4HB4A

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(537dltvk541/glceq)-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
209
structure length
209
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 59
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb4A00
2ZR9A 5IK2D 3LAWA 4RD1A 1Z47A 1ZCBA 3U7GA 3M0EA 2IWHA 4ESVA 4DLSA 4A8JC 3W9YA 2W2VA 1F6BA 4YLGA 1LS1A 5EP3A 1Y3AA 2OHFA 2ZYTX 5AWFC 1GDDA 2RGBA 2J7KA 5H68A 4B3FX 1GKUB 1SVWA 1II9A 4B47A 3THWB 1KK1A 4LHXA 4V0MA 4D81A 4R2IA 3GLIE 2WWYA 1N6NA 4Z1MD 3DOFA 4GZMA 1PLJA 1QZXA 1NI3A 1Z07A 2YOHA 4GMXA 3QBTA 3IEUA 1ZC4A 2ZU0C 1HEIA 3PENA 3CH4B 4PHTA 2O8BB 4RVCA 1II0A 4NTZA 4CRWB 3HU3A 2H7VA 3AVTA 3NDBB 5E3HA 1XD2B 2RMKA 3EPJA 1MABB 1KMHA 2C2HA 2ATXA 2CHVA 4D4KA 3AVXA 1AZTA 2WBLC 4E22A 1P7CA 3SE0A 1LW7A 2ZRIA 4TN1A 1NIPA 1YR9A 3VAAA 2VP2A 2QP9X 2P3SA 3QBVA 1ZIPA 3B1ZA 1CEEA 1TQ4A 2ZSAA 2GKSA 3MWKA 4QNMA 2VP6A 5G53C 1SQ5A 3ZYCA 4UNRA 2O0HA 3P1JA 4HI0E 4M9QA 1KO5A 1ESNA 4LSGA 1Q1QA 2JLYA 3BS4A 1MOZA 2QGZA 4ZDIA 3REFA 4PTLA 1P9WA 2QMUA 3HPQA 2XITA 1L7VC 1JAIA 4R2HA 2ZJ8A 1R10A 2ERXA 3GJ0A 5AJYA 4ZIRA 4P32A 3QE0A 4A36A 5KTYA 3SC3A 2PEZA 5P21A 1QG2A 3BJIC 1Z8FA 2A78A 3I72A 4W9MC 1CRPA 2CL6X 2KJQA 1KTVA 1R8QA 1ZVQA 1S9DA 3QQ5A 4NHOA 421PA 2O8DA 1JALA 1KJWA 2CLSA 2FGJA 4V0OA 5GVSA 1LB1B 1F48A 4OHZA 4Q00A 5BQ5A 2IYXA 1Q12A 3ZVRA 4P4SA 5LD2B 3WY9A 2X2EA 5BN5A 5C18A 4XD7D 1E4VA 3AVUA 4QJ5A 3FMOB 1LY1A 2REXB 2J1LA 3KXLA 5KDLA 1GNPA 4TL8A 2ZR0A 1CU1A 4TL6A 3GFPA 4HLQB 3FFBA 2H92A 3OEHA 2QM8A 2FE4A 4ASUD 5K8TA 2PMKA 1PUJA 1XXHB 1D8TA 3I4LA 1NL3A 1Q44A 2VYFA 1BO6A 4BFYA 5JSZA 3QEJA 4EFLA 3CBQA 2PZGA 1KO8A 2XNSA 3QXCA 1VTKA 4KCGA 2NO9A 4PSVA 1Z83A 3BORA 4JBYA 1DTSA 3BAFA 4ZCIA 3EPKA 3IILA 3JVUA 5L3QB 4F93B 3ND9A 4JMPA 4MITA 4RFSA 2CJWB 1QHGA 2WJIA 2JASA 5HCIA 2IYUA 4ZKDA 4IDQA 3CKLA 3T12A 1N0UA 1N6LA 3B1VA 2NO0A 3LQQA 2OAP1 2WSSA 4NKRA 4I1OA 2G0TA 1T0JB 4JVSB 3RS2A 3K0FA 1G21E 2WAYA 2F9MA 1X6VA 3CZPA 4JKIA 4KVGA 2VHCA 3JZAA 2WM9B 1ZNZA 4LJ7A 2KWIA 1R8SA 4OJKA 2GJSA 3CRW1 1P3JA 4RD6A 2WJGA 5J4LA 1WXQA 1YE8A 1GNRA 2JLRA 5F9HA 4M1KA 4KVAA 1A2BA 3DHWC 1UJ2A 2WSMA 5CM8B 3TUJC 2BVNA 4DLRA 4MGYR 3K53A 1R2QA 2B21A 1SKYE 4KYUA 2J46A 4MYUA 2KB0A 3D3QA 4JLNA 4DUGA 2VF7A 1IN4A 4IXMA 3FB4A 4LV8B 3WBKA 1P2SA 3NH9A 5CK4A 2OLJA 3EARA 1NBME 1NSFA 3HR8A 5KNDA 1VIYA 2GJAA 4FI3C 1CBUA 5C2JB 1G16A 5FTJA 4HZUB 1L4UA 2PBRA 1XMIA 2A5YB 2V9PA 2XTNA 5CJPA 3KQNA 4PAOA 5DYGA 1NN1A 4ZI3A 3AF2A 1VCOA 4B2IA 1KZ7B 2FSFA 2XXAB 4KAXA 4JKYA 2IUSA 3QXSA 1P9NA 1W2HA 3EZ9A 3N70A 4PHHA 4IVRA 3BBPA 1VMAA 1CR4A 1M7GA 5JJIA 2AL7A 4FMCF 3NEYA 5J4VA 3HPRA 2RKOA 2GJ9A 4C0LA 1GUAA 1AGRA 2IF2A 1QHHA 4M0LA 1H8HA 4WZAE 5FUVA 3NC1C 3CW2A 2HUPA 4HAZA 4W5HA 1NF3A 3VX3A 1Q21A 1QRAA 4QG7A 5CB8A 4ON9A 5DYIA 3MD0A 1U90A 2W2XA 2ZEJA 4KODA 4FW9A 1ANKA 1G64A 2FEMA 2ZROA 1AGPA 3RWOA 4BFUA 2XJ4A 3BH7A 2ANCA 2DR3A 1KMQA 2R62A 4ZKEA 2ZRAA 4X8HA 4J0QA 5TARA 4B44A 4URUR 1ETUA 2QBYA 2WSSD 1WE2A 2GXSA 2H17A 3C5CA 1JEEA 3VR1A 1M34E 4LBYA 4JBWA 2Z4SA 1N0WA 4LYHA 2ZRHA 2OM2A 2F1HA 3H1TA 1NNEA 5SZHB 1OSNA 5JRZA 3A1WA 4TL9A 4G5SA 1DAFA 3HU1A 1G6OA 1BMFA 4TMKA 4HB2A 5FI0B 1MKYA 3NEJA 1XTIA 4GP6A 4B32A 5C1BA 4Q4HA 1T5IA 4DUGD 3E70C 2G83A 1G3RA 3A1TA 4PZLA 4B33A 3U4QB 3AGQA 1XD9A 2F3RA 4HUQB 4DIDA 1TEXA 3FGNA 1E2QA 4ARZA 5KSZA 3QF4A 1RE0A 1L8QA 4DSNA 4AD8A 4ZDKA 4NP6A 4IOMA 4Q7LA 1W36C 5JLJA 1NP6A 4HYYA 2FFHA 2QPOA 3QG5A 1XXHE 3AF0A 5JEDA 1ZD9A 2QQEA 3SDZA 2ZXUA 4MKHA 1WCV1 2JIZA 3H4MA 3OIWA 3Q85A 1J8MF 3EIHA 3DDCA 5D3MB 2RB4A 1UDXA 1W4BA 4M9ZA 4Q4AB 4Q47A 4QGAA 4KFTA 4LYFA 4B43A 2GILA 2J0UA 2OFOA 2ZE6A 3CR7A 4FMCB 1T9HA 4MUAA 4KSBA 5JWOA 1E94E 3Q8XB 1Z6YA 4JLKA 1OW3B 4RZ3A 1M8PA 2Y8EA 4WZ6A 1KJZA 1H8HD 1IXSB 3TIFA 3PCRB 3HYRA 2QN6A 5EP1A 4PZZA 1M7BA 2P67A 1U8ZA 1YZUA 2W83A 2FU5C 2YINC 1DOAA 2IHYA 4TWZA 5B2ZA 2QI9C 1E2HA 1GSIA 1P5ZB 1W46A 3HYTA 4Z8YA 3U3OA 3I73A 4EPYA 4F4JA 1T3HA 1U9IA 4RD4A 2FA9A 2CCJA 2BM0A 4MYHA 3U7HB 2HXYA 3QENA 1Z0FA 1JI0A 1US8A 1ZD1A 1ZRHA 1DAGA 1NVVR 1VECA 4KJZA 2BJVA 4DLWA 4O3MA 3AVYA 4LX0A 5EP2A 1ZD8A 3LBIA 4Q01A 4GP7A 1VCMA 4RD2A 2C9CA 1KI4A 4GOXA 2B7BA 4S35A 3UATA 1M74A 1SXJA 4G3XA 5KO2A 1E2FA 2HXSA 4PSKA 1SHKA 2O52A 1G3MA 4M1TA 3QVVA 3LO5A 1E6CA 4NDZA 1G5TA 4C2TA 2H18A 1G8YA 4DSTA 4TTQA 5E95A 3PUZA 2AHOA 2CCKA 1FTSA 5FPSA 1TMKA 4TQAA 4B48A 3R9IA 1GFIA 3THXB 1EFHA 3ZZ0A 2YKGA 4OI4A 1YR6A 3P26A 2JA1A 4QGGA 2UZIR 1IXZA 1CLUA 2OBNA 4AYTA 3FKQA 1ZU5A 4EPXA 2N1BA 1HY3A 2DFNA 1E4YA 2IYWA 2GZAA 4IHQA 4FWIB 521PA 3SHFA 3TSOA 4D4LA 1W0JA 1XDBA 2HYDA 2OZEA 1M1YE 4MKGA 1RKBA 3OESA 4ZIRB 3CH5A 4QNRA 1Z63A 1D5CA 4QJ4A 3CF2A 4H1VA 3H0KA 2UKDA 1U94A 4FMDF 4C2UA 2VF8A 2JIZD 2WWXA 2P6NA 4FMBB 3ZDQA 3U6KA 5JHHB 2O8DB 2ZJ5A 4BEBA 5GADl 3I62A 3RABA 3SBEA 3H2YA 2QEQA 2FG5A 2CMKA 3CX6A 5FOSA 4P4SB 2JEOA 1KSFX 3WHLA 1EESA 3VR6A 3FTQA 4PC7A 4YMUA 2F1RA 2C77A 3L2OB 3LV8A 821PA 1G7SA 5IDVA 4DIEA 3RC8A 2ORVA 5FOUA 3L0OA 4QHSA 4UNQA 2GDJA 2C8VA 3LWNA 3AH8A 1ZM3A 4A2PA 3ADCA 1GM5A 2L0XA 3TNFA 1SVSA 2Q9CA 4DSUA 4WZBE 3UMRA 4EPRA 