4HB4A

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(537dltvk541/glceq)-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
209
structure length
209
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 59
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb4A00
4XH9B 3A4LA 3AKEA 3I1FA 5CITA 4CW7A 1E99A 3FMFA 3ADBA 3CLVA 4B43A 3PEUA 1X1RA 2VP5A 1KDPA 1ZM7A 5F9FA 2O8DA 2GKSA 1AN0A 4BLQA 3BFVA 4ABYA 1TNDA 4HB3A 4PC7A 4TYWA 1NRJB 1JNYA 2QE7A 2D3WA 1R4AA 3OHMA 1XEXB 1JECA 3ZZ0A 2VF7A 1CR4A 3MCAA 1IY0A 2J0UB 3CPEA 1HUQA 3EARA 4TQ9A 5CLQA 4B74A 4JBWA 4DT1A 1W7AA 1JAHA 1LW7A 2EW1A 3AVXA 4DSUA 3LW7A 5EP3A 1MV5A 5JEDA 1ZINA 1TPZA 4KVGA 5TARA 1E79A 4M4SA 3KJGA 2HF8A 2LCFA 1A82A 4MDFA 2C5LA 3AF0A 3FWYA 1RYFA 1FQKA 2X8AA 5CJPA 3X2SA 2ZI4A 1CTQA 2RGCA 4A8JC 4C0QC 1KO4A 5E7MA 2PLRA 4US2R 2FPMA 4O25A 4II7A 1NIPA 1G5RA 1TEXA 1VDZA 2N42A 4QXAA 4BQSA 1VCOA 1NLFA 1E1QA 2IYWA 3AVPA 1AKYA 3GLGA 2RGBA 2JDIA 2OCBA 3PR1A 4MKIA 3Q8XB 4NDZA 4Z8YA 4M9SA 2ZRAA 3SJZA 3V4FA 4XVUA 1QVRA 2GZAA 5HPYB 4XIGS 2FGKA 2XX3A 5G3ZA 3UMFA 1RPZA 3L43A 4DWJA 2GRJA 5C18A 3I61A 3H1TA 4Q9JA 1GOTA 1N25A 1IXSB 3ZIAD 4ASUD 1AZTA 1GG2A 1W5TA 2BM0A 2FSFA 1P60A 1S1MA 1T5IA 4Y0VA 5EE9A 4EPVA 3UKDA 5HCNA 2OESA 2I3BA 4V03A 1NN3A 2JJ1A 5EE3A 3K9LA 4BFWA 1WA5A 2ZAOA 4TT3A 2XNDD 4JLAA 2P6RA 2GVZC 5F9HA 4WA7A 2RHMA 2PH1A 4RZ2A 1E2KA 2GK6A 4ZCLA 1WBDA 4RD3A 2ZRMA 3ZD6A 2EWWA 4W9MC 4IKEA 1NF3A 4JLNA 5DE3A 4AKHA 4HZIA 4EJSB 5KSYA 4KO8A 1M2OB 3FGNA 4DLZA 4WIAA 1JXMA 3EZ6A 1Q57A 3R8CA 3OFNA 2GDJA 4LV6A 2ORWA 3K0AB 4LWZA 4LHVA 3JZAA 3AVVA 2P5SA 1ZRHA 3W90A 3RRYA 4AYXA 3QPUA 2WZQA 2W6ID 3EA0A 2CNWD 1E9CA 4KSBA 2ZXUA 4PZYA 3HWSA 5JEEA 3PITA 3GLFE 1QHHA 3QXJA 2FEMA 2OHFA 5GADl 2GJAA 3EXAA 1COWA 4YXWA 2ZSEA 4EJSC 3B85A 2PL3A 2XZLA 3B1YA 2AKAB 4W5HA 2GTPA 5FOSA 1U0LA 4KAXA 1ZMXA 3MJHA 5C4MA 1T91A 1KJZA 2BMDA 3WY9A 4P4TA 1E2FA 2Z4SA 4D26A 5JS8A 4JKYA 1S9DA 5EJEA 4C7OA 2ZTSA 3NWJA 4IDHA 1DG3A 2JGNA 2EU8A 5SZHB 4A0GA 4P0TA 1CR2A 1JXOA 3Q9LA 2GETA 4LK2A 3HU2A 1VCMA 3U7EB 4M1KA 1KZ7B 1YZGA 3MMPA 5JJLA 3LH5A 4NCJA 4UJ3A 3LLMA 4BLTA 3C5CA 2WJGA 1E9DA 1H8ED 3KFVA 4KFUA 1OXXK 1EFTA 3FHOA 2F55A 2J7PD 2ZJ5A 4IOLA 4M1WA 4R2HA 3MWKA 2QL6A 1M7BA 2AK2A 3QG5A 1RC8A 3UPUA 1Q22A 1UKZA 2IYLD 2VA8A 1FW6A 3RAPR 1OH8A 3ZZUA 4DIDA 1G3QA 3KKNA 1OLOA 4Q9IA 5HE9A 5HZHA 4JS0A 3LNCA 4UNQA 3IEUA 1WQ1R 4PANA 1KSGA 1A7JA 3HYTA 1XD2A 4M1SA 4NYIR 4AURA 3DZDA 4DC9A 2R2AA 4BWYA 3A36A 1T4GA 4TMZA 2HXYA 3T5GA 3L0OA 3A6PC 2X77A 3BC1A 3BBPA 3DM5A 2IYYA 4IDQA 2YC4C 1D2NA 2R9VA 3SQWA 4MRSA 5AJXA 4I1UA 3GQBA 3KUDA 1ZUHA 2QZ4A 3LFUA 4NH0A 2W6JA 4MQBA 3QXSA 5IK2A 1XU4A 2GEDA 4W5JA 3THYA 1YR9A 2Z6VA 1DELA 4ACAA 1RW4A 2HDNB 3MRSA 3ADCA 4PO8A 1F48A 4HDQB 3J81k 1RYHA 4TWZA 3X1XA 3D8BA 1MO3A 2H5EA 5DHAA 4DHEA 4FCWA 3UG7A 1XTRA 4BFXA 1OPXA 4Q66C 4TMTA 4HB0A 3TQCA 2FF7A 5FI0B 3GFOA 4ZKEA 1Q1ZA 1EFHA 2WKRA 3KQUA 2ZITA 1TQ6A 2IXFA 4JVNA 2GK7A 2VHTA 3IQXA 4IW3B 1YZKA 4KHZA 3T1TA 5DH9A 1H8HA 1U98A 4PHFA 4D0LB 3AF1A 1QG4A 4HAZA 4DDTA 5HZKA 3ADDA 1TUEA 4Q1FA 3NBFA 1QHSA 4DLWA 2Q9CA 2EVWX 2WAXA 1W49A 1GRQA 4D82A 5LD2C 1G7RA 1W47A 3CF2A 4DT1B 4CVNA 1C1YA 5C1BA 3H2YA 3ZH9B 1J70A 4HDCA 2J46A 1P9NA 1OH5A 1ZD8A 2J0SA 3CUEF 1AIPA 2ZRFA 5HE8A 1G4AE 1X8JA 3ASZA 4HI0E 4GDFA 3SC3A 3KQLA 5E3HA 3REFA 1VG1A 2O8EA 4GNKA 4GZMA 4TYPA 4L5BA 4M1MA 3RRZA 1D9ZA 2QQEA 5FPHA 1E9EA 1UKYA 4Q9KA 4JT2A 4RFSB 3ZVLA 1R5OA 3H86A 1NN1A 2DFLA 3AB3A 2IEYA 2P6NA 2GWHA 3PG5A 5AR1A 4QM6A 3Q5EA 4PC6A 4IOKA 3UMSA 5FBRB 1MO5A 2QT1A 3EPLA 3W8RA 4KBGA 4E09A 2GESA 4MRRA 4CEHA 2OSBA 5FTNA 3VAAA 4TLBA 2YNMA 1US8A 1U99A 2ZROA 4B6FA 2ZJBA 4C0AC 4DUGD 1FNNA 4TLAA 4I1SA 4HAVA 3CRQA 2FOLA 2GCOA 3EC1A 4RZXA 3K53A 1D8TA 1Z0KA 4N0DA 2HT1A 3NBYC 1OSNA 1QG2A 2PJRA 2W0MA 1SKQA 1U81A 2W2TA 4D25A 3C14C 2AN9A 1RVDA 4XD7D 5FPYA 1CP2A 2J87A 4PHGA 1UFQA 3JVUA 3RYTC 4OQFA 2CHGA 1KNXA 1Z83A 4E07A 1SVSA 1COWD 1OE0A 1FMJA 5KDDA 2REBA 5KUTA 1P75A 3BFKA 3WBKA 4OYHA 2RAPA 4WZBE 3EAQA 1N6RA 3SQXA 1N0UA 2P6UA 1K6MA 4GSYA 2NPFA 1SHKA 2QG6A 3DM9B 2FX3A 3ICEA 3BWDD 1MT0A 4V0ME 2ZI9A 3N2IA 1X6VA 1E2EA 5DIFA 2QORA 3GPLA 4YDSA 3IQWA 1UJ2A 1N6LA 2ZYVX 3OIUA 1KO7A 4JZKA 5DHFA 421PA 1XPOA 2DR3A 4E22A 1DAMA 2ZUDA 4Q4HA 4DBLC 2H7VA 1W2HA 3TSOA 3K9NA 3AVWA 3X1WA 4B2PA 5JBQA 1U2RA 3BB4A 1SXJA 3KJIA 2XB4A 3AVOA 3C8UA 5AUQA 4HUTA 1PLKA 4LHZA 1FX0A 3LD9A 1W1WA 3KDSE 5TV2A 2G1JA 5DI3A 2AXNA 2FU5C 2FSHA 5DLQC 4CEHB 1JAIA 2WBLC 3GMTA 4DEYA 2VP2A 1P7CA 4MRPA 1KJYA 1OIWA 1KK3A 1OIXA 3I32A 3NG1A 3NHBA 1G8FA 3HDTA 4ZCIA 3FMPB 3SBEA 3E70C 1M7HA 3BAFA 4PQFA 1CLUA 5G3YA 3VFDA 1WBBA 4YMSA 1QHNA 1KAGA 5D3MB 1YZUA 2FPKA 2P3SA 1W4AA 2FH5B 4KLNA 1G17A 2FSGA 4C0SA 5CDFA 1R8SA 3QEOA 4V02A 3VX3A 3QI2A 1GWNA 1NJGA 4S35A 1KO8A 4ZKDA 3LAWA 2VF8A 2E1RA 2WWIA 2UKDA 3D7MA 3DKPA 3IBYA 1KI7A 1OKKD 2XJ9A 5C46F 4HEJA 3AVTA 5B64A 1HA3A 2JJ2D 4ACBA 1I2MA 2ONKA 3SS8A 5KU1A 4LBZA 3PQCA 4URUR 2JATA 2ORVA 1XNJA 4EDHA 4D4KA 2WOOA 3MD0A 3W3AA 3QSYA 2CL0X 4M9XA 1W0KD 3B7GA 2F1HA 3KL4A 1TEVA 2GJ8A 2Z0MA 3AP1A 3VHXA 4DEXA 5CM9C 4QM7A 