4HB4A

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(537dltvk541/glceq)-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
209
structure length
209
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb4A00
2HCBA 4C2UA 2D2FA 3EPJA 2ZRBA 3AF2A 4LJ9A 1VPLA 1WQ1R 4BFYA 2JLZA 1WB9A 2Z5FA 5AUOB 5E7JA 3GQBA 1AK2A 3OE7A 2FGKA 4MGKR 2DHRA 1TF7A 3B13B 4Q4LA 1N3BA 721PA 5J4LA 2EYQA 4C0QC 4DDVA 4XWKA 1S8FA 2Q9AA 4WAUA 1UBFA 2BBSA 2IYXA 2OEPA 4TN1A 1MV5A 1ESMA 1PUJA 1GSIA 1FPMA 3BS4A 4BFSA 4W5WA 121PA 2Q21A 5AJXA 3I92A 2F43A 2OFXA 3GJ7A 4NL4H 3FGNA 4C0SA 1YZKA 4OHYA 1XMSA 3KQUA 1HA3A 5B64A 4JSTA 5FFMA 4CEJB 5DLQC 3U7GA 2FSGA 4DDUA 2DYKA 1EFRD 3SFVA 4GOXA 3AP2A 3X1YA 4PHGA 5JHHB 4G5RA 5HZHA 1CJKC 1GP2A 1VCNA 2A9KA 3CW2A 1BYUA 4MYTA 4O2LA 2ZRKA 1Z5ZA 5JWRA 2VHTA 2PL3A 3ZVLA 1GKIA 3DM9B 4B34A 1LFDB 1JAIA 1XD2B 4U00A 5CB8A 1SXJE 4PZZA 4DLTA 2IBMA 4BLTA 2R6FA 3THWB 3KTAA 1E9FA 2W2TA 3U3KA 1XTRA 2FFHA 4MRVA 3NEJA 2ZXUA 1XEXA 2J5XA 4JLDA 2GK7A 5DI3B 4C7OA 3A36A 4OQXA 2I4IA 4M22A 3I4LA 4O2RA 1CJTC 3P32A 1II8B 3R7WA 1P75A 2QT0A 4AY2A 1TF2A 3QY0A 1ZD8A 2LWIA 1E9EA 1Z83A 1NMXA 1RVDA 1KY2A 4RVCA 2YVUA 3QBVA 3LBNA 3QQ5A 1N6RA 3T1OA 5FBQB 5BN5A 2G0NA 5JI3E 1W4AA 2CK3A 2RAPA 2I1VB 2QM7A 1D5CA 1OE0A 2RGNC 1C9KA 1XDBA 5J5CA 4YMVA 4JYBA 3EPHA 1ANKA 3DL0A 5GJBA 3FB4A 3A4LA 4JLPA 1QVAA 1E1QA 1HQYE 1LF5A 2F1HA 3F5FA 4PANA 5H1YA 1T5LA 2WWIA 4FINA 2Y8EA 1Q1QA 4HAZA 1IY2A 4IKEA 2VHUA 1XCGB 4KHZA 1AS2A 1FW6A 3GJ8A 1E2GA 1NG9A 4LCBA 1XCPA 4H1VA 2WZQA 4XD7D 5DI9A 2ZU6A 4RD2A 2W6JA 2NO9A 4FXPA 3TH5A 2D62A 4YMWA 1KI2A 1E79D 4EIWA 1ZM4A 2QBYB 3Q9LA 2QMUA 4B6FA 1Z3IX 5KYKA 1W36C 1OFIA 1SXJA 2P5TB 3SJAA 2NPIA 2OCYC 3GLHE 2YZ2A 4Z51A 4Q01A 4G5GA 1RRCA 2C2HA 4IVPA 2DBYA 4IVRA 1N25A 2Z43A 4A2WA 4RSGA 2C8VA 3U44B 1E1RD 2QP4A 1VCIA 2H17A 1TL7C 1AZTA 2PBRA 4LV8B 4ZI2A 3DKPA 4XSGA 5HCIA 4D4KA 2BMDA 2OSBA 3SJBA 5E4FA 5B57C 3OESA 2G1KA 4Y0VA 3TLXA 3GJ6A 1OW3B 5J4YA 1DAHA 1YZTA 3CF0A 1YQTA 4BECA 1N6PA 1DG1G 3RAPR 2A5JA 2ZJZA 5EP3A 1QRAA 2BWJA 3WNDA 4QJ3A 1ZM2A 4DLWA 1OFUX 1X6VA 3QUSA 3Q8XB 4XH9B 2C78A 4Q4AA 4JKYA 1W46A 2J45A 3QF4A 4IDQA 1T0JB 1LV7A 3BIFA 3K8YA 5BYJA 1CEEA 1EFRA 621PA 2IYVA 3AF0A 1M2OB 2TMKA 1Q21A 3EW9A 2A7QA 2CVFA 1ZJ6A 4KFSA 2ZAOA 1OB5A 4D26A 2IC5A 3T5DA 1S0UA 1KTVA 4JJKA 3PJRA 3SQXA 2JAQA 1S1MA 3VX4A 4BFZA 1ZD9A 4PQFA 3L8ZA 3IPXA 2C99A 4BFXA 4F4JA 2GKSA 3IBGA 4OYHA 1MO3A 3CRW1 1AS3A 4LRWA 4CYMA 2QQEA 1YE8A 2QP3A 4C0BA 2XJ9A 2H1LA 1OH6A 3DMDA 4Z1MD 4WZBE 5LB2A 1KMHB 1T3HA 2B21A 3KKOA 1TQ2A 4OQMA 5D3MB 5EE3A 3GLHA 2P6UA 4LHWA 5IHPA 1XJQA 1G16A 2ZR9A 2AD1A 4CEIA 5C4MA 2P5SA 3CNOA 2Q3FA 4XVRA 3M6AA 3NDPA 1JR3D 1MOZA 3ICQB 2VF7A 4C4PA 3H86A 3EIQA 2ZRPA 5K8LA 1Z22A 4GZLA 4DSOA 3CPEA 2AL7A 3ICEA 4RJLA 1GM5A 2WBLC 1S3SA 3K0FA 2HLDD 3KXKA 2VSFA 3UXMA 5CB6A 2GA8A 1IONA 4CDGA 1CRPA 1Z08A 2P0EA 4R2HA 2IHBA 4B73A 3FHCB 2OZEA 3QPVA 4IRUB 4L5BA 2HF9A 521PA 4M53A 1YZLA 3T12A 4ZCIA 4ZKDA 2XXAB 1KDTA 1XEWX 5KSYA 2O8BB 4PR0A 2ZRMA 3TQCA 3EA0A 1Q20A 4QGGA 4F93B 3THXB 4CEHA 3NEYA 3B7GA 4KITB 1GRQA 4M9QA 2IT1A 4AURA 1RZ3A 3BJIC 1PZNA 4BASA 2NMVA 2RGGA 1E79A 1OIWA 1VYUA 3P1JA 4GMXA 2CLSA 1S1CA 3Q7QA 1Q0UA 4QL3A 4X8OA 2ZJAA 1QG2A 3T61A 1TTTA 3AVYA 5G41A 4MUBA 3MCAA 1KO1A 4Q21A 4C0LA 2ODEA 4KSCA 3EC1A 3A1VA 3K0CC 1KKMA 1OB2A 1U0LA 1F48A 5DISB 2OCPA 1JR3E 4OBEA 1E1RA 1SKQA 4FWIB 1OFHA 5KDLA 1OH7A 2A5DA 1XF9A 2RGCA 4JBXA 4Z54A 1GVNB 1TEVA 4EPRA 2WSMA 3B78A 3B6EA 1NVVR 4QGFA 5EP4A 3SQWA 1XTIA 2GEVA 3I72A 1JJVA 2JJ8A 3VR3A 4Q4HB 4P0TA 4L16A 1TNDA 1Z06A 4A0RA 3VR2A 2NZJA 4PO9A 4EQ6B 2VP4A 1W0KD 4Q7MB 2VP6A 3WYAA 1NI3A 4DB4A 2HJGA 1IQPA 3DO6A 1VHLA 1HY3A 4KODA 1R0YA 1MO4A 4NTZA 3M4YA 4Q7JB 3ZVMA 1WP9A 5HPYB 4B71A 3LXRA 4WA7A 4CEJA 2GXSA 1LS1A 1KZGB 3AVOA 1UDWA 3A58B 2NO1A 3CX6A 4TMTA 4TLDA 5FI0B 1OIVA 1W48A 5TB5A 5JFGA 4LJ8A 4F4CA 4QHYA 1DPFA 2RGEA 2QA5A 1DADA 5JSZB 1XX6A 1G8PA 2A2ZA 3KDSE 1Z0DA 1XD2A 3B8HA 4B3FX 1KYIA 3GLGB 1JR3A 3THWA 4O0MA 4GP6A 1GTVA 2JLUA 5BN3A 3CF6R 4PC6A 4YXWD 3EZ2A 3WHKA 1P9WA 1G19A 4JVLA 2ZI9A 3IGFA 2HLDA 4IXNA 5DI3A 5L8VA 1FMLA 1US8B 4DCVA 1II8A 2QI9C 5FR2A 5KNDA 1JI0A 3SEAA 2XTNA 1BOFA 2IWRA 4Q47A 2XZOA 4EFMA 3SNHA 3QVVA 2YHSA 1XTQA 1KNQA 4MH0R 1F5NA 4G3XA 4OI0A 1NBMD 4GPTA 2PEZA 2D4HA 4ZDWA 4KI0A 1YVDA 1O3YA 3E70C 4MRRA 3W6PA 1EWQA 2AKYA 3AEZA 2QRZA 2IXEA 3DDCA 4H9GA 2ORVA 1M7BA 2KB0A 2ZRLA 5JEEA 1ZUNB 1TU3A 1N0WA 2QM8A 1FTSA 1I4LD 1LF0A 2ZUCA 4NBSA 1JQLB 3PQCA 3PUWA 2QAGC 1N6IA 3BGWA 1IJFA 2E87A 3QXSA 4B44A 4E09A 2CEAA 3D6TB 3HYTA 4AG6A 4AKIA 4OJKA 3ZLJA 1D8TA 2WWXA 4V03A 2H5EA 1N6LA 2QBYA 1RIFA 3GMTA 5P21A 2ZREA 3TUIC 1M74A 4DBLC 5HTKA 2YV5A 1KO5A 3BC1A 4LJ5A 5IDVA 1IAQA 4KLNA 4KO8A 1DO0A 2LCFA 3SZRA 1VG8A 5FTKA 1U2RA 4LHYA 3EAQA 1GL7A 2BMFA 2IF0A 1KKLA 2ZITA 1Z0KA 3ONWA 4LPKA 5G40A 2VRWA 4GFDA 1MRSA 3U44A 1WBBA 2YWEA 5JS8A 4GDFA 4FMBB 1AJEA 3ZQ6A 2GILA 4MYHA 1AKEA 1BS1A 3TQFA 4AD8A 3WBJA 3UMRA 4RZUA 5LPNA 1W0KA 4BLSA 4YMTA 1KGDA 3SN6A 3UMFA 5LDDC 1NBME 5EE1A 4JVSB 5SZKB 3U4QB 4TWZA 3TSZA 2OV2A 4DUGD 1AN0A 2W58A 