1JKJA

E. coli scs
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords succinyl-CoA synthetase alpha subunit
publication title Two glutamate residues, Glu 208 alpha and Glu 197 beta, are crucial for phosphorylation and dephosphorylation of the active-site histidine residue in succinyl-CoA synthetase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 110
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1jkjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jkjA01
3MTGA 4J7XA 5IDXA 2GASA 2HO5A 3IKVA 3SLKA 1AXEA 4BKQA 3PHGA 3IMFA 4TMFA 1WNTA 5FF9A 5EJ2A 1DC4A 3PWZA 3UH1A 3ZNQA 3GPIA 4EEXA 1ULSA 3H4VA 3ROPA 4YT8A 2NSDA 3KSDO 3DOOA 3H65A 1E6EA 1LUAA 1DOHA 3I52A 4AJLA 4B7UA 5EPOA 1VI2A 5IN5A 4D41A 5TSDA 4DLLA 4YA6A 2EIHA 3L07A 4JJGA 4XQ9A 2PLAA 5I7SA 1SO8A 4FFNA 3C7DB 1JU9A 5A05A 4ESOA 4D44A 2Y1DA 1DAOA 3D3EA 1VM6A 1JTVA 1NNUA 3W6UA 5IJZA 3WMXA 4BNZA 3NDIA 3RVDA 1QKIA 2BFAA 3OEYA 2NV6A 1M2WA 2OO5A 3LLVA 4D46A 2WE8A 2YHIA 3DL2A 3RBVA 2J5RA 4GLOA 1LSOA 5T67A 3QRWA 4MO2A 4MVJI 3GRPA 3WSVA 5I8ZA 4RVUA 4B3HA 2E48A 3VPFA 3CMCO 5I7FA 4NHEA 1I10A 3RCBA 4YJGA 1PIWA 2PA3A 1NM5A 3ETDA 3GNQA 3ZU2A 4FFRA 2C2YA 4M1QA 2Q1TA 2Y1EA 5CAEB 2Q1SA 2V6FA 3GLQA 3V2GA 3NT2A 1J5PA 1DIRA 1GPDG 1YQDA 4S3MA 4XJSA 4GQAA 3GZNB 3MWEA 3WGHA 3E9NA 2JFFA 2DFDA 2HMWA 3EMKA 1E7QA 3ZH2A 2J3IA 1AN9A 2IE0A 2EGHA 2QZ9A 3Q2IA 3U4IA 3QA9A 3GZ4A 1L7DA 3KB6A 2O3TA 4BQPA 2WDZA 3JQ6A 4L8VA 1EEHA 1ENZA 3VDRA 1P1IA 1J6UA 2DU8A 3KZVA 1RM5A 4OYRA 1WVGA 4CQLA 3AWDA 5CPFA 4XWYA 1T1SA 4BMSA 3HJAA 4RQTA 1AHHA 4XDZA 5TF4A 1F17A 2BMAA 1H9AA 5ILGA 2C0CA 4W6ZA 3B6ZA 4XQCA 3JYLA 2RBEA 3WLFA 2VCYA 4WCFB 4RF2A 5KJ1A 4PLZA 4CLXA 1PJ2A 4CM9D 3SXPA 3WWZA 1T1RA 4GX0A 2NVUB 5DBIA 4WNCA 4XYEA 3NRCA 5L95A 2PZJA 4E21A 1ISMA 4IQ8A 1UZNA 3WQRA 1BG6A 4AJPA 4CQMD 4EW6A 3HFSA 3N7UA 4KP7A 2CZCA 4DQUA 4U8GA 1VRWA 2QQ5A 3CZRA 4D79A 2Q1WA 1EQ2A 1R16A 1KY5A 4KMSA 4RL6A 1DIAA 3DFUA 1NWHA 4ZA2A 1HLDA 2C29D 3IDSA 4A73A 1X14A 3DZIA 4O5OA 1KS9A 3WGOA 3S2GA 3PDJA 2J8ZA 3W8DA 3GVHA 1MG0A 4IGFA 2D0IA 1YWGO 3JQAA 3OMLA 1ML3A 2V6BA 4Y9DA 3MZ0A 4QT0A 1C0PA 1XU9A 1Z75A 2Y66A 4NBWA 3ZWWA 8ADHA 3UUWA 4I5FA 2WJPA 1RYDA 1N7HA 2P4QA 4UVDA 4EYEA 2B4TO 3GFBA 4A0SA 2P5UA 5DT9A 4II2A 3OECA 2B36A 2WD8A 4XQEA 1QORA 1I3NA 1NYTA 3RWBA 4PIVA 2V65A 3EHEA 2YQ4A 4N7RA 4PLPA 2JJYA 4W7HA 4RPHA 3ICCA 2UAGA 4NMHA 1VSVA 3HFGA 4TRRA 4XR9A 1VLLA 1T2CA 2VYVD 3DONA 3L4SO 4NJOA 4YJDA 2J3KA 3U4CA 4E3ZA 5ITVA 3WICA 2A9FA 1PGPA 3AOEC 2NTJA 2UV8A 4YACA 1P44A 2G82A 3K9QO 3DBRA 3OEWA 4GH5A 1UAGA 4I9UA 4P38A 4DREA 4F46A 2NU7A 1OI7A 1N1GA 1O94A 4BB5A 1A7KA 2W90A 1HLPA 3D1LA 3NJ4A 1B16A 4PZEA 3ONDA 4JX8A 4ND1A 1ISGA 4G5HA 4BNLA 3UFXA 3CH6A 4MINA 2DM6A 1SCUB 1PU2A 1XELA 1A4UA 2HU2A 3ZNOA 3ZWCA 1HE2A 3LC2O 3OETA 4XRGA 4N18A 1LNQA 5JMPA 2FPGB 4Q3CA 2DAPA 5JYEA 4FW8A 2P91A 4UUOA 2VHWA 4Q3NA 2ZTVA 4RJTA 1EFKA 3WLEA 3D4PA 1J0XO 3ASUA 1EVIA 3F5QA 3H9GA 2WYWA 2AEFA 4OH1A 1LJ8A 5K9ZA 3UF0A 3MWDB 3VH2A 4FBGA 5G2OA 3TWOA 3I9KA 3AFMA 1M66A 3PI7A 2ZQYA 2EW2A 4ZGWA 1FF9A 4U0KA 1Z82A 1JKFA 4GSLA 4M54A 4J6FA 5I9MA 3OQBA 3ZWPA 1HEUA 4GVXA 3BTOA 2AMFA 1ISIA 3FR8A 1VC2A 4HFNA 5G0VA 4E2XA 5B12A 3NJ8A 1BDMA 4O1MA 2Z95A 4FFPA 3ZW9A 5IAAA 1M76A 2AE1A 3LU1A 2G76A 3WX0A 2OXIA 1V8BA 1O5IA 3JQ9C 4OSPA 4G81A 5CP8A 4RVSA 3DZBA 4L73A 1P74A 2JHGA 5KJCA 4J7UA 1CEQA 2YUTA 5A9TA 3I1JA 1DC3A 1WXDA 1DRUA 1SB8A 3PWSA 4L0QA 4UEOA 3QVTA 3GAZA 4XYLA 3ANMA 4WCDA 3WIDA 1TI7A 3DO5A 1DSSG 3OJEA 4OOEA 3H6KA 3VAZA 1K89A 3WJAA 4YWJA 5TJHA 2BHLA 4TZTA 3C3XA 2VZ9A 4J16A 3O26A 1V35A 1YL5A 4U5QA 1GYQA 1ZZEA 1U3TA 3B1KA 4BGEA 1ZH8A 4URFA 2YZ7A 1JDJA 1HYHA 4MOWA 5C37A 1AE1A 1PJBA 2RIRA 3RKUA 4GWGA 3NAQA 3MJCA 3WYBA 1SBYA 1CQIA 3LF1A 3LZ6A 3LLSA 4UREA 4J49A 1UXJA 2GF2A 2XAAA 1H2HA 5KTKA 4RDHA 2VHZA 1I3MA 5CAEA 1GV1A 2IZZA 3EC7A 3QVXA 4MP6A 3JD3A 4YDRA 1ZK2A 4R5MA 1QMGA 2BGKA 2RHRA 3GZNA 3RFTA 4MDHA 1EUCB 2EGGA 4LCJA 3LT1A 1N5DA 4EITA 4TKMA 3HB4X 1PEDA 2X5KO 3PJDA 5C5IA 5EL0A 1A9ZA 1UDCA 1JA9A 4J1TA 4PN3A 4DLBA 3KBOA 5A1TA 4BO1A 3H5AA 1DIBA 2X9VA 2H5LA 1HSOA 1T26A 4I5DA 1YRLA 3DMYA 2WD7A 1W8DA 2WEKA 5JBIA 4J1QA 5CPBA 1M6HA 5A04A 4MIYA 1LQTA 5IZCA 4WK6A 3I9JA 4WLOA 4B8WA 1UXHA 4PLTA 1DBVO 3KEQA 2JAPA 4K6CA 4XR4A 1IOLA 3KVOA 1OBFO 4XQGA 4TSKA 2NVUA 4AJ4A 3PZBA 1CETA 1XGKA 4R9SA 2CD9A 1ISJA 4PVDA 5JDCA 1EZ4A 4QTZA 2OHXA 2QRKA 1Q0HA 2PZMA 2YJZA 1P0FA 5FFFA 1P45A 4RCVA 3PWKA 1BW9B 1NPTO 1ZVMA 1EDOA 2VTDA 1Z45A 3I3OA 2OUIA 4FS3A 1RM0A 2HMVA 4J0EA 3S55A 5B4VA 3UOGA 4PZCA 3WQQA 4YR9A 4XIYA 3HADA 2ZCUA 3JV7A 3P2OA 1R37A 1I01A 1XR3A 5G4LA 3GRKA 1FDSA 2GD1O 1KEUA 1DC5A 4R3NA 3RUDA 1MXFA 1E3EA 5MDHA 1KETA 4OIMA 3VVCA 4K1LA 3W4IA 3FHLA 3HG7A 4GX2A 1IPEA 4QSMA 1HT0A 3ADPA 3WNVA 5GZ1A 1PTJA 2P4HX 1ENOA 3PEFA 1UP4A 4Q9NA 3E48A 2X6TA 2IRWA 1F12A 3OA0A 2Q99A 3QVWA 5A02A 1T2AA 2I6TA 2EEZA 4UVGA 4NFSA 1XDWA 5L4NA 5GZ3A 3KYCB 3JQBC 1QV7A 2ZQZA 4JP3A 4OHUA 4GBJA 1WAMA 1DLJA 4BO8A 5L53A 4GMFA 1H6BA 3OIDA 3O9ZA 4FJ2A 3EVNA 3ICPA 3PLNA 4WKGA 2OP1A 5CDGA 1U4OA 3B20A 3DMTA 3I9MA 3LT4A 4AJIA 2PKRA 4XD2A 4YXFA 