4Q4HB

Tm287/288 in its apo state
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
583
structure length
583
Chain Sequence
GPILEKPALKNPTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEKDDPDAVELREVRGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter
publication title Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/transport protein
total genus 216
structure length 583
sequence length 583
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
B PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 4q4hB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q4hB02
2ZE7A 1JAIA 1NMYA 2VRWA 3DZDA 1MV5A 1XPRA 2Z83A 5F3WB 2JLVA 2XNSA 2QQEA 3K9NA 3LXRA 3UMFA 2NPIA 2W83A 5JMTA 2KJQA 2WICA 2ZI6A 3NWJA 5KSPA 3PIRA 1E94E 4C0LA 3X1XA 3TAUA 2FGJA 4WW0A 1SGWA 4UNRA 1DTSA 2A9KA 4D6PA 5EQTA 2ZYVX 4ZCMA 4HZUB 3L8ZA 2JEOA 3ICQB 5JECA 2CDNA 3EWSA 1G41A 1HURA 3ASZA 5H68A 1GP2A 2PCLA 2OT3B 4TL7A 4PO1A 1EGAA 3LW7A 3NHBA 1XXHB 4MDEA 2JJ8A 4Q7MB 1LF5A 2QT0A 3SJBA 5DI3B 4Z1MA 1H8EA 3THWB 1Z2AA 1N6IA 3C15C 1Q21A 3BBPA 2O0KA 3EA5A 5ELXA 1L4UA 2A5FA 1E9RA 5F9FA 5GVRA 4ZI3A 2WBLC 1SXJE 3EC1A 4MRPA 1T8UA 1XD8A 4RD0A 3A36A 5J4LA 4D25A 4JYBA 3U3JA 3F8TA 5BN5A 1UKEA 2V3CC 2MMCA 4F4CA 4GFDA 5FR1A 4AG5A 4POAA 4AI6A 1ESMA 3QPWA 4RZXA 4OYHA 2PJZA 3PJRA 3QKRB 1GKIA 2DFLA 4LBVA 3IGFA 4EQ6A 4QBFA 4G01B 1SQ5A 5DIFA 1E4VA 2QN6A 1FP7A 1G17A 1NI3A 4KLNA 4F91B 1TU4A 4TYNA 4HLDA 3TQFA 3MWLA 1AS2A 1IJEA 1NVVQ 2IYQA 3J81k 4FMCB 1NMXA 2CLDX 4FMDF 5FUYA 1XFAA 3AVXA 4PC1A 2ZS7A 1VHTA 4CEJA 1KI6A 3K0CC 3PFIA 3VR4A 4ZI2A 4BLTA 1SVKA 3GLFA 1XZQA 2F6RA 3R20A 3CPEA 4L4UA 4JLDA 4M9QA 2LWIA 4PSAA 1NSTA 3W5JA 1G291 1IHUA 1I2DA 3T1QA 4B43A 1XDBA 4P4SA 3ZZ0A 2GJ9A 4MGYR 2O8CA 1DBSA 2AN9A 1XU4A 1JR3A 3DZ8A 1MT0A 