3VX3A

Crystal structure of [nife] hydrogenase maturation protein hypb from thermococcus kodakarensis kod1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
235
Chain Sequence
IDPREIAINARLEGVKRIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPPTVHGIKFMTIAYYTTPLRGKEISDALIELLTITRWDELDYLVIDMPPGLGDQLLDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEEGHKVIGVVENMKLREKDVEKLAEEFGVPYLVGIPFYPDLDAKVGNVEELMKTEFAGKVRELAGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Structure of a Novel Archaeal HypB for [NiFe] Hydrogenase Maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Adp binding protein
molecule keywords ATPase involved in chromosome partitioning, ParA/MinD family
total genus 79
structure length 235
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vx3A01
4LJ6A 2GJSA 4A2QA 2BMDA 3WXMA 2QP4A 2XEXA 2D62A 4YXWA 4BZXA 4DLYA 1W0KA 3M4YA 4FMBB 1E1RA 1ONBA 3KXKA 1N6PA 4XVQA 4MGIR 3SFZA 4Q47A 4Q9LA 1JALA 3UG7A 1G291 3NEJA 2C8VA 4QGGA 1VCIA 2OO7A 3AKEA 3KFXA 2V1UA 2OAQ1 2VA8A 1FW6A 4LYJA 5CK5A 5FTKA 2BKEA 5E4FA 3GPLA 5HKKD 3FMIA 5DLQC 1T5IA 2NG1A 3B2EA 4IDNA 5CJ2A 4LGMA 2I4IA 1UFQA 1Z22A 2OXCA 1TMKA 4PC6A 3UMSA 1LB1B 3PXGA 3LX8A 1EWQA 3NHBA 1P9NA 2ZQ5A 2PMKA 5LB2A 3VR1A 2QE7D 5FBVB 2ZREA 4FMDB 5SZKB 2IEYA 5LPNA 4Q21A 1AS3A 4WZ6A 4E03A 3C5CA 1GKUB 3QEOA 1F48A 1XZQA 3LO5A 4TL7A 5JBQA 4I1VA 4JS0A 1T5LA 2BJWA 4IJMA 4B3DA 2JJ2D 2VP0A 1J70A 2R8RA 3UK6A 1CJUC 4P3YA 5JS7A 1IQPA 3CNLA 2FEMA 3I4LA 3QXJA 4DLRA 1KDTA 6Q21A 3MMPA 3ZD7A 2IS4A 4DBLC 1NLZA 3AP3A 2F7SA 2ZTSA 4K81B 1XEFA 4IVPA 3A1SA 1CJMA 3K8YA 2O5VA 4BFXA 1I4LD 4CRWB 5FUYA 4TZ6A 4NCKA 3KQHA 2C9OA 2XSZD 3QKTA 5B57C 2H16A 5TMPA 3W5JA 4P4SB 4CEIB 3UKDA 2O8BB 3K70C 4QHSA 3CF2A 1BMFD 4UNNA 3MWLA 4IOMA 2ORVA 3PQCA 4EIWA 1E6CA 1XZPA 4XSHA 4DIEA 2WICA 1I2MA 2ZJ5A 3QNUA 1TF2A 2IUSA 4D4MA 1U8YA 4MRSA 1OKKD 4DLVA 5CITA 3D8BA 1XTSA 2JCSA 2KWIA 2QPTA 2JLUA 1SXJE 2FJUA 3WY9A 1FMLA 1ZW6A 4OQFA 421PA 4Q9JA 4IEIA 1RKBA 3O8DA 4O0MA 4UNQA 3WNBA 4B2IA 2WSSA 1UM8A 4OI1A 5HR5A 2RMKA 1E1QA 2CDNA 3X2SA 3EA5A 5J5CA 1UKVY 3IIMA 2NMVA 1NVWQ 3L8ZA 2CK3A 1Z83A 1IJEA 2ZR9A 4U7DA 2WIAA 2IYWA 4PAMA 2QSYA 1P2UA 4TZ0A 3U3JA 4D82A 5JSZB 5BW8A 3EZFA 1SHKA 4XD7A 3T1OA 4C2UA 5C1BA 1QHNA 1TEVA 1P2SA 4RFSB 2BBOA 3ADBA 5EE3A 3T12A 3CH4B 1NNEA 3GLIE 4NE2A 3AF1A 1P2VA 4MITA 3U5ZB 1E32A 1S0UA 1SZPA 1WMSA 1B0UA 4EQ6A 4TLBA 3MRSA 4GDFA 1OJLA 4BLRA 3I8XA 1N2CE 3L82B 3MSXA 2O8BA 2W58A 1E0AA 1OXXK 1XU4A 2GETA 1S9DA 1R8QA 4B75A 2FNAA 1G20E 3NEYA 5EXXA 1SVWA 4KBGA 4G0NA 1MV5A 4NYJR 2RKOA 1FQKA 3HYRA 5EXTA 2ZRMA 1ZM2A 1CIPA 1OYWA 3AP1A 2MMCA 4JKIA 2W83A 521PA 4A82A 2YZ2A 2OEPA 2OE2A 3DO6A 5AJWA 4IVRA 5H1YA 1UEJA 1GL9B 4GT1A 5FBRB 1UKEA 4QHYA 1OIXA 1E9SA 2GA8A 4NH0A 3RSLA 2EWWA 5GJWC 1TUIA 3O8RA 4BFVA 2OLJA 1XMIA 2Y8EA 1OHHA 3VR5A 1JAHA 4LPKA 1QHXA 3CPEA 2F1RA 4Q1CA 3L0IB 2ZRIA 2BBSA 2G0TA 2ONKA 2WJGA 4JLPA 4TYNA 2GBLA 2NIPA 3QIAA 4OHZA 3BWDD 1YR8A 2XXAA 2ZJBA 4MKFA 5JWHA 2CJWA 2DFKB 2FG5A 3IGFA 2V55B 5L3RA 4LJ8A 2F1HA 3N5CA 2ZRNA 3QF4A 3D31A 1U81A 3T35A 3RRYA 4XH9B 3B9PA 1VG0B 3DEFA 1W4RA 1WXQA 2ZUCA 5KPJA 2GXSA 2XTNA 1DBSA 1NJGA 4OI0A 3PEYA 5L3QA 3K9GA 1OH8A 3B78A 1D2NA 2DWOA 1P6XA 2RHMA 3GLHE 3MD0A 5DYGA 2Q9BA 4D0NA 2ANBA 2YOFA 4KAXA 1SVIA 2JJ1D 4LPSA 2XOKA 1AK2A 1DEKA 1W0JD 2XB4A 2CNWA 3IILA 1ESNA 4HATA 4C0BA 4ZI3A 5KPDA 3AVWA 5GJBA 1P60A 2GZAA 4TL9A 1OW3B 2B92A 3HU2A 2R2AA 1G7RA 4N3NA 3ZZUA 1JJVA 2UZIR 5FUXA 1BH2A 2HXSA 3KFVA 3LNCA 2R6DA 4L16A 3K70D 4FWTA 4MUBA 5FL7A 2ZE7A 1UBEA 3T5GA 3TAUA 1DPFA 3GLGB 1K6MA 3CRVA 2WMOB 1KO5A 4ZPXA 4JLNA 5EP2A 4DUGA 5AUOB 1IXRC 3OE7D 4G5SA 5BN3A 3FOZA 3MWJA 1P9WA 3QUSA 2AX4A 2GK7A 2ERXA 1KJZA 2EVWX 3MFYA 1SVLA 3KQUA 1Z0KA 2H5EA 2XJ9A 2WAXA 1E98A 2HUPA 4EUNA 1UJ2A 3AP2A 4G5QA 2FFHA 2Q3MA 4Y0AA 4ZKEA 5AJYA 3L2OB 3PV0A 4I81A 4Z8XA 3B13B 1GILA 2JLYA 2DYKA 5F2EA 3A36A 1BIFA 3X1XA 2YNMA 1DAHA 1VG9B 1Q21A 2FPKA 1RVDA 4ZKDA 2GCNA 2HYDA 4FD2A 3B1VA 1QDEA 2BMJA 4RKFA 1Z07A 4BECA 4B6EA 3GCGA 3Q72A 3SHWA 1XD9A 4OJQA 1T9HA 4LZZA 1DO0A 1G6HA 1AA9A 1XCMA 3FPAA 2C9CA 3N2EA 2F1IA 4Q1EA 1DAGA 4YMUA 3W90A 4FW9A 3FKSD 1Z3IX 5JCZA 1A7JA 1KNXA 3ZVMA 3OF5A 4NU0A 4C0HA 2PH1A 2ZRKA 1KSGA 1XPOA 3P4XA 4CDGA 3U3MA 2YWFA 3PFIA 4LUCA 2YKGA 1CR2A 5EXSA 2J87A 1SXJA 4OQLA 2ODBA 3DMDA 2FPMA 2PBRA 1JI0A 3AQ4A 4PC1A 1E9BA 4QNRA 2W6JD 4NDZA 3CPHA 2WJIA 1NKTA 5JEEA 2QM8A 3THXA 5FOWA 2DFNA 5CYOA 3NIBA 1P72A 4EKDA 2QEQA 1H8HA 3K09C 4EQ6B 5JFGA 2RGNA 4RCZA 1G5TA 4MUAA 2IYLD 3DZ8A 1KAGA 3EIEA 3FFBA 4KI0A 4U5XA 4BFSA 4XWKA 8OHMA 3KQNA 1NLYA 3B1WA 4QM6A 5HCIA 3RWMB 4ZO4A 4DVGA 5BN5A 4MH0R 3PEVA 2WWFA 4NCNA 4IDHA 4B2LA 4M1SA 1YU9A 4B35A 2FSHA 2VL7A 1ZM4A 2AFIE 4BASA 4DCUA 1NY6A 3A1TA 4PZLA 4C0LA 5K8UA 4N0DA 3HPRA 1NY5A 3MWYW 4DHEA 1U99A 4JBWA 2QP9X 1KYIA 3UXMA 4ZIRB 2Q3HA 5HE9A 2ZU6A 3TSZA 3A4NA 3LQRA 1PVOA 4JVSB 3GJ5A 1HA3A 5HE8A 3U60B 3EASA 4Z1MD 3S1AB 3VHLB 3Q7PA 3Q7QA 4QXAA 2WWYA 1PUIA 3NG1A 2JJ8A 1ZNWA 4MRVA 1O3YA 4KV9A 4DLXA 4TMTA 2OAP1 3U4QB 3CX8A 4MQBA 4US2R 2QT1A 5AR1A 3UATA 5DN6A 4I4LA 1DAMA 3SYKA 1PLLA 2GDJA 1PJRA 4M22A 2BEJA 4LI0A 2E9SA 2C04A 