4BMNA 5F5LA 5BR7A 1KYQA 3PQEA 4R68A 2PD6A 1HE4A 4I5EA 1DFIA 4IINA 1GAEO 3WGIA 3HN7A 2HMSA 2O7SA 2OL4A 2B5WA 1GTMA 3K6JA 1H9BA 3ADOA 1IB6A 2A92A 4W82A 4E5YA 2E49A 1B7GO 1SCUA 3ZWAA 3OICA 2VWPA 4PFJA 3WQSB 1LEHA 1G0OA 2YQ5A 3I9LA 4U0JA 3RUEA 4FB5A 1JAXA 3FRJA 3H9JA 1JKJB 2FPGA 2AQIA 1M75A 1U5CA 3IAHA 3WFIA 2O23A 1E3JA 2Q2QA 1GZ3A 1W4ZA 1KC1A 3FSRA 4PLVA 1YE3A 2DT5A 3OJ0A 4F6LA 1NHWA 1R66A 3PP8A 3HWRA 3CSDA 1PQPA 4JBGA 3UCEA 1ONNA 2BFMA 3QW2A 5DBFA 4DC0A 4NBTA 1LLCA 4PLYA 4M89A 1KOLA 1D1TA 4CLHA 4B7XA 1PJ3A 1PJ4A 3KSUA 3MWDA 3GY0A 5AXCA 3I5MA 2WM3A 4RVGA 3HB5X 4U6QA 3COSA 5B37A 4WLNA 2VT3A 2X0NA 1TXGA 1ORRA 1YXMA 4NFYA 1I2ZA 3H2ZA 3GK3A 1LRKA 3S2EA 1CYDA 4D3SA 4CMEC 3ON5A 1HSZA 2D5CA 3B1JA 3ENKA 3Q1LA 1PZGA 1Y6JA 2BF7A 4G2NA 5JLAA 1B3BA 1NAIA 3N58A 4DPMA 5HM8A 1QLHA 5A5FA 2D8AA 4Z9YA 3RU9A 2AQ8A 3AU9A 4FJ0A 2H1SA 4O6VA 2NVWA 3NTRA 4EZBA 1P1RA 5GY7A 3H5NA 1U5AA 3PIIA 1UDAA 3E8XA 5EMHA 4J91A 1XEAA 2EJVA 5ES3A 2VZ0A 3E6AA 4A26A 2DC1A 1C14A 2DBVO 4C7JA 1PL7A 3UVEA 7ADHA 2FPPB 3U5TA 4JNKA 5H83A 4B4VA 3DEYX 2DTDA 4CM9A 1NP3A 2R00C 5K6AC 3HDJA 1OZAA 4KUEA 3BTSA 2Q50A 3VHRA 4R3WA 3JD1A 1HE3A 3WGQA 1XSEA 4R1TA 5L45A 3PDUA 2I76A 2RAFA 1W73A 1W0CA 3HDHA 1IUKA 4ZICA 1D3AA 1I2BA 3C85A 4RLHA 1PJTA 1IE3A 3GQVA 2HK8A 1O6ZA 5A06A 1DFHA 1U2DA 4XA8A 3ANNA 3KLPX 1LRJA 3FNEA 4BGIA 5ENDA 4CMIA 5BSHA 5IF3A 2NU6B 3GNSA 4FOSA 3OJOA 3OQ6A 3AK4A 2FN7A 4NNJA 2BFOA 4OSOA 3BMNB 4QECA 4ONEA 4YEDA 3FI9A 3PHIA 4LMPA 1HXHA 3QY9A 1C0LA 1EUCA 4UVHA 1GL3A 3PLRA 2VHVA 5CEEA 2HRBA 4B3JA 2ZB8A 2FY8A 4JXKA 2NTNA 1ZBQA 1X0XA 3JSAA 4FN4A 4DIOA 3GG9A 3NX4A 4BV9A 3CTMA 3KV3O 3HSKA 3P7MA 4CMKA 4INAA 1AXGA 2W2LD 1E3IA 4ND2A 4BO7A 1YOVB 3IP3A 3ST7A 3PFWO 3EAGA 4K9DA 1IULA 3WWYA 3BA1A 2G0TA 2VYVA 5F1PA 1N1EA 1R12A 2VHYA 2X0IA 2VZ8A 3WBBA 3ZHZA 1E7WA 3AU8A 2FSSA 4GX5A 4DYDA 1YH3A 3DTTA 2CF6A 3BMCB 2PY6A 3IUSA 3M1LA 3GDFA 1YBMA 1BW9A 2O2YA 2E37A 5KJEA 2UVDA 3S2FA 1ZSVA 3AM5A 2OORA 5A3VA 4ND5A 1TB4A 4E5PA 2UYYA 5CFZA 2C7GA 2IXAA 3C7CB 3ANLA 3DXFA 1WW8A 2A4KA 4YT5A 4EUFA 2HMUA 2NU8B 2NM0A 2Q3EA 2X58A 5A9SB 3EZLA 4A7PA 5JAZA 3E5MA 1GCOA 4R54A 1YGYA 3V5NA 1I30A 1PGNA 4B4UA 3TL3A 4CM5A 3ITKA 2O3SA 3DHEA 2X23A 4EUHA 1RYEA 2Z5LA 1XKQA 1Q7CA 1YB4A 4JIGA 1AHIA 1P1JA 4GKVA 4IDAA 3RUCA 1ZK3A 4ZVVA 4E6PA 3VZRA 1LC0A 1ARZA 2QX7A 1LLDA 3JYPA 3C24A 4PG6A 4ZQFA 1PZEA 4DBZA 4IBOA 7MDHA 2E4AA 2FZEA 3KYCA 3WGZA 2B35A 1Y9EA 3PIDA 4GSKA 3ZI0A 5CDUA 2O3UA 2PH5A 4YTEA 1ID1A 2PH3A 1NR1A 2DBZA 3WIEA 3QWBA 1X0VA 2NLOA 5JAIA 4OOFA 2GRAA 1SPXA 1YQXA 4I1IA 4EJ6A 4ZJUA 3H9UA 4EUEA 3R1IA 3FNHA 1HYEA 3RU7A 1XA0A 5ICSA 3NTOA 3ZWYA 3GAFA 4PG4A 4JN6B 2NQTA 5BNFA 3W4JA 3GPDG 3H7AA 4BO5A 1Q7GA 2CMDA 1HRDA 3MJTA 5KNLA 4IIUA 1H6CA 1DLIA 4WNIA 4JP2A 4BOYA 1FJHA 3FWZA 1MC5A 2Q45A 3D3WB 4YQZA 1GD1O 4WUVA 3PYLA 3RSHA 4QX6A 3KTDA 2E82A 3OFSA 4YRBA 4YAGA 5JO0A 2CDAA 4B4WA 1ZO8A 4WASA 1PR9A 1JKJA 3IUPA 4NI5A 5L40A 4NU6A 3BXXA 1SZJG 4IJUA 4FIZA 2D4AA 5COQA 4CM3A 2ZB4A 5FI3A 1U1IA 4XYMA 4XZ3A 3GA0A 4ZD6A 3SLGA 1EFLA 1UR5A 1O89A 3G0OA 1A72A 3TDKA 1LDNA 5JXWA 1Z74A 4IPTA 2RHCA 3T4XA 2W4QA 4Q3EA 1T2FA 2Z1MA 4QO7A 1EMDA 3WGTA 3ZU3A 5DF1A 4FC6A 1GFSA 4MVJD 4B7CA 1E7SA 2PTGA 2HQ1A 5DCWA 4WLUA 3SC6A 4RGBA 1QYVA 3D4NA 3F6YA 1DHTA 1TLTA 1ZNQO 3NKLA 4IJVA 1Z7EA 1HTBA 3WOHA 5DBGA 5T6BA 3DOCA 1IYZA 2I3GA 1GU7A 1U8XX 4QXMA 4RZHA 4KQWA 1XLTA 1ZFNA 3OQ1A 3IL2A 1OOEA 5ADHA 2B4RO 4I8XA 3VH1A 4HV4A 1LDMA 2A94A 4ALNA 1LTHR 1ZKMA 1BMDA 4J43A 3Q9UA 4FQ8A 1Q0LA 5KVVA 2ZTMA 4KOAA 3QP9A 1BXKA 1X15A 2FPPA 4MVJE 4YYZA 1ZMOA 4IDGA 4FPXA 5F1KA 2XXJA 3VH4A 3MEQA 1E3WB 2AA3A 2PFGA 3EY4A 3KYDB 5TS3A 1PWZA 4L76A 1B15A 4ZQHA 3TFQA 3H9QA 1DIGA 2QW8A 4CJXA 4PCVA 4RORA 1U3UA 5G0SA 2FP4B 2P2SA 2Y99A 3LC1O 4DIFA 5C7OO 2YV1A 3I83A 4R16A 2DUUA 5T8KC 2AHRA 4OXNA 3VPHA 3ZDFA 2D59A 2FPIB 3QQPA 2RH8A 3NDRA 5AQ1A 2RCYA 4CMBA 2B4QA 3I23A 1X7GA 4FCCA 1HDRA 2NU6A 2GO1A 4RZIA 5HS6A 3C1TA 5BT9A 1I0ZA 2Y67A 3DZGA 3I9NA 2GN9A 3BMNA 5LDGA 2QYSA 4KDEA 3VTZA 3ORFA 1C0IA 4CR8A 4CMGA 4AJEA 2PGJA 1ZSYA 2OZPA 2C07A 2VN8A 3JYOA 3Q11A 3QWFA 4YT4A 2JAHA 4HX5A 3RC9A 3UICA 2V7PA 3QE3A 1I32A 4LN1A 1YBAA 2AW5A 2D3TA 1M67A 1OC4A 2DBQA 4ZQEA 3DFZA 5H81A 5JMWA 3RROA 3QHAA 1YKFA 5A03A 3GH3A 3ZHXA 2EW8A 5G0UA 3FR7A 4E31A 1YOVA 3EW7A 2Y68A 3ZWOA 1ADCA 3NGLA 3ZN2A 1SEPA 2YYYA 3TPCA 5EN4A 5DNAA 4A10A 5IDWA 1KY4A 5JCXA 3ZWVA 3MOGA 1YQGA 3I4FA 2UDPA 3CPSA 1WLYA 3BMCA 2Q2VA 1GUYA 1DO8A 3UXYA 4BMVA 1IZ0A 3BMOB 3PYXA 4KUHA 4DQXA 4NR0A 3WBFA 1NQ5A 1P31A 1X1EA 1ADFA 4ZRNA 2NU8A 4Y98A 2GERA 1SB9A 3U4HA 5KJ6A 3DAFA 5JY6A 4BNHA 3PXXA 3GUYA 3RASA 2I5PO 4QFDA 1C3VA 1WWKA 3KHUA 3O03A 4CLRB 4U7WA 5JYDA 4JLWA 1EUZA 1QXSA 2VT2A 1EBUA 3TOZA 2FSVA 3JQFA 1GQYA 3UCXA 5KVCA 2O2SA 2AE2A 1U28A 1NPYA 2IDZA 3ONFA 2G1UA 2YV3A 2DVMA 1MGOA 5F5NA 1N2SA 4J1SA 1NX6A 1H2BA 1DJQA 4LVUA 3H9EO 2CDCA 2P9CA 1GY8A 2O7QA 4WLFA 1I3KA 3PJEA 1I36A 3DOJA 9LDBA 3TOXA 2LDBA 2G17A 5DP2A 3BIOA 4CMJA 1N8KA 4A2CA 4DL9A 1LDEA 1VJTA 3JQDA 4AJKA 3CMMA 4BKPA 3S1LA 4Z0TA 2Q1UA 1NXQA 4IIVA 3L4BC 2V6MA 3QSGA 5CG1A 2ZCVA 2HLPA 5IN4A 1F14A 1PJLA 