4MYTA 4CGZA 3OAAD 5FUXA 4B3XA 2ODBA 1KJWA 2J7PD 4BFTA 2CBZA 1YQTA 2GETA 3TQCA 4OQXA 3IQXA 2GBLC 4IRUB 1UPTA 2QP3A 3B2EA 4UXJA 5LD2B 5G3ZA 1AGPA 2QTVB 3O8BA 4I81A 4TYWA 3CW2A 1YJ5A 4C3ZA 2OUKA 3TKLA 3FMFA 3U2QA 3KKPA 4OHVA 2OESA 2AR7A 2HXSA 4LYJA 4X8LA 5EXSA 2O8FA 4NHOA 3RWOA 1II8B 5FH9A 4DJTA 3QKTA 3KB2A 4NCIA 1E1QA 3B85A 2NGRA 1RFLA 4F92B 1OPXA 5EJEA 3FWYA 3VR3A 4M9SA 1W0KA 4AK9A 2AXPA 1NJGA 5LD2C 3A4MA 1OXXK 3IPXA 1Z22A 2NOAA 3E1SA 3T1VA 1Z0DA 2V4ZA 5EP1A 1HYQA 3UXMA 2D74A 3VNVA 2CLCX 2NO9A 4DLWA 2J46A 4I1VA 3O8RA 1UKZA 2DHRA 1P2UA 4DT1B 1E2GA 4A8JB 2W0MA 1SULA 4MYUA 4QBIA 4DDWA 4IJMA 1ZNXA 2WMNB 1L2TA 4DUGA 3WNDA 5J4VA 6Q21A 2QMEA 4WBSA 1MABA 2WIAA 3BS4A 4W5HA 5GVSA 3SEAA 1VECA 1VCMA 2CCKA 1JJVA 4Q19A 3U44A 4LHWA 2OILA 1ZYUA 2J1LA 5DN6A 4LPKA 1T0HB 3JZMA 1X86B 1KO4A 3GCGA 2D4HA 4H1VA 3ADBA 5FBLB 2ZS8A 3SI7A 3WRXC 4PAMA 4A82A 4QXAA 4B35A 1OH7A 4L16A 4CEIB 1L8QA 2R6GA 1TAGA 2ZRJA 3OIWA 4RFSB 3WNBA 3CKLA 2DBYA 5F9HA 3KFVA 3WYGA 1D8TA 5FOWA 3QENA 4Q9JA 4G5GA 1MRNA 3Q3JB 1RKBA 3GMTA 5KU1A 1NRJB 4P4TA 3LD9A 1J7KA 2J0UA 2QY9A 3CONA 1P62B 2CVHA 2GK6A 3I3SR 3LVQE 2IW3A 5CJ2A 1IQPA 4OQLA 1KZ7B 3MSXA 2Q3HA 1PUJA 2VH5R 1FFHA 2IYVA 4TMWA 3VQTA 4TSFA 5TXGA 2FZLA 1P9NA 2OLJA 1KI7A 3Q72A 3OIVA 4YMSA 4NMMA 5JCPA 1TEVA 3OIUA 1F6BA 1KSHA 1GVNB 4R9UC 5DYIA 2G0NA 3AKEA 5JEEA 3DMDA 3I32A 1XRJA 5JEDA 3THXA 4O2LA 4NYIQ 2J0VA 2KB0A 4C0BA 1QF9A 2Q21A 4I1UA 1KDPA 1Q0UA 2QGNA 2QA5A 3CR8A 1IN5A 2QQ0A 1P60A 4EJSA 2OZEA 4LX0A 3DVLA 3LBIA 5P21A 5L3VA 2C78A 4LJ4A 2ZRDA 3GLGE 3AP1A 2ZANA 1RZ3A 4MA4A 3KKMA 2VHJA 4NP6A 1T91A 1WBBA 3EAQA 1NLYA 1WE2A 5M04A 2ZYUX 1SVSA 3CX7A 4TYYA 4OK5A 2JGNA 3K0AB 5AUNB 1SVLA 5CYPA 3UPUA 4BFXA 1BMFD 3NBXX 4CT4B 5IT5A 4OQMA 1VMAA 1W2GA 4LJAA 5G41A 1XMVA 2X2FA 1BOFA 2ZYWX 