3VX3A

Crystal structure of [nife] hydrogenase maturation protein hypb from thermococcus kodakarensis kod1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
235
Chain Sequence
IDPREIAINARLEGVKRIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPPTVHGIKFMTIAYYTTPLRGKEISDALIELLTITRWDELDYLVIDMPPGLGDQLLDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEEGHKVIGVVENMKLREKDVEKLAEEFGVPYLVGIPFYPDLDAKVGNVEELMKTEFAGKVRELAGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Adp binding protein
molecule keywords ATPase involved in chromosome partitioning, ParA/MinD family
publication title Identification and Structure of a Novel Archaeal HypB for [NiFe] Hydrogenase Maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 79
structure length 235
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vx3A01
5JS8A 1QG2A 3EW9A 2GF0A 3OAAD 3QKSB 4Q01A 5A5GA 1YZGA 2ZSDA 3OIUA 1G3QA 1FNMA 3DO6A 1ZNYA 1P3JA 3BC1A 4NCJA 3KKQA 2W2TA 2WVJA 5J40A 5JSZA 3U6BA 3CR7A 3NEYA 4K46A 2BCJQ 2GZHA 2AKAB 3THWB 2I1VB 1DARA 4OI2A 2IYWA 2IYVA 4L5BA 2CNWD 2YV5A 4PTLA 1X3SA 2D7DA 4HSEA 1KJZA 1TAGA 2N42A 3F3YA 2VP2A 3IQWA 3Q7QA 4Q4JB 3H86A 2A5FA 4RKFA 4US1R 4DDWA 2J59A 4G0NA 4GOXA 5LB2A 2JLZA 1OH5A 2QRNA 2BBOA 2E87A 4B3XA 1E0AA 3P4YA 3GJ5A 2CK3D 1FUKA 3T1QA 2EQBA 2VP5A 3BJIC 4IVRA 4TYPA 4TYYA 4I1UA 2J41A 4B48A 1KY3A 1Z28A 2KBEA 3ZVMA 3AVOA 3X1ZA 5FL3A 1DG1G 1T6NA 1LFDB 3P4XA 1LVGA 4LDJA 1XD9A 1CU1A 2OCYC 5D3MB 4H1UA 5DYIA 1E9DA 1M7BA 1QZXA 3O8DA 4AURA 3JVUA 4DLZA 2D06A 2ZJOA 2Q9CA 3E5HA 4KFTA 2BMJA 2ZR0A 5BQ5A 1KK0A 1VMAA 4TMTA 2R44A 2WHXA 4PC1A 2ZUBA 1IN7A 1KAOA 4HLUC 5EXTA 3ZYCA 3OEHD 1GWNA 3UANA 4QKQA 4NMMA 4Q9JA 4IHQA 2R6DA 5F2EA 4DUGD 5E4FA 1VECA 4NL4H 3IO3A 3K0FA 4P4TA 2IXFA 4HB4A 1EGAA 1DAKA 2A9KA 3WMFA 1E96A 3HU1A 3GLIA 4QBHA 4IVQA 5FI1B 1U2RA 3HPRA 4JVNA 4TL8A 4BZXA 1W2HA 2YZ2A 4HB0A 2C77A 2BEKA 1E4VA 3HJNA 1OE0A 2PJRA 4AYWA 4IOJA 2KBFA 1E2HA 4M2LA 2CLDX 2DYKA 1N5KA 3DKPA 4P4SA 4ITRC 1W48A 5E7IA 5H70A 4JLKA 3ZD6A 2OLJA 3CZQA 4AIIA 3NC0C 2NTYC 3VU9B 4QM6A 1UKVY 1SVIA 2BJWA 5BN3A 1XWIA 1G4UR 1FOEB 1UADA 1U94A 4FD2A 5L3SA 5LD2B 1OXSC 1NNEA 3GEHA 4RD2A 1DE0A 2ZEJA 4N3NA 2V3CC 1IY0A 1G3MA 4WVFA 5F98A 3A58B 2EFDB 4TN1A 3CIOA 3GCGA 1KI9A 4N0DA 1VHTA 2O8DB 1GZSA 1T0HB 2C8VA 2V8OA 3ZLJA 1W0KA 2ZI3A 2ZYTX 5KYKA 4HUTA 5BN4A 1GNPA 5AK0A 3MGCA 1S1MA 2RHMA 2OV2A 1OXTA 1TEVA 4GOJA 1HV8A 1A82A 1OV4A 1XXHA 4RD4A 2G9NA 4DKXA 4LYHA 4TMXA 5GVSA 3BH7A 5M04A 5JWHA 1NY6A 1ZP6A 2AR7A 2F9LA 3LA6A 4URZR 4CT4B 3NBZC 4M9ZA 5EZ5A 4NP6A 4AKGA 2R8RA 4ZKDA 1II8B 1J8MF 3QG5A 3FYHA 4DSOA 1G16A 5HZHA 1VDZA 1G6HA 3C41J 4UNNA 3CX7A 5SZIA 5DHAA 1L4YA 4HAUA 4B71A 5JWRA 2ZVPX 3VR6A 4JMPA 3BS4A 5CB6A 3AF1A 4D4LA 2XZLA 1CF4A 4D0GA 4ZPXA 4QNMA 3V9PA 3CRMA 2H18A 1PUIA 5BYKA 4FCTA 1NIPA 1NN5A 3WNCA 4D0LB 1NVUQ 1VTKA 2OHFA 2C95A 1MO6A 3GFOA 4CEJB 1OF1A 1JJ7A 5KHOC 3VAAA 1KO8A 2FN4A 4A8JC 4TQ9A 1BMFD 4O25A 3D31A 3ZJYA 1EFRD 4DWJA 4L15A 3T34A 1NRJB 2IYSA 4EQ6B 2FWRA 1GRQA 1NN1A 5A4JA 4A0HA 3MCAA 2GVZC 2ZRNA 1A7JA 1XEWX 2G77B 2ZITA 3KXKA 2QSYA 2RGGA 1KDRA 1IN4A 3BWDD 5FR2A 3BRWD 1Y63A 2KB0A 1WB9A 4M53A 2OFOA 2AFIE 1AQYA 2GXUA 1OH6A 5EZ6B 4KXFB 4HZUA 4GP7A 3UIEA 3CNLA 3GEIA 1II9A 3SYKA 5FPHA 1G8HA 3QF7A 1T3SA 3AVXA 3Q9LA 2J0UA 2FSHA 5JZVA 3QBTA 2ODNA 2CVFA 3LVQE 2EWWA 4D6PA 1RW4A 5JRZA 1FMLA 4PO8A 2EFHB 1EFTA 2VL7A 1DELA 3MWYW 5KSPA 4B3CA 1C4OA 3KUCA 5FR1A 4EFMA 1IXZA 3R20A 1G291 5JI2E 4DLRA 2ORVA 4KFUA 1X8KA 3Q72A 4G5GA 3M0EA 4RY2A 3QKSA 5FI0B 2GXSA 2ZAOA 2PL3A 2XEXA 4CYMA 2YC2C 4X8LA 4C0JA 1QBKC 1NLFA 4DEXA 1NN3A 2V55B 3LH5A 3FKQA 2J0QA 1SXJC 3THWA 1XMSA 3U3RA 1UDWA 4XVQA 1XRJA 3QF4B 3W3ZB 3QUSA 1F2TB 2ZRIA 2QT0A 2AL7A 4Q19A 2YINC 4NYMQ 4EIWA 2EW1A 4QHYA 3EIQA 3ECCA 3NIBA 1B0UA 1EWRA 2UKDA 3C15C 2ZIAA 1CIPA 1UM8A 4Q4JA 2NPFA 5H8WA 1KI2A 1OKKD 2FPLA 3SDZA 5TY0A 5FUXA 1G6OA 3B85A 4Q1EA 2FSIA 2MMGA 3RSOA 1P4SA 4ZDWA 2ZRHA 4GDFA 4CEIB 4JZKA 4OJQA 5KDOA 3T1TA 2BKUA 1KZGB 1GL9B 2C5LA 2H57A 1E1QA 1QRAA 3M1IA 4TLCA 4NU0A 1NLYA 1AGPA 1NKTA 3D6TB 1KSFX 3CX6A 2PLRA 5AJWA 5FUYA 4MDFA 2QM8A 4Q66C 4MGZR 3SEAA 4JBYA 5J4YA 4IOKA 4MRRA 2O52A 3LRPA 4RSGA 3IDQA 2J5XA 5F3WB 1FQKA 4MYCA 4ZCLA 3VX4A 1OSNA 4LZZA 3TJZA 5CJPA 1SVWA 1TQDA 3F8TA 1P2TA 2FV8A 3RC3A 2P6UA 3CH4B 1X8LA 4QXAA 3MWKA 2IX3A 1KGDA 3HR7A 1Z0DA 4QOSA 1LY1A 1WE2A 2C03A 4M22A 4MGIR 4P33A 5JCZA 2X2FA 3HR8A 4LBVA 4LHVA 2DY1A 1UKYA 1N6OA 2Z4SA 4CT5A 1WCV1 2CL0X 4QGAA 4TLEA 1U98A 1M1YE 2IYYA 3LQQA 2ZI9A 2J9RA 3WY9A 3KKMA 3KUDA 4NBSA 1IXSB 4AKEA 3ZH9B 4HB3A 1NBME 4A4DA 1XEXB 3B9QA 2IYLD 2DPXA 5A0FA 1LW7A 3VU9A 5IT5A 1D8TA 1ZU4A 1TF2A 2ATXA 1FFHA 1Q3HA 4M1TA 3SR0A 3AP2A 5B2ZA 2W58A 5DH9A 4AG5A 1A5TA 1XD2B 2F3TA 3LBNA 1S9DA 2CCKA 1GNRA 2NO9A 3OEEA 5GJCA 4EJSB 5FOXA 4BLSA 4YC7A 5FPKA 1ZM3A 2ZE8A 3EZ9A 4R9UC 2OESA 1J90A 3X1DA 3OZXA 2KE5A 4QM7A 4A2PA 4HAWA 4TYWA 3C16C 3CWZA 3U4QB 1N6HA 4NCKA 2OEPA 1JJVA 3KXLA 1P2UA 2WBLC 3GLHA 4YMWA 1F6BA 2XJ9A 4Z51A 1Z0KA 4Z54A 2FFAA 2V4ZA 1T3HA 1E79D 2OILA 4JVMA 4EPRA 1E9AA 5JI3E 5L3QB 4V0ME 4E07A 821PA 3AVUA 2P5SA 3NH6A 3U2QA 3L82B 2WICA 2QMOA 4PC6A 3KQLA 2REXB 