1JKJA

E. coli scs
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords succinyl-CoA synthetase alpha subunit
publication title Two glutamate residues, Glu 208 alpha and Glu 197 beta, are crucial for phosphorylation and dephosphorylation of the active-site histidine residue in succinyl-CoA synthetase.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1jkjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jkjA01
1E6EA 3CUKA 4E13A 5KKAA 3RUIA 2D5CA 4BVAA 3WLFA 5L51A 1GL3A 4GPD1 3WSVA 4DPMA 3AW9A 1S6YA 1UDCA 1E3WB 2EHDA 5AXCA 5DBFA 2BFOA 3GF4A 2Z1MA 5C3MA 2Q1UA 3D5QA 3N7UA 2G5CA 1PX0A 2YV3A 3KSZO 4CL3A 4PN3A 4AJOA 1GUZA 1NHGA 4TWRA 1XELA 4GL4A 1HRDA 2OOSA 4B4VA 1R4NB 2OORA 3QV1A 5KVSA 4R5HA 3NT2A 3U4IA 1UJMA 4B3JA 1YL6A 3LT2A 4ZN6A 2EERA 4FR5A 1LNQA 3IQDB 5TT0A 4I08A 3OECA 1VI2A 1ZKMA 5K6AA 2PZLA 2CF6A 1YWGO 1U4SA 4LVUA 4MP6A 4D42A 3C7DB 1E6WA 4LW8A 1WNTA 4A7PA 4MVJH 4F46A 2EF1A 4BL5A 1EBUA 1YBMA 2D59A 3KM0A 1A9ZA 1JA9A 2NADA 4DQXA 3H9GA 3S2GA 4TKMA 3LK7A 1ISMA 1FMCA 2WD7A 2CNBA 1FK8A 4ND3A 2QW8A 4J7XA 4PIVA 5JY6A 4TROA 5KWEA 4LCJA 2HAEA 3ST7A 3S2FA 4BV8A 2F1KA 3O26A 1QYXA 1E3EA 4B4WA 1F17A 3RROA 2D2IA 3PJEA 1IZ0A 4O0LA 3BXXA 3F5SA 5I7EA 1LLCA 3BMQA 1JKJB 1CDOA 1HE5A 2X7HA 1DEHA 3H6KA 4E2YA 1GD1O 2PGDA 3WB9A 1HSOA 4ESOA 2ZQZA 4BIIA 1NVTA 1LRLA 1U4OA 2P5UA 5JC1A 1UZLA 4YEDA 1SEPA 3PWSA 4CLEA 3ZNPA 3BTVA 1KIFA 2HDHA 1QKIA 1VJ0A 3ZV4A 4E5PA 1XIVA 5ENDA 1ARZA 1ONNA 3L6DA 3IKTA 4AICA 3W4IA 3DZFA 1HDZA 5T6BA 4BNZA 3D64A 3EUWA 6ADHA 3KEQA 4BNLA 3C85A 1SCUA 3U5TA 3A28A 1V8BA 4BNYA 2X5JO 1RPNA 4TZTA 3E8XA 4YJFB 2AMFA 1O0SA 5K6AC 1EBFA 1GZ3A 3GMSA 3GZ4A 4CR8A 4DTIA 3JYPA 1XKQA 2Y99A 4AJIA 3OIDA 3PIDA 3AOGA 3EC7A 2WYWA 4BQPA 1P9LA 4WLUA 4GKVA 3ZU4A 1C0IA 2Q45A 3UFXA 4EUFA 1V3UA 4GGOA 3V8BA 2DBRA 3WMXA 2JFFA 3K9QO 1DIAA 4XX0B 3I5MA 3GA0A 2P68A 4XQEA 3JSAA 4GX1A 1DBVO 2FR0A 2Y0DA 3NV9A 1XU7A 2O4UX 1KC3A 4CM8A 1P1IA 3VKUA 4TRRA 3AU8A 4Z3DA 3RFXA 1LBEA 3SLGA 4NQZA 3JQBA 1BDBA 4R9RA 4KMSA 1NAHA 4L4RA 1YGYA 3DOJA 2DAPA 5TC4A 4DMMA 1OI7A 2GN6A 5CEJA 4NI5A 2ZJ0A 3GEDA 4XYMA 2HRBA 2UV8A 2NTNA 4DQUA 3S1LA 2AA3A 3JQ8B 1VE9A 4AJPA 1T2DA 4WLFA 2FZWA 3GVCA 5LDHA 4JCOA 2GCGA 1SOVA 1B26A 3KO8A 5AOVA 1CQIA 2TMDA 3M1LA 5JAZA 3WS7A 4JLWA 4CR6A 3RVDA 2C54A 2VRCD 1ONOA 5LDGA 1LSJA 4BOYA 1ZSVA 4HADA 1IUKA 5EQFA 1P0FA 4NFHA 2BD0A 2NUAA 4CM3A 2VT3A 2J5KA 3I9NA 2I76A 1KVRA 1UZNA 4WEQA 4Z0PA 3CXRA 1GPJA 3NJ8A 1NPDA 3TZQA 4P4LA 1OBFO 2JD1A 4R01A 1X7HA 4KZPA 4RVGA 1FF9A 4W7IA 1WVGA 1Q0HA 4XQCA 4HX5A 1B16A 3BMCB 4HV4A 3I3OA 2QHXA 2JCYA 1PGPA 3ZW9A 4IS2A 3PHHA 1WLYA 2YDXA 3ZWAA 1N2SA 5BNIA 4DMLA 4F6CA 1PJCA 2ILTA 3M6IA 5JAMA 2HCTA 3NTOA 1MA0A 3I9MA 4P4GA 4IQGA 3IAHA 1Q2XA 3DBRA 5B37A 4B8ZA 4BO7A 2YZ7A 4BNHA 3GGPA 2WJPA 4EBFA 2RHRA 4GAEA 5KJ6A 4E12A 4UVHA 2V65A 3GH3A 3MJSA 4PLZA 1PJ2A 4ZQGA 4I5GA 2O2SA 2VHXA 4J4HA 5A03A 1ULSA 1C1DB 3GLQA 4FBGA 4XB1A 1RM0A 3ZW8A 3MJTA 3IS3A 3RUEA 4BS9A 4W82A 3GY0A 5HWSA 4LGVA 3CKYA 5FEUA 3F6YA 1Q7BA 3H65A 2DBZA 5EL0A 5A3VA 1UH5A 2X1HA 3G0OA 4FD3A 3PJFA 1JWBB 1F12A 5I7SA 3FN4A 1UZMA 1HZJA 3K6JA 3RJ5A 4BKQA 4GX5A 5DCUA 3EDMA 2FPPB 5BT9A 2GNAA 5F3RA 4U0KA 4MVJA 4CL8A 3OA0A 1SZJG 2BFAA 2GD1O 3WGTA 2JKVA 2X5OA 1FDTA 3WWZA 4EJ0A 3MJ4A 2E4AA 4L4SA 2YV2A 1J6UA 2XPCA 5C7LO 2FR8A 2NQTA 3MCVA 1WDMA 1R4MA 2G82A 1TT5B 4YRAA 4Y6SA 1SB9A 1FXSA 4J4BA 5DDIP 4DLLA 1P0CA 4DLAA 4UULA 3ZWCA 4Q3AA 3SX2A 3E82A 3PPIA 5G4KA 2Y1DA 4DL9A 4J1TA 5ILOA 4DIFA 1LU9A 1RKXA 1N5DA 1I36A 2GASA 5CP8A 4ALJA 3WGIA 1LJ8A 3VH1A 3DZKA 3E03A 1O89A 4QX6A 1NPYA 2O3QA 1GU7A 3DAPA 2EWMA 4NNJA 1A7AA 4Y98A 1A4IA 3K96A 1ZO8A 2BMAA 3MOIA 3HN7A 3NKLA 4GI2A 3WGHA 4UREA 1YL5A 3K2EA 4II3A 4L9RA 1C3VA 2Z1NA 1V6AA 2OP1A 3K2BA 2QRJA 4TRNA 4KP7A 5HA5A 3VZPA 1WMAA 1GZ6A 3P7MA 1NVGA 3ZWXA 1KEVA 3G1TA 5IFLA 3VOSA 2IZ1A 2DUUA 3PLNA 3ONDA 3QA9A 4NIMA 4RLHA 1KYQA 1HLPA 1LSUA 4L75A 4KDFA 3HB4X 4L4XA 1YONA 1G0OA 3WGQA 5DBIA 5CFZA 2NU6B 4CM6A 4WNCA 2VYVA 1M67A 2HK8A 1CYDA 3JQDA 5DNAA 4ZD6A 4E30A 1P77A 3FD8A 1ZVMA 2WE7A 1L1FA 1PR9A 1AE1A 2IE0A 1B14A 3EZLA 3JV7A 3R1IA 4LMRA 5ENVA 4PLFA 5JBIA 5K0ZA 1ISIA 3ZDFA 4CMIB 2DVMA 2IYOA 3Q11A 3DWFA 3KBOA 1GCUA 4XDZA 1AN9A 3I9JA 5JO9A 3IMFA 4BKOA 5ES3A 3ZWYA 3TOZA 1E7WA 2DTXA 5JY1A 2V6BA 4B7CA 2Y1OA 4MVJI 2VHVA 2C2YA 4DVJA 3ZWOA 3DOCA 2O7SA 4P4NA 3GNQA 4ZJUA 3AU9A 2HKIA 1ZEJA 2OGUA 2CY0A 3NDIA 2PH5A 2Q4BA 4QXMA 1R0LA 4LSWA 5CPBA 4J49A 4JBGA 5JS6A 5HM8A 4IJVA 1KERA 2ZYDA 5DOVA 2ZCUA 2UVDA 3GRPA 5IDXA 4IDEA 1HYEA 2VWPA 1PL6A 1NBOA 3NDJA 3ETEA 1HE3A 1YRLA 3GN2A 3JD2A 1HT0A 3WGGA 4BO5A 3GUCA 1DHTA 1WZIA 5DZSA 4IINA 3W4JA 3CZRA 4U6SA 4XWYA 2AG5A 4WEOA 3VAZA 4YCAA 2FY8A 3GDGA 5KIAA 4LRTB 3KLMX 3QVSA 5DOZA 5U1PA 1I32A 3MTJA 1MG5A 2VNSA 1FJHA 5JMWA 4IXWA 2VWGA 5L4NA 5B4UA 1Y8RB 1ZW1A 3JQ7B 1ISGA 2QYSA 4CLRB 4AJEA 5KJFA 2HMTA 3WLEA 3D3EA 4OMUA 4RGBA 5EESA 2E82A 4FC7A 2Y93A 4QT0A 1N7HA 4WLVA 4J6FA 4FDAA 2HLPA 2BF7A 2PZJA 1QYWA 1BTOA 1T1RA 1IPEA 4BB5A 1HSZA 2I66A 4QO8A 4EITA 4R5MA 3KLPX 2QRKA 3VH3A 4BO9A 3MWDB 3HN2A 1CETA 5G0UA 3SC6A 1U2GA 3Q0EA 2YHIB 