2WSSD 3IDQA 5EXTA 1EX6A 4LZZA 4TMZA 5HE8A 3GJ0A 3I8SA 4BLQA 5J5CA 4U02A 1XCGB 3G5UA 3UG7A 2HJVA 2WWFA 4HDCA 4LJ8A 4II7A 2BCGY 2IYLD 2RGEA 5D3QA 3RVBA 3SC3A 3UATA 2GEVA 821PA 5J47A 3VU9A 3B13B 2QMOA 5FL7D 1E99A 4IW3B 4U5XA 4GDFA 1J99A 3LW8A 1JB1A 1N6KA 2X77A 1G8YA 4HLQB 2QPAA 1W48A 1OSNA 3UMRA 1CKEA 1DAEA 4PHFA 4DLRA 2VO1A 3KQKA 3L82B 4HB3A 1AKYA 4JBYA 4Q9HA 4ZCLA 3KUCA 3RRNA 1IY0A 4PSKA 2IA5A 2H8KA 3GJ6A 1P2SA 1GRQA 4UXHA 1JJ7A 4UKDA 3FE2A 1ZCBA 2P5TB 4W9MC 4GL2A 1FOEB 2CHQA 4RD1A 4HZUA 2Q3FA 3PUZA 3P32A 5HPYB 4ILEA 1N3BA 3CPJB 3PENA 2ORWA 3H0KA 4Q1EA 2XZPA 4IHQA 1EFCA 2PLFA 2ZEJA 3I92A 2P6UA 2JASA 1XEWY 2AL7A 2XOKD 3HR7A 3AVUA 4LWZA 1R0WA 5DI3A 1U2RA 4OHWA 4BQSA 3QXCA 4JVMA 5C4MA 2A5DA 1MO6A 1PJRA 3NVAA 3WY9A 2QRNA 3VNUA 3BRWD 2GEDA 4EFLA 3WYAA 5FPYA 2GXAA 5CK5A 1QHHB 2J0SA 4GOXA 1QHXA 5AJVB 2UVQA 2ZSFA 3ZVNA 1KO8A 3TLXA 4B34A 1KZGB 1JQLB 2O8EA 4U00A 1TL7C 4YDSA 2WOJA 3QSYA 4AKGA 1ZD1A 4LJ6A 2R6AA 4DLYA 5FBVB 1VG0B 1NP6A 4GOKA 5AJXA 4B2LA 2ZE6A 1XTSA 4P33A 1YZLA 3TR0A 2VSXA 1U9IA 1JEEA 3QG1A 4L9SA 4MUBA 1JNYA 2GXQA 3FGNA 4OQNA 3UWOA 4MITA 4P4UA 4BASA 5DI9A 4DLUA 1GRRA 2A3RA 3PEYA 1VYTA 1NJFA 2EWWA 4M53A 4TL6A 3V00A 4JT2A 2FMXA 2N46A 5A0FA 2OFXA 3W90A 2PZGA 3MLEA 1W46A 3QXSA 4I4LA 4LJ7A 2ZRHA 3AF0A 2IT1A 2V54A 4KVGA 1JECA 3WMGA 5E7JA 3NBYC 1N2CE 2KBEA 3HWSA 3RC3A 2OM2A 3R9WA 5BXQC 2IC5A 4QM6A 2JIZD 1ZD8A 3UG6A 1KDTA 1XB2A 3Q7QA 2GCOB 4PHHA 4Q7LA 3I4LA 2WJJA 2YVUA 3B1YA 4OI2A 5LBIA 3KTAB 5SZIA 2VHCA 2C95A 2DPXA 4DWJA 4UNPA 3KUDA 1F3OA 1F2TA 2IUSA 3NEYA 4KJZA 2E9SA 4OHYA 3KB1A 3SJAA 4JSTA 5EP2A 4G5QA 4JL5A 3DM9B 2ZE5A 2C9YA 2CHGA 3LLMA 3R7WA 121PA 2A7QA 4OL0A 3LXXA 1KK3A 1YZQA 3S1AA 4NTZA 1Q3TA 4BFUA 5FI1B 2VTKA 1DG3A 3T1TA 4AWXA 3A37A 4HAZA 2ONJA 2UZ3A 4O3MA 1ZINA 