1XJCA 5LD2C 2QBYB 1RRGA 4HAYA 5GJCA 3NWJA 1G291 1ODFA 1OXUA 3FYHA 3L8ZA 3B60A 3I8SA 3WRYC 3ASZA 3AKYA 1VIYA 5EXTA 3B9PA 4Z8YA 2GKSA 1KMHA 3CRRA 3RRNA 4I1VA 1IN7A 1G7SA 2CNWD 3BFXA 1LVGA 4UNQA 1PLKA 1M8PA 1Q1ZA 2OCBA 1WA5A 5FBRB 1Q22A 2VP9A 2DWQA 1E9RA 4XOIA 3IKJA 4KXFB 4O3MA 3VHLB 2OILA 1KK0A 4LDJA 1DAMA 4X8LA 2IX3A 1KSHA 2JA1A 3MFYA
chains in the Genus database with same CATH superfamily
4L27A 4LC9A 1WJGA 3RI3A 3C5EA 3KJNA 1SZPA 4JS0A 4IYJA 1MP0A 1O1YA 2LDBA 2YV1A 3PQ2A 5A3SA 3R8XA 3UGJA 2AKEA 4DR4B 1JG1A 2WHRA 1LD3A 4PXAA 1DAIA 4KSBA 4N48A 4L4UA 3KETA 4KX5A 1Z8FA 1KYZA 1M6VB 1MVNA 2E1RA 2RGUA 3N39C 4K7JA 4RAOA 4EW3A 1DT3A 1S3FA 1BG6A 4KXUA 1F6BA 1X1AA 4LG1A 3U9SA 3EXG2 4OUDB 3QVWA 3BEDA 3D4OA 4HBZA 4IMJB 4MYRA 1KOGA 1QLWA 3EG9B 4D0GA 4NZYA 3I8XA 3KYIB 1NKTA 4NIMA 1GAEO 4E2XA 2OUKA 3UPUA 1ZOLA 4PO3X 4PC2A 2BGKA 5HRUA 3TK1A 1B00A 3BTSA 4QVIA 3IR7A 3O9ZA 2FFBA 3PFHA 1M67A 4R8RA 2D0IA 1S02A 2JIOA 2ZI5A 3LVQE 1H9CA 4GP9A 1SKYB 1TCVA 1BMTA 2I4OA 3A6GA 4LQ4A 5JECA 5KYTA 2LDXA 1F3OA 1GSOA 2VPXA 3ZCPA 5KWEA 3P0JA 3SQLA 3W79A 1E1CA 5ICGA 1I4TD 3N76A 4G0NA 2VJKA 1IXZA 4LQCA 4F92B 1VTKA 3G59A 3HYCA 5F7ZA 1T9GR 3WZMA 4YXFA 3MS7A 1XJ5A 3K71B 2FE4A 2ECFA 4MI1A 8AT1A 4FZJA 1BKDR 1HKUA 5BWNA 1PT8A 1G5QA 3ESYA 3HN7A 3OTWA 1DLIA 2GO7A 4RTSA 5AJUA 3VTAA 1L4BA 1W5FA 1BQ4A 2A9QA 2J9GA 3IUMA 3OUTA 4RXMA 4B71A 2XNKA 4IUBS 3NWEA 1IM8A 3IQWA 1PFWA 4HLDA 4ZU6X 1QYDA 5A7FA 3LUHA 1H0SA 3L0PA 2EJTA 5G0TA 1KDTA 3SHOA 4AWBA 1T9BA 3FZQA 4B17A 1GSIA 4L73A 3K2QA 4ZXFA 4C0XA 5JS2A 3P26A 3PC2A 4PG7A 3DD1A 4MZDA 4X7BA 4EJSA 1O8BA 4Q4JB 2RD2A 4CTMA 5KQPA 1AO3A 1P0CA 4IDBA 2CZQA 4FR2A 3WHLA 2CC2A 1TGYA 1XHEA 4KQIA 3T99A 1Z6ZA 3DC7A 4OMFG 2ES4A 1S1CA 2VNAA 3G2KA 4YCJA 1M2FA 2LTAA 2XGOA 1CERA 3VV2A 2H6EA 3BXOA 4P5PA 2C54A 4EI2A 2OCPA 3HR4A 4TV9A 1G9SA 2QYHA 1KVQA 2XLCA 3FPJA 2J08A 5BVGB 1JWBB 2GXQA 1A82A 1NXXA 3UWOA 4DREA 2RDMA 4GS5A 4FSDA 3WKAA 1WTAA 4NJOA 4HUQB 1EFPB 3OF5A 1Z6AA 1MA3A 1CF4A 1JDVA 5D3QA 4RFSA 1C7ZA 4AUEA 4BFVA 3TLBA 5KREA 1U3CA 2O8EA 5HNKA 1KZYC 1XX6A 1KAGA 1NL3A 2OKGA 3MELA 3L79A 4CG3A 1C4KA 3Q8WA 2Z83A 3F73A 3KR2A 1SCUA 4YR9A 1EAMA 3G2JA 4LI3X 4P38A 4D6XA 2Y1KA 1GG9A 3U9LA 2YUTA 5FPYA 4MQ4A 4MGYR 3U4AA 1FDIA 3JQGB 1CIPA 3KOXA 4JP2A 4HMOA 