2VLIA 4TMWA 3VHXA 2CCJA 5J4HA 1VMAA 5K8TA 4U02A 2GJ9A 4C0AC 5AK0A 4R71A 1OXUA 1P73A 2EWVA 4TMZA 2QBYB 5TARA 3BERA 1T3HA 1YHNA 3IDQA 2WBLC 1JEEA 1KK1A 5D3MB 5BQ5A 1FMJA 2VP5A 2FOLA 5CM9C 3D3QA 3K0CC 2CJWB 1J8MF 1RW4A 4KLZA 1P5ZB 2FGJA 4PO8A 2XNDA 4Q7MB 4UQOA 2F43A 3LVRE 1AKYA 1LS6A 2D4HA 3NVAA 3LW8A 3GEIA 1CEEA 3PVSA 3PUWA 4JLAA 3IIKA 3R8CA 1GM5A 3SFVA 4W7SA 1WE2A 4HZUB 5EE1A 3O8CA 5FBWB 4F92B 2LCFA 2IL1A 1E2GA 1T8UA 2Z5FA 1R0ZA 4D81A 1ZC4A 3AVXA 2AFHE 4RD6A 4KYIB 3RHFA 3GFPA 2PCJA 1DTSA 2C03A 1YVDA 4IEEA 3ZLJA 1KZ7B 2G88A 4UXIA 4WXRA 1S1CA 4BE7B 1JB1A 2RGDA 1DARA 4A0RA 2OCPA 1ODFA 3K0EA 3A8TA 1ZM9A 2QTVB 4XWOA 5EUQB 4RSGA 2EYQA 4ZCIA 3H86A 2ZI5A 3KUDA 1FFHA 1R5OA 2ZAOA 1EWRA 3BFKA 3SQWA 3V4RA 3HJNA 4M1TA 1M2OB 5DHFA 2V6JA 3DM9B 1Q12A 2QMEA 5P21A 2CLSA 1OFUX 2WSMA 3PUZA 3CUEF 2WWWA 5EZ5A 1E2MA 2AR7A 3QQ5A 2J0SA 2H1LA 3G82C 5SZIA 3TSWA 4TMKA 5DI3A 5C46F 1WQ1R 5KSOA 1DAIA 4M1YA 4C4PA 1RIFA 3BJIC 5FOTA 2KSQA 4EJSB 4KITB 2HJVA 3QXSA 2JIZD 4A8JC 3UMFA 1Q57A 2P67A 2G0NA 1KK3A 4TT3D 2FH5B 3NTUA 2QN6A 4A36A 3THWA 1U0JA 2WOOA 4HAUA 1DO2A 2D06A 4G1UC 1QHYA 2PJZA 4I1UA 1KI2A 1G3QA 2DWQA 2JLWA 1XEWY 3K0FB 1Z29A 3VR2A 2WJYA 1FNMA 2JDIA 3PIRA 4YDSA 1IXZA 5FI1B 2YOGA 1U9IC 4P0TA 1Z6XA 2FMXA 1AN0A 3KKPA 1KZGB 3M6AA 3QEJA 3NDBB 2BCGY 4IFEA 3W6NA 3B7GA 1G4AE 3KJEA 2J3EA 4C0KA 4V0LA 3AVOA 1ANKA 3A1WA 1NN3A 2ZR0A 2HV8A 1N0UA 3I72A 4US0R 5JRJA 1ZRHA 1F5NA 1PLJA 2A3RA 4F38A 2QAGC 5IK2A 1UKZA 4V0KA 4B47A 3HP1A 1JR3E 3RLFA 3X1WA 1UBCA 2QAGA 1UKYA 3PUYA 4FMDF 2MMGA 1MT0A 5G3YA 5KOYA 1SVKA 1NMZA 2OBMA 2ZRPA 5CM8B 5C18A 2GEDA 1RRGA 4HLCA 1R8SA 5A4JA 2XAUA 3UPUA 1NBMA 4QOSA 3THXB 3WYFA 1T3LA 1S8FA 2IBMA 3CR8A 3F8TA 5L3SB 4MDEA 5FPYA 1AS0A 3N70A 2B7BA 2IXEA 3KL4A 4JVLA 1G7SA 3SEAA 1RRCA 1ZINA 3HU1A 2G3YA 3FMFA 2HT1A 1E1RD 1KKLA 2WTUA 2IW3A 1E4VA 1NL3A 2TMKA 2RGCA 4MYCA 1E2NA 1GUAA 4PAOA 1PUJA 4LJ9A 3BH0A 4QBHA 5FPTA 2YOHA 1YZTA 2O8FB 1YE8A 3DM5A 3P27A 4UJ3A 1M8PA 3E2IA 4PZYA 4Q4HB 1CULC 3HYTA 2XTMA 1Z0JA 1Q1QA 1VPLA 3QG1A 2EFGA 1F2TA 5KSZA 2BDTA 2QT0A 4F7WA 3GJ8A 1TX4B 3TNFA 3P1JA 2EFCB 4PQFA 1DG1G 2QL6A 3KDSE 4WBSA 1F2UA 4QC2A 2O8DA 1QG2A 3KKOA 1E2FA 2GZHA 4P32A 4QGHA 3WBKA 1WBDA 3SQXA 3QXXA 2CLDX 2GAOA 3SU8A 5C4MA 3PCRB 4KLNA 3B8HA 1E9RA 1G41A 3HU3A 1IXSB 2JJ2A 5LB4A 3TLXA 5EXPA 2R6AA 1XPRA 4P31A 5DIFA 3ZZ0A 4AG5A 5FFMA 2Q9CA 4X8MA 5FUVA 2VSOA 3ZIAD 4DLTA 3GLIB 1AIPA 3RVBA 3RC3A 2GVDC 1Z6YA 2O8CB 2OBLA 3ADKA 4WW0A 5DNYB 2Z4SA 4JSYA 3T1TA 3SNHA 4EJSC 4C2TA 4DSNA 1IN5A 4B43A 2XSZA 3TE6A 4AKEA 1NIJA 2ODWA 4JVNA 1E3MA 1Z6GA 4P4SA 3CRQA 2QRNA 4DWJA 3BRWD 3BD9A 1KAOA 1EXMA 1BMFA 3I8SA 4JJKA 3C8UA 2ZETA 2LKCA 2C9YA 3CRW1 1KHTA 3E5HA 3FMOB 2A30A 4B3CA 4QFMA 2RGBA 4UXHA 5FTNA 1ZD9A 3KB2A 2BWJA 2IYSA 3CW2A 5DO9A 3H0KA 1OKKA 2YV5A 5FBLB 1JBKA 1TQDA 1VG1A 3WHKA 4OQNA 3BFXA 1E9DA 1A2KC 1IHUA 2VP6A 2YHSA 1TU4A 1LTQA 3THOA 1Z6TA 4LK2A 2D3WA 2QAGB 2DHRA 5K8LA 3PG5A 4UKDA 3VU9B 4D4JA 1KDRA 5KHOC 5JRZA 3BK7A 4LV6A 2G1JA 2AHOA 1DG3A 2IYZA 1HE8B 2IYVA 3CX7A 3EAQA 2VHCA 2IS2A 2R6GA 2GRJA 2OFOA 3WRXC 4LJ5A 1U0HC 4DB2A 5BXQC 5SZHB 2VBCA 1T8TA 1DS6A 2BBWA 4DXAA 4OHXA 1ZNYA 4L9SA 4AKIA 1I2DA 1X8KA 1IY0A 4JVMA 4AYTA 1E2EA 4WOPA 1NN5A 2ZANA 4H9GA 5KNDA 4C30A 5TVKA 4IHQA 1KKMA 2ZVQX 3W5IA 1U98A 3RRMA 2QENA 1P7CA 2P65A 3TJZA 2LKDA 3GJ3A 4QBIA 1ZIPA 4JSTA 2EU8A 4XJXA 1RE0A 1LVGA 3I32A 1R0YA 3E70C 3LX5A 2L0XA 2PJRA 1IN7A 4URWR 2J0UB 4LHVA 3M0EA 3W8RA 4DCNA 3PEWA 3AH8A 4XIGS 4DSTA 1MO4A 1FOEB 2QGZA 4NYIQ 4C9BA 2MSEB 2ZJZA 4GPTA 5KDOA 1S3GA 3THWB 4OHYA 3AF0A 1P61B 3CRRA 3HR7A 4ZV4A 1D9XA 1T91A 3GJXC 3F3YA 4DB4A 2PL3A 4NKRA 4DDWA 2A5YB 4CEJA 2QSZA 1E0KA 2I1QA 3R9XA 1N6NA 3I61A 1XP8A 1OHHD 4QGAA 4EFMA 5BN4A 4HAYA 3P4YA 3DVLA 1NP6A 2ZI3A 3R9WA 5G41A 1W46A 1EFRD 1IN4A 4DLUA 2J41A 4OQMA 4O3MA 4B34A 1K5GA 2ZRJA 4OQXA 4DDTA 3CO5A 3WYAA 2BVNA 4HSEA 2Z43A 4V0MA 3N2IA 4QNMA 2VHQA 1R4AA 1E2IA 3B1XA 2ZYUX 2GWHA 2SHKA 2BOVA 2Q3FA 3ZZTA 1VDZA 2VIIA 4OL0A 3VFDA 3DZDA 4L5BA 1XJ0A 4KCGA 2YVUA 3EWAA 1KOFA 4L15A 2ERYA 4PHHA 1NI3A 2ZIAA 3GFOA 2XTZA 4M0LA 2GEUA 3K0FA 4MYUA 2F6RA 2RAPA 1OIVA 1NSTA 4PQYA 4BZQA 1KSHA 2CNWD 2N1BA 2ZYWX 3KXIA 4HAVA 3RS4A 4GI7A 1RYHA 5GJCA 3VQTA 4KSBA 1XJQA 1GAJA 1XFAA 1YJ5A 4RZ3A 2V4ZA 2C2HA 5KSPA 4V02A 1E2PA 4EPRA 1ZM3A 1MR3F 3LDAA 1DAEA 1Q3TA 4LYFA 4E09A 2ZITA 3AEZA 5B2ZA 1TNDA 3OAAD 3EC1A 1J2JA 2C99A 5FOXA 2BCJQ 3KJGA 3OFNA 4CT4B 1CXZA 5CIWA 1KI9A 4BLTA 4LHXA 4Q1AA 3GMTA 3KKQA 2QQEA 1Z06A 2IYXA 3AGQA 1IONA 1GTVA 4MDFA 1ZMXA 1ZUHA 3W9YA 2RH5A 2JASA 3EZ6A 2EYUA 5H70A 1FX0A 2WJVA 3I5XA 2Q0HA 4A6XA 2FU5C 1IBRA 2LWIA 2B6HA 2ZJ8A 1YZNA 5F9HA 1VCNA 3I92A 2E87A 1G21E 2CXXA 4DJTA 1GDDA 2W0SA 4XWAA 3F0TA 3EPHA 4C3ZA 3EG5A 2V7QD 4FCTA 1P9RA 1ZIOA 2DY1A 4ACAA 4LOAA 4F4IA 3B85A 1ZD1A 3U44A 2PEYA 4BFUA 4YMVA 2ZXUA 1WB9A 2CL7X 2F3TA 1HURA 2R6CA 3ETLA 2FFAA 4MRPA 4M1OA 1Z6AA 4GSYA 5A5GA 3FHTA 3WRYC 2A5GA 3BXZA 1AGPA 4X8LA 4GOJA 4TYPA 2ZR7A 5EP4A 4Q01A 2QUZA 2G77B 3TKLA 2VF7A 1NMYA 2BM0A 1EFUA 2YWHA 3W34A 4V0ME 2WPDD 3EA0A 2PEZA 2X1VA 1SKQA 5JJKA 3LRPA 1ZVQA 4TQAA 3CF6R 3KUCA 1ZCAA 1COWA 1BYUA 3A1VA 2WWXA 1YZKA 2EFDB 4LRWA 