4Q4HB

Tm287/288 in its apo state
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
583
structure length
583
Chain Sequence
GPILEKPALKNPTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEKDDPDAVELREVRGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ABC transporter
publication title Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 216
structure length 583
sequence length 583
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
B PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 4q4hB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q4hB02
3RSLA 1W0JD 3KQKA 1EG7A 1W5SA 3KL4A 4XWKA 4IDNA 3A4MA 1OXXK 4DXAA 2IYUA 4TLDA 5FH9A 3BH6A 3AVOA 2OILA 3SBEA 4NTZA 4MRNA 1E2QA 1CULC 3AVVA 2P6UA 1XTJA 1ZUHA 2VSFA 3QNUA 2ZRBA 1G3MA 3GLFA 2GF9A 2XNDA 2JIZA 5JMTA 5FL3A 4HUTA 2ZR9A 5J4HA 2XJ4A 4DBLC 2WAXA 1G4AE 1M6NA 1LS1A 2F6RA 1N5JA 1GRNA 2J41A 3MFYA 1E2GA 4IRUB 5FOVA 2ORWA 5KPDA 3LX8A 4QBHA 3CBQA 4FCWA 5FR1A 2GF0A 1TEXA 1N5KA 2N42A 3JVVA 1MT0A 1R5OA 4RZXA 1OT3A 3THYA 1W4CA 2ZUDA 5KDDA 1WBDA 2WOOA 3G82C 1IY2A 1OIVA 2JEOA 4Z8XA 2ZJ8A 3KKQA 3HDTA 3SI7A 3TW4A 3SQXA 3DVLA 3GP8A 4G3XA 3GPLA 1XCPA 1FP6A 1RRGA 4NBSA 3WRYC 3KB1A 5K8IA 4L5BA 2VSOA 4QKQA 2DHRA 4GNKA 5FPKA 1T4GA 4QM7A 1Y63A 4QOSA 1NIJA 2VP9A 2VP6A 3Q5EA 5FPHA 3P1JA 4ERNA 2GNOA 2IYSA 3T5DA 1PJRA 1S96A 2IHBA 2OSBA 3MMPA 1KJZA 2BKUA 4EPYA 4IXNA 4WXRA 3EG5A 1HE1C 2C03A 3FHTA 2IUTA 4NHOA 3LO5A 1JR3D 4US1R 1GNPA 1OPXA 5DO9A 2DFTA 4RFVA 1ZNWA 4C7OA 5B57C 4PQRA 1M7HA 1S9HA 3W5JA 2IYQA 5DH9A 2G0TA 2IT1A 2JJ1D 1IN8A 1ZIPA 3TVDA 2PEZA 1Q44A 1U0LA 2FSGA 4N3NA 1T0HB 3P32A 3TW8B 3WYGA 4CEHA 4UNNA 2N1BA 1B0UA 3BBPA 5EZ5A 1LNZA 1CRQA 1MKYA 3RVBA 4RD6A 4A8JC 4DB2A 1GWNA 1HYQA 3NBFA 4Q48A 3EPLA 1E1RA 1ZCBA 2ZEJA 4WBSA 1ELOA 2ZU6A 1ZC3A 1KZ7B 3OESA 1NI3A 1K5DA 5F98A 2FWRA 3Q72A 2IYVA 3U6KA 3THWA 3DO6A 2ZJOA 2AL7A 5TXGA 3QVVA 2R6AA 4OJKA 3NH6A 4F38A 1SXJC 1JR3E 4LJAA 3LAWA 3ZGXA 1EX6A 2WWGA 2B21A 4LHZA 4LOAA 1W36B 3DPUA 1OKKD 5K8LA 2GVDC 2IA5A 2QRNA 2FNAA 3BXZA 2W6ID 1U90A 2Z4RA 1QHYA 2CJWB 3QSYA 4ITRC 2QZ4A 1T0JB 4PHGA 3TJZA 4FMCF 2ZREA 4AK9A 2P3SA 1M2OB 3X1YA 5AUOB 1ZD1A 2ORIA 4NH0A 2VL7A 3H84A 4BE7B 4OI4A 3CZQA 2YWEA 2OCYC 1SXJD 3VKGA 3ZVNA 3U3JA 2OEPA 1V5WA 1D5CA 2IC5A 2R62A 3K0FA 4LBVA 2O8BA 3KXIA 4MYCA 2LWIA 4V0ME 1P2TA 2GEDA 5B2ZA 4BRUA 1JI0A 1G1MA 2QI9C 2WHXA 3GQBA 4XJXA 4ACBA 5HKKD 1VYVA 3ZDQA 2IF2A 2ZUCA 4XVQA 1QHHA 1TF7A 2QA5A 4RZ2A 3TUIC 3PEYA 4LDJA 5FI1B 3DMNA 1HT1E 4OBEA 4AD8A 1OHHA 3T06B 1CIPA 1KTVA 2KI5A 3CF6R 2AX4A 4TLEA 1R2QA 1ZIOA 2ZRJA 1G291 2W2VA 3EZ2A 2ZRLA 1BS1A 5JS7A 2JLVA 3AB3A 3L0OA 4ZKEA 1DAIA 1KIMA 4JLMA 4B3CA 2R65A 5P21A 3I62A 2GXSA 2FMXA 3CR8A 5KTYA 1SXJE 2GXAA 3B60A 1KDOA 4U7DA 3SFZA 4E03A 4B3DA 2UZIR 1M34E 1MH1A 1II0A 3CB4A 3EWSA 1NKTA 3HP1A 3RRZA 4Q1AA 1KMQA 1EK0A 1XEWX 3OE7D 2UZ3A 1E9AA 2QM7A 5FBRB 1ZNYA 3AVYA 3BFXA 5SZIA 1ESMA 3CW2A 4BEBA 3LWNA 1Z28A 1E2KA 3KFXA 3V9PA 3OIUA 3GJ5A 1DAFA 3QUSA 3EC1A 3B2EA 1G21E 1Z6XA 1IN6A 2XITA 4B6EA 4ESHA 2DYKA 2V54A 3I8XA 4MGZR 1OH8A 4HAYA 2GCNA 3ZD6A 2QAJA 4LHWA 1C1YA 2P0EA 1AS2A 2G9NA 2XXAA 4QGAA 1XMIA 5G3ZA 2IS4A 2J0VA 2VEDA 1X3SA 5D3QA 1FOEB 2XJ9A 3F3YA 3QE0A 3RLFA 5JEDA 1QDEA 5JI3E 1XPOA 2PCJA 3MCAA 1DBSA 1IBRA 3K0AB 4D4KA 3RYTC 2ZRPA 1E79A 2JDIA 1HTWA 2YC2C 2XTMA 4DLRA 2ZQ5A 3EIEA 3K09C 3RAPR 3TVTA 3CUEF 2B92A 2RHMA 3BERA 3JVUA 3BOSA 4W5JA 1CLUA 1KAOA 6Q21A 3N2IA 3EZ6A 1PLLA 4US2R 2W0MA 4Z51A 1SZPA 1VCOA 4XD7D 4DKXA 5BW8A 2HT6A 3ZH9B 4XSHA 2J0UB 4RD1A 2F3TA 4BFSA 1FUKA 3GJ6A 4TMKA 1PUIA 1OFHA 2WWHA 4A1FA 4D80A 1N6HA 1YZLA 2XNSA 2ZYWX 3P26A 3ZVRA 1GVNB 4JMPA 1SKYE 2ZJAA 4C4PA 2OM2A 2AXPA 5DISB 3QEOA 2R6CA 2P5TB 2CLSA 1QG4A 5SZKB 1GKYA 1JNYA 3BK7A 5IT5A 2CE7A 4M21A 2O8DB 2PMDA 4GZMA 3LH5A 4D0NA 4RFSB 1W49A 2ZE5A 1L4YA 2ORVA 3FMOB 1G18A 1RW4A 5FOTA 1QHSA 3IIJA 3PUYA 1G7TA 1GOTA 3UXMA 4HLUC 2WIBA 3NEJA 1NVWQ 2C04A 2ZRIA 4FN5A 4I81A 1T3SA 5TARA 1KKMA 3RDPA 1W0JA 2G3YA 3IO3A 4RVCA 1DAMA 1YE8A 3AVTA 3LD9A 5F9FA 3ONWA 3THYB 4PC7A 3CF0A 1ZINA 3R7WA 1Z63A 5J40A 2ZRFA 2OFOA 3VR3A 1RYFA 2KB0A 1O3YA 2GJKA 2ONKA 1IAQA 5D3MA 3WNCA 3ADCA 3FMPB 1R0WA 1GL7A 2REBA 1AZSC 3VFDA 3LDAA 1EESA 3CWQA 3ADDA 4WZ6A 5G53C 2DPXA 2XB2A 1UPTA 3QXHA 1P75A 1D6JA 1TQ6A 2O8FA 4UNRA 4LK2A 3U2QA 5KO2A 3MWJA 4W7SA 1IHUA 4CYMA 3A1TA 2CCJA 2SHKA 4ACAA 2PJRA 1RVDA 1CR0A 4JJKA 1DARA 5J5CA 2ZSEA 3IEVA 4NZYA 2NZJA 3VR2A 2QAGC 1CJKC 2L0XA 4C7OB 2LCFA 3AKEA 3VNVA 2XTZA 2ZJZA 1CJUC 3K1JA 2FN4A 1E99A 2GK6A 5JJLA 4MKIA 1XJQA 4DB4A 2NO6A 2AK2A 2O0JA 2O8CA 4EJSC 1W5TA 1LB1B 1LTQA 4CEHB 4FWIB 3U5ZB 1OH6A 4HAZA 3O8DA 1KO1A 3C4JA 1FP7A 4PSAA 4TMTA 3B1WA 1BH2A 1E98A 1GILA 2WZQA 4OHXA 1L8QA 4PC3A 3X2SA 1JR3A 4TZ0A 1GL9B 5K8UA 1JEDA 1G3QA 4MA4A 3AP2A 1Z2CA 3UANA 5FUYA 4AKGA 1R0YA 2C2HA 4KBFA 1E2HA 4FWTA 3THWB 2XEXA 2V1UA 2HXSA 3SJBA 3DL0A 2JJ1A 5FUVA 2WICA 3TSOA 4MKFA 2A78A 2EFCB 3GJ8A 4OI1A 3H2YA 4Q4HA 3UPUA 3J81k 4LV8B 4GRAA 4C0LA 5L3RA 1TAGA 3SBDA 4LPSA 3QJYA 4L16A 1LW7A 1NNEA 4EFLA 1UDWA 5LD2C 2RMKA 3W6NA 2FV8A 4AIIA 2D74A 5DGXA 1GITA 4DLZA 1E2IA 2NO0A 1UKVY 4V0MA 