4WIAA 3A1SA 4Q5IA 4DT1B 4LBWA 2H57A 2OFOA 1GFIA 3LX8A 1E96A 2CE2X 2YC2C 2YOFA 3GFPA 1U0HC 4TMKA 5DGXA 3AVXA 2V9PA 1IN7A 3QXXA 3UIEA 3D7MA 3K9LA 4TQUS 3SJZA 4KFRA 3E5HA 5DYIA 1FFHA 2QORA 3RSLA 3LDAA 4MRPA 1Q1ZA 3EZ7A 4D82A 5FUVA 5JHGB 1GRNA 4A0FA 4QJ4A 3THYB 2J1LA 2V7QD 5EXSA 2IS4A 3VKGA 3I5XA 2H8KA 4FW9A 3OF5A 1U81A 1GUAA 4RD6A 5AJZA 3ADDA 1ZYUA 1UKVY 4QM7A 2O0HA 4Q4JB 3QF7A 1NN3A 3RRZA 1KK0A 1BMFD 4R2IA 1LW7A 4IFEA 4WW0A 1U9IA 1TUIA 1G6OA 3UWKA 4YXWA 2O0KA 1R10A 1KMHA 3OAAD 5D3MA 1C4OA 2ERYA 4M1OA 1W44A 3RC3A 4FI3C 1H8HD 3GJXC 1N0UA 3VNUA 1E2MA 3QIAA 4PAQA 3PITA 2AHOA 2UVQA 1LB1B 1B23P 5FUXA 5HE9A 1IBRA 1R2QA 3PUXA 2IUTA 3H4MA 5FOWA 4US0R 1MO5A 3CX7A 4CRWB 1GL6A 3FE2A 1R0WA 1NJGA 2YWGA 1Q1EA 1I4DD 1NBMA 2FH5B 2QMEA 2R62A 3KFVA 4MDFA 3NHAA 3RWOA 3JVVA 3KJGA 2O8FB 4ABYA 4BZPA 4OK5A 1OLOA 1ZW6A 4U7DA 2FU5C 1W7AA 2XXAA 1ZVQA 4KBGA 1UKZA 1W36B 5JJLA 2O8BA 2GJKA 2H16A 3THXA 4GRAA 1KJZA 4BUJA 3ND8A 3GEIA 1W4BA 2ZRJA 2GZAA 1KO7A 3B60A 4TTRA 4LOAA 3X1DA 3HDTA 1OXXK 4PX9A 4CT5A 1U90A 1JALA 2BKUA 4HB3A 4PC3A 4ZCMA 2A78A 1R6BX 1W5SA 5IK2D 2VH5R 4UNNA 4NYMQ 5SZHB 2AWNA 4KSBA 3TMKA 2XEXA 1QHNA 1T0HB 4TT3A 4JLAA 4R98A 4I99A 4YDHB 3ZZTA 421PA 4NCIA 4ACAA 1QZXA 4XWOA 4HUQB 5M04A 1DAFA 1OXTA 4UNQA 3GLGE 3K9NA 2IYQA 3SC3A 3T5GA 1F2TB 3CH5A 4LYHA 3HR8A 5FPHA 3N2EA 3LBIA 2YKGA 2P67A 1NG1A 1TQDA 3F8TA 3K09A 1G7TA 1NN0A 1ZCAA 1KI4A 3REFA 2GJSA 2OAP1 3O8BA 1I2DA 1L4UA 2ZE7A 2CBZA 3U3JA 4DUGA 4U02A 3MJRA 4QHSA 4IDHA 3W8RA 1ZINA 2PT5A 3ND9A 4NYIR 5IF9A 3QEJA 3GLIB 3OIVA 5JJKA 1OPXA 4Q4HA 3CWQA 1MH1A 2PX0A 2AX4A 3WXMA 2W2VA 1XEFA 3B85A 3N5CA 1ZNYA 1NVXQ 3QNUA 4JLMA 2CLDX 4EQ6A 4IEEA 3AVUA 3VKWA 3PIRA 3CB4A 4D0NA 1KSHA 1NKSA 4MYUA 2QEQA 1AQUA 3PG5A 4FMDF 4JT4A 2AWOA 2VPPA 2ZS7A 1AGRA 3I8XA 1HH4A 1XZQA 2VIIA 4DSUA 1RKBA 5EQTA 4ASUD 2HYIC 4G0NA 2JA1A 2WKQA 3DPUA 3RS4A 3AP3A 3BB4A 4DKXA 5KU1A 4HZUB 2ORIA 2WPDD 1BMFA 4DJTA 1J99A 1FNMA 1DELA 2ZSDA 4KCGA 3BD9A 1D2MA 1J90A 2ATXA 5JCZA 2BBWA 3N70A 1Z0FA 3W3ZB 1H8HA 1XJCA 5JSZA 3RC8A 1KO8A 5EXXA 4URWR 2HCJB 1UEIA 3B9PA 3QKTA 5DSZA 3QEOA 2B92A 3GLGA 2E9SA 3GEEA 4LX0A 3PV0A 5JWHA 4NYJQ 3H0KA 2ZETA 1YZNA 1ZUIA 3RS2A 3QBTA 1KNXA 2BJWA 4GSYA 3NC1C 2MMGA 3K0EA 3NH9A 4MUAA 3QJYA 4LBYA 1OHHD 1US8A 1NL3A 3AF1A 4TMVA 1CJMA 1D9XA 2CE7A 3RS0A 4B2IA 1EFCA 2PZEA 3PEYA 4HLCA 4AYTA 2DR3A 3GFOA 3A1WA 4PXAA 4US1R 2ZRCA 3SBEA 3EPKA 4C2TA 1X1RA 2FPLA 5KPJA 2AK2A 4PQRA 4ZPXA 4EJSC 2C9OA 3FMOB 2BVNA 3ZS8A 1Y63A 1G8GA 2A3RA 1NLFA 2OBNA 3B2EA 2ZI3A 1XNJA 3LA6A 5FOVA 2H7VA 1Z8FA 2QQ0A 1XJ0A 2PT7A 4PAOA 1G5RA 4BLRA 1VG9B 5JCPA 5KHOC 3A1UA 1NLZA 3NXSA 1P2SA 2CCJA 2ZJ5A 5DHFA 3WMGA 1Z07A 4NMMA 1W36D 4KU4A 3RHFA 2REBA 4AKHA 2ORWA 3KKNA 2IW3A 1A5TA 2H92A 2N1BA 5IK2A 3BAFA 3U7FB 4HI0E 4A15A 1IM2A 4M1WA 2JDID 4S2EA 5JJIA 4EUNA 2GZDA 2FEOA 2P6RA 1QHIA 4II7A 4L4UA 5KOYA 2WKPA 1OF1A 2FJUA 3C4JA 5AWFC 1JAHA 4LV5B 3WRXC 3QE0A 1HT2E 4QFMA 1F6BA 2J0UB 1E9SA 1RE0A 4PPGA 1T9HA 1P6XA 2EFGA 5C1BA 1E2KA 1E2QA 3AKEA 1T91A 1Q1BA 4TZ0A 1E9BA 2FGJA 2HUPA 3LY5A 4P4TA 3AKCA 3MGCA 1Z6TA 3IPYA 2P65A 1Z0IA 1CIPA 1IN8A 2GXQA 1DAIA 2O52A 3VU9B 4KVAA 3BH7A 2IUUA 3ZVNA 2F1RA 2IYLD 3RWMB 4JLVA 1NNEA 1BKDR 3PEVA 3NHBA 2NO6A 1TUEA 2GZHA 4IFBA 5JRZA 4LPSA 3U4QA 5LD2C 1PJRA 3VFDA 4LYFA 4F7WA 1U98A 4MDEA 1L8QA 2VHCA 3N2IA 4AYXA 4DT1A 1FP7A 3DM5A 1Y3AA 4XOIA 5K8IA 2XB2A 3RLFA 1GZSA 5L3VA 3U3MA 4Q1BA 2VHQA 5EUMA 1KI7A 1IN4A 4IEIA 5D3QA 5E7IA 2EFEB 4JL5A 1N5KA 5CM8B 3SS8A 4DCTA 1P9RA 4D25A 3IIMA 3NH6A 1X8JA 1D2EA 4GP7A 1WA5A 2G0TA 3QENA 4ESVA 3THYA 4PZYA 1H65A 2ASEA 3WHLA 2VSXA 5C46F 5JBQA 3AVVA 2DY1A 4ZV4A 3G0HA 2GJAA 2F9LA 2PX3A 4MITA 3UANA 3CRMA 5FPKA 2Z4SA 3KUCA 5FTLA 1Z2CA 4Q4JA 3FPAA 4DLUA 5FUWA 1SKYE 2D06A 2DFTA 1RRFA 5KTYA 3RRNA 3FKQA 2RGNA 5CJ2A 5EE0A 1KSFX 1RJ9B 3R9WA 2ECKA 2R8RA 1NSTA 2XNDD 3AKDA 1DARA 1OHHA 2OCBA 4V0LA 4Z8XA 3U2QA 1CR0A 3E2IA 3IUYA 1W47A 1IN5A 3W6NA 1PV4A 1R7RA 3KXIA 2J0VA 4URZR 1DAKA 4A36A 2ZSBA 4IHQA 3L0OA 2GK6A 1GNPA 1DVRA 3I8SA 4TL7A 3GP8A 4A1FA 4CT4B 4O25A 2GAAA 4AKEA 2QAGB 1PLLA 1CXZA 1UAAA 1W49A 2FEMA 3GLIE 2B8WA 2BEKA 4PSKA 4FMCB 4A8JC 2O8FA 2CNWD 2J7KA 2ZJOA 2Q9BA 5HKKD 2Z83A 2V3CC 2CMKA 5TMPA 3H1TA 5J40A 1EESA 5JRJA 3TRFA 2ZIAA 1SVMA 4NU0A 5TDHA 3EASA 2ZI5A 1E9RA 5DHAA 1QVRA 4TQ9A 2QY9A 3VMFA 2Z0MA 1NMZA 1NSFA 4PSAA 1DAEA 3DEFA 5ELXA 2FF7A 3ZZ0A 2GTPA 3R8FA 2VTKA 2XAUA 1LNZA 2QZ4A 3RSOA 2JDIA 1W4CA 4TL9A 1JEDA 2GEUA 1Z47A 2IYRA 4QOSA 3KZ1E 1XCMA 3WY9A 1JB1A 4TLEA 4TLCA 1EX7A 1OXSC 1IXRC 4HAWA 2MSEB 1OH5A 1KI3A 4GT1A 4OHWA 3AUXA 4HUQA 4FMCF 3QI2A 4LUCA 3WYFA 4LYJA 3NG1A 4DVGA 1XMIA 1N5LA 1TADA 2EFHB 3K9HA 1F60A 1F2TA 1OYYA 2JASA 4TYWA 3DVLA 3Q5EA 3RNLA 1NVWQ 2QPAA 3CM0A 4G5QA 4HZIA 1LS6A 2QMOA 3Q72A 2YYZA 1NJFA 2BM1A 2FZ4A 4A2QA 3LQQA 4IDNA 3SYKA 3MWKA 3WP1B 4DSTA 1SZPA 2DWQA 2Q0HA 3AVWA 1NN5A 1TPZA 3AP1A 2ODWA 5L3RA 1ZC4A 3GLIA 4B75A 3ADKA 1YJ5A 2FX3A 2XZPA 1VECA 3D31A 1G3QA 1OXVA 3W9YA 1EG7A 5CYOA 4XJXA 2D7CA 2KE5A 2OG2A 3A8TA 1E0KA 4LDJA 4ZDIA 1GKYA 4TLAA 1VG0B 3NDBB 4BZXA 4RD1A 4QC2A 5FOUA 3LLUA 4IJMA 