1COWA 2J3EA 1II8A 1MH1A 2W6JD 3PUVA 3WNDA 1UKZA 1BO6A 3CR8A 1AZSC 4GI7A 1GKUB 1W47A 3MSXA 1XEWY 3GLFB 1QHXA 3P1JA 2FMXA 4LOAA 3KFVA 1ZNXA 2QG6A 4OQNA 5FTLA 4M4SA 3H4MA 4G3XA 4JLNA 4RD3A 1D5CA 4HLCA 1N5IA 4P3YA 3AVWA 1YQTA 2VSFA 1KTVA 3GFPA 1OPXA 1DAMA 5HE8A 3WRXC 3K70C 1OIVA 2PZGA 2WMOB 4C3ZA 5JJIA 5BW8A 1W5SA 2P3SA 1G8GA 4YXWA 2PT5A 3ZQJA 4CEJA 1OXUA 3UG7A 4I1SA 4PPNA 1XFAA 2DWPA 3I72A 4JJKA 1ELOA 3PITA 2V1XA 5JLJA 2AD1A 3QNUA 3REFA 4Q1CA 4CDGA 2QGNA 4EQ6A 1KOFA 3W9YA 2O0HA 5JBQA 3TKLA 4WZ6A 2IYZA 1XTRA 1VYVA 1GILA 2D74A 1UF9A 3AF0A 4GMXA 4LJ5A 4OQXA 3RABA 4C0BA 1LV7A 1Q22A 1DO2A 2BBTA 4BUJA 2ZRMA 1ZJ6A 2DWOA 2XZPA 3EASA 5DYGA 1Z0IA 1H8EA 3FHCB 4TLAA 3TIFA 1LTQA 4OYHA 3EPLA 4MKIA 2CCGA 2QUZA 4RZ2A 4M1YA 3CLVA 3KB2A 2AK3A 2G0TA 2A5GA 2ZTSA 521PA 4B3GA 4X8MA 2IS6A 2GCOB 1FTNA 4HDOB 1TF5A 3BERA 2ZRKA 3PUYA 4WZBE 2GAAA 4D4JA 5IF9A 5FTJA 2OLKA 2A5YB 3MUFA 3K0SA 3LFUA 2JJ1D 3GQBA 1XZQA 2B7CA 1D2NA 4JL5A 1BYIA 2YHSA 3OAAA 1S96A 3GJ6A 1GRNA 5F9FA 3D7MA 2OAQ1 3SQWA 5JJLA 3GJXC 3TAUA 4OHXA 5KNDA 1UEJA 4IKEA 5CK4A 3QKRB 1P60A 3NTUA 3TR5A 3NC1C 2JA1A 5AJZA 1E98A 1Q0UA 4RZ3A 2O8CB 2P5TB 3IIKA 3K09C 4LBZA 4NHOA 3UXMA 2IYXA 4ZKEA 1G5TA 1F2TA 3AGPA 3K53A 1SKQA 3KDSE 1BIFA 1Z07A 1X8JA 3FMOB 3I5XA 3AVVA 4O3MA 1UBGA 4OQLA 2WTUA 1RRGA 3TH5A 5KNBA 3LXRA 3RRZA 3I4LA 4KCGA 4I81A 5AUNB 3UWOA 2OUKA 3U3OA 2PEYA 1N6NA 2MSDB 1E4YA 4BWYA 1E2NA 4JSTA 2Q3HA 3WYAA 1TADA 4QGGA 2X2EA 3I32A 4OHZA 2XGJA 4Z8XA 4CEIA 2W0MA 2WAYA 4PPFA 1JPNA 3BD9A 1P9RA 4WW0A 1S9HA 3EC1A 1CP2A 1J7KA 2J87A 2X8AA 4OBEA 121PA 4R71A 2K5UA 3VX3A 1N3BA 2GKSA 4MYTA 3OEHA 4PAOA 4XTCS 2CLCX 3RS3A 1RJ9B 4MITA 4DUGA 3CPJB 3FOZA 1KY2A 5AJYA 2JLUA 3B5JA 3I8SA 4HB2A 1RC8A 3NBFA 4G5QA 4OHYA 4ILEA 5JRJA 1WRBA 2QTVB 3N2IA 5LBIA 4JIMA 4LJYA 1CTQA 2FPKA 4M1SA 1U9IA 1DVRA 2OG2A 2CE7A 4PC2A 5DI3B 3M6AA 3PUZA 4RKEA 3REGA 4GMDA 2GJ9A 2WIAA 4DC9A 2ZR9A 2AN9A 4B2IA 1HQCA 1E2LA 5HZKA 5HE9A 1W1WA 1E69A 1SQ5A 5LDDC 1ZYUA 2RGXA 3VKHA 1XTKA 3LBHA 1M7HA 1VCOA 4NTZA 1MRSA 1FTSA 3G82C 3C7KA 2ZSBA 5KSOA 2ZJAA 1XMIA 1AQUA 2Q3MA 4YMUA 2Z4RA 2ZRLA 4RFSB 5FPYA 4NYIQ 3N2EA 4P0TA 2GETA 4XVRA 3A4LA 2HYDA 2RGAA 4OI4A 4A15A 2VHTA 3UG6A 4PQFA 2VF8A 3JVVA 3QXHA 4LUCA 5DLQC 4YONB 1XD2A 4BFUA 1E9RA 1Q20A 3LV8A 2WWWA 4EJSA 1XX6A 2GBLC 5EE0A 1M7GA 2ZYUX 3LAWA 5EE1A 2QY9A 1YZTA 4G5SA 3U60B 5SZHB 5GJVC 1CXZA 4I1VA 5FBLB 1CS4C 1Y3AA 4BFWA 3FGNA 3T1VA 4YLGA 3V4FA 3U4QA 3OFND 3EIEA 4N1AA 2O8BB 1T5IA 1YRBA 2P6NA 3KJHA 4CIDA 5KSYA 3PIRA 2IXGA 3THOA 3MRSA 3TE6A 2BMEA 2IF0A 2ZUCA 4QL3A 1QVRA 2WJYA 1DG3A 3W6OA 2XOKD 5FUVA 2BMDA 3HP1A 3A37A 1C1YA 4F4CA 5TVKA 2WJIA 3GJ3A 3QVVA 5CIWA 2FA9A 3EZ2A 4ACAA 1D2MA 2QP3A 1KI6B 1PUJA 1IJFA 1H8ED 2EFCB 2AXPA 5G3ZA 3W34A 1E2EA 1U8AA 1XNJA 4HAVA 3GLFA 3RC8A 3SE0A 1P72A 2Z43A 3Q5EA 3UMFA 2RKOA 4QHSA 4PPQA 2I4IA 1XP8A 2ZJ5A 4G5RA 2GILA 5GVRA 3RVBA 3TW4A 4F4IA 1TU4A 4E09A 2ZI5A 3B1XA 5SZJA 3FFAA 1WBDA 1EG7A 4JLJA 1UBCA 2YC4C 2R62A 1BMFA 1IY2A 1M34E 3IHLA 1EFRA 4BFYA 1KO7A 1P62B 1X1SA 2ZSEA 1NSFA 1EX6A 3UPUA 4Q02A 3RS7A 3FKSD 1JR3D 4IRUB 3SS8A 1OXVA 4M9XA 1XXHE 2GNOA 1JXMA 4MKHA 1GNQA 1T0JB 2AWNA 2MSCB 4E5UA 2WWXA 3EPHA 3SHFA 4JKIA 4ACBA 4PO9A 3LD9A 2H17A 4JYBA 3BE4A 4IFEA 5AJXA 3SOPA 1E2DA 1XTIA 1JXOA 3EG5A 2GWHA 3QY0A 5KO2A 4B47A 3V4RA 4MRPA 4HLDA 1KNQA 4A36A 1E9EA 4GOKA 3VQTA 2YOGA 1N2CE 1IN5A 4OI1A 3B78A 3RDPA 3AKDA 1N0WA 2DBYA 4BEJA 1W36C 1TQ4A 2GCOA 1HE1C 1U90A 4Q4AB 3W8NA 4B34A 1ETUA 3WRYC 2E9SA 2PX3A 1X1RA 2JLVA 4LJ9A 1ZRHA 1PLJA 5KUTA 1G64A 2AWOA 2XSZA 3TQCA 2V7QD 5C2JB 3QKTA 4CEHB 3QOFA 2ZRJA 3OESA 3BFXA 1GL6A 3L8ZA 5FOSA 4Q7MB 3SJZA 5AWFC 2CVHA 2GCPA 1E0JA 3S1AB 1S0UA 2ZE5A 2RH5A 3LO5A 4XD7D 2ZRCA 4ZDJA 3PJRA 2G0NA 3OIVA 1NSTA 1SXJE 2JASA 2ZSAA 1KMQA 2YOFA 3CH5A 4UNRA 3PEWA 4XIGS 2H8KA 2YWFA 1ZCAA 2DFKB 3QXSA 2YWGA 1W0JD 1I4DD 1OW3B 1OKKA 2WJJA 3SYNA 2VPPA 1NVVR 1P61B 1E2IA 1YR9A 1W4AA 3A4MA 5L8VA 4DDTA 5CLQA 5G40A 3U7HB 1L8QA 3BB1A 3SJAA 3U7FB 2IYTA 1FZQA 1NF3A 4QGHA 3U44A 1KHTA 4TMKA 4LPKA 3X1WA 5CM8B 3WBKA 3ONWA 2P0EA 1UBFA 5JJKA 1KK1A 5DE3A 4Q47A 5IRCD 4EFNA 2X19A 3QPWA 2GVDC 1Q3TA 4KFRA 4PHTA 3KFXA 2XTZA 3LX8A 1CR0A 1DADA 3O8RA 1C9KA 2QEQA 5J4VA 2FFBA 2JJ2A 3HWSA 1G8PA 4ZDIA 4B43A 4ERNA 5K8TA 3X1XA 1QF9A 1TNDA 3CM0A 2HEIA 3IEUA 4HZIA 1GKIA 1UFQA 3P32A 5FBRB 2FEOA 1W4CA 3WP0A 3ZZ0A 1P73A 4KYUA 4Q1BA 4TYNA 1RJ9A 5LB4A 4ABYA 2PX0A 4TYQA 1YR6A 3VNVA 3PEUA 1V5WA 2PMKA 3QVUA 1WBBA 4RZUA 1ZCBA 1E2KA 2I1QA 3B1YA 4DLUA 4PC7A 1FP7A 1HT1E 1N25A 1SULA 1TEXA 1TUEA 2AXNA 3CONA 3CZPA 3K9HA 4WAUA 2IA5A 3KJEA 5KDLA 1EWQA 3HPQA 4GL2A 2PT7A 4AKIA 4MQBA 2ZI7A 5IK2D 1ZBDA 2FJUA 4DCVA 1E6CA 1QHSA 1P5ZB 1J99A 4PSVA 2BMFA 2B6HA 2TMKA 1CR4A 4Q00A 1XBTA 5FOWA 4OKSA 3J81k 1DAEA 3RAPR 1JI0A 5C18A 3B13B 2QPTA 3TSWA 1T3LA 3MD0A 2GJAA 4JS0A 4W5WA 3LLUA 4L9SA 4IXNA 2AD5A 1G8YA 2CJWB 4LYJA 5EJEA 4RFSA 4AKHA 4BFTA 1BYUA 2XNSA 1SVOA 3I62A 3AQ4A 2IL1A 4FWTA 3UATA 1BKDR 4GBMA 3ND8A 1KO1A 2ASEA 2UZIR 4DCSA 4CVNA 1E0SA 2EWVA 3MJHA 4M1OA 3GFTA 4WBSA 1NLZA 3OIWA 2FSFA 2VF7A 2O8FA 5DGXA 4W5JA 2O8BA 4U7DA 221PA 1WXQA 3C8UA 2VP0A 1E79A 3DM5A 1ZM2A 4B3BA 4M21A 4MGKR 1A2KC 