3MGCA 1F2UB 4MDFA 4GFDA 2PX3A 2C03A 4A6XA 3BGWA 1FMLA 3CPJB 1Z6GA 2C99A 4YXWA 4BECA 1U9IC 5FI1B 3C14C 4C30A 2NQ2C 1F3OA 4DCVA 1I2DA 1LF5A 2CCGA 4B75A 5L3VA 4IEEA 4QC2A 1E0AA 1XMVA 2ORIA 4OK6A 3ZVMA 2IXEA 3ICEA 3MJHA 1SXJD 1VYTA 2HV8A 2D4HA 3W8NA 3PUWA 4RZUA 3I92A 2OILA 4C4PA 2QL6A 3IO3A 3U6BA 1G9XA 2BC9A 3K0FB 1IN8A 5K8UA 1E9AA 1L2TA 4DC9A 3GJ7A 3O8RA 2WICA 1R0WA 2BKUA 4K46A 1XXHA 4K8OA 4MKFA 4P33A 4OI0A 4FWTA 2PT7A 3A37A 4BZPA 3WP0A 4TL7A 3QKRB 3I5XA 4HLDA 3B9PA 4UJ5A 3DEFA 2EQBA 2IL1A 4HZIA 1GL6A 2JCSA 1E0SA 2AFHE 2G1KA 1N25A 2VEDA 4UXHA 2AWNA 2EYQA 2YYZA 4ZCLA 1KK2A 5L3QA 3ZJYA 3CR8A 2RHDA 2AD1A 5DN6A 1OXXK 2CJWA 3MWJA 1OPXA 1W0JD 2GF9A 4Q5IA 4FMDB 1OFUX 1G1MA 1GP2A 1KI6A 4NE2A 2ODBA 2ANBA 4B6EA 3R20A 1CP2A 1S8FA 4C0AC 4TZ0A 2YC4C 3AKYA 3HU2A 4CIDA 1OH7A 1UBGA 4LJ4A 3T06B 1LS6A 5SZKB 4EFMA 1NMYA 2QQ0A 1IAQA 2XTZA 3UK6A 1SKQA 3TR5A 5A0FA 1CTQA 1G4UR 4JLBA 4M9SA 1VHLA 2UVQA 4F91B 4TLDA 1VG1A 1V5WA 1ZM7A 4HAXA 3OAAA 2R6AA 1G17A 2J0VA 1IJFA 3DMDA 4KBGA 5EUMA 1P73A 1WP9A 2N46A 3AQ4A 3GMTA 4C0HA 2NO1A 4DXAA 4ZDJA 2OSBA 5DE3A 1KDOA 1FW6A 4MKIA 2ONJA 3RRNA 4EPVA 2O5VA 4TMWA 2PCLA 1RC8A 3RS0A 4YMTA 4AY2A 1GG2A 1ZNWA 3K09A 1QHHB 2G77B 4JS0A 5DSZA 1U0HC 3QPUA 1IN7A 2FN4A 3ONWA 1TQ2A 2YWGA 5D3QA 1WRBA 4PPNA 4RCYA 1W44A 1R6BX 4GBMA 4B3XA 4YXWD 4MQBA 4A92A 5JJLA 5GJVC 4MGIR 1FQKA 3KJGA 3K70D 2EFCB 4W7SA 4S2EA 2Z5FA 4PPGA 2Q9AA 3RS3A 4AKHA 4XTRA 5F9FA 4F38A 2FV8A 3AKCA 2ZRPA 2BBOA 4RKFA 3T1TA 3T35A 5LD2C 5JWRA 5AK0A 1OXVA 2ZI3A 4B74A 5FUXA 3L8ZA 1OV4A 3PIRA 2ZS8A 5LBIA 3LD9A 3LRPA 1GILA 1E2EA 3Q9LA 2GESA 2PEYA 4U7DA 4RKEA 4BLRA 2ZE5A 2XTMA 2J0QA 2ZRNA 4AWXA 3ADDA 1E79A 1E0KA 4BE7B 1DVRA 1G8GA 3ZS8A 1EK0A 1T4GA 3CB4A 2V8OA 4PPQA 3SYKA 2ZSEA 5EE3A 2CLDX 4XVQA 3L0SA 2QROA 3LLUA 1KKLA 5DN6D 1GZSA 1Q20A 3BOSA 5DISB 4A2QA 5GJWC 4B2PA 1GKIA 2IT1A 4HLCA 3CRQA 1Z2AA 3W3AA 1JQLB 5FL7D 5L3SA 2GK7A 4WXPA 2V54A 8OHMA 2GWHA 2IS6A 3AUYA 5ELXA 1NLYA 3EZ6A 1S96A 2GBLC 2I3BA 2VBCA 2ZUBA 4LZZA 2ASEA 5KDOA 2IEZA 1U0LA 4IOLA 3GEIA 3QOFA 3CPHA 3JVVA 4JLJA 4I81A 4KLZA 2QE7D 1CJKC 3KJIA 2AN9A 4NYJR 221PA 2YOGA 4BLTA 3SNHA 5AUQA 3C41J 2IF0A 1ODFA 3QVUA 2V55B 4PHGA 2WZQA 3RRZA 1P72A 1W5SA 1CJUC 3BFVA 3ZZUA 1K5GA 1DO0A 1P61B 2K5UA 3THOA 2DFKB 4HLUA 2WOJA 1XTKA 4CYMA 3K09C 1GOTA 4GZLA 3W6OA 4LGMA 2YWFA 4X8MA 4HUQA 3P4YA 4AURA 1KZGB 1T3SA 2BHRA 4XSGA 1W4AA 2YVUA 2XSZA 4ACAA 2QAGB 1AS3A 3B1YA 3MCAA 2KE5A 3ZH9B 3T1OA 4DEYA 4JLPA 3OIYA 5F98A 1E98A 2ZRJA 2Q3HA 4M1OA 1E32A 2YJTD 3D31A 3DZ8A 4B3BA 4WA7A 1JNYA 1US8B 3EWSA 1LNZA 2NPIA 3H86A 5D3MA 3LH5A 5BN4A 1DG1G 1FNNA 4LJYA 2A5GA 1DBSA 1XU4A 2ORWA 4AG6A 2VP5A 1RFLA 1TL7C 3FPAA 2NO6A 1SXJB 3KUDA 4BLQA 2RGCA 2CE7A 4HB3A 1R5NA 4JVMA 1W7AA 1K6MA 1N6KA 3L0PA 3SHWA 4ASUA 1E79D 1A4RA 2A5FA 2B92A 4KYIB 3U5ZB 1KI3A 4QHTA 4JIMA 4DRZA 1N6PA 2OCYC 4Q9IA 4BGDA 2VHJA 1S1CA 4ZV4A 2R8RA 3IIMA 4A1FA 1XCGB 2GAAA 3GFOA 4AKGA 1XEFA 1CS4C 1KK0A 1LF0A 2ECKA 1TQ6A 3CONA 4X8OA 2XZPA 3B1XA 1D6JA 4LBZA 3KXKA 5EZ5A 3SEAA 5CIWA 3FDIA 1MO5A 1Z08A 2FZ4A 5JMTA 5HPYB 3QKTA 2ZETA 2NZ8A 4Z51A 5E4FA 3FMFA 3RANA 3VHXA 3PVSA 4TLBA 3WBJA 1YZQA 1U2RA 4BASA 3QNUA 1N6OA 4URZR 3MMPA 3NBYC 4OHVA 3NTUA 4Q9HA 4TLAA 1FZQA 4E5UA 2UZ3A 1I2MA 5A4JA 2NO7A 2AKYA 2ZI9A 4OL0A 3SFVA 1P2VA 4HATA 1X1SA 3IIJA 3AGPA 4D4JA 4XWAA 2EYUA 4GOJA 2Z0MA 4EQ6B 4RCZA 1M7HA 4LV5B 1AS2A 1GRQA 4KFUA 3Q5DA 1XNJA 3THXA 2FF7A 1Q0UA 3FFAA 4MRSA 1UBCA 2H57A 1Z3IX 5JRJA 1E2LA 4Q02A 4IDPA 1XRJA 5FR2A 4M1MA 4D2IA 3LW7A 3AF3A 2XSZD 2CL7X 4N3NA 4PQYA 1F5NA 2GXQA 1M2OB 2WIAA 3SJCA 2GJKA 3AF1A 4FXPA 1OH6A 5FBQB 3TLXA 4M4SA 3WHKA 1W1WA 1OE0A 4TMTA 4A0RA 2DWOA 3K70B 2FFBA 3P4XA 1EGAA 1GTVA 1E0JA 5HCNA 2X19A 4DDUA 1E9EA 2WKRA 3TSZA 2BEJA 1X8KA 3MRSA 1Q22A 4HDCA 5FR1A 1PLLA 4PX9A 3AVVA 1B23P 3W5JA 2PH1A 1G3IA 3SS8A 4MRVA 3EA5A 1E2IA 4AYWA 3LXRA 2YV5A 1G7TA 3LNCA 1JPJA 3WXMA 1CR0A 2W00A 4B3GA 3T61A 4OHXA 1A2KC 3GLFB 3W5IA 1F2UA 2IYRA 2XNDD 2Z6VA 1XTJA 2ERYA 2W6JA 4P3YA 3TBKA 5JJKA 1QG4A 4NCJA 2CK3D 3NKVA 4V03A 1DELA 4ZPXA 4A82A 3L8YA 1YKSA 2EFEB 4N0EA 5IT5A 2WAXA 3K9GA 5FUWA 2EVWX 2PLRA 4D0LB 1KI6B 4N0DA 1Q57A 4W5WA 4M53A 1N2CE 1EFUA 1SHZA 1HQCA 1IY2A 3ASZA 4QBFA 2Z83A 5FPKA 2FGKA 2ZYWX 1G19A 1V43A 1JR3D 2JDID 2AK2A 3CRVA 1UBEA 2G3YA 1HURA 3Q72A 4D26A 5JHGB 1IXRC 1K8RA 1NVVQ 4Q7MB 3TMKA 5FBLB 1Z0IA 2AXNA 3K9NA 5LDDC 2QTVB 1OIVA 2IA5A 2QSYA 5FBVB 2IC5A 5DI3B 5DHFA 3ZQJA 1G5RA 3QKRA 4Q1AA 2Z4RA 2NTYC 2EFDB 5G41A 3DZDA 1P6XA 2RGDA 2ONKA 4LHWA 2A5DA 3Q7PA 2QUZA 2HT6A 4HEJA 1JJVA 2GF0A 2JJ1A 2LKCA 4IDHA 1XPRA 4Q7KA 1SXJE 1CRQA 4D25A 3ZS9A 3F8TA 2WJJA 1N5KA 3TUIC 2FH5B 4OYHA 4XWOA 2XB2A 3SN6A 2MSEB 1O3YA 3UG7A 3LDAA 3SQWA 5G3ZA 2DHRA 2R6FA 1S2MA 4LOAA 1MO4A 1AS0A 4AK9A 2Q3MA 4PR0A 4LPSA 4UNSA 3I3SR 4GNKA 3AM1A 1JB1A 3WRYC 1DO2A 3IDQA 3F5FA 3TVDA 4I99A 2IUUA 1QHSA 2ZAMA 2IYSA 3KKPA 4PO9A 4PQRA 1OXUA 3VR5A 4IEIA 1I4DD 2IYQA 1RRFA 3TK1A 2ZYUX 1KO1A 1YZKA 3ICQB 4TYWA 2FEOA 5A5GA 4LC0A 3Q3JB 3U44B 2O0JA 3A36A 1QBKC 3B60A 1IHUA 3RC3A 3V4RA 3A1UA 3RRMA 2FWRA 1XJQA 2W6JD 1UPTA 4P31A 1KI9A 2BDTA 