4Q19A 2FX3A 3K09A 4TLAA 5FTJA 5G53C 3TQFA 1CS4C 4IOKA 4QJ4A 3TVTA 4ASUA 2NPFA 4EFLA 4URUR 2BIFA 2O0KA 2C5LA 4MYTA 2X8AA 1G19A 4TYWA 4JLOA 4N1AA 1JEDA 4GMDA 2AKYA 3B9QA 4BRUA 5C4GB 2QROA 4JYBA 3TUZC 2A2ZA 4QBGB 5IHPA 4V0OA 1GFIA 1UPTA 3FFAA 4JL6A 4MGYR 3BORA 2GF0A 5L3SA 1T6NA 3T5DA 3CWQA 3LBNA 1UBGA 3EIQA 2DPXA 4R2HA 1XEWX 1UDXA 1O87A 3OIVA 2RGGA 2V1XA 3B1YA 1US8B 5IF9A 2X77A 3AUYA 3PR1A 2XZOA 2Q9AA 1E79D 2AKAB 5FOUA 4DDUA 4Q03A 2WKRA 3VNVA 1KTVA 1WRBA 2WOJA 4F4CA 2OESA 121PA 1R6BX 3QKUA 4GOXA 1HH4A 4TLEA 2QMOA 4AG6A 1XTJA 4DIDA 1F6BA 1HQCA 4OHVA 1S4QA 1KK2A 2RGNC 4Q1BA 2D2FA 4BEJA 1EG7A 3GEEA 4U00A 4CF7A 4DCSA 1IJFA 3ICEA 4R2IA 3SYNA 1N5KA 1ZCBA 2JATA 1VHTA 3R8FA 4IDPA 4WZAE 1GKIA 2GVZC 3KXLA 3WMGA 3RSOA 1KI7A 2CHQA 4GBMA 4HUQB 2IYRA 5F3WB 2V8OA 1P4SA 1W48A 5FR2A 3HWSA 2QORA 1G7CA 3TR5A 2YYZA 5CB8A 1W4CA 3D6TB 2WKPA 1XCPA 3VTKA 1U2RA 3AVQA 4FINA 1L4UA 1P2TA 2VF8A 2WJJA 2ZI4A 3WMFA 5HKKA 2ZS7A 4RD3A 1XMVA 2J0VA 1TTTA 4W5HA 1OXSC 3NBYC 5TV2A 4Q9HA 2VO1A 4UNRA 1ZJ6A 2Z4RA 2XNDD 4YMSA 1GWNA 4BUJA 1HTWA 1Z0IA 5L3QB 2FFQA 3B6EA 2A78A 3ZVNA 3LBIA 3GJ7A 5FOVA 1KMQA 4A0FA 2ZRGA 5J40A 4FCWA 1Q3HA 1U94A 4RZXA 3CKLA 4DT1A 3IIJA 4YLGA 1A1VA 2AK2A 1FP6A 2ZUDA 1QBKC 4HUTA 2HLDA 3CIOA 3K70B 1OSNA 1Y63A 1OXTA 2QI9C 4QGFA 4GOKA 3TIFA 3LAWA 2C78A 2QNRA 1KDPA 3WBJA 2IXGA 2FSIA 3NH9A 4QKQA 5CLQA 1B23P 1M74A 2RGAA 3K1JA 4GP7A 4E22A 3L43A 2XJ4A 5FOSA 2PT5A 2W0MA 4LJ7A 4C7OB 2EFEB 3GLHB 1GKYA 3VX4A 3FMPB 3LXRA 1S2MA 1YR9A 4TL8A 1DAFA 5E95A 4EPYA 2NO6A 3EWSA 1FUKA 5FTLA 1UBFA 5FL3A 4DSOA 1JR6A 4KFTA 2WV9A 2XITA 4B76A 3U2QA 3SBDA 1F3OA 4Z51A 3QBTA 4W9MC 4ESVA 1S9HA 2GCPA 4LSGA 1ZC3A 1TADA 2IUTA 3GLGA 2CMKA 3SE0A 5DI9A 3FVQA 3RS2A 3QKRB 3C5HA 3CF0A 2OUKA 1D2EA 1G8FA 1WP9A 2OT3B 2GCOB 3B5JA 3MAAC 1HV8A 1AM4D 1Q0UA 4NCJA 3P32A 4Z8YA 5E7IA 3C16C 4IXMA 2WSSD 1ZUIA 1KJWA 1R5BA 1LF5A 3W3AA 3TQCA 4JT2A 3OHMA 3K0AB 1HT1E 2IHYA 3RS5A 5TDHA 1XPUA 3IEUA 3L8YA 2CK3D 2IHBA 4US1R 1IY2A 3TGPA 4L9WA 2IT1A 5FPHA 4JIMA 1TPZA 3TSOA 1IY1A 3SS8A 2W00A 2ZSFA 3RNLA 2R6FA 4XTCS 1NN1A 3OEHD 4BRWA 1DVRA 2ZROA 3QF4B 2VYFA 4LV5B 2W6IA 1E2QA 2REOA 4RD1A 4NYMR 4QRHA 3Q3JB 3IQXA 1Z47A 4LBZA 5AUPB 1UEIA 3OEEA 4KFUA 1RJ9A 1X8JA 1KI6B 4FWIB 2NO0A 4Q00A 5EUMA 4DEYA 3AV0B 2ATXA 2X19A 2B7CA 4G3XA 4Q7KA 3QPVA 4XSGA 2WJHA 1XD2A 4RKEA 3T34A 3GJ0A 4LJYA 3AVUA 3K9HA 1H65A 4NBSA 4B3XA 3Q85A 1VYUA 3F5FA 721PA 4J0QA 3ZVRA 2G9NA 2ZRLA 4Z54A 5JEDA 2ZYVX 5ANRB 2ZYTX 4KODA 1JPNA 2ZE6A 2OG2A 3DMNA 1CU1A 3MCAA 2DFTA 3AVTA 1QZXA 3M1IA 2PX3A 2ANCA 2Q21A 1FL9A 3K9NA 3CH5A 1QVAA 3PJRA 1DELA 3WNCA 1KSFX 2EFHB 1G16A 3V00A 4CEHA 1XNJA 2P6UA 5UKDA 3CWZA 2A5DA 3TH5A 4LC1A 2OLKA 1FNNA 2D2EA 2OBNA 5CLLA 1NVUQ 4H1UA 1Z0DA 2F9MA 5TXGA 3X1ZA 1ZBDA 4CEHB 5FPSA 1QVRA 2WVJA 1HQYE 5AJXA 1C4OA 1SXJB 3FB4A 1SULA 1EX7A 1FTSA 1ZUNB 4NL4H 1RC8A 3U3KA 4FMCB 5CYPA 2CCGA 4YMTA 4OHWA 1JNYA 2VSXA 3THYB 3SJCA 3K53A 1N3BA 1JXOA 4WIAA 2IS1A 2ZRBA 4W5JA 2ZJOA 4Q02A 4F4JA 1BO6A 3EC2A 3H4MA 4D4KA 4M1MA 4BLQA 3Q8XB 4Q48A 2B21A 1W0KD 1KMHA 3MGCA 3O8BA 3RRZA 4CIDA 3U6BA 3I62A 4PX9A 5IDVA 2ASEA 3GEHA 3JVUA 1E0SA 4ZDWA 2IYYA 1VHLA 4IOLA 1W0JA 3PITA 3ONWA 3MWKA 2PMDA 4Y0VA 5D3QA 3UIEA 3AF4A 3QI2A 4GP6A 2HCJB 4JLDA 1K5DA 3CLVA 4D26A 5E7JA 3AB3A 4I1SA 5F9FA 3U7EB 3CNOA 2J7PA 4G5RA 4HAZA 2NQ2C 3KTAB 4FI3C 4XTRA 1HYQA 5KDLA 5AUNB 2BKUA 4C0QC 2JLQA 2K5UA 4QG7A 4BZPA 1P75A 5FI0B 2N42A 1F2TB 4DUGD 1NVVR 2QE7A 4MYHA 5B30A 2YWEA 3OIWA 3QKRA 2GF9A 2CE7A 2ZJAA 1QHHA 2ZSEA 5ELXA 4YC7A 2J59A 3VR3A 5EP1A 5JLJA 1VTKA 3OESA 4ZI2A 1EFHA 1X1RA 2GXQA 2H57A 3WHLA 4MGKR 4HLQB 2WKQA 3CR7A 3GLFB 1OT3A 4RFSA 2JA1A 2OV2A 3C4JA 1TF7A 2JAQA 4AC9A 2PZGA 4B2PA 4I1OA 3RYTC 5EE9A 2CVFA 3W6OA 4M21A 3T1VA 3I3SR 3BC1A 5TB5A 3I73A 1U0LA 4M9ZA 5BWMA 2PLFA 4E07A 1FZQA 2DWPA 4URXR 3U61B 3CM0A 2NZJA 4JLVA 1BKDR 1QRAA 4FN5A 3A6PC 4RY2A 1W44A 4C7OA 4Q5IA 1W36C 3SJAA 4XVUA 1MOZA 3IBGA 2F1JA 4HEJA 5H68A 2REBA 2J9RA 3FKSA 4GL2A 3AVVA 4KHZA 2J0QA 2IYQA 3UWOA 1S3SA 1KK0A 4O2LA 3VKWA 5J4VA 3QJYA 1G9XA 3Q9LA 1UDWA 1JECA 3SZRA 4B3GA 1NSFA 2QP3A 5AJVB 4DCTA 3JZAA 1KDOA 2VEDA 3SN6A 2W6JA 1LV7A 1E1QD 4D0GA 4HI0E 5GADl 4EFNA 1DE0A 4K8OA 1WF3A 2VRWA 3OIUA 2FA9A 1SXJC 2ZSDA 2O8DB 4HB2A 4KFRA 3GD7A 5B64A 1KI4A 2G83A 2NZ8A 2VSFA 1KSJA 2E1RA 3IPXA 1KO4A 1II8B 2IF0A 1S1MA 1N6RA 5CK4A 1SGWA 2A5JA 1KO1A 4V03A 4XD7D 1CF4A 5DSZA 2ECKA 4HAWA 1ZAKA 4LJAA 2IF2A 4IDQA 3BH7A 5JJLA 1LS1A 2ZRFA 4OK3A 3E1SA 4NCHA 1T4GA 3RS3A 2CEAA 2HF8A 4CEIA 1E2LA 2H92A 4FMCF 2CCKA 4KBFA 4OI2A 4ESHA 3ZQ6A 2R9VA 3HPQA 5KNBA 1EFCA 1XMJA 4P33A 3NDPA 1XXHE 3RDPA 1XBTA 3LW7A 3AF3A 4LX0A 2GKSA 1IOZA 1NN0A 2QPOA 4Z1MA 3SBEA 2CLCX 2D74A 4TLDA 1L8QA 3IQWA 3LVQE 2ZS8A 5JCPA 1W47A 3DOEA 2ZM5A 1N0VC 5H8WA 1U8ZA 4AD8A 3MJHA 4HB3A 4DT1B 4I99A 1U8AA 3C14C 1KI1A 3ZQJA 4LYAA 4LYHA 1CJTC 1G4UR 3H84A 4TQ9A 4TLCA 5KYKA 2GTPA 3PENA 4LCBA 4A2WA 1F2UB 4IXNA 5JHHB 5DN6D 1VCOA 4L8GA 2KE5A 1W36D 3CNNA 4M9XA 2QQ0A 3G0HA 1OYYA 4JLBA 3EARA 2ORWA 1AJEA 2WAYA 3LXXA 4M4SA 1EGAA 4AK9A 4CEJB 4TSFA 5JWOA 1OB5A 1ETUA 1Z2AA 3IPYA 1NJFA 4LY6A 3TK1A 4OKSA 621PA 3C41J 2VP4A 4NPHA 1G5RA 4HLDA 1IM2A 