4JJZA 2VF8A 1Z08A 1AM4D 1G16A 3V9PA 2CK3D 1OIVA 3WRYC 4K81B 1KMQA 1NF3A 4C0HA 5C1BA 1R4AA 1G5PA 2FA9A 2GTPA 1T5IA 2ZU6A 1NBMD 2R8RA 3FKQA 3PR1A 5EE5B 4FIDA 1NN1A 3W5IA 3NKVA 3MG9A 3BFVA 3D7MA 2ZSBA 4PQFA 4B32A 3MUFA 1R5BA 1COWA 1S1MA 3NBFA 1XWIA 2H57A 1CXZA 4CVNA 3W34A 1WP9A 4EQ6B 3BGWA 1Q1EA 1P9WA 3D6TB 3PG5A 4A0RA 1NY6A 3CO5A 4K46A 2GVDC 1FP6A 1G8PA 1NVXQ 1TF5A 3L0OA 3N2IA 1Z6XA 1W0JD 4CEJB 4IXMA 1WMSA 2GCNA 1KI6B 3EARA 2P2LA 2JA1A 1X1RA 4LV6A 4D82A 4B44A 1M7HA 2ZAOA 3GLFB 1DAMA 1CF4A 2OAP1 3W9YA 1E1RA 1GNRA 1N5KA 4LHYA 4KSCA 4L8GA 1PLLA 2W6IA 1R5OA 3K09A 1ZM4A 2BV3A 2JJ1D 2EQBA 2IX3A 3BE4A 2JDID 3QIAA 3K9HA 1RRCA 3KJEA 2O52A 3SU8A 1FW6A 1HE8B 3C7KA 1N6PA 3DL0A 4B2IA 4JIMA 4LBZA 4A36A 1WQ1R 2O8CB 1DAFA 4Y0AA 5F2EA 3BIFA 1XXHE 1DELA 4AY2A 1XEXB 4QJ4A 4A0GA 1CP2A 1XMJA 5J4HA 5KUTA 4IOMA 1OW3B 2F3RA 4D80A 3IQWA 1AIPA 4F93B 3TSWA 1DPFA 2IUUA 1E9FA 1DE0A 4M1MA 1TQDA 3UIEA 4XVUA 4IFEA 3GFPA 5H70A 1E9DA 4DIDA 4M2LA 2BC9A 1LW7A 3CRW1 3A6PC 1TUEA 1R0ZA 3TRFA 2HCJB 2O8FB 5FBWB 3AF1A 1ZIPA 4JVSB 1ZM9A 3K70B 2VHTA 4JT4A 4M1YA 4GRAA 1CS4C 3EZFA 5EZ6B 3TBKA 3KX2A 1Z0AA 1TQ2A 3AVQA 2G6BA 2CVFA 1E0AA 4YQFA 4PHTA 4TLDA 2HF9A 5FTJA 1RRPA 2OCPA 3C41J 3HYRA 4HAUA 4UJ3A 2ZRMA 2H7VA 1E2NA 1YU9A 2WOOA 4RD3A 5AR1A 3W6PA 3VR6A 2ZJOA 4WXRA 3ZIAA 5LPNA 2ZUDA 3TE6A 5HE9A 3U3MA 2PH1A 4YMUA 4ACBA 1HV8A 1MABB 3K70C 1P7CA 5AUOB 3ADDA 2P0EA 1F2UA 4LYAA 3U44B 2ZJ8A 2HYIC 3PV0A 1K8RA 3T5GA 2JLZA 2C9OA 1EESA 3U6KA 5ANRB 5FTKA 4WZ6A 3SHWA 4YMTA 3ND9A 5KSYA 1FPMA 4AURA 4PC6A 2FJUA 2WKQA 1SZPA 1W47A 1OYWA 3EASA 2G3YA 4PPFA 4ARZA 1VKJA 4NYMQ 4UNSA 4A9AA 2C04A 2GWHA 5L3QA 3CR7A 3PUVA 5JFGA 2ZI4A 1GWNA 3OEED 4NYJQ 3B6EA 5J40A 2KWIA 4X8HA 2IWRA 3RRZA 1GKYA 1Q44A 1HT2E 2ZRLA 3HPRA 3ZD6A 3QPVA 3L0IB 2J0UB 1QRAA 