4HB4A

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(537dltvk541/glceq)-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
209
structure length
209
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 59
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb4A00
1SGWA 3U3JA 2GZHA 1U0LA 3S1AA 1I2MA 2G0TA 8OHMA 1IN7A 2PCJA 5TY0A 4C0KA 2XAUA 1DOAA 4K46A 4NCJA 3GLIB 2ZRPA 1YZQA 1G7TA 3QPVA 3WHLA 4EPWA 3L43A 4ZKEA 2B8TA 1K8RA 2QAGB 2GDJA 3BGWA 1CJTC 1NVWQ 1IJFA 5KPDA 2RHMA 2WSMA 1RFLA 1JBKA 3OFNA 4LY6A 5AUQA 2O52A 3AGPA 1EGAA 3GLHA 1FX0A 4P0TA 4CEJA 2QRZA 1DTSA 1FQJA 2ZS7A 3AUXA 1LY1A 3FKSA 2FMXA 1H8HA 3LX5A 1VYUA 5G3ZA 3RDPA 1XTKA 1CJVC 1R4AA 2FEOA 1FMLA 3PEUA 4TMXA 4QNRA 4A9AA 4IDHA 2XZOA 3VNUA 2GXSA 1R0WA 1J7KA 4EDHA 4DBLC 3H86A 4LCBA 1KNXA 2F7SA 3FHOA 4GP6A 3THWA 4PHHA 4NYJQ 4AG5A 2PT5A 2MSDB 1CU1A 1LV7A 1YZGA 2C78A 3RS5A 3WYFA 4AYWA 4E07A 2CHVA 5K8UA 1JR3E 2ZU0C 3N5CA 4HDCA 2VTKA 4HEJA 4QHSA 4DEYA 4TMVA 5EZ6B 2ONKA 2OT3B 5AUOB 5JCPA 2ODEA 5KO2A 4A0GA 4ARZA 2LWIA 1F2TB 1ZW6A 4R98A 4AD8A 3J81k 1SXJB 2HF9A 4DSUA 2J7PD 4JLBA 5FR2A 2O0JA 3IEVA 2QM8A 1QHNA 1T3SA 1X1SA 1XEWY 2ZI3A 4OK5A 2VP0A 4DEXA 2F3RA 3FE2A 5JJLA 1UAAA 1NL3A 1W4RA 4K8OA 5EP4A 5BN5A 1LW7A 2HXYA 5E7IA 1TQ4A 2A5GA 2C9OA 2L0XA 2VSXA 4KSCA 1E99A 4E09A 2ATVA 4DCNA 1JAIA 1EXMA 5HKKD 4KU4A 2HDNB 1GTVA 1DAEA 3FHCB 1FZQA 2FX3A 3W5IA 3HWSA 3VFDA 2CCJA 1RW4A 1VKJA 1U0JA 4JBWA 2WSSA 1EFRD 2ZUBA 2HJVA 4HATA 4GDFA 3BXZA 3CRW1 3C15C 4HDQB 3IDQA 1KK2A 2JLUA 4XIGS 6Q21A 3UMFA 3I8XA 2DY1A 4G5GA 3GPLA 2ZI9A 3SHFA 3Q5DA 1KTVA 2FA9A 1P4SA 3SJAA 4OI2A 1R5NA 2HUPA 3T34A 1XF9A 1X86B 1KK0A 3RRNA 4JMPA 4QGAA 3RS0A 2J5XA 5G40A 5AJVB 3ZDQA 4A4DA 4L9WA 1XZPA 2FU5C 4TZ6A 1YRBA 4MYTA 1G18A 1P72A 1P9NA 2AFHE 3CONA 2O8EA 3AF1A 3T06B 1F60A 4GOJA 3PUVA 2WMOB 1ZU5A 1II8A 1U94A 4AI6A 2GEDA 1TL7C 2W6ID 1KGDA 2IXEA 4KCGA 4ZDWA 3U7HB 4NCIA 2PZGA 1EWRA 4QOSA 5FTLA 4QJ4A 2WKQA 1E9AA 2J3EA 3L2OB 1U9IA 4WIAA 5JEEA 2AXNA 4LZZA 5EE0A 3BD9A 3ZD6A 2PX0A 4HZIA 2QT1A 2GNOA 3ASZA 3SS8A 5DI3B 1Z2AA 1TF5A 1E9SA 3VR2A 2R9VA 4K81B 4KV9A 1A1VA 2AKYA 2R62A 5H70A 1TX4B 3CO5A 3WBKA 4KLNA 1YZUA 2HLDA 2V1UA 1RC8A 2ZE6A 2ZRAA 3R7WA 3EPKA 5SZIA 1T5LA 3VMFA 4A8JC 4LK2A 3IGFA 3B5JA 1NSTA 3SYNA 2H8KA 3RRYA 3R9WA 2AXPA 1V5WA 2BHRA 4YMSA 4ZPXA 4PC1A 2MMCA 4RFSB 4TYPA 4ZDJA 2ZE5A 3ZIAD 1JR6A 1MKYA 1JR3D 2IL1A 2O5VA 2V1XA 4EFLA 2X77A 4DXAA 3ICQB 4HLDA 3NWJA 2QE7D 3PITA 4TL8A 1LF5A 3QSYA 1E9EA 2DFTA 4YONB 3QKRA 4L5BA 4QL3A 2OCPA 1W46A 2KE5A 2IW3A 2KBEA 3LXXA 3NEJA 4TQUS 5KSPA 1X1RA 1HQCA 3DZ8A 3ZVMA 3RWOA 1DPFA 1E2FA 2QPOA 4C0QC 3H84A 2GF0A 4JKIA 2O0KA 2QY9A 3K09C 4ON9A 4XD7D 4MQBA 3M1IA 1LF0A 3DM9B 3E1SA 2QBYA 1QHHB 1QBKC 2ZR9A 4IVPA 4PZZA 2ZS9A 3NDPA 4HSEA 1TMKA 3VR1A 3AVXA 3IO5A 1XEFA 1W36B 1BOFA 4HYYA 4KODA 3OE7D 3NBXX 1XEWX 3L82B 3EZ9A 4AKHA 2W6JD 2F1HA 3EWSA 1ETUA 3FGNA 3BFKA 3LRPA 1G4UR 4ZKDA 4P33A 2ZSEA 5HE9A 1E2MA 3A58B 1DELA 3IIKA 1TUIA 4JYBA 4UJ3A 4DLUA 2ANCA 1Q57A 1NF3A 4ITRC 1KKMA 3A8TA 1XMJA 1Z06A 2V55B 2IUTA 5IRCD 1FP6A 1E94E 2GA8A 5KTYA 4DWJA 1VHTA 2DCUA 3OIYA 4JSYA 3SDZA 3IHWA 2O8FA 3FMOB 4LC0A 2FPKA 2JA1A 1XMIA 2VP6A 3CLVA 2KWIA 3THYA 2CJWB 4CEHA 2X8AA 3TK1A 1KDOA 2HCBA 2WVJA 2XOKD 4NHOA 4BFUA 3LBNA 1U90A 4RD4A 1E2PA 2Y8EA 3IQXA 4DB2A 1Q20A 1G8PA 2A5DA 3IKJA 4C2UA 3CB4A 1DBSA 5FPYA 4CW7A 4ZIRB 4XWKA 3RLFA 2E1RA 1FP7A 1KI2A 2X2EA 1ZUHA 1JPJA 3NHBA 4R9UC 1L2TA 3ADCA 2ZITA 4B2IA 2FSGA 3ZZTA 3DZDA 3PCRB 4C0SA 1CBUA 2BM0A 4YC7A 1KDRA 5L8VA 1EX6A 3UIEA 3GEEA 2JJ8A 3SYLA 2PCLA 2HCJB 3H0KA 1Q1BA 1W0KD 2JLZA 2D7CA 1VYVA 3AKDA 4GL2A 4QFMA 4TSFD 4RKEA 3EAQA 4Q7JB 4OJQA 2IEZA 1G7SA 3AVUA 1KAGA 1BH2A 2MSEB 3CZPA 4LJ6A 2C9CA 4JLVA 2WIAA 4URUR 3RVBA 1QG4A 3QXHA 5JHHB 4QBHA 4DJTA 2F43B 1IJEA 1GWNA 3U44A 4I1UA 5KNDA 2DHRA 4Q02A 4GMDA 3HU3A 1MV5A 4M0LA 3E5HA 5C1BA 2QMUA 2VP9A 1FMJA 4G3XA 1Z0IA 2EW1A 4GP7A 4O2LA 2VHJA 2ZU6A 1KY3A 1GUAA 2ZR0A 2VHQA 2H7VA 4B3FX 2GVZC 4GNKA 5FOWA 1Q1QA 3KX2A 1W44A 1JNYA 3L8YA 3K70C 3I72A 4JSTA 1BKDR 2BMEA 4JL8A 4UKDA 1NLYA 2BBTA 5D3QA 3KJHA 2RGDA 1GG2A 2DWOA 4UJ5A 4NONA 2Z4RA 2YJTD 1XJ0A 3X1XA 2ZE7A 3NG1A 1N6HA 4NMMA 3BB4A 1G6OA 1SULA 2NZ8A 1NJGA 4HUQA 5D3MB 3KQUA 5KDOA 1G8YA 1FOEB 2GXQA 4QJ3A 1T8UA 4FWTA 1D8TA 1R2QA 4MDFA 2YKGA 2HYIC 1KJYA 3QXXA 4LHYA 1I4TD 3CR8A 1GDDA 1XD2B 2W2VA 3L0IB 5K8IA 4L4UA 2V7QD 1GKYA 2C98A 3OIWA 3TE6A 2NO7A 1P60A 2K5UA 2R6GA 4FMBB 1Z28A 2C95A 1KZGB 3NBYC 1E0JA 5J4VA 4MITA 1U8ZA 2WJJA 3TAHA 5KSZA 5CK4A 1CR0A 2IYLD 4IFEA 621PA 4P4UA 1OKKD 5IK2A 4WXRA 4NYMR 1LFDB 4Q4AB 2ZSDA 1W48A 4YLGA 1R5BA 4KI0A 4BFVA 3SJCA 3DOEA 3TSOA 3KQKA 4HB2A 2YOFA 4XOIA 3WMGA 4GZMA 2C03A 3SJZA 1JJVA 2I1VB 4BRUA 1U99A 421PA 1IN4A 2QP3A 3AQ4A 5AK0A 2CLSA 1OH5A 1NKTA 2NO9A 3DEFA 4PO9A 5H8WA 4H1VA 3PEYA 2HJGA 3UMRA 4A6PA 1AQYA 3QKUA 821PA 1MRNA 2IA5A 4M21A 1A2BA 2A9KA 2IF2A 2OLJA 1RRPA 1XTIA 5EP1A 5CDFE 5GADl 2XJ4A 4TQ9A 2XGJA 3K0CC 5JLJA 2B7BA 2JDID 3B1VA 2FPMA 2ZRBA 2QQEA 2IHBA 4P4SA 5CK5A 3RS2A 2WIBA 3KQNA 2V54A 3KFXA 4BEBA 1LTQA 1AGRA 1TQ2A 1Z2CA 2J59A 3ND8A 3QE0A 