3U4QA 4D2IA 3MFYA 1QDEA 2NZ8A 2F9MA 2O52A 2QE7D 4IEEA 2PZFA 4TYQA 1U8ZA 3QKUA 5JHHB 1BOFA 2WWHA 3IEVA 5JLJA 4A36A 2XEXA 2YOGA 5A5GA 2GAOA 2VO1A 3FKSD 3AVQA 4URWR 3RSLA 5M04A 4B3BA 5TMPA 4PO9A 3U6KA 1HT2E 5CYOA 4LYJA 2ZRBA 4GRAA 2W2XA 1US8B 4CIDA 1G7TA 3LVQE 3JZMA 5EXTA 5LB2A 4M0LA 2YVUA 4AG6A 3CBQA 2DWQA 3OEED 4L16A 4OHXA 1PUJA 1ZJ6A 2DFNA 3CF0A 1N5KA 1XJ0A 2J7KA 3IILA 2ODWA 4IVQA 4K81B 5E4FA 2ZETA 5TVKA 2QRZA 2QBYA 2VQSA 4MKFA 3H4MA 1YRBA 2J3EA 3ND9A 4URYR 4CZ2A 2D7DA 2QPOA 3IHWA 1TQDA 1EK0A 1AZSC 3K0CC 3OEEA 1N6OA 2C98A 1P2VA 2NGRA 1CKEA 2V3CC 3QF4A 1UADA 4ON9A 1L7VC 4LYAA 3RDPA 2K5UA 5KSPA 3RLFA 3KB2A 5KNDA 3VQTA 3REGA 4G5OA 4QOSA 2AR7A 1A1VA 1Z6GA 4GP6A 5K8LA 2LWIA 2IS2A 2JASA 4LHYA 2KBEA 1X8KA 2IYRA 2Z83A 4P33A 2BDTA 1GSIA 2VP0A 3CONA 4ZI3A 2V7QA 2NIPA 4PZZA 721PA 1F6BA 5J4HA 2CLDX 2ZUCA 1IN8A 1QZXA 2CHVA 3PXGA 2BCGY 2P67A 1Z2CA 1ZNYA 1FOEB 3N5CA 4A4DA 1PUIA 1OW3B 3DHWC 1II9A 2VYFA 2IUSA 2WAYA 1X1SA 2J7PA 2IWRA 3EG5A 1NKSA 3NHAA 2HV8A 1NMXA 5KDLA 5TDHA 1MOZA 1QRAA 4GPTA 1W36D 2XXAB 2QAGC 4XSGA 4V0KA 2UVQA 4AK9A 3LDAA 2UZ3A 3QQ5A 3KXLA 3CR8A 4KCGA 1UF9A 3SDZA 4A1FA 4N0EA 1GILA 5FTLA 1CBUA 1UBFA 2FE4A 1GTVA 4OI4A 4DXAA 3I8XA 4XWOA 2O8BB 1KAOA 3NXSA 1GDDA 5CDFE 4IDPA 3EPHA 2ZJAA 3EIEA 1JEEA 1W4CA 2B7BA 2RKOA 2XB2A 1GL9B 2IYQA 1G6OA 2AX4A 1TMKA 1MH1A 5D3MA 4I1VA 2GAAA 5BQ5A 1S9HA 3BH0A 3OZXA 2WM9B 1AQYA 4XVRA 1IM2A 1YQTA 3K0AA 1GITA 3PUXA 3THXB 2ZRPA 1VCIA 1T3LA 2MSEB 1TADA 3ADKA 4LJ4A 2WV9A 3UMRA 4M9ZA 1NG1A 4A8JA 2RCNA 4U5XA 1G3RA 4QJ3A 1NL3A 1ZD9A 2G1KA 3OFND 4QBHA 4P4SB 1C4OA 1NBMA 1XX6A 4NP6A 2WIBA 1PZNA 2JLWA 2EYQA 5CM8B 2ODNA 3W6NA 2N1BA 5DSZA 4LC1A 1LTQA 1WCV1 4WZAE 5C2JB 5BN4A 4KBFA 5CJ2A 2ZRIA 4AYTA 4F38A 3THWB 1KY3A 5TXGA 1HQYE 2FMXA 3ZS8A 4Z51A 2ZANA 3A1SA 5DO9A 1MR3F 4Q4LA 2ZRCA 2H92A 2VHUA 4LYHA 3QPWA 5JI2E 1KK0A 4JJKA 4L9SA 1NBMD 4LV8B 4TT3D 1W36C 4C2TA 4G1UC 2FFAA 4UXIA 2HLDD 1IOZA 1T3SA 4TQAA 2D62A 1PLLA 5AUNB 2WJIA 4X8MA 2ZU6A 4GZLA 5EXSA 3F8TA 4D4LA 2IWHA 3BORA 5AK0A 2GEUA 5H8WA 1Z0DA 1HV8A 5B2ZA 1ETUA 2X19A 1Z07A 4RD2A 5CB6A 1W36B 3KJHA 1R5NA 2CE7A 4ZO4A 3TVTA 3UIEA 1CULC 2B21A 2CCKA 3GLHB 4H1VA 5E7JA 3SHFA 5KPJA 3P4XA 5H70A 3SU8A 2ATVA 4CEJA 2O0JA 1J8YF 1P62B 2DPXA 2FFQA 2ZRHA 1U9IC 2GNOA 2NPIA 2RGNA 3GLFA 1SVKA 2HCBA 2ZE8A 5AUOB 2QBYB 1DADA 3GJ5A 1E2GA 3VU9B 2HXSA 5BN3A 1IN7A 1Z0FA 1G41A 4MGZR 3SE0A 2H8KA 3AEZA 2D7CA 5DGXA 3B13B 1NVWQ 4KV9A 5AUPB 4OI1A 1X3SA 3UXMA 4X8HA 4FXPA 1W48A 2KE5A 2VEDA 2G83A 2YV5A 5L8VA 2RGEA 1KDTA 3U44B 1WMSA 1JALA 1XXHA 4NKRA 3DVLA 4HZUB 5LPNA 2CXXA 4NE2A 3AH8A 1ZYUA 3K0SA 4R2IA 4URVR 1ZNZA 2PCJA 1YR8A 4NL4H 5LDDC 1RRFA 2VH5R 2ODEA 1DAEA 4R71A 1VG9B 4LBWA 4B3FX 4NYMQ 3W3ZB 5EZ5A 3TRFA 3CWZA 2V7QD 1E1RD 4HAYA 4G5RA 3KQHA 3GJ0A 1EESA 2IK8A 1Z0AA 3IO5A 2PMKA 2ZI6A 5CK4A 3CO5A 4QFMA 4OKSA 4BEBA 1ZC3A 5JWRA 1DPFA 5DI9A 1ZM2A 1DAIA 2FEOA 3TAUA 2AXPA 1TU3A 2W2VA 1IN4A 4FWIB 4Q1DA 4RSGA 4A2WA 1N6IA 1SVIA 3L0IB 2FZ4A 2QAGB 2D4HA 6Q21A 5CK5A 1SXJE 1E4VA 1CS4C 2D2EA 2QU8A 3W6PA 1NSFA 2DCUA 3X1ZA 2O8BA 4Q1EA 5JCZA 5EUMA 2BJVA 4YC7A 3SFVA 2QP4A 4JVMA 4EPXA 2GXAA 3CPJB 3TNFA 1IQPA 1G7CA 4CEJB 1W4RA 2C78A 4LHXA 3T34A 3TLXA 2X1VA 5KNCA 3TMKA 4IDNA 3R9WA 2QQ0A 1F2TA 4H9GA 2CL6X 2KB0A 3KFXA 2IYSA 4LJYA 2IXEA 4WOPA 3ZVNA 2C99A 3EZ2A 2IA5A 2ZS9A 3ECCA 5F98A 3BK7A 4KFTA 3TQFA 3I72A 3GEHA 4QJ4A 1E2PA 1WE2A 2WOJA 4KFRA 1SXJC 4LJAA 2ZSBA 5FOTA 3TSWA 3UWKA 4D6PA 4HLQB 3OAAD 4QBFA 3THOA 2ERXA 1TF5A 2ZS7A 3IGFA 3OESA 3PUZA 4MITA 4WAUA 1YZLA 3RVBA 1D2EA 5IK2D 2A5DA 4CT4B 4QGHA 1DARA 1EFCA 3THWA 1OV4A 1OH7A 3QE0A 2E87A 4WW0A 1XZPA 1IAQA 3FYHA 4TL6A 4CEIB 4IVPA 1HURA 3AGPA 2PMDA 1TQ2A 3NEYA 2CJWB 4Z8XA 4DSNA 2GF0A 4HLDA 2C96A 4V0OA 1KIMA 2HF9A 3T12A 2FJUA 2O8FA 3CF6R 1VMAA 1ZCAA 4QC2A 4ZIRB 3GLIE 2IYUA 3NBZC 1P5ZB 1D5CA 4DSOA 2JLVA 1JR6A 1Q21A 2HEIA 2JLZA 2G77B 2IUUA 2A5YB 1V5WA 2G88A 4GBMA 4RZUA 2EFDB 4AD8A 2Q9AA 1XDBA 5FUXA 3BE4A 3RS5A 3X1DA 5JSZB 3QXCA 4C9BA 1KO1A 1DS6A 3LO5A 4MYTA 2CLSA 1E0SA 2QI9C 3P26A 4LY6A 2GBLC 2OUKA 2G9NA 1KI6B 1EFUA 1Z29A 1XTQA 3W9YA 1E6CA 5FI1B 3SNHA 1KHTA 5TB5A 2ZRLA 1IJEA 3S1AB 2WJJA 1P3JA 3KZ1E 3CH5A 4MYHA 4TYYA 3F0TA 3EZFA 3RWMB 2P0EA 4Q48A 2CL7X 3GJ6A 4ESHA 1VKJA 2NQ2C 4G5GA 4PFSA 4JKIA 1KSFX 1JR3A 3I5YA 1XWIA 3VKGA 2IS4A 2ZSFA 1E9RA 3B1ZA 3EWAA 4G01B 4QBIA 1UBCA 2D74A 3PUVA 1ZBDA 2OV2A 1OIVA 2W83A 2F1RA 3E5HA 4TTPA 2QMUA 1W5SA 4A0RA 4AKGA 1NP6A 4AY2A 1ZIOA 3GLGB 3T1OA 3ZQJA 4JBYA 2WICA 4MRNA 4LC0A 1RRGA 3JVVA 4OK5A 1GP2A 1BS1A 1KMHB 5AJYA 2B8TA 5B58C 4HSEA 5G41A 2ZRNA 4NBSA 2QT0A 1P2SA 1U90A 5H1YA 2B7CA 4EQ6A 1PV4A 5GJBA 3DEFA 1BH2A 1ZUIA 5FOVA 4DKXA 1TUIA 3AV0B 4KLZA 1Z0IA 1XPRA 4M9QA 3LXXA 1LY1A 1DAHA 1BKDR 1DAKA 1XMIA 5KTYA 3HJNA 3PCRB 3T1VA 1OXVA 2WWXA 2W6IA 3MLEA 4FCTA 4D4MA 5DYIA 1PJRA 4EPTA 1RRCA 4TTQA 4DLRA 4ZIRA 4KU4A 4XVQA 1R2QA 4YQFA 2HLDA 4C3ZA 1QHYA 3MWJA 3RRNA 3LLUA 4GFDA 4Q18A 4RZ3A 3FFAA 1S4QA 3GEIA 4NHOA 1YZNA 4UQOA 1AS3A 2IHYA 2OXRA 1CR0A 1JJ7A 1ZNWA 4MDEA 1TQ4A 1J90A 4P32A 1KJWA 2G6BA 3K0FA 4Z1MA 3SYKA 5L3RA 2OZEA 3FPAA 3O8BA 