4Q4HB

Tm287/288 in its apo state
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
583
structure length
583
Chain Sequence
GPILEKPALKNPTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEKDDPDAVELREVRGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter
publication title Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/transport protein
total genus 216
structure length 583
sequence length 583
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
B PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 4q4hB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q4hB02
2AK2A 3EW9A 1CXZA 5FFMA 2GRJA 2B8TA 1W0KA 1EX6A 4B74A 1G16A 5J4KA 4QNRA 1AZTA 2FZ4A 4NYMR 1IN8A 1W2GA 5FL7D 5H1YA 2ZU0C 1U8YA 3VQTA 5FBRB 1R8QA 3AVYA 5CITA 4UNQA 1YRAA 2ZRCA 1UF9A 2HV8A 4KFRA 4L15A 4P33A 3PXGA 2ORVA 3A1WA 1OW3B 1G17A 4W9MC 1M7GA 2G6BA 5EUMA 4PQYA 4YXWD 3K1JA 4TL9A 3RSOA 1G21E 1KHTA 4JJKA 1OXUA 3GJ6A 1XD2B 3X1DA 1G7RA 3LW7A 5CYPA 2ODBA 4Q9HA 3X1WA 4DEXA 2QAGB 2Z6VA 1OXVA 2YOFA 3IKJA 3QOFA 4HAYA 2ATVA 3EZ7A 3TK1A 2Z5FA 4PHGA 4M21A 1M1YE 3EARA 3FFAA 1S8FA 2FNAA 2J0UB 3B1ZA 4NYIQ 5SZIA 4QKQA 4ZIRB 5JZVA 1Z5ZA 4V0ME 1ZM9A 4FMDB 2R65A 4TQ9A 1WBDA 1RRFA 3GLIA 3TW8B 4MYHA 4GOJA 2V9PA 5AUNB 4KLZA 5EP4A 3L82B 4B76A 4EQ6A 4BEJA 1ZNYA 2QORA 4FW9A 1CLUA 2H1LA 4UXHA 4V0MA 2KBFA 1NMXA 2B7CA 3VU9A 2B7BA 4F93B 3RNLA 2V1XA 2IHBA 2QE7D 1W47A 1R4AA 4YXWA 2NQ2C 1UM8A 1YQTA 1UBCA 2EW1A 3A4NA 4ACBA 1XTIA 1E98A 2C78A 4BLSA 3UANA 2XTNA 3QPVA 1GZSA 4JT4A 4YLGA 1E9CA 2ECKA 2VQSA 3PUXA 2ZJ2A 4TTRA 3WY9A 5FL3A 1FUKA 2MMCA 1PJRA 2J5XA 1E0KA 5KOYA 2CLCX 1G8PA 5FBQB 2QI9C 2BM0A 1KAGA 1OH8A 2WBLC 4TQAA 4PXAA 3PEVA 3EIHA 2BBTA 4XWAA 2FH5B 3LXXA 2AWNA 3WMEA 2BBSA 3ADKA 5CJ2A 4AYWA 3AP2A 5JEEA 1XXHB 4AWXA 3RS3A 1N6RA 1RZ3A 1W1WA 2FSHA 3BWDD 5FOWA 5F3WB 3NIBA 1Q12A 3C41J 3BB4A 1XD2A 2QP4A 1CF4A 1U81A 3CF2A 3CR8A 3B1WA 2JAQA 5JEDA 1Z22A 1UFQA 3V00A 2OBMA 1VMAA 2IXEA 3NH9A 2D3WA 2QAGA 1MR3F 3LWNA 4DKXA 2A7QA 2OAQ1 1OHHD 4JL8A 1GDDA 2RGNA 2QE7A 2VEDA 1NSTA 4J0QA 4TQUS 1YVDA 4E22A 5JJKA 2HYDA 1Z8FA 3HU2A 2F9MA 4MKFA 2J0UA 1GILA 3VKWA 5KPJA 3MWKA 4ZIRA 5AUOB 2V6IA 4NP6A 2BEJA 4ITRC 1VYTA 5E7JA 4ILEA 2OFOA 4YMVA 1DELA 4RD6A 1KDPA 1G7TA 1M6NA 1ODFA 4JLPA 2NPIA 2OUKA 4LYHA 1KJZA 2BC9A 2VYFA 1UBEA 4OHVA 1E79D 1UPTA 1XMIA 3NC1C 2CK3D 1IN5A 5JS7A 1E2KA 1MH1A 2YOGA 1P5ZB 2ZRKA 3BBPA 4C2TA 4DZZA 3GJ8A 1LF0A 2GESA 4PO9A 3ETLA 3SU8A 2Z4SA 1J8YF 1E2PA 2W2VA 3W90A 2RGCA 1QDEA 3NEJA 5KDLA 4B6EA 5L3SB 3NHAA 3VMFA 2I1VB 3DOEA 4ZI3A 3VNVA 1FNNA 1R0WA 1NY6A 3TR5A 1JB1A 3JZAA 4OKSA 2WTUA 4JYCA 4KBGA 1KK3A 2FPMA 2W2XA 3U3JA 1SXJA 3UATA 1OHHA 3ZJYA 3KKQA 4M22A 4DT1A 5HTKA 2BDTA 521PA 4JL6A 4BZXA 2A9KA 1T8TA 2O0JA 4GBMA 3AVOA 4M1OA 2WJGA 1EFUA 1XXHA 2E1RA 3OESA 1FFHA 2ODEA 1X1RA 2J41A 3TGPA 4Q4AB 1P73A 4ABYA 2QUZA 3UWOA 2ZPTX 4OK3A 4TYYA 5JECA 1QF9A 2DYKA 1CJVC 2OAP1 2QQEA 5JRZA 1KIMA 4NBSA 3MJRA 1NL3A 2BMEA 3GFPA 1W4BA 1EXMA 3QKSB 1E79A 1YR8A 1HV8A 2CK3A 2K5UA 4B3CA 1MO4A 4POAA 3X1YA 5BW8A 2JCSA 5FH9A 2NPFA 1E9FA 1ZIPA 4LSGA 1CJTC 2QY9A 4GOKA 4R98A 2CVHA 4HDOB 4EPTA 2BJWA 3CUEF 1BIFA 2MSDB 5KHOC 1RRCA 4IOMA 1KI3A 5EE3A 2TMKA 4EFMA 1I2DA 3MJHA 3AKCA 1G19A 4OQNA 4A2WA 1AGPA 3AVXA 3EPHA 1KI4A 2RGEA 4PC6A 4QBIA 1U9IC 4BLOA 4NPHA 5CLQA 3KQUA 3R8FA 2AL7A 4KYUA 3I73A 2ZYTX 1GVNB 8OHMA 3ZVMA 1A5TA 4M2LA 2D74A 5L3SA 4LI0A 4NCHA 1MO6A 4DC9A 3LO5A 2GETA 2XEXA 5BN5A 1SGWA 2RGDA 1OF1A 5BQ5A 2IUUA 3DEFA 5C4GB 1N6IA 1F48A 2O0HA 1ZU5A 5ELXA 2ZI7A 1VCNA 4FCVA 3KKMA 1X8JA 2ANBA 1R0ZA 4RD4A 4CW7A 1E2GA 1I4LD 3SQXA 5FOSA 2YKGA 4Q7LA 1IHUA 2IEZA 3ADBA 4QBGB 1DO0A 4Q4AA 1ZMXA 1NN3A 4ACAA 4G5SA 1CR1A 4A8JC 2Z83A 1G6HA 3DO6A 2C8VA 3KUCA 4ZDWA 2AKYA 4C0JA 1YHNA 4RKFA 3EXAA 3RDPA 1NNEA 3U3KA 4X8MA 2EFHB 3CRQA 3C15C 2VA8A 3QKSA 3BOSA 1W46A 4D82A 1U2RA 2BEKA 3JVUA 3TJZA 2OZEA 4N3NA 2V1UA 3T1OA 5JBQA 4PZYA 4LYJA 2ZRFA 2FJUA 1YR7A 2BMJA 1E2HA 4QJ4A 3CWQA 2IK8A 2GHIA 1GKIA 3KQKA 4ZCLA 1U0JA 2QMHA 1I4TD 1LTQA 4PC2A 1EWQA 1R10A 5CYOA 3WMFA 1VG0B 2GXAA 1NLFA 3U4QB 4G0NA 2ZRNA 1E9EA 1Z83A 4QL3A 4U5XA 4DSTA 4TMKA 1KSFX 3PFIA 2HCBA 3HDTA 3L0IB 3PUVA 2RH5A 1E99A 2AFHE 2YC4C 4OQXA 2D7DA 4MRSA 1Z28A 4TYPA 4Q21A 1KI8A 1F2TB 1S3GA 4DVGA 4XWOA 3CRVA 3QBVA 3B5JA 1D5CA 4B34A 1OYWA 1KO7A 4URUR 3SS8A 4JLOA 1P72A 1L4UA 4BLRA 1GRNA 1XJQA 2VHQA 2YWGA 4AIIA 4I4LA 3U7GA 2GXQA 4G5GA 3KB1A 4HI0E 4A2QA 4JBXA 2KJQA 1BYUA 1NY5A 2C95A 3PVSA 1TNDA 1L2TA 3I5XA 2P5SA 2RGBA 3SOPA 5LDDC 1JPJA 1CP2A 1FP6A 1SZPA 3CBQA 3IQXA 3I92A 2O52A 3P27A 1XDBA 3ADDA 5DYGA 1XD9A 1GG2A 3B9QA 4AKEA 4BFTA 1J8MF 4L5BA 4B32A 2O8FB 2AN9A 1IY2A 3W34A 1GKUB 4W7SA 1U8AA 4NCIA 3N70A 2FZLA 4FMCB 3AF3A 2W6JD 1XTKA 2FEOA 4P3YA 5TVKA 4MDEA 3Q5EA 3FOZA 1XPRA 1FOEB 2ZAOA 4QBFA 3KXLA 1DAIA 2XX3A 1N0VC 2P0EA 3OE7D 1JXMA 2OFWA 3AH8A 1N6HA 1KSGA 1O87A 4R2HA 1UBFA 3R20A 3OIUA 4D4LA 2VSFA 2IYWA 3AKDA 4ASUD 4CDGA 3U4QA 2QTHA 2XTMA 1DO2A 2Q3MA 2NZ8A 3NDPA 4C0AC 1Z2CA 5IHPA 2HXSA 4B3GA 3QQ5A 3PCRB 5GJVC 3CO5A 2ZI5A 4LZZA 3ND9A 4IW3B 4BZQA 3ZS8A 1RVDA 1P9RA 4IVQA 3J81k 1KO4A 1Y3AA 3WBKA 3QF7A 2G1JA 