4WLVA 3GDOA 3AI3A 1UP7A 3CEAA 5DZSA 1KVTA 1YS4A 3L6DA 3D3WA 5CHEA 5JSFA 4AICA 5CEJA 4C7KA 3KYBA 3U09A 4GWKA 4GVLA 4DMMA 4Z0PA 2FHSA 1AUPA 5JCJA 1HETA 4RF5A 4LSWA 4IDEA 3D0OA 4PLFA 2HJRA 2UUOA 5L3ZA 3QWIA 5GMOA 1BWSA 1XCBA 1FK8A 2JD2A 4J2HA 4YPOA 5JDIC 4OQYA 4UVIA 3JD0A 2PD3A 4CLEA 4CV1A 1VE9A 3GGPA 1S7CA 4AJOA 1QLJA 2J6IA 2X22A 4H3VA 4CV0A 3TSCA 4W4TA 1WDMA 1MFPA 1XQ6A 3V1YA 4D42A 3HQ4O 1BRMA 3KSZO 4E2ZA 4EJ0A 3AUTA 4YBZA 1DAPA 1DJNA 2BI7A 2DTXA 5A9RA 4E12A 4W9NA 1WMBA 4BNMA 1RM4A 1BGVA 1P0CA 4RPGA 4CL3A 4FC7A 4CUKA 1P33A 1I24A 4IJKA 1GZ6A 3M2PA 1KVQA 3PJGA 1TA4A 2CFCA 3QIVA 4O63O 2OBNA 1R6DA 1MP0A 5JY1A 2W2LA 1HYGA 1ZJZA 3U62A 1NASA 4CM7A 5I7VA 4XDYA 1D7OA 2ZYAA 1GEGA 1I2CA 4YAKA 1ZEJA 5BQFA 2BRUA 4Z9FA 3FD8A 3ZHYA 2OBYA 4XCVA 3IJRA 3GHYA 1E7YA 2BGMA 5LC1A 3L9WA 3PYMA 1EUDB 4I9HA 4JQCA 5TT0A 2QIOA 4WCFA 3KO8A 4RPKA 3AUSA 1E6UA 1TT5B 4OL9A 1E3WA 4XYGA 4BKOA 2IODA 1KEWA 3PFFA 1ZSNA 1H0KA 4IZHA 5DP1A 4EBFA 4YT2A 2NACA 5EQFA 3I9OA 2FP4A 1J49A 4IGEA 3UHAA 5CDSA 1H6AA 2DKNA 4FGSA 4NZ9A 1N7GA 1W6UA 3GEDA 4NBVA 5I7EA 2DBRA 2FPIA 4PG8A 1O95A 3MTJA 2EG9A 4ZU3A 3H5RA 2EERA 2GZ2A 3INGA 2P9EA 1NAHA 2BLLA 1A5ZA 4KDFA 3JQ7B 2Y05A 4UAGA 4BKRA 3RFXA 2XPCA 3TFOA 1NQTA 4Q3BA 4O59O 1JVSA 1ZK4A 1ZK1A 3ZV6A 4J7CA 5ILOA 1UZMA 2VNAA 3D4OA 3PQFA 1YJQA 1ZW1A 2NQ8A 1D8AA 3OA2A 4N5NA 4OMUA 4TRMA 4B79A 4JJFA 3NEPX 1SOVA 4BS9A 1HL3A 4L4SA 5KIAA 4XB1A 4X54A 3IOYA 3V2HA 3AOEA 1T24A 1WDLA 1QYCA 1T25A 3W8EA 1BXGB 4IDBA 3ETGA 3C1AA 5KVSA 5JE8A 1NQAO 2JD1A 4W7IA 3KUXA 3H3FA 2V6GA 4Y67A 4ALMA 1EVZA 3FCOA 4M86A 4XJTA 4BO0A 5B4TA 1CERA 3E18A 4BNGA 3U0BA 2HSDA 4LRSB 4YJHB 3GUCA 4D3FA 1JAYA 1UJMA 3F4BA 2R6JA 4PLCA 3DR3A 4IQGA 3VPXA 2GSDA 2PNFA 1PSDA 4TROA 1ZCJA 2BELA 1Z7BA 3KEOA 4GMGA 1LQUA 4OM8A 1E1KA 3BMOA 2B83A 4I08A 5G0WA 1R15A 1N9GB 4CODB 1QYDA 4OKIA 2GUGA 3TQHA 5BNIA 4E2WA 5FWNA 3R6DA 3GMSA 1LSJA 1ISHA 4YAJA 1ZIDA 3VOSA 1OFGA 5C7IO 3ETEA 4UEJA 1PX0A 1PS8A 4BNTA 2TMGA 4QUKA 1X7DA 4BO6A 4CR6A 3QVSA 1RJWA 4CLRA 3GGOA 1Q0QA 4Q39A 4BUCA 1KIFA 4DLAA 3RAJA 4J0FA 4RPJA 3QVOA 2PZLA 4FGWA 3FBGA 1LC3A 1P1HA 4LRTB 3L6EA 4CL8A 1ULUA 2YDYA 1QYWA 1HF3A 2AG8A 4BGVA 4D7AA 3G17A 3JQGB 1KERA 1GZ4A 3WG9A 3ITDA 2VTEA 1AGNA 2Z1NA 4NG5A 4MVJA 2X7HA 4LCEA 1R0SA 3JQ9A 3ZCXA 4MPDA 3MCVA 3FTPA 4ZN6A 1IHXA 1KC3A 4AG3A 4R5HA 2DUWA 2O4CA 1PQUA 2RH4A 4LMRA 3V8BA 1XIVA 1PS0A 3CINA 2VOJA 2EWMA 4OXKA 2GZ1A 1RPNA 1UDBA 1B8UA 5LDHA 4TRNA 3NTQA 5TT1A 1UZLA 5DN9A 1RWBA 3NUGA 4BIIA 2CNBA 1FDUA 3FPLA 3I6QA 4CMAA 3CZMA 3M2TA 2PZKA 3BTVA 1IZ9A 5U4QA 4R69A 5CG2A 1P1KA 2AQKA 4H16A 4MVJF 3WJ7A 5L7TA 1N92A 4IXTA 1B26A 1JN0A 4NBRA 4WLEA 2X4GA 4PGFA 2HUNA 1G6KA 3TZHA 4KWIA 2J3JA 1VSUA 4WECA 3M6IA 1WP4A 5JCJD 2CF5A 4PZDA 3TF5A 4CUJA 4OQZA 3WTBA 1GR0A 2JCYA 1UP6A 3A14A 3Q2KA 3GDGA 5KWEA 3MJSA 2X9NA 4TKLA 4TZKA 1NHGA 5J23A 3CUKA 1V9LA 3IS3A 4K28A 4B8ZA 4CM1A 2JFGA 1ENPA 4AJNA 4BNXA 1I8TA 1JWBB 1UH5A 3O4RA 4DQVA 4ND4A 5IDQA 3PTZA 2VOEA 4YCAA 2Q46A 3JCZA 5IXYA 3KXDA 3SVTA 5IG2A 2OP0A 1NVTA 1CF2O 4UULA 5LCXA 3D5QA 5KVQA 1V3TA 1Z73A 4I9NA 5COBA 4JJIA 3F9IA 1SEVA 1FDTA 2Y0CA 3V2UA 1CRWG 2HKIA 2O48X 4RVHA 2GZ3A 2FR1A 2GCGA 3FPCA 1H6DA 3JQEA 2HRZA 1MV8A 3P2YA 3W8FA 4LISA 1LSUA 2IYPA 3F46A 4R4JA 2SCUB 3GT0A 5AYVA 3OIGA 1S6YA 3F1KA 1E3LA 3A1NA 1IPFA 2EF1A 2UUPA 4RDIA 5T57A 4FOOA 5GZ6A 1PZHA 1U3VA 2B0JA 4BNJA 1YJ8A 2O3RA 1BHSA 2ZB3A 4D3DA 2HK9A 1EUDA 3SBOA 3DAPA 1DRWA 3C7AA 3JQ8B 2HK7A 4IUYA 3DZJA 1TT5A 3UAGA 3OF2A 2VWQA 5T64A 3DB2A 3ROMA 1YL6A 4KWHA 1HDXA 3WS7A 2JFHA 2CSUA 2DQ4A 5BSFA 1ZEMA 3TL2A 3AI1A 5TNXA 2X0RA 1K6IA 2VWGA 2WE7A 1EDZA 2EHDA 2P68A 1T4DA 1ZMTA 2HJSA 1XQ1A 5DULA 1DIHA 4GPD1 2B69A 4BV8A 5HS4A 3LF2A 2O3JA 3NYWA 4L4RA 1DPGA 3B70A 5JC1A 4CM8B 1T2EA 4IZIA 2X0JA 3PRJA 2YW9A 2W8ZA 2E6UX 1T4BA 4R01A 3HHPA 1J4AA 4GLLA 1MA0A 4RLSA 3SJ7A 1V3VA 4XGNA 1KVSA 4O0LA 3JQBA 3PK0A 3FBTA 1KVRA 4NIMA 1U7HA 4ITUA 4DUPA 3IJPA 4XGIA 1MG5A 3AJRA 1ONOA 4J2OA 3UCFA 1D1SA 5I9LA 1NVMB 4A03A 4GGOA 1VJ0A 4NK5A 4RV9A 4MVJG 3RFVA 3MJVA 1Y8RB 1ZJYA 1P1FA 1Y8QB 4UEKA 1MB4A 3MJ4A 1LSSA 4OXYA 1BXGA 1H93A 4Y6RA 1SMKA 2EXXA 3OJFA 2Y1GA 3K31A 4TVOA 1NVGA 3HDQA 4YAIA 3CIFA 2O3QA 2F00A 4YJHA 1B0AA 4J9VA 4MKRA 4FDAA 5KCZA 1MUUA 2F1KA 5JAQA 2CVZA 4E32A 4L4XA 1NFRA 2CUKA 2VRCA 4PRLA 3GHHA 5F3RA 4Z3DA 1N9GA 2H63A 4WOKA 1BXZA 1GQQA 4MVJH 2YHUA 2QZZA 2ZIZA 4BNIA 4Z3KA 2YFQA 2C54A 4LVCA 2H6EA 1DC6A 4HNGA 4R1SA 4J1NA 4IM7A 1EE2A 3RUFA 1TEHA 4MKZA 3UGKA 4R1UA 4I5GA 3WFJA 1C1XB 1A4IA 2BGLA 4DA9A 2D5AA 1NQOA 4R1NA 1U3WA 2CVQA 1P9LA 1P3DA 4N54A 5EINA 1Y5RA 3PPIA 2YV2A 3ZGYA 5AXDA 3GN2A 5G0TA 5IDYA 3K8ZA 2GLXA 2QHXA 3GVPA 3Q0EA 1LBEA 2HAEA 3JQGA 4CMEA 6ADHA 3RC1A 4II3A 2WMDA 4BQRA 1HDCA 3PQDA 1LDGA 1UXKA 2AQHA 2Y93A 4PG5A 1UXGA 4YQYA 2PV7A 4QO8A 1LX6A 2O50A 1E5LA 6LDHA 1NR7A 2W2KB 2ZYDA 3DAGA 2VHXA 4GI2A 4L74A 4IDCA 1ADBA 2EP7A 1F8GA 1PGJA 1ONPA 2FR0A 2ZYGA 2I99A 2VNSA 3DDNA 1OMOA 3RJ5A 3I4CA 1CQIB 2X1HA 3ROKA 1A9YA 3E5RA 3CE6A 5TQVA 4BHTA 5FEUA 5IXSA 1DRVA 2J5KA 2R00A 2WWRA 2ZTUA 3G1TA 4HFJA 3UN1A 3C1OA 1LDBA 4P4GA 3ZWBA 5K6AA 4IDDA 3AY6A 3SJUA 