4B3CA 2FZLA 1ZM3A 3N2EA 2AWNA 3BH7A 4IVRA 3E1SA 1KI8A 2NZJA 1QHXA 4OK3A 2D2FA 1VHLA 3S1AA 1EWQA 1Z47A 2JJ1D 2BBWA 3B6EA 4BLSA 3Q5DA 1ZP6A 3R8FA 1D9XA 1S8FA 3U3RA 3K09C 4PAMA 3RHFA 2V8OA 2VL7A 2ZSDA 2ZI7A 3WHKA 1E0AA 4TMKA 2VHCA 4TL9A 1GFIA 3VHLB 1E9FA 5FTJA 3M0EA 3NVAA 2XGJA 2RMKA 1MABA 4O0MA 3VKWA 2QTVB 1DAFA 1BMFD 3QKRB 1OXSC 5EZ6B 3AF2A 3BOSA 3BS4A 3LBIA 4RVCA 5EP2A 4G5SA 1N5JA 2QROA 4Q19A 1XFAA 3TW8B 3NTUA 3KKOA 3I92A 2AHOA 3FTQA 1R7RA 2A5FA 2GZHA 2IYXA 1N6KA 4HATA 3OF5A 2J9RA 3K09A 1TTTA 4TTRA 1XTKA 2DFKB 2R8RA 3VKHA 3NBXX 1Y63A 5SZJA 2EFGA 3P32A 2RB4A 2FFBA 5L3QB 1VG0B 5CIQA 4XTRA 3TUJC 3K9GA 4NYIQ 1LVGA 3LV8A 4HUQA 1IBRA 1HYQA 1S3SA 1XEXA 4NYJR 1E79D 1T3HA 2EFHB 3CPHA 2VP9A 2XZOA 1Z63A 1GVNB 1NY5A 4JL5A 4QGFA 2BOVA 4DB4A 3QXHA 4HAUA 1R0WA 5KO2A 2YKGA 3DL0A 1TF2A 3BIFA 4AKEA 1U0JA 5JCPA 3RSOA 2JLXA 2A3RA 4FIDA 1NI3A 5BN5A 3GJ8A 1NN0A 4Q1AA 4V0LA 3AUXA 5G40A 1Z8FA 2PJZA 2ZVQX 2VSXA 3Q85A 2QM8A 3T61A 3VTKA 2R62A 4MRVA 2CDNA 3EZ9A 1VTKA 1N0WA 4XJXA 1LS6A 4WBSA 1P73A 4LJ5A 4XTCS 1P6XA 3TBKA 2KBFA 1E9SA 3V4RA 4B71A 1YR7A 1GUAA 3LBNA 3TUZC 2GCNA 2CBZA 2V6JA 5AJWA 4LZZA 1F2TB 1JJVA 1DEKA 2BEKA 3W5IA 2ZREA 1VYTA 2BM1A 2IW3A 2OILA 3NDBB 3FHTA 1HE1C 3OEHA 4HLUA 3VR1A 4D4JA 4FN5A 3U2QA 2BBSA 5FBQB 1KMHA 3QEJA 4IFEA 4QKQA 3G5UA 1LF5A 1K5DA 2G0NA 1NG9A 3SHWA 1FL9A 1XXHE 4IXNA 4ESVA 2V6IA 1SXJB 4TL7A 4U02A 2WMOB 1E2MA 3ZLJA 4AC9A 1MKYA 4M8NE 1ZD1A 1CU1A 1EFRD 1LFDB 3FHCB 3CRMA 3SJAA 1E69A 4Y0AA 1U8AA 3K1JA 1RFLA 5J4VA 2WJHA 2ODBA 2ORIA 2ZRGA 4HUQB 3D31A 2DB3A 3B1VA 4JL6A 2JEOA 3GD7A 2C2HA 3MAAC 3OIVA 3SOPA 2HYIC 3SEAA 2QGZA 3MWLA 3U3OA 5F2EA 1G5PA 4BUJA 1Z6AA 5GVSA 1FTSA 1R8QA 1Z22A 3P27A 4PZLA 4F7WA 3KQNA 3SJBA 2BMFA 2Q9BA 4IRUB 1E98A 4EFLA 3V00A 4URZR 1GM5A 1R0ZA 4Q7KA 3GEEA 3WMGA 3KKMA 2QMOA 1WP9A 1ZM9A 4CF7A 2BVNA 1OT3A 2ZPTX 5FFMA 4BFZA 1E0JA 3EZ7A 3AP2A 1AK2A 4FMBB 3B60A 1UAAA 2BMEA 2XSZD 4TSFA 4EKDA 2QP3A 3PEWA 2AD5A 5EQTA 1E96A 4IOMA 3T15A 3KKPA 4C7OB 1NSTA 1MABB 2EFEB 1XBTA 3Q7PA 4LV5B 2NO0A 1D6JA 1Z08A 3H0KA 5KDOA 1NN5A 2ZI3A 1L4YA 2ZRJA 1OB2A 4Q7JB 4AG5A 5ANRB 4JJZA 2NO6A 2QA5A 4AIIA 1XMJA 2XJ4A 3C5HA 4B6EA 1BMFA 2ZS8A 2BIFA 4B33A 2J0QA 5JFGA 3TJZA 3I73A 3QJYA 4BZQA 3LW8A 5CYPA 3A58B 2LKCA 2EWVA 4B3DA 2YYZA 5DI3B 2G0TA 3WNDA 5DNYB 3ZGXA 2MMCA 1CJTC 1Q1QA 3BERA 1P61B 2RGAA 2O8FB 1ESMA 1XTIA 3RS0A 2YWHA 3IIMA 4TYNA 4BRUA 4PPQA 4IJMA 1K5GA 5J40A 1B23P 2B8WA 4PR0A 1WRBA 4BFYA 4HYYA 2XAUA 3TAHA 1MRNA 1I4LD 2OCYC 1EX6A 1E2DA 1T5LA 2C8VA 4OL0A 2IBMA 1KNQA 2F7SA 4B2LA 4DZZA 3KB1A 4A0FA 2PCLA 2GA8A 2QRNA 3O8DA 4I4LA 4KODA 1K8RA 4L15A 2IF2A 3B2EA 4LGMA 3ZIAA 4OHYA 4JLMA 2RGXA 4LJ9A 1CJKC 2J45A 4OHZA 3GJ7A 2VLIA 521PA 2HCJB 2WPDA 4QNMA 1UEIA 4NCNA 4RCZA 2OAQ1 2PBRA 3THYB 3IUYA 5FPSA 4DLSA 1Z3IX 3NC1C 4XD7A 2QNRA 4K8OA 4OJQA 4RD0A 1DG1G 1JR3E 1HQCA 1NY6A 4LBVA 2H1LA 3LX5A 3ZVMA 5HKKD 5ELXA 2ZEJA 4DDVA 3A8TA 2V55B 3QKRA 3LBHA 4LJ7A 2KSQA 2JAQA 4EQ6B 4LRWA 2BEJA 3B8HA 4TSFD 1L4UA 2L0XA 4DUGA 5J4LA 1Q1EA 2XNSA 4NZYA 3K9HA 3K8YA 2BCJQ 2AK3A 1Z6YA 3L0SA 1BYUA 1E0KA 1WXQA 2BKUA 2FDCA 1P2UA 3FFBA 2OAP1 5FL7A 3GLFB 4YMTA 1GZSA 3O47A 1UM8A 4HLCA 1CEEA 4PHHA 3P4YA 1KZGB 2PX3A 1LB1B 3QF7A 1SVMA 2ZQ5A 1T6NA 4KVAA 3O8RA 3DO6A 5JWHA 3SR0A 1N5IA 2YWEA 3CRRA 4JLKA 1Z2AA 4U00A 5K8TA 2WJYA 1ZAKA 3QF4B 4JYCA 4NTZA 2OFXA 3K70C 4LUCA 3EWSA 2ZYWX 2OM2A 3PUWA 1R0XA 3LXRA 1OFUX 1ZM4A 3P1JA 4TQUS 3EPJA 1EFRA 3BFXA 3FDIA 3DMDA 1UBGA 4PXAA 3GFTA 4P4UA 1DVRA 1XD9A 1XMVA 2NG1A 2CLCX 3Q7QA 4YMUA 3ETLA 4ZCMA 3UWOA 4JLBA 1W44A 2DWPA 2QSZA 2R6DA 3FE2A 5FUYA 4P3YA 3CX6A 2ZE5A 2JLSA 4RKFA 5SZIA 5F3WB 2QGNA 1H8HD 5B57C 1KOFA 1NBME 1JPNA 1C9KA 3OAAA 1KI9A 2BMJA 5BW8A 4QRHA 1CJUC 5K8IA 1P9WA 1TL7C 2GXQA 1IONA 4EAQA 3B5JA 4OI2A 1SKYE 2REXB 4NYJQ 5D3QA 1RIFA 2QAGA 5CLLA 5IDVA 2NMVA 4UXHA 2H57A 3E2IA 4PQYA 4R7ZA 4S2EA 5G53C 5KPDA 1KYIA 2R6AA 1DO0A 1XEWX 3K0EA 1BO6A 2QN6A 3SZRA 3ZDQA 1TF7A 1G8HA 1ZIPA 2HYDA 2MMGA 3TR0A 2KJQA 4QGGA 1AGPA 4ITRC 3SFZA 3W6OA 1AQUA 2YWFA 1ODFA 3B1XA 4MKHA 1KI6A 3FMIA 3T35A 3HYRA 1XCGB 2R6GA 4DVGA 4D0NA 1W0KA 1UDWA 4FMDB 1KDOA 4UJ5A 5GJWC 2WTUA 2O8CA 4Q4JB 1P72A 1DE0A 2QY9A 4DLYA 1G3UA 1ZU4A 3QIAA 3NEJA 2ZI5A 2FFHA 4DSTA 2PEZA 3RANA 2R65A 4LCBA 1M7GA 1ONBA 2AWOA 4J0QA 2BKEA 2Q3FA 4FINA 2W00A 1HE8B 2VTKA 4RFVA 1XD2B 3HR8A 3SBDA 5K8UA 2JA1A 3IKJA 1XXHB 1E9AA 3PEYA 1Z5ZA 3CX7A 2A78A 1N5LA 3QXXA 1G64A 4BLRA 3GLIA 2CHQA 1TX4B 1YZQA 1J2JA 4LX0A 2IHBA 2YOHA 5C4GB 5SZKB 1G3MA 3B9QA 1N3BA 1X86B 3A4NA 1XJCA 2CK3D 1CIPA 4PSAA 5A0FA 1JB1A 3R9XA 1ZNXA 2A5GA 3M4YA 3QG1A 2A5JA 2F1IA 1OFIA 1E2LA 4LDJA 4OI0A 2QENA 3AQ4A 1H8EA 2V9PA 1M6NA 1VYVA 2ZRDA 3PVSA 4ZI2A 3C7KA 4X8OA 1S0UA 3DOFA 4WXPA 5IRCD 3IO3A 4E5UA 1OB5A 3HPRA 3U3KA 2P2LA 2ERYA 1G8YA 2GXUA 5FPTA 3R20A 3M6AA 1PLJA 4Z1MD 1T9HA 2ZYTX 5GVRA 3SI7A 4M21A 4W7SA 2J0UA 2IS1A 2AFHE 4BZPA 1II0A 1IXRC 1Y3AA 4PTLA 2JLUA 4LBYA 1UKEA 1CRPA 4TMWA 1U9IA 4DCSA 1E4YA 1HT1E 2V1UA 2FPLA 2PEYA 2REOA 3RRMA 3U61B 4I99A 1F60A 4EPYA 4O2RA 4KITB 2WIAA 2XITA 2WWWA 4DDWA 3EX7C 3UANA 3CX8A 1J99A 3CB4A 