4A4DA 3LQQA 2O52A 4DSUA 1HY3A 4RJLA 4TQUS 3CZQA 4QHTA 3DHWC 3KX2A 4D4LA 1NBME 1H8EA 4PANA 1T0JB 2ZI7A 1T3SA 1NRJB 3NWJA 1XTKA 2A7QA 1E2HA 4GMXA 4C0SA 3EPJA 4Q1DA 4M1KA 1U90A 1GSIA 3BAFA 3REGA 1JAIA 3T1QA 3P20A 4B32A 5EE5B 2MSDB 2A9KA 1JR3A 2ZAMA 3TR0A 3FE2A 4TL6A 4D2IA 2QM7A 2G1KA 1OXVA 2XOKD 2VHTA 3W3ZB 1QF9A 1CR4A 1OFIA 1TU3A 5J4YA 1D8TA 5M04A 1LW7A 4RCYA 4OBEA 3VNUA 2J0UA 2QA5A 2V7QA 2BHRA 3KZ1E 1NVXQ 1YQTA 1RFLA 3LWNA 4ZDKA 5HPYB 1N0WA 1M7BA 4P4TA 2HDNB 2NOAA 3QSYA 5FL7D 1XB2A 1X1SA 4BFZA 3GLHA 1XX6A 2J46A 1Y3AA 1TUEA 4Q4AA 3A37A 4GZMA 2C96A 3FDIA 5FPKA 3R7WA 3U3RA 3OE7A 2MSCB 1E0JA 4HLUA 5CIQA 3UG6A 2BC9A 2FEOA 3ZS9A 2ZE8A 1N6KA 2GK6A 1XXHB 4RZ2A 4F91B 5EJEA 1E69A 3TVDA 2JLRA 1FX0B 3A58B 5GVRA 3WMEA 2HXYA 4PC2A 1GIAA 1GRQA 3MJRA 3AUXA 1D2MA 4TYQA 1WA5A 1FQJA 4B48A 2B8WA 2WWIA 5DYIA 5J4KA 4KVGA 3CZPA 5DE3A 4G5GA 4HB4A 1S96A 2V6IA 1Z0AA 4KXFB 4B3BA 1Z5ZA 2GESA 2JIZA 3X1DA 3QVVA 4ASUD 4TT3A 3C15C 4X8HA 2KBEA 4NP6A 2DB3A 3WYGA 2A5FA 1GL6A 2FZLA 1WCV1 1ZYUA 3TW8B 3AKYA 4JL5A 1WBBA 4YONB 1Z8FA 2ZVPX 1YR7A 4URVR 2QMHA 4YMWA 1L4YA 3VAAA 2IS6A 1AS2A 2GAAA 3FGNA 4H1VA 2V54A 3KTAA 4UJ5A 1E9FA 1XD2B 1N6OA 1N6LA 2EQBA 3W6PA 4GRAA 2GILA 1HEIA 2FSFA 4PXAA 2IYUA 1YR6A 5B58C 1IN8A 4LWZA 1KJYA 1G3RA 1SXJD 4KVAA 4AIIA 3DOFA 4UNSA 4A2PA 3QKSB 5AWFC 3A4LA 3KKNA 5KNCA 2DBYA 2VPPA 1TQ4A 3FHCB 2CL6X 5BYKA 3ADCA 2XB2A 3R9IA 1H8HD 3TMKA 3LFUA 1G64A 2ZE5A 2PCLA 3IO3A 1CJVC 2OXRA 4PHFA 4DZZA 1ESMA 3QXHA 4D0LB 1VECA 2P5TB 4MA4A 4ACBA 4ZIRA 1QHIA 5JI3E 5LD2B 5AUQA 2ZI9A 1E2DA 2RGXA 3IUYA 1OB2A 2OHFA 4PHGA 3RANA 5DI3B 4DDVA 2VHUA 1MRSA 2ODEA 3CBQA 3U7FB 5AJZA 2GBLC 1BS1A 4BFWA 3BB4A 4JLJA 3OZXA 2OSBA 1IAQA 2QTHA 2ONJA 1OH6A 1OLOA 2VHJA 2BBTA 4OK6A 1RRFA 3Q5DA 1A82A 4PHTA 2KB0A 3GLFE 1GZSA 2ZRHA 4CT5A 1XRJA 2PZEA 4ILEA 5FH9A 3I1FA 3ZGXA 3SJZA 1Z08A 3V9PA 5KUTA 1MH1A 1KNQA 2R62A 1EX6A 3BGWA 3DKPA 1G3MA 4A8JA 2OCYC 2PX0A 2BJVA 1CP2A 1MABB 4HDOB 2QAJA 1GNPA 1VG8A 4II7A 2HLDD 4JYCA 4JZKA 3NKVA 3OIYA 3UMRA 1D5CA 2NTYC 2XZLA 4O25A 3SDZA 2IYTA 1U9IA 3QG5A 3MG9A 3B60A 5FBQB 4YXWD 1N5IA 2YC2C 3ZIAA 2OCAA 2C98A 2BMFA 2H8KA 2NGRA 4UXJA 2PT7A 3JZMA 4JJZA 3ASZA 2AN9A 4DLSA 4LBWA 4PO9A 5DGXA 2RCNA 1XMSA 2V3CC 1NIPA 4P4UA 4PAQA 3LD9A 3R7WB 4TN1A 4S35A 2NO7A 2Z6VA 4NONA 5KSYA 4PPNA 2AWNA 1EESA 4RD0A 4RZUA 2JLZA 5FUWA 1GITA 2PZFA 2ODNA 3ZJYA 2FGKA 3ZVLA 3SI7A 4PPFA 3TW4A 2CE2X 5E7MA 3BB1A 3NBZC 2QMUA 3QVUA 1YKSA 1Z2CA 2HF9A 1E99A 2O8FA 4L4UA 4PZZA 1ZNZA 1E9AA 2P0EA 3K0AA 5K8IA 5C2JB 2IX3A 5DISB 2HJGA 4AKGA 1II9A 2J1LA 1W5TA 3VU9A 1R7RA 1IN6A 1SVSA 3TAHA 2EW1A 2XNSA 2ATVA 3L0PA 4Q7JB 4Q4JB 4CW7A 1CRPA 2AWOA 3FWYA 3REFA 2UVQA 4S2EA 1MKYA 3J81k 4Q4JA 5EQTA 2P2LA 4MKHA 4MKGA 3K0SA 2VTKA 2F3RA 1Q20A 3G5UA 1G5PA 3HDTA 1W49A 4MKIA 1G7TA 3FTQA 3X1YA 3AKCA 4PC7A 3QOFA 4BQSA 2X2FA 1AGRA 1GNRA 2P6NA 1ZM7A 1A2BA 2W6ID 4NZYA 4KSCA 3U44B 1FUUA 5EP3A 1ELOA 4GZLA 3AM1A 2ZS9A 3KJHA 4BGDA 4M2LA 1N25A 1XEXA 3OEED 4ZDJA 2CHGA 2D7CA 3R20A 1J8YF 1L2TA 4WAUA 2IWHA 3S1AA 4B44A 4EPWA 2F55A 4GNKA 1KI6A 2GXUA 1QHSA 4PSAA 3BOSA 1XEXB 4A92A 1AZTA 1FTNA 2J5XA 4KYUA 4IFBA 2QGNA 2ZRCA 4TMXA 4Q4LA 2J45A 2VQSA 4PFSA 3SOPA 1DADA 3RC8A 3ND8A 2JDID 1SQ5A 2KI5A 3RS0A 1LY1A 3H2YA 2WM9B 2HCBA 2FDCA 1J99A 2FSGA 5GVSA 3EW9A 3KQLA 2O0HA 3AF2A 1G3UA 3KKMA 2W2XA 3AGPA 1SKYE 4NMMA 4QL3A 3GLFA 1US8A 2AD1A 2WWHA 3VX3A 4ARZB 3H1TA 3HR8A 4ZCMA 3TUIC 1VYTA 4NTZA 1G6OA 3CPJB 4KO8A 4NYMQ 5HZHA 4Q4HA 2GXAA 4JLMA 3LBHA 1RZ3A 2GZDA 3K9LA 1D9ZA 2FZ4A 4AYXA 4B6FA 2H17A 1TL7C 2C95A 1EFRA 1R5NA 4K46A 1G3IA 1M34E 1Z0FA 4WXPA 3TBKA 4CVNA 2QRZA 4LBYA 4PR0A 2P6RA 2YJTD 1J7KA 1E9EA 1II8A 1I4DD 1T0HB 1G1MA 2FF7A 5DH9A 1UAAA 1VYVA 2RB4A 2AD5A 1OH5A 4HAXA 1KI3A 3SJBA 3KQKA 1RJ9B 1M6NA 4HUQA 5FR1A 2ORIA 1FP7A 3DL0A 3FYHA 1Z28A 4O2RA 1OFHA 4FCVA 4QJ5A 4NHOA 4BWYA 1TEXA 2DR3A 1R10A 4EDHA 1CKEA 3UANA 3CRMA 2UZ3A 2XZPA 2QU8A 3AVPA 2AL7A 4M1WA 2ZSBA 1SKYB 2C77A 2I3BA 5JI2E 2IK8A 1X86B 2OCBA 4OI4A 3EPKA 1M1YE 4KFSA 5SZJA 5EE0A 5HTKA 1MRNA 3V4FA 4A9AA 2Q6TA 5HZKA 4HYYA 2IWRA 2CVHA 1RPZA 2VH5R 2J7PD 3CONA 1EFTA 3ZDQA 1GVNB 3IO5A 3T61A 1XTIA 3B82A 2ZRAA 1X3SA 3L0SA 3AVYA 2WHXA 5JHGB 1D6JA 1GRNA 4N0EA 2GJAA 4PSVA 1NG1A 2YC4C 1ZP6A 4QJ3A 1J90A 2O8EB 2V9PA 4D25A 3ICQB 1JJ7A 3A4MA 2ZU0C 4IW3B 3EPLA 2NPIA 1MABA 3RRNA 4JL8A 221PA 4EJSA 4URZR 1XWIA 4OYHA 4R98A 5KU1A 1NKSA 1R0WA 3SHFA 2QZ4A 4WA7A 1W5SA 1EK0A 4A0HA 2BMEA 4M53A 2IEZA 1CR0A 1XDBA 2DFLA 1L7VC 2JJ1A 4E5UA 5CDFA 4ERNA 2OFWA 5E3HA 1CLUA 4R9UC 3KJIA 4HLUC 2WMNB 4Q1FA 1NLFA 3Q5EA 4QBFA 1G8HA 1OPXA 1YZLA 2GEVA 1G8PA 2NO1A 2FV8A 4IDOA 3NC0C 1P3JA 1W2GA 1YZGA 3MUFA 4URYR 1E2KA 1CJKC 1CBUA 1DOAA 4AI6A 4OK5A 1PV4A 3GJ6A 3BFVA 5CJPA 4B74A 2KBFA 2ZRDA 3P26A 4LHZA 4LHWA 2CHVA 2I1VB 3VKHA 1JQJC 3BH6A 3QKSA 2WPDA 2ZUBA 3ZH9B 1OIWA 4MRRA 4AKHA 2R65A 1OH7A 1OV4A 1QG4A 3KB1A 3LLMA 1DAKA 2O0JA 4B3FX 2B8TA 1Q1BA 4DRZA 1CTQA 1COWD 4Q4AB 5F98A 2Z0MA 4RFVA 3RABA 1G8YA 821PA 1MO3A 5KDDA 3THYA 4CYMA 2HYIC 1KO7A 1Q1ZA 4YQFA 4TMVA 4G5OA 2P5SA 4D6PA 4JBYA 1NMXA 5L8VA 4AY2A 4LV8B 5JJIA 1W1WA 3B1ZA 2FE4A 1GNQA 1MO6A 5JECA 4ZCLA 3EZ7A 5BYJA 3MLEA 1N6HA 