1JBKA 2F9LA 1KNQA 3UMSA 3WYGA 2ZRMA 3PUVA 3KQUA 3LBHA 1EX7A 1KNXA 1X8JA 4IVQA 1CIPA 2OLKA 1YJ5A 2YWHA 1EX6A 1T6NA 1GVNB 1XFAA 5KYKA 2PT5A 5G40A 5L3SB 4AG5A 1NVXQ 4US2R 4B3CA 1UKVY 2Z43A 2LWIA 3RNLA 5KNCA 1J99A 1OIWA 4RSGA 1FUKA 3FMIA 1OHHA 3C15C 1KDPA 4GOKA 1KJYA 1KI1A 1DARA 3C5HA 2PL3A 1FFHA 1R0ZA 2OT3B 4A15A 2O8CA 4IVPA 2ZAOA 3B9QA 3UWOA 4M1YA 1XZQA 4Z8XA 2XOKA 1Q3TA 4PO1A 3QSYA 1OFHA 3OF5A 1W48A 3EIEA 1FP6A 2HJVA 4DZZA 4M2LA 4IOJA 1MR3F 1T91A 2BBTA 4Q9JA 4EJSB 1AN0A 4NL4H 1RYHA 2JJ1D 2WOOA 4CEHB 4LJ9A 2J3EA 1FOEB 4BFSA 5BYKA 1KGDA 1R0YA 3B78A 4L4UA 1UKEA 3D8BA 2OXCA 2PLFA 4JBXA 5TVKA 3CWZA 5DLQC 1VCIA 1NY6A 3QJYA 4FCTA 2BOVA 4K81B 1KIMA 4BLSA 1OIXA 2QA5A 1XJCA 3AKDA 3NIBA 1D9XA 1HYQA 1HE1C 4RD3A 3EPLA 5CIQA 2Q0HA 2DCUA 3RYTC 4UXJA 3GLFE 2QTFA 1BYIA 5FFMA 1VG9B 4U00A 5EXSA 1II8A 1CR2A 5CYPA 4YMWA 4CVNA 2KI5A 1D2MA 1KAGA 4JLVA 2HEIA 3PV0A 3DMNA 3NH6A 1YR8A 2Q9BA 3RLFA 1TX4B 4PANA 3G0HA 4GMDA 2A30A 1AQUA 2C9YA 2KSQA 2QU8A 3AVQA 4ZDWA 3X1WA 4KI0A 2E87A 3KTAB 3PJRA 3WMEA 5J40A 3KFVA 3N2EA 2ZPTX 2FSGA 3AVOA 6Q21A 3I5YA 2GVDC 4FCWA 1YZLA 4Q18A 3HJNA 2ZI7A 1A1VA 2QMHA 4OI2A 3FYHA 4JVLA 2R2AA 3EASA 2ZJ2A 3S1AA 2B6HA 2QAGA 3BRWD 3WMGA 1YRAA 1YQTA 3QKSB 3DM9B 1VDZA 3SU8A 4CT5A 2CXXA 3LQRA 2WWGA 3P27A 2NMVA 2ZRCA 5J5CA 3OZXA 2YWEA 2V6JA 1NLZA 1F2TA 3FWYA 5AR1A 1RRCA 4B71A 1U8YA 3FVQA 4M8NE 3ECCA 2AX4A 5AUOB 1OHHD 1G4AE 3EZ7A 3R8CA 1QHNA 1U8AA 4URYR 3E5HA 5BW8A 3Q5EA 1NLFA 4POAA 2ZU6A 2LKDA 2YZ2A 3BB3A 4A0HA 3IUYA 4L9WA 1XX6A 4EAQA 2RGAA 3KJHA 2XOKD 3MWYW 2X2FA 3RHFA 3FMPB 1WBBA 4TLEA 5AJWA 2DB3A 3NBFA 1ONBA 4BPBA 4XIGS 4MRRA 2G9NA 3FHCB 2BMEA 2W58A 3MLEA 1EWRA 4R9UC 3RS5A 2G1JA 1XMJA 3NBXX 2JLUA 3LVRE 2N42A 4LYJA 4YC7A 4L16A 3VR3A 4DLVA 3OHMA 4YONB 3HR7A 5FTLA 2GNOA 2RHMA 1W5TA 3MUFA 1G8HA 1T8UA 2VRWA 1VYVA 1HH4A 3U61B 3WP1B 1MT0A 2MMCA 4W5JA 4BFTA 5JFGA 2FJUA 4DSOA 3B82A 1G7CA 4PQFA 4DBLC 1HE8B 1LV7A 4NONA 4AI6A 4BFVA 3V00A 1EWQA 1AQYA 3KL4A 3ZZTA 2YOFA 2ZE7A 3EXAA 1TF7A 1G6HA 3NHBA 2D2FA 5C4MA 1B0UA 3AVPA 3X2SA 4EQ6A 1N5JA 4PFSA 2QGNA 3PFIA 2FOLA 2RAPA 4B34A 4AKIA 1DAMA 2ZM5A 3VHLB 2RGNA 4NYJQ 1EFTA 2ZYVX 3PR1A 5EXXA 5L8VA 1JPNA 4KFRA 2F1IA 5HE9A 2CHQA 3QPVA 1N5IA 1UEIA 3GEEA 4JSYA 3ZVNA 5J4KA 2D3WA 1GNQA 2QAGC 3EC2A 4YMSA 4A6PA 3C16C 4DDWA 4QXAA 4KU4A 4C0SA 3NWJA 3CUEF 1E2JA 1JR6A 1J7KA 2OV2A 1NJFA 2E1RA 2JATA 4G01B 5H70A 3R7WA 5F2EA 3VKGA 3ASYA 2IK8A 2IS2A 1UKZA 2ATVA 1OH8A 1NMZA 2FX3A 4B35A 3GP8A 4F4CA 2D7CA 1SXJC 4PC6A 1JECA 3D6TB 5AJZA 2QM7A 3R8FA 3ETLA 3IQWA 1IOZA 2FPKA 3BH0A 2H1LA 3K1JA 4YDHB 3CX7A 3CNOA 2GEDA 3B1WA 4WXRA 4C0KA 2ODWA 1E2DA 2CDNA 1AKEA 1XEXB 4PXAA 2NG1A 2QZ4A 2VLIA 3K0CA 3GLFA 3WNCA 1YZTA 1OB2A 4BQSA 2VIIA 3U7EB 2ODNA 4DJTA 1E2KA 2HLDA 1YZGA 3CNNA 3B6EA 4GSYA 3T15A 3SOPA 1P62B 1T3LA 3O47A 2ZITA 3FHOA 1ZC3A 2YNMA 2V3CC 4Q21A 4PO8A 2A2ZA 1DE0A 2XB4A 4OJQA 2B8TA 2LCFA 4B73A 4JYCA 1MRSA 3TQCA 2E9SA 3MFYA 2QT1A 3RS7A 1K5DA 2FNAA 2ZRDA 4NH0A 2I4IA 3KX2A 4TTRA 5FL7A 4F4IA 4QFMA 1G7RA 1HTWA 1C1YA 2A7QA 4PAMA 1TUIA 3O8CA 1D9ZA 3SZRA 3DVLA 3IHLA 3THYB 3ZIAA 3C4JA 2CE2X 621PA 1ZW6A 4MDEA 5EUQB 2P6UA 4C0BA 4D0NA 1GAJA 2PJRA 4HB0A 2QE7A 3B7GA 5DI3A 2ZVQX 5IHPA 1X1RA 4GPTA 4WOPA 4CEIB 3KQLA 3GLIA 3T1QA 1UEJA 2P0EA 3AKEA 5F3WB 1W36B 2BM1A 1OXSC 2RGNC 1E9SA 5FBRB 2WTUA 4QBIA 1XTRA 5CDFE 2C95A 4GRAA 4DWJA 3PQCA 3NXSA 1E9BA 3WNDA 2AXPA 1Z0JA 3WYAA 1EG7A 1PVOA 1JR3E 3TSWA 3CM0A 2BJWA 1L4YA 3FKSA 1VG0B 2OUKA 3EG5A 3H84A 2IXFA 2HT1A 3K70C 5KSPA 2WKPA 1P60A 1ZM2A 4OQNA 4I1SA 3HWSA 1KDRA 2CVFA 5TB5A 3RAPR 1RW4A 1PUIA 4UJ3A 1OJLA 1KYIA 2IEYA 4RFVA 4TSFA 4NYIQ 4QRHA 2XZLA 3LFUA 1TQDA 1COWD 1G41A 4WAUA 5EE0A 4D0GA 5J4HA 4RJLA 4GI7A 1Q1BA 4LPKA 4AYXA 4XVUA 3GJXC 3GFTA 4TYQA 3KQKA 1HT1E 4G5RA 1ZNYA 4Q7JB 2O8CB 2OG2A 3U44A 2PMDA 4KHZA 2QORA 4C0JA 2EWWA 2HCBA 5FTMA 1D2NA 1BOFA 1E96A 3WNBA 1NSTA 2O8FA 1Z06A 1DAHA 4BZQA 2VSOA 2HLDD 1U81A 1N6RA 2CNWA 1YVDA 1S0UA 3CZQA 4KFSA 5FBWB 3J81k 1UADA 4F7WA 4DLTA 2V6IA 5CYOA 3VKHA 2HDNB 3HDTA 5TV2A 3QPWA 3SJZA 2GXAA 2NOAA 2CHGA 3M4YA 3SJAA 3VTKA 2DWQA 3P32A 3AP1A 4MGKR 2V7QA 4BZXA 3DO6A 2ZRLA 3U3JA 4A9AA 5CB6A 2IX3A 1KY2A 2DY1A 4A8JA 4DEXA 4O25A 2CL0X 4V0LA 3VR4A 3KKOA 1BYUA 2ZUCA 4OQMA 2C96A 1CKEA 4EPWA 3ZIAD 5KUTA 2PJZA 4AC9A 1J70A 2IBMA 2IHBA 4TTPA 1II8B 2D7DA 3TW8B 3QKUA 2QT0A 4KLNA 2C98A 1GITA 1NIJA 1ELOA 3UPUA 1IY1A 4LJAA 4EJSA 3A4LA 3QEOA 4US1R 4CEHA 3DPUA 1ZINA 1OB5A 4CEJA 5TMPA 4B2LA 4CDGA 4TYPA 5KDDA 3UXMA 4LV6A 5BYJA 3RSOA 1WA5A 3EZFA 4DKXA 3OFNA 4EFNA 1HUQA 2FZLA 3NVAA 4GT1A 3S1AB 3VR2A 2HCJB 3K0EA 3SJBA 3FKSD 1T0HB 3IHWA 1KSGA 2HYIC 2JLVA 1GL7A 1NJGA 1U99A 1XP8A 2ZJAA 3ADKA 3U7FB 4PHFA 4US0R 4QM6A 2ZVPX 1XCPA 2R65A 2ZQ5A 4ABYA 4LJ6A 4JL8A 3Q7QA 4TSFD 1RZ3A 1F2TB 4D82A 4LUCA 4MA4A 2IW3A 2B7CA 1XPOA 4HDQB 4C9BA 2HF9A 2V1XA 1AIPA 5E7IA 5SZIA 3RDPA 5CJ2A 2QPAA 5FPHA 2O0KA 1R5OA 4UXIA 1RRPA 4E09A 4Q03A 3SI7A 2C5LA 3KTAA 1A5TA 2FPMA 1R0XA 1DS6A 2DYKA 2FFAA 1NG9A 4XJXA 2JLWA 3V4FA 4ESHA 3TAUA 2H5EA 4KSCA 2VL7A 4LY6A 2IYZA 2R6GA 2CNWD 2VTKA 3IO5A 4QGHA 3TQFA 2GCOA 2OBMA 