4Q4HB

Tm287/288 in its apo state
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
583
structure length
583
Chain Sequence
GPILEKPALKNPTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEKDDPDAVELREVRGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/transport protein
molecule keywords ABC transporter
total genus 216
structure length 583
sequence length 583
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
B PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 4q4hB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q4hB02
4LDJA 2DFLA 3P1JA 4A0FA 2ZSDA 5FPHA 1QRAA 4G01B 1YJ5A 2G0TA 1RRCA 3KTAA 4A92A 4QBIA 3PVSA 3QVVA 1N5IA 4M4SA 1C9KA 2KI5A 4QGFA 3MJHA 1SXJE 1IXZA 3CRVA 3NVAA 3PIRA 1OH7A 1T3SA 2EVWX 2YWGA 2W2XA 4MKIA 3I1FA 4KSCA 2REBA 3FHOA 2FOLA 3GEHA 4JKIA 3SQWA 1LY1A 5CITA 2P2LA 3RS4A 3GD7A 4QHTA 3ZVRA 1QF9A 1K5DA 4ZDJA 1NMZA 2MSDB 2V1XA 4URYR 5BN5A 2EYUA 1G7SA 5J40A 1XD9A 3VR3A 3CR8A 3K09A 3GJXC 4RD0A 2IUTA 3ZVMA 4D4MA 1U94A 1IAQA 1OJLA 5F9FA 1EWQA 4CZ2A 3HYTA 1Z2AA 5J4HA 5DISB 3FB4A 4MKGA 1P62B 3B1WA 5SZKB 2HLDA 4KFRA 4BE7B 3IGFA 1CRQA 1G8HA 2W0SA 2R6AA 4MGKR 1KMQA 2IYLD 4AG6A 3KQNA 2JLZA 2Q21A 4MDFA 4XTCS 3RSLA 3GLHE 2QT1A 1NF3A 3Q3JB 1XNJA 1G8FA 3FHTA 1Q3HA 2QY9A 3A1VA 3EC1A 4HLUC 2BEKA 4YMSA 1UBGA 5FBWB 2GXSA 1E99A 5IK2A 1NP6A 3QQ5A 2BKEA 1XPUA 3KFVA 3TLXA 1JALA 1NSTA 1G3IA 1PUIA 2QMHA 3K0FB 3WYFA 2YVUA 3B1XA 3P32A 3MFYA 3TJZA 2FX3A 1XJCA 2MMGA 4B48A 1W4AA 2I3BA 4TL6A 2VF7A 4C0SA 3T35A 2ANBA 3QF4A 1G16A 2RGBA 4RZUA 1AJEA 1SVLA 1E9BA 3KQLA 5FTJA 3TAHA 4GZLA 3OIYA 4LZZA 3B9PA 5J4KA 4WOPA 1EX7A 3LBNA 4TYNA 1N0VC 4ZPXA 5F2EA 4P4TA 4WXPA 1OIVA 1P73A 5J4VA 2GKSA 1G21E 2IWRA 1W4BA 3AKDA 4QGHA 3PXGA 3LW7A 5CYOA 5IRCD 4OHZA 4C7OB 5KU1A 2GNOA 1KK0A 3T06B 1Z0DA 5A4JA 5FOUA 1UADA 4O2LA 1HEIA 1P3JA 1JEDA 4FI3C 3RANA 4WZ6A 1OSNA 1YE8A 3IPXA 4MH0R 3QKRA 2F43A 2WJHA 3PEVA 4CRWB 1VYTA 1WBDA 2A5DA 2VP5A 3DPUA 3UANA 1XD2A 1OH6A 1ZM4A 1IN8A 1AS3A 1KKLA 1E2EA 1KI8A 1HA3A 3TH5A 4F92B 3X1ZA 3BAFA 4D82A 4QKQA 5EP1A 1X1SA 3A8TA 5IT5A 2J0VA 2ZUCA 3GQBA 1P4SA 3TNFA 1DAHA 1XTJA 2N1BA 1TX4B 4DRZA 3ASYA 3QENA 2W0MA 1W46A 3DL0A 5C46F 4CYMA 4PO9A 4U7DA 2WWIA 1E94E 1JQLB 1N2CE 2I1QA 3D3QA 5AJZA 3GLFA 3GFPA 1XJ0A 1RKBA 5FBQB 4KITB 2IL1A 3NC1C 3UMSA 2FSIA 3VHXA 4AC9A 1FW6A 3TW8B 2FNAA 2AR7A 5FBLB 1TQ2A 3SFVA 1NKSA 3FVQA 2RCNA 2LWIA 4KVGA 2WWXA 2AHOA 1RVDA 4C30A 3TAUA 2W2VA 2DCUA 3I32A 4G5QA 4BLSA 4MQBA 2O8EA 2J0UB 2BJWA 2B92A 3AVUA 2ORIA 2QMUA 4OI0A 5DHAA 4UNPA 1W49A 2AK2A 1GM5A 5C1BA 2NZ8A 5EXTA 4HZUB 1W0JA 4DLVA 1SQ5A 2F1IA 1A7JA 2QRNA 2ZR9A 4Q01A 4XVRA 5C18A 1FFHA 5KHOC 3B85A 3U7FB 1U0JA 4Q47A 3AF3A 4BZPA 4D2IA 3W5JA 1LVGA 3QEJA 1SVKA 3L0IB 2P6RA 2WIBA 4Q7JB 521PA 2ZANA 4Z8YA 1ANKA 4IXNA 2JCSA 2R2AA 1GL9B 1HURA 4IFBA 3LXRA 2RGGA 3SU8A 2W2TA 4FN5A 2FWRA 1ZYUA 4YXWA 1AM4D 1A5TA 2ZRCA 4FW9A 4PPFA 1NN1A 4OYHA 4WA7A 1CEEA 4MA4A 4CVNA 2P5SA 1UPTA 4MGYR 3JVUA 1E4YA 4Z54A 3P26A 4XOIA 4LRWA 1KZGB 1VKJA 4B3XA 5H8WA 3K0CC 2ZJ8A 4Q4AA 3JVVA 3B7GA 3KQKA 1D2MA 1HV8A 1G7TA 1UBCA 4P33A 4ZDWA 1JAHA 3SR0A 2V9PA 4D4LA 1SVWA 4L9SA 2ZVQX 1G41A 2XZPA 5FTLA 3THWA 3QI2A 5FTMA 1DOAA 1Q1EA 2GCNA 3DM5A 221PA 2WWGA 4HLDA 1XZQA 2WJVA 3DKPA 4FCTA 5FFMA 2JLSA 4TLBA 2YWEA 3ADKA 3CZQA 4HATA 4PHFA 4KSBA 4NU0A 3REFA 5HKKD 3O8RA 3QSYA 1HUQA 4R98A 2B21A 4AK9A 2HXSA 5HR5A 3EPKA 1GITA 2R44A 2H57A 1TUEA 4DCNA 3PG5A 1KK3A 3W90A 1IY2A 3BIFA 1DBSA 1UM8A 2TMKA 2ZRFA 3CWZA 4FMCF 5BYKA 4P31A 1VHTA 4PHGA 5FUXA 2O8CB 4LSGA 3AVVA 4GL2A 2OCPA 4Q4HB 2RMKA 3U60B 2R65A 1X6VA 2LKCA 2C9CA 1NVWQ 2D4HA 1E9EA 3LD9A 2XTZA 1SXJD 3UWOA 1G18A 5CB6A 1KDTA 1UEIA 3B60A 3C7KA 4B3CA 1NVUQ 3FMFA 2OO7A 121PA 2IYTA 3S1AA 4CEHB 1TQ4A 3MJRA 1S96A 4WBSA 4RD6A 4Q9HA 4RD3A 1U98A 5SZJA 1CR1A 2ZRLA 4C2TA 4KFTA 1Q20A 2QAGB 1JR3A 2QQEA 1T5LA 1E0SA 2QENA 5FBVB 2JLWA 4IEIA 3B5JA 1GUAA 2NZJA 3EPJA 4IXMA 1MRSA 3RAPR 1GKIA 1G8YA 1KJZA 3NHAA 2ZU0C 4HAZA 3JZAA 1Q3TA 3AKYA 3CWQA 3KB2A 4BFVA 2IBMA 4PSVA 1Z83A 4YC7A 3HDTA 4BFTA 2J7KA 3FKSA 1Q0UA 3BJIC 3MG9A 1NIJA 3K9HA 4AKHA 2BDTA 4JJZA 1RZ3A 2OFWA 2ECKA 1FP6A 5DGXA 2FG5A 1IXRC 3DOEA 4DLTA 3GMTA 4ZI3A 5JMTA 4F4IA 4RD1A 2HEIA 4Q19A 5G41A 3ZJYA 2XOKD 4ESVA 1NY5A 2X2FA 4B2IA 4ACAA 1L4UA 3CONA 5CB8A 4U02A 1LB1B 1A2KC 2IYUA 2OUKA 3I92A 4OK5A 2JGNA 2G88A 2ZSFA 4AYXA 4EFNA 4HLUA 4DJTA 3VNVA 5BXQC 2I4IA 4PX9A 2RHMA 4LOAA 2QTFA 2H16A 1KHTA 2G83A 4YONB 4B34A 5E7IA 1IHUA 2DWQA 2GZDA 3O47A 1SHKA 1OE0A 3HPRA 2A3RA 1RFLA 4Q1CA 1PJRA 3CBQA 2OBNA 2ZAOA 3UKDA 4Q5IA 3R8CA 4B3GA 1PVOA 1D8TA 4NBSA 2E87A 3ZH9B 2P6NA 1HTWA 1QHYA 4DCSA 5FOXA 3WXMA 3K70C 3THYA 3T1QA 3Q7PA 1XEXB 5B2ZA 5KPJA 2QG6A 4MUBA 2O8FA 4BZQA 2H7VA 3QF4B 3RRYA 4Q9LA 4Q4JB 2ZE8A 2YV5A 5KSPA 1GNQA 3OZXA 2V7QD 2ZYVX 5GVSA 2V7QA 4I1UA 3I4LA 3QXXA 4S2EA 5DI9A 4DHEA 2PLRA 3VAAA 2W00A 5BWMA 4HB0A 1NLYA 3KQHA 3A1SA 3N70A 3OIUA 5FL3A 3AVYA 3LBIA 4M1WA 4G5SA 2R6GA 3QXHA 4JBWA 4Q7KA 1KZ7B 3K9LA 1EFRA 5ANRB 5L3RA 2IXEA 4OI4A 2FZ4A 2VHUA 3QJYA 4I99A 4XWKA 1VDZA 5FUYA 3UK6A 3AM1A 2WICA 1HY3A 1F48A 4M21A 2IUUA 3U4QA 4BFWA 1R5NA 4N0DA 