4Z9YA 5IDYA 1VM6A 2DC1A 1HETA 3DONA 3ZV6A 1PGNA 3K5PA 1A71A 1GPDG 4FGWA 1XYGA 1ZEMA 4FJ2A 5CDYA 5JFOA 3RU9A 2O2YA 3ULKA 3ONFA 5J23A 1J49A 2OP0A 4QTZA 5HS6A 5BSEA 2Q50A 4R1NA 1D1SA 2Z5LA 3FPLA 3GG2A 1MC5A 1W0CA 3N58A 4CMHA 4GKBA 1U2DA 2EJVA 3JQAA 3S8MA 2C5AA 3WJAA 3VZQA 4QSMA 4HUJA 4XQ9A 2LDBA 4FB5A 1AXEA 3OIGA 4GBJA 2R6JA 1E1LA 1IL0A 3WMWA 4OOFA 2PWZA 4IY1A 1JVSA 5KCZA 3CH6A 2OO5A 3C24A 3FPCA 4R41A 3BHJA 4XD2A 8ADHA 2GERA 3QRWA 3WNQA 3NJ4A 3R6DA 3ADPA 1KEWA 4RF4A 3NAQA 3TN7A 1I2BA 4GVLA 2XXBA 2PD3A 4Q9NA 4F45A 2I99A 3ONEA 3ZZNA 1I2CA 4IDBA 2WDZA 1SC6A 1GUYA 4D41A 3EVTA 2I5PO 5TJHA 1KY4A 4J4TA 3EYWA 4PLPA 2HK7A 4ITUA 3ROKA 3UAGA 2Q2VA 4Q39A 3OJFA 3QE3A 2HMUA 1NQOA 1K6XA 3RAJA 2W4QA 1TI7A 1R37A 3VKVA 4E2WA 5JO0A 3VZSA 1PGQA 1XWFA 4NG5A 3IKVA 1VSVA 5JYDA 2C7GA 1DIBA 3BHMA 4RPGA 5GZ1A 2OHXA 3UN1A 5B4TA 1HL3A 4J0EA 4YDRA 4Z0TA 1ZFNA 3RKUA 3VPFA 4CM9D 1VJ1A 4DYVA 3FWNA 3UCEA 1RWBA 4YJHA 3CMMA 4YWJA 5C7IO 3AM5A 1E3SA 3ADOA 2J3KA 3QWHA 4IDDA 2VTDA 4QO7A 3RC2A 3UCFA 5BR7A 2GN9A 2GF2A 4W9NC 4CR7A 1NASA 2X0NA 1BW9B 1F0YA 2Y0CA 2A94A 3FHLA 3O9ZA 3RUDA 3HFSA 1I3KA 4YR9A 3ZWVA 3WBBA 4P22A 3BMOB 3RU7A 4F3YA 4CQLB 2G17A 3U0BA 8LDHA 3GHYA 3U4HA 4CM5A 2NU8B 4HFMA 3CIFA 1O95A 2ZTLA 3QP9A 1Z7BA 1I01A 1LSOA 1VC2A 4LVCA 4OYRA 1ZK3A 2WD8A 2A92A 1H94A 3MEQA 4QUKA 3AM3A 2OFPA 2SCUA 1I3MA 5L45A 3KSDO 4M55A 1Z6ZA 1PWXA 4ND2A 1GTMA 1Y9EA 4U5QA 2CDAA 1GQYA 4RVFA 3KETA 4GX2A 5KNLA 4OO3A 3EY4A 1O8CA 4MVJF 2P4QA 3DC2A 4WPGA 4HBGA 3HG7A 4B8WA 1E7YA 2X22A 3FNEA 1WP4A 3I6IA 2NU7A 2V7PA 3AOEA 4QFCA 5CAEB 1EMDA 1U1IA 4CUZA 1ZNQO 1ZK0A 1ISHA 1PEDA 1GADO 4J2OA 3E1KA 3ROPA 3H9JA 3VZRA 2J5QA 4PG6A 1NR7A 3IUSA 4J43A 4WUVA 2E48A 1PQUA 4EEXA 5COBA 2YYYA 4BO6A 4CM4A 2Q4EA 4ZICA 5AYVA 4IZIA 3PRJA 4BUCA 1GY8A 3KEOA 2H6EA 2FSVA 2D1YA 2JFGA 2PV7A 3QVTA 4OJNA 4XKJA 4D45A 4FC6A 4RVSA 4WNIA 2PZMA 4PLVA 3TPCA 1BG6A 5CG2A 4O59O 3I83A 3JQGB 3DAGA 2FPGA 3HUDA 2VHYA 1BVUA 1DC5A 3B70A 2Q49A 3GOHA 4O1MA 4PVCA 4F6LA 3PHGA 2VN8A 3Q2KA 3ABIA 4XR9A 2VQ3A 4TRMA 3T7CA 2B0JA 1YB1A 3ZI0A 1T2AA 2FZEA 4RVHA 4YJGA 3ZN2A 3GR6A 3AY3A 2NACA 1VKNA 4KDEA 1WPQA 2PR2A 3GZNA 2O3SA 3WQRA 4FQ8A 1P1FA 1ZSNA 2Z95A 3BMNA 2WSBA 3H7AA 1B0AA 1QG6A 3OIFA 4IPTA 4MO2A 5T57A 1PZEA 3HHPA 3DZBA 3FRJA 3S2IA 3PWKA 2P91A 4A2CA 2RH4A 3LQFA 3VH4A 1PZHA 1P3DA 1CIVA 2V6FA 5EQDA 5H82A 4E6PA 5FYDA 3RFTA 2RBEA 4D7AA 3PGJA 4PG5A 1LLQA 3KUXA 4WCFC 2WWRA 3AOEC 3WYBA 1TT7A 2DT5A 4R16A 4WOKA 4HXYA 2DFVA 2P4HX 1ZMOA 4YB8A 4YPOA 2UDPA 3KYDA 5LC1A 3ETDA 1W4ZA 4A5OA 3H9UA 5L4SA 1XEAA 4YTEA 3FR8A 2GPTA 1YKFA 1ZSYA 2B5WA 3KYCB 1I5RA 1DHRA 4RQUA 3TL2A 1LUAA 4KWHA 1V35A 3DB2A 1NWCA 1V9LA 4OHUA 1R66A 2WE8A 1IHXA 3E9QA 4GLLA 1BXZA 3FCOA 1PS9A 4XRRA 1M6HA 4FFPA 1ADGA 3HDYA 3PZRA 1E5QA 3L4BA 4BNMA 1PJQA 4D3DA 3OEWA 2VCYA 2FPIA 3TL3A 2YHUA 5TJ9A 4JBIA 5KVQA 1UXGA 3GG9A 3AY7A 4EYEA 4ZQFA 3LT1A 5TT1A 3ZWNA 2NVWA 1UXIA 5DP2A 1Q0QA 1ZXBA 2C7VA 2JCVA 4D3FA 1ENPA 3D0OA 5A9RA 3LZ6A 1YH3A 4K6CA 2H5LA 4BKPA 2CFCA 1V3VA 4FIZA 5T5QA 1T2CA 1Y9AA 2Y1FA 3HE3A 5JSFA 3B6ZA 1IB6A 2Q1WA 5JNLA 3C1TA 4OH1A 1N9GA 4DWVA 4E2XA 1KVQA 1AXGA 2EGHA 4O63O 3LT0A 1ADCA 2VUTA 3PYLA 3EHEA 4QEDA 1L7DA 3ZWPA 1C0KA 1XLTA 1DSSG 3DZHA 4IQ8A 4J2HA 1HDRA 4ZRNA 3MJEA 4XJSA 1B8PA 1LDNA 2VWQA 4FCCA 3ZGYA 3OFSA 4YJDA 5CDGA 1C1XA 3OP4A 4A0SA 2VUUA 3F1LA 2VRCA 3FNGA 2VRBA 3NDRA 4OAQA 3DTYA 3KVOA 4DRYA 2WD7B 1LQTA 3JYOA 5I9LA 1NQTA 2HJRA 1YJ8A 3JD3A 2PKRA 4Z9XA 3WYEA 2GZ3A 3BA1A 2BRUA 1YB4A 2AW5A 1YXMA 3L07A 4CMBA 3TFOA 2PK3A 1T2EA 5BNFA 5F5NA 2X0JA 2E6UX 3RUHA 3L4BC 1X0VA 2YDYA 3A1NA 3PI7A 3QWFA 1R12A 1JQBA 4BB6A 2VYNA 3MTGA 4CV2A 4J3FA 4Z0HO 4OQYA 4DXHA 2EG9A 3ZHXA 3BMQB 3VPGA 1GYQA 2EEZA 1WMBA 2UUPA 3WXBA 2CVQA 2POQX 2QQ5A 5IDWA 1BHSA 2CUKA 4WE3A 3DFUA 3PJDA 1YO6A 4XCVA 1O9BA 5JYEA 5F1PA 3VC7A 1QRRA 2NVUA 3G79A 5JCJA 3LF1A 1I30A 1XR3A 4OM8A 1MLDA 2NM0A 3DZIA 1PJ4A 3DZGA 4CLOA 1AGNA 2X86A 2GN4A 3WDSA 1H6AA 1XU9A 5DCWA 3DO5A 1KETA 2WMDA 1ZUD1 3W6UA 2E37A 4IDCA 1SCUB 2B5VA 4YBZA 2GUGA 5ADHA 5EN4A 1CEQA 1DIRA 2GR9A 5JW6A 1Q7GA 4Y9DA 4R54A 4ZHSA 5TIIA 1T25A 1P1JA 2NSDA 3I1JA 5IG2A 3V2GA 1GV0A 1W8DA 4AJ4A 1DLJA 2GSDA 1BMDA 1NYTA 2VHZA 1RM3A 1YQXA 4INAA 5MDHA 1YBAA 4OKNA 4ROSA 4PZEA 5JE8A 4NBUA 5IF3A 4I9NA 4A27A 3IJRA 5DBGA 1IOLA 1GFSA 4TQGA 1Y1PA 4NBWA 3ZV3A 3UFXB 1NM5A 1E1KA 4CV1A 1OAAA 4ONEA 4FFOA 2QRLA 2X9GA 4XYBA 4C4OA 3HDHA 3HDQA 1U3UA 1HWYA 1TEHA 1IYZA 1ID1A 5JC8A 2JCXA 1D7OA 3AK4A 3M1AA 4FS3A 4CM8B 5HTOA 3GRKA 3JD4A 4P38A 1GAEO 3IL2A 3TQHA 4Y6RA 4UUOA 1ISFA 3F4BA 2BHLA 3AUSA 5JXWA 1NR1A 1Q7CA 4S3MA 3TZ6A 1GV1A 3E5RA 4BO0A 2IDZA 4YAEA 3GVIA 2Y68A 1FDWA 3FTPA 2X58A 3CZMA 3RI3A 3QWBA 4AJNA 4AJJA 3IP1A 3MWEA 3OICA 2VHWA 1TB4A 3NX4A 3QHAA 1I8TA 4JBHA 4DQVA 2P2SA 4XIJA 4RF5A 3RBVA 2OBNA 1CQIB 1LRJA 2ZTMA 1QYCA 3RUCA 1DAOA 2B4RO 1ZIDA 1B7GO 1DJNA 3BTOA 2EP5A 6LDHA 3TZCA 4B7XA 4O6VA 4OL9A 4RO0A 4Z3KA 3GNSA 4Y8VA 2NUAB 1LLUA 2AG8A 4K9DA 4MVJG 1LEHA 5L7TA 4D0SA 2VNAA 4UUNA 3RUAA 3KB6A 3E48A 4A03A 1RM5A 4EUHA 7ADHA 1JKIA 4I8XA 2VZ0A 4QECA 4QFDA 1LDMA 5IDQA 1D8AA 4JK3A 5IJZA 