4Q4HB

Tm287/288 in its apo state
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
583
structure length
583
Chain Sequence
b'GPILEKPALKNPTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEKDDPDAVELREVRGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter
publication title Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/transport protein
total genus 216
structure length 583
sequence length 583
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
B PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 4q4hB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q4hB02
1ZCAA 3RVBA 3C7KA 5CJ2A 4PC3A 1MABB 4GZLA 3OEHD 1NIPA 5FUWA 2QBYA 4HB3A 2PJRA 1RVDA 3VHXA 1I4DD 1QRAA 3D8BA 1XEXB 2BEJA 2REBA 1UJ2A 3CM0A 2Y8EA 3KZ1E 4V0KA 1GDDA 3AB3A 5TV2A 3ZLJA 3FB4A 1CXZA 3ASZA 3IO3A 4NYJQ 1NKSA 4CVNA 1G3RA 3C15C 3L82B 3NTUA 4UQOA 5FI1B 5CLLA 1OKKD 2O8CA 1FL9A 4R2IA 3PEUA 4BZXA 1W4AA 4YDSA 3A1SA 4TSFD 1S2MA 5EZ5A 2CBZA 4BWYA 5IK2D 5JFGA 2YNMA 4B3XA 2DWQA 1ZCBA 2ONJA 3AKDA 2YWFA 4NTZA 3SOPA 3THWB 2EQBA 4OQMA 4CIDA 2Q3HA 1BKDR 1RPZA 4NYMR 3RRZA 1KZ7B 1MR3F 1NN0A 3AP2A 1LF5A 1XJQA 3AF2A 5EE1A 3W9YA 4DCTA 4DT1A 4AY2A 2ZUDA 2KSQA 1G4AE 2PX3A 4JMPA 1I4TD 2WSMA 3TVTA 4HUQA 2DHRA 3IDQA 1H8HD 1ZD1A 1XEFA 2BBSA 3F0TA 1FQKA 4ZO4A 1JI0A 2UKDA 3LLUA 2OBNA 3DOEA 5FTJA 4BLTA 5L3QA 1VTKA 3GJ8A 4EPWA 2IEYA 1ZAKA 3C14C 3K0FB 2YVUA 1LF0A 4G0NA 4G5GA 2BEKA 3QSYA 2HJGA 3KTAB 1EESA 3NG1A 4YLGA 4FMBB 4IHQA 1FX0B 3L0OA 4Q4AA 1IONA 3ND9A 4HDQB 4JLDA 4UKDA 1US8A 3QUSA 1OIVA 1TEVA 3TVDA 1K6MA 2PEZA 1II8A 1LFDB 3W8RA 3OFNA 1P2SA 2GBLA 4P4UA 4E22A 4Q1FA 1EFUA 1TEXA 1TPZA 2XTZA 3U3KA 4HB2A 2ZM5A 1VIAA 2GXSA 4A8JB 2IX3A 2ZI4A 3TIFA 2V3CC 1NNEA 1XTRA 2WSSD 1R7RA 2IWHA 2C5LA 3GJ6A 4ITRC 2XZOA 1S3GA 4M1WA 2F9MA 3EPKA 1YRBA 1Q20A 2A9KA 4JL6A 4D2IA 3K09C 1OKKA 1DAEA 1ESMA 2BDTA 5E95A 1CEEA 4QFMA 4Q4LA 5LBIA 5AJZA 4AYXA 1MRNA 4RZUA 2VHJA 2XTNA 1G8HA 3GJ3A 3QF7A 4MDFA 1EFRA 1OPXA 4HZIA 1XB2A 521PA 2ZYUX 3IBYA 2V6JA 1SULA 2FU5C 4PPNA 1HE8B 4JVMA 1NBMD 3MLEA 1AGRA 3U44A 3I8XA 1E99A 2OLKA 4AI6A 5KYKA 2FSFA 3LX8A 4V03A 2IS6A 3FGNA 3IHWA 2OBMA 2FPLA 4PO8A 4KBFA 2A30A 1OLOA 2OZEA 2FEMA 1VCIA 2CK3A 3OHMA 4L9SA 2B7BA 1E1RA 4JJZA 1CR1A 3SEAA 2DFNA 4MKHA 3BOSA 4OK3A 2W6ID 3GMTA 1H65A 4X8LA 4RD6A 1TTTA 1P7CA 4F4CA 3ECCA 1N6PA 4C0KA 3BWDD 2DBYA 3B2EA 3ADKA 5FPTA 4YXWD 1Z0DA 3NH6A 1XEWY 4OBEA 2VF7A 5LDDC 4LY6A 3RS3A 3K53A 1L4YA 1M1YE 2P5SA 3AVVA 1KMQA 3AP3A 3SZRA 3AH8A 5AJYA 1TUIA 3K0AA 4Q18A 2A7QA 2H5EA 1X8LA 2FF7A 2FFAA 3ZQ6A 5C4MA 1SVLA 2QORA 3VR2A 2XB4A 2YJTD 5GJVC 1SVWA 2OCYC 3QQ5A 4JKYA 4BUJA 4P32A 3NBXX 3RABA 1JXMA 2ATXA 3QF4B 3BE4A 1NVXQ 1Z0FA 5DE3A 4P4TA 5DO9A 3CWZA 1JECA 2F7SA 3ZZUA 3W6NA 4L16A 4PXAA 2FDCA 2BMEA 2QTVB 3PR1A 4NCIA 4YDHB 4E07A 1L2TA 3RHFA 1R6BX 2P3SA 2WPDD 5EE0A 4B43A 2PT7A 4D82A 3EIHA 1E9EA 4ARZA 3GJXC 1IBRA 1ZJ6A 2WOOA 1WRBA 2JLXA 4CEHA 5F3WB 1OH5A 2XNSA 4EPRA 2GXQA 3PUWA 1TF5A 1V43A 4N1AA 4GI7A 4DDUA 4EKDA 1MABA 1DBSA 1X6VA 1M7HA 1XTSA 1NL3A 2MSDB 3UKDA 3WBJA 5M04A 3GLGB 5JECA 1NG1A 2HLDA 2EWWA 3T15A 2ZJ8A 1XEXA 1QHGA 4EPTA 4Q4JB 5F98A 1ZIPA 2GEVA 3GLIB 2VRWA 4PPFA 2IYUA 1I2MA 1UKEA 2J45A 3FKQA 3HU1A 2XJ4A 4RD0A 4D4KA 1GKUB 1N6OA 5FOVA 5JRZA 2EVWX 1XTKA 2RHMA 4WZAE 4LJ4A 1E2LA 2R6CA 4G5QA 4M1SA 3LXXA 4CW7A 2PEYA 2QSZA 5TMPA 1WMSA 4WOPA 2WHXA 5LD2C 1CS4C 4C9BA 1EFHA 4B74A 3LFUA 1ZC3A 4KV9A 3THWA 4TMVA 4QG7A 4ZKEA 1T3LA 2W2VA 4L9WA 1AGPA 4NYIQ 1IN4A 2KWIA 5J40A 4V0MA 1Z22A 5AWFC 4Z1MD 5FI0B 1KMHB 1Q0UA 2VHUA 3IPXA 5JWHA 1IN5A 4DUGA 1KYIA 2E1RA 2F1IA 4FMDB 2LKDA 3U3RA 1YZKA 2QI9C 1T8UA 1NF3A 4ZDKA 1FUUA 1Q22A 4NBSA 3N70A 1XTJA 1RRPA 2B6HA 1UFQA 2GVDC 2JAQA 2GESA 2BM0A 3U3MA 4CRWB 1KK3A 4P4SB 1KSHA 4A82A 3K0FA 3TW4A 1M34E 4MYUA 4PHHA 4Q4HB 1GIAA 3KTAA 2VYFA 1IJFA 3A36A 3P4XA 4TZ6A 5JSZB 4FCTA 1A4RA 2QMOA 1ZYUA 1FX0A 4GSYA 5FL3A 4HLDA 3UATA 3FHTA 3GEHA 4M9QA 3VU9B 1TQ4A 3PEWA 1OYWA 4QHTA 2PT5A 5CJPA 1A2KC 3SJAA 3AF1A 2XXAB 4OI2A 3THXB 4US2R 1ZC4A 4KFUA 1ZM7A 5AJXA 4JLNA 2I3BA 1W0JD 1KK0A 3REGA 5KNBA 3F3YA 2YOFA 2OLJA 3LD9A 4A8JA 3R9XA 3FTQA 5EXPA 1CBUA 4FD2A 3T1OA 4MUAA 2ZRKA 3M6AA 1ODFA 3QKRB 5GJWC 3W5JA 1YR6A 3U5ZB 2YOGA 4YMVA 5TB5A 3BBPA 1NMZA 1YR7A 2H57A 1RYHA 3UPUA 2ZJ5A 4RD1A 3VX3A 4WZ6A 1XMVA 5DYIA 3FOZA 2AXPA 1CJVC 1LW7A 4H1UA 2QQ0A 1P2TA 3K0CC 3K0EA 4II7A 1E2NA 1GSIA 4B71A 4JT2A 3NH9A 4IDQA 1HH4A 4PZLA 2F55A 1U8YA 4POAA 3G0HA 2XTMA 3JVVA 3D7MA 1DG1G 1LVGA 1NBME 4JVLA 4Z1MA 4W5WA 1CJMA 1XPRA 2Q9AA 3EAQA 3VMFA 1GRNA 1G7CA 2NO9A 4HZUB 1Z07A 1G18A 821PA 3KL4A 2C03A 2ZI3A 2WKQA 3ZJYA 1Z2AA 4WBSA 4N0EA 4PSVA 3Q72A 1SQ5A 3WXMA 2CE2X 2XZPA 3HJNA 1W36D 4IKEA 1G8YA 1T8TA 1E9BA 3E2IA 5FFMA 2GILA 3X1WA 2XGJA 2RGAA 3CF6R 2V55B 1KDPA 1P9WA 3WMEA 1Q21A 4OI0A 5LB2A 3TUZC 2GVZC 3NEJA 4PANA 4PO1A 4A2WA 1CIPA 1QHNA 1VMAA 5KDLA 4B33A 4CT4B 4N0DA 2CXXA 2KI5A 1X8KA 5JJKA 2ZAMA 1JAHA 3UXMA 5LB4A 4DLUA 1W0JA 4DZZA 3H84A 2ZETA 2RGNC 4HB0A 5E3HA 4QM6A 5EUMA 2OE2A 1PV4A 1VDZA 1BS1A 2A5FA 2H17A 1ZUNB 2ZQ5A 3WRXC 3U2QA 5TXGA 2K5UA 3QF4A 1G8PA 4JLJA 3BH6A 4EFLA 1MV5A 3RLFA 1N6RA 