3TBKA 5F3WB 1E0JA 1G3RA 1UPTA 2X2FA 2IS6A 2ZRHA 3VR1A 3FVQA 3EC2A 4JLJA 4XD7A 3CONA 3WMEA 2CDNA 2DPXA 2KBFA 5JI2E 3TR5A 4HZUA 3LAWA 1NIPA 5FBWB 1VCOA 3BFXA 3WNCA 1AKYA 3MFYA 3KX2A 3SI7A 2WMNB 1Q22A 4L8GA 4LC0A 2FG5A 2G9NA 1ZM9A 3DZDA 4D2IA 3EWSA 3T1TA 3AVQA 4MGZR 2OT3B 4FCTA 4XTRA 4PHHA 1SVLA 2GBLA 2BIFA 4EPTA 2XB4A 4Q7LA 2Q3HA 4KJZA 2NIPA 3Q5DA 4GOJA 2O5VA 2GF0A 4YMSA 2IYSA 4QBGB 1T8UA 3TNFA 1Z6YA 3JVUA 2ZU0C 4P4UA 4TMZA 2A5YB 3O8RA 2XOKD 2AXNA 2WVJA 4ZKEA 2CNWA 3EXAA 4B47A 5HKKA 2J41A 4X8MA 3P4XA 4PC1A 5TY0A 3VR4A 5H8WA 2QPTA 3B1YA 3DOEA 1YU9A 3X1ZA 1E2NA 4Q9HA 3P27A 2J7PD 3NC0C 4PHFA 1W2GA 1UEJA 3KJIA 4LY6A 1MO6A 3H84A 4GNKA 3QXCA 3BRWD 1T5IA 3U60B 2N42A 3SBDA 3GPLA 1ZU5A 1XD9A 4QNMA 4LZZA 5E7MA 4HAUA 2ZUDA 3IO5A 4EPWA 3HU1A 3ADBA 1P9NA 4OKSA 3RRMA 3L0IB 4A4DA 3K1JA 5F98A 2O0JA 3QKSB 4B3XA 2O8DB 4LHXA 1NKTA 1KK2A 1XXHE 2AFIE 2F9MA 3QXJA 4KYUA 4NONA 2PCJA 4RZXA 3L43A 4Z1MA 1N5JA 3CZQA 1AIPA 4Y0AA 3UG7A 4GI7A 4X8HA 2BDTA 2DB3A 5C18A 4RKFA 2EFCB 2J0UA 1U94A 3SE0A 1P2VA 3CR8A 1U99A 4TSFD 2QGZA 5JWOA 5BN4A 1E99A 4XVQA 2HF8A 2JLQA 4FIDA 1GILA 1E4YA 2GCPA 2E1RA 3AB3A 3ZZUA 3VU9A 1G4AE 4W5JA 1A2KC 2BC9A 4DLZA 2MSCB 2FZLA 3V00A 2J0QA 4HDQB 3W5JA 4OQLA 3P20A 2REXB 4V0KA 2HEIA 2WV9A 1YZGA 3CNLA 1IY1A 4HLDA 5DH9A 1J2JA 4MGYR 1DBSA 4V0OA 1HYQA 2WIAA 2G77B 2YJTD 2WWWA 1KOFA 2QE7D 3PXGA 3UMSA 4ZDJA 1CF4A 2CCGA 2R6CA 2CHGA 4QJ5A 1A2BA 1OKKD 4IDPA 4Q9JA 1XB2A 3KQLA 3TUJC 4M1TA 1K6MA 3VR6A 2HDNB 5EUQB 1SVOA 2EW1A 2J0SA 3TSWA 4NP6A 1G1MA 3ZYCA 3C8UA 1JXOA 3SHWA 4BRWA 1LTQA 2D3WA 2PJZA 2GESA 4JLBA 4M4SA 1QHSA 1UDXA 4V0ME 4UXIA 2DFLA 5EP2A 4E03A 3RANA 2GJ8A 1YHNA 821PA 5SZJA 2PEYA 6Q21A 4B33A 2IYWA 2NO0A 4F4IA 3ZJYA 1XEWY 2KBEA 4TYPA 3TKLA 5AR1A 2EU8A 3QPUA 4EJSB 2A30A 1GKUB 1RJ9A 2GF9A 3SYNA 1IJEA 2J87A 4M0LA 2V1UA 4BQSA 2IX3A 1FOEB 3TAUA 4M9XA 2QSYA 4M9SA 1X1SA 4Q1DA 2BMJA 2WWHA 2XOKA 4QXAA 3VR5A 1A1VA 2GXUA 4JL8A 3A4NA 2IYTA 2VLIA 3LVQE 1N5IA 3LWNA 3NBFA 3NWJA 2EQBA 2V55B 1KI9A 5CDFE 1E2FA 4OK3A 3W3AA 3IKJA 5FBVB 2F6RA 5AJYA 1W4RA 5FPSA 5KNBA 1G21E 2J7PA 3A4MA 4LK2A 2QAGA 2GNOA 1CRQA 2BM0A 2QUZA 1J8MF 4HAXA 1KI1A 3EG5A 5EZ6B 2W00A 4YDSA 5B58C 2WICA 2WSSD 2C98A 2P2LA 2QNRA 1MABB 5JMTA 1EWRA 1D2NA 3EARA 4OQFA 1E98A 5KUTA 4OI2A 4RFSB 3QSYA 1MT0A 4TYYA 4HB4A 5G3ZA 1RRGA 3FFAA 2WJJA 1JXMA 2OE2A 5UKDA 1KK1A 2O8CB 2W2XA 3DKVA 2JATA 4KYIB 1G7CA 4ITRC 3K70C 1U8AA 3SFZA 2GVDC 1FQJA 2UZ3A 4JT2A 1FQKA 4TYNA 3S1AB 4V0MA 4YMUA 2CCKA 1G41A 4TMWA 5EXPA 4PHTA 4CW7A 3OIYA 5EZ5A 4S35A 2MMCA 2Q9CA 1Z0JA 4QKQA 4AC9A 4KAXA 1XD8A 5LD2B 3OEED 2JLSA 3LLMA 4TSFA 2ANBA 5J4HA 5HE8A 2ONJA 3JZMA 1KY3A 2QROA 3MD0A 3L82B 2IF2A 1M1YE 4RY2A 4BEBA 3UATA 4DB2A 1E32A 4C30A 5GVRA 1E0SA 5AJWA 1XTKA 1F2UA 4RCZA 2WAXA 5FBLB 3BFVA 5AUPB 5EXTA 5CDFA 2ZYTX 4ARZB 1M8PA 2AK3A 2OUKA 3EA5A 2FE4A 4JJZA 4JZKA 3BBPA 1G8FA 2MSDB 3EZFA 3AF3A 4X8LA 1JJ7A 2R6AA 3L8YA 1OSNA 2CLCX 2QE7A 4OHZA 3FKSD 1G6HA 2AKAB 3GLFE 2V54A 4Q19A 1OKKA 5BQ5A 3OZXA 1TEXA 2NZ8A 2C04A 1KDRA 4IW3B 2VP5A 1TX4B 1VYTA 2FMXA 3BXZA 3FHOA 4WZAE 4A6XA 4XVUA 4MRSA 5F9FA 5H68A 1QHGA 4LJAA 2FFQA 1N6KA 3MLEA 4DIEA 1G20E 2C96A 3MWJA 2ZR0A 2C03A 2DWOA 4L15A 1U0JA 3TW8B 2YINC 2FPKA 2CL7X 3JZAA 1OH8A 2ZTSA 1KAOA 3U3OA 4TZ6A 1FUUA 5KO2A 1AM4D 2V8OA 4GBMA 5FR1A 1RPZA 3TE6A 4M1SA 2VQSA 4URYR 3R9XA 4UXHA 4KBFA 2JLXA 3VTKA 2ZRIA 1SHKA 1SULA 4OQNA 2VYFA 3O8CA 1FL9A 2OLKA 4ON9A 4A8JB 1HV8A 1Z29A 3C15C 1CR4A 3PFIA 2QG6A 5DO9A 4PQYA 1G5TA 5JZVA 1QF9A 1SKYB 2FFBA 3DOFA 4B74A 1BIFA 3HR7A 1I2MA 4NH0A 2ZR7A 3BERA 4NHOA 2WHXA 2QTVB 3OE7D 2VEDA 1G3UA 3K9GA 1ETUA 2OXCA 2FSHA 3V4FA 3KXLA 4A6PA 3LD9A 2F3TA 3FFBA 1XMVA 2WSSA 3KKMA 4OK6A 5DE3A 1J7KA 1QG4A 2GETA 1RW4A 1ZM3A 2FFAA 2GDJA 3BH0A 2BOVA 3TVDA 3FTQA 1T6NA 3ASZA 3I1FA 4EPYA 3QKRB 4PPQA 4A82A 4PTLA 3PCRB 1N2CE 3EZ9A 3L0PA 2HXYA 1FNNA 4C0KA 4OI4A 3X1XA 1KI6B 3DHWC 1JPNA 3UWOA 2JEOA 2WJGA 3W6OA 2N46A 3U5ZB 2GVZC 4N3NA 1GG2A 5B30A 1N6NA 3ZDQA 3NKVA 4G5SA 4US2R 1E9CA 1ONBA 5A5GA 4E5UA 4MYCA 3UPUA 2IWHA 2R6DA 4ZO4A 1ODFA 4DRZA 1YR6A 5G53C 2V7QA 2F3RA 2VP9A 3VQTA 4UNSA 1TAGA 4I1SA 2WOJA 3UK6A 4CIDA 5DNYB 1Q44A 3OEEA 3QKSA 4E22A 2O8DA 2WWYA 1FX0B 4E07A 2QAJA 4P31A 2XNSA 4U5XA 3E1SA 1ZCBA 1A7JA 1XWIA 1CJVC 2FOLA 3A1TA 3Q7PA 1F3OA 4HLUC 3OAAA 4K81B 4UXJA 2P3SA 1MR3F 2ZROA 4N1AA 3RS5A 1NRJB 4DCSA 4HDOB 3ZS9A 5LBIA 4DEYA 1WBDA 2UZIR 3KKQA 4D4JA 4R9UC 1KSJA 3SR0A 1ZC3A 4G1UC 1YR7A 2EVWX 4URXR 3GD7A 2CK3D 3K0AB 4V02A 3FKSA 1YR9A 2JJ1D 1UM8A 2VO1A 3SYLA 3CRRA 3IQXA 3CPJB 3C41J 2AD5A 2JCSA 3T06B 4BLQA 3AH8A 3R20A 4I4LA 4DLSA 2XSZD 2W0SA 3KJHA 3C14C 3W5IA 3I62A 4W9MC 1E2LA 2ZS9A 4HYYA 1RYFA 2V6JA 1II9A 5EE9A 1SVKA 5KDDA 4Q9IA 1II0A 5A4JA 4LHZA 1FUKA 2GAOA 3AGQA 1VKJA 2W6ID 5FTNA 3B1WA 2BBTA 3HWSA 3RS3A 3CH4B 3TGPA 1NVUQ 2KSQA 4P33A 2ZYUX 3B1VA 1CU1A 4DZZA 1M7HA 2ZE5A 4D0LB 3U61B 2OESA 3MSXA 4Q02A 2QP9X 3ZQJA 2CJWB 3EX7C 3GFTA 2DFKB 2ZE6A 2O8EB 1XPRA 1VG1A 3DZ8A 1GDDA 3ZD6A 3CR7A 2PCLA 3I73A 4EJSA 3KFXA 3NVAA 4RZ2A 2ZI4A 4W5HA 1WRBA 4WZ6A 4CVNA 4DSNA 2EWWA 1YZUA 2V4ZA 1VMAA 