1N1EA 4BNIA 1J4AA 2ZB3A 5G0VA 4IGEA 1WWKA 1U28A 5JAQA 3RC1A 3GEGA 4CM1A 4YQZA 5T67A 3DBRB 4WCDA 3ITDA 1A4UA 4YAIA 3JYLA 3OJLA 1EQUA 1P33A 2WYUA 1I3NA 4RZIA 3EMKA 1M76A 5T64A 4I5EA 4K28A 5H83A 2FWMX 3FWZA 1E77A 3ZV5A 5JDIA 1E92A 2AEMA 1KEPA 3OJ0A 4WLNA 1GUFA 3H4VA 1LDBA 4DYDA 1UUFA 4K6FA 2HRZA 4YRDA 4CODB 1QYDA 3KTDA 4AL4A 4R1TA 3OEYA 2PFGA 1X14A 4N18A 3ANNA 1EUDA 1UXHA 4PZDA 4RPKA 5TSDA 1X1TA 4M86A 4MKXA 4J7CA 3RASA 3GGOA 3TZKA 4NHEA 4NFSA 4E21A 4PLWA 3AI2A 5I8ZA 2O3UA 1BDMA 2DUWA 4ND4A 3EAGA 5DCYA 2CMDA 1R4MB 1JDJA 5THQA 1XG5A 1ZK4A 2WTBA 2PKQP 1SAYA 5F21A 4CQMA 1T26A 1TA4A 2QZ9A 3GDOA 3W1VA 3DMTC 5BQFA 1ADBA 3HDJA 5G4KB 1NFFA 3LLSA 3BTSA 3KHUA 3NUGA 3ROMA 3WOHA 4E32A 1VL8A 3O03A 3H3JA 3GFBA 4XZ3A 4NBRA 4TVOA 4CLXA 1U5AA 2ZATA 2NNLD 1DOHA 1LRKA 3JTMA 4N5LA 4XB2A 3GUYA 2ZCVA 4G2NA 1XA0A 2Q99A 1DIGA 2P9GA 4XYLA 4RQTA 4OKIA 1MG0A 3F47A 4WK6A 3DMYA 4FW8A 3C3XA 3WGZA 4AVYA 3BZUA 3ZNOA 1X7DA 3GDFA 3QWAA 2DM6A 2W2KA 1PU2A 2AQIA 5GY7A 4E31A 5JDIC 1JU9A 3BTUA 2JHFA 3OQ1A 4NZ9A 3DHYA 4D43A 4HNHA 2AE2A 5FWNA 4XQGA 1Q1NA 1ZXLA 1HZZA 4ZGWA 3AUAA 1IHYA 3VPHA 2ET6A 1YQDA 4ALNA 2R00A 4B3IA 1YBVA 1ZZEA 2V6GA 3IDSA 4ZRMA 1A7KA 4JJIA 4JQCA 1BXGA 2FR1A 1VL0A 4RPHA 3A06A 1EFKA 5F1KA 1H6BA 3UF0A 4MIYA 4GVXA 4LN1A 1QV6A 2Y66A 3L77A 1EK5A 4CMEA 5AQ1A 5HRUA 4WOJA 2BI8A 1C0LA 4OXYA 5JLAA 5LCXA 3OQ6A 4KOAA 4RZHA 5TRTA 1OFGA 1QYVA 2XF8A 3H5AA 4OXNA 1Z82A 3WBFA 3GC6A 4BMNA 3RQSA 1TXGA 4Z9FA 2Q2WA 1PTJA 1HDOA 4TKLA 3PP8A 5GZ3A 4M1QA 4PCVA 1MB4A 3WTCA 3VHRA 1KC1A 1QR6A 1MXFA 1UP4A 3H9EO 1E6UA 3HADA 4BNXA 4AG3A 1Z75A 2C82A 1RYEA 2RCYA 5A9TA 1QV7A 4CV3A 1NWHA 2GYYA 2R2GA 4Y67A 1EE2A 5ITVA 3INGA 5DT9A 1M66A 5U4QA 3VDRA 4Z6KA 5TNXA 2I67A 4FFMA 4BNTA 2FOIA 2ZB8A 3PTZA 1DJQA 4KUHA 2X23A 1N92A 1TLTA 3A14A 4WASA 3LYLA 1JLLA 4GX0A 4L73A 4DPLA 1EK6A 1R15A 2IEDA 5EPOA 3LC1O 4YQYA 5IN4A 3BIOA 3QVOA 4WKGA 5EIOA 3DZJA 3OJEA 3S2EA 4AJ1A 4BMVA 5A9SA 2R00C 1OC2A 2GLXA 1EUCA 3MJVA 2AEJA 1S7CA 2FHSA 2FN7A 3QWIA 1EDOA 1U8XX 3JD0A 4W9NA 5TLSA 3FF4A 2B35A 1CQJA 4MDHA 2WYVA 4CMEC 2QZZA 3OF2A 2C20A 4ZQBA 5COQA 3U49A 3RCBA 5KKCA 2WM3A 3AFMA 5L95A 2C59A 3GVXA 2P9EA 4KQWA 3UOGA 1E7QA 2C0CA 2EGGA 2O7QA 4XA8A 3HB5X 4RORA 2Y1EA 4MIOA 4BGVA 4R9SA 1ZMTA 4PLCA 4D0RA 4TVBA 3SC4A 1PZFA 3ANLA 1CWUA 2FP4A 3IP3A 4PG8A 2DLDA 1E3LA 3R3JA 1QLHA 2TMGA 4IXTA 1SB8A 4M54A 4K26A 3RFVA 2DKNA 2BGKA 4KUEA 1B15A 1B2LA 3ZWBA 5CPFA 4CLDA 4NK4A 3JQEA 2EKQA 4MPDA 4C7JA 1LDYA 4CMJA 1NHWA 4JXKA 4LK3A 4B79A 1XGKA 3SEFA 1ML3A 1YOVA 1VL6A 3DFZA 3ZNQA 4E4YA 1DDOA 1DFGA 1ENZA 3U9LA 1GYPA 3UXYA 2I3AA 3LDHA 4EJ6A 2EV9A 3CSDA 2NTJA 4RDHA 5A02A 3JQAB 1Y7TA 2GN8A 2B36A 2GDZA 1PWZA 4BNFA 4NDNE 3DBHA 3FBTA 1B3BA 3AWDA 5I9NA 2AE1A 3OH8A 4ZU3A 1LTHR 4UEJA 1CRWG 3LSYA 4IGFA 3WFIA 4IJUA 3RJ9A 4FGSA 3QY9A 3D3WA 3GPIA 3GK3A 3JYQA 4J9UE 1HDYA 3V2HA 3DDNA 4OSOA 1ZH8A 1ONPA 3JD1A 1PR3A 2BFMA 3WNVA 1WDKA 4JX8A 3GGGA 1I24A 2ZIZA 2ZYAA 3N74A 1ZK2A 3C8MA 4RF2A 1T24A 3IIEA 2DBVO 5GZ6A 3I9LA 1G0NA 2NU9A 1D4FA 2NQ8A 4DBZA 1WXDA 5ER9A 5IXYA 3F46A 1LA2A 3KXDA 1QMGA 4U0JA 3ZCXA 4BNVA 3WYCA 2JD0A 1UXJA 4HFNA 1QSGA 2OZPA 1HE4A 1P74A 1KEUA 4YVFA 2IZZA 4IQ0A 1ZBQA 4B3HA 2J3IA 1O5IA 5KJCA 4N7RA 1Y8QA 1SPXA 4OIMA 2BI7A 4KQXA 3BHIA 1VLLA 4GQAA 3ZHZA 5B4VA 3I4CA 4MIEA 2Y67A 3FI9A 3C7CB 4IJWA 5L7YA 5KVVA 3TJRA 4YJHB 3JQAD 3ZWWA 5CHEA 1PS0A 3D1LA 4D3SA 5BNTA 4WCFA 2CF5A 3AY6A 2VZ9A 5KJEA 1PJSA 3PIIA 1PL7A 4OXKA 1N1GA 1HEUA 2QYTA 3K73O 2NVBA 5A1TA 4BO3A 3DBLA 3VDQA 1KVSA 5A4DA 1Y6JA 1A9YA 5MGBA 1DXYA 3O8QA 1ZJYA 2VTEA 5G0WA 5DP1A 1SEVA 4DBVO 3SJUA 4IDFA 4CUJA 5IAAA 1DB3A 4RF3A 4E5YA 1O6ZA 3PEFA 3TNLA 3WIDA 3LT4A 3OM9A 1E3JA 2P5YA 3C1OA 1F8FA 3CEAA 3ENKA 4AJKA 2SCUB 5JDCA 1SBYA 3QLJA 4NJMA 3HSKA 2GZ2A 5HBRA 1RM4A 3GVHA 4MVJE 1WZEA 4WGGA 2J8ZA 1WDLA 4H15A 4UAGA 3I6QA 3P19A 3OMLA 1U8FO 4HKTA 3QVWA 3F3SA 4NU5A 1DC6A 1NVMB 3ZHYA 2PNFA 1BSVA 3CPSA 1DAPA 2EP7A 3EGOA 3VH2A 4PLYA 4YRBA 3H2SA 2NU7B 2YY7A 3E9NA 2W90A 4FN4A 2DTDA 1NP3A 2QIOA 3B20A 1K2WA 3JYNA 1E3WA 3QQPA 2O4CA 4LMPA 4E5NA 5L7WA 4IMPA 1IE3A 3OQBA 3UKOA 2ZB4A 4G5HA 1KVUA 2W2LD 4LISA 4CM4B 4MKZA 4EDFA 3RUFA 1B8VA 1MXHA 1PIWA 1NQAO 1R4NA 1Z74A 2BGLA 4R69A 5I9MA 3K31A 2A9FA 2PY6A 3K8ZA 3E5MA 3T4XA 3INTA 1DRUA 1EVZA 2VT2A 4XR4A 1OOEA 3PQDA 2FPGB 4L76A 4BHTA 3DOOA 1AHHA 3ICPA 2JD2A 4UUPA 3KOUA 2RH8A 3ZH2A 2O3RA 2PGLA 1KVTA 3CTMA 2Q46A 3T4EA 3QJ5A 5L4LA 2B4QA 2G1UA 2DPHA 3LC7O 4M49A 3VPXA 4IJKA 4YJGB 4FFRA 1G1AA 3KV3O 4BNUA 5JDCC 3ASUA 3GZNB 1UXKA 4W99A 1LXCA 3PHJA 4BO2A 3PJGA 5G4LA 1JWAB 3BMNB 1VKOA 1Z7EA 1E7MA 2O3JA 3JQCA 2YFHA 3X2FA 2VWHA 5L3ZA 2BKAA 1RYDA 4M87A 2PLAA 1E3IA 2BH9A 3GPDG 4J1NA 3A9WA 4TRJA 1HDXA 1XHLA 1T4DA 1MX3A 2O50A 3ON5A 1YDEA 4J7UA 4XEHA 4BGUA 3AM4A 3OA2A 1JKJA 2J5RA 3FTNA 5DN9A 1UDBA 3KYDB 3WICA 2UUOA 3NT4A 3SJ7A 1H5QA 3K92A 4LSMA 4K1LA 4RJTA 1GZ4A 3ROQA 1PS8A 3CINA 2H1SA 3NTQA 3PQFA 2A35A 2ZB7A 3B1FA 5FFFA 4PLTA 5I7VA 1HDGO 4GLOA 1B8UA 1EVIA 3V5NA 4HFRA 1EVJA 1ENOA 2A4KA 3LVFO 4ID9A 4NJOA 2HMVA 1MGOA 3HZZA 4IM7A 2B69A 1PJLA 2PTGA 1I33A 3LLVA 1PQWA 4E0BA 2Y0EA 2FPIB 