4L4UA 2MMGA 2Q3FA 4JLAA 1XCPA 3RRMA 4V02A 3AVUA 1B0UA 4H1VA 4RD3A 1Q57A 2RGGA 2RGXA 2W2TA 3CPJB 2IYXA 4TTPA 5B2ZA 2AR7A 3AM1A 4D6PA 2IC5A 2QMEA 3Q7PA 5FOWA 2YC4C 3B78A 4B3DA 3CNNA 5FBRB 1WCV1 1E0JA 1W47A 3B9PA 3GPLA 1DAKA 1JJ7A 4DIDA 1R2QA 3RC3A 3NDBB 1FW6A 4R71A 3PUVA 2NOAA 4Q01A 2G9NA 5JEEA 1VECA 5E7IA 4XSGA 4OYHA 2ZI6A 2XSZD 3BGWA 1E9DA 2ZI9A 3GLGA 2ZUCA 1L4UA 1E9SA 1BYIA 2N1BA 4KSCA 4Q4JA 3MCAA 3OAAD 4LBZA 2RH5A 3CIOA 3OIWA 3M0EA 2W00A 4DCUA 3GLIA 2F1HA 1OH7A 3QPWA 1MRSA 2ZJOA 4DCSA 1IY0A 1L8QA 1E9CA 1FP6A 2WICA 2ZJZA 1SVMA 4FCVA 1TQ2A 3LVRE 1SVSA 1OSNA 4Q66C 2EFCB 2IF2A 1HQYE 2PL3A 2QN6A 2QTFA 3B6EA 4G5RA 2R6FA 3TSOA 3L0SA 1E98A 2G3YA 1NVVQ 3FKSA 1EFCA 1KIMA 2VHTA 3GD7A 2V6IA 3QOFA 2BHRA 4R2HA 2JLUA 2CEAA 4Q03A 5DN6A 1II9A 1LTQA 1KMHA 2QPTA 4NONA 4Q9JA 4I4LA 2JJ1A 4B3FX 2UVQA 4M4SA 4BLPA 1U81A 1R0YA 3QPUA 4KBGA 5C18A 1A5TA 1YJ5A 2F6RA 3BH0A 1M8PA 1E2FA 1R0ZA 2ZRGA 1JB1A 5JEDA 2JEOA 2FPMA 4GZMA 1GG2A 2CL0X 4P4SA 1AS0A 4Q4HA 4Q9KA 2ZSDA 3PXGA 4B76A 3ETLA 1E0AA 1XNJA 1N0VC 1XTQA 4UXIA 5JSZA 4Q1BA 2ZJYA 4IEEA 1E1QD 5JHGB 4PFSA 3VU9A 2VIIA 2XX3A 4DJTA 1S8FA 1OE0A 1TMKA 1PZNA 3U3JA 2XXAA 3HDTA 3THXA 1P75A 4EJSC 2VP5A 4K46A 4QKQA 4LCBA 2ODEA 2XSZA 4LC0A 2EW1A 1FPMA 3HPQA 3LV8A 5GVRA 3RDPA 3TAHA 3MUFA 4UJ5A 3QKRA 1H8ED 3OAAA 1N0UA 3KQLA 1DOAA 2WJGA 4S35A 1F2UB 5LD2B 3T35A 1N5IA 2ZITA 3UWOA 5HPYB 5J4LA 3U3OA 5GJCA 2Z83A 5KO2A 1NLFA 4LK2A 1Y3AA 4IVQA 3W8NA 1XMJA 1C4OA 4OI1A 3GJ5A 1T4GA 3B1WA 3OIVA 3P26A 4DWJA 1GAJA 3KKOA 2ODNA 1S96A 1SHKA 3TR0A 3TR5A 1NG9A 4TTQA 4AWXA 2IT1A 2XNDD 2P6RA 1FMJA 1FTNA 3ASYA 1KSJA 1ZUIA 1N6IA 1HA3A 4Q7JB 4QNMA 1KY2A 1BOFA 1QZXA 5JCZA 2F43B 1NMXA 1E2JA 2RGBA 1WB9A 3LBHA 5DLQC 1KJWA 2JATA 5F2EA 4HZUA 4ZCLA 2BJWA 1P62B 4NKRA 3AVOA 5KOYA 1IQPA 1J8YF 2OG2A 2RKOA 4LYHA 4PHTA 5FTKA 1GKIA 2ZYVX 4XWOA 4LJ9A 4C0QC 2C9OA 4V0OA 3GFPA 3QBTA 3NVAA 3GJ7A 4JL8A 2GF0A 5JS7A 4DB2A 1E2KA 2HF9A 3QJYA 4NL4H 4PR0A 4UNPA 4LV6A 4C0SA 1SKYB 2NQ2C 2VSOA 1TU3A 2EYUA 1O87A 2DB3A 4FIDA 3K09A 3VR1A 1M2OB 4HAUA 2RMKA 2QL6A 3B8HA 3C4JA 3DZ8A 4DHEA 4C0HA 3KXLA 2YWEA 4WZBE 3K70D 3WNCA 3VR6A 1D2MA 2P0EA 3CRQA 2LCFA 3PJRA 2CDNA 2QUZA 3CONA 3OEEA 2WJVA 2AKYA 4DSNA 4I1OA 5JRJA 4NYMQ 4F4IA 1VCOA 2H92A 1TL7C 2ZYWX 2ZXUA 3OZXA 3ZZ0A 2HV8A 4IXMA 2QG6A 1YZNA 2JLQA 1OHHD 1LV7A 2D7CA 4P33A 4BFZA 4F91B 4BEBA 3AVWA 4CZ2A 1T0JB 5ELXA 4QRHA 121PA 3LBNA 1IOZA 2O8EB 1IY1A 3QXXA 1OB5A 3SBEA 4AKGA 4F92B 2WAXA 2KE5A 1KZGB 3RYTC 3VKGA 3CPEA 3CNOA 2FN4A 5AR1A 3T61A 1J70A 4B34A 2DFKB 3TW8B 1ZU5A 5G3ZA 2ZRJA 3V4FA 3SQWA 3Q9LA 1QHSA 2DY1A 2IYSA 2WAYA 1E9RA 1NN5A 3G82C 5HKKA 5A5GA 1G8GA 2ZRFA 2BBTA 3VR4A 4LHWA 3V4RA 4AG6A 2MMCA 2IF0A 3K8YA 1GITA 3ZS9A 4JLVA 5EE5B 1VG8A 1EG7A 1Y63A 3N2EA 4GP7A 1KTVA 1QVRA 3KKQA 5CYOA 4TYQA 5EP1A 2QEQA 3D31A 4C2TA 3QVVA 1ZM3A 1GUAA 1W36C 2XB2A 3I32A 1ETUA 4HSEA 4M0LA 4PC2A 3EARA 3B7GA 3PG5A 3K9HA 4QNRA 4O3MA 2C95A 4BGDA 4MGZR 2OHFA 5JWRA 4MRNA 2C98A 1JBKA 4QJ5A 4PAMA 4NHOA 4WAUA 4Z8YA 3CF2A 1TADA 1ZIOA 421PA 5H70A 1TQDA 2IXFA 4AKEA 3CZQA 4LZZA 2ZI7A 1WF3A 2AD1A 2H18A 2NO6A 1G3MA 2WIAA 3H2YA 4QJ3A 4LBVA 4JBYA 1XEWX 1N5JA 4JLBA 1E2QA 5BYKA 4DDWA 2IW3A 2JLYA 1GOTA 2CLDX 2IBMA 2ZPTX 3KKNA 3W3AA 5F9HA 1XP8A 2OT3B 1ZNZA 3AVPA 1CLUA 1N6NA 3CNLA 1AZSC 2NZ8A 4B6EA 1PUJA 2CVFA 3EZ7A 5DI9A 3PCRB 2Q21A 4URUR 5E7JA 3PUZA 1YQTA 5D3QA 5KSZA 3L0IB 2H16A 1ZNWA 4W7SA 2HYIC 2GA8A 1OH8A 2WIBA 2CNWA 3J81k 3FFAA 1BYUA 2JGNA 2BBWA 4TL6A 1R0XA 2A5JA 2C2HA 2Z4SA 3B60A 1OFTA 1G17A 3SJZA 2RGDA 5EQTA 5IT5A 4LHVA 2A5GA 2WWIA 3TBKA 1AQYA 1KNQA 3WP0A 3U7FB 1F2UA 2DWPA 2VLIA 4PAOA 5CYPA 3P4YA 3TAUA 3I5XA 3BC1A 3PVSA 2GTPA 1IXSB 1XZQA 1HEIA 3LY5A 4Q48A 2ZSEA 5C1BA 4PHFA 4DVGA 2FE4A 4OK5A 4XH9B 2ORVA 3I62A 5CLQA 4LC1A 4G01B 1RJ9B 3VTKA 2BOVA 4Z54A 2NO7A 2WMOB 3KXIA 4AKIA 3AVYA 3BXZA 2HDNB 221PA 3OF5A 2QPAA 3VX4A 5L3RA 3DOFA 5GVSA 5FTMA 1XRJA 3W5IA 4U00A 4ZDWA 3VKHA 3ZZTA 2F43A 3K0SA 2FV8A 2X2EA 3LA6A 2AWNA 4OHYA 4FMDF 4JLOA 4EQ6B 2QP4A 1NVUQ 2CE7A 3IQXA 1N6LA 4KJZA 2R65A 1KNXA 4HEJA 3NDPA 4EJSB 3KQHA 1E79A 5DGXA 3LVQE 3E70C 3DKVA 3SC3A 2A3RA 4B2PA 4MGKR 2IYQA 1BIFA 1N6KA 1RRFA 4LGMA 1XBTA 4MDEA 2N46A 4DB4A 3C8UA 3OEHA 4W9MC 2ZVQX 3A1TA 3B1ZA 3HP1A 1OT3A 2RHDA 4W5JA 3SNHA 1G4UR 1LS1A 4M1TA 4ZIRB 1QVAA 4G5SA 5JWOA 1VG0B 2CHVA 3MFYA 4LJYA 2FWRA 4B3GA 1RIFA 1IHUA 4B48A 4MQBA 3K0CA 1SXJE 2ZAOA 3LH5A 3PENA 4W5HA 1TU4A 3CO5A 3FHCB 4MGYR 1W49A 4TLDA 5FPSA 4A92A 3X1XA 2IS1A 4CEIB 3MWLA 4TSFA 1F6BA 4GFDA 3C41J 4IXNA 5IK2A 5AUPB 4B75A 4C4PA 2XITA 2OEPA 1ZNXA 2ZIAA 1JQLB 2YINC 3PEVA 3HR8A 3B9QA 5HZKA 4A36A 1VIYA 2AHOA 1F2TB 1GNPA 4LHXA 5FBQB 5TY0A 2O8EA 2WWGA 3LW7A 5DIFA 1G19A 3QBVA 1VYUA 4B73A 2GWHA 4HAZA 4Q19A 2C8VA 3EZ6A 1Q3TA 4GPTA 1XWIA 2WKRA 3IILA 4FI3C 1H8HA 4LJ5A 1KSFX 4Q7KA 1KI6B 1ZM9A 1E2IA 2WJYA 1C1YA 1OXVA 1I2DA 2PBRA 2QQEA 5AJVB 3T1VA 1UBEA 2FZLA 5KSPA 2GZAA 1CJUC 3AKCA 3BJIC 4WW0A 2Q3MA 1HV8A 1G64A 2O0JA 2C77A 2QP9X 1KO1A 3CB4A 2RGNA 621PA 1S0UA 1ZBDA 3R9WA 4YMUA 3LQQA 4IDOA 4U5XA 1IAQA 2WZQA 2WJJA 3PQCA 3HR7A 3QKUA 4MGIR 1W0KD 3QVUA 3QY0A 1W2HA 3TNFA 4QHYA 2R62A 2WSSA 