2F9LA 3U5ZB 2PT5A 5EXPA 3VNVA 1N6NA 1Q44A 3T06B 4C0BA 2NO1A 4DCTA 3NC0C 3RS2A 1MO4A 2ZRKA 1KI1A 5DYGA 5JJKA 3GJ4A 2O8EB 4Q9LA 2ZR7A 2ASEA 1R10A 3HPQA 4DLVA 1U0HC 2C9OA 3ICQB 3CM0A 2ZU0C 3MUFA 4HZUA 2DBYA 4TL8A 3A1UA 1A2KC 3OE7D 4RY2A 5FPKA 1XD8A 3AKYA 3MWYW 3H84A 2BHRA 1XMSA 2YC2C 2XZPA 2C77A 1M1YE 2GEVA 3BB1A 3R7WB 5L3SA 2C03A 3AKCA 2W0SA 2ZE6A 5JRZA 3ND8A 4AKIA 1YZTA 2WHXA 3LQRA 2ZIAA 4WZ6A 2Q3HA 3WMEA 1YHNA 2ZJOA 3F3YA 1VECA 2OCAA 4LYFA 3HU1A 2IYVA 3UG6A 3LA6A 2LKDA 4UKDA 2FV8A 1XCMA 5BWMA 5DISB 3QUSA 3QKSB 2R44A 4M22A 4U7DA 2GCOB 4FMCB 4JBXA 2OBNA 2IC5A 4PC2A 4PAQA 4DB2A 1OH6A 3CKLA 4BPBA 4JLPA 3DPUA 1CF4A 3A1VA 1YKSA 2CK3A 5JSZA 5P21A 3L0PA 4KJZA 2BBOA 5JECA 1G5TA 3GJ3A 4CYMA 4W5WA 4O2LA 3EPKA 1KDRA 1KKMA 221PA 4MGIR 3PFIA 3BXZA 3M1IA 3QPVA 4QHTA 3U3MA 1LNZA 3VMFA 4GOXA 4CRWB 1MRSA 4DRZA 3ZZTA 2PZGA 1R5BA 1XF9A 1E2HA 1FNMA 4L8GA 5DN6D 3KTAA 3CH4B 4DCNA 4HAWA 3L8ZA 4R9UC 2GCPA 1G291 3R9IA 2XSZA 3NIBA 2WWFA 5UKDA 3L82B 4EUNA 2VSFA 4F93B 3NKVA 2BJWA 3WYGA 4X8LA 2J5XA 3U6BA 3ZJYA 5AJZA 4OQXA 1R6BX 2CCGA 4DCUA 3O8CA 4NONA 3SJCA 5FUVA 1Q3HA 1KSJA 2O0KA 4TMXA 4G5QA 4GOJA 4OQMA 4XSHA 4CDGA 1VYUA 4M53A 2R6CA 3UK6A 2CCJA 4LHWA 1GNPA 1FQJA 5L3QA 1G20E 2AFIE 3U60B 3EIHA 2PLFA 4DIEA 3WRYC 1GL7A 2ZJ8A 5FTMA 2Y8EA 3FB4A 4CT5A 1Z28A 3W8NA 3GLHE 3FOZA 4Q7LA 3PEVA 5JRJA 1OJLA 1IHUA 1G1MA 4G0NA 3BD9A 4Q1BA 1OFHA 4FD2A 1Z0JA 3ASYA 3KKQA 1FUUA 5LD2B 1XJQA 2ZUBA 1Z6TA 2CE2X 5LB4A 4HB2A 2IUTA 5EUQB 4QHYA 1NVVR 2C95A 2ZJ2A 3W5JA 1SGWA 1XZQA 4UNPA 5J5CA 2F43B 2QTHA 2ZR9A 3B78A 4P31A 5JS7A 3WHLA 2XTMA 1EG7A 4QJ5A 2AKYA 2HT6A 3EIQA 1KKLA 4WXRA 3W34A 1NNEA 2NOAA 3OEHD 1DO2A 1S3GA 3VR6A 4GI7A 1GRNA 1G6HA 2RGDA 2X2EA 2OE2A 2ZM5A 1KMQA 4JLVA 4F92B 4ZDWA 3ZS9A 1ELOA 3F5FA 1ZW6A 1G19A 4BFUA 2JLRA 1LF0A 4MGYR 1G3IA 5B30A 1YVDA 1FP7A 4IDOA 4M1YA 2V54A 1AS0A 2FSIA 4LJ8A 1S96A 2YHSA 4OJKA 2B6HA 4KSCA 1UEJA 4BECA 5EXXA 4Q02A 4LPSA 4PC3A 2ONJA 1P4SA 2GBLA 1JQLB 2DWOA 1EWRA 2WKPA 4YLGA 5HTKA 4HLUC 3VX4A 4QL3A 1NJFA 1D2MA 4BRWA 4RFSA 3EA5A 5JJIA 5FL7D 1FX0B 2ANBA 3QY0A 3GCGA 4B75A 5BXQC 1II8A 1FZQA 2ANCA 4B32A 4TMVA 4IHQA 2CJWA 1M34E 4JLOA 4MKGA 5FH9A 5JMTA 1G9XA 4BFSA 1VHTA 4D81A 2Q0HA 3WXMA 4BZXA 4E03A 3U7GA 3I3SR 3I4LA 1SVWA 3CZQA 3VR4A 3L2OB 4MA4A 2JJ2A 2DY1A 1XEFA 1OKKA 4LJ6A 4B2IA 5KYKA 3QKSA 4D80A 5KHOC 3K70B 1CJVC 1HEIA 1F2UA 4Q47A 4M1TA 1FTNA 2HJVA 1ANKA 1NKTA 2CVHA 5DN6A 4HDOB 3SYNA 3IIKA 4BE7B 2ZVPX 3VU9A 1CRQA 1AJEA 1KTVA 3QENA 1DOAA 1E9BA 4JLDA 4JSTA 4AWXA 4Q03A 3I62A 3RNLA 2DYKA 4NCHA 3X1YA 1AM4D 5FBWB 1DBSA 1S2MA 1ZVQA 5E7IA 4Q4AA 4YXWD 1GL6A 2I1VB 2WVJA 3U44A 4RD6A 1Q20A 2SHKA 2DHRA 3IBGA 2J1LA 3QKTA 4EJSA 4JSYA 2CMKA 3CNLA 5FUWA 3B1WA 2OCPA 2FWRA 3CRVA 4DLUA 4A9AA 5JZVA 2YWGA 2F3TA 1NLZA 3VR3A 5L3VA 2OG2A 1KGDA 3EW9A 1NVUQ 4EPRA 2KI5A 1XP8A 4DJTA 2IXGA 4C0LA 3UATA 4NCIA 4F4IA 3U4QB 5AJVB 1QHHB 3D3QA 5FOWA 3N70A 1OXUA 1LS1A 4BFTA 1KI4A 1UBEA 2OEPA 3VR5A 1F3OA 1YJ5A 1KK2A 2ZJYA 1J8MF 3U3JA 4IOJA 3GLIB 1PVOA 3RS4A 1LV7A 2VIIA 3OE7A 1RRPA 5FR1A 1EX7A 4M2LA 5KNBA 2XXAA 2P65A 4YMVA 3TVDA 3QOFA 3LX8A 3NDPA 1R0YA 4OBEA 1JI0A 1JEDA 2NO9A 2Z4RA 4PX9A 5TY0A 3I5XA 4CEIA 4FI3C 4PAOA 4JVLA 3A37A 1BYIA 3PENA 4EPWA 1NVXQ 1T8UA 4LOAA 4BLOA 5JWOA 4Q7MB 4B44A 4B48A 1SVOA 1FFHA 4KYIB 2IX3A 2EFCB 2I1QA 4TZ6A 4LPKA 1XEWY 1VCNA 4JL8A 4EIWA 4FWTA 2V1XA 4A92A 3L8YA 2OLKA 4KXFB 4JLJA 4UNRA 4KI0A 4QGAA 3IPXA 2JDID 2IYTA 4QG7A 3THXA 2BV3A 2R6FA 3AUYA 2BBTA 1OXTA 2EYUA 2GVDC 4CGZA 5FOUA 1SULA 3OIYA 4OK6A 5HCIA 3TR5A 2HUPA 4EFNA 4O3MA 5JI3E 1E2JA 4BASA 5KOYA 4JYBA 4G3XA 1AGRA 3SYLA 4A0HA 3TW4A 1NMYA 4RJLA 2QEQA 4QHSA 4BEJA 1DAGA 3D6TB 3BGWA 1KSHA 1A5TA 3KXIA 4QNRA 4POAA 1CXZA 2H16A 2OFWA 4BLPA 3V9PA 2JLYA 3HR7A 4Q4HB 3CNNA 4NMMA 3DZ8A 3LWNA 1VIAA 3ZQ6A 4C0KA 1RKBA 1H65A 1Q1BA 4XWAA 2ZYUX 3B82A 1TAGA 1DTSA 2OFOA 2NTYC 2QSYA 1ZU5A 1T0HB 4MYUA 4AYWA 3A4MA 1L8QA 3RABA 4NPHA 1SVLA 1MO6A 3R7WA 4IEIA 5L3SB 5A4JA 2VPPA 4ZPXA 2KWIA 1S1CA 2H18A 3KXKA 4UNNA 3CWQA 3KQKA 3WRXC 1IN5A 2WWYA 1U94A 2VHQA 1EXMA 3LY5A 2ZAMA 1W0JD 4A6XA 2BWJA 1RJ9A 1G21E 4RKEA 4OQLA 1FMLA 4Q21A 1V43A 3TUIC 2YZ2A 4OQNA 2Q6TA 2V4ZA 1NVVQ 1FPMA 1GKYA 1VIYA 4PSKA 1IY2A 3AGQA 1XPUA 2J41A 4NU0A 3TSZA 1E32A 1CR1A 4EFMA 1F5NA 3TIFA 3GLHA 4LI0A 2WJVA 3WP1B 2Z43A 2TMKA 2GHIA 3NH6A 4Q4AB 4ARZA 1YU9A 4F4CA 2WSSA 1QF9A 4JIMA 1KI3A 3GLGE 2ZJZA 4GT1A 4IXMA 4URXR 2C04A 2IT1A 2JJ8A 2WMNB 3FKSA 4KYUA 4QBGB 1G7SA 2QMEA 3WYAA 3KTAB 4ILEA 2GILA 4ERNA 2RHDA 5BYKA 621PA 1JPJA 1M74A 4GOKA 4MUBA 4DDUA 1B0UA 3WNCA 2J59A 3WMFA 5J47A 2WSSD 3DOEA 3TGPA 4B3GA 3VNUA 5E95A 3AF4A 4RCYA 3PIRA 4I81A 1YRAA 4IFBA 3DMNA 3U7FB 3P20A 4L4UA 3Q72A 3WBJA 2W6JD 2RGNC 3A1TA 4B73A 2C9CA 1TU4A 2OO7A 4FMCF 4UXJA 3AM1A 3T1QA 3GP8A 1N0VC 1AKEA 3QNUA 1WB9A 2ZSAA 2VP4A 4K46A 4B76A 4FMDF 5HR5A 2OLJA 3LVRE 2QPTA 2WWGA 1E2QA 2YINC 3KX2A 1L2TA 2OXCA 2F3RA 4H1UA 1JBKA 1X8LA 4F91B 5FBLB 3VR2A 4XWKA 1I2DA 1SHZA 2ZE7A 4BFVA 1XTSA 2YOFA 3SN6A 1YE8A 3CRW1 1SZPA 1UDXA 3BJIC 1KY2A 1XCPA 3C41J 2VSOA 2D06A 3QVVA 4JVSB 4TN1A 1SKYB 3G82C 1O87A 4GL2A 