1JKJA

E. coli scs
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords succinyl-CoA synthetase alpha subunit
publication title Two glutamate residues, Glu 208 alpha and Glu 197 beta, are crucial for phosphorylation and dephosphorylation of the active-site histidine residue in succinyl-CoA synthetase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 110
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1jkjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jkjA01
3CSDA 3BMNB 4PRKA 2B83A 2BI7A 1GAEO 3GPIA 3IMFA 5DT9A 4DXHA 3TZ6A 4OXYA 3ZWPA 1CQIB 1JW9B 1FK8A 3V2UA 3IP3A 1ZK3A 1LC0A 1C1DB 3B20A 3KEQA 4YDRA 5I8WA 2WWRA 3DOCA 3FTPA 4BNTA 3KYCB 4Z0TA 1HSOA 3ZV3A 2NSDA 3BHMA 1J5PA 4FOSA 2Y1DA 2ZYDA 4HFJA 4R1NA 2X23A 3DBHB 4PLVA 2WE7A 1JWBB 3C7AA 3HJAA 4NI5A 3QHAA 3GGGA 2FRDA 3EVNA 5CP8A 5B1YA 4TRRA 4JCOA 4E12A 1J49A 4XGNA 2RIRA 2P5YA 1RM0A 4BHTA 4MVJH 2OBNA 1DFIA 1EFKA 3MOGA 5BSGA 3ZW9A 2YV2A 5G0VA 2O2SA 5EJ2A 4AG3A 4CLXA 1XU7A 2I76A 3AM3A 2VHYA 1E1LA 4YT5A 4ALMA 3EHEA 4L8VA 2ZQZA 3PJDA 4OQZA 3ZH2A 3GT0A 1BTOA 2EV9A 4UUMA 2BFMA 3GAZA 2JJYA 3NX4A 4PVCA 4XD2A 3VTZA 2X4GA 2DPGA 2DUUA 2VN8A 1PR9A 4ZVVA 3HWRA 3VDRA 3RWBA 4FDAA 4K1LA 3GC6A 5U9CA 5T67A 1R15A 1DJQA 3K92A 5JDIA 2IYOA 4E13A 1SB8A 3D64A 2NQ8A 4ALNA 4AJLA 2I5PO 4DIFA 5L45A 3D4OA 6LDHA 1U4OA 4NJMA 1A72A 1N7HA 1CDOA 1Y1PA 3PDUA 4OL9A 4YRAA 3E48A 3FTNA 4DRYA 1CIVA 3QVXA 1ORRA 3OBBA 3IJRA 3WMXA 4FFLA 5KJ1A 1GEEA 3UOGA 1JKIA 1DJNA 1LSOA 2AA3A 3DZKA 3RBVA 1JQBA 2WSBA 3W6UA 3M6IA 3ROQA 4KTVE 2CDCA 3IDSA 2C2XA 3FRJA 2NQTA 3QIVA 2H1SA 2FPIA 1DC4A 3ONFA 3OIDA 1SEPA 4FC6A 3OH8A 4ZHSA 1IHXA 3EUWA 5EIOA 1ZSVA 4W9NC 3DMYA 2J3JA 2DC1A 4WNCA 3LSYA 3E6AA 4DQUA 2G1UA 1QLJA 3E9QA 5JS6A 1NBOA 3CTMA 3K96A 4B3JA 1ZK1A 3E9MA 4BNZA 2E82A 1LSSA 3DZJA 4Q39A 5L3ZA 4LW8A 3JYNA 3L07A 4NBRA 2NU9B 2P5UA 1WDKA 2P9CA 1F8FA 2ZTMA 2B4QA 4CUKA 5GMOA 4B8ZA 4D0SA 1WZEA 1ADFA 1MC4A 3CUKA 4J90A 3ZWXA 4H16A 3JSAA 1YOVA 4CQMB 1FMCA 3PVZA 2FWMX 5JC1A 2J5KA 1A7AA 3C1OA 2VHZA 3I83A 2D59A 4R5HA 3W6ZA 3W4JA 1XQ6A 1Z82A 3GUYA 1YL5A 1PZGA 1M67A 2X5KO 4FFPA 2Q2QA 1JLLB 1GYRA 3EZYA 1H9BA 4KWHA 2DM6A 4QO8A 1E77A 1V9LA 3U4HA 2ZB7A 3HZZA 3UVEA 3F5QA 1PZEA 4F3YA 3AI2A 4LCJA 2G0TA 4Q3BA 1H6CA 2Q1WA 3WFIA 4WLOA 4QFCA 2HAEA 5CEFA 4GX2A 3B6ZA 2I6TA 4II2A 1E6EA 4XRGA 2NU8B 1YJQA 4J2HA 3DONA 4TRJA 3TFQA 3QWBA 4E21A 7ADHA 5IG2A 2QZZA 3IJPA 3JQFC 4NFSA 2YDXA 3OETA 5THQA 1NPDA 3LT4A 1HE2A 1UP4A 4CV3A 1C0KA 1Z75A 1GUYA 4RF5A 5HS6A 4H15A 5BSEA 1F12A 4GPD1 2JCVA 1ENOA 3AWDA 5T8KA 4O0LA 3QP9A 3BXXA 4J7XA 4OKNA 3SXPA 3WGZA 4IQGA 3NT2A 1DRUA 3QJ5A 4KUGA 4YJFA 4D79A 2X0IA 3WBBA 1YQGA 3MTGA 1MXFA 2HDHA 2VRCA 2OUIA 4XJTA 3CMMA 4GGPA 1UDAA 2PGDA 3UFXA 2I67A 5KJFA 1PWZA 3L6OO 4HX5A 1EFLA 5CG2A 4D0RA 4KP7A 1HETA 4YRDA 5A9SA 5F21A 4GKBA 2CZCA 2SCUA 2BFOA 3Q9UA 5IJZA 3V1UA 2X9VA 3OQ6A 5L9AA 1H6AA 4J9VA 1EDZA 1B0AA 5HWSA 5JYDA 3DMTC 1GZ6A 1KEWA 4A03A 4B3IA 3AUTA 3TZCA 1JN0A 1MG0A 4NJMB 1UZNA 2AEMA 5F1OA 1YBMA 3O38A 4GX1A 4R68A 3TN7A 3L4BA 5G0TA 1LQUA 2P4QA 1EQ2A 4IJVA 4RLHA 5DF1A 3U5TA 1IY8A 4EUEA 1NTOA 5TT0A 3K30A 4YWJA 3RD5A 2R6JA 1P0FA 2JD2A 4ZQBA 1JKJA 4KMSA 5JO9A 1KIFA 1E1MA 3CKYA 3KZVA 5K0ZA 3PLRA 3ASUA 1ADCA 3M2PA 3L4SO 4IIUA 3U0BA 2CF5A 3NJ4A 3PGXA 2VYVD 5AXAA 1YONA 4KQWA 3RUDA 1O95A 4ZICA 5TJHA 1YGYA 2I66A 1W4ZA 3GGPA 1I01A 1L7EA 2Q4EA 5A3VA 4AFNA 2D4AA 4AJHA 2DQ4A 2O4CA 3H9QA 4IMRA 5KTKA 1LJ8A 5DBFA 3FPCA 3GZ4A 4HWKA 4JLWA 4ND5A 3GDGA 4FPXA 2C5EA 2GO1A 5IZ4A 3E03A 3DZHA 1DBVO 1VLLA 2G17A 1YOVB 1HSZA 2UVDA 2PH5A 1QYCA 5JDIC 1I0ZA 3FNFA 1V3VA 3GG2A 3KEOA 4AJ1A 1B14A 1JVBA 1KC1A 2Q1TA 2VWGA 5LC1A 3DWFA 3D5QA 4EW6A 1T4BA 3QWHA 3EGOA 1JU9A 1R0SA 3ADOA 3HSKA 1HYGA 1V35A 2Q2VA 3Q0EA 1MP0A 3JQ8B 4YJGA 5EMHA 3VPSA 4EZBA 3STHA 1NVTA 3WSVA 2BMAA 3R6DA 1GR0A 2YW9A 1I3LA 3ZWOA 1QP8A 5G4LA 2ZTUA 4IDEA 1ISGA 4A10A 5DN9A 2WM3A 3PWSA 5DULA 3W4IA 3KRTA 2PTGA 2X5JO 1E3JA 3NTRA 2TMGA 4BUCA 3K2BA 3TRIA 5L53A 4IDAA 3TOXA 3LZ6A 2AG5A 3G79A 4W7IA 2Q49A 3H8VA 1RM3A 3NYWA 3INGA 1P1RA 3EMKA 4MJLA 1BXGA 3U62A 1NR7A 1E3SA 3PHLA 1E5QA 3F47A 2UDPA 4CMIB 1HE3A 3UN1A 1H9AA 1EUCA 1VJ1A 4BO1A 1KEUA 2GN8A 4OSOA 4DLAA 4YJFB 2C7GA 2B4RO 1KVTA 3D3WB 3MEQA 3GVIA 4WK6A 4MP6A 3ZWMA 3LT0A 5AXBA 5ICMA 3OEWA 4PGFA 2A92A 3LVFO 1L7DA 5G4KB 2B37A 1GUFA 2P9EA 4J2OA 3RKRA 2PZMA 4OXNA 1NQ5A 2A35A 2Y0DA 2O23A 3AY7A 1QSGA 1VRWA 3SBOA 4PLGA 5DCWA 1NQTA 2OORA 3WNVA 4BNIA 3W8DA 5DNAA 2BKAA 1B8UA 1EVJA 1HE4A 1P1HA 3FNGA 3JV7A 2SCUB 2YFQA 3IUSA 4FGWA 4IY1A 5B37A 3WJ7A 1AHHA 4PCVA 3VC7A 5F1KA 1UAYA 2RH4A 4CV2A 4D45A 2H5LA 2AQ8A 3PI7A 3ZNOA 3E18A 4ID9A 1R6DA 4TKLA 1K3TA 3QVWA 3UCEA 4J7CA 2GERA 1PS8A 1QV7A 2GNAA 3ANLA 4B7XA 5A02A 4EEXA 1BRMA 3TWOA 3C7CB 2ZB4A 2HQ1A 2PY6A 3JCZA 2VZ9A 3PWZA 4YR9A 1I3NA 1HYHA 3PZBA 4GKVA 5T8KC 2ILTA 1P31A 2ZB3A 1LDYA 1CWUA 1XR3A 5IXYA 2C54A 1O5IA 2A9FA 3ZWWA 1HE5A 1X14A 1M76A 1PGQA 3K8ZA 2OP0A 3S2IA 4CM7A 1DDOA 5F5NA 2ZJ1A 3ZZNA 3GNTA 1I3KA 5T6BA 4LSWA 4DMLA 3D1LA 1ISFA 4N54A 2AE2A 3FR8A 3K6JA 2NU7B 1T25A 2PWZA 4Q3NA 4BNKA 3CIFA 3KO8A 4FN4A 5L51A 