3K9LA 4PPGA 1G9XA 2W0MA 1OXTA 1AS2A 2PMDA 1D2NA 1EFTA 1FNMA 4JL5A 3WYFA 4DIEA 4NYJR 1XD8A 5K8UA 4RJLA 2ORIA 3CRRA 5HCNA 3AVTA 3K70C 1SXJC 1KDRA 3MD0A 1BO6A 2V8OA 4TQUS 4KLZA 3RANA 5AJWA 1G5PA 4M2LA 1GL9B 1Z2CA 3A4NA 2V1XA 1NBMA 1YZGA 1ZUHA 4LDJA 3QIAA 4NDZA 1UAAA 4NCJA 1HQCA 2BVNA 3VAAA 2ZU6A 3GLFE 3I1FA 2ZJAA 1U8ZA 1Z29A 2VPPA 4IDNA 3ZVNA 3VNUA 1J2JA 3M1IA 3VNVA 4J0QA 2RGEA 2VEDA 1TNDA 4OHXA 3JZAA 3IEUA 2ZREA 3W34A 1G7RA 2IYWA 5GADl 1PLLA 3DL0A 4ABYA 4R98A 4C0BA 4ESHA 2W6IA 1P5ZB 1Q1QA 1W36B 3Q3JB 4XD7D 4TWZA 1XZPA 3NIBA 4LPSA 4YXWA 3UIEA 4BFVA 4HUTA 1YZTA 4EFNA 2O8BB 1YU9A 2IYLD 2ONKA 2JLRA 4ZCIA 3IGFA 2C9CA 2GZHA 3KJIA 3R20A 1CR2A 2X77A 4O2LA 1RJ9A 3SU8A 1E2GA 1KKMA 2FFHA 1Z06A 1PLKA 3EPLA 4QGAA 4EIWA 4DC9A 3GLHE 1XCGB 3BK7A 3FMIA 4M8NE 2OCPA 3D3QA 3PEYA 1XX6A 1AS3A 3X1YA 4OQFA 1J7KA 2IWRA 1GRQA 1WBBA 1AQUA 5CK4A 5KDDA 4NCNA 2JA1A 1XF9A 4M22A 4LJ7A 4AKHA 2BMJA 4DLTA 1P73A 1HTWA 4HLUC 4TYNA 4OL0A 4EFMA 4EQ6A 1Z63A 2WPDA 2GDJA 4JS0A 4MYTA 4A15A 2HJVA 4IJMA 2KBEA 4C0JA 1JEEA 1T3HA 4EJSA 2P65A 2D2EA 2QE7D 4B2LA 3KUCA 1DO2A 3O8CA 2I4IA 4OHWA 2R44A 1GZSA 3JVUA 4F7WA 5ANRB 3UMRA 1MO4A 2W2XA 1EGAA 4QGFA 3FMFA 3K9NA 3QG1A 5JMTA 1O3YA 4ZIRA 4A6PA 4BFXA 2QSYA 4IDHA 1Q44A 4A0GA 1N5KA 1JPNA 1U0HC 2V7QD 2FOLA 1DADA 1Q1ZA 4HYYA 3NBYC 4I81A 4XD7A 2UZIR 3CX8A 4IW3B 1KI3A 3DM9B 4XTRA 4FWTA 1P61B 4EUNA 2J7KA 2EFHB 4C30A 3IQWA 1CP2A 1T5LA 4CEIA 1G3IA 3ZIAD 1CF4A 1G5RA 4N3NA 3ZDQA 1A7JA 4JYBA 5TDHA 1NVWQ 2OAQ1 3OESA 1VG1A 4KVAA 3RS7A 2GAAA 2PCJA 3HYRA 4BFYA 3QXSA 1P9NA 4JBXA 4YMTA 5BN5A 4QM7A 3K1JA 3HU2A 4GNKA 4LOAA 1GP2A 4C3ZA 3BFXA 4P0TA 2DWOA 1E2MA 3FYHA 4RFSB 4DSOA 1F2TA 2YKGA 4NPHA 1KHTA 4DLRA 4D0LB 2PZEA 3MRSA 4LI0A 4OHZA 2BV3A 3A37A 1VPLA 3OE7D 1CULC 3A4LA 4M1OA 3MWJA 3ZS8A 4A0FA 5J4YA 1XPUA 3CRVA 5EP3A 1KI6A 4AC9A 4KU4A 3I4LA 4O0MA 4LHYA 4CF7A 2GETA 2QY9A 2WWWA 2WWHA 2QROA 2V4ZA 2FNAA 5EXSA 1BMFD 4TMTA 1QBKC 1XDBA 5SZIA 4ZI3A 3DHWC 3H0KA 3GEIA 2QGNA 1AK2A 5FR2A 1MO6A 2P5TB 2C04A 1Z0JA 1X3SA 2EFGA 4GOXA 1UF9A 5AK0A 3AGQA 5K8TA 1Q1BA 5DI3B 3Q5EA 2AX4A 2TMKA 2J46A 1R0WA 2KJQA 1ZD9A 2ZRMA 2DPXA 2ZRNA 2J87A 3T1QA 1DAGA 1OXUA 1JQJC 3IBGA 3LO5A 1ELOA 4BEJA 2W0SA 2NG1A 1DPFA 2B8TA 1W4RA 2ZS7A 3KQUA 2PX0A 2ODWA 2CLSA 4MUBA 3MAAC 4M1YA 5SZJA 2IEZA 2P6NA 1QHXA 2O0HA 3EC2A 3P32A 4URWR 4Y0VA 2I1VB 5JLJA 4TZ0A 3BB3A 1DS6A 4CT5A 1E69A 1KI4A 1FZQA 1OIWA 4URZR 4AK9A 4DLWA 4FW9A 2QA5A 3KJEA 4LWZA 2QAGC 4MKFA 4RZ2A 1U98A 5DYGA 5FOUA 2VP0A 2FSGA 3ADCA 1OF1A 3R7WB 3AVQA 4DSTA 1CRPA 3A1WA 5J47A 2ZANA 3R8CA 3VKWA 4TL7A 3TUJC 5KPJA 2A78A 3PITA 4D26A 1RFLA 3NWJA 1E4VA 1P2VA 2D06A 3FMOB 5P21A 2BKEA 1COWD 2V1UA 1DELA 4FMCB 4B47A 3KDSE 2FSHA 3EW9A 5EXTA 4AD8A 2W6JD 1CJTC 1BMFA 1P4SA 3THYB 4ASUD 2NMVA 4XIGS 1OXXK 3U61B 2EU8A 2C78A 1WA5A 1SZPA 2QMHA 3SFZA 3LBIA 2O8BA 4G1UC 3ND8A 4C0LA 2RGCA 1YKSA 2J1LA 1F5NA 2NPIA 4D4LA 5CK5A 4LUCA 1G3QA 1P2UA 1M7GA 2OUKA 1OJLA 2OXCA 4JBWA 3P20A 4HAYA 3HU3A 3SI7A 1N0WA 4DCNA 1JR6A 2REOA 3K70B 1SXJB 4LJ6A 1GFIA 2GKSA 2HT1A 1F3OA 2HT6A 2VP4A 2JIZD 1NMYA 2JJ8A 3WNBA 2VQSA 1YR8A 1AM4D 4DLZA 3E5HA 2IXEA 4TMWA 5H8WA 1DTSA 4TN1A 2C96A 1XU4A 1N2CE 2CL6X 2JDID 4YONB 3THOA 2CHGA 2JLVA 5KPDA 3IIMA 3CH5A 4GT1A 4L15A 2QAJA 4A2QA 4FCWA 4WVFA 5D3MB 1OW3B 4KSBA 4X8HA 4LX0A 3SJBA 4URVR 5GJBA 4JYCA 4BFTA 3WBKA 4BRUA 1UPTA 1KO8A 3SJCA 3E1SA 2VSFA 5C46F 4IOMA 1HT2E 4UNSA 1A1VA 4RZXA 3BIFA 5FTLA 1R5BA 2QZ4A 2WBLC 2W6JA 5FL7D 2ODBA 4C0AC 2O52A 4O25A 1KSGA 3EPHA 4ASUA 3NBFA 1FFHA 4A2PA 4BFWA 1QG4A 1KY3A 4QBHA 1PLJA 3W3ZB 1U9IC 3MGCA 3QKTA 5KSYA 3T5GA 2JJ2D 1KJYA 1NIJA 2FGJA 2ZRBA 4Q47A 5G40A 2OESA 3EA5A 2LWIA 5JHHB 1X1RA 2ZUBA 3CW2A 3KB2A 3U6BA 1UKYA 2BBOA 3T5DA 4RFSA 1HURA 2VTKA 3MSXA 1GTVA 2ZE5A 1ZM4A 3B82A 4PZZA 4CYMA 4B35A 1KO4A 1WXQA 4QBFA 3EIQA 4A1FA 3RWMB 3O8BA 4US1R 3SFVA 1AN0A 1ZINA 2ECKA 3SQXA 4K8OA 1GNRA 3BD9A 5BYJA 5IDVA 1NP6A 3ZYCA 3NXSA 3GLFB 4Q9HA 1DAFA 1FNNA 2NTYC 3B1YA 2JDIA 2VBCA 2WVJA 3I5YA 1E1QA 1E2DA 5SZHB 2IS4A 4BECA 1E96A 3EXAA 4Z51A 3GLGE 1DAHA 2HXSA 5DI3A 5C4GB 1CR0A 4Z8XA 1DO0A 3V9PA 3TH5A 3G5UA 3LXRA 1KDTA 5HZHA 5IRCD 2ORWA 1VHLA 4TT3D 1SXJD 3KJHA 3RRNA 3MMPA 4LV8B 4AG5A 1H8EA 3EWSA 5LPNA 1U0LA 3B85A 2CVHA 5B58C 1W4BA 3LQRA 2YWGA 4TYWA 1TF7A 3WYGA 2GEDA 1ZD8A 4X8MA 4ZDJA 2ZTSA 2R9VA 3TSWA 5EP2A 4YQFA 4Q1AA 1Z08A 4RKFA 1XMSA 2J59A 5CM8B 2FG5A 4MITA 4JSTA 1MT0A 3MWYW 4QC2A 4D0GA 4MYCA 3GLHB 2WKPA 4H9GA 2XNDA 1HE1C 1Z6AA 4GP6A 1NVVR 1SVIA 4IFBA 5CDFE 5G41A 1D6JA 1KI8A 3EG5A 3ADDA 3FWYA 1KJZA 1FQJA 1UBFA 2QT1A 3CRW1 2IHYA 4M9SA 1W1WA 1RZ3A 3R7WA 2FZ4A 4EPVA 5FR1A 4A9AA 3W90A 3CR7A 2V9PA 4JLKA 4KCGA 2X2FA 2WWYA 1D5CA 4DDVA 4B3BA 5J4KA 1EWQA 2IYYA 4OJKA 4PPQA 1CKEA 4JT4A 1R8QA 2QTHA 1NSTA 3CLVA 3QKSB 5CITA 3AP1A 4DEYA 4ACAA 1A2BA 2Q9BA 1D9XA 4QHSA 2AFIE 3ICQB 4YC7A 3KX2A 2CLCX 4QBIA 2XOKD 4DLVA 2W83A 2ZRDA 2BCGY 1G1MA 3THYA 3PUYA 2A5YB 3I92A 1Q3HA 3RSLA 2RB4A 4P31A 4BLOA 1XTIA 2P6UA 2JCSA 1U8AA 4XTCS 4OQNA 4Q5IA 1IN6A 3X1ZA 5DHAA 4WXPA 1Z8FA 3LRPA 1ONBA 1DE0A 4IOJA 3TGPA 1Q1EA 3R8FA 4R7ZA 4DLYA 5DSZA 1G21E 1SXJA 2GJ9A 2GK6A 2VL7A 4GMDA 