1ZNWA 1DAMA 2ZYVX 5JS7A 1IXZA 1RYHA 5CIWA 2Q3MA 1AZSC 4MKFA 1G3IA 1Z6GA 2ODBA 2WJYA 3LW8A 1XMJA 2F7SA 3PUYA 1E3MA 5AUNB 2HJVA 1PUIA 1E9AA 1ZUHA 1S9DA 5HCNA 1JECA 3PR1A 1VYVA 4OJQA 5TARA 4NE2A 2QU8A 2RGXA 1MRNA 4HB2A 4WBSA 2PZGA 4G5OA 5CLLA 3T1QA 1DEKA 1MABA 5GJCA 4M1MA 3SHFA 2XJ4A 3T35A 1R8QA 2CL6X 2WIBA 5AUQA 2XX3A 3LVRE 4B48A 2GRJA 4RFSA 3CBQA 2KJQA 3AVTA 2ZSAA 4HAVA 3VHXA 4HUTA 5J47A 2PLRA 3CF2A 1G18A 1S96A 2O8CA 4ASUA 1Q3HA 4BFWA 4LWZA 3QG5A 4IVQA 5CYPA 1V5WA 2C9YA 2C9CA 2WPDA 2ZUBA 3WBKA 1AS0A 3S1AA 4B6EA 5IT5A 5H70A 8OHMA 4DCUA 1G9XA 1OYWA 2FN4A 2C95A 2RGAA 4LSGA 4NYMR 3W34A 2OHFA 4LHVA 1KAGA 3LV8A 1KZ7B 3BH6A 4LI0A 3W8NA 4A9AA 2YOHA 4Q9KA 3CX8A 2KI5A 4Q1AA 5LB4A 1XXHB 2NPFA 5GADl 2BKEA 3BOSA 4NPHA 4Q03A 4TQAA 3TR0A 2ZJ8A 5GJVC 5FOSA 4ESHA 1NVVQ 2JJ1A 5F9HA 1ZIPA 2OFWA 2ZJYA 4JL6A 3KQNA 2EYUA 4Q7KA 3TVTA 3WMFA 1EFHA 5C2JB 5G3YA 1P72A 2VBCA 4ARZA 2QL6A 2ZAMA 4NDZA 4YC7A 2XSZA 3RABA 3U3RA 3UKDA 4F38A 1SXJC 2QTFA 2CHVA 1G5PA 3LX5A 2ZRDA 4DLYA 4P4SB 2ZSFA 4LJYA 4EDHA 3KQKA 2B7CA 2WJVA 3B1ZA 3TSOA 1N6HA 3BORA 3W90A 1XTSA 2LKCA 3LO5A 3MJHA 4FD2A 1PLKA 4TYQA 2QENA 2W6IA 4I1OA 2WOOA 4PO1A 1T8TA 4JLNA 1H8ED 1UKYA 2ZE8A 4M8NE 5CK5A 4Q00A 3FYHA 4DDTA 5KNCA 1ZP6A 4PAMA 4JSYA 3NBXX 2R6GA 1OV4A 5K8UA 1KDPA 2G1JA 4C0HA 1KK3A 2XITA 4F91B 1RFLA 1E6CA 3BFKA 2FPMA 4TTPA 4BZQA 4C0AC 2F1JA 2NQ2C 3RYTC 3CNNA 4WXPA 4BLPA 3REGA 1OIXA 3AF4A 2KWIA 4KV9A 1HTWA 4Z8YA 5BYKA 2EWVA 4A8JA 1KMQA 4D81A 2AFHE 3IEUA 4JVNA 1Q12A 4NZYA 4FWTA 2WJIA 2CL0X 3AQ4A 2IA5A 3C16C 1VTKA 4LBVA 4NYJR 2AR7A 2OBMA 1Z63A 1CKEA 4BRUA 5GVSA 3M1IA 1X86B 4BLOA 2WJHA 2ATVA 2OAQ1 3RS7A 1ZNXA 2GCNA 3IILA 3MWLA 4ZDKA 5L3QB 2NG1A 4R71A 2PMKA 1SGWA 1UBCA 2WKRA 3MG9A 3SJCA 1G17A 3P4YA 1ZIOA 4EPVA 3K70B 3IBYA 1F2UB 1E2IA 4IOJA 2FDCA 4UKDA 4NCNA 2BJVA 3CLVA 3DMNA 4RFVA 4YONB 3OIWA 1S3GA 2HT6A 3KKPA 5B2ZA 1EFUA 4V0NA 3CKLA 3QKRA 2RB4A 1KI6A 1QHHB 1WCV1 3KJEA 5C4GB 4ERNA 5E95A 5HZKA 3QXHA 4WXRA 2GJ9A 2QRNA 4QGHA 2OM2A 3VHLB 5GJWC 2QPOA 1P7CA 4D4MA 4UNRA 5DN6D 4MGIR 1ZMXA 1JNYA 1VHTA 1KJYA 2C5LA 2XGJA 1GNRA 1IXSB 2IYYA 3BB1A 1X3SA 4B3GA 1T4GA 4NCJA 2RGDA 4UQOA 3UG6A 4KXFB 4BFUA 2YOGA 1J8YF 1FX0A 4Q18A 1ELOA 2RGBA 3ASYA 1CR2A 2QTHA 2VP0A 4DHEA 2LKDA 4AK9A 3IIKA 1J70A 1G291 4QNRA 4I81A 3GCGA 3ZIAD 4LYAA 3NTUA 4AIIA 1JR6A 2XNDA 2GBLC 1E94E 1AGPA 1W5TA 3B9QA 2ODNA 4DLXA 4BPBA 4RD3A 3WP0A 3GJ0A 4UJ3A 3FWYA 1AA9A 4QBFA 1P62B 4A2PA 1NP6A 4POAA 1TQ4A 3K0AA 4IDOA 1ZAKA 1E69A 4ILEA 5TXGA 4ZI3A 2RHDA 3LQRA 4XTCS 4IOMA 1IHUA 1DAGA 3MMPA 3GJ3A 3GEHA 2WM9B 3TJZA 4A0GA 4ZIRB 4F92B 2PLFA 3AM1A 1NIJA 2I3BA 1YR8A 4NKRA 1H8EA 2QT1A 3QKUA 5A0FA 1W0JD 1R5BA 2VF8A 4L9SA 5KSOA 4MQBA 4HEJA 2V6IA 3AUYA 4RD4A 3QOFA 2ERXA 3GLFB 3IO3A 4L9WA 3CRQA 5F2EA 4FCVA 4P32A 4ZCLA 4MKHA 1VIAA 1LVGA 1K5DA 1N6OA 2WAYA 2X1VA 4N0EA 5FL7D 1WXQA 4IOLA 4PC7A 4Q9LA 1A4RA 2JLWA 1ZRHA 4DWJA 3K0CA 2VL7A 2I1QA 1G7RA 3LH5A 1XFAA 4K46A 3K53A 2IS2A 4PFSA 3A37A 2JGNA 3OIUA 4JMPA 3IEVA 1DO2A 4GOKA 1HE1C 3CO5A 1CJUC 2CJWA 1CS4C 2WWGA 3C5CA 1CP2A 3IHWA 4I1UA 1JPJA 1JQJC 1CLUA 4HB0A 2O8EA 4LJ7A 2CXXA 3HU3A 4M2LA 3WRYC 1GITA 1KHTA 1XPOA 4M1YA 2JJ2D 1EX6A 2DFNA 3U7EB 4B3DA 3U6BA 4AWXA 4QM6A 2ZVPX 4DIDA 5DYGA 4JLKA 1GRRA 3C5HA 5FUYA 4D80A 1RC8A 4B2PA 5FBRB 4O3MA 4BE7B 3AKYA 1ZNZA 3CZPA 2ZRAA 3OEHD 4JVMA 1O87A 2BCJQ 1YRBA 4TL8A 2RMKA 5IRCD 1QHXA 1TU4A 3OFND 2ZRNA 4B3CA 3D8BA 1UJ2A 4URVR 3AGPA 2D2EA 4QBIA 4DCNA 1D9ZA 3Q85A 2BHRA 4PPNA 2WMOB 1P3JA 3P26A 2BMEA 3K70D 3VNVA 4JS0A 4QBHA 3TUZC 3G82C 1E2HA 2Z4RA 5DN6A 4JKIA 2JLRA 1UBEA 4DLRA 4QG7A 4EAQA 1XRJA 2G83A 1G4UR 1ESNA 4Q48A 3RVBA 5BW8A 5SZIA 5KSZA 4TL6A 3IHLA 1HURA 1L4YA 2OCAA 3QVUA 5CM9C 3L0SA 5L3SB 1ZD1A 2ZANA 1T3SA 1TMKA 3R8CA 1P60A 1ZM7A 4KFTA 4LV6A 3RDPA 2A5FA 3SDZA 4PC2A 2IXFA 3SU8A 2ONKA 1PVOA 2NTYC 4LGMA 1G8YA 1UF9A 2GCOB 1X8KA 3X1WA 4RZ3A 1TQ6A 2GHIA 3ZIAA 2BV3A 2DWPA 1XBTA 2OBLA 4C3ZA 4YQFA 3J81k 3MUFA 3TAHA 4KLZA 4PO8A 1GL9B 2RCNA 1MKYA 1HUQA 1XXHA 3CPHA 1UFQA 5FL3A 1S9HA 4C0JA 4CGZA 3PUZA 1M34E 2ZPTX 4DEXA 1XPUA 3L2OB 4B35A 4NYIQ 4M1KA 1QBKC 2IEYA 4HDCA 1R0ZA 3CIOA 4W7SA 1E2DA 2REOA 3KB2A 2JIZD 3VX3A 1S4QA 1CBUA 1ZBDA 4XWAA 3C7KA 1B0UA 1W0JA 5FTJA 3V9PA 3CWZA 1G3MA 1EXMA 3SOPA 4P4SA 4AG5A 4BFTA 1VCMA 3HYRA 5KSPA 4EPXA 3T1VA 3BE4A 2X8AA 2XTZA 5KDOA 1R5OA 4PSVA 4DXAA 1OT3A 2V1XA 1HQCA 1LY1A 5FL7A 1UADA 2F43B 5JLJA 3PVSA 4A92A 2CVHA 2VP2A 4R7ZA 5CIQA 5JEDA 5EJEA 2ZJ2A 3NIBA 4DC9A 1COWD 4K8OA 3HPRA 4WVFA 3FOZA 2FA9A 1FTNA 5E3HA 1FMJA 1T3LA 5TVKA 1EFTA 1P2TA 4RD0A 1D6JA 3LXXA 4CZ2A 4A0HA 4URUR 3OHMA 2G88A 2OLJA 4TT3D 4BFVA 3ZD7A 1NN1A 4Q1EA 5KPDA 1W2HA 1FP6A 1TF5A 4Q1CA 5FTMA 2XTMA 3R9IA 1BO6A 1L2TA 1ZU4A 3KTAB 2JJ2A 4FCWA 3QPWA 4B76A 3A6PC 1V43A 1E2EA 3TK1A 1VDZA 3VAAA 2RHMA 4OL0A 1XEXB 4HATA 2R65A 4TLBA 3PUVA 1DE0A 4C7OB 4AI6A 4OI1A 3TIFA 2B6HA 3R7WB 3OEHA 3LBHA 2IK8A 3RRYA 4RKEA 1IN6A 3OFNA 2R9VA 2ZI6A 2QGNA 3GJ5A 4MKGA 5FOTA 3LRPA 4UNPA 1U9IC 5L3QA 3EWAA 1KIMA 3V4RA 4IOKA 3IQWA 1OXUA 4HLQB 5CLQA 1VIYA 1GWNA 2IYUA 2Z6VA 4JLOA 3ZH9B 2L0XA 3HPQA 1P2UA 2FNAA 