3WP0A 2IS6A 1S4QA 3TSOA 621PA 2RGXA 2BBSA 2G9NA 3ONWA 5HTKA 4URVR 3QKSB 2Q9AA 2Q3FA 1AS0A 2IXGA 5FI1B 3WBJA 4UNRA 1P5ZB 3ZS8A 3QEOA 2BJVA 3ZQJA 4B33A 1AQUA 1QHIA 5G53C 4Q48A 1DVRA 3W6PA 2REXB 4LBWA 1KI4A 2ZRIA 1GP2A 4LV8B 4JVMA 3Q5EA 4L9WA 2HT1A 4GOJA 1Y3AA 4NHOA 2OILA 421PA 4M1MA 4G0NA 4GFDA 4YQFA 4OK6A 3RC8A 3KKOA 4LUCA 3TQCA 4URWR 2GJKA 2OHFA 3K0AA 3M6AA 3TVDA 5CDFE 3Q85A 4LJYA 3BB3A 1YZGA 2PZGA 3HU1A 4K8OA 5KNDA 4PAQA 5EE3A 1IXSB 2VSFA 1XXHB 2A5FA 2HYIC 2ZRPA 1FQKA 1RIFA 2F1HA 2QPOA 4D80A 1XU4A 5BN4A 1OKKA 5F3WB 4LV5B 3P27A 3A6PC 3T1TA 1MABB 1W36C 1V43A 1KYIA 3I3SR 2JATA 2J7PA 1KI3A 1U99A 4RKEA 3LQQA 1N6KA 2HYDA 1RRGA 3U3OA 2QGNA 2ZRBA 3T5GA 3TR0A 5L3VA 5G3ZA 4B76A 3A4LA 3U61B 3FMPB 2R6DA 2YOFA 2JJ2A 4Q1DA 4B44A 1SXJA 4PHTA 4V0ME 3RS7A 3ZDQA 2WJJA 4JT2A 4OHYA 1E2FA 4M1TA 5FBRB 5HZKA 2O8EB 1EK0A 1IN6A 3CH5A 2J5XA 2Q3MA 3D7MA 2AL7A 3S1AB 2A30A 4CDGA 4D4JA 4GMXA 1R5BA 1S0UA 3SJCA 2R8RA 3VR1A 5F9HA 1NL3A 3VKWA 1OB5A 4R7ZA 4RJLA 1DTSA 4TTRA 1CJUC 2IX3A 3U44A 2OBLA 4LBYA 1XD8A 2YC2C 3MD0A 1F2UB 3D6TB 3BB1A 1E2QA 4HUQB 1COWD 1U8YA 2VHCA 3R7WB 4FCWA 3B2EA 4MUAA 4ZKDA 3P4YA 4M9XA 2QMOA 4NPHA 1TL7C 4H1VA 1G4AE 3SS8A 1B0UA 2ZTSA 3VMFA 1OFIA 5JWRA 1G3MA 4DLWA 1IJFA 1DO0A 2JDIA 1XMVA 4KLZA 2XJ9A 3F8TA 3HPQA 4PAOA 2ZRKA 3KDSE 1B23P 4P4SA 2BM0A 4DBLC 4A8JC 1Z0JA 3RHFA 2Q9BA 4RKFA 4OHVA 4TLAA 1XD2B 1ZRHA 2Q0HA 5J4LA 2JLXA 5DIFA 1N6OA 1AZTA 1ZP6A 2WMOB 4JBXA 1CF4A 3CF6R 4M2LA 2AFIE 5C4MA 1IY0A 4A15A 2NO7A 3OAAA 1E69A 3THXA 4YXWD 2A5GA 2BBTA 1TQDA 3IIMA 2HLDD 2ZS7A 3DZDA 1OFUX 4G5OA 2ATVA 1X8JA 2FSGA 3Q7QA 1MKYA 1X3SA 4PZYA 2XITA 3OE7A 1KAGA 5EXSA 1J8MF 1QZXA 2QU8A 2Z83A 4DLZA 4E03A 2FA9A 3QIAA 1UEJA 3QY0A 1G8GA 1J2JA 1XCPA 5IHPA 4PO1A 4UKDA 3QVUA 3QXSA 4A0RA 4P4SB 4ASUD 1ZD8A 2DBYA 4MRSA 1H8HD 2JLYA 1U8AA 5FOTA 3I72A 4XIGS 3T5DA 2Q3HA 3U7HB 2WJGA 1NLZA 3O8BA 4WZBE 1TEVA 1C4OA 4UQOA 3FGNA 5CIQA 3OEED 2H1LA 1Q57A 1OFHA 4MGIR 3I5XA 1DAMA 3B82A 1F3OA 4GRAA 5B30A 4RZ3A 4I81A 2IS1A 4G3XA 3MWKA 4DVGA 4W5WA 2DYKA 2PX3A 2FEMA 3NH9A 2WIAA 1SGWA 4S35A 2GVZC 3LLUA 4W5JA 3PEWA 2IT1A 3L2OB 1P9WA 4TLEA 4OQXA 2J0UA 1H8ED 2QL6A 2Z4SA 1WF3A 3NEJA 2WWFA 2AWNA 1G64A 4MYCA 2NPFA 3VU9B 4F7WA 4M1OA 2HDNB 3OAAD 5DI3A 1ZNYA 2D06A 4Q4LA 1ZJ6A 1ZCBA 2NTYC 5AUQA 5FL7A 1JEEA 2ORVA 3W5IA 1FP7A 1CJVC 1R0XA 3VKGA 2EU8A 3CX7A 4BLPA 1XBTA 1OIXA 1GRRA 1DO2A 2KBEA 3W3AA 3TKLA 1W7AA 1ZC3A 1MO5A 3SOPA 1NVVQ 1ELOA 1OHHA 2ASEA 2UZIR 3ICEA 2ODWA 1Z06A 2PT7A 2WBLC 2Y8EA 2NGRA 2P6UA 2XXAA 3QKTA 1A82A 3PENA 4D0GA 2FE4A 2O0KA 3A58B 1N6IA 1E0AA 4EJSC 1DADA 4U5XA 2ZI6A 4CIDA 2REOA 2IYWA 1R0ZA 3KXLA 4FWIB 3A4NA 4JT4A 4RCZA 5L3QB 4N1AA 5IF9A 2QBYB 1ZIOA 3QKRB 1ZUHA 3PUXA 3THOA 1N5LA 3W6OA 4D0LB 1E2GA 4D0NA 4DT1B 4RD2A 3SZRA 1RPZA 3X1WA 1P2SA 1F6BA 3EXAA 3GLHB 3W3ZB 4ZI2A 1VIAA 3EWAA 2KJQA 5H1YA 3UXMA 3C14C 1EFCA 1US8A 1R7RA 5FH9A 3L8ZA 5AUPB 2GETA 4TSFA 2IUSA 3CIOA 4B2PA 1NSFA 2OCYC 3BBPA 2ZRNA 3IO3A 3TSZA 3C16C 2C9YA 5IK2D 2CNWA 2KE5A 5KPDA 2PBRA 1S1MA 2B7CA 2Q9CA 4EQ6B 4TQUS 4O3MA 1E79D 2NPIA 3KJEA 2BC9A 2C78A 3C4JA 1W4CA 2C98A 1F2TB 2CXXA 2FFQA 3IO5A 2D7DA 3SBEA 1U9IA 3X1YA 2G0NA 4GPTA 3GLGB 5LB2A 3ND8A 1G3UA 3NC0C 1LS1A 2HF9A 4JLNA 2QE7D 3WNBA 2XB2A 3J81k 1II8A 1SXJC 5A5GA 4RD4A 1S3SA 2OLKA 1CJMA 3V4RA 4HB2A 2FFHA 2FZLA 3GJ3A 4NZYA 5FR2A 4F91B 1GVNB 2WJYA 3C5CA 2VP4A 2J0QA 2AKYA 3PR1A 1D9ZA 2GZAA 3QXCA 4E09A 3LO5A 2W6IA 2PEZA 4FMDF 4DIDA 2WKRA 4D81A 1AKYA 2ZI7A 4TL8A 1XXHE 4URXR 2GAAA 2ZAMA 1OH8A 4AD8A 3QPUA 4EDHA 2NO6A 3K0EA 3TQFA 2IC5A 2FPLA 3KB1A 5G3YA 1KIMA 3LRPA 3HU3A 4LYHA 1CKEA 1RRFA 4KVAA 2F1RA 5JEEA 2V8OA 1YR6A 3O8CA 3REGA 2QGZA 1ZVQA 3GEEA 1I2MA 1M8PA 1JECA 1TTTA 5TV2A 3AVXA 5CLQA 5FPKA 3CRQA 1I4TD 3THXB 2YC4C 5TDHA 2VSXA 4MRPA 5AUNB 5AJVB 3LH5A 4QC2A 4QHSA 1W4RA 2XX3A 4TL9A 5KUTA 4TYYA 3SN6A 4TT3A 1VG1A 3BORA 3A37A 2CJWA 1R10A 4Q1AA 1SVMA 4IDPA 3VX4A 4C2UA 3EWSA 4CF7A 4YMVA 3LX8A 1CU1A 3DM9B 4TZ0A 2FSHA 3MSXA 3M0EA 4KCGA 1F5NA 1CS4C 4UNQA 4FMBB 3VR4A 2GEUA 5L3SA 2ZRJA 1OW3B 3TRFA 2CCKA 2PCJA 2Z4RA 2GZHA 1XFAA 4C0BA 1II8B 2P65A 2IYVA 3R20A 4EIWA 3FHCB 5K8UA 2GA8A 3IIKA 2XGJA 4OHWA 4IW3B 5E7MA 4C3ZA 5EP4A 2IWHA 2H92A 3FDIA 1HE1C 4HAWA 5EXPA 3GJ8A 3I8SA 5J4YA 3A1WA 1C1YA 2X2EA 4TYQA 1KI7A 2ZJOA 1F2TA 5M04A 2FFAA 1ZC4A 4WIAA 2XZOA 1ZINA 2NOAA 4PZZA 1WDTA 4CEHA 3U3MA 3GJ7A 2OCAA 2QTHA 4NONA 5DLQC 1J99A 4LPSA 5TXGA 2NQ2C 4TMWA 1CXZA 3ZQ6A 2C2HA 2O0HA 2DFNA 3CM0A 3C8UA 2B8TA 4QNRA 3U3KA 1SXJB 1Z5ZA 2ONJA 1R2QA 1SKYB 2BVNA 1XTRA 3GJ6A 2GEVA 3NDPA 3QPWA 3CUEF 1SHZA 3ADDA 3WMGA 1MABA 2V4ZA 4CT4B 4DUGA 1Z2CA 3QE0A 5GJVC 1UKZA 4EFMA 5JCZA 4X8OA 3B1VA 1KI9A 1P9RA 1Z07A 4Q21A 3H1TA 2JLRA 2QM8A 3KXIA 1EWRA 3TK1A 4HZIA 2XJ4A 2FGJA 3A1TA 5IDVA 4DDWA 1LFDB 4NYMR 2ODBA 1ESMA 2D3WA 1ZMXA 2D2EA 5TMPA 3AVTA 1MT0A 1P7CA 2OXRA 2I1VB 3T34A 1N0WA 3GLIB 4A6PA 3VTKA 4DXAA 1OLOA 1IN7A 4ZDIA 2GDJA 2H8KA 2WAYA 3A36A 4L16A 5FUWA 1T8TA 1XTKA 2ZRGA 4IVPA 3T1OA 1UAAA 3PUVA 2ZE7A 1UDXA 3SE0A 1D6JA 3OEHD 4KI0A 3QKUA 5TY0A 1NRJB 1GIAA 2ZETA 4PANA 4EPXA 4NYIR 1R8QA 4WXRA 5LD2C 3IBYA 721PA 1AQYA 4Q9KA 1Q21A 3ZGXA 