4BB5A 3IAHA 1GV1A 2QYTA 3QQPA 1UDBA 3WDSA 3TL2A 4PN3A 3KVOA 5JCJD 1JWAB 1FXSA 1PGNA 4XIYA 1LDBA 4ZN6A 1NP3A 2HJSA 3B1KA 4HP8A 1LUAA 4A5OA 2W2LD 4BO8A 1GPDG 1LTHR 4XYGA 4MP3A 4MP8A 3VVBA 1U8FO 1GD1O 3AUSA 2IYPA 3I52A 2HSDA 3G1UA 3MCVA 1ISMA 4MIOA 2G5CA 3L9WA 3L4BC 3ZHBA 2GRAA 4U5QA 1ZMOA 1X0XA 4M55A 3WIDA 3NUGA 4NBWA 4BO6A 4D41A 2ZCVA 3JQAA 3UCFA 1N1GA 4CLDA 4WE3A 1P33A 1R66A 1NQAO 4M87A 1KVUA 3FR7A 1PS9A 1WDMA 1Z7EA 4NH4A 3ZV4A 3C24A 2YFHA 4N5MA 3NDRA 3NT4A 2DAPA 3JD0A 1A27A 4L75A 5COAA 2V7PA 1F14A 2VRBA 3PJEA 1CQJA 5HBRA 3GUCA 3AM5A 1C0IA 5TNXA 3A06A 3BMNA 5ITVA 3P7MA 4BNWA 4CMHA 3F46A 5JXWA 1BXGB 1CQIA 3CEAA 3AI1A 3DL2A 2CUKA 4HBGA 1C1DA 4OHUA 4UUPA 5GZ1A 4K9DA 1MGOA 3RC2A 2O4UX 1ADGA 3KYCA 4IDCA 5DOVA 4O1MA 1BSVA 1F06A 3DBHA 3AU8A 3BTOA 1IL0A 3WOHA 5KJ6A 5CDTA 1A9ZA 4IGFA 3ZV6A 3FNHA 4BV9A 1R4MA 4MKXA 1T24A 2EJWA 2GZ2A 1T2FA 3ABIA 4FS3A 2NUAB 1N7GA 3CZRA 3DTTA 1E6WA 1TT7A 4F6CA 1AN9A 1ENPA 3PZRA 3ICCA 4BMVA 4O63O 5JY1A 3H2ZA 3T4EA 4PLWA 4O5OA 4C7KA 1HXHA 4CQMD 5CPBA 1P1IA 1YQXA 4UVHA 3BIOA 1B3RA 4M86A 3W4KA 2BLLA 3A1NA 3AM4A 5TJ9A 4ALKA 1W8DA 1E0DA 3NGLA 1KBZA 5L40A 1LLUA 2PZJA 5IZCA 4DIBA 4CMEA 3S2FA 5KJCA 3S55A 2C59A 1EZ4A 1Y8QA 1DOHA 4CM9D 2RHRA 2FPPB 3ZGYA 3G49A 1E7SA 4QUKA 5JE8A 1KERA 4XX0B 3G1TA 1YQDA 4Y8VA 3C85A 3F4BA 1XKQA 2GZ3A 3H6KA 3BMCB 3D3EA 4MO2A 4OO3A 2D5CA 1SO8A 1VJTA 3PQDA 1Y5MA 2JFGA 4FFRA 2UYYA 1I10A 1I30A 3MJVA 1SC6A 8LDHA 2W4QA 5GY7A 4B4VA 3VZQA 4DQXA 4PG6A 1YBAA 1GQ2A 4BS9A 5JC8A 1YDEA 4PLZA 2DBVO 4Z0HO 1IPFA 4PG5A 2WTBA 1VPDA 2O3UA 4GWKA 4Q3EA 1M6HA 1MA0A 1O6ZA 1J4AA 1LLCA 1PJ4A 1SOVA 3JQFA 4WLEA 9LDBA 5HM8A 1B8VA 1FDWA 1HEUA 2B35A 4XWYA 4C4OA 2JKVA 4DBVO 1MFPA 1AUPA 3DHEA 4CL3A 5KKCA 4R01A 3GDFA 5DZSA 2CMDA 3JYOA 4L4RA 3HE3A 3KBOA 3FSRA 4I5FA 1ENYA 5IDYA 3TDKA 3OP4A 4MOWA 5CDUA 2Q3EA 4BKRA 5J23A 5CEJA 4IINA 1QYDA 1IZ0A 4URFA 3O26A 5JBIA 1NWCA 4I9HA 3U9LA 5H83A 2GN4A 3PDJA 3GEGA 4BO0A 1QORA 2G76A 4XR4A 2UAGA 4BO2A 4E5KA 4DIOA 2PD3A 1LRKA 4JBIA 5BSFA 4N7RA 5C37A 2DT5A 4BB6A 1X1EA 4CR8A 4UAGA 1MV8A 1MG5A 1CYDA 2PZLA 5KVSA 4UEKA 3VVCA 3WJAA 2WMDA 3Q11A 1HYEA 4RPLA 3PFWO 4R9RA 4MVJE 3JQAB 4CM9A 1PJBA 3UHAA 4CUZA 4ESOA 4GSLA 4CLOB 1LSUA 1LDEA 1ML3A 2CFCA 1PJLA 2Q50A 3PYMA 1J0XO 3H2SA 4WKGA 4J0FA 5EQDA 3PFFA 1M6WA 2NU8A 1HDZA 3DMTA 4M89A 2GDZA 3OJFA 1UR5A 2D3TA 4LISA 4WLFA 4OOEA 3QVOA 4BV8A 4J1NA 1R37A 3QA9A 4FQ8A 3LC2O 4R1SA 3N7UA 1CETA 3I9NA 2VOEA 2I3AA 2XXJA 4KUHA 3PQEA 2PR2A 3WQQA 1HL3A 3UW3A 4EEZA 1XWFA 4YXFA 2IZ0A 5U1PA 4NFHA 1HDOA 1HLPA 2NADA 4OYRA 1UXHA 4BO4A 2DKNA 2H6EA 3K31A 2BHLA 2PFGA 5ILOA 1EE9A 3I9JA 2IEDA 4LMPA 5FI3A 1NM5A 3DBRB 1ZK2A 4KDFA 5EINA 4B7UA 3RFTA 1DIBA 1HDYA 1R4MB 3R3SA 4BKQA 3ZNNA 9LDTA 3EAGA 1PSDA 3QW2A 1P45A 1UZMA 1XEAA 2C07A 1JAYA 4I5GA 2OGUA 3AU9A 4EBFA 2X0NA 4DREA 3VZRA 4W82A 4LK3A 1MX3A 3DB2A 5LCXA 4E33A 3LLVA 3B1JA 5TF4A 4IZIA 2VT2A 3QE3A 2OOSA 3AW9A 1G0OA 2DU8A 4IDDA 4BNHA 4MVJF 3ANNA 3JQEA 3HG7A 4HY3A 5B12A 1I33A 1Y8QB 2Y1FA 3BHJA 3DAFA 1P1JA 3AUAA 4QFDA 1S7CA 1BHSA 1J6UA 4RORA 3ZNQA 1Z74A 4TWRA 4WLVA 1WVGA 1YH3A 2DBZA 4KOAA 3H9EO 4HNHA 4BIIA 2PNFA 1XQ1A 3DBLB 3HDQA 2BH9A 1NWHA 1T2CA 4YT4A 5HA5A 2V6FA 1UXIA 4XGIA 3AFMA 4HXYA 3FPLA 4JX8A 4YB8A 5KCZA 4L9RA 1KY4A 3GR6A 4JP3A 4LCEA 5BNTA 2J8ZA 3F1LA 4B7CA 2B36A 4NR0A 3T7CA 3WYEA 1U3WA 4R9SA 4J49A 2WYWA 4DLBA 1KVSA 1EUZA 2P91A 1K0UA 4J6FA 4N18A 4R69A 4IDFA 2Y05A 4Q9NA 3EW7A 1RYDA 5DCUA 2X1HA 3SLGA 2Y68A 2UUOA 1S6YA 3RJ9A 2FSVA 2WD7B 4MVJG 1I8TA 5JFOA 2C7VA 3CXRA 1P74A 3OA0A 3WWZA 1PGOA 3CZMA 1IB6A 2VRCD 4ZJUA 4U0KA 5JO0A 4CM6A 3HHPA 4XCVA 1K6JA 3O8QB 5IZCC 4CMEC 4AJPA 4PFJA 2ZATA 1WDLA 1NAIA 1FDSA 3C7DB 3DFUA 5ER6A 3LQFA 1QMGA 3DAGA 5JY6A 1P3DA 3BZUA 3FN4A 3PIDA 1EE2A 1EVYA 1GU7A 1LLDA 4BNFA 2Q2WA 2AXQA 3PXXA 3JQ7A 2VHVA 4HFNA 3JQ8A 4ZRNA 5A4DA 1BXKA 2Q99A 4GLOA 3RUAA 1DFHA 3GVCA 4RVSA 3V2GA 1LC3A 2QZ9A 4TROA 3QRWA 4F46A 1EK5A 2HCTA 4I08A 3U4CA 1YJ8A 4JP2A 2DTDA 3X2FA 1T1SA 1QG6A 2FMUA 3Q2IA 3TNLA 2Z95A 2O50A 2FP4A 3MJ4A 1Y7TA 3ICPA 3GQVA 4M49A 3TSCA 2YQ5A 4JXKA 4QTZA 3TL3A 1E3LA 4LRTB 5BQFA 1B7GO 3K9QO 4XB1A 1KYQA 4BO3A 1V3TA 5JSFA 2WEKA 3CINA 4R3WA 3AOEC 1Q7BA 4X54A 5EN4A 1E7RA 4RF4A 2QIOA 4XA8A 3H9UA 1VSVA 5T5QA 2BF7A 4R1TA 1NYTA 2YHIB 3TQHA 1OFGA 4CMIA 1IULA 3WWYA 2R00A 4FGSA 1VE9A 4HNGA 3WIEA 3F1KA 1MUUA 5C5IA 1EK6A 3MJTA 4WLNA 4XRRA 3ZHYA 1LXCA 3GRKA 3D3WA 2HU2A 2AQHA 3DZGA 2GGSA 1R16A 4BNMA 5JAZA 5G4KA 3UCXA 3DC2A 2IDZA 1B26A 3MTJA 4J43A 4CMJA 4IXWA 4J0EA 2X7HA 4DVJA 2VQ3A 3JD1A 4CL8A 4DL9A 2H63A 1WLYA 1GEGA 2JFFA 3C8MA 1NXQA 3NJ8A 4I8XA 4PZDA 4ZQHA 4JJGA 4G5HA 1LEHA 4CM1A 3RU7A 1DO8A 1Y5RA 1YL6A 2RHCA 1NPTO 3KLPX 1JVSA 1IUKA 1X0VA 3GNQA 4IM7A 1MFZA 3EVTA 1PR3A 3BA1A 5A9TA 2X8LA 1KS9A 4CJXA 1UUFA 4K6FA 4ZQGA 2QG4A 1EUDB 5THKA 2OMEA 4W7HA 2FPGB 5TGDA 1B2LA 4FB5A 3IS3A 4QQRA 3WYBA 4RVHA 1PJTA 3DOOA 3BYZA 3PTZA 4EUFA 4WCFB 4UEOA 1E6UA 2F00A 2OZPA 1N92A 4ITUA 4FD3A 4B3HA 1BG6A 2I3GA 3RASA 2Y1OA 4NBUA 3UAGA 3KTDA 1EVZA 3NGXA 3RBZA 4DMMA 3RUEA 1CEQA 2Q4BA 1VM6A 2O3SA 4NHEA 1SAYA 4WUVA 4Z0PA 1NHWA 1Q0QA 2NTVA 4ND2A 