3W3AA 421PA 1F2TA 3H86A 4LV5B 3QY0A 1DAGA 3WYAA 2BKEA 3EZFA 2JJ1D 4ZCMA 3VR1A 2ONJA 2Z4RA 1Z6GA 2DHRA 1XF9A 1CKEA 1KSHA 2W6JA 1UBGA 2GILA 2QPTA 4KI0A 4P4SB 3CPJB 4QC2A 1DS6A 2IL1A 2OILA 1HYQA 3EZ6A 5J4LA 2JLZA 2NG1A 4GL2A 3OE7A 4B2PA 3LNCA 1RYFA 1T91A 3MWLA 3ASZA 3OIVA 821PA 1S3SA 2ZSFA 4BLTA 1FTNA 3F3YA 2ZI3A 4HZUA 4ASUA 1NRJB 3OEED 2XB2A 2OBLA 1X6VA 1JEDA 3PENA 3I1FA 2RGNC 1YZNA 4JYBA 2O8FA 2CEAA 3GJ4A 2C96A 5DSZA 1G6OA 4C7OB 1LY1A 5GVSA 1ZAKA 4IHQA 5FI0B 3SZRA 2IYTA 2Y8EA 1HURA 1E9DA 4RD3A 1SVLA 2WJIA 3U3OA 4ARZB 2EFGA 3NVAA 5DHFA 4DSOA 4Q7KA 2JJ1A 3ZD7A 5JRJA 4D4KA 1KI1A 4JZKA 5F98A 1CU1A 4NONA 4DUGD 2WJJA 3BH7A 3Q72A 4NZYA 1G3IA 1OIVA 4TYQA 4DSUA 2ZRJA 4YC7A 4MKIA 2PJRA 2YVUA 2YV5A 1P3JA 3CM0A 3KXKA 3VKGA 4V0KA 4PAQA 2ZRPA 5FPSA 2XSZD 2O8EB 2J46A 4PX9A 2LCFA 1EG7A 3KQLA 4MGZR 1Z0IA 4M53A 4ESHA 3I8XA 2ASEA 3TSOA 1IAQA 1RIFA 1XTJA 1L7VC 2H7VA 2GXSA 3LY5A 2PZGA 1EX7A 4IOJA 2ORIA 4JKIA 4BPBA 1MABA 3DZDA 3B1VA 4PQRA 1SXJC 3GMTA 5L3RA 1YRBA 1W44A 3EC2A 2V55B 3KDSE 4IEIA 3K09C 2IYUA 4DDVA 2ZR7A 3KQHA 1QHHB 3H4MA 2WICA 3WNBA 4HUQB 1NN1A 5FUWA 4P4SA 1B23P 2FG5A 3U3RA 4LC1A 1DE0A 4DLTA 4MKGA 4U7DA 4DCVA 4MYUA 2DFTA 3HP1A 4JBYA 1ZC4A 3ZVRA 2QAJA 4URXR 4A8JB 5E95A 3RWOA 2VLIA 2QQ0A 3PUYA 1KO5A 2F3TA 4ZPXA 4DUGA 3LFUA 1ZM7A 4I1SA 1FMLA 2WKQA 3TE6A 4OI0A 3RC3A 3PG5A 4FD2A 1NBMD 2GEUA 4Q1BA 5IRCD 5DHAA 4C7OA 5KNBA 1I2MA 2XSZA 3D8BA 5JFGA 1A82A 3EA0A 4HSEA 1Z0JA 3AKEA 2IYLD 4LHYA 4MITA 5AWFC 2NGRA 2LKCA 1JR3E 2ZUDA 2DWQA 4ARZA 2RGAA 2BBOA 3AP1A 4TSFD 2PLRA 1IY1A 2OT3B 3BS4A 3SE0A 1TMKA 1ZM4A 2PT7A 3OEHD 4O25A 1FQKA 3NBFA 1FX0B 3FMFA 4IXMA 3WRYC 1N2CE 1HH4A 1U9IA 3QEJA 5FTNA 2CE7A 2CL6X 4RZ3A 3TBKA 2WHXA 3W6PA 4HB4A 3RS7A 3GPLA 3SYKA 3P20A 3AVTA 4PAOA 2ZYVX 2DWPA 2Z43A 3TNFA 4HATA 4B48A 3A4MA 4LOAA 4URYR 1ZNZA 2UZ3A 1QHIA 2GAAA 1WCV1 1AN0A 2KSQA 4LHZA 2R6AA 5GADl 1OH6A 3M1IA 1C4OA 2KWIA 3ND8A 4Q1EA 1NVVQ 4PSKA 1CJKC 3CONA 4TMTA 5CM9C 3IEUA 3FE2A 4HLDA 1SULA 1QHHA 3KZ1E 4C0QC 1NBMA 4G01B 4HUQA 1KKLA 3M0EA 4BFSA 1BMFD 2CLDX 3NWJA 4O2LA 1CJUC 1G8FA 2ZS8A 4V0NA 3X2SA 4BFWA 3UWKA 3PEWA 1IOZA 2O5VA 3K0CC 1ZD1A 2GCPA 2J9RA 5TXGA 3VR4A 1ZC3A 2QTVB 4TT3A 4TSFA 2FSIA 4GNKA 2DCUA 4BFZA 2J7KA 3OEHA 3UIEA 4A8JA 5TY0A 3FHOA 4US1R 2CDNA 1VCOA 3A1UA 5LB2A 2GF0A 3ZZUA 1N5LA 1CRPA 1WRBA 2VF8A 4ZV4A 2LKDA 3LD9A 5SZJA 3EWAA 1D2EA 3PQCA 3NXSA 4B73A 4AG6A 3FKQA 5J40A 4DCNA 5J5CA 3FHTA 2BWJA 2F1HA 3N2EA 4DLXA 5IT5A 3L0SA 1C1YA 4JL5A 5F9FA 1OXXK 5GJWC 1HEIA 1E69A 2GDJA 3L0OA 3VU9B 1W5SA 2GA8A 1P2UA 3LVQE 2X2FA 3UMFA 4BFUA 4EKDA 3MD0A 4LJ4A 4I1UA 3JVVA 4G5OA 3TUIC 3AUYA 3MSXA 1BMFA 3NBXX 1F2UB 1AZSC 1J7KA 2CHQA 4C0SA 2WWGA 3SBDA 221PA 3GEEA 1ESMA 3WHKA 3L43A 1W48A 1E94E 2RGGA 3EWSA 4M9ZA 2AKAB 3O8RA 2VH5R 1E2LA 3K9NA 2ZAMA 1ZIOA 3A36A 3F5FA 3GEHA 5TDHA 1LB1B 3PEUA 4QXAA 3WMGA 3AQ4A 2ZM5A 5CJPA 1E2NA 4OK6A 3QENA 1E9AA 2P2LA 3HJNA 3GFTA 2OBNA 4QNMA 1OLOA 4B44A 1HTWA 2ZRHA 2WSSD 4RD2A 1N25A 4MUBA 5HCNA 4JLAA 1NP6A 4HAXA 4TN1A 1JXOA 2H92A 5FBVB 1XBTA 2DPXA 2GVDC 3S1AB 1PLJA 2RAPA 4CT4B 4D80A 1KTVA 1US8B 2IHYA 2QPAA 3FMOB 2P5TB 3IDQA 1X8LA 1XPOA 1E2QA 3IO5A 2EWWA 2D2FA 1YZGA 2ODWA 2BCGY 1KMQA 2QRNA 4KV9A 5FPTA 3V4FA 1E1RD 4CYMA 3RHFA 2FFBA 2VHJA 1Z0AA 3ZH9B 3P32A 1KYIA 2OM2A 3V9PA 3RRMA 2WIAA 1E3MA 1Q44A 3GLIE 4R2IA 3NEYA 5DE3A 4D0GA 2VSOA 4G1UC 2OCBA 3HPRA 4OQLA 1FP7A 2WWHA 3CZQA 3DDCA 2X19A 3RANA 3DM5A 3VFDA 3KTAA 4A15A 4YONB 2J87A 1AQUA 1N6PA 1X3SA 4BECA 2WV9A 1KOFA 2FF7A 2NO7A 2PZFA 4LJ8A 5KSZA 3E2IA 1A1VA 2WSSA 4XSHA 2OCPA 4FN5A 2GJ9A 1QHGA 5FOXA 4CZ2A 3THXB 3D31A 3DKVA 1F2UA 4JT2A 3KFVA 2ERYA 3TUZC 3C5HA 4WAUA 2VHUA 4YDHB 1P7CA 1ZUIA 1I4DD 4NE2A 1G7SA 4CEJB 4Q03A 1VIYA 4GP7A 4Q1DA 5DH9A 4R7ZA 1GSIA 1YKSA 3QI2A 3QBTA 3NC0C 5DI3A 4JLKA 1W7AA 4CGZA 1SXJB 4DT1B 1E1RA 4FMDF 4MH0R 3RAPR 2ZJZA 1RFLA 3K0SA 1E2MA 4LC0A 3EZ2A 3FMPB 4CT5A 4AD8A 3S1AA 2CVFA 2ZR9A 2G0TA 4F4IA 4PFSA 1US8A 5EXSA 1SHZA 2IYSA 3U7HB 5LPNA 4QJ5A 1YZLA 4A6XA 1K5DA 2F43B 2ODNA 3GJXC 1E2EA 2J7PD 4DLRA 1F60A 2NMVA 1JEEA 4OL0A 3OHMA 1LW7A 4DIEA 1SXJD 4LBYA 1G64A 2PCJA 1KY3A 1II8B 2NO0A 3IEVA 2VBCA 5JI2E 4LJYA 4OI2A 4E09A 1U94A 2GCNA 3U5ZB 1FZQA 2JEOA 2JGNA 2NO1A 3AP3A 1T5IA 1TX4B 2J45A 3IIMA 1IJFA 4GP6A 4LRWA 5BN3A 5TARA 2V6JA 2XGJA 3TH5A 3E5HA 2XTZA 1PVOA 5KNDA 3EIEA 4AKGA 3AKYA 4Z1MD 3SFVA 4F92B 4PTLA 4AY2A 4PR0A 3AF4A 2ZE8A 4D4JA 2VHCA 3GQBA 4Q01A 4C0BA 3THXA 3U2QA 2IS4A 2R2AA 3B8HA 1B0UA 1Q0UA 4WOPA 4I1VA 3VR2A 1W4RA 5JCPA 4F4JA 3T06B 3TMKA 3WYGA 3MCAA 4A0GA 1R0XA 4LV6A 2YZ2A 3P1JA 1SXJE 1T0JB 2IXGA 3AVUA 4ZDKA 1GL9B 1PZNA 5KSOA 3KX2A 1OH7A 4WXRA 3RABA 4CEJA 5FTLA 2J7PA 4PPGA 3VX3A 5J4HA 2J59A 3B13B 1ZCAA 1XXHE 4X8LA 1ZNWA 4RD0A 3TQCA 2DY1A 1E4VA 5TV2A 5EJEA 1Q1EA 1S2MA 1J99A 1KY2A 2FWRA 2Q9CA 2FX3A 3K09A 3TW4A 2IYRA 1OFUX 2KB0A 4TWZA 2HEIA 2W6ID 3TIFA 2C04A 2XOKD 4N0DA 4GPTA 1SKQA 3MRSA 4LHXA 3MLEA 2VRWA 1JR6A 1P75A 3SN6A 1XX6A 3BERA 4XOIA 3G0HA 3B6EA 4FCWA 2QSZA 1HA3A 2V8OA 1RYHA 3QG5A 2F43A 4YMUA 5K8IA 3ZQ6A 3VNUA 4KO8A 3OAAA 4Z1MA 121PA 4JBWA 2A2ZA 1IN6A 3AF2A 3K9LA 3QKTA 4HLUC 5TB5A 2DR3A 3IQWA 2A78A 