3SC4A 4DTIA 2QG4A 4YAEA 2PKQP 4XKJA 3QJ5A 5THKA 3WGYA 4JBIA 2C59A 2P5YA 3GEGA 2EKQA 2LDXA 5U9CA 1QYXA 4DPLA 4HKTA 3K96A 3TZ6A 4CLOB 1BDBA 3IC5A 3K30A 3P19A 1BVUA 4YJFB 3DHYA 4HUJA 4QFCA 4NK4A 4BKUA 4BNUA 2WD7B 4W9NC 3K2BA 3ULKA 5EQDA 2B5VA 5G4KB 1PJCA 1PJSA 4BO3A 3A4VA 2FMUA 3INTA 2GN4A 2PWZA 1R4NB 3D64A 3ZHBA 3GVIA 3OHSX 5DDIP 3O8QB 4RVFA 4ZRMA 2R2GA 3EGOA 1LLUA 1ZXLA 2JL1A 2ILTA 5HRUA 1VL0A 1LXCA 2I67A 2PKQO 5IZCC 1O0SA 3KRTA 4ND3A 5A4DA 3VDQA 1XYGA 4BO4A 5K0ZA 1QSGA 4E0BA 4WCFC 4ZQGA 1MC4A 4L75A 5TGDA 3DZHA 4E4YA 2BD0A 3A28A 3HN2A 3AY3A 3U4DA 4HY3A 1UAYA 5JDCC 5DOZA 1R4MB 1KEPA 3NDJA 2SCUA 4JROA 1PL6A 2X86A 1A71A 3QV1A 1PQWA 1X13A 5CDTA 1FDWA 5AXBA 2CY0A 1VL8A 3GFGA 5DOVA 3AY7A 3JQ8A 3LQFA 3RBXA 2NNLD 1HDYA 5KJFA 1LU9A 5I8WA 1Q7BA 4J4HA 2OMEA 1NPDA 1HE5A 2I9PA 2C5AA 4IXWA 1EE9A 3WDSA 5TX7A 1E0DA 2OOSA 3QLJA 3GVXA 3ZZNA 1PGQA 5DCYA 3SEFA 5JC8A 4XEHA 3VH3A 5FI5A 2WYUA 1H94A 3S8MA 4TQGA 4OKNA 4YB8A 4IS3A 2C7VA 4DBVO 1SAYA 1YDEA 3WXBA 3KOUA 4CPDA 2X9GA 1E7MA 3GR6A 2HMTA 4CM8A 4LK3A 1V6AA 4LGVA 5A9SA 1V3UA 2DTEA 4R41A 4CV3A 2G5CA 3GGGA 2NU9B 1YDWA 4E2YA 1B2LA 4E33A 5TLSA 1DHRA 2JCVA 3INRA 4XYBA 3RD5A 4Z6KA 3VPGA 1WMAA 2C2XA 1YB5A 3AUUA 2J5QA 3RUHA 2DLDA 3NT5A 3DTYA 4P4LA 1I3LA 3ZU5A 1PL8A 4IDFA 4Y8VA 2ZK7A 1Y9AA 1OAAA 1EK5A 3DMTC 3OSUA 1C1DB 4FFMA 3DBHB 2OGUA 3LT2A 1HDGO 3OP4A 4ROSA 3FNFA 4BNYA 2VYND 5L51A 1Y8RA 2GYYA 1Y8QA 4ID9A 4PLWA 3SX2A 4AJ1A 2PK3A 2DFVA 4K26A 1U7TA 1YB1A 2FR8A 3QWHA 4NPCA 2JKVA 1SC6A 1I33A 1H5QA 1CQJB 1Y1PA 3IIEA 3K5PA 4RO0A 3JTMA 3RC7A 3L0DA 1HZZA 3STHA 1E7RA 1PWXA 2HCTA 3RC2A 1FXSA 2QYTA 3DBLB 3K2EA 2W98A 4IY1A 2NUAB 3RKRA 2GN8A 1QRRA 3C8MA 1A27A 3GEMA 1ZK0A 2IEDA 2EJWA 2VRCD 3UKOA 2A35A 1R0LA 1C0KA 1KBZA 2NADA 1ZXBA 1BVRA 4BL5A 4RVDA 4CV2A 1ZUD1 1SOWA 3W4KA 4F45A 3E03A 4ALLA 1BSVA 1PR3A 4CLDA 3JD4A 2FZWA 4MP8A 4LW8A 4AVYA 1E1NA 3HZZA 3W1VA 3X2EA 1QR6A 1P77A 2NWQA 1C1XA 3TNLA 5HWSA 4M49A 5HBRA 1GUFA 1U2GA 3TZQA 3CKYA 2IZ1A 4KUGA 1A7AA 1E3SA 5TC4A 2CVOA 4WE3A 2BFPA 3JQCA 3GG2A 1ISFA 3G3EA 4DMLA 1XHLA 4GGPA 3BYZA 2DPGA 4TWRA 3AI2A 5BSGA 3O38A 1SNYA 4ILKA 4MKXA 2WYVA 2NVBA 4C4OA 3VZQA 3GF4A 2Y1FA 2ZTLA 1EK6A 1PS9A 3JYQA 4HXYA 3A06A 2W2KA 1VL6A 3R3JA 5C3MA 2ZJ1A 4P8RA 3DWFA 3T7EA 4CQMB 2ET6A 4FFOA 4NU5A 1GDHA 2WTBA 4MP3A 3ZV5A 3FN4A 3TRIA 1K0UA 3IKTA 3VVBA 3PGXA 3E82A 1GUZA 3F1LA 4CMIB 3WB9A 4WPGA 3BMQB 5ICMA 1QP8A 1MXHA 2BI8A 4JK3A 5JPIA 3WGGA 4ZHSA 4H7PA 4DYVA 1Y5MA 4CMHA 4FSHA 1X7HA 3M1AA 4UVEA 1L1FA 5JNLA 1XU7A 1GYRA 3WYCA 2DPHA 1DB3A 1JW9B 3ROQA 5DCUA 4ALIA 4XB2A 5T8KA 3OJLA 3BHIA 1CJCA 1NFQA 3F4LA 1JLLB 4CLOA 3KYDA 1Y81A 1YVEI 2GN6A 3WMWA 1PZFA 4YJFA 2C5EA 4DXHA 4H15A 5HA5A 3WYEA 4DRYA 3BZUA 1QV6A 5G4KA 1EQUA 3RBZA 5L4LA 1UUFA 1LI4A 3DQPA 4DIBA 2PGLA 1MFZA 1R4NA 3AUAA 4Z0HO 3OM9A 3U3XA 3P5SA 4ALJA 3AM3A 3H2SA 3O8QA 3I6IA 4L9RA 4D0RA 4F3YA 4BO9A 4LSMA 4AFNA 3L9XA 1LLQA 1PJQA 1GEEA 1E1MA 1PGOA 1UXIA 3LSYA 3L6OO 3LDHA 4XX0B 4NFHA 1WZIA 2EV9A 5BSEA 5ER6A 2OFPA 1GCUA 3T7CA 2EKLA 1LRLA 1YL7A 2FWMX 4R9RA 1RKXA 4PG7A 5COAA 1VJ1A 4MJLA 2YDXA 2ZB7A 5I9NA 4N5MA 3BHMA 3NGXA 4QEDA 1E92A 1R4MA 3DBVO 4CR7A 2IEBA 2FOIA 3T4EA 4QQRA 1O8CA 4PVCA 2IXBA 2PGDA 2I3AA 2QRLA 1HZJA 3KLMX 4G65A 2JD0A 3A9WA 4AJHA 4PLGA 4BNKA 5TIIA 4FR5A 2EKPA 1GADO 4U6SA 4YRDA 8LDHA 2EP5A 4CMCA 1Q1NA 2Y0EA 3G1UA 1R0KA 3JQAD 4PLHA 1HDOA 4Q3AA 3WTCA 1NTOA 4D43A 2Y0DA 5F21A 5AVOA 5MGBA 4S1VA 2PR2A 4CM4B 3W6ZA 4E5KA 3BAZA 1YO6A 1K6XA 1NWCA 4GX1A 4BNFA 3NV9A 4GKBA 3B1FA 4A5OA 4D45A 4E30A 3EK2A 5ITWA 4CM6A 3VZSA 2POQX 4WEQA 4NJMB 4KTTE 5T5QA 4B4OA 1LDYA 4RF3A 4E13A 4NBUA 3K92A 2VWHA 4OGWA 3GNTA 1EBFA 1IHYA 1E5QA 1OC2A 1RM3A 3DZFA 1L7EA 2D1YA 2YFHA 2D2IA 4D0SA 1I5RA 1ENYA 1HDZA 4EI2A 1B8VA 2X5OA 3PVZA 2NU9A 1FMCA 2C82A 1T2DA 5TRTA 4EEZA 5THQA 1DXYA 3FTNA 2GGSA 3VPSA 2YY7A 3VKVA 2CDBA 3PHJA 1M6WA 4BNVA 1NFFA 3GVCA 4EDFA 4WOJA 1D4FA 5U1PA 5H82A 4DWVA 4HWKA 1GQ2A 2GDZA 3FF4A 1CDOA 3Q6IA 4XGKA 4YRAA 5A5EA 3X2FA 4BNNA 1DFGA 4JBHA 3ZNPA 1C1DA 1QG6A 3KM0A 4NDNE 3WSWA 3DBHA 4GL4A 3LVFO 3HDYA 1ADGA 4J4TA 2FRDA 2WSBA 3K73O 3RI3A 3DHNA 2BH9A 2Q4EA 3RQSA 2YHIB 3TZKA 2J3HA 4EGFA 4MVJM 5TJ9A 5EIOA 4R51A 5IFLA 1E6WA 3D5TA 3ZV4A 3L4BA 3V1UA 1CQJA 1K5HA 2ZKLA 3RUAA 2Q49A 2VUTA 4JCOA 3AOGA 4A27A 5KKAA 3RUIA 3EVTA 1B8PA 3GMDA 4YJGB 3DBLA 5JAMA 2NUAA 1Y7TA 3ZW8A 1YBVA 1JWAB 4OJNA 5F1OA 4F6CA 1GPJA 2Y1OA 4W99A 1EVJA 2VUSA 4Y6SA 3VKUA 4IQ0A 1WDKA 1U8FO 5JW6A 3MWEB 3EUWA 4J4BA 3HUDA 4JGBA 4Q3DA 3WNQA 3FWNA 5JDIA 1E1LA 4K6FA 3CXRA 3F47A 5L9AA 3GOHA 4UUNA 2Q4BA 2JHFA 4RQUA 3JD2A 3ZNNA 4MIEA 4DC1A 2VQ3A 3V1TC 4CQLB 4M87A 1VKNA 2VRBA 3PJFA 2P9GA 3EDMA 3GC6A 3LC7O 1FDVA 1JKIA 4HBGA 2Q2WA 4IMRA 4M55A 4RF4A 4ALKA 5IZ4A 1GYPA 3PHLA 4DGSA 2GR9A 3ABIA 4FJ1A 3D7LA 2B37A 1U4SA 1IY8A 5AOVA 3UW3A 2IYOA 1JVBA 5L4SA 3KETA 3F3SA 3F5SA 3G79A 1KVUA 1TT7A 3LK7A 4IMPA 1MX3A 2BKAA 4J90A 4KTVE 3MJEA 1O9BA 4OAQA 3FNGA 3R0IA 2AXQA 3EYWA 5B1YA 3TJRA 4CQMA 3Q9NA 3ZWXA 1VPDA 4FFLA 1BTOA 1VKOA 4PRKA 1B14A 4Y6PA 3NT4A 2GNAA 3ONEA 2HDHA 4B3IA 3U49A 2I66A 3PGJA 4IS2A 3GN1A 5BNTA 4FD3A 4CUZA 