4MRRA 2F3RA 4TT3A 4YMWA 5HE8A 5JJLA 5L3SB 3CUEF 3SYLA 3GFTA 1XXHE 5A4JA 2GK7A 3SN6A 4MRPA 1S1CA 5FUYA 1KDOA 3L8YA 3L0PA 2VF8A 2QAGB 1T0HB 1OHHA 5KNCA 2WJHA 1E9AA 4ZDIA 4Q7MB 5EZ6B 2OO7A 1AKEA 1ZW6A 4LHZA 2GJSA 2H1LA 5G53C 2BJVA 4TLCA 5B57C 3FPAA 3ZVLA 1Z83A 3W6OA 3ICEA 1VG9B 5L3VA 2ATVA 5FOTA 1LY1A 5D3MA 4DRZA 4B32A 4KYUA 2XEXA 2AK3A 1IJEA 3QENA 3RS0A 1JEDA 2P2LA 2G1JA 3P1JA 1T91A 4BLQA 4FWIB 2J41A 4NCHA 4LYJA 3GFOA 4TMZA 3QI2A 1PVOA 4HDCA 3GCGA 3FVQA 2IS2A 3QNUA 4ZV4A 1DVRA 1NSFA 4JLMA 4OKSA 1DEKA 2XOKA 3OFND 4S2EA 3GEEA 4NCKA 2FFQA 1VCNA 3F5FA 1LNZA 3ONWA 2C9YA 2AD5A 1G41A 2FGKA 4KXFB 4B6FA 4FXPA 3TRFA 3RNLA 1WP9A 2IHBA 1OFIA 5KTYA 3BFVA 2J7PD 4ZCMA 2RAPA 1QF9A 1Z6XA 3N2IA 3L2OB 4MA4A 1JAIA 4X8OA 3U4QB 5JJIA 3EX7C 1G5TA 1KAGA 4HLUA 3F8TA 4GDFA 1EFRD 1BH2A 1KK2A 1CJKC 4RVCA 4UXJA 3SHWA 4WXRA 3MJRA 4MKGA 4XWAA 5C2JB 1RE0A 3SYKA 4KLNA 4I1UA 1P60A 2O0KA 2BC9A 1R8SA 1VKJA 2O8FB 4LPKA 2VSXA 2ASEA 4UNNA 1XFAA 1NJFA 5SZKB 3CWQA 2H8KA 3DEFA 4KITB 2QENA 4LBYA 2HCJB 3T1TA 2X1VA 4BFUA 3GLFA 1P72A 4NH0A 5DISB 5HTKA 3UK6A 2CK3D 4TL8A 4EPYA 2BKUA 3ZVRA 3UG6A 2Z5FA 1E1RD 1W4CA 4BQSA 5CB6A 3WYAA 5EE3A 3AVXA 4US0R 2CCGA 3IO5A 2ZR9A 2OBLA 2A2ZA 2GJKA 3WMGA 2VH5R 3AGPA 1K5DA 4Y0AA 3HWSA 3A1UA 2D7DA 2OILA 3R9IA 4OQLA 4PSKA 2Z43A 3KB1A 1JR3E 2ZE6A 4TMXA 2E87A 3BRWD 4FN5A 3IHLA 3KKPA 1D8TA 2FMXA 3QXJA 1UBGA 1UADA 1ZMXA 2D4HA 1S4QA 2REXB 1X86B 3IIKA 3I73A 5DNYB 1QHIA 2QP3A 3U6KA 5K8IA 2JLSA 3NC1C 3IIJA 3RC8A 1SHZA 2IA5A 4IFEA 4PQYA 4RCYA 1RYFA 2PLRA 1XCMA 4RCZA 1ZVQA 3A4MA 5KUTA 3GLHA 4LJ8A 1Z47A 8OHMA 4B2IA 2D2FA 1YHNA 4XVRA 3T34A 1JALA 2J7PA 1L7VC 2CMKA 3MG9A 4CDGA 1YVDA 4ACBA 1N25A 4XVUA 1U0JA 3VQTA 3O8RA 3W6PA 4TTRA 1NLZA 4TLEA 4O2RA 1MH1A 3JZMA 2ERXA 4M1KA 1YZUA 4TQ9A 1YRAA 3AKEA 3RAPR 4D25A 4IRUB 2AK2A 4DKXA 4F4JA 2WMNB 3QKSA 1GWNA 2DYKA 1NN3A 2ZI5A 3NC0C 5EUQB 1GM5A 4BZPA 2A5DA 3IEVA 3TKLA 4DCVA 2YHSA 4KAXA 2HLDD 5DH9A 1S9HA 1AKYA 2YC2C 2JASA 3S1AB 3EPJA 2YOHA 4HB4A 4XJXA 2NZJA 3QXCA 4GBMA 3ZVMA 4DLXA 2ZRHA 1HUQA 1U94A 4EDHA 1XD9A 4TMKA 2NO0A 2R6AA 2IYTA 721PA 4M53A 1KO7A 4JVSB 4L5BA 5L3SA 4Q9IA 2AFHE 1OXSC 3KXKA 1II0A 4PTLA 3UG7A 3RS2A 2LKCA 3C5CA 2J9RA 4PO9A 2CCJA 2QAGA 3UANA 2ZVPX 3WHKA 5A0FA 3H4MA 1J90A 3D6TB 1LS6A 2G1KA 4AIIA 2E9SA 2NIPA 4DUGD 3AF4A 3KQNA 4ERNA 3FMPB 4PHGA 2EYQA 2XJ9A 5B64A 2L0XA 2P67A 1G8FA 4ILEA 1KKLA 2QRZA 3DZDA 1W48A 1T5IA 1W44A 2BM1A 2HXYA 1Z0KA 2W58A 1GRRA 3CX7A 2J0QA 1G3UA 4ZKDA 3LLMA 1J99A 2MSCB 3AUXA 2ZRCA 1RRGA 3NKVA 4RD2A 4I1VA 1AZTA 3AF0A 4IDPA 1EK0A 4LJAA 1N5LA 4HAVA 4B44A 3UMSA 4B3CA 2HUPA 2ZJ2A 2FX3A 3H1TA 5G3YA 2ZYTX 4Q1EA 2OFOA 4HDOB 4LYFA 4RKEA 3KJGA 2CHQA 5CB8A 4IOKA 1K5GA 1Z0AA 4ON9A 4OJQA 3CKLA 4Q7LA 4BASA 3NHBA 3TSZA 2NO1A 4GOJA 4NU0A 4FMCF 4MRSA 1SKYE 4AYWA 3CR8A 2OAP1 2YZ2A 2IL1A 2QU8A 1E6CA 1NRJB 3KFVA 2B8WA 3TUIC 1W0KA 4GMXA 2PCLA 2VP6A 1S1MA 5CIQA 4D0NA 3SDZA 5CM9C 1MO5A 4BFSA 2FH5B 1IM2A 1JPJA 1UM8A 4IVPA 4MYHA 3EA0A 4TYPA 1UKZA 3U4QA 4PAQA 4XWKA 1NY5A 4Q1DA 4DBLC 1I4LD 2GAOA 1E0SA 5J4VA 2IYZA 4V0LA 2VA8A 2F1RA 3B1VA 3P27A 4Q02A 5KSOA 1FUKA 4A0HA 2O8FA 3WMFA 1G6HA 1JXOA 4G3XA 4ZI2A 2XZLA 4NZYA 4CEJB 5KHOC 2Q6TA 3WHLA 2BWJA 5JI3E 1M74A 2IYVA 5KDOA 3WRYC 1Z5ZA 4QJ4A 3O47A 3N5CA 4EAQA 1R5NA 2CJWB 2QM7A 3FE2A 4XVQA 4I99A 4TL9A 1MOZA 1IN7A 4KHZA 1W2GA 3TLXA 2G88A 2GRJA 2QRNA 1XJ0A 5K8LA 2DR3A 5FOSA 4TLBA 2ZS8A 1NY6A 2GNOA 2ZSFA 3Q5DA 4PX9A 3U7GA 4JIMA 1TUEA 4GL2A 1U9IA 2RCNA 3RWOA 1C9KA 3AQ4A 4D81A 2J0UB 5B30A 3C16C 1DARA 1RRCA 1TAGA 3EZFA 4A6XA 3AF3A 4I1SA 3V00A 3CX6A 5FPKA 1G7SA 3TE6A 2OSBA 4BPBA 4C7OB 3RRYA 1UEJA 1Z28A 4OHVA 3A6PC 1GILA 1P6XA 4MRVA 2QNRA 3O8DA 2GBLC 4D4MA 4RD4A 3LNCA 5FPYA 2GHIA 3DVLA 4KVGA 3SE0A 2QMUA 2AL7A 4G5OA 5FUXA 1XXHB 1SVKA 2ZRLA 2IK8A 2OM2A 1GL6A 4PQRA 3MJHA 4QXAA 3DPUA 2QT0A 1OIXA 1P3JA 5H1YA 2VHQA 4L8GA 1Z6TA 4UJ3A 2Z4RA 1N6HA 2IUSA 2X19A 1E2EA 1TX4B 2ZS9A 2IUTA 3OIYA 1MKYA 3CBQA 5TARA 5UKDA 4E09A 2ERYA 2F9LA 4JZKA 4WIAA 5BW8A 4ESVA 2VHCA 3DO6A 3QE0A 5BWMA 1KOFA 1UKVY 3LW8A 3PIRA 4V0NA 1FMLA 3TK1A 5HR5A 2UZ3A 3FDIA 2QE7A 2DFTA 2Z6VA 4PC7A 4DSUA 2ZU0C 3DMDA 2G0NA 2G0TA 1M6NA 2ZROA 3K9GA 3EIEA 3EC1A 5HCIA 3QEJA 4OK6A 1YZQA 1E9FA 2GEUA 2QGZA 1U2RA 3S1AA 1WDTA 3VR5A 1G6OA 3BFKA 3DDCA 1AIPA 4WA7A 3QEOA 2V7QA 1B23P 2ZJBA 5BQ5A 2D3WA 3UWKA 1OH6A 1Z6GA 4F38A 2CCKA 1J8MF 1NLYA 1Z6YA 3FKSD 2ZRIA 3BERA 3ZIAA 3EZ9A 4MH0R 1ESNA 4QBGB 4KFRA 2GCOB 1XJCA 2B21A 5DN6D 4BE7B 3IKJA 4V0ME 3A58B 1EXMA 2JJ1D 1T6NA 3GQBA 1IXRC 1XD2B 1AA9A 2OXRA 4BRWA 5EJEA 2FSIA 2JLZA 2ZRAA 4NYIR 5JZVA 4AURA 2BMFA 1G16A 4LV5B 5EXXA 3OE7A 4YMSA 1ZM2A 2OFWA 2FFBA 2GZDA 4PSAA 4NMMA 4TLAA 3BB1A 5TVKA 1NKTA 1P9RA 2QPOA 2PH1A 4QGGA 3IPYA 3I3SR 1UDWA 3AUYA 4GOKA 1NN1A 3PV0A 4RSGA 3TJZA 1U90A 2DCUA 1KO5A 2J3EA 4HAWA 3IUYA 3TMKA 1KK1A 4RFVA 2JLWA 3A8TA 1RC8A 1E2PA 1A82A 2D74A 4PQFA 4E03A 3DMNA 5FH9A 1K8RA 4M9ZA 1QHYA 2GJ8A 1MO3A 3NEYA 3CRMA 4Q1CA 4LYAA 2EFDB 2ZRPA 3RS4A 3NBZC 2ANCA 2NGRA 2HYDA 2YV5A 3ZD6A 2KBFA 3AEZA 1E32A 4KFTA 2ZR7A 1SGWA 3KQKA 5FBLB 1D9ZA 1KAOA 1NJGA 4BZQA 3SR0A 2F3TA 5E4FA 4OI4A 1SVOA 4M21A 2ANBA 