1E1RA 1E94E 2QP9X 2O8CB 3AF3A 3RC3A 4HB4A 3RS7A 2F43A 4N1AA 1Q0UA 1I4TD 1QBKC 2FG5A 4OHVA 2I4IA 3GFPA 3DKVA 5FTKA 1WF3A 2IEZA 4Q9HA 2OBMA 3G0HA 2CVFA 4C4PA 2BC9A 4US1R 3RC8A 1RE0A 1GAJA 1QHIA 2B92A 3FKQA 3CR7A 2QM7A 1N6PA 2AD1A 2VBCA 3T5DA 1XB2A 3FVQA 2UZIR 4TZ0A 3AVYA 5GJVC 4Q00A 1FP6A 3HP1A 2J0VA 3ZD7A 1SXJD 2WSMA 2DFTA 2O5VA 4C2UA 4HAXA 2QUZA 1HH4A 1G18A 3CIOA 1E3MA 1RZ3A 1W4BA 4PPFA 1AA9A 2EQBA 3BB3A 1KI2A 4JMPA 1G16A 2XOKA 5HKKA 2A2ZA 3GJXC 2C9YA 1G8GA 3WNBA 4YDHB 3NH9A 3CW2A 4M1OA 5KSOA 3Q3JB 1OHHA 1A2BA 5EP4A 4YONB 4FW9A 3QBTA 2OBLA 2WPDD 1JQJC 1F2UB 2GF9A 4YMWA 1J7KA 1II8B 1KK1A 3OIWA 1U8YA 4US0R 2CNWA 4MYCA 1GNRA 4A15A 2IS6A 1IXZA 3C15C 1OFTA 1GKUB 2Q3MA 1W2GA 2PX0A 2GZDA 2QPAA 3KJEA 3MSXA 4A82A 821PA 4Z54A 1N6HA 3IDQA 4PC1A 1ZC4A 4DLTA 1RJ9B 4L9WA 2F1JA 1OHHD 4XOIA 2NO7A 3A1WA 5AWFC 2GJKA 4Q01A 3TE6A 4ZV4A 3AP3A 1IN6A 1OYWA 3RS3A 2RGGA 4JT4A 2MSCB 5KSZA 3QBVA 2XOKD 3QVUA 4B34A 8OHMA 4UNSA 2HJGA 1N2CE 2YJTD 3IIJA 4F4JA 3AKDA 1HY3A 3WP0A 4GMXA 4ZDIA 4TLCA 4C0HA 3ZYCA 3CNOA 5IHPA 5J4KA 2CEAA 5BYJA 4ARZB 3IPYA 2XNDA 2O0HA 2OT3B 4TLEA 4NYMR 4MGKR 1T0JB 5H68A 1Z6XA 3MGCA 3PV0A 1JR3D 4A8JB 4B35A 3IHLA 1VG8A 2QMHA 2AL7A 4NCKA 3AVUA 2XTZA 1KO5A 2IL1A 2P5TB 1CJMA 4Q5IA 4ASUA 3K70D 4TLDA 3BRWD 4P4SA 4PO1A 2FA9A 3I8SA 4Q1CA 4C0JA 4DCVA 1NIJA 4C30A 121PA 2A30A 1UPTA 4MH0R 1M8PA 4V0MA 4OHWA 4DLXA 1FUKA 3B9PA 4I1OA 1Z06A 3PUYA 1OYYA 3FMOB 4KFSA 3DDCA 4FCVA 4B47A 1ZCBA 3WYFA 3MJRA 4ZDJA 5CB8A 5J4YA 2G3YA 2Z5FA 1E1QD 1GKIA 2W58A 2QAJA 1E2NA 2PT7A 1GRRA 4R98A 4A2PA 4MUAA 2O8DB 1E2IA 4D0GA 5EP1A 3LRPA 1UKVY 2VHJA 5JHGB 1EGAA 2X2FA 2FN4A 1QVAA 3LQQA 1WDTA 2N46A 4N3NA 3K0CA 4PHTA 1SQ5A 2FGJA 1ESNA 2IF0A 4A2QA 2ZR0A 1XRJA 2VP6A 3K0FB 2JLQA 1T8TA 2RH5A 1YR6A 2ECKA 4PSVA 4Q4JA 1G8PA 4WVFA 2FNAA 2VRWA 1GIAA 5FBVB 3EC2A 5EE1A 2H17A 1OF1A 3HU3A 3TKLA 4GP7A 5IT5A 1G4UR 4PPNA 3EASA 5GJCA 3C16C 5FR2A 5LBIA 3RWOA 1XTJA 5EE5B 3TH5A 1Q12A 4A6PA 3KUCA 2QTFA 5FOXA 4ZDKA 2PZEA 3C4JA 4PPGA 3PJRA 4PQRA 2WKQA 3U7HB 2E9SA 1AS2A 1W46A 2F6RA 2JIZD 3ZVRA 4B3XA 1Q3TA 2ATXA 2XTNA 2A7QA 5EE0A 1VPLA 1ZUNB 1O3YA 5IF9A 1HTWA 3BH6A 1GNQA 3ONWA 1IY1A 4V0NA 1I4DD 1P2TA 1A4RA 1IJFA 4GMDA 3CZPA 1BIFA 1NMZA 3MG9A 2GJSA 4RD4A 2JCSA 1P9RA 4AI6A 1NLYA 2Q21A 2A9KA 4LSGA 4RD1A 1QHGA 4BGDA 5FL3A 1W0JA 2IYZA 5CIWA 2JIZA 3TK1A 2MSDB 2GXSA 2GJ9A
chains in the Genus database with same CATH superfamily
4KR9A 4F8EA 4CW7A 1E99A 3TBHA 3ADBA 2DX7A 2DT8A 4NBWA 2DHCA 1ZD3A 3NJ8A 2DLCX 1YZVA 2VP5A 1KDPA 3MGBA 3IIIA 4JI7B 2HF7A 4P08A 2GKSA 1AN0A 4BMXA 3BGSA 2AFRA 3BFVA 1TNDA 2BAGA 2IUEA 1PD1A 1ZKDA 7REQB 3NMUF 2CLLB 1TD9A 3KUKA 4Y9TA 1BOOA 1Y6RA 2QUJA 4KQIA 1M0WA 4X7RA 5T4FA 1VMIA 2QE7A 2HWKA 3AZOA 5C52B 3I8OA 3C3BA 1AXGA 1JECA 4COOA 3UMJA 3VPAA 2J0UB 2ZIZA 4N5HX 4RQBA 1BEUB 5CLQA 2OUIA 3CZ5A 3EIWA 1WZUA 2EW1A 5BQOA 2R6ZA 5EMNA 4UCXA 3UUEA 1X1DA 1XYGA 2JW5A 3UNXA 1HDYA 1L4GA 4BE9A 2OCXA 4NH4A 1H2AS 4ZMRA 3KQPA 2APJA 3PTAA 1E79A 2IP4A 2NTVA 3FWYA 2HY7A 2ZI4A 3KQMA 1EHIA 5BOSB 2OECA 5E7MA 4US2R 2PS1A 2MYPA 5KYYA 4B6JA 4JR2A 5M7EA 3HJFA 4O8CA 1G5RA 5IANA 1TEXA 1VDZA 4G89A 1PEDA 4QXAA 1WKVA 1VCOA 1NLFA 1VPWA 1IHYA 4ID9A 5KQSA 4KR3A 1WQ4A 3A7DA 5IPFA 3RAFC 2RGBA 2JDIA 1LNSA 3PR1A 4QOEA 3Q8XB 2BFEB 5H0IA 2D1SA 3T1NA 3PFBA 3TECE 3CEJA 2ZRAA 3FUTA 1ZZGA 3SJZA 1QVRA 1O54A 5HPYB 3E8SA 3E4DA 5G3ZA 1RPZA 3SG0A 1HWYA 2WINI 3L43A 3IJRA 4BXOB 4DWJA 2GHTA 4F84A 4PBSA 1F0KA 2A67A 1WP4A 3F7NA 5CFNA 3EUWA 3JSAA 1QRDA 1WF6A 3CFYA 1WM1A 2I6TA 3I9FA 4K2AA 3QY9A 4GIBA 5ERXA 4C5AA 4KTVE 2C7QA 1N25A 1AMOA 1MGPA 3SCZA 3MWDB 3ZIAD 3QYFA 1GG2A 5IW8A 3DULA 2BM0A 4JYMA 1P60A 4RV4A 4RPLA 4WZAA 2PMEA 4ID3A 4BV2A 4DS3A 2VXYA 4Y0VA 5EE9A 4RA6B 4D9JA 5DT9A 2OESA 3HCAA 4KGDA 1YQUA 1D09A 2XT9A 5EE3A 4REMA 4ITVA 1WA5A 1H3NA 2PUVA 4TT3A 1IK6A 2XNDD 4JLAA 2GVZC 2R8XA 4MUIA 1PV2A 3HB5X 4QXRA 3FBGA 2PUEA 2P6RA 1H4TA 3AXTA 1NT2A 3HFRA 4MCIA 1N0HA 2QZZA 1P44A 1GARA 5HQ3A 2PH1A 1AUVA 1B6RA 1H2EA 2QTLA 3BWXA 3H2IA 4LA4A 1NAHA 3E0XA 5K2OA 4UZSA 4XYBA 4ZI7A 4IKEA 1NF3A 3C3EA 4I9FA 4JLNA 3O83A 4LE1A 3DBHB 4UHCA 4XAQA 4HD8A 1X87A 4X0EA 4WASA 1FDRA 2I6UA 2IHKA 1C9MA 1TW2A 4HZIA 3Q7IA 4EJSB 1QF7A 4FUTA 4BN5A 2ZJ6A 4DLZA 1JKFA 1I2ZA 1JXMA 3HKBB 1Q57A 1FLNA 3H9CA 3HLKA 1TZKA 2ORWA 4LWZA 1QQAA 4UM9D 2Y76A 2P5SA 4Q37A 5DNAA 4JI2B 3RRYA 3GPCA 3PPVA 2NU7A 4CM8B 1QIGA 4W5RA 4H6WA 3RSSA 2ZBUA 3BWMA 1E5XA 2XMCA 4PZYA 5AK6A 4AN4A 3OQVA 4D02A 3HWSA 5E9JA 3PITA 4JBIA 4P84A 3QXJA 2ZB8A 1E6KA 2OHFA 3TAXA 1EYZA 1D4AA 3R5FA 4YXWA 4HNGA 5HW0A 5JZOA 3B85A 2XZLA 4IKPA 3R0JA 2YZMA 2Y1EA 4MV9A 3JVDA 4Y6LA 2WP0A 4MWDA 4W5HA 5H80A 2E0IA 5C5DA 1ZVKA 5C4MA 2VDPB 3SWWA 4L8YA 2DPMA 4P4TA 1PJQA 2X3YA 1SIWA 2Z4SA 4JKYA 3OUUA 4HT3B 4C7OA 4J3FA 4OFBA 1KMNA 1X1QA 1DG3A 5LOVF 4OD0A 5SZHB 5GZ3A 1ES9A 4H35A 2D2IA 3E15A 3Q3CA 4LK2A 5ITZA 4ZV7A 4R2JA 3L01A 4QFCA 1A9RA 2UZ1B 3N0XA 5CVUA 1Z5WA 3U7EB 9MHTA 1SC3A 3SX4A 1NYTA 2HPZA 5B58T 3MMPA 3ROPA 1U31A 5JJLA 4P36A 2IOQA 4NE9A 1FU4A 1UZMA 3A4YA 3D8UA 3F67A 3LVBA 4NARA 4PM4A 4KFUA 3MCUA 4AO8A 1ODKA 1TKRA 