2J6IA 1E5LA 3MJCA 1FDSA 4W6ZA 4YJFA 5CEEA 5IXSA 4NMHA 1ZCJA 1N8KA 1EFLA 4H3VA 1NFRA 1WW8A 5IZ4A 2GZ1A 4BNWA 2J3JA 3A4VA 1PGJA 1YS4A 2X4GA 3GAFA 4N54A 4HWKA 2NV6A 5KTKA 4PLGA 3FSRA 3E18A 3UGKA 1U3VA 1NNUA 1WAMA 3GT0A 4W4TA 1FDUA 2LDXA 1LC0A 1U3TA 2VUSA 2X6TA 3W6ZA 1H93A 1JVBA 1DFIA 3GQVA 4NBVA 3COSA 1N9GB 4XX0A 3ZU3A 3JQFA 1HXHA 1VPDA 3PYXA 1QORA 4J9VA 4UEKA 2H9IA 4WLEA 2IYPA 2YJZA 4MOWA 4AJHA 3SXPA 4FPXA 3F1KA 1T4BA 1X15A 5JCXA 1X13A 3ZNNA 2HJSA 2IODA 2JHGA 5H81A 4XGKA 3KSUA 1LI4A 2OUIA 3UH1A 5BSFA 3CMCO 4EJMA 4HY3A 1C1XB 4MVJM 4YT4A 2YUTA 2C07A 2JL1A 5I8WA 5AXAA 4YT5A 3D4NA 5A05A 4URFA 2YQ5A 3JQ8A 5EJ2A 1J0XO 4UUMA 5DF1A 1VSUA 5BSGA 4LCEA 3QSGA 2CDBA 3L9XA 4EW6A 7MDHA 2H63A 3L6OO 4AJLA 3RD5A 2DTEA 1ADFA 4XGIA 1XQ1A 4W7HA 4NU6A 4BQRA 1X0XA 1F8GA 3U62A 1PJBA 5FF9A 3TZHA 4GMGA 3VVCA 1IPFA 3PK0A 3TDKA 1JAYA 1W6UA 4YA6A 4CV0A 1EUZA 1LX6A 1DLIA 3I9OA 4GWKA 3WTBA 5A04A 1EDZA 2JJYA 5EINA 4WECA 2HMWA 3PGXA 2I6TA 1BXKA 4PVDA 2VOJA 4YAGA 5BSHA 1R0KA 3NGXA 1DC3A 2HMSA 1MV8A 3PQEA 3S55A 4EEZA 3FNFA 2XAAA 3OHSX 4N5NA 2NVUB 3BMCA 5EERA 4FFLA 1U7TA 4BO4A 1KBZA 4AJ2A 4DGSA 1DRWA 1PL8A 4S1VA 3HNPA 4O5OA 1I3LA 4CLOB 2ZQYA 3NEPX 2C29D 2PZKA 1B3RA 2VOEA 1MFPA 3JQFC 4KTVE 3KRTA 3AI1A 3G17A 1U7HA 1I10A 3RBXA 3X2EA 2HK9A 3V1TC 5DULA 1OMOA 2DQ4A 2D5AA 2DU8A 2P9CA 3JQ9A 4YAKA 1C1DA 1M2WA 1V0JA 4DPKA 4BV9A 4J1SA 2OMEA 1ORRA 1UAGA 3H2ZA 4IZHA 4MP3A 4BMSA 3D4OA 3EK2A 1R0SA 1C14A 1JKFA 1XDWA 1H9AA 1EVYA 4R51A 4R1SA 2FPPA 2VYND 4NFYA 2OL4A 1U3WA 2FRDA 4GMFA 1JN0A 1EQ2A 3L6EA 4ZVVA 4X54A 4II2A 1Y5RA 2Q1SA 3HFGA 1E1NA 3RC9A 3OSUA 3UHAA 3WGYA 3D7LA 4UVEA 4UEOA 4ILKA 4IIVA 1TT5A 4DA9A 1XQ6A 4OGWA 3DMTA 3HQ4O 3EZYA 2AHRA 2BFPA 2RIRA 4QQRA 5ITWA 5JAIA 2AXQA 4D46A 1H6DA 2E49A 5JCJD 3Q2IA 2DPGA 5IN5A 3ZU5A 3JQBC 4RDIA 3DHNA 3TOXA 4IDAA 2IZ0A 3QVXA 3WSWA 3ICCA 4E33A 1DC4A 4IIUA 1PGOA 3IOYA 5AXDA 3MWEB 4PZCA 4EGFA 3I23A 3P2YA 1H9BA 1HKUA 3BAZA 5ICSA 4NR0A 1UR5A 4MVJP 5TX7A 3T7EA 2Y05A 5A5FA 4DC0A 4E5MA 3SVTA 1K6JA 5EMHA 5AVOA 1R16A 3GAZA 3P2OA 5KJ1A 3B1JA 1K6IA 2Q3EA 3HWRA 2I3GA 2VZ8A 3JQ9C 1HE2A 3G49A 5FI5A 4R4JA 4RVUA 1GDHA 5ICMA 3AUTA 4MKRA 5JMPA 1GQQA 4YT2A 3OETA 3L9WA 1I2ZA 2NU6A 1LLDA 4I5DA 1V3TA 3I52A 3E9MA 3WWYA 1UDAA 3PZBA 3O38A 3RC7A 2X8LA 3PDUA 3O4RA 2AQKA 1YVEI 3TRIA 2ZYGA 4YAJA 4CMIA 3DBVO 4HP8A 2I65A 3ANMA 2V6MA 3TSCA 1XSEA 1ZK1A 4XIYA 4YACA 3FNHA 1N7GA 1DRVA 2XXJA 4J16A 1GYRA 2X9VA 1PSDA 2Q2QA 4XYGA 4JIGA 1LDGA 3L4SO 4GGPA 4G81A 2WEKA 1HYHA 2Y1CA 4DUPA 1ULUA 2B37A 2NTVA 2IXBA 4I1IA 2Y1GA 2X0IA 4GSLA 3WGOA 1T1SA 2PKQO 3GFGA 4ALKA 5U9CA 3DTTA 4E3ZA 3FBGA 1A5ZA 1Z45A 1DPGA 3INRA 4RPLA 4BKRA 1KS9A 4CJXA 1EUDB 3JQ6A 5IZCA 1LC3A 2Q1TA 4FOSA 3DQPA 3ASVA 3M2PA 4MJLA 2IRWA 3G1UA 5TQVA 3GNTA 4PG7A 5ILGA 1T2FA 1DIHA 1P1KA 4I9HA 1KY5A 2W98A 2GRAA 3UUWA 3PXXA 4GH5A 1XCBA 2PH3A 4CPDA 1HDCA 1ENYA 4IDGA 4L0QA 4BO1A 1JTVA 2FMUA 1YB5A 4JJFA 2UYYA 4R3NA 1U5CA 3W8EA 5L40A 4EZBA 4CQMB 1JW9B 4HNGA 4B4UA 3PVZA 4CLHA 1DFHA 4DIBA 3MZ0A 4N5MA 4DLBA 2J3HA 1Y8RA 3JQ7A 3DAFA 4MVJD 3I4FA 4FOOA 1Y5MA 4RLSA 4CLRA 3Q9NA 3F5QA 4CUKA 5KVCA 3TWOA 1QXSA 1P1RA 1ZJZA 3NT5A 4NK5A 1IULA 4DC1A 2D8AA 2YV1A 2X9NA 4E5KA 1NX6A 3BYZA 3IJPA 1E7SA 2F00A 1J5PA 2CZCA 3DL2A 3WR5A 4FSHA 5L53A 3V1YA 3W8DA 4U6QA 1Y81A 4G65A 1SMKA 1I0ZA 4NH4A 3U09A 3AI3A 4JGBA 3UICA 3K30A 1NQ5A 3DXFA 4NPCA 2EXXA 1D1TA 4XJTA 1RJWA 3Q1LA 3MWDA 2W2KB 4Q3EA 3PFWO 4RPJA 5T8KA 5FI3A 2YHIA 1D3AA 1SO8A 3ZWMA 2DBQA 3TF5A 3GHHA 5TF4A 4M8SA 5B12A 2PD4A 1BRMA 1X1EA 1CJCA 3F4LA 4GSKA 1BXGB 1YL7A 1GQ2A 3H8VA 2D3TA 1IY8A 3H5NA 1VRWA 4B7UA 5IZCC 4P8RA 4CM9A 3H5RA 1GCOA 4A10A 3I9KA 3KZVA 2D0IA 2GGSA 1HF3A 4KWIA 1DO8A 2CD9A 4CQMD 2VYVD 3HJAA 4R3WA 4PRLA 2ZK7A 4D44A 1LDEA 3M2TA 3ZU2A 3Q3CA 5CDTA 9LDTA 1M6WA 1SNYA 4OQZA 4D79A 4TSKA 4UVGA 1ISJA 4ALMA 4BNKA 3V2UA 5C5IA 3IC5A 3VTFA 3ETGA 5GMOA 3Q6IA 4HFJA 3U4DA 3RIHA 4PG4A 4AFNA 2JAPA 4Q3DA 4UVDA 3FR7A 1YE3A 4CMKA 3TFQA 5L9AA 2DFDA 4ALLA 5A3JA 1PQPA 2EW8A 2HU2A 3IUPA 2OXIA 3SLKA 1K5HA 5KOIA 1H2BA 2PD6A 4RL6A 4YT8A 4PRKA 1FDVA 4YXFA 4LRSB 4BKUA 4JNKA 1JLLB 5T8KC 3U3XA 3LC2O 2JFHA 2X0RA 4Q3BA 3NYWA 1E7RA 3PLRA 1AUPA 4C7KA 3PFFA 1PJ3A 5JPIA 2RHCA 4J1QA 4R68A 5A9SB 1GEGA 3RBZA 1P44A 3PHLA 3QIVA 4XDYA 1EUCB 4TMFA 2AEFA 1L7EA 2B4TO 4XYEA 1HYGA 3PYMA 3AFNA 3EW7A 3VPSA 3PHIA 1HTBA 4PGFA 5TS3A 1W73A 1GR0A 5K9ZA 4I9UA 4M89A 4A26A 2W8ZA 1CQJB 3GMDA 4RVDA 1GEEA 2B83A 1IZ9A 3UW3A 3VVBA 3B1KA 3NRCA 1BW9A 1O94A 3UVEA 4CMGA 4JJGA 5ER6A 1BGVA 4XRGA 2O23A 2HQ1A 4R1UA 5A5EA 4JN6B 2BLLA 3NTRA 4I5FA 3BMOA 4EI2A 4U8GA 3WX0A 4J90A 2PGJA 4CQLA 3R3SA 5HS4A 2G76A 2NU8A 3E6AA 4JROA 5C37A 4L8VA 2CSUA 2FP4B 3VTZA 2EIHA 2HO5A 2ZTVA 4ZQEA 4IMRA 1A27A 4ZA2A 2I9PA 1H6CA 2ZTUA 2QX7A 1NXQA 3P5SA 3QW2A 4ALIA 4EUEA 1P45A 5C7OO 1AHIA 3ITKA 4IUYA 4E2ZA 1EE9A 1MC4A 3AJRA 1YOVB 4YYZA 1PZGA 2FSSA 2ZJ1A 4OOEA 1K3TA 5G2OA 2O48X 3ZHBA 1NTOA 4BGIA 4WJZA 3KYBA 4DIOA 2ZKLA 3PWZA 2W2LA 3WQSB 4NBTA 4ND1A 5CAEA 3DBHB 2HUNA 3R0IA 1E0DA 2BELA 2YFQA 4Y6PA 1HLDA 2OBYA 4JP2A 3WG9A 3U4CA 1YJQA 3L0DA 1K0UA 3D3WB 5CG1A 1H0KA 1F06A 