3MJCA 4B8WA 2C5AA 3DDNA 4I5DA 5JAQA 3RUFA 4KQXA 2CNBA 1YVEI 1PEDA 2BFAA 1PX0A 4GLLA 1QYXA 4IDBA 2CF6A 1U2GA 3LK7A 1E5LA 4FBGA 5BNFA 2NU7A 1PQWA 5KVQA 2WJPA 2X9GA 1U7HA 3DXFA 3L6DA 4WNIA 4D43A 4DLLA 5B4UA 3LT2A 3BTSA 1VKOA 5HRUA 3GFGA 1VKNA 3GDOA 5IAAA 2EGHA 1DIAA 3ZI0A 3E5RA 4DC1A 2EKLA 4KTTE 2DBQA 1BW9B 3ENNA 5DOZA 3ZU2A 1GYQA 1X1TA 4G81A 1JA9A 1YO6A 2XXBA 3Q2KA 4JIGA 4CM8A 3RVDA 4TRNA 2VWQA 1TI7A 5DP1A 3T7EA 3SX2A 4U8GA 2EGGA 5I9LA 1GCUA 2X58A 4YPOA 1U5CA 4DBZA 3JQ7B 4EJ6A 2O3RA 1Q1NA 4WCFC 3ZU5A 1ISJA 3GN2A 3JD2A 4QX6A 1ZMTA 2FR8A 5DCYA 1R0LA 4I1IA 2NVWA 4PIVA 2GCGA 3RUHA 1DRVA 2VUTA 3KM0A 1VL6A 2JCXA 3ANMA 2HRBA 3ZV5A 3GF4A 2FP4B 3ZWVA 5CDSA 4NZ9A 4Y67A 4YACA 3VDQA 1F17A 4WPGA 4PLCA 2UV8A 2J5QA 4FW8A 1GCOA 4IJKA 4D3DA 3F3SA 1PJ3A 3NV9A 1Y9EA 1U9JA 2CDBA 2BFPA 2EW8A 4WOJA 4RO0A 4DYDA 3W8FA 1HLDA 1Q7CA 4FIZA 3PIIA 1GL3A 2ZTVA 4OH1A 1SCUB 1GZ3A 3LC7O 5F1PA 4XB2A 2QRKA 1DC6A 1NQOA 1GZ4A 4R3NA 4WEOA 1R12A 3L0DA 1N9GB 4RV9A 3OQBA 3F4LA 4AL4A 5C7LO 1XGKA 1NAHA 4ZRMA 5JMWA 2AG8A 5JYEA 3TFOA 1FDUA 2OFPA 2B5WA 1PL7A 2EIHA 4IS3A 4Y98A 4QXMA 2NUAA 4YJDA 4E3ZA 1V0JA 1IZ9A 1ZW1A 4L73A 5U4QA 2ZB8A 3WTCA 1U8XX 5JLAA 4FSHA 3WX0A 3QVTA 5ENVA 5AXDA 1R4NB 1RWBA 4KDEA 3TF5A 3P19A 5H82A 4JK3A 4QECA 3GEMA 3X2EA 4BKOA 1KY5A 5MGBA 2JAHA 3PGJA 2XPCA 1NNUA 4EYEA 4INAA 3NKLA 1CRWG 1F0YA 2DFVA 3BMOA 4XQEA 2FSSA 4XZ3A 2GZ1A 4RL6A 4E2WA 3FF4A 3TZQA 3JQAD 4BGIA 2FPPA 4GSKA 3DHYA 2B69A 1O9BA 4XX0A 1Y9AA 4A7PA 5A05A 4R54A 4NG5A 5L7WA 4IQ8A 3JYLA 3BMCA 5IDQA 4K6CA 2I99A 2HMVA 1KOLA 1G1AA 1H2BA 4WLUA 1DEHA 4RCVA 2YV1A 1V6AA 3KXDA 4M54A 4GAEA 5ITWA 2VWHA 3PHGA 1M66A 1Y6JA 2QRLA 2R00C 3EY4A 2PKRA 3I6QA 3DR3A 3MOIA 3B70A 3GHYA 4RPGA 4WOKA 3GK3A 2NU6A 1X7GA 2EW2A 4GX0A 1X7HA 3M1AA 4BNNA 3VH3A 2RBEA 3AOGA 1LDGA 4W99A 3L6EA 4N5LA 4BO5A 4A0SA 1H93A 3SVTA 2Y1CA 1WMBA 2QHXA 4CLEA 1IOLA 4DTIA 2W2KB 4ALLA 1ZFNA 1E3WA 1Q0LA 5TQVA 3O9ZA 4W4TA 1H5QA 3BMQA 5I7VA 2Z5LA 4NDNE 4OQYA 1IE3A 2C82A 2X0JA 3EYWA 4MKZA 4UUOA 1JDJA 2J5RA 1I24A 2Y1GA 3E9NA 1YXMA 2X6TA 4MIEA 4UVEA 4CLHA 4CM8B 3QVSA 4ZGWA 5A5EA 3C1AA 4PRLA 2J3HA 1YBVA 3CMCO 4TKMA 4ROSA 3FD8A 4L76A 3WGHA 2D8AA 2F1KA 1FDTA 3I3OA 4JGBA 3RFVA 4BNUA 3QLJA 1ADBA 1HDCA 1T2EA 3IIEA 2WYVA 1PJQA 3OF2A 3GMSA 2PH3A 4D3FA 5CDGA 4CLOA 4BQPA 4ZQFA 2QW8A 2C2YA 3A14A 2Q45A 2EG9A 2O7SA 1D3AA 1ZIDA 1TA4A 3LYLA 4I5EA 3PYLA 4UVIA 2PZKA 4GWGA 1NHGA 3F9IA 3WB9A 4OOFA 4E2XA 3WGIA 4MPDA 2X0RA 1AHIA 4BL5A 1OC4A 5T57A 1RYEA 1NVGA 3CH6A 4J1SA 5A9RA 4MVJD 3HADA 4I9NA 4IXTA 4NFYA 2X86A 3H5RA 4PG8A 4Z9XA 2DPHA 3H9GA 4XDZA 3UH1A 5C7OO 1GDHA 5CEEA 3I9MA 1B3BA 1HKUA 2ZKLA 1EDOA 3RFXA 3BTVA 2JCYA 4RGBA 3ZCXA 3DAPA 1LRJA 3WGGA 1LNQA 2YDYA 1SBYA 3DBRA 3MJSA 3V8BA 4A26A 2GSDA 4CMBA 4CLRA 4PLTA 1WP4A 4WGGA 4RZHA 3WYCA 1DLJA 2DBRA 2JD1A 3RC1A 1LX6A 3HDJA 4XQ9A 3WMWA 4QO7A 1QLHA 1GV0A 4B79A 4ZU3A 3HN2A 4YBZA 2BGMA 4D7AA 4TZKA 3AK4A 2G82A 4A73A 3DO5A 3P2YA 3VAZA 1YE3A 4G65A 4H7PA 2BGKA 3PLNA 4UEJA 5A3JA 2PV7A 3ITDA 5COQA 1SPXA 2FN7A 2CSUA 2O3TA 2V6BA 5IN4A 3BMOB 1NVMB 3ZU3A 3A9WA 1JTVA 1N8KA 4CODB 3DBVO 4PLHA 1H6BA 4J91A 2VT3A 4PVDA 1VSUA 4OGWA 4PZCA 3SC6A 2GPTA 4GX5A 1HWYA 1LDMA 3LC1O 2TMDA 3S1LA 3DBLA 2EP7A 2Y66A 3WLFA 1N5DA 5A1TA 2DLDA 4BKPA 1FDVA 5KNLA 4MVJA 1ONNA 1E92A 2VWPA 4NPCA 2GUGA 2V6GA 4FFOA 2VTDA 2YHUA 1UP7A 4CR7A 3G17A 1W0CA 4MVJI 3UICA 3AI3A 3S2EA 2YYYA 2NU6B 1ZZEA 4C7JA 4IIVA 4CMAA 5HTOA 4ND1A 3D5TA 1UXJA 2Q1UA 4AJ4A 3E5MA 4ALIA 2O2YA 1XA0A 4EJ0A 2AE1A 3KV3O 1UP6A 3E1KA 3AOEA 2VNSA 4QSMA 2FOIA 5I7SA 1HF3A 4GVLA 1EQUA 5FYDA 4E5NA 3H5NA 2Y67A 2WD7A 1WMAA 3GEDA 3VH2A 4ZA2A 1E3WB 1G6KA 2YY7A 1I2BA 1U2DA 4J7UA 4K28A 3BMQB 3VZSA 1ISHA 1PZHA 2LDXA 4QT0A 1DIHA 2ZK7A 3O8QA 1N2SA 3JQDA 4DC0A 2E4AA 1GUZA 1U7TA 4MKRA 3S2GA 5KVCA 3LU1A 1E1KA 1E7YA 1T2AA 3PK0A 4A2CA 1A71A 3DZIA 4F45A 2HMWA 4E30A 3VPFA 3U49A 3ZU4A 5EERA 4IJWA 3PQFA 3GNSA 2WDZA 2ZYAA 4BMSA 2VTEA 1XU9A 3OJ0A 1VC2A 4IGEA 1ZXBA 1MC5A 4NK5A 5EQFA 3WBFA 4RVGA 4XEHA 1H6DA 4CV0A 4IS2A 1AXEA 3WNQA 1PTJA 5L7YA 3VH4A 2P4HX 4O59O 1DC3A 4AJEA 3A4VA 4CM4B 5IDWA 5G2OA 4DPMA 1HZJA 4YQYA 3HB5X 4ILKA 4JROA 3KHUA 2C20A 3N58A 3V5NA 3WICA 2JAPA 4OM8A 4J1TA 3TJRA 3NTOA 3U4DA 2B5VA 2D2IA 4P4NA 1DHTA 1XIVA 2O3JA 4YCAA 2HKIA 3A28A 2UUPA 1MXHA 2J6IA 3ZN2A 2YHIA 1RPNA 3GRPA 1UAGA 2NV6A 3F5SA 3RC7A 1LBEA 2C29D 1UH5A 3BTUA 5IFLA 3FCOA 1I5RA 3D4NA 4CLRB 2RAFA 1X13A 3SEFA 2EP5A 1G0NA 4K26A 2GASA 3L77A 4E4YA 1UXKA 3H65A 5DBIA 3GVPA 2YQ4A 2HMUA 3Q6IA 2DUWA 3KOUA 3S8MA 4R41A 1EEHA 2X22A 4YAKA 4R4JA 3RIHA 1ID1A 5HS4A 1Z7BA 1GY8A 2Y99A 4BNXA 5KOIA 3ZWAA 3IKTA 1U3UA 2NNLD 4FFNA 3ZNPA 3LLSA 1GQQA 2JHGA 3DEYX 2FZWA 3NAQA 1P9LA 4OSPA 2QRJA 4EJMA 1YB5A 4FJ2A 1O94A 5L4SA 3PWKA 3FWZA 3AY3A 2GLXA 4LMRA 4AJOA 1VL8A 4LSMA 1NFRA 2EWMA 4JBGA 4HUJA 5JPIA 2HUNA 3N74A 1O89A 4XYBA 1EMDA 5A03A 4DQVA 1AXGA 4Q3AA 1ZEJA 1B15A 3JQ6A 3K5PA 2P2SA 1PQPA 4BO9A 3HB4X 1EUDA 2QX7A 2FPGA 5TS3A 3PHJA 5JAIA 5JCXA 3ONEA 4KZPA 4PLFA 5KKAA 3VHRA 3V2HA 5I7EA 1ZSYA 1M2WA 3T4XA 3U3XA 3P2OA 4ZD6A 2JFHA 3Q1LA 4WCFA 1YL7A 4CQLB 4OMUA 3NRCA 2FZEA 3SLKA 3OIGA 