4B6FA 1FX0B 2B21A 4PPGA 1Q21A 2BEJA 3CBQA 1XCMA 3DL0A 4M1WA 4RD1A 4BFSA 5BXQC 2ZRBA 1ZNZA 3PFIA 1UPTA 1FP6A 2W6JA 1EK0A 2ZR7A 2ZRPA 2QQEA 1WP9A 2JCSA 5EXSA 3NXSA 4Q9LA 3T5DA 2FZLA 2WWGA 4LJ8A 3RS5A 1KI6A 4ZI3A 2IC5A 4JBWA 3DZ8A 2D3WA 4Q7JB 3RLFA 1HUQA 2XJ4A 1RYFA 3NWJA 3SJCA 4BLQA 1R0YA 2IBMA 3GLGE 4A0RA 1Z6TA 3VFDA 1VG9B 2QT1A 2BHRA 4C7OB 4RD0A 4JYCA 3LY5A 3EZ6A 1QHHA 4KFSA 4QG7A 3TLXA 5TMPA 3R9XA 1GP2A 1IN6A 4UXJA 3SJBA 1WMSA 4A6XA 1RKBA 2IF2A 2RHDA 4BLPA 4H1VA 2PZEA 4OHWA 4R2IA 2GJKA 2WKQA 1OXXK 1QHYA 4U02A 4BECA 3GLHE 2GDJA 4DLSA 2NGRA 5KTYA 4E22A 2XSZD 4PHFA 3O47A 3SNHA 4QC2A 4LJ6A 2JLSA 3NVAA 2WWYA 2HT1A 4RCYA 3GD7A 2JLYA 4NPHA 5DN6D 3QXJA 4D81A 5FL7D 1E2FA 1HYQA 2PH1A 1MKYA 1ZC4A 1OH7A 1L7VC 4POAA 5JECA 2RGCA 2GK7A 2GA8A 5G53C 1SVKA 4M0LA 3EIHA 3KQHA 2W2VA 1XMVA 1YR7A 5JWOA 3I5YA 3LW7A 4Q4AA 2JJ1A 1J2JA 1GVNB 1VKJA 3T1OA 4E03A 4ZV4A 4HEJA 5L3RA 2JAQA 1DAGA 1OB2A 1QG4A 2NO6A 5J4LA 1GUAA 1O3YA 4GZMA 4EFLA 4LHZA 2WM9B 2QTHA 4CEHA 3TSOA 3D8BA 1TMKA 5FPTA 2F1HA 3AV0B 1SVMA 1F48A 4KAXA 4X8HA 2ODEA 3BGWA 2X77A 5J5CA 5D3MA 3S1AA 5GADl 4EPVA 2JJ2D 1BS1A 2EVWX 4FMCB 1TQ2A 2MSEB 5GJBA 4FWIB 3R7WB 1IONA 3SU8A 1NMXA 1SKYE 2IXEA 4LV8B 4BE7B 4FW9A 4JBXA 3GMTA 4Y0AA 1ODFA 1U0HC 2IK8A 2QAGB 1KI1A 4GRAA 1CJUC 2VEDA 3U7EB 1EESA 3N5CA 1JAHA 1JBKA 5J4KA 3W90A 3G5UA 2F7SA 2N46A 2QBYB 1OFUX 2HDNB 2CL6X 5KDDA 5L3VA 1MO3A 4C0KA 4DDUA 5KSZA 4DZZA 1VCIA 2IW3A 2F43B 4D26A 4N0EA 2JJ8A 4BFXA 5EE5B 2ERYA 1HH4A 4QHTA 4KODA 1KKMA 1M8PA 4TLDA 5KNCA 3NH9A 1KDTA 3K9LA 4IDHA 1Z6YA 3H1TA 3MWJA 2JLWA 2NO7A 1W4RA 4GZLA 3FVQA 4NYJQ 2XB2A 1ZIPA 3DEFA 3IKJA 4L9WA 5J47A 3QEJA 3KB1A 1ANKA 4IDOA 2IWHA 2OBNA 4LJAA 1BH2A 4XWOA 2GEDA 1K5GA 4HDQB 2VHUA 3FMFA 3WYFA 4C0SA 3PUXA 2C96A 4EDHA 1GDDA 5KU1A 2QGZA 3KTAB 3SYLA 3QBVA 1P9NA 2ZE6A 3BBPA 1UEIA 2O8DA 1HY3A 4XWAA 4PQYA 3TUJC 3A1TA 4KV9A 5HKKD 1CEEA 2WPDD 4DLTA 3TNFA 4ESVA 1EX7A 3TVTA 1Z6XA 1M74A 2GEVA 2OXCA 4OQFA 4Q7LA 2WWHA 5C4GB 4FMCF 2ODBA 2ATVA 2PCLA 4DSNA 4I4LA 3CKLA 1YZNA 2NO0A 4C4PA 1K8RA 2JGNA 2ERXA 4DHEA 1JEEA 2XTMA 4BLRA 5TB5A 4R98A 4C0HA 2F55A 3IEVA 4JJZA 3LW8A 4G01B 4H9GA 5E3HA 1R5BA 2CJWA 2WAXA 3A1UA 2VHQA 3BFVA 621PA 4M9QA 1NG9A 3Q3JB 4I99A 4G1UC 4PHHA 5LD2C 1N5JA 4UKDA 3DOFA 2YWHA 3PR1A 1WF3A 4QJ5A 4TQUS 1KMHB 4Q7KA 3OFNA 3AGQA 4CF7A 3UK6A 1YHNA 3ZZTA 3FHTA 2JDID 4B44A 3E70C 1R7RA 2UVQA 3RNLA 1Z08A 2XOKA 2ZYWX 3K0CA 1ESNA 1QHNA 2YVUA 2FG5A 5JHHB 2A5JA 4QJ4A 1FX0A 1AS2A 4JLPA 3EC2A 3BIFA 2F1JA 1QVAA 4AYXA 2ZJYA 4R7ZA 1Z3IX 2LKCA 4D82A 1HQYE 3TUZC 4DB2A 1XD8A 1Q57A 1A2BA 4Z1MD 4RCZA 1U8ZA 2ZI6A 4MKGA 1OHHD 1ZVQA 3IILA 4NCIA 4HYYA 3K1JA 5DNYB 3ZVNA 4ZO4A 4YMSA 2ZRAA 2EU8A 3QXXA 5FTNA 1HTWA 3R8CA 5EE3A 2OFWA 2ORWA 4KJZA 4B74A 4TLBA 4DEYA 1FNNA 1VHLA 3QI2A 4C7OA 3PXGA 2PJZA 3QXCA 2FFHA 2G88A 4F38A 2Q9AA 1E3MA 3FKSA 4OK6A 2HF9A 1JR3A 4LI0A 5FUWA 4DCNA 1PJRA 4DLXA 2VYFA 1AM4D 3A1WA 1E99A 1VG1A 1Z83A 4UQOA 3WHLA 4A0GA 4FXPA 2FF7A 2H5EA 2XXAB 2IYUA 3Q85A 4FCWA 1A1VA 3QPUA 2ZROA 3I1FA 1XJQA 1Z2CA 4JL8A 2D4HA 3ZVRA 3TQFA 4LV5B 2RGEA 2IEZA 2BCGY 2ZJ2A 4M1KA 1PZNA 1R5NA 1S1CA 4F93B 3IBGA 2HLDD 4B2PA 2XNDD 4C30A 4DXAA 5JMTA 3BB3A 3BOSA 3QF4A 4S35A 1XZPA 2IHBA 2W6IA 4QRHA 4CW7A 2R6GA 1N5LA 4UNQA 3U3JA 3U61B 1GAJA 3SBEA 4US2R 1T9HA 1GRRA 1XJCA 2CBZA 2PMDA 1OYWA 1D2EA 4WXRA 1VCNA 4KO8A 1ZD1A 1WA5A 3AVQA 3EARA 4AK9A 2WJVA 1RE0A 1YE8A 2C9YA 1Z0JA 4KU4A 2V7QA 4Y0VA 1DAIA 4P4UA 3E1SA 2DFNA 3CRRA 3C5CA 4HDCA 5BWMA 3E2IA 2ZS7A 5CM9C 5FFMA 4B3FX 1XEFA 4IJMA 4Q1FA 2EYUA 3X2SA 3ASYA 4XD7A 4JLOA 4C2TA 3O8BA 2DHRA 1G3IA 3K0FB 1CJMA 3TR0A 2QE7D 1MABB 1M6NA 3QKUA 4PFSA 4BFZA 2HV8A 3GPLA 2ONKA 2F3RA 3U3MA 1XPUA 3R7WA 1XB2A 1R8QA 1I2MA 5CDFA 4NZYA 1W0JA 2WV9A 2OBLA 2B7BA 1D9XA 1NVWQ 2QAGA 1G5RA 1RVDA 2W0SA 3R8FA 4LY6A 2HCJB 2QENA 2QBYA 3DM9B 2OSBA 1E32A 1JNYA 4ZI2A 4LX0A 4AY2A 5FOTA 4A0FA 2DFLA 5HCNA 2QP9X 1EXMA 2ZVQX 4DIEA 2JLXA 2GESA 3KKNA 3MMPA 4B3DA 2PBRA 2ZS8A 5DI9A 2F43A 2GJSA 1SHZA 2ZRDA 1IXRC 1BOFA 1NJGA 3B1ZA 4GFDA 2W2XA 3CRW1 3K8YA 3OF5A 4TMWA 3VKGA 4TTPA 1QHIA 1OFHA 2IS2A 1XF9A 4TT3A 4XOIA 2Z0MA 3AKCA 1HEIA 1XEXA 2NG1A 3W6NA 3K70D 3TK1A 3PQCA 3MJRA 2GTPA 4A8JB 1SVLA 4Q1AA 1N6RA 4TL7A 2ECKA 3PV0A 4PR0A 5ANRB 1US8B 1VYUA 1XXHB 2D2FA 5TV2A 4AC9A 1PV4A 3UWKA 3T61A 2Y8EA 1RYHA 1NL3A 5P21A 3RS2A 4D25A 3EPKA 3B60A 4MUBA 3KTAA 5C46F 3IO5A 4K8OA 2ONJA 3ADDA 5IK2A 3A36A 1QHGA 4EPXA 3P20A 5EE9A 3B8HA 3GLIE 1U9IC 1OT3A 1XMJA 2QAJA 2IUUA 1WQ1R 1S2MA 3LLMA 3ZDQA 2N1BA 2VQSA 2G1JA 1DOAA 1D6JA 1VIYA 3AEZA 1E2QA 4YMTA 2ZPTX 3AB3A 2RGNA 2YNMA 1AKYA 1NKSA 1XPOA 2BBSA 3CF6R 5C4MA 5L3QA 1UJ2A 1GKYA 3D3QA 2BBWA 4RJLA 3MG9A 2VIIA 2VH5R 2XAUA 1DO0A 2IYQA 3GP8A 1Z2AA 2BIFA 3W6PA 4Q03A 1YVDA 3L8YA 1R10A 2QU8A 3RANA 1IJEA 4BEBA 2YKGA 2O8EB 4JT4A 3BFKA 4KHZA 2BC9A 2FPMA 4D4MA 2ODWA 1OH8A 1IM2A 1Z63A 4MYUA 2WOJA 2ZQ5A 3VR5A 4EJSC 3THXB 2J0VA 1MV5A 1KMHA 5JS7A 4A82A 3ZIAD 3ZS9A 4D4KA 2WSMA 4PX9A 1SXJB 3BH6A 3IIMA 4PHGA 1EFCA 2OCBA 5JFGA 3NKVA 4IW3B 4DSUA 1DAHA 2HXYA 3H84A 3L0SA 3TMKA 3WXMA 4MYHA 3B1WA 3THYB 2ZXUA 2HJVA 3WP1B 2FGJA 3T5GA 3HDTA 4B75A 2J7PA 2RGBA 4B73A 2Z6VA 1L2TA 1R0WA 