1G5RA 5J47A 1IN4A 1II8A 5JWOA 4DIDA 4W5WA 2HDNB 3C14C 2ZJOA 1T5LA 2ZS9A 4KJZA 3TVDA 2VIIA 4IDHA 1Q1QA 2ZUBA 4KXFB 1G291 1A2KC 4CRWB 3FDIA 3FFBA 2VP5A 4P31A 3EPLA 1Q1ZA 5FUYA 2N1BA 5CM8B 2R6DA 1E32A 4OHZA 721PA 1XB2A 2NO9A 1NJGA 5F9HA 1X86B 1MT0A 2IYZA 2JLQA 1G20E 4A36A 2YOHA 1D2NA 1KDOA 2JIZD 4IJMA 3NKVA 4WBSA 2GTPA 2QNRA 2W6IA 5FOUA 3GP8A 2XOKA 5AR1A 5EP1A 3PR1A 1Z6AA 2QP3A 2XZOA 5KNCA 1R5BA 1IXRC 5DISB 1EFRD 3CLVA 5FTMA 2F1JA 5DN6D 3W6NA 2DBYA 3A58B 1XCGB 2CMKA 1NN0A 3IPXA 4L9SA 4OI1A 1NKSA 2GCOB 4QGGA 3IHWA 2WMNB 4KSBA 5BYKA 4BRUA 4CEHB 4PSVA 1TUIA 3M4YA 2P65A 2O0KA 1T3HA 2AHOA 1VG8A 2Q0HA 1E6CA 1ZRHA 4IVRA 4MQBA 3W6OA 3CF0A 1KNQA 4GRAA 3SJAA 5TMPA 3C7KA 3WP1B 4TZ0A 2ZXUA 4DCSA 2OFXA 1SVWA 5L3VA 4NU0A 3QXSA 4RFSB 5B2ZA 2GBLC 2CNWD 3M6AA 3K0CA 2QZ4A 3Q8XB 2KE5A 2WWXA 4TL8A 1KK2A 2DFLA 3QF4B 3W5JA 3EX7C 2P6RA 3UG6A 4NH0A 4RCYA 4Z8YA 3MUFA 1E2DA 4IOLA 1OH5A 2JIZA 2A5JA 1FQJA 2PEZA 2EU8A 3UG7A 3PITA 2QBYA 2RMKA 2WKPA 5JJLA 4QRHA 2ZTSA 4JIMA 1TEXA 4HAZA 2ZRIA 1SVSA 3K53A 3DKPA 1OB2A 1E0JA 3DL0A 4QFMA 1EFRA 1OKKD 1XEFA 3GEIA 4R9UC 5DN6A 3W8NA 4ZKDA 1AIPA 3RRYA 2PLFA 2QL6A 3I5YA 2VP9A 5FTKA 2ERXA 4BUJA 2CL7X 4RSGA 1YZUA 4JLJA 3AGQA 3KKPA 2WOOA 5HE9A 3VHXA 1VIAA 1VCMA 4RKEA 3U61B 1XTQA 3NBZC 3V4RA 3HU1A 1KK0A 5C46F 1Z63A 4H9GA 4PHTA 1UKZA 4RVCA 1WMSA 2IT1A 3LBNA 2IS2A 2G9NA 4NKRA 3K0FB 5K8TA 3CX8A 5EE1A 1JECA 5C2JB 4Q7MB 3T5GA 4KU4A 1BOFA 1DVRA 2C9CA 2CNWA 2ZRLA 3CX7A 5JHGB 3QXCA 3AV0B 1P61B 3CB4A 4M9QA 3KJHA 1GOTA 1W5TA 1OSNA 2GCOA 4UXJA 3F0TA 3I4LA 1NI3A 5LD2C 4RZUA 4CEHA 3Q7PA 4CVNA 2J0VA 3NH6A 1YJ5A 4DDUA 5KPDA 5CLLA 5C1BA 1GUAA 1S9DA 1XPUA 3L2OB 1WA5A 2ZYWX 5F2EA 4NTZA 2EVWX 1XD8A 1NG1A 5AJXA 2DB3A 3LBIA 4I99A 4PO8A 1CR0A 4LJ6A 2B6HA 3A1VA 2GJSA 1OKKA 2O8DB 3AGPA 1DPFA 4RFSA 2AXNA 3CNNA 3QVVA 2OHFA 4FI3C 4NMMA 4A6PA 1AJEA 2C5LA 4DDWA 4OBEA 2JATA 3QF4A 4MUAA 5CK5A 3AVVA 4HZUB 1LVGA 4TMXA 4MYTA 4XIGS 1CBUA 4S2EA 1HQCA 1ZNXA 2P67A 1K6MA 3N5CA 5BWMA 3AVWA 5AJWA 4QGAA 5BXQC 1NF3A 2R6GA 3EPJA 3PIRA 3K0AB 5KO2A 2WVJA 2BHRA 4B3FX 3MMPA 5FR1A 2X8AA 3WYFA 4WXPA 3GLHB 4URVR 2JLSA 5EZ5A 1TTTA 4OI4A 5LB4A 2XJ9A 1JI0A 1UDXA 2FN4A 3HR7A 3B2EA 3D7MA 5FUXA 3KKOA 4OHXA 3TVTA 2PMKA 2Q3FA 2UVQA 3EG5A 3C8UA 3K0FA 4BE7B 3BRWD 3GJ3A 1Z0KA 1XTRA 2X77A 1TQ4A 1M7BA 1Z0FA 3BH0A 5FR2A 2ZJAA 1YE8A 1HE1C 3RSLA 1GKYA 4TLAA 2R62A 2A5FA 1G7CA 4D0LB 4DB2A 3OFND 1YZTA 3SJZA 4JSYA 4L16A 1YU9A 4FXPA 4UQOA 4IOKA 1MABB 2FSGA 1Z3IX 4M4SA 2CCJA 2I1QA 3ZYCA 2H57A 2ZRGA 3JZMA 5HZKA 5B57C 1QHXA 2D7CA 1DG3A 1UKVY 4QHYA 2RGXA 1UEJA 4PHHA 4B71A 3LBHA 1GWNA 1IJEA 2R44A 3WXMA 4KFUA 3VTKA 1L8QA 1CRQA 2O8DA 1BO6A 3ADCA 2YINC 2AWOA 1G18A 1HT1E 1VYVA 3TSWA 4BLQA 2WKRA 4E07A 3RVBA 1KI7A 1XMSA 4LHWA 3SNHA 2W58A 2JLWA 4PPNA 4FIDA 4DLYA 2N46A 4HYYA 3RC8A 4DLSA 2FFAA 2GNOA 3TQFA 4C0LA 5L8VA 4HDQB 4PSAA 4PZLA 3X1XA 3K70B 1EFHA 3DPUA 2NOAA 1T3SA 3QKUA 4O2RA 3ICEA 3IPYA 3K0AA 2QA5A 5JHHB 1Z6XA 1M2OB 1ZINA 3GLHA 4JS0A 1NVVR 4ERNA 1SVOA 2FEMA 3I3SR 4IFEA 3OFNA 2AK3A 3QKRB 4DDTA 5DI9A 1MO3A 4C0HA 4IDQA 4KSCA 2BV3A 2ZI4A 3NHBA 4Q02A 2Q9BA 1WP9A 1KNXA 1YR6A 3PUWA 1LV7A 1ZYUA 5CIWA 1CTQA 3BAFA 1VHTA 3C16C 2Q9AA 2CBZA 2EYUA 3LXRA 1G41A 2G1KA 4JVLA 5JMTA 1V43A 3IBGA 3P4YA 3FMIA 3OF5A 1R6BX 4IRUB 1D2MA 4Z8XA 5L3QB 3K70D 4FWTA 4KVAA 2I4IA 3GFOA 4UNRA 3DVLA 1J70A 4JLBA 1TF2A 4M1SA 4EPRA 4I81A 2VPPA 3R9IA 4D2IA 4P4UA 4A0HA 1IM2A 2BMFA 1FW6A 4UXIA 1J90A 1GL7A 3DM9B 2CL0X 4JVNA 2MSCB 4TL7A 4C0KA 5J4YA 3E70C 4D26A 3ZLJA 2XJ4A 2QT0A 4CIDA 1G9XA 4OHYA 2FGKA 3IO3A 1FL9A 4UNSA 4D25A 3LAWA 1S9HA 1W49A 1UADA 1JAHA 2DFKB 5GJBA 3LA6A 3ZZTA 5EE9A 1XNJA 3ICQB 1G3QA 3DMDA 4LBVA 2H17A 1OXSC 1WQ1R 1TQ2A 3T35A 2IWRA 1T0HB 4ZDJA 2BIFA 4M1MA 1XFAA 4JLMA 4EPVA 1ZUNB 2HJVA 4N0EA 5FTJA 2PZEA 3AB3A 4NHOA 3T34A 1IBRA 4LJ9A 2GEDA 4HEJA 4GZLA 4HLUA 4Q5IA 2JA1A 5FUVA 2JLXA 3X1ZA 2GJ8A 3FVQA 4HB0A 3SR0A 2RKOA 4DCTA 3KB2A 3FWYA 1GRRA 4XWKA 4KITB 4DJTA 2CCKA 3Q9LA 3VR3A 1SHKA 5EZ6B 3NDBB 3QKRA 2BCJQ 4S35A 4TT3D 4C2UA 1XJCA 4IEEA 5FI1B 2IX3A 2WJYA 1LS6A 2ZJ8A 4EPYA 2HF8A 5JCZA 1G5TA 1KSJA 4OQFA 2GZHA 4PC7A 2QMEA 3LW8A 4LJAA 3ZGXA 2VP6A 4OJKA 2XITA 3BC1A 1R2QA 4B2IA 2C03A 1TF5A 3AM1A 1FUUA 1VCIA 1Q3HA 5L3QA 3BGWA 3SEAA 1UDWA 2VL7A 4G3XA 2JLVA 4Q18A 2A5DA 4N1AA 1OFTA 3E1SA 4A92A 2J3EA 3A6PC 2W83A 2VP4A 2HXYA 1AS2A 1XEXB 1G3UA 1NBME 1U98A 2QP9X 4LPKA 5KYKA 3SDZA 4TMVA 2ANCA 2B21A 4EJSB 2REXB 5LD2B 2RCNA 5HPYB 1N5JA 1WF3A 3WHLA 2ZSBA 3QEOA 3T5DA 2G88A 3SYLA 3B85A 1TUEA 2ZEJA 5E7IA 2ZREA 2R6CA 4XD7D 1HE8B 1GAJA 1NKTA 2QMUA 5EXXA 4QHSA 3QUSA 5HE8A 3LQQA 2WMOB 1Z29A 4JVMA 3RS5A 2GBLA 5B58C 1Q22A 3FB4A 4HUTA 5B64A 1M7HA 4GT1A 2PEYA 4OYHA 3UXMA 1IXZA 5DLQC 4DHEA 4MRVA 3ASYA 1DAKA 1NIJA 3H1TA 3MG9A 4BFXA 1AGRA 2JJ2A 2H18A 2GZAA 2WJVA 3VHLB 3A4LA 2PMDA 2ZJBA 2C9YA 4EFLA 2YNMA 4LGMA 3ECCA 3D3QA 2HF9A 1EWRA 2GEVA 4TLDA 1NSFA 2OO7A 1P62B 4UNPA 5A5GA 4LJ7A 4XJXA 3VAAA 3W5IA 3KTAB 3BFXA 2BM1A 1LFDB 3SC3A 2CE2X 3BXZA 2NZJA 1N5KA 3ZVNA 1YR9A 2CHGA 3DMNA 1KMHB 3DOFA 2ORWA 4PANA 1OYYA 2R6FA 2FOLA 4MGKR 3IHLA 1KAOA 1YZQA 2WOJA 4RY2A 3B1YA 4XD7A 4HAVA 