1UBGA 2OXRA 1E2PA 3H2YA 1PLJA 2IL1A 1JEEA 4QHTA 1SVSA 2C77A 4I1VA 4HSEA 2RH5A 1EK0A 2ZRFA 1E0AA 2QN6A 3NBZC 1QHHA 3U6KA 3NBYC 4MKIA 4TMXA 2ZI7A 1XP8A 2AN9A 2H18A 2ZM5A 1AQYA 4LBZA 1KI8A 2ZYWX 2DCUA 2YNMA 4KVGA 3ZGXA 2W0MA 1DOAA 2P6NA 3GJ4A 2JLVA 3ECCA 1K5GA 3IDQA 4JBWA 4OHVA 1C1YA 2IS1A 5EP1A 1KO4A 1WMSA 2UKDA 1L7VC 3MWYW 2G3YA 5JECA 3B1XA 1BYIA 2ZSEA 1RRPA 2QMHA 4LJ4A 1SQ5A 2B7BA 5CJPA 3I3SR 1SXJB 4BWYA 3AV0B 4PPFA 1P61B 4XIGS 2ZS8A 2PMDA 4TTQA 1P4SA 2HXSA 1CTQA 1G8HA 1KSGA 2WWFA 2ZVQX 4OHXA 3B82A 1R8SA 2IYZA 1KDOA 2FSFA 2J59A 3I32A 3AVPA 4DDWA 2X19A 1QHYA 2PH1A 3PENA 3BK7A 3FHTA 4YLGA 4JIMA 4MA4A 1NF3A 4GMDA 2GXAA 2D7DA 221PA 2W83A 1NLYA 4G01B 4IXMA 2EFDB 3K0SA 2JIZA 1GNQA 1OFTA 2ZQ5A 3BWDD 1NY6A 4AKGA 4NCHA 1YZQA 2K5UA 4JBYA 4DLVA 1GIAA 1M6NA 5AJVB 2GWHA 4AYWA 2QSZA 1QDEA 3BB3A 3FDIA 1DS6A 2XZLA 3KUDA 1XTJA 2HV8A 1Z28A 3THOA 1M7GA 1WF3A 2IHYA 5J4VA 4M21A 5TV2A 1R4AA 1IY0A 4ZIRA 3IIJA 4Q66C 4Q4AB 1COWA 2NOAA 4D4LA 3K09C 3QF4B 5BWMA 4EFLA 1XU4A 2X77A 2J46A 2OILA 5DIFA 1P5ZB 1X8LA 3ADCA 3FMIA 1U8ZA 2R44A 5FI1B 4HAYA 3ZVRA 3GLFA 4B2LA 1XZPA 1GOTA 3TW4A 3LW7A 1P73A 3PEWA 2PJRA 4FMDB 3EIHA 1R5NA 2ANCA 3HP1A 4N0DA 1SVIA 2G6BA 5CK4A 3EIEA 5K8TA 4EKDA 1E4VA 5J4KA 1E9DA 1U8YA 3Q3JB 1IOZA 1A82A 3O8DA 4JYCA 4D0GA 3G5UA 1Z2AA 3GLHB 1G7SA 3ETLA 5FPYA 2PZFA 3M0EA 3EZ6A 1WE2A 4CEIB 1NY5A 2X2EA 3D3QA 3MAAC 4PZLA 1NMYA 1HT1E 1Q3TA 2IXGA 1CULC 2Q6TA 3U7HB 4BGDA 4QGAA 4B32A 2HT1A 3I61A 4GL2A 3LFUA 5BXQC 1W1WA 1Z0AA 1DTSA 2D74A 3X2SA 5AK0A 4ACBA 2VA8A 1N0VC 1SVWA 1Q57A 2BCGY 2FV8A 3K0FB 2BBOA 2F1IA 5ANRB 5CITA 5EE5B 2ZJBA 2A5GA 3FMPB 2GEDA 2B8TA 4LC1A 4LJ6A 3WNBA 1S2MA 1G64A 2CHQA 1EGAA 2IEZA 4H1UA 3PEUA 4NCKA 3EPLA 1Z6AA 1R0XA 1SHZA 4M9ZA 1DG3A 3B5JA 2AXPA 3T34A 2VSOA 4QRHA 3CUEF 4RCYA 2RKOA 4BEJA 4CEHB 2NO7A 1YKSA 2SHKA 3KB1A 3KQHA 3KL4A 1YRAA 2VHJA 4P3YA 2WTUA 3CRVA 1E1QD 2YC4C 2J3EA 4HLUA 2JLYA 2F55A 2R2AA 1Z6XA 4C9BA 2NGRA 2ZRGA 1JBKA 2OO7A 4KFUA 2BEJA 2YWFA 2IUSA 4J0QA 2FWRA 5FOXA 3VKHA 5L3SA 3QG1A 4MRNA 1CR1A 4B43A 4D6PA 3WYGA 4WOPA 2W6JD 5HR5A 3HU2A 3FMFA 1FZQA 2YWHA 4B3BA 2FSIA 1UKEA 2J9RA 3MRSA 4XSHA 1WDTA 2GCOA 3F3YA 1BH2A 1E2JA 3I5YA 3F0TA 1HEIA 3HJNA 1GAJA 2ZEJA 3LNCA 1HE8B 4EFNA 4CF7A 1SXJD 3T15A 1I4TD 5FH9A 1KJWA 5FPTA 3O47A 4GZMA 4Q1FA 2HYDA 1K8RA 1OJLA 4UJ5A 4FN5A
chains in the Genus database with same CATH superfamily
1H2YA 2VSNA 4LVNA 1FE8A 2JIOA 3FIJA 1JEAA 3R7DA 5HOEA 2XQFA 1GO2A 4R2LA 2GJ4A 3R5KA 1VPLA 2BGUA 2JLZA 1ZOOA 1NW8A 1O4WA 2QLJA 2VYNA 2Z5FA 3F5SA 3WLSA 1MG0A 4F71A 5IZCA 3AINA 3HRKA 4MGKR 2DHRA 4FYJA 1TF7A 4QJBA 1C4KA 4Q4LA 1VSUA 4Y9RA 5J4LA 3DC2A 1S7CA 4AMBA 2AG6A 4DDVA 5J9FA 1POXA 3O73A 2Q9AA 2EJTA 3S2SA 3W2TA 4WAUA 4Q4CA 4NU5A 4U5QA 1NQOA 5AK5A 5AP9A 3GRRA 1PUJA 1G0OA 4BZZA 2MYPA 2NUPA 5D7NA 2G76A 2Q21A 1Y33E 2FLWA 4B6QA 4ZFNA 4PGHA 3I92A 3VMMA 1N8SA 2VF5X 1GU7A 2Q4BA 3WQBA 3OPQA 2FAXA 4A27A 4K6OA 2Q5FA 3GFGA 3GGDA 2YASA 5EGNA 1EFRD 4BNJA 1WXGA 2XCIA 3HA3A 4GNRA 3PRYA 2P2NA 1TZJA 4PHGA 3BGOS 4G5RA 1CJKC 3NANA 3IE1A 3P9YA 4GKVA 4DRXA 2O3QA 4MYTA 5AO9A 1XDUA 4IWXA 4GAEA 2HF2A 1RADA 1ATZA 2PRJA 3DM9B 3OO1A 1FFAA 3KZMA 1TGVA 1SXJE 4R5HA 4U00A 4ALIA 5EIWA 1YJCA 3THWB 3KTAA 1E9FA 2A8YA 2W2TA 3K05A 3D7KA 5DBGA 3NTXA 4GLOA 1Z33A 1J8VA 1EDEA 2RARA 5KVQA 3TQQA 1ZVVA 4B3HA 1KJNA 2J5XA 5CXXA 1B41A 2GK7A 4NS4A 4CG0A 1WEHA 4M22A 4O2RA 1GV1A 5ERYA 3UT0A 4QEKA 1TF2A 5KWVA 2LWIA 2OXTA 1JDBB 1M67A 5JY6A 1U5BB 4L8LA 1RVDA 1TD1A 5T4FA 2D1YA 1BFDA 3QQ5A 1N6RA 2O7RA 2GCIA 4FDVA 5AVXA 4PLZA 3OZDA 3F7NA 4O4HB 1RXVA 2YXEA 3LZDA 1C9KA 1XJ5A 2BZ0A 3SX2A 3W2IA 1F51E 4OHBA 2NYVA 3G9UA 4AZSA 2PD6A 1ZAYA 5CJJA 2P41A 1F20A 3FB4A 4OPMA 5D8DA 5GJBA 3QA3E 4R3WA 4KIUA 3WLPA 2VWHA 1LF5A 2F1HA 4GRDA 4D8UA 1TIPA 1TZBA 4AJNA 3L7LA 3UUFA 5EJGA 5L6LB 4CLRB 3AK4A 4OX9Y 2O07A 2Q41A 1FW6A 3E4DA 3DBOB 4I19A 2JJQA 5CCBA 3ZW7A 1Q7EA 2WZQA 1CW2B 4Y6OA 1J9ZA 1OVMA 2EZ4A 4CJXA 2VWGA 4RD2A 2W6JA 3FY4A 2QVZX 1ZIDA 3L0YA 4LSWA 2JKZA 1TJNA 1PR1A 3TH5A 5GOZA 1BW9B 2DGDA 2LNDA 1E79D 1EVLA 3FSRA 4EIWA 3GC6A 5LLDA 1F4LA 3PYXA 4LNHA 5EWLA 3OOSA 2V7GA 4OO3A 4B6FA 1LVUA 3PE3A 4YRQA 1KRHA 4MDHA 3WJ2A 2N47A 3GZ4A 1QK5A 1JW9B 1YQ9A 1EE9A 2JI6A 3HS3A 1DCFA 2H4JA 2YZ2A 4Z51A 3EBOA 3IB3A 4UEJA 4IVPA 2RHRA 4UULA 3UJCA 1YJAA 1ARZA 1A8PA 1RHKA 1O4VA 3O21A 5EZYA 3JD1A 1H6CA 4IVRA 4AO6A 1XHFA 3ZWPA 3WYEA 2Z43A 3D8SA 4RSGA 4FOLA 5JCXA 2QTTA 4N7MA 3JW8A 3SDSA 5MN4A 3U44B 4KAFA 1AZTA 1K06A 4OGFA 4PVCA 1B6TA 2Q1WA 2TRSB 3HDVA 3MLAA 1NVTA 5EMHA 4D6XA 4D4KA 4YRZA 2CSUA 4KXWA 5E4FA 3EJ6A 1CB0A 2FPUA 2G1KA 2H5LA 4WOJA 2CDBA 1DKLA 2XMPA 4L51A 4Y0VA 3PKJA 3OZGA 4G9GA 5HA5A 5C8DA 1YZTA 1KA9H 2R1TA 2A67A 4BECA 3ORRA 4XYBA 2D8MA 5AH0A 3BX1A 1ECPA 1UMCA 4JHXA 4XYEA 4NABA 2TS1A 2XYPA 4O2AB 3V97A 1QRAA 3AWIA 4I9FA 1E6MA 5F9MA 4B4DA 4RPIA 1Y81A 1GAEO 5J59A 2G5GX 3V4ZA 5KQLA 3Q8XB 4PICA 4GPAA 3IALA 4CDMA 2AUMA 2C78A 2I2BA 2FW1A 1CZLA 1W46A 1NAIA 5IXYA 3KSAC 2V5AA 1E5TA 4NBUA 1V16A 4D9NA 3GGCA 621PA 3PNOA 5K3OA 4R5MA 1Y89A 3WDKA 1M2OB 1KMCA 2O7SA 2P35A 2YN2A 3TPFA 