4PPGA 5FTMA 4LHYA 4NYIR 5DHAA 1Q44A 1TQ2A 2BEKA 4CZ2A 3QBVA 3T06B 1ZNXA 1TF5A 2PLRA 1E9CA 4IVQA 3W8NA 2CBZA 4POAA 2QG6A 2IXFA 4KJZA 2ZSAA 4DLZA 1BOFA 1OFTA 4Q9IA 4TYYA 1ZU4A 1G18A 3U4QA 4C0JA 3GLGE 1NF3A 1A4RA 3NBXX 3NXSA 5IRCD 4DKXA 3NHAA 4PC3A 1MO5A 3AKDA 4Q9KA 3TUJC 2W2VA 2XXAB 1RYFA 1E2JA 3IHLA 4DEXA 1LNZA 2GHIA 3LH5A 3PEUA 1GL7A 2AK3A 4MRNA 3WP0A 1PZNA 1ZD8A 1GRRA 1XTQA 2NO9A 2ZI6A 5JSZA 3IHWA 4ABYA 3ZD6A 3U7HB 1RRPA 1KMHB 4ITRC 1Q1EA 5GJVC 3VR4A 1W36B 4TSFD 5LD2C 4RD2A 1AQUA 5J47A 2OILA 3IKJA 4YDHB 4FIDA 1KO8A 2HT6A 1UF9A 3T15A 2ZJ2A 3WP1B 5LBIA 1E94E 4RVCA 3PUXA 3U7GA 2JLVA 5EZ6B 4F93B 3QXCA 1G17A 5HCNA 2KJQA 2F43B 2AXNA 1QHGA 1KI8A 2WZQA 2DCUA 1GP2A 3LV8A 4DCVA 4PPQA 4UNPA 3TRFA 3U3OA 2QBYA 1H8ED 4EPTA 4B73A 2QPAA 2JLXA 4BFTA 3GJ4A 4DLWA 1PLKA 1Z63A 1E4YA 5KO2A 3UWKA 3IBYA 4CGZA 1M7HA 1V43A 4AYWA 2YINC 1UADA 2CL0X 2GCOA 1LFDB 1KY3A 1XD8A 1JXMA 2FFBA 1JR3D 3ZS8A 2N46A 1W7AA 1XJCA 2WWGA 4PQRA 4Q7LA 3CB4A 3SC3A 2UKDA 5J4LA 2ZPTX 3D7MA 3JVVA 4A8JB 4Q66C 4IRUB 4XOIA 4M9QA 1XCGB 4IOJA 1KGDA 3EX7C 4MGZR 2RHDA 2O8EA 3ADDA 4LJ4A 1R2QA 2R44A 1QHHB 4AURA 3LLUA 1WDTA 3C7KA 3VKGA 4JKYA 5G3ZA 3GP8A 3GFTA 4A1FA 1BYIA 3QPWA 4TWZA 1JPJA 4A6PA 1NG9A 3BIFA 3ND9A 3DDCA 2XGJA 3OAAA 2D7DA 1N5LA 1SVOA 3OFND 4XVRA 3GLIA 1KIMA 1AKEA 1VIYA 1FPMA 1Q22A 3NC1C 1AZSC 1XTRA 4ON9A 1W4AA 1XXHA 2BM1A 5KTYA 1HUQA 4GFDA 3LY5A 3DPUA 1F60A 3BBPA 3L0OA 4EAQA 4HDCA 1I4TD 3RAPR 4RD4A 4B71A 2ZEJA 2JGNA 4TTPA 5D3MA 1P62B 4JLKA 1C9KA 4PO1A 4HZUA 2YWGA 1VCMA 5JWRA 3BE4A 3QE0A 1V5WA 1XF9A 5TY0A 3I5YA 2IC5A 1W4BA 1CRQA 4WVFA 2JLSA 4BPBA 1A5TA 2RGEA 2QTFA 4BLOA 1TQ6A 3QENA 4BLSA 2J7KA 1GG2A 4AWXA 3SR0A 3EXAA 5CB6A 3FHOA 1CR1A 1TAGA 4EPVA 4LBVA 3RWOA 1II0A 3CX6A 3A1UA 2IA5A 3BS4A 1R0XA 4JBXA 4W5WA 2GJ8A 4G01B 3DKVA 3EZ9A 4A0GA 3ASYA 2F9LA 3VMFA 2WIBA 2FWRA 4WZBE 4TTQA 4X8OA 2IUUA 4B33A 5JMTA 4HZIA 1YRAA 1C1YA 1YZQA 4JT4A 5CDFE 3OEHA 4QM7A 1K8RA 4Q18A 4BFYA 3GQBA 4BLPA 5JZVA 4EPXA 3IEVA 4NCIA 2X2EA 3BB3A 4ARZA 2VP9A 1VKJA 1ZU5A 2HEIA 4IKEA 5LDDC 2O8CA 4KU4A 2H18A 3EIHA 2AXPA 3ECCA 2BV3A 3NBFA 4BEBA 3QPUA 1GOTA 4NYJQ 3SYLA 1N5JA 2Z83A 1G8GA 1M7GA 1SVMA 1KY2A 5IT5A 4DC9A 4LC0A 4HB0A 4HDQB 3NH6A 3WNDA 5A0FA 4M9SA 1YZUA 3O47A 2FPLA 1YRBA 4PSKA 2GNOA 1SHZA 4V0NA 3EZ2A 5L3VA 3QF7A 3FKQA 2OZEA 5G40A 3U6KA 2REXB 1W2HA 1OF1A 1VIAA 4OJKA 2VP2A 4TTRA 1X8LA 2G6BA 2JEOA 2QY9A 5JS8A 1E79A 2OFXA 2W2TA 3PUVA 3VR6A 4FXPA 2GJKA 2ZJYA 4LDJA 5IK2D 3LA6A 4D80A 1JQLB 4A15A 4R7ZA 3K0CA 3ZYCA 2FN4A 2H7VA 1X6VA 4JMPA 1OE0A 3RS7A 1LF0A 1HT2E 2OM2A 4PTLA 2XX3A 3QY0A 4M8NE 2P3SA 1AQYA 1NBMD 1NVVQ 4ZDIA 1E96A 1N6IA 1HE1C
chains in the Genus database with same CATH superfamily
4A2QA 1KDZA 1RYYA 2XMSA 1G8JA 2DKOA 3MBIA 2GSWA 5E6RA 4A0QA 3ZOKA 2QP4A 2XEXA 3OQ6A 3V46A 4E4RA 2JBHA 1IEWA 2PGXA 4DLYA 4F2GA 3M4YA 1ZH0A 1LVHA 2QVGA 1N6PA 2G07A 4CQLB 4Q47A 1U7XA 5TMDA 3UG7A 2IXTA 4PONA 3B53X 2Q6KA 3O21A 5BNFA 2OO7A 3PYLA 3KFXA 2VK1A 3NPMA 5FTKA 1EH5A 5CK5A 2JVKA 4V1CB 1FW6A 3ITEA 1HK7A 4ZT3A 4UU1A 1MENA 4ZOAA 4CU2A 1LTHR 4MWCA 2QVXX 3D7NA 3TRDA 2VDKB 2O5RA 3E9RA 4IDNA 3SHVA 4IJ6A 5CJ2A 1C3OB 4U7PB 4CQMB 5TQ0B 4EKGA 1VRCA 2WVGA 4C7MA 4IZOA 2XYVA 3LO8A 1KXJA 1TMKA 2Q6VA 3LRTA 2HHAA 2PMWB 1N1EA 1UT5A 3MJTA 2QLBA 3GDGA 4NU5A 3PXGA 2LPMA 4ZZ1A 3NHBA 3C6MA 1CY4A 5IVDA 5GM1A 3SEZA 3OP1A 4HNGA 5LB2A 1XCOA 3DTVB 1A8SA 1GV1A 2AEMA 4N3GA 4F60A 1BMDA 2JFNA 2QRVA 1P77A 2BMAA 5AVQA 1MF7A 3C5CA 2H5IA 1MPXA 1WULS 2J4CA 3UC9A 1TMYA 3LO5A 4OBXA 4TL7A 4Y67A 1L4LA 3L0BA 4I1VA 2DQZA 4JS0A 3BJMA 3V1TC 3W1WA 4JUDX 2Q4DA 2VP0A 5AHRA 1F8FA 2POCA 1XAGA 2H11A 1CJUC 4LOKA 1BQ4A 2P9CA 1SXHA 4P3YA 1KFKB 2FEMA 5TS2A 2HWXA 5SYAA 4LIPD 1KDTA 2EZ4A 4UU7A 3R3UA 2AFIA 4QYXA 3ZD7A 2PZ8A 4DBLC 3AP3A 4X6UA 2ZTSA 3CHYA 2P4SA 3HYLA 5A9RA 2A5LA 3ZEIA 3LUHA 1N9GA 3HGMA 1I7SB 2H16A 4FS3A 4YT8A 4PINA 4P3NA 4P4SB 4TRRA 3AJEA 3P2YA 5KYWA 3GCWA 1BE1A 4XM1A 2NM0A 4LZOA 4OATA 1ADFA 4V3CA 3EFEA 3IBTA 3L49A 3MWLA 1GCUA 4I5EA 3D1VA 4XSHA 4DIEA 4BWGA 3DCNA 3QNUA 4JNKA 3N0XA 1ENYA 3KUUA 3MYYA 4MRSA 3WLHA 4DLVA 1EMDA 1V11A 3GMDA 1EP2B 3FN4A 5ES4B 4MWTA 3PXUA 4G89A 4GZ6A 3WY9A 1GPAA 3WLRA 2Q6OA 3O8DA 4UNQA 3WNBA 3OX2A 2WSSA 5HR5A 1UJBA 3GFFA 3ZE2B 3X2SA 2PTHA 5H9WA 1CJBA 2YN0A 4Z4HA 3HN7A 4H6VA 4RAQA 1P2DA 2GEKA 1IJEA 2ZR9A 3BTOA 3G8AA 3IPAA 2MT9A 2NQ8A 2WIAA 4H60A 3A3NA 3ESZA 2GRUA 4OH7A 3UOAB 5HIAA 4TZ0A 2WJZB 3QE2A 1TFRA 2WD9A 3KWMA 6ABPA 3MTEA 1SHKA 3OX3A 3DL4A 5JC1A 2BKAA 1GXSA 3FZEA 4O4HF 5C1BA 4FQ8A 1HTBA 2LUOA 1LPBB 2YHIB 3TNYA 4CQLA 1TEVA 2R47A 2ZPAA 4RHUA 1AZWA 5EE3A 3T12A 1J1ZA 1L4FA 3LXUX 4K3UA 3CB2A 1TD9A 4X45A 3ENWA 1JQDA 2WFLB 3N6XA 1E32A 4DGSA 3U40A 5HKBA 2C7BA 1B0UA 4EQ6A 1CF9A 3MRSA 1OJLA 4BLRA 3PLRA 2FHPA 3D1LA 5KHLB 1HEUA 1DCTA 3R5SA 2O8BA 2W58A 4JIGA 2IV2X 1YE3A 1E3EA 3ZK7A 2GETA 3DG9A 3ZHBA 3P8ZA 3EGEA 3HM2A 1E6EA 1VLHA 5JADA 1PFWA 4DNPA 5G4LA 1SOAA 3C8HA 3NEYA 5G2OA 5ALDA 4MA5A 2WU1A 1VL0A 1IPEA 1KF0A 1QMPA 1C7EA 2WYUA 2YWXA 1JYEA 1ZM2A 4OHFA 1OX5A 4LMPA 4WGGA 2UUCB 1CF2O 4RE5A 5EQJB 521PA 4A82A 2H4JA 1T0IA 1O95D 2I0FA 1QH1A 3PC7A 4MJ7A 4XQEA 3VSAA 2OEPA 2OE2A 2PGOA 