2AEJA 3ASVA 3Q3CA 3TZCA 4KQXA 4HFMA 3BMQA 4N5LA 4AJJA 1CWUA 5L7WA 4TRJA 1NBOA 4TVBA 4YVFA 3HNPA 4UUPA 1F8FA 3JQAB 3RIHA 3WR5A 4E5MA 4GAEA 1Z6ZA 3ZWMA 4XIJA 3JYNA 4UUMA 4HADA 1G1AA 1YONA 4BVAA 1B3RA 4KZPA 1JLLA 4J3FA 4WEOA 5JS6A 3LYLA 5C7LO 4HNHA 1IL0A 1TVEA 2XF8A 3U9LA 3E9QA 3EZYA 4MIOA 5JO9A 5KKCA 2ZATA 5EERA 4AJ2A 2H9IA 3QWAA 2JCXA 3E9MA 1JQBA 2QRJA 3DC2A 3PZRA 4P4NA 4NH4A 2IZ0A 2AEMA 5FYDA 1DDOA 1KEVA 3L77A 5JFOA 1HKUA 4HP8A 3ZV3A 1XWFA 2I65A 4XX0A 3JQ7A 4WGGA 4WJZA 3OIFA 5ER9A 3G49A 3N74A 1V0JA 3IQDB 4EJMA 3DBRB 4E5NA 5B4UA 3OBBA 2XXBA 2NU7B 1LA2A 2ZJ0A 1K2WA 4BB6A 3LT0A 3HE3A 2GPTA 4P22A 1GV0A 1EVYA 3PHHA 4MVJP 2Y1CA 5L7YA 3R3SA 1Q2XA 4DVJA 3AFNA 1MLDA 3ZWNA 1K6JA 1WZEA 3VTFA 1E77A 5EESA 5A3JA 3UFXB 2VYNA 3BHJA 1HWYA 5AXAA 1G0NA 9LDTA 1DEHA 3MOIA 4J9UE 4BO2A 3S2IA 1U9JA 1F06A 3VZPA 1X1TA 2X5JO 3RJ9A 3BTUA 1K3TA 2NTVA 4IJWA 4ZQBA 3AM4A 4CM4A 5CEFA 2AG5A 3IP1A 2VUUA 3H8VA 3AW9A 1XG5A 4DPKA 1F0YA 2C20A 4RPLA 1CIVA 3E1KA 2X8LA 4HFRA 4Z9XA 4BGUA 4BNWA 2O4UX 4AL4A 4XRRA 3H3JA 3ENNA 3VC7A 2TMDA 4NJMA 3ZU4A 5ENVA 5CDYA 4M8SA 4NQZA 3DZKA 5KOIA 5HTOA 2XOXA 1WPQA 3JQFC 3TN7A 3OH8A 4OO3A 2PD4A
chains in the Genus database with same CATH superfamily
1UT6A 2XOKD 2AFHE 3V8QA 1BKDR 2HU5A 2ZUBA 2BHSA 1U28C 2BMJA 2GHTA 3IURA 3IKVA 4WA7A 1JQJC 1AXEA 3SLKA 1Z6XA 1XQ9A 2H2DA 4HNRA 4GQIA 3C15C 4BTEA 5EJ2A 1DC4A 1VL1A 3PWZA 1TZBA 2HBRA 4NKRA 1ULSA 5DN6A 1RMTA 2ZRLA 3SP1A 3SYMA 3VVLA 3MGCA 3L0PA 2NSDA 3KSDO 4N48A 2OPHA 3Q12A 3ET5A 3MIIA 3Q8WA 1E6EA 3PFGA 4X1KB 2EDCA 1VI2A 3K5WA 4D41A 2HWWA 3HXKA 2X7JA 4HWGA 3TBKA 3L07A 4YUWA 1SC9A 1V1RB 1SO8A 4TWBA 3A4NA 1TA9A 3EZ6A 5D1HA 3CZ5A 5TMEA 4MWTA 3F6BX 4ESOA 4CNQA 2Y1DA 3ESCA 4BP8A 1AK9A 3TGWA 1NNUA 2QJTA 1DKOA 3UG7A 4HSGA 1G19A 3WQBA 4B2LA 4BNZA 1G8KA 3AWIA 3NDIA 2E5LB 1NVKA 1KYYA 5FUMA 1QKIA 2BFAA 3SR0A 3CVVA 5I47A 1M2WA 2OO5A 4ZOLA 2O1EA 5C9ZA 2IS2A 4D46A 2WE8A 2YHIA 3GXBA 4MQMA 2K4MA 4YRLA 3TIXB 4AN0A 1KJWA 1M6VA 4B8YA 3QRWA 2PMDA 4MO2A 3BWBA 3GRPA 2YHBA 4LQLA 3QOFA 5KHOC 4J0GA 1L1RA 2CCJA 2MYPA 2QN2A 5J40A 2XGJA 1Z4OA 3KUUA 1I7NA 3SFTA 5LKAA 5EP3A 4J2TA 5EY5B 2JLYA 1DU4A 2GDJA 2I7VA 3OZEA 4NEHB 2ISCA 3AQIA 2PXXA 4DEXA 3J81k 2WU4A 4FFRA 2C2YA 5DGTA 1KI9A 1TUBB 1SXGA 4FQ7A 4MXDA 4PSKA 4JUFA 3OT5A 4Y6GB 5CAEB 1F5NA 1YC2A 2ERCA 1D6JA 1ZD9A 4Q16A 4K0RA 4Y1RB 4DWWA 1CJUC 4GYWA 4U7HA 3BCSA 5AWFC 1EGVB 3Q2OA 1FSPA 2IE0A 2EGHA 5JTUA 3Q2IA 2WKPA 2O5VA 1G63A 2O3TA 1IWBB 4AC9A 2BKVA 2QD1A 4LQ4A 3JZMA 2VAPA 3EAQA 3JQ6A 4L8VA 2XQFA 3EZXA 1CZNA 1TW3A 4F6RA 1ZM3A 4OYRA 3D5EA 2DQYA 5CPFA 1A7JA 1UWLA 4POAA 5CJPA 3KKLA 3MUFA 5FL3A 4BU1A 4BMSA 1EFCA 3D6VA 4KRGA 1PT8A 4K3UA 1AHHA 3EXFB 1ZW6A 1U0TA 3DO8A 1T9HA 5ILGA 1Y3HA 2O8BB 4WKPA 3NKFA 2OCIA 3T54A 2OD9A 1ZL2A 5CX1A 1SBZA 4LI3X 2RBEA 2YJGA 3BSYA 1CUYA 2BE9A 2XUAA 4I6EA 2O2CA 2W0SA 4KGDA 3WLFA 4BX0A 1G2QA 4CLXA 2ZSUA 4I1UA 3DP7A 3SXPA 4OI1A 3T1QA 1RDFA 5F4BA 2NVUB 1JXMA 2CJPA 3G8DA 2HWKA 1FFHA 2EFDB 3CZQA 3ELUA 1COWD 4HRAA 4QFMA 4WNCA 4AB1A 1UBRS 1ISMA 1VHJA 3DAHA 1ECCA 4IQ8A 2IUYA 2CK3A 4RXTA 3SEZA 5KSZA 5LOVA 1BG6A 2QTHA 4YMSA 4HATA 2IU0A 4EW6A 4N6GA 1A76A 2CDRA 4LGYA 3HFSA 4CE6A 2OM6A 1VRWA 3IUJA 1Z39A 4DLNA 5CD9A 1EQ2A 3FKJA 1KY5A 4Q4HA 4RL6A 2DYKA 1J9GA 3EQ2A 2OXTA 2XRYA 4ABYA 4ZA2A 3HR4A 1HLDA 3WL8A 2VJMB 1WL8A 3DZIA 3CNHA 1KMHA 3WXMA 3NLLA 3ILSA 3S2GA 1N6OA 1NI4A 3ZZMA 4EQ6B 4YCLA 1YS1X 3HR7A 2P3QA 1MG0A 4IGFA 2CEAA 4P80A 4W1SA 4Y9DA 4KZKA 2TRSB 4KAJA 1NN3A 1Z75A 2V8OA 2Y66A 4MWOA 2I4OA 2PZGA 4NBWA 3UUWA 2P5TB 4JR2A 8ADHA 1EYZA 3SGLA 3IP7A 1N7HA 1YCGA 2P4QA 5F5XA 1L7OA 4TL8A 4ZVLA 1P9OA 4FOPA 4QRIA 1EP1B 3A9UA 4IV8A 5HKLA 4A0SA 1KQOA 4ZHQF 5DB4A 1B4DA 3D81A 3V80A 1IDOA 3AHHA 1BN6A 1T0UA 1J1IA 2B1QA 1QORA 1NYTA 3F6SA 4DMGA 4JI7B 4M9ZA 1E4YA 1Y6QA 4G5QA 3GFFA 4RK6A 2G5PA 1SUSA 2VBIA 4X93A 4PQGA 5DGHA 3A4LA 4LZPA 4W7HA 4RPHA 3W1EA 2CXOA 1XZLA 2UAGA 3U5ZB 3ZIAD 4ABTA 4LYGA 3WYNA 5LIRA 3U0VA 1ECFA 2F48A 1MJGM 4CF6A 3B9PA 3TSOA 4CU2A 1KBOA 5JVDF 1EFPA 4NATA 1MOPA 5TQJA 4BRUA 4G89A 1TAHA 1YI8A 1W29A 2C61A 1USWA 3LVRE 1TO1E 3K0FB 2WSSD 1V26A 2UV8A 4PYOA 2X5XA 1Q16A 3VSCA 3K9QO 3DBRA 4GH5A 4I9UA 4P38A 4YRMA 5HKOA 4DREA 4RTPA 3KVRA 5EJ9A 5E6UB 1N1GA 1XVVA 5E1OA 3L7LA 2NMVA 4OQFA 1HLPA 3GLHB 4MI9A 1VE7A 4AZ3B 1L5MA 2P1ZA 1V5EA 1Z33A 4UCWA 5BPHA 4OCZA 3NJ4A 4PZEA 3CH7A 4RSHA 4DUGD 5FAXA 3WNCA 1HLFA 1ZOPA 4QOHA 1QUEA 1ISGA 1MZVA 2HA6A 4M98A 2FN8A 3E23A 4R6WA 2GEJA 1P2VA 1L5FA 1Q1BA 3JPWA 4MINA 3BCHA 3ZD9A 4F04A 2R8YA 2HU2A 3EBPA 4V38A 3FSEA 5FNVF 5SICE 2C9BA 2JBAB 3EY9A 5DHAA 5K3SA 2O05A 2UVQA 5JMPA 4NF2A 4OF4A 2QN7A 5JSZA 2G70A 2ECOA 4FW8A 4KK3A 1GPYA 3L1IA 4Q3NA 5LD2B 5IVHA 2CFOA 1EWKA 2NZWA 2QUHA 3LQ1A 5J4KA 2GWRA 3QYJA 1XVTA 3PNMA 3D4PA 1E94E 1OI2A 4CW7A 1J0XO 1EVIA 1LPAB 1DEAA 4Z7NB 4IV0A 1YR2A 3CRZA 4RTLA 1US8A 5AKIA 2FJ0A 1I7DA 2FWAA 2WPDD 3G0GA 5G2OA 3RSLA 3TWOA 4D80A 3EX7C 1BU5A 3QXSA 3NC4A 4LWZA 3QUCA 3PI7A 4A2PA 4AW9A 1IVNA 4ZGWA 3JYHA 5J4HA 3SZ3A 1FF9A 3BJEA 3DE0X 3GJRA 4GSLA 1MPTA 1JDZA 1XKLA 3R0ZA 4J6FA 2X4DA 3OQBA 3BAFA 1IHDA 3ABZA 1HEUA 3N2GB 4GVXA 