3BRWD 1TF7A 4JLKA 4UXJA 4GNKA 1NMXA 1T6NA 821PA 4KO8A 3V4FA 2VPPA 3L0OA 2IK8A 1OF1A 2J59A 5E4FA 1V5WA 3GCGA 4CGZA 5ELXA 2A5JA 2ZXUA 4AKIA 1Z6TA 2G3YA 3N5CA 4GSYA 1G5RA 2EFCB 2XNDA 3SJZA 4ZCIA 1GTVA 4AG5A 5CM9C 3AF4A 2O52A 3MGCA 3QOFA 2GESA 4OJQA 1YR9A 1IOZA 2BCGY 2RGNC 1AGPA 4KU4A 4LHWA 1LF5A 1AGRA 2C96A 1U9IC 2O0JA 4DWJA 3ADCA 2G77B 1AKEA 1YQTA 2ZU6A 3ZYCA 2PJRA 4PR0A 1W44A 1DAIA 3NHBA 2F1JA 2N46A 2DB3A 2FSFA 2C03A 3WNCA 3WHKA 2EFDB 5E95A 2WAXA 4L5BA 1CRPA 5B64A 5JCPA 5JRZA 1Z22A 2JJ2D 3EA5A 3WMEA 4QG7A 3MLEA 1ZM9A 1FX0A 1W36B 1NNEA 2A7QA 1ODFA 3SFZA 1E0KA 1J7KA 4LV6A 4TMKA 4Q02A 4PSKA 3W6NA 4JS0A 5JJKA 1IM2A 1K6MA 2RH5A 4XTRA 4K46A 3B1YA 3KQUA 1MOZA 2QMEA 1W0KD 4LX0A 2VP2A 3CRMA 3ZZ0A 4V0NA 2AKAB 3FFAA 2VP9A 3FYHA 4DCUA 1VPLA 3IHWA 4LJ7A 1Z3IX 1E98A 2XZLA 2Z43A 2D2FA 1BYUA 1G20E 4XVUA 3KTAB 3GPLA 1YVDA 3LW8A 1W48A 3IIJA 3VR2A 5EJEA 4WZAE 1XTSA 4DLUA 3WRXC 2KSQA 4XJXA 4HAUA 4P4UA 4DDUA 3AUXA 1GSIA 2AXNA 3PUWA 5CDFA 2Z5FA 4D25A 4A36A 1FUUA 2F43B 3EASA 3AB3A 1OB2A 4GP6A 3FMOB 3H2YA 4ABYA 5EUMA 2DFKB 3CPEA 1KI6B 4F4JA 2NIPA 1BIFA 1M1YE 1G5TA 1KO5A 1E3MA 2GJSA 4D26A 4BFSA 5CIWA 4DDVA 4FIDA 2RGAA 2RB4A 4C7OA 1EG7A 3BE4A 3PUZA 2FPKA 2GVDC 4BUJA 1E1RA 4HZUA 4KYIB 1XMJA 1TAGA 1XPOA 5EE0A 3ZVNA 2CHGA 2VLIA 1TADA 3I73A 1YZLA 4JL8A 2QN6A 4DIEA 1HYQA 1HQCA 1E2NA 1S3GA 1N6HA 4Q9IA 1DAGA 1E4VA 2DFTA 4Q7LA 2OFXA 1G291 2IHBA 3BB4A 5B57C 4KBGA 4RZ2A 3BH0A 3KKNA 4B47A 3L82B 4NCIA 1G7CA 1T3HA 1VCMA 1RW4A 5DN6A 4QJ3A 3EZ6A 4IRUB 2GTPA 4LCBA 1VIYA 2DY1A 2ZSAA 2CLCX 2CE2X 1MO4A 1QG2A 1SVOA 1VG9B 5KDDA 4POAA 3M4YA 1Z6GA 3TSWA 2O8DA 1E2PA 3UG7A 3NKVA 4RVCA 2AN9A 2QSYA 3MRSA 1XZPA 2ZRMA 1PZNA 2WV9A 2CLDX 2YHSA 2BIFA 3SNHA 4V02A 1DEKA 1GKUB 2ORWA 3LX5A 2QP3A 4F93B 1GRNA 3W8NA 2GBLA 4DLSA 5P21A 2CHVA 3LAWA 2VF8A 4HLQB 2HJGA 1IONA 3Q72A 2WSSD 4TLCA 2ZUDA 2AXPA 2ZI5A 2ZQ5A 5JZVA 2ZPTX 1MR3F 1UFQA 4ARZA 4AYWA 2G1KA 3RS2A 1LS6A 4EPYA 4ARZB 3K8YA 2ZJ5A 3KXKA 3BOSA 3U2QA 2ZYTX 2WJIA 2ZR7A 3HP1A 3PEUA 4Z1MA 2G6BA 2JLUA 1VCNA 5BW8A 4OKSA 5KDOA 4FMCB 2XEXA 2PCLA 4PHHA 1Z0FA 1GL6A 5KNBA 2ZS9A 4QGGA 3CLVA 4NDZA 1VECA 4LJ4A 1EFHA 3O8DA 4G5GA 3K70B 2WKPA 3GLFE 1MV5A 3EX7C 1JR3D 1N3BA 2X8AA 4YMTA 4B75A 1BYIA 2YWHA 2WOJA 1S8FA 2JJ1D 2WVJA 4MDEA 4KHZA 1FNMA 1QHNA 3R7WA 3TW4A 5JJIA 1TUIA 4AWXA 1NKTA 4RSGA 4W7SA 4NCKA 5JHGB 4IDOA 1WBBA 1E9SA 2CE7A 4DCTA 2MMCA 3FKQA 4KBFA 4LJ8A 4EKDA 4HLCA 4QFMA 4X8MA 4TMTA 2GK6A 1U8ZA 1E2LA 1Z29A 2J9RA 3EPHA 1QG4A 1KDRA 2BV3A 3AF1A 2R6FA 1LV7A 1R0WA 4JLAA 3CNLA 2IHYA 4A4DA 2CL6X 4Y0AA 4YMWA 2OM2A 2GXAA 4KV9A 2VP6A 5DNYB 3SBDA 4B6FA 2QUZA 2HXYA 1Q22A 1U0LA 4E22A 1XCMA 3ZS9A 2CCJA 1LNZA 4EPTA 2BBOA 5JWOA 3EW9A 5HKKA 4IVQA 1OFTA 4NTZA 1M6NA 1N6NA 1NVXQ 1UKEA 1VG0B 1YR8A 2CHQA 3B8HA 3AVOA 3EAQA 1D2NA 5D3MA 5F98A 4Q1FA 1N25A 2XAUA 2VH5R 3K09C 3NH6A 4JVSB 4JLDA 4MRVA 2QNRA 2JIZA 4LY6A 2A5YB 5HCNA 1KDPA 3IDQA 3AP3A 5AJWA 2ZM5A 4BLTA 2ZE6A 4JZKA 1ZBDA 2YINC 1AN0A 4GT1A 2FH5B 1DARA 5EP3A 1CTQA 3R9WA 2W6JA 1Z6XA 3W8RA 4L4UA 4LI0A 2VIIA 4A2QA 1N6LA 3NWJA 1QHXA 1KI2A 1EXMA 2GJAA 3K0AB 4URZR 2GF9A 3DMNA 1JPNA 1U81A 3RS0A 1KAOA 4B73A 4JL6A 4PC7A 3RC3A 5D3MB 1HE8B 1QHHA 4B71A 3E2IA 1GNRA 2YOHA 3CNNA 3DEFA 3K53A 5JI2E 3U5ZB 5JFGA 2GHIA 1Q1BA 3AF0A 3V9PA 1XMIA 2RGDA 2VP0A 1J8YF 2QORA 4PAMA 2UVQA 4OI1A 3U7GA 4ZV4A 2PL3A 2P0EA 4RFSB 4R9UC 2PEYA 4NYJR 3HJNA 1UBFA 1O3YA 2CVFA 3K9NA 4PTLA 4NP6A 5DSZA 5GJBA 1CR2A 3WHLA 1KMHB 4IOLA 2VEDA 4LHZA 3GJ0A 3T61A 1KJYA 1N6PA 5CM8B 1GL7A 2UZ3A 5AR1A 4IVRA 4URUR 4IDNA 4ZIRA 4HDQB 1ZNWA 1JJVA 4WW0A 1WA5A 5FTKA 5EXXA 4US0R 1ZM3A 1M7GA 1H8HA 1NI3A 3DDCA 1UF9A 3KUDA 4BRWA 3OE7D 3H84A 4GOXA 3BERA 3KFXA 2V54A 2IYXA 4TYPA 4DSUA 3PEYA 1ETUA 1AZSC 4LK2A 1G4UR 4LJAA 3CZPA 2O8FB 3NG1A 3N2EA 4I1VA 1IY1A 1XEXA 2GXUA 3MWYW 4OL0A 2GCPA 2IYQA 4DSTA 2NG1A 2CJWB 4I1SA 3CNOA 3FOZA 5FPYA 1OV4A 4HB4A 2HCBA 4IDHA 4Q00A 4QL3A 2E1RA 2ZRHA 2ZSBA 4KJZA 3TE6A 4IJMA 5EP2A 5FI0B 3SHWA 3THWB 5GVRA 3CH4B 5GADl 2W6JD 1X1RA 1KGDA 1VMAA 1E2IA 4RZXA 4KXFB 3TBKA 4Q4AB 4GI7A 4LYFA 2OE2A 4IEEA 3SC3A 1Z6AA 2JIZD 1A4RA 1T8UA 3I8XA 1OT3A 1P2VA 2IS4A 3EZFA 3QBTA 4QM6A 2CK3A 3RRNA 1KJWA 1P2TA 2A2ZA 4MKFA 2VYFA 1S1CA 3LVRE 5EE5B 4NH0A 1K5GA 4PSAA 4DLRA 1Z08A 3ND9A 2W58A 2VHTA 4JLMA 2RHDA 2KWIA 1UKVY 4NL4H 2OZEA 1WMSA 4U00A 4DSOA 1DAFA 3T15A 2WHXA 4M1YA 3U44B 4LGMA 4US1R 5C2JB 4XD7D 1RRPA 4OHXA 4DB2A 4QXAA 5JSZA 3R9IA 1OXSC 1ZAKA 4JLBA 3UWKA 1LF0A 3I5YA 1E9RA 3FKSD 2FDCA 4LJ5A 4BECA 2ONKA 1XRJA 1BH2A 2FPMA 1T0JB 1NJFA 3CPHA 3DMDA 2AWOA 1ZNXA 2AFHE 3TUIC 3R9XA 4H9GA 2HJVA 1BMFA 3DHWC 1XPRA 1KNQA 2GRJA 4C0LA 4DEYA 3BC1A 1OXTA 2J7PD 1EESA 4R2IA 3F3YA 2PT5A 5JECA 2K5UA 2ZR0A 3C15C 2UKDA 4JYCA 4BEBA 3Q8XB 3LNCA 2HF8A 1E79A 1JR3E 1S9HA 5AUOB 2DHRA 4MRNA 4A2PA 4DT1A 1WP9A 1T4GA 3P4XA 4C0AC 5KSYA 4II7A 3MWLA 2WMNB 4Z1MD 4Q9JA 2D62A 2ZROA 4Q18A 1ZD1A 4FMDB 4TSFD 2RGCA 1YKSA 4M9QA 3L43A 4ON9A 3X2SA 2QM7A 4DEXA 1XF9A 2N42A 1UKYA 2OG2A 3GLGE 1AA9A 3GFOA 4HYYA 4E5UA 1YZUA 1CR4A 3OESA 3SQXA 3W9YA 1T91A 3SYNA 4AKEA 5LPNA 1ZIPA 3LBHA 3EZ2A 1E2KA 4NKRA 1QDEA 3A1UA 2V55B 4KFSA 