3P26A 1OIWA 5BYJA 4OJQA 4A0RA 4FWIB 3SJBA 4V03A 3EASA 2F9LA 4TZ6A 4Q48A 2ZSDA 2ZE5A 4LV8B 1OB5A 2YWHA 4JSTA 3P4XA 2ZI6A 1XEXA 3SI7A 3QPUA 3VR5A 3MGCA 4G5QA 4MA4A 4QM6A 2N42A 4FMBB 3SHFA 4NDZA 3GLGB 4EJSA 5DNYB 4YMSA 3KQNA 1JBKA 5DI3B 3RRZA 4Q1AA 4YDSA 3TRFA 3K0EA 1D6JA 3FTQA 4P32A 1GL6A 1JALA 3AVPA 1G8GA 4EIWA 3A1TA 2OESA 1N0UA 2HLDD 3D6TB 4HZIA 1P2SA 2QMOA 1G5PA 3IGFA 3QPWA 2UKDA 4R71A 2GJAA 4MRRA 1W2HA 3A1SA 4AYXA 1NVWQ 1H8ED 2X2EA 1R0YA 1UAAA 1ZVQA 3QNUA 3IIKA 1Q1BA 1UJ2A 2BKUA 3BK7A 3BD9A 3C5CA 4HAUA 4JLVA 1QG4A 4GZMA 3T61A 1QHSA 1XMVA 3BJIC 2IF2A 4TMWA 4NCKA 1OV4A 4LYFA 4B6FA 3T1TA 1ANKA 2KI5A 2ZE7A 4QBHA 3T12A 5K8LA 1ZUHA 1NJFA 3B60A 1M34E 1JQJC 1KI2A 1CEEA 2BJVA 3O47A 3RRNA 1LF5A 1NN5A 2ZI9A 4DRZA 5CK4A 1II0A 2CHVA 4PC1A 2ATXA 2WWYA 3B9PA 1MV5A 2IBMA 2XZLA 5FPHA 1S1MA 2LWIA 4A1FA 1R5NA 4II7A 1KMHA 1RE0A 4LYAA 5KDOA 1L4YA 2GXUA 4WIAA 5D3QA 3DHWC 3QVUA 3ZQJA 3KL4A 4ZDIA 1Q3TA 2GKSA 3T1QA 5A4JA 1ZU4A 1BKDR 2ZUCA 3CF6R 2HLDA 1G1MA 1KGDA 1O3YA 4Q1FA 2FE4A 4B3DA 4B2LA 5C4MA 3GLGE 2EWVA 1DAFA 3PV0A 1G4AE 1VECA 5FL7A 3SFZA 1WB9A 4AKHA 2O8CB 2AFIE 1H8EA 4Q47A 4DB4A 4TYWA 1XCMA 3HYTA 3GLGA 3I72A 4Q4JB 1TF7A 2NTYC 1UEIA 1OE0A 5J4VA 1QHYA 4LK2A 5BN4A 2VF7A 2WWIA 3KUDA 5JLJA 2QROA 3LQRA 3O8DA 4PZZA 3W8RA 2FA9A 2WSMA 4KHZA 2FGJA 1GNQA 3IILA 3QXHA 4NCJA 3G82C 1ZM3A 2A5YB 2F6RA 1II9A 1BS1A 3QIAA 1IXSB 4C3ZA 1P2VA 5HCIA 4DLZA 3K9GA 5IDVA 4Z51A 2F1RA 2GF9A 1QG2A 3I61A 3WNCA 4M8NE 2YHSA 4F4CA 3BB1A 1JJVA 1NLYA 3H84A 1FTSA 2A30A 3HR8A 5KSPA 3UPUA 1QRAA 2ZETA 1X8KA 5JS8A 1K8RA 2Q21A 5G40A 3WBJA 1N0WA 2OEPA 4PO1A 4LY6A 3LH5A 1P60A 3CX6A 1CR2A 2XAUA 5GVRA 2YWFA 5EP2A 2VTKA 4GOXA 2HT6A 5G3ZA 1EGAA 3WP0A 1KKMA 1S96A 1S1CA 1TL7C 2ZVQX 4Q19A 3U7EB 2EYQA 4DEYA 3REGA 1U0HC 2GAOA 2PT5A 4ZI2A 4MRNA 4C9BA 5JSZB 5EXTA 3VKHA 1XU4A 4HLCA 3OAAD 1TQDA 3NG1A 4EPXA 4NYMQ 5LBIA 2ZVPX 3W3ZB 2GJKA 4B35A 2AD5A 5KDDA 2AD1A 2V3CC 2AR7A 4NL4H 1N6KA 3O8BA 2IS1A 4TTPA 3B82A 2GVZC 3RS4A 1SVKA 1C9KA 2PH1A 4D4MA 2I3BA 3LRPA 3BFVA 2O8CA 3BH6A 4GMDA 5ANRB 4U02A 1E4YA 4FCTA 5D3MB 4Q4JA 2V4ZA 2FSFA 1XZQA 4KBFA 4KODA 4GSYA 4M1YA 1FMJA 3A8TA 1Q21A 2HCJB 4TMZA 3Q3JB 2OLJA 2ZRAA 4AURA 2W2TA 2WM9B 2QG6A 4WZAE 5A0FA 4A4DA 2PX0A 4BQSA 2RHDA 1W4CA 3KKNA 3AEZA 3FHCB 1XJ0A 4TL6A 1LNZA 1IQPA 1AS3A 5G41A 5HKKD 4IDPA 4KFTA 2KBEA 1CJMA 1NLZA 5KTYA 4QG7A 4PAMA 3UK6A 2ZJ5A 3KFXA 1FPMA 1G3MA 1KO1A 3W9YA 1NIPA 1VHLA 2ZRBA 4LJ5A 1IY0A 3N2IA 1MOZA 2EFDB 3LX5A 621PA 2FFHA 4IDOA 3K70C 1AKEA 4V0LA 2QBYB 2JLRA 3QXXA 3GD7A 4KFSA 2IS6A 4BFVA 1P6XA 3LVRE 4DLWA 2D4HA 4KCGA 3QJYA 2HT1A 4B33A 2B8WA 1AKYA 1DEKA 1E9BA 3EPKA 2ZSEA 2QEQA 1DAMA 2ZANA 3TUJC 1VPLA 4AK9A 5JSZA 1DG1G 4KYIB 2PCLA 2VP0A 3T1VA 4EAQA 1F5NA 1U8ZA 4HB3A 2BMDA 2PX3A 4Q00A 2DFNA 4LUCA 3CW2A 5GJCA 4Q9JA 2JLYA 2L0XA 5FPKA 1D8TA 2FPKA 3AVQA 2W0MA 3B78A 1E0SA 4NCNA 4QJ3A 2ZQ5A 4F91B 5HKKA 3SBEA 2C9OA 3PEYA 3TR0A 3ZIAD 3ZD6A 1XEWY 1TU4A 4A82A 1XMJA 4X8OA 1TU3A 4CF7A 1SQ5A 3UMSA 4BWYA 4M1WA 5D3MA 3BFKA 4XTRA 4YMWA 3VR6A 4M1TA 4DXAA 2IYQA 3Q7QA 2BVNA 4MGIR 3CRMA 5JWHA 3HWSA 4L4UA 3MAAC 5H8WA 5AK0A 1DTSA 1SKYB 2H16A 5C18A 2IUTA 2QENA 2H5EA 2OV2A 1FNMA 4ON9A 5AJYA 1W0JD 1R5OA 3LDAA 2G83A 4OK5A 1RC8A 2MSEB 4W5HA 2EFEB 1W4AA 1MKYA 1E9RA 1E2JA 4H1UA 1NVUQ 3KJEA 4NYJR 3O8CA 3QE0A 1W36C 4PPFA 4M1KA 1AA9A 4MRPA 2IUSA 5CB6A 1NMZA 1Z2AA 3FPAA 4CEIB 1J2JA 1DARA 1GRQA 4O3MA 1DADA 2YJTD 3THYB 4LWZA 4UKDA 2J0QA 4Q4HB 2C2HA 1Z47A 4HB2A 2ZS7A 4UNNA 2D06A 2CLSA 5DO9A 2IW3A 4AI6A 4GFDA 3ZIAA 2ZRDA 3Q85A 2ZJYA 1E96A 1ZW6A 4TLEA 2IWHA 1GFIA 4AYTA 4LBZA 1RKBA 1COWD 1KI9A 4F38A 3GCGA 1ETUA 2IEYA 3TAHA 3EA5A 1T6NA 3L8ZA 2HUPA 3L8YA 3PJRA 5FBLB 2B92A 2ZSAA 4L8GA 1R8SA 2A5GA 1M74A 5EP3A 5H68A 1E2IA 3GLFB 4BRWA 4RD1A 1K5GA 4PHFA 2YC2C 5EQTA 5EUQB 4WZ6A 2G3YA 2YWEA 5AJVB 4Q9KA 2Q3HA 2IYYA 1JAIA 1W0JA 2A3RA 4TLCA 4UJ3A 4AC9A 3H0KA 2W0SA 4HAWA 4ZO4A 1KI6B 2JJ8A 4KLNA 1GTVA 2V7QD 3HU3A 4EJSC 1WE2A 1Z6TA 1U99A 3CPEA 4DLUA 1SKYE 3EZ9A 1CIPA 5KU1A 3R8CA 3ZS9A 1H8HD 1EK0A 2FDCA 4TLBA 3CWZA 2OE2A 1AQYA 5FBWB 1ELOA 5CB8A 1A4RA 5B30A 2Z0MA 3C4JA 1RPZA 5EE5B 3R7WB 1QZXA 2W00A 4EFNA 2GWHA 1WBBA 1COWA 3LLUA 1SVMA 4URWR 3CIOA 4Y0VA 1GIAA 2OXCA 2Q6TA 3FKSD 1TPZA 2IA5A 3UMRA 2EFCB 2F3RA 2HYIC 4B75A 4AKIA 1XZPA 2O8BB 4CEIA 3TKLA 1AM4D 3FYHA 3GJ0A 3THYA 4US2R 1XEWX 4Q4HA 2NIPA 1AS0A 5DIFA 4Q9IA 1DBSA 1OFHA 4RFVA 4TYNA 2WPDD 1N3BA 4Q66C 4RZXA 1M8PA 3REFA 1E9SA 1R7RA 2V7QA 4IXNA 3GLFE 2SHKA 3EC1A 1H8HA 4IKEA 1HQYE 2D62A 5E3HA 4BGDA 4P0TA 4F7WA 1PUJA 2C98A 2FPLA 1OFIA 1SVIA 3CH5A 3SJCA 3VX4A 3THOA 5HR5A 3GLFA 1OT3A 4LX0A 4NYJQ 3WNDA 5AUPB 2FFQA 3BE4A 1CR4A 5FOTA 3EIQA 4JLDA 3OIYA 2ONKA 3RLFA 1U90A 2QSYA 2GK7A 2ZROA 2WJHA 3L0PA 1Z06A 1KZ7B 2JDID 2R8RA 4H1VA 4ESVA 4A9AA 1CULC 1KI6A 4JLNA 4FMCF 4OHWA 4Q1CA 2G77B 2VSXA 5G3YA 3FKSA 3SHWA 1PV4A 4DBLC 3K8YA 4D81A 3NBYC 2X1VA 4W5JA 4EUNA 3I62A 1OJLA 4MGYR 2QT1A 3BB3A 1XP8A 3H2YA 1OIXA 2OG2A 2EQBA 2WWWA 4V0OA 2QM8A 4I1OA 2GZDA 1MO5A 4QGFA 3R7WA 2HJGA 2WIBA 4L9WA 3U60B 2WPDA 4X8HA 1BH2A 1GITA 4O0MA 1F6BA 1V5WA 2WAYA 1Y63A 1E0AA 3KJGA 2ZRMA 4DSNA 2OCAA 1NG9A 