5E95A 3I73A 1ZNWA 4DRZA 4UNPA 4Q4LA 3I92A 2HJGA 3ZZUA 2J46A 3CX8A 1IOZA 3T12A 4FMDB 2WZQA 2VA8A 4EPWA 1W2GA 4AYTA 4RFVA 3KQUA 2FSGA 4LJ7A 1U8YA 3L2OB 1XU4A 2EFGA 4IXMA 1FQJA 3BK7A 2OM2A 3A8TA 1G41A 1UKEA 1E1RD 3AP3A 1JB1A 3LBIA 2W6ID 2HXSA 1ZM4A 1A4RA 5FOUA 4QBIA 1P2SA 2WJGA 1TTTA 2HF8A 4ON9A 1M2OB 3VHXA 3P27A 2WWFA 4FINA 1E9CA 1NBMD 1DS6A 3OIYA 1JEDA 1P2VA 4Q18A 4JLBA 2V6IA 4Q48A 1OB5A 2QMEA 2W83A 3SN6A 1OIXA 4LRWA 1TL7C 2D62A 4PAQA 2UZ3A 4C9BA 2XXAA 1R0XA 2LWIA 4HLUA 4IOMA 4RD6A 3L0OA 4NDZA 1G20E 1S3SA 4UNSA 5DN6A 2NPIA 1F2UB 4DJTA 3RRNA 5FBQB 1NP6A 3EWAA 5FL7A 3QKRA 2NZJA 4DBLC 1KKLA 3RWMB 1CR2A 4AD8A 1RFLA 5HR5A 3AH8A 5KPDA 3R9WA 3UKDA 1E2GA 3TGPA 1DAFA 2O8CA 1CRPA 2C04A 2ZUDA 1R4AA 2OE2A 4C0LA 2AHOA 2JEOA 2DR3A 2LKDA 1CLUA 1NMZA 2VSXA 3ADBA 1JR6A 3QJYA 3KKPA 4D80A 4ASUA 2GZAA 2ZREA 1DTSA 1G7RA 1F3OA 5DIFA 1UAAA 1TUIA 1R8SA 3T35A 2NZ8A 2C78A 1Z5ZA 4XJXA 1MO4A 5DSZA 3MFYA 5KPJA 2IUTA 1F60A 2YYZA 1Z0AA 1YKSA 4LPSA 1MOZA 3EAQA 1RRCA 4MDEA 3IHWA 2BKEA 4FMDF 3WHKA 1KJYA 1OIWA 3A1SA 3AVYA 2WWIA 4LHXA 3L0PA 2GZDA 2AK2A 4M9SA 2QPAA 2OT3B 4PC3A 1G3UA 2WMNB 1HE8B 1RIFA 1CR1A 1YZQA 3AF4A 3IQXA 3QEOA 2XZOA 1IHUA 1JQJC 1NVXQ 1TX4B 4TT3D 2KWIA 5AJVB 1MABA 1GM5A 1AK2A 5AUPB 2FU5C 4TMVA 3CF2A 2QMHA 1AIPA 1DPFA 2V54A 4RVCA 3CRQA 3QPVA 5CYPA 4MA4A 2RB4A 421PA 2BJVA 1NI3A 4PSKA 4A6PA 1SZPA 4JLMA 3DPUA 2NQ2C 2VHCA 2O0KA 2R6FA 5H68A 2QM7A 4BZQA 2GXQA 2VSOA 3B82A 3FWYA 4KVGA 1ESMA 1KK2A 1G5PA 2KJQA 4LJ4A 1U0JA 3FMIA 4LYFA 2ZANA 2GEUA 3AKEA 5EUMA 2WJHA 3QQ5A 3U7GA 3C5HA 5DI3A 4LBYA 4US0R 5IDVA 3HU2A 4FCVA 3GLGB 3AVTA 1P6XA 3QE0A 4EUNA 3QENA 3LXXA 2V9PA 4NYMR 1OJLA 3CNNA 1YRAA 3B1VA 4FMBB 1R6BX 4TSFD 1VPLA 3K70B 1R0ZA 2ZE7A 3VTKA 4HLQB 3LWNA 5EUQB 3H0KA 3VR1A 1H8HD 2ORIA 4W5HA 4WZAE 3JZAA 4ZIRB 2QNRA 4BRWA 1N6LA 2H16A 4A8JA 5EXPA 3RYTC 4L16A 3GLHB 2G83A 1US8A 3B2EA 3QIAA 2CE2X 3EZ7A 1D9ZA 1ZUIA 1YZKA 2CHQA 2Q21A 2H92A 2VO1A 4LSGA 4F7WA 5HKKA 2WPDA 3SBDA 2FFQA 4YDHB 2GHIA 2XB4A 2D2EA 2NOAA 4UJ5A 4YDSA 4URVR 4D0NA 5TXGA 2CEAA 2H1LA 1LNZA 1W4BA 2BWJA 2R9VA 2J1LA 2V6JA 5K8UA 4TZ6A 2JLQA 2ANCA 2B92A 4PXAA 4OK3A 1G7CA 3VMFA 2ZS9A 2RGDA 2J7PD 3AP1A 1HA3A 5D3QA 4C0QC 1W36D 2VLIA 1E2MA 2QORA 4BFVA 2V1UA 2A30A 2L0XA 1FPMA 4HUQB 1V43A 1ZMXA 4OHVA 1ZIOA 1N6KA 1Z29A 1NJFA 4JL6A 2WOOA 4P31A 1NMYA 2XTNA 4ZCIA 2O8EA 4G5OA 1XJ0A 1G21E 2VTKA 1Q44A 5SZKB 3U5ZB 5HCIA 1NVVQ 3THXA 2JATA 1RRPA 2A78A 2JDIA 4V03A 4TTQA 4NE2A 4NYJR 1GL7A 2GXAA 1GIAA 1SXJA 1SKYB 2ZETA 3EPJA 3W5IA 2AKYA 4LC1A 2XITA 1OLOA 1ZM7A 4DLWA 3WNBA 4TQAA 3AF2A 2BOVA 1T8TA 3FFBA 3EWSA 3FPAA 4DVGA 3THYA 3B9PA 4MUAA 2PEZA 2XX3A 2Q6TA 4MRVA 1EFUA 3UMRA 1T5LA 1IQPA 4Z1MA 2NIPA 3CO5A 3RRYA 4BPBA 3H2YA 1OHHA 5AR1A 4DSTA 1CULC 3OHMA 1VG8A 2F1IA 1F5NA 2P65A 4CRWB 3KJGA 2OO7A 2QQ0A 5E7JA 1Z6AA 2C98A 1NG1A 4Q9IA 2J0SA 1NY5A 1G1MA 3C14C 3HYRA 1G4AE 1U0LA 4M1MA 4A9AA 1KAGA 1SHKA 2REBA 1AKEA 2F6RA 5EQTA 5UKDA 4NKRA 2KSQA 3RRMA 5HTKA 4QFMA 5TARA 2G1KA 1PLKA 1G18A 1II0A 4HATA 4KBFA 2ZYVX 4IEIA 1I4TD 4L4UA 3PUWA 4ASUD 3IPYA 5HPYB 4JLAA 4LCBA 1GFIA 1W46A 2OCAA 5CK5A 3WYGA 1ZD9A 1NN0A 4XSHA 3TBKA 2DWQA 2RMKA 3A4NA 4JVLA 1MT0A 1R5OA 2OAP1 1E2JA 3AUYA 1S8FA 3WMGA 3EZFA 3HYTA 3IUYA 3G0HA 3B7GA 1FMJA 3DKVA 1AS0A 4GPTA 4BZPA 2C9OA 1X86B 1MR3F 8OHMA 4WIAA 4JLDA 4B35A 1F2UA 4NH0A 2HLDA 4PSAA 2XNDA 3T15A 1FW6A 1Z0FA 3JZMA 3VHLB 5BN5A 5EXXA 2X1VA 4UXIA 3CUEF 4K81B 4KLNA 1N6PA 2GF9A 4O0MA 3TSZA 4FI3C 5KOYA 1TQ6A 1P9WA 3SFVA 5JEEA 5E7MA 4XH9B 2AX4A 4M8NE 4IOLA 1OFIA 1K6MA 1KYIA 4URWR 2VP6A 3PCRB 3V00A 1P7CA 4BASA 4DLYA 1CJKC 2B8TA 4GSYA 1E9FA 3AVPA 1IAQA 1JR3E 1XTQA 3DHWC 3EA5A 1JAIA 3K0AB 1JQLB 2QN6A 4UJ3A 5CJ2A 5JEDA 1ZAKA 5JCPA 4CGZA 4URYR 3VR2A 5FPSA 3SHWA 1MRNA 1XCGB 2ZJZA 3PEVA 4GT1A 4QBGB 4TZ0A 2HCBA 4BLOA 5AUQA 2QE7A 3U6KA 2NO1A 1OYYA 3BAFA 3MWLA 3NBXX 1Z22A 4EPTA 5B57C 4OQMA 1Z47A 3CPHA 4IDNA 3TVDA 2LCFA 3CWQA 2B8WA 2GRJA 3W8RA 1Q1BA 2HT6A 1Z06A 1LS1A 2J7KA 4Z8YA 2QROA 2O0JA 4P32A 2IUSA 3CF0A 1W0KD 1Q12A 1S4QA 2GCNA 3ZQ6A 4Q21A 3T06B 2R6CA 3KL4A 3ZGXA 3F0TA 4MH0R 4NCNA 1LB1B 2WKRA 3PENA 3SI7A 4TL9A 1W44A 1G7SA 3NDBB 1N0UA 1I2DA 4LK2A 4XVUA 5C1BA 3AUXA 3BORA 1CJVC 1H65A 2QL6A 2YJTD 3VKWA 3KQNA 3DDCA 1E0KA 1AA9A 4J0QA 2YWEA 4B2LA 2ZU6A 4CZ2A 2GK6A 5JHGB 4R2HA 4F4JA 4YMVA 3GJ4A 2ZI4A 4ESHA 2R2AA 3AM1A 4IEEA 1YU9A 2RCNA 1PLLA 1XTSA 3GLGA 2P6RA 2PCJA 1UBEA 3X1YA 3FDIA 4EPYA 4AI6A 3MLEA 2R65A 2DFTA 3SZRA 3TW8B 3ZS8A 1Z8FA 3MAAC 3FE2A 1FUUA 2QRZA 4F92B 1W49A 4XWKA 5AUOB 4XTRA 1VYTA 2QMUA 2JIZA 4ZIRA 4C0AC 1LF0A 4Q4HB 4TL6A 4WXPA 4WA7A 3KX2A 4I1OA 2Z5FA 5K8IA 5CDFE 1YZLA 2BV3A 4BRUA 5DO9A 1FL9A 2BM1A 2FNAA 4ARZB 4W7SA 4IVPA 1G3RA 2OCPA 4PZLA 1AS3A 2PZFA 4DCTA 4DT1B 3EX7C 1N6IA 3GJ0A 1TF7A 1T91A 2G6BA 4OK5A 4F91B 3GEEA 3OE7A 3Q8XB 1S3GA 5IHPA 1AZTA 1VG0B 2I3BA 1NIJA 3PG5A 5ELXA 3AF3A 3ND9A 2OXRA 1MO5A 3IGFA 1SXJD 5CLLA 3RHFA 3BB4A 3I3SR 5LPNA 5EP1A 1T8UA 4PO1A 4KI0A 2A3RA 1KDPA 3LX5A 4V0KA 2QA5A 1EFHA 1W36B 1UDXA 2SHKA 2FH5B 2IEYA 4KSBA 1GITA 4MRSA 4X8OA 4AWXA 4PZYA 4DDVA 2YOHA 1QDEA 2ZRFA 4HUQA 1Q1EA 1KJWA 2VRWA 1GSIA 3U44B 2IS4A 2BM0A 5CYOA 1KSGA 2ZRGA 3RS4A 