1Q1ZA 2J41A 1NG9A 3E70C 1DAKA 3IBGA 3K0CA 4QM7A 2C9OA 4QNMA 3BH6A 2CK3D 2WOOA 1D2EA 4IFEA 1EFTA 1CJKC 4HAVA 4NCJA 2VQSA 4LHXA 2ZRAA 2GJ9A 1FPMA 2IF2A 3NXSA 1IQPA 1KDOA 3I61A 4ZKEA 3SJAA 3AGPA 5HE8A 4QJ4A 2F9MA 3VX3A 6Q21A 2J87A 3DZ8A 2J45A 4RFVA 4QHYA 5DI3B 1UJ2A 5KYKA 1SULA 3FMIA 1NN3A 4HUTA 1K8RA 3AGQA 4G5RA 1KY3A 1E2JA 5DYGA 2OBMA 5J5CA 4TWZA 1N5JA 3RWMB 4EFLA 1EFRD 2R9VA 2ZJBA 3AF2A 3RVBA 3ZD6A 2R62A 4JLVA 4O0MA 5DN6D 1Z0IA 3X1DA 3FPAA 1HT1E 3ADBA 4PC1A 3CRW1 4P32A 3UMRA 4A6XA 2XNSA 1NG1A 4ZIRB 4AI6A 1BKDR 2C5LA 2WWYA 3NTUA 8OHMA 5BYJA 1E96A 4NYJQ 1VCOA 2AX4A 4RY2A 2GBLC 4M9ZA 3K70D 1PLJA 1KK2A 1I4LD 4A82A 3KX2A 2VRWA 3VFDA 4FINA 1TU4A 5JLJA 1DE0A 4BGDA 2ZIAA 2O8BA 3VHLB 2EFGA 3OHMA 4R2HA 1BS1A 1E0JA 2DR3A 3UMFA 2PH1A 5CJ2A 2BWJA 4IOJA 1N6RA 3OIWA 4EQ6A 1P72A 1G7RA 3WBKA 3THYB 2GK7A 2VA8A 2ZI4A 1N0UA 4B2LA 4PPNA 3AUYA 1YZTA 2YZ2A 4UNNA 3AV0B 3EIEA 3CO5A 1G5PA 3CRRA 3GLIE 1R5OA 3F5FA 5LB4A 4JKYA 1QHSA 1ONBA 4JL5A 4PQRA 3U3JA 1NVVR 2QRZA 4XSGA 4JLPA 1E2HA 4NYMQ 3FE2A 3L0SA 4O25A 2QQ0A 2ZVPX 1IN4A 3M1IA 3UG6A 1I2DA 4M1KA 1VCIA 1XEWX 3HR8A 1WXQA 4MYUA 2QROA 3EARA 5A0FA 4ERNA 1GZSA 2C04A 4Z8XA 1GAJA 1JR6A 3SI7A 2BMEA 3KKMA 3NIBA 4Q1BA 2XTMA 4W5HA 4ESHA 5KO2A 4XSHA 3EIHA 5UKDA 1RE0A 4BFXA 4N0EA 1JQJC 2FF7A 2OFOA 4D6PA 5JHHB 3DOFA 4J0QA 2WM9B 1LW7A 4IHQA 2D74A 3QG5A 1KO8A 3H4MA 3BS4A 1TNDA 1GKYA 1GG2A 3PCRB 3AP2A 1RJ9A 3G82C 1ZU4A 1KKMA 4AYTA 3V00A 4LPKA 2EQBA 5EZ5A 1G6OA 1UDWA 1W2HA 4UXHA 4GP7A 5DH9A 2JJ8A 1OYWA 2DWOA 4AURA 4C0QC 1KY2A 2QAJA 2IA5A 5KSOA 1R4AA 4NCHA 4DDTA 3NBZC 1X8LA 4G1UC 3SYKA 1DAEA 4MYTA 3CX6A 4PC6A 1YZQA 1COWA 1GWNA 2ZRDA 1ZM2A 2XNDD 4JLOA 4LHVA 3QF7A 4GMDA 4BFUA 5K8LA 1WQ1R 1Q44A 4C0KA 2GF0A 1US8B 4V0OA 4OI2A 1BO6A 1S9DA 3OF5A 3WNDA 2VO1A 3FTQA 1FTNA 1GFIA 1OIWA 2RAPA 4A2WA 3AEZA 5BN3A 2ZS8A 1GNPA 2FMXA 3NDBB 2O8CA 3NBXX 5FOWA 1Z63A 3D8BA 3MCAA 3AKEA 2OXCA 2X19A 2VSOA 1JBKA 3AVQA 1NY6A 5KOYA 2CDNA 2ZJAA 2F7SA 2HV8A 4A0GA 3U6BA 2CBZA 2CCGA 3BFXA 5AK0A 2VTKA 3CF0A 4OQLA 3H0KA 2RGEA 2MSCB 1XXHA 1FMLA 4JSYA 1G19A 2G1JA 2OAQ1 3KKQA 1JXMA 3CKLA 2CEAA 4L15A 5GJWC 3SHFA 2VL7A 4PO8A 3WYGA 1HT2E 4EAQA 2RGNA 4UJ3A 3TGPA 4BLQA 4QJ5A 1SKQA 1R8SA 4M53A 1OH5A 2OT3B 4DCVA 3SDZA 1G6HA 3WP1B 2CVHA 5FOSA 4BFZA 3FWYA 4QBGB 1RYFA 4F4CA 4ZCMA 1P61B 4L8GA 5HPYB 1OXVA 1NMYA 1G17A 2IEZA 1W5TA 5HCIA 4CT5A 3C5HA 1Q1QA 3E1SA 2XSZD 2PX0A 3BGWA 4LWZA 4A0HA 1QBKC 3AP1A 2F55A 2ZJ2A 3EC2A 1KOFA 1P75A 4ILEA 4XWOA 1IJEA 3CB4A 2ZITA 4HB3A 3UPUA 1WRBA 2QTVB 1W0JD 3IPYA 4KLNA 3K1JA 3IEUA 5JS8A 3KKPA 3N2IA 2EW1A 3RLFA 4PQFA 2O8DB 1GOTA 3LQRA 2DPXA 1KO1A 4PC3A 1G8PA 3PQCA 4BEJA 3GP8A 4TQ9A 4LC1A 4XWAA 3CW2A 4ASUA 2KB0A 1PLKA 2QP9X 4HUQA 2QA5A 4NCNA 5TVKA 5JJLA 2JEOA 1IBRA 3G0HA 4FD2A 4EJSB 4LBVA 1JAIA 2BMFA 5EZ6B 1FL9A 4PXAA 2CMKA 2AK3A 3QNUA 1KMHA 2VHQA 4HAXA 1M7BA 3ETLA 3L0PA 3QG1A 5H70A 2FFBA 5TARA 3UATA 4W9MC 4Q4JA 5FOVA 4B3BA 4C9BA 1TQ6A 1Q12A 3KUCA 4WVFA 1D9XA 1E6CA 1NLFA 1R0YA 1CBUA 2Z0MA 2A9KA 1RC8A 2VHJA 1G9XA 2EWVA 4IKEA 2WWHA 2CL7X 3B6EA 2OLJA 3ZD7A 1XCGB 2X77A 3HU2A 4MRRA 2IF0A 3B9QA 1GILA 2P3SA 5EE1A 3TIFA 2GWHA 1NJGA 1MH1A 2H18A 4YDSA 1JI0A 1AS2A 5CLLA 3IEVA 1ZM7A 2B8WA 1SVIA 1VG8A 2JDID 2BEJA 4DLXA 3B78A 1ZUNB 3ASZA 4FWTA 2NO9A 2JASA 3LDAA 2PLFA 4JBYA 4V0LA 2GEDA 4PPGA 1AK2A 1M7HA 1E1RD 3ECCA 5L3QA 4MKHA 5FTNA 3TUJC 4OBEA 1G1MA 2IXFA 3EA0A 3WMFA 4AIIA 4BQSA 2C8VA 1Y63A 4TMVA 1MRNA 3CX8A 1KO7A 1IN5A 1U90A 4NE2A 4XH9B 1Z47A 4BLOA 4UJ5A 2P67A 4B3FX 3OIVA 4Q03A 3AH8A 2NO0A 2JA1A 1OXXK 1L8QA 4EPRA 4OQMA 1N5KA 3NEYA 4YLGA 2ZI3A 2MSEB 4UXIA 2XOKA 1YRBA 1SKYE 1DG3A 4OJKA 2BCJQ 3LXXA 1XP8A 4M1SA 4DSNA 4EPVA 3WY9A 2QI9C 5H68A 3KJIA 2Z6VA 4TMXA 2LCFA 2ZYWX 2BMJA 1Z6YA 5E7JA 5CK5A 4MYHA 4YMUA 4Q7MB 1P9NA 2QE7A 2ZREA 1QVRA 4JIMA 5JWHA 3VR6A 5FPSA 4C0JA 5JS7A 3VU9A 1W0KA 1XMSA 2WZQA 3ZIAA 2PMDA 1QVAA 4TTQA 2ZJYA 4ACBA 1FUKA 4M0LA 4DKXA 3U4QB 4KODA 2O8BB 1NBME 3KL4A 3VQTA 4A8JB 1EGAA 1YZKA 1HH4A 4R71A 4DB4A 1ZU5A 2ATXA 3X1XA 3PITA 4BPBA 3ZIAD 4EJSA 5KSZA 4UNSA 3B1ZA 5LBIA 4QBHA 3CF2A 3JZMA 4LBZA 4Q4HA 2V6IA 1BMFD 3LFUA 1T9HA 2GJ8A 4TTPA 3U7EB 1S2MA 2ZSEA 2EFEB 4NMMA 4LYAA 2NO1A 1CIPA 1CLUA 2CNWD 5CK4A 3ZLJA 1FMJA 4KAXA 3LV8A 4QOSA 4CEJB 2QAGC 4TZ6A 3U6KA 3E5HA 4Y0VA 1Z28A 4DZZA 1U0HC 2IS2A 1J90A 1CP2A 3CPJB 3KZ1E 3BFVA 4JMPA 1XDBA 5HE9A 2O5VA 2PZEA 1TF2A 4JVNA 4TL7A 1P60A 2QZ4A 4OK3A 2HCJB 1JJ7A 3CR7A 4OQFA 3RDPA 2ODNA 2EYQA 3FFBA 3NBYC 3RYTC 3PFIA 5AJXA 1JPJA 1P6XA 2F3TA 3ZZUA 4N3NA 4X8HA 5KTYA 4M22A 1VHLA 3W34A 3IUYA 2F9LA 2IEYA 4ZO4A 1XX6A 1E2DA 4I4LA 2X1VA 1ZD9A 2ODEA 1TMKA 3RS5A 1W36D 4QBFA 1NBMD 3WYAA 4PC2A 2C95A 4KFUA 2PJZA 1MO6A 1HQYE 4ZCLA 3K0SA 3H86A 4XVQA 5K8TA 2XTNA 3BFKA 5AJYA 2QSZA 3SEAA 2D7CA 4M8NE 5HZHA 3LVQE 1TU3A 1OHHD 2WTUA 1TPZA 1EFUA 5DO9A 1E9AA 2QT0A 1XJQA 3AQ4A 3R8FA 2YNMA 4GOKA 5GJCA 4CEJA 1O87A 1E9FA 1XTQA 4HDOB 4HEJA 5FL7D 1X86B 1L7VC 5DYIA 1Z8FA 3QXJA 4BLRA 1E2MA 3VNUA 5FR1A 3AVWA 1ZCAA 1NN5A 1T0HB 4PQYA 1XEWY 1XB2A 1H8EA 4MITA 3MMPA 4RCYA 4A1FA 4C4PA 2J0SA 2BKUA 1SVSA 3DO6A 4FXPA 1W47A 3QBVA 1QHGA 4DUGD 1FQJA 2CL0X 1W5SA 