5ILGA 2R2GA 1ZO8A 3ROPA 4Y6RA 4NBTA 3U4IA 2IZ1A 3RSHA 4YQZA 2NACA 2B4TO 4CM3A 1TT5A 2HK9A 5L7TA 1D1SA 3BAZA 4L0QA 3GAFA 1GYPA 4OXKA 4FCCA 3UXYA 4AVYA 2Q46A 2O48X 3CPSA 5COBA 3JQBC 4BNJA 2BRUA 1BGVA 3B1FA 5C7IO 1EBFA 1YB1A 2PLAA 5I7FA 2Y1EA 2RCYA 3RROA 1Y8RA 4U7WA 4YAJA 4HKTA 4E31A 1WPQA 2BELA 4E32A 5TLSA 1OMOA 3PRJA 1PJ2A 2HMTA 1BW9A 3JQGB 3H3JA 4JJIA 4Z9YA 1E7MA 1DIGA 3LF1A 1BDMA 2WE8A 3C1TA 1ZH8A 3OFSA 3WGTA 4XYEA 4RPJA 1PJSA 2W98A 1B16A 2YUTA 5AVOA 3DZFA 4BOYA 4E5YA 3FBGA 1ULUA 3KYDB 1FF9A 3PEFA 1WWKA 4R16A 3GY0A 4B4WA 4YAEA 3ZHXA 1BVRA 1KVRA 1TEHA 4BKUA 1H2HA 1NFQA 2EKQA 3GPDG 5K6AC 4QEDA 2OP1A 2V6MA 4GQAA 1TXGA 1K89A 3IC5A 1YS4A 1BVUA 3GH3A 2C0CA 1XCBA 1Z73A 5ADHA 4JNKA 3ZHZA 1YKFA 5BR7A 1SOWA 2EKPA 3I4CA 3KLMX 4RPKA 5FI5A 5BSHA 3ITKA 2EF1A 3MWEB 1JAXA 2QYSA 4BNYA 4LRSB 4RVFA 1LSJA 4YRBA 1GADO 2CDAA 2Y93A 3LF2A 4XYLA 3VZPA 1X7DA 3PJGA 1LDNA 1DSSG 3RUCA 3ZWYA 3M1LA 5CAEB 4YA6A 2FY8A 1ZXLA 4ND4A 3GVHA 3PPIA 1W73A 2BGLA 2X9NA 4DWVA 1GQYA 2EHDA 3WGQA 4LVUA 4Z6KA 1VL0A 4HV4A 2I65A 4DPKA 4O6VA 2FR0A 1SCUA 3I4FA 4P4GA 4HFMA 4RJTA 3FI9A 5AYVA 4WASA 3H9JA 1UJMA 5LDGA 3D4PA 4IUYA 2D1YA 3ZDFA 2NLOA 3NT5A 1N9GA 2IZZA 3JD4A 4DA9A 5KIAA 1MB4A 2AHRA 1U1IA 4HADA 5EPOA 2OBYA 5CPFA 4WCDA 1ZSNA 4IZHA 1Q0HA 5H81A 4AJKA 4RPHA 1ZVMA 4D46A 3ADPA 4A27A 1Z6ZA 4CMGA 4CMKA 4DGSA 5FEUA 1ZNQO 4YYZA 4R1UA 4MINA 3Q9NA 4LN1A 2J3IA 3HNPA 1LRLA 1R4NA 2YV3A 5GZ3A 1GPJA 5JDCA 1ZKMA 1I3MA 1P1FA 4GBJA 1RM4A 2NTJA 4RQUA 1R0KA 3I9OA 4RQTA 1PGJA 1U3VA 4AJIA 1ISIA 1CF2O 2E48A 3KSUA 1OZAA 1TLTA 4JJFA 4Z3KA 5B4VA 1HDXA 3C3XA 4ALJA 3SJUA 4F6LA 1PL6A 1P44A 4YTEA 3GFBA 4RF2A 3JQ9C 3WQSB 4IBOA 4RLSA 2WYUA 4U6SA 1E7QA 4AJ2A 3OHSX 1LU9A 4Y9DA 3JYQA 2P68A 3KETA 4KUEA 2ZIZA 3HFGA 3AJRA 3GGOA 3R0IA 4BNGA 5AQ1A 1RM5A 3NDIA 1TT5B 3VKUA 1A5ZA 3SC4A 4DYVA 4NBVA 1I32A 1T1RA 1O0SA 2CVZA 2EXXA 4EGFA 2VOJA 3I9KA 1WAMA 7MDHA 1H94A 3WLEA 1DXYA 5TT1A 4XYMA 1E3IA 1QXSA 2GR9A 4LGVA 1FJHA 2OL4A 3I6IA 1NASA 4NU6A 3KB6A 4YEDA 3WGOA 1ZEMA 4RDHA 5AOVA 3L9XA 2GF2A 2PK3A 1VJ0A 3HQ4O 3WSWA 1ZBQA 3FWNA 2Z1NA 1N1EA 4IPTA 2FPIB 1K5HA 1Y8RB 3D0OA 2W2KA 3ZWCA 5TIIA 3W8EA 1Y81A 2O7QA 3OICA 2CD9A 4I9UA 4CM5A 2HK7A 2POQX 1YB4A 1YWGO 4GGOA 1MLDA 1C1XA 2IE0A 4J3FA 4ONEA 3ORFA 3H5AA 1I2CA 5A04A 2NVUA 1QR6A 1NX6A 4RDIA 1KEPA 4RVUA 5G0WA 3DHNA 4IDGA 2DTXA 3IOYA 5L4NA 5ICSA 4UUNA 3I5MA 4FC7A 4RZIA 5CG1A 1GFSA 4P4LA 3WR5A 3COSA 2VHXA 2HLPA 3GVXA 1I2ZA 4JN6B 1Z45A 3OQ1A 4R51A 3FNEA 3OEYA 2EERA 4NK4A 1WW8A 1T4DA 4IJUA 3WQRA 2Z1MA 3R3JA 2D0IA 3VPHA 4UVDA 1P1KA 1P77A 3ROKA 1C14A 1ONOA 2E49A 2VUSA 2VCYA 1X15A 3PP8A 1NR1A 1A9YA 1H0KA 5G0SA 3ST7A 2IRWA 1D1TA 1V3UA 1OAAA 1HZZA 3EC7A 4U0JA 3RCBA 3WTBA 1JKFA 2XF8A 5TX7A 4M1QA 4P38A 4W6ZA 3RUIA 4BGUA 3JQCA 4E2ZA 2VZ0A 4GMFA 2EJVA 5BNIA 1QRRA 5EESA 1HTBA 3GZNA 1L1FA 2NM0A 2XAAA 4B4OA 1DLIA 1TVEA 3ULKA 4DPLA 4P8RA 5FWNA 4BQRA 2OXIA 2W90A 2JD0A 3RAJA 3WFJA 5I9NA 5T64A 1CERA 2PD6A 3ASVA 3E8XA 4YJHA 3NTQA 3VTFA 3OECA 5CDYA 3I9LA 2YZ7A 4J9UE 1OOEA 2VYVA 1RJWA 4D42A 5A06A 3RU9A 3HFSA 3QY9A 1ZK4A 4XDYA 4EITA 3I23A 4WEQA 2PKQO 3HN7A 4XQCA 3KSDO 1BWSA 3EZLA 2NWQA 4BGVA 1K6IA 2HMSA 1ONPA 3ETGA 3CE6A 5CFZA 3H7AA 4E5PA 3HDYA 1UXGA 2HO5A 4EI2A 1PL8A 2JHFA 2GYYA 1C3VA 3W1VA 2CY0A 4WECA 4M8SA 1ULSA 2WD8A 1PZFA 3P5SA 4NIMA 1DB3A 1ZK0A 3UFXB 1PGPA 5F3RA 3UF0A 1GTMA 1BXZA 1C0PA 1D7OA 1K2WA 1KETA 1V8BA 1LA2A 1AE1A 5A9SB 5ENDA 4II3A 4YT2A 3IUPA 5C3MA 3V1YA 3AUUA 4YAGA 3AY6A 3VPXA 4OKIA 2VNAA 3M2TA 1DHRA 3DFZA 2B0JA 1ZUD1 2BI8A 2E37A 3GMDA 1DAOA 2GD1O 3PHIA 1A4IA 3DTYA 3GLQA 4H3VA 8ADHA 4P22A 5I9MA 3INTA 3O4RA 2XOXA 3SJ7A 1ARZA 4YVFA 4TSKA 5TSDA 4Q3DA 1QYVA 3WGYA 4XR9A 2O3QA 1JKJB 4UREA 5BT9A 3RQSA 2VUUA 3GHHA 2PA3A 3ONDA 5JDCC 1XSEA 5F5LA 3U09A 4ZQEA 4TMFA 1UZLA 4D3SA 1C1XB 2ZJ0A 3GOHA 3RBXA 1CJCA 3O03A 2DVMA 1PIWA 3MZ0A 1U3TA 4CPDA 2ZQYA 2NVUB 3IL2A 5TC4A 5LDHA 1T2DA 2NTNA 1SEVA 4YT8A 1O8CA 5ES3A 5CHEA 4MIYA 4NQZA 1XLTA 3IKVA 2CVQA 3RC9A 3QWAA 5IDXA 2V65A 3DZBA 4MVJP 1ENZA 2DFDA 1WXDA 1NFFA 4RF3A 4E5MA 1U5AA 3BHIA 2X5OA 4LVCA 5JNLA 1Q7GA 3RKUA 4E0BA 4BO7A 1IHYA 2D5AA 1SMKA 3RI3A 3D7LA 2W8ZA 4GMGA 4S3MA 2Y0EA 1D4FA 3ON5A 3IP1A 2AEJA 1WNTA 1EVIA 2AQKA 3V1TC 1YDWA 3LDHA 4FJ1A 2H9IA 4CM4A 1PS0A 1DAPA 5IN5A 2QQ5A 2GN9A 4J4TA 1DIRA 4YJGB 2A4KA 3K2EA 4NU5A 3MWDA 3G0OA 4L74A 1HDRA 2YJZA 1I36A 3H4VA 4J4HA 1SB9A 5I8ZA 2IXAA 3E82A 4NNJA 3GZNB 2AEFA 5FFFA 2CVOA 5IXSA 4TVBA 3LT1A 3QWIA 1K6XA 4PLYA 5FF9A 4RVDA 4EDFA 1WZIA 1PQUA 3HUDA 3ETDA 4YJHB 3QWFA 5JAMA 2A94A 1DPGA 1XG5A 1KEVA 3OA2A 5K9ZA 4PLPA 1IYZA 5JW6A 4L4XA 4IQ0A 1EBUA 3AFNA 3JTMA 1RKXA 3JYPA 4Y6SA 4Z9FA 3JQBA 1IPEA 3QSGA 3R1IA 5KWEA 1A7KA 3K73O 4GL4A 3TPCA 3OJLA 2FHSA 3ZWBA 1EUCB 3OJOA 5MDHA 3DOJA 1VI2A 1B8PA 1HRDA 4TVOA 2RH8A 1QYWA 1XYGA 1T26A 4YAIA 5A5FA 4W9NA 5DP2A 3H3FA 4FOOA 1F8GA 2Y0CA 4XQGA 4BGEA 1KC3A 2IXBA 1ZCJA 5JCJA 2OO5A 2E6UX 4UVGA 2VYND 5DDIP 4NJOA 1LQTA 2Q1SA 4GI2A 3KUXA 4FR5A 2W2LA 1QKIA 1M75A 1OC2A 3JD3A 4JBHA 4Z3DA 3QV1A 4AJJA 1AGNA 1P0CA 4BVAA 2PD4A 1C0LA 4WJZA 5K6AA 4CQLA 3ZW8A 3UKOA 1XELA 1D8AA 2JL1A 1TB4A 