4ENPA 3DO6A 4IVRA 5H1YA 1HI9A 2J3QA 3MQ2A 1FYVA 3TXXA 1OIXA 7REQB 1PZEA 3DONA 5GJWC 5A5FA 3TTUA 3HB1A 3KV1A 3OLXA 2C9DA 3ZQKA 1OI4A 3O8RA 3IXQA 4RADA 1XMIA 2I7TA 2Y8EA 2JZNA 3CEMA 1L5KA 4LPKA 4B46A 3AEXA 4AKSA 3V33A 1DWUA 4YAEA 5CBPB 3X0DA 2BBSA 2G0TA 3I6ZA 4JLPA 3I9V6 5E1MA 1SBHA 4ZAWA 5LFAA 2JIMA 1AUQA 4DQLA 1UMDB 5FBKA 1SD1A 2CJWA 1L4MA 2DFKB 2V55B 3IGFA 2Q1TA 5HG0A 4MR8A 3SEQA 3ZUPA 1L7BA 3NOQA 3RV3A 5IDYA 2YFQA 3E3AA 4G1CA 3T35A 2GAJA 3RRYA 1QMGA 5A1TA 4QDKA 4UDYX 4E30A 2QSUA 2LRHA 1RYBA 1VSUA 1ADCA 4I4TF 2XTNA 4UAGA 1ZFNA 3O4RA 1RR6A 2WWTA 4DNQA 4EL5A 3K9GA 2OCXA 3QUCA 3UCEA 4ALJA 1OH8A 4EGAA 3B78A 3B5EA 3A1CA 5BW5A 4FEGA 3WFZA 2DWOA 4O4JB 4X94A 1BHO1 4Y2XA 3DKKA 4FSXA 5A0VA 2RHMA 3MD0A 5A9TA 3LDFA 1YIDA 3JQQA 5CT8A 3FB1A 1PR3A 2EBUA 3LQKA 5FD8A 1W0JD 4C0BA 3IILA 2CNWA 4CNBA 3W5BA 2HJRA 3OQPA 1P60A 4A27A 4F96A 1U6KA 1KJNA 2N75A 2OORC 2A9FA 4B6SA 5LLTA 3BQ9A 1OW3B 3WC4A 1ZK2A 2R2AA 1G7RA 3FPGA 4N3NA 2VI5A 1VE1A 2HMAA 2YRXA 3CEPB 1JJVA 4CQJA 4M9CA 3K70D 4HNQA 2WA1A 1UR5A 1E61A 1K6EA 1XYYA 2VPIA 3L7DA 5EKXA 3GLGB 5HUJA 3LIPA 4HQNA 1UXIA 4WESB 1DQNA 4NMLA 5AUOB 1IXRC 1GEGA 3TQTA 1RRMA 2C5FA 2H51A 1MX3A 4M7RA 4ETMA 4EA8A 5TT1A 4P2GA 5HRUA 4EECA 1DIGA 2GK7A 4FFVA 3ZNNA 2A9VA 2ZYDA 3DB1A 1SVLA 1Z0KA 3IP5A 4G84A 4GMGA 2XJ9A 4RS4A 1E98A 1SRQA 4D99A 3U9TA 4FOSA 1QVVA 2XBUA 5AMXA 3ZWYA 2FFHA 5CLIA 5G4KB 1RKUA 4N54A 5AJYA 3VDNB 1YK1A 5LZ4A 4Z8XA 3PQFA 1GILA 2DYKA 5F2EA 1Z82A 4BQOA 1NFFA 2AG6A 5TIIA 1BIFA 1P39A 1MG0A 2EW2A 2XVMA 4HDKB 4UVDA 2WP0A 1DAHA 3X1XA 2WFMA 3B8EA 4JB0A 1RVDA 4ZT2A 2HYDA 1P7PA 4QO7A 3JASB 3KDPA 2RGWA 1L3IA 1GUBA 4WFJA 1WSDA 2BMJA 2C4HA 2P35A 4Y2UA 4ZMBA 4LOHA 1JDNA 2MYTA 1M3SA 2QXTA 1ZVKA 2Q5EA 3SHWA 4B6EA 4OJQA 5SYNA 1XPUA 4L73A 2G40A 4RK5A 4EHAA 1ORVA 2C9CA 1T1GA 4YXFA 2I6QA 3I04A 3ZWDA 4EP1A 2P6PA 2QTTA 3DC7A 4YMUA 5L4SA 1EK5A 3ODGA 5K3CA 1QKKA 1KJJA 2QE6A 3I64A 3I6YA 1W7AA 4UNIA 1EX1A 4LUCA 2YKGA 4CWAA 5EXSA 1SXJA 2JFPA 4OQLA 4QDTA 1BX0A 1QH8A 3D5TA 3E2PA 3A6FA 3FOBA 3HJRA 2PBRA 3B6JA 3NASA 1QLWA 1ZOLA 2ZGVA 4PC1A 5IJ0A 1FYFA 2HREA 3ZNQA 1JEQA 3KPUA 2QLTA 1AF4A 2DVMA 1WKCA 2WJIA 1MFPA 4ZODA 4WNAB 4MROA 4WKNA 5DTRA 5IEBA 3GLRA 3THXA 1BDJA 4HYEA 5F4ZA 5FOWA 4Y9TA 1WXHA 1EEXB 2DFNA 3ZHZA 4CT0A 3ROXA 4EENA 2OECA 1FRQA 2I8AA 2J5KA 3FFBA 3NBKA 1CQXA 5EWMB 4XWKA 3FG9A 2GN1A 5AHXA 4ZFNA 3B1WA 3KQNA 3R6LA 4QM6A 4MS4B 3TEJA 2WWFA 2JHFA 3T5PA 3C39A 3O95A 4IDHA 1RKXA 3HBMA 3RHSA 1EFPA 4LAFA 2B3DA 4ESEA 2JIQA 1USGA 4WXMA 4XR9A 1B8VA 4O29A 3I76A 3WADA 4C0LA 4NCXA 3FDFA 3MWYW 2O19A 4C76A 3LGXA 3OCWA 2PUAA 4NZ9A 2OP1A 3HN6A 5DT9A 2OPHA 1XRRA 2QP9X 3CW9A 3L8FA 2PXCA 4UAJA 1Q7EA 5C1IA 4C87A 3HJTA 5HE9A 3FOEC 2P3OA 2GN6A 3JQBA 3A4NA 4RJ2A 2F48A 1HA3A 5HE8A 3RC9A 4KH0A 1GYQA 1VRWA 1NXQA 4RPIA 1SBIA 3QHQA 3O2NA 3DHYA 1YH3A 4AW9A 4LKOA 3ZCPA 2HO5A 2JJ8A 3C7AA 3N2LA 1RWWA 3EE6A 1BROA 4DLXA 5EWJA 1FFBA 2QTGA 3HVHA 3U4QB 3LA8A 4C78A 2QT1A 2YJ6A 1C0PA 3EH1A 3KYCB 3WIOA 4PZ0A 3UATA 4AZVA 4F7DA 2CVQA 2PS0A 3FI9A 4V0QA 2D8AA 4I4LA 3COSA 5GV7A 1DAMA 1WU8A 1YOVA 3K30A 2GDJA 2AEFA 2BZ1A 2ZP1A 4KNWA 4M22A 3D8NA 2E9SA 2VLIA 3BM5A 2AOXA 1Z75A 1SA0A 2GPJA 4OJMX 2CCJA 4L7VA 4LXQA 3T5BA 3VHXA 1QV6A 1Y5IA 1VMAA 3L18A 5K8TA 2GJ9A 3OCCA 5AKKA 3A4TA 1SB8A 1OXUA 1AQNA 1BJTA 2A9QA 3QFSA 3VO1A 2FZWA 3E3MA 2AT1A 2JGRA 4R3NA 3UMJA 3IDQA 3JY6A 3KZMA 3ONFA 3I6IA 5BQ5A 2VF4X 3II6X 1M0WA 4YRZA 3OZVA 4JC5A 4MW9A 3AIMA 3K0CC 3O8QB 2P6MA 2JG3A 1CNEA 4AN4A 2FGJA 4PO8A 3RUDA 4BDTA 1H4TA 2XNDA 5I7SA 4CMCA 5ELLA 2J32A 1F14A 1ULZA 1X7ZA 2D4HA 4YRQA 1SKUA 5KVCA 1SCQA 1TVMA 4UPEA 3PUWA 3RBVA 5JFOA 4GPD1 4EYEA 1XT6A 5E7QA 3BD8A 3SM3A 4MUYA 1POWA 4HZUB 4V1CI 5FBWB 2X9NA 2BFBB 2IL1A 3FYUB 1RBZA 1V8FA 4LY0A 4W6ZA 2AFHE 1X0VA 2WV7A 4DQ0A 1ZOIA 3K96A 2PMEA 3VXKA 3FI0A 2WDZA 3GWGA 2I91A 3O94A 4IAOA 3H9UA 4L6AA 4IEEA 5KREA 3FY4A 1KZ7B 5EL0A 1FLVA 4G0UA 5TR9A 3D64A 2J09A 3H6GA 1ECCA 2CD7A 1PL7A 1DARA 2NACA 5ALJA 3RJTA 3S3TA 4A0RA 2Y93A 4MUKA 1MPTA 4KXWA 4OJNA 1ZM9A 4XWOA 1YF3A 1ND5A 1B15A 1Y8CA 4M7WA 4FX5A 4TS1A 2ZI5A 4BNUA 2C2MA 2JCBA 1R5OA 5ALHA 4Z9AA 1F12A 1EWRA 2UUPA 2NU8A 3V4RA 5ULLA 2DEUA 3AB7A 4M1TA 4F5DA 5JAUA 1WDWB 1LH0A 3BIOA 3DOCA 5DHFA 3I2YX 5JV5A 3DUFA 4PSCA 5P21A 1K9SA 2I99A 2CLSA 1OFUX 2NYUA 2BY4A 2WSMA 5CXUA 3JVEA 1E2MA 2XUHA 3QQ5A 4DIBA 5SZIA 4CLDA 3TSWA 3OZAA 2P2CA 3UWPA 1EFVA 2JEYA 1F2VA 1AXEA 2HLPA 5FOTA 4B4UA 2HJVA 3ILSA 3TSYA 4IDFA 2G0NA 2OHGA 4TT3D 1Z4JA 1W35A 2FH5B 1WXGA 2B20A 2CNOA 1IZYA 2YIDA 1LSJA 2QN6A 2FWNA 3H11B 1AMUA 4WK6A 1SPBS 3OUZA 1A9ZA 2QV0A 3F6YA 5HMLA 1ETHA 1XAJA 2WYWA 4XRGA 1XVIA 4Q12A 2Z2ZA 1JA9A 1H2WA 1LC0A 4ER5A 3RYHB 3R75A 4BL5A 1GR0A 2F9FA 5FI1B 2O2ZA 1UM9A 2XRYA 4P0TA 3D2AA 1Z6XA 2FMXA 3LUGA 2BCEA 4L2IA 1KZGB 3JAKB 3FOWA 4HDRB 1SFRA 4FZVA 4WV3A 3MWEA 5DU2A 5FUQA 2P90A 4GKJB 1DFIA 1JIUA 1UJ6A 5AI5A 3KJEA 3IKVA 5DWQA 1NN3A 1G21B 2V7VA 4TVSA 4UHKA 2HV8A 1N0UA 1JHUA 4US0R 4KPFC 5JRJA 4DJFC 2B7LA 1F5NA 1PLJA 1PR4A 3D3EA 4DCPA 4F38A 4JI8B 1G6KA 5E8RA 4CM4A 1AK9A 4Y2RA 3COJA 3HKCA 1WABA 1PNRA 4IIDA 1JR3E 3GRVA 4ISCA 1P4JA 2IYEA 2P68A 1C3EA 1U31A 4NBUA 1DBIA 1C3LA 1U02A 