4CEIA 3F0TA 4HSEA 4IOMA 2BOVA 1WCV1 2OEPA 3SJBA 1W1WA 1M2OB 4BZXA 5JSZB 1MO3A 1KSFX 4V03A 2YKGA 5DE3A 1E32A 1YZNA 4TLDA 1XTIA 3OEEA 3HR7A 1CR0A 4Q66C 1XEFA 2OCBA 4HI0E 3KJGA 1QHHB 3ZZTA 3TR5A 5TB5A 1RJ9B 3MAAC 4K81B 2EFHB 2L0XA 4OQNA 4BASA 3VR5A 2HT6A 4LJ9A 5EE9A 1ZUIA 3RWOA 4IDQA 5J47A 2LKDA 4M9SA 3TUZC 2QBYA 2QP4A 2XSZA 1T5IA 1OXUA 2ZYUX 3NBFA 4KYUA 4BWYA 4YDHB 1FTSA 5JI3E 4A9AA 4I1OA 5K8IA 1EX6A 5JBQA 5KNCA 5EUQB 5JEDA 1WB9A 2FN4A 2QPTA 2JLVA 4QGAA 2ZUBA 3LLMA 2HUPA 4B43A 3QUSA 4WAUA 1KNXA 1YRAA 3ICQB 1NIPA 1M74A 2F6RA 2ERYA 2WPDA 2XXAB 3C41J 4B32A 1KSHA 5FUVA 4TQAA 1X8KA 4JSTA 3OFNA 3EPLA 4MGZR 3RRZA 3BXZA 5C4GB 2J46A 4IOKA 1Z0KA 4LJ6A 4GBMA 4PPQA 3DKVA 4TT3D 1D5CA 2BM1A 5SZHB 4XD7A 1PUJA 2FEOA 4ZDKA 2QAGA 5CJPA 1H65A 3QKSA 1FX0B 2Q6TA 1P2UA 3L8YA 4JYBA 4P0TA 5LD2B 3Q5DA 2W83A 4JLJA 4B3DA 4E07A 1KSJA 4F38A 4D4KA 2ANCA 4CEIB 3BK7A 1FNNA 3EZ9A 3ZVLA 4AKGA 2IYSA 4QRHA 4GDFA 4JVLA 2YJTD 3U3RA 1TF5A 1YR7A 2GCOA 1A2BA 1G3QA 1VYUA 5JRJA 1I4DD 2J1LA 1A1VA 3K0FA 2IYZA 5G40A 2A78A 3GEIA 1ZNZA 1DELA 3IKJA 2H17A 2FGKA 1VTKA 5EQTA 1RYHA 3T1VA 1R6BX 3GJ4A 1OYYA 4Z51A 3MWJA 3PUYA 2GCOB 3GLGA 4B35A 4EUNA 3RSOA 2W6ID 1FZQA 1CJTC 1KI1A 1NN0A 3DVLA 1KK1A 4NYIQ 4A8JA 5L3SB 2NMVA 2PZFA 1OPXA 5B58C 2R6CA 3IHLA 4RFSA 2QPAA 2B7BA 2AD5A 4TMZA 2QEQA 2IYRA 4HDCA 3BWDD 5SZIA 2DWPA 3OFND 2JAQA 1II9A 3IILA 2FJUA 3OEHA 2WPDD 2ZI9A 4P3YA 2OV2A 5E3HA 1AIPA 1FOEB 2J3EA 1II0A 2JJ1A 4TYWA 1GRQA 3K9GA 3WRYC 1ZW6A 2V3CC 1UBEA 1LTQA 5D3QA 3GLFB 2OAP1 3T12A 1OKKD 1WE2A 2YWFA 3D31A 3PV0A 2AD1A 3LA6A 2GAOA 4AY2A 2VBCA 5KDLA 3RS3A 1BOFA 2ERXA 2EWWA 2OSBA 2PMKA 3KJHA 5L8VA 3GLIA 3HYRA 4DC9A 4LYJA 2H5EA 4HAYA 2P5TB 4CW7A 1E9CA 1DPFA 2BBWA 2ZJZA 3QPVA 2GXQA 2JLQA 5CYPA 1KSGA 3RRMA 1Z0AA 1YHNA 1JB1A 2C99A 2IW3A 1TEXA 2WSSA 4PZLA 2YOGA 2OESA 4TN1A 1T3LA 2ZE5A 1DG1G 4V0KA 4LC0A 4V0MA 3I62A 2CLSA 2FV8A 3VKHA 1L4YA 3SYLA 2B6HA 3A4MA 4GZMA 4BFYA 1E9DA 1JXOA 2F3RA 3AVPA 1F2UA 1G3RA 2E9SA 2V6JA 2XB4A 3MUFA 2WSMA 5DHFA 3TVTA 2V1UA 2IYYA 4BRUA 2SHKA 2WKQA 3EIQA 3RNLA 3IQWA 5LDDC 3HWSA 1DS6A 1GDDA 1E1QD 2ZEJA 1PV4A 3BD9A 3EG5A 4Q1EA 4JJKA 2YYZA 4LHYA 5BQ5A 1M34E 4FCVA 4EPWA 4DLYA 1W2GA 3GJ5A 1F60A 3AKCA 3LY5A 1JNYA 4B74A 4US2R 4PFSA 2BMDA 3LWNA 4B6EA 4C0HA 1ESNA 2FU5C 1U2RA 1KTVA 3B13B 3UIEA 2C77A 4O2RA 3GFTA 3G5UA 3PJRA 3P20A 1KO4A 1SZPA 3BH7A 4X8LA 4H1UA 2RKOA 1CULC 1XWIA 3GLHA 2GILA 2WWWA 1VYVA 1PLLA 1KI6A 3IQXA 3TMKA 1NBMA 2KBFA 5FPTA 3EZ7A 3RABA 1E1QA 5AWFC 1YU9A 1L2TA 4ITRC 2BHRA 3Q9LA 1J70A
chains in the Genus database with same CATH superfamily
1DZ3A 2O1SA 4LDJA 4ZHQF 3IV6A 1JDTA 5FT9A 1MZVA 3OE4A 1TQ8A 3OZFA 5BNFA 4YY3B 2HTFA 1DJPA 4II2A 1QRAA 2IY7A 4I19A 5IMSA 1L1QA 2G0TA 2PKCA 2C8LA 2YXBA 1M10A 2RGYA 4UHBA 1E3EA 2IY8A 1JTVA 5DX1A 1IXZA 1DNPA 2F8LA 4IDAA 1ULSA 1Z5WA 2A1TS 1JSCA 2EVWX 3D0QA 1R64A 2GYYA 2ZJ3A 3FDJA 1QC5B 2BGWA 1MAAA 2FOLA 2PR7A 3PC2A 3QU5A 4JKIA 3ROQA 5KX5F 2G9UA 3SQWA 3FBWA 1C8BA 3OC0A 3V2GA 3GD7A 3FPCA 4QHTA 1XWWA 1GTRA 4J07A 4ZDJA 1NMZA 2UYGA 3KDAA 4W4TA 4WH0A 2OXIA 5LA6A 4RHFA 4LZPA 1GR1A 3VR3A 2VDNB 5CLGA 1EH5A 3SS9X 4B85A 4RD0A 3G2IA 2JI8A 3ZVMA 1G8JA 4FFBB 4D4MA 1OJLA 4YBRA 5EWJA 2Q3EA 4AWBA 1VSUA 1ESCA 1K4KA 4JHLA 4YO8A 1QIIA 5DISB 1LBIA 3FB4A 3O8NA 1PEDA 4OREX 3B1WA 5SZKB 1NXPA 1UXJA 3RG8A 4BE7B 5KNLA 1SPXA 4HCJA 3KVVA 2R6AA 3D5TA 3LPMA 3AEYA 3JQGB 4Y1RA 3X2EA 1VFNA 1KMQA 2XWBF 4EMSA 3NTLA 3KQNA 2Q21A 1IRIA 2YHIA 1CUUA 2DX7A 2R7AA 2V03A 3GLHE 4XTCS 2DY0A 1OWOA 3AO0B 1HRKA 4RZQA 4RYDA 2X4DA 4F6RB 2QY9A 4F1JA 3FHTA 1PRYA 2O59A 1HZJA 4HLUC 1QFSA 1KAMA 5FBWB 1W88A 1ZK3A 4ZJYA 1FE8A 4O2AF 2VDVE 4WRRA 2ZQYA 5JZMA 3HY3A 4EF5A 1XPUA 2BYTA 1JALA 1NSTA 4PBTA 1PUIA 4RIHA 4RV4A 2C4TA 3WAKA 4RVSA 2RG1A 1FLDA 3RO7A 2EJWA 3TJZA 3WB9A 3AERB 1XJCA 1WNFA 4IQ8A 2FPIA 3EGXA 5DCUA 3HGQA 4ZYVA 1NJ5A 3DD5A 3DE6X 4I08A 4M8IA 3T35A 3W77A 2CV1A 2WVAA 3T3OA 2JAPA 3WAGA 2QMZA 1SVLA 5JUWA 4CG2A 1SBHA 5DCYA 1NT2A 4XGKA 1MB9A 1SXPA 1MC1A 3ZCTA 1JIKA 4BVGA 4RTNA 3ZDBA 4OLHA 5F2EA 4WXPA 3E3AA 1OIVA 4BMDA 3DP7A 5BNTA 2YR0A 1SIWA 1G21E 2RDMA 1XN1A 3CWCA 4C08A 3O75A 4BB6A 2XMDA 2HQBA 1LBHA 3BCSA 4GLFA 3RC9A 2YQ5A 4IX1A 1WDLA 1I14A 2GNOA 3KQVA 4W8HA 1Z0DA 5J2TB 2EKDA 1U2QA 3FVTA 3LT5A 2D5CA 3EG9A 1FNBA 3JVEA 1SUBA 4I50F 4G4SP 1G0NA 3PEVA 3DTVA 5KTPA 2WT9A 1C0EA 1WBDA 3UANA 3DPUA 1V39A 2WHQA 2QUHA 1ZM4A 5EIXA 1JIIA 1XLVA 2E21A 2WFLB 4PU0A 1Z5VA 4AZTA 3UJ3X 2A7XA 4L5AA 4F92B 4DR3B 3BAFA 3HXLA 3NRBA 3HUUA 4QKQA 3A8TA 2VPQA 1SUPA 2BMAA 3ACBA 1Q15A 3GQBA 4I9NA 3UEOA 2J9GA 3Q3HA 1DAHA 2N1BA 4BLVA 1TX4B 4DF3A 5AW3A 3QENA 3DL0A 4G0PA 2XECA 3KYCA 2WWIA 2I1QA 1NLUA 5AJZA 3FHJA 3T0GA 3GLFA 1OBOA 1RKBA 5FBQB 1XL0A 2JKZA 4E5VA 3NC1C 3N58A 4U7HA 1XZIA 3KDPA 4KN9S 5ECYA 2FSIA 3VHXA 4Q3KA 1CZOA 1XZBA 3I76A 4OP2A 1PNQA 1X2BA 4P8RA 3PPXA 3NO4A 3R3SA 2LWIA 4KVGA 4DIBA 5ARBA 4OV6B 4MYSA 4X61A 1MB3A 2AHOA 5K3FB 3HB5X 5ARCA 1Z4MA 4G5QA 2QZ9A 2W6CX 3WTBA 4EPXA 3VDXA 2O8EA 1T5OA 2AYZA 2YJ3A 2QMUA 3E2MA 5GGXA 5CEFA 2C9DA 3O93A 3AR7A 2GB4A 5EOVA 5EXTA 3RNOA 2WHYA 3PGLA 1RYNA 4D9NA 2X8LA 2V6MA 2PL5A 2ZR9A 