1LSSA 5F1OA 2IEBA 4CM7A 1A72A 2GO1A 1UAYA 1P1HA 1E1MA 5B1YA 3RKRA 4RV9A 3PDJA 1H2HA 3V1UA 2O3TA 3DHEA 3G3EA 1UP6A 4ZQHA 1LQUA 1PJTA 3WQQA 4A73A 4FFNA 2NU9B 3WJ7A 4FJ1A 4KTTE 1NAIA 3JQGA 1F14A 3RWBA 3F9IA 1BWSA 1MFZA 1UP7A 4BNNA 4UVIA 1CERA 5G0SA 2G0TA 1G6KA 4MP8A 4IS3A 1TVEA 2C2XA 5I7FA 5CDSA 2HSDA 1M75A 4Q3CA 3SBOA 2EKLA 5F5LA 1K89A 4B4OA 2AQ8A 4BNJA 3ENNA 5CEFA 2CVZA 2BGMA 4BO8A 3C1AA 4H16A 3MOGA 5A06A 2XOXA 1Y8QB 3DR3A 4IBOA 1QLJA 3WIEA 1QP8A 4XGNA 3NGLA 3GVPA 1R6DA 2UAGA 1OZAA 2NLOA 2C5EA 2NWQA 3CE6A 2CDCA 1EZ4A 1MP0A 1X7GA 1EEHA 4OSPA 4RCVA 4J91A 3WFJA 4CMAA 4ND5A 2CVOA 2RAFA 3LF2A 1Q0LA 3AUUA 4L74A 4WCFB 5COAA 5THKA 4WLOA 1NPTO 3W8FA 2YW9A 3GN1A 5TGDA 1SOWA 1C0PA 3D4PA 4DREA 3LU1A 3DBLB 4PFJA 3DEYX 1P31A 1BVRA 3RSHA 3O8QB 3JCZA 4PLHA 1YQGA 4KUGA 2PA3A 3H9QA 3W4KA 4J0FA 3OBBA 1CF2O 1NFQA 4H7PA 2JAHA 4JP3A 3STHA 3UCXA 4BGEA 3Q9UA 3D5TA 1OC4A 2IXAA 3H3FA 9LDBA 4BNGA 2EKPA 3KYCA 3GEMA 5G0TA 2QG4A 4NJMB 3C7AA 3OJOA 1VJTA 4TZKA 2AQHA 5AXBA 1JAXA 1YDWA 2EJWA 2X5KO 4GWGA 2D4AA 1U9JA 3ORFA 4FJ0A 4MINA 1Z73A 1KOLA 4CMCA 5CDUA 1MUUA 2EW2A 3EVNA 4U7WA 2YQ4A 4Q3NA
chains in the Genus database with same CATH superfamily
4NONA 4FEEA 1DTWB 1LPSA 4N6NA 3ROGA 4KBYA 4BVAA 5BQ3A 4EB6A 4PZ9A 4MPTA 4LOIA 2GCOB 4LZLA 3AW9A 1S6YA 1M1YE 2Z1DA 5FOXA 1CRLA 4B2PA 4W5RA 1E3WB 3V8VA 4YV1A 3EVBA 2YYZA 2NV0A 4YRLA 3OX2A 2XT9A 4C1NA 2B1JA 4XOUA 5C3MA 1V1RB 2V5AA 1USKA 2CLEB 3N7UA 4HDKB 4Y9TA 4B9AA 4AJOA 2IOQA 3UG6A 3C98A 1Q95A 5JH7A 4HPXB 4EFMA 4GL4A 1W59A 4ZHQB 1W93A 1R4NB 1M7HA 1U5BA 3QV1A 4DEVA 5JXIA 3D2BA 1P5ZB 2VPQA 3GLTA 5EXTA 1N4AA 3TDMA 1NVAA 3HC7A 1AKMA 4HUQB 1OFHA 3OTQA 3F49S 1KIMA 1UJMA 4JMLA 4WH0A 4ZPJA 2AZMA 3IXQA 4PAGA 3M3DA 3ZCVA 4F21A 4RULA 4FM9A 3GCDA 3LT2A 2QLMA 4M46A 4M0UA 1Y1SA 2Y76A 4IHJA 1EFRA 3SS7X 4ZN6A 3CKKA 1QVAA 4WI1A 5G41A 3RKSA 1AUOA 5GGXA 1H0SA 3EWAA 1JJIA 2IYNA 1XDSA 1K92A 2ZOSA 5LSAA 3WWPA 3VNVA 1ITZA 5JNSA 1VGVA 5K0JA 5E8RA 5L45A 4HGQA 4DMGA 4YUXA 1E6WA 4LW8A 4QJIA 4MVJH 4A7PA 2Y1LA 5K3OA 1J39A 3FVTA 2QB5A 1R0XA 1BGXT 2PXXA 3C5WP 2EGUA 3IMGA 5ALEA 2BP7A 2EATA 2AGVA 2Q1YA 1IAQA 1N8NA 1QIEA 3CNBA 4DLYA 1Q21A 2O6LA 4TROA 3W6PA 4F6RA 3ZHRA 2ZRIA 4PANA 4LCJA 1LPMA 5DLQC 3JZFA 1UBFA 7MHTA 2VIIA 1ND5A 2Y4OA 1EWKA 3CTPA 1T10A 3O26A 1ZU4A 4ZOEA 3FCAA 3R3XA 2V03A 3LBFA 4OTZA 4R31A 2J3DA 1I7PA 2PAFA 3CQ9A 1LLCA 3HO6A 2F3RA 2JK1A 3NRJA 3VZDA 3UIEA 1IBSA 1CDOA 1JKJB 1Z8DA 4WFKA 5CH3A 1XVVA 3LQQA 1U0FA 1HSOA 2VBFA 2ZQZA 1PDVA 5DTRA 1VOTA 5JC1A 1LRLA 5IKXA 5JALA 5CCBA 4BTVA 5KYYA 2Q3HA 3O75A 3ZE9A 1SEPA 1AO3A 3ZNPA 3BTVA 2H07A 4IILA 3T06B 1KIFA 3L1UA 1QKIA 3A6KA 1PHRA 3FYUA 1X42A 1J7KA 1XIVA 5ENDA 1TZKA 2BFFB 2CVFA 4DCSA 1V11B 2C4HA 4DY6A 2HB6A 4M99A 3R9KA 1X8XA 4AICA 4N7MA 5JROA 2OORC 3KX2A 1ECJA 1U7XA 1MB9A 3AKEA 3G85A 1DADA 3EDQA 5KHAA 3D64A 4BNZA 1GFWA 4CT5A 1IJKA 3DWIA 3TQSA 1HFJA 1MB3A 3NQ41 3I2FA 3SXUA 4QVIA 3LGAA 5LP6A 3RT9A 1SCUA 1VJCA 3U5TA 1Z63A 4GC5A 1W6RA 3A28A 3ZUPA 4F4JA 4BWVA 3ZK7A 4IR7A 4TZTA 1KJNA 3KHKA 1O0SA 3OZRA 3QE2A 3E4DA 1GZ3A 2XJ4A 3GMSA 2V0NA 4G89A 2IYXA 2R7LA 2ZIWB 2C96A 4MCIA 4RXTA 4PWYA 4WA7A 4AJIA 3GL9A 3HUFA 3HKDA 3GOQA 5ERYA 4UJ3A 4WDQA 2Q8NA 4BGDA 4RW0A 4UNRA 2XF2A 3EC7A 3W3AA 1VCMA 2WYWA 3OD5A 5KTPA 4ZKDA 3HXQA 3HL4A 3IHLA 1U3CA 2F90A 2FSPA 3WLMA 2CHEA 1CK4A 4QYIA 2HZ7A 3Q5DA 1NDUA 4RFLA 3V8BA 2FZGA 2F3UA 2ZZNA 2PV0A 4CFYA 2HQRA 4UZEA 4OQLA 5I3ZA 2R7MA 1M2FA 2YNMC 5EMMA 3KQLA 3NBFA 3L4EA 3KSMA 5I3CA 3PFKA 3IVCA 3HVJA 1SQSA 4XQEA 5J40A 4B3BA 3JSAA 3OCWA 3UAWA 4EX6A 4GX1A 3X1KA 4QBFA 2RHWA 1PV1A 2WAOA 3ZKWB 2EZ8A 1JAIA 4TOIA 4AQ7A 1RRGA 5DSXA 3ROTA 1TEZA 1N8TA 4TRRA 3AU8A 3RFXA 1XLTC 1TMKA 5E8JA 3TJMA 1LGYA 2D5LA 2WWTA 2WWFA 5TC4A 1DP4A 5EFZA 5E9WA 4DMMA 2RONA 6PFKA 1QZZA 2ZJ0A 3GEDA 2J41A 3CURA 3FPEA 3G13A 4XYMA 4DANA 3NLLA 4NVRA 4MWTA 5NLLA 4CRWB 1OXVA 4RKRA 4LYEA 3JQ8B 1D2AA 1VE9A 5E6RB 4AJPA 4C03A 4WLFA 1XCLA 2WJHA 2P8SA 3W2HA 1E5DA 4M60A 1QP0A 2JH9A 4RVOA 1L7VC 1TM5E 4JCOA 4MAFA 3TO5A 4Z7OB 5FOSA 2CT8A 3M1LA 2JC3A 4GKKB 3AR6A 4GDFA 1JT9A 5DI3A 4CR6A 1W36C 2BRUC 3DTNA 2IIPA 2Y27A 1S8NA 2BY4A 2VRCD 1LSJA 121PA 1KEEB 2D06A 1UPUA 3ZDCA 1ZSVA 4YV2A 2RH5A 3Q8LA 4CIXA 4F3CA 1FOEB 4DLRA 1YFZA 2BD0A 2OC4A 4NYMQ 2KS6A 2MINB 1HQYE 2WG2A 2J5KA 3I9NA 1T8RA 1U6KA 3SC3A 5CTAA 1UZNA 1YZ3A 1K0FA 1WD5A 1F4VA 3NJ8A 3OAAD 4HC4A 4HVCA 4ER3A 4FHZA 3MHPA 5CNKA 5I01A 4W7IA 1M34E 5HK9A 1WVGA 2J9FB 3LUBA 1P0PA 2J1LA 4HV4A 3I3OA 4XTRA 3ZW9A 2JCYA 1PGPA 1HORA 3C3AA 4FINA 5CBKA 4M0CA 2C2GA 4G1FA 1WLYA 3L0ZA 3ZWAA 1UBJS 3O21A 2WLSA 1ND6A 2WIAA 1PJCA 2YICA 4DEYA 5B4TA 2O2EA 3NTOA 1MR3F 1VYHA 1WY5A 2PQ6A 4IQGA 1GFIA 5IMBA 5B37A 1H4QA 4NL4H 1BMTA 2YZ7A 1WB5A 3AIOA 2JDID 2XEXA 3HGTA 2GQ0A 5FPSA 5IAKA 5EJEA 5EJ9A 2RHRA 2VTBB 4GAEA 4JJEA 2BAGA 4E12A 1XYVA 1ZVKA 2V65A 5K0SA 3FCUB 4AKGA 2ZRNA 5CFRA 1NP6A 3EDCA 1G98A 3ONWA 4J4HA 2VHXA 2UUAB 3AJEA 4ESEA 1ULSA 1C1DB 3GLQA 5IUKC 1RM0A 1SY7A 4O4LA 4HBZA 3R9XB 2XQVA 3PUJA 4BS9A 1YMQA 521PA 3P9PA 2FTKE 2NPFA 1CY1A 2LWIA 3PF9A 5JYBA 3GY0A 1BVYF 4W9MC 4MQFA 4MR8A 3HNRA 3SBDA 