3RRYA 1U8ZA 1NVVQ 1C9KA 4DDVA 4Q7JB 2CE2X 3SNHA 3NBZC 4HI0E 1W46A 3K0FB 1KGDA 2O8BB 5EXTA 2BMJA 4W5HA 1TUIA 4W5WA 3WBJA 3DKPA 2Q3FA 4Q4AA 3B9QA 2JCSA 2A2ZA 4DLWA 4KFUA 1ZM4A 1OKKA 4JBYA 4URWR 4WAUA 4DWJA 4A8JA 2ZM5A 1QHHB 2W6IA 1IN7A 1XD2A 3RRMA 5DI3A 3EX7C 3QQ5A 3EAQA 2ZJYA 2KE5A 1JB1A 1KI9A 2RH5A 4PPGA 3ZIAD 2WSMA 3PUWA 5M04A 1U9IC 2OAQ1 5GJCA 2QTVB 1RC8A 3ASYA 1XMSA 2D62A 2WJHA 4GP6A 4DEYA 1WA5A 3PENA 4KVGA 4DCNA 1SXJA 4Y0AA 1ZAKA 4A4DA 4B43A 1X1SA 3FB4A 3I61A 3RS7A 1IXSB 4CT5A 1LFDB 2WSSD 3U7HB 3WXMA 2BEJA 4BRWA 1U0HC 621PA 3K70B 3CPHA 5HKKA 3MWLA 1G8YA 4LWZA 2IEZA 4R9UC 3GLGE 3H0KA 2PZEA 4A92A 3BH7A 4N0DA 4DSTA 2OT3B 5AUPB 1QVRA 1UEIA 2WVJA 4UNSA 2P6NA 4ZI2A 2ATVA 4J0QA 1BIFA 1BYUA 4LCBA 2YJTD 1Z83A 3SHWA 3ZQJA 4KAXA 4URZR 2P67A 1FW6A 2E1RA 3PUVA 5FR2A 2YWGA 3QXXA 4H9GA 3SN6A 2HJVA 5DN6D 2ZI6A 4JSTA 2I3BA 3I8SA 5EXSA 4RD2A 1L2TA 3RS3A 1W44A 5H8WA 2XXAB 4TYPA 2IUUA 1F3OA 2BWJA 4LBWA 4Q4LA 1VCIA 4MUBA 5DYIA 1S9DA 3U4QA 1G64A 4MRRA 3QPVA 2VF7A 3OE7A 4MGIR 3NHAA 4GL2A 5GJWC 3R9IA 1IY0A 3KZ1E 4ON9A 4TTQA 3N70A 1ZNZA 2GCPA 3TUZC 3B1XA 2B8TA 4TTRA 3RANA 3NC0C 1S0UA 3BH0A 3CH4B 3W6OA 2VSXA 3LW8A 3DM5A 1X8LA 1G3IA 2YNMA 4QRHA 3I73A 4JLKA 2WMNB 3UK6A 2QMOA 3AF3A 1ANKA 4L4UA 5FL7A 1XPRA 4JVLA 3DZ8A 1YZNA 4FW9A 2IYTA 4N0EA 1NLYA 2IXEA 4IHQA 5EXXA 4U00A 3VR4A 3CRW1 4LPKA 4BUJA 4P0TA 2EFHB 1V43A 4B35A 3FFAA 1G7CA 1SVWA 1OFTA 5TV2A 4A0FA 4ILEA 5CLQA 1PV4A 3VMFA 3C5HA 4BGDA 1U99A 1PVOA 4A9AA 4MKHA 4LSGA 1N0UA 1DELA 2D06A 1XNJA 3VU9B 2ZSBA 1KOFA 4BFVA 4YXWD 5KSOA 3WNDA 2F9MA 3CRRA 4FINA 4DLTA 4DLVA 4TZ6A 2WWXA 3MGCA 4QJ3A 1D9XA 4JIMA 1E6CA 1S4QA 1IONA 3SDZA 3CX8A 1JJVA 4XD7A 5CJPA 2YWHA 3IBYA 1KDRA 3CONA 5A5GA 3T5GA 4C0BA 2KBFA 5IHPA 1WMSA 4IFBA 2R2AA 4C3ZA 3K09A 1E9EA 4PC1A 1D9ZA 2FSIA 3LBHA 4LC0A 721PA 5G40A 3IDQA 5TMPA 3HU3A 4QM6A 2ZE7A 2VH5R 2I1VB 3UMRA 1VHTA 3EPKA 1OXVA 1AA9A 5D3MB 5EP3A 4KYUA 3ZZ0A 1Z6GA 2ANCA 3AF1A 1IN4A 5CM9C 4PO1A 5FBWB 3EXAA 3QKTA 1RZ3A 3KKPA 4M1MA 4ZDJA 4ARZA 4M1KA 1J8YF 2AFHE 1OYYA 3E1SA 1Q3TA 2O8FB 5C46F 2C77A 1OB5A 4F92B 1GM5A 1CBUA 2UVQA 1DVRA 2CBZA 1G3RA 3D3QA 3K9LA 4KCGA 5HZHA 5JI2E 3AP3A 4NU0A 1UBFA 1E9DA 5B30A 4OL0A 5CLLA 1IJEA 1E96A 2YHSA 3MJHA 1EX7A 1RJ9A 5J4YA 2JLSA 3EW9A 3GFTA 3ZZUA 1WE2A 1X1RA 4LRWA 1TU3A 1N5IA 3CRVA 3PIRA 4Q7KA 4HLUA 5EUQB 2BBTA 1FTNA 2HXYA 1M7GA 2ZI4A 1P60A 2WM9B 3IO5A 4V03A 1NLFA 4OQXA 4CEJA 2O8CB 1TF2A 2IK8A 3PEUA 1KSFX 3KJIA 5L3QA 2XAUA 2F1IA 2Q0HA 3ECCA 5KSPA 2G1KA 2IS2A 1NBMD 3BIFA 1GKUB 5BYKA 1SKQA 2QM8A 1Z47A 1D8TA 2WV9A 4EQ6A 2CCKA 1R0XA 4UNPA 2FFHA 4QFMA 4F4JA 3WP0A 2D2FA 1BKDR 1WRBA 2BCJQ 3SYKA 4AY2A 2C99A 3S1AB 2C95A 1VCNA 1M74A 1ZC4A 3IIMA 3HU1A 2RGDA 4DIEA 1UBCA 3LXXA 1Q21A 1Z6AA 2OFXA 2CCGA 2WKRA 4NL4H 5FFMA 1XJCA 3THXA 1KYIA 4H1VA 4Q7MB 2QMHA 1TEVA 1K6MA 1MRNA 3QY0A 4D2IA 1OXUA 4A6PA 2QAGA 1M8PA 4NYIQ 2BBWA 3KX2A 1A1VA 1CR2A 1X8KA 4LBYA 5AJZA 2JLQA 2ZR0A 3NBYC 4QHTA 1NBME 2KJQA 1R0ZA 1KDTA 2FZLA 3K0CC 1FNNA 2WWWA 3VR1A 4GOXA 1FZQA 4TQUS 1Z8FA 2D7CA 5B58C 2ZETA 1GZSA 4B73A 2HLDA 4EJSA 3KQNA 1N6IA 2IYXA 4BZPA 2XSZD 4LGMA 3QG5A 3NDPA 4OK3A 4Q4AB 1N6KA 3SJAA 2FJUA 4BFXA 4DLXA 1YU9A 3P4YA 1NVVR 2JA1A 2ZYTX 1R6BX 1XF9A 1XD2B 4OHVA 3HR8A 3KJGA 5DI3B 1F48A 5AWFC 4O2RA 4OHZA 1OSNA 4FCVA 1Q22A 5LB2A 1W7AA 4QBGB 1IOZA 1E0SA 1X8JA 4NYMR 4Q66C 4KODA 3AKYA 3AM1A 5CK4A 5KYKA 5KSZA 2JLUA 4PR0A 3L82B 4YMSA 3AKDA 4CGZA 1KO4A 1G8FA 1P2VA 1Q1QA 2JASA 3QBTA 3GLGA 3LVQE 2RGGA 3SFVA 3W8RA 4HAWA 3AQ4A 5KHOC 1SHZA 2KSQA 3L8ZA 2WWFA 2ODBA 2Z83A 4LJ9A 4KI0A 1GKIA 1AZTA 2FSFA 4A36A 2EYQA 2MMCA 2X1VA 4WZBE 1N25A 2AD5A 4NCIA 2EWWA 3U44A 3ZQ6A 4C0JA 3O8RA 4ABYA 1ZBDA 4RSGA 2F3RA 4CF7A 4BZQA 3U7GA 3ZIAA 1W1WA 1XXHE 3L43A 3GFPA 1L7VC 1XD8A 5JECA 5JSZA 4WIAA 1GFIA 3OF5A 3CPEA 3TE6A 4B2LA 1E9FA 2QUZA 4MGYR 3GLIE 2VLIA 1YZUA 4JVMA 1T5LA 4PSKA 3WNBA 2A7QA 1US8A 3C16C 4ZO4A 1B23P 4ZDIA 3RS4A 4JL6A 2WSSA 2OBMA 3GJXC 4MRSA 3UMFA 4EFMA 1JALA 2IWRA 1QHNA 1Z0IA 3AUXA 4MYTA 1UFQA 3Q85A 5KSYA 1U9IA 4BLOA 3U4QB 4UNQA 2AXNA 3T1VA 2QP4A 3CM0A 4HEJA 5HE9A 3FOZA 4KXFB 4JKIA 4DSNA 5GJVC 1SHKA 1G6HA 2ZU0C 1CXZA 2ZI5A 5G3YA 1KMHB 2WPDA 1RKBA 5CB8A 5E3HA 1U2RA 2V1XA 3A1UA 4TYWA 2GEUA 2QRZA 1E0KA 4P33A 5JFGA 1GTVA 5BWMA 3V4RA 1EFRD 1NL3A 1Z0DA 2JAQA 4V02A 2BIFA 5GADl 1MO5A 4DSUA 3SHFA 2FGKA 5BN4A 2Q3HA 5DN6A 2WOJA 1NY6A 2FZ4A 3V4FA 3TH5A 1RE0A 1ZCAA 1SKYB 4C0HA 2ZRKA 4K81B 5J4VA 3QPUA 4PZLA 221PA 3VX3A 1E1QA 3I32A 5JRJA 1QHIA 4DUGD 1YR7A 1G5RA 2J5XA 4DCSA 1N3BA 1Z22A 3B5JA 5HTKA 4MGKR 3I1FA 4URVR 3ZYCA 4IOJA 2P5SA 2VBCA 1II9A 4MRVA 2ZI7A 2BM1A 2H5EA 1XB2A 2IYZA 1DG3A 4Q9LA 2R44A 2HF8A 3FVQA 3AKCA 1S3SA 5C2JB 2O8EA 3PCRB 4YDHB 3OEED 2ZE8A 3IEUA 4PC2A 4D0GA 4LHXA 3TK1A 5L3SB 5C1BA 3CLVA 1UBGA 4TL9A 1Z6YA 2QBYA 4OKSA 2PT5A 1HUQA 2BJVA 5C4MA 1XTIA 1CF4A 5JRZA 1OB2A 2GBLC 1TL7C 3K9HA 1ZVQA 1SGWA 1VYUA 4LYAA 1G8HA 4IDQA 3P27A 3C14C 3GCGA 4Q47A 2A3RA 2ZS9A 3KKMA 5HPYB 3SJZA 2ZTSA 1TU4A 1G5PA 3KB2A 3DHWC 1N2CE 3UWOA 4HUQA 1KI6A 3UATA 1DS6A 4WZAE 4YXWA 5C4GB 2ODEA 4CEIB 1IXRC 1E2FA 3O47A 2HCJB 4WXPA 1SQ5A 3LVRE 2BHRA 2OBLA 4GPTA 