2XNDA 2ZRFA 1SVLA 4IXNA 2ZJBA 3SYLA 1N0VC 2CK3A 3QKSA 3VNVA 1G8FA 4IJMA 4DVGA 1P75A 5JCPA 4Q1CA 1FUUA 3T1VA 2V7QD 1E2GA 3LA6A 5FH9A 1CXZA 4C3ZA 1N3BA 3VQTA 3BFKA 5JWHA 3GCGA 4NCIA 2SHKA 3RRYA 2W0SA 4OI1A 4B76A 3I61A 3BXZA 2DPXA 5CDFA 3NC0C 4BLOA 1Q1EA 1XD8A 2TMKA 4KV9A 4DLZA 4C7OA 5JZVA 4RD0A 2WJVA 1WB9A 1JR3A 1G18A 2D06A 2JDIA 1E2MA 2OO7A 1IONA 5AJVB 3EWAA 5AUNB 3U3RA 5KSOA 4LWZA 4MUBA 4IOKA 3OEEA 4G5GA 4RY2A 3A6PC 2BKEA 3ADBA 1CR1A 2GAOA 5FOTA 1NY5A 4TQ9A 4IFBA 4BFXA 4EJSC 1X86B 1BH2A 2WMOB 2WWIA 3K9LA 4OBEA 2QMEA 4HSEA 4HLUC 3QIAA 4OHYA 1PZNA 1T8TA 2ZJZA 2QRNA 1IN5A 3CPEA 4LJ5A 1E9DA 3OFND 1E2PA 2JAQA 3LBNA 1E1QD 1W47A 3CLVA 3MJRA 4DCUA 4NYIR 1KY3A 1W49A 3GPLA 1KI8A 4A4DA 4LDJA 5UKDA 3CX8A 5CM9C 2R9VA 1NVUQ 1S3GA 3C8UA 2AFIE 4FCVA 3X1XA 3R7WB 2F1JA 3GJ4A 3PEVA 2WIBA 4Q48A 3W8RA 5KSYA 2V4ZA 3FE2A 1SULA 3K8YA 1DADA 1WF3A 1ZUIA 5JI2E 2F3TA 4A2WA 3FOZA 3PEYA 2ZTSA 2NZJA 2VHTA 1OFIA 4X8LA 2GCNA 4M1SA 3OE7A 2VSFA 721PA 4B6FA 3CIOA 1XB2A 1O87A 1NVWQ 4HB4A 3AEZA 2RGGA 3GLHA 3KJEA 2G0NA 3O8DA 4PC3A 4PSAA 3VU9B 3BERA 5CLQA 1I4TD 1RYFA 3LVQE 2IS4A 1ZUNB 3X1ZA 2VQSA 1NN0A 2J9RA 4TQUS 5JS7A 3TKLA 1C9KA 3GD7A 1OKKA 2ZREA 1Z6XA 4P4UA 2QY9A 1IQPA 2QPTA 3REGA 2ZRKA 4R98A 2EWVA 4TYNA 4TYYA 3K0AA 3AP2A 1RJ9A 2GEUA 3ZD6A 5FOXA 1KSJA 1TNDA 3CF0A 4BLPA 3ZLJA 5K8IA 2BBWA 3U2QA 5FTKA 4YMVA 2OCAA 4ERNA 3WYFA 2OCBA 4MYTA 1R7RA 4RZXA 2ZUDA 2VHQA 1ZJ6A 2XJ9A 2P5TB 3ZD7A 1Z22A 1J2JA 4TMZA 121PA 4D80A 4KBFA 1EFCA 2GETA 3ZQ6A 3L82B 4XH9B 3OEED 3T5DA 3SYNA 3G82C 4BUJA 4Z54A 3BWDD 3R9XA 2EW1A 1LTQA 3A4MA 3IEVA 1FNMA 2P65A 1XEXA 4IKEA 1QHXA 3GJ6A 4NYMR 2H16A 4CW7A 2GCPA 1PJRA 4Q4LA 3GLGE 2G88A 3A1SA 1NN5A 2P2LA 4G1UC 2WV9A 2HJGA 2GHIA 3PXGA 3NG1A 5BN3A 1X8LA 3IQXA 5AJXA 2J0SA 2CBZA 2JGNA 1N6IA 3IPXA 4O2RA 4XSHA 1G8PA 4DCNA 2AD5A 2Q21A 1HA3A 3HP1A 1MO6A 4DT1B 2REOA 2QAJA 4HAUA 3BC1A 3KDSE 4D4MA 2BCJQ 3B5JA 3KFXA 1C4OA 3UG6A 5FPTA 3THYA 2GVZC 4TZ6A 4BRWA 2VA8A 5EQTA 1JJ7A 3OE7D 1VKJA 1ZIOA 2JJ2A 3CWQA 4AKEA 4A0GA 1GL9B 3A4NA 4QL3A 4CEIA 2ZSFA 2RGXA 3T5GA 4IDNA 2MMGA 1QHYA 2G6BA 4V02A 2NGRA 1UFQA 1XBTA 4FD2A 4V0KA 2ZI4A 1TADA 1Z2CA 2RGEA 2O8EA 2O8FB 5J4YA 1Z0KA 2Q3FA 1OKKD 4JJZA 3JZMA 2FSIA 2IWRA 4YQFA 2FDCA 2XX3A 4G0NA 5GJBA 3AV0B 2GEVA 1J90A 2X8AA 4DLUA 3W34A 2PCJA 3EIQA 5LB4A 1KHTA 2AR7A 1E2NA 3AF4A 4EDHA 3EAQA 1FL9A 4IW3B 3OEHD 5DNYB 3TVTA 3PUYA 2J41A 1QHIA 1XCMA 3W6NA 4GL2A 2WWHA 5JS8A 1NG1A 1Z29A 5K8LA 2D2EA 4UNNA 3WMFA 4JLDA 5JI3E 5SZJA 4A8JB 1WMSA 1GIAA 4IRUB 5EE5B 3UKDA 5KPDA 1W0KA 4BEJA 5DI9A 1MO3A 3CRRA 1D2EA 4LCBA 2AWOA 2REBA 2R6CA 2VSXA 4JT4A 4XWKA 3KZ1E 3F3YA 1KO7A 1NN3A 3I1FA 4DCTA 2WMNB 2QP4A 1F60A 4TMXA 2QP3A 1TUEA 1GRNA 2XGJA 1DEKA 4URVR 1M6NA 3BK7A 4BFWA 2ZJOA 1UAAA 3AUXA 4JLOA 4L15A 1VPLA 2VO1A 4WBSA 2RCNA 4PZYA 1OFTA 4OQFA 4EIWA 1S3SA 1BIFA 1ZU4A 3BH6A 3KKMA 2IUTA 5KNBA 1FMJA 4Y0AA 4GDFA 4CEJB 2J5XA 1G291 4WW0A 5FL3A 2ZR7A 1TF2A 3IGFA 4FIDA 5DO9A 3RVBA 3RWMB 2FPLA 2WPDA 5FTNA 1U98A 4P0TA 4Q4JA 1P9RA 3EX7C 3QXJA 2F43A 3UMFA 3C7KA 1FX0B 2R44A 3A58B 3VX4A 2WWWA 4HAVA 4L8GA 2J59A 1E69A 1U0JA 1SGWA 1T5LA 1E1RA 4KXFB 3KKQA 2XAUA 3I8XA 2JJ2D 1AJEA 1NKTA 2ZRGA 3KUCA 4LYAA 1E3MA 4LHZA 1NMXA 5KPJA 4O0MA 1PLKA 2HF8A 1AM4D 4I4LA 5B30A 1W36D 2EU8A 1JXOA 2OESA 1UDWA 2IYYA 3V9PA 1LFDB 3VMFA 2ZI5A 4NMMA 2FMXA 1YU9A 1W2GA 1N6HA 2ZANA 3TH5A 1SZPA 2PZEA 4JJKA 2H8KA 3F0TA 1QDEA 1S4QA 4BFZA 5FPYA 1VHTA 2GCOB 3KB1A 4BRUA 1MV5A 1P2UA 2JJ8A 2AKAB 4ZI2A 2JLXA 3T34A 3DKVA 3SBDA 2GK6A 5EP4A 1ZUHA 4M22A 3E1SA 3GLGA 1A7JA 1RRGA 1KI2A 4V0NA 3U60B 1Q1ZA 3KB2A 2Q6TA 2OCPA 1IM2A 2OEPA 4UNPA 2BMJA 5JBQA 1W0KD 1W4RA 4PC1A 1JAHA 5TDHA 3LLMA 3TAHA 1SVOA 3KKNA 2W2TA 3PITA 5HE8A 2XZOA 4LHVA 4C7OB 1ZCAA 2BEKA 5DGXA 2PZFA 5CK5A 4EPTA 1ZAKA 1JXMA 2QSZA 2OBLA 1KK3A 5HKKA 1CJVC 3B2EA 4NU0A 1OF1A 1UM8A 4DB2A 2OXRA 2BV3A 4DDVA 2VP9A 1KAOA 5H8WA 2ZRBA 3MSXA 2FSHA 2DBYA 1YR7A 1DAEA 3TR0A 1IJEA 1ZMXA 1ZM4A 5EZ6B 4JL6A 1UBFA 4LBVA 3NHAA 2MSCB 3E2IA 3CNLA 5BWMA 1AZSC 1MH1A 5LPNA 2F6RA 1NBMA 3BIFA 2D62A 2VH5R 3L0IB 3QF7A 1KMHB 2WPDD 4OHWA 5EXPA 1YHNA 2P5SA 3K9HA 5FUYA 4TT3A 4Q19A 1BMFD 1IY0A 3UWKA 1GWNA 3IBYA 1FP7A 2JLQA 3IKJA 4JZKA 1QF9A 4MGZR 4C0QC 1IBRA 3SFZA 2NPFA 2GTPA 3EC1A 4L5BA 1E1RD 3I8SA 4TLCA 1DAKA 3THWA 1KO4A 2NIPA 5L3RA 2J7PA 5GVRA 3TJZA 1H65A 1OT3A 3GJ3A 3KXIA 2ZSBA 3I32A 4P4TA 3QG1A 4XTCS 2R6DA 4ITRC 1PV4A 4JYBA 3AP3A 4JL5A 1E9CA 4CF7A 1LVGA 1NRJB 1R5BA 3GEHA 2O8BA 2F7SA 2BWJA 4Q1BA 2GZHA 5EE9A 1I4LD 5TXGA 3GLHB 2IYVA 4IDOA 5FOWA 1XZPA 1XD2A 1YRBA 1MABA 3NDPA 4KITB 4QBHA 4QBGB 2DFTA 2GXUA 4HAWA 1XJ0A 2C04A 5JCZA 2IS1A 4Y0VA 5AUPB 2DWPA 1S9HA 1GRRA 1ZYUA 2ZI6A 1RVDA 2ZS7A 5E7MA 1SVMA 3K0AB 2GJ8A 1EFRA 1RJ9B 1EXMA 1TU4A 4DCSA 4O2LA 2DFLA 1Z28A 1Z5ZA 1WBDA 1AKYA 2VP4A 4EKDA 2FFQA 2YC2C 2WJHA 5JSZB 4DLXA 2ZIAA 4QJ3A 3QI2A 4NBSA 1COWA 3LX8A 3PEUA 4L9SA 4M1WA 4DHEA 3IBGA 1H8EA 2I1VB 2WJYA 5HKKD 3SQXA 3P20A 4NZYA 4E03A 4U5XA 1VYUA 2I1QA 3M1IA 4URWR 3MWLA 3IIKA 5EE1A 3R9WA 3VU9A 4M21A 1A82A 3W6PA 1AK2A 4RFSB 3ZVLA 4UQOA 4QKQA 3D7MA 4NPHA 5BXQC 5KOYA 