3F6YA 1JFFB 4KPFC 1PV4A 1Q7BA 3H65A 3HUEA 5BR8B 2ZUCA 2GN2A 4ZU1X 2WJ3A 1UH5A 2VP6A 5DXJA 4CKBA 4FD3A 4WK0B 1PYDA 1XAGA 4B5KA 2SECE 3KEGA 3K6JA 2JASA 2X7XA 3OOSA 4GX5A 3EAQA 3RJ5A 4BKQA 4JI2B 2FPPB 2PSEA 3SYKA 4D9JA 4AQYB 3FOAA 1M1XB 2NSHA 4U0KA 4CL8A 2NO5A 4GYYA 4CQNA 2IOFK 2BKEA 4WOBA 4KFRA 2JKVA 1B6TA 1FDTA 4EJ0A 1JR2A 1E32A 4PBRA 1J6UA 2XPCA 3RW9A 2FR8A 1EB9A 2NQTA 3AJ9A 4WBNB 3LQKA 4JR2A 3WWCA 5JFTA 3LGXA 1PN3A 4RHFA 2QY9A 2QX8A 4DLLA 2G28A 5DK6A 1CPYA 1ZWKA 3AR2A 4N0QA 3W90A 4Q1AA 2WIFA 1W25A 4LCBA 5HBGA 3SX2A 1IRXA 5G4KA 4WNYA 1UOQA 2WY2D 1QOQB 4HEA1 2Z6QA 3IXMA 3C15C 2C9YA 3COYA 2NYUA 3F7MA 1TCUA 2GPYA 5ILOA 1QWOA 4QLOA 1RKXA 2GASA 1XZ8A 4ALJA 1EX6A 3CZ5A 3E03A 5JNUA 3LXMA 3C0KA 1UPCA 4NNJA 2HDOA 4NNPA 2PBLA 1E8MA 3HN7A 4D9EA 5E95A 1CJMA 1JDBC 4YJ2F 4QXRA 1OV6A 4UREA 4ZOLF 1U63A 3I9V6 1KK0A 2HT6A 1V6AA 4KP7A 3EIUA 3I2HA 3GLGE 4FXPA 4I50B 1II8A 3P7MA 3P0EA 4UBOA 4KQGA 3IQZA 2XQFA 5AIAA 3OIUA 4YO8A 1V1JA 1VKRA 3UWKA 1HDEA 3QA9A 1KDYA 2B78A 1HLPA 4L75A 1Z37A 3BL8A 3T5MA 4DW8A 3ETNA 4L4XA 5KTOA 5DBIA 3HEMA 1RAGA 1Q1EA 2GLTA 1C8BA 1PZXA 2HK8A 3EPPA 4FYKA 4NMMA 5DNAA 3D7SA 2PSSA 1ZVMA 2WE7A 1HPLA 4FUTA 2WYHA 1EWQA 2IE0A 1B14A 3R1IA 3RBAA 4KG7A 4ZVRA 2R6CA 4N8SA 5EJGA 4CMIB 1KGDA 1Z7YA 3AINA 5DGDA 4AMVA 1AN9A 3I9JA 2YWCA 3MC1A 2R85A 2XYGA 5GADl 3IVMA 3H2BA 3WP1B 3ZWYA 3TOZA 3JQRA 4B7CA 2P6UA 2GTHA 3QBTA 4MVJI 2VHVA 3H1TA 1YDGA 2ZBFA 4DVJA 3DOCA 4M3NA 2YWFA 1T36A 3T6KA 4EAAA 4GXRA 4X85A 3BSWA 4GOKA 3MWLA 4C87A 4ASUD 3GPLA 3A6DA 2CY0A 4M37A 1NSFA 1XCOA 3U60B 2ATEA 1Y9DA 1YAJA 2QRUA 3NDIA 4LV8B 3K1AA 4EDHA 4V3CA 1RD4A 1E63A 4J49A 2ZYDA 4LY6A 2ZB2A 4Q1BA 1I1QB 3K1TA 1FMJA 4IDEA 2XWJI 5AW9A 3U17A 1Q3TA 3CLRD 4AMZA 2CL5A 3ETEA 3KJGA 3PDIA 1QCDA 4JC8A 1YRLA 1L5KA 3RYFB 5EHZA 1NYQA 1G1MA 1WKVA 4LF8B 2G06A 3L0OA 1M2VB 1TK9A 3N2IA 1KBQA 1HE1C 2MSCB 5EWLA 4F7WA 4F9TA 2G1AA 5HF8A 4B17A 3TE7A 3I0ZA 4QOFA 5EKUA 3K9WA 4HLNA 2L17A 3GJQA 3HVHA 4QEZA 2FY8A 3E7DA 3FYHA 4IEIA 1GPYA 4LRTB 4WEOA 4V1CA 2H1OA 3HL0A 5B7GA 1PR0A 1CZRA 3R09A 1SXJC 4OBBA 3SZ3A 1W2GA 5I7RA 2GKSA 1T0UA 5BOSA 2ZJ4A 1M6EX 5CA1A 5B4UA 3JQ7B 5ALGA 1UFOA 1H1TA 4LJKA 1IPHA 1RRMA 3H75A 2II6A 1IZZA 2IIBA 3B3AA 4BCDA 5JBNA 1AO0A 4FOTA 1QF6A 1TVKA 1Z4NA 2HMTA 1KFBB 3D3EA 3VDXA 2XOKD 2PUBA 1YCHA 1XF9A 2AF3C 4I4TF 4YMTA 4ND8B 1HQDA 3FAZA 3EOBI 4M0DA 2YCLA 4WLVA 1XMVA 1M2KA 2HLPA 2PZJA 2X8JB 1QYWA 4DT1B 1BTOA 1T1RA 3H2HA 4JGGA 1UBOS 3FKQA 2I66A 2MYNA 2QLTA 4N65A 4QGFA 3L7NA 4W1RA 5EE9A 3VH3A 4BO9A 4G1EB 4L3OA 1A5SB 3ZHUA 2H3EA 3HN2A 2RMKA 2HTEA 3P71T 3Q0EA 2OVFA 2PWAA 2WHPA 5KNBA 4PAMA 5CVTA 1T8PA 3CJRA 2GZAA 5EWMA 2O54A 3ZWDA 3K5PA 5DH9A 4G4JA 3RLIA 4G5SA 3CCBA 4NU0A 5JRJA 1WW2A 1JYEA 4G01B 2I22A 2R2AA 5JFOA 4UTRA 5EOVA 2A86A 2O2YA 4CN8A 3ULKA 2CLMB 3HU2A 3X1XA 2QROA 1SKQA 2OP0A 5LA6F 1T6NA 1Z8FA 5E4JA 1OB2A 3TLGB 5EP2A 3VU3A 1D1SA 1TUBB 3C14C 1KQFA 1JPUA 1E1YA 4OAOA 3A9RA 4OP2A 3N58A 4O33A 3H9CA 4K9PA 4XIIA 4GKBA 3R5JA 1SVLA 2J9GA 2D7JA 2Q3CA 3COWA 4KQMA 3VZQA 3IPRA 3KQYA 1DAEA 4UDOA 3V34A 3E2MA 1SUDA 3Q1KA 2Z08A 1BU5A 4MV7A 5HQJA 2WM2A 2WIDA 1GPLA 1EFPB 2PWZA 4CIDA 2CYCA 2R6FA 2OO5A 1JQDA 2P1DA 2FX5A 1RWOA 1SIWA 3LVBA 4PE5B 1JTFA 4LXTA 5BWBA 2VDMB 1AHPA 2CMKA 2VDVE 1MB2A 1RYNA 1GGVA 1KEWA 3OLQA 3HKEA 4JMPA 4RF4A 2QLNA 4ARIA 3HKCB 1II9A 4M8IA 4LF5B 1T9BA 2H2GA 3ZZNA 1PD0A 3DNFA 4D41A 1SC6A 4WKOA 4NOJA 4U1RA 1TUIA 4MW6A 2OILA 4BBZA 4CFZA 5FV4A 4ECEA 2ZBDA 4PLPA 2Q6TA 2HK7A 1RKVA 4ITUA 4Y2GA 2C83A 4WXYB 1BEEA 4ZZ1A 3ILVA 3PDCA 1USGA 2OCIA 4Q39A 2LD4A 3QE3A 2HMUA 3WLQA 3F7TA 1EBBA 5D3QA 3UK6A 4ACBA 4D9BA 4EG1A 1XHEA 2OLJA 4R3UC 1AV7A 2I2FA 1K6XA 2VDUE 4EFKA 3QNMA 1R27A 4DIDA 1ILWA 1Q14A 2O0HA 1BS9A 5JO0A 4WBSA 4PC6A 1F6WA 3DZ8A 3T41A 1IVSA 1E4OA 1YUMA 1OIVA 5CVEA 1EX1A 5EMLA 1GA1A 1OIXA 3IKVA 3EGXA 4PYMA 3CRQA 3L84A 3U6KA 4JR0A 1VSVA 4IF4A 1Z83A 2H4ZA 2JVKA 3BB3A 1QHGA 3MWJA 4RPGA 3UUFA 2W22A 1BN7A 4W5TA 3EULA 1XV5A 3MRXA 1HL3A 2BW0A 4ILEA 4Z0TA 3B1VA 3RKUA 3LIIA 1EJ0A 1VJ1A 3F9CA 3FWNA 1MKYA 2CYAA 1Z9BA 3OOHA 3P4UA 1P17A 1XTSA 3FDFA 3UCEA 1DE0A 3GI1A 4AXXA 4DV7B 4LHVA 5AM1A 3ADOA 1U8YA 1KZ9A 3QWHA 2GXQA 3RC2A 5BR7A 3ME5A 4OHRA 2X2PA 2QT9A 4CR7A 3NP7A 1A9PA 2ZBRA 1F0YA 4FEAA 2Y0CA 5DTIA 4K40A 3DEJA 1KP9A 2BEUA 4Q16A 3O9ZA 4J8PA 1KJQA 1I3KA 3HFSA 3KD2A 1ZI8A 3RUDA 4AP5A 2N47A 5ED4A 3RU7A 4F3YA 3PFNA 4POOA 3EEOA 1N2XA 5IP5A 3T7DA 3CGWA 3A4NA 4KMOA 3G2PA 2CBXA 2ZTLA 4OK3A 3STTA 2XVXA 2OCGA 2LW7A 4LVCA 1LSOA 4Y0AA 3N0XA 1U1CA 1ZK3A 1SKUA 2Q9CA 4K9MA 4ZCMA 1KAMA 4D26A 4HATA 1QZXA 1SKBA 2C2MA 2HJVA 5G3ZA 1VHQA 2IPNA 3T12A 4ND2A 1C9EA 3C4JA 2A7QA 2CDAA 3T1OA 5KMGB 2X3FA 4HAWA 4E14A 5F78A 2QPOA 4RZ2A 1V95A 3FBWA 1ZNZA 4D99A 4OO3A 1UJ6A 3OM8A 3PKJA 1O8CA 4GUAA 4MVJF 1UDWA 5ALKA 1N5RA 3B52X 4NY1A 3RTAA 3VUFA 3WLLA 4EENA 4YQFA 1SUIA 3IVXA 5EUCA 3HG7A 3D2CA 2TMKA 4LG1A 3E9DA 2H57A 3M9LA 1WP4A 5K8IA 3II6X 3W9YA 3QYFA 1V39A 4K0RA 1EK1A 2B21A 4LHEA 3RSCA 3F9RA 3VU1A 5IUNC 3ZXYA 3IDAA 3KPUA 4B6GA 1EFUA 3MPOA 1NW9B 2NO1A 4RABA 2ZGVA 4HEQA 3ICEA 3L92A 4BIMA 4DA6A 4PICA 4LS3A 1R6BX 3ZIUA 