3KQKA 3FHOA 1G19A 2R6AA 1YR8A 3TUIC 3WBJA 3VR4A 3ZIAA 4A1FA 2FEMA 3L0IB 2FX3A 5JSZB 1J8YF 2WSSA 1E94E 5EP2A 2Z83A 5FOVA 4QJ3A 2EFEB 4LHWA 1GTVA 3CW2A 3AKYA 4BLTA 4NYIR 3DZDA 4C2UA 2DCUA 1KZ7B 3K09A 3SC3A 2KI5A 2GAOA 1KNXA 1GG2A 2PLFA 3ETLA 2ZJ8A 3IIJA 3DMNA 3K0CC 4TTRA 2QI9C 5B64A 3DOEA 4GNKA 2C99A 4URUR 1JALA 2AFHE 3P26A 4FN5A 4PANA 5H1YA 2ZU0C 4GP6A 3BH0A 2OBMA 3NDPA 4B6EA 2QP4A 4WOPA 2VHJA 1G7TA 4IDPA 1G9XA 4DLVA 1YZUA 3ADKA 3W3AA 3NBYC 5FBWB 5CB8A 3ZD7A 3FMPB 5G41A 2VP4A 2ZM5A 3C4JA 2CDNA 1E1RA 4BQSA 3CNOA 1ZM9A 3FTQA 3BXZA 2CL7X 3GLFE 2FE4A 2QZ4A 1PVOA 1T4GA 2QPOA 4QGFA 4TWZA 4Q9KA 4QBFA 3ZVLA 1NBMA 4B33A 3LDAA 2E1RA 1I4LD 3SFZA 1Q1QA 1J70A 4U00A 1E2PA 1X6VA 1E1QD 1YJ5A 1KI4A 4B76A 2CNWA 2HUPA 4ZCMA 4W9MC 3LNCA 3DMDA 1KI7A 1XPRA 4D2IA 2IS1A 3RSLA 4JSYA 4NONA 1B23P 2HYIC 1DBSA 5CITA 4Q1DA 4PZZA 1JPJA 4YQFA 2NMVA 4A2QA 3EXAA 1G17A 4U5XA 3F5FA 1E9BA 6Q21A 2CK3A 3QSYA 1U81A 3GJ7A 4JT2A 4HAYA 4LBWA 3IPXA 2Q9BA 5K8LA 5B30A 3GLIB 1AN0A 1KI8A 3IBYA 3M4YA 3CRVA 1RPZA 2DB3A 2IT1A 2ZAMA 2VBCA 1TU3A 3A1VA 4ZDKA 1W5TA 5F9HA 1ONBA 3PVSA 2IWRA 3Q5DA 2GJ8A 3O8CA 1IBRA 4KBGA 3FB4A 4V0MA 1AJEA 1KO4A 4P4SB 1WDTA 5B58C 3I61A 2VP9A 2CHVA 2QSZA 3NEJA 3NHAA 2G3YA 4BGDA 1U99A 3WMEA 1JECA 4DCUA 3A6PC 2A7QA 4IFBA 3U3KA 1LS6A 3K0AA 2BVNA 1Z6GA 4KITB 1KDOA 3N70A 4JKYA 3VNUA 5L3SB 3B6EA 3I8XA 1L4UA 4HAXA 2ANBA 3CPEA 2J45A 3RS0A 4JLVA 1KO5A 2OFXA 1ZU5A 2GBLA 1ZD8A 1KSHA 4O2LA 3TAHA 3OEED 5GJWC 1CKEA 4V0OA 4S2EA 3K9GA 2EYQA 2FDCA 4LYAA 2FOLA 1ZC3A 3ICQB 1RRFA 2Q0HA 2JIZD 3KKOA 2REOA 2D7CA 1XTJA 5EP4A 4II7A 4KLZA 3Q7PA 2QAGC 2A5DA 1CJTC 1E9SA 1VIAA 5DISB 1KIMA 4V0NA 4HAZA 4DIDA 2IYRA 3LQRA 4LGMA 1AGRA 2WIBA 4HI0E 4IDQA 3EA0A 4QNRA 4XSGA 5G3YA 5BYJA 4DB4A 2C2HA 3PEYA 1OFTA 1ZINA 2H7VA 3CB4A 4Q5IA 3R9IA 5FH9A 2CCJA 3OE7D 1COWD 4B32A 1ZW6A 5CIQA 4EKDA 2FGKA 4LC0A 4LWZA 4TSFA 4Q9HA 4O2RA 3ADCA 5EP3A 2W00A 3KXIA 1G8FA 2QTFA 4FIDA 4KVAA 3NG1A 4UXHA 1O87A 3VR3A 3LVRE 4MGYR 721PA 1H8HA 4RZXA 4LV6A 2BDTA 2O5VA 4A92A 1N0VC 4OL0A 2ZJBA 1VCMA 1XDBA 2C9CA 4URXR 4PQRA 5TDHA 2O8FB 4Q4HA 3KJIA 4YXWD 3TRFA 4OI0A 1P75A 1DEKA 5FTKA 3RWOA 4V0LA 2F9MA 1KSJA 2OZEA 4AG6A 4ARZA 1TPZA 3DVLA 3K0EA 3W5JA 4NCHA 2CHGA 3ICEA 3GJ8A 4KSCA 4DT1A 1SVSA 4EAQA 1ZUHA 1GOTA 1KK3A 2WSSD 3L43A 3KZ1E 2ZSFA 3UMSA 4A2WA 4LHYA 2F1RA 2CLSA 3K9NA 1KI3A 1K5DA 2MMCA 5DHFA 1HURA 4HZUB 1IY1A 2A2ZA 2FZ4A 1SGWA 4KYIB 5FBVB 2CMKA 1RZ3A 2RGNC 4V02A 3NHBA 2P67A 1R2QA 2J0UB 2Q3FA 4TMZA 5FTMA 4PAMA 3QG1A 4L8GA 4MKFA 4MRNA 1CBUA 1QHHB 3SQXA 2JLRA 1Q1ZA 1W7AA 2P2LA 1IN8A 1ZUNB 3ASZA 5J4HA 1CRQA 2CXXA 2RAPA 1XCPA 2WKPA 2IHYA 1LF5A 1HT2E 4JVSB 4OJKA 3HU3A
chains in the Genus database with same CATH superfamily
2NSLA 1GUYA 3IOBA 5AKKA 3TD9A 4FUTA 4AJPA 5ERGB 5BURA 5JS8A 3E9CA 3CLHA 4LJLA 1CY6A 2W6PA 2EEZA 3OIUA 3H7AA 3L7LA 2W2TA 2ZIFA 3N0XA 4NAUA 1JH9A 3DAFA 5I4IA 1JIXA 1EJ0A 1I7PA 4D0SA 3THWB 4H4CA 1R8YA 4PLTA 2X0EA 3FDJA 4YV7A 1WMDA 2OV8A 3JZIA 2IIBA 5BUSA 1J2EA 1CS0A 5AM2A 2YXEA 4L5BA 4BVJA 1ESCA 1SXGA 1MAUA 2NYVA 3P96A 2CNWD 4YBRA 1LDEA 1P7YA 1YASA 4OGLA 3ZGZA 2GFHA 2IYEA 2D7DA 4HSEA 4CIVA 3AIIA 1R66A 1T9KA 3GEMA 3P9QA 5FXMA 4E46A 2XMCA 1QGED 3JQDA 2VP2A 3O93A 1CUFA 2WZCA 4YJHA 1GPBA 2J59A 4G0NA 2FDXA 4GOXA 5SICE 1M6WA 3KAKA 4WASA 2M6LA 5IFKA 5ALTA 5IKOA 1U6IA 2MSWA 1IVYA 4UU8A 3RBZA 4B3XA 4MIKA 4X3CA 1GO2A 4L50A 4K6HA 5H7XA 1KS9A 3PXAA 1PR5A 3IAUA 2VP5A 3WL3A 4TYYA 5LMZA 2D00A 4BKOA 2P6MA 4RVUA 5EQJB 5GONB 3D7LA 3IT1A 3GN1A 1HL3A 1VMDA 1Z28A 1ZVMA 2EFYA 1M2VA 3E8SA 3AVOA 3WTBA 2BP7B 3EHEA 1T6NA 2MTBA 4LDJA 4MVJE 1XZDA 2HTFA 4PBSA 1EE2A 1NHWA 1QZXA 2BMAA 4Z7JA 3A7EA 3TRIA 2ZJOA 3K8OE 2QTWB 3V2HA 1FXUA 2BMJA 4PE5B 2Z8YA 3BF8A 1EKXA 1B3BA 1KK0A 4GWGA 1RHQA 2QS9A 2ZUBA 5F21A 5JCJA 3OX1A 5CTAA 2QR3A 3FYDA 5IAJA 1SD2A 4HWRA 1KAOA 1E1KA 2G70A 3F6SA 4MWBA 4J2OA 3UB4A 1GWNA 3HM2A 3ZYCA 5FAKA 1TD9A 2PRKA 3AUAA 1JFFB 3FNGA 4Q9JA 4ZCTA 1C7RA 2ACEA 2R6DA 4RIHA 5E4FA 3P97A 3CXRA 6REQB 1Y3BE 4G9GA 4LGYA 2PKXA 3D7NA 3NALA 4Q3OA 5FLXA 3NJ8A 1TECE 2XT6A 4MMXB 1V26A 4BMOB 4CQLB 1OY1A 5FI1B 4YR7A 4KNYA 2XIQA 3VKVA 4UBLA 3HN7A 4WKGA 2XXBA 4TL8A 1Q0TA 2VTVA 3GRKA 4FFBB 4BZXA 4OHBA 3FUCA 1CEYA 2BEKA 3CCCA 4BU0A 1TLFA 3V32A 4UMVA 4IOJA 1C8KA 1RMQA 2KBFA 2JI8A 4HNVA 1ZFNA 1I6KA 3ROMA 3PNMA 1I4WA 3K32A 1W48A 4KQGA 1NR7A 1YA8A 3DB2A 1I1QB 3R5HA 3I8OA 4JLKA 3ZD6A 4OLBA 1HYEA 1SD5A 3NC0C 1CZOA 3VU9B 3HJUA 4LSMA 1UKVY 3J7AC 2BJWA 2LW7A 2VATA 4BZZA 5BN3A 1GRVA 3HHEA 3IEXA 5FWXA 3JYNA 3CLUD 1A8QA 2Y1DA 1B6RA 4ZQHA 4PSUA 3QX9A 3LYLA 4YJGB 1CQIB 4ALLA 3U37A 1NNEA 1X38A 5ALWA 2V3CC 1W96A 3H6HA 5F98A 2YJ5A 2QU7A 2V74B 1KI9A 4MUHA 4N0DA 2FYTA 4A5SA 1W0KA 1CZLA 2ZWMA 3IULA 4FW8A 4MMZB 2FN8A 2ZYTX 2QR2A 3GAMA 4OJTA 5KYKA 4HDSB 3H75A 1CK4A 4FQ8A 1IZ7A 4J0GA 1K97A 2HY7A 5AK0A 2PSJA 2V65A 4MW7A 4CHTA 4AECA 1M1NB 1IYZA 5ITZB 1X3LA 2X8WA 4GOJA 4XGNA 4RD4A 3JAWB 4ENSA 1NUTA 5TC4A 4P0QB 1SAYA 3PXUA 4OIFA 5B7GA 2AR7A 1JKIA 3M3HA 3CEMA 1GGEA 1DKRA 1JG7A 1CUWA 1V16B 3H11A 2R8RA 4ZKDA 1LQ2A 3AR2A 1F7UA 3KUXA 1JEQB 1F8YA 1NI4B 1J8MF 3QG5A 4CR8A 1G16A 3C41J 4KVZA 1ZSVA 2I0FA 3CX7A 5E8RA 1HE2A 1D4FA 