1MT0A 5KOYA 1AKRA 1SVKA 2OBMA 2ZRPA 4J1TA 1D0IA 4JAVC 5CVJA 3AONB 2GEDA 3CISA 3VNAA 5LQKA 4HLCA 3VOBA 1PUXA 1DAOA 3OPXA 3JX9A 2WJWA 5A4JA 2I65A 2YICA 4W7IA 2G76A 2Z08A 3JQGB 1FSPA 1AS0A 3Q2IA 4OFXA 5NULA 3SEAA 3LOPA 3NR2A 3FMFA 1TJ3A 3F6EX 1R8JA 1E1RD 4WCDA 5GTDA 2IW3A 1E4VA 3C7CB 2FVXA 3TW6A 2RGCA 5DOVA 4JITA 3FHJA 3SY8A 2XB9A 3WGTA 4CTNA 3WQBA 2UDPA 3GNQA 5F2OA 1YZTA 4CGYA 3PLNA 3IUEA 2FG6C 3BL5A 1KEPA 4JQOA 2WTBA 4PZYA 3IEKA 4Q4HB 4GQBA 3HYTA 8MHTA 1Z0JA 3BTVA 3CU5A 1Q1QA 2NU7B 1E6WA 5E2AA 4W82A 3T0IA 2Y1LA 2EFGA 1BXZA 3GAZA 5AP9A 3WMWA 1FMFA 4F7WA 5BRJA 3IVGA 4XQGA 1PWHA 3P1JA 2EFCB 1FDWA 4M49A 4F84A 3OZFA 4OKNA 3WK6A 3KKOA 4LWPA 4NENA 1E2FA 2Q3DA 3BAZA 4QGHA 3GT3A 5AM1A 5C8YF 2Y1GA 3GUZA 1YJ8A 4PM4A 5IP5A 2Q27A 1WBDA 4AIRA 5KCZA 3ENKA 1PVDA 5ARBA 2Y99A 2CXSA 3B8HA 4F3RA 1BXKA 1FFXB 2RHHA 3HGTA 4IXTA 1G9SA 4WRRA 1UPUA 3UK1A 5LB4A 2DQYA 1OREA 2R6AA 4P31A 1J8FA 1OPRA 3EIUA 4XWGA 3P5BA 2VH2A 3QUQA 2Q9CA 4IM7A 4X8MA 5FUVA 2VSOA 4G26A 3ZIAD 1IHPA 1YD7A 1AKUA 4FFBA 3K2EA 2GVDC 3RC3A 4WBNB 4BVKA 4RIFA 1LRLA 1N77A 3K8ZA 3EVCA 3JQ7A 4EBFA 4MMXB 3KT3A 4MVCA 3TTXA 3WO1A 4YMGA 4K05A 3MS2A 3TE6A 4EY8A 3PC4A 4HMPA 3RIGA 1JFFB 3IAUA 3CRQA 3VPBA 4FFOA 1AHHA 2QRNA 4TSKA 3BRWD 3NI2A 4BVFA 4DWJA 5BVGA 1EU1A 1Q0SA 3DV0A 5A3JA 2IUFA 1ODJA 3B9RA 4MUXA 5IDWA 4QPPA 1H94A 2C9YA 3AESB 1KHTA 3CRW1 1VB5A 3FMOB 1MC8A 4JEMA 1FSGA 4B3CA 3VZDA 3NGXA 4Z3OA 2B35A 3TTVA 3UJNA 1IYZA 5A5VA 1UXKA 2IYSA 3TSCA 1OKKA 2WPNA 2YV5A 3RBAA 1JBKA 1A8QA 4MO2A 1HKHA 3K1TA 5EZQA 5BRNA 3O9MA 3R7FA 3WHKA 2IITA 2B2NA 4QATA 4B8WA 5KNDH 1G2QA 1MQSA 4OQNA 1I0IA 3CEHA 5JYEA 1IHUA 3T9AA 2VP6A 1HETA 5AVZA 3NOOA 1ZXLA 3X1JA 3TSAA 1GGJA 3NTVA 2PUDA 1B2LA 5HBGA 1NNI1 2Q3CA 1BEEA 2B8JA 1DNPA 4WD3A 5KHOC 4E88A 4F46A 5JRZA 3BK7A 4LV6A 4M1ZA 1TEHA 4DV5B 1CEYA 1J20A 3ISJA 3Q1LA 1DG3A 1DUVG 2C7VA 3CX7A 4GBJA 4P6VF 2VHCA 4K6HA 5EIHA 1I5EA 4AAYA 4QGSA 5EJ8A 2MINA 4WCFC 3F3SA 3OE4A 4QWWA 1K06A 4LJ5A 3OG9A 4OG2A 5FWYB 5AVXA 5IYZA 4DB2A 4R1OA 1U5CA 4X91A 3TIXB 1HLFA 3U3ZA 2BBWA 1MT3A 1Q0TA 3A7EA 1H1LB 1B1AA 4Y6RA 4DXAA 1R4NB 1IY0A 1LDMA 4ETWA 4CKCB 2WIJA 5EJAA 4RUKA 1NN5A 2CXUA 2P4EA 1K4KA 4IQ4A 3OQMA 4IHQA 3CZRA 4K9KA 3LCUA 2ZVQX 4UCXA 2BI4A 1U98A 1UAGA 1LBSA 1L5GB 3H2IA 3RRMA 2Y0BA 3T7SA 2C7RA 3Q98A 4JX8A 2D2VA 2JANA 5B3KA 1P1KA 2DE0X 3LQ1A 5HNKA 4XJXA 3GJ3A 4QBIA 2CT8A 3H8WA 1O5OA 3EMKA 4P3XA 1LVGA 3I32A 5AW9A 3O90A 1R0YA 1XVVA 2Z8XA 2C4NA 3GT4A 3LX5A 2L0XA 2GYWA 4BP1A 2G36A 4LHVA 2BFEA 3D4OA 3A26A 2XWQA 2XUKA 4G85A 4WZBB 5K1ZA 2QGZA 4Y7CA 5T5QA 4MVJP 2BHNA 4I4TA 3EXEA 3RM3A 1N75A 2DX7A 4OHYA 4BMDA 1IOWA 1D9XA 2IEBA 2NZUG 3GGPA 5F7XA 4GC5A 2QUHA 1T91A 1RZRA 3GJXC 3E9ZA 3MHTA 2FW8A 2PL3A 5KJ6A 1E7SA 2HHLA 4WQMA 4KQCA 4I8DA 5F12A 3EIXA 2QSZA 4N9QA 1U63A 5K2OA 4DR6B 3G3EA 2VF5X 2J4FA 3SS7X 4MS1B 1JF8A 4X20B 1OHHD 4HH0A 4B3RB 1C9EA 3PXCX 3VSBA 4OOEA 2Z8YM 1OLSB 1G21A 2EBWA 1GZ3A 2EL7A 3I0NA 4HNAB 1PQ4A 1EFRD 2VWQA 2QJWA 3PHJA 1DV2A 4HO1X 4CG2A 1RYEA 1M54A 2FZCA 1J9ZA 4S1WA 3G68A 4J2HA 1YIOA 3IMCA 4LJKA 1QS0B 4L27A 5I9TA 4ENRA 2IKSA 4HSEA 4X00A 1YKGA 4BO4A 4QNMA 1KKUA 2OYRA 3LECA 4EHBA 1E2IA 4NK4A 4PTYA 4LXYA 1U9ZA 3UJ3X 3N7UA 2ZM6B 3EEYA 4WASA 3HADA 5F2KA 2VIIA 1VPTA 2GGSA 1GPKA 3QU7A 4FTWA 3TBHA 1NVFA 3ORRA 3VFDA 2ACVA 3NHPA 4IDEA 5COQA 2FWIA 2B1RA 3LE8A 5J2TB 3EWAA 1ZICA 3Q87B 1N1DA 3GFOA 1X42A 4D44A 3ICPA 1CHDA 4M0LA 8OHMA 1BTOA 5IJWA 2F6RA 1LDNA 4UUAA 1JHDA 2YWRA 3E5NA 2V7EA 5TE9A 3IELA 4PQYA 3DLHA 5LQRA 1MORA 2VA9A 2CNWD 2WABA 4ZXFA 2NUTA 1YFLA 3VJMA 1ZVVA 3BHMA 1MNAA 1RYHA 2IE0A 2VXYA 2CD9A 3LYHA 4KSBA 2GK3A 5GJCA 5IBPA 4F12A 5BSKA 4HQ6A 1GAJA 3WIBA 3P71T 4E5VA 4O2AA 4ZANA 3NTXA 3FTFA 3LC2O 3WB2A 5T4HA 2JARA 3L6OO 1E2PA 1RAAA 4CTMA 2M6RA 2X58A 1JSRA 3F4KA 5CA1A 3BL8A 4RDCA 4RY9A 1GYPA 2ICAA 4L5YA 2H06A 4U6QA 3AEZA 1K66A 4I36A 5B2ZA 5I7AA 5HQ3A 3OAAD 3EC1A 3FF4A 3ER9A 4RMIA 5CIWA 3F9RA 1TMOA 3PFKA 1P33A 3FVTA 1I30A 3PRHA 1C1XB 4NR0A 4PGHA 3UV3A 4FILA 3KKQA 2JAXA 2QQEA 3AERB 3AGQA 1JJFA 2HHHB 4QTTB 2FMIA 2PZLA 5CIYA 4MDFA 3FZGA 3E53A 4H3SA 4L8FA 1U28A 3FCYA 5AHKA 2C5GA 1WUIS 2YWJA 2JASA 5H70A 3BX1A 3RVOA 5ALWA 2WT4A 1ZSNA 2FU5C 1NWCA 3RRJA 2B6HA 1YZNA 1PGQA 2HBRA 4MRAA 5F9HA 1RM4A 1XN1A 2WU3A 1JSCA 1ORHA 1PK8A 5DGIA 2QXYA 1U2QA 2WVAA 2D1SA 2X2OA 1R6AA 1TFUA 1KYYA 2NV0A 3DTNA 1N1MA 5MFZA 1U3FA 1PJSA 2HCRA 4DCOA 1UKAA 4MSUA 3HLYA 3GGGA 4C6HA 3QLUA 2DY1A 1ZIOA 4X1YA 4ACAA 3IQFA 3U44A 1FJHA 1ZD1A 3TI9A 1G59A 1L5HB 2OZPA 2I55A 5ALIA 2DPLA 1BRTA 3BMNA 4ZU3A 2F3TA 4DEVA 2CF6A 2HQSA 2Q1XA 4DG8A 1YQUA 3KLBA 4M55A 3HGQA 5KZMB 2D3TA 2FFAA 4RSMA 1DTWA 3T52A 4L8YA 4L57A 4XDGA 2C29D 1AD2A 3L9WA 2O2EA 5LZ7A 2R8OA 1J39A 3VVCA 3WRYC 5A5GA 5BV1A 3BXZA 5LQMA 1GCGA 1U0OC 4GOJA 1JPVA 1GY8A 3PR3A 1WPGA 2QUZA 3GLKA 2G77B 1A95A 5HFJA 1DJPA 3U17A 3CVJA 1ECPA 3LYLA 1NMYA 2BM0A 5DNAA 3W34A 1R64A 4C1BA 1PCXA 5IKOA 1TM1E 3EA0A 1IE3A 3KOUA 1FB5A 1HOXA 1XZIA 2PEZA 2X1VA 4ZYVA 3DR5A 2XMPA 4OF4A 1AXRA 2NUAA 3CF6R 3KUCA 4MV3A 3SF0A 2K2WA 2WWXA 1ZOSA 1SIBE 4Q19A 4J91A 4UTXA 5TY0A 3TQRA 4EVSA 3IT0A 4IOKA 3N28A 4XCVA 4W1PA 2PYDA 2PZJA 1NDQA 3PFGA 3PNOA 4URUR 