5JVDA 2ZAOA 1BCSB 4J1SA 3SQXA 2D1QA 2H65A 4I08A 3FYUC 2ZBEA 1PJ2A 2WU1A 4FBGA 4NV0A 4BNKA 2JH9A 3IPXA 4WPGA 2P0AA 4WNAA 2NUTA 5JAZA 3J7AC 1NFQA 1SG9A 1MO3A 4KE8A 4LRWA 1TEZA 1LJLA 3ZGYA 2QRGA 3MTIA 4CYMA 1FXWF 2QP3A 4L4YA 5B6PA 5A0TA 3DMDA 3C3WA 4MXDA 1GUZA 3KKOA 1N5OX 5LA6B 3ROKA 4IQGA 3MTEA 2PV7A 2H4FA 3QFRA 4LF6B 1JHUA 2J3DA 3DXFA 1G16A 3WGYA 2B6NA 3DEKA 2P5SA 1CVRA 4HMOA 5C1OA 1IIBA 4I0WB 2I4RA 2QN9A 1YH3A 1WAMA 5AM3A 3QFTA 1A5BB 5HIMA 1T4CB 2I8LA 1HG1A 1JR3D 2PVPA 2ZULA 4JASB 4LCEA 4MWSA 3GPDG 4NU8X 3ICQB 2J4FA 3DWGA 3H86A 3OMXA 1NJ6A 3EIQA 1EYZA 1Z22A 3H2GA 3KT6A 3MFQA 2YYSA 4UM7A 4ZYLA 2C7PA 3HWX1 4PNPA 4TZTA 3ICEA 4GLBA 1H6DA 1HMPA 4FONA 1S3SA 3DC7A 2CXQA 1LDBA 4N40A 4PFQA 1RAIA 4ZYVA 2ONCA 5AW1A 3E5NA 5CB6A 4OHCA 5KX5F 4C04A 4MW6A 1L5RA 4H2DA 4MICA 5JZMA 1CRPA 5KINB 2XD9A 2YN4A 2YWJA 3FHCB 3L7DA 2J3HA 3ANXA 1AKRA 3LY8A 4ENRA 3QEBZ 1AKNA 1JEYA 4QDJA 4ZEWA 1P31A 3T7CA 4Q34A 1E8NA 1XEWX 3CN7A 5KSYA 2CZQA 1XF1A 2Y6UA 2B3DA 1D7OA 3IAUA 3TQCA 5FAXA 5FOVA 4CEHA 3I76A 3GYBA 1GRQA 2W71A 4JYZA 4I55A 4UPVA 4NESA 5F1OA 2HNBA 3MXOA 1PZNA 1T9BA 3GLUA 3O92A 4H7IA 1OIWA 1H2EA 4ZVLA 5A3VA 3G88A 4GMXA 3WLLA 1NF2A 4QL3A 1U2QA 4O33A 4R8SA 3WLTA 3T61A 2GPNA 5KJCA 2QD3A 4CLHA 1E1CA 1QQ6A 2OY0A 5E6UA 1ZOLA 5EYPB 1Q0ZA 1KO1A 1REQA 1X7WA 1QQAA 1GAXA 4KSCA 1PZMA 1D0IA 3EC1A 3A1VA 4M0CA 4BJ5A 4RLHA 3DEJA 4MVJH 4X9XA 5H81A 4YAJA 2R48A 3AZOA 4R6WA 2HLHA 4LRXA 3BDAA 2AJ8A 3EVFA 1E1RA 3KLMX 4U39A 4EYEA 1FRVA 4KXVA 3IEXA 4ML3A 3DZIA 1C7QA 3PP8A 3CURA 1U7HA 4TYMA 1GVNB 1SEVA 3KB8A 4TRJA 3NFRA 4Y6LA 3E3AA 2FZGA 5EGSA 3AM5A 2IV3A 4D5EA 1T9ZA 3GMDA 1B15A 1F9AA 2VJKA 1U2SA 5IMSA 3U4DA 5FBKA 5H9WA 1XVIA 3G6KA 4H4CA 3VVCA 1GVHA 1UXKA 1M6EX 1U1EA 2PTGA 4PTZA 3EAGA 4XGIA 1L5SA 5AQEA 3VR3A 5HKBA 3FUXA 2C88A 4N6NA 3W79A 1FB5A 4E70A 5ER9A 1TNDA 3W9BA 3VR2A 1YIDA 3DYBA 3PYMA 3QVWA 1LU9A 1SH7A 2ZWAA 3G2IA 1E2BA 1EK6A 1ZX1A 1W0KD 4J0FA 4Q7MB 5K3EA 3LTNC 4FXOA 3TI9A 5AOAA 1PV2A 2GVNA 2SCUA 2P9EA 2O6HA 3AL3A 2EX4A 4RMNA 1CP3A 1VHLA 2EW8A 2GUGA 5IAOA 1BRTA 1JTVA 4Y2PA 1JXQA 2QTGA 4X7RA 5EKTA 3M4YA 5D84A 1P7VA 3RUAA 1QHEA 3STHA 3R4CA 4NE7A 3B51X 3GHHA 3LXRA 3UCEA 3ZHXA 4RTSA 3E7WA 2GXSA 1WDLA 3CC8A 4UHDA 4EG6A 1Z62A 1E7MA 1RJWA 3VZQA 5HNKA 5FI0B 4TLDA 4YTEA 1OIVA 1W48A 2RI1A 3V8PA 4WK2B 1QVVA 3E2MA 3D3NA 3EE6A 5BW5A 1N5MA 2QXYA 3LF1A 5K0CA 2E4XA 1D1TA 4HNTA 2SICE 4KR0A 3OX3A 3WQQA 4KQHA 3AR8A 3E05A 3ZDYB 3KDSE 1G66A 4KIWA 1JFFB 5JALA 1KYIA 3FKJA 1PD0A 3EISA 4QQNA 5BOSB 3THWA 1OOEA 1J2UA 2O3RA 5T41A 1GTVA 3LBYA 5KJ1A 2JLUA 3Q1KA 3Q2IA 3T3NA 5IJXA 3GROA 4K7JA 3BQNB 3IOYA 3ZHZA 2GN6A 3LCMA 1EZ4A 1LBTA 2A1TS 2WVHA 2ZI9A 3O8QB 1KR2A 3NTQA 3VDQA 3TTUA 2XV1A 5KVVA 3L0CA 1KXZA 2ZBDA 2QI9C 1WOMA 3SEAA 5IVKA 3S44A 3D64A 1U5BA 3M9WA 3EZNA 2KM1A 2YZ7A 1ZGBA 3HGQA 2QN7A 3M6FA 4C1BA 4EFMA 3ICPA 3PKZA 2YHSA 2DMRA 1DX6A 4MV8A 1THMA 1AKQA 4O4HA 4PQGA 1EQAA 1KNQA 1YBFA 2R1UA 2WT4A 5KC9A 4HFRA 4UTOA 4GPTA 4M9CA 4B9EA 1FZTA 4B80A 2B1IA 4RIFA 5F1KA 2C7OA 3JSAA 1VIDA 2H2DA 2QRZA 4L7QA 2YY6A 3RF7A 1FFDA 4J76A 1XK6A 2KB0A 2WABA 1S8AA 2QWXA 1W29A 4WY8A 4CLRA 2FF5A 1N0WA 2QM8A 4AF7A 2NTJA 3ZG6A 4H7EA 3DO5A 3E58A 5CM2Z 1JQLB 4NAVA 1YS1X 4OTZA 1CR6A 1TECE 2ZBUA 3BN3A 1NJ8A 1XAJA 4DXHA 3O31A 4YCCA 2E87A 1JDVA 1QK3A 2HI0A 4AG6A 4OJKA 1BW9A 1D8TA 2C8JA 1PJ8A 1CC1S 1PR9A 1CUSA 4EY7A 1N6LA 1U80A 5BORA 1XZAA 1CCWA 4LC9A 2YV5A 1R9NA 4PRLA 4GC5A 3VDNB 1U3GA 2CLKB 1VG8A 4REOA 1L1QA 1HFKA 4Z99A 5FTKA 2QV7A 4W9NC 1M10A 4QPDA 3ORQA 5LJIA 3FPJA 3IS3A 5B1HA 2JFUA 3IP6A 4RTMA 3K2BA 3TXAA 5DWVA 4JJAA 5G40A 1QO9A 1JVBA 2VRWA 2A0UA 4PZUA 4EHLA 3U44A 2ZB2A 3OURA 4PCAA 4GDFA 2FQXA 1FP2A 4ZT3A 2NLOA 4E2ZA 3CF4A 4NZNA 4YV1A 1AKEA 4AD8A 1R4ZA 1RCTE 3U1BA 3LG2A 2ZSUA 5D2CA 3BILA 2OSVA 5IZ4A 5LDDC 1UJ5A 1NBME 3MVEA 2WSBA 2WB4A 2QGFA 2SKCA 3F47A 3QQPA 2Q4TA 4JBNA 1AT1A 3IJRA 3JCZA 2CYCA 4TWZA 5BUQA 2CNDA 4Z86A 1D8AA 1PZHA 3EOAI 4L5YA 4WIAA 4Y98A 4HHEA 4YAKA 1Y42X 2XGSA 3ESRA 3RU2A 4DT1B 2QIPA 1SEPA 3C7DB 3D1LA 1C8BA 2Z9CA 2XB8A 4O2AA 4CCAA 2BISA 4OB7A 3M6IA 4P82A 2C3MA 2YOFA 2YC2C 3GFPA 3LFTA 1U0HC 5DGXA 4LRSB 3ABRB 2Z5VA 1ZS9A 5A5VA 3UIEA 2D6FA 3GR6A 5CFZA 4BMCA 3SJZA 1Q0PA 3GB9A 3OU2A 4ES6A 3MAJA 3E5HA 4GPZA 3RSLA 3TD6A 4EL0A 5KVAA 1Q1ZA 1HDCA 2YXDA 3PZRA 4QICA 4RZHA 1M2OA 1UK7A 3QWHA 3ABZA 5FUVA 4V1CB 3VV3A 4A0FA 2IZ6A 3R8XA 3MGAA 1BCSA 2KW5A 3B6ZA 2V7XA 3ZBPA 1O5TA 2HMAA 1TD9A 1U81A 4XRRA 4V2IA 4N3AA 5AKXA 1SIUA 4O29A 4QM7A 1UAYA 1UK9A 3AY3A 5IBPA 4BIIA 1CSEE 2O0HA 1LK7A 1LW6E 1KK0A 4R2IA 1J5PA 3L3BA 5HG0A 2EKDA 1U9IA 3LZCA 1XHLA 4YY3B 4YXWA 3EMKA 4QODA 4FGSA 5LA6A 3CGGA 4L02A 3FCEA 1C4OA 1AH2A 1W44A 3HJAA 4HYQA 1H8HD 2A1IA 2D2VA 2W2QA 3KSZO 2HLPA 2IIPA 5DVZA 2WJWA 2AHOA 1DUIA 1Q11A 1XKLA 2IYPA 4HP8A 1XZMA 3QV1A 1T4CA 2QXTA 4PVDA 1PNOA 1IBRA 4HOYA 5KTMA 3JQFC 3QVTA 8LDHA 5FRDA 1ODJA 4JD5A 3VZRA 4XPIB 3H4MA 5FOWA 4OHOA 4US0R 3QEMB 3G9ZA 4CRWB 4X95A 3L7IA 1I4DD 1PDWA 2R62A 2JIRA 1CUFA 3AOGA 3BJMA 3ZNQA 3H1BA 5KTKA 5M34A 4MDFA 3RWOA 1V95A 3JVVA 4P0QB 1U6JA 5E6RB 4YDQA 3CVWA 3OVMA 3NORA 