1SUWA 2V8BA 1MAAA 1IEQA 5T5QA 4A0SA 1GUBA 2Q5LA 5C7IO 4J7XA 4Y8VA 2ZVPX 3BDVA 3G0IA 4MR7A 3T3OA 1MHTA 2I6TA 3IB6A 4JMPA 2BGGA 4B6RA 1LI4A 3PIDA 1CF4A 3EXEB 3T1HB 5KNDH 4UHBA 3V9PA 1ZI8A 1XC7A 3IUQA 5B3LA 1FDVA 4CG0A 1E18A 1YUMA 1NIPA 3KPWA 1PHRA 3DF9A 2QTMA 3E5MA 5AVZA 1ULHA 1CY4A 3GFOA 2C9ZA 1G59A 2F9FA 4CEJB 3OJ0A 3V8PA 1SRRA 3ML1A 5F35A 3VPDA 1BMFD 1Z45A 3ZJYA 4G1BA 4FEEA 1HE4A 1DEOA 1MH9A 1Q1AA 2IYSA 1Y42X 2Z1NA 4PLWA 2OWDA 2XRFA 1CV2A 3GPIA 5A4JA 5LDGA 1JVBA 1FDSA 2VAMA 3L07A 1A7JA 2G77B 4QPCA 4BTEA 4I5DA 1OFUA 2QSYA 4YUAA 1XMXA 2GARA 2H4ZA 4FOPA 3U3DA 3BWDD 1XCJA 2VYVD 5EGSA 3FJ1A 4H0FA 4QOIA 9LDBA 5CPBA 1WB9A 3ZLBA 4BO2A 2E4ZA 4M53A 2JBAA 1AQYA 2CXRA 4IGIA 3T7KA 1D03A 3S0JA 3T1NA 4Z3OA 1OH6A 1RYMA 2YJNA 5EZ6B 5CMLA 3GWGA 2ZK7A 3TOSA 3ZD9A 2Q2QA 4G1EB 4B83A 1X7ZA 5CT8A 1BNCA 3ID6C 1E6WA 3SYKA 1YBFA 2CNLA 1MO2A 4WKPA 5SY9A 2QUJA 2C4UA 3Q9LA 5JCXA 3NGMA 4R41A 1EUDA 2FSHA 4BNXA 2RJOA 3QBTA 2CVFA 3S2IA 2EWWA 1H0SA 4FYYA 4NU6A 5JRZA 2IH4A 1K9VF 5KSPA 2O05A 4EFMA 1ZUNA 1WHTA 5FO1A 1QAQA 2C29D 1L6RA 3LUPA 3P7MA 3LBYA 2ORVA 1X8KA 3Q72A 4G5GA 1BOOA 1IEXA 3F7OA 3QKSA 2JANA 3RVJA 4CI0B 1U8UA 2GXSA 1ENOA 2PL3A 3FPKA 1UBRS 3PQ5A 4L0MA 3V8BA 2XMBA 1NN3A 1YJBA 3M2TA 3LH5A 2XMPA 1GGMA 1G5HA 1NTRA 1NUAA 2PWZA 2WFLB 2XWJI 5FULA 5EIBC 5KHLB 1XMSA 3UT6A 3AR3A 4XVQA 4NRDA 1S7GA 3W3ZB 1V45E 2I99A 2AL7A 3I05A 3MBIA 3PU6A 3LVBA 1JYSA 1U7PA 4FYXA 4NYMQ 3ECCA 3L8FA 4UHDA 5ALFA 1B0UA 4GI5A 1WDLA 4GXRA 2Q9UA 2ZIAA 1QB8A 1LPPA 3LQYA 4HDRB 3TL2A 1Y6FA 4BP9A 5H8WA 4ZHQA 3T7AA 1OKKD 1O94A 1Z7BA 4CLHA 5TY0A 4EFKA 1NF9A 4RIEA 3OT1B 1G6OA 3B85A 5DZSA 3WZLA 4OJMX 4CN8A 1OREA 2MMGA 3E82A 2H59A 4GQAA 4ZDWA 4TTVA 2SCUB 4YRTA 2X40A 4L4ZA 4JQSA 4BNUA 3H2IA 1P1IA 2FK8A 4CKWB 2QRLA 3DR5A 1XCOA 4MEBA 2Q1YA 5CU7A 2RD2A 1VI6A 1H2RS 1HMPA 3EGOA 1XTUA 3TI7A 3TOZA 3ZBTA 1KZGB 4CV0A 4NENB 4F5DA 1YS4A 2MDTA 2P2DA 4IDGA 1UANA 4DRYA 3RAEC 5F52A 4O3FA 4NU0A 4D9NA 4QT4A 1YDWA 3T94A 5DK6A 3GK3A 3H0EA 1R50A 3PWZA 4RVGA 5ADWA 3BWXA 2O5CA 3V8QA 5IC6A 3S2YA 1ADGA 3UBMA 2OG1A 4HDNA 3FROA 4QUBA 3SEAA 3GRPA 2CV0A 4LQLA 4MRRA 2XUQA 1A5AB 4JA2A 4IHJB 3LRPA 5K0SA 2DTXA 2R8EA 4YFVA 5DFAA 3PXXA 2PXHA 4DC1A 3QBEA 3UENA 1Q17A 3CUKA 5F3WB 4RADA 1OVMA 2CZCA 2GKOA 4LZZA 5LXTF 1TQDA 3UK2A 4RH1A 3I01A 3ND7A 2FV8A 1H2AS 1Y7LA 2P6UA 4ZREA 1X8LA 1TJ5A 1O8BA 1UXJA 4M83A 5AKIA 1LY1A 4DM7A 4LBVA 5JPDA 4LHVA 4F9EA 4ZVLA 4YQZA 4A6DA 2DY1A 1UKYA 2ZG6A 1U2EA 1XLUA 4BKPA 2Z4SA 2J6HA 3LBFA 4BNFA 4UCXA 4PZUA 4CT5A 1GTSA 1X80A 4CI9A 3KU4A 2CL0X 2XWQA 5C8VA 5ALDA 3U5TA 1XWFA 2VQ6A 4DIBA 1BJKA 3VBCA 1UC5B 1IXSB 1FRQA 3OZSA 2GBPA 3JAKB 4B3RB 4MMYB 1XEXB 4A4DA 6YASA 5DWDA 2NU8A 3GLUA 3FIJA 4JUDX 2DPXA 4G67A 5A0FA 4CJXA 1LW7A 3MGBA 5IXJA 4JY7A 1D8TA 4DV0B 3LQKA 1TF2A 4RVSA 2FFJA 2GZSA 2PU5A 5B2ZA 4JB3A 2BFDB 2GEBA 2QPLA 4TS1A 4DY4A 1E89A 5CP8A 2F3TA 4G24A 3LBNA 3EDYA 1S9DA 4UEOA 4YAWA 3TW6A 2NO9A 4BLSA 3SWWA 4KN6A 1Z36A 2JIRA 3BRQA 3E5NA 4YC7A 5GIPE 4FFSA 2ZE8A 3EZ9A 3AIMA 3WWEA 1YAJA 3ZW7A 4ZYUA 4KPGA 1EA5A 1TMGE 1T5TA 2QUBA 5T6BA 3D9QX 3C16C 4WLOA 1F0PA 2OEPA 3KXLA 4AM8A 2WSIA 2OV4A 1IFXA 2IVZA 5IDXA 1MV8A 4AUNA 2ODQA 4LF7B 4M1EA 5JNTA 3WQBA 4DTIA 2CV2A 3D6NB 4IAOA 1Z0KA 4U7HA 3VDRA 2JFZA 4DQXA 1HPLA 4ITVA 5A3RA 1E79D 2OILA 4GR9A 4JVMA 4CKZA 1JHQA 4GKKB 4LDRA 5AW4A 2W70A 4CTMA 3STTA 3TRDA 3LC2O 3L77A 3FPLA 1TOAA 1ZMTA 3N07A 3U4AA 4PZPA 3S28A 2VK2A 3L82B 2F3UA 2OR3A 4PC6A 3VBEA 5DCYA 1X9HA 2BRUA 3CEPB 3U1VA 4RU1A 4DBZA 3M5WA 4FGZA 4XRRA 4Y9SA 1X2EA 4JC8A 1GKUB 5AI6A 3VVMA 4ENQA 4KR6A 1XEWY 3O1JC 1W85A 4IINA 3V8NA 2FMXA 1WVMA 3KFVA 3OZTA 2DF8A 3TCKA 2QL9A 1A7KA 4RMIA 3EXHA 2NSJA 4JLNA 2C5FA 3BWEA 3FYCA 1NJSA 1DI0A 3SVZA 1THTA 1KTVA 3GFPA 1DAMA 4GZ5A 4ZOCA 2PZGA 4I4TF 4C3ZA 2WB4A 3AXTA 3L92A 2G28A 1W5SA 1JLLB 1GZ7A 5JG7A 2P3SA 3WB2A 5K01A 1UUFA 3WL7A 2VT6A 4EX6A 4ZTUB 3ZQJA 1OXUA 2FJPA 3MC1A 3UG7A 4I1SA 5LLDA 4HS9A 5JLJA 3D6VA 2AD1A 2AUTA 2BDUA 5K4GA 3QNUA 1Y9DA 3REFA 2RHOA 3F1LA 4MPPA 2Q3LA 1XAJA 5LQAA 3N3BC 2YYAA 2H4HA 4OKIA 4WZ6A 2XVZA 2FSPA 3AF0A 2D74A 4ABYA 3EMVA 4C0BA 2J3HA 3L5KA 4DMRA 2E4AA 4I9NA 4RM2A 4BMNA 2FKAA 2JZCA 4B6OA 2IODA 1Z0IA 4TLAA 5DYGA 1H5QA 4ANFA 3F4LA 1A95A 1LTQA 1RABA 4OYHA 3TTSA 4MKIA 2QZZA 4BQOA 2CCGA 3LXMA 3TLBA 5TVGA 1W8IA 4RZ2A 4CF6A 5F78A 3CLVA 3FCSB 2AK3A 1OCEA 4N18A 4NULA 4QUEA 4Y6PA 3UUWA 1L5SA 4GBGA 3BJZA 1VXOA 1RWKA 3BREA 4TXHA 5AJHA 4AJ9A 1UC4B 1XOIA 2IS6A 3V42A 1FTNA 4HDOB 4HMOA 2HIHA 1TO2E 1X39A 1H42A 3TSYA 2YS6A 2GDZA 4K1LA 2GAAA 4Q34A 3VI3B 3GCDA 3NTOA 4D4JA 5HSGA 4Q05A 4ZVVA 5EHZA 4L08A 4I50F 2DFDA 4WJLA 2JK0A 4IS2A 2P4HX 2JJ1D 3LQ1A 1JG1A 4NX2A 2IOFA 4GLOA 4JJ6A 2B7CA 3ER8A 2YHSA 5HK9A 1PJTA 2VJQA 1S96A 1GRNA 5F9FA 3D7MA 1QE3A 2OAQ1 1JBEA 1GGFA 1OZAA 3L6UA 1JTFA 1NWHA 1VL5A 3IP3A 5JAIA 3UBTA 1UMCA 1P1HA 3NONA 1P0IA 4CMIB 5CT6A 2RBKA 1G55A 2YFKA 3TDNA 1THGA 1JFSA 4C6HA 1DAPA 1S8OA 1PIWA 5HCUA 3JQPA 5KYXB 3WRVA 1E98A 2ATCA 1M5TA 3N7AA 1JZSA 2BFFB 2O8CB 2P5TB 1CNEA 1YBAA 2H8GA 3PQ3A 4NHOA 5EKDA 4R05A 3UXMA 1MD9A 2IYXA 3DAPA 1G5TA 3CUVA 1F2TA 3K72B 1KIFA 1K2WA 1R0CA 3A4TA 3K53A 4HAOA 2HWKA 3HLTA 3JWJA 1I1HA 