1V25A 5IBQA 5I5GA 5KYGA 4DV7B 1WTCA 2L82A 1I36A 1AQIA 2ECFA 3FHOA 3EB9A 3I2FA 3KALA 4TTIA 1YTUA 1TJ3A 3EH1A 3UJ6A 3MWKA 5F51A 2QL6A 3PXBA 5HFAA 4U7HA 3R23A 4O2AF 3K2BA 4XM2A 4Z53A 2EX0A 1W85B 1Q74A 3U7JA 5ALEA 1LXCA 4OOEA 5IU6A 3JQAD 2ZULA 3HTXA 2BCEA 1FMFA 5TPWA 3A1NA 3OQ6A 1OLOA 1QAQA 4PSDA 4Q9IA 3ABSB 5HE9A 3R6DA 3PKIA 3GYGA 2OP0A 3A9WA 3DONA 4JS0A 3VGJA 4F21A 5BSEA 1QH1B 3NONA 1A7JA 5FOQA 1EZ4A 3SDBA 3P52A 3O8QB 3W2FA 2A9FA 1K0UA 1YI1A 1CUUA 5DCWA 3BKWA 3ITEA 1BEZA 4B7CA 3KL2A 4GYJA 3PC8C 4OM7A 3SIRA 3VSEA 3WGHA 2JCBA 5CGQB 3QI7A 4JI0B 3LNTA 4FN4A 4IBOA 5LQUA 1C1XA 1JA1A 5G4KB 3UT0A 1UJ5A 1QRRA 1SA0B 4ARVA 2IYYA 2JCXA 5IARA 5ALRA 2EHJA 5CXSA 1D2NA 1G59A 4RANA 1HZZA 3FY4A 2W6JA 4GKVA 3O1HB 3GT7A 5FHQA 2YN2A 1B8VA 2EX1A 5E2IA 2JHGA 5K3FA 5T4HA 5L45A 2GEDA 4W5JA 2F8TA 3KXDA 3A3NA 4RW0A 1BHQ1 1YR9A 1DELA 5ICFA 5J2TA 1SC1A 3JPYA 3E9RA 3LBAA 2VPWA 1FLDA 3O2SB 5KJ1A 3ADCA 1KMIY 4PO8A 1F48A 5C5CA 4K28A 3ROKA 4O4LF 3MXTA 3RC2A 1U4NA 4HXYA 1RYHA 3X1XA 4O3FA 2GLUA 1A9OA 2CUKA 4LS3A 4EOGA 1OPXA 4OHFA 1RJDA 3C3JA 4PZAA 4TMTA 2FF7A 1JPVA 2FQWA 3Q6NA 4QUKA 5ERYA 3OCZA 1WDLA 2Q1XA 2VZEA 1W94A 4BIMA 2XUIA 1R1DA 2C7BA 4IZOA 4E5SA 4L85A 2VTBB 3O8NA 4HGRA 2VHTA 3IQXA 2VPYA 4IW3B 3ZHUA 4BEVA 4W8GA 2GR9A 1CHDA 5DH9A 4CU5A 2I4MA 3G6WA 1WABA 2E3JA 3OBIA 4J94A 4GSKA 1BRTA 4OA5A 4DDTA 2B8EA 2FK7A 3ADDA 3BQNB 1QS0A 2FPPA 3A1CA 4S0ZA 3EXG2 3TL3A 4IYRA 3W9UA 1IRXA 1G9SA 1LLQA 2Q9CA 2Y0CA 3G8YA 2WAXA 1L5RA 1W49A 1GRQA 3H2SA 3DEJA 1XCBA 3JQFA 3P9SA 4ZYXA 5LD2C 2WA2A 2VWGA 1W47A 3MT7A 4KG7A 3GROA 1BG6A 3H2YA 3ZH9B 4DR3B 3IB3A 4LJSA 1Z4QA 2J46A 1RLJA 4FHFA 3SDSA 3O84A 4CIYA 5AQ1A 3AU9A 4TRMA 5LOVB 1OH5A 3CUEF 3IQHX 5CGZA 1VL0A 4HBZA 1G4AE 1C7IA 1X8JA 2XUQA 4I9GA 1ZH6A 5E3HA 1QYVA 2BLLA 2IOFA 4GNKA 4M1MA 4N47A 2EQ5A 3KPWA 3GZJA 3IV6A 1VP3A 3O3CA 4MYRA 2QK4A 5A4AA 4JT2A 4K0RA 4O4HA 4QECA 4B40A 5M34A 4RTJA 3DYBA 2I6GA 4DTIA 3D1LA 2GUWA 1EE2A 1C3OA 3FPHA 3D2LA 1L5OA 4I6EA 1RTKA 3HG7A 5JY1A 4DV0B 1RXUA 3O26A 5J2UF 2QLMA 3AERA 2O3SA 4EATA 5FBRB 4CJXA 4X61A 4L95C 5A03A 1K7CA 2BM8A 3HCPA 3B3AA 4BBJA 2YCBA 2A92A 1XROA 4KBGA 4Y2SA 5L7TA 2PAFA 1ZEJA 2OSBA 3IQFA 2OHOA 4FS3A 4QARA 4KOEC 1F12A 2X86A 2YNMA 4WN9B 5KZMB 1NASA 4GMFA 3CRQA 3C3WA 4IHAA 4KK3A 3C1AA 5GONB 4TRJA 4N0DA 3IDOA 3S7ZA 1PKEA 4YBZA 1SKBA 5CFOA 1TZJA 4DA6A 3G9TA 4P6VF 1PS8A 4C7MA 2PJRA 3WLQA 3U7IA 1JIUA 2REQA 1ONPA 4XKJA 1SKQA 2PHZA 1FRNA 1T1SA 1RQ7A 3C14C 5FPYA 3H9GA 3CT4A 1UFQA 2JIPA 5I7WA 3RYTC 2CHGA 1KNXA 1YL7A 1COWD 1NU8A 3ZW9A 4BKOA 2REBA 4UBOA 1DJOA 2YHBA 5A9TA 3BFKA 2CZCA 2XA1A 3PZBA 3M3PA 4LN1A 4MUKA 1K97A 3WBKA 4WZBE 1JXAA 2O8VA 3HY3A 3IRUA 4MWEA 2IKQA 4CR7A 5CA1B 2GB4A 3WGGA 2HJWA 2HPAA 2QG6A 4EL0A 2PUBA 2FX3A 2IOFK 3TZEA 3U81A 4CKCA 5KI6A 1MU0A 1MT0A 4RQTA 3TOXA 2IIVA 2ZI9A 3A4TA 4FYYA 4FBMA 4KSYA 1XRPA 2QORA 3HLTA 4HNQA 5BRNA 5AMXA 4CF3A 3OIUA 3GT3A 4GMGA 5DHFA 3OQ1A 1OWLA 4F4UA 4HPWA 2DR3A 2ORED 2B1RA 2I55A 1ARZA 1DAMA 1SCBA 4UBKA 1H2HA 3D8HA 4XW2A 3DT9A 2WIKA 3UWMA 3EFOB 1U9YA 1W2HA 4ADSG 3A7EA 1QCCA 1YXMA 3KLBA 3LC1O 3R0XA 1SXJA 2DSNA 2ZB3A 4UHHA 2GZ1A 2GAJA 3J80A 1RLUA 1GAXA 1OI4A 4Y7CA 1PLKA 5KHAA 3HKDB 4X1YA 4Y67A 4KIUA 3I0MA 3LD9A 4RTOA 4KQKA 3VDQA 3WQHA 2V6FA 2AXNA 1J23A 3SOZA 2YX1A 3O91A 1W19A 1JAIA 2RJ3A 3EMDA 1XJ5A 4YQZA 3GMTA 5ALOA 3ZTYA 4S05A 1P7CA 2ISSD 2QN7A 4X20A 4LVOA 5JAPA 1TT7A 5K7SA 2Y1DA 3EXHB 3NHBA 2XYQA 4PYLA 3HDTA 4ZCIA 5F4BA 2J5BA 1P7WA 4RSRA 3E70C 4M7WA 1FXWF 5DCLA 1CLUA 5G3YA 3LG2A 3CSUA 4U3JB 3OF3A 3VFDA 5CVVA 4KZKA 3PB3A 1QHNA 1K3TA 4YCBA 2P3SA 1W4AA 2WUGA 3OWXA 1G17A 2V5VA 4DG9A 3EZLA 4HDAA 2M1XA 4C0SA 1DUSA 1R8SA 4C4XA 3UC9A 1E3JA 2BW0A 4GRDA 3BRSA 3QI2A 4S35A 4BNXA 2YYAA 2Y1FA 4ZKDA 1Z7GA 2VZ8A 1HRKA 1IBSA 2BY4A 5FV7A 5DTJA 1QFSA 1KWKA 2UKDA 3D7MA 3DKPA 4MR7B 3EISA 3DVRX 5AJHA 4NR0A 4UEJA 1OKKD 3L6UA 2RH8A 2QUBA 4B4OA 4P3KA 3IXLA 3UMCA 2ONKA 3SS8A 5FLXA 1IY9A 3N6RA 4MV8A 2QMZA 3KYJB 4S1NA 2TS1A 5DTMA 2ORVA 1BFUA 1XNJA 3RU9A 4L07A 1E5VA 3PI7A 3OZTA 4Y2UA 4E15A 4EDHA 1THGA 3W3AA 1L5QA 1BRMA 5LQRA 1EA7A 4G4GA 3IDZA 4EI8A 2NU9B 3IAFA 5AI6A 1W0KD 3B7GA 3KL4A 2DY0A 3AP1A 1WXFA 3FPEA 4MPTA 3UXYA 3U4QA 3KJNA 1OAKA 5C32A 4ZJYA 2NZ8A 1N1DA 2F9MA 2O52A 2PU5A 4BX0A 4UEWA 5H4GA 2AMLA 3ND7A 3ZZMA 5CT4A 4CM4A 2I78A 3KB6A 2FR0A 5AW7A 3UAXA 3OTIA 2GTHA 1S01A 2K2QB 5HUHA 1BOFA 2I1LA 3GI1A 3PWSA 1ZY2A 5KX5A 4WOBA 4FCCA 5A5GA 3ISJA 5B2EA 1T0UA 3MW8A 3RSLA 5LNK6 1KRHA 4PYIA 4BJ1A 4MQLA 4EVQA 3I9LA 4UFOA 4KREA 4R16A 4EK9A 3U6KA 3EVNA 3PS9A 2ZRBA 3ITDA 3M6FA 3QPAA 3AI7A 3M9LA 4MV1A 5CYOA 7REQA 2ZB4A 3CJQA 2XQGA 3RVQA 4CIDA 3U39A 1AUPA 1G7TA 3LVQE 2ZTMA 3JZMA 5AW2A 4FZJA 3WB9A 1NNI1 3HMQA 4M0LA 1RI1A 1EFVA 4AG6A 1H1LB 3CGGA 3NQ41 4M1ZA 1Y5RA 5K0GA 2VJCA 3UK2A 2OK7A 4K81B 3W5CA 3MB8A 3EZGA 1CRWG 4PGGA 2XUHA 1WVMA 1YRBA 2J3EA 3ASUA 3SF8B 1OT5A 5LBUA 2ZWVA 2YXEA 2VJBA 4ARBA 3NM5A 1AZSC 3W1EA 3DEIA 3GRRA 1X92A 2ACVA 3QF4A 1B93A 2Y9MB 3RDPA 4FOPA 4Z4EA 2INGX 4Z9YA 2V8BA 2ATIA 3MMXA 1MEJA 2GPNA 3VQTA 1AQNA 4IIYA 3REGA 4G5OA 4QOSA 2AR7A 2BFBB 3DYIA 4MW6A 