3A37A 2ZYVX 3EWAA 2V55B 1NSFA 3FWYA 4YQFA 4ZCMA 2OCAA 5KDLA 5JS8A 3LA6A 2RHDA 2ZS7A 3LX5A 4ARZB 1BOFA 1OXSC 4B44A 1AS3A 4HSEA 1U81A 5J4LA 2H92A 3GEHA 4YMWA 4B33A 4KITB 2BDTA 3MSXA 1XCGB 1XTSA 2OE2A 4DDWA 4B3GA 4E22A 4FIDA 5KOYA 3TAUA 3QPWA 4XWAA 2P65A 5FBVB 1CRPA 4LJYA 2KWIA 2QP3A 5CK5A 2OHFA 1KO8A 3WBKA 4BZXA 3QI2A 1KKLA 1EFTA 1YQTA 2AHOA 2WIAA 4JLJA 1A4RA 5KNBA 1J2JA 5JJIA 3UG7A 4KYIB 4FXPA 1H8HD 5H1YA 5TDHA 2GXQA 1JJ7A 2VPPA 1M1YE 4JLNA 821PA 1LV7A 4CEJB 3A4LA 4EPVA 1ZUIA 1IM2A 2ZRHA 4M9ZA 4DZZA 1KK1A 1XWIA 1A2BA 1FMJA 2ASEA 4M53A 5AJXA 4ZPXA 4BLTA 5L3QB 1RYHA 2Q9CA 3O8CA 3DOFA 4IVQA 3EA5A 3B7GA 1OH7A 2QSZA 4P4SA 5ELXA 4NDZA 4PHHA 4OHYA 4Q5IA 3R9WA 2W2TA 2VHTA 4LJ4A 2EW1A 1NIPA 2K5UA 1N6RA 4H1UA 4BLRA 1FQKA 3V00A 1YZGA 4Q18A 4FMCB 1RIFA 4D82A 3KXKA 4DCUA 4NCNA 3MUFA 4ZIRA 1W4BA 3GJ0A 4NCHA 1H65A 4EPWA 4ESVA 4PAOA 1BMFD 2H17A 2NGRA 3GEIA 4NYJQ 1DO2A 3B6EA 3GLFB 2NMVA 2ZJBA 1YHNA 4TTPA 5CITA 3KTAA 2CLDX 2OUKA 2OCPA 1GP2A 4UKDA 4OHWA 5JHGB 4UXHA 1GG2A 1NBMA 2CHQA 2A5YB 2QQEA 4IDPA 4LYHA 2QAGB 3ZS9A 4B6FA 2RB4A 3D7MA 4FD2A 2IL1A 3KUDA 2GHIA 2WAYA 2WJJA 1MABA 4Q02A 1UAAA 4Z8YA 2LKDA 4BFUA 4OQLA 4A0HA 5L3VA 4G5GA 3U3MA 3C7KA 2NIPA 1LF5A 4URUR 1ZW6A 4PPNA 5IRCD 1EWRA 3AVUA 1A82A 4EJSB 1R7RA 1VG9B 2DWQA 4HYYA 1EFHA 2F1JA 1F60A 4IDHA 4DLYA 1OIXA 4DIDA 1S8FA 1E3MA 3QG1A 4WA7A 4Q7LA 4LV6A 4PHFA 3I4LA 1FPMA 5FUWA 3B85A 3TUJC 4NCJA 3RC8A 2DFNA 2WJGA 2A9KA 2XGJA 2IS6A 3CO5A 4IOMA 4PPQA 1PLKA 4BPBA 5A4JA 1P9NA 4M1OA 2FG5A 2VRWA 2VF8A 3SR0A 4GSYA 3TQFA 2G0NA 3HYTA 2OZEA 3I5YA 4C30A 1SVOA 1VKJA 1M7BA 3NVAA 3OEHD 2AWOA 8OHMA 2XSZA 1TQDA 2ZI9A 3H1TA 4FMDF 1CJTC 1FUUA 3REGA 1HE8B 3EIHA 1XXHA 4TL8A 4JL8A 1F2UA 4NMMA 3T1OA 3WRXC 1Z06A 4XTCS 4BFWA 3GLIA 1P5ZB 1GAJA 4MKGA 2BV3A 3K0CA 4V0KA 3SZRA 5DHFA 1Q57A 1QF9A 4O25A 4D0LB 2CL6X 1VG8A 1W2HA 2ONJA 1VCMA 1ZD9A 1YZKA 1MV5A 1KI8A 2EFDB 3AVQA 4DT1A 1YR8A 2QMUA 4A0RA 1IQPA 2GILA 4KO8A 4TLAA 1US8B 4IJMA 1KZGB 1II8A 1C4OA 2W6JD 4DLUA 3M4YA 3NC1C 3X1WA 2IF0A 3IQXA 4BFTA 4M1TA 2XNDD 3L2OB 2JIZD 3IQWA 3EPHA 1P9RA 3QVUA 4JLBA 4JT2A 1XEXA 2C9YA 2Z4SA 4XVUA 5GVSA 1AKEA 2DY1A 1W4RA 2GJ8A 2Z43A 3KUCA 3MG9A 4D26A 4HATA 5KNDA 1VECA 5HCIA 4JZKA 1R4AA 1KK2A 1VTKA 1XEFA 4DLSA 1HQYE 3LQRA 5H70A 4Z54A 2Q6TA 5KU1A 5IDVA 4XOIA 4JLAA 4ZCLA 4GFDA 1KJYA 3A1WA 3RC3A 3GJ7A 2QN6A 3HWSA 4Q00A 3L0PA 4ASUD 1OH5A 3MLEA 1CTQA 4TL6A 4BWYA 2PMKA 2MSCB 3Q5DA 1NF3A 4P31A 1D2NA 2F1HA 1UKEA 2BC9A 1E2DA 3QIAA 2CHGA 3TNFA 1D2MA 3AVPA 4F4IA 1UADA 3A8TA 5FOXA 2ZJ2A 2AN9A 4G1UC 1N6PA 1TNDA 2EVWX 1NJGA 3UMSA 2FFBA 2RGBA 3PITA 2DBYA 1S1MA 1XFAA 4TQ9A 3D31A 1WB9A 1N5LA 2W83A 1EFRA 4G0NA 1JPNA 4HDQB 1ZD8A 2NO7A 4JKYA 3JZMA 2NPIA 2QBYB 2YVUA 4B2IA 2NQ2C 4IW3B 4WOPA 4JSYA 5AK0A 1KSHA 3IBGA 4M9SA 4QL3A 4DSOA 3TAHA 2QPOA 2MSEB 4DUGA 4A6XA 2GCOA 5E4FA 3BB1A 2PBRA 2QTFA 4E5UA 3FYHA 1H8ED 1O87A 3AVWA 1P3JA 2H18A 5AJVB 2V7QD 3AF4A 4UQOA 1RRFA 2BMEA 3T15A 2WWYA 1WQ1R 3T1QA 2I1QA 3OEEA 3OAAD 2HYDA 2RAPA 4AKEA 2DWOA 3MD0A 3OZXA 1P4SA 1XTKA 2R9VA 3PUZA 1NN0A 4TQAA 3A1VA 2FU5C 2OFWA 2ZSAA 1VYTA 2E9SA 1K8RA 3ND9A 5FPSA 2V3CC 4O3MA 1GNRA 3QEJA 4L9WA 2WTUA 2RGNC 4O2LA 5DYGA 1P7CA 2FFAA 4IFEA 1Z0JA 2ZUBA 2OAP1 2BKEA 4JYCA 1EGAA 2BMFA 2ZRCA 4I4LA 1E32A 2QENA 1SVMA 1KSJA 4MITA 1OLOA 2XZOA 2J0SA 1N6NA 3GLHE 4Q4JA 1G4UR 1F5NA 1Z2AA 2J7PD 1E4YA 1KI2A 3E2IA 4IXMA 5E7IA 4YMVA 2Y8EA 2NTYC 2XX3A 3NHBA 5CB6A 2H57A 2GTPA 3ZVMA 2ERXA 1Z0AA 2GBLA 3AGQA 3NDBB 1CEEA 2PJZA 1Q1ZA 2QROA 4URXR 1XEWY 4AI6A 3JZAA 2AR7A 1JXOA 3D6TB 4LZZA 3KQHA 3PEWA 4TWZA 1P61B 4QJ5A 1NKSA 2CVHA 2PT7A 4KFRA 1ESNA 4TMZA 1G41A 1EFUA 3ND8A 2IEYA 4PXAA 4M1WA 3W9YA 2HYIC 5LBIA 3WYAA 4YMUA 4PFSA 3FKSD 4P4SB 4FI3C 1R10A 2GKSA 1J90A 4FCTA 2QPTA 1KK0A 4X8LA 2ATXA 1P72A 3TR5A 2ECKA 2GETA 5FTJA 5F3WB 1CR1A 4Q1DA 5CIQA 2HCBA 4B74A 4LY6A 2ZE6A 2V6JA 4I1UA 2XOKD 4P4UA 2GJ9A 3K53A 2XTNA 4ZIRB 4YONB 5CYPA 1H8HA 1W4AA 2O0HA 3QXCA 4IEEA 4M9XA 4DJTA 4CW7A 2OLJA 1UKYA 2GWHA 5EXPA 1YZQA 4GT1A 1XRJA 1MO3A 3I3SR 3KTAB 3K70D 1U8YA 2NO1A 5FI0B 4LHVA 2RGXA 3CIOA 3OHMA 3NG1A 3VQTA 3DMDA 1MABB 3RNLA 1YRBA 3SS8A 1W2GA 2VHUA 4E07A 2JJ8A 4YLGA 2GXUA 1KSGA 3FE2A 3R7WB 1OV4A 4GI7A 1OIWA 1Z0KA 5CDFE 3WHLA 4KFSA 4DVGA 4MYUA 2WBLC 5TY0A 2ZVPX 1AQYA 5HCNA 2AFIE 1DPFA 3TRFA 1UJ2A 3HYRA 1BMFA 2V9PA 1J7KA 1WF3A 1J70A 1P2UA 1F6BA 2OBNA 2GK7A 3N5CA 1E9SA 3K0SA 3VTKA 4BECA 4TLBA 2X77A 4IOLA 1COWD 3QXJA 4BQSA 3BJIC 1YR6A 4RY2A 4NCKA 1VIYA 1Z29A 4PX9A 2F9LA 2A5DA 3UG6A 1SVLA 3L0IB 2N46A 3X1XA 3CH5A 4OQNA 4AG5A 3MWKA 4G5QA 4FMBB 4R2HA 1J8MF 2C96A 1GNQA 1AGRA 1CKEA 1MRSA 4GOJA 1PUJA 4M22A 1IJFA 1ZRHA 2GESA 1HQCA 2FEOA 4TMWA 1I2MA 3BAFA 1IY1A 3QENA 4WVFA 4XSGA 4XH9B 4GMDA 1XXHB 2MSDB 3CNLA 3LNCA 4ZDKA 3Q9LA 5G41A 1FFHA 2QU8A 3MWYW 2CXXA 3A1SA 3HPRA 3GLIB 1RRPA 521PA 4A2WA 3GJ3A 2YZ2A 1KY3A 2VP4A 1JBKA 3LW7A 4IEIA 4G5SA 1XD9A 2RGEA 1Y3AA 4O0MA 4DEXA 4Z1MD 5BN3A 3NH9A 4AC9A 2ZI3A 3HPQA 4A0GA 4DT1B 1KAGA 2FF7A 2FPMA 4NP6A 2REOA 1XU4A 4TMVA 4JYBA 3W3ZB 5HE8A 3MJRA 4HB4A 3TQCA 1NN1A 2IYLD 4PQYA 3T35A 4I1VA 3I72A 1T8TA 3Q7PA 1SVSA 3EASA 1GIAA 2C98A 1SULA 