4K9OA 1OIVA 1ZONA 2PUJA 3NU1A 4NX2A 4KXXA 3W2TA 3ZD6A 1ULAA 1V7PC 3ELWA 4FZVA 1X1CA 4KNVA 5B53A 1QH1B 3GLUA 13PKA 4XUEA 1G20A 4G4SO 4YRAA 3EXEB 4WDRA 1HDOA 1XAHA 2J9ZB 2HSGA 1U1GA 1XWFA 2PV7A 3GOQA 3UJ8A 1RLIA 4ZFNA 4NU5A 1ADFA 4NS1A 5JASA 1P9LA 2WK1A 2NNLD 3WBFA 1C8VB 1W5SA 2QV7A 3IGFA 1Q0PA 2WLSA 2VJPA 4H6VA 1C30B 1I6KA 1VJGA 1RWWA 3HHEA 2CDAA 1U99A 2WOOA 4F6RB 2OCYC 3KU4A 1E1LA 3NOXA 3AF0A 1I9CA 4GX1A 2LCQA 3WLKX 3SIWA 1Z0KA 2G1AA 2PL3A 4HAUA 4XVRA 4O63O 3WSVA 5KJFA 2VSOA 4C01A 2Y0CA 3ITNA 4OQFA 1SXJE 1B3RA 3LLVA 1Y1LA 4QGGA 1OCEA 1IHYA 4TVOA 2BZGA 3A36A 1MX3A 4YCBA 5P8WA 4BZPA 4MV7A 4EH1A 2DCUA 5ICFA 2UZ0A 3NBUA 3KEFA 4LV5B 3OETA 2NO9A 3WSTA 4IDNA 3LWNA 4DF3A 2UUOA 1PYOA 2J9YB 2Y3IA 4Z9BA 4Z3KA 4QXOA 4E7OA 4G0PA 1EX6A 4F9EA 2CNKA 2IEDA 3PC8A 2XHEA 3MVEA 2BHNA 4OXYA 1ZKDA 2V6JA 4TN1A 2F43A 5JZVA 1O58A 4YDQA 2MCFA 2RGYA 2FHSA 3LG2A 2Q3BA 1BOFA 4LJ8A 3ZKWB 1YR9A 2ISSD 5JO0A 3EZYA 1UBOS 2Q8NA 3QM1A 4MDFA 5PGMA 5KEIA 1VMEA 4KFCA 5H59A 3TNDA 2J3QA 4C22A 2OUIA 4M7RA 4O0MA 3RSHA 5D3MB 3U3MA 1Q12A 1WMAA 2AJDA 2HPHA 4JUAA 4XVHA 3H5WA 4ZI2A 4W99A 3P2IA 4Y0AA 3JAKB 4RIGA 3LQQA 5ALSA 1DV2A 4CL0A 4CT5A 5AW1A 4O1HA 1C0IA 1NXWA 1P9OA 1KZ7B 1L4HA 2AWNA 4YRQA 2BYTA 3IP8A 3DWGA 3GVHA 2NUPA 4HEA1 3RUFA 4D79A 4KACA 3GAAA 1QFYA 4PC6A 5CLQA 4Z8XA 4QGBA 3PQ4A 2NP7A 1SBNE 7REQA 4MWEA 1BHO1 5JJIA 4PBRA 4R01A 4H7FA 3U48A 2JJ8A 2QVGA 2CL0X 2GASA 2Q99A 3TQHA 3ZWYA 3V1NA 4B3RB 3OQPA 1CZKA 5AM0A 3UJ7A 2Q07A 4I1SA 4PR3A 3BE5A 3O3MB 4TTRA 2Z3ZA 4BCCA 2DUMA 3TNYA 2C4VA 9MHTA 3FSGD 2GSDA 5TS3A 2CFIA 4DDWA 1OROA 4E94A 3L7AA 5CMLA 4V1CI 4MUIA 1ZMTA 1BIFA 3BH0A 2UYQA 2FR0A 1XG5A 4LC1A 1TVKB 3NG1A 2HDNB 1GUAA 1Z22A 2VYFA 4YRFA 1ULZA 4LCJA 1SOUA 1P33A 1DEAA 1YE3A 3ROQA 5K6RA 1VRCA 1W0JA 2NZXA 3AU9A 2VJYA 3OEEA 4BAGA 4ARIA 1NULA 2WKRA 1XEFA 4K0RA 4KMMA 3UOGA 1O94D 4YASA 3LP8A 4WINA 4BX2A 1PR9A 2V98A 1JE0A 4BQSA 5FD8A 2FI1A 4FZRA 4P3KA 3DLPX 2V8OA 1U81A 3A04A 1Z5PA 3D31A 4IFTA 5EXEA 4L3VA 3T54A 1OAOC 2D00A 3MJCA 1JDTA 4BVHA 3JR7A 3N6VA 4MIYA 4PSUA 4PZYA 5IKOA 4BKRA 4J75A 4JYAB 1DELA 2W6JD 2WOJA 5TC4A 2A5GA 4F2GA 2FP4B 1X86B 3IKMB 2WFZA 3HVUA 1GPH1 4JZYA 4BTEA 4FGLA 4CQNA 5ALDA 3DGEC 4WK0B 3HB7A 1A88A 2HXGA 3PB3A 4HXFB 1RHUA 1W2GA 1U3FA 3CHYA 3N2LA 