3QXSA 3CZQA 4B34A 4BRWA 4BZPA 4I99A 4DT1B 4GI7A 4RY2A 1KI8A 1NRJB 1ZNYA 2ASEA 5EXTA 1ZC3A 1TEXA 3FFAA 3C5HA 4MRRA 5ANRB 4ZO4A 2NPFA 2J0QA 2V6IA 4XTCS 4M1SA 1PLJA 2RGNC 2FV8A 1E2IA 2G83A 4JKYA 3EX7C 1Z3IX 5JJIA 1NKSA 5AUPB 4D0LB 1V43A 5GJVC 4PHTA 4IDPA 2NO1A 3T1TA 3B6EA 3NBZC 3AVQA 4G5RA 4KBFA 3GEIA 1E2QA 3X2SA 1O3YA 1H8EA 5CLLA 1RE0A 2IUSA 1NBMA 1JPNA 1ZD9A 1RKBA 2VHCA 1P9WA 4RD3A 3ZH9B 1IBRA 1JXMA 2VL7A 1T0HB 4IEIA 2QAGA 4L15A 5FTJA 2IK8A 2Q3MA 1KK1A 4F38A 4B3CA 2O8BA 1OFUX 3TIFA 3V4RA 2PEYA 1Q0UA 1GITA 4JVNA 3B85A 3CPJB 3EC1A 3NTUA 4L16A 2NO0A 2ODWA 4Q4JB 4RZXA 5EE9A 2NQ2C 5EE1A 4CEIB 4HAYA 2IBMA 3GJ6A 4LWZA 4LC1A 1B23P 4LYAA 4PAQA 2P67A 1ESNA 3W5JA 1OPXA 2OFOA 4IXMA 4ACAA 2J0UB 2RAPA 2VEDA 1FQKA 1N0VC 1AN0A 1VDZA 3TW4A 1M74A 1AM4D 2RGEA 1QZXA 3AP2A 1P75A 3I5XA 1HQYE 3CX6A 1U8AA 3BS4A 5FL7A 5IDVA 4BFSA 3U7EB 2ZRLA 1FL9A 5CM9C 1GOTA 1GL9B 1UEIA 2BKEA 3C41J 1VHLA 1SXJA 3IPXA 3U6BA 1F2UA 1SHZA 1KSHA 2PX3A 3DKVA 3LD9A 2EWVA 1KNQA 4M8NE 3R9IA 2W58A 3DO6A 3LVRE 4DCTA 4D81A 2FG5A 4OQNA 3TVDA 3NH9A 5EJEA 2GAAA 2VO1A 2ZS8A 2O8DA 1M34E 4KSBA 3TH5A 2QSYA 3BH6A 1W2HA 3G0HA 2FWRA 5CJ2A 4X8OA 3W8RA 3GLHE 3ADKA 3GJ7A 3PUXA 1E79D 4LYJA 2GXAA 1X6VA 5FBWB 2E87A 1CRPA 3GCGA 3WNDA 1WMSA 3T35A 3UANA 3REFA 4MGIR 1IXZA 4DSTA 4JLDA 4DZZA 2ZAOA 1ZMXA 2CHGA 2H57A 1BIFA 2VIIA 2ZREA 3QNUA 5KOYA 3FOZA 3A4NA 4NCKA 4YXWA 4M9XA 1VYTA 2OO7A 2BWJA 2GWHA 3MJRA 5GJCA 3CWQA 1I4DD 1G5TA 3CBQA 1FPMA 1ZD8A 5EE5B 3K0AA 4A6XA 3LWNA 5IT5A 1MOZA 3EASA 3K9HA 3A4LA 3QI2A 5DISB 3RWMB 1OHHD 4XTRA 4B76A 3AVVA 2JLSA 4ZCIA 4Q18A 4B3XA 5DIFA 5ELXA 1QVAA 1HTWA 1KJZA 1Z0JA 1ZRHA 2ERYA 3AB3A 3I92A 3KKQA 3L0PA 4M9SA 1KK3A 4FI3C 4PQFA 3MMPA 1FUKA 3OEHA 1QDEA 3U4QB 2A7QA 2P5SA 2H5EA 2D7DA 4UQOA 4A8JB 1MR3F 3GJXC 2ZVPX 2FGKA 4DLYA 2FNAA 4RD2A 2XB4A 1M7GA 1NY5A 4QGGA 1GRNA 1C1YA 4DLXA 1OXTA 4MRNA 1Q3TA 1XTSA 1YZKA 2NZJA 2H1LA 1KSGA 1DS6A 2PJZA 4Q9IA 2G0NA 2ZUDA 4GBMA 4AK9A 2IS6A 4TYQA 2IT1A 4M53A 3ND9A 1D2EA 3OAAD 4MKFA 1I4LD 5DI3A 5KDDA 3W6PA 5B58C 2VHUA 4QBIA 4JLJA 5JRJA 5JWRA 1KOFA 3RNLA 3C8UA 1W36D 4C7OB 3MGCA 3VTKA 4DDVA 4D4KA 1GVNB 3I4LA 4RVCA 3RHFA 3T61A 1N6IA 2Q3FA 2J0SA 3VNVA 4LBWA 1L4UA 1P61B 4Q1BA 4ACBA 1T6NA 3RS7A 1GNRA 1NP6A 4HUTA 4ASUA 4CGZA 4EPYA 3CKLA 4C3ZA 1PLLA 3Q5EA 2IS2A 4OI0A 4M22A 2VQSA 4GZLA 2CLDX 4XWAA 2CNWA 4OKSA 1K5GA 2WHXA 4NH0A 1T3LA 1U98A 4F7WA 3D8BA 2JGNA 2QG6A 1Q12A 1U9IC 1ZM7A 4W5JA 1EG7A 4LV6A 1ZUNB 1W4BA 4JVSB 1JQLB 2DFLA 3ZZUA 2DB3A 1WDTA 4JS0A 3PXGA 5EXSA 3U3RA 3P20A 1N6KA 2FF7A 4IDNA 4PPFA 2C5LA 1G21E 5FL3A 5TARA 3SBEA 3WMFA 1KI3A 4Y0AA 3ADBA 4QC2A 1II9A 1UDXA 1E9BA 1GZSA 3CRQA 4QGFA 4DDUA 4XVUA 1OFHA 1AA9A 1X8LA 3B9PA 3RRMA 4V0KA 4B33A 4EFNA 4AY2A 1KHTA 2GK6A 2Z83A 3VKHA 2IUUA 3RABA 1IN6A 2G6BA 3M0EA 2FEMA 2QAJA 3MSXA 3FHTA 1HUQA 4HLUA 1Z6XA 3X1WA 2FPLA 1U2RA 1VCIA 5J40A 1GIAA 1S1CA 3EZ6A 4A92A 2RCNA 2ZSBA 3CF0A 1JAHA 4R2IA 3UMSA 3QENA 4R2HA 4L9SA 1U0HC 5JWHA 3M6AA 2GBLA 1KKLA 3A1UA 1N0WA 1ZM2A 2JATA 2HEIA 2WAXA 1UADA 2CJWA 1UKEA 4EAQA 2GJ8A 2N42A 2REOA 4MKHA 3RS4A 2BEJA 2ZRJA 1ZUIA 3VQTA 1T91A 4BEJA 4NKRA 2R8RA 1KIMA 1LB1B 2RGBA 1NMZA 3RC3A 4ZIRA 3H1TA 5AUNB 1SKYE 1ZNZA 1G291 1TU4A 3VR5A 4G5SA 1XDBA 2G1KA 2IYUA 2A5YB 5EP2A 4FMCF 5JSZB 4H9GA 1JEDA 1RRGA 3U6KA 4FCWA 3SZRA 1SHKA 3EPLA 2G88A 1FW6A 4EJSA 1Z22A 3KXIA 2IXFA 3EPJA 3K0FB 3ZS9A 1KI6B 3SNHA 4BZXA 4O3MA 4I1OA 4Q4HA 2ZRFA 1IXSB 2JAQA 5TMPA 4Q7LA 3WP1B 2KSQA 2VPPA 3LQQA 4LV8B 4WZ6A 3TUIC 3WNBA 1XU4A 2OILA 1G20E 1YQTA 2X2FA 3IO3A 3O47A 2WSSD 2ZI6A 4DKXA 2ZM5A 3DOFA 4Q48A 3K70B 2N1BA 4KYUA 2LCFA 2ZYWX 1E1RD 2DPXA 3MWJA 5B57C 2ZANA 2WV9A 3BK7A 1OYYA 1QRAA 4EPTA 5HZHA 1G7CA 121PA 1T4GA 3KZ1E 3TAUA 2F43A 3SQWA 5B2ZA 2WJIA 3B1XA 1D5CA 1VCNA 3CF2A 3VX4A 1IQPA 3BWDD 1XCGB 3CNOA 2VYFA 2GESA 1SVOA 5GVRA 3TRFA 3BH7A 3ONWA 3Q3JB 1US8A 1R0YA 2QMOA 3TUZC 1A7JA 3TSWA 1E2DA 2YVUA 2SHKA 4BQSA 3CH5A 1PZNA 2DR3A 1CP2A 1YJ5A 3SFZA 2EQBA 2JEOA 4PSKA 4F91B 4DB4A 4B75A 2J7PA 3E2IA 4JJKA 3O8CA 3WHKA 1EK0A 3MWLA 3B8HA 3GP8A 2QPTA 4PX9A 1SVLA 4KYIB 4RSGA 1Z6GA 1S96A 2C96A 4JBYA 4B32A 3PUZA 3CIOA 1YRAA 2A78A 4Z8YA 2PL3A 4W7SA 1TNDA 1WP9A 2GJKA 2RGAA 4HAVA 1XCPA 4CF7A 2HLDD 2XXAB 5CB6A 3Q9LA 3MWYW 5CITA 1MO5A 1T5IA 1HE8B 2Z0MA 5HKKA 2FFAA 1ZINA 4MGKR 4LJYA 1QF9A 5FUYA 4KFSA 4F92B 2WBLC 1EFRA 3REGA 1AGPA 3IPYA 3P26A 4PQYA 3B2EA 4V0ME 2WJVA 2QRNA 4LI0A 2Q9CA 3ASYA 1G4AE 5DLQC 5LBIA 2QSZA 2BIFA 4MUBA 3JVVA 3GD7A 4JL5A 3QF4B 2OESA 3U5ZB 4MKGA 1GRQA 1KY2A 1M7HA 2QTHA 1XRJA 5HPYB 2WZQA 1VG9B 3HYTA 4FW9A 3VR6A 1OXSC 2AWNA 4DUGA 3DDCA 1JALA 3PUWA 2F55A 2AK3A 2ZJOA 2BMDA 2YWEA 3AF2A 2O8CA 2GCOA 3OEEA 4JLOA 1J99A 1Q1EA 4Q9KA 4GFDA 1E2HA 3BE4A 1GILA 4Y0VA 5JBQA 4Q1EA 1X3SA 3UG6A 1W4CA 3KTAA 1OB2A 1CIPA 1G5PA 3NKVA 3JVUA 1G16A 2W6IA 3QVVA 4Q7MB 3AVWA 1Q44A 1S9DA 1T3HA 2CEAA 3O8DA 1NMYA 3K9LA 5BYJA 4EQ6B 521PA 4MDEA 3NDBB 1L7VC 3QUSA 5BN4A 4DT1A 1AKYA 1YR6A 2FSIA 1ANKA 3D3QA 2RH5A 4IFBA 5JJKA 2B8WA 1XP8A 3KB2A 2KB0A 2PH1A 1ZM4A 3C7KA 2YC2C 1FFHA 4B71A 3LW8A 4BFWA 5BXQC 1ZJ6A 3MD0A 1OXUA 2QP4A 5L3SB 4LYHA 