1O6BA 1VC2A 2GEDA 4HFNA 3EXIB 2C8KA 3NJ8A 4FCTA 2ID9A 3KHSA 4WXHA 4EKEA 2Z95A 2XKAA 4UJ5A 5JXGA 4RY9A 1G18A 3MXTA 4G1BA 1V8BA 3V8EA 1ISPA 4HVCA 1Q7RA 1M9NA 3QBVA 3AIKA 5LSAA 3ZBQA 2DWCA 1CUBA 4HDNA 5F33A 1DC3A 4L0QA 3PWSA 4UEOA 4BVGA 1WHSA 4EKNB 1KTIA 2BBSA 3ANMA 1XL0A 3SJBA 1YA8A 4QRDA 1K2VN 3OTGA 3PVCA 2FK8A 2JKZA 3PC6A 3WLPA 4RHUA 3TZBA 3VAZA 3KXLA 1K89A 2F43A 2OCGA 2QLJA 3WL7A 2WJ4A 1A5TA 3WJAA 2BFFA 4BEWA 1JHMA 5C32A 1OWNA 1LBHA 2FW8A 3V6LA 3KZNA 4J16A 3LW7A 1YL5A 1O5TA 3LE8A 1ZZEA 5EZYA 2X41A 2GILA 1LPPA 3ILYA 1Z7GA 1IM2A 2E9SA 3X1WA 3S8EA 1AE1A 4R2IA 3OIWA 2XR1A 2PDAA 5JSYA 2OHHA 3MJCA 3UGJA 3SIRA 3HCRA 3WHIA 4BGDA 2WT9A 3LLSA 1OLSA 1UXJA 4AO8A 3BFVA 1N2XA 4RKRA 4C03A 5KTKA 5EE9A 3FZGA 2VHZA 3I62A 5I5GA 2IZZA 1GGNA 1PI3A 3CWZA 1TUIA 3WDKA 3I6YA 1C41A 1XDUA 2WB4A 4RDCA 4N0EA 5A3SA 3BD9A 2F8SA 3RFTA 1EUCB 4IHKA 3HB4X 4JI1B 1P0MA 2X5KO 2P75A 4RK1A 1JA9A 1IEXA 3O0DA 3RODA 2R8EA 4KPGA 3ANXA 3KBOA 3TW8B 5A1TA 3FOFC 2QYHA 1WB4A 3H5AA 3IA2A 4K6MA 3A31A 4MWBA 1WCIB 1SKYE 4UOQA 1XRMA 4I5DA 5TB5A 1YRLA 2WD7A 1HY3A 3R8FA 3EEQA 4ZT7A 4UMVA 2WEKA 3MS7A 2JGLA 4DSUA 5JBIA 3NHLA 4J1QA 1WF3A 3V8PA 2IPXA 3VUEA 5A04A 1P8AA 1LQTA 5IZCA 4RAQA 1SULA 2I7CA 2EG5A 2GETA 4PINA 4QUAA 3ZCVA 4PLTA 3O8LA 3KEQA 1AUOA 2HNAA 3F49S 3U44B 3MLEA 4K6CA 4DQLA 3M34A 2F7SA 4QJIA 2RSLA 1IOLA 1OBFO 1L7BA 4XQGA 1WCWA 4MR9B 1NURA 4P5PA 4TSKA 2Q1XA 3RT1A 2BFBB 3VQTA 3WMGA 3CYFA 3IV6A 1MU0A 2VLIA 3RTAA 2VT7A 3KEGA 3PZBA 1XGKA 4MKIA 4IUBS 2CD9A 5AK0A 4PVDA 2B98A 2QLLA 1YQTA 1ZU5A 4AYXA 2QRKA 1EZ1A 4C88A 3VR1A 2W00A 3H84A 2ZRDA 3PWKA 1U2EA 5EJ5A 2IBSA 2BKXA 3FHOA 4RZXA 2IHJA 3DNMA 3PNLA 1KJ9A 2GHRA 2R8RA 1AN0A 2OUIA 4FS3A 3VKHA 2CLEB 3OKAA 2VFAA 3TIGA 1E3TA 3PNOA 2VQEB 1Y63A 3EC1A 4I0WB 4XIYA 3WQQA 3V1MA 2F3PA 1HYBA 1ZWLA 1XRSB 4A0HA 4XCQA 3UK1A 3B3FA 1FDSA 4R71A 2GD1O 1B1CA 1KEUA 1DC5A 3Q72A 2J33A 4MS4B 3WIVA 4OIMA 1XROA 3OZBA 4H9GA 4WUTA 4ZTZB 3FHLA 1N0IA 2GD2A 2C5GA 3HG7A 1SA0B 1L7RA 2BBWA 5LLSA 5CBPA 3ADPA 4AI6A 4HI0E 1J2TA 1PTJA 2GK3A 4OP3A 5LZ4A 1KKMA 3MPOA 4DLZA 1UDRA 5J47A 1JNYA 5KHAA 4LJ9A 1QJCA 1UP4A 4MJ3A 3MMXA 3E48A 2ZUFA 4LJAA 1F12A 4NCBA 2VJKA 3N0VA 1V1MA 4BDSA 2I6TA 2EEZA 4UVGA 1HDEA 1QJ4A 4JQOA 4YFYA 1ZIXA 1FQOA 2C97A 3DNPA 4JHXA 4O4JA 3JQBC 1X1SA 4YC7A 2ZQZA 2XUPA 2KS6A 2ZU6A 4JP3A 4LYJA 1JHDA 4LHZA 1LK7A 4TV8A 1TPZA 3LV8A 4QYMA 4LRYA 4OI0A 4L5CA 4YDQA 3VYUB 1UBCA 3O9ZA 4FJ2A 3N87A 3QX3A 2BR4A 1XVIA 1RHMA 2WJJA 1QOPB 3FPKA 3QELA 1PFUA 5C18A 5KYYA 2QSUA 4OH7A 3QX7A 3TLGB 4QJ3A 3S40A 1B42A 2JJ8A 3EXG2 3DMGA 3LXMA 3DMTA 3I9MA 4OHFA 1C4KA 1J0DA 5BN5B 3VR3D 5J43A 5LXTA 4MICA 3ZD6A 3A9VA 4JELA 4EB3A 2HX1A 3UT5A 5F5LA 3PQCA 4LKOA 2DEUA 3LSTA 1XHFA 1Y9ZA 1VBKA 4FFVA 4QAJA 1KYQA 5C5CA 2QAGC 4R68A 4AKHA 2PD6A 4I5EA 3OE7D 3FKSD 4IINA 3WGIA 1RAEA 4CF3A 3HN7A 2XYQA 3AR7A 5AKYA 4ZZ2A 2AOWA 1NI3A 3OTHA 4GC9A 2B5WA 3OC6A 2XWSA 1O7JA 5ALHA 3A37A 1H9BA 2CCKA 4HDMA 5IYZF 1KZHA 4W82A 1ONSA 2V7BA 2IW3A 3L7AA 5DHQA 4E5YA 5TVKA 2W70A 5E9WA 2XZLA 1GPBA 1SK9A 3BH7A 3L5KA 3TR0A 2ASVA 4YROA 4BQEA 4PFJA 2QRVA 3P2MA 3I9LA 2YQ5A 3LKZA 4FB5A 1DCTA 3VO9A 1YS9A 4XUDA 5FJIA 3UAWA 2BGUA 3H9JA 3L7CA 4RD2A 3GLFA 4FHDA 2QXTA 2GPJA 3IOBA 5LZ8A 3U3DA 1W4ZA 1DC8A 4YK7A 4TSRA 3OJ0A 4N65A 4YRPA 4F6LA 5GIOE 2BFCB 3HWRA 3CSDA 1U8AA 3EOBI 3GLSA 1ONNA 5EFOA 3UCEA 1LLCA 3P9QA 1ZD4A 1D1TA 4JJ6A 1F9AA 3KSUA 3MWDA 3PRYA 2BEWA 2C4NA 3I5MA 4J3JA 4RVGA 3HB5X 3EWAA 1SC4A 2YJNA 5B3KA 1BX1A 1GARA 1KU0A 1ORRA 1VG0B 1YXMA 3FNIA 3TNYA 2J7PD 4NPAA 3H7IA 3CF4G 3RU3A 2QIPA 3GW8A 4IIJF 1O54A 3AF1A 4EHJA 5EZQA 4D3SA 1OH8A 1U9IC 1HSZA 2D5CA 4P2GA 1J2JA 1PZGA 2BIFA 4C0SA 5JLAA 1NAIA 1CR6A 3OOWA 4JC5A 2G08A 1SD5A 4QARA 1I7QB 3L7DA 3QF7A 4HB3A 2VXBA 1WKCA 3LUBA 4KN8A 4UTVA 4FGZA 4FJ0A 1NUUA 4MDYA 4E14A 4X44A 3CRRA 2F3UA 4M88A 5E4TA 1YA6A 1PO7A 3LUKA 4ZKEA 3PIIA 1GIAA 3VDMA 2P2CA 1Y1QA 3BL5A 1H8HA 1KK0A 2EJVA 2O9JA 1C14A 2HPAA 3TAUA 1PL7A 3ITEA 3IB3A 1KO4A 4BAUA 4TN1A 3DULA 4B4VA 5BRJA 4F4IA 3W6PA 1FBTA 1Z16A 3IERA 4I4TF 2H54A 4S1TA 4Y18A 4FGLA 2P0EA 4L8LA 1D09A 4PYQA 4R3WA 4YFVA 2G1KA 2ZROA 3G2KA 5LD2C 5FD8A 3WGQA 2I76A 2RAFA 4CXMA 3EG9A 4URXR 3HDHA 5CD1A 3IGFA 4HLQB 4CN9A 3L82B 2JIBA 3C85A 3C4VA 1CLEA 5HCIA 3OE4A 4CQNA 2P9HA 1HR0B 3HEBA 4G5SA 4L5IA 3F6CA 4A4DA 1AKRA 1SQ0A 1W76A 3BIXA 3A2MA 4CFYA 3ORRA 5TPWB 1LRJA 1LTKA 3CXUA 2IX3A 3LS2A 3OJOA 3L05A 3GDHA 4XARA 1CEEA 3OQ6A 3GBSA 5J2TA 2ACVA 3BMNB 1FVHA 2PXHA 2GCPA 3O1IC 4ONEA 4O2BB 4M8IA 4L2IA 4WT7A 2FZ4A 3LPCA 1HXHA 3QY9A 5BRAA 3AHJA 4S2UA 5A7FA 3L1JA 3CM0A 3E70C 2VHVA 1SU8A 4GR5A 4Q7QA 4F93B 2ORED 4PHTA 1V25A 1NF2A 2FUNB 1GZ7A 5DV9A 1Q7EA 2OGWA 3JSAA 1R5NA 1RKUA 3MA0A 4Y2SA 3AX6A 3NX4A 3TZLA 2BH2A 1DTSA 3KV3O 4G5GA 1TECE 1ABEA 1K7SN 1KPIA 5L3VA 4OX9B 2AMVA 1GTG1 2ID8A 4KE8A 4TTPA 5IKPA 2WINI 3E5NA 1E3IA 1AA9A 1QH1A 3W5DA 4TYYA 2I29A 4P0QB 4MQBA 2YYZA 3KWLA 4N8EA 1G291 2QLMA 3EA4A 1IULA 3M6MD 1H5UA 2EJBA 3P9RA 1HH4A 3PT9A 4OJYA 1KO5A 1PG5A 2HF2A 5F1PA 3PJRA 5D5QA 4PZZA 2AI2A 1IEQA 5CB8A 1E7WA 3AU8A 3CUEF 2FSSA 5ENZA 2C8VA 3OX3A 4XTRA 1O6GA 1QOQB 2CF6A 