4Z4IA 4ZCPA 3KYCA 4IAOA 4JJ4A 4QBIA 3IDFA 1TK2A 5BSWA 5ED0A 4CF5A 3MTAA 2OHGA 1PQ4A 1N78A 1F0KA 3JVEA 1G64A 2QR5A 3CTMA 4YACA 3VDNB 1XD2B 1HFKA 1YFKA 2R6AA 2XYRA 5E6UB 4B6GA 1YTUA 4RXUA 2YS7A 2FFRA 4H7KA 4HB2A 2FSHA 1JKJB 4UXHA 2HT1A 2NNWB 3JQ8A 2CBGA 3B5JA 3VJRA 3D7LA 5F1OA 2I71A 2KSQA 1RM3A 5CA0F 5JD6A 2QTMA 1OU4A 1ZIXA 2FV8A 2ZQYA 2AI2A 4FFRA 4L3WA 5FLKA 3ZYZA 1KKLA 3AETA 2JLBA 4GI3A 4NJEA 3ILHA 3KSBC 2GK6A 1PSWA 3PNQA 2J3HA 1QRAA 1XXHE 1RE0A 1IUKA 1XTSA 5KSPA 1VHTA 1MJGA 1RIFA 1UPBA 3EMBA 2JIDA 5A7HA 5T4FA 3RC7A 1POXA 3GLIE 2CLMB 1QANA 3KEOA 1U8YA 3L0SA 4KV7A 3FYUB 1DX9A 4TLEA 4HWKA 3OQBA 5IBPA 4E5YA 1TJPB 2GK4A 2JLWA 1P77A 2C0PA 1L1RA 1TT7A 3JYHA 4UBNA 2PUEA 5EWLB 3COSA 2YASA 5IH7A 1WCIB 1A2QA 1I32A 3BA6A 3BIFA 2HX1A 3A06A 3KDSE 3OMWA 4OHUA 5CRIA 3WIVA 4A0RA 4Y6SA 4UNRA 2FMTA 1MEOA 1Q0UA 1PAUA 1PFGA 1T36A 4EWLA 5J58A 3H5NA 1RHQA 2QL5A 1ZD5A 4P35A 3UT6A 2JBHA 4ZYYA 3SVTA 1JLLB 2REOA 3B12A 1X7XB 1RMTA 1W52X 3PDWA 4TZTA 3IQGX 3PC6A 3S5JA 4KP7A 3S29A 4CI0B 1YRWA 1ZICA 1VI2A 3A28A 1DTEA 4MIEA 5CLHA 1KSGA 3UC9A 1NJ1A 1MOZA 1TI7A 4PCUA 4ID9A 1WCXA 3C1UA 3RE1A 4EKDA 3QW4B 3HLKA 1NBME 1GZ7A 2B98A 4G5HA 4IJ5A 4MROA 4UOQA 2FSUA 3TZCA 4AJIA 1IWPB 4BEVA 2HR1A 4G07A 4DRXB 1RAIA 1DQYA 1PR3A 1X7WA 4EPVA 4U8HA 3SEQA 3CXUA 3M4YA 2HJRA 3QKRB 5EN4A 3JD2A 1L5QA 1I0ZA 3T0IA 1G9XA 3CVVA 2UZ3A 4HH3C 2CUZA 2NZYA 3C0KA 4QU8A 3KOYA 3WZLA 3UFXA 4Z7QB 3AJ8A 2P4UA 4MVWA 1CV2A 2YJ5A 3B1YA 5I9IA 4HRYA 2NV6A 3ROKA 4H1WA 1Z63A 5TQJA 3GI1A 3HU3A 5E4YA 4ZYZA 4GKAA 3T9DA 1B7GO 1HG1A 5BSVA 3GVCA 2XNDD 2Q3LA 1U8FO 3W05A 3C2QA 1W1WA 5IDVA 5C1IA 2WM3A 3PL5A 4KVAA 5JYDA 3BB1A 1RLMA 1E92A 2X5NA 1CDZA 2MU1A 2RI0A 1H4TA 2RJOA 3QELA 3HA7A 4M87A 1L5SA 4P32A 1YQWA 4HO1X 4MK4A 1DWUA 5CDFA 4YT2A 3PSHA 2QMQA 4OGFA 3W2FA 3BREA 1KFJB 4E5UA 2ZUEA 4TS9A 3ABQB 4MV8A 2DPMA 5KJCA 4DV7B 4JROA 4HMPA 2GVZC 3UAGA 2BFCB 2XF8A 4DN6A 3KD2A 1HT0A 1HORA 1WY5A 4GU5A 2QP9X 4QU0A 1G2PA 3DAHA 4Q4CA 2P69A 3QFHA 2FX5A 3I12A 2HBRA 2JFWA 4PC3A 3AEUB 4DR6B 2VQ3A 3K53A 5CLJA 5HKKA 3E9YA 4TV8F 3W5DA 1K97A 3EGDB 2EBWA 1LW6E 2RARA 3DOFA 4FLMA 5GIPE 1TIBA 2Q1SA 2PYIA 1CCWA 5BV8A 3ZV6A 1P6XA 5HIIA 4WBSA 2H2WA 5IFLA 3DTNA 2VDNB 4XGQA 3T35A 3V7WA 3U61B 3A1WA 1SFRA 4MW7A 2C0QA 1GSHA 1WY7A 4HNAA 