1KDTA 3U6BA 1D9XA 2IC5A 2O8BA 3UKDA 4LDJA 1RRGA 3GLHE 4P4TA 1XCPA 2CCGA 2E9SA 2JASA 1QHNA 4XTCS 1KJYA 4U00A 1Q20A 1ZD8A 1XTSA 3Q5DA 4JMPA 2GK6A 4KVGA 3ZDQA 4FINA 2V54A 2C77A 2JDIA 2VP2A 1GNPA 2WWFA 5DGXA 2OCYC 1VG9B 2QAGC 2IF0A 2REBA 4A2PA 3GJ5A 5AJZA 4GDFA 2QRZA 3K9HA 2P3SA 3F8TA 2XB4A 5SZHB 3RS2A 1MRSA 1OPXA 2QN6A 4MKHA 1A7JA 2MMGA 3CKLA 4QGHA 3EAQA 2UZIR 3HPQA 4MDFA 3U7FB 1VTKA 3FGNA 4HLQB 4K8OA 5IF9A 1Z07A 2XNDD 1UKEA 4E03A 1KDRA 1PLLA 4BZPA 4YMTA 3B1XA 4WW0A 3RS0A 1HY3A 2ZU6A 2ZYUX 2P6UA 1P4SA 1N6LA 2XZPA 3NTUA 1WDTA 1H65A 3HYRA 1RW4A 1VG1A 1Q57A 5KUTA 3LLMA 4LPSA 1T4GA 3CRW1 3MWYW 2ZITA 3SQWA 1D9ZA 1DOAA 1GNRA 1XWIA 5IK2D 3ONWA 2WAXA 2XXAB 1P2TA 1E1QD 1G8HA 2IYVA 3I8SA 2C99A 5CIQA 1LS1A 1N6NA 1T9HA 1JPNA 4KAXA 1S0UA 3SYNA 4G5RA 5JWRA 5EE0A 4E5UA 3CH4B 4RCZA 4XVQA 4A0FA 1CS4C 3CPHA 5G53C 3ZZ0A 3G5UA 1U0LA 2WZQA 5CDFE 2JLUA 3R9WA 5FPYA 2D2EA 4WVFA 2ZE6A 3OEEA 4ZCIA 1NMYA 1JR3D 1P9NA 2H8KA 2ZIAA 5CDFA 5SZKB 1G8YA 1W36B 2G0NA 3LX8A 3WRXC 3BORA 3B7GA 2XNDA 1HT2E 1ESNA 3U44B 1Z6YA 3QSYA 4Y0AA 5JI3E 2QM7A 1VYUA 4D6PA 5UKDA 2OXRA 3CNOA 4LHVA 4QM7A 4IDNA 3A37A 2PJZA 3IIJA 1ZP6A 2VO1A 1NVXQ 3PUZA 4HDCA 4TTQA 3TAUA 4Z54A 3U6KA 4QHTA 1EFCA 1N6OA 1QVAA 2BBWA 3GJ7A 1PUIA 1RJ9B 5E7MA 2F7SA 2QTFA 3OZXA 5IK2A 3IUYA 1N5IA 4Q9LA 1E1QA 1W36D 4C4PA 4AG5A 4BASA 1DAEA 2QU8A 3IBYA 5K8UA 4XH9B 1ZM2A 2JJ2D 1TAGA 3CR7A 4EDHA 1G4UR 3RYTC 3DZ8A 5FOVA 1EFTA 1PLKA 2XNSA 4DCUA 3R9XA 4YQFA 1VKJA 4URZR 4M9XA 1F3OA 4EPWA 2F55A 4WZBE 3KXIA 3THWB 4BLPA 5P21A 1YZKA 4US0R 1JR3A 2CJWB 1ZJ6A 1UKYA 4D0NA 4XVRA 4MYCA 2XXAA 4GI7A 4QOSA 4B47A 4BFYA 2FMXA 1MRNA 2RHMA 4BEBA 5KSYA 2O8EA 2F1IA 2OLKA 2DWOA 4RJLA 4C30A 3CNLA 2CXXA 2QPOA 3MWJA 1IONA 1VDZA 1ZBDA 4B3BA 3OIWA 5EXPA 1JNYA 5HZHA 1S4QA 1Z08A 3CRRA 4K81B 4M0LA 1E2FA 2OSBA 1AK2A 4NYIR 5DYIA 3U3MA 2QGNA 3BIFA 1JQLB 2REOA 1DAHA 1EESA 3MFYA 3RWMB 4JJZA 4LBWA 3TLXA 1ZCBA 1IN7A 4DLVA 3U44A 4M9SA 4GMXA 1JJ7A 3T15A 1GP2A 4UJ5A 2AX4A 1QVRA 2VHTA 2J0SA 1W0KD 2R9VA 4B43A 4PQFA 5JJIA 2YYZA 1Z0DA 1RJ9A 1A2BA 1KZGB 1T8UA 1ONBA 1X1SA 4Q7JB 5H70A 3CZPA 1ZD9A 4ZKEA 6Q21A 1G3RA 1QBKC 2ZR0A 4JKYA 4JVSB 3ZVLA 4LCBA 4DWJA 1T3LA 1XRJA 4B3XA 3KJIA 1KO8A 1OXTA 3LV8A 3QG1A 2RB4A 1KK1A 4OQMA 4K46A 3AF1A 2FU5C 2PL3A 4PPQA 1WXQA 1TADA 1HUQA 5AUQA 1GM5A 2J1LA 2PBRA 4IVPA 2IYXA 1P9WA 2IXFA 1RRPA 2P6NA 2E87A 5M04A 3GLIB 3THWA 3AUXA 2BOVA 3QXJA 1FX0A 4IFBA 4XSGA 4EQ6B 2CJWA 2NO6A 1TEVA 4XVUA 4RZ2A 3AF0A 2AXPA 5E4FA 4V02A 4PC3A 4Q4LA 2QGZA 4WA7A 1TQ6A 3I32A 1KJWA 2FV8A 3TSZA 1BYIA
chains in the Genus database with same CATH superfamily
3EW9A 2BFBA 4NCXA 4O1HA 3TRHA 5KCMA 1PNRA 2NXEA 1G16A 1SVUA 2Y1OA 3NETA 5J4KA 1RBYA 4MR9B 3QVTA 4E31A 4R51A 1BRMA 1SG9A 1Z17A 2FMIA 1HLDA 2IP1A 2WAOA 4LZWA 5I7UA 1R27A 1YFZA 1QJ4A 2FW1A 1NW9B 1JDUA 4KFRA 1K7FB 3VTAA 2RAUA 3A1WA 3IV6A 1OW3B 3DLIA 1G17A 3N3AC 4PLZA 4ZVSA 3VPAA 4Y6QA 1M7GA 3CXUA 4V1CI 4OYLA 2AV6A 4M37A 2XYGA 5LQRA 3GIWA 2C2GA 4PQYA 3W2GA 1AH2A 2WIFA 3F4KA 1FU8A 4CIYA 1G21E 4JJKA 2GSWA 3MJEA 3PDWA 4Z6KA 2KX7A 1Y8CA 3DLAA 2KPOA 4MI6A 4AUEA 3LYUA 3X1DA 3MHTA 2B1IA 4AJNA 2H08A 3JQ6A 2YJ4A 4Q9HA 2IVFA 1WUJS 3OCJA 3X1WA 3RTDA 2JHAA 4DEXA 1O94C 2M9MA 1RMQA 5A5VA 8ATCA 1HRKA 3O4FA 3V5NA 1FFDA 4K6MA 2I2BA 3QOFA 2NADA 4HAYA 4P81A 2VOEA 3EH2A 2V03A 3TK1A 4ND6A 2FRXA 4IIBA 4P22A 4PHGA 1SCKA 2DFVA 3HM9A 1KAQA 1M1YE 3GYGA 4TV9B 3QUAA 3FFAA 4MB6A 2FNAA 5SZIA 4QKQA 3QVGB 1E5DA 4ZIRB 4D0SA 1O6BA 2MINB 1PRYA 1Z5ZA 4RTSA 1ZM9A 1B6SA 1VE3A 2H9AA 4N5HX 1WBDA 1RM4A 4NS1A 5HFJA 2GNAA 1W30A 4MYHA 4G1VA 2M1XA 2V9PA 4RPJA 1FMCA 4FZVA 4HG2A 2XYPA 1WHTA 2QV7A 1ZNYA 3KKKA 3VU9A 5HZGA 4QAQA 2ZBVA 5J1TB 3UGQA 3JALA 1EK2A 1TYEB 2NO5A 3DCYA 3JWEA 4F93B 1LPAB 5JAMA 2QE7D 3A6DA 2A92A 2Q3EA 2JKVA 1DRVA 4DCGA 2ZJ0A 3CX3A 5FI5A 2FG6C 5JATA 2BSQA 3GGGA 5D5PA 3V1NA 1JHVA 1M67A 1T36A 1R6VA 2BFDB 2RHGB 3UANA 2YFKA 1LSSA 2C1XA 4JT4A 4KE7A 1FMFA 5DM2A 1BE0A 3EVZA 4R7TA 1UZUA 5FL3A 1YZHA 1Z56C 3AYXB 4PYJA 4KQXA 3RVQA 1E0KA 5KOYA 3HVKA 1T5TA 4EG5A 1G8PA 3CA8A 5JADA 3I6BA 2VDJA 2BM0A 3BMQA 3JQFC 3TM4A 4NQRA 3DMHA 3I9V1 2WIDA 1D7OA 2BI7A 1QHEA 3ESAA 4I55A 5DEIA 3ZHQA 3PEVA 1T5BA 4HH4A 1RXIA 4ARIA 4XWAA 3HFRA 2JZNA 4E1VA 3DXFA 2AZDA 3WMEA 1KAHA 3LPAA 4IJKA 4LRXA 3V4OA 4P3OA 5JNVA 3DXXA 1GTMA 1RQ2A 1ULSA 3RS3A 2ZYSA 3N74A 4A2CA 5F3WB 5FOWA 4ALLA 1C3JA 1ONPA 2Z2JA 3NIBA 1NT2A 3NDIA 5EJ4A 3BB4A 1ID8A 3KEGA 1CF4A 2PYDA 4E70A 1IEVA 2GEBA 3CZCA 1O95C 1C9DB 3C24A 3TCXB 3DB2A 4G23A 1E58A 2DHEA 4PRZA 5JNWA 4MCJA 3ZW8A 2CL5A 2QAGA 1I1OA 2C7BA 1UDAA 3ZN2A 4DUZB 1E6MA 5AKZA 4B4VA 1H2YA 5K3FA 3TOSA 3WMXA 4C6TB 1GDDA 3A4IA 2QE7A 3HL0A 4UD6A 2V9CA 2XMPA 1NSTA 3F8SA 4J0QA 1W1IA 1YS1X 5JJKA 5CB4B 1NUSA 1CUSA 2HYDA 2KM1A 1QC5B 3ZV7A 3WGVA 3KVNA 3PIIA 1KVRA 2FPWA 4MKFA 4A10A 3RC1A 1CEXA 3H2JA 2V6IA 3E2MA 2HJ9A 2BEJA 4P58A 4ZCPA 3BHNA 1VYTA 1X14A 5IKOA 4ILEA 5BWLA 1ISIA 2F8MA 1DELA 3SKXA 4YV7A 4ZEMA 4GU5A 3HJCA 4A26A 1KDPA 2NW6A 3NRJA 4HX5A 4AN1A 2C7OA 1DC4A 2W2PA 1N9KA 4H31A 4JLPA 5BSWA 4NENB 3W1VA 3DL4A 3C1TA 3P2IA 4MVYA 1X1AA 2FRDA 2GHTA 3OPYB 3WYNA 5JO0A 2FP3A 1UPTA 