4CKXA 3KEFA 4Z99A 1ZX1A 1I6KA 3WYFA 3DR5A 5COBA 3RHTA 3QG5A 1WM1A 2YYYA 1ESEA 4BO6A 3FUCA 4KGXA 3ZIAA 4EG8A 4XVUA 5KREA 5KYXB 1HURA 2C4VA 1M6VA 1JXAA 1Q74A 1VHWA 4OP3A 1Q6ZA 2OZVA 4IRXA 2Z9BA 2ZM6B 2VQEB 1V7ZA 1T3HA 4ZYYA 1JMVA 4RVSA 1ZUIA 1JG1A 2VAWA 1RKQA 4G07A 2NT3A 5A7FA 2PZMA 1AN0A 2ZIFA 4PLVA 4OQNA 4EO7A 3O8CA 3JQGB 3FTEA 3JAWB 4PC7A 4TV8F 2HMYB 4LZJA 4R9UC 2VHYA 1G7CA 1Q19A 4BFLA 4NSNA 4O1MA 1TE2A 4W63A 3ZY6A 2VN8A 3Q2KA 5KYWA 3FMVA 4EGJA 3T7CA 2B0JA 4N3AA 5AUQA 2IV3A 1FTNA 5CNMA 3KL2A 4JVSB 4YJGA 4FEGA 2I1WA 1TPYA 2M6SA 3IB3A 1S4MA 2IL1A 3GR6A 2A9RA 2VYQA 3AY3A 3MCTA 4HZUA 2IQ5A 3QXXA 3UC9A 4Z2AA 4FQ8A 1P1FA 2YW2A 3OU7A 2VJDA 4TV9F 4JENA 1B0AA 5IM5A 3C4VA 2HF2A 2HPVA 3OZBA 4IPTA 4MO2A 4UBNA 3IRUA 4GICA 3BJEA 5GJVC 3W2FA 1R6TA 3TMYA 3HHPA 3NVMB 1NGSA 3L7OA 1FP6A 3PWKA 3TH5A 3ZOZA 1NMZA 3IEXA 2FWNA 4WN9B 3T7RA 1ZOLA 3QXGA 3GRCA 5FYDA 2E18A 1ZR4A 1FQJA 1GRQA 1L5RA 2EWWA 2QMYA 2PEZA 3GROA 1K8QA 2A5DA 4Q4DA 5JSUA 3WHIA 4WOKA 3JXEA 2DFVA 4J3NA 4D4LA 1K66A 1A69A 2FEOA 1BAPA 1R5BA 4YB8A 5TGTA 4GE3A 3VOBA 4YPOA 1W4ZA 3H5WA 3W1EA 4QQ8A 1PR6A 1ZN9A 2OV6A 3GARA 3WRVA 1XEAA 1ORIA 4OP1A 2BZ1A 1ISSA 1M6YA 7GPBA 1H2XA 3MTAA 1R6VA 3KPWA 3QYPA 3KYCB 3WMGA 1I5RA 3H6HA 2WKPA 3GFOA 1UJBA 2V3WA 4NLLA 1GKKA 4W8OA 4KWHA 2G8LA 2WJIA 2UZ1B 1DU4A 3E9QA 1KKLA 1QKKA 4GLLA 1PS9A 5A2GA 1RAAA 1G8YA 3SZOA 4YMVA 1M6HA 4Y0NA 1OPXA 3T3NA 4PRYA 1R9GA 3EXHC 1PJQA 1J9ZA 3D31A 3DVLA 3OEWA 1HV8A 4ROTA 3SLRA 4RV4A 3TL3A 4EJSC 4KODA 1E94E 4F5DA 2YVLA 4UHEA 5KNCD 4WL0A 2P0EA 5JZ9A 2P0AA 2FX3A 2CXTA 5DHPA 1X92A 4K9OA 3WGNA 4I8DA 1AKEA 2JLXA 4B6OA 1DNPA 1EDDA 1CB0A 2GYVA 2J0UB 4MJ7A 2IYVA 4OUDB 1IDOA 4D3FA 2ZJ5A 3L8GA 2E5FA 2WB4A 3ELWA 3K5IA 4HNAB 1V3VA 4RU1A 5PNTA 2GSWA 5T5QA 3AEUA 4O0MA 1WCYA 2Y1FA 3HE3A 3B6ZA 5DO9A 5LBIA 4EYSA 1XTPA 2B4YA 3IURA 3ANSA 1NSTA 3D9QX 4BXOB 2ZFUA 1EGQA 4BRZA 2R1VA 3VV2A 4OY3A 4ENQA 2EGHA 4J0KA 4KO1S 2GVDC 3EHEA 3FCCA 3ZWPA 2QGFA 2ZDGA 4R71A 4IVPA 1ANKA 2Q5FA 4RD4A 3DZHA 3I04A 4J2HA 4MAMA 4Y1GA 4IG4A 2VPIA 3L8CA 2VJCA 5AOCA 1UOOA 4Y1RA 7ADHA 3MJEA 1U2EA 1MNQA 5K8CA 4GVPA 3FRHA 2CMFA 4LDAA 1U3DA 5UKDA 2WWVD 4KXWA 3SCZA 4KOEC 1B6SA 5CDGA 4EY5A 2XUPA 4TN5A 5JYCA 3HA3A 3IESA 3UMGA 4ZAGA 1Z07A 3F1LA 4P3KA 4KR7A 4YJ3B 3BH6A 4I4TA 4OAQA 1LW7A 1NRIA 3DTYA 2FSUA 1U1EA 3I05A 3N6XA 5I9LA 2HV9A 4ZYUA 1DEKA 2I8AA 5CK5A 4EI7A 2IS4A 1CDZA 4KFSA 4TMKA 4IGIA 3JD3A 4UUAA 1O9HA 1S9DA 3BX1A 3F8SA 5LVAA 2GZ3A 3BA1A 4MWGA 1YB4A 1W4CA 1KXJA 1SVIA 2ZYVX 3L07A 4N8DA 4R2IA 3WZLA 1T2EA 3ZGLA 4CMBA 4I6JA 4EH1A 4AG5A 4I3FA 3ND9A 5KTRA 1NMXA 2Q3DA 3RUHA 3L4BC 3VI3B 4EHHA 1JR3A 3A6PC 4KXLA 4M9SA 3DEZA 2RHDA 4GOMD 3MTGA 3SQNA 4BB6A 3HBNA 1RLIA 4CV2A 5JLJA 3EE6A 4K05A 2IEAA 3INNA 4I14A 2EEZA 1WMBA 4IYRA 5H59A 4FX2A 1JLRA 4O2BF 3WXBA 4F71A 5IJ9B 5DISB 2Y1XA 4GNRA 4OLAA 1TA9A 4WE3A 3NP9A 1KDRA 4LWPA 1YO6A 2GD6A 2I6FA 1O9BA 3NKFA 1XDGA 4D9GA 5E9QA 5TE9A 5ABPA 3THWB 1XQ9A 2BBTA 5F1PA 3G79A 2NVUA 1GL7A 5J3JA 2APJA 4P5EA 1XQXA 1MLDA 2NM0A 5AKKA 1NI5A 1QF7A 4QUIA 5BN3B 3VDNB 5F4BA 2GN4A 3OPYA 1K5GA 1DEOA 3HM9A 4LRXA 3DO5A 1KETA 4RD6A 4KO3S 1FQWA 4PBTA 4FMCB 3MK31 2Q6OA 4PF1A 2FLWA 4JI4B 5I9TA 1IY9A 3QFSA 3I62A 3H1FA 3GEPA 4RSHA 2GUGA 1W36B 2H4YA 4EWLA 2NTYC 1VL1A 1Q7GA 5TIIA 2NSDA 3LPMA 4PNPA 4E51A 5IG2A 4DXDA 3AVWA 5HZGA 5IVDA 4TXHA 3V9AA 4BFSA 4NV0A 1X8LA 1J7JA 2ERCA 2GSDA 4YN3A 1YQXA 2G67A 2N0SA 3CZAA 2LNDA 3V4OA 4EA6A 5JE8A 4U5XA 1C8VB 3ZDQA 5L3QB 2ZIUB 1X9IA 3RC8A 5IF3A 4I9NA 5F9FA 3WLJA 2JLSA 1JG3A 2WVAA 1W1IA 2QD3A 3IJRA 1BHO1 2P9TA 2ZEJA 4HRYA 4NBWA 3PTLA 1I4TD 1NM5A 1E1KA 4MW9A 4JT8A 2XKBA 2ZRPA 1ADJA 3CR8A 2NAPA 2K87A 2X9GA 3FOZA 1ZONA 5CYFA 1OI4A 3D3KA 4PWZA 5KSZA 4C4OA 2LIVA 4QYXA 2AOWA 1BH6A 3JRXA 3LUHA 1HWYA 1TEHA 4HUTA 1OKKD 3KZKA 5HFJA 2JCXA 1D7OA 4WZ6A 1OH7A 4DHWA 5J2TB 4RLFA 1JNYA 2NZXA 4RJIA 1L7RA 1TJ5A 4FYWA 2AG6A 3JD4A 5FNZA 1GAEO 5KOYA 2DJ5A 2WG1A 3KKPA 3A2LA 4R8KA 1PR4A 2W6CX 2IZOA 1UJCA 3F4BA 1K06A 4IKOA 4D8TA 4RD3A 2JI8A 4R7TA 4GECA 3ITNA 2D7DA 1CNEA 4XPIA 4M98A 1GILA 3IP5A 4C88A 3AEZA 3GVIA 2VDQB 2Y68A 3B48A 3C8DA 3CS3A 1QU2A 5GJBA 1L2TA 4M53A 1VQ1A 4HEA6 3KXIA 5HRCA 1UBEA 4AJNA 4GI5A 2XUGA 2ZBUA 3IP1A 5JI2E 3MLEA 5IK2D 2BBOA 3NX4A 1S2LA 4G8BA 1Z35A 1I8TA 4DQVA 4JLDA 3IDOA 4KDCA 4XIJA 4BYGA 3DE1X 3IT3A 3TTVA 1CF9A 1O6CA 3RUCA 3EPJA 2GO7A 1FYEA 3CUYA 3QV2A 2GWRA 2CVPA 3M82A 3JATB 4Y2QA 1H0HA 3D6AA 1Q5PA 3KOZA 4KLZA 5IBQA 4B7XA 4O6VA 4YJKA 2HCRA 2JGNA 2WD9A 3QEOA 3C5VA 4RO0A 4Z3KA 5AW0A 4MMZB 4MVJG 2NUAB 2AG8A 1LEHA 1QQ6A 4E1BA 7YASA 3ROXA 3AZOA 1H2ZA 1IIBA 4EUHA 4L2IB 5GVRA 2I4OA 1CT9A 4U6NA 1OU4A 2CWWA 4JK3A 5T7BA 3KSBC 5D51S 1JV2B 1VMIA 4JJ6A 1J4AA 1LVUA 1BFDA 2ZB3A 3HB1A 4RKWA 1QJCA 1WWKA 5EYPA 1U0EA 5E1DA 3KJQA 4Y2UA 1MJ5A 1SG6A 5JAQA 3RC1A 2EAUA 5AJUA 4CM1A 4KRGA 2EQ5A 4P4UA 4QJ5A 1H2WA 4MS1A 4P36A 1Y1QA 4QTYA 1OZFA 3ITDA 3JYLA 1JDBB 5E7QA 1EQUA 1KYZA 1IQPA 3AJ8A 1IBCA 3QFRA 4JEIA 3O8OA 4EJ2A 3FPAA 5IANA 2AMVA 5DRTA 2FSHA 3RQIA 4KCGA 5AJVB 3U81A 3FWZA 4Q48A 5EKDA 4C04A 5JDIA 2AEMA 3EUEA 3WRXC 3FNIA 1PVVA 3CUWA 3X1WA 1YDFA 