2GKGA 2WABA 1Q74A 3HB9A 4K5QA 5TQ2B 4IUYA 2GJKA 2HK9A 2JKYA 2PPLA 4PO1A 2PQ0A 2BFDA 2WSSA 1UDRA 1VGRA 2MYPA 4HQRA 5DXAA 4AP5A 3GBVA 4Q7QA 1HYBA 2Q9UA 4N5DA 1VE9A 3IE0A 4U2CA 3ISVA 5TGTA 3OQOA 3HJTA 3BH6A 4ARZA 4QYSA 3PGLA 3U7RA 1NW3A 1ADJA 1DBWA 1R8SA 4Q3DA 4BJ5A 3PYLA 1DPFA 1Z5UA 2HIHA 3F1LA 4GQBA 3QWHA 5KVAA 4IFBA 1G9TA 3UPDA 3NV9A 4UC0A 3UICA 3DNMA 1G3RA 1G17A 2VT7A 3EF1A 5AVTA 2MIIA 3A6FA 5LBIA 3LGSA 1SRRA 3H0KA 3OIFA 3D5QA 5CIYA 5F2EA 4AJJA 4KG7A 4MAMA 5LQRA 5CB6A 4YS6A 3ZLBA 2VNHA 2BJVA 1P7ZA 2FWBA 2W2LD 4A91A 4EYSA 5MGNA 5C5IA 4Q39A 5KQSA 2O6LA 1CR6A 3R0VA 2PBZA 3PGXA 3F4LA 4L74A 3SFVA 2FGKA 4JENA 5GTDA 3LLMA 5ES3A 3OLZA 4CUKA 2I1VB 2FY8A 2YY7A 4EHBA 1KRWA 1X1BA 3R76A 3TH5A 4F4FA 1P60A 4E5VA 3UAOA 5LMCA 3FTQA 4I66A 1OC4A 2DBRA 4IP0A 5EZ6B 3USCS 4DV3B 1QYXA 3EHEA 1X19A 3ADPA 1MVLA 2W6ID 4PWYA 3VH2A 4YUAA 1UCFA 1X3SA 1YRLA 2ZB3A 3AR6A 4LJYA 4NG4A 5A5FA 2O0KA 2TMKA 5HX7A 2TMGA 3PEVA 2VYNA 3CLRD 2FLKA 4AJ1A 2C4TA 3T9FA 1VCIA 1L3BA 3SYNA 1FUKA 1USUA 5A5DA 3IAEA 4X71A 2J0QA 1J9GA 1KP9A 2YQ5A 3AUXA 3DEIA 3Q7SA 4TTPA 1ZH4A 3DF7A 4GPEA 3I1JA 3IBCA 1I36A 5K4GA 3DMYA 3L07A 3JQAD 3NBKA 1T24A 2H2DA 4Q9HA 1N6OA 4IR7A 4M1SA 4PLHA 4DSOA 5TSDA 2WMYA 8ATCA 3A27A 2HXSA 4HNQA 1IHXA 1NP7A 3OJWA 2W6QA 4YQEA 3W8EA 4B3DA 1O95A 3JPYA 3AB3A 3PJRA 1ARZA 3C4VA 4R7TA 1AKWA 1JALA 1KO5A 1NRXA 1ZI9A 2H31A 2H2GA 1SK9A 2UZAA 4B3MB 3MB5A 2OE2A 4ROTA 4Y0NA 3GEIA 3VSAA 3SSMA 3SC2A 3S7TA 4DFDA 2ZXUA 1WMDA 4QEKA 1NATA 4BDTA 5JV5A 1P0MA 3R6LA 3B6EA 3KJZA 3NONA 4ZVLA 3HXKA 1F06A 2NLOA 2JLSA 2XOXA 1FQWA 3F74A 3HCEA 3H75A 3I04M 4A5OA 4BNWA 5A04A 3RCBA 1H4QA 2HV8A 2I8AA 3SQWA 2UXBB 1FJXA 3N5CA 4JB0A 1AKQA 3Q8XB 4XJXA 1WVGA 3MLBA 3FOFC 4JGIA 1TUBB 1ZISA 1DBRA 3E82A 2OHIA 3B1WA 3QXJA 4PTZA 3UAZA 3X1WA 2AFVA 5BNTA 4V0KA 4XVCA 5AVZA 4BO2A 2CCJA 1QGYA 5TJHA 4N9WA 2D1QA 1UC4B 3HO6A 4JYPA 1Q1BA 2J3IA 4KBFA 4NFHA 4KAFA 1EDOA 1MBZA 3ZTWA 3U62A 1IBKB 1E0DA 3IP1A 3ITEA 4OD0A 1SKQA 4FR0A 3VR6A 4D80A 5EIAA 4GR4A 2QBYA 2ZETA 2OGTA 2Y1XA 1USIA 4S3MA 3QEOA 4P6VF 2GMWA 4OQQA 4BATA 5CCEA 1AGRA 5TQ0A 3DA8A 3BWDD 2FRXA 1ESCA 2OO5C 2GHTA 2VA9A 2A78A 3TRJA 2Q6VA 3Q2KA 3GLGE 4M21A 4IM7A 2CD7A 4Q1CA 2M32A 3DMRA 2PM8A 3DTVA 3FKSD 4I50F 4MVJH 5AI8A 5DEIA 4BO1A 1DJLA 1TZCA 4MCIA 