2PIAA 4LN1A 3NHFA 1O94D 2CB9A 4CF4A 2HREA 5HRCA 3EBLA 3D6VA 3W2HA 2DLNA 1ZVQA 2GKGA 2OCDA 2AH5A 1ZJZA 3I58A 2QOEA 2NU8B 3KPWA 1QH8B 3DULA 1RBQA 1BQ4A 1KJZA 3BWBA 4WN9B 4BNHA 4GH5A 3DBRB 1W4BA 3T3OA 2GZAA 5LQSA 2PO5A 1EP2B 3B60A 3Q1LA 1ORHA 3NOXA 3L0DA 5HS4A 4DAEA 4JB3A 2NXEA 4IS2A 3QLVC 4MWBA 3CVUA 3IUBA 2QZPA 3L41A 4QYXA 3X1DA 5JLAA 3UBTA 2RIRA 1OXXK 1RFGE 1T8PA 4PX9A 1U90A 3AEYA 2BKUA 3JQAB 4Q15A 1I8TA 2GSDA 1AQJA 4ZCMA 1I5OA 5F5XA 3U48A 4XX1A 3A6LA 5EYPA 5ECWA 1HNXB 1GNSA 4NYMQ 2I2DA 4KSBA 4YDHB 2GPBA 3MT9A 5A2GA 5KVCA 1AKVA 1JT2A 1RJFA 2ES4A 2VYVA 5ETJA 4J6FA 421PA 5H9VA 4XWOA 5JDIA 2YS7A 1ICIA 1L5MA 1ZD4A 7ABPA 1VHQA 1U7PA 5BSMA 2GM5A 3BAZA 2I29A 3JZFA 4O3FA 3R3ZA 1F2TB 5MDHA 3HR8A 3N2EA 4HGPA 3N8GA 5JC1A 2G9RA 4W8GA 1XMQB 1BGVA 4W5NA 3O4FA 1BS2A 1ES9A 1NN0A 4MB6A 4WUVA 5E4YA 2GJSA 2PAFA 5ARDA 4CMJA 4UATA 1KRXA 2BTOA 2NAFA 3U3JA 4DUGA 3DE3X 1FDWA 3C5VA 4K26A 3ROZA 1DJOA 3O03A 3HCRA 2HBRA 3ND9A 5BT8A 4O59O 1NHGA 2X9GA 4YWHA 4UOZA 4COOA 1U02A 2P2CA 2DLDA 3IRUA 3N5CA 4FFSA 4JLMA 2WMYA 3ZE6A 1K3UB 2X86A 2V0GA 3M9LA 3N2YA 4P5PA 4PZEA 3IVAA 4KXNA 3PIRA 3CB4A 1CUDA 4P08A 4F5ZA 2HRZA 2TECE 3BXHA 4FFNA 1NKSA 3T3MB 1K5PA 1F38A 4FMDF 4PN7A 1SKAA 3REQB 5L51A 4CUJA 4IXWA 2GEKA 1I2AA 3KS9A 2ZS7A 4E13A 1RS0A 2ZK7A 1HFWA 3QV2A 2XUKA 2YJNA 5IT0A 4IPTA 1N2BA 2JFFA 2DTXA 4Q3CA 2HYIC 3ZWXA 4ND3A 2QB5A 1NYLA 1CEXA 1SIOA 3PFGA 2PRSA 3BB4A 3C6BA 2OXEA 2W4IA 1ZK2A 1R16A 2VT2A 3DZKA 3KAKA 1HZZA 4HZUB 4KQ9A 4QDXA 3K5IA 4ETMA 1FNMA 4IUDS 1DELA 2ZSDA 1OTHA 2G70A 3BD9A 1Q74A 3FOAA 4QTXA 2Z08A 2ATXA 3K5HA 5DGDA 3RSSA 3UAVA 3AO0B 3I12A 3N70A 2V7VA 3BHJA 3VH3A 3Q8KA 2IH4A 1K0FA 4LRQA 1PW7A 4MUMA 5KYTA 1UJBA 1UPAA 2GWRA 4LOIA 5K1ZA 5KAPA 2P3LA 3KDAA 5AOVA 4URWR 3HRHA 3KHUA 3B9PA 1JFFA 1U5AA 4OV6B 3OWXA 2VPWA 4UHFA 3WWDA 4MA5A 1FDSA 3HADA 4LX0A 5BOSA 4TXMA 5KC8A 2ZETA 2VK2A 1PQUA 1S7GA 2EG5A 3AEXA 4NEGA 3HY3A 4YVFA 3RGGA 2IY8A 1LLCA 1T10A 2BJWA 1QONA 3Q3CA 4GSYA 4DWWA 3O8QA 3EODA 4HFJA 1K08A 1T15A 1NL3A 1VSQA 4N03A 5DW3A 1F1JA 1U3FA 1BDIA 3PXXA 1U3VA 5EERA 5KWEA 3LY9A 4UMDA 3OQNA 4HLCA 3V8BA 1WKVA 3NHLA 2J6IA 3HN7A 1GAWA 2R47A 4PXAA 1GRCA 3RJMA 4GR9A 4KUHA 1P7WA 3SBEA 5J2TB 3EPKA 1RXYA 3EMVA 3KLNA 4PQRA 1EBUA 4F8JA 2LPMA 4G1FA 2EDCA 3NTLA 4PSUA 4RGQA 3MJDA 4NCXA 5AKZA 3FMOB 2BVNA 1GHTA 1Y63A 1G8GA 2QUKA 5DTIA 3JX9A 3W4IA 2OBNA 3EQ9A 2ZI3A 1XNJA 3H2HA 4NWIA 4QT4A 2PUBA 1PT6A 3GGSA 2PS1A 2QQ0A 3GARA 4BLRA 1G5RA 1VG9B 1HZJA 3UJ8A 4DPKA 2CCJA 3JASB 1FLAA 3SZ3A 4B8ZA 4H59A 4ZARA 3MUEA 3H2KA 4ZEXA 1ADYA 4P83A 3GIDA 1N2HA 2M6SA 3S28A 3NHUA 1W36D 4B3MB 4M7OA 1I10A 1HQDA 1YAHA 2ORWA 2V45A 3GUCA 4ER6A 2BFNA 5ESXA 3E9ZA 1RZVA 3VZPA 4BEVA 1U2DC 4ZODA 3U7FB 4MPDA 1IN1A 4A8HA 2BLLA 5BW4A 4A15A 4M1WA 4UU0A 1KFCB 5HF8A 2A9PA 3CJTA 3KBOA 4HVTA 4KQ2A 2C1EA 2IDKA 1XXLA 2LBPA 3GL9A 4MR7B 4FFDA 4U2CA 4LE0A 5LUAA 5F1YA 5GAJA 5EOVA 4II7A 5EKUA 2WKPA 1OF1A 4QELA 4QU9A 1E4EB 4BB9A 1D6MA 1UXHA 2P11A 4PNZA 1PSDA 3EDMA 3EW7A 1B1CA 4XGKA 4IIYA 1FJGB 2J0UB 2QQGA 3HBAA 5EHIA 4B6SA 1T9HA 1HEUA 2EFGA 4ARBA 3IV9A 1E2QA 2WZCA 5C1BA 1SBQA 4GYJA 1E9BA 2HUPA 4TZ0A 1SUDA 3AKCA 1IZYA 3MGCA 3N05A 3RUDA 1JMKC 1Q95A 2FR0A 3W5BA 1BX3A 3AERB 4ZOCA 1U0OC 2B3TA 2IUUA 3R3UA 3SHOA 1S3FA 4BQOA 4JLVA 2ZYGA 3NHBA 3S2ZA 2DRIA 2PGDA 4GKKB 1TUEA 1NW6A 1T3TA 1IXKA 1E1MA 3P9IA 1ZD5A 4X65B 2EKPA 5GINE 1RCUA 2F64A 3VFDA 2PUHA 4JP1A 3AHEA 2AG1A 2IDZA 3T38A 2BJHA 1E1LA 1LZLA 2IZOA 5ALHA 1L5LA 4DT1A 2JRLA 3N2IA 4I66A 4CLXA 1C8VB 4EECA 1EVEA 1EH5A 1GL3A 4QBTA 4XOIA 2D59A 3RTCA 2XMGA 1GZSA 4BNWA 3R24A 2OFPA 4B7XA 3SYMA 2K7ZA 1KI7A 1IN4A 4QSMA 3SIPA 1DIOB 3T5PA 2WB2A 5BUSA 1ZI8A 1FMFA 4JL5A 1N5KA 4H17A 4X90A 5CM8B 2O5EA 5KU7A 3E15A 2QW0X 3PHIA 3SE7A 4GP7A 3RVNA 2G0TA 4V1CA 3EEIA 4M1ZA 2MYNA 4PGMA 1DCMA 2ZJ7A 4PZYA 4EUHA 2ASEA 3WHLA 2DQKA 2WA1A 3N7AA 5C46F 1R1DA 1AA6A 3SCZA 3AVVA 4NOJA 2ZWOA 3HDQA 3TTWA 1KEKA 2F9LA 3UANA 3CRMA 3EDCA 3F2VA 3KUCA 1ZMOA 3QUTA 4J0DA 4G8CA 2DFTA 2OV1A 4N6OA 2W2LA 4IIVA 4KUGA 4YWJA 2FPRA 3FKQA 4LVUA 3EXHC 2NO5A 5EE0A 1ISRA 3JWIA 4U8GA 4BP1A 5C3UA 3AKDA 1SQGA 1XA3A 1OHHA 2YDXA 3IAS6 2X8WA 3QEKA 2BGWA 2QJRA 2WSYB 3E2IA 3HNPA 3IUYA 1W47A 1GN8A 4M7WA 3W6NA 1PV4A 4YPFA 4NR0A 3O3MB 3RROA 1Y6RA 3VI3B 4IDEA 3I8OA 1CD5A 1GNPA 1EUQA 4XPIA 3VC3A 1X0VA 3VVMA 4B85A 4CQMD 3P0EA 5JZSA 3GP8A 3QEMA 4CI0B 3A1FA 4RH1A 1V9SA 4CG1A 1WOYA 2AV6A 2NNLD 2WIFA 3KEOA 4O4JB 1CXZA 3SGLA 4DV1B 1W49A 2OO5C 1T6YA 2FEMA 1OGJA 2JI7A 3ZHYA 2ATCA 2B8WA 3M81A 3OLXA 4PSKA 3THRA 4DXDA 5E6RA 2Q9BA 4RK0A 2JAUA 1RMTA 3ZXIA 5HKKD 2VLBA 2ZUSA 7MDHA 1MX3A 3H1TA 1JAZA 4YN3A 5G1PA 4RENA 3OETA 3PXBA 3IAFA 3AY0A 2A7XA 2NU8A 4EY4A 2VPQA 1QH8A 2F3PA 2J67A 4XZ3A 2QTBA 4W6ZA 3EASA 5AXDA 3UPTA 1WZNA 5ICGA 1QJCA 1CG6A 1QVRA 4HRVA 2B9EA 2WILA 3DBRA 3PHLA 4IZ6A 4KRYA 4WN9A 3V55A 3ZYZA 1DSSG 4F3CA 1E5XA 2XQJA 4PEVA 3ZZ0A 5C7OO 2VTKA 1Z2PX 4X1OA 2QZ4A 2JHFA 1SUSA 1R18A 3NOVA 2V6MA 4ZVTA 4N47A 4O1IA 3DE4X 1S6YA 3JQAA 1EUYA 1JEDA 3B36A 1AUXA 2OMEA 3LA8A 1XCMA 1JB1A 3BCRA 1TE2A 4TLEA 4D42A 3C1OA 3QUCA 4AQ7A 1OXSC 