2RARA 2G04A 4GT1A 1XTSA 4V39A 1BW9A 4A5SA 4RL4A 3QKTA 4D9IA 2EFEB 3GLIB 2CNWD 1VJ5A 4QQNA 421PA 5L3QB 1SU6A 2HIAA 1IUPA 3C7CB 2IXAA 4Q48A 3BL8A 3I76A 3SHFA 3T7IA 3ZDZB 2W11A 2HMUA 1W4RA 2IV7A 4FS8A 3F9RA 3LUCA 1WJGA 5JMTA 2QVLA 5A9SB 1YF3A 2FE1A 1K4YA 3EZLA 3HVIA 1TF7A 1GCOA 3LRXA 1YGYA 3PCTA 3QPBA 5KYVA 4AMYA 4KPYA 1I30A 3CG0A 3JWHA 1JB1A 3ITKA 5F98A 4DSNA 2O3SA 3KAJA 4KE6A 3DHEA 1MO2A 4EUHA 2WVAA 3WDLA 1E1RD 3I6MA 3AVOA 3ZZUA 4JIGA 2AV6A 3BRQA 4IDAA 4X5OA 4CZ2A 4QOSA 4RGVA 3AJEA 3V4RA 3FPFA 1QFZA 1JH9A 1LC0A 1DQSA 3A6EA 1JDNA 5AW5A 1HNZB 5AW8A 5KYWA 4BFWA 3SXJA 4AMUA 2B8NA 2Q1YA 1ZLYA 3HWX1 1HBJA 3C24A 1ODKA 1KO1A 5CDHA 4UD2A 1Q44A 5EZSA 5EFZA 2ZRAA 1AZTA 4AQYB 2YNMA 3KYCA 3WGZA 5JSKA 1X80B 2B35A 4XWTA 5FBVB 1DZIA 1TQ8A 3BJRA 3L6UA 3ZI0A 1AA6A 5CDUA 2J1LA 1SKBA 1K88A 4G07A 4GPTA 3BWMA 1T6ZA 1ID1A 3PFKA 1NR1A 2PT7A 4W5NA 3H83A 1SHUX 1V8DA 2IYTA 2NLOA 4P81A 4UCXA 4BX2A 2D3WA 4OB8A 1P5JA 4OOFA 5EA2A 1GT6A 2PUFA 2AZMA 3NR2A 5DRTA 2DT8A 1YR9A 2RFLA 1XCPA 3PGA1 3RU7A 1THTA 1G3QA 2DR3A 2JHAA 3FYSA 4CG3A 4JT4A 2XD4A 2G1AA 4PG4A 4REQB 1KOGA 1XRRA 4JN6B 2IYEA 2H8GA 3G0IA 5KOHB 1HEIA 3FYUC 3H7AA 3QFSA 4BO5A 2QE7D 3IHWA 1Q7GA 1GTRA 2CMDA 3JTEA 4ZU6X 3PC2A 3PXUA 4NAUA 2FV8A 4M1OA 4Z9AA 2FEAA 4WNIA 1J8QA 2GBFA 5FWXA 3CY6A 1DWQA 1JS1X 2AI3A 2EFHB 2WU0A 2OYCA 5AUPB 3HU2A 1T6BY 3OFSA 1JEOA 1OAOC 1Y3DE 1GUDA 2NG1A 2XDWA 4JASB 3DDWA 1NMSA 2CDAA 4QPNA 4DR5B 3GLVA 2Z09A 1ZO8A 3NM6B 4JLBA 1ORVA 1E96A 4BY9E 4GLBA 4EF6A 2WAOA 2FEXA 2D4AA 2AXEA 2N47A 3G2QA 3Q9SA 2M1XA 5COQA 4EA9A 5JS7A 4HLUA 1HA3A 1M1XB 4IVPA 2WU1A 5FI3A 2OT3B 4ZJZA 2XB2A 2RK3A 5CK5A 1KH1A 3HJBA 5BN1A 1KI3A 4MW9A 4F9TA 1KJZA 2REQA 1J56A 4M0CA 1CHDA 3A1FA 3K53A 5JXWA 4IUDS 3V1NA 3T4XA 2W4QA 4QO7A 1WXEA 3TKAA 1RZRA 1XF9A 2LIPA 3LL7A 3MQFA 3WGTA 1L5QA 2Z8YA 4O3FA 3KQLA 4NZNA 3TZEA 1ACMA 1GFSA 2IHVA 2P1RA 3HS3A 3LUAA 3M9XA 3OFJA 4IJ5A 4U5XA 4AS1A 4F4JA 3SC6A 2FLVA 4QJ4A 1QYVA 3GQBA 5DYYA 3W06A 1KYWA 3F6YA 1DHTA 4XWAA 1TLTA 2XMQA 3NKLA 3G9XA 4IJVA 1NUAA 1XMPA 1HTBA 3AJDA 3K1AA 3RWOA 5J2UF 4GHWA 4PBTA 2GHIA 2GAJA 3S99A 1U0NA 5HQ3B 2V54A 1GGEA 1NRXA 1TC2A 1R7RA 1XLTA 1ZFNA 3OQ1A 3IL2A 5IT5A 5CFQA 5ADHA 1LDMA 1K5PA 3GJSA 1TO6A 2I2DA 4ALNA 1LTHR 4XQ0A 1G9XA 1ZKMA 3HZHA 4DSOA 2DZDA 4RA9B 3FGOA 1Q0LA 3HSYA 4JMPA 2ZTMA 2PV0A 1PT5A 5ALEA 4BJ5A 1PZNA 1Q1GA 2HK6A 3X1KA 4KXMA 2CXXA 4WZAB 5F1KA 2Y0BA 3RSSA 4P32A 2PL3A 2V0NA 2AA3A 3H18A 4QU9A 2JLRA 2PQ0A 3C97A 4GKAA 5K3BA 4ZCSA 5TS3A 5BN3B 3H87A 4ZAXA 3TFQA 1LNZA 1ZGJA 2C2GA 2FETA 2J31A 2J6BA 4JR0A 1J1ZA 5EIBD 2FP4B 3QNMA 5G0SA 2WZBA 2Y99A 2Y6UA 4YDHB 4DIFA 3PS9A 1ZOIA 3AR2A 2Q7XA 2BN4A 4R16A 5ECYA 2AHRA 4B47A 1M33A 4LDQA 3VPHA 3DV0A 2FUCA 1T91A 2D59A 3EVAA 4W7SA 1BA2A 2DFNA 2WVJA 3QUAA 2X4IA 2RCYA 4Q7JB 2A1TR 2Q3BA 3I23A 1KAHA 3ZE9A 4AN1A 1F0PA 2PTHA 4FCCA 2POCA 4TMKA 3VSEA 3WWZA 5HS6A 5DI9A 1SY7A 3ADDA 8ABPA 1POWA 2I80A 3DZGA 1KDPA 7ABPA 1V8FA 2A2ZA 1V7PC 3QU9A 2GTPA 5M29A 1C0IA 1FRZA 3H42B 1XYVA 3ZPXA 1NJ6A 5HW0A 2BUCA 1ZSYA 4WJLA 5JS1A 1FP4A 3B48A 1D7AA 1NBMA 5JVDA 5CGQB 2JAHA 8MHTA 1UJ4A 4HX5A 2EX4A 2ZYTX 2Q4OA 3RC9A 3UICA 4AZWA 4TYNA 5TPZA 2D3TA 1O4WA 1II8A 3K6KA 3FDJA 3BGIA 1CLUA 2AF4C 2BKUA 2CB0A 3FUWA 2H9YA 3DFZA 2G9QA 4ZQEA 5H81A 3L8HA 3RREA 3S1AA 4FZJA 3VKWA 1XXHB 3W0LB 5H8WA 4YCSA 5IHPA 1E0JA 2EW8A 2CV1A 3FR7A 4E31A 1Z8HA 2G72A 1JBQA 2O2DA 4WESB 1G5IA 5C3UA 1SZCA 1YOVA 1FS4A 2WOJA 3LD9A 4BWGA 2UZIR 4F92B 1D07A 1B0PA 1XPJA 4IO0A 4UNPA 5KWVA 3VTKA 1Q1ZA 2A9VA 2ZLBA 3PXGA 1HV8A 1U2ZA 3HPRA 2Y1LA 3W5SA 1E8MA 4YPVA 1TGVA 2BONA 3FRIA 4FFBA 5IF9A 2J4CA 2RC6A 3P0EA 3TLXA 5IDWA 5DLDA 5IJWA 3H2YA 5FNVA 2I2BA 3TTXA 5JCXA 3A36A 3I4FA 1YVRA 3TD2A 2UDPA 3BXPA 3TQCA 4EF5A 2BMWA 1WLYA 3BMCA 1Y9JA 2QTVA 3FHCB 1UBHS 2CLOB 4EMSA 2P9TA 4QATA 1O0BA 4V0MA 3RM3A 1JZTA 1TZ2A 2EW1A 3K0CC 3PYXA 3QQ5A 3BREA 5ALGA 3T06B 2IYNA 4R8MA 3WBFA 2V5UA 4EYGA 1M72A 1K66A 4WX2B 1CY7A 1NQ5A 4EAAA 2WWVD 5I7UA 5CURA 1M2VA 2BVNA 2NU8A 1GVNB 2GERA 1JEQB 2IEAA 4K8OA 3D0KA 4HLCA 1ODTC 1IWOA 5JH7A 1FSZA 5KNCA 3IAM6 2ZWOA 3PXXA 2EZ8A 3KHUA 5LDDC 3ONWA 1P60A 1I4DD 3CJTA 4ZAGA 3FIUA 1KYXA 1OBOA 4P33A 1IN4A 1QFYA 2AD1A 3O1LA 2VT2A 3TOZA 2FG6C 3MTDA 3I61A 3GMIA 4F4FA 1F7VA 2O2SA 2ZCJA 2RAVA 1SBIA 1RXEA 2QMYA 3R5HA 1O08A 4U2EA 5HFNA 3IT0A 3L0OA 3QYAA 1DCMA 1VYUA 2H7VA 1N2SA 2VDMB 3O9VA 1NX6A 4X90A 4YP1A 1H2BA 3LUFA 1CKEA 2C3OA 4M53A 5FUVA 4HVLA 2OWDA 2J0EA 1TM4E 3B9RA 3VU8A 3WNZA 2CDCA 1HQYE 3QUSA 9LDBA 3THXB 1I3KA 3DOJA 3CUSA 3OQJA 3AILA 4JB8A 2HJWA 1AGXA 1CRLA 2G17A 2J59A 3NZEA 3PA6A 4PU0A 4B43A 3UUFA 3Q3GE 3M4JA 2R1VB 1O57A 3FWPA 1J8VA 1GKLA 3SX4A 1DX6A 1N8KA 4KNWA 4HB4A 1U0GA 2HQSA 2YWBA 1OXVA 1ZESA 2R8OA 3R23A 4Q19A 2W48A 4QYIA 4X7PA 3JQDA 4EZEA 2WILA 2YTZA 2OY0A 4JLMA 4GWLA 4HDRA 3S1LA 2OXRA 3KT6A 2AR9A 1CC1S 3N8IA 4AZVA 4IIVA 3V3KA 4O4IF 1AVTA 2TS1A 5KYUA 1S1MA 3EULA 1GA6A 2ANCA 2W6ZA 5FOVA 1G4AE 3AKEA 3KKEA 3DXYA 5IN4A 2WWWA 3HYNA 3PHCA 1KZ4A 4HNAB 2AL7A 2W6NA 3PUYA 2P6UA 4QUBA 3GJ4A 2HI0A 3U56A 1T15A 1YS4A 3LPNA 2FXVA 5JSFA 3SBDA 4A2QA 2A9OA 3WLNA 4AULA 2OD2A 1P2DA 3EXG1 