3TBKA 3WHKA 4PQFA 3M1IA 3B78A 1XEXB 2DFLA 2J0UA 3R20A 4TT3D 5GJBA 3VKHA 1JEEA 2YINC 4IDOA 4Q4HB 1CS4C 4M1SA 2ZYUX 2VA8A 3LQQA 2G1JA 3L0SA 2WJVA 4MDEA 4LYJA 3C41J 1DG1G 2BBOA 2ZAMA 5EJEA 4DDUA 5JCPA 4MRPA 2IYRA 3KFVA 4YMTA 2CNWD 4N1AA 3UKDA 5CIWA 1OFIA 1IXZA 2ZSDA 2ZANA 4LC1A 4EKDA 2AKYA 2Q9AA 4PANA 5TB5A 5SZHB 3EA0A 2DB3A 4PTLA 3QF4A 1QVAA 2W6JA 3ASZA 5FPTA 4CDGA 3REFA 5JWRA 5ANRB 2O8DA 5KNCA 3WMFA 1JAHA 3WP1B 1Q20A 2C9OA 1NJFA 1DADA 4RCYA 1PZNA 4RFSA 1P9WA 1WBBA 4CZ2A 2A5JA 1DTSA 4P32A 2PX3A 5B64A 3EPJA 4A8JB 1WDTA 3FGNA 1N6LA 5LPNA 2GAAA 2HF9A 4QNMA 1E9CA 2D2EA 1HY3A 4GP7A 4QBIA 121PA 1R5NA 2J45A 1G20E 1Q3HA 4AKHA 5EE5B 4TYYA 4Q19A 3A36A 3WMEA 4BASA 3TGPA 3SU8A 1MR3F 4C9BA 1SXJB 3L8YA 2HV8A 3RS2A 4ASUA 4TN1A 4Q01A 2CLCX 3A58B 2PX0A 2PEYA 3RWMB 2QE7D 2QNRA 3DDCA 4DC9A 1P73A 2PH1A 3CNOA 2GCOB 1I4TD 2WKPA 4JBWA 1T8UA 2FA9A 4E09A 1F2TA 1NY5A 2ZXUA 3GD7A 4QGGA 3IGFA 4KU4A 1ETUA 2ZIAA 3PJRA 2CDNA 2J3EA 2QGNA 1DAGA 3C8UA 4ZDWA 1JPJA 3DOEA 1T5IA 4R98A 1OF1A 2JLXA 3NKVA 4OI2A 1FX0A 5JLJA 1QBKC 2J59A 1NG9A 4HAVA 1QRAA 5E95A 4EPTA 2IHYA 4C0AC 3QOFA 2V8OA 1MO6A 2H16A 4D4MA 4S2EA 1N6OA 1W48A 4GOKA 1XCMA 2RCNA 1TTTA 3MRSA 5EP2A 1QZXA 1XX6A 3GLHA 1G5TA 2WWIA 2IUSA 3B1VA 4LUCA 1H8EA 2WKQA 3VX4A 1JR6A 2V7QA 1HV8A 3BRWD 3PV0A 3RWOA 2ZROA 3FKQA 4XTRA 2FH5B 4B3XA 2GJAA 1BYIA 2IXGA 4TSFD 2F7SA 1HH4A 4Q4JB 2W00A 4MYHA 3B8HA 3OAAA 4B75A 2VTKA 3U3KA 4KVAA 4R2IA 4F91B 1UEJA 1OXTA 4BFYA 1EWQA 4M2LA 5JCZA 4B2PA 3CX7A 1S1CA 2QPAA 4LJ7A 1DEKA 1E94E 2B7CA 3FHOA 4HLQB 5IK2D 3VAAA 4X8OA 4EIWA 2ERYA 1W0KD 1FTSA 2CMKA 4PZYA 1DO0A 2CL7X 2FGJA 4MH0R 1NVUQ 3KJHA 3AP1A 1E2LA 4MUAA 1GDDA 3OFND 3T61A 2GJSA 5DI9A 1Z6TA 2O0KA 5FPYA 2FDCA 5E7JA 4OJQA 1KI3A 4D6PA 1KNXA 2ZITA 2CHVA 1NMZA 4B47A 4KBGA 5JHHB 1P62B 1E2NA 2J7PA 3ICQB 1TUEA 3W3AA 3TIFA 3CX6A 2Q3MA 2DR3A 1LS6A 2RGNA 4NPHA 3HR7A 4L8GA 2JLWA 1TQ4A 5DHAA 3BORA 2BBSA 2WJIA 3ZS8A 2IWHA 1J99A 2OO7A 1UF9A 3ZVLA 4ZI3A 1T6NA 3BWDD 1LF0A 4PAMA 4RD0A 2BJWA 2PCLA 1U98A 4B3BA 2QT1A 1G8PA 3AV0B 3FKSA 3U60B 1A5TA 1FL9A 1T3HA 4ZKDA 4GMXA 4HZIA 4TMXA 5CDFA 2VHCA 2VIIA 3WYFA 3QKRA 4DRZA 2WMOB 2EFGA 1SVKA 3LBNA 1R5BA 2JGNA 3IPYA 3WMGA 1W36C 2FSHA 2REXB 4YDSA 1HURA 2YOHA 1Q12A 1WCV1 2IXFA 1Q1EA 2XOKA 3LLUA 4HZUA 2JJ2D 4I1SA 4MQBA 4EDHA 4EPXA 4DDTA 1WXQA 3ADKA 1D2EA 4OK6A 5JEEA 2G77B 5IF9A 1NN5A 3IHWA 5BQ5A 1AQUA 2VYFA 1OJLA 3EZ7A 4RD4A 1NMXA 4HLCA 4RJLA 2X2FA 1AN0A 4D25A 1DAHA 4GBMA 2J87A 1GSIA 2X8AA 4B76A 2AWNA 3GJ4A 1W36D 3SYLA 5GVRA 4M4SA 2A30A 1JXMA 3B13B 1ZJ6A 1VG1A 1G17A 1ZMXA 2IYWA 4WW0A 4I1OA 4F93B 1PLJA 4KLZA 1ZU4A 1L4UA 4RZ3A 2J9RA 2VO1A 3F5FA 3VR6A 1KI1A 3DZDA 5EP1A 4Q1CA 1RJ9B 3PVSA 5EUMA 2PLRA 4JVSB 4TL7A 4KLNA 4QG7A 3EC2A 2C9CA 5FL7D 3NEYA 3PR1A 4L15A 1T3LA 4P4TA 1E2EA 1HT2E 5EE3A 2NPFA 4RKEA 1COWA 4HAUA 2QT0A 1OFUX 1FMLA 1OW3B 2FPLA 2R8RA 2HDNB 4X8HA 1YZTA 3VHLB 4AKIA 3FFBA 3Q8XB 3BFVA 2G6BA 3G0HA 1NRJB 1EFCA 2GZHA 1G19A 1I2DA 3BC1A 4C0QC 3U7FB 3M0EA 2AD1A 1X6VA 4EQ6B 4JL5A 5AR1A 5J4KA 3K9NA 4G5OA 3B1YA 5KDOA 5KUTA 2R6FA 1MOZA 2OESA 1I4DD 1XZPA 4B71A 4POAA 1EXMA 4M9QA 5C18A 1WP9A 1XBTA 3QKSA 1E4VA 4QXAA 3U3OA 4IOKA 1JQLB 2CVFA 2EU8A 2D3WA 4Y0VA 3FHCB 5FOWA 3THXB 1XMVA 2FEMA 3WY9A 4IVRA 4EAQA 1FNMA 5H68A 3ZJYA 1TX4B 1DAEA 5DSZA 2Z6VA 3VNUA 4Z1MA 3A4NA 4PHTA 3AGPA 1A7JA 4BLPA 2J7KA 4JT4A 2AK3A 2OLKA 2F55A 1CR4A 1YJ5A 2E87A 2QGZA 2NO9A 1NP6A 2OCBA 3CKLA 4KV9A 4Q1FA 1Q1BA 4KJZA 5EP4A 3VU9A 4Q9HA 3UWKA 3W90A 3KKOA 3SQWA 5EE1A 3BFKA 5FOUA 3QF4B 1AS0A 2H8KA 3D8BA 1E2MA 3ETLA 1RPZA 3AUYA 3IUYA 2YOFA 2FX3A 2GEVA 2A5FA 4QBFA 2XZLA 1ZUNB 2Z0MA 1IN5A 4NYIR 2TMKA 1QG2A 2I4IA 5FOSA 4C0KA 2D4HA 1XP8A 4DCVA 1LVGA 1ZM9A 1YKSA 3LRPA 4PO8A 4TT3A 5E7MA 3GMTA 2ZRNA 2JLRA 2QORA 1VPLA 4G01B 1Z3IX 1U8AA 4XWOA 3OIWA 1NG1A 1ZYUA 2F43A 4PPFA 4RCZA 5CM8B 4Q21A 2CNWA 3NTUA 3IIKA 4NONA 4B48A 1DOAA 2YV5A 5FTNA 1RRCA 4Q03A 1UM8A 3F0TA 1ZM2A 1KI4A 2DFKB 1AGPA 2EQBA 4HB0A 3VKWA 3W6PA 3GLGB 2JLYA 1VHLA 1P6XA 5EE9A 4PZZA 1KDPA 2GVZC 2NG1A 1TF5A 1F2TB 1NMYA 1S2MA 2CK3D 3NBXX 4OYHA 3B82A 3RS5A 3W5IA 2ZS8A 5LD2B 4QHSA 4RZUA 3CZPA 2GA8A 3K8YA 3U44B 2GRJA 5EZ6B 3TSWA 2C8VA 3R8FA 2QEQA 2W58A 1R8QA 4UJ3A 4R71A 2CL0X 1FX0B 2XB4A 5JSZB 3CRMA 2G88A 1KHTA 3SJCA 3SYNA 1CP2A 4GDFA 3U3RA 1KI7A 2YKGA 2IBMA 2ZAOA 3TKLA 1R8SA 4NE2A 2QE7A 3H4MA 3CNNA 2VP5A 4UJ5A 3AH8A 1CU1A 4B34A 4B32A 3GLHB 1GRRA 3O8BA 3GFOA 3ZD7A 4A15A 3BB3A 5FBLB 2VP0A 2ZRDA 4HB3A 4Q1EA 2P2LA 2RGAA 2AKAB 1E69A 4LX0A 1G6OA 1NN3A 2PZFA 4CT4B 2ODNA 3QXSA 4TYNA 4F4CA 2PLFA 3N2EA 3EZ9A 5TVKA 1I4LD 1ZP6A 5FBQB 4TYQA 4AG6A 3S1AA 1AIPA 4V0NA 3RSOA 1SVIA 3G5UA 3CR7A 4US0R 1JECA 4HAXA 1E9RA 1XZQA 1ZM3A 3T1TA 3CPJB 2HLDD 4EUNA 3K9GA 2IS1A 4XIGS 4A2QA 4NKRA 5JBQA 4K46A 3VR5A 3PUXA 4QGHA 3CRQA 1OYWA 3B1ZA 1CJVC 3CF2A 4CVNA 3M6AA 1E0AA 2ZR7A 1GRQA 2PZGA 3KXLA 1UKZA 3THOA 2V6IA 2ZJ5A 2QP9X 1AKYA 4ZCIA 3TMKA 4M1YA 2O5VA 3Q3JB 2Q9BA 4JLPA 1XJ0A 4TSFA 1RFLA 3GLFE 4OI0A 3AEZA 2HEIA 2QQ0A 5AJWA 4II7A 4X8MA 2VQSA 3X1ZA 2O8EB 5JZVA 3DEFA 1VMAA 2ZVQX 4PO9A 4L9SA 1AJEA 4A2PA 1UBEA 4LHYA 2YOGA 1VDZA 4JVNA 4JBXA 4D4JA 5CJ2A 