4KI7A 1TYBE 4V3CA 3G2OA 4LWPA 5G3ZA 4JHXA 3JATA 4XRRA 1FVFA 2C77A 1URPA 1TQHA 4IDAA 5E3IA 3D3NA 4N8SA 3G1WA 3LJKA 1KJ8A 2GN9A 1NQXA 5JZMA 3RVMA 4TWRA 4BQRA 4JXZA 2IOYA 5EE1A 4U7PB 3O8NA 1C9KA 1I2MA 3USZA 1UPCA 3U4HA 1Z16A 3TYXA 3I34X 4P82A 2QD4A 2EFCB 5K01A 2P3OA 1YA8A 3IQDB 1TEVA 2VPTA 3AIOA 4MUYA 3HFJA 5TX7A 1U11A 4K88A 1K8RA 1M6VA 1E1QD 2JCSA 2V7WA 4N03A 2JGRA 2Z04A 4QXPA 1D9XA 1FE8A 3AF3A 4QOSA 2CMKA 4QFBA 2Y27A 4OUDA 4B9EA 2LZ0A 2FJUA 3B1JA 4KGZA 4LSZA 2X9VA 2YBEA 3EG9A 1AK9A 2X8AA 1D4FA 3TTXA 2IS4A 2XD9A 2YMMA 3K8YA 1NRIA 4TLMB 3D81A 5H5JA 4Y98A 1F12A 5COAA 5C8DA 5M04A 4BE9A 3T5AA 2P62A 2H4YA 4MJ3A 1IQUA 3ZIDA 4YQFA 3GUYA 1AS0A 1BEZA 2W2XA 3MC1A 3IBFA 5IT4A 5AK5A 3TD2A 2O5VA 4P3PA 3V55A 3I2IA 2C2BA 2DUUA 2X6QA 3TOXA 3F8TA 3L1JA 4JFAA 4NZPA 5IARA 4B4VA 2ZRCA 3NAQA 4LYDA 1JR3D 1BVRA 1UXGA 4BLSA 1V5FA 4BGUA 4HK4A 1UKBA 2EFJA 5C4IA 4N0EA 4DDMA 1LPSA 3UHPA 1S2IA 3K9FC 1XZGA 3UMBA 4KLCA 4P7BA 3ZS8A 3ON5A 3MK31 3I2FA 4U7JA 1Z2NX 4TRJA 2PJUA 1KIAA 1NPTO 3FDIA 2Y68A 5ESXA 1UJ2A 3GDGA 1UZUA 1L5FA 3KQHA 1VE5A 1HT2E 3U5TA 1NQUA 1R9NA 3QYAA 4YK7A 2CJWB 3N6XA 1PTJA 4LPKA 4ZGBA 1KTIA 2EBFX 1A8IA 1U0HC 3MMSA 2A0UA 4C6RA 4Q4JA 1GQ2A 2X2FA 2JGNA 5BMVF 5C8YF 3LC2O 1H5QA 3W9BA 1EFAA 3NDPA 3HRKA 1N8SA 2QYTA 1CS0A 4DCPA 3TS1A 1V96A 3B7PA 2IS2A 2CVZA 3UJHA 1WG8A 3DHNA 4H7HA 2VS1A 3P4XA 1PYDA 4G0WA 1Z13A 2BJWA 4RJTA 5BVGA 3GJ8A 1NFFA 3JQPA 2GDZA 3PJFA 4TL6A 2BGJA 1SQGA 2A92A 1XPJA 4TT8A 5BNZA 2B5OA 1FXSA 1U9IA 2WJZB 4HUQA 1ABEA 2I8LA 5J9FA 3K9LA 3LH5A 2OD2A 1EFPA 1CY6A 3R7BA 1MN6A 3PHIA 3VR2A 3DLIA 4PLPA 1WMBA 1QCCA 2CLCX 2PS0A 3G1UA 4D3XA 4XX0A 1JW9B 3IX7A 5AKJA 5AM5A 1GG2A 1IWOA 3M9LA 2IEIA 2ZYIA 1WBDA 4QDOA 3A6PC 2ZBGA 4GX5A 2RBEA 1N2ZA 2HNAA 2IPNA 3PTLA 4J3NA 3SZRA 5KOIA 3L18A 3VUFA 1I7QB 3JQGA 3SKVA 1HDYA 1A5BB 3L49A 3G88A 4IG9A 5B57C 5TMPA 3BL8A 4U7HA 1FXWA 1QVWA 2VP3A 3J7TA 3WK5A 2Z5GA 2PBRA 3ONWA 3VPAA 3JVVA 4A2WA 5IULC 1T0UA 4HUTA 2IYAA 2F9MA 1UJNA 2ODTX 4IS2A 4RLFA 5JQWA 3EXEA 2OCIA 3C7AA 4W1QA 1XPUA 4G09A 2YMPA 1TQ2A 1W8IA 1CBUA 5HE8A 2I4MA 5IVPA 1QPZA 1YULA 1YZTA 4JQYA 2WJIA 1X39A 1WIWA 1T34A 2FDRA 3G89A 4K9DA 1ODJA 1M0WA 4PYQA 4ZVNA 4BMXA 3FFAA 1FLAA 2FMHA 3OTGA 3OPMA 1C30A 2FX2A 2YX1A 4UHFA 4F6RA 3MTQA 3E7WA 1WDMA 3OP1A 