3TGPA 3CRVA 4LHWA 1ZIPA 3F3YA 4LPKA 2ZRNA 3GLGE 2IYRA 3GLFB 2VSFA 4JT4A 4TL6A 2EFHB 2WJGA 5JECA 1ZU4A 2WJHA 2AD5A 1UBEA 1KO8A 4QHTA 3KXLA 1G17A 2HT6A 2C99A 4UNSA 2ATXA 3U3KA 3ZIAA 4BLRA 1JR3A 1T0JB 2QE7A 3ZYCA 1NIJA 4GMXA 1OT3A 5JS7A 1HA3A 2GF9A 1MABB 5FTKA 3NHAA 2ZTSA 2IYQA 3NH6A 1YR8A 4UNPA 2WICA 3S1AB 5C4MA 2YOGA 5KNCA 2OFWA 3CRMA 4OI1A 4Q21A 2NG1A 3U61B 1ZVQA 5L3QB 5BWMA 4LJ8A 1DAIA 1QHIA 4UXJA 1GRRA 5TV2A 1N5JA 4QBGB 1XD9A 3D31A 1DVRA 2YOHA 1ZM9A 5DO9A 2WWFA 3MG9A 4XD7A 4M4SA 4YDHB 2QZ4A 1E32A 1R0ZA 3NC0C 1MT0A 4Q4JA 4M1TA 5DHAA 4TMWA 3GLHB 1FX0B 3A1SA 1VCMA 5CLQA 1YHNA 1XEXA 3TUJC 1TF7A 3U3MA 5A4JA 2GJSA 1R5OA 4GRAA 1UDWA 3UWOA 3KFVA 2RB4A 3TR5A 4MH0R 2F9LA 4C2TA 2VHTA 2Z5FA 5EZ5A 1NLFA 2XNDA 5HR5A 3QJYA 3FVQA 3LLMA 1Z6YA 2I4IA 2R6CA 4GSYA 4LV5B 1D6JA 1KAOA 4BLOA 3GEHA 2OUKA 2QAGC 4IVQA 1E9FA 1KI4A 2KI5A 4HDOB 3AVOA 1GKUB 1JB1A 1NBME 3NC1C 2KBFA 2OZEA 3C4JA 2AD1A 1ZM3A 4TTPA 1S0UA 4PTLA 4EPRA 3T5DA 2XOKA 5FBQB 3VR4A 5FOTA 1ZCAA 2GAOA 1IM2A 3P4YA 4LOAA 1CR2A 2IYZA 1ZP6A 4NE2A 2VA8A 4KLZA 2ZSFA 3B1ZA 3QKSA 1P2VA 2IYYA 4OHVA 2JIZA 2Q9AA 3AGQA 3GFPA 4DLVA 1CTQA 4OK3A 2ZROA 1F48A 3Q8XB 2B6HA 1S9HA 3RRZA 4A2PA 2P6UA 3SEAA 1G3IA 2QGNA 1RRCA 1W1WA 4URZR 4YMWA 1G7RA 2VP4A 4F93B 1Z29A 1M7BA 4B6FA 3WP0A 1JQJC 3OZXA 2CE7A 1G8FA 1YZLA 4MA4A 4ESHA 4DIDA 1SXJC 1P3JA 1W0KA 2R6FA 1JECA 4TSFA 3TR0A 2OG2A 2HXSA 4LJ7A 1R8SA 3TW8B 4JIMA 3UG7A 1YR7A 1G1MA 1KMQA 2XSZD 4OK6A 3GFTA 3KL4A 4TT3D 4A0RA 2JCSA 1N5KA 4BLTA 1JJ7A 1NI3A 4D25A 2B7CA 3O8BA 2D4HA 1MO4A 2ZUCA 1CRQA 4WZBE 2WPDD 4YDSA 1OH6A 3LLUA 3HPQA 2W2XA 3KKMA 2G77B 3T1QA 2JJ2A 1P62B 3SYKA 1XPOA 4JLKA 2YZ2A 2FDCA 1NVXQ 2XEXA 3B78A 4KO8A 1VECA 2O8EB 2BVNA 1CULC 2BBOA 5FUWA 1N25A 4QJ5A 4Q9HA 1EESA 5G53C 4A1FA 2EYUA 1II8B 2ZAMA 2J41A 4B43A 2D3WA 2UZ3A 1WCV1 2ZYUX 1WXQA 2CDNA 1COWA 4URWR 4BUJA 2JASA 4D0GA 4DRZA 3Q72A 3I62A 1BS1A 3QPUA 1NN3A 4XVQA 3HR8A 2A5JA 4C7OA 5CB8A 1RJ9A 3QQ5A 4MRSA 1N0UA 2AKAB 4QKQA 1TADA 1VMAA 3KUDA 3C14C 4B6EA 3THXB 1TQDA 1O87A 1N5LA 1N6OA 2JJ1D 4AWXA 2IC5A 3NEYA 4CYMA 1ZBDA 1N5IA 3IBYA 3R7WB 3VU9A 4TL7A 1NVUQ 1YE8A 1DG1G 4IOKA 5A0FA 3ZD7A 1OFTA 2CXXA 1UBGA 2GJ9A 3L0OA 4TLBA 3FMFA 1E0SA 4Q9JA 4ERNA 4D80A 2DBYA 4TMTA 5KYKA 4YQFA 1A4RA 1NBMD 3C5CA 4B48A 4RD1A 1XFAA 4PSAA 2NTYC 1D2MA 2X1VA 1BMFA 2BJWA 1E98A 2DFNA 2V4ZA 3H4MA 3PG5A 4ZDIA 4BFXA 5J5CA 4ZI3A 1UM8A 1L4YA 5EUQB 1E3MA 2Q21A 1ESMA 4D6PA 4I4LA 2WWYA 4RCYA 4TLAA 1OF1A 2ZJBA 1DG3A 1SKYB 1HY3A 2EFCB 3CH4B 5A5GA 2RGGA 1GM5A 3IUYA 1PUJA 1VIAA 4TN1A 2CK3D 3KJGA 5H68A 4CT5A 4BFTA 4QNMA 3RS3A 4ZCMA 2J1LA 1N6NA 4XJXA 2J0VA 2GCPA 2JDIA 2XTZA 3VR3A 3GLIA 3FTQA 4WBSA 3AM1A 2IYTA 4A0HA 2LKCA 3P4XA 2WTUA 4LRWA 2F1JA 4TYNA 4E03A 4OJKA 1KSFX 5EUMA 1XXHE 1P73A 3UXMA 1R8QA 3K70D 1DAFA 1GSIA 4RCZA 1IHUA 4FINA 3W6NA 5E3HA 2RKOA 5DSZA 3WYGA 4LJ5A 2W0SA 4NYIQ 4PC2A 4G01B 4IHQA 3KQHA 3Q7PA 2IWRA 2FH5B 3N2EA 2GEUA 4PANA 3OF5A 3I61A 2H16A 3GLFE 4OHWA 3GMTA 1N6RA 1SVMA 1TTTA 4BECA 4CEHB 2IYVA 4TTRA 5FPKA 2FE4A 2FSFA 2QP9X 5JSZA 1UFQA 1VIYA 3MWKA 4B44A 2F1IA 4MUAA 3KQLA 3QIAA 3VHLB 3ZZ0A 4DDWA 2PLFA 2ZRMA 3AKCA 1F2TA 3K0FA 3B82A 4FXPA 1E0AA 2ZI7A 4GOXA 1CR4A 4HLUC 1P5ZB 1WF3A 5F2EA 1MRSA 4W5WA 2Q9BA 4UNQA 4EPXA 2OXRA 1E2KA 1X8JA 1NVVQ 4KBGA 4O25A 2QA5A 4M9QA 5GJBA 1ZCBA 3FWYA 4YXWD 1ZNWA 2GBLC 3EIQA 4MRPA 3HDTA 1N2CE 1RIFA 1F6BA 5AJWA 1G6HA 1LVGA 1Z6AA 1NG9A 3IIMA 3RSOA 2BKUA 1S3SA 4ZV4A 3P27A 1II0A 2Z4SA 1G8HA 2ZRCA 2BCGY 3FDIA 1SQ5A 1M8PA 5FTNA 1SVKA 4HAXA 5HE8A 2ZRHA 2Q6TA 1Z6TA 1UKVY 3KXKA 3FMPB 2NMVA 4LJ4A 4V0NA 4Q66C 4Z1MA 4YMVA 2CVFA 3VX3A 3U44B 1OE0A 4EJSC 4S35A 3OEHD 5J47A 1Z5ZA 5AR1A 2QU8A 1SVWA 1TPZA 2UVQA 4BLQA 5KUTA 2ZJ2A 3D6TB 4A0FA 4B3DA 5JCZA 1IOZA 1DARA 4DLSA 5B30A 2H18A 4N0DA 2H92A 1AKEA 1GL7A 4UNRA 3WMEA 3FB4A 5FOVA 1E6CA 4BPBA 5DGXA 2IYSA 1L8QA 1A82A 2BMFA 4A15A 2ZPTX 1JI0A 2PEZA 3MAAC 3HR7A 1CEEA 2OLKA 3OIVA 5DN6A 4TZ0A 5LB2A 1UJ2A 3W8NA 2ANBA 4AC9A 2J9RA 3HU2A 2C04A 2XXAA 1XD8A 4HUQB 3LH5A 1HURA 3W9YA 2E9SA 2RMKA 2MSCB 4C0AC 4D4JA 1E9RA 3QXJA 2WWXA 1Z63A 1QHYA 3PJRA 2IS1A 2CCGA 5FBRB 1OXXK 3F5FA 1VG1A 3EZFA 4QM7A 3T12A 3SI7A 5F9FA 1G19A 4ASUD 3IIJA 4EKDA 3AP1A 2CMKA 1SKQA 2DWPA 4LPSA 2GEVA 2QI9C 3EIEA 4PC6A 1YZNA 1MO3A 1OIVA 2WMNB 4ZCLA 5F98A 4DIEA 1FUUA 2P0EA 1KDTA 4XWOA 4WXPA 4L8GA 4Q1AA 3W34A 4JLAA 2J45A 2I1QA 3GLGB 1GL6A 4URYR 2C77A 1S2MA 4RFSA 2ZRIA 4DHEA 3TMKA 3Q7QA 3A37A 5UKDA 2JLXA 3PUYA 4UXHA 2AL7A 2GVDC 3R8CA 4ESVA 2D74A 1E1QA 5AJXA 1C9KA 1W0JA 4KFUA 4RJLA 5SZHB 3WNCA 1DAMA 1NJFA 3BFXA 5KNBA 1P2UA 2BCJQ 4OQXA 3SE0A 1S8FA 5AJZA 1Z07A 3EC2A 4PO8A 1BYUA 4EQ6A 1EFCA 2QUZA 5JFGA 3EZ7A 2P6NA 1NLZA 2ZXUA 4F4CA 2DYKA 4D82A 3G5UA 1KI1A 4P4SB 1E9CA 3OAAA 3LA6A 2EFDB 2YNMA 3OFND 5FOUA 3ADDA 2JLQA 3I3SR 5FPTA 2QEQA 1QHHA 5DHFA 2LKDA 2GZAA 1ZC4A 1M2OB 3KJIA 2FN4A 2EU8A 4OI4A 5L3SA 2IYWA 3NVAA 2VBCA 3FKSD 1OW3B 4DVGA 3VKGA 1H8HD 1G8GA 4OL0A 3U7GA 5E7MA 3LX8A 1NSFA 5JMTA 4QHYA 2OHFA 3K1JA 4UNNA 5BYKA 2VH5R 2DFKB 4FWIB 4AKEA 1YKSA 1EX7A 3LY5A 5AJYA 2GCNA 3I8SA 3PV0A 1TAGA 2ODBA 3B1YA 2AK2A 