5C35A 4TWIA 3AVVA 2EJVA 1UBGA 2V7XA 3EZYA 2PSHA 3FNQA 2WTUA 1PP4A 1OWNA 1Q1NA 1PVDA 3TH5A 4ZEMA 3RRZA 3WHIA 3I4LA 4YAOA 4I81A 2CVPA 3GFSA 4RX1A 5EJ7A 1ULZA 2KHZA 1EXNA 2PEYA 4FKZA 4N3GA 1E4YA 1FLVA 4BWYA 3HYCA 3W5DA 1Y4SA 3AQIA 3EOAI 3T5MA 2ZJ7A 4E2ZA 3ENNA 5SYNA 5FPQA 4OHZA 3T4XA 3D02A 3UFBA 5JNRA 1KMNA 4X7BA 3M33A 5DBIA 3BX1A 5EMKA 2W0MA 5KQLA 4D97A 1XK6A 2ZRQA 3GRCA 1P9RA 3T4PA 3RIHA 1WY5A 3GAAA 1Q6ZA 2YUIA 3CE9A 3PK0A 4JU9A 5TRTA 3ZZMA 3QH4A 5DMHA 2J87A 2JI6A 1PJLA 4BVAA 5LZ9A 1VGRA 1J0AA 1DC3A 121PA 2J3DA 5AHKA 2H5IA 3NFYA 4IJWA 1G6Q1 2GKSA 3PPVA 4UE3S 4PAWA 4WKBA 4BO7A 3AERB 1CDEA 2CLCX 3TMYA 1O58A 1RJ9B 3PRKE 2PH7A 4F6RB 1T29A 3V80A 4DNFA 2H00A 4GR4A 2JW5A 4D02A 2RAVA 3VJKA 1IJKA 3I8SA 3QOWA 4HB2A 3EF3A 4YAFA 5GV7A 2YN0A 1BHSA 2QGFA 2H1SA 5TEWA 1P2BA 1RP7A 1QG6A 3N2IA 4JIMA 2O59A 4LJYA 1RWVA 1MDBA 5A2GA 1X94A 1CTQA 4JP3A 4DPLA 4PC2A 4OBXA 5HG0A 4RKEA 5IXSA 2GJ9A 1ZLXA 2CLHB 2HA4A 2ZR9A 2FSVC 3D7SA 3GJQA 4FKBA 4UAGA 1HQCA 1I1OA 4ZT3A 4B2IA 5K3CA 4EA7A 5HZKA 2NU7A 3HN6A 5HE9A 5K6RA 3AU8A 2G7MC 1SQ5A 2W11A 5EIXA 3VKHA 1J23A 4DHWA 1XMPA 1D6NA 1VCOA 2ZYDA 3LBHA 3IBFA 2NN3C 3G82C 2ZSBA 3BKWA 5KTKA 1BJTA 1I7QB 1PBTA 2Q3MA 3WLPA 5FQNA 3T9CA 3ETJA 3UC5A 4YMUA 3IDSA 5FPYA 3SHOA 1Y5IA 1RXSA 1VYHA 5ALXA 4AY5A 1VKZA 1HDRA 1LSSA 2N3ZA 2Z3VA 2HYDA 1ZWKA 3W1VA 4OI4A 3DOUA 2G8LA 3D8HA 3UG6A 2VF8A 3QEMA 1Y82A 5DLQC 1XTPA 4EZEA 5B2FA 3HCRA 3U4MA 3D7KA 4WNIA 1E9RA 4ENVA 4UFOA 4BGUA 4EJSA 3F98A 5EE0A 5EWLA 5EJ8A 5EE1A 3TM5A 1HYGA 1YZTA 2JAPA 2QY9A 4G5SA 2G9RA 5I7EA 2B1IA 4JP8A 2HO5A 1P2GA 4YRGA 1IB6A 1OYVA 1QBGA 3EOBI 3K94A 1CS4C 3NANA 3Q0IA 3T1VA 3U4QA 1IAVA 2RCYA 4YPOA 2O8BB 4OU4A 1T5IA 2P6NA 2B4KA 1AXGA 5CLGA 2P4QA 3S2SA 3PIRA 5KSYA 1BTOA 3N2GB 4CIBA 3SXUA 2W48A 3THOA 3ZDFA 1YFJA 4S24A 3TE6A 1WMEA 4GVPA 2IF0A 2WJYA 1DBIA 2HB6A 3Q6NA 2HU2A 3C3PA 2QQGA 2CF6A 1DWUA 3HP1A 1C1YA 3QVMA 4ALIA 5IASA 5IZ4A 5JD4A 3GJ3A 1KEEA 1FFWA 4YDRA 1W93A 3WC4A 4MAAA 5ARCA 5JAQA 2H4FA 5A4MS 1ODLA 1PR3A 4BVGA 4N6NA 3GZJA 1E2EA 1SG0A 4O5AA 1P1JA 1YCGA 2WINI 1EWYA 1P72A 3X44A 3D2AA 1UWKA 1QGDA 3B2NA 4QHSA 1Q0PA 4PPQA 1JS1X 4G5RA 4F2PA 2QTRA 1VBKA 4GX0A 4F4IA 3TW4A 1RPAA 1Y8RA 3IUBA 3AB7A 3PF8A 2A1UA 2ZI5A 1A69A 3B1XA 3FFAA 5SZJA 4FDLA 1XZCA 1WBDA 4JLJA 5AW9A 3D6UA 1BMFA 1IY2A 1FDIA 3ECSA 3IHLA 4RPIA 1KO7A 2JFOA 5BSTA 5FIUA 5JISA 2ZWIA 1VKRA 1IUOA 2W2LA 2Z2KA 2QW0X 3N87A 2GN9A 4FDVA 1JR3D 3TIIA 1JE0A 1P6UA 3V3KA 3RJ9A 1JLHA 3VO8A 4BB5A 1JJAA 4MQFA 5ALHA 1JXMA 3FHLA 1VKHA 3EVTA 1YR1A 4MKHA 2P3QA 1PK8A 3TNDA 4WJZA 3RWBA 1L4MA 2AWNA 2MSCB 4LYGA 1CQJA 3ZU2A 2WWXA 2NXJA 2VYVA 3LLCA 4JKIA 3EPHA 4PO9A 3LD9A 3NHFA 4JT8A 3JQAB 4OREX 4B31A 3C3CA 3SOPA 1HDEA 3O21A 2CJFA 1XTIA 5KNDD 3OT4A 1EHYA 3UJ9A 1JXOA 2GWHA 3AM4A 3QY0A 3DEAA 3P0FA 4B47A 1SFRA 4HLDA 5AVQA 1MVNA 2H1IA 1S4MA 1R64A 2LVBA 3VQTA 3JRXA 3QFRA 5HEKA 4KQEA 1IN5A 1NC1A 2D8AA 1N0WA 5KYYA 3BCHA 4C4AA 4LXIA 3DE3X 4YCCA 3DZHA 1XNHA 2J9GA 2GCOA 3ZWYA 3DC2A 3U17A 1U90A 4Q4AB 1O0BA 3E58A 1VGVA 2HWXA 3WRYC 1CUUA 4KQCA 5HS4A 5IEBA 4MPDA 1X1RA 5KHAA 2PD4A 1ZRHA 2RH4A 2N9UA 5KUTA 4JJEA 1GPYA 1CY7A 5AIAA 1RAFA 4GAEA 3TQCA 4RE5A 1JKMA 5K7SA 1Y5MA 4Y2HA 3O83A 5I8WA 2O3TA 5FOSA 1OGJA 3EZGA 3L79A 3SJZA 4RC9A 4AF8A 1ORDA 1QFSA 3QEAZ 4HH3C 4X5OA 2ZE5A 1NJ2A 2C3PA 2X0DA 4UE6A 5CFQA 2ZRCA 3PJRA 1JHUA 1K7FB 5ABPA 5CEEA 1SXJE 3C3AA 1S2DA 3RVOA 1UBJS 3WK9A 2X86A 2HA3A 5C5EA 2YOFA 5I9LA 3CH5A 3GV0A 4HDKA 5BW4A 5KNLA 3HI6A 4B7CA 3A9VA 1ZCAA 3EXFA 5CVDA 2Q6LA 2YWGA 3SYNA 1OKKA 2UDPA 4C76A 3LOPA 3G7NA 1E2IA 2B83A 2G09A 3F3MA 4FC7A 3A4MA 2FG6C 1OLSA 2D4AA 2IYTA 3A6LA 1NF3A 1Z16A 2NZVG 3I2KA 1Q84A 2JAWA 4TMKA 4AWAA 2XYQA 4RQAA 5BV7A 1DKLA 2P0EA 4DC0A 5JJKA 3TKAA 1MJ5A 4AZ3B 3OPYB 1C80A 4M0EA 5DE3A 1K6EA 4BJHB 4AZ0B 4EFNA 5TSDA 3QPWA 2GVDC 3UCXA 4X64B 3KFXA 2B69A 4DLBA 2XYPA 1YK0A 2P9QA 1P2DA 1C9KA 2OVFA 2QEQA 4LZNA 2JJ2A 2A9VA 4YN3A 3CRZA 4WHMA 5TJHA 2ZT7A 1W4LA 3GDHA 1K8XB 4HC4A 1LCIA 3VNSA 1TYAE 2G36A 3CM0A 1ABFA 4BKQA 4C29A 3IEUA 5F5XA 1IB0A 3FZNA 2P7IA 4M60A 4NMHA 3EQ8A 5FBRB 4P5PA 1GAQA 1GZUA 3FGPA 1QS0B 1RBZA 2WT9A 3G59A 2F3SA 4Q1BA 1SC3A 2PH5A 1CD5A 1HI9A 1SN7A 4IIJF 3LKDA 3ZDRA 1G0NA 5LB4A 3EDCA 3OD5A 7REQA 1E8DA 3ABRB 2PX0A 2I8CA 2JKVA 3DMTC 1R5JA 1N1MA 1V5WA 2PMKA 3QVUA 4BQPA 1WBBA 1E2KA 1PQ4A 3ZLUA 1BCRA 2V0NA 1BXZA 1B6SA 3NKFA 2AZMA 4XPIB 3G2HA 4UAUA 4WAUA 5KDLA 4AF7A 2YHUA 5DCLA 2AG5A 2PT7A 3MQ2A 4ME6A 1E9VA 5IK2D 1ZBDA 4DCVA 3QFHA 1CUZA 1J99A 4MO9A 3AU9A 1VA5A 2BMFA 2EBUA 3K0HA 5GWXA 4GOND 1PZEA 2TMKA 5LKRA 3KT6A 2VTBB 3T9EA 4KL8S 3UJNA 3SC6A 1SBTA 1DAEA 3RAPR 1JI0A 4G0QA 3EBPA 2QK4A 2Q7OE 4J75A 2YNMD 3D0QA 3RG8A 4W5WA 4F85A 2FN3A 3B6JA 4L9SA 1S2LA 2WIFA 1OZFA 3F46A 4M0MA 3FVTA 3L6DA 4XLLA 5H59A 4JU8A 5JC8A 3R7BA 4QU8A 5JQGF 1Z4JA 4L02A 1T2VA 1YI8A 3LT5A 1P1FA 1RAAA 5EJEA 3W5CA 3UKJA 5LQUA 2VZ0A 1V96A 4BYMA 1SOWA 4ZARA 4M0DA 4Q3AA 4D4HA 2IL1A 1LDYA 4FP9A 4BRZA 1WWKA 4X1IA 3HKBA 3NETA 4NNOA 5T64A 4L5YA 4GBMA 3ND8A 2ASEA 4RZSA 4CVNA 1CWUA 1E0SA 2Q5QA 5KB3A 1YDGA 2DJIA 2IUYA 3GFTA 4NFHA 4H7PA 5DV9A 3BL8A 4OLHA 2QX7A 1JA0A 1NLZA 3EMDA 1FUIA 3HDGA 5DX8A 5K3DA 3HYLA 