3KOMA 4OHVA 2VTBB 4J0HA 3CVUA 1E2KA 4U6SA 1P5ZB 2ZRKA 5IC4A 3GJ8A 4GGMX 2IDKA 1UWKA 5BRAA 4YJFB 2GESA 3SDBA 5B1YA 1B42A 2R5WA 3D1LA 3LYLA 1QLHA 3B89A 1J8YF 1ULUA 2W2VA 3EYWA 3W90A 4FYWA 2PKXA 1THMA 4UE2A 5KDLA 5IUJC 3EXFA 2J5KA 2P0AA 3H6KA 3R23A 3ZCPA 1M83A 1K6EA 1R0WA 3P9YA 4EGCB 3KQPA 2BFAA 3IE1A 1QTQA 1JB1A 5E9JA 4B85A 3WLRA 1T9BA 3ZLUA 5F3RA 3JZAA 4OKSA 3ZK7A 4WLOA 1STOA 2FETA 3DFZA 4HDKB 4W1QA 2CMDA 4YA6A 3TZEA 1JIXA 3U3JA 3KKQA 4M22A 2OV4A 3UATA 5B2FA 3M6FA 1JFLA 1LPOA 5IABA 1M3SA 4BZXA 2Q1SA 2Q8PA 1P9OA 3NHRA 4LXGA 1D09A 1EDBA 4LSWA 4FDVA 2QUHA 4M1OA 1XXHA 1D2RA 3FRIA 3GD5A 5ULLA 2NACA 1TYDE 2FWAA 4KX5A 4Q4AB 2HTFA 1CE8B 3LC0A 1H42A 1Q11A 2E48A 4D9KA 1NAIA 1O4VA 2ZPTX 3GNQA 4MUIA 3JR3A 1AQNA 3DJFA 4GYJA 5IBPA 1MGOA 1F51E 4N5NA 3BSSA 4DGSA 1FNSA 1B0PA 2ACEA 5JFOA 1KYZA 4LRYA 1EVJA 2WUFA 1N1DA 2CF5A 5ES4B 3TMYA 4WBNF 4Q3CA 1JZSA 4F5YA 5LP6B 1W59A 2IU4A 2O0LA 1YBVA 2NYAA 3AJRA 3GFPA 3MJRA 3BDAA 3QKSB 3NGXA 1YR8A 4GI5A 1M6VA 5LC1A 3V6MA 5GQSA 3KQOA 5BW8A 2I2AA 4X6LA 2R6JA 3U7IA 4RHCA 3WA6A 1L4KA 1JJFA 2QY9A 3Q8MA 3WK6A 5BSMA 3DXZA 1LFAA 2RGYA 1FA9A 3GP5A 4PXSA 3TUIC 2G80A 1P4GA 4NJMA 1HZZC 3N0RA 3PUKA 5BQFA 4MROA 4UAUA 4OQNA 4A2WA 4QYXA 3EUWA 1VBKA 4G24A 4YJGA 1I3NA 3QX9A 4BLWA 3U16A 3ZDAA 2I3ZA 3DE6X 1YCDA 4EG3A 3OU7A 1NVTA 2HWYA 1J2UA 1U65A 3GJRA 4R8LA 3O75A 5JAUA 1ISRA 4OBWA 3WK8A 1ZGBA 3DE2X 3KDPA 3LRXA 4EYEA 1CUBA 4BCBA 3S2FA 2Q0XA 2R25B 8OHMA 4MQ5A 3ZVMA 1HI9A 1A5TA 4M2LA 5CVUA 3TX6A 2BTEA 3O4JA 1WUHS 2B3DA 4LI0A 2LNDA 1FLNA 1UM9B 3T5MA 3D8SA 3QLVC 3HA7A 4WA8A 5DYYA 4FOPA 3ZQKA 4TKVB 5BN5A 4F4FA 5E9QA 3WMWA 1ABFA 4RTLA 1OF1A 2GPBA 2OBXA 1FZTA 3V7FA 4PAGA 1ZU5A 3DZFA 2DF8A 1PJ2A 5HKLA 4L5YA 4Y9UA 1WY5A 3WDSA 1BH6A 2MSNA 2GO1A 1E2GA 1YI8A 3SQXA 2XMBA 3Q11A 5DHTA 2YKGA 3HXPA 5EIXA 4JI8B 4Q7LA 4HAOA 4QBGB 5LDHA 1X7ZA 3FF4A 3W4JA 3HEBA 4C6HA 1TC1A 3SJUA 3AUJB 5JSKA 3GJSA 3Q7SA 4GPD1 1ZMXA 2X0DA 1EQUA 1NUQA 3N7AA 3KJZA 1GPWB 2NLOA 2VPXA 1Z25A 2QRJA 3FPGA 4IQ4A 2Z83A 4KW7A 1G6HA 4E3WA 4B3MB 2C8VA 3EW7A 3HSKA 3ILVA 1M75A 4MINA 1TK2A 1YHNA 3DEJA 5A5FA 2EFHB 3AWDA 4HWSA 3UT5A 3P5BA 2E6UX 3ZWKA 3GFGA 2ZB3A 4KDEA 2XIJA 4D82A 1CF2O 4IH1A 1KRHA 1SC4A 3JVUA 2PX8A 4TUYA 1UK7A 3F97A 3MWGA 4QPJC 2YFQA 5DHQA 2V1UA 1EMDA 2NSJA 3T1OA 4PZYA 4AZ3B 4RENA 4II3A 3I2JA 2FJUA 4YCSA 1HFJA 1YR7A 3ODGA 4I3GA 4WXYB 1PDVA 2IHVA 2WHPB 3CWQA 2GHIA 1TE2A 3KQKA 1U0JA 3ESXA 1HEUA 2QMHA 3D8HA 1I4TD 2A3NA 4PC2A 1XJWA 1E1DA 2HJSA 4A0QA 1VG0B 4KO4S 5GMOA 4TV8B 1S8AA 1RABA 3P2JA 5ENVA 5LYJA 4G1CA 4MCHA 1LC0A 1Z83A 1IZZA 2QLLA 3ORQA 2JHGA 4OSOA 1C9MA 4CCYB 4CLRB 4E5DA 2YIMA 1T2UA 3QVSA 1YOBA 3JD4A 5EHGA 1PD0A 1SURA 2HWXA 2EL9A 2PX2A 3PFIA 2HCBA 4Q3KA 5CVDA 4ZAZA 5BT8A 2RH5A 1YBHA 1E99A 4QUDA 2D7DA 2XKJE 5IPFA 3NJRA 4WSOA 3JS5A 3OQJA 1Z6PA 4I4NA 3ABSB 1M2VA 2YCLA 4MWDA 5JMWA 3TF5A 3CT4A 3VPHA 2WR8A 4U7JA 1D5CA 4WXMA 3L8EA 1OYWA 4ZCQA 4D9HA 2QN2A 4TKMA 4HYTA 3SS8A 2UVPA 3GPIA 4KDRA 4EG1A 1I2BA 2VPZA 3MGGA 1SBZA 2F62A 4I66A 1JZQA 2B1JA 4XB6B 3NP9A 4NBUA 1P1KA 5JD5A 4KGDA 3QEMA 3JV7A 3PVSA 4BE9A 2P2ZA 4IMRA 3Q9NA 1GG8A 1PFKA 3SOPA 3MEQA 2O14A 2RBGA 2Q6OA 1FP6A 3AJAA 1FXUA 1SHUX 2PUHA 3GC6A 5ILGA 5TIIA 4FDLA 5AKYA 2O52A 1M54A 3P27A 5F5XA 1V1MA 3F1KA 4H4EA 1KZYC 3E05A 4R2MA 5ISMA 1MZVA 1R4MA 4B32A 1A95A 4DUPA 4BNFA 1GKUB 3BTUA 4W7SA 4NCIA 2ZWVA 5EKDA 1Z4KA 4DPKA 2VJCA 1XTKA 4B0PA 3OHSX 1X87A 3Q5EA 1QVWA 4DJEC 2ZAOA 1N9GA 4YAEA 1DAIA 2JVKA 1N0VC 2WDZA 4JJGA 4YBRA 5ELLA 1HQDA 5HQJA 3AH8A 4XQ0A 5DXAA 1KSGA 3UPTA 2XOEA 1NDUA 3LQKA 4XLTA 3W05A 4O02B 3PD1A 2NU8B 2MJLA 1NI4B 3U31A 3FUUA 2X9NA 4KUGA 2IYWA 3AKDA 3P2KA 4CDGA 2MDTA 2XTMA 3RIGA 3T9AA 2Q3MA 4G25A 5HG0A 1L6RA 3OJ0A 5ADWA 2WUGA 5ICEA 2P2DA 4WJKB 1WAMA 2YH2A 2CFCA 2XMGA 1C2YA 3QQ5A 2A86A 5AW6A 1PR3A 2NM0A 3CF4G 2ZI5A 4IW3B 3QFTA 3E3OA 1C9JA 4HRXA 4IJVA 4IVQA 3J81k 1KO4A 1JWAB 5DT9A 4MQMA 4RK6A 1RXSA 1CR6A 2PMWB 1X7GA 3OZVA 4LV5B 4EHIA 2ZULA 3IR7A 4K6OA 3WYAA 3ZDEA 2XQGA 2A1UB 5KOIA 4HT3B 1YJCA 1CY7A 4L4ZA 4OX9B 3VR1A 5FA5A 1NBWB 4Y9DA 1W88B 1CQJB 1Z6GA 4EGJA 1SCIA 1WUIS 2YWRA 2IPNA 4W5TA 3HUTA 1ZIDA 2HF7A 4KQMA 1OZAA 2I1LA 2QL7A 4F72A 5JV5A 2I6QA 3EY9A 2OILA 1ZS9A 4HR7A 1GSHA 1HYQA 2CUKA 2ONZA 3LZCA 5J4LA 1WXWA 4L28A 3LNCA 1PG5A 1N0HA 3IODA 5CA0F 1WVGA 4YMIA 1UK9A 3OIVA 4PGMA 4XA8A 3PFKA 4RVOA 1FFXA 3CINA 3LUKA 3OEED 3IPAA 3QRWA 4N7MA 1GFWA 4PR3A 4Q4CA 4WRRA 5JAOA 3WS7A 1ZR4A 3CB2A 2RGNC 4PIMA 1O4WA 4KXNA 2O8FA 4UE3S 1YCHA 1BNCA 2C9DA 2O2EA 3GJ4A 3PFGA 4KGZA 4MLDA 4M8SA 4QD3A 2QR3A 5DSZA 5JDCA 2YR0A 1XJ5A 4REQB 3L49A 1SEPA 5GVSA 5FI0B 1LEHA 2I9KA 1HURA 1RI4A 3HR4A 1E60A 1WXHA 1MEJA 1ULBA 2PJUA 4ECAA 4UVGA 5MGNA 1SVLA 1Y3HA 2JGMA 4MR7B 2H0RA 1QZUA 4E2ZA 4GWKA 3WGGA 5MN4A 1W9MA 5DHFA 4BNWA 4CG2A 4DSOA 2PUFA 3GEBA 3ZYCA 5JRJA 3FAZA 1D03A 2DUNA 3R5XA 4JZKA 1G6Q1 5B6IA 2F67A 4L76A 4NMXB 3EVAA 4DUGD 2Q6KA 1WKVA 4DSUA 1XRRA 1ISPA 4J91A 3OZAA 1YULA 2ZWOA 4LDAA 1KP2A 4PAQA 4V0KA 4ZO6A 3UH0A 1YB5A 1DU4A 1I32A 3A32A 4EGAA 1SD5A 2YV2A 4IF6A 3RKUA 2B82A 5A9TA 4MGZR 4DDMA 5ALGA 5SYNA 4GW3A 3HZHA 2MSWA 3OVMA 4I9HA 2HQRA 3PC6A 3ZHRA 