4IEEA 1TUEA 1XTQA 1RYFA 1ONBA 2A3RA 1DADA 3AVYA 3W6OA 1E2NA 2AFIE 5J4YA 3MUFA 3LNCA 2YWFA 2VF8A 1OLOA 3A1TA 4PO1A 4Q5IA 5J4HA 3ZVNA 1Z0AA 1VTKA 1KMHB 1J70A 4Q47A 1UBFA 5L3QA 3TLXA 1GAJA 4M1MA 3EA5A 3BJIC 4OQMA 3B60A 4LHZA 1EFHA 4TMKA 4EFMA 3HYRA 3N70A 2H17A 4JZKA 4G5QA 5M04A 2IEYA 4LJ9A 2O8BB 3EW9A 3P32A 2CL0X 4AKGA 1S3GA 2Z43A 1CJMA 4PZLA 1TEVA 5F3WB 2YYZA 2IWHA 4AYTA 3BBPA 5LD2C 2ORIA 4Q1CA 2NGRA 5P21A 4B3BA 3K53A 1E96A 1U8YA 2R65A 5KPJA 3ZQ6A 1D2NA 2ZRGA 1ZD1A 2GKSA 4IRUB 3TSZA 5B64A 2ZJYA 3B7GA 4W5HA 2QT0A 1S1MA 2W2TA 1HT1E 3H2YA 1E2LA 3WRYC 2GXUA 2ZEJA 4IOMA 2D2EA 3QVUA 3KB1A 2ZJAA 3AVPA 1HH4A 4ILEA 4PHFA 1FTSA 3X1YA 2GJAA 2VSOA 3A36A 1T9HA 5EXXA 2XITA 2FGJA 2OE2A 5DE3A 1UKYA 1E9DA 2W83A 1F2UB 2IHYA 2JLRA 721PA 5K8TA 4NCNA 1TF2A 3U7FB 2P6RA 1VPLA 3ECCA 2GK7A 3DL0A 2A5FA 1WQ1R 4MYHA 1IAQA 2O8DB 4Z51A 2IXGA 4JYCA 5DNYB 2HYDA 5KDLA 1PV4A 3PENA 3N2IA 1IXRC 1Q21A 1QG2A 3PR1A 5TVKA 2BEKA 4JVLA 4LHVA 4YMUA 4TQAA 4AG6A 221PA 2XB2A 3V00A 4TLEA 3LW7A 5L3RA 3QY0A 4MGYR 5KHOC 1OH7A 4BFYA 3TQFA 1E69A 3JZAA 1QHXA 4JL6A 2GRJA 4DCSA 4HZUB 3KDSE 2GHIA 4A82A 4TYYA 1OYWA 3UWKA 2G9NA 5D3MA 4AIIA 1XTJA 1E1RA 2YHSA 1KSJA 3CW2A 3FKQA 2PZEA 4C30A 3KKNA 3U3OA 2BOVA 1AQUA 3K0AB 3SFVA 5BN3A 1ZIOA 4F4JA 4Q1FA 1XD2A 3SQXA 4PFSA 2FOLA 1RZ3A 4IOJA 2PJRA 1PUIA 4RD6A 3T1VA 3NXSA 2OCYC 1F3OA 2V8OA 2FZ4A 1EFTA 2BJVA 2RGXA 5CIWA 3HPRA 4Q00A 3QKTA 4KXFB 4DUGD 5J4KA 4B3GA 1N6LA 1Q1ZA 4PQRA 2D62A 1QHGA 3OEED 3GJ8A 2N46A 1XCMA 4WAUA 4WVFA 1R10A 5TXGA 2BV3A 3RYTC 2PBRA 4Q4AA 1BYIA 5JEDA 4O2RA 3SC3A 2A30A 2VLIA 2ZIAA 4IOLA 2ORVA 3PVSA 2GTPA 4A2QA 3TKLA 1CLUA 1OV4A 2CBZA 3GJ3A 4B74A 3ZS8A 4OBEA 5TB5A 3R9XA 2P65A 3SOPA 4N0EA 2NPIA 1KDPA 2RGCA 3LO5A 1R7RA 3CM0A 4MGZR 4MYCA 5G41A 2HT1A 2REXB 3DM5A 3HU1A 2AHOA 3C16C 4DC9A 2EVWX 1XWIA 5E4FA 3THXA 4UXIA 3KKPA 4Z54A 4OYHA 3KUCA 2D2FA 5FI1B 1AZSC 2ZVQX 4U00A 3BERA 2EFGA 1Z83A 4WA7A 3DMDA 1G9XA 4RZ3A 4MYUA 1IY2A 1JXOA 1J90A 1T8TA 2R6AA 2WOOA 2XTMA 4US1R 5FI0B 4CEJB 5FPHA 5FTMA 3LVQE 3WYAA 2CHQA 4HLQB 2EFEB 4D0NA 1XXHB 3BORA 5TDHA 5DYIA 1HEIA 4PXAA 2FSHA 4D26A 1GNPA 1Q22A 1NNEA 2ZR7A 1Y3AA 5L3VA 4QXAA 3SJBA 1VG8A 2CL6X 2QTFA 1XX6A 3DKPA 1EWQA 5CM8B 5SZKB 4P32A 4WZAE 4N1AA 3LAWA 3L0SA 2OAQ1 2J46A 4KVAA 4NBSA 4WOPA 3GJ4A 4JLPA 3DVLA 3LDAA 4NDZA 4RKFA 3RANA 2MMGA 2BC9A 1AS3A 4CDGA 4AURA 1FNMA 1AS0A 1UEJA 3DPUA 3EARA 4ABYA 4LSGA 3I1FA 4E22A 2XTNA 3AF3A 4B47A 3IEUA 4M1OA 1CR1A 1W47A 2QQ0A 5FPSA 1OB5A 4OHYA 4CVNA 5FFMA 3AKYA 4XSGA 2D06A 4QG7A 5LPNA 3R20A 2XNDD 3U60B 2F6RA 2VP5A 3W3AA 2YWHA 3EA0A 3B1WA 1NMXA 2ECKA 2JLYA 1KZ7B 3CPEA 4POAA 1E2GA 4EPVA 2QMHA 4D4MA 3T15A 3EIHA 3PFIA 3EWAA 2ZETA 3WXMA 1H65A 4C0BA 4V0OA 1K6MA 5C46F 4CEIA 1WA5A 3K9GA 3OE7A 3A1WA 2YINC 2YWGA 2B92A 2HV8A 2OSBA 2ZJ5A 4FCTA 4FD2A 4C9BA 3BH0A 2IS4A 2CCKA 5JZVA 2J0UA 2QNRA 2W6JA 3LBIA 2TMKA 5K8LA 1G41A 2ZI5A 5KSOA 1CKEA 4IW3B 2YV5A 3BAFA 3DHWC 1IY0A 5JI2E 4S2EA 1OXVA 1B0UA 4M1YA 4PC7A 1WB9A 4EIWA 5DH9A 3THWB 4IVRA 3PIRA 2GZDA 3EG5A 4G0NA 4KJZA 3U2QA 3AV0B 1W2GA 1P7CA 1S4QA 4HI0E 4U7DA 1DEKA 3QXCA 4BE7B 2JIZD 3AEZA 3VHXA 3BOSA 2NIPA 4RFVA 2BBWA 2XZPA 3CPHA 4X8LA 4EJSB 1CJKC 4DDTA 4N3NA 3GLIE 2Q0HA 4ARZB 2VP2A 4Q4HB 4C0JA 1Y63A 3TBKA 4IJMA 4PC3A 1YZTA 2J87A 3OIUA 1JEEA 2X19A 3CX7A 3QF7A 4HB0A 4PPGA 3UPUA 4M1KA 3GJ5A 2OBLA 2I3BA 1Z0FA 3WBJA 1PVOA 4R7ZA 4BGDA 3X1ZA 2B21A 4JT2A 4BWYA 4RZ2A 2JLWA 5HZKA 3RC8A 2F9MA 1E4YA 4XVRA 2AWOA 2UKDA 3QG1A 4IDOA 3SHWA 4BLSA 4V0MA 4NU0A 4TL9A 2J7KA 4CIDA 5JS8A 1Z08A 1DAKA 4ZI2A 2EYQA 2JJ2D 5FBVB 1ZYUA 1RVDA 2NOAA 1OFIA 4ZDKA 1US8B 1QHSA 3CUEF 1ZNXA 1W5SA 2BM1A 5IK2D 3V4FA 3NBFA 4BASA 4TLCA 2ZJZA 3KJEA 4I1VA 5FOXA 2O0HA 3BRWD 2VRWA 2PMKA 2IYXA 1SXJE 3Q85A 3X1DA 2NO6A 2QM7A 3CWZA 3K0SA 1CS4C 1AJEA 4M1WA 1NN5A 1COWD 2OCBA 1W4AA 2C8VA 4FN5A 4PZYA 3U4QA 1C4OA 4A8JA 3VKWA 4C0LA 1E2JA 3AKEA 1E2EA 3WY9A 1SVIA 1NIPA 3NIBA 4QGHA 5G3YA 3UATA 2XNSA 1KI9A 3MFYA 3T1OA 3B13B 4HB3A 4F4IA 5F9HA 3K8YA 1F5NA 4NYIR 1WE2A 1KYIA 1FTNA 2PMDA 4PAOA 2ZJ8A 4XH9B 2QL6A 1IONA 3I5YA 4RD0A 2A2ZA 4LX0A 3ZQJA 3RAPR 3AF4A 2CVHA 5JRZA 3THOA 4KFRA 5EE3A 4B73A 3AUYA 3QEJA 4U02A 2OEPA 4EUNA 3CNNA 2WKRA 4G5OA 3K09A 3ZGXA 1YU9A 3G82C 3OESA 4WW0A 3GLGA 1Z0DA 2XSZA 3LXRA 1Q3HA 1BMFD 4TT3A 2FFHA 3GQBA 2ZE8A 2V7QA 4IKEA 1ELOA 2WPDA 4BLPA 2QPAA 1K5DA 4MRVA 4NL4H 2BDTA 2AX4A 1NG1A 1YVDA 3R8FA 2XX3A 4J0QA 3AVTA 1GP2A 1N3BA 1NVVR 3TQCA 3BIFA 1H8ED 1NN0A 5EQTA 4HAZA 5LDDC 2QENA 5FR1A 2O8CB 2WWGA 1RRFA 1LNZA 2GCOB 1FNNA 2R2AA 4G1UC 1XPUA 1OKKA 2PT7A 5H1YA 2QGZA 3EPHA 2WWHA 1SVSA 3V9PA 1HE1C 4XSHA 3QKRB 1TU3A 3HJNA 5BQ5A 3KTAB 5IF9A 4IXNA 4TTQA 2QROA 3HP1A 4LGMA 2ZRDA 5IHPA 5FUXA 3PEVA 3E70C 3TVTA 4Q1DA 4PSVA 3EZ2A 3LFUA 3F8TA 2W0MA 4I1SA 3QPWA 2QBYB 2OXCA 2FJUA 4B2LA 2OAP1 4PAMA 1GKIA 1YR9A 2WWWA 1OIXA 2JJ1A 3EXAA 2ODNA 2QMEA 1CF4A 1UPTA 3MLEA 1P9RA 5JWOA 3UK6A 1WRBA 4NP6A 4QRHA 1IY1A 1KO4A 1NY6A 2C2HA 5LD2B 1XPRA 1R0XA 2WKPA 3SR0A 1PLKA 4HAWA 3ICEA 4GPTA 1DO2A 5C4GB 2RHDA 4DSNA 1M1YE 1AIPA 5FL7D 4Q4LA 4OQLA 1CJUC 2R6DA 4DCUA 2YC4C 1KMHA 4GT1A 2OBMA 