4AYTA 3LY5A 5IK2A 5K8TA 4NYMQ 5JJKA 2EFEB 2FFQA 3AF0A 3EIQA 1LY1A 4DCTA 2BVNA 1W0KA 4JLOA 3FMIA 4D4LA 3F8TA 4C2TA 3FPAA 4Q9JA 2A5GA 3A6PC 2H7VA 2QTHA 2BCGY 2W0SA 1NLZA 3OFNA 3QKRB 2YYZA 1G7RA 2YC4C 2YWFA 3IILA 5AJYA 1P2SA 5DIFA 2UKDA 5HR5A 3C5CA 5KPJA 2J46A 2W2XA 3HJNA 1TADA 5JWOA 4OK5A 4F7WA 5F9HA 1S3GA 2OG2A 4HZUB 4HB2A 4HUQB 1E1RD 1KI6B 4LJ6A 5FUXA 4LYFA 2RKOA 2DCUA 3VHXA 4BLQA 4BLSA 4A82A 4JS0A 4AURA 2QSYA 4XVRA 3LLMA 1MO4A 1TPZA 4YC7A 4RKFA 1FQJA 4QNRA 3KDSE 2EWVA 4Q9KA 3IKJA 4PC6A 4AWXA 5J47A 5FTKA 2D7DA 1E9BA 1KO7A 3TR0A 1ZM7A 4BEJA 3HU2A 4FMDB 4U02A 2B8WA 1T91A 4ZV4A 2FPKA 3TLXA 2BOVA 1DE0A 2FOLA 2VHJA 3IPXA 3U61B 4IVPA 5JWHA 1XTQA 2WPDD 4URYR 1KJWA 3LXRA 3BE4A 3U7EB 1GL6A 2ANBA 4C0SA 3SC3A 2NOAA 2JJ2A 3K0EA 4S35A 2PL3A 2ZSFA 1VIAA 3NXSA 3P20A 3U6BA 5DLQC 4JLDA 2JLZA 2Z5FA 1G7SA 1K5GA 3KQLA 2GAOA 3RS0A 4PSVA 4C2UA 1NVXQ 3FDIA 2OXRA 1E1QD 3FTQA 3BD9A 1BO6A 1YRAA 3LFUA 2H1LA 1YVDA 2FE4A 2IYYA 2CJWA 2NZ8A 3NIBA 3EARA 3IHLA 4UXJA 5L8VA 3K70C 4MDFA 3SEAA 1KMHA 1QHGA 3E70C 2G83A 1OHHD 1T9HA 3OIVA 4KSCA 1GUAA 5CYOA 4HDCA 1N0VC 2LKCA 2BMDA 2C5LA 2R6DA 2J0QA 2O52A 5F2EA 4DHEA 2CEAA 3QKSB 1JQJC 2P6RA 3TSZA 2QMEA 2GZDA 1G3UA 3RHFA 4IKEA 1X86B 4GZLA 4HDOB 3FMFA 1QHXA 2IW3A 3I92A 5SZJA 3RRNA 2MMGA 2GDJA 3QKUA 1W47A 5BN5A 1E0JA 2J1LA 4PAQA 4RD3A 3RABA 1VG0B 4LJ5A 2ZRGA 3OIYA 1KK3A 2R6GA 4LJ8A 5LB4A 1DAKA 3X1DA 4R7ZA 3BS4A 2RGCA 3QBVA 3CWZA 4JLVA 4P3YA 4Q1BA 5EQTA 4NYJR 3ZLJA 2DWPA 2KBEA 1N0WA 4QHYA 4AYXA 3GEEA 3PQCA 3T12A 4QGFA 4LV5B 3KQUA 3NWJA 3LBIA 1A2KC 3B9PA 2C78A 3QF7A 1E2JA 3R9XA 2BEKA 5L3SA 4M8NE 2VHQA 3BGWA 3DM9B 3W34A 4UXIA 4LI0A 1TMKA 2X2EA 1U0JA 2QL6A 1XPUA 2HUPA 2GZAA 2B7BA 5A0FA 3AVXA 4HLDA 1G9XA 4JJZA 2VP2A 1OE0A 1UDXA 1Z07A 1Z0FA 4EPRA 1KNQA 3AF2A 5UKDA 3BB4A 3PFIA 1U94A 1AK2A 2F43B 4OQFA 2B6HA 2ZRAA 2WJYA 1E2PA 2ZRMA 2IX3A 1E79D 2JDID 3C15C 4BFZA 2ZPTX 1KY2A 4CEIA 3H86A 3SOPA 3PXGA 4CIDA 4G5RA 3UIEA 4V0LA 2QG6A 1ONBA 3KKNA 1G8GA 5EE0A 1Z08A 4KHZA 2XZPA 1Z5ZA 2Q21A 4D81A 3Q7QA 2HT1A 4I99A 4LBZA 4W9MC 3R8CA 5AUNB 3MAAC 1F2UB 2ODWA 2JATA 3I5XA 2BM0A 2X19A 3KJEA 3DKVA 3ICEA 3PG5A 4QC2A 1AM4D 5FTLA 3LV8A 5LDDC 1NSTA 3EZFA 3K0AA 4KFTA 1ODFA 1ZNXA 1TQ2A 1XTRA 1CJMA 4KSBA 3W8NA 4QJ4A 5BYJA 1KO5A 2V4ZA 3OEHA 2QY9A 5AUQA 1YR9A 4V0OA 1II8B 1Q0UA 1ZU5A 3PEVA 4B3FX 3P4XA 1G16A 5DNYB 4OQMA 1HEIA 2HJGA 4TLCA 2F1RA 5DE3A 3ADBA 5BXQC 2OV2A 2CK3A 3ZZTA 2EYUA 3SE0A 3T34A 4EFNA 4AYWA 4CRWB 4Q9IA 4K8OA 4U5XA 2OXCA 1XMJA 4M0LA 1HA3A 1XDBA 421PA 5HZKA 5FTMA 1JAIA 3E5HA
chains in the Genus database with same CATH superfamily
1LRLA 2FLKA 3TR6A 5I47A 1UWLA 3IQFA 5LA6F 4DADA 1WHTB 5H3CA 2MYTA 5LP6A 4DABA 3ZOKA 1IOLA 2D1YA 3VNAA 4DXAA 3WIDA 2IYUA 1OX4B 3R7LA 2PX2A 1FMFA 3BH6A 1ZITA 3E27A 4B1FA 3L01A 5LQDA 3FIUA 4IUDS 3D02A 3E9MA 4YAEA 5B2EA 3JQ7A 1SWVA 2LDXA 3Q41A 4ZCTA 4O4HF 4JU8A 5HF6A 3ZY2A 3NONA 5TRTA 4NECA 1R74A 2ZWPA 2X42A 1YQWA 5J4HA 4BO2A 2JI9A 2WAXA 1Y9AA 1U7DA 2J41A 2OD2A 1YC2A 1VSBA 3VMMA 3Q3EA 1RT9A 4L3WA 1IZ7A 1FXWA 4E51A 3RVMA 3CBQA 1KZ6A 1IOWA 3L6CA 3BMNB 4F21A 2DPHA 2EL9A 3T9DA 3U4AA 1XC7A 2N42A 1HMYA 2QMYA 2ZUDA 3VC3A 2QD1A 4WLNA 5IBRA 2WOOA 1FJGB 1OIVA 2JEOA 3SQXA 2ZJ8A 2XCRB 3SI7A 3TW4A 3UVEA 3VZQA 4PQGA 1WVGA 4HWSA 1XCPA 5ELMA 5BP7A 3GPLA 3E7FA 5K8IA 3OIFA 3PPXA 2BFDA 2VSOA 3PWSA 5ILOA 1E20A 5T57A 3L8MA 1UOPA 4PNEA 1DJMA 4U9IS 1XJWA 1NIJA 3Q5EA 2VP6A 2V7BA 4BV2A 2ES4A 3P1JA 2XQFA 3AL3A 4FHEA 4ZANA 4JI2B 2XUQA 4WQMA 2MR5A 1V4NA 2QW1A 2BKUA 1QG0A 3Q6IA 4WXRA 4I08A 1O08A 3W9UA 3GDGA 3EG5A 1O7JA 2AIRA 3I4FA 3MD9A 3BXGA 4E94A 3AJDA 4LC9A 5BSFA 4ALLA 3AZPA 3FHTA 1CS0B 2QRKA 2JCGA 3GGGA 4BVAA 1DRWA 3KS9A 4LY3A 1D2RA 1M2HA 3LC2O 3ND6A 4B45A 3R5SA 3D5QA 1Z0ZA 1F7UA 5DO9A 2FRXA 1PU2A 1ZNWA 2VYVA 3UC9A 3H6KA 3I8OA 1HT0A 4DF3A 5B57C 2H7XA 2FK7A 2X4DA 4IIJF 4C7OA 4KN5A 2HD4A 3W5JA 3N0TA 4HEQA 1HTBA 3E3MA 4FTWA 1Y4SA 1R9JA 2IT1A 2JJ1D 3HKBB 4NI5A 1IN8A 4RSMA 3MHTA 1PWEA 2PEZA 1Z6ZA 3VTZA 3FWHA 3EFEA 1IBMB 2J9FA 2VDUE 3F6YA 1ODJA 4TX1A 4UHJA 3DHYA 2HK6A 2RC6A 2RI1A 3KLNA 5AHOA 4EKIA 1I2BA 5ALJA 1SB8A 3EVCA 1B0UA 2WD8A 1N8TA 4DA9A 1PJAA 2CHUA 3TRDA 3JQEA 2IZ7A 3GN1A 3ZJVA 1WG8A 4PNPA 5AIAA 4ZK2A 5T6MA 2PQMA 1ZCBA 1Q83A 2IXDA 4LOLA 3HXLA 1ZC3A 4Y2SA 4Z4QA 1AF7A 1E5TA 1KZ7B 1J2RA 2HDOA 4N3CA 5I7WA 5KYXA 3PNYA 2NUAB 3O74A 1X1TA 2IYVA 4BGEA 2ZB3A 1XA0A 5H9VA 4Z4CA 3ZJTA 2CT8A 3HYSA 1HLGA 5BWCA 1I7NA 2A1UB 2AL7A 1ZA1A 2GGSA 3JD3A 1C2YA 2Q99A 2PNJA 1RIIA 3R76A 5CW2A 1CQIB 3TZHA 3WAGA 2V74B 1E61A 1EX6A 3HLTA 4E3ZA 1ZBQA 3C7DB 3AI7A 2GVDC 3AOEC 1KJNA 1SJ9A 5LP6F 4BO9A 2XUHA 1QHYA 4XLTA 5J2UA 3QSYA 4ITRC 4UM9B 1BNCA 3F97A 3TJZA 2ZJ4A 3F3KA 3H5VA 4RIFA 4ENQA 3BJZA 3SIRA 1M2OB 2VG8A 4KACA 3CJTA 4K03A 5EFOA 1P5HA 5CA1F 3PFBA 3PUJA 4NH0A 1HDCA 4DILA 4DTIA 4BE7B 3ZJUA 3UUGA 2OCYC 3FCEA 4G1VA 2A67A 1M67A 3EVNA 4I55A 1L5GB 1V5WA 4UVHA 3O1JC 3UJAA 1HNWB 2VDVE 1D03A 1R0LA 2XLBA 4IZHA 4FQ7A 2XYQA 4KIUA 4HL6A 2F64A 1A76A 2GEDA 2Y66A 3PL5A 4O4HB 4QUBA 3GQBA 3IRVA 5ALSA 2GT1A 3PDJA 4ACBA 3ZDQA 1B2LA 1RMQA 4RCVA 1FXWF 5KYTA 3PEEA 3DV9A 2PUFA 3PPIA 4XVQA 2Y1CA 4M1ZA 