4DLKA 3VC7A 5BQXA 1TCVA 4LOHA 2ZJ3A 3OQVA 5IJXA 4DIBA 2QJOA 1KVTA 1EX7A 2W6ZA 3RGWS 1JIUA 1RHKA 3OLCX 1NGSA 3MZ0A 2GBGA 4PQRA 1LCIA 1JW9B 3KZXA 4RY8A 1IPFA 3EC2A 1MVNA 3SYTA 1Y89A 1RQGA 2AMLA 2ZR7A 1PQ4A 3K0BA 1QHHB 3H4MA 1S89A 1UMBA 1PR4A 1R0BA 2R1UA 2WICA 4JQOA 1R50A 1KARA 1NN1A 2TSYB 2W2QA 3PDUA 3PXAA 2FG5A 4FP9A 4HGPA 4ZT2A 1DE0A 1ZK2A 2PRSA 5I5GA 2E7ZA 4IIJA 3GUVA 3M6IA 1BA2A 1KFJB 3DZHA 3G5LA 2C4VA 5CJJA 3K9WA 4B3SB 4OOEA 2DFTA 3HP1A 1OZ0A 5CYGA 3WGOA 1UBLS 1WLSA 2CFIA 4N8EA 4ENUA 5BQOA 2GN1A 1LDGA 1RMYA 1UK8A 1U3DA 1ZD4A 1KERA 3DZKA 3H1PA 3RWOA 3AFOA 4ZPXA 4DUGA 1E63A 2EGGA 4I1SA 2D6FA 2XZTA 3QPDA 2WKQA 4Q37A 3G2HA 4QU8A 4OOFA 4XLZA 2VKTA 4E14A 4ER5A 5B1EA 2FPXA 4C7OA 1PP4A 5DNDA 5AHOA 3Q6IA 5DHAA 5ADUS 5LOVA 4HGYA 4EUSA 3FYSA 1VRCA 1A82A 1CG6A 1IEXA 1FYXA 1LA2A 2IYLD 4MITA 2IEBA 2NGRA 2ESRA 2I65A 4ARZA 1EBFA 1Z4NA 1JAZA 4D46A 1LPPA 3QV1A 4LJKA 2OSVA 3ITNA 3L0YA 3MIZA 5EOVA 2RHOA 2PO5A 3DEHA 3WWCA 2DR2A 1UMCA 1BROA 1CQZA 1FJ2A 2FKAA 2FXIA 1N8SA 1ZM4A 2G70A 2OT3B 3BS4A 3E3MA 1TMOA 3NBFA 4O25A 2G06A 5EWJA 4MVJD 1EUQA 1PG2A 1DWPA 2PDAA 3CRZA 3CEJA 4M0KA 3QEJA 2WT9A 2H54A 4N48A 2WHXA 3DQPA 5C35A 1G0NA 4AFNA 3RS7A 1L5RA 2ODTX 3LUPA 2CMHA 2A9FA 2Q8QA 3GA5A 1RWWA 2DWPA 4PAOA 1JAXA 5HBRA 1SU8A 3S2IA 3AXSA 4HATA 4RC9A 3B6JA 4HH0A 3ZG6A 1JEYB 4K9RA 2V5AA 1W9HA 5G4KA 2GAAA 1JBQA 1AN0A 1IULA 5B3AA 3RKRA 1KEKA 3VU0A 2GH1A 3AHDA 4LXUA 4UTNA 1A71A 2E85A 5H5JA 4M46A 4DRXB 3F6YA 2D2XA 4LIPD 3ND8A 2CYAA 5H3HA 3C5WP 3FSGD 3KLBA 3JATA 2IU3A 4O4IB 1NC1A 4U1RA 1NVVQ 4PSKA 4L9RA 4N18A 3IEUA 3AL3A 1E7MA 1OLSB 2AA3A 4C0QC 3Q0EA 5B3LA 1D6NA 4N6NA 3PGVA 4G01B 2QHXA 4MI9A 1ATIA 3ANTA 2CLDX 4V0NA 4QYSA 3X2SA 1N5MA 4AMYA 3OO1A 2PS3A 5DXJA 3UM9A 4BNUA 1WXFA 4LXHA 3G3EA 4FGWA 4F5ZA 4MVJE 4JJ4A 4CM9D 4QJIA 8MHTA 3U49A 1FTYA 2PWBA 4MPDA 4L8LA 2FSIA 3A3NA 3GF4A 1DSSG 1BZYA 1GPBA 2GCIA 2J7KA 5TY0A 4A8JA 4CF5A 1R9MA 4QFCA 5F1OA 4ZD6A 2RJOA 3SQDA 1L3IA 1XDZA 4MVJA 4US1R 3SSOA 4D44A 1CJBA 3IKTA 1HLFA 3C7DB 3A1UA 3JQDA 3WSVA 3W9UA 4BZZA 5BOSA 4MV6A 5HRUA 2H85A 3LWBA 4LAFA 4Q6BA 1QBGA 2CMGA 2VF8A 3QWIA 5ILQA 4O4LA 1Z5OA 4KWTA 1TGYA 2B34A 3SZOA 4L78A 4CE6A 4BMVA 3S44A 4AG6A 4HRAA 1WSWA 1VQ1A 3DGFC 2P68A 3FHTA 2F17A 2BWJA 2F1HA 4QUEA 4DLXA 5IT5A 3VUEA 7REQA 3V4SA 1XK7A 2M2IA 4JL5A 1C0LA 1OXXK 1KZ4A 5GJWC 1WX1A 1QLWA 2R7AA 4G63A 4ZQIA 3FSGA 1WPQA 3Q98A 2IQIA 1ENYA 2RGUA 2AN1A 2GA8A 2HSJA 4MP8A 1P2UA 3QLJA 4ZZ0A 1E20A 1UPUA 4NEHB 4ZANA 3UMFA 4BFUA 4JODA 2IV7A 3OZTA 1QFYA 2WUWE 3Q41A 5ICFA 3KU4A 3Q9UA 4RTOA 5EXEA 3AHFA 1Y1PA 1F2UB 1AZSC 1RBZA 3DV9A 1XDGA 3U7RA 3A05A 2IOQA 2Q3CA 2VK8A 3STTA 3GEEA 3WHKA 4AJPA 3ZWBA 1W48A 4CM9A 3S2UA 5LQJA 3O8RA 2VH5R 1A0OA 4FZRA 4UW9A 3K9NA 5AVWA 2ZAMA 1GRVA 4BO9A 1G9SA 3KYJB 3QPAA 5AJHA 5CJPA 4C7KA 1XYGA 4I5DA 2NV2B 4OK6A 2WF9A 2P2LA 3FNRA 4OY3A 1B74A 3GFTA 1QYCA 2ZRHA 4ZK6A 3DDHA 1YQXA 3W77A 3C2QA 4EFDA 4JLAA 3E1KA 4TN1A 4EHDA 3RVDA 1I1NA 3JWPA 4ZU6X 1IBMB 1KP9A 1IOVA 1IHDA 2GVDC 3LY8A 1FFCA 1YBMA 2JGAA 2AB0A 2ZT6A 3FNHA 4MV9A 1NU8A 3N7UA 2RAPA 1H2FA 1XMXA 3KZOA 4YYZA 3ZGLA 3DKRA 5IVKA 4Y1RA 1ZI6A 2IZ6A 3B9RA 2TS1A 1M66A 1VGQA 3PE6A 3WLFA 4F12A 3HO8A 5CT4A 3UQZA 1YZGA 4OHBA 5BVGB 1JIVA 2LPMA 4IHJB 5FPTA 1I2CA 3TIVA 3M3HA 3V4FA 3ICOA 2WAMA 3RHFA 2FFBA 2X0KA 1Z0AA 1ZH0A 4BO0A 1KYIA 3QIVA 2LCQA 3RHTA 5IZCA 1Q44A 2RB5A 1AUVA 1YF3A 1XZMA 3MS2A 4GWGA 3HJBA 3GLIE 2Q9UA 4R2IA 3NEYA 4YHHB 4UHKA 2ZWPA 4MEAA 4W6ZA 1K5PA 1YR2A 3FLBA 4NNJA 5I3ZA 3DJYA 3EGVA 3GGSA 3ORFA 3CZQA 3KUKA 5F4ZA 3BGIA 4KKVA 3DM5A 3TTWA 3BX1A 2W43A 3KTAA 2EKDA 4A15A 3O7MA 1RWNA 4M98A 3A2KA 3KPVA 4XDZA 4P3PA 4F4HA 5C51B 2X40A 5KSZA 1ZJYA 5E4JA 4V38A 2VWGA 3GT7A 2WB4A 3JQAB 4XSHA 4DMFA 1X0XA 2XQJA 4CKZA 5JDIC 5FOXA 1P7VA 1QHGA 4IXDA 4CZ2A 2VYCA 5J59A 4DN6A 4JXXA 1RM5A 3NEPX 3T0IA 3THXB 4ER3A 4LRUA 2ZB4A 4JT2A 3GT0A 1UL1X 4OHCA 1TA0A 2XNCA 3EHDA 1R0RE 5KOJB 1LDNA 3I9V6 3OZEA 1I4DD 1G7SA 2IX9A 4EM6A 1OYOA 3RF6A 4CEJB 5H83A 1ECLA 4X1YA 2OG1A 3DE4X 4RK4A 4R7ZA 5DH9A 3WGNA 1JHYA 3A6ZA 1YKSA 3NKFA 6AT1A 3ZC3A 1Q7BA 1EDDA 3C4QA 3NC0C 4CGZA 1Y42X 3D3WA 3ZV6A 4MH0R 3VDMA 4LK3A 1W6RA 2ZJZA 1RFLA 4F46A 2PSHA 5GOTA 5FWNA 1PE0A 1A7KA 5IDQA 1TD9A 2JC3A 3CVOA 3EZ2A 3FMPB 5TGDA 4CT5A 1WETA 3VR2D 4AD8A 1VL8A 3OCXA 4GD3Q 1NAHA 1US8A 1ZH2A 1E3LA 5EXSA 3KQTA 4NI5A 2KQUA 2YTZA 3ZTYA 2XDQA 4F1JA 1PBTA 5BNFA 1A77A 5LPNA 2H51A 2P9ZA 4FDUA 4ML3A 4QJ5A 4WDRA 2AN3A 1K5DA 3FPCA 3IFSA 3QNWA 4FUQA 2DAPA 3CISA 2VZ0A 1FU4A 1TPYA 5IU6A 4C04A 2NMVA 1IATA 3OHMA 1LW7A 3UMCA 1G64A 1PV1A 4RM3A 3WI7A 3D0RA 4R8RA 4OEHA 1II8B 4AO8A 2RBKA 3E27A 4TMYA 2VBCA 1T9GS 2IEAA 1DKLA 3NCTA 4LJYA 5EHIA 1QUEA 1GGNA 4R1TA 1PWYE 3WO1A 5CFPA 1PDOA 3ZYZA 2JCGA 5BR8B 3AP3A 4ID3A 1OWPA 2XBLA 2E4UA 4K5QA 4ESOA 5BSHA 4JU8A 5MDHA 2OC9A 2BN4A 2CFOA 3FB1A 5FYDA 2V6JA 3KPWA 1ZKDA 1CY4A 4CLOB 5DYTA 4N12A 3KO8A 2UYQA 4YBZA 2XGJA 2NT3A 2XTZA 3DXYA 4UUAA 1PVOA 1A1SA 4P93A 4AKGA 5K3AA 4GBJA 2C5GA 3LBAA 1I14A 1PNTA 3ZXIA 4F92B 2HA5A 2YXEA 1TJNA 4HNAA 1CWUA 2FLWA 4AB1A 3LOQA 4D4JA 3SMVA 4WK0B 4HOYA 3D0OA 4BMDA 4C0BA 3JU3A 3VR2A 4DREA 4FK8A 2H8GA 