3KHSA 3LDGA 4C6TA 1R0KA 4ER5A 2FMTA 5C18A 2VCYA 2I22A 1F0KA 3LDHA 5IMBA 3IE0A 4R05A 1Z4IA 2OK8A 4N7MA 4BLWA 3AF3A 4BZPA 4D2IA 2NXEA 1L4GA 1LVGA 1SVKA 3L0IB 1PZEA 1TXGA 1LW6E 2PX2A 2VSNA 4Q7JB 2ZANA 3TLBA 1TYAE 5LFAA 2HW8A 2AEMA 1CB7A 4YR9A 5B1EA 1DRJA 3C8HA 4Y1RB 4Y98A 1GL9B 4I4TA 1LBEA 4IFBA 5IWCA 4MQFB 1B3RA 2RGGA 3KKLA 4HNHA 4L51A 2WP0A 4ZOLA 4FN5A 3C3MA 3HWWA 3SU8A 1TFUA 2ZRCA 4FW9A 4G1EB 2YHBA 3ICCA 3H19A 2HA3A 1ZBQA 4HDKB 5CUQA 3WTCA 4MA4A 2QD1A 4MGYR 2OR3A 3HP7A 3JY6A 3ON5A 2IU6A 4LTMA 3ZE7A 4I4CA 1KZGB 1VKJA 4JEIA 2ET6A 3AHDA 2VWPA 4I50A 4QUAA 1BE0A 1JG7A 3TX2A 2ZJ8A 3IURA 3V8QA 4RULA 1HETA 5TJ9A 4G97A 3OI7A 1X14A 2NADA 1ZISA 1GNVA 1IZZA 1HL3A 1H1LB 2QQFA 3HY4A 3M9WA 1KRHA 3HKCB 4P33A 1RXEA 4QD3A 4ZDWA 5ICEA 2V9PA 2HPAA 3AXTA 1SVWA 3DXXA 4FJ0A 2IVFA 4HP8A 4L9SA 4NAVA 5AJHA 3ES9A 2XZPA 1YC5A 2COEA 1A9RA 3PHGA 3WLOA 1VBKA 3THWA 5FTMA 2HV9A 3OZRA 5LMUB 1DOAA 3E9EA 1PZFA 4YGXB 2DQSA 1PFVA 3AX6A 3DHEA 3TBHA 2YZMA 221PA 2WWGA 4EVQA 5HUQA 4OQEA 3RC7A 2HBYA 2WJVA 4HDNB 1TIKA 2X4LA 3NHPA 3TLMA 2RIRA 3CV3A 4XIFA 2BDUA 2XA9A 3CZQA 3DMFA 3VU3A 4X3OA 4AO7A 3O8RA 4LE2A 4MP8A 4RA9A 3WIBA 4R98A 2EJVA 2QD2A 3LLSA 4EHDA 1RQLA 3EEFA 3M3PA 3EVGA 5AI6A 1QGOA 1HQDA 2EAUA 5ALJA 5ELLA 4HFMA 3VZSA 2W2MA 2NTVA 3UWPA 1EK2A 2H2WA 4KSYA 4G8CA 4QARA 4EX6A 1ZK1A 3I53A 4R8MA 5KNBH 2Q99A 1XT6A 5I9NA 3BHJA 4GKAA 3OPNA 3AVVA 5A3VA 4UTZA 3NT2A 2R65A 2R1VA 2Z04A 4XQGA 1GTG1 5D51S 4BV8A 2LKCA 2GLXA 4IMPA 3FXAA 3EEYA 3GJYA 1VIVA 3AHFA 1NVWQ 2H1IA 2HA4A 1E9EA 3ISJA 1NUHA 2N75A 1XA0A 3LOUA 4PEVA 1SXJD 1X7WB 1DJOA 1QFZA 2CXPA 3AYXB 3NWBA 3R76A 1G18A 3B60A 2WE7A 4LCJA 4M38A 2O07A 1NTOA 3HFGA 3T5BA 3V7WA 1NVUQ 3GNSA 4B3CA 3ELBA 4IR7A 4OHPA 3V32A 5DXAA 1GTSA 2IPLA 4HNTA 2IYTA 4V38A 3WQBA 4CEHB 3I9KA 4FC7A 4DQUA 4RVDA 5C81A 1S96A 4WBSA 1DCFA 3GV0A 1B2LA 2YJ6A 4HOYA 4L0CA 5SZJA 1TIBA 3RF6A 5JS6A 1GYQA 4C2TA 1KZ1A 5NULA 5DB4A 3SC6A 1E0SA 2XRFA 5FBVB 3EUAA 1VKOA 2CV0A 3B5JA 1T2DA 4NEHB 2RSLA 1KFJB 1TAHA 1GKIA 1LLQA 1KJZA 2DBZA 2Q8NA 2ZU0C 3NHAA 3EGVA 3BTVA 3Q41A 4NFYA 2D0IA 4NV0A 3E3LA 3NM6B 1M73E 2E82A 3WMRA 4HH0A 2Y77A 5FP0A 3T5PA 1CY0A 4E1AA 3OU7A 4RVNA 3HDTA 3NX4A 3CLKA 4FJ2A 4BFTA 5HKAA 2NSJA 4OHUA 3DT6A 4MJXA 5AHXA 1LLDA 1NIJA 1FFSA 5F35A 4BC0A 4CMBA 3EYAA 4YQYA 2DU8A 1OBFO 1VMDA 1RABA 3IULA 3N2ZB 1Z7BA 2GK3A 2ECKA 1FP6A 2I2FA 2FG5A 2TS1A 3BE8A 3IDSA 4XJVA 2D8AA 3U16A 4DLTA 3GMTA 4ZI3A 4JJIA 4FE7A 4CM8A 1PU2A 2DRIA 3E22B 3ZJYA 4ESVA 4MO9A 2HIMA 1NY5A 4ZI7B 1MRZA 2YW9A 4BNTA 4BJ6A 1L4UA 1BGVA 3CONA 2Q5OA 4G8JA 4LDQA 1LB1B 3EZXA 3ZXSA 4BV9A 3L8CA 2G88A 4AYXA 3VNVA 1I5OA 2R7KA 3BSFA 2I4IA 4PX9A 1I3OA 1NW7A 3NHFA 1WV1A 2QTFA 3F7MA 4F1KA 4YONB 3FWNA 3HB7A 2JF0A 2BEVA 2UYQA 3CZCA 2DWQA 1JAYA 1LC3A 4B4KA 1UPAA 3VRHA 3ILVA 4DR2B 2VPIA 3FCAA 3HPRA 4ZVUA 5IAEA 1IULA 4AY3A 4RGYA 4F9EA 3TFOA 4HQKA 2FRXA 2OZKA 2FXIA 3M6XA 1ZD4A 3AHEA 3MA0A 1D8TA 2C4MA 4C6SA 2E87A 4F45A 4ENUA 4MS1B 1U63A 2A0FA 1HTWA 1QHYA 2PVPA 3C3CA 3I6QA 4KDRA 3RW9A 2P5YA 3THYA 1EVQA 1LPNA 3LX6A 5E4JA 5KPJA 1B8UA 1R50A 4UCWA 4KPUB 1U5BB 3SCZA 3CSUA 1N8NA 3W05A 4Q9LA 1NW8A 5KYUA 4YIKA 3OZXA 2HSWA 3QWBA 2V7QA 4ZICA 4DHEA 2OCKA 1LNQA 1G6KA 3OFVA 4ODIA 5DNCA 2PLRA 4LNUB 5ERGB 2YNMD 1UJCA 6REQA 3Q3IA 4FYKA 5BWMA 1UMCB 3N70A 4QYSA 1UBNA 3AVYA 3LBIA 4ME6A 1G42A 1JLHA 4L22A 1JQEA 4I3FA 3G85A 4R2MA 1ABFA 4CHGA 4GUDA 3S81A 1RLJA 4PIMA 5KX5A 1FRVA 3QJYA 2J5QA 1B42A 3MTQA 1BVRA 3ILHA 5JD5A 4DZTA 4GOND 1V0JA 3GAZA 3HKBB 2IS6A 3B3AA 4C14A 4C21A 621PA 5TEVA 2PUTA 4URVR 1NVMB 2Q9AA 4J0HA 4KNYA 3TL2A 2P2CA 4L07A 5HMLA 3I6ZA 4E09A 4MROA 1RMYA 3ZS8A 4EF6A 4U7PB 4UNRA 3Q3CA 1P0QA 2BJVA 3Q0IA 3A6ZA 4XDGA 1QHIA 5KYXA 1XMXA 4MEJA 5G53C 4XYBA 8GPBA 2GM3A 5HF5A 2REXB 2ZWAA 4LBWA 4BNHA 2QDKA 1GP2A 2RE8A 2I34A 1POXA 2QRKA 3CTMA 4Z4GA 4MJ3A 2LCQA 2E7ZA 1Y3AA 5DCLA 421PA 4G0NA 3R6DA 1Y4UA 2Q6OA 2HF2A 4GFDA 3ANXA 1LUAA 2ENUA 1XZFA 4LUCA 3M6AA 3R40A 4A0QA 4REQB 1U0RA 1JJAA 4EGSA 5CDFE 4BMPB 1OI4A 2GTIA 2Q6LA 1ISGA 3M34A 3P9ZA 4I0WB 4LJYA 4LZAA 1EIZA 3BEDA 3EPRA 2PZGA 3HU1A 4K8OA 4MP6A 4P3OA 1SOAA 4Y8VA 2HYIC 2XUOA 2BGUA 4G84A 3TSCA 2F1HA 1YTLA 4D80A 5K20A 3U7QB 3KQWA 3GUUA 5CEJA 2ST1A 3OZSA 4J1TA 3N2NA 3AB7A 2PA0A 2DR0A 1ADJA 3MHPA 3LT1A 5JCOA 1O94C 4RQBA 1PJ8A 3KELA 3C6YA 3EG9B 4U2EA 3I3SR 1U28A 3IT0A 2J7PA 3O6VA 4RKEA 1RXCA 3JQEA 5D1NA 1N6KA 4YUZA 5BN3B 4QIHA 1N2GA 3U3OA 2QGNA 3DGEC 4YRPA 3KLNA 2GPBA 3SDBA 3TRDA 4CDMA 5B36A 1IOWA 2NUTA 2C2YA 4K6KA 3T4EA 2VTBB 4IV0A 4B44A 2GSWA 3WIDA 4H6VA 1T9ZA 1SWVA 2H4YA 4PHTA 1QGUB 3FNQA 3PUKA 4GMGA 1Y5LA 2H4XA 3LGAA 1NVDA 1PJ4A 3HNRA 4KZPA 4L3OA 5D7BA 4M1TA 1KQFA 3VGJA 3UYKA 3VC2A 5REQB 1R6AA 1UAYA 3OKPA 4AJJA 3G8AA 5BRJA 4E2YA 1C9EA 2AJBA 2AW5A 3CTPA 4WY2A 3VJLA 4ITVA 4QAQA 2PE5A 3ITNA 1CYDA 1E6EA 1R5BA 4QDZA 3RSHA 5LLTA 2R8RA 3KL2A 3G2HA 3H2KA 3DTNA 4JBHA 3VKWA 3DBOB 4EKGA 3F7NA 4NS1A 1QAOA 1T29A 4PYJA 1OWPA 3HO6A 2XV1A 3K2IA 4RH3A 2OHJA 4Z3OA 3UMMA 1UDBA 4YV0A 1COWD 2JCXA 1NM5C 2QLMA 1L5NA 3P4YA 2O3SA 3GF4A 3ORQA 2PJUA 1TVEA 5BSHA 1HR0B 3B52X 3ELUA 4EJMA 3PFCA 3SS8A 2ZTSA 4FJ1A 3OLQA 5H3HA 5JWRA 