4KWTA 1BX3A 3TUIC 2ZKLA 1ZGJA 5LYYA 3DMNA 1XMPA 1HT1E 1Y8AA 3M2TA 5F3DA 1J97A 4NMLA 3OD5A 4N6GA 4FGLA 1GAEO 2E85A 1USVA 3ACDA 4Z0TA 3EE6A 2QTVA 4S1VA 3IAM6 2CLEB 5AW5A 1BDIA 2QTLA 1R2QA 1YQQA 4I4NA 2Z1NA 1RYNA 4HWKA 5EHZA 2H1WA 2FWJA 3L0OA 4MI9A 4DJ5X 3SX0A 3ZD9A 5A0TA 4A2CA 2QTCA 1BGVA 3IOBA 1RP7A 1KIMA 2FZGA 1YQEA 2ZUVA 4PGFA 2R65A 4MO9A 4OFZA 5P21A 2GXSA 3I04M 3WB2A 1ACLA 2FMXA 3H7IA 4GUDA 2Q6IA 4XX0A 5K0ZA 1KDOA 2D5IA 5KTYA 1L7NA 5AVSA 1AU9A 4OGKA 5LMZA 2AOTA 5KWJA 1C1XA 4EKEA 1MH1A 1J20A 5EJ9A 1W88A 1M2EA 3HP1A 4FGUA 1XEWX 5A9RA 5FBRB 4RJ2A 1ZNYA 4PGHA 1ESMA 3DF7A 3H5LA 4BEBA 3DF9A 4C06A 4HMQA 4EQZA 4YS6A 4D8UA 3DMRA 1XTVA 4WK4B 5ULLA 1PV1A 2X8LA 4ZO6A 2V4UA 3RIYA 1DAFA 3SY8A 1MAHA 2LXNA 4FDVA 3RRXA 1Z6XA 3KVOA 4KYTA 1XNHA 3JYQA 3K4QA 4B6EA 2V54A 1IZ0A 3I9JA 1BCSA 4F9TA 5JMPA 2QAJA 4IIJB 1G5IA 2G9NA 2WJAA 4X0EA 4C3UA 3SZGA 1YB1A 2QB5A 2ARKA 5TQJA 5B2FA 4Z49A 1LJ8A 3P7MA 3DS8A 5AVWA 3GX1A 1X3SA 3B36A 2XJ9A 5JEDA 3RSZA 3H18A 1QDEA 2ZT5A 4NPAA 4RYDA 1RQ7A 3MCAA 4QODA 1Z5OA 1KPGA 1C4KA 4ND8A 5H7XA 4BN0A 4RNCA 1R6AA 3UJCA 1YV9A 1HTWA 2PYZA 1W94A 1V7ZA 3HA3A 3EGVA 4DLRA 3CLKA 1Y8RB 2IOFK 3K09C 4AQ7A 1MENA 5LUBA 1E3WB 1V1MB 4DMUB 1GGVA 2WD7B 6Q21A 1CY7A 1CLUA 4XZ3A 1I0ZA 3V80A 1RHUA 1QHEA 1H22A 1DDIA 1FU4A 3K92A 5MF6A 4HV4A 1BN7A 1JLLB 4GXQA 5J5VA 1O6GA 2OXEA 2ZCUA 4UDYX 3KT3A 5J2UF 2H3EA 3DOCA 4RD1A 3HB9A 1WW3A 4FDUA 3VH3A 1EJ6A 1I7LA 1WVMA 5LYJA 1AGYA 1N6HA 3ZDAA 3EMVA 3UEOA 4EHAA 3UPTA 1PJQA 4Z2AA 3MQ2A 1MJGA 1X14A 4G8CA 4ZVLA 3ZWDA 1RKVA 5BPHA 5I48A 1D7OA 5JANA 1U2DC 3OECA 2OGZA 2W2QA 5IZ4A 2P5YA 4CF6A 3EZGA 2P5TB 1SXPA 1QPZA 3AUUA 1WCWA 3EXIB 3TF5A 1KQ3A 1M54A 2JHPA 3BK7A 3JQ7B 4C7JA 5CIYA 4R01A 5IM5A 5IT9A 2O8DB 4DCCA 3CLHA 1ACMA 1SKUA 3LF2A 4GZMA 4ADSG 1TVCA 2YYYA 1XK7A 2YFYA 2X9VA 2V0NA 4J94A 4N3BA 5FV7A 1L4YA 5HRCA 1M2VA 2ORVA 4PZAA 2YIDA 2RDMA 2Z6AA 3DPSA 1QGYA 3BHMA 3UXMA 4HLUC 3FPBA 2QJFA 3IEKA 3KR2A 4FN5A 2ZRIA 4I81A 1KKMA 2G3YA 4RVCA 1AGXA 1YE8A 4PCVA 1CZHA 3ZLBA 2BD0A 3GRKA 3L05A 3NETA 3COPA 1X1CA 1E4OA 1W19A 1AQNA 1DIOB 1SUDA 5J40A 4NHEA 4ZZ0A 1A8IA 2R47A 2OFOA 3FW1A 3VBEA 3BE8A 4E14A 1IAQA 1TMYA 5D3MA 1BFKA 2BFDB 3C5WP 4IDDA 5IVKA 2MDTA 4RK7A 4Q3BA 4RVUA 3VFDA 2PUDA 4EZBA 5G53C 2DPXA 3QVMA 4EI9A 2XB2A 4IP0A 1UPTA 3IAEA 5K3OA 1P75A 1D6JA 3ZG6A 4U7TB 4NENB 2VH2A 1O5OA 2PPVA 2A9OA 3HACA 3KLMX 2GSDA 4LK2A 3OPQA 3RHZA 3TX6A 4EHFA 3GFSA 1I3MA 3JR3A 1IHUA 4CYMA 4KQ6A 1TZKA 3A1TA 5AK4A 1EUQA 5FYDA 3DB1A 5J5CA 2R1TA 13PKA 1K86A 2VJDA 3AO0B 4MR9A 5INTA 1HDZA 2FQ1A 1UWCA 2WFLB 3K72B 3CUWA 4RH0A 4RM2A 2Z3ZA 3K9BA 2ZK7A 2LCFA 4PGMA 4KTVE 3WGHA 4JQOA 2K6GA 4HPWA 4B79A 3VNVA 1SIBE 2ZJZA 1CJUC 4HX9A 1QOQB 3K1JA 5BWLA 1E99A 4WACA 4XGRA 1ESZA 1XJQA 2W11A 4LXGA 4Y6GB 4ZQEA 4JJEA 5BVHA 2J9FB 4IS3A 1TJ3A 1LB1B 3W7VA 1NZDA 4F9GA 4BKQA 3RUFA 5DHPA 3O83A 3ANXA 5C53B 4EUHA 1PT5A 3ZUPA 1N2ZA 1QIFA 2FSVA 2Y71A 3C4JA 5JRDS 2CFOA 4IQFA 3B1WA 1NJ8A 4I6GA 3PZBA 3ZV7A 3LUCA 3UAYA 4FZVA 2WZQA 4OHXA 2I71A 3L0BA 3DQPA 4TTAA 3X2SA 2YXDA 3I2GA 4GS5A 3L9XA 5KYXB 1OX5A 3V97A 4G09A 3SK0A 3AP2A 5BN1A 4E1AA 4ZALA 3CN9A 4B4KA 2QL9A 1EZ4A 3FR7A 3I23A 2LUOA 1TFUA 2HXSA 3JVDA 4CCYA 2C58A 2ET6A 3ZWOA 1HQDA 2IE8A 2P4UA 4MKFA 4MW6A 4LG1A 2EFCB 4OI1A 3W2IA 4UAGA 5J2TA 1ZK1A 2ZT7A 3E3LA 3A2KA 4CQMD 3GRPA 2O2DA 4GRAA 4MW5A 5L3RA 2XBUA 1VSTA 1TAGA 4W9NC 3M6MD 3EUAA 1A8QA 3RV3A 2D5AA 4EFLA 3FTDA 4GM4A 4EEKA 2FV8A 2P2YA 3KJZA 3MWEA 4Y6QA 5DGXA 4AIIA 1DDOA 5ALLA 1E2IA 3JTMA 5J3JA 1GNSA 1JHOA 2M1ZA 4UOQA 1U8ZA 2GD2A 4I55B 3IE1A 2HMYB 2AYZA 1XHLA 2O1XA 1E3LA 3QLVA 4DMMA 4DV7B 1UL1X 3KEGA 2AXQA 2PVSA 4WN9A 1O0CA 4NVRA 2PHZA 1J06A 4CODB 1RPNA 5GIOE 3DKPA 4F9FA 3PX2A 3GQBB 3U31A 1XAHA 2K7ZA 5A9SA 4KFUA 4E4TA 4B81A 1C1DB 1V8OA 4URWR 3PX7A 4DWJA 4J2OA 1POWA 4Z4EA 2OBYA 1TZ2A 5A4MS 3QMPA 2ODPA 4MAAA 3EAQA 3EX7C 1U2GA 5E3JA 3QLUA 2NADA 3QPAA 2KE5A 3V3KA 3J7AC 1CFJA 2HQOA 1O57A 4BVJA 3OZRA 1J6UA 2QTVB 2Q6KA 3F9IA 3GI1A 2IU4A 3DLCA 1EP1B 2H2GA 2WJHA 4Q3AA 4RTLA 1CUCA 1CUIA 5C3UA 5JNRA 5A2QA 1Z7BA 1UUFA 3DYBA 2ID8A 5K4HA 5JCXA 4JASB 1J09A 1GA1A 5DYNA 1G2IA 3T7IA 4A4DA 1X1SA 2F62A 2YWRA 3HKEB 4HK4A 4YEDA 4B43A 3I61A 3L1JA 2VDPB 4RAQA 3GGPA 3OBIA 1LBHA 5EFZA 4XX0B 1EGHA 2BEJA 4FFNA 1U0HC 3R74A 4BRWA 2OZPA 1SHTX 3HSSA 2X5KO 4TWBA 4RTQA 2AOTB 1T2CA 5DLPA 1G8YA 1C1XB 1DQZA 4NJEA 5JO0A 3C6MA 1GUDA 1SZDA 3H0KA 4A92A 4OA5A 4BYMA 1X1DA 1MC1A 1TZBA 4UOEA 4N0DA 3KK0A 1TJPB 1MVNA 4KN8A 4DQVA 1IWOA 1UP6A 2J3QA 2P6NA 2P7IA 3OLZA 4J0QA 4LCBA 3NCHA 2C4WA 3KWLA 5EEHA 2VRBA 2BGNA 1Z83A 1QAMA 2VT7A 4XLLA 4QJIA 3QBEA 1FW6A 2E1RA 3QTBA 3H8WA 4WBXC 5CEEA 3PRKE 3QXXA 3SN6A 3UBTA 4RENA 2HJVA 3TNLA 1T8YA 4XOUA 1DQNA 3ZDEA 5CH5A 4XJTA 1BCSB 2LCIA 3CW9A 3PUHA 4ICIA 4CMKA 1AHPA 1W44A 1PWZA 4TYPA 4R9RA 3L5KA 3NUQA 4W5NA 2E4ZA 1LPOA 1Z4PX 1O96A 4PQEA 2W9XA 4KN6A 4WJLA 1S9DA 2JK0A 4PWZA 1SUAA 2EW8A 4QAJA 3WQBA 3OE7A 3BF7A 1YT5A 3NHAA 4IDCA 4JBIA 3R9IA 4MQFA 4ON9A 4K6HA 3T7AA 2G4VA 2JI8A 2Q8PA 2XGOA 3N70A 4TTQA 4UCWA 3VBCA 3DO8A 3UT5A 1QDLB 4ZQBA 2B8TA 2WUDA 4TTRA 5EJAA 4BQPA 2MYNA 3OM1A 1OI4A 4RPLA 3U9LA 3ZYZA 