4KE7A 3TUZC 3VO9A 1EXVA 4RK4A 5KX5B 1KETA 4ZV9A 2G07A 2IE8A 1Q0LA 2CNBA 4R2HA 1K5PA 1OH6A 1L4LA 1RM5A 2XQJA 4TUYB 2QQEA 3RVKA 4KL8S 1K5DA 3D4NA 1WRBA 3F4BA 3FCXA 3IBYA 3ZZ1A 2XVZA 1G8FA 4DLVA 4XCQA 2AG5A 3UUGA 3D6NB 5DM4A 4Z1MD 3QLVC 4DRYA 5HJEA 3KQVA 2NO6A 3MCWA 3IUBA 2VHUA 1RHJA 4CGZA 1LBIA 4G1UC 5AJZA 3FWYA 1EEXB 2WWGA 4FFNA 3NPMA 4QHYA 4Q1AA 1AF7A 4RK1A 5CM2Z 2BI8A 2F1KA 2AEMA 1GPUA 3V7NA 5KYUB 1IHDA 4Z51A 2C7QA 1PEKE 3NGXA 3CZAA 3FVQA 4WKGA 1QBKC 3QLEA 4O2AB 3JR3A 4ZVSA 5IKXA 1U2TA 5L7YA 2R4UA 3TG8A 1G5RA 2HMTA 4BGVA 3Q41A 2XUIA 4N5HX 3EJWA 4PAOA 3ISTA 5D3MA 1ECCA 1KAOA 5DLYA 5BW5A 4I3HA 1XTVA 1QJ4A 2QMYA 1N5IA 4LDQA 3JAKA 3ZHRA 4ND8B 4WK4B 2Q46A 3B78A 3D59A 3R6GA 5JSUA 5K6AA 4CI9A 5IX8A 1GSAA 2GN1A 1GPWB 4H59A 1RIIA 4OXQA 2R5FA 2BELA 4BAUA 1CJVC 1W1IA 2Q9AA 2WINI 4U2DA 3RVJA 5AVSA 5BYKA 3Q85A 1Q16A 3C4JA 4R3UC 4V03A 1FL9A 4N76A 1TIKA 1TYAE 1GUZA 2GESA 3OE7D 2YYAA 4C43A 1CC1S 1KMMA 4MARA 1I4DD 1TAHA 3IOMA 1N77A 2Y1LA 1KF0A 1Q6YA 1WKBA 2P6NA 2VPYA 2WSLA 3JRXA 4KQWA 3VHRA 5BWOA 5KC9A 3RT7A 1Q77A 1OTYA 1E7SA 4URWR 2NXNA 2ZYUX 5LMNB 2NZ2A 2KLBA 4KQFA 2FEWB 2EJWA 4ZOBA 4LA4A 1U0JA 4MW5A 4IF6A 1TVKA 3K6JA 4LWZA 3WLLA 2JHCA 2P2YA 4MXDA 4W9NA 2WYHA 5CPFA 1KDPA 3ZE8A 5B30A 2W2TA 2ZYRA 3QMMA 3MUEA 4EI8A 3QFSA 2AZ4A 2I7VA 1M6WA 4PBTA 3D7MA 2L82A 5HF5A 3T7AA 1KNXA 3P9ZA 4OM7A 5CYPA 5J4VA 4NK4A 3ICPA 4BLWA 3H9QA 4K8RB 4D99A 2FEAA 3D0RA 5CFZA 1P29A 3RYCB 1GLNA 3S1SA 1P4SA 3WLSA 1GLGA 2CVFA 2H0AA 5FUYA 1NVTA 3HKBB 2WG2A 3BBPA 4UBKA 3F6SA 1YZFA 2IV2X 1ZGHA 4MS3B 3UN1A 1FNCA 3PUVA 1ZW6A 5KNDD 4TSRA 2AD1A 3L7BA 4DNPA 1VLJA 1ZMBA 3RYFB 1W0KD 2FP4A 4RTMA 3CRQA 4UHHA 1Q3KA 1Z34A 2UUCB 1C9EA 4TYPA 2CZCA 4U9UA 1D6SA 2HADA 4EEZA 3H2BA 2Q5IA 2BRUC 3FPLA 1M2VB 3NHSA 5L3QB 4MGHA 1LCIA 4TSFA 2XYVA 1VL8A 3QWIA 4BVAA 2QS9A 5FV4A 2Y9MB 4GLOA 2ECOA 2ODPA 3VJKA 4EF6A 3G5AA 2H1RA 4LV6A 3B48A 3JWPA 1XD2A 1T2CA 4HWRA 1F48A 5E6UA 5ENVA 4RD2A 4ZOCA 3EGIA 2J30A 2QB5A 5K6TA 4LQLA 4YWJA 1QU3A 1JKJA 1U31A 5KNBA 4DA8A 4RTOA 2O8CA 1D6MA 1IB0A 3VFDA 5DTQA 4L76A 3FCSB 4J4BA 1FP7A 1MTOA 4K40A 2Q3EA 5EJ4A 2A88A 1G4UR 4GM1A 4GWLA 1R4MB 5JZSA 1C9YA 1XROA 2A94A 3MGCA 4PYNA 3TR0A 1IQ0A 3EIHA 1ZEJA 4JD5A 1EVEA 1NX6A 5I4KA 4GE0A 2O7VA 1MC8A 4RVNA 3UH1A 4DQKA 3FYUA 