5DWDA 1BCSB 4YB8A 4KLZA 1XJWA 1MEJA 2AZ4A 2G40A 4TV9A 5FEMA 3I52A 3HXTA 3KDSE 4P36A 3WIVA 1B23P 4A8JC 1NMQA 1TJ3A 4QQNA 3W2TA 5AXDA 4KC0A 1PL0A 3MSCA 1N5OX 5MFZA 4TLAA 4YJKA 3QE2A 5T4HA 2Q9UA 3RTBA 3C3EA 4RK0A 2JAWA 5DIFA 3ULKA 3ZQUA 1YD7A 1IUPA 2JGDA 1AZTA 3JYHA 5EYPA 4B40A 2ODQA 4EYEA 2WMOB 2OWDA 4JBXA 4WECA 4H17A 1IM8A 5C4MA 1IY0A 2NO7A 4EB3A 2IYEA 1WQ4A 3OAAA 4YJ3A 3J7AC 4O4LA 4YXWD 1UBUS 2RHLA 4EL0A 1TEZA 1BH6A 4DA7A 4MUIA 5DLEA 2ZS7A 3ABSB 4HVLA 3E9CA 1MKYA 3COZA 2CY0A 1L8LA 1CY2A 3GRUA 4TXLA 1YT5A 5F64A 2FRDC 1P4AA 4OD0A 2OQVA 3LUCA 4G0YA 3PIDA 5JYCA 1GKLA 1VSVA 1W59A 1IG3A 4DLZA 2H2GA 1YIDA 2NW6A 1CLEA 4EGQA 5IM4A 3HGMA 2X6TA 4UKDA 3J81A 5IX8A 5E4YA 2C94A 1SVNA 1RE1A 2W11A 2WG1A 3ZWVA 1JJFA 4P4SB 1ZD8A 1KF0A 1P2GA 4OX9B 3V8MA 2JLYA 2EJTA 5ITZB 3I72A 3VU0A 4CM9D 1D7OA 2Q3HA 4K9NA 4UREA 5B5SA 3IQDB 2WZCA 2SECE 2ADOA 2DLCX 3O8BA 3R6LA 4WZBE 2B9VA 4EAAA 4LQLA 1A8PA 4UQOA 5CIQA 2IZ6A 1QRUA 2H1LA 4XDZA 1GN8A 4IKOA 4MZXA 4N9WA 1Y8QA 1DAMA 4GRAA 5A5DA 1N4DA 4OYRA 1EZ1A 1QAQA 3A11A 5KYVA 3VOBA 1SCBA 5MGNA 2IS1A 2QN7A 2DYKA 3NH9A 4H77A 4KACA 3WSWA 1AU9A 3HCWA 1JEAA 4S35A 1MTOA 4ER6A 1NXVA 4W5JA 4C43A 3FZQA 4TVOA 3PEWA 5B1HA 4YRCA 4BNWA 3HBNA 1WW2A 4P7JA 2B37A 3M9LA 1NMEA 3P19A 2QL6A 2Z4SA 4EZEA 5FB3A 3IP8A 2WWFA 4NBNA 2AWNA 1WPXA 1M6HA 3UHOA 1Y4ZA 2HDNB 2OP1A 5KZMB 2EQ5A 4CUKA 1ZJ6A 3MTIA 4KQ2A 5FL7A 2FW1A 5IG2A 5IXYA 2C7QA 4QJBA 2IYOA 3W5IA 1DQYA 2FI1A 1R0XA 2H54A 4KXNA 1FU4A 3CX7A 3QTLA 2FN8A 3IODA 1QU2A 5C53B 2O2IA 5DGIA 3DO5A 2XMBA 3MYRA 2GBPA 4TUYA 3SLKA 1Y1KE 3T95A 3PFGA 2D2XA 3Q8WA 1SN7A 2QD4A 1VPWA 1ELOA 1OHHA 2ASEA 2P5UA 2UZIR 3D7NA 3ETHA 3K16A 1ORWA 1Z06A 2O57A 5A4DA 5A62A 1BDJA 2IOFA 1DG9A 3QKTA 4G1MB 3PENA 4WZBA 3SC2A 4FB4A 4F3YA 5CDUA 3IBFA 2FE4A 1K98A 1YI1A 4CL0A 5EKSA 4EJSC 1ZOSA 4U5XA 3O9VA 1H42A 4DA4A 4YHHB 3E22A 1E59A 4N82A 1Z2DA 4R81A 4TV8F 5F4BA 5TEWA 2IYWA 3QITA 3DBLB 4RPGA 1B8PA 4CDNA 1UPBA 2I99A 2D5IA 3DBIA 3PNOA 4QE3A 2EZ4A 5GIPE 5BQOA 3KR1A 1ZIOA 3QKRB 3UAWA 2Q4DA 3U1TA 4A5OA 2VDRB 3BWBA 2RH9B 4PWYA 1Z68A 4AMZA 4EOGA 4CIBA 1TOAA 1LX6A 2FCRA 3GT7A 3X1WA 4WXEA 1YQEA 1P2SA 4YAEA 3W3ZB 3OTWA 5KKCA 1OTXA 3EHEA 3TZCA 3AMVA 1A8UA 3KYDA 1WU8A 1WCXA 3DOUA 5ALYA 3DZBA 3NMUF 2HI0A 3D8UA 5MN6A 5FH9A 3TAXA 1A8HA 1ZLXA 2IOHA 3IP9A 3L8ZA 3OEYA 2WNHA 4L4RA 4M9CA 2GETA 1RBYA 4EHIA 4HRAA 3CO0S 2IUSA 2Z1NA 3WADA 2XI4A 3IO3A 2OV6A 4RPHA 1AF4A 1OTHA 4YCSA 3FSRA 4DDMA 2CNWA 2KE5A 5A5EA 1FS5A 2Q9CA 4BUZA 4ALLA 4LFAB 1CFJA 4TQUS 4O3MA 3WJ1A 1T36A 3KJEA 3R0VA 1CZNA 3VSAA 4BNVA 4NI5A 1W4CA 1NVEA 1Z4NA 2C98A 1F2TB 2CXXA 1XPJA 2ZFUA 3BMQA 3CW8X 3EMVA 3PB3A 4GYJA 4I55F 3ZCXA 4DW8A 2D7DA 1TZ2A 4QDUA 3KPWA 4FHZA 1XV5A 4Q16A 4L75A 4AXXA 5LB2A 3R7DA 4ZYZA 2ZTVA 3NC0C 3REOA 5JAUA 5DGTA 2H6EA 4E2ZA 2FX2A 1LBTA 4UM9D 3P2YA 2HBRA 4YCJA 1R9NA 4ZARA 3NDIA 3J81k 3DUWA 3UAXA 3PXDA 1T1GA 4YP6A 2HHAA 4RQAA 3V4RA 2FFHA 1TECE 3GJ3A 3M89A 3BDVA 4YX9A 5KNCH 3GBSA 1GVNB 1L7RA 3LPNA 5LQUA 2IE0A 3OTIA 3PR1A 3D6MA 3QXCA 4IJUA 1K9SA 2JGEA 2PEZA 4LISA 3QE9Y 3EXHC 1AKYA 2AI3A 3IOYA 4MMYB 3IUNA 1XXHE 1X3LA 2Q1XA 4URXR 3M5WA 4N4AA 4WLNA 1D07A 4EDHA 5EKTA 3K0EA 4YMIA 1QK4A 4WBNA 4BB9A 1RYDA 2BRUA 2UDPA 1PF7E 1T8WA 3HU3A 1XKLA 3MQ2A 2AZMA 3USZA 3FCXA 4JVOA 1XMPA 3QHAA 3BHMA 3DPSA 1P0CA 1F4LA 1JECA 3W2FA 2XD4A 1U0OC 3WGGA 1AGYA 4CKEA 1TTTA 3CZRA 1J1ZA 2Y9PB 2NUPA 4C1BA 4PGGA 4O4LB 4OU5A 4CLHA 4B3MB 2P79A 5LYJF 2IPMA 1TT7A 4HDRA 4J7XA 4EA7A 2PIDA 1W4RA 4TL9A 2PX6A 2OG1A 5FBKA 5A4FS 5KKAA 3U39A 3K0BA 3IPCA 4DV0B 1E58A 1NQUA 1K08A 3CZ4A 5SYAA 3A37A 1YAJA 2CJWA 2D5AA 3SX4A 1Y5IA 4BL5A 3T3GA 2ILVA 2Y05A 3VX4A 2RAFA 4KIWA 1ZK2A 2BTQA 2V6FA 3ZCRA 3EXIB 4EG1A 3FYTA 1F5NA 1CS4C 4UNQA 2NVUA 2CXOA 4FMBB 3RS8A 4Z0TA 4QGSA 3NPMA 4TLLB 4TTTS 1CC1S 4C2AA 1AA6A 5ICCA 3LY8A 4EHBA 2P8SA 3RK0A 4AP5A 3HEBA 3K32A 1E6MA 2FVXA 2Q5EA 3PHBE 1QH1A 2H4JA 4R84A 1I32A 4F06A 1OLUB 5CFOA 1QH8A 2WDPA 3D6JA 1M2KA 2QLBA 4JXJA 1JXQA 3S8EA 2FSVA 2VF4X 1HE1C 3O2JA 4NZ9A 4BFLA 4CLXA 3A1WA 3LRTA 1KI7A 3L4JA 2GQ0A 1RQXA 3KALA 3HNPA 5KAPA 3RI3A 3TPCA 1OAAA 3O1JC 5J2UA 4FEEA 3T7EA 3AWDA 2NOAA 3UBMA 4ID9A 1SRQA 2ABWA 1CE8B 3KRTA 4PPYA 2QQGA 1VE7A 1Z33A 2CHEA 2OA0A 5A6SA 4F3NA 1CXZA 2XQKA 1F7VA 3AY3A 2C2HA 1L4MA 2GBGA 2O0HA 3S29A 1IL0A 1YRLA 3CM0A 3C8UA 2B8TA 3U3KA 3PICA 1SXJB 4UBJA 2FZCA 3LOPA 2ONJA 2W4QA 4FOLA 1SKYB 4EEZA 1DX6A 1M6YA 4D4IA 3BF7A 1W85A 1QP0A 1VBFA 1XLUA 4NE7A 4NHEA 2GEVA 3G3EA 2PYIA 3B1JA 3NDPA 3QPWA 4PICA 3DNFA 1U80A 4RSMA 5JD3A 1U3DA 4MWBA 1FFCA 1YMVA 2CB9A 4NXMB 1XDDA 1FNSA 1R6VA 2B99A 2GX6A 4CT4B 3I30X 5A3SA 3ROMA 4BX9A 4DUGA 5E6UB 5HW0A 4Z1OA 5DLYA 1SC6A 4EFMA 3EISA 3WLTA 2YQ4A 3B1VA 4G67A 5BVHB 4XCQA 3H1TA 4PQEA 1CZKA 4RMGA 4W9NA 3KXIA 3REQA 5ALOA 4N5MA 1CJCA 1R0BA 2PX5A 1BC5A 3A1TA 3A1FA 3H9GA 3HUEA 3JV7A 5CYGA 2R751 1W8IA 2D3WA 5T4FA 2DLNA 2NSDA 3CLUD 1RU3A 4Y2UA 1MT0A 5TMPA 1P7CA 3JYNA 2PKEA 5FLEX 2BZ0A 5AM0A 3VTKA 4NJEA 4DXAA 3FCUB 3GLIB 3LDFA 3SK0A 4J0IA 1KIFA 5FUWA 1F8YA 5IVDA 5AIBA 4QQKA 1XTKA 1QYCA 5ALDA 1KTIA 1B0AA 5DF1A 3LQFA 3U3ZA 1KERA 1KIAA 1YMQA 2RJNA 4I1RA 4R7TA 