4IDNA 1IN4A 1ANKA 1H8ED 1XEWX 2QGZA 4Z1MD 4TLBA 3ADCA 2AK3A 1XEFA 2WM9B 4QBHA 2EW1A 5E4FA 1ZUHA 3VX4A 1OJLA 4LOAA 4KI0A 1D2NA 5BQ5A 3RDPA 4IDHA 1LFDB 1GZSA 4ZKDA 2DWOA 3BH0A 2LCFA 4J0QA 5EE1A 1QBKC 3CH4B 4UNNA 1AJEA 3TSOA 1D2MA 2NMVA 2PT5A 3IEVA 4HATA 3QEJA 1RRGA 2GEUA 2YOGA 1TQ4A 1N0VC 3ZGXA 4B73A 3THXB 1PVOA 2JDIA 1XPUA 1FZQA 5TMPA 2OHFA 4NBSA 3W8RA 4AKHA 2XITA 2DWPA 1IXZA 2MSCB 2A5JA 4NH0A 4EJSB 2ZUCA 1P5ZB 1G9XA 1NKSA 4P3YA 5DLQC 3JVVA 1FNNA 2IL1A 3QUSA 1FQKA 2BM1A 2V6JA 3QI2A 2ZR9A 2B7BA 2GAOA 3D3QA 2VL7A 1H8HA 2NO7A 4QG7A 1N6OA 1HA3A 4GPTA 4ZPXA 5UKDA 4DVGA 1T6NA 3L0SA 3Q5EA 5HZKA 3GLIA 2VPPA 221PA 2ZI7A 1P4SA 1VCNA 4URXR 1X8KA 2YZ2A 1JR3D 1SHKA 1UF9A 4PO8A 1XCMA 4G5SA 3MFYA 3TUIC 5KOYA 2YOFA 1KJYA 1DS6A 1BYUA 2V6IA 4D2IA 3GFTA 1A2KC 4HB4A 4GMXA 3THYB 1G8GA 1F5NA 2F9LA 2WAXA 3KKNA 2ZSEA 1GL6A 1ELOA 1NVWQ 4Z8XA 2QMUA 5TVKA 2BBTA 3MMPA 1W36B 5GJVC 4DLVA 1ZNWA 2QORA 2CXXA 2NTYC 1C4OA 1XMIA 2QI9C 1TQ6A 2BCJQ 2ZREA 1US8A 1E9SA 5FPSA 3PXGA 1E1QD 3HU3A 2RGDA 3NH9A 3EPJA 3K70D 1EFTA 2EFHB 2HT6A 1W0KD 1A7JA 4Y0VA 1G18A 2FNAA 3BWDD 3ZJYA 4ERNA 3U4QA 3AVVA 3QJYA 1OV4A 4Q4LA 2RGNA 3FPAA 2XTMA 2X8AA 3CNNA 1R0XA 3SYLA 4BLPA 5IRCD 1W36C 4A6PA 2EVWX 3BJIC 2GKSA 4FMDB 4Z54A 5B30A 1KJZA 5L8VA 1XTJA 1QVAA 4IFBA 4E03A 4C0KA 1E0JA 2AWNA 4DUGD 2WIBA 3OEEA 2FEMA 3CRRA 1SVMA 3KJHA 4ZDKA 3U7FB 1UBFA 4RD2A 1N0UA 2I1VB 2GILA 1FTNA 4KBFA 2BKEA 5DN6D 1MO4A 2QNRA 3LX5A 4QKQA 3VR5A 4TMKA 1JAHA 2KI5A 3KQNA 2P67A 2VF7A 2P5SA 2D2FA 4BWYA 2FFBA 1HY3A 1OHHA 3GJ3A 5DHFA 4CEHA 3TUZC 3MGCA 2EWVA 2YJTD 3C8UA 4JLBA 4RCZA 1XD9A 4BZXA 2PX0A 1ESNA 2BJVA 2V7QA 3H86A 5A5GA 1ZM3A 1XZPA 1OLOA 1E2JA 2HCBA 1EFRA 2O8EB 1NG9A 4JLAA 4AKIA 1SVWA 1MRSA 5FR2A 1E2MA 2ERYA 4PSVA 2WJHA 2ZETA 2DB3A 4LDJA 4IDOA 2ZI5A 4ASUA 