1WE2A 2GJAA 2FPKA 1V5WA 3SHFA 2O8DB 3ADBA 2WM9B 4E5UA 3QPVA 3ZH9B 1CR4A 4D4JA 4U7DA 1VCMA 3B1XA 1VYVA 1U99A 3PUXA 5IHPA 4AYTA 2J5XA 4CEJA 4HLQB 5CDFA 3GJ0A 2J0SA 5J4HA 1F60A 4D80A 1Z0IA 1CTQA 4K81B 1QHHB 2I1QA 4OQXA 1W7AA 1RW4A 1R10A 2CJWA 2Z0MA 5JS8A 3Q85A 1NI3A 1E3MA 1JNYA 2WOJA 4HAXA 1G291 3KUDA 2WWXA 1R5OA 1OFUX 3HPRA 2BMDA 4BLRA 1M7BA 2WTUA 1W5SA 3TQFA 1COWA 4DDTA 1G7TA 2R6GA 5J5CA 2QBYB 1YZLA 2ZSBA 4KFSA 2IYRA 5FPHA 3EZ2A 3H86A 2WJIA 4DLSA 1SKQA 5FBWB 1QDEA 2J0UA 1ZP6A 2AXNA 4Q00A 3BORA 1HY3A 3ZQJA 2CL7X 1ZU4A 4KO8A 2V54A 4IVRA 3QXHA 4C7OA 1CRQA 1VHTA 3LDAA 4JJKA 3BB4A 5H68A 1S3SA 2MSEB 2O8CB 4HI0E 2OFXA 5JI2E 5HE9A 2SHKA 3WY9A 3ZGXA 4P3YA 3C5HA 4A8JC 3OEED 4TYYA 4ZPXA 4NE2A 1F48A 4QOSA 1WQ1R 1XXHA 5BN3A 3T12A 2GXAA 2H7VA 1EWRA 3PFIA 2OV2A 2JIZA 5EE9A 4LRWA 1UDXA 2O5VA 4PC1A 3VFDA 4LSGA 1FTSA 2ZSAA 2GXUA 4XOIA 4A0RA 1IN8A 1ZNYA 5BXQC 5FBVB 1ANKA 3I8SA 4A4DA 1DAIA 4DT1B 1T9HA 1XPOA 3M4YA 1W5TA 2ZE7A 3BS4A 4JKIA 4DXAA 4QGHA 3TQCA 4HUQB 3L8ZA 4CGZA 1IXZA 2OCAA 4BLSA 1GVNB 5E7MA 2HEIA 5JCPA 3DKPA 5L3QB 1E0KA 4URYR 2ZEJA 1T3SA 1PUIA 2BCJQ 3CPHA 1UEIA 5BN4A 2B7CA 4Q21A 5HKKD 1IY2A 4C2UA 2PZGA 1FP7A 1AJEA 3GLIE 1JR3D 1HT1E 3VR3A 4M9XA 1G20E 2G83A 4Q4AB 1KI2A 2NPFA 3CZPA 3U7EB 1DG3A 1US8B 2ZR0A 5FUVA 5AUOB 2AWOA 2DFLA 5EP4A 3X2SA 3B13B 2PMKA 1II8B 5FL7A 2C99A 3U60B 5CIWA 2J0VA 1GNQA 2G77B 1D2EA 3LWNA 2XAUA 2ZE8A 2QM8A 4KYIB 4Q9LA 2OCBA 3FHOA 4JSYA 2JJ2A 2GCOA 3A1VA 3L43A 4DEXA 4U02A 1GL7A 3LX5A 1YR9A 3HYTA 3T06B 3UMFA 2AN9A 3RSOA 4RZ3A 1XD2A 1JJVA 4XSHA 4HLCA 3I72A 3BAFA 2X8AA 2R6DA 4M1MA 2PZFA 2YYZA 1R4AA 3AV0B 2R2AA 1KI9A 3NHAA 1E4YA 3I61A 1RKBA 1CU1A 2AKAB 2VP9A 3REFA 1HYQA 3GP8A 2GF9A 3SBDA 2YWHA 5KNDA 3U44B 4QL3A 3SYNA 3VHLB 5AUNB 3KKMA 3X1DA 5AUQA 2IXGA 1W46A 1EX6A 1UBCA 3SS8A 3Q7QA 4RY2A 2GCPA 5IF9A 1TQ6A 3CF0A 4IEIA 4JLPA 1KI7A 3EASA 2CNWD 2WWFA 5L8VA 2HF8A 4PC6A 5JBQA 1Z3IX 1OV4A 2FA9A 3B5JA 1VYTA 2B92A 1PJRA 4FINA 1QG2A 4KI0A 3Q8XB 2KB0A 1E2HA 3MWKA 4R9UC 4TQAA 2EFEB 1Q12A 2IUUA 1JR3A 1KI1A 3EWAA 2G6BA 2EWVA 3DM5A 5FOXA 4GRAA 4IOLA 1OFHA 2N42A 2GCNA 4KODA 4HATA 5F9FA 3CH4B 4F93B 3WNDA 5KU1A 1TF2A 1X8JA 2D62A 3RS5A 4UNQA 3K0AB 2PLFA 1WBDA 4LBWA 1S9DA 1YE8A 3AKYA 1EX7A 3KFXA 4EPXA 3WP1B 2F1JA 1OB2A 4PZYA 3U7HB 2O8DA 3LAWA 1XMIA 1GKYA 4JVNA 1DAMA 2Q0HA 3QG5A 2Q9CA 1N3BA 6Q21A 2WV9A 3OIUA 5FTNA 1FOEB 1X1SA 2VP2A 3FFBA 2FJUA 3ZD7A 1OYYA 1QHHA 4UXHA 1KGDA 1LB1B 2R8RA 4MKIA 4URXR 5DHFA 3BH7A 2BIFA 4ARZB 4UNRA 4CEHB 3GJ4A 2FEOA 1E94E 1ZRHA 2VO1A 1E79D 2HCBA 4NP6A 2PJZA
chains in the Genus database with same CATH superfamily
4GQBA 2XXJA 1U1FA 1INLA 1VA4A 3CKKA 4IQ4A 4MICA 4PC3A 4Q9AA 2QY6A 4IJUA 2QBYA 2YIDA 4LXTA 3DDNA 1RVDA 5TSDA 2VZ9A 4MR8B 3I5UA 4QOIA 1S01A 2EF0A 2DUWA 2BEJA 2REBA 3CM0A 3KZ1E 2Y8EA 4V0KA 5TV2A 3AB3A 3KP1A 3FB4A 1CXZA 1ZK4A 4N6NA 1MQ8B 1JAZA 1OTXA 3DMTA 1TC2A 3H2IA 3IO3A 3MCVA 3QEMB 1D0VA 2YV2A 4N47A 3UAGA 2PZAA 3A7EA 4UFPA 2BI7A 2L18A 1K6EA 1Q50A 1ZGGA 5A0VA 2L19A 3KPJA 4NZPA 3COJA 4IV0A 3IDSA 1B8UA 1RQ2A 1M2WA 2AOTA 1RKQA 4Q3LA 4J2HA 3FZQA 1R6AA 1S2MA 1TZMA 2IOHA 1W5FA 2CBZA 1RWOA 2VYQA 4TSFD 1BFUA 3Q2KA 2TSYB 3HGMA 2XQIA 1ZCBA 3PNSA 3RU7A 4Z4IA 1ZPDA 2YWFA 5FEMA 2D0PB 3HEMA 5JIBA 4AMVA 2QW1A 1MC4A 2MINB 3NBQA 1RPZA 4NYMR 1KZ7B 4TRNA 1NN0A 2A59A 1P91A 2RKBA 3AP2A 4N8DA 4N4AA 2VG8A 2J07A 3P2KA 4DCTA 4DT1A 3H1GA 3E9CA 2KSQA 2VEOA 4REQA 1XHFA 4ZOLA 1D4ZA 2BUAA 4JMPA 2P4SA 2O2XA 3QUCA 2WSMA 2VTBA 3UAYA 4UM9B 2YJGA 5DXAA 3LLUA 2GD6A 5T8KA 1DX9A 2QZ9A 3WNZA 3WR5A 2FWMX 3GGCA 3QX9A 1P6QA 1VTKA 1X7DA 2ZIXA 1L5ZA 1BHSA 5LP6A 1PFYA 3C14C 3EG9A 4KR3A 1RVV1 2OKGA 2VYNA 1DSSG 1LF0A 2Y1DA 4N12A 5FYQA 3QSYA 2B99A 1QZTA 2NUAA 4NMHA 2BKVA 3BA6A 3K4QA 4RLSA 3L0OA 4G63A 1IONA 2VCHA 5LZ7A 4F1WA 1S2DA 3DZFA 1US8A 3TTTA 4S1OA 4M0FA 3PFNA 4M0PA 4DDTA 1KFJB 5DGTA 2B61A 2PEZA 1N4AA 3U4MA 1U3UA 3BWBA 1U0OC 1OFGA 4AJIA 1TEXA 1QKIA 2XTZA 4S1WA 4HB2A 3U3KA 5ICEA 2GXSA 4FNGA 5ICGA 9LDBA 2BE9A 4ZMBA 2QTWB 2RBKA 3KVOA 2PY6A 3OT4A 1XTRA 4RWEA 3OCWA 3JY6A 4PINA 2C54A 4IMJB 3E5NA 4ITRC 5TF4A 2IV2X 1NYQA 4X9XA 1Q20A 1RS0A 2A9KA 4D2IA 4GSLA 3W4KA 3WOHA 3FFWA 1ES9A 3Q87B 1ESMA 3EDQA 4DXDA 1JHXA 1RWNA 1FE8A 4Q4LA 2FQXA 2BFBA 2QTAA 3STYA 3G2LA 5EIXA 1T2NA 2H5IA 3AI3A 4YCDA 4LJSA 5THXA 2VHJA 3GVHA 4Q6BA 1G8HA 2JJMA 3H97A 3PNQA 1KF0A 2V9CA 4LRYA 5FI3A 2FWNA 5DN9A 4EELA 1CY6A 4L78A 2ZYUX 3SEZA 3UJ6A 1SULA 1YQEA 2POCA 2YW9A 3Q9NA 5KC9A 4JVMA 3G88A 1HDCA 4L5IA 3UWPA 3BG5A 2O0LA 4JEHA 4XJVA 3VTFA 2IEDA 2O07A 5BMVA 2Y05A 5CHYA 1E99A 3BXEA 3GWGA 3K71B 4QARA 1HG0A 2FPLA 4NBVA 3ED5A 3MBIA 4KBFA 2VYCA 4DV0B 2A30A 2HRCA 1OLOA 3EXHA 3KLOA 3WJ1A 4ZGGA 2HO4A 5BVHA 2CK3A 2EV9A 4BNWA 4NOJA 3AETA 4L9SA 1ZLYA 4LNUB 3I30X 1L6RA 1AKQA 1O6CA 2I9PA 3KYDA 1QNFA 5HBGA 3AUUA 5HQJA 2DFNA 3BOSA 2EARA 3QI7A 1W93A 3GMTA 3HKDA 3P9YA 4WUTA 1P7CA 3FF4A 4X8LA 4AS3A 5CLJA 3ROQA 3EEOA 4F4CA 2GUGA 1AKVA 1SQGA 2N0SA 3BWDD 1FVOA 1TAHA 3MS2A 4ZMSA 3F3MA 3GAZA 2VF7A 4N0PA 4WECA 1L7RA 4CN8A 3BREA 4LY6A 3RS3A 1L4YA 1M1YE 1KFKB 1TUBB 2P5SA 3A1EA 4L7VA 1KDVA 3UMMA 3AH8A 3AILA 1KH3A 1KEWA 2ESRA 3AM5A 