2I7CA 1GUFA 2C9BA 4U9IS 3PR3A 5C31A 2IYUA 3H19A 1GA6A 3MCAA 1UUFA 4K6FA 2HRZA 3B3GA 3I09A 4CODB 1QYDA 2AKAB 3OZCA 4JLVA 3SQWA 3A37A 1GGKA 1VE1A 2WJ6A 1RWKA 3RRFA 2IHUA 2PFGA 2WNIA 3DMGA 4QTXA 1Q0TA 4M38A 3I2YX 3E22A 2NOAA 2YXNA 1UXHA 1Z2EA 3LPDA 4PZDA 4HXGA 5TSDA 2EFDB 3FDIA 4EFLA 1X1TA 2QV0A 4MKXA 4J7CA 2LV8A 5JJKA 3A0RB 1XPRA 5KDDA 4JOQA 5AVVA 2W6MA 4E21A 5BNZA 5CD9A 4DQXA 4KR3A 4DOMA 1T9HA 2DUWA 3K53A 3ZLTA 1JIVA 2W37A 5CXXA 4L57A 1R6XA 3G5UA 1IN8A 3Q7IA 5ARCA 1JDJA 2JIQA 4C7MA 2H1LA 1DIOB 4MUYA 3V4RA 1YBFA 3GDOA 4J6EA 2EFEB 1TGVA 3NC4A 1KI1A 4ZJYA 5JARA 5KNDH 1QTIA 5BQFA 1JEJA 1FBNA 4DCPA 3BG5A 2MSDB 2R9VA 2IE8A 1EJBA 1J0AA 3AL0C 1E64A 2YV4A 3O03A 1VMAA 3HNOA 4HRAA 3NM4A 3OM0A 4O1HA 2O8BB 3L0IB 5K4GA 1RC1A 4NBRA 4K5QA 1RAEA 2NNLD 1MHTA 2PO7A 3N75A 2W00A 3JTMA 4J3JA 3U3JA 1C5KA 4EECA 3MMNA 1H2RS 5JV5A 3EJ6A 2Q99A 1GU0A 4LYYA 1K8XB 3D8SA 4KNWA 2P9GA 4ZIRB 3TVTA 1JR6A 3F47A 1BDIA 4C4AA 3W8RA 1FP7A 2QMEA 1X7DA 5D87A 2DM6A 2W2KA 1KR5A 3CLRC 1PU2A 3H5TA 4QPCA 4DSAA 5GY7A 4E31A 1XFAA 2JHFA 3BTUA 1Z22A 3BWCA 4IVNA 1XT6A 3DHYA 3LL4A 3GUVA 3UAXA 1SXJB 2AN5A 1LPNA 3JWPA 3NVDA 4FSDA 5LQUA 1RWPA 2XOEA 2XT0A 3AUAA 4ZGWA 2ID7A 1QF9A 1IHYA 1Y7LA 2QTNA 1JE0A 2VDWB 1WQ4A 4HDSB 5IJAA 2R00A 2QSYA 2JVIA 2X3UA 3BF7A 3GCXA 1Q20A 2P5SA 3IDSA 1A7KA 4JXJA 4X7PA 4JJIA 3KQUA 1P4JA 1IEVA 1DEXA 3ASYA 4IIXA 4U9HS 1A7UA 5C1DA 1RHQA 1T13A 3UAVA 1EFKA 2FF7A 5EJ4A 3M4XA 5EJFA 1OCEA 2Y66A 3L77A 4FYMA 1G291 2FUEA 1C0LA 4AD8A 2H18A 1BKDR 3D1JA 1C41A 4OXYA 1A2BA 5JLAA 5LOVF 4ZI7A 3NWOA 3U13A 4RZHA 4E1AA 4IFTA 1MAHA 2P40A 3E53A 3ZE6A 5TRTA 421PA 4JYAB 1OGJA 4MKIA 3ZVNA 5E4FA 4M4SA 3Q40A 3RQSA 2IF2A 1OYWA 4FUQA 4Z9FA 1AMOA 3G68A 4TKLA 5ENZA 5G1OA 1OA0A 5GZ3A 1YI1A 2OGWA 3D54D 3U0VA 1OR8A 4YR7A 1NQXA 5DT2A 3LXUX 4DMHA 3BXOA 4IOJA 5CIQA 4OFZA 4AG3A 2QDKA 3AYXB 3FAKA 1KJ8A 1O08A 1RYEA 4HWTA 1COZA 1P2TA 1RJ9B 3WY9A 2O9JA 4KJXA 1X7ZB 4AK9A 3PGKA 3QEMB 1NW7A 4TWIA 4C0WA 2JKYA 1ZD1A 4CZ2A 3ROZA 5C46F 3KJHA 4NZZA 1YMVA 2UYCA 4AZ0B 4Z6KA 5TNXA 1BCSB 4BNTA 5DYNA 3I92A 3LO5A 1RZRD 3S81A 5EA2A 5ADUS 1XE3A 1ZGCA 4QUDA 3A14A 3ELYA 4BC0A 2QBYA 2FF5A 2BMDA 2QTVA 1XTRA 1WW3A 2XUAA 2Q1XA 3AUJB 3M5DA 2I2XB 3QVLA 4GX0A 4JBWA 4UFNA 4CQJA 4DPLA 3ETCA 4X1OA 4PYNA 3C1UA 3M8KA 5DSZA 4ZAVA 3QVOA 5EIOA 4AJ1A 3DZJA 3OJEA 1EP3B 3UT5A 2BTOA 3DXYA 3OWXA 3RK0A 1OC2A 3BULA 3SQXA 4QDXA 3V7FA 2EL9A 1BYUA 5I7UA 4X7RA 3O8DA 1J56A 1YASA 3IAM1 4W9NA 5LLDA 2J3QA 5TLSA 3S5UA 3PL1A 2A5FA 4NEHB 4E46A 2PS1A 5J4HA 1J70A 2DWQA 2WYVA 3EGDA 1W48A 1SCJA 2QZZA 5M5BA 3CRNA 5COQA 1H3FA 2A9VA 3JR3A 3EIHA 3SFZA 3EEQA 5K7SA 4C08A 2P9EA 1T3LA 4C0XA 1G16A 3ZJVA 2PT9A 5BXYA 1FIUA 2NSJA 4O2BA 4C0BA 3ZY5A 4E4TA 2Y1EA 5CFLA 1G38A 4MIOA 1N7IA 1JB9A 3U48A 1M5RA 2BUBA 1ZMTA 4D0RA 4O25A 1NVUQ 1YS7A 3UJ8A 3R7WB 2VCHA 1CWUA 1ZUWA 2FP4A 2QD2A 3G2MA 3IP3A 4FX5A 2QY6A 2Q8PA 1PF7E 5TARA 4AZVA 4DNFA 2ZDQA 2DKNA 3GXOA 5BWMA 2BGKA 4E09A 5KTSA 4HAZA 4J7AA 5HKBA 2EKQA 4HDNB 4QYSA 4RS3A 4C7JA 1GNSA 4CMJA 3C6YA 3HB9A 1XGKA 1VBKA 5H3CA 2WI8A 1C3LA 2ZJ3A 4KXVA 1YOVA 2IHKA 2A3NA 1KDPA 1NSYA 3FSEA 1VL6A 1DDOA 2Q5EA 1ENZA 4F5ZA 2BI4A 1NLUA 1S5PA 2DWCA 3VR6A 5FOUA 5E6UB 2GCPA 3HEBA 3HDGA 3LDHA 3OD1A 3RIEA 1QP7A 3QBDA 5EJ7A 2NTJA 4OBWA 3HYRA 1T8YA 3O47A 4V02A 2OXEA 2I4TA 1JXOA 4OQMA 3U3RA 5B30A 4RYLA 1QIKA 1E6MA 1ZINA 2Q7OE 5ALUA 1B3BA 3AWDA 3PNLA 4MLPA 2QRZA 3G2NA 3JVIA 3FMFA 4TM8A 4UEJA 3LSYA 1E66A 4IJUA 2ZVPX 4IUDS 2JGDA 3DZDA 1R5JA 1RKUA 1Z47A 2ORIA 1ZLXA 4KSYA 3RYHB 2YUIA 3DDWA 3FHCB 4LECA 4OSOA 5EP3A 2E5LB 1Y42X 3JD1A 1PR3A 2AFRA 1WDKA 3KU4A 5IS2A 1T1GA 5T41A 3GGGA 4HF7A 3KKQA 1I24A 2ZYAA 1PUIA 1ZK2A 3C8MA 3DCIA 4RF2A 4IKPA 2M32A 1TKCA 2DBVO 4PRZA 1VMKA 1CCWA 2HWYA 4C76A 2FMIA 4LNHA 3UGJA 4TL6A 3SZRA 3RS4A 5BN4B 3QX7A 3KD3A 4YP9A 3E7FA 3AV3A 3F6SA 3PCRB 3F46A 1LA2A 2FZLA 4B6RA 1QGYA 3UOAB 2CEKA 4MQ6A 3ZCXA 4F2PA 1DBQA 5LQAA 4DLWA 1HQCA 1UXJA 4P81A 1TEVA 4D9CA 4F2HA 1HE4A 3QVKA 1KEUA 5HJEA 2XW6A 4QA9A 1R9MA 4KYTA 3TSZA 1QIIA 4JB3A 5CVDA 4CDMA 4F7DA 4RTKA 3EQ8A 3G8BA 3Q72A 4RY9A 1SKAA 3FMIA 3FYDA 1T3ZA 4OIMA 3V8RA 2RD2A 1F3LA 4KQXA 5BWNA 2D5BA 4RSRA 5AWFC 4GQAA 1RI5A 2YC2C 5JEEA 3VBCA 4Q9LA 5K0TA 1P7WA 3Q3HA 4I55F 3FJYA 3NBUA 4MIEA 5JSKA 4AY3A 1ESDA 2AHOA 2Y67A 2CFOA 2ZANA 1QB7A 2AOTB 4BZXA 2ZUTA 2O5CA 3TJRA 2JLRA 2EX4A 1JIXA 2P5TB 1F38A 3DKKA 1UANA 3O8BA 4RY0A 2RJOA 2MJLA 5KJEA 2VZ9A 5G53C 2CFTA 3BD6A 2YS7A 3RVNA 5FX2A 1PL7A 3KVYA 5KIAA 4OXKA 1N1GA 2AFIB 1Q16A 1M0WA 2ZWOA 1RQGA 2QYTA 2XQKA 2CXRA 5D3ZA 4BO3A 1LD3A 3N8KA 2M9MA 1QFYA 1Y6JA 1E79D 4C05A 5HVNA 1IN1A 3WRWA 4Y6OA 3P20A 2BFWA 1U9IC 2Z5VA 1JZTA 2F1JA 3QXJA 4AWAA 2F1HA 2VTEA 3E70C 3P4XA 2YFKA 3JALB 2WJWA 1FVHA 2WU0A 1N2OA 3LOQA 2Z2XA 4JX9A 4TTVA 5J59A 3TW6A 1TU3A 3SJUA 1WTCA 4RTPA 1F6BA 1NIPA 2H1IA 2FQWA 4IDFA 2IYQA 3BSSA 3JPYA 4CUJA 4M9UA 1GG9A 1OAOC 1Z2AA 3OE5A 5DXFA 2GN1A 4S35A 3WIDA 1O94D 1E3JA 1ZVQA 3R8XA 3ZXSA 1G21B 4AJKA 1M6NA 1TCBA 1W52X 2SCUB 2JGEA 4J0HA 3RSGA 4C6RA 4NJMA 3HSKA 2PNJA 3VOAA 2V7QD 3GVHA 4NBLA 1L9XA 2IVZA 1NIJA 3LH5A 3REQB 1SH7A 2VJQA 5EIAA 1RQLA