1NN0A 5DO9A 1NBME 5G40A 1G1MA 2V55B 4TSFD 3OE7D 3CNLA 2VP0A 4IDQA 1IN8A 4W5JA 4QOSA 1ZNZA 2ZRBA 4OI1A 2BWJA 2SHKA 2ATVA 4JVLA 3LQRA 2B8WA 2G88A 4BGDA 4HAXA 4C0JA 4DRZA 3QEOA 1QHYA 3SDZA 1XTQA 4V0OA 1KO5A 1LS6A 5FOSA 1U9IC 4LBWA 2E1RA 4CRWB 3C5HA 3L2OB 3O8CA 5J4KA 1ZC3A 2ZRAA 4RKEA 1XX6A 4ZCIA 2H17A 3VKWA 2RAPA 4OHXA 4N3NA 4ESHA 1XEXA 4LI0A 3IO5A 3QBVA 3FHOA 2FGKA 3AF3A 2GF0A 3CRQA 1OFUX 1GL9B 2MSDB 4ZKEA 3QY0A 1WRBA 1GNPA 4O0MA 3ZQ6A 3N2EA 4KHZA 1ZUIA 2XAUA 4I1SA 3VFDA 1XTRA 4TT3D 1N6HA 1XJCA 621PA 1Q1BA 1E79A 2GDJA 1DO0A 2HDNB 3NC0C 4HSEA 4PQYA 1M6NA 2Z4SA 3A8TA 1F2TB 4QNRA 4WXPA 1W4CA 1YZKA 1AQYA 1E32A 3MD0A 4DLTA 2WJYA 2PJRA 1VG8A 2FZ4A 2QSYA 1Z47A 2QEQA 4MRVA 3R7WB 2OBMA 3S1AB 4G5OA 1Z2CA 2VP9A 3PVSA 5E95A 5IDVA 1KI1A 1ZU5A 3ZVMA 5IHPA 3NH6A 3NDBB 3VHXA 2FN4A 3PCRB 2EYQA 4PR0A 1YRBA 2OV2A 2AD5A 1G20E 3K1JA 2JLWA 4KFSA 1W36D 3QXJA 2ZTSA 1CJUC 1T5LA 2GAAA 2OE2A 4IEIA 3A1VA 1LF0A 1C9KA 1S8FA 3Q9LA 3KFXA 3EPHA 1T0JB 2F1JA 4TYQA 2R62A 1KMHA 3U7EB 3KXLA 3SZRA 3RWMB 5HCNA 3RSLA 4KBGA 3AGPA 2WSMA 4A8JC 4EPTA 1G7SA 5BYJA 2RCNA 2CJWA 2YOHA 4HLUA 3TMKA 4B76A 3DMNA 1I2MA 4A0FA 2ZI3A 3B5JA 4E22A 4TL9A 5FFMA 1Z0JA 3LLUA 2QBYA 3ZS9A 2BMFA 4KFRA 1Z6YA 1DEKA 2IS4A 2ZQ5A 2G1JA 5DH9A 4ZDWA 4Q7JB 3QVVA 1JEDA 3HU1A 4YLGA 3AVYA 1ZU4A 1ZC4A 3RAPR 2XSZA 5JZVA 1T3HA 1VIAA 2HT1A 2P65A 4DLXA 4DDTA 4RD6A 1AGRA 4MKFA 5KDDA 3SQWA 1EFUA 4Q47A 2REXB 3LBNA 4PANA 4M9XA 1FMLA 2BMDA 4URWR 1K5GA 3OE7A 1ZRHA 3D31A 2H1LA 5AJYA 1OFIA 2Q9CA 1KGDA 5DGXA 4ACAA 4M1OA 4NKRA 3JVUA 1FQJA 1CJMA 2IYTA 5JHHB 3LAWA 4HEJA 4BFYA 4QGHA 2WJVA 4W7SA 3SQXA 4MGIR 3IILA 1NVUQ 3F5FA 4JVNA 2W0SA 2AWOA 3EIEA 5KDOA 2GXSA 2HJGA 2QE7A 2ZRNA 3R8CA 5CM8B 2P3SA 1LY1A 3NXSA 4XD7A 1P75A 2PMDA 3K09C 2IHYA 2DYKA 4Q7KA 1YVDA 3VTKA 5EXXA 