3F2IA 3BH0A 2OG1A 3LTNC 3EPRA 4LFAB 3DM5A 2JFYA 4OXXA 4UCQA 1G3IA 1IUPA 1T10A 3A6FA 3QWIA 5M7EA 4R84A 4CIWA 1NUHA 5BXYA 3SIPA 3HO1A 3AF3A 1ANKA 2GMWA 3MJFA 3HUTA 4RYLA 3FWZA 3BMOA 4CKCA 4FYVA 1KZ9A 3C24A 4FW9A 5J43A 5KWEA 2EQ5A 3NOOA 1S2IA 2E18A 3PC2A 1NLYA 3A1FA 3NDJA 2ZIFA 3OJLA 4I2NA 4IHQA 5KAMA 1GDHA 3CRW1 5IHXA 2DY0A 1SY7A 2AOVA 2QM3A 5LYJB 2EF0A 2R5NA 4CLRA 4AJ1A 3LYHA 3WDLA 3WAKA 4B4OA 4EMUA 5KJ1A 3Q1KA 1DCMA 5K6AC 1PV4A 3BGSA 4Z4HA 4BGDA 1MA0A 3VOBA 4R2JA 3TEFA 2HRQA 4A9AA 4K9MA 2HQBA 4EO9A 3HCNA 3VU9B 3QJ5A 4BFVA 1C9NA 1SELA 4GKBA 1VCHA 1RM3A 3FUVA 4FINA 4QDOA 4TOIA 5JAUA 5AKXA 4DUPA 1PR4A 4LAFA 4DLVA 2IEIA 2BZGA 5JMWA 1YRHA 4F2GA 2BFEA 4LSWA 2JH8A 1E6CA 1YB6A 3G5LA 4DJFC 3KVYA 2D1SA 3PPYA 4XD7A 1M2VB 3ONFA 4KG7A 1KDRA 5A7GA 1EE1A 4P98A 1N3LA 2VT3A 3CONA 2WSBA 4MI3A 3IPLA 3FUUA 3UT6A 1ZR2A 3N2KA 4HWOA 1VSVA 2DWCA 4KDRA 1HLFA 4MV9A 3OQ1A 1BX0A 4H59A 5CH3A 5EHQA 4JLSA 4KGXA 1EJ2A 4PC1A 2HPVA 1V8BA 3LBHA 5DN9A 5HJ7A 3RVSA 1WTAA 3D4PA 2TYSB 4ZOQI 3EQ7A 4HNVA 3S8YA 3SSOA 2H1IA 3DPIA 1CUXA 3IDQA 5TMPA 2CZGA 4LXUA 4QQFA 5MDHA 1JEQA 4BE9A 5KNBD 2RHGB 2XB8A 3AR6A 5D3MB 5EP3A 5KJEA 4QG3A 4C3VA 2W6QA 4K6OA 5HZMA 5CM9C 3EXAA 3QKTA 1GSAA 2WWTA 3CZAA 2VJAA 3IVAA 2QZJA 3E4CA 3MWDA 4UU7A 3KZVA 1J8YF 3P2JA 4MX8A 3P5BA 5TQ0A 1KVUA 1Z68A 2DKFA 3DXZA 2G25A 4TXHA 3D7RA 2C77A 3RIXA 1NXTA 4AECA 5FBKA 3ZDZB 1CBUA 4HX5A 2QR5A 2CBZA 3BQ9A 4D74A 1G3RA 1N2XA 2JHAA 2BAGA 3K9LA 4KCGA 2ZUFA 3CX3A 2DLNA 1BH6A 1O95C 1QH1A 3EHDA 4NU0A 4O6VA 5K1ZA 1A9RA 4YJKA 2BZ1A 5REQA 5C37A 3VOAA 3R7AA 4BLWA 4PEVA 4OL0A 1A5BB 3FPJA 5CLLA 1E1CB 1UT8A 1BE0A 3EW9A 3D2BA 4LRWA 1JG6A 4KQHA 1TU3A 4EY7A 4CLRB 2K87A 1N5IA 2NU9A 4KV7A 2N3ZA 3SC2A 5CVJA 2BBTA 4PAMA 2ZI4A 4PG6A 5EIXA 4MPTA 4XFJA 1P60A 3BGDA 5BSUA 4U5QA 4CEJA 4IVNA 1PFWA 1Z4NA 1OGYA 3HS3A 2IITA 3AHIA 4RJTA 1TF2A 7YASA 3WX0A 5L3QA 1I36A 1I2ZA 3VPHA 4XWWA 2QXUA 2XAUA 4RLHA 3T5PA 3WGMA 4FFBB 1DC8A 4CQJA 2IS2A 1NBMD 1PDOA 1CZNA 2AXEA 1SKQA 2QM8A 5BYKA 1Z47A 4CIDA 3HJFA 1GKKA 1QOZA 4LDNA 1I1OA 1R0XA 3X44A 2A94A 5EJ5A 4QFMA 1ZVJA 5IEBA 1RKUA 5E7QA 2NZYA 2BCJQ 3SYKA 2C2WA 4AY2A 4HS9A 3UMBA 1VCNA 1A8HA 1NQOA 3WXBA 4AZTA 3SZUA 3NB0A 3UT0A 4DIEA 1Q21A 1HFWA 3HP7A 1C0IA 1Y37A 3NM6B 4MZDA 4X6YA 4A23A 3EZXA 2HBRA 2OFXA 3C3YA 2NTVA 2WKRA 4BO5A 1XJCA 3JD2A 4J91A 4CG3A 5J2TB 3DUFA 3EVAA 3JQAA 4I3GA 3CVJA 3QX9A 4EW3A 1AA6A 1ZOOA 3M4NA 1XQ1A 1ZMBA 1ZPDA 1F9AA 1GYRA 3ORYA 1U65A 2QSJA 5DU2A 3MB5A 5THQA 3IQDB 4DYHA 1G5HA 4AMZA 3OOSA 4NYIQ 2XVYA 3MWEB 3VSCA 5AMXA 2HA5A 1CR2A 1X8KA 3GNSA 4J7AA 3NJ8A 4QDUA 4U3JB 2EDCA 1Z16A 4NFSA 2PJDA 1NBME 3C3MA 4LVOA 2R4QA 1RVV1 3LSTA 4ZARA 4YN3A 4YV1A 3RU7A 1N36B 3W5SA 1ML3A 1N34B 5B58C 4JCCA 1YTLA 1GZSA 3AETA 4FFMA 4DC1A 4IZOA 1N6IA 3GCZA 2XSZD 5TF0A 3ZWAA 4LGMA 1DQPA 2VJPA 3U09A 3GJZA 1Q50A 2DQ4A 3EYAA 5CCBA 2RI6A 3KL2A 5G0SA 4DLXA 4ER3A 2JA1A 1R6BX 1XF9A 3ZI4A 5IKPA 1U9ZA 5H3LA 3CVUA 3HR8A 1X80A 5IJ0A 1RAEA 1Q0PA 4FUTA 2UXBB 3QVKA 1KXJA 4KQMA 5A02A 1NQVA 1XE3A 1X8JA 4QBGB 2ZT8A 3C7CB 1MTZA 2J5BA 4AFNA 5JSFA 4KODA 1EM6A 2XNHA 5AT1A 3O6VA 1IC6A 1S2DA 3VVBA 4OG2A 1P4RA 3QV2A 2ETVA 3DVSX 2Q1SA 3L82B 3VYWA 4ZOLA 4AZ0A 4YMSA 1I14A 2Q0XA 1I51A 3AKDA 5A4AA 7ABPA 2JASA 2CF6A 1Q1QA 4AXBA 2C59A 3N8HA 4GZ5A 1KETA 3LVQE 2RGGA 3SFVA 5JATA 1IXYA 3OIGA 1GEGA 3W8RA 4ITUA 5KHOC 3HFSA 3L8ZA 2LCQA 1NPTO 4D57A 1Q14A 1NJSA 4KI0A 1AZTA 1GKIA 4EEXA 5HYVA 1JKIA 4MS3A 4K28A 3ZNOA 1LWNA 2HF7A 2XVZA 1QQTA 4NJEB 4LKOA 2Q28A 4C03A 2PGLA 3F2VA 4O5OA 3U44A 4C0JA 4LOIA 3WZ2A 4ABYA 2R87A 4RSGA 2DR2A 1JFSA 1V0JA 5KTKA 3IUSA 3FZEA 3EK2A 3QSGA 3AERB 5LC1A 3T7SA 4LY0A 4BATA 5JSZA 2QN3A 2ECOA 1GFIA 4IH4A 5EIWA 1YA6A 1BE8A 5T4HA 1N8KA 4UU1A 1JFRA 2CLMB 2M6KA 2VLIA 2OKGA 4R3WA 1T25A 2Z2XA 4XCXA 2A3NA 2Y1EA 2ZWOA 2R66A 2BLLA 3IHTA 5HOQA 1KPHA 3T3IA 3H11A 3R3ZA 1LGYA 3C16C 1O4WA 3L18A 3WLIA 3GJXC 3HG7A 3WK5A 4ZYVA 1EK5A 4W5RA 5D3ZA 1K2WA 4OLHA 5ENZA 4C29A 1Z0IA 5D8DA 1PG5A 1O96B 4UMDA 3I83A 1N9GB 1EWVA 2AEMA 4FXOA 4BU0A 6AT1A 3RBZA 3B5EA 5ALPA 2QP4A 3T1VA 3FOZA 1V11A 3I1IA 3FPHA 2ORYA 3NC4A 1IB0A 5F21A 3CISA 4RVFA 2XUJA 3BXHA 3WK8A 3ZU4A 5LIRA 5I9TA 1MGPA 5G3YA 5CB8A 3UT5B 2BFOA 4O8ZA 4BIIA 4TYWA 1XHFA 2V9ZA 1LPNA 2GEUA 3ETJA 4KAFA 5JFGA 4PYMA 3BWVA 4U2DA 3SAJA 4KX5A 1NL3A 2V0CA 3B9RA 2FGKA 2Q3HA 1GKLA 4J9VA 2FZ4A 2VC2B 4TUYA 5DGDA 2CJXA 3UHPA 1F8XA 1RE0A 1ZCAA 2PRZA 2R6JA 221PA 4R8VA 1E1QA 3WOHA 3GG2A 2J5XA 4IJKA 1B00A 4PBRA 1D6SA 3FNGA 4IS2A 4MGKR 3ZQUA 4JP8A 2FMKA 1W87A 1WQ3A 2GS9A 2ZRQA 2YN4A 1ZOIA 3P2IA 4P82A 4MRVA 4R9NA 5JC1A 3VUFA 4OIMA 3MPUA 5AOBA 2H5EA 2RGWA 3F5SA 4WPGA 1DG3A 3QVLA 4Q9LA 1B74A 2W71A 4J03A 4FYXA 3PCRB 3C6ZA 1B6GA 5BV0A 2ZE8A 1UZAA 3IEUA 4YRIA 3CLRD 1U7WA 3O92A 1SK8A 1SBTA 5C1BA 1AMNA 2BFEB 2NXCA 3GLQA 3COSA 4BWFB 1P8AA 4OKSA 2PT5A 1JDNA 1HUQA 1SOWA 4KO3S 4NSNA 3EZLA 2BJVA 1BQ4A 1VP3A 1XTIA 4OHOA 4FYPA 1OB2A 3QX3A 2YWBA 2DQYA 1YQDA 2PSJA 3K9HA 1ZVQA 3KSBC 4QX6A 5A05A 4IDQA 3TLCA 2FR8C 2YXNA 4JP3A 1FLVA 4Q47A 4LSMA 2K2WA 5IT0A 2DPYA 2B35A 2XWBF 1W76A 3E7PA 3GDFA 2XCSB 3UV7A 1ZL0A 1Y5LA 3K20A 4ZOLF 4LQ4A 4F1KA 4OX9B 