4AKIA 4MKIA 2DWQA 1DAGA 1PJRA 2P2LA 4Q03A 5KSYA 2V9PA 4PHGA 4DLRA 2G3YA 1SXJD 1VG0B 1UKZA 4M2LA 3B9QA 1KJWA 3JZMA 2O8FB 1HT2E 4HLCA 2W00A 4DLZA 1W36C 1R6BX 3RSLA 3THYB 4JLMA 4GOKA 4M9ZA 5KU1A 4JLNA 3GFOA 4CRWB 3D7MA 4LBVA 4TWZA 3MJHA 1Z0KA 2CK3A 1G3MA 4NYMQ 2EWWA 2WAYA 3LV8A 5CYOA 4RZUA 2P5TB 3GJ0A 2R44A 1MH1A 4P31A 2BBSA 2Z6VA 1IN5A 1KI6A 1X8KA 1A2KC 1XEXB 4LJAA 3BC1A 2CE2X 1RYHA 1DE0A 2ORWA 3FMIA 1ODFA 1XZQA 2ZYTX 4IDQA 5E7JA 5HCIA 5EP3A 1EFUA 4I81A 2QTVB 5C2JB 5HTKA 4PPQA 4Z1MD 3T5GA 2OV2A 4LBYA 4NPHA 3PEWA 1AK2A 4PPNA 1W7AA 4NZYA 1G3QA 2QORA 4QBFA 1P2SA 1KI7A 1UF9A 3IILA 4II7A 4Q19A 2ERXA 1TQ6A 4TYWA 1XMVA 5SZJA 2OBNA 4DSOA 1XTRA 3P1JA 4Q7KA 4H1UA 1AS2A 3CF6R 1MO6A 3K9NA 1KO1A 3PQCA 1J2JA 5FOSA 2GETA 2F3TA 1A5TA 1OSNA 3BB3A 3W3ZB 3SN6A 4O0MA 2AR7A 5DN6D 2Q3HA 3ZJYA 1XJQA 2PZFA 3CR7A 4FCVA 5AWFC 1UBCA 3QKSB 4NCHA 5J4LA 1HV8A 3CNLA 3I32A 5LB4A 1IN8A 2WM9B 1LS6A 4W9MC 3AP3A 1KO7A 5JI3E 3SU8A 1AZTA 4HZUA 4FMDB 3M4YA 4HB4A 3IBGA 1RPZA 2FZLA 4C0HA 2JLVA 1QVRA 4X8HA 2OM2A 3IQWA 4US2R 1P6XA 4DCVA 3ETLA 4E5UA 5CDFA 4LBZA 1G64A 1DO0A 2WOJA 3SBDA 4DLTA 1P2TA 2XZLA 1N6PA 3O8RA 5EXPA 1E79A 4Z8XA 4KAXA 1XNJA 4B35A 3K0EA 5FBLB 2OCAA 5C18A 2FFBA 2XJ9A 3QOFA 2ONJA 4BFZA 4C4PA 2KJQA 4B2PA 2BMJA 2ZI4A 3F0TA 4BZQA 3CX8A 1SZPA 1D9ZA 3K0CA 5CYPA 3QBVA 5BW8A 3AF0A 3VAAA 2V6JA 4V02A 5CJPA 4URVR 2FFQA 2IX3A 2CL7X 5FH9A 3I73A 1J8MF 4JJZA 4OQFA 1E1QD 1G3RA 3UKDA 1HYQA 3A6PC 4A36A 2CNWD 2C9YA 4Q01A 4KITB 1W0JD 1E0KA 3QF4A 1W49A 4P3YA 3DMNA 1OHHA 1VCOA 5HCNA 4A2WA 4JVMA 1CXZA 1NN1A 2IF0A 3BB1A 3OHMA 4TLDA 4D4LA 1WBBA 4OHXA 1XB2A 4LUCA 1G5RA 1OJLA 1I2DA 4X8MA 1XBTA 1BO6A 4KVGA 4Q9LA 2RGNA 2ZRKA 2ZQ5A 3FPAA 2AN9A 2V3CC 1E4VA 4KFTA 3MCAA 2OFXA 1U81A 4NYJR 2UZIR 4LDJA 3ZLJA 1RJ9B 3WRXC 4V03A 1OIWA 2VF7A 4AYXA 4DLWA 4D2IA 4R71A 5FUVA 2HF8A 3LQRA 4CT4B 3KKOA 3FFBA 4FMDF 4NTZA 1Z8FA 3AH8A 3QG5A 1XJCA 1XXHA 4FIDA 5DYGA 5GJWC 4URXR 1GFIA 3VU9B 5CIQA 3ZVLA 2PLRA 3IHLA 1WBDA 1XMSA 3BFVA 1DAHA 1ZAKA 3ZVRA 4FMCB 5DI9A 1OH8A 2WWIA 4OHZA 1Z47A 1D9XA 1LS1A 3TNFA 3W90A 3GLFA 2P3SA 4P4TA 4PR0A 4US0R 1J8YF 4TMZA 4JBXA 3TJZA 2F1RA 2REBA 2G1JA 3CRRA 1GNQA 5E95A 2ZYVX 2CLCX 5JHGB 2QN6A 3LBHA 1G3UA 4LYFA 4YMTA 3QBTA 1W5TA 3MRSA 4HAUA 4KHZA 4U5XA 2WJYA 5GVSA 1M6NA 3A4MA 4LHXA 3L8ZA 2GILA 3A1VA 4V0LA 1KO5A 3FYHA 1MABA 4QM6A 4CZ2A 2ZSAA 3QEOA
chains in the Genus database with same CATH superfamily
3VO9A 5K09A 3G2JA 5HRCA 1UJCA 1O0CA 2D5BA 2E2WA 2A0KA 1A9OA 1OX4B 1BDBA 3KTFA 4BMOB 3T5MA 1NUAA 2R6R1 2B1IA 2C2OA 2XKKA 3V1YA 2OFFA 1DOAA 1K5HA 1G7TA 3WHLA 2A4KA 4CUJA 4R1NA 4HYEA 2B8TA 2GDJA 3CNQS 2OXTA 3FZNA 4YT4A 2RHLA 1IJFA 4FYIA 1R00A 4FOPA 4LZNA 3PB3A 3OFNA 4JFRA 4ER6A 3PZBA 1ZD5A 2O52A 3TLJA 4GL4A 1GG5A 2HWYA 4XDZA 1EE2A 1UH5A 3EGCA 1DTSA 1FQJA 2VHZA 2J3HA 3AUXA 5AK4A 4GWLA 4IV0A 2BY4A 2AI3A 2FMXA 3CFYA 5DM70 2PYIA 4RWZA 3TR6A 1MD9A 1W75A 3LX5A 5G3ZA 1GTJ1 1PX0A 1CJVC 1KAEA 1YS7A 5T8KC 1CG6A 1GAQA 3MMZA 3WRVA 4A9AA 1M75A 2IOFA 3FPGA 4DR3B 2GXSA 1SG0A 1QCCA 3KVOA 5EMMA 1FS5A 1EJ2A 2QSJA 3TZBA 4XZ3A 2F7SA 3JQFA 2X22A 4JUBA 3KZOA 4QTUB 3RBAA 2MSDB 5EVCA 3I0MA 3V1MA 1DRUA 1VBMA 1H2BA 2IKQA 2C0CA 2C78A 4XIJA 1GZ6A 4AYWA 4Z7JA 4E07A 3W5AA 1CZLA 3QSGA 3WBFA 3ZU3A 4YRAA 1MB3A 3IP9A 3LG2A 2VTKA 2CXHA 1OWOA 3P5BA 2X8JA 5K0JA 4A1OA 5AUOB 2EERA 2EGGA 4MW0A 2G09A 5DLEA 5KO2A 4ARZA 5LFAA 1JHYA 2LWIA 2XECA 4DS3A 4R98A 4E1VA 3UMYA 1TJYA 2ZK7A 1LLUA 4DSUA 2O5CA 3FR8A 2J7PD 4IDGA 3RRJA 1C30B 5JYDA 5JTUA 2ZVDA 4R0MA 2EDAA 3KYCA 4JITA 3UJHA 1T4MA 4OK5A 5LQAA 3TD2A 2EKDA 3BGDA 2F3RA 1KH2A 3FE2A 4KXMA 4MV1A 4DN6A 2B4KA 3GI1A 4ZZIA 4QU9A 3RSQA 3PLRA 3RTCA 4WI1A 2HO4A 5EA2A 1T13A 4B0OA 2R66A 3ZXUB 1LA2A 4NJOA 1LW7A 2HXYA 4UAVA 1TJ4A 5E7IA 1DDOA 1E99A 1ZICA 4NMLA 4E09A 2ATVA 4I50B 1W76A 4BX8A 1VE1A 4WFQA 4X45A 4INAA 4H6WA 4ENWA 3E9MA 2HDNB 4CJXA 2N9UA 1T5TA 3ER9A 2W71A 1DAEA 1FZQA 3TMYA 5CGQB 1JKFA 1U0JA 3KEQA 5KOHA 2ZUBA 4HATA 3LLSA 2GEJA 3QFFA 4BU0A 2PE5A 1P1IA 3CRW1 2OHJA 3C15C 3CWCA 3MK31 1DX6A 2AR9A 4RIGA 3WLEA 1T8PA 1SCUA 5BUSA 5J2TB 2WFLA 1XQ9A 1POWA 4G5GA 5CB4A 4P3XA 4HXEB 2ZI9A 4IHAA 2PFKA 2O5RA 4HQ6A 1M2KA 4PW0A 2NU9A 1V6AA 2G72A 4YEDA 2VTEA 1PGJA 3RQIA 2YZNA 1EEHA 1VPWA 3Q3GE 3WI7A 4QGAA 3FGPA 5G40A 3ZDQA 2W98A 1KA9H 1MG0A 1XK7A 5ITSA 5JYBA 3FW1A 5FUBA 4KMRA 1XLVA 2PXXA 2QVXX 5LC1A 2J30A 4TZ6A 1P9NA 4KPEC 1R8XA 4IHJB 4LXUA 6PFKA 4V1CB 2O8EA 4LX8A 3W5SA 3PNOA 2C2GA 3GEMA 1G66A 2PQ2A 4DJEC 4JYAB 3COSA 3JQ7B 3AJ9A 1KOJA 2FN8A 3CMCO 4HV4A 1U94A 5IDWA 3FRIA 3FUTA 5BP7A 1RAIA 1U2ZA 2E0IA 3G2MA 2HEGA 4KCGA 2O7RA 1OTXA 1JDBC 4JU8A 3U7HB 2WHYA 2Z56A 3MUOA 3RYHB 2A3NA 4R69A 4DNQA 2J3EA 3M1YA 1U9IA 4JGGA 1R1DA 2ATEA 5IP5A 3SP1A 2AXNA 3V32A 4DMMA 2DECA 3ORSA 1K6XA 4HZIA 1E7QA 4QO7A 3SC2B 2XUJA 4RC9A 1N8TA 4KV9A 2BCEA 3Q12A 3OQ6A 1EE9A 1MDBA 3ONNA 4KLNA 3V4LA 4W6ZA 4F72A 5DCUA 2QLNA 3GAMA 5TMDA 2I80A 4MWSA 1N9GB 2XQJA 2WTXA 3C87A 4ME6A 3L6OO 4LK2A 3HVUA 5SZIA 3SYNA 2H8KA 3GJTA 3L49A 1SUIA 4YMSA 4C1NA 3TKYA 4B9EA 1EBFA 1J6UA 1ZN8A 2XNHA 4HDMB 4DA9A 4XA8A 3ICQB 4EFLA 3WGVA 1AHIA 