1R6BX 1W4BA 5E3HA 4YONB 1G21E 1KI4A 5CYOA 4OK3A 1TUIA 3E70C 3NBZC 1LB1B 4HYYA 3AQ4A 3N5CA 4TT3A 2WJIA 5FTNA 2PZFA 4QM7A 1E9EA 2XNDA 4WAUA 3VAAA 4EFMA 3QQ5A 1E96A 4AYXA 5IK2A 3SBEA 2QRZA 3SN6A 5JWOA 1DARA 3IKJA 3ZS8A 3M0EA 2YHSA 1NMZA 1P72A 4CT5A 1KI8A 2H18A 2IYRA 3THYA 1D9ZA 2QAGA 5TB5A 2H16A 4U7DA 3EIHA 4C9BA 2ZR7A 3W8NA 3GLFE 4DB4A 4F4IA 2JAQA 4C0SA 4Q1AA 3WP0A 1F2UB 1GTVA 721PA 3AP2A 1P3JA 5FOUA 2MSEB 1EXMA 5SZJA 4N0EA 2NO1A 3QVUA 3BB3A 3RS4A 4US0R 2EYUA 3KXIA 3KDSE 5B64A 3Q7PA 1GNQA 4Q66C 1JR3E 4ARZB 4WZBE 4NL4H 4AYWA 1AA9A 1DG1G 5L3QB 5G53C 2FU5C 4L15A 1OH8A 1IY2A 4QNMA 2ZU0C 1ZMXA 1AZSC 1K5DA 1M8PA 4IOKA 2QM7A 1Z6AA 4C2UA 1FX0A 4DC9A 1QZXA 4BUJA 1OXVA 4QRHA 2WAYA 3FMIA 4UQOA 5FPKA 5EZ5A 1P61B 3C4JA 2YWEA 2Q9BA 1U94A 3CZPA 3KKOA 1LNZA 2J3EA 3ZZTA 2CLSA 2EFCB 5DSZA 1R0YA 1IAQA 2WWWA 3LFUA 1R8SA 1COWD 2WWHA 2ZPTX 4Z8YA 1E69A 4Z51A 1OB2A 3RANA 2C5LA 1D2EA 4JL6A 1BYIA 1IY1A 1XMSA 1XBTA 2GJKA 3R8FA 5KHOC 4KVAA 4UJ5A 1FUUA 1NVVR 3QOFA 3A4NA 3LH5A 1CRPA 2X2EA 1RVDA 3DHWC 1A5TA 2O8BB 1FL9A 4FCTA 4XIGS 1X1SA 2VYFA 3W3ZB 3EXAA 2C77A 5CLQA 1R7RA 1Q1ZA 2A30A 4N0DA 1E0SA 3K0FA 4W5WA 4XSHA 1D5CA 1DADA 3T61A 3F3YA 1YR8A 1JPNA 2XJ4A 1J8YF 1E1RD 4ZIRA 3IEUA 2C9CA 5AWFC 3SHFA 2XTZA 3SFVA 4ABYA 2ZJ2A 2OCAA 1U81A 2W6ID 1CR1A 4LV5B 3K0CA 4DIEA 3PQCA 3GLIB 3CWZA 2NIPA 1JI0A 3FMPB 4QL3A 3ZVRA 1IJFA 4FMBB 5KNDA 2QL6A 4A0HA 1D6JA 1G7TA 2C2HA 4GOJA 4RJLA 2CCJA 2QENA 4PTLA 1TU3A 1CRQA 4HAYA 1EX7A 1UKYA 2GESA 4LYFA 4H9GA 4C0QC 2BMJA 1ZAKA 4LPSA 5KSZA 1ZM2A 4R2HA 1Z0IA 4JMPA 2WWIA 3PITA 4LK2A 2F55A 1T3LA 5F98A 4CYMA 3K9LA 3FFAA 4TL8A 3I61A 1GRNA 1KSFX 2BEJA 2GBLA 3SJZA 3LBHA 5L3RA 5CDFA 1US8B 2HV8A 4D0GA 1KOFA 4FWIB 3GPLA 2IXEA 1OF1A 1BH2A 1TMKA 3U4QB 1GILA 2GXUA 1WDTA 3CWQA 2CNWA 2HF8A 3T1OA 