1QTRA 1E58A 5LJLA 1FIUA 4IZHA 1DXYA 3K0AA 2I76A 2JLCA 1GCOA 3I2HA 1X8LA 1I3NA 4K9QA 4U1RA 1VLZA 4DMMA 2VUTA 1SVLA 1T2VA 2GZRA 3A3PA 2C3MA 3AJRA 4JJ8A 3VR2A 3DP9A 3MPUA 5GJVC 4Y6SA 5GIOE 3H5WA 3GYBA 2I54A 4P32A 4BNNA 5F3RA 3FNIA 3PQDA 4BLUA 1Q5PA 3OLXA 1TUGA 4P4TA 2Z4TA 5DO9A 2CC2A 3CWZA 3SWWA 1SVUA 3H2GA 3RM3A 4L16A 2R11A 4ZALA 5AOVA 3VPDA 2I6FA 4PXAA 3IBCA 4NCIA 1OBFO 3MWEB 4YDHB 4WDQA 1ZK2A 5IKEA 3B6ZA 3UYLA 2SCUB 1R6BX 2P3SA 3GCWA 4P8RA 4WY5A 4ZYVA 3FYUC 4NMLA 3EIHA 5TLSA 1IBRA 2ZFUA 2APJA 2C2YA 3L4JA 3WL5A 2HN9A 4P98A 4C4YA 1R4ZA 2PX8A 3DZIA 1ABEA 5CYGA 1KQGA 1O0SA 1OH5A 3OQIA 1R0KA 3PUWA 3WK7A 1TF5A 1V43A 1ZIYA 4CCWA 1NXOA 1VB5A 1EFPB 4J0EA 4D99A 1MABA 2GLXA 3JQCA 4G5HA 1XTSA 4NFHA 3DO5A 3KZKA 4NJMA 1GPBA 2GZ2A 2NU8B 4E1AA 1BN6A 5FUMA 2OZLA 3CRNA 1KC1A 1B8PA 5M04A 1NG1A 2HLDA 5LYJB 4NXNB 1IQUA 1XEXA 2B0JA 3AUSA 5D7NA 1LBTA 2YIVX 3AL2A 5BV8A 5F7XA 1HL7A 2JGAA 4IIJA 3D6JA 4TXNA 1JHMA 3ZZMA 1PR5A 1RKUA 1DC8A 4X90A 4D4KA 1P2GA 4DC0A 3BCSA 3LBYA 3M1YA 2EHJA 4JWKA 4UZEA 4KLAA 4KPUB 1HPLA 3HG7A 5G0VA 1WSDA 5JRZA 2IPAB 4LDZA 4DYVA 1SQSA 2YS6A 4DR3B 3KWLA 1EJ6A 3I0ZA 1ZHFA 2WHXA 3ELUA 5FWYA 1CS4C 2QTRA 4DIFA 4Q16A 3VYTB 2JFYA 1KR5A 2XGOA 3EEBA 3LFUA 1WU7A 4KV9A 4AUNA 4KKXB 3A2LA 4TMVA 3HVHA 1T3LA 2BGTA 4L9WA 4YROA 1IZ9A 2XW6A 1DOHA 1O97D 1AURA 2FMHA 4BX2A 4XCXA 5EWMB 5AVOA 4ETWA 4Z1MD 1Q0UA 2AOUB 1L8OA 3IPXA 4V39A 4QLBA 5I8WA 1GSOA 3HO6A 4OBWA 5EY5B 4JJAA 1QGUA 1SBNE 2CNKA 4RPHA 5H4HA 4YNBA 3ZU5A 1UJ6A 3ZLTA 3B6KA 1JBQA 1SKAA 2WG2A 1MQSA 3CGWA 4N0MA 4N40A 3N2KB 3R6WA 1Y5IA 1QPBA 2ZYHA 2EKLA 4WESB 4C4XA 2FG7C 2RHTA 1Q22A 5B1EA 1IG3A 1YI8A 1YIAA 1JYEA 2WHRA 1KP9A 1RRPA 3N70A 4K28A 2B6HA 4LVOA 1BTOA 3O6VA 2GVDC 4NV1A 3DYVA 2VDKB 2GESA 1KOLA 3WIBA 4QU0A 2Z5GA 2LGJA 4P4SB 2PUWA 3T7AA 1NR7A 2PKRA 3BHIA 3K0FA 1F8YA 4PHHA 4R01A 4TS1A 1V35A 3KTAA 1FSZA 2VYFA 3ZDYB 4MRAA 4TZ6A 5BN1A 5E9JA 3S81A 1IIRA 2QMOA 1ZYUA 3B5EA 2GYWA 3BGSA 3GDOA 1NXVA 4ZT3A 5LA6F 3VHRA 4LF9B 1FU7A 5DIZA 2VRNA 2JC3A 4DVJA 1MA0A 1JLLB 1MB2A 3Q8WA 3B8EA 4U63A 3FLBA 3AXTA 5HIIA 4B45A 1KK0A 5A9SB 2JAXA 2JKVA 3IOCA 1Q2UA 1PTJA 5HOEA 1YB2A 2PU5A 2XCOA 3LD9A 2Q6VA 5HGJA 1JEQB 4KWEA 5IW8A 4A8JA 4K6FA 4HEA1 2TYSB 5B7NA 5INTA 4YIKA 1ODFA 1YR6A 3M34A 4MIKA 3CQ9A 3GYGA 4JLWA 4EO9A 1VRWA 1ID8A 3B51X 2JH8A 1ZK1A 5EGNA 4NG4A 4KE9A 4OFBA 4DSZA 4MO9A 1NMZA 2VZ8A 3WBFA 3ZNQA 4YMVA 3WL3A 2P2DA 1RI3A 2ZJ5A 1OTYA 3G23A 4QQ8A 4WZ6A 4YRDA 5TC4A 5M29A 1RLTA 5CA0A 5JVDF 1NQUA 2QQ0A 3ZZ1A 2IU6A 4PCUA 1PEDA 2OCKA 3SLRA 5JYBA 3H1EA 1CUSA 1A04A 1GSIA 3KV1A 1I5OA 3NH9A 4B71A 1HH4A 4PZLA 3UC9A 2QVYX 4M55A 1U8YA 2FPWA 5F76A 3G0HA 1AUOA 2Y0EA 2XTMA 3RTCA 2XE7A 3D7MA 3JVVA 5CW1A 3TFWA 3UW1A 4BO5A 8AT1A 3KAQA 1K06A 1J9EA 3ESCA 3AIIA 2GK3A 2PL9A 5B6IA 1JKIA 2PBFA 1PE0A 4OAPA 5FA5A 4O2AA 2Q9AA 5F64A 3CX4A 5DCWA 4DARA 1G7CA 3JQBC 3Q7SA 4FVTA 3DCIA 3TTYA 1DXQA 1AGNA 2VJKA 2X14A 2H4YA 1TLLA 1G18A 3PHIA 3KR2A 4HZUB 4KN9S 4BEWA 3HLTA 1H6DA 2B4RO 4MVXA 1C81A 2WIKA 3ZJYA 1GD1O 3A6ZA 2V65A 2XNCA 2J9XB 4JJIA 1TM1E 5GOZA 4PSVA 1JEYA 3WIEA 1S7GA 3F8WA 4Z4EA 3NIGB 4IKEA 1T8TA 2E89A 4J16A 2GILA 1MX5A 3PDUA 2V55B 3A4YA 1T0BA 3ZYZA 1CR6A 3EFOA 3WMEA 2P9QA 4LTDA 5CFLA 4OI0A 1V4VA 1XTPA 3TO5A 4GOND 3TUZC 3NEJA 4GLOA 5EFZA 3JRWA 3KT8A 2VNSA 4HJRA 2CXXA 5KDLA 2B0CA 3EUFA 4FGKA 2RHJA 3OPYA 5LB4A 4DLUA 1W0JA 4UOEA 2DQZA 3EZXA 3SK0A 2VJDA 3NHKA 5LLSA 5U1PA 4LWPA 1PV4A 1OLXB 3M4XA 3M3DA 4D98A 2Y1WA 1ZUNB 3L6UA 1QAOA 1AC5A 3TZKA 2RSLA 3U2QA 1ZJYA 5TXGA 1GZ6A 4OSOA 4JITA 4X7RA 1ZGBA 3QF4A 2HM7A 2PK3A 4JLJA 4KK3A 2J9FA 4XUGB 2QRJA 4CM9A 2QL9A 3ZU3A 2PUTA 3OE5A 1DBQA 1IK6A 4IZIA 4IBOA 3AVUA 1SOVA 1XCPA 2QTVA 4V02A 4AN4A 2HQBA 4H1VA 3F6YA 4M8KA 4N3AA 4RD3A 4FM9A 3DAYA 4RLFA 3T3HA 2W2TA 1MD9A 2RGXA 2IYXA 3A7DA 2AR7A 5DGDA 5FO0A 2IC5A 1NQVA 3Q7PA 3VNBA 3EQZA 3B78A 3WG9A 4B3DA 1NBAA 3ICWA 3NIDB 1HT3A 1J8FA 4MDYA 1W88A 1W47A 3FXAA 4P93A 3B9PA 1UFOA 7MHTA 1QB8A 3NDBB 1VHQA 2EW2A 4F85A 1XRNA 5MGNA 4ITVA 2G9NA 5JEEA 3N2GB 2G82A 2ZI6A 1TFUA 2CYAA 3BGWA 3UT0A 2PTGA 2JBAA 3GLGA 3O4HA 4MW0A 2ZUCA 4Q0MA 4A91A 2VOEA 4KSCA 4Q4JA 1B15A 2JW5A 4LBZA 5L40A 3OIWA 5MF6A 3GLIA 1LUAA 1BEZA 1N7JA 5AW1A 3O95A 2BFPA 2JEZA 1OFVA 3QIVA 3ET4A 1IY0A 1MOSA 4P7FA 1L8QA 4WT7A 4EGJA 3AFGA 1EZ1A 5G4KB 1IXYA 2PMWB 3OIDA 3DULA 4UVDA 5BSTA 3LVRE 1SVSA 1HF3A 1C3VA 1OSNA 4ID9A 2EFCB 2PL3A 3LGAA 4J76A 1T25A 1VL2A 2O1EA 3B6EA 1EHYA 2COUA 3PC6A 2R6FA 4FZ3A 4QXQA 3OTIA 4U7PB 1L7XA 3S7ZA 1XZCA 1EFCA 4CM4A 4L02A 2WQZA 2GASA 2HMWA 3PDWA 4FS8A 4L07A 1GN8A 2CEAA 1DQNA 1XVIA 3AFOA 4FW8A 4Q03A 5DN6A 3SD7A 3IOYA 3UK2A 5J4LA 2YWCA 1A95A 3FPEA 2OBYA 3T4UA 3QA3E 2BTQB 4PYMA 1DKNA 1J2UA 1JLKA 2X23A 4D57A 4S0ZA 5K8VA 3L9WA 3U9LA 1D1QA 3S1SA 4K0RA 1YD7A 5HM8A 1U0TA 5TEVA 4C5AA 3THXB 1D07A 3E6AA 1QK4A 2GEFA 4ENTA 2VHVA 3IODA 4HHEA 4NV3A 1Y1LA 2NT3A 1Y7HA 3Q3VA 2CFSA 2GPBA 3TBFA 4ZOEA 3H11A 3K5WA 2FDRA 4N18A 1A3CA 2QVXX 4G41A 4PZ9A 3GJYA 2VHEA 1C0KA 3BBLA 3YASA 4BMCA 4PFSA 1RYEA 3VU9A 1C4XA 4EB6B 4L75A 4DJTA 4F4UA 1HEUA 1NXTA 3PI6A 2VHWA 3IUEA 4XEHA 1P75A 4H7JA 3RASA 2I71A 2NVWA 1WW3A 2H4XA 