3PC4A 3KAKA 4GWKA 4HG2A 4BZXA 4DMMA 1D2NA 3X2SA 3UG6A 2I6XA 3GX1A 1I5OA 1TVKB 3D0OA 5H02A 4PLFA 2UUOA 4QTUB 2JJ1D 2LR0A 3QMWA 1SD2A 1P9RA 2JIPA 3PUKA 1E2MA 2ZSFA 1QX4A 2GX6A 4OQYA 1RE1A 1UFRA 5ARBA 2XQJA 4I9FA 1VE9A 2UZ1A 3KOWA 3K3PA 5KTTA 1RWVA 1A8QA 4C76A 3COZA 5KAPA 4OYHA 2J6IA 2X22A 4H3VA 1N2GA 4BB0A 5CNIA 2WMNB 3ZGXA 4B80A 4JDUA 1G5FA 1MFPA 3V1YA 4D42A 2O8EB 4S24A 4KFRA 5ADVA 5JCOC 1FZTA 1PK9A 2BI7A 2DTXA 3IAEA 3D54D 4RK5A 4CFZA 4E12A 2PSHA 1WMBA 2O8FB 1XZBA 3LHFA 1N5IA 1AKQA 2NZUG 4B2YA 3IO3A 2H29A 4II7A 4CL3A 5HJ2A 3UK0A 1UZAA 3K0AA 3R3ZA 4IJKA 4D9BA 4C7OB 4DIMA 3QIVA 2VP9A 2EWVA 3GJ7A 3PJGA 4O63O 4TM8A 2O8CB 2OBNA 1UIMA 1R6DA 3HKDA 4HHEA 3VYWA 3ZVKA 2P6RA 1SVMA 1WP9A 4CVNA 1ZIYA 2ZEJA 1E58A 2H65A 4PYNA 5EGSA 4D99A 5LMNB 1SGWA 1LH0A 1ODLA 2R6FA 4UHFA 3KR0A 3SZMA 3VJMA 1GEGA 1I2CA 3KQTA 1RJFA 1ZEJA 4RNDB 4X7MA 2PX0A 5AKXA 3ZHYA 4A3SA 2OBYA 1M3SA 1T9GS 3IJRA 3GHYA 1UBLS 3OFVA 1FX0A 1XP8A 3BDVA 3PYMA 4K05A 1XTPA 2CVPA 1TTPB 2CLCX 3ODPA 2QIOA 3WSTA 1CY2A 1L5HA 3EIFA 4BMDA 2XB6A 2RJ3A 4XYGA 4BKOA 4JV5B 4BV3A 1ST2A 2VSQA 2ZI6A 1KEWA 3RTDA 4RIGA 1MORA 3R7WA 4B09A 4YT2A 1R00A 3AEXA 2QMQA 3AHIA 1J49A 4IGEA 2MCFA 3HCFA 1H2AS 2PEZA 3OCJA 1QKJA 4RETA 2QD5A 4FGSA 4D4KA 8GPBA 4ECEA 4NZ9A 1MX1A 1W6UA 4IXMA 4U6NA 3SYNA 4CF4A 4ZO9A 3GEDA 1O95A 2FLKA 5BURA 3GP3A 1NUTA 4PXAA 1Z6PA 2DCUA 2XJ9A 1Q15A 4ZU3A 9ATCA 1M34A 1PWEA 4HYQA 4Y2YA 4GF5A 1ZGAA 3INGA 4M9CA 3W78A 4F8JA 1Y3CE 1NAHA 1VZ3A 1YZ3A 4MZXA 2PT5A 1NV9A 4KDFA 5C1BA 4K3VA 2XPCA 3CGGA 3KKMA 4MVXA 3TFOA 1Y3AA 1NW9B 3HBMA 4ZOCA 2R8XA 3ZE1B 1AV6A 5CFLA 2C4TA 2V3WA 4MUFA 1SVLA 5G3ZA 1KPGA 5BSUA 4YECA 1YZLA 3OG9A 4ZTBA 2JFBA 1N78A 5JISA 4LJKA 3VSBA 1YVUA 3D4OA 1YJQA 4GYKA 1ZW1A 4R8SA 5TPZD 4MKFA 3L6RA 2PVSA 1JALA 4JP5A 4OFZA 1T3ZA 4OMUA 2R8ZA 3D6HA 4Q1VA 1EXVA 1XUOA 4B79A 2QBYA 3ESZA 4QGGA 1NKSA 2V7EA 1HI9A 4WXPA 4M37A 1SOVA 1H2WA 2D54A 2Q0HA 3UGTA 4BS9A 5KNCH 1ZCAA 3A1CA 2PU5A 4FHFA 5AVYA 1DRJA 4B6GA 3IMCA 1CVRA 1T24A 2VC2B 3KQKA 1T25A 5IYZA 4C0LA 4FCWA 3C1AA 5KVSA 1GPUA 3MYRA 4HJXA 5JE8A 1NQAO 1QF6A 1GPKA 2V6GA 4E5UA 3SDZA 3AUJB 3TUZC 2EKDA 2CSXA 2HA5A 4M7PA 1CERA 3E18A 5GV8A 2VKQA 4FFWA 1HKHA 1RMQA 2BFDB 3S0JA 1VMEA 3IKLA 3GUCA 3V7YA 1UF9A 1UJMA 2JVIA 2FU5C 4ENSA 4JP1A 3W5CA 3ZXUB 2PNFA 1PSDA 4D5GA 1ZCJA 1UT5A 2BELA 1GSAA 1P9WA 1Z7BA 2H0QA 2H4FA 3KEOA 3OFND 4GMGA 4X1YA 5FBZA 4US0R 5G0WA 3U3JA 1CQWA 5TR9A 4MMXB 5ALMA 4HWTA 4C6TA 2OO3A 3RYHB 2ZRQA 1NU6A 1I14A 1WA5A 3DL4A 2B4YA 5GJBA 2H2HA 2I34A 2TMGA 3VR2D 2LIVA 5F7ZA 2IF0A 3QG1A 3WHLA 2HZBA 4D3YA 4UTPA 1U8ZA 1C4OA 3H9BA 2IHTA 1KI1A 1S02A 1RJWA 2RHBA 4HPJB 5FPQA 4B76A 4N01A 4FIDA 4V0KA 1VA4A 1QV9A 1D4AA 3Q88A 4YAOA 4DCPA 1X77A 3ZQ6A 2JDID 1C7QA 4JWKA 1NXVA 4RPJA 4YWHA 2PZLA 3SAJA 1J0BA 1RZVA 2AR0A 1DTEA 3L6EA 4CL8A 1SRQA 2UYOA 4DIEA 2YDYA 4NZOA 3RU2A 3MFQA 3VMMA 1QS0B 1QYWA 3DC7A 3M6FA 1HF3A 1SHZA 4BGVA 2ATCA 3JQGB 5H7XA 3TAXA 4PYRA 3AHCA 4J76A 5LA6B 3W3AA 3CURA 3QXXA 3ZDAA 3R3UA 4KCGA 4JFAA 1VYHA 3BJIC 2DPYA 1X1DA 2X7HA 3MJFA 2ETVA 1R0SA 3BULA 4NEQA 4QU0A 1L1QA 3FTPA 4RU1A 2YJ5A 2Q3DA 3RC8A 1M6VB 4I4TA 1U2RA 4GOOD 2O4CA 3AEQB 4R83A 4LMRA 1K8XB 1U31A 3LOQA 5IT4A 5MGNA 2EWMA 1UMCB 2FQ1A 1KEEA 2O8DB 4KQ6A 5BNWA 1B8UA 2IPNA 2OO5C 3NTQA 5TT1A 1AMOA 3GBPA 1UZLA 5DN9A 3NUGA 3VPDA 1C0EA 4BIIA 1EHYA 4NDAA 5DM60 3I6QA 4Q03A 1QFSA 1ULZA 3CZMA 2AKYA 4PPGA 4Z86A 4H59A 4D8WA 2D1QA 4TWZA 5DASA 4NDZA 2CJYA 1IZ9A 4CCYB 5JNRA 5U4QA 3Q40A 4QOFA 1N92A 4FZVA 3S6JA 4LXYA 3DT9A 4ROTA 1JN0A 4NBRA 2V96A 4MV5A 2ECPA 2BFNA 1OWOA 3E9EA 5LQCA 4XASA 4KWIA 1OFHA 2OHVA 2ZJBA 1MO3A 4DQDA 1THZA 1CR0A 1SIWA 2CF5A 1MW9X 1HQKA 3I5UA 4OQZA 1Y6ZA 1NMYA 3RE1A 5AW1A 3H0CA 3X44A 3KEFA 3T1HB 3DTVD 3WK8A 3IAS6 1OYVA 3O8DA 1DOZA 1LV7A 3MJSA 1TVCA 2ORVA 1PCXA 3BDAA 4JLPA 3G7UA 1G21B 1BS1A 4G23A 4TKLA 4C20A 5J23A 4G0OA 4NFLA 4Q4JB 2IV3A 4J0DA 4KI7A 3JS5A 3WLKX 1AM4D 4B8ZA 4AY5A 2A1UA 3AI7A 1K8YB 4WFIA 1I8TA 4MYUA 5ILQA 4DQVA 3LW8A 3GWZA 1DKRA 2EBWA 4RLQA 5EJFA 2Q46A 3NH9A 3TD9A 1V37A 1KDOA 1J21A 2ZWVA 3KXDA 4YRCA 1KQGA 2L18A 5IG2A 4TZ6A 3B3QA 5P21A 4GUAA 2D4HA 3HL4A 1NNI1 2GMWA 4WW0A 1UADA 2OE2A 1JHZA 4JH0A 3MT8A 2CMKA 2YIMA 4CKEB 5AK5A 1V3TA 4JJIA 2Y0CA 1FDTA 3H4TA 3SM3A 4WBNF 2YFYA 1HNXB 4A8PA 1KSHA 2VJBA 3D4BA 2O48X 4MKHA 2FR1A 2GCGA 5FV4A 4MW1A 1BC5A 1TF5A 2C2KA 3JQEA 3OZXA 4CTMA 1VPTA 2QMOA 4JL8A 5BRNA 1G2IA 1BWQA 4JBWA 1V47A 2PAFA 3FNRA 2QL7A 3GAMA 3QW4B 1NI4B 1E3LA 3A1NA 2EF1A 4P3PA 4XVCA 4GZ5A 3IEKA 3UM9A 2ACWA 1QYIA 3AKYA 2B0JA 4PONA 4BNJA 4UTRA 3LX4A 2O3RA 3G9TA 3QE4A 4G8JA 4H0NA 4TTTS 2H1OA 2IHBA 5J5VA 1AIPA 3DAPA 2WIDA 1WZUA 1XKXA 1MTZA 3UANA 1TT5A 1CUGA 3ROMA 4NOKA 1H4SA 3G5LA 1U81A 3G5MA 5KQGA 2JASA 1HNWB 3ZJ5A 4B7AA 4NAHA 1NU8A 2R4QA 4B3DA 2CSUA 3N2NA 3QBTA 5IVIA 1X9GA 1SVWA 3BSWA 1ZEMA 3TL2A 1A1VA 2HSWA 3TJZA 3W8NA 3O1HB 5TNXA 2X0RA 2H4ZA 2F4VB 5IAKA 5IDVA 3NHZA 2C95A 4I1SA 2ZB2A 2ZS9A 3BHNA 2XW6A 5DULA 1TZJA 4C22A 3U9SA 4BV8A 5HS4A 3EIHA 5DM0A 4L4RA 1RYNA 1YRQA 2I6UA 1XT6A 4HWRA 4R2XA 3DE3X 4E5SA 1T2EA 2WFMA 4L7VA 4ZOAA 1IM8A 4IZIA 3HYCA 4WN9A 4F4CA 3PRJA