2BIFA 1A50B 3H18A 1FDSA 1HZZA 2PS3A 2VN8A 1H3NA 3KS9A 3TLMA 2VG8A 3TX2A 1FU7A 1HDZA 1W73A 1ECGA 1WBJB 1T9AA 2HGZA 5ENDA 3RVDA 5A1JA 1M9NA 5IHPA 1GFIA 3P9CA 4JL6A 5ADWA 5JSUA 3BORA 1OASA 3LBNA 3VZRA 1W88B 2HZBA 1F17A 1UDXA 1O87A 4HQKA 4TLMB 4M0KA 3NAGA 5JNSA 2X77A 3PGMA 1I3OA 2OV6A 1VZ2A 3G5LA 3EG9B 4KUHA 2XCLA 3PR1A 3URMA 5L6MB 1E79D 1U7PA 2YVKA 4AB1A 5FOUA 5CEEA 1O0BA 3WRVA 4U1RA 1GZ7A 2WOJA 5BSUA 3QK7A 3OQBA 1XLTC 2PPVA 5K03A 1DC3A 2J4DA 1XZMA 3KEFA 3O82A 3QKUA 3RE1A 4MWGA 1LPOA 3L7YA 1HH4A 1U7TA 4IMPA 2QMOA 4O2AF 1T29A 4PS0A 2RBGA 5K0LA 5HOQA 3ZU6A 1O54A 3PIDA 4NHEA 3ICVA 3H99A 3JPYA 4CIXA 4DFDA 1EG7A 3E0QA 3OZTA 4RA6B 1IJFA 4G97A 2BAGA 1TM4E 1N5KA 4WNAA 1WG8A 1ZCBA 2WMYA 3FUVA 3OEYA 2R11A 1ZIYA 2QX6A 2GVZC 1QR6A 4N5NA 1JSZA 3RSOA 1GG9A 3WQSB 1DWQA 4JOCA 1ZK1A 5FQNA 2TMGA 2CBXA 3RUEA 3UGTA 4G0WA 2IYRA 5HVNA 2XA9A 5IXSA 4AY6A 1P4SA 1W48A 1ZMTA 2B4KA 3HB4X 3KJNA 1TYZA 2EV9A 1X3LA 5FR2A 3ZD8A 4BTEA 5CB8A 5IS2A 2ZUTA 3MRXA 5JZ9A 1SUAA 3ZIDA 4H18A 2XRFA 3B70A 3I6QA 5JD4A 1XCPA 1WPXA 2EX4A 2R85A 3CCBA 3CS3A 1U1EA 1Y3DE 1P2TA 2Z2IA 2VF8A 3DLCA 3BQNB 3ZV7A 5HKKA 4IX1A 1A7AA 2FP3A 2NYVA 4RD3A 4W5HA 2WFLA 1Q11A 1JU3A 4KRGA 4OHRA 3K1AA 1ADGA 3HI4A 3HWWA 3WGHA 3UBTA 2XNDD 4ARAA 3HM9A 1Z3CA 3S2GA 1KORA 1SG6A 4MVJH 2Z3WA 2A78A 1V25A 2C5HA 3GJ7A 5FOVA 5CEJA 1JFFA 3LSYA 4BB6A 1HZZC 1L4HA 3ED1A 9LDBA 2LD4A 5HMMA 3AYXB 1U94A 2QAIA 4UAUA 2IYFA 4X93A 5K3EA 4YP1A 4W1QA 4DT1A 1N2HA 4DQUA 3OZWA 3D0QA 1A1VA 1C0KA 1MIOB 1MGOA 1WKBA 2ZULA 2ES4A 3NYRA 3OQOA 2C5EA 3G8BA 1QBKC 4PGMA 4E2YA 4HUTA 3PFFA 5JD6A 3CIOA 1ZJ5A 4J7CA 2EDAA 1E5LA 1GUYA 2TYSB 3NWOA 4KQMA 1PT5A 4YPOA 1OXTA 3UTCA 2QI9C 4Q6WA 3KOZA 1ONNA 3V80A 1PNOA 3K8QA 4GLBA 1NNLA 4GOKA 3DL7A 2C78A 1T4CA 3P9YA 4G25A 2I7CA 5JMWA 2NPOA 5C31A 2FSIA 3EFOB 5CLQA 3K1JA 4P08A 1A0OA 5EESA 1HR0B 1Y8QA 2CFSA 2XJ4A 4IJVA 4BVJA 2PY6A 4LJ7A 4C7OB 2YFHA 1I10A 4NZZA 4PYMA 4KN6A 3CWCA 2IH5A 1FDOA 2NSHA 4CKWB 4EPYA 3A2KA 3EWSA 5SICE 1PQYA 3PRYA 1ZI6A 4OIMA 2M32A 2QJTA 4DSOA 1JR6A 3QW2A 2DCMA 2ONZA 4OSOA 1DV1A 4UHJA 2XITA 3SNKA 4JYZA 3O1IC 1PR1A 1DCMA 3DV9A 1IUPA 4QXPA 3ZDDA 1NBEA 1S9HA 2GCPA 2Q28A 3TNJA 2NWQA 4FFNA 3DUWA 4RYDA 4Q05A 1VBFA 3SE0A 5HIKA 2ZCJA 2MR5A 1FYWA 3VKUA 3T54A 3ZWPA 3KPVA 2GFIA 4K88A 3B5JA 2CBGA 1CP3A 1OX4B 4LTDA 3UBMA 3P32A 4OXQA 3U7IA 4P7KA 4YJKA 1PQWA 1XXLA 1N5OX 2EQAA 1ZUIA 4RIEA 1NU6A 5JANA 5I4IA 1QK4A 4E7OA 4LF9B 4MHOA 2HMYB 3A3OA 4GYYA 3W3AA 5B1DA 2AC7A 4Y8VA 1A27A 3TKAA 3QQPA 1XWFA 3X1KA 1PJLA 4JT2A 4MVJI 3ZX4A 5C5CA 4X1IA 3L8YA 1DQZA 2IHBA 3PKZA 3SSAA 4TTVA 3TGPA 1GSOA 1M2OA 4L9WA 1QCYA 2P2ZA 3H5LA 4MUNA 4N5IX 4ZYLA 2UYCA 4R5HA 5EJ4A 4JIMA 1WSAA 1TZCA 4LVCA 2VT2A 3EC7A 2ZSFA 1C81A 3PFNA 2W2KA 3O8LA 1N2CA 4AJEA 3ZWWA 1A9OA 4Z3KA 4EHKA 1UT6A 2VYFA 4LV5B 4YUWA 1ENPA 2W6IA 4RD1A 3TD6A 3I28A 5AW3A 1OFGA 4INOA 4L5CA 4DYHA 2YW9A 3LHIA 3MINA 4LBZA 4GG1A 3C7DB 3BDAA 1PYDA 2XGGA 1OLSA 3E61A 5IJXA 3CVUA 4Q00A 4WUVA 1SUIA 5DWVA 1WXXA 5A7HA 4DEYA 5DNEA 1U3GA 3AV0B 2X19A 2P9YA 1CUFA 1NUUA 1RYZA 2AZTA 3QPVA 2BE9A 3VPHA 4JQZA 5TPWB 3UPTA 4LJYA 5EAIA 4NBSA 1VYUA 3NGMA 1U7ZA 2ZRQA 4YDRA 3F5FA 1M1UA 4MV6A 2JCYA 3DZBA 5CX4A 4ZYWA 4J0QA 3ORYA 3L77A 1T13A 3FX2A 3GFRA 2YXLA 3FFXA 4RAOA 2P9FA 3QEBZ 2ZYTX 1P1RA 3I09A 2ZE6A 3MCAA 3DMNA 4KODA 1AQIA 1D1PA 2R7AA 2DFTA 2RI6A 2DG2A 3M1IA 3W5VA 4DTCA 1WZ2A 4GKKB 2ANCA 2Q21A 4M36A 4OX9Y 4L0MA 1EVJA 3C1AA 4KW7A 1PK9A 4XCXA 1DELA 2M98A 2EFHB 1KSFX 1G16A 3FF1A 3CIFA 3P9ZA 3V00A 4CEHA 3WGYA 1GN8A 1L7QA 2P6UA 4J1SA 3FAZA 4QPNA 2OLKA 1FNNA 1FUEA 1QWSA 2ODPA 3O4VA 2IDMA 3TLYA 4UBIA 4H7DA 2XMGA 1C14A 2PVPA 4H1UA 1Z0DA 2F9MA 1K0UA 2CYBA 1ZBDA 2D0PB 5TXGA 3JCZA 2JGKA 1SXJB 2QZSA 5AJXA 1Z4NA 1T1EA 1T25A 3FB4A 5EVCA 5KINB 1EX7A 4P7JA 3B1JA 3BD6A 4J4TA 2EEZA 4NL4H 3G9TA 4FMCB 5CYPA 1X1CA 3IJRA 3JXEA 4N40A 3ECAA 2VSXA 3NDJA 4ZI7A 3THYB 3T7TA 1QPGA 1L5NA 4ND3A 1K5HA 1JXOA 1E6LA 1R8XA 2ZRBA 3AWIA 3M8KA 2IS1A 2HM7A 4W5JA 4A6DA 1OGIA 5DBGA 5ARCA 1IAVA 3NWPA 1KMHA 3I62A 4FR0A 4MNTA 4TKVA 6REQA 1JJAA 1Z6PA 1UOEA 2ACWA 1SG0A 2BR3A 3C48A 3Q7RA 4PX9A 2PUEA 1UEXC 4LC9A 5JXWA 2EKDA 2CZGA 2ASEA 2O2YA 2BFFB 2Q5QA 4AZSA 4DMUB 2BFBA 4E31A 4YK7A 3CN9A 4ZA2A 2K6GA 3GVIA 2GEFA 3B3QA 4Y0VA 2GB4A 1C3VA 1ZWLA 4MUEA 2PMDA 3W1EA 4BIMA 1OI3A 2XYPA 1Y5LA 4XYEA 5FO0A 3VGPA 4RETA 2QW1A 3NEAA 4MDYA 3ZN2A 1DCKA 4HF7A 3SX4A 4B2YA 2ESRA 3Q0TA 5TSDA 1DFGA 1GN9A 4WNCA 4ZYZA 1A5SB 3DZHA 3SKVA 1AMNA 3QUBA 4G5RA 2IZ6A 3DQQA 3G6WA 4XTRA 5AUNB 1HYQA 5TQVA 2BGGA 4U39A 5JTUA 2BZSA 2IOYA 2K5UA 1M1YB 2WTMA 5IUJC 1J33A 2FWJA 3TLGB 1FRFS 4ZOEA 4INZA 4O1IA 1P74A 2FZEA 3OIWA 3QKRA 2ZJAA 4MVJG 2ZSEA 4YC7A 3VR3A 4B6QA 1XROA 5B6PA 1LTKA 4CIYA 5B55A 1VTKA 1XSEA 1JI3A 4C03A 1HBJA 2H57A 5AJUA 3E15A 3DMPA 4OPMA 3CR7A 3LTEA 1MTZA 4CM3A 3X43A 4BP3A 1XAIA 5HF6A 2M6LA 4DLBA 2XODA 3L06A 1HSOA 5I45A 4B2PA 2PZGA 4I1OA 3IJ5A 3PI7A 1KBZA 3UFXB 4Q3BA 4NMXB 3L6EA 3TTTA 4E5YA 4DF3A 1NX6A 3AUJB 2ISCA 3ZKAA 2XT9A 5GPBA 3UUEA 3CM0A 2VQ6A 2PX4A 4CLXA 5TJHA 2PGLA 4DM3A 1BKDR 1PHPA 3RYFB 1QRAA 3WDMA 3ZI0A 3VHRA 2A33A 4X41A 2RIPA 1NLMA 1W44A 2F3QA 2YXEA 4EB3A 5HX7A 4Q5IA 1OI7A 1G98A