5IT4A 2QE7D 1E2UA 4TL8A 3SHVA 2AEJA 1JNXX 1VKZA 1LF5A 1T2VA 2FP4A 2IQ5A 1FJ2A 3LCJA 3MINB 5LVAA 2FZGA 3LKBA 3HHPA 4YV0A 4MWOA 3ZUGA 5BWCA 2IW3A 3ONVA 4N03A 2I7CA 2DHEA 3SQDA 1Z15A 2VRBA 3HEMA 4PNPA 4OV6B 3C3KA 3EF0A 3FBGA 4XVCA 2QPOA 4C0QC 1Q50A 3IQHX 5KZMB 1JFSA 2G1PA 1IB6A 4RA9B 2F3UA 4TROA 5EHGA 5IYZA 4LOKA 3H8SA 3KSMA 4MAFA 4MQBA 4ZEXA 3DM9B 1TVKB 3E1SA 1MC5A 1QBKC 4PZZA 3PGA1 4YP7A 2OVBA 3SJ7A 4XX0B 3SX4A 1QYWA 4HSEA 4TTAA 3SCZA 4CLOA 2WD8A 2CHEA 3FTCA 1XFDA 4HZGA 4RVSA 2BEUA 3G2HA 5CG2A 5AIBA 2D00A 3DBRB 2XCRB 4EHHA 1XEWX 4G4SP 3D3WA 4BVJA 5GTDA 1USUA 1VMEA 1EM6A 2QMZA 5KQPA 2F1HA 4G23A 4ESEA 3EWSA 4UEKA 1J09A 3BXFA 5ISMA 3LY7A 4MS3A 3DSRA 2E4UA 3WL5A 4CM4B 4P7KA 4JQZA 2I76A 3V2UA 3IJEB 2VAWA 3UB3A 4B84A 1G5IA 3LPDA 3IIKA 2LCIA 1D1SA 3C6KA 4JYBA 4MW4A 4HNUA 1U8FO 3WOVA 3KT3A 2EX0A 2FMHA 5ITWA 1XMJA 1Z06A 1E3QA 1FP6A 3U9TA 3U7IA 4RA6A 4DWJA 5JEEA 5JNVA 1UWKA 2OV3A 2BLLA 3CLVA 4LC0A 2VP6A 2KWIA 3GCZA 1UT5A 3GLKA 5ETJA 3THYA 2CJWB 3CH6A 2OM6A 3ZWCA 3WKEA 3AJEA 3RYFA 1FP4A 3GAZA 4LDZA 3ZK9A 3E3LA 5A9SB 1U90A 3EY4A 4Y2UA 3TCNA 5IAAA 5JJ5A 1DXQA 1OASA 1Q20A 3PUIA 3OT4A 1B6SA 1E7WA 2MR5A 3CB4A 5FPYA 1RWOA 1C9JA 2C07A 3N0XA 3OLQA 3PC8C 4UZSA 1KI2A 1BJKA 2YXEA 1V96A 4LDRA 2YWCA 1JPJA 4B5KA 5CHYA 2XB9A 4PTZA 3A4YA 4TXMA 4YO8A 4UTOA 3W4IA 2FSGA 1RD4A 5E3IA 3ZZTA 4ZT2A 3I83A 4XFKA 4QEDA 4IBOA 2IY9A 2QRJA 4PIMA 3IBFA 1KDRA 1ZR2A 4BO6A 1EX6A 1TO6A 3AO0B 4H7KA 2A1UB 2OSVA 2JJ8A 4N8EA 4WKOA 2PJUA 5BQOA 1QRUA 2HL6A 5L7TA 2HCJB 4OSPA 3GGCA 4F4FA 2JLZA 3AKDA 4C0XA 1PTJC 3LY8A 4TSFD 3USCS 2NYUA 3ZCRA 4JBHA 4Q7JB 4OJQA 3KK0A 1ES9A 1W4LA 3KELA 5B1EA 4LJ6A 4CQMB 3E61A 3RVBA 3VOAA 1QG4A 2XVMA 3OCYA 1RXWA 1DJLA 1UZLA 2F43B 1EQAA 1XYYA 1M2WA 2R4TA 1GWNA 5F1YA 2WYOA 5K7SA 1WU7A 1DFHA 2O7VA 1HOTA 2JJQA 4DREA 2Z58A 4EG8A 3E5HA 1OREA 3NV9A 3DPIA 3K4HA 4EENA 1KZ9A 5A0VA 1Z0IA 1X1CA 2WR8A 4O2LA 5EUBA 1UK6A 1BEEA 2ZVJA 2ZR0A 1DZIA 3Q7IA 3OEWA 4NENB 2YHAA 3H97A 3L8YA 1TO2E 1X77A 1A97A 4RJJA 3IUJA 2BMEA 4ZCQA 4UKDA 5EIOA 3WWYA 1CUXA 1JGTA 4KG7A 3BGSA 2BBTA 5D3QA 4UPEA 2P91A 2RGDA 4Y2SA 2WD9A 2E37A 5DBEX 2V8BA 3GPBA 4UJ5A 5ELLA 4GXQA 1Y5MA 3FPKA 1MVNA 5FV7A 4QU0A 1JXAA 1I0IA 1D2GA 1QONA 1N1EA 4HUQA 4NJEA 5CG1A 3MM4A 5LJIA 3HTXA 4FXOA 4QJ3A 4MUXA 4F96A 1XVAA 4MDFA 3S2UA 3W7AA 2HYIC 1KJYA 4LHYA 2PMEA 3CR8A 1E9VA 1T1JA 2RI6A 2W2VA 3DFMA 3FJYA 2OCXA 5AK3A 2FB9A 5EIAA 4UOEA 4L4UA 2WVGA 4BL5A 4YV2A 4WWHA 1ODLA 1P60A 4RSRA 4LISA 2R6GA 2VSNA 1Z28A 2C95A 2XGSA 1KZGB 3D7KA 1AQ6A 1SM4A 4FMBB 1RQPA 3NBYC 4P0QB 1E0JA 2AN4A 2NYAA 2R48A 1Z0ZA 2AYZA 5J4VA 3VNQA 1IULA 3HI4A 1J2TA 2NSLA 3VYTB 5KSZA 2C7BA 1KOGA 3K9FC 3UC9A 3WB2A 4IFEA 1PK9A 621PA 5B36A 2JI4A 3JWPA 4WXRA 2AOXA 3B52X 4NYMR 5ALOA 2ZSDA 4GSKA 1R5BA 1FX1A 3C3CA 3SJCA 3TSOA 1E5QA 2DFPA 4HB2A 4I55B 5KKCA 3KQKA 4Z4EA 5CGZA 2REQB 4XOIA 4KIJA 4YCAA 4RHTA 3FZYA 3SJZA 3HUTA 3JTMA 1W5BA 3H05A 5I7UA 2I1VB 1U3CA 3HLTA 2HA6A 3AQ4A 2CLSA 1ZOIA 4LZOA 2NO9A 4UEQA 3DEFA 3BTVA 4H1VA 1G60A 2WTBA 2WABA 4WEQA 2B2NA 3I5AA 2X7HA 5EIHA 5GONA 2ZKLA 3BVPA 2JKYA 3CRNA 3QKUA 2E5LB 4YRTA 1MRNA 2A9KA 2PRJA 3DL4A 2PTHA 1RRPA 2UXDB 4EGFA 2XJ4A 2QTZA 2VJYA 2YYAA 1BCRB 1DBQA 5ALUA 2XGJA 5CB4F 2HNKA 2IPLA 3MT9A 1TD1A 2AZMA 4I5DA 3RS2A 3K4PA 2WIBA 1PDOA 1IQUA 1UT6A 2A92A 2VN8A 1AE1A 1HYHA 2X7XA 3HUEA 3PGLA 4XGRA 5IW8A 3LC2O 4N40A 3EUFA 3HXLA 1LTQA 4JCOA 1MW9X 4NBLA 4DV7B 5JJLA 1Y34E 2ZULA 4B34A 4BRWA 1Q5PA 4DT1B 3H1EA 4GI7A 4OD0A 5E2AA 1GZ5A 1U8UA 5IN5A 4XFJA 1LDMA 1NVBA 3UAVA 2Q6OA 3N2GB 1JIQA 1SCBA 4J3JA 4ZJZA 2R7NA 3PFGA 4G85A 5ANRB 4ZO4A 1WXHA 3WIOA 5AKHA 2WJZB 1DV2A 4GZ5A 2J0QA 5DCWA 4MWEA 2V6IA 2H0RA 2R1TB 4JB0A 1PLJA 1UXIA 1YT5A 2YXBA 4L6IA 3ZC3A 4JKYA 1Z3IX 2YFKA 1HE3A 2X40A 4N5HX 1NKSA 3KB8A 2MR6A 4N12A 2I5PO 2HZBA 4FR2A 4D0LB 5GJVC 4OGFA 1N8NA 3AG6A 3Q5GA 3C6YA 4KN6A 4KBFA 4ETNA 3IAUA 4YACA 2ZSIA 5DF1A 3X2SA 4O29A 1O3YA 2B0CA 4ZODA 4DCPA 1QQTA 5CLLA 3IAXA 1W36B 5AVUA 3ZGNA 5J2UF 1Q19A 1NBMA 3JATB 1X3LA 3HK2A 1VQ1A 1MEEA 1P9WA 2VHCA 2ZJ0A 4C4SA 4TN5A 4J16C 2H4ZA 4K9QA 4V3BA 5CX1B 2OKGA 2VL7A 1T0HB 1Q92A 5CDHA 1NZFA 1L4KA 4H1WA 2FSUA 2OPHA 4NV3A 3TN7A 1KK1A 1A9PA 1MW8X 4TTIA 3O94A 4B3CA 4IMJB 3E3MA 2JKZA 1JFLA 3DV9A 3DBVO 2R7MA 3GZNA 2C4TA 4KUEA 3PVCA 2BI4A 1YSCA 2INGX 1JHXA 2O0MA 3FIUA 4H7HA 1IPHA 2WZBA 4LZPA 1GITA 4D99A 3B85A 4MVJM 3EC1A 1NA5A 3ABZA 4DGQA 2HRZA 1SXQA 1SB8A 4PRLA 1BKSB 2WT9A 1U0TA 2NX2A 4PLWA 1UOPA 3WE7A 4LWZA 1QDLB 4LYAA 4PAQA 2ID7A 5K3FB 3RK4A 3ZIUA 1RYNA 5CEFA 4IXMA 7ABPA 2NZWA 1OLUA 2J0UB 2RAPA 4YRGA 2V0CA 2VEDA 4XPIA 4GQBA 1DC4A 3FF4A 1VDZA 3TW4A 1ISIA 1WOYA 2HJRA 3WFJA 3QBDA 3PYXA 1SKBA 4DCJA 1QZXA 4MB2A 2OCKA 3O92A 1R0LA 3W7BA 1U8AA 5FL7A 3IBSA 4PBTA 2WTEA 2YWBA 4HADA 5JCJD 2P3OA 2AGVA 5C8DA 1QAQA 2I87A 3IR7A 2DR2A 5CM9C 2JFFA 1E8NA 3D1JA 3EVCA 4BVAA 3L01A 1SXJA 1RWQA 1GU0A 2PX3A 1SHZA 2VPYA 3DKVA 3LD9A 4DCTA 5BVGA 3LVRE 4D81A 3W1EA 4CHTA 3GFQA 3JWJA 1NW6A 3EUWA 3F8SA 1QRSA 2OBBA 2D1FA 2RHWA 2VO1A 3HI6A 4HNVA 4KSBA 4RK4A 2GBGA 3C43A 5FWXA 3MRVA 3G0HA 3C4QA 4YP9A 3OC0A 4HH3C 5IT9A 