3SE0A 4CV1A 5JS2A 3ANYB 3T7KA 5JY1A 3DEIA 1POWA 3IVRA 1QVVA 2NV0A 1GIAA 1XF1A 2Q4BA 1EVEA 2E4VA 4IIUA 4GUAA 4MXDA 5F76A 4FD3A 2YZNA 1Q11A 4WXRA 3AC0A 2F3SA 1AQYA 3MGAA 1Q21A 1YIOA 2HCTA 3HJUA 4HWPA 4UXJA 3DLTA 5ALXA 1T6NA 2AXQA 821PA 1TEHA 2VPPA 3UUEA 4D43A 1OF1A 4OGGA 1V5WA 4LKOA 1GNTA 1E64A 1PW5A 2PMWB 4CGZA 4O4HA 2A5JA 1U1DA 2MINA 1WL8A 1X92A 2ZYRA 3DW3X 3SYTA 3TLCA 4BYGA 2G3YA 1G5RA 2B94A 2EFCB 3JR3A 4MEBA 4K2HA 4BBJA 4FFVA 1GTVA 3SF8A 1E3DA 4NPCA 5CM9C 1JFTA 3JQ8A 3QOFA 1GGVA 3BX1A 5CR9A 2J9FA 5B3JA 1DC5A 1Y48E 2YASA 2X1MA 2H7XA 5CBKA 4LHWA 5EIOA 3SX2A 1YQTA 2O4CA 1KVRA 4CG0A 3ZYCA 1EIWA 3OFJA 1NZDA 1VHQA 2X5OA 3NBMA 3UN1A 2DZDA 1CNFA 5JE8A 4RFLA 2LTAA 5G0TA 1W44A 1FYWA 1DAIA 4RPIA 2A9FA 1CQPA 4NFSA 1I9CA 4XRGA 3PUJA 2C03A 1BS9A 2SCUA 3EXEA 3PE4A 3DE3X 3RTAA 1N78A 2EFDB 1WMDA 4PINA 1QB8A 3DMPA 3MK31 2RH4A 3BULA 1Z22A 3EA5A 3RYIB 5JRZA 3KR0A 4GXTA 1PTKA 4O3FA 1PEYA 1MAUA 5GGYA 4DXHA 1JA1A 1FX0A 1ORTA 1FFGA 1I2BA 2C7VA 5DBEX 5FYDA 3W79A 4B87A 5EWJB 2R79A 5DBIA 3ZGNA 4TMKA 3V4PB 4Q02A 4PSKA 2M6LA 1RADA 2FPGB 3R3UA 1P91A 4FKMA 1NR5A 1IM2A 3FLAA 3O73A 4JS0A 4QT0A 4AU1A 4ERXA 2ZBQA 3AOEC 4K46A 3W4IA 2I87A 1N2CA 2J32A 1KPHA 5AVYA 1CQIA 5KNCD 1I7NA 1BCRA 1SU4A 3N3BC 3L6RA 4JELA 3KQUA 4LRXA 1MOZA 1W8DA 1RWQA 5IM4F 4CF5A 1XRPA 1S4MA 4QYIB 1EQUA 4LX0A 1KEKA 4F3TA 4V0NA 3ILSA 2AKAB 3FFAA 3IUEA 1Y33E 4UAGA 1K5PA 4UAJA 4L4ZA 1ZXXA 3JWPA 4B6JA 2XZLA 5EN4A 1TGYA 2ID4A 3ZWKA 3LW8A 4IGEA 4I9UA 2LXNA 4CL8A 2ZIGA 4F4DA 1YS2X 5CPBA 2YVLA 2LE0A 2Q45A 2RBEA 3QEMB 3TFQA 4BWFB 3NONA 1GSIA 4DDUA 1EG2A 2JC3A 2Z5FA 5CDFA 1FUUA 1WDWB 1DWQA 2JJMA 4JEUA 3KKZA 3AB3A 4L3VA 4GP6A 5DXJA 1E7MA 1A0OA 2DFKB 4LZLA 5EUMA 2BFFB 4LXXA 2PH3A 4RIGA 1X70A 4BO0A 1YDWA 2JBWA 4EHLA 4JA2A 2AN5A 3H5NA 3PVZA 4NX2A 4R1TA 2H51A 4FIDA 3WWPA 2UXCB 1BEZA 2P90A 4PIPA 3BE4A 4LSWA 2WWVD 1GSAA 1MXHA 1LFAA 4R68A 3T5CA 4GD3Q 4CU5A 3MHTA 4FFNA 4IF4A 3U31A 1H4TA 5JSUA 2YVKA 3GZNB 1LTKA 4KYIB 5T5QA 4R31A 4BUJA 5CA0B 4RDHA 1DLIA 1JHOA 1G2PA 1Z5PA 2Y92A 5KB3A 3T41A 4UUBA 4XOUA 2HNKA 2E4YA 5ALPA 2QN6A 2O54A 2C5BA 1KBQA 2RHHA 4GGMX 4DIEA 4P2BA 1HQCA 1L5ZA 4ZT3A 2QLNA 2C1XA 1N6HA 1XL1A 2I6UA 2ISCA 3LQYA 1Z56C 1PR4A 2WM8A 4N0PA 4HFRA 3KWLA 5BT9A 2B25A 2RG7A 3ZW7A 4RZ2A 4DBLE 1VGQA 3OJWA 3KKNA 3PUIA 3L82B 4WDQA 5T67A 3DCJA 1G7CA 3D3WA 3B9RA 1EZ4A 2P7HA 1KY4A 4UBNA 4TYMA 1RW4A 4DMHA 5KQMA 1HNXB 1H22A 1VIYA 1O03A 2CE2X 4YROA 1MO4A 1QG2A 1SCQA 4POAA 5JAPA 2O2EA 1WXGA 3HHPA 4MKXA 1P7VA 3E48A 3TNLA 2DXIA 1SNYA 3NKVA 1FU8A 1N8SA 2AJTA 4RVCA 5KYTA 2HQ1A 3TZQA 3SWWA 3QFHA 3T7IA 2WFZA 1A4IA 2WHPB 1PZNA 4KPEC 3ZI0A 2AOUB 2WZBA 3SNHA 1RZRD 1DEKA 1O58A 2ORWA 2AOWA 3LX5A 4NZMA 2XBUA 3EHDA 1AXGA 3D3EA 5AOBA 2E6UX 4MQMA 2WAOA 2ZIXB 4B5KA 1RLIA 4DLSA 2YS7A 3OA2A 1MIOA 3LAWA 4RKQA 4R2XA 1E7WA 3Q72A 3WRWA 3KEOA 3W8DA 2AXPA 2CKMA 1GSHA 3H2JA 2JHGA 2ZI5A 2G1UA 2ZQ5A 3H65A 2BKVA 3EVTA 3NGMA 4FHEA 4M1EA 1MR3F 5H3CA 5LYJA 3T9FA 4DWWA 2G1KA 1SC4A 2NUPB 5ALKA 1Q19A 2ESRA 4HWTA 4NF2A 3TM4A 3WJ2A 2OK7A 4OLBA 3A6HA 1OLSB 3BOSA 4OUKX 2WD9A 3T0IA 2ZR7A 4DV6B 4OP3A 5BSGA 3MJ4A 4BZWA 4RA6A 4R51A 1ZJYA 2JLUA 4FMCB 4HDKA 1EFKA 3VR0A 3ELYA 3KOWA 1PGOA 4GI1A 3WLAA 1LRJA 2AG6A 1F17A 1RP1A 1RHKA 1NQVA 2EBFX 4G5GA 1GUDA 2WKPA 4ZU3A 1MV5A 3WK4A 1J0XO 3CA8A 4JQYA 2F3PA 4YMTA 2WR8A 2E4UA 2FW8A 3JARB 4X94A 3UAYA 3UNXA 2WVJA 3IMCA 1SA0A 4MO2A 2AN1A 4KHZA 1FNMA 4ENSA 5EIAA 3WNQA 1KE1A 5JJIA 1CUFA 3N0XA 4DMFA 4KWIA 4AWXA 1SCDA 4P86A 4RSGA 4W7SA 1P1RA 1WBBA 3A9RA 4DCTA 1EU1A 1U3UA 1Z36A 1DCMA 1ZIDA 1C4KA 2MMCA 4IIHA 4DYHA 4QYXA 3S2GA 4KBFA 2WV7A 4LJ8A 4XUGB 1XMQB 2C5GA 1GPLA 3H7IA 3PE3A 2YFHA 4L73A 4RK4A 4WFJA 2C61A 2HA0A 5DGDA 3RSFA 4BV3A 4TMTA 3ZLVA 4M0EA 1FJHA 4ECAA 1P7YA 2J9RA 2MDTA 2B36A 4EATA 1WUIS 4A3SA 3C3WA 3LUPA 1CUVA 1T9BA 2R6FA 3DFIA 3CNLA 3A9VA 2OM2A 3HMKA 1AOXA 1PX2A 3N8KA 5DNYB 3ZHZA 4B6FA 5DWQA 2FCAA 1U0LA 3GC6A 3I83A 3FPFA 2GN6A 2GBFA 1LNZA 3E2PA 3F4LA 3H1AA 4EPTA 5CXQA 5EXDA 3EW9A 1Q7RA 4NTZA 3ZWNA 5KAMA 3S7ZA 1EHIA 1Z75A 4UUQA 3PQFA 3AVOA 3I9JA 1C3EA 2FYTA 5H59A 2YZKA 4Q1FA 1QONA 2XAUA 2VH5R 3B20A 3K09C 4GX5A 2JIZA 4LY6A 1OQAA 2QUKA 3EUFA 2J3MA 1KDPA 1QC5A 3IQGX 4PLHA 4KN6A 2JI7A 5AJWA 1TI7A 2ZM5A 4EELA 3DV0A 2ZE6A 5CLJA 1ZBDA 2YINC 4A1OA 1WULS 3SP1A 1SBYA 1JP7A 3DFZA 2XWSA 4IJ5A 1JFFB 4QOJA 4DM3A 4F85A 5EFZA 3C85A 2VK4A 3L1HA 5CXSA 2I8CA 3ZCUA 2R8YA 1PQ4A 3SJ7A 1WB5A 3DWFA 3G49A 3IDAA 4LI0A 3LHIA 3QEKA 4QECA 2FQQA 4WLVA 3REQB 3SR3A 4A2QA 4M9UA 5AVRA 3H2SA 4EL5A 1N6LA 3TRIA 3NWJA 4ZEMA 4IQ4A 5BMVB 1B1AA 4EUFA 4F9FA 1N8KA 5BUSA 2WUEA 3SHTA 1LQTA 1RJEA 3SFTA 2GF9A 1JPNA 1MQSA 4WCVA 3IOMA 4AZ3B 1KAOA 3F5QA 5EJMA 1EX9A 2WSIA 1YNOA 2GAIA 4UUOA 5ERXA 3NW9A 2NUBA 1ND6A 1QO0D 3TOCA 1JNXX 1IATA 2I2WA 4DR5B 2YOHA 4QEZA 4KXQA 3F96A 2QZSA 5E8RA 3F2VA 3RUHA 5JFGA 3R5XA 2CNBA 2ZYDA 2E37A 2WQ6A 2IEAA 3ZDDA 3V9PA 2Q2NA 3DGFC 1DAOA 4O4JA 5FNVB 1DINA 2C5SA 2ZUVA 4RENA 4F2WA 1GFWA 2FKNA 1LPAB 1Q91A 2RGDA 4YRDA 4YPOA 2QL5A 4V1CA 1IB0A 2ZZKA 3RYIA 4PN3A 2VF5X 1ZI8A 3U7GA 3Q9NA 4K9SA 1G5FA 2F17A 1ZXBA 4R9UC 3E4CA 2DCMA 2PEYA 1QR6A 3FYUC 4YP5A