1V2HE 1TT7A 4K9OA 4RNDB 1TVEA 3IOEA 3UV3A 4MW4A 4G8DA 1OH5A 1KI3A 4YI5A 2HZBA 3I04A 3NIGB 1XAGA 1EVZA 4FMCF 3TJMA 3OC6A 3NGXA 2HNAA 1JR4A 2JB9A 1ZN9A 4ZP1A 3FYSA 3ZCTA 4DVGA 5HRAA 1Z5GA 1DRWA 3BIOA 2P8JA 4MLDA 1F2TA 2XNJA 2VHVA 3BTVA 3DE0X 3CUWA 2JASA 3KVYA 5LXTF 1UIRA 1RWOA 3DVLA 3KR9A 3WRVA 2QPAA 1E3DA 3CM0A 1LBSA 4NZZA 3TGLA 1LS6A 3Q72A 2YYZA 4XCVA 1XR3A 2BM1A 2AJTA 3ABOB 5BW6B 3LWBA 5CA0B 4A2QA 3O91A 4IDNA 1W581 3LL4A 3MWKA 3WP1B 4DSTA 4U2GA 1SZPA 2DWQA 2Q0HA 3IR5A 1YDHA 3SKYA 1FFXB 3LHDA 1ZC4A 1V4BA 1ENYA 4IHAA 4TUYB 4B75A 1J97A 2GYUA 2WAOA 2XZPA 3ZKAA 2CLFB 3D31A 4L8YA 1G3QA 1ICEA 4O5OA 2P27A 4F21A 3HB7A 1AMNA 1EG7A 4RY0A 2D7CA 1UC9A 3I45A 3KD2A 2PO7A 4EX6A 2KE5A 1DJLA 1A27A 2OG2A 1YD7A 2Z8ZA 3I2JA 3NX4A 4D8WA 3NDBB 16PKA 3FDZB 4TLAA 1LBEA 4YT4A 3KKEA 5AW5A 3REQA 4BZXA 5A7FA 5IHXA 5FOUA 4PZ9A 4KQMA 5EJ2A 3R77A 4IJMA 2QJWA 4GOLD 1DHRA 3R5HA 3JVEA 1G3RA 3CUSA 2PPVA 3Q6IA 3EC2A 5F51A 3WMEA 1MENA 3FSEA 2DG2A 2CDNA 2IUYA 2PUAA 3CEMA 1GYPA 3LAWA 4HZUA 3VR6D 2YR0A 1VCOA 4K2AA 5FBWB 1CEQA 1DHTA 1Q22A 2PSSA 1XPJA 2HRCA 4WFKA 2IXAA 1LWNA 5CGQB 3RIMA 3VOBA 4DQVA 3LC0A 3T1TA 1C7ZA 4PHHA 4GF5A 4HKTA 2OP1A 2BIFA 3TDMA 5EHXA 4KPGA 4Q7LA 2RHJA 4UTRA 2ZBRA 4MUFA 2NIPA 2PH7A 4EFKA 4R9NA 2PKXA 4YMSA 2XA1A 1DQYA 2QUJA 5EXEA 4S1VA 1FJ2A 1ZZGA 1Z0UA 2BUBA 1J8FA 1N9ZA 2I7CA 2PTHA 4LXHA 3VNRA 6ABPA 4ZQBA 3JQQA 1Z17A 3G2PA 1B6RA 2VXBA 3E81A 3SZLA 4CIWA 3GGPA 4CQLB 1Z5OA 2ZU0C 3UW3A 1XTTA 3JVIA 2A5YB 2IRWA 2PXXA 4QO8A 2HNKA 4BQRA 3WGIA 2AXNA 2WVJA 5GONB 4B47A 4LTMA 2J41A 3P4XA 3T3IA 2ZXEA 1BN7A 2QPTA 4LNUB 3D6HA 3GP3A 4DJEC 5H8WA 5J2TA 1L5OA 4MAFA 1E2NA 1QP7A 5KNBD 3P27A 5DTRA 2EHJA 5BYBA 1UEJA 1XCOA 1X3LA 2FK8A 3I64A 3K32A 4WZAB 2WG1A 4NH4A 3WG9A 4HWSA 3ZV6A 3VO1A 4NNPA 5AOBA 1T5IA 3U60B 3NCTA 1ZQ9A 3SBDA 4GDMA 4OFBA 3NAGA 4JI8B 2QL9A 2ZR8A 4J0KA 3JASA 1ZW1A 4LZZA 4JUCA 4HAUA 1V3QE 2FG6C 2Q4EA 2ZUDA 3IIEA 5EMKA 2H1OA 3ADBA 4JBIA 3EVZA 3WIDA 3RRMA 3L0IB 4KXLA 1EUDB 4RESA 2K87A 4KACA 2IOHA 5F98A 4B6JA 2O0JA 1GV0A 3QKSB 3SYTA 3KM0A 3UXEA 2ZW9A 2E18A 5ISMA 5BR7A 5CNIA 3X43A 2CN1A 4N0PA 1XXHE 3ICOA 4N9WA 4DQXA 1KXJA 2FUG6 4MR7A 3HTXA 1NXPA 1Z0ZA 4TM7A 4EVSA 4UEOA 4RACA 1TLFA 1VLVA 3L43A 3D6MA 4Z1MA 2CXSA 3FR7A 3GGOA 1YS9A 2X0RA 1ZA2A 2FOXA 3UT6A 3MRTA 2J0UA 4TWBA 4DA8A 1P0PA 1U94A 1P2VA 1Y5RA 1VJDA 3ZHOA 2QGZA 3TQOA 3WS7A 1V8OA 2VJCA 3TYXA 4BV8A 3AERA 3TBFA 3AB3A 4RANA 5GIPE 5JD5A 1YR2A 2XCUA 3PDJA 1PWYE 4YS6A 1GSHA 2BC9A 3DONA 4JWTA 2MSCB 4DLZA 3F97A 2FZLA 4YFVA 4YAUA 2J9GA 1ONOA 2ZUVA 4QTUB 3W5JA 3MLBA 4V0KA 3TM5A 1QFXA 1PK8A 2WV9A 3CNLA 1EEHA 4HLDA 2EX1A 1GUBA 1ZCFA 2ZTLA 3DVSX 3UUEA 4Y2TA 1NTRA 1DBSA 2QY6A 4GWKA 1A98A 1UMKA 3U4AA 1VBNA 3CCFA 2G77B 1VSVA 2WWWA 3FCOA 1ZUWA 5HQTA 3ZQUA 3UMSA 1CF4A 2A9OA 9LDBA 4QNNA 3SHTA 2G5PA 2BTQB 4IDPA 1FQOA 2Q4OA 3TUJC 1FDIA 1UBKS 3H8VA 3OY2A 1VJCA 2C2MA 4BGVA 3KZVA 2UDPA 1TO2E 4P38A 2EW1A 5G0TA 3TLAA 3EEQA 4DCOA 1IZZA 1PNQA 4KH1A 1LJUA 4NP6A 4Y2VA 1JSLA 4MUKA 2OG1A 3VPAA 4DMCA 4GYYA 2Y2VA 2D3WA 4I5DA 4M4SA 4JLBA 4KX3A 4UDYX 4Z4CA 4NI5A 1RQXA 2XVAA 3GX1A 4TRNA 4UXIA 1B00A 1JN0A 1I6MA 1ULHA 2DFLA 2WFMA 3KHSA 4BHTA 1ESZA 3NP9A 2C07A 4KN6A 4YP9A 6Q21A 4CV1A 1A7UA 4JJGA 3ZJYA 2X9QA 4YRMA 1SHLA 3EQ6A 5J43A 4TYPA 2W6MA 2X9NA 2Y1XA 2EQ5A 1QYXA 4EJSB 4PO3X 3OCXA 3EEYA 4QWMA 2IX3A 3HKDB 4ZQFA 2XODA 3E7FA 1AQLA 4QXAA 3KWMA 4JLUA 1P3Y1 4DDKA 5T7BA 5I51A 4HWKA 1ZRNA 3A4NA 2ZIWB 5J1TB 1KPHA 1N5IA 2Q5LA 4YNBA 4KO1S 1WHTB 1ZD2P 4OK3A 2V65A 3A0RB 1MG5A 3L6EA 3WB1A 2I0FA 5FPSA 1A3CA 1G21E 2AVNA 2J7PA 1BFKA 1SMKA 3SLRA 3WL7A 2ENWA 2QUZA 2BM0A 3P7MA 3OZBA 4O4JA 4BE4A 1D2HA 1X0XA 4H7PA 2XKKA 3OZRA 1X7DA 3LKVA 4G0OA 4P53A 3RG8A 3R3HA 3BRWA 5EZ6B 1F0YA 5T57A 4PE5B 4YPOA 1C3EA 3TQSA 3OWHA 1T2VA 3DG9A 2HCFA 4BN0A 2WICA 4YV7A 2C98A 3Q8WA 2ABWA 4N0MA 3UA3A 1XFDA 1ZSYA 2CNBA 4AVYA 1I0LA 3HE3A 1EWRA 1A9QA 1SUPA 3FBTA 3WWYA 3EARA 4AUKA 4OQFA 2RSLA 1IULA 4ZREA 2CHEA 3FSGD 3FDJA 4RFSB 3OCVA 4RXTA 2DPHA 4CPDA 1LI5A 4DV3B 2G6TA 1JXMA 3IPLA 5UKDA 1FFBA 4IIGA 3FVRA 4C08A 1KK1A 3BQMB 2O8CB 1Y6GA 1BHO1 2JGRA 2JATA 4KYIB 2W6QA 2EL7A 3O3CA 1T8SA 5ERXA 1SCIA 1U8AA 4E33A 1CQIB 2UZ3A 4HY3A 1MC8A 1ZXXA 4EW2A 3QZUA 5ECGC 1JHQA 1T2EA 4ZOLB 4CW7A 2Q6LA 4D8XA 5EZ5A 2AOWA 4S35A 2DFPA 3K0HA 1GZ4A 1Z5VA 2G07A 4HGZA 5ICEA 1SQSA 5EMNA 2QX7A 1JFLA 1Y9JA 2Q7OE 1XD8A 4C7VA 2J4CA 3RT9A 4D3XA 3G89A 2ONJA 3JRNA 4BQFA 1GCGA 4I9NA 3L82B 2IF2A 1RAGA 2FSVA 2KLBA 4TXLA 4BEBA 3UGKA 3WTBA 2WFZA 1SD1A 3DGEC 3DVAB 3G2OA 4L27A 4C30A 4BQPA 1Y9ZA 1C7EA 1LK5A 2P2GA 4CLDA 5AJWA 4RCZA 1F2UA 5FBLB 1QO0D 1IRIA 1RT9A 5AUPB 3O1JC 5TT1A 1DKPA 1Y8QB 2AK3A 1LQUA 2OUKA 3NLLA 5ALZA 1DKMA 5CA0A 4MS1B 2WWRA 3G7SA 2QZSA 2W37A 1G8FA 5IT4A 3KSRA 3LGXA 3DD5A 4ROTA 1Y1KE 1XU7A 4HN4B 3T4PA 4UVIA 1QAOA 1FFXA 4M46A 2PNFA 3BIXA 1OFGA 2HBQA 1N3IA 1YDGA 2QE7A 3ANLA 1MCZA 1G6HA 2UVPB 3IAAA 4TUYA 3RAJA 5BMOA 1SOWA 4LY0A 4B79A 3G6WA 4Q19A 3HJBA 5BQ5A 1M0EA 3OZXA 4QT0A 4IW3B 1VYTA 4MRSA 3WLJA 3FDZA 1QHGA 5H68A 5L40A 2R6JA 1WVGA 5HKLA 2AUNA 4BNXA 3QWFA 2C96A 1EBBA 3T7SA 5DHUA