5CJ2A 3UUFA 1I5RA 2QRMA 2ZCVA 3VPSA 3W8RA 4P80A 1RHMA 3CLSD 2ZZNA 3GJ7A 3LT1A 4FBMA 5DFAA 4LYJA 3NM4A 4JJ6A 3ESZA 4WASA 2QVGA 1X6VA 5FBWB 1RCTE 2E87A 3EDCA 3GCGA 3U31A 4Q3BA 3ZWOA 5CDSA 1CRPA 2CFRA 3DGEC 4MPDA 5I45A 1EZ4A 3AHIA 1ONPA 5T4FA 4K9LA 5DWQA 2NUPB 3DMTA 3QNUA 4P3OA 3ROQA 4RVOA 4KQGA 2ZT5A 3DBLA 4NCKA 2VEOA 4MRAA 4X71A 4H6PA 4JT9A 4M9XA 2WKWA 1EGHA 2OZKA 1QIEA 4RHEA 4DR4B 3PJDA 1I4DD 3INYA 2YIDA 2VFAA 1P33A 4NY1A 2I7XA 1RJEA 5EKTA 1MOZA 4K2HA 2G70A 3QI2A 5CT6A 3VYSB 1V25A 5IKMA 3N8HA 1XDWA 2BFEA 4BX0A 1V8PA 3RS9A 4ZPJA 1WABA 3C5WP 4ZCIA 4YCNA 4A6EA 1QO0A 4YP5A 1VA5A 3EULA 3DP9A 4LZWA 3PR2B 1JIUA 3L0PA 4J3FA 4M9SA 4AB1A 2XIJA 1CF2O 2X3FA 4KK4A 4MR9A 2QD2A 2HPAA 3OEHA 3B6IA 4IIDA 4MQLA 4M6WB 2HXGA 5A5FA 3MJCA 3U4QB 1KYXA 2IP4A 2D7DA 4UQOA 1VGVA 3GJXC 4BQEA 5B6IA 4DLYA 2XB4A 5TEWA 4ARVA 2CD7A 4QGGA 1XQWA 4NHEA 4UCQA 4OLJA 2PMFA 3DONA 1KSGA 1QHFA 2F59A 4AMBA 1ZJYA 2PJZA 4ZVOA 3LHSA 2G0NA 2ADFA 1L5RA 3HA2A 4GBMA 3PF8A 3UGKA 4TYQA 4U6NA 2D54A 2IT1A 5IJWA 1D2EA 3WL6A 1I4LD 5BNIA 3FAZA 3W6PA 3QELB 2VHUA 4MIEA 1MF7A 5I9MA 2WC1A 1K7SN 3C8UA 3HU5A 4C7OB 2AXQA 3VTKA 4BQRA 4OP1A 1FJHA 4DDVA 1IEWA 1UXKA 1HE5A 1CIVA 4PAWA 1UPBA 3DOJA 3L7AA 4RZIA 3VNVA 5D00A 5TPZD 2XLBA 2XBUA 3F1KA 1GFWA 3BM5A 2CXQA 2PX5A 4RADA 4Q1BA 3M34A 1RLOA 2Q3EA 5I5GA 1A5ZA 4PLPA 1YK1A 1GNRA 3WDSA 1VHQA 3VR0A 5LMUB 4EPYA 2IS2A 4PRZA 1WIWA 1C3OA 2RGYA 4M49A 2PJDA 1Y6FA 4IGEA 4XWAA 1SBQA 2PWBA 2CNWA 2GZRA 3CLHA 4OKSA 5I4BA 4B3HA 2OGZA 4M88A 5TF0A 4BVEA 2YIVX 2FW1A 4PS0A 1TO1E 1YWGO 2CVPA 3EJ6A 1T3LA 3UHAA 2YN4A 5I9SA 2LDXA 3ES9A 4W9NA 4IGKA 3C8HA 1EX9A 4FW8A 1RXIA 2WU1A 3GGGA 3CG0A 1ZZGA 2VTVA 4YRLA 1FSSA 5BW5A 2VHXA 1ZUNB 3ISJA 2C3YA 3D0OA 2UYQA 4G56A 4O4JB 2DFLA 4CM1A 4FB5A 1Z56C 2QTTA 4JS0A 3OM8A 5EJIA 1E5DA 3R7LA 3U7JA 3P20A 5A71A 4G8JA 5ALWA 2CUNA 4ZYZA 2Q1XA 3CT6A 5TARA 1G8SA 3FBWA 1T5HX 1KI3A 3ADBA 4IJ6A 4QC2A 5KQGA 3CRQA 4QGFA 1GZSA 1TMYA 4CTMA 4PFQA 1P9OA 1A88A 2X0RA 3KTOA 4XCVA 2EEPA 2V96A 1AA9A 1X8LA 2PGNA 3A9TA 2HFJA 3E84A 4JQCA 3RRMA 4OLBA 4EFNA 2E3JA 5FCDA 1DT5A 1KHTA 2BHSA 3ANSA 1OX5A 4UHCA 3G8AA 3V4SA 2IUUA 1R4NA 4FX2A 1OUMA 3ECAA 1EFKA 1N8KA 2XNCA 3M0EA 3QVLA 4MUGA 4OQYA 3ZEIA 2FEMA 1GA4A 2QAJA 1PZHA 1TCAA 1R50A 1USGA 2O2XA 4MVXA 4AO6A 1N2CA 2EZTA 1IRXA 2FPLA 1JX6A 3E22A 1GGNA 3MMNA 1ID1A 3PNLA 3UW3A 4A92A 1P6QA 5AVQA 3AHJA 1JAHA 4R2IA 5ER9A 3TDMA 2QYTA 3QENA 1PR5A 4OBXA 6YASA 1ESCA 2X2PA 3H3FA 2IZ0A 3OM1A 5EYPB 2C3PA 2IUYA 1KKLA 1YK0A 1CDOA 1FK8A 2JATA 1IIBA 2HEIA 1UADA 3L9WA 1T1IA 1RM4A 1VZ3A 4HNAA 3N6RA 2ZWAA 1O97C 3RS4A 3O1JC 2AJBA 4H0NA 2UXBB 5HQ3B 1E7MA 1LB1B 5LQDA 2RGBA 2AKEA 3PHIA 2BKAA 4F6LA 5A62A 2X7JA 1RS0A 2GBIA 2JCVA 1SKYE 2QYOA 3H1TA 3QVGA 3R4CA 4KUGA 3PGXA 4ZD6A 2HB6A 3MTAA 1XDBA 4G5SA 5H83A 2G1KA 5EP2A 2Q1SA 2CUKA 1QGYA 3CUVA 4H9GA 4MWTA 3KKLA 3KC2A 3E9YA 1SHKA 1O5IA 4RV4A 1KEKA 2J3JA 2P5UA 1W6RA 1O5TA 1RAAA 2HA0A 3JQQA 2VCHA 3K0FB 1X2BA 4O3MA 3NPMA 5TMPA 1IXSB 1ZS9A 4KLAA 4Q7LA 1M1ZA 4QGBA 4YWHA 1GJRA 4WZ6A 2XDAA 3W78A 1YL5A 3WR5A 2IHJA 3W4JA 2GM3A 3O6VA 1A7KA 1H2WA 1G20E 1U3GA 1NMEA 2IXDA 2X2FA 2ZI6A 3O47A 4DKXA 2QR5A 3WAGA 3OJFA 2G06A 5CD1A 4MO9A 2ZYWX 3OF3A 2DPXA 4ZVKA 2PS0A 1PI3A 3IQDB 3DWIA 5JQGB 2C5FA 4ZAWA 2IQIA 1AUQA 4GX1A 3BSWA 3H4TA 1HG0A 1LLCA 1PZMA 1RACA 2C3UA 1N2XA 2Z95A 3M6XA 3OVMA 3TAUA 3WMXA 2PR2A 4NWIA 4AN1A 2DQKA 1UFRA 1U6KA 3WQSB 1V9LA 2JFNA 4LZAA 4IIEA 3LCVB 4OXNA 2A0WA 2I6TA 1QKKA 2Q50A 3BWDD 1XCGB 4DPKA 5KBYA 3CNOA 1DOZA 4AQ7A 1F8YA 2VYFA 2GESA 2Y0PA 5E6RA 3UPTA 1U1CA 1SVOA 4ALJA 5K5EA 1RWNA 1CZOA 2PUBA 5K0FA 1T1GA 1NQAO 1F5SA 2AEEA 2DRIA 2MINB 3D1LA 1T36A 3E8XA 4FU0A 3PS9A 3ULKA 2VPQA 3BK2A 1V1MB 1ZGZA 5JAUA 2V97A 2F9FA 4EG5A 4QIHA 3SZ3A 2WT8A 2X41A 4K9RA 4L75A 2PSJA 2YVUA 3IOCA 4M8LA 3ZWNA 2OXFA 4C0WA 4A5OA 4DJAA 2DR3A 3A6JA 4ZYLA 3UBTA 1VZ2A 4ZA2A 3WMWA 4B75A 3Q1LA 2J7PA 1U7ZA 3DWFA 3ETJA 2XBMA 3MWLA 4LAFA 1KE1A 1OQAA 2N1MA 5LJLA 3DOIA 3GP8A 4OREX 1SVLA 4HRVA 4YP0A 1QDUA 5E1OA 4ZV9A 1T1RA 1K4KA 1OOEA 3OJLA 2V7VA 5DTJA 2D6FA 1YRAA 5DT2A 3IV6A 1GDTA 1VHJA 5LP6A 4W7SA 4DW8A 4Q6BA 5K6AC 1NUSA 2BFDA 1XCPA 1LSOA 2AX3A 5JAIA 3ENWA 1BVYF 2IYAA 4U9UA 1ZI8A 2OBFA 4N49A 3DOCA 2DVMA 3NDJA 1RE1A 1W581 2OYSA 3H5OA 1C8LA 4MGKR 1SOWA 4LJYA 1LU9A 1X94A 1NQ5A 1QF9A 1WEKA 3HO6A 1KEVA 1XAGA 2Q5QA 3INGA 2C8JA 1GA1A 3P26A 4S3MA 3WGMA 1RLUA 3VZQA 4N39A 4F60A 4OFBA 2QRNA 4QUHA 2OAGA 3C6QA 1IZ0A 1QVWA 5DLQC 5LBIA 5FQNA 4EVIA 3DD1A 1QFSA 2B0JA 3EFOA 2X15A 5AI8A 3RIHA 2QTBA 3QF4B 4BATA 3UH0A 4J0GA 3IQGX 2YV1A 3U4CA 4D3YA 2H9YA 5IS2A 8ABPA 4LS3A 3ERCA 4Z4CA 4LVUA 3GLSA 4ARIA 3RODA 3EEYA 1FRZA 3MWEB 3BSYA 2ZZKA 2YJGA 2W93A 2BMDA 3LZDA 3DAGA 5AW3A 1W73A 4MUHA 2VHEA 1PSZA 4WBNB 5J43A 3DE6X 3LE8A 3HRIA 2O2EA 3JX9A 1U0BB 2I78A 2BHNA 3E7XA 5EMJA 3NKVA 3O7MA 3QVVA 1G16A 2WKSA 3IP8A 5HK8A 3X3HA 4ZOCA 2XRMA 4B3JA 4ER3A 1AQNA 1Q44A 3T5BA 2ZUSA 1D7OA 5JRDS 1L7VC 3KU4A 2VUTA 3P9RA 4BO1A 3L06A 4LJKA 5BN4A 4IWYA 2WJ3A 1AKYA 2FSIA 3PHCA 4V0SA 3D3QA 3KOYA 1L7RA 4IFBA 2AUMA 2B8WA 4KR6A 2DUJA 2YJ6A 3R7SA 3UMVA 5KWVA 5BUQA 