3PICA 3DNPA 3S2EA 2OCGA 2B2NA 3UWOA 3FPGA 5CEFA 3UATA 3PFKA 5EVCA 3ETEA 5I4IA 4O3FA 1JEQB 4OJNA 4H18A 4DMCA 3SLGA 1E2FA 1E3TA 1RM0A 2VDMB 1OAOC 1SQ5A 2QRGA 5GAJA 1D0VA 2BHRA 1MJHA 2OBLA 1ES9A 3FWYA 3LVRE 2V55B 3IEIA 4GPTA 4OH1A 4DY6A 1EDDA 4K3VA 5T4BA 4NJMB 4ZCMA 3TG2A 5JS8A 4WGFA 3RIGA 3VKGA 1A88A 4UFNA 2ZS7A 1MHTA 3UZUA 3RHTA 4HBGA 3JQQA 5FBHA 1CSEE 5TQ0B 3GAAA 5IUJC 1JILA 2CVQA 3L41A 4GKVA 4JOQA 4ND6A 3VZPA 4B33A 1NXPA 1YDHA 3IXQA 3MSXA 5CBKA 3NWEA 4UAVA 4B3GA 1U8FO 1XTSA 2OE2A 3AI3A 3UH1A 4FIDA 2DX7A 4BNGA 1QH1B 1E2BA 1TM3E 4JI8B 2QJTA 4M7RA 4LJYA 5JJCA 2KWIA 3CJRA 5DHRA 5EJMA 3HL0A 1QUFA 1EUYA 1YD7A 1CUGA 3K35A 4JLJA 3VSAA 5JJIA 2D1RA 3D3WB 3WLTA 3KP1A 5EHXA 1ZONA 1TI7A 1ENPA 4FXPA 4KYIB 1KERA 2NU9B 3SC2B 5B3LA 2GXQA 4K9OA 2VPPA 4JLNA 1M1YE 3STVA 3TLKA 1CK4A 2VPZA 821PA 3HVHA 4KBYA 4CEJB 4HTFA 2X0NA 3MLAA 4Y30A 1XAGA 4DA0A 3KDPA 4M9ZA 1SQ0A 4NR0A 1BHQ1 1KK1A 1XWIA 1YRWA 3EISA 3LDUA 5L3QB 4BL5A 3HGQA 3PFGA 1RYHA 3B89A 1JMKC 5A5VA 2GZ2A 4D9GA 1OWNA 4G2NA 3II6X 4P4SA 3WYDA 3D0KA 4DCJA 4WX2B 4JODA 3JYLA 2EGHA 3R9WA 1IATA 1TKBA 2VHTA 3TB6A 1J9EA 2CFTA 4ZQCB 1GU1A 3TLYA 4D5GA 2EZ4A 3TXYA 3PA8A 4J8PA 5HQTA 1KH2A 1NIPA 3QOYA 4G1FA 4JJ7A 3CINA 2D59A 4PY2A 5LMUB 4BLRA 5LBTA 2WP8J 3V00A 4LIPD 1YZGA 1VL6A 4MINA 4HWTA 4FMCB 1T4BA 1RIFA 4TUYF 4RMJA 4KWCA 4ZV9A 2V4MA 3G17A 5KNBH 3GVIA 3DLBA 4DCUA 2FE1A 4NCNA 4WY5A 1W4BA 3G1WA 3T3HA 1L9KA 4UFOA 4ZU6X 4EPWA 2BGWA 5TEWA 1J49A 2L18A 4NPCA 1CZRA 4M87A 1DO2A 1OILA 5B4UA 4UHEA 3DUFB 3JQAB 3GLFB 2NMVA 2ZJBA 1YHNA 4TTPA 5CITA 2OUKA 2R60A 1GLNA 4ARBA 4G23A 1R37A 1GU7A 1VI2A 4H77A 1F1JA 1SQFA 2QQEA 4IDPA 2P2GA 4WZZA 3KUDA 1UAAA 4YP6A 4Q02A 1Z4LA 3AI2A 4FFWA 5CT8A 2LKDA 4BMPB 1G8MA 4GMHA 4OQLA 1NI4A 2XZDA 3PQDA 4A0HA 5JFOA 3FLAA 4G5GA 3GHYA 2NXEA 3C97A 1TLLA 1AT1A 3OLCX 3VAYA 3LT4A 4URUR 3LFTA 3NVDA 1QIHA 1RM5A 1M1NA 4HNGA 5LXTA 4UE2A 5DGIA 1N2JA 5BUZA 4B46A 5HW0A 1EFHA 4AN1A 4ENRA 2I2DA 4DIDA 5IARA 3T41A 1DKQA 1J0DA 1JDBB 1JR4A 3QG1A 2WDPA 3ITEA 2K2QB 2ZZKA 3IYLW 3QYFA 1VXRA 4LV6A 3G68A 2NACA 4PHFA 1MDBA 1PAUA 5FUWA 5AM2A 1V6AA 5TIIA 5IJ0B 2DFNA 4L7QA 2ZWMA 1GDTA 2XGJA 2IS6A 4U7FA 1WB6A 3ZBPA 5SY4A 4D8YA 1OZ0A 2JBAB 1PGNA 1KAMA 3LT1A 4GR9A 5EPOA 2FG5A 2E4AA 2VRWA 1JFTA 3TQFA 2AG1A 1TYAE 2G0NA 1KZ1A 4BUCA 2VJYA 2G40A 3FNIA 3HYTA 1M66A 1PYGA 5HEKA 1L7BA 4MV3A 4X91A 3DQZA 3UWMA 4AZ0B 4IXDA 1URPA 3RREA 2JZNA 3G8BA 2NVBA 2JCBA 3UW1A 3I01A 3OEHD 3RFFA 4MHSA 4RLSA 1T24A 4IFTA 1HDGO 2YFHA 3S8MA 4FHZA 3F74A 5CFZA 1Y48E 2HHAA 1O9HA 3H1TA 4FMDF 3S99A 1GTMA 3ZI0A 3U3XA 1FUUA 1HE8B 2FEKA 3CKYA 3PGXA 4MS3B 2DQSA 1O9BA 2OV8A 4JL8A 1I8TA 4QYIA 4EJMA 1F2UA 1ZOSA 2NM0A 2AUNA 5E1BA 4NMMA 1T6ZA 3VPXA 5JYBA 2JGAA 3HXQA 3WRXC 4PZCA 3JQGA 2FPIA 1P5ZB 1R5JA 2DE0X 3CEPB 1VJ1A 4L8WB 1SU4A 2B9VA 1CJCA 2ZB4A 1K7EB 1VLJA 1N1GA 1Q57A 1VRWA 4D0LB 3KZNA 1VG8A 3AINA 1ZD9A 2OHXA 1KI8A 1X39A 1E7SA 3JSXA 3RRNA 2GCEA 2GYVA 2IXBA 1P4GA 1YR8A 3PNSA 5L7TA 3KQMA 4P3XA 3IJEB 2BMAA 2KMLA 2W8BA 5IAJA 4G1EB 4ETNA 3OT1A 4P22A 4FFRA 5HM6A 4U2GA 1C4OA 1CNEA 3M4YA 1JEJA 3CMCO 1KH1A 5CLGA 5KNCD 4BFTA 1FE8A 5JXIA 3QVTA 3NYIA 4OHUA 4E21A 1E1LA 1TVEA 2JIZD 3SYMA 5C35A 1P9RA 3EPHA 4QAQA 3FTNA 4CKYA 1XEXA 1U9YA 2C9YA 2JAHA 4GW3A 2BCEA 3WLLA 2DY1A 1QGUA 4BRZA 4D99A 2RJOA 3BT7A 4C7OB 2Z43A 1IN1A 4FSXA 2DC1A 4P4NA 4JAVC 1V11B 3ZW9A 3FNFA 5IKMA 1R0BA 4JZKA 5DRYA 1C7QA 2NV6A 1O5TA 3B3QA 3LCRA 1VTKA 1ODTC 1TO1E 3T4EA 4Z4IA 1HQYE 2QWXA 4R2LA 4YUVA 1O94A 3EXG1 3MELA 2XCLA 3A0UA 4H3HB 5HKAA 3GC6A 3ZJ5A 5JG7A 3ZWBA 2H9YA 4ZCLA 4TN5A 4GFDA 5DNUA 4AS3A 2Z1DA 5CH8A 4B83A 3A1WA 3RC3A 2QN6A 1ZZGA 1P4JA 1VBNA 2Q2VA 2GHTA 4TTTS 1IAVA 3DYVA 4TUYB 4TL6A 2PMKA 3Q5DA 4JDUA 4EA9A 3HBMA 4L5IA 4UDXX 1SOMA 1JR2A 2PGJA 3LHIA 3KVRA 2Y1WA 1QONA 1UC8A 3M7IA 4PVDA 2HQ1A 3ZY6A 1RQGA 2VNJA 1I7SB 3TDKA 1MW8X 1HL3A 1D2MA 1ZQ1A 3PVZA 3TNFA 5KNDH 3AVPA 5DSXA 1UADA 4EY8A 7ADHA 3BEOA 5FOXA 2ZJ2A 4JJ8A 3S70A 3T0GA 1GL3A 4JX8A 3K1AA 1N6PA 4TTIA 3HM2A 3PCTA 2FFBA 4IF6A 4DJEC 1ORRA 1GUZA 2FX2A 4QJBA 5LXTF 5IBCA 3CA8A 5CAEB 4ZEMA 1WB9A 1EFRA 1Y33E 5LU8A 5B1IA 4IWNA 3HR4A 2FI1A 1M83A 1K4KA 2H4WA 4JK3A 4P38A 4UAUA 4HT3B 2V6GA 5AK0A 4M9SA 3PBKA 5FI3A 1ECJA 1GGMA 3HZZA 2Y1FA 4TS9A 3TAHA 4AJHA 1SVUA 2MSEB 3EGOA 2XQVA 4O4JA 4Y6RA 5G02A 2EW2A 1D1PA 5F76A 1H8ED 1FRVA 3OLVA 4R2KA 3DKKA 4WZAA 4E5YA 1NA5A 5BOSB 5HHTA 4E0BA 3D1LA 5FHRA 3LQ4A 2Z95A 2WWYA 1WQ1R 1TGVA 1K27A 1NDUA 4XGKA 4B4VA 1UK6A 3F7MA 4Y1GA 3PYMA 3BD8A 4GMKA 1J9GA 2ZUUA 3G0GA 1SXQA 2VDLB 3K0KA 3C0KA 3DO5A 4R0NA 1ADFA 2DWOA 1P0CA 1YASA 1PFQA 3OZXA 3EQZA 2CC2A 1H93A 1HYBA 1NN0A 1VC2A 3GDWA 5AKYA 3RU3A 1MT3A 2FEAA 3DWIA 5DGTA 5LMCA 2A4MA 1VYTA 2E9SA 2NYRA 3EOBI 2JGMA 2DTEA 4JJIA 2E5FA 1GNRA 1XKLA 3EULA 3L4SO 4O3MA 1LJLA 1NQ5A 2LRHA 3F5QA 4J3JA 3UWDA 1GGFA 1I3CA 1PE0A 4CV1A 4DBVO 1PQWA 1Z0JA 1A9XA 2OAP1 3DOJA 3MTJA 2PQ2A 4JYCA 1ZI8A 4EKYA 2LV8A 1JQ5A 1QFYA 1EGAA 2XUIA 3PFFA 1H0KA 2PGIA 4UZFA 3C3BA 1P45A 5FORA 2G76A 4J07A 1GADO 1LLDA 2C92A 1OLOA 2ICAA 1N6NA 3GLHE 1TIKA 1DBRA 4OKNA 1W85A 1AD2A 4M0CA 4JOCA 4JP1A 1E4YA 4IXMA 2F8SA 3IMKA 2QX7A 1XVVA