4E6PA 1W6UA 4G2NA 4TQGA 4Y6PA 3VKVA 5AXCA 2VHWA 1OBFO 3TZKA 3FBTA 3GG9A 4AJNA 4XKJA 1BDBA 3GN1A 4TRMA 6ADHA 3OM9A 5GZ6A 1XHLA 2NVBA 2I9PA 5JMPA 1SNYA 4J16A 5L4LA 5TRTA 4NMHA 3PJFA 1DC5A 4J1QA 2OHXA 4L4SA 5KVVA 4IMPA 4U6QA 4CV1A 2ZCUA 2LDBA 1UDCA 3G3EA 4CUJA 1E3EA 4OIMA 4TZTA 1ZJYA 4XJSA 3INRA 4AICA 1E1NA 4DUPA 3OJEA 3JQGA 4XGKA 1NPYA 3KSZO 3VOSA 4PZEA 3PHHA 1E7WA 1ZJZA 5ER9A 3F6YA 1OI7A 4B4UA 2PGLA 1QV6A 2P9GA 5L95A 3Q3CA 2PGJA 1U4SA 2HRZA 3DQPA 1Q2XA 4N5NA 4EUHA 4FJ0A 3RJ5A 2PKQP 3KYDA 5EL0A 3OSUA 2NU9A 3ENKA 4J4BA 1KVQA 2VYNA 1U28A 3I1JA 3PYXA 2VZ8A 3EDMA 5IF3A 5B4TA 2HJRA 2J3KA 1SZJG 3TZHA 2IEBA 4MVJM 3OIFA 4ND3A 4Q3CA 4S1VA 2AW5A 4CQMA 4CR6A 3UUWA 3TOZA 1DRWA 1HDGO 3KYBA 2ZYGA 1LI4A 1XDWA 1BMDA 1LLQA 3EK2A 3ETEA 4UULA 5DBGA 3WG9A 2EEZA 3MWEA 4GVXA 3HDHA 4KWIA 2AMFA 3JQ9A 4OAQA 4BNLA 1JLLA 4JQCA 4D44A 2BD0A 1PJCA 4GH5A 4PG4A 3OMLA 3MWDB 5KJEA 1PWXA 4CMCA 4E2YA 3ZWNA 3VPGA 5CAEA 2ZTLA 1PU2A 2AQIA 3GA0A 2FR1A 4PG7A 2DTEA 2HK8A 4HFRA 4XIJA 4FFMA 3ROMA 2ET6A 1HT0A 3FHLA 1YRLA 3NEPX 5G0UA 2GN6A 4OJNA 3UGKA 2IODA 3NDJA 4MDHA 4R5MA 4BNVA 1DFGA 3WS7A 4BMNA 1A4UA 1CQJB 3WXBA 3IQDB 3MJEA 3VH1A
chains in the Genus database with same CATH superfamily
2M98A 1C3JA 3QEOA 4N3CA 4PC3A 3N2YA 4P2BA 2AKYA 4JKOA 4AWAA 4Q4HB 1SXHA 4IXMA 4JMLA 4ZCMA 1GAEO 2EDAA 3D3NA 3DM5A 2P0EA 2OXEA 3GPIA 1YRHA 1P2UA 4OXYA 3TZ6A 4BWVA 1VIVA 2J32A 3V2UA 1NNEA 1FSSA 1LC0A 3KEQA 4QDXA 4MUNA 3SHVA 3V1TC 4Z0TA 1MV5A 2AFIE 2DUMA 1X19A 5KWSA 4HFJA 4ZEXA 4PLVA 1IRXA 2XWSA 2BEKA 2H1RA 4JOBA 1Q7RA 3DCJA 3GGGA 3DWEX 4GZLA 4O1IA 2RK4A 2XXAA 1EJ2A 3USES 1KDRA 1J49A 4HGZA 3VPAA 1M8PA 2NO5A 2P5YA 3L8EA 3NGMA 4M1MA 5EWJA 3UMGA 3W9BA 4BHTA 3LGXA 5AIBA 3CX8A 3AR4A 4QGBA 4Y3UA 5T6MA 1EFKA 1SBHA 1SXJD 5CB4B 1PWEA 2YV2A 1TYZA 1Y33E 2O2SA 2PAAA 3LSTA 2PUAA 4WGFA 1E3TA 1ZM4A 2I76A 2VHYA 1E1LA 1PK7A 3AR5A 3IMGA 3MF4A 3A05A 3G0CA 4B3CA 5JQGF 3CUTA 5HQJA 2ZQZA 1XA3A 3E1SA 3G2MA 3PJDA 2QTVA 3MRXA 1BTOA 2EV9A 1IY9A 1T9KA 2XRMA 4LJLA 4M9UA 1ESZA 4XD2A 3STUA 1NIPA 2QY9A 3E2MA 5DGDA 1CY1A 1FNCA 2VN8A 4MV5A 1D6SA 1VJDA 3PT5A 3W5HA 4ARIA 1LJUA 3VNQA 4B2YA 3LD9A 4JKIA 4UEQA 4C6HA 3VKHA 3HWRA 4Z2YA 4PGAA 2ZUEA 3FYHA 4K1LA 2JHPA 3GZJA 3KTAB 4E4RA 3V9AA 4F92B 4G1FA 3H1BA 1LPNA 4C04A 3RGWS 3DOIA 3QVGB 1J8QA 1L4MA 3GCZA 4AJLA 3D64A 1R9GA 5L45A 2GRJA 1N0UA 1QIEA 2VF2A 6LDHA 1U4OA 3BE8A 5E9AA 1Y1PA 3VR5A 1WV0A 4OL9A 5HUHA 3S8YA 2GN0A 1TD9A 2VRWA 3AR9A 4KO2S 4R1OA 3ZDEA 2A1UB 4ZMBA 5KYUB 1YB2A 5EJ5A 4KPEC 1E2MA 3U7RA 2Q5JA 3IJRA 3KP1A 3WMXA 5ED4A 1CYEA 3DZKA 1TM5E 3RBVA 4ADSG 3W6UA 2G04A 1ZXXA 5DU2A 3F7TA 2E1RA 4JLAA 2PS9A 4J0CA 3IDSA 1BRTA 3FRJA 4N76A 1RE1A 4MUFA 1GNQA 3SBEA 3GLTA 3OIDA 4QWMA 3V7NA 2LTAA 1YZUA 5TPZD 3C5HA 2I71A 1JB1A 1ORWA 2AXNA 4QG7A 4OQPA 2J3JA 2Z2JA 3G59A 3NWBA 3R7NA 5LYJB 4TLLB 1FNMA 2G1UA 2OZLA 1QLJA 1SIBE 4JBLA 3VPBA 1OLUB 3E9QA 4NICA 3JAKA 4G1CA 1UZUA 4B3JA 1D2EA 3GLSA 4BP9A 3E9MA 4BNZA 2ZRIA 1RHUA 2YOHA 4IJQA 4KIGA 4WVFA 4R2JA 3I62A 1X9GA 3I64A 4XVQA 3TGWA 1N3LA 3DFIA 4H7FA 3N0TA 4LW8A 4GMDA 2FEAA 1QQ7A 1TCBA 1UBHS 4UBOA 1KTVA 2BLNA 2HA7A 2XLBA 3KZ1E 1QFYA 4LXYA 2CK3D 1NJ8A 1F8FA 3QUTA 3WWPA 1SXJA 2JLRA 1AU9A 1FMLA 1S2MA 1YV9A 4R71A 2HA5A 2R96A 5BMVB 3CUKA 3ZWXA 3PQ2A 1N2XA 1RQXA 1MVOA 3HEBA 2SKCA 1YOVA 2AFIB 2HI0A 2P9HA 4CQMB 5JEEA 2J5KA 1OROA 2FLVA 2Q3MA 2I2WA 2XNDD 3B2QA 3WKAA 3LWZA 2IZOA 1GDDA 4PANA 3VNUA 1Z0ZA 3C1OA 3RS5A 3EB9A 3W1WA 2IW1A 2LCFA 4XM1A 5FXMA 2CL6X 4C9BA 2XHEA 1YU6A 3QMPA 4B71A 2HRRA 4CEHB 4E88A 3ED1A 4KPGA 1SC3A 4WK0B 2Q2QA 2VYCA 4OMCA 2WNSA 5CFOA 4RA6B 4QO8A 4HDCA 5IANA 1V9LA 1K7FB 1TJYA 2ON6A 3VYWA 4IIEA 1KQNA 3HZZA 3UVEA 5CT9A 4J16C 4P54A 3UOAB 4F3YA 2JEYA 2MR5A 4Q3BA 1RJEA 4ZVMA 1DCKA 4DW8A 2ARKA 3VI3B 3THXA 4BLVA 1G5HA 2W6JD 3GP5A 3NHPA 4YRLA 1HC7A 3WFIA 4I1YA 4S2UA 4QFCA 4WLOA 4Y0AA 5CEFA 3RRJA 1AUVA 4NPHA 3B6ZA 3WBKA 4EJ2A 3H16A 1G4AE 4XRGA 1S3IA 2JDID 1KMCA 4MV8A 3MGCA 1LK5A 2QXTA 5AHRA 3S3TA 3DONA 2XGGA 1T5BA 4WBSA 4EG0A 5IT0A 5IG2A 3LQKA 4JT9A 2QZZA 1SOAA 1HFEL 3F9CA 3N0XA 2ZRGA 3JQFC 4I46A 3BUSA 1A3CA 1VDZA 4AO7A 2IELA 3L92A 2WAXA 1KA9H 1XMXA 2WG2A 4MVYA 1P73A 1R8QA 2H2WA 1JQ3A 4JA0A 4NOKA 1NRXA 2BW0A 2W00A 1HE2A 5CFNA 5I3ZA 4H2DA 1Z75A 3BSFA 4YMLA 4DIEA 4YRGA 3BQNB 1BDIA 5K3OA 4NECA 3DLCA 2GILA 2PBFA 2XVAA 4KZKA 1W9HA 3OU2A 2JCVA 2NPIA 3BK1A 2PZFA 2UYOA 3P9IA 4LI0A 1ENOA 3AWDA 5DM4A 1XJ0A 3SIRA 3SQXA 1NW4A 3Q3EA 2XWJI 4KN6A 3Q2OA 2CXQA 2HWWA 2JEOA 5E4FA 3WGZA 4LYEA 4EW1A 3U6KA 3NT2A 1DRUA 2NO4A 1MVNA 4MHSA 2EC5A 2X0IA 3WBBA 4MQ5A 1YQGA 3MTGA 4YAOA 4EECA 4L6CA 1M0WA 2HDHA 2BEUB 2CK3A 4EUNA 2DWOA 4ENSA 5C4IA 2Q1XA 4P31A 4D4MA 2JFNA 5EMJA 3DEZA 4PWYA 2XEDA 4GU5A 4YMIA 3GCXA 4XJTA 4URWR 2O7NA 2QROA 1B42A 4I4TA 4PHCA 1LW7A 1IVNA 1ZAYA 2HRQA 5CLIA 4QHSA 2XNDA 1JG4A 1TL7C 1RXYA 3T7RA 4HWPA 4YJ2A 3TEFA 3H4MA 3FPBA 3T5PA 4IZ6A 2AUNA 5FD8A 5BN4B 4D0RA 4BQIA 3VR3D 4HNVA 4QPZA 2CGEA 3LXXA 3PFKA 4JSYA 1WSBA 1CY8A 5F21A 4GKBA 1KRXA 2SCUA 4N5HX 3V1UA 4NU8X 2L2QA 3CRNA 2H2GA 1QHGA 1EDZA 2E87A 1ACLA 1DCFA 2RH9B 3DMTC 1GZ6A 3R0JA 5DKFA 4A03A 4B3IA 4REQA 