2VYCA 4GP6A 4ED9A 5K8LA 3QE2A 3ZD9A 2AQ8A 2LWIA 2WQZA 3N8IA 3UW1A 2IS2A 4O4IF 2IYRA 4P33A 2DQZA 4C4SA 2W6OA 2VR1A 2VT2A 2VP0A 2Q07A 5EJ4A 2PX5A 2QLLA 3OQBA 2NIPA 4Z3KA 4R1QA 4TGLA 1K7FB 2FDRA 4ECAA 1EGMB 1M2NA 2A84A 4GE3A 3RVPA 1R88A 1ZNYA 5BR8B 1GUFA 4H3VA 4Q82A 3GMDA 3PUHA 1LDYA 1DI0A 2GASA 3FW1A 3HY4A 1I1HA 3ONDA 1U0FA 1ULUA 2DJIA 2DLDA 4AZSA 3UHJA 3V1NA 1E1DA 3KTOA 3EG5A 5ESWA 5KVVA 5TDHA 2XUJA 1AK1A 1TK9A 3FJYA 4GPTA 2QAGC 1IHPA 3VYVA 3LDAA 1FJ2A 1FFDA 2ET6A 3C6YA 5JQGB 1MW8X 2OGZA 1IVYA 4TWRA 5G1OA 4KCGA 3UGTA 4EX6A 1RPJA 1JILA 2XIQA 1QIDA 4B8YA 4R9RA 1KYZA 2FE4A 4BX9A 2XDYA 1EHCA 3VNQA 3VM6A 2C5BA 2AXEA 1USUA 4IRXA 4A73A 4PRKA 4IDPA 4M88A 1ECJA 2XMDA 3RUHA 1JEEA 1W4CA 1P4JA 1D2AA 2XB2A 5HP4A 1XRMA 1V4NA 4L4SA 5EYPA 3RHTA 3SXUB 3WDKA 4QVIA 3OZXA 3IP9A 1GZ3A 2OKCA 1AQYA 4FYKA 1V8PA 1YQTA 1OV6A 1ITZA 1GITA 3P9RA 4CCYB 3PUXA 3ZW8A 3THXB 2ZJ3A 2AJDA 5G1PA 1VCIA 2ILVA 1QF6A 2MSEB 1ZOIA 1TADA 3ADKA 4WEQA 1QPBA 2DLNA 2HLHA 3UMRA 1QOZA 5DHQA 5IWCA 1J5PA 4U5XA 5CTAA 2H85A 4QJ3A 1P91A 3OFND 5THKA 3NYWA 3PHJA 2XKAA 2OBYA 3JAMA 4N41A 1R4MB 1N2OA 1NBMA 4R69A 3M2PA 2EYQA 5CM8B 2ODNA 4OUDB 1UPUA 4C0WA 4W1SA 2JLWA 2FR8C 4LC1A 1HETA 5C2JB 3KLOA 3DWIA 3DJFA 3EZNA 3WGYA 2IPMA 4KBFA 4HJRA 3M33A 4XJTA 4I1IA 5ILGA 5DNDA 1HQKA 1KY3A 2R47A 1UBUS 2YBEA 3E3OA 3FPSA 3IVAA 3OEWA 4MCJA 4ZP1A 4ZT6A 3VUFA 1CEQA 4F3NA 2QI9F 5B5SA 5JISA 1DC8A 3EEQA 1W6UA 2Q6OA 2VHUA 2QUAA 4LYHA 5AHKA 4EGCB 5ICGA 4L9SA 4MS4B 1NBMD 4LV8B 3ZKWB 3UH1A 1WAMA 3RYCA 2AJLI 1TA9A 5COBA 4TQAA 1DQSA 5JAIA 4M36A 2YICA 3FYUC 4RPGA 3OZFA 1I7DA 1Y1QA 1FQOA 3LF2A 3R3UA 1XN1A 5A6SA 4GZLA 4H16A 3F8TA 2Z58A 3LDUA 3WWDA 5H8WA 2X0DA 1ETUA 2GKOA 1Z07A 1W36B 3JTMA 1U7UA 1RAIA 1K0FA 3KJHA 3TVTA 3HKCB 1SCDA 2B21A 1E7YA 4QQ8A 3GLHB 2PZMA 4URFA 3WGLA 1RAEA 3LP5A 2HWUA 4BMZA 3VMMA 3DCNA 3WQBA 4H0FA 3CEMA 4CEJA 2Z4TA 3LK7A 1XL0A 3PA6A 3F98A 5JSQA 2IZ1A 3GRYA 2IX9A 5AUOB 4R31A 3S0JA 1IWOA 1E2GA 3NAZA 3TTVA 1FRQA 4GXRA 3VU9B 2WU4A 3MS2A 3ZCQA 3U44B 2P9ZA 3CIFA 1HEUA 2ABWA 4NV3A 2C5AA 1YT5A 2D7CA 5IF3A 3B13B 1NVWQ 4BB5A 4D96A 4M38A 3E9YA 3CZ4A 3E9MA 2D2VA 3OLXA 3VV2A 3NBAA 1X3SA 1U8TA 2AYZA 4IUYA 4PNZA 4FXPA 4QASA 5JMPA 3AONB 3PC3A 3DE6X 1U3FA 3UW3A 4DPKA 4YCNA 5L8VA 2B34A 2E82A 5IDWA 1J9ZA 1NQUA 2R7LA 1WMSA 3AUJB 3DT8A 4OQ4A 4YA6A 4OATA 5DNUA 4EVRA 1FU7A 1LBHA 4HZUB 5A9SB 2FR1A 3COWA 3KBOA 3NEAA 1K27A 4GVXA 3DZIA 3UTDA 5LPNA 1ISIA 3ZJUA 4OQQA 2Q1YA 2VDLB 4C7XA 4N9QA 3PI6A 4KV7A 3RFTA 3KZNA 3PEFA 3H97A 4R71A 5C7LO 2Q7XA 1NX9A 3KTFA 2P1ZA 2Q3DA 4RIIA 5ALMA 3U7QA 2E21A 3QNWA 4G5RA 3KQHA 1IE3A 4RF5A 4ZO8A 4IWYA 2C2OA 3HWRA 1PFWA 3IO5A 1DGQA 2I33A 2YRWA 1O6FA 1IJBA 4OKSA 4RJJA 3DCIA 5FA8A 3GIWA 2AYYA 2HX1A 3ANMA 1MEEA 2CLEB 3TS1A 1PTJC 2VI5A 1Z4IA 4JFAA 1QTRA 3P0JA 1MOQA 4FZ3A 4A2WA 2AXPA 1TU3A 2H2AA 1IN4A 4FWIB 4Q1DA 1A96A 4KQ1A 4RL4A 2XYHA 2CHUA 3JYPA 1GCAA 1VLZA 1I5EA 2HIAA 2V6GA 3MGAA 2ODTX 4CNQA 5IEJA 2PSHA 4TV9B 3CF4G 2QDKA 3FD8A 1RWOA 4IWNA 4IICA 4II2A 5AM1A 4AJ9A 2D2EA 1CS4C 1QGAA 2GSWA 2FRDC 2NTEA 1NSFA 2P8SA 2O8BA 4QTZA 3D6UA 3U09A 2AW3A 1WQ3A 1DXHA 3NYIA 4C4RA 3IR6A 3OO0A 1OX6A 3UJPA 4C4YA 2QP4A 4UZFA 2XZDA 3E9EA 4TLLB 2GEFA 5BYBA 1PZMA 2NTJA 4EPXA 2GXAA 3TNFA 4BMOB 1QH1A 3MILA 2XTJA 5MDHA 2IZZA 4ZQBA 3T34A 4LAFA 3TLXA 3AOEC 5FPPA 5D8DA 3D3JA 2QVYX 2R1VA 1C9DB 3PHIA 2KB0A 2JCYA 2HMYB 3WMWA 3O38A 4ZT5A 3GRVA 4DIFA 5CBKA 4LJYA 1W8IA 5E2AA 2GPJA 3VO1A 3TRIA 5IXJA 2BKXA 1C41A 2C99A 2F90A 3KE9A 2PGIA 3OOWA 4TRRA 4CQMD 2XQFA 1PWXA 3ECCA 1RLTA 4ZYTA 5F98A 4MLZA 3GEHA 1Q50A 4ZO9A 1E2PA 1WE2A 5EQFA 3C1UA 3QFFA 1H2FA 3PNYA 2WOJA 4KFRA 5FOTA 1BD3A 2Z5LA 2JK1A 2ZSBA 4QUJA 3TSWA 3HYSA 4HLQB 1E7RA 3OAAD 4QBFA 5A02A 4CLRB 4NAHA 1ZRSA 4DWVA 5JBIA 2JH3A 3CISA 3OZIA 4O4HB 2OV3A 3EY9A 1TF5A 2XUAA 3OESA 3PUZA 1ULBA 2D59A 4QAJA 4WAUA 2RHOA 1O6CA 3TW8A 2XRZA 4CT4B 3NRJA 1DIHA 2JAUA 1Y42X 4QGHA 1F4LA 3THWA 1KH3A 4HHEA 3A1EA 1XZPA 3U1VA 4C3OB 2ZCJA 1E4OA 1H9AA 4IVPA 4YP5A 4BNNA 2PMDA 2PWBA 4H7DA 2W48A 4KWTA 1XDSA 4DSNA 2FHPA 3ZDDA 1LA2A 4HLDA 1ZVVA 1KIMA 4MW5A 4QOIA 3S3TA 4D8WA 2EERA 5LUAA 2J5RA 3T4UA 4WBNF 1GUZA 3G7UA 1VMAA 3PQ8A 4QC2A 1J9GA 3A27A 3NBZC 1JR6A 4R0NA 4XARA 1V1JA 4FKBA 2M6KA 1L4MA 1NM5A 2HEIA 2JLZA 4EHFA 3IP1A 2G88A 1V5WA 4GBMA 4RZUA 3GVPA 4AD8A 5IVPA 1XDBA 2QVGA 5C1IA 3BE4A 3HACA 3R7DA 1HLPA 5U9CA 1I8TA 1HE5A 3H6GA 4UOQA 4BOYA 1O03A 1WTAA 3AFNA 3G2HA 3UK7A 4NZNA 2WUDA 3QHQA 4I6GA 1UFVA 1M34B 3ORHA 1O58A 3NT4A 4LY6A 4Y2YA 1L4FA 3ESCA 3GXOA 4HFRA 4CMGA 2WU8A 1Z29A 5E6RB 3GNTA 3HC7A 2RBKA 5DNVA 3SNHA 4CF5A 5TB5A 3RSHA 2PL5A 1IG0A 1H5NA 1HYBA 1M2OA 1IJEA 4MTLA 5EJ5A 2H1FA 3TZKA 3GA5A 4AUEA 3SVLA 3F0TA 1S2NA 3EZFA 3FCCA 3FJ1A 4Q48A 2CL7X 1AMNA 3AR6A 1MJGA 1Y8ZA 1FDUA 1FNBA 1O9HA 2WYOA 2CWDA 3ANTA 4JKIA 4LOJA 2H1WA 1XJWA 3FVRA 5BV2P 4HH1A 1WCIB 1RWVA 1I6MA 2G9UA 3L0DA 3QVXA 4NENA 3B1ZA 4MGEA 3I5YA 3EWAA 3VKGA 1UBCA 3PK0A 4RY8A 4IXWA 1ZBDA 1EE9A 1QNFA 4D45A 3NAQA 5AD1A 1NP6A 1SHUX 4ZGGA 3DNPA 1JEYB 3BMOA 4CM9D 5AKYA 1MCZA 3R3VA 4Z0PA 1ONNA 3T1OA 3ORYA 4RNCA 3QEKA 5ALQA 4DF3A 4MRNA 