1Z6TA 1VIAA 3MAAC 3OIVA 2MSDB 2ODEA 1OYYA 1KDTA 1TEVA 1Z0DA 1NBMD 2XEXA 3UANA 2V1UA 4MYCA 3N2IA 1QVAA 1XEWY 1KKMA 2BIFA 1VCNA 2WWFA 4TT3D 2W6IA 5KHOC 4I1UA 1P4SA 3A1VA 2OFXA 3LX5A 3KQHA 4OQLA 2J7PD 3PUXA 1N5LA 1HV8A 1ESMA 2J87A 1Z0AA 2AK3A 3EA0A 3N5CA 2OAQ1 5IRCD 5HZHA 4KO8A 1E9RA 4CGZA 4RZ2A 4OQXA 5E7JA 3W3ZB 3RSLA 3TW4A 4UKDA 3CO5A 2P6RA 3DKPA 5KU1A 3BFXA 4OK5A 4H1UA 4B3DA 1HT2E 2GBLA 1OLOA 1S1MA 1CULC 1XMSA 4EUNA 1WQ1R 4HDOB 2BCGY 2CEAA 1KSHA 2O8EB 1AA9A 2A3RA 2EFGA 3DM5A 3LXXA 4LHYA 3B8HA 3U3KA 3VFDA 2PX0A 4HUTA 1G20E 4ILEA 3CRMA 5IF9A 3GLIB 3NBZC 3ND8A 3K0SA 4V0ME 4NCNA 1EFRD 1WDTA 3TUZC 4FINA 1BKDR 4PPFA 4ACBA 1XPUA 4DT1A 2QENA 1UKYA 3B85A 1DAIA 1KOFA 1DG3A 2WHXA 5LB2A 4BWYA 1XTQA 1OYWA 2OE2A 3OIUA 4WIAA 3TRFA 1Q3HA 3WRXC 2W0MA 5C4GB 1TTTA 3A8TA 3X1YA 5J47A 2BMFA 3EZ2A 4HAYA 2VHUA 5CLLA 4TMVA 2ZSDA 1H8ED 3RS4A 1OXTA 4D6PA 5HZKA 2IYLD 1TPZA 4I1VA 1QVRA 4R7ZA 3G5UA 5GJCA 2VP0A 4AIIA 1CJTC 4HZUA 3TE6A 3DL0A 1HQYE 1ZP6A 2C9OA 4LJ8A 2F55A 3O8BA 1NKSA 5B58C 3K0CC 4G5QA 3IPYA 3GJ5A 3AB3A 1RIFA 5JECA 1TAGA 3LW8A 3PEWA 2XXAA 4IFEA 2QBYB 4Q9LA 5DH9A 1FQJA 2ZJYA 1J8YF 1W4CA 3TGPA 2QRZA 1MRNA 3EPHA 5C46F 1X3SA 3BD9A 1Y63A 2QG6A 2KBFA 2A9KA 2W6ID 3LY5A 3VKWA 4JT2A 3BB1A 5IK2A 5HR5A 4LRWA 4Q4JB 3X1DA 2JLZA 1E99A 2D74A 2VPPA 1Z6AA 4LBWA 4QHYA 5H1YA 4QM7A 2F43B 3GLHE 3UIEA 2IYTA 4WVFA 1GKYA 2J45A 4Q4HB 1SVIA 5B57C 3PG5A 1G5PA 2RH5A 3QY0A 4FN5A 4ZCMA 3DOEA 5G3YA 4Z1MA 4QGFA 1XTSA 4MH0R 4NCHA 4CZ2A 5B64A 4ARZB 1RPZA 3QF4B 1CJMA 2X1VA 3GJ8A 5JEEA 4OK3A 4Q66C 5EJEA 2GRJA 4F92B 2GA8A 3BE4A 4JVNA 3FHTA 4XOIA 5CITA 3U3MA 1YZNA 4U02A 4CT4B 5TY0A 3VNUA 2ZE8A 3QUSA 4DLYA 3MG9A 4M9XA 1G3QA 2C78A 1FTNA 4NYMQ 4MRPA 4DB4A 3QXXA 3OAAD 2KBEA 4II7A 1DPFA 1E1QA 4Q9KA 4NCKA 2IXGA 5FOVA 4E07A 1TU3A 2B8WA 4URXR 4LK2A 1P2TA 2QMOA 4LI0A 2J0UB 1FX0A 4MRNA 2GZDA 1FPMA 1XF9A 3GLGB 1R4AA 2YHSA 5ANRB 4A0FA 1IN6A 5EXTA 4JLAA 2WVJA 3L43A 1ZNXA 1XEWX 4LC1A 5DIFA 5DHAA 3U4QA 3BB4A 4JLMA 3GQBA 4XVRA 1ZM9A 2BBSA 4H9GA 1VG8A 3CF6R 4ZO4A 3W90A 1JEDA 3QXHA 4PC2A 3EW9A 4QOSA 3AVWA 4YDSA 1SVKA 1KI7A 1G3UA 1JQJC 1CF4A 1OH5A 2ZS9A 4OKSA 4R71A 1XWIA 3M6AA 4Q1DA 2EFHB 2QTHA 3B13B 5M04A 1ZBDA 2CVHA 4N1AA 2BMDA 2WKQA 1UF9A 2CLCX 2JLSA 5HTKA 1SKYB 1BS1A 4PAQA 4JSTA 4DDTA 2X77A 4Q4AA 4Q1EA 1E9FA 3ZGXA 2QNRA 4XD7A 3SR0A 2A5JA 2OFWA 4G5OA 1TF5A 4Q1FA
chains in the Genus database with same CATH superfamily
1OWLA 4OYRA 2VFAA 1TFRA 3FWHA 4H0FA 3LAWA 1NXQA 2G5TA 3NV9A 1Z47A 4INOA 4KAFA 4RD1A 3UHPA 2H6EA 2OWEA 3U7GA 1NDQA 2CLMB 5IJ9A 3K6SA 4MCHA 1SMKA 4A8JC 4D92A 4ESVA 1DIAA 2OGUA 3DEKA 1HZZA 2O57A 1LS1A 1T8YA 1Y3AA 1DKRA 1FK8A 5AWFC 1GDDA 3P9YA 2J7KA 3ZE6A 3IL2A 4E1BA 5DHTA 4H7IA 3D2BA 2MU1A 2F8LA 3DUFA 4LHXA 4OHPA 3NCHA 4A8TA 4DABA 1VA5A 2HO4A 2Q5EA 4D81A 3SNKA 4R2IA 2OVBA 4P6VF 2CBGA 2PGDA 3GLIE 2BDEA 4EF4A 1HNXB 4K0KB 3ZGOA 1PJ3A 1NQTA 1QZXA 4GPAA 5T6MA 1ZH4A 5JR3A 1M1NA 3IEUA 5KJ6A 4IM7A 4WXEA 2ZU0C 4AUMA 1HEIA 4Z3KA 4OFXA 2HLPA 5C3UA 2HSEA 5K0NA 3TCXB 4P81A 1JEYA 1A71A 4NTZA 4OL9A 4EENA 1TGVA 4BN5A 1J0XO 3KSAC 2Z04A 1UBOS 1HFWA 4PBRA 4WV3A 3JVEA 5E3HA 3AVTA 1G66A 5IT0A 4YCSA 1L4FA 4G4IA 5ETJA 3AVXA 3BDVA 4J0KA 2PMEA 2WBLC 1X9GA 3SE0A 1ZVKA 3GGCA 1LW7A 3GRAA 1NR7A 4DOMA 3BULA 4TN1A 4GKJB 3REQB 1NJ8A 4WN9A 3K96A 2Z5GA 4YNBA 1TQ4A 2HQRA 2ZSAA 3LHKA 4RLSA 5A5VA 4F12A 3VOBA 3AEXA 3ZYCA 3P1JA 4HI0E 3ISVA 3ZG6A 3USCS 1FCJA 1ESNA 3FDZB 1Q1QA 5T4HA 4BATA 4JJ8A 2Q6LA 5DWVA 2DF8A 4GMGA 4D9FA 4EHIA 2Q4TA 1ZXBA 1CYEA 1J2EA 3EQ9A 3N59A 5K01A 1Y34E 1KH3A 3RUDA 4ZHQB 1ZL0A 5B3JA 3CF4A 4Q3EA 4E2WA 4H59A 4BQRA 1U3FA 1IAVA 4UREA 4DLKA 5KTYA 4A36A 3KELA 5P21A 3RM3A 1QG2A 2BJHA 4TV9F 5IXJA 1Z8FA 1KAQA 3I72A 3LHDA 3HNRA 4B17A 4MWSA 4OKIA 1P6QA 4MKXA 2CL6X 2P62A 3I6MA 5AM0A 5KYXA 1CRPA 4GKAA 3DDSA 4M98A 3ROTA 1N2GA 1BHSA 4V0OA 1LB1B 4IQGA 3WRYA 5BP7A 3BL5A 4H2DA 1R3UA 3ZVRA 3WJ7A 4BWGA 3IPAA 4JITA 5BN5A 4ARSA 4XD7D 5IU6A 2VLBA 4FFSA 5TPWA 7ADHA 4IDBA 4AJJA 1NU6A 2HI0A 2YBEA 3IULA 3O93A 3PC2A 3R44A 2FVXA 1WUYA 4XB6B 1RT9A 1RZUA 1CU1A 2DE0X 3DO5A 3ORQA 1EINA 3BEOA 1NV8A 3MELA 1Y5NA 3B6ZA 1FYVA 3ESCA 5AOBA 2FE4A 5K8TA 4HNGA 2OAEA 2PIAA 4FDAA 1QV6A 1YCDA 1G6Q1 3A9WA 2H7XA 1A4XA 3HY4A 2XAAA 3KVVA 1Y8RA 4CHTA 1BO6A 3S2SA 1Z33A 4QG3A 1OLXA 2RHCA 5FNVA 3KQQA 4X0EA 4YDQA 3L0DA 4PEVA 2PMCA 1KO8A 3F3MA 1IB6A 4RM3A 2H7YA 4A0SA 3R7DA 1VTKA 3WJ2A 1FJ2A 2P69A 4GWKA 3GBPA 1KWGA 1Z83A 4U6SA 3M6FA 3OD1A 1IE3A 2H2GA 4YRIA 4UPEA 3ND9A 4MVJA 2HSDA 2PT6A 5IAKA 5GOZA 2D2VA 1QHGA 1QMPA 2OOKA 1U2QA 4HWPA 1RHUA 5HCIA 3T5BA 1A9YA 4ZKDA 5IH7A 1P5HA 4X63A 3QZUA 3OZCA 4CM4A 2OAP1 4II2A 5F23A 2PO5A 5B4TA 5LC1A 3N6RA 1KDVA 2ZXEA 4ISBA 2G0TA 3HCEA 5E9AA 1TK3A 4A8PA 4EQZA 2X86A 3E7FA 5DP2A 4YRRA 1X6VA 1NMQA 1U2GC 2V65A 2P68A 2VG8A 3ZE8A 2JFYA 2ZYIA 5L40A 1ZNZA 4TM8A 5H81A 2BTEA 4L7VA 4A26A 4OJKA 2HX1A 1PR5A 5TV2A 3EZGA 4J0EA 4U9HS 3LDHA 1GNRA 4OATA 4U2KA 1BEZA 4WFJA 5IBPA 4HDAA 1Z4OA 1JQBA 5I9NA 3W7VA 1GPNA 1UJ2A 2J8ZA 5EWJB 2CB0A 1ONOA 1XVUA 1MT3A 2H1VA 2R96A 2VT2A 2BVNA 4ZMBA 1JDUA 2JG3A 4MGYR 1RWVA 1FFGA 4HR7A 