4XLZA 1TOAA 4PYKA 1JN0A 4JR1A 2W6JA 3TZCA 1UFVA 1MG0A 4NJMB 3QVUA 3RTGA 3RTAA 1RBZA 1YBMA 4NAHA 5H8WA 2OV3A 1JHYA 3QNMA 1FVOA 4ZYUA 2JDIA 1CUDA 1EQ2A 3KLNA 3U5TA 4JC8A 4L22A 1IY8A 1C3LA 1G2QA 2OKGA 1VSBA 4MGIR 4LQ4A 4XFJA 2OLKA 1KHHA 1SQ0A 2C78A 2GPYA 2O0MA 4LI3X 1XTZA 1OGYA 4M0UA 3W9YA 4URXR 1P0FA 2QLFA 5AM0A 1OV6A 4G84A 1E1MA 3HGMA 1DG3A 4CN8A 2FFAA 1GSAA 1NM5C 1R64A 3VHXA 5K0ZA 4N48A 1T9ZA 3EW9A 5H9VA 3M2PA 4PQFA 1OIVA 3L4SO 3L7CA 4IIUA 3TSZA 1DC8A 3DV2A 3PGXA 4US1R 5BWBA 2VYVD 1YNOA 3PHCA 3SXUA 4OLBA 4H1HA 4KQWA 4ZIRA 4Q37A 4IJMA 2VP9A 1P9WA 3C14C 1EWYA 2XA2A 4IGAA 3FPGA 2NQ2C 2JPDA 1L7EA 2Q6KA 4YRFA 3H8JA 1Y3CE 2D4AA 3BMXA 4FB4A 2DQ4A 3CH7A 3DMFA 3QMVA 4X24A 1XJ5A 4IMRA 3MGGA 4N6GA 5AH0A 5DBFA 1FYWA 3BJZA 4JEMA 5E8JA 5EWLA 4B84A 3GZ4A 4JLWA 3D54D 3GDGA 3IT2A 2DXIA 2I4OA 4BMCA 1O03A 5IZ4A 3DL7A 5TMDA 4H4CA 1SXQA 2I3DA 4KQ6A 2H7XA 1SCDA 3BKWA 2VBIA 5DLQC 4BB0A 3CVUA 4YMWA 4DEYA 1Z5OA 2IPXA 3DW3X 3HJRA 3SC3A 5ITZB 3D3QA 4HSGA 2BH2A 4UFNA 2C4MA 2E4UA 2OESA 1VRCA 4P84A 3UJPA 5DGXA 3VR3A 4PINA 3OZSA 4UHBA 3OF3A 1B14A 1JVBA 1KC1A 4WINA 1PR2A 3JX9A 3A6EA 5E4JA 4KGXA 3D5QA 4Q3KA 5DM70 4PBTA 1KL7A 4BFVA 1MN6A 1WSWA 3Q0EA 1E32A 1PK8A 2Q2VA 2G09A 4MYUA 2LGJA 1MP0A 3EEFA 4TQ9A 5EMHA 3VPSA 1QP0A 1YTUA 5IABA 3ZLBA 1NVTA 4QUJA 4H7HA 4W1QA 2AMJA 1XK7A 4V0RA 5AW9A 1C8KA 1E62A 2BHNA 4ZEMA 1E2IA 4MDFA 1OXBB 3FFTA 5G4LA 2PLRA 2ZTUA 4RZSA 4K9NA 4LA4A 1V45E 2Z9CA 3TQRA 3W4IA 3K2QA 3KRTA 1WEKA 3IOCA 1UBKS 2DFKB 3K35A 4NU0A 3TW4A 3NTRA 4AG6A 1JALA 4B7AA 2RFLA 3RJZA 3K2BA 1ZCAA 3CPHA 3K72B 2BGRA 4OREX 2OMKA 4W7IA 2Q49A 3ETHA 4G8BA 2Q6TA 2IOFA 1RM3A 5KYYA 3INGA 2A67A 1P1RA 2PG3A 4NEQA 5LWHA 5MN5A 4DV0B 3U62A 1SHUX 1E3SA 2JJ8A 5LIPA 2B61A 1QQAA 1YC2A 2XOKA 1V11A 4RQBA 2BONA 1SXJC 3UN1A 4YJ2F 3JVVA 1EUCA 3A25A 1H0RA 3CW9A 3EXFA 1O6CA 4MUXA 3SX0A 1I13A 4YRNA 3KQHA 1JHVA 3JTEA 2V58A 3PDIB 4OSOA 4JA2A 3L7NA 4YJFB 3ORYA 3RKSA 4TYMA 1FP6A 2HA6A 4ASUD 3CC8A 1TVMA 2R44A 1PLLA 2WFLA 2WKQA 3LY5A 3A1UA 2PH1A 4WK6A 5ICMA 4CTOA 1HORA 4PGFA 5E8RA 5C34B 2I6UA 8MHTA 3CLHA 3HR8A 2YC4C 1QTIA 3QTTA 1EKXA 2F2TA 1G8SA 2E21A 3HBJA 1LPMA 4LZLA 4PRZA 3BFXA 2V1XA 4JVOA 4R7TA 5JFTA 5AVZA 4S1OA 1WHSA 1F0PA 2O23A 4RV4A 4EHIA 3TD6A 3VU1A 2C2MA 5DCWA 4BNIA 1Y34E 1Z34A 2B30A 5AMXA 3SG0A 4MV6A 3CURA 1S02A 5DNAA 3RFXA 1DBIA 3IUSA 3KXLA 2GD2A 3SJZA 2Z0MA 4OX9B 2DKFA 4PCVA 3VC7A 1LW6E 5LMUB 1I3CA 2YS6A 3ILXA 2ONKA 4BE7B 2JVIA 1MO6A 1Q1ZA 2QSJA 3LBFA 2AQ8A 3QBDA 2AW3A 1Q6ZA 4ID9A 3SIWA 4BCCA 3PRYA 4RE5A 4L78A 3RV3A 4B0OA 1J2YA 3ER8A 1JHXA 2QAGB 2VVTA 3LCJA 4MUBA 3VKFA 1PS8A 4ZV9A 4ZYVA 3LP5A 4KQFA 4TT8A 1CLEA 2B2XA 3IB3A 4YCBA 1SJ9A 5DXAA 3V4ZA 4EEXA 4X41A 4ABTA 4YFVA 5KZMB 5AW2A 3DP9A 4LPSA 3JCZA 4XIFA 4L72A 2YJ6A 4RVOA 4X63A 4XLLA 3SGLA 4GKVA 4B2LA 2R11A 5JIBA 1VQ1A 1JDPA 4G41A 4CCAA 1P31A 2ZB3A 1WO8A 3MLAA 1XR3A 1CZKA 3QVVA 2E4YA 1J1IA 2C54A 5IXYA 3UPUA 2GPNA 2A9FA 5FUXA 1Y4UA 4FFSA 1NW7A 3I04A 4G26A 3S1AA 3COYA 2ZWPA 4CM7A 2OP0A 4BGDA 1GPKA 2BUBA 2GK3A 2HU8A 1T2VA 2TS1A 2NO1A 5I48A 2PSHA 3ZZNA 1K97A 1XRMA 1LV7A 2YIVX 3EYAA 1I3KA 5HFAA 1OWPA 3V8RA 4D9HA 2YIDA 4FMDF 4NCJA 2BCGY 1NN3A 3C3WA 3D1LA 4TXJA 3RRFA 4B2IA 3TLXA 5CDFE 1AA6A 2P67A 2Y76A 1R8JA 1E5XA 1KY3A 1T25A 3N28A 3MWLA 4IZOA 4Q3NA 4ASUA 4ER7A 3CIFA 3KO8A 4RIHA 2ORIA 1G5RA 3D4IA 1T0IA 2V9PA 3EZGA 5I9SA 3QQPA 1YR8A 4X1YA 2XCTB 3TPFA 3ZE1B 4DM4A 1NI4A 2Z98A 1SVUA 3GJ8A 3NVKI 3DMPA 3FTEA 2BP7A 3DV9A 3IDZA 2I6GA 4RKYA 4WK4B 1NP3A 2ZUFA 4FCTA 4A5OA 1L7PA 2YVUA 4FONA 2OCGA 2W2LD 4RHYA 4Y1GA 3VVBA 2I7XA 1CR4A 3SHOA 4PBRA 3I52A 3KJFA 5TXGA 2H1FA 3L0SA 3LM8A 1T35A 2G7ZA 1Z7WA 1CDEA 1I6WA 1KI4A 1AKVA 1T9BA 4UU1A 3L0IB 2PWPA 1BU5A 3O83A 1OT3A 2HXYA 3Q3GE 3TBHA 4D9NA 1CY7A 5KQGA 4Q9IA 2A2ZA 4NBWA 4AB1A 4DLPA 1PVOA 3GUVA 2FMXA 3DEFA 3BK2A 1X1RA 3UCFA 2ZP1A 3K9WA 4Y2HA 1DAKA 4BFZA 5SY6A 4M87A 2GAOA 4RTPA 2FK7A 4IHJB 3I2KA 2OPBA 4XARA 1F9EA 3R5SA 2CJXA 4DM3A 3NDRA 1UOOA 4RMJA 2O8CB 1A27A 2W37A 1F14A 4YRZA 2QMHA 3B6EA 1CQJA 1XDZA 4R84A 5LR6A 3GUCA 3AM5A 1C0IA 1YS7A 4BN0A 3IX7A 4QLAA 1EVEA 4ZOLA 1A95A 5AK3A 3CEAA 1HKHA 3C98A 3DL2A 3LP8A 4EB0A 3V6MA 4U2GA 2V5UA 4OHUA 1RWPA 3UB4A 4EDHA 1NXXA 2NAPA 4PCUA 4UUPA 1XRQA 1V5FA 4IDCA 1GXSA 2JIRA 1C80A 3NONA 2XMBA 1F06A 3A9CA 3BB3A 2VXOA 1QOQB 5E3HA 1OLXB 3G9XA 3LBYA 2XCSB 1UKZA 1IL0A 3IJ5A 3DOFA 1JIIA 4XVUA 5KJ6A 3U6BA 2F7SA 4D26A 2W4MA 2WT4A 5CDTA 3WOVA 1ABFA 1QGUB 2C5LA 2E55A 3AYZB 5DHTA 3DWIA 4A1OA 4J2TA 3R8CA 3WV5A 4DABA 1AV6A 3PNMA 3HACA 4FS3A 1N7GA 2BWJA 4YMSA 1N0IA 2NUAB 3CZRA 1F1BA 3X3HA 4KHPB 5E3IA 3ECAA 4F6CA 4HXFB 1IK4A 2QRGA 4GF5A 3PXDA 4R1LA 2RONA 1DWOA 1RWXA 3EEYA 3SMVA 4EHLA 4PLWA 1HXHA 2P2GA 4PEVA 1JLSA 2ZR0A 1BE1A 2OCKA 3E9RA 4M0PA 4LKOA 2I0FA 4JFAA 3OE1A 4QSHA 1VP3A 1W8DA 4UPEA 5IT5A 1KBZA 2P3LA 4MQ4A 1I1OA 1LLUA 2PZJA 3KD2A 2VG8A 3ZY6A 2QG9A 3QXSA 3CX3A 1VYHA 4A6XA 1DOHA 3U3KA 4IXDA 3KKMA 4CM9D 2FPPB 4YMUA 2XMQA 3NHUA 4HC4A 2N1MA 2C8VA 3NP9A 4X91A 3F4BA 5KHAA 4RELA 1C4OA 4MO2A 4EELA 4KRYA 2HM7A 1K9VF 3BGWA 1VJTA 1ISPA 4DILA 2GCIA 3JR7A 3UENA 5SZJA 2H1IA 1UKBA 1W5BA 