2AOVA 4JJAA 2VF7A 4BX2A 2O8FA 2P30A 1WXQA 1E79A 1NZDA 3DDZX 5DM1A 4M21A 2O6LA 1A2KC 1FF9A 3FM9A 4FFVA 4UE2A 2I6GA 4PPGA 5ALZA 4EA9A 3OECA 5AI9A 3QX8A 1G20A 4M1WA 4RD1A 4Y1RB 4EHHA 4F3TA 1PQYA 1GU0A 5K3FA 1PGJA 2V7BA 1D7OA 3GGPA 2FQ1A 1UPTA 4RM3A 4YAJA 5LP6C 2QQEA 3N0WA 4I66A 2JCSA 4QYIB 1D8AA 4PNHA 1JNXX 5ALLA 4QDUA 5EXSA 2WWGA 3NBMA 3RS5A 3BCSA 1OR8A 3DZ8A 1NQVA 1W6RA 4YRPA 3M2PA 3RJMA 4U2KA 3VJRA 2QXYA 1FBTA 2XJ4A 3SJCA 3I23A 4HQOA 3GLGE 4MW1A 4ZAFA 3DLHA 4YJFA 4P5DA 5HKLA 3G88A 4CM5A 3PNBA 1SKMA 3QNWA 1B16A 2FW9A 3VDXA 3VM6A 3WL8A 4CKBB 1CUEA 4RF2A 2ZOSA 4G8BA 2XF2A 3E18A 3DDSA 3TLXA 3ICPA 4BC1A 5HVNA 5HMMA 3VV2A 3STHA 2R8XA 4KMRA 4OHWA 4R2IA 2GJKA 2WKQA 1JQEA 1OXXK 1QHYA 4PICA 4U02A 5AOCA 5KTYA 3L7DA 4WD3A 1D6MA 3IAS6 4YAEA 3V55A 1MB0A 1XV5A 3SNHA 4QC2A 5AW3A 4LJ6A 3HJHA 4ZVMA 3INGA 3NVAA 1GQQA 1ECJA 3IHKA 4JB2A 2I6UA 3H5AA 4RCYA 5E1BA 3ZBPA 2IIQA 4ZV9A 1HYHA 3OQMA 3AETB 4S3MA 1QH8B 3JWHA 1PJ8A 3RVDA 1X0VA 3QXJA 4HNSA 3VNAA 4D81A 4J8PA 4B5LA 1E2FA 3W6UA 1MW9X 3ZCQA 4IMJB 2B34A 2AW5A 2RAFA 3GJZA 2PH1A 1TLTA 3KJNA 3L1VA 3UFXB 2TS1A 3DEZA 2QVXX 5JECA 4UW9A 1OH7A 2NXEA 2OYCA 4Q3KA 4JQZA 3ACBA 1JWAB 2DKNA 2IXAA 1RLMA 4M0LA 3EFBA 3TZLA 1XMVA 1YR7A 2YXBA 4CFSA 3LW7A 3GQVA 5LQNA 3I0MA 3RVLA 1F1BA 3U4GA 1J2JA 2JJ1A 3F8SA 3K9WA 3TX6A 1EZZA 4PLGA 3T7IA 2OGWA 1NNUA 1D7AA 1MN6A 3PXEA 5L3RA 4ARUA 5L40A 3QE9Y 4B6EA 2PX4A 3NBKA 3OLWA 1QG4A 3VU3A 2IZ5A 4AS3A 3J81A 1V5FA 3A6ZA 1UPXA 5AW8A 4P82A 5J4LA 1FQWA 1PYOA 4I4CA 4EFLA 2WHPB 1QMPA 4X61A 5EZYA 1ZL2A 1NVBA 2QTHA 3ONNA 1R1DA 1HDZA 1XGKA 3V4LA 2P9EA 3D8BA 4FGLA 5FPTA 2F1HA 5B1EA 6GPBA 5M29A 3R0IA 1Z35A 3IPRA 4UDYX 1LX6A 1Z5OA 2FUKA 1F2DA 2MSEB 3D6AA 4RHXA 4FGWA 1YH3A 4KLCA 5J63A 2ID8A 4HNUA 2IXEA 1J33A 1XCBA 2GAFA 3C5VA 1B76A 5DU2A 4DWWA 2BKAA 2M6RA 3A28A 4DYDA 5I5GA 1V7QA 1ADYA 1ODFA 4QYWA 4MUXA 3U7EB 1Z8DA 5A6SB 1EESA 4GLFA 1XVUA 4CDRA 5J4KA 3W90A 2N46A 4YT2A 1X7HA 3RHTA 3ZHYA 4L8YA 1OFUX 2CL5A 2QN9A 2CL6X 3B53X 1YIAA 5LQDA 1MO3A 2QLBA 1H05A 2W2NA 3MWDA 1L4KA 2QLLA 1Z68A 2XADA 1SR8A 2HMSA 1SWVA 3LA8A 2REQB 4J07A 4K7JA 2HA6A 3TO5A 2IW3A 4HPXB 3ZLVA 4ZODA 1UMDB 2B8NA 3AEYA 1A5BB 3E7PA 5DYWA 3Q41A 1HH4A 5FYQA 2PZMA 4BBAA 1KKMA 2VJLA 3VR5H 1KDTA 3K9LA 4IDHA 2CFIA 1AOXA 1F14A 2EG5A 4IDBA 2JGRA 4KLRA 1FTQA 5F2OA 5I7FA 1QIDA 3IERA 3OPNA 1W4RA 2BFBA 4XUEA 4Q6BA 3FVQA 5CRIA 4DOMA 1E5QA 2EJWA 2XB2A 3MT0A 4L9WA 2QIOA 3IUMA 2EJTA 3EFOA 3QEJA 3QLJA 5K9ZA 1JXQA 2WD7A 1JJBA 1XTVA 2LZ0A 3FMVA 2XKKA 2CJYA 3WYEA 2CLMB 1BEUB 2R00C 3IIIA 3Q3VA 2IUEA 4QVGA 3RYIB 3BMQA 3SF8B 4Z7OB 4NY1A 1ARZA 2VHUA 1EQAA 4EG8A 3KZKA 3DFMA 3LPAA 4J0JA 1UOPA 2VI5A 5D87A 1Y8CA 4NECA 3V46A 3KTAB 3BA1A 2ZE6A 5FAXA 4MB0A 4HSGA 3OICA 1TPYA 3FVWA 3TNYA 1J5XA 1HY3A 4XWAA 4AZSA 3OTHA 3VOTA 3A1TA 3E3LA 1ECLA 4WXYB 1P0CA 3JARA 2WPDD 3RSCA 2AFIA 2CZGA 5AI5A 1LQTA 1HZZA 3HXTA 1M74A 2P35A 2D0IA 4E1BA 3UMJA 1C14A 3A0UA 5HXAA 2VTBA 4FU0A 4YJ3A 3V7NA 3VRHA 4L95C 5D1HA 4KRGA 1YZNA 4GQBA 4C4PA 1IQ0A 1QVWA 1U2DC 2HJHA 5BRAA 1K8RA 1V1RB 2GASA 1XU7A 2NUAA 3FHJA 4G65A 1YI0A 3PDIA 4N4AA 1ZJWA 2RIRA 3ZWMA 1UR5A 2DHCA 4E14A 3WMWA 1U4NA 1M6YA 5BSEA 4JJZA 1IXYA 2UU9B 1PZGA 2L42A 2CJWA 2P77A 2UUPA 2WAXA 4JLUA 5G0VA 5AW0A 1Y1QA 1HM5A 1X1BA 2WG2A 3BFVA 3OFSA 4PZ9A 4QEZA 5K4HA 2ZCUA 2PRZA 3Q3JB 1FBNA 3HVUA 4QJIA 1N5JA 2RGRA 4C4ZA 1EBUA 1AHIA 1SK8A 3K5IA 4G0MA 2IE8A 3ELBA 3TZEA 1WF3A 4QJ5A 3X43A 4BBZA 1KMHB 3RRJA 4UPEA 4ZI7A 2A1TR 3ZHSA 3FD8A 2C5SA 4IMPA 1BXGB 3AGQA 1YDFA 4MUKA 1EM8A 3JVEA 1YHNA 3RJZA 1PJBA 5I51A 2PV0A 4LOKA 4UM8B 1FFSA 4XM2A 3HGTA 1Y3DE 3GLGB 1S01A 3FCAA 5E4JA 1ESNA 4ZO6A 4OJNA 4QJ4A 1FX0A 1OUMA 4JLPA 4QPDA 1DWOA 2OBYA 2ZT8A 1DOHA 1QVAA 5K6AA 4R7ZA 1Z3IX 2BONA 3PA8A 4TSKA 5A71A 1GADO 4R84A 3TUZC 2PK3A 1XD8A 3UF0A 1A2BA 2PQMA 4HN4B 1U8ZA 4JOCA 4N8EA 2G08A 5KYUA 1N8TA 2PV7A 3BGVA 3IILA 2UYYA 3K1JA 4HYYA 3ZVNA 5KAPA 4ZO4A 1IOLA 4OUDB 1HTWA 4OKNA 3R8CA 4BCCA 3E6AA 1XDDA 2ORWA 3AHGA 1RAEA 2B9VA 5BV1A 1JYFA 3G1TA 4EELA 2LUOA 3QTBA 3F7NA 5BMOA 1OX4B 4PRLA 5JJCA 3QI2A 3C2QA 4C7OA 4JXZA 3RADC 1O96B 4LFCB 5FJJA 2FFHA 2GPSA 5JS2A 1TUGA 3B9BA 4F38A 1GR0A 5C1PA 3VO1A 5I3CA 1JA1A 3NS7A 1DQPA 1JR3A 1UL1X 2YWBA 3DMGA 2G5CA 4LI0A 5JPIA 1F7VA 1PJRA 5TQ2A 1RHMA 2E1PA 2VYFA 1G2QA 3A6GA 3AXSA 3AI3A 4NFYA 3HHPA 2WA2A 3ESBA 5DYNA 1DIRA 3UKOA 2ECQA 2X6RA 1QYVA 3FVRA 2H5EA 3L7IA 1BXKA 4EGQA 2FZKA 3ASVA 3K16A 1I3MA 5DIZA 3TCNA 2ZROA 5AM1A 3RYCA 1JEJA 4JL8A 1J24A 2D4HA 2QDKA 3ZVRA 4MWTA 4YJHB 3DOCA 2QM3A 1QDUA 2BCGY 4GVXA 1C2TA 5TJ9A 1PZNA 2C9DA 5I4KA 1ZH8A 3HMKA 4CWAA 2HLDD 3RUIA 1CB7A 3QVOA 4C30A 4XYLA 2NSHA 2QR5A 3DP7A 3QF4A 4S35A 2QXTA 2O1XA 3NYRA 4CW7A 2HK9A 3CURA 1L5NA 4ER3A 2C0PA 4J0HA 1LLDA 3F49S 2G7ZA 1GRRA 2ISCA 3E3NA 3KHKA 3SJUA 1PEAA 2M2IA 4LRYA 3H9BA 4QEDA 3RK1A 4FQ7A 1VCNA 1YV9A 5KMGA 4QNNA 4XQGA 3VUFA 1U4SA 4AK9A 2AF4C 2WJVA 1V4BA 3HFJA 5LLTA 8GPBA 1AQJA 1Y3CE 2I2FA 1Z0JA 5KZMB 4KU4A 1TYZA 3KL2A 2B20A 3NYWA 4L1KA 4H0CA 1BQEA 4P4UA 3TINA 4ED9A 1U1DA 1TI7A 4C04A 2VK4A 1ZGBA 2DFNA 2PRJA 4NBNA 1UMBA 4FX2A 2O1WA 4X94A 2YV3A 3EK2A 5CM9C 2ZS7A 3H9JA 4B3FX 5BWMA 4RTMA 2H31A 3C3XA 3TKYA 4Z0NA 3LCJA