3KYJB 4WK4B 1QIMA 4A10A 1GGKA 1JR4A 4MYUA 3UOGA 1NFFA 2PL9A 4MR7B 1LPOA 1C8KA 4LV8B 4AT1A 3WBKA 2A59A 4GKBA 4TV9B 1NE7A 5CK4A 3ORYA 4RM2A 3DLPX 3ZXUB 3UYLA 5ICMA 5P8WA 1CBUA 2QTMA 3QTBA 3ZN2A 4HZUB 3UJAA 5K0JA 4C1BA 3CNBA 1W1UA 3L7MA 3BWEA 2RH8A 3KQNA 1Z6QA 4XPZA 1NFRA 5THQA 5JS1A 4PAOA 2E89A 3V34A 4ZI3A 2Z2ZA 1VCOA 4AVYA 2ZJ0A 1D4OA 4I8XA 4NDAA 1YQUA 1YSCA 3IS3A 1C1DB 4KAXA 4KIJA 3RC7A 2FE1A 4AJ4A 2XCTB 1YAJA 4YRCA 3QXSA 2HJ9A 3EZ9A 4IZOA 4PHHA 4IVRA 3ZNQA 1VMAA 1SBNE 1YZHA 5IW8A 3FPGA 2DBZA 4QDXA 2WLTA 1MTOA 2Y1LA 1CWUA 1HNNA 3C6MA 2Z30A 3AOEA 2V9ZA 2B36A 4PZDA 2CZQA 1CJSA 3KK0A 4NNPA 4C0LA 5J4VA 5JC1A 1AGRA 1QHHA 3V8RA 2PR7A 1T5BA 1L8AA 3S2YA 3ZV4A 3OX4A 5JSHA 3NC1C 2AC2A 2F62A 3CW2A 1T5HX 4V1CA 1PAUA 5IANA 4W5HA 1NF3A 4R1PA 2JLAA 3AW8A 1UXOA 2ET6A 2PL5A 1L7XA 2EJUA 1RFGE 3D3JA 4KTVE 4LVNA 4QG7A 4ZVPA 4BX3A 1GSOA 1CEYA 5CB8A 3FXAA 3RW9A 5IYZF 2I4TA 4KODA 4MVJD 2XQGA 3VJKA 2ZROA 1U0FA 3SQMA 1XYVA 1E3SA 2XJ4A 1JG3A 2Z5VA 2ANCA 2DR3A 4DMUB 1IY9A 1XO1A 2ZRAA 2Y9MB 1L3IA 2AS0A 2W37A 2XYVA 1KFKB 4KSYA 2QBYA 5U4QA 2AC4A 3C5CA 4PZPA 1UPBA 2H17A 3VR1A 5A0TA 1X19A 4GC5A 3UCEA 5JVDF 2IXTA 2B2XA 2XE6A 2ZRHA 2OM2A 5FLXA 2F1HA 4UTXA 4YJ3F 5GM1A 3TIVA 2V3VA 3H1TA 2FW1A 1P7YA 3G2KA 1NNEA 1F0NA 1K5HA 5SZHB 1M5TA 4KNYA 1PVVA 4P54A 2ZYSA 5JRZA 3CZ5A 1UPCA 2JD0A 4MQLA 2OV3A 3KXDA 1K06A 4OHRA 4TUYA 4X54A 3U4AA 1GHTA 2FUEA 2PV7A 4HGPA 4EHHA 4EO7A 5HIAA 3HFRA 1MB0A 1FUYB 1ARZA 3HU1A 4UE6A 3T3MB 4IIHA 1FDOA 4RHCA 4HB2A 2FN3A 2ADFA 1LDEA 1H5NA 4RH0A 4UARA 1ISMA 5FI0B 3T5MA 2XMRA 4S0XA 3FNBA 4TV8A 2PRJA 4B32A 4BKPA 4Q4HA 1AQNA 1FUEA 3NQ41 1OASA 4AMVA 3BXXA 4N03A 4EVRA 2G83A 1G3RA 2E1PA 2IX9A 2B78A 1JLRA 4IFTA 4PZLA 5EJGA 4B33A 2BE7A 2X0FA 4RELA 1E8DA 2JJYA 4DIDA 4ND2A 3KQYA 3QF4A 1RE0A 4QVGA 1M6HA 5AW7A 4AD8A 2EFJA 1S4MA 2HMAA 5C53B 4L8YA 1UC5B 4X7MA 4IL5A 1DU4A 4RMGA 4AN1A 1GA4A 1XXHE 3AF0A 1G5FA 5GTDA 2QQEA 5DRYA 5JEDA 3MHPA 1SY7A 2YQZA 5KYVA 1K3UB 3ZHOA 4W5RA 5B4UA 2JGDA 3V6MA 1J8MF 1KEWA 4PYNA 1EGMB 2X4DA 3DDCA 4M76B 3OQIA 1PG0A 4KMSA 3D7NA 1SHJA 2I2DA 2JIPA 4PV7A 4KFTA 1JKMA 4MUJA 3K4PA 4ZAZA 4B43A 4DR4B 3QNMA 2H51A 3EZNA 5JZSA 4YT8A 2B0CA 3DOOA 5JWOA 1AQIA 1Z4QA 2ZSHA 3T52A 3Q8XB 1Z6YA 2HREA 1TJYA 1ZK0A 1L4BA 1SUCA 3D6VA 1W59A 1KE1A 1IG3A 3AOEC 3LRTA 3LL4A 1KVSA 2PLNA 4WZZA 1KJZA 1NX6A 2IDJA 1M1ZA 3NYQA 5JXWA 3KKKA 1IXSB 1QR6A 1QLHA 1P44A 2CDRA 2TMDA 2Z1DA 3A9RA 4ID3A 1FP2A 1YB2A 4IO0A 1RTTA 2VCHA 3HYRA 1H3FA 1M7BA 1WPXA 1YZFA 1U8ZA 2W83A 2C2WA 5C8YA 5PGMA 5IYZB 2YV1A 1USKA 1TM7E 2QI9C 1E2HA 1GSIA 1P5ZB 3A2MA 3FGOA 3MTAA 3O74A 2K87A 1T1IA 3AR9A 5GMOA 4BRZA 6PFKA 1X9HA 1JX6A 1T4MA 4EG6A 1HR0B 4EY7A 1CLEA 2FA9A 1KPHA 3HMKA 4NZZA 4BB9A 4DNQA 1UMBA 1WZIA 1PS9A 2CCJA 3EBOA 2DPYA 4K28A 4PXYA 2C7BA 4MYHA 4KREA 2HXYA 1US8A 4KJZA 2H2WA 4F2DA 1VECA 3N8NA 2GK3A 2BJVA 4LX0A 3KHKA 5JVDB 5EP2A 4CI0B 1DFIA 3TQOA 3OURA 3RK1A 2NU7A 4GP7A 1PL6A 1VCMA 4YJ3B 1U28C 5AT1A 2C9CA 5G0VA 3OZTA 5KAPA 3U17A 5AK3A 3HUEA 1TIPA 4NG5A 3U48A 3FUCA 3L40A 2HXSA 4PSKA 4QPPA 3FG9A 1U0BB 2O52A 1G3MA 3HBFA 4BAGA 5EIAA 1UIMA 1ICEA 3S28A 4KK3A 3QU4A 1F12A 3EY4A 4PYMA 4WKGA 1VL0A 5FADA 1VGRA 3B51X 4C2TA 2P3QA 2H18A 4O4LA 4AL4A 1KJ8A 3UTDA 4DSTA 1T1GA 5E95A 2HSJA 3PC8A 2P2SA 1BXGB 3ASUA 4B48A 1GY8A 3R9IA 1U9CA 1P9OA 1ZRSA 2NUBA 3L04A 3MFQA 5E9WA 4HUJA 3V1UA 3D4LA 3ZZ0A 4OI4A 4EB8A 2YN4A 4C7KA 2YKGA 4X1KB 1K9SA 2BZ1A 2JA1A 4FLMA 3NAQA 2C3PA 1CLUA 4X94A 1X92A 2H5JA 2OBNA 2GB4A 2JAOA 2VAWA 4BP9A 4EPXA 5CNKA 4D96A 2GZ3A 2DFNA 1H4VB 1BDMA 3MCZA 521PA 4JA2A 1E1CA 1KP2A 2IPNA 3BD6A 1AKQA 3D81A 4MKGA 3TZBA 4ZIRB 1D5CA 4QJ4A 3CF2A 4OXIA 3R0IA 1U94A 1ZMTA 2GD2A 3FY4A 1OBHA 1D8AA 1T1EA 3UAVA 4ZOLB 1R6TA 2R751 1FTQA 2P6NA 2YMPA 4FMBB 4PHCA 2C4HA 5JHHB 5A4AA 3I62A 4MWCA 2JFQA 3H2YA 2FG5A 2E4AA 2JEOA 2JGRA 1GU7A 3WHLA 1A7AA 3OLVA 1F2VA 6CHYA 3T3NA 4LZLA 2BHSA 1R66A 5DYNA 3BMCA 3VR6A 3EN0A 3VISA 3HKDA 2C77A 4WK6A 1XROA 2O2SA 4INPA 5IDVA 821PA 4W9RA 1OQAA 4QHSA 5BRNA 5ITSA 2C8VA 1Y6JA 2HK6A 2DR0A 3GNTA 1KAMA 3AH8A 5EAIA 2OYRA 4K9SA 3EVEA 4WASA 5FXMA 3O3CA 1FLDA 5DPMA 4F04A 3V97A 1T24A 3BJMA 1OTXA 3FTEA 2ZB8A 2AOVA 4C0HA 4PLTA 3TO5A 1L4HA 1NTOA 1RC1A 4EPRA 5AVRA 1RXSA 1N2IA 2HWUA 3U26A 1F2UB 1GUBA 2JW5A 4GFDA 5EIHA 4MDFA 4BO9A 1GYQA 3VZQA 4Q3KA 3OQVA 4DREA 3DKKA 5JAZA 3GLSA 5JO9A 1YI0A 5IAOA 3KVOA 1VPTA 1FMLA 4YXWA 2OV4A 5AM5A 4BECA 4R84A 3RVOA 4J4TA 3I83A 2RGWA 4G4GA 4JGGA 2X9VA 1I80A 3O82A 1LF5A 4CKBA 3K9WA 1XNRB 2VQEB 2FUG1 4GOMD 5DGIA 4Z7QB 1TM2A 2X4LA 4IEEA 2Q4OA 4GQAA 1X1QA 4OK6A 3USES 1IXYA 3A4TA 5LZ5A 4DYHA 1BKSB 1JDVA 3UW3A 4RZUA 3W8NA 3FZNA 1NUHA 1NRWA 4HMQA 4C4PA 2M1XA 4O08A 4E2XA 1KEEA 2BC9A 4P53A 4NR0A 1MJFA 4Y1EA 3UENA 1RHKA 3GOQA 1W76A 4DC9A 3O8RA 5A9SA 1JTEA 1ZK4A 4PGAA 1KQNA 4M0CA 4CL0A 1PGJA 4G81A 4J6EA 2XMGA 4IJQA 2DZDA 3A37A 4KG7A 4XLLA 5K3SA 2VHVA 4DE5A 2P11A 1Z2DA 3FAZA 4M0FA 2QVCA 1KE2A 3WADA 5ER6A 1UBRS 3LCRA 1NU8A 4ZAXA 2IL1A 4C0WA 2ZWPA 3AR4A 4W63A 3HEBA 3L06A 3RQSA 1H1DA 4RPCA 1I9GA 3OIDA 3EWIA 3C8DA 3ZJYA 5CD9A 3CR8A 3GRZA 1J2YA 4DDKA 5EZQA 2AD1A 