3SYTA 3MXOA 4E6EA 3MJVA 4GI7A 5TY0A 3TLKA 5EZ6B 3GIWA 1CDZA 4PG6A 3RT1A 3TQQA 1KAMA 1GQ2A 2FPMA 1XN4A 3FWPA 3IP5A 1YDEA 5LQSA 4YDQA 2OY0A 1IN1A 2XMRA 3CRMA 1VPDA 2P65A 5IBPA 1NKSA 4GWKA 5K0CA 5AKIA 4BJ6A 1PJ4A 3ZYZA 3VAYA 1B8VA 4XWYA 2JKVA 1E5TA 1FFAA 4PPNA 1PE0A 1PT7A 2QW1A 2ZAMA 4MQFB 4RD3A 2PMBA 1OKKD 5EYPB 5CA0A 3ROGA 3VSCA 2RGGA 3AVOA 1VL5A 3SYKA 1AB5A 3AFIA 4RMGA 3C5EA 3HE3A 1KYXA 2IHKA 3FSRA 1ENYA 1SULA 3ZHSA 2Z4TA 3GD7A 3TCKA 4GR5A 3FYSA 2FMFA 4QTXA 3RVSA 2WSIA 4IINA 1EX7A 4WESB 1IZ0A 4URFA 1KO5A 3S6JA 2C83A 1NWCA 2OLJA 5JBIA 4F4DA 1XL1A 2J30A 1TAHA 3CUWA 4IIJB 1OY1A 3NUQA 5A4MS 2YY5A 2G76A 2PO5A 4MROA 1SXPA 4E5KA 1BS9A 4JBIA 1LRKA 4MJ7A 4ND8A 5BSFA 4GICA 2QUAA 5L3VA 2DT5A 1NW8A 1A8PA 3EVBA 1NE2A 3LXUX 3NH6A 4K9LA 4UAGA 1DQSA 3W5BA 2PZLA 1QH9A 1B8OA 3A4IA 3Q8XB 4MUIA 4XIGS 5AHOA 4FDVA 1IHDA 2C58A 2MTBA 3LOQA 5KYWB 4DRXA 4B1FA 1HG0A 3OX3A 2F6RA 3PFWO 1XCGB 3F49S 3WQHA 3EWSA 4MVJE 5AD1A 1EK1A 2GZAA 4YUVA 3A31A 4JLUA 1RP7A 4BMXA 3GJ7A 3WDMA 2ZETA 3A7EA 5AICA 3KQWA 4CM9A 5B2FA 3EA0A 2RD2A 1DZ3A 4CLOB 1WETA 2R7LA 5EIXA 2R66A 1ML3A 4HDKB 1Q2UA 1OZHA 1HOTA 3AO0B 3NTUA 4D5EA 4Q9KA 1YZGA 4ARSA 2Q50A 4B3SB 1J0XO 3H5VA 1RABA 1FRQA 1KYVA 3N2NA 4WKGA 4JVNA 1RMYA 1HDZA 4KAJA 2NU8A 2GDZA 3OJFA 3R4CA 2CXXA 2V4ZA 2DHDA 2Z9DA 3KZNA 1U11A 3MQ2A 3QVOA 4H3HB 4OOEA 4WLFA 3TRDA 1R37A 3QA9A 1U0BB 2QYHA 2XCIA 1KMMA 4G89A 3RVKA 2I3AA 2QPTA 4WK2B 1V8ZA 1VLJA 3G7NA 1GPBA 3IELA 5B2ZA 5FOVA 1U8EA 4RM2A 1FS4A 1DOZA 4YXFA 2IZ0A 5CT6A 5U1PA 1HDOA 3ABSB 4QJ5A 5EE3A 3O8RA 4CIVA 4CETA 1UXHA 4ZEOA 3IUMA 4R0NA 4BO4A 2BHLA 5ILOA 4U7TB 4GP7A 3D1JA 4LMPA 3DBRB 1VI6A 4J0HA 4MS4B 5EINA 3WJ1A 2EHJA 3HYSA 5K3DA 4F4IA 4I1UA 4IIXA 4YNBA 1PQ4A 4YALA 5B1HA 4PO1A 2D00A 4BKQA 4DKJA 9LDTA 4HZUB 3BB4A 1PSDA 3EAGA 3HV2A 5LKAA 3HSYA 2Z4SA 2F3SA 1LQ2A 2G6BA 3HJGA 1DWPA 1XVVA 2DQYA 3BULA 1N7IA 5HJ2A 5IJ0B 3HY4A 1FFXA 1WXEA 1EYZA 2ZIAA 3U81A 3F5MA 1X94A 5CM2Z 3GJTA 4FIDA 3VSBA 1NBMA 4EBFA 2H1CA 4DV1B 3BSWA 4LK3A 2O59A 1NY5A 3P2EA 3BERA 4LZJA 4QLOA 5JD5A 2BHSA 3L7DA 1NW6A 2IOQA 4PIMA 5LCXA 5BNWA 5HRCA 4E33A 3M6XA 3CG4A 1E64A 4AN4A 2VYFA 4IZIA 2VT2A 4OHOA 3RLIA 4EG8A 2OOSA 4P53A 4BNHA 3ILHA 3JQEA 3PD1A 3OCVA 1Q1BA 4QFDA 1P1JA 3G2PA 3B6MA 1PEAA 2QD5A 4F7DA 1L8LA 1GG2A 3PTLA 3N8HA 1DQRA 5L6MB 3MRTA 3G7SA 1UBRS 5HMLA 1WBDA 4TWRA 3D59A 1SY7A 1XROA 1YT5A 2ZITA 4MXDA 5U4XA 1E63A 5DVZA 4F6RA 5LP1A 2CSXA 3MWYW 3QX7A 5LU8A 1SUAA 1ZOIA 3QJYA 2PNFA 4X3CA 3DBLB 3HDQA 2HV9A 1NONA 2BH9A 3E35A 5CA0F 1AKYA 2VZEA 1NWHA 1Q17A 1ZM7A 2Q8QA 4RMNA 1KI6B 1ZOLA 5B1EA 1UXIA 4XGIA 4I2VA 2QTTA 1R9NA 1AOXA 1FJ2A 4U2FA 4ECEA 4GBGA 4HF7A 3GR6A 3PHBE 4JP3A 4N3NA 3W2EA 3WMGA 1JQLB 1ZINA 5EJ6A 2B36A 3QEBZ 4Z4GA 4GPEA 2V6JA 4YLGA 5SYNA 421PA 2XADA 5AUQA 1KVSA 4YXWA 2RE8A 4TL9A 1YFLA 1ZD2P 1XCMA 1JYFA 1WXWA 1F8XA 2KQUA 3GLRA 3HM2A 3Q12A 1AKWA 4KX5A 5AVUA 3OO0A 1RTKA 3MINB 4AS3A 1FX0B 1N0HA 3KJQA 3RJ9A 2W42A 2WD7B 3TVYA 2XBMA 4MVJG 1KSJA 1I8TA 3GJXC 2O8BA 2XKJE 1RXCA 4LGMA 4NYJQ 3RABA 1QRTA 3OA0A 1PGOA 2O2DA 3FPJA 3RVBA 4BECA 2VRCD 1FYDA 1RC0A 3WP1B 5JO0A 3OZDA 1SXGA 3ZCRA 2W11A 2I34A 1G5PA 3BJMA 3T1OA 3ZLUA 4DCVA 5M2QA 1U4NA 4D0LB 5LZ7A 2VNIA 1ZGGA 1A4XA 2VJCA 3C7DB 4UBLA 1QMGA 1W52X 2CUNA 1RXVA 1SN7A 4LXGA 3H5OA 4NS4A 1AIPA 4I81A 4AZ3B 1GZ5A 5JD6A 2C00A 3LC0A 4BFCA 2AXQA 5DB4A 4ZRNA 1W581 3JQ8A 2DPLA 4MQUA 5EC8A 4F2DA 5BV7A 5KOJB 3RUAA 4EZIA 2QNBA 4CL2A 1IPHA 4RVSA 3V2GA 3AF5A 2R97A 1O5OA 3OLXA 4OUDB 3HJUA 1OHHA 1JIUA 1QZTA 1Z2DA 1JEQA 3OX2A 5E7JA 2RC6A 1NNSA 2YMLA 1YA8A 3ZDDA 1YZFA 1AB6A 3JVIA 2B4AA 1K92A 1P72A 1JU3A 1XYYA 2CLCX 1MABB 1OFVA 2FMUA 2R1VA 2Z95A 1OIXA 4RWZA 4DMRA 4E3WA 3L1VA 4LRTB 4NZNA 1R0XA 1B7GO 2YWGA 2QN1A 5JSYA 4BQSA 3EZ9A 3THOA 3WZMA 4Q7KA 4N01A 1CIPA 3H5IA 3ZC3A 3AZPA 2OV6A 2H92A 4HNTA 2AR9A 4RFSB 4TWZA 3TLZA 4B5LA 3KAKA 4C0SA 3T5DA 4X54A 4Y2TA 2NXJA 4RF4A 1IHUA 4XA8A 5T5QA 5FBVB 3ICEA 4WV3A 1SIOA 1VMIA 1RBQA 2X77A 3IQFA 1WU7A 4I7EA 1QGAA 1RLJA 3TQHA 4CMIA 3LUAA 5CVCA 1TMGE 2QVYX 2R00A 4FGSA 2E9SA 1AS0A 3UMCA 2UVPA 3HMQA 3WIEA 1Z18A 1VSTA 4KXMA 4MQBA 1Y63A 4KYIB 3SICE 5FO1A 1LXCA 1NJFA 1K4MA 3D3WA 5JECA 1FYVA 3HFJA 1KGDA 3DZGA 2M32A 2GGSA 5JJ5A 1LK7A 4RM3A 4DIKA 4EMUA 4F8EA 5C80A 2V1UA 1TJ4A 4KYVA 2C2GA 4KR7A 1UWKA 1KJYA 1QCDA 2QX8A 3CZQA 3DC2A 1SCBA 3MTJA 1D2HA 1H2WA 2G06A 4PAMA 4TWIA 3RM3A 1QX4A 4P4UA 4PF1A 4DVJA 3JD1A 4TMFA 5ARDA 3FM9A 3A4NA 4HTAA 4CL8A 3QW4B 1OH8A 4AI6A 4ZQHA 1RWOA 3NJ8A 4PZDA 5BXQC 3GLGA 4CNQA 4WDRA 1LJLA 1LEHA 4ZCPA 3A1VA 3U7JA 1KZ7B 4MTCA 5HRAA 3I09A 4ZODA 3SYNA 5I3CA 4C78A 4DLRA 4UTVA 3EY9A 3RU7A 1VYTA 3DAOA 3OPYI 1GRRA 3RSGA 5K8JB 3BA1A 5A9TA 2HHJA 2X8LA 4CI0B 4DMGA 1UUFA 3HCBA 1UFOA 4M1WA 4MHOA 2QI9F 3VZBA 2O8DB 3WDKA 1V6CA 4KK4A 2X8JB 4W7HA 4HLDA 3UMVA 3OWXA 1I80A 1T5LA 2AI1A 1II0A 4BQQA 2IV3A 1E20A 3MT9A 4FB5A 4Q16A 1XE3A 3AWIA 1T5TA 2CLEB 3F3YA 4RVHA 4UQPA 3R3ZA 4RTRA 3DOOA 3ZVNA 1EVLA 3BYZA 3ESAA 3LVQE 4ZOEA 4EUFA 2J0UA 2JLCA 1SVWA 2OZPA 4I19A 4L4YA 4C1NA 3GZTB 4OXXA 2ZUTA 2A0WA 3TE6A 3NKVA 3Q72A 5A2QA 2RHLA 1RIIA 2QXYA 3GT3A 4KN8A 4NMLA 3RASA 2Y1OA 