5LQKA 5DH9A 3D8SA 3IMCA 2QTFA 3EX7C 4A6DA 3M1IA 5BWBA 1NRJB 4XB1A 5CFRA 4EIWA 4PZEA 2K5UA 2ZCUA 4PO8A 5EWLA 2P5SA 4QUBA 1PKEA 3LX4A 3NHBA 4R9UC 1T8YA 3C7DB 1KEWA 3PDJA 2IRWA 4G0MA 1YR8A 4JA2A 4RZ2A 3S5UA 4D6YA 1FW8A 3FSRA 1QYRA 2V3VA 1NV9A 5DP2A 1UKAA 5ADWA 2ET6A 2QTRA 1EFVB 3SMVA 4TLCA 1JLLA 1H5NA 4OXNA 4R2JA 4ETIA 1X7XA 1Z25A 5IDWA 4D4JA 2F2TA 4YO8A 4OHVA 2YNMD 2FVYA 4WBNF 3PNYA 4RGVA 5JS6A 5FLYA 1I1QB 5AUPB 4V0LA 2Y1GA 4YHBA 1SH7A 5JEDA 1HE2A 4IZOA 4M0FA 2X1MA 3TXXA 1IMOA 4UCQA 2WA2A 4Q3OA 4DW8A 4KJZA 1M34E 1GQOA 3UJAA 4DRXA 4HV4A 2HW8A 4PZAA 4OHFA 5LOVF 3H19A 4KN9S 1WZIA 3F6YA 5T6MA 3QKRA 4EX7A 1NQWA 2VT3A 4NFSA 1E18A 1IZ7A 2V59A 3GHYA 3KPUA 3L7YA 4QPZA 5ANRB 3R9IA 4DEXA 4F1JA 3SX0A 4BUJA 2W0SA 1H2EA 2O06A 1MW9X 4LXTA 3V1YA 1ISPA 4V0OA 4OHYA 3DAFA 5E3HA 2O19A 1YQTA 1NVDA 2QTHA 2X4IA 1UJ6A 3AX6A 3O84A 3PLRA 1ZJ5A 1ZOPA 3E5RA 4PR0A 3OZCA 4DG5A 1EFRA 4PGAA 4GM0A 4I7EA 4L3OA 5LB4A 4DQVA 1YZUA 1UKCA 3ZNOA 3SJAA 2G83A 1ISSA 3Q9LA 4Y2JA 721PA 4EO7A 3UMGA 3AG6A 2NT4A 1N75A 3BGVA 3DBLA 1PD1A 3JQBA 3OO0A 4RHCA 1OB5A 1LJ8A 4HGNA 2QN6A 2WU0A 3H9UA 3O92A 3ZS9A 1E58A 1EP9A 3PGJA 1P7VA 1Q0TA 1C2TA 1VBFA 2PGOA 1LVHA 1RXVA 2B0CA 2A14A 3A6JA 3IR5A 4HS4A 4KMSA 4EY7A 1UWLA 3ZC3A 3W1EA 4CHGA 3W0LB 2PANA 4AULA 1PG0A 4Z1OA 2BFCA 1QP4A 3FETA 1BWSA 4IJUA 1S3GA 2QT1A 4Q82A 4LGYA 2IUSA 1N9KA 1VPTA 4L5IA 2R6GA 1H2FA 2ZJFA 3JAWB 3LGXA 3GJ3A 3QLJA 5ARCA 3V8RA 5FX2A 5JCPA 3AEUA 1RYFA 2WHYA 5FOWA 1B6TA 2IHZA 2QX7A 3ONNA 4TLDA 1XR3A 1EB9A 3HBFA 4Y18A 5AXBA 4AKHA 4IHJF 1R0CA 3CW8X 1DKRA 1CDEA 4QU9A 3PLAE 4D0SA 2VDUE 3MMZA 5D85A 3O03A 3IBSA 2COEA 1TAGA 3C74A 4KXVA 4KMRA 2C3MA 3NC0C 4XWGA 2EHJA 4PHCA 4EDFA 3LT2A 3DL2A 1MQAA 4PM4A 4PAWA 3A3OA 2WUDA 5IMBA 1V5IA 2AT1A 4WZAB 3FNGA 3MT8A 1E3SA 3O95A 3QNMA 3S6JA 3VDRA 3VO2A 3CKLA 5BSHA 5A0VA 1E2JA 3G2QA 4JOQA 2WUGA 1PR5A 1J8VA 4OXKA 1JEQB 4EQ6B 3VTFA 1OAKA 4NCBA 4Q9JA 1X3LA 2AEFA 2C4WA 1X13A 1B3BA 3H5RA 4KN5A 1POWA 1ZINA 1JLRA 1NUAA 1JECA 2OG2A 6NULA 5JXIA 4AO8A 3ZGVA 2ZS8A 4QDJA 1C3LA 1P2FA 4MH0R 1DRVA 4FUQA 4PX5A 4DUGA 2H8KA 1ONSA 2ONKA 2X0NA 2OFPA 5CU7A 1XMVA 3E70C 3TEFA 4EJ0A 2FSVC 4D5GA 5I7WA 2MSNA 5EINA 5A4AA 1L7XA 1GGJA 4ARAA 1BROA 5B3AA 1LWNA 4J90A 3A3NA 1P1JA 1ST2A 3DVAB 1V3UA 5BV1A 1OH7A 3U37A 