5DN6A 1OXXK 3RIEA 1SCIA 1U9YA 1EVIA 1CHDA 1CZOA 1OPXA 2JFVA 3QE4A 5TT0A 4TXLA 3CSUA 1GP2A 3FFXA 7ABPA 1DX9A 2ANBA 2FZCA 2PZBA 1TO6A 1JKJB 3BN3A 5B7PA 4NMWA 4NQRA 4CIDA 5HZGA 1HT0A 1NOIA 4EG5A 4K6HA 5SZKB 1I3LA 5IH3A 1NMYA 1LQUA 1KAEA 2NUPB 1IAQA 1ADJA 3KE8A 4OM8A 1SXPA 4NBUA 4A0QA 1JUDA 1V4VA 3JD1A 1VHLA 1QR2A 4F91B 3LYHA 3VR6D 1V5WA 1ZM7A 2J9GA 4JT8A 2OBYA 4KVZA 2J0VA 1RYYA 1FDUA 3W9BA 3LUJA 2N46A 1UWLA 4NAVA 2IH2A 3STHA 2FMFA 2OSBA 5JDIA 1JJBA 1KDOA 4CM6A 3HADA 1UOOA 3G8DA 4K6FA 1UM9B 5B7GA 1PEDA 4XRGA 3Q0IA 4YMTA 1WP4A 2LZ0A 1C3XA 3W4KA 4X65B 1DC5A 4D8WA 4HXFB 3TLGB 5JXIA 3NJRA 4ITVA 4LXTA 4TXHA 4XM1A 1ZI8A 3ONWA 3DAPA 2E4WA 2Y76A 3WC4A 3TZLA 5B37A 3EFOB 3L6RA 3OOYA 4XIIA 1QQAA 4OREX 5EVCA 1A8QA 2JARA 2OLEA 4YXWD 1QK3A 4A92A 4BL5A 1RKUA 4JBLA 4ZANA 3IT0A 3UV6A 3QELB 1BS2A 4Q4CA 4RDIA 6REQB 1Z13A 3AFNA 5IUJC 4DMLA 2HDOA 1PR4A 5KYUB 1P77A 4MUNA 3AKCA 1K98A 2ZRPA 3I9MA 3WWPA 3T1TA 5LD2C 2C3YA 5JWRA 3J81A 2VJCA 2ZJ4A 2PUJA 1L4NA 2ZI3A 2X8JA 2Y93A 3QTTA 4MQEB 5FUXA 3LO8A 3BRSA 2CDAA 5EIWA 1TFUA 2QMYA 1BHJA 3L8ZA 5F78A 1MFZA 5K3DA 3PIRA 3NWEA 4PONA 5DNCA 2YXPX 1WVGA 1OX4B 4NCAA 1GNTA 2E0IA 3QVGA 1KH2A 4QLAA 1EAYA 1TYAE 4UATA 3Q9LA 2H59A 1PWYE 2PEYA 1CY6A 1JE0A 4KQKA 4RKEA 4YFVA 3Q6MA 1RAEA 1RIIA 3R3YA 4XPIA 3VOSA 1ZRMA 3MTQA 2GZ1A 3AR2A 2X6RA 2ZRNA 4JC4A 4N5DA 4AWXA 2AGVA 4DMCA 4YR9A 4J2OA 3ADDA 3V48A 2C2BA 1YZYA 3Q0EA 4BE7B 2E6KA 2B2NA 3IALA 1CFZA 1EK0A 2HMTA 3CB4A 3GRRA 3M83A 1NYTA 3NHRA 2AW3A 5REQA 4L0MA 3TI9A 5DN6D 1GZSA 5BSFA 1FPQA 5HQ3A 5KINB 5DMXA 1YMUA 5CX4A 1SKBA 6GPBA 4JYZA 2OBBA 1TKBA 4B2PA 3I04M 1E7YA 1GADO 2IT1A 3O8NA 2Q3DA 4EL5A 5A3JA 1QZZA 3HGTA 1Z2AA 1VE9A 4FYJA 2V54A 2IS6A 2HV9A 4WZBA 1RHRA 5F5XA 1WR8A 3W8FA 1DX4A 3JRXA 3AIIA 1XAIA 3HMQA 3PC3A 3VJMA 4LZZA 2MR6A 3ZCVA 3NI2A 1S2GA 3QOFA 4JLJA 1T5DX 4XJSA 3G9QA 2JANA 3MN1A 3HQ4O 4JYMA 2ATCA 4K2AA 4JEUA 3V4VB 2FSVA 1BOOA 4J49A 1AQJA 3GDOA 3C41J 1CUHA 2V55B 2Q6KA 5B7QA 2WZQA 1P72A 4X71A 1M67A 1N2BA 1YB5A 3C3CA 4R2WA 3BFVA 1CZLA 6AT1A 5KTMA 1P7VA 4YP6A 4D9BA 1K5GA 1P61B 1WKBA 5IAJA 2D1FA 3THOA 1ZAYA 2J3JA 4QATA 4RAQA 2WOJA 4CYMA 2H08A 3LUAA 5I9TA 3GDWA 3ENNA 1TA0A 2XVXA 3BFJA 2H8GA 3Q7RA 4DL9A 3U19A 1ORIA 2FPUA 2DUNA 1P2DA 3KPYA 2QRVB 4LGMA 4HUQA 3P4YA 1NURA 4AURA 1MD9A 2BHRA 1R74A 1SBZA 1Y3HA 4D99A 3ORHA 2EARA 3I6BA 1QE5A 3JQAB 4EP1A 3RC9A 1QONA 2BI7A 4MVJM 2AOTA 1C7IA 3ZHVA 5EY5B 2YJTD 1GTG1 3SVLA 3EWSA 4BNNA 1ETHA 1THMA 1LNZA 4UM8B 2WVHA 4OUDB 3CEMA 2BM9A 4BVEA 5BN4A 1MQAA 5DEIA 5C1PA 2W48A 1XCJA 1ULUA 4AG6A 3QGMA 4YT2A 3FPAA 2DKNA 4PY2A 2FWMX 1O9HA 2HGZA 3FR8A 3E4CA 4S1WA 1MPXA 4OQDA 2QTTA 2YVAA 1LPNA 3FI0A 1QYVA 2RGCA 1LXCA 3KEGA 3FKJA 4JI3B 4BLQA 1CY7A 1Q91A 2VF5X 3D8TA 3PNMA 5L6LB 4Y2VA 4FVTA 1F8FA 1ZMOA 3L1HA 1BW9B 4GR4A 1U8UA 4JELA 3VYVA 4ASUA 4W5TA 3U5ZB 1KI3A 4HKTA 1N6PA 4NESA 4Q9IA 2VHJA 1S1CA 5I45A 2Q1YA 2C20A 2AI2A 2JFOA 3HCDA 4S1PA 4ZV4A 4WLVA 1ORRA 2Z98A 1AKUA 2LD4A 3DMHA 2NZ2A 1CS4C 3EMBA 2G4CA 4JDPA 4LE1A 3B1XA 5FBHA 1G8KA 1DJPA 1QK5A 3ROZA 3SEAA 4EUEA 5LFAA 1YFLA 2IYOA 4TROA 3SIXA 3UMVA 2D5BA 3WNZA 5HFNA 2FZ4A 2XGMA 3QKTA 1YXMA 2NZ8A 1P2GA 3U9TA 4CL8A 1VJ1A 4AP9A 3TTVA 5AH0A 5EGSA 1MRZA 3RANA 3N2NA 3V9AA 3VHXA 3PUJA 3E3AA 1U2RA 1V9LA 5CG2A 3QNUA 3HRIA 4RHXA 2YW9A 3N2KA 3X43A 4HO1X 3C6XA 3TQHA 3NJ4A 3TRDA 4QVIA 4UU7A 4UHKA 5FIUA 1DQYA 5A4JA 1XTZA 1B0PA 3UFXA 4BNGA 3ZZNA 2VWQA 1P2VA 4HATA 2Q46A 1X1SA 4LW8A 3RRBA 3AM5A 4BZZA 1RU3A 3G9UA 2HQOA 2YXNA 4O2AF 2QXUA 4RCZA 4QRIA 4DGQA 1CRWG 4UCFA 3ZZMA 3QUTA 4YRLA 3JARA 1UJMA 2QD2A 4DM3A 1Z3IX 1E2BA 2C31A 1E2LA 4Q02A 1XRJA 2R3SA 1XPJA 1QANA 1NXTA 2CD9A 3PHJA 3E2MA 3ZW9A 3PWTA 3O2QB 2NVUB 1CS0B 3FGPA 1BMTA 3GG2A 4N3NA 4PQYA 3WRVA 4A23A 4F9GA 4ZHSA 1I30A 2OA0A 1M2OB 2CV0A 2GJKA 1OH6A 1PSWA 4X1YB 1E63A 4Z9XA 2BZSA 2H0QA 3ITEA 1DFGA 3AI1A 4L02A 4A0RA 2QQ5A 1TUGA 1K2VN 2J6BA 2O1SA 2XBUA 4UHHA 5AW6A 3ZOZA 2JFWA 3BCUA 3D0KA 1SC1A 3QVOA 1PK8A 4PAGA 1E1NA 2WHYA 3TPZA 2PUFA 2X19A 1TGYA 2D3TA 4GOLD 2JEZA 1JSLA 4IIJA 3VDQA 1ECGA 2OKGA 4ERXA 1K8QA 5LJIA 3S8EA 1EA5A 2HQBA 3GGGA 3DNFA 4PX9A 2X13A 1LJLA 1J8DA 4F4FA 1I2AA 2WFLB 3GZJA 2WTNA 4EA9A 4N5IX 4DEVA 4M9RA 4QU5A 1E2IA 1TMYA 3O8LA 4JI2B 1QIIA 1EM8A 5ED4A 1CY1A 3AHFA 3P0FA 3Q98A 1JPJA 5JZBA 4BNFA 4B3GA 3OJ0A 1CUJA 4PWZA 1A2KC 2JIMA 3T61A 1MW8X 1SC4A 1Z4KA 2IYRA 5DNVA 1JPVA 1Z6PA 3L9WA 3ZWXA 3CKYA 4DBLE 5IN4A 3TBKA 5JJKA 4V03A 5DM2A 2AEMA 2IUFA 3INYA 4HRXA 4CODB 4ZPXA 4CG2A 3QYAA 1JAXA 4MW9A 1RWWA 1XQXA 4EW1A 1YKSA 3FFWA 3JALA 3HKEB 4ZVMA 5B12A 4XIJA 1AG9A 3HBNA 3L7LA 3LC1O 2VJPA 3DNPA 4DSAA 5FUWA 4S24A 2VDPB 4F8JA 2EVWX 3H9UA 4RLQA 4U3JA 2FW0A 4CWAA 4D8TA 4RJ2A 2BLNA 3IHKA 3N39C 4CI9A 4N0DA 3AQIA 4BX8A 3QWBA 2VWGA 1SHZA 2X0RA 4WOBA 1HQCA 3TTSA 2ZYWX 1K6XA 4YCBA 4XRRA 4B83A 3GJZA 2D2IA 1NJ2A 3EAFA 3EW7A 4C76A 5HOQA 3R5FA 1J20A 1K6EA 1JDBC 1CYDA 1JE1A 1NVVQ 1V3UA 3TMKA 5FBLB 3QE9Y 3K9NA 4D4GA 1DNPA 2QTVB 3LQ1A 4G8JA 4GZ5A 1OIVA 4O2AB 3MVEA 2V7UA 5FBVB 3ZXYA 3AILA 2DSTA 3QKRA 4MCJA 4U4AA 1FQWA 2CLFB 1RLIA 4BVHA 3DZDA 4Z3DA 2PWBA 2RGDA 1FUIA 2ONKA 