3CN7A 3DO8A 4CL0A 4QKQA 2XSZA 5E9WA 4ZXPA 3WMRA 4GPEA 4R2LA 1X92A 3G2PA 1KBOA 2JGRA 3RDPA 4WL0A 1K89A 3K32A 3TXXA 5E3HA 2YQ5A 1H8ED 2ATIA 1MIOA 3JATA 3OAAA 1ATZA 5LD2B 1F2UB 1QP0A 1MAVA 3EGWA 1AHNA 3GGOA 1ZD5A 4TUYB 4Y18A 5HG0A 3S28A 4HG2A 4EBBA 2PS9A 4O8ZA 5C8XA 1MJGM 2AQKA 2OGZA 4IIFA 2Z83A 5GJCA 3U3OA 3ZK8A 3L77A 2CB9A 1A72A 4IVQA 3U1BA 5ALZA 3DMHA 1XEAA 2GN4A 2ODAA 2R96A 2HA3A 3QVLA 1IE3A 3MJDA 3P26A 4FFBB 4EHJA 3ICCA 1JFLA 4ZO8A 1S96A 1GAEO 1NG9A 2AJ8A 2CN1A 2XNDD 3ZGVA 2P6RA 1RCUA 1Y1TA 1YA4A 3ASYA 2XE8A 1HLGA 1ACLA 2RD2A 2H7XA 1KY2A 2ATEA 2FSUA 1QZXA 3DFKA 3BL6A 5JCZA 1E2JA 1TJ3A 3NRBA 2JATA 3U3XA 3KTFA 5F2EA 1JDVA 2BJWA 3IUSA 3EIUA 4NKRA 4C5CA 2WG0A 2PD4A 2QXYA 1YR2A 3BEDA 2OKCA 4GSKA 1B2RA 2VWPA 3P45A 5E0KB 1XZAA 5FTKA 1PCXA 1ZIDA 3VR4D 2A0XA 1MN6A 5EHIA 1M8KA 2JK1A 1IZ8A 4Y9SA 4XWOA 1EIWA 2C9OA 4EY6A 1H05A 1ZG3A 1ORWA 3JYQA 1GAWA 4J3NA 3ZR4B 1LSUA 5JSHA 1LCIA 3DNPA 2V3WA 2NU7B 5JS7A 2Y77A 4PG6A 3QJYA 4C0SA 2NQ2C 1AXEA 2VSOA 3GCXA 4PLVA 4ZVNA 2EYUA 4E4RA 1BMQA 3PGJA 3LFHA 4PLPA 1ODLA 5FULA 3IKLA 1M2OB 1JZQA 4HAUA 1Y6GA 4CFSA 1P44A 1OLUB 3VPBA 3DZ8A 5AOAA 2AXEA 3KXLA 1NUHA 1XDDA 2AFVA 2YWEA 5LCXA 3VR6A 3ND6A 2NU9A 4FBGA 4AJNA 3RUDA 4EG3A 3CRQA 1MAHA 3EUWA 3M4JA 4UTXA 1R9JA 4JQZA 1I36A 4I5DA 4I1OA 5JRJA 4NYMQ 2IGTA 3OZXA 4C5BA 3TR6A 3UXHA 1ORHA 5JH7A 1CFZA 3H5OA 2JLQA 1FXWF 1E3SA 3ITNA 1H94A 4B84A 3UBMA 2ZSIA 3IXMA 1QE5A 2I78A 4G1EB 1L7OA 3HJTA 2PNFA 3JW8A 4I50B 5LBTA 5AW6A 3KHSA 4ZVSA 3UT6A 2RH8A 2VNAA 4FHEA 3FGOA 1IOZA 3RUPA 3TDKA 1I4WA 1F20A 4HNQA 3LC0A 3U7IA 4AKGA 5I8ZA 2I3DA 3EZNA 1TJ5A 2FXVA 4YJ2F 4ME6A 1AD2A 3D3WB 2AN1A 2NP7A 4S1NA 2AIRA 2D5AA 3HCCA 3QVGB 2H52A 1RAFA 3CNOA 5AICA 4DGQA 1GU0A 3ETNA 2MYUA 3H75A 1ZD3A 1ZU5A 2ZRJA 3WYBA 1QLJA 2IYSA 1ZD4A 3R0XA 2VNJA 4I66A 1PL0A 1ZUD1 5HRUA 5A5GA 4ZCPA 3OZIA 1DDOA 2C31A 4C3VA 4CKYA 4EI8A 4LHWA 1W59A 2WW8A 4CCSA 3WLJA 4JQSA 1SCDA 3K8YA 2IF0A 2OFPA 1K6IA 1H3FA 5EE5B 1KTVA 3DV9A 4LOLA 4YRQA 3KKQA 1QFSA 4YYZA 3EGEA 2QQFA 4IQFA 4JI7B 1WZ2A 2Y93A 1UMKA 4CM7A 1RMQA 3VNRA 3IXQA 3PTLA 3ZCVA 3AUKA 5B1DA 1ETUA 4RJJA 1BDIA 2DQYA 1L8LA 3LQ2A 5BT8A 5BWNA 1FX1A 4YGXB 1WJGA 1ZK0A 3PG5A 2YJ3A 3T3OA 1U5BB 4E30A 3SHOA 5CT6A 4O3MA 2C95A 3FX2A 4Q3BA 4QECA 1SWVA 2OHFA 3ZHZA 1SOUA 1KFBB 1DNPA 1NXQA 2ID8A 4L0QA 3DFIA 3ENWA 4P35A 1ENOA 1D2HA 3LSYA 3UPDA 1JHPA 1I3CA 1JFRA 1M10A 1R0LA 1ZOLA 3G8CA 3ZE1B 1FFSA 3IBTA 1QRUA 5H70A 2GERA 2IXFA 4U2CA 2E4WA 4DUZB 1YBHA 3P2OA 1WF3A 2AD1A 1CZKA 5LXTB 1UBSB 5AT1A 1IU9A 4EP1A 1LRKA 1NM5A 1FFCA 3DOIA 5DASA 3PHLA 4N5HX 1GOTA 2IBMA 1T4BA 3IR7A 4BKRA 1Z8HA 3GLVA 1ZNZA 3EIFA 1MIHA 4PG7A 2QUBA 1N6NA 4V2UA 5EVCA 2ZYDA 1AZSC 3AG6A 4MINA 4RM3A 4WRRA 2C5HA 3A3NA 3CZ5A 1U7XA 5AIBA 2CVFA 2EERA 3AR6A 4Q9NA 1ABFA 4NVRA 1FLNA 2Q21A 4URUR 1U2DA 5D3QA 1DFGA 5KSZA 4KOAA 1ENZA 4W7SA 2WIBA 4U9IS 2JGNA 5FLXA 2BBWA 2B98A 1ZJZA 4ABTA 2Z4SA 3NXKA 1MX9A 3IV7A 2QRUA 3LC2O 2XRZA 2EL9A 4BN0A 1U8TA 2RGDA 3H9BA 4BVKA 4LHVA 2ONCA 1R1DA 2WWIA 1KNQA 4OP3A 3ER9A 1U8XX 2E7ZA 4UVGA 5HUHA 1WXWA 3U7FB 3AB7A 4O2BA 2VLIA 1LLQA 2EBWA 4KRYA 1RJWA 1T5OA 5IYZA 5C52B 4BN5A 3C8MA 3QV2A 4I3FA 4IH4A 2UUPA 3TAUA 5FV7A 1QRTA 2LTAA 5BR1A 2GTPA 1L8XA 3PNYA 3RVRA 1QMPA 2ZZNA 4BJ6A 3LY5A 2UZ1A 1J0AA 4I55A 4HVTA 2Q7OE 5AI5A 3WGHA 4DVGA 3KHTA 5C1BA 2FE4A 3LT4A 1O03A 4MW2A 2Q5CA 2C3UA 2NSLA 5CLQA 1H9BA 1R8XA 1RJ9B 4FTWA 4G01B 1JHVA 5DNAA 4LF4B 3KXIA 2HDNB 2K2QB 2Y1FA 5KVVA 5J3JA 2Z30A 4PONA 1GPNA 5JD6A 1SCUB 4F0JA 2QPAA 5L3RA 3D8HA 1ESEA 3DOFA 4K6MA 1G5QA 4UVEA 2CJXA 1SQFA 1XRSB 3GV0A 3L4EA 4ZDWA 4DLAA 1YASA 4QU5A 3F3KA 1LBQA 4KAFA 2FV8A 5IEBA 4P34A 4X85A 5DK6A 1N2SA 1SOMA 3BE8A 3ZLBA 2X2EA 3LA6A 3PQ4A 1U3WA 3DCYA 2AWNA 1XP5A 4RGQA 3ENKA 1WP4A 1Y0BA 4OHYA 1P4RA 4NENB 4EQ6B 2H7YA 2Z9DA 5FNVF 3RBAA 5HDQA 1RWMA 1N6LA 2COEA 2W43A 3ZLUA 4KJZA 3FD8A 1GEGA 3OP1A 1TJ4A 4TWIA 4BEVA 4ZYTA 3GRPA 1PWXA 5FHRA 3KQHA 1VA5A 3E70C 2HU8A 1NJ6A 3D6UA 3ZHVA 2IYQA 3TVYA 5JUWA 1BIFA 1RRFA 2R86A 4P86A 4B2YA 5HGXA 5IT9A 1I94B 4MDEA 2XVXA 3OEHA 2Q2QA 2ZVQX 4YJKA 1D0SA 3G0CA 3DAFA 2QLBA 1R0BA 3LHSA 2V7BA 3O94A 2B20A 3BSYA 4ZIRB 1JA1A 2B94A 3EVNA 3GEGA 3WDKA 3K6SA 3VH3A 4CKWA 3HXPA 3KOUA 1DXOA 4J8PA 4LJYA 3VU1A 4D4IA 2FCAA 1IHUA 2JVJA 4MQBA 4CM5A 4N54A 1Q0ZA 3K0CA 4YAIA 1Q17A 2JFOA 1B42A 1T9KA 1TU4A 2R7LA 1SU8A 2PYIA 2TRSB 2UV8A 3N7TA 3TNJA 3HJRA 2FPRA 1U2GA 3JQRA 2Q07A 3KALA 4MX8A 4B75A 4GECA 2XITA 5TIIA 4GE0A 1WB6A 2I91A 1Z7WA 5YASA 3QHQA 5SYMA 2RIPA 1F8FA 4Q3OA 1IOLA 1ZGAA 2YINC 3R0JA 4HY3A 3E3NA 3NCTA 4ND8B 4AY4A 3WDLA 2QR3A 1BDHA 1T43A 4KO1S 5F78A 1MRZA 4A36A 3D5QA 1QYDA 3MOSA 4Q7QA 1ID1A 4II2A 5SY6A 2YHAA 5TPWA 3EXIB 4BKMA 3CVOA 1E7WA 5EC8A 2IH4A 3QBVA 4OXKA 4B73A 3ABOB 5JALA 1CYEA 2C8VA 3EZ6A 1Q3TA 1SKBA 3EQ9A 1U9CA 2FLWA 1RXCA 2QLFA 5DJ5A 2QR5A 2B1IA 3JYLA 3CXUA 3BZWA 1CK4A 4K9KA 1CD5A 2WJYA 1C1YA 4DL9A 4EITA 1I2DA 3LM8A 1Y1RA 2V3VA 1ENPA 3FUWA 4QYIA 3NBKA 3DB1A 4NBNA 5DB4A 3RS9A 1GR0A 2FZLA 2VRCD 2MYTA 3TXAA 5KSPA 3HJAA 3WL7A 1CJUC 2QDXA 2QX8A 1DU4A 4MQ5A 3ZHSA 2EFYA 4OXIA 5JNVA 1YCGA 1HV8A 1G64A 1KO1A 4GX2A 5FHQA 5C8DA 1S0UA 1Z75A 