4UCWA 3QI7A 2ZT6A 1TQ8A 3EFEA 5DLEA 1JPUA 5HR5A 2P35A 2OHFA 2XTMA 2C9ZA 4YJHB 1ZCZA 3QBEA 1EIWA 2OHHA 1L7EA 3VOTA 4CEHB 2DFDA 1K27A 5JT1A 5DSZA 3DV0B 1VHJA 3O8CA 5CG2A 1NLFA 2PZMA 5J2UF 1CUHA 2GPNA 3W1WA 2G0AA 2NUAB 4OHZA 2JD1A 4ALJA 1QFXA 4TTAA 4TMVA 3OC6A 4HX5A 2I6QA 4O4IF 3O21A 3RUAA 1M1YE 1JFFB 3OZVA 3BCUA 2DY0A 3NKFA 2NPOA 2P5TB 3GJTA 2JEOA 1V39A 3GYBA 3V9AA 3OIDA 1VMIA 3P5BA 5DHSA 3PUWA 4BKQA 1LKZA 2BKLA 2L18A 2VNIA 3LRTA 2EX4A 4W9RA 2P2CA 2FOXA 5IAKA 2B83A 3TNJA 1WSAA 1D2AA 1NIPA 3L9XA 3EIXA 4G0QA 1D2GA 1JAXA 4RCYA 4KDRA 4ALMA 2VK2A 4DJEC 4DYHA 5K8CA 3KAQA 1YZLA 3BRCA 4PYMA 4AMZA 4D26A 3BK1A 4FMCF 1RBYA 3ZYCA 2ZE6A 4FYMA 1BMQA 3QWAA 3KYBA 2YMLA 3ICEA 3OMXA 2QRHA 2GPBA 2IEZA 3F67A 1KDYA 1FLNA 1N2HA 1JYEA 2LKDA 3CR3C 3ESZA 3QUCA 4IHQA 4PYRA 5JQGF 1QDUA 4DA7A 4D9FA 2N3ZA 4D3FA 2GJ8A 2VYVA 3ML1A 2WHPB 3OKFA 3VZPA 1BFKA 1LPOA 2D2FA 5ILGA 1TZMA 3JW8A 2O2ZA 1IZZA 1Z12A 4ZK2A 1E2NA 4X7PA 3AFIA 1O97C 2XXAB 3ETEA 4Y2QA 4F6CA 3B85A 1U8TA 4RPKA 3OPQA 1QZXA 4X6UA 3TUIC 3U3RA 1O57A 1W2WB 1GCOA 2Q4DA 4PZCA 4NPAA 1UAGA 2R4TA 2FXIA 2XB2A 1XRLA 3A3PA 3E2IA 4GM4A 4I1IA 1A9QA 1N7HA 3VDQA 3KR9A 4ZMSA 3MWYW 3AO0B 1FUIA 4LDRA 4ND3A 3ZHBA 4MDYA 1KI1A 1EP3B 1EUCB 4F1WA 3QSYA 2IU4A 2F67A 2NTYC 3CU5A 1OA0A 1D1PA 2YUIA 3QMPA 2FMXA 2O7QA 4IZHA 4MV6A 4OIMA 2X22A 1ZL2A 4JBLA 4D3DA 5AW0A 4FT2A 4J2OA 4MJLA 4TQGA 2ESRA 5CG1A 2RFLA 1U4SA 2X5KO 3MOSA 5ADUS 2NVOA 4O33A 1J0BA 1CJUC 2QUKA 5IT5A 3HE3A 5KJ6A 3X1DA 2XDYA 1WW8A 2G7MC 1T9AA 4FFWA 4LC0A 4YAWA 1AQIA 1YL5A 4JUCA 1OLUB 3HUTA 5CH8A 4F71A 1IJEA 5ULLA 1WQ4A 1SHJA 3MMPA 1VJ5A 2JAPA 3ODPA 5K0FA 1KWKA 3LYAA 1HRKA 1JPJA 2D8AA 4KX3A 1VDMA 5DGDA 2IYUA 2DR0A 4RQAA 3W5UA 3WJ1A 4CKXA 9ABPA 3GP8A 2QBYB 521PA 3LX6A 4QPPA 1BSVA 3SEAA 4QJBA 2JHAA 5D6NA 3O8QB 4U7WA 2ZATA 2H57A 1DRWA 4EK9A 3KLNA 3T3PB 4F72A 3T38A 5CDTA 3E3MA 3SZUA 3ENNA 5L7TA 1RT9A 4L1KA 1NFRA 1AOXA 5IWCA 4ZJYA 1FSGA 2P9QA 3V1MA 5JSHA 1TXGA 5KYVA 4FW8A 4TL8A 1GZHB 4A8TA 1SVKA 2KX7A 1RRVA 1QV6A 2DHEA 1NQVA 3LPCA 1PGNA 4GWGA 4LHZA 5HSGA 5AKIA 4MRNA 1ZH8A 2GRAA 4UNSA 5FQNA 5EJ6A 4BTLA 4ZT6A 3V8QA 2XUKA 4DJ5X 1RFLA 3H1TA 1H69A 4J1SA 2P2DA 4MV3A 4YYEA 4BN4A 1V0JA 1K4KA 2RGNA 3GZTB 5AYVA 4DR3B 1FBNA 2PZGA 3RS7A 3DDZX 2XBLA 2XNCA 3FNIA 1GARA 1NMXA