1EE9A 3KVYA 3PT5A 1H22A 5HS6A 3Q7PA 5AKGA 4R05A 4CMAA 5KYYA 5LP6A 1AKNA 4DUPA 4HEHA 1N2JA 2JJ1A 2WEKA 4A5OA 3ORRA 4ZCRA 4M54A 2LKCA 3AETB 3GYBA 1XPRA 4TMFA 1U1EA 3DDHA 3I6QA 3ZS9A 3F8TA 2AUMA 4HFNA 3TUIC 2XB2A 4KQ1A 4JXKA 4HCJA 2GZSA 4YRQA 3FYSA 3OZ7A 1R6AA 5CFOA 3G88A 4PR0A 3I3SR 4GNKA 3U4DA 3MMSA 4FHEA 2QR2A 3I01A 3QWAA 3NHPA 1CNMA 3H17A 3D9QX 3IJ5A 1KOJA 2BTQB 2WZBA 4OSOA 4UM9D 4KOEC 3N53A 1H2ZA 4OLFA 2LIPA 3UK2A 2ZAMA 3CZMA 4PO9A 5KNCH 4D9EA 2V7GA 2PGNA 4YPFA 2P4SA 2BFFA 3MMXA 3D2CA 3KQPA 5B1EA 2PUVA 2YCBA 2AB0A 1MXHA 1RRFA 3IP5A 5CB4A 5HQTA 2NM0A 4OJNA 4ENPA 2G71A 4BPRA 2FEOA 5A5GA 4P82A 1NDUA 4M55A 1WW8A 1ORDA 3AEKB 3IEIA 1LSOA 3B60A 5MGBA 4Y2XA 1BVYF 5JO0A 3MTDA 3RS3A 1BGVA 1QPBA 1NXWA 2F9LA 1KNQA 4XUDA 4G9BA 4EEZA 1Y8AA 3PUVA 3WYGA 3LBHA 1EX7A 3R7AA 1L1EA 3IAM1 4IVQA 5CNMA 2OLKA 1SM4A 1I6MA 1T1RA 2H1SA 1JEQA 1GVNB 4MOWA 3PUHA 1JLLA 1FRVA 4N18A 2HHJA 4B31A 2XUJA 5G40A 5L3SB 1IL0A 3OO0A 1NAHA 4ZZ2A 3VI4B 1ESCA 4IGIA 1UKVY 5BT9A 1T9BA 3RNLA 5EJIA 3RIXA 3ONDA 4HNTA 3QLUA 1FUKA 4GOKA 5CDUA 1KDPA 1PQWA 3OT1B 4RMIA 2ZIFA 4Y7CA 1RXVA 3K3PA 4I9HA 5IEBA 1FFHA 3UK0A 2A1UA 4B5LA 2WE7A 3QTLA 3K32A 3O31A 3FNIA 3GT4A 4ENRA 1XZQA 1NVGA 3WAJA 2XOKA 3BWCA 4UVEA 5JSKA 4BMDA 3KZMA 1M10A 3RTDA 5KTKA 4DZZA 4ZC8A 1ABFA 1YS7A 3GJQA 4M2LA 1GA6A 3WL5A 4IOJA 1PR3A 4BN4A 1T91A 4IY1A 1S02A 4X6YA 3GF4A 3GLKA 3OI7A 3EUEA 1ONNA 4LOKA 4EJSB 4XUEA 5AD1A 3UGJA 1RWXA 1Y7TA 2JJ1D 4B6RA 3NDJA 1MVLA 2C42A 4HNAB 1O4WA 5JXHA 1JG7A 2J3EA 3P0EA 3AEQA 1FOEB 2VTDA 5BYKA 1EWVA 2DVMA 4JUBA 3UAYA 3B78A 3M7IA 1Y6ZA 1UKEA 3D8BA 2OXCA 3RHTA 5TVKA 3VC3A 3HEMA 4AX8A 4GW3A 1ZVMA 4AZ0A 1U6JA 3KLOA 2PTGA 1KIMA 3MBOA 3V33A 2QA5A 1E8MA 5E6SA 4D45A 1BFDA 1C4WA 2IPLA 1C14A 4J75A 5CA1B 5JAHA 3TGWA 3UHJA 3ITKA 4YAFA 5F5NA 3JALB 2ZAYA 1QRUA 3GLFE 1YRYE 1USUA 1ENOA 1A9SA 4EUSA 1PFYA 3L7CA 4W7IA 5HRCA 2YZKA 2KI5A 1KAGA 2UDPA 4C78A 4ALKA 4GLOA 1CK4A 3KHSA 1YR8A 3PJDA 4TTVA 3RLFA 2PFSA 3D0QA 4L0CA 3ZCSA 4DRYA 3GUZA 1TX4B 4PANA 2IBTA 3STWA 2A30A 4ZDWA 1PYOA 2KSQA 3G0HA 2OHOA 3NETA 4GQBA 1PT6A 3KTAB 3K1AA 3KLBA 1PCXA 4WCVA 1DP4A 2QQGA 1IVYA 3FPEA 3PJRA 3TLEA 4UQLA 4LNHA 3I5YA 2P77A 4EATA 1IK6A 1SQFA 3EYAA 1QO9A 3PC4A 4KIGA 1IWPB 2GLTA 2NAFA 3RYCB 3HJNA 1U80A 1L4LA 2AVNA 2QMZA 5CYGA 4WNCA 2PWAA 1DAOA 4OF4A 4OI2A 2ZZMA 1XUOA 1YBMA 4NDNE 3BRWD 4DA7A 1NMSA 3WMGA 4BMZA 1YRAA 1YQTA 2FETA 3DP7A 3P0HA 2XYQA 3QKSB 1VDZA 2PTHA 2QNIA 2YVLA 3NOXA 5D5PA 3SU8A 4CT5A 3L6OO 2WWGA 2ZRCA 4I4NA 5JADA 2YVQA 1W87A 3L84A 1NLZA 3FWYA 3U60B 2GN6A 3OEWA 3OQJA 5D86A 1XDGA 1RRCA 2YY5A 6NULA 2C3UA 3ECCA 2BONA 2W71A 5HM8A 4MR8A 2AZ4A 2AX4A 2WTBA 3ZHUA 5AUOB 2VPWA 2QLFA 3ZHRA 2DPHA 5EJ8A 3EZ7A 4HWRA 1F0KA 1GPLA 5AHOA 5EHXA 2CFRA 3QLUC 4URYR 3LIIA 3BQMB 4ZYWA 2QT9A 2ZK7A 2RK4A 3SYMA 3NP7A 5JNVA 5ALFA 2YZ2A 4MHOA 4QDTA 3PGA1 1OZ0A 4ABTA 3G17A 1OR8A 4QDOA 2XOKD 2X2FA 3FMPB 4B3SB 3PXCX 4HDNA 4TLEA 5AJWA 4PLZA 3C74A 1NONA 2CFCA 3FNFA 1W88B 1UC4B 2EX1A 2O7SA 3D3KA 3LSTA 1U3VA 2B30A 2GPAA 3CUYA 3L18A 4GZ3A 2NTNA 5TGTA 3MLEA 2Y6VA 4H1HA 3I30X 2DETA 3KP1A 2IZZA 4R2KA 2JLUA 2M98A 1UOQA 2OHXA 3LRXA 1XAHA 1T34A 1XALA 4LYJA 4Z2AA 3G7NA 4ONEA 4BYGA 4PZEA 4DLVA 2PR2A 4UUNA 3HR7A 4TKVA 5FTLA 1JFTA 1GTL1 5AJHA 3U49A 3T3OA 1W5TA 3QI7A 2WUDA 4Q3CA 4HFJA 5GQSA 2VRWA 4FGKA 1VYVA 4N8SA 4RSRA 4RETA 3U61B 1USGA 3RVKA 3EGOA 3FDXA 3DT8A 3ZCTA 4CKYA 1LA2A 2QDKA 4MA5A 1KETA 1B3RA 1PTKA 1G7CA 3QX3A 1XTVA 1IPEA 2PD4A 4N48A 3PT9A 4AI6A 3GYGA 4MWEA 3IKVA 4RGQA 5MHTA 3V00A 3OZAA 1Z8NA 4PCLA 2FWJA 2QTWB 4R9SA 1INLA 4TOIA 3JATA 3WJ1A 4YAJA 4B6PA 3NHBA 3RGWS 2X5XA 5IJAA 2V0GA 3VDXA 3UAOA 2E49A 2CXTA 3EIWA 1YK1A 1Y8QB 2FP4A 2NU6B 2PAFA 3UMBA 2X5NA 3PFIA 1EBBA 3UT5A 2O06A 3FAKA 1GFWA 1VI6A 4P2BA 4BDSA 2AXEA 4ER6A 5IWCA 4AKIA 3M8KA 3RB8A 2R7LA 3NTQA 3O9MA 3P0JA 1HLPA 4L3VA 3VPAA 3Q3EA 5BORA 1THZA 4NJEA 5HXAA 1QQBA 1QF6A 2C97A 1UFOA 3IA7A 3Q87B 4AJEA 4M1QA 3H13A 4H0NA 2QRQA 2CHQA 4F06A 1KP3A 1AU9A 1N5IA 1UEIA 2HA3A 3GEEA 3QPVA 3L6EA 4JSYA 3ZU2A 1GNQA 3ZVNA 5EPEA 3NM5A 4J6FA 4I5IA 3G3EA 2OZLA 1EQAA 4OHUA 3VOTA 2APJA 4JGBA 4KU4A 4MICA 3ZKWA 1PZHA 5HW0A 3ER9A 4L75A 2BFAA 1N4AA 2OV2A 3QE2A 2E1RA 5H70A 4C4AA 3VJLA 3VKGA 5F2EA 3KAQA 5EGNA 3H7IA 4R54A 3FLBA 4CF3A 4POOA 2ZT6A 1UKZA 3W5BA 3IOCA 4JQZA 4YS6A 1U7WA 3U0BA 5L4LA 2XMBA 4Q82A 1K08A 1FRQA 1F51E 1SA0A 2EBWA 2FX3A 2GKGA 4RHFA 4F4CA 4Q37A 2NP6A 1K7FB 5EWMA 1DUIA 1TM1E 4ZCQA 3ERCA 4H7PA 3HFJA 5AJZA 5J63A 3ANNA 3CURA 4I8IA 4FT4A 4LG1A 1T2EA 4BVJA 2H06A 2ZBEA 3DCJA 1P1BA 3DAYA 3K1JA 2H1LA 4HS9A 3WDSA 3R9XB 1I2ZA 4FQ7A 5CLJA 2ODWA 4XR9A 1YZVA 4ZK2A 1KFBB 1OAKA 3L4BC 2CXRA 2JI9A 2NG1A 2Q99A 3K0CA 4MB2A 3H83A 2W2NA 2RAFA 3ZHXA 2I4OA 1LW6E 2B83A 2HLDA 2B4AA 2WC1A 3O83A 3B1FA 2A0XA 4GSYA 3T15A 3EOAI 3LHSA 3WB0A 4DIUA 2C5EA 1LZKA 2JIRA 4BHTA 5LMCA 1TIKA 4PO8A 5BN3B 3NIWA 1LDGA 2XB4A 4KE6A 5B4VA 1UK6A 1OBOA 2LCFA 4YAUA 1QKJA 1TZJA 3PHCA 3TQCA 3A4IA 3HA2A 3HBAA 2N1MA 4CKCB 4ND4A 5AXBA 1WXDA 4NH0A 2ZRDA 3KX2A 3DC2A 5FL7A 3ZU5A 1D6SA 4CN9A 1I24A 4EG0A 1QOPB 5HCUA 5K03A 1X1TA 1TUIA 1X7WB </