1DKUA 1TVKB 5K0LA 2YHIB 3D3JA 3I58A 2IZ7A 4MJLA 4U5XA 3B3JA 2DPYA 5IBRA 3TX6A 1WUJS 4FFOA 3WRXA 1GT91 4BX9A 1I13A 4UMFA 4CI0B 1A50B 2R25B 2YN4A 4GO1A 3QYPA 3UXEA 2Y3IA 4OQZA 3MT9A 5DGIA 2TS1A 4LYGA 3RJ9A 2JVKA 2R62A 1C3OB 3K9LA 1ZA2A 1NQXA 4DA4A 1SKMA 1D2NA 1FNMA 5I3ZA 4JL5A 2IXBA 3MXTA 5LIRA 1A9OA 4OD0A 4P4LA 1G38A 2IITA 4RV4A 1GCGA 1WBJB 3LHFA 3GELA 3H1PA 3IJ5A 4RJLA 5JDCC 1NAHA 1RIIA 1U7UA 1V8BA 4DJAA 3IDOA 1EGHA 3DD1A 6NULA 1BH6A 2Z2KA 1JLSA 4A73A 1BU5A 4TQUS 1STOA 4RF3A 3WISA 4JR2A 2OAEA 4ONEA 4M2LA 5AJWA 10MHA 4EA6A 2H1IA 3TAXA 4ND4A 4WOCA 1NBMA 1ZUHA 4NDZA 3SIXA 3A26A 4L8YA 4R1QA 4QEDA 4Z7JA 3ELDA 5ECDA 1RHQA 4M1ZA 3VAAA 2ZU6A 1RFGE 3E7DA 3TTUA 3WIOA 3GLFE 3OPMA 3HBFA 2Y27A 4HXYA 4IDNA 4D8TA 3M1IA 4WOJA 3AERA 1WD5A 1NC3A 2M6SA 1JDBC 4J0QA 1QRSA 5F21A 3VNVA 4JC5A 3FCAA 4GC9A 4IDGA 2VEDA 4HXEB 1K92A 3GCZA 4G86A 4FGLA 2ODPA 1DUIA 2IYWA 3W34A 5GADl 2YYYA 2ACWA 2ZCUA 4ABYA 1JKFA 3HN7A 3FPSA 2I6SA 3FTFA 1Q1QA 4XD7D 4RPCA 2HU7A 3L79A 1XZPA 2HA0A 3TW0A 4B9EA 1V6SA 2WNSA 2HMTA 4BIMA 2HJRA 4ARCA 4KAJA 3UIEA 4BFVA 1X7YB 2DFDA 4M86A 2O8BB 1NZJA 2Y99A 4RNDB 3FUCA 3GHHA 1VL8A 1YS7A 4OXQA 3FSJX 1PT9A 2C9CA 4LHEA 3OTGA 3UJBA 1UUFA 1YB5A 4UCFA 3N6XA 5MFZA 3FDZB 4PYIA 3WWZA 4BX8A 2JLWA 1U0FA 3V1MA 3OKAA 5DOVA 1E2GA 3D8RA 3EFHA 2QNIA 4DA6A 4D9EA 3R7BA 4JQYA 1IBSA 1SK8A 3HBLA 4M8NE 2OCPA 7GPBA 4DZTA 2BUCA 3X1YA 3EGVA 4OQFA 5F51A 3K9WA 1GL3A 4BPRA 1YQGA 1YS1X 5DTRA 3L8EA 4HDSA 5CK4A 2H2WA 4CIBA 3D4LA 2ZBFA 4MTLA 4RORA 1JG7A 2BMJA 1UJBA 3NQ41 2FW0A 4DLTA 3K5PA 1Z0SA 3KOWA 3IQDB 4IGKA 3H1AA 3M7IA 3QQPA 3GROA 5CCDA 3VR0A 5BVGB 2Q3EA 2GYUA 2WPDA 3KJNA 2HLNA 3KOOA 2HJVA 4IJMA 4C0JA 3H99A 4BP8A 1PYGA 4L5CA 4ZU1X 5JADA 4EJSA 1A77A 2P65A 3DEYX 2VHXA 3OT1A 4MB2A 4EG4A 5HOQA 2D2EA 5SYAA 1L5HA 3V1YA 4B2LA 1T5TA 1DO2A 3VUEA 3D3NA 2XCLA 3CMMA 1ZEJA 1NW5A 2J3LA 4Y6LA 2DFVA 4HN2A 5CVUA 1QZZA 2Q5EA 3OLQA 4F7WA 3I23A 3BWXA 4LRTB 1ICEA 3RSQA 2VNKA 2C97A 3K9NA 1UKCA 3QG1A 3GLTA 1BWRA 4YACA 3VR5D 3L4KA 4A23A 3AO0B 2R1TB 3VO1A 3NC4A 1T5SA 4COKA 3R09A 4ILKA 1N5KA 1U0HC 3NANA 2FOLA 3CZAA 4B4OA 3IDAA 3CVYA 3REQB 2UZIR 5C35A 1WUTA 3CX8A 4IW3B 4PYQA 2J6IA 2F48A 1KI3A 5ITSA 3P0FA 4FWTA 1P61B 3FCXA 3I2GA 5HKBA 2J7KA 4C30A 3IQWA 3QK7A 1CP2A 1T5LA 4CDNA 1G5RA 1V26A 5DOZA 3OF2A 1IOVA 4HMPA 4JYBA 1NVWQ 4L2IB 4OATA 5TDHA 1XROA 1YAJA 2Q6IA 3PX2A 4HTFA 2R00C 4KVAA 3V8BA 4OSEA 1M6VB 3WB2A 3WGTA 2AUNA 1HEYA 4BFYA 5DXJA 1BDBA 1E3WB 3AEXA 4GNKA 2X5OA 1RQRA 4P0TA 2B9EA 2NTVA 3AESA 4JH0A 4K9DA 3ZUPA 4RFSB 1UOOA 1F2TA 2EXXA 4UEJA 4NPHA 2YKGA 2R6R1 5IDXA 1IEWA 4DLRA 5JARA 2OMKA 3ANNA 2PZEA 1OWPA 4LI0A 1KJJA 4AN0A 3A37A 1IZ0A 3IPLA 3WYEA 1VPLA 5K4GA 2QT9A 4LEIA 2RJ3A 3JQGA 3CW8X 2NPOA 3BTOA 3M49A 3WC4A 1KI6A 4NZMA 2KLBA 4KU4A 1J1ZA 4AC9A 1BNCA 3HB9A 3I4LA 1WUKS 4CF7A 2BFOA 4OLHA 4NHEA 3TCKA 1C29B 1U02A 1WMFA 2J8ZA 5D2CA 2Q2OA 2ZTLA 4FFNA 1XDBA 1XN1A 5SZIA 3U4CA 3SX4A 4RWZA 2Z2XA 2RGRA 3DZJA 5CB4F 1FFGA 2VDWA 1MO6A 5AJHA 2RH9B 3LUHA 2MSNA 4QYWA 1GZ4A 1O5OA 1P1IA 1X3SA 1Z5VA 1R9MA 1QQBA 2PX2A 3AGQA 2W42A 1V5IA 4X6LA 1ZOOA 3OZFA 6YASA 2J46A 5FPQA 1XNRB 1RWWA 2AMFA 4FEAA 4GGOA 4Q05A 1ZD9A 1J97A 4ARUA 4D9MA 4NBKA 5IM5A 4CL3A 1T0UA 3PHCA 2C3OA 4BE4A 1UT5A 2J87A 4KL8S 3T1QA 3PUIA 5C8VA 1IMJA 3LO5A 3IBGA 4MQEB 1ELOA 2JAHA 5ERYA 4V1CI 4N48A 2G9UA 1DPFA 3DNFA 3IHKA 3TKYA 1YFZA 2B8JA 1W4RA 4A2CA 2ZS7A 4NIMA 3RU2A 1QF7A 1GUFA 2ODWA 4W5QA 3MD9A 3S99A 1AMUA 4TWJA 5MFPA 3MAAC 1P4AA 1FLVA 4GPD1 2I66A 1QHXA 3EC2A 2QDKA 3P32A 5JLJA 4TZ0A 2Q3CA 2D00A 1QF6A 1Y5LA 3AXSA 5AP9A 4X20B 2FEXA 3ZHCA 4IWNA 2PUEA 1UMDB 2Y76A 4HPWA 2MR5A 1OIWA 2IBSA 3D8UA 3R44A 1QU3A 3DZGA 1H5QA 4FW9A 2QA5A 4E1BA 3F67A 4ZAXA 3KJEA 2X4GA 1FNSA 2FPUA 4MKFA 4RZ2A 4JP2A 2VWHA 2VP0A 4GS5A 4QREA 2Z5LA 4R05A 4V2IA 3DCJA 1TRHA 2BGNA 4YRLA 2ISQA 5AI6A 4NY1A 2WILA 1O94A 4DSTA 4E51A 4TKVB 5HTOA 1N2OA 1JLMA 3DVAB 3ZZNA 5KVSA 4O5AA 3R8CA 3DDHA 5EWLA 2G67A 1L7AA 3QVSA 2FMTA 3PITA 4KRFA 1PI3A 2Z6QA 4D26A 1E6KA 2IQIA 2YS7A 5F3DA 2XGGA 3RVPA 4O4IF 2CDCA 4B47A 5KOIA 3CNEA 2FSHA 4KDRA 1YHZA 1FXUA 2W6JD 3VSEA 1IHYA 1YGYA 4QXOA 4DEVA 1DHRA 1NMQA 1TI7A 4CUZA 4XIGS 2BHLA 2XDWA 1XALA 3BSSA 1SR8A 4JQCA 2ZCJA 3U61B 1QS0A 5I4CA 1LH0A 1NF2A 2I6XA 5KVQA 4ERXA 2GBPA 3LBIA 3VKVA 4G1UC 1QRDA 2NQTA 2P4QA 5KX5B 3T5AA 2NPIA 1V25A 2W6CX 2DZDA 3V7WA 1H5UA 3LUKA 3CJQA 4JBWA 3A9SA 3SEFA 2Q2NA 1K4MA 1H6CA 2P62A 2D0OB 2CXNA 2G9VA 3AY7A 1N0WA 4BQRA 4DCNA 3QUQA 3ZIDA 4C1BA 1SXJB 1IY8A 4KTVE 3U49A 5JAOA 3DV0B 5KOHB 4R3UC 1GFIA 3U7QA 3FNRA 4LQDA 3ENZA 4IIVA 3BSFA 2HT1A 1VQ1A 2ILTA 2VP4A 4UAGA 1B74A 3COSA 4H60A 4HNRA 4EBFA 3A6DA 2QZZA 2XCTB 2PD3A 2YTZA 5AXBA 1YUBA 4BUZA 1NUPA 3ZXXA 4BNZA 2WRZA 3IQGX 3PX3A 4D3YA 4TMWA 3TNYA 4E5SA 1DTSA 5DYTA 2NNLD 4LY3A 4TN1A 2WT9A 3RKSA 1OAAA 4PTYA 1UC4B 4YONB 4QDKA 4GLFA 2JLVA 1QYVA 1MVNA 2X9QA 1TJYA 2Q5IA 1OU4A 1BS2A 2NLOA 3D0QA 4R0NA 1G2PA 4ZXFA 4KRGA 2B5VA 3LLSA 1J6UA 2CNNA 5J63A 1OW3B 4KSBA 1LWNA 3BCHA 3JYNA 1RC0A 3OZEA 4LX0A 1Z12A 3ZWVA 1Z6QA 3QKWA 2RI0A 1MX3A 3E9QA 5CCBA 5I4IA 4HXFB 3B2NA 3GDWA 3EZLA 1XAJA 2VSFA 1G6Q1 2QZSA 4IOMA 2C0CA 3TX2A