4NEGA 1F17A 1O6GA 2H9IA 3LY7A 4A0GA 3KOOA 3I39X 4RPKA 1JI3A 3SG0A 3KX2A 2Q5QA 3P4UA 2W37A 2WJ4A 3TYXA 1M6YA 3VX3A 4HNSA 3GZJA 2VT7A 2H1OA 2J59A 3B13B 5U4QA 4QQFA 2P0YA 1E4VA 2XGGA 2I7TA 4MIKA 1U6JA 3VAZA 1KY2A 3OY2A 3K09A 1SHTX 1ZUD1 1Z39A 1GQSA 2P79A 3TTXA 3G23A 1IY8A 3I5MA 4TWZA 4GNRA 3D6MA 2AJBA 2AI3A 4MVWA 3TOXA 3WXBA 3W78A 3AEUA 4C4AA 1EGVB 1SK9A 1UH5A 2PS1A 4PZ9A 4B6SA 4WZAA 3PR3A 5JIBA 2P75A 4WV3A 3WZ2A 3S0JA 1J23A 1O6CA 3KT0A 1XX6A 4HGOA 2G5TA 3QTBA 4CMIB 1IDOA 4TRRA 5JPIA 5H4HA 1RYHA 3H4VA 1DP4A 4YMUA 3IUNA 4MJLA 3OAAA 3WIDA 121PA 2HSGA 4JBWA 5E3IA 5EKSA 1IN6A 3HMKA 1BMTA 2Y99A 3M81A 4PGAA 2DR3A 3SICE 2A78A 1G5RA 4ND1A 1IN4A 5JWOA 3F9CA 4UTZA 5DX1A 3CZ5A 3HCCA 3O31A 1D1TA 4G6ZA 4W5WA 2JBAB 3G8CA 4JWTA 5B36A 3CVXA 4DV1B 4LFAB 5CX1A 4U7GA 4ZVQA 3KTFA 1DRWA 2VIIA 3TVDA 4BB6A 1P2FA 2GPSA 3PQ8A 3PUIA 4NMWA 4XUGB 4LCEA 3FDIA 4C07A 1PT6A 2EHDA 5BSVA 3EPLA 1Q1ZA 3A31A 5DF1A 4H7JA 5CFMA 721PA 1XB2A 4NZOA 3S1SA 5F9HA 1Y81A 1V11B 2GYYA 5EINA 1MT0A 4JOQA 2OHGA 3LBFA 2JLQA 4RGBA 5D87A 4C7XA 5EJFA 4D6YA 3JQ8B 4NBKA 3HYSA 2BZGA 2YOHA 3V1KA 4EJ6A 5L40A 1KDOA 1FDUA 2CUZA 2JIZD 4ZMSA 4IJMA 4KZKA 4XQGA 4FUTA 4ZZ3A 1V3TA 2GBIA 3GRFA 4BGEA 4KGVA 2WD7B 4Y18A 4ESEA 1UQTA 1KR2A 1UIRA 5EP1A 1SBHA 4AUNA 1SOUA 4HTAA 4G81A 4DR1B 3CLVA 3K0HA 3W6NA 3MN1A 2A84A 3GDOA 4J2TA 4TQGA 3UJPA 4YMLA 1T4DA 4L9SA 4K05A 1JB9A 3IHWA 2WMNB 3EQ7A 1ECJA 4OFBA 3F3KA 4Y2SA 4BRUA 1XP5A 1BVUA 3M4YA 1GXSB 4YFYA 1OASA 2AHOA 2O05A 2YJ6A 2Q0HA 2GJ4A 3CLSC 3D5TA 3OM9A 1E6CA 1ZRHA 5JSQA 4JASB 4BVBA 4MULA 3ZOZA 2FYTA 4G8DA 2DH5A 4GRAA 4WDQA 2NVUB 4OB6A 1PEYA 2XW6A 3PPYA 3L4BC 2ZIWB 2BP7A 1N77A 1R74A 3QXSA 3ZWNA 1VLMA 5B2ZA 5LXTB 2YVAA 3O7WA 2CNWD 5F12A 1BS9A 3K0CA 4TL8A 4JJ7A 3SF0A 4CG1A 1IIRA 5COAA 3N86A 3TOCA 3AG5A 3RJTA 1VE5A 4N3CA 5A4AA 3QF4B 4X45A 3EX7C 1HDIA 2P6RA 4XUDA 5TJHA 1XDWA 2YMLA 4CKEB 1E2DA 5CDTA 2R2GA 4EG7A 2JIZA 2A5JA 1OLUA 2AVDA 2K2QB 3UG7A 5LYYA 3AW9A 3PITA 5EIOA 1NUHA 4CKWA 2WKPA 1O57A 5JJLA 2P3OA 1O5TA 4UHBA 1RPJA 4R54A 1S4MA 1VHJA 2JFWA 4HAZA 1SVSA 4AP5A 3D6JA 5ITZA 3IR5A 1JSCA 3IOCA 1E0JA 4LCJA 5C37A 1OB2A 2O7RA 2OBFA 1DT5A 3C6BA 3GEIA 4PNEA 2PLFA 2B1RA 5KTMA 1E7YA 2QL6A 3CVYA 4HWPA 4B79A 2CL7X 4JLJA 3AGQA 1QF7A 2H29A 4C76A 3V2UA 1LBQA 1OXMA 2WU4A 3VHXA 1VIAA 2B0CA 2BFWA 4V0QA 1ICIA 6ADHA 1TEZA 3NBZC 5JAIA 3V4RA 3FOFC 4LY0A 1R8YA 4H9GA 2AVNA 4RVCA 2IT1A 1AKNA 4WWHA 2WM8A 3K0FB 3IALA 3RU2A 4QAJA 1VOTA 5FNVF 4COOA 4XM2A 5HJ5A 3T5GA 3RCBA 2CNWA 2C9CA 1E5QA 2GGSA 2C2XA 3AV0B 3WADA 1J25A 5EY5B 4BQPA 1GOTA 1FDOA 1OSNA 1W5TA 1YK1A 2DRIA 2GCOA 3KE9A 3F0TA 5E9WA 4YRLA 3I4LA 4P3KA 3M83A 5LD2C 3Q7PA 2PIAA 4R3UC 1C30A 1I6MA 2FF5A 3O4VA 3ZBUA 1GUAA 1YBFA 2V6FA 2FVYA 3L2OB 4FN4A 4M0CA 6REQA 5AW4A 5F2EA 1VJ1A 1EWKA 3EAFA 1NG1A 3EVFA 5AJXA 3LBIA 4EY3A 4JYZA 1CR0A 4RMHA 4HMOA 2EQAA 3EXEB 1WXXA 1JU9A 2GJSA 3MINA 5DLPA 3CUYA 2AXNA 5C7YA 3GZNA 2Q62A 3QVVA 3LIPA 4FI3C 4DVJA 1NQAO 1AJEA 4WKCA 5LR6A 1JG4A 4YIHA 4J2HA 3WLKX 4OBEA 5CK5A 1KVQA 5EJ7A 4OTZA 2WFLB 4CU2A 4TMXA 5BWCA 7REQB 1IBSA 4S2EA 3PNSA 1XALA 1WZUA 3N5CA 1XTUA 4HDSA 3TI7A 1UPBA 3DV2A 5AJWA 1CFZA 4QGAA 3STHA 4PHCA 3B48A 3JZFA 1TFRA 3A6HA 2R00C 4ABTA 4GYWA 1QH1A 1L7NA 2FPPB 3VYUB 3EPJA 1LZLA 5IN5A 4KR9A 2J3JA 2CHUA 2QJFA 4WT7A 1FNCA 1W581 2QI9F 2X8AA 1WS6A 2YV3A 4GSLA 4N40A 3WYFA 3T4EA 2DUMA 3UJHA 4OI4A 1YB2A 3FOEC 1MOQA 2A94A 1QOZA 2XJ9A 2YDXA 1W76A 3ZIDA 1JI0A 3HR7A 4RFLA 1E3JA 1EUDB 1NVFA 3EBLA 2AJCA 1LZKA 3AR8A 4PNPA 4UZFA 4DPMA 4OHXA 2JD0A 3NDRA 5IXJA 3D9QX 3OT4A 3TQQA 4UTPA 2I2XB 2GHRA 3DCJA 2FZVA 2Q3FA 3FBGA 3OOEA 1TUBB 4C3OB 5H9VA 5I01A 2WYHA 1KQOA 4D9NA 4QT0A 2DLDA 2Q6LA 2IP2A 4CV3A 1OGYA 1WLYA 3GJ3A 1XTRA 3F7MA 3FLAA 1Z0FA 5FR2A 1Q1GA 2AC7A 3BH0A 1PVDA 2ZJAA 5TRTA 1WBBA 1L7BA 4TXHA 1E8NA 1FSPA 4M7PA 5DSTA 2A9OA 5BNIA 3F5DA 4N76A 4G67A 5GZ1A 2EARA 3TGWA 3ZQUA 1NJ2A 4JSRA 4IDDA 3NNDA 3T4PA 4FXPA 4I50F 3BAZA 1RHJA 1MABB 4IOKA 2M6LA 2CCJA 2I1QA 2ZRGA 5IDYA 1SELA 3ZGNA 1OREA 4CG0A 1IH8A 3L3BA 4YUWA 1ZOIA 4ETMA 3HNOA 4WOKA 2Z5VA 3FYTA 3UH1A 5JROA 2Z3WA 1L4LA 3VTKA 1BHSA 1A9SA 1L8QA 1VFNA 1G9TA 2X22A 2ZM6B 2YW2A 1BO6A 1IZ8A 2OD9A 3MTGA 3IMEA 5DULA 2YINC 5A7HA 1G18A 2RG7A 2IGTA 1WDKA 1I3MA 2V7WA 2VC2B 4WEQA 5EWMB 4W9MC 3RVBA 3G02A 3E2PA 5JZSA 4D45A 3KT3A 2ODPA 2P8SA 4PPNA 3QA3E 1MX1A 1WXEA 4DLSA 2FFAA 4PVDA 4RU1A 3LPCA 4C0LA 1A27A 4MXDA 3AUFA 4R0NA 4UASA 3UGTA 1PR1A 4YT5A 4PSAA 1LLQA 1NW6A 4KR0A 4MPJA 4RA6A 2FY8A 3BWXA 3EQ8A 3ZV3A 3MWDB 2E6KA 2NOAA 1EWYA 2YS6A 3QKUA 3WLPA 3IP9A 2HHLA 4A73A 4LTNA 3IUEA 1M2OB 4YRRA 2K2WA 4JUFA 3ZCRA 5EAIA 3GLHA 1NVVR 2UYHA 3WGIA 3GK3A 1M33A 1PN3A 1CYEA 4Y6OA 3ESQA 1QH9A 5DI9A 1EA7A 5LZ5A 4KSCA 2BV3A 3KVVA 3SZLA 4RGYA 1MU0A 1GKKA 1WP9A 1ZYUA 1AHPA 4M0UA 4WH0A 1CTQA 3D6VA 5CT9A 3PXCX 4K9MA 1JKJB 5CNMA 1V43A 2UUAB 4HYQA 1VBFA 1Q7EA 2WF6A 1TYBE 4JAVC 1QORA 4JD5A 1MA3A 4JLBA 1UT5A 3LC2O 4M1SA 3B20A 4UM8B 4Y9RA 5GGXA 3X2FA 4FDMA 3PXBA 1A96A 2HDHA 2W8ZA 3JARA 2DUJA 3UUWA 4IILA 3R9IA 3RTCA 2EQ5A 1LWNA 1QIGA 3JVIA 4A0HA 4W1PA 3L40A 4PLFA 5HK9A 4FGJA 3AF6A 1RC0A 1EYZA 2P9HA 5DTRA 4JVNA 3HYNA 4P5EA