4LC0A 1TT5A 3ZCVA 4JJEA 4HMQA 5THXA 2VJQA 4M0CA 4NRDA 2ZRNA 4DC1A 4H3SA 1ZA1A 3TXYA 1L3IA 1ZUNA 1WKBA 3CKKA 4GBJA 1P31A 1VJRA 3F49S 5GJBA 1BH2A 2B4AA 4OAQA 5C81A 4WQMA 3RK1A 1ZEMA 4WFKA 1EFPA 1S7GA 3MHTA 3CJTA 4LNHA 2C88A 4CU2A 4B87A 1F9AA 5KTYA 2QGFA 2IU6A 3T7DA 3ZWDA 2X4IA 2W6IA 4KR2A 4W5OA 2WTXA 1O8BA 2CFOA 4D4MA 4EPTA 2VQ3A 3A9CA 4K6CA 1EZZA 1SCUB 3NWPA 5EI5A 4TTQA 3RTDA 3OKPA 3V8RA 1AKQA 4XVQA 1R2QA 1QQ7A 3FXAA 1UMBB 3IUEA 5KTRA 3FTCA 3M5WA 4YJHA 3CUVA 1SBNE 3FOFC 3RRNA 2NT4A 1UXGA 4N82A 2FMKA 2B35A 1IDN1 4RZ3A 2WT9A 4HDRA 3T9DA 4DZRA 5JXJA 4OQPA 3GHHA 3RUCA 4PZDA 2BHSA 4WV3A 1AS3A 2FZCA 2A86A 2OXRA 2DAPA 1BJTA 2V45A 3NVMB 4X60A 4MDEA 1TQ4A 1UP4A 1QLWA 4RK6A 1J5XA 3GGGA 2WEKA 1JR2A 5DM70 2J3HA 3ZNQA 2RJOA 1U7WA 1ZM3A 1RD4A 1KI8A 1X7WB 2NZJA 4LRYA 1CS0A 1DPGA 1MJ5A 5FT9A 2WY2D 1VHLA 4Y8VA 3JRXA 3D1VA 4UEQA 3S1AA 5IUJC 2JJ1D 1FCJA 2RFLA 2FSVC 2GT1A 3B6EA 3AUFA 3Q5DA 4NDAA 5FDFA 2EBHX 3ER9A 1NQ5A 4BP1A 2LD4A 4ZT3A 3Q3GE 1P6QA 4H7JA 2EZ9A 4PAMA 2VL7A 4UFNA 4FGKA 1GXSB 2PA0A 4TL9A 1GFIA 1PZGA 3VHLB 5MFZA 3M0EA 4BP3A 5EVJA 5L9AA 5H81A 2Y0DA 5JAHA 2ARKA 2OD7A 4CKXA 1OXSC 2UVPB 3AF2A 4W5QA 2QIPA 1DP4A 2R79A 4G5SA 4G85A 1N5JA 5EP2A 1AA6A 2YZ7A 1U8UA 1TI7A 3I92A 3FTQA 1GAEO 2OGSA 1R7RA 2PYDA 4NOLA 4JJIA 1LK0A 2A5FA 2R7AA 2A5LA 4R84A 2H1OA 4HATA 1QR6A 1FUIA 1QYWA 4RH3A 5THQA 8LDHA 3E9CA 2VQFB 2DFKB 4ES6A 2A3NA 2OK8A 3VKHA 3NBXX 2GDZA 2FI1A 4DPMA 1H94A 4I5EA 3MGGA 2ZZNA 1KQOA 1SU4A 1W8DA 1JUDA 3DH0A 3S27A 4ZTBA 5BW4A 3L7JA 1GDHA 3B20A 3TUJC 3EEOA 4FGWA 1CB0A 2HFKA 1J2TA 3JTEA 4JZYA 2GBFA 2P6PA 3VRHA 2A0FA 2CDCA 3JAWA 1S3SA 3AI1A 1XEXA 3OIGA 1S7CA 2V96A 4PX2A 2XZOA 4JB2A 4QGFA 4KWIA 4YAIA 2BOVA 2QAIA 2QLFA 1R0WA 2XWPA 4I5IA 5I6DA 4FFDA 2EBUA 4YRFA 4MROA 5JCPA 4ZN6A 4FOLA 4WE3A 4BJ3A 5JNRA 3GJ8A 3FGOA 3OU6A 3C4VA 1NN0A 2XTAA 1GJRA 1T36B 2XEDA 3ENVA 3TZHA 2WJ3A 4OFXA 4O5OA 5BUZA 1FU8A 1SUDA 2R25B 4XR9A 4G0PA 3JQRA 4NK4A 3RT9A 4KPFC 1XZMA 4BCBA 4FDTA 3S6JA 3DZKA 3DVQX 3ROXA 1UQTA 3PE6A 1ZH2A 4XTCS 2E4WA 4EEZA 1U0BB 4IIEA 1KIFA 1E9SA 3PXAA 2DCMA 3NRBA 5JNUA 1TJNA 2H4HA 3V55A 4R7ZA 4RJTA 3TUZC 1E66A 3NTVA 1P8AA 3D8TA 1F2TB 2CZGA 1BQ4A 3ADPA 3KC2A 2HKIA 3SBXA 2O50A 2BEKA 2VQDA 1HSOA 4YMIA 3W5IA 3TNYA 3REQB 4F8JA 2BM1A 4KVZA 3WE7A 3DE3X 1JG1A 5HF9A 4OMUA 2I67A 3A28A 3GRCA 5F7XA 5IAGA 2JA2A 4AJ1A 1P33A 3M89A 2B83A 4WZBA 2HQ1A 3MYRA 4Y1FA 1NJ1A 1EQUA 2FQQA 3KEQA 4RE6A 2BBSA 2DBVO 1H6AA 1WMDA 1JR4A 2C84A 2ZIFA 3TMAA 5KKCA 3PNOA 4IFEA 3UYKA 3L92A 4RMHA 1W5AA 1DAPA 3NKFA 1PL0A 2YH2A 4Z4GA 4OGFA 2QM0A 3H1PA 4Q24A 3DB2A 1C7FA 2JBHA 3ID6C 1LX7A 4GMHA 3SC6A 1CU1A 2V6BA 4ZOBA 3OU2A 1GPLA 2WSIA 3CRMA 4V3CA 3H2KA 3QE9Y 3R3JA 1Y3DE 2ZRGA 1EH5A 1N7GA 3IHTA 4HUQB 3ESRA 4JL6A 4HWGA 4F7DA 2DUUA 1YDGA 2JEOA 4NAUA 2XT6A 1A7AA 4DUZB 1EKXA 4L4ZA 4KUEA 2VTBA 5CEFA 3NWEA 1RXSA 4G97A 4DAOA 5DOVA 2QGZA 3HV0A 5B3JC 3JZIA 3U3OA 1A2QA 4QUEA 3CKYA 2NU8B 4BUJA 1Z6AA 4I9HA 5F52A 3SJBA 4RXMA 4JOQA 4ZAVA 2IH4A 3RO7A 3VPDA 2DBQA 4WFIA 4FVTA 2WJ4A 4HBGA 1TKAA 2XV1A 1GM5A 2MIIA 5F12A 4A3SA 3EDRA 4N48A 3GR6A 1CDZA 2HBQA 2LDBA 2QMOA 4FEEA 3VGPA 2R8PA 3WWPA 1P0FA 2Q5OA 4RADA 3AP2A 1AK2A 1FFEA 3B60A 3LUCA 5KSWB 1EP1B 1XVLA 1O96B 3HKEA 4BVHA 5L4NA 1M67A 4BU1A 3OP4A 4LECA 2QP3A 1AUQA 2J6HA 2H1HA 3QJ5A 4BIIA 3FRJA 5FWXB 4PG4A 1ECPA 1RM3A 1KEWA 3RGWS 3MLAA 2EP5A 1MABB 3ANXA 1K88A 1OZAA 3K30A 3AI3A 1CG6A 3BTUA 4LSMA 2OCDA 1XZNA 3GGCA 1LPOA 3ETNA 4AG5A 5IX8A 2OWDA 3QVGB 2CBGA 2A9RA 4JJZA 3ZHQA 1XMJA 4KQ6A 1YDWA 3QU9A 1T26A 1BE6A 3GBVA 4NZPA 4WESA 3AZQA 3RK0A 1SHLA 2PXHA 3I73A 1Y9ZA 1ZIYA 3P2EA 5B6PA 3RFFA 4BZQA 1UAYA 3WLTA 3RV3A 3QM1A 3SE7A 1EDZA 5AKZA 3V4VB 3QLVA 2IBSA 2FP4B 4GQAA 1IPFA 1FYEA 2XLBA 1Z7WA 3LSTA 3ZNPA 2ZYDA 5DBFA 1Q1QA 3BIOA 3BERA 1G8KA 2R66A 3ZE2B 2O8FB 1ESMA 3DVAB 1QIJA 1AKVA 4X1KA 2ZB7A 3SFTA 4TYNA 4JQCA 1BDIA 1C7ZA 2ZWAA 1VXRA 4UVEA 4MR9A 4PPQA 4TKMA 4CCSA 4D42A 1XCOA 3FWNA 4IJMA 3WHPA 4F12A 3ANLA 1K86A 2AI3A 1EEXB 4U39A 1VMKA 5J40A 4WGFA 2QYSA 1SVNA 4PR0A 4G41A 3UGQA 3R76A 5LP1A 1V5FA 3AG6A 4BFYA 4DCGA 4CMIB 2XAUA 4YRCA 3F9RA 2KM1A 4EGJA 3E18A 3N8HA 4G09A 3UBTA 4OX9B 4J0HA 2XWSA 4OQDA 2C8VA 3N3AC 2ODPA 4A2CA 3WWOA 3DAOA 1KNQA 2NSJA 3GMIA 2NW6A 3GEPA 3L6RA 3C5WP 4DZZA 2DECA 3KB1A 4A0FA 3H7AA 2PCLA 3O8DA 4CDRA 4H4EA 2J5QA 4GLBA 3UJAA 1MUUA 2ZBPA 2YMLA 4TRNA 2Z1MA 3B2EA 4LGMA 3ZIAA 3PDUA 3GT4A 4BO8A 2WJPA 3SGLA 1M54A 3GJ7A 2WPDA 3IBCA 1CQZA 2PBRA 5JFTA 1ZFNA 3M6IA 4KXQA 1ADFA 4W7IA 4EFDA 4Z3DA 3RREA 3THYB 2GZMA 3T5BA 3NC1C 1LBSA 1L7BA 3EVZA 4MKRA 4YR7A 4RD0A 1JR3E 4TSKA 2PS3A 3T95A 1L5WA 4TKUB 3M6MD 1QV9A 3E9DA 2F1KA 2HJHA 2XKJE 4TXMA 3THRA 4AN0A 4G2NA 4KK4A 1GR0A 3LBHA 2R6JA 2B4RO 1TC1A 1ST2A 2KSQA 3JVIA 5K45A 4LYGA 4LRWA 4EQ6B 5JNVA 1B0ZA 5EWLA 1QONA 4WBNB 2YNMD 3PGKA 3WS7A 2GN8A 4A0QA 3HXLA 3K8YA 3L7DA 2BCJQ 1LLUA 1EP3B 3HKCA 1AMUA 3HJBA 4DR2B 1LBTA 1ADYA 1OGIA 1T4BA 1E0KA 3O8OB 1WXQA 4W4TA 1GQYA 2BKUA 2FDCA 2SKCA 3TRDA 1ZXLA 2NZ2A 3C45A 2OAP1 3DL2A 2IU3A 4RYLA 4RWZA 2VBGA 4HWOA 1AG9A 5FL7A 2ZSKA 5IABA 3IVXA 1KPIA 2XAAA 4WMLA 5BWBA 5CB4B