1ZM4A 3HYSA 1WSDA 1C2YA 3ISVA 5IULC 1FFHA 1BFDA 4B71A 2FSPA 2YMQA 3FDZB 4RTSA 1E1MA 1DXYA 1RADA 3IUQA 1ZJ6A 3Q7EA 2QP4A 4XUDA 3S3TA 1DRJA 3TGPA 5JMPA 3TCXB 1KYZA 2Q3DA 3DAYA 3ITNA 4L4SA 1VMKA 2ZRNA 1F2VA 4F5DA 2VSFA 4QUDA 4X1YB 4TL6A 2A67A 1KZYC 3CJQA 5DNWA 1G6KA 4NARA 3LNTA 3D6UA 3QNMA 5LYYA 1UBEA 4EGAA 3KXLA 2HT6A 2Q2QA 1W5FA 2ATXA 3W77A 5E7QA 7ADHA 1EHYA 4M8KA 2UZ1A 2QE7A 1XL0A 3TQIA 1VLJA 5DULA 3ORHA 1OT3A 5JS7A 3SYRA 3O8OB 3GT0A 4XKJA 3T3IA 1H2YA 3NHAA 2GPNA 4HWGA 4UNPA 2VKQA 5FEMA 2P9YA 1MXFA 1YQDA 1B26A 2WICA 3A2MA 3HVKA 5EJ4A 1RMTA 2YH2A 5JO9A 4J76A 3DYVA 5JSKA 2IPXA 1LBIA 4DIUA 1ZVQA 5BWMA 4LJ8A 4UXJA 4HMOA 4DIFA 4JI7B 3F1LA 2JFYA 3D31A 1C8VB 1ZGBA 1ZM9A 4IJVA 1OD6A 3A7EA 3SD7A 3MG9A 3EMKA 2JAHA 4F5WA 2P35A 2HZ7A 2QZ4A 3QV2A 1GPJA 4YDHB 2D0PB 3NC0C 1NW7A 4V3CA 4Q4JA 5DHAA 4YI5A 2VF4X 3G59A 4ZCRA 5EIEA 2QAIA 5TT0A 1I4EB 1R5OA 4GRAA 4WLEA 3KFVA 4FZ5A 4KE7A 1L5NA 1KS9A 5JROA 2VK8A 2FRXA 4D9IA 2XNDA 5TT1A 1HG1A 4XX1A 2LD4A 2HW8A 2K2WA 1RP1A 4HFJA 1ZGHA 1RQ7A 1EVQA 1J0EA 4EF5A 1D6NA 2IV7A 2GK3A 3BILA 5AJHA 3PF9A 2MSKA 3O4GA 5IXSA 1Z5OA 1MDFA 3GEHA 3BWXA 3AIIA 3GOQA 2QAGC 1ISJA 4IVQA 4N47A 4BB6A 1W4ZA 2WTAA 1NLMA 3N8DA 1JB1A 2J9FA 3BUSA 3FPHA 5ALPA 1FLNA 2QL5A 2X8JB 2XVYA 3BGOS 4PZDA 1PU2A 4LFCB 4D9GA 4TTPA 2DAPA 2GCEA 1ZMTA 4O5AA 2YIMA 3BHMA 4JK3A 3UAOA 4QTTB 1YI8A 3COYA 1LQ2A 1ZCAA 4PBSA 3FPBA 1AO0A 3WIUA 5GY7A 4NE2A 2QD1A 5WRFA 2VA8A 4DQLA 2BFWA 1GFZA 5AW9A 4WN9A 3R3YA 1M2HA 3INRA 1VHWA 3PFKA 2ZSFA 1F9AA 4KLZA 5TS3A 1IAVA 3C1UA 5LKAA 5I51A 1DBWA 1PJZA 2PKYX 5H3CA 1NPYA 2JIDA 2V7PA 1J21A 5IJ0A 5CNMA 2V58A 1B8PA 4UUNA 2PXHA 3SEAA 3HJHA 4KGDA 4CE6A 3I45A 4KO3S 5LQCA 3P9PA 2QLJA 4IICA 4CKBA 3NMUF 1JHRA 2FUNB 3ZLVA 1XU9A 2QZ9A 2ZZMA 2IOFK 4XWGA 4KO4S 3ZJ5A 3WP0A 3WLRA 3EEQA 1CHDA 4D9JA 4H15A 4B1FA 3R5KA 5I9NA 3N53A 5KOHB 2PT9A 2ZBGA 1JECA 2NO5A 4WD3A 4TSFA 1MB0A 3TR0A 3ZWYA 1JQBA 4Y6QA 1F4PA 2OG2A 4Q3AA 3WHIA 1P5HA 1SCUB 1YR7A 1G1MA 2WFLB 3STUA 2XSZD 4OK6A 4UE3S 4FYVA 1W1UA 3KL4A 1ZOOA 5E2IA 5EUCA 4YRKA 1KMCA 4TT3D 2E48A 2W9XA 3ZI0A 5IMSA 3I2GA 2OQVA 7MHTA 4TWJA 4D25A 3AZQA 2WA1A 1EP3B 4YLYA 1I9GA 1C7IA 4HNSA 2NU9B 4KB5A 4WZBE 2G17A 2E1PA 2XDQA 2XTJA 2W2XA 4WKPA 5K0SA 3VKVA 3OQIB 4C6SA 2ATIA 4G63A 3NUGA 3KKMA 3QX3A 5EXDA 2G77B 4DDHA 4FONA 5GMOA 2AFVA 2BKVA 4OP3A 3OCVA 3K71B 1P62B 3GVHA 4E5VA 1L0BA 4FYKA 4JLKA 5HRAA 5DNUA 4K9DA 2RH8A 1NVXQ 2D0DA 1VKRA 2XEXA 3B78A 4XLLA 2O8EB 4RU1A 4ZTZB 1N25A 3EC7A 1YC5A 4AJEA 3WDLA 4DNXA 5AK5A 4DJDC 1NYLA 5AI0A 1QS0B 4P82A 4URWR 1WXQA 5DB4A 4BUJA 2OZVA 2JASA 5I9BA 4EB6A 2VHWA 1GZ7A 3Q72A 3LUDA 2OHXA 4CHGA 3CXRA 3UJ6A 3IAS6 3BICA 3HYNA 2EZUA 4MV9A 4XVQA 2ZYAA 3OJ0A 1L1QA 2H5JA 3ZHZA 1V7ZA 1QCYA 4I5EA 5DK6A 1KEUA 1QH1B 4IEFB 5EWJA 4LGVA 4GM1A 4WQMA 3DQPA 2IJGX 3IPRA 3OMXA 1E1DA 2JBHA 1DKLA 3O1LA 4J07A 4LY0A 2IZ7A 5HZMA 5MGNA 3THXB 2ILTA 4C3OB 2W6MA 2W2LD 2MDTA 3MBOA 4JGIA 3A4TA 3D5TA 3CW9A 1NVUQ 4TL7A 4BMZA 1YE8A 2PGLA 1DG1G 1QSGA 3U9SA 4ZGWA 3BPSA 1OFTA 3MTIA 1JHZA 4YUWA 1NXXA 4N7RA 4JBYA 3UQZA 3G2PA 3FMFA 1E0SA 3B7WA 3IMGA 3K35A 2DBYA 3MS2A 1XZFA 4Q9JA 4AL4A 3NJRA 4TMTA 2P2SA 3C5CA 1MB2A 1SQ0A 1Y1KE 3GEPA 4LQCA 1U0NA 4PSAA 1HNNA 1XMXA 2IIBA 5JAOA 3RFFA 5LP6F 3F6RA 2FP4B 1CEYA 1OTHA 1AVTA 4RM3A 2WDZA 3TRKA 3VOSA 5CDGA 5HM6A 2V4ZA 2JI6A 3HMKA 5LWHA 2VAMA 2RBGA 4YAKA 1KBZA 1M76A 1KJNA 2CHFA 3K16A 3QU7A 1OILA 2EHDA 4JP3A 1Q74A 4B4DA 3WAJA 1YL7A 1TT7A 2YMMA 3DL7A 4TLAA 2ZJBA 4HXGA 4GGPA 3GH1A 4PGAA 2HU2A 4KIWA 3L4BA 1DUIA 1U1FA 3CH4B 3BZUA 4Y6RA 5IYZB 2Q5HA 2D2XA 4WKBA 4ENRA 3L4JA 3P19A 1P2FA 2YJNA 4KEAA 4RWEA 4TN1A 3KJGA 4RETA 5H68A 5GIPE 2Q99A 5AOAA 4Q12A 4ZCMA 5BSGA 4CDNA 2QIPA 1O1YA 2X76A 2J1LA 5KTRA 1BX1A 1ESZA 1AGXA 1N6NA 1Z5WA 2GCPA 3PC3A 3GLIA 4WBSA 4ZAGA 5KIAA 5LWQA 2IYTA 1BXGA 4RACA 3BJMA 3ZWQA 3G0IA 1GPNA 2OORC 3ABQB 4A0HA 2VBFA 1BXRA 3P4XA 3H5VA 2FEXA 2WTUA 1EZ1A 3ORQA 2JI8A 5LXTB 5TF4A 2F1JA 2GUGA 4BPRA 5G4KA 4E03A 1QIGA 1B7GO 1WZCA 3UXMA 2CMFA 1R5JA 1DAFA 1GSIA 1WJGA 1KFKB 4UUQA 1UODA 4FINA 2PZJA 3W6NA 2WAOA 1K66A 4ARCA 3EQ9A 1YDHA 2W0SA 1W1IA 5KYXA 1JLKA 3KQHA 3WISA 4JT8A 3Q3CA 1QJCA 3QKWA 5ALMA 1RLTA 4KE6A 4KO1S 1T5BA 4RA6B 4WTOA 4I1PA 3PUJA 3BE8A 3GF4A 3L7YA 3GLFE 1SY7A 1E59A 3E1GA 5B1DA 3ELUA 4OHWA 2Q28A 4RYDA 5EC8A 5JYEA 1EVZA 4FZVA 4Y2YA 1YD7A 5K3AA 5DM60 2AG1A 2F90A 1HBJA 4TV9F 2BFAA 1TTTA 2ZR8A 4MUNA 5FPKA 2FE4A 3N2YA 2PMWB 1FP4B 1RBYA 1VIYA 2D7JA 3NYWA 4B44A 1YDFA 4CKEA 1I4OA 1ZO8A 4XYBA 1H3FA 4WGFA 4J0HA 3ZZ0A 4WKCA 2ZRMA 2CL5A 3AKCA 2R8ZA 1J49A 2R7KA 1Y1QA 3TW0A 4GOXA 4ISBA 1N0IA 2GD6A 4HLUC 1WF3A 1BRTA 3KP1A 1QUEA 3G13A 1D0SA 1MRSA 2GZ1A 3BIXA 3DTVA 4FEEA 2I4LA 2QZZA 4P4GA 3PIIA 4W5WA 3VH4A 1YGPA 4UBKA 3IOYA 4GLLA 3DDWA 4O25A 3RHTA 2X5OA 1ZXBA 2XI4A 4M9QA 1OA1A 2YWJA 5BV8A 4YXWD 2FWNA 2AQHA 3OY2A 4J2TA 3F7OA 2GBLC 5IM4F 2G76A 3HN2A 2J32A 3O95A 4L8VA 3ER8A 3T52A 2WINI 3M1AA 2H2IA 3PXXA 2BRUA 4P6VF 5AJWA 5HCUA 5I8PA 1LVGA 1GQRA 1Z6AA 4M7OA 1ZUWA 4C3UA 2BKUA 1RYYA 3N07A 3P27A 4ZV4A 1KEEA 1WKVA 4TV8A 1IZ7A 1RPTA 2Y9MB 4Q9DA 1QV6A 4Q39A 2O2CA 5DP2A