3SSAA 3RVJA 3UAGA 3UT5B 1O77A 4R05A 1EVZA 2FSGA 1V1JA 1ATIA 1QAQA 2QJWA 2WHYA 4RKWA 2Y6VA 4NHEA 4I1VA 3NCHA 1CUHA 3IBYA 2PFSA 4ND2A 4O5AA 4RY8A 1JSCA 4F71A 1YVEI 1PEDA 2K6GA 3UG7A 1K75A 5ERGB 3Q3VA 5KQRA 4OYLA 4WKPA 2XMPA 3UOWA 3ZHUA 3AR3A 4TTVA 4I3HA 4AWXA 5EKSA 2ORED 1K8QA 1XTTA 3L6DA 4D43A 2WF7A 3PXCX 2ZI6A 1YR3A 2WOJA 3A6GA 3UEOA 3BGVA 3NFYA 1VKNA 1WUJS 2RBGA 2EGHA 3VYRB 2VQ6A 1CY6A 1PX2A 4DC1A 5EJ9A 5IYZA 1EI9A 1XEXA 4MTLA 3ENNA 2ECPA 1X1TA 1L5MA 4G81A 5TPWB 3SYRA 4TLCA 4JITA 2I2AA 2D6FA 3NAMA 2VSOA 4BX2A 4CXMA 2PRKA 3KOWA 1TI7A 5DP1A 5LOVF 3ET5A 4M9CA 1PT6A 2EGGA 2ZSAA 2GA8A 1YRAA 3DEJA 4LDRA 1P3Y1 3UAVA 4C89A 4D3YA 5EHGA 2XMCA 3HKCA 3X1MA 3ZD8A 4YPOA 3BXZA 2ZDGA 3ZDXB 3AL0C 1AQYA 1FU8A 4WCFC 1TJPB 3I28A 5E7IA 3ZU5A 1DEXA 1QONA 5BY2A 2CDRA 3JD2A 2IS6A 2CKDA 3FBWA 3SI7A 3WO1A 4JXZA 2ZJ3A 2BISA 4H18A 4J0DA 4Q01A 5E9WA 5LU9A 4G25A 3G8BA 2NVWA 2VDNB 3RUHA 2ZYWX 1TZ2A 1VLMA 3ZVRA 1Q0PA 4KH0A 4WL0A 1DEAA 2QI9C 3HCOA 1ECFA 4RK1A 4NZ9A 3V4LA 4HPXB 3VDQA 5C8DA 1L4GA 1J2JA 2YJ4A 4PLCA 3BD6A 2ZUVA 2Y9MB 4FGJA 1LBIA 1P4HA 4DUGD 1RHJA 3DPIA 3A3NA 2HU5A 3WKCA 1GCOA 2LZ0A 5KTOA 4YREA 3CM0A 2J4CA 5LUAA 4WOJA 2GF0A 2YCBA 4HQRA 1XQXA 1T4CB 4TN1A 9ATCA 2FPXA 3WGVA 2Q7XA 3G2LA 3SJAA 4E46A 3HXPA 1GL3A 4PHHA 1JXOA 3I9FA 4RYDA 1T15A 2HYIC 2WZQA 5DGIA 2QRKA 1DC6A 1NQOA 3U26A 4R3NA 4WEOA 3W6NA 1A9XA 2YZGA 5AI9A 2DSTA 3RS7A 3J81A 3F4LA 1Z25A 1DEKA 1XVIA 2CZGA 5C7LO 3H5WA 3KHKA 5IHPA 3QKRB 5E7QA 3R6LA 1IU9A 1JXQA 2XB8A 1JKMA 1ZI9A 4RA9B 4TMYA 4D0GA 2Q5FA 2B5WA 4JVMA 4EQ6B 3S2SA 1GPH1 4E3ZA 4PPGA 4WXPA 3UQZA 1IZ9A 2G9QA 4DR5B 4NZOA 5U4QA 4KPFC 3WTCA 3CT6A 1UM9B 1U8XX 2L17A 5EIFA 3E23A 5REQB 3C3PA 3QGMA 4BV3A 5ENVA 1ZD9A 2I2CA 4XWAA 5AXDA 4AMZA 1BMFD 3UHPA 1X2EA 1ZICA 4MARA 3TF5A 2UYCA 5H82A 3P97A 4NH0A 4QECA 5DNEA 4BKOA 1W36C 3VMFA 1RE0A 4U63A 2JAHA 5BV8A 3RRBA 4F21A 1O0CA 2H0AA 3PGJA 1GKKA 3FMVA 5K1ZA 1R2QA 4YCDA 4EYEA 4YDSA 2OHJA 1VHQA 3BMOA 1F0YA 3CNNA 4LDNA 4E2WA 3L18A 1RBYA 4US2R 3JQAD 3WB1A 4DCUA 4B81A 1VBKA 5JT1A 1AMUA 3KQLA 2BFBB 3MA0A 4GSKA 2IEAA 1PV1A 2WPDD 3DHYA 4L8YA 2XTAA 1K5DA 4M21A 4P2GA 4A7PA 1P2SA 2H9AA 1FU7A 3RR2A 2BTQB 1ZVJA 3DCNA 4IQ8A 1TZBA 1ZY2A 3SCZA 2AWNA 4P7FA 1UBGA 5DLYA 4TV9A 3ISTA 1SQ5A 1UMDA 2CLLB 2VTBA 4WLUA 3G5UA 3HUFA 2OD7A 3SN6A 1YE5A 1JYEA 3K70D 2YV1A 3KXDA 4M54A 4PGHA 3THWA 1NG9A 1G41A 4GZ5A 1KFCB 2R00C 2PMFA 1VIYA 5C8XA 4O8CA 1J1UA 1W4LA 2XTJA 4D80A 4G0ZA 4AUMA 5IYZF 3QUSA 3TD2A 2CMHA 2WZDA 3GHYA 1XZCA 3WWCA 1QYIA 5IVPA 5HCUA 1JDNA 2YXBA 4RPGA 2IX3A 1YRQA 3QELB 2W6OA 4GX0A 1VB5A 4XDGA 1VHLA 3H5LA 4X6XA 2J4DA 1Z8HA 3VH3A 4BNNA 4CRWB 4EGCB 2ZI7A 3OKAA 3CPEA 2WTEA 1FXWA 1J5XA 4YP5A 2VF7A 4MHTA 3PUKA 1H93A 1Z4NA 3P9XA 3P9PA 5J4YA 5CT8A 5J4KA 3SR4A 2XTNA 1ZU5A 2B21A 1NVBA 1YUMA 4ALLA 5IC4A 3UV7A 3S8EA 3O8BA 4W4TA 5C3UA 1Z28A 3LUFA 3R3XA 3PR1A 5ELXA 4F4JA 5I7VA 1YCFA 3P0EA 5J2TB 1V4VA 1BMTA 1USVA 2C2OA 4JJZA 1BMFA 4KG7A 2Q6OA 1JDJA 1G16A 2C98A 4ZGWA 5CEJA 1YXMA 3GV0A 3PDCA 5A5EA 1TO6A 3QVSA 4A6PA 2BBWA 3C1AA 4PRLA 4TKZA 4UCQA 3DTNA 4FLFA 1JQDA 3MCWA 4IFBA 3PQ5A 2AFRA 2F1KA 3HI6A 4TT3D 2FPRA 1NI3A 3VZDA 2P8SA 5FWXB 5CH3A 1T2EA 4LOIA 5JNSA 1G1MA 5KMGA 1RMTA 1QYRA 4Y0VA 4LOLA 3OF2A 2JA1A 2XQJA 2PH3A 3A1FA 3REFA 4D99A 2DB3A 2WPDA 1ZI8A 4H3KB 1OFUA 5MFPA 2EG9A 2O7SA 4WSOA 4W9RA 1ZIDA 1TA4A 3EDYA 3ILYA 3LYLA 4PHTA 4ESVA 1M74A 4L08A 2PZKA 5K5EA 1NHGA 3G5TA 4JUDX 3WB9A 4Q02A 4E2XA 5CT4A 3A3KA 4ZMRA 3WGIA 4MPDA 2IUFA 1VIMA 1SUFA 1XZHA 3TR0A 5T57A 1IN6A 1NVGA 3HCPA 3TJZA 4LXQA 1OI3A 4EHBA 1P6XA 5JXIA 3P96A 3VRHA 4J1SA 3IULA 1ZNXA 3KCNA 3VTKA 2VLIA 1UBFA 3HADA 3IQGX 1C9DB 2REBA 3LVRE 4NFYA 1QDLB 3B3QA 1W1IA 1LNSA 3FYDA 4TX1A 2CB9A 4W5WA 5TQ2A 4ZCRA 3IEVA 4RD6A 2DPHA 1N25A 4XDZA 5C7OO 1GDHA 4ARZB 1D2AA 5CEEA 4UNQA 4DJFC 3GFSA 1HKUA 2DECA 4WACA 3G13A 1ELOA 3HBMA 4CNBA 4DNFA 3OMWA 3ZCXA 1RZUA 1Z0JA 2RGYA 4K86A 4DNPA 5LZ9A 2WJGA 2L42A 1M9NA 1HQKA 3MJSA 2YMPA 4G97A 2PKEA 5DASA 4B6FA 1YCGA 5LQAA 4CMBA 2CHVA 3KHSA 4PLTA 1I2DA 2OFWA 4HAXA 3MB8A 1ZA2A 4FWBA 1ZAKA 1WP4A 3ETCA 4C4RA 1AM4D 3WYCA 2OCXA 1EVKA 2GHTA 5AJUA 1UKYA 1EWTA 4KN9S 5ESXA 1XO1A 3HDJA 4AP6A 2VTBB 2HDWA 3WMWA 1JR3D 4QO7A 4JJAA 5BV0A 1XZBA 5G40A 3GLIA 2A7XA 2GM5A 1UBSB 4EEKA 5FTLA 3DO5A 2GVZC 1G5IA 2NYAA 4K3VA 2GPWA 4D81A 4TV9F 5AXBA 3MNFA 6CHYA 3DLPX 1C2YA 4RC9A 4MWSA 4MS1A 2VJMB 4QUGA 2O3TA 2V6BA 1O7JA 7REQA 5IN4A 2WG0A 2GEUA 1C7RA 2IYRA 4IXNA 3A9WA 5D3KA 4TMVA 1YFKA 2V7VA 4HQLA 4J03A 2Q6VA 4KYTA 4ZCIA 1Z2OX 3AETA 2XVMA 4OA5A 4PYQA 4PVDA 4EKNB 2IEGA 1YU9A 1BXRA 4PZCA 1LDMA 1P8AA 3H19A 2TMDA 3S1LA 3Q7SA 2EP7A 1N5DA 3P4XA 1PDVA 3RIEA 2C92A 1RW4A 1QZUA 1RYZA 1L1RA 2VWPA 2GUGA 3KSBC 2G0NA 2YHUA 4KXNA 1W0CA 1T2NA 2HQSA 2JFXA 5I4CA 1ZZEA 2P3OA 3IFSA 2ODQA 2WF5A 2R6ZA 4QASA 3SY8A 5KSZA 3NHMA 5K3FA 4C7OB 3LWDA 4O02B 3UUFA 1JEDA 5H3HA 2Q1UA 3W5UA 4AJ4A 4C88A 5LQUA 4ALIA 1BJTA 1N2IA 1XA0A 2BEJA 3ROZA 4ECAA 1W8IA 2VNSA 3ZUGA 1KXZA 1HF3A 2GM4A 3EQZA 2HHHB 2BAGA 1E18A 1XQVA 3H5NA 4JFRA 2V7QA 2EFJA 2XT6A 2XWQA 1UWLA 4IO1A 1K5GA 1E3WB 3WL5A 5FOWA 4D4LA 5CFLA 1P0QA 4LVOA 1MO4A