1R10A 1XP8A 4JL8A 4PPNA 3SE0A 2XGJA 1J2JA 3CZQA 3LWNA 4I99A 1TTTA 1YKSA 4JBWA 4L5BA 3EZ7A 4BFZA 2J0QA 4PC3A 4TN1A 3ZH9B 2QU8A 4GBMA 3B9QA 2XB4A 3ZIAD 2FPMA 5AJWA 1GSIA 4P0TA 4PXAA 1T3SA 2ANBA 4D4KA 2O0HA 4V02A 3CBQA 2NO0A 3GJ4A 4PPGA 4XVRA 5EXPA 1XD2B 4V0MA 4PAQA 3D8BA 4XJXA 5HR5A 4TMXA 4B33A 1UBGA 5DNYB 4LYHA 4FINA 3IPYA 4TQ9A 1OYYA 3GFOA 2FE4A 5C18A 4RVCA 3WHLA 2CE2X 1HQYE 5EUQB 2IEZA 4Q4AA 3A58B 3KJGA 4FCVA 4CEHB 3WBJA 4IVPA 2A5GA 4KITB 4NPHA 3BD9A 5JWHA 2GRJA 3BB4A 4OQFA 1W2HA 1IOZA 2QG6A 1WB9A 2F3TA 2I4IA 2NPFA 5KNCA 4LC0A 3SYNA 2VA8A 3KQHA 5CIWA 5DISB 1IXRC 3T5DA 1QHSA 3CX6A 1RIFA 3HDTA 2C03A 3HP1A 3LO5A 2IYXA 2OAQ1 1ZIOA 4K8OA 3RS5A 1T4GA 2RGBA 1EK0A 1R8QA 1ZD9A 2D2EA 4HUTA 5J4YA 1I4TD 3QNUA 3B9PA 3OEHA 1GUAA 5JI3E 4Q9KA 1J8MF 5BW8A 4JZKA 3HU2A 2QAJA 1RW4A 3AUYA 3B1XA 4C4PA 2W6JA 3Q85A 4NYIR 5JWRA 521PA 4KO8A 4D4JA 2D7CA 5KPDA 2FPLA 2PT7A 2JJ2A 3CH5A 4EFNA 4Q9LA 1LVGA 1XNJA 2JLRA 1CJKC 2OFOA 3L43A 3LVRE 3U3KA 2YKGA 4YMWA 2MMGA 2A5YB 2KE5A 1A1VA 1S0UA 3RRYA 5AK0A 1F60A 3Q8XB 4ESVA 2RGGA 1GITA 3E5HA 3DOFA 5CITA 1VHLA 3OZXA 1KYIA 1YHNA 4TQAA 5HKKA 1OFTA 2QT1A 3GEHA 2AK2A 3RS2A 2QSZA 2XJ9A 1II9A 1H8HD 3U6BA 1JXMA 3A1TA 4M21A 5TDHA 4TMTA 2ZS9A 4DCSA 3EZ6A 4DHEA 3AKCA 3AF4A 4GNKA 5AUQA 3WXMA 4D26A 1DVRA 2ZUBA 4Q4JA 1W5TA 2RH5A 3E2IA 1A2BA 2W58A 2CEAA 3AGQA 4XWOA 2ONKA 3AP3A 2VLIA 3NEJA 3ZVLA 1U98A 2B7CA 2JLYA 2J9RA 1OH5A 4NCJA 3U5ZB 3MJHA 2FDCA 3OFNA 1L7VC 3SNHA 4HDOB 2BIFA 1G3UA 2ORVA 1E2IA 2PEZA 2ZE8A 2QM8A 4HUQB 4LJ5A 4YDHB 3BORA 2E87A 1U8ZA 4DEXA 3UMSA 4BLRA 4B3FX 2W00A 3I8XA 2IBMA 3M6AA 2YWFA 4A6XA 4DSOA 3R9XA 1NKTA 1PZNA 2VP6A 4C0AC 2P6RA 1NLFA 1T9HA 1GAJA 3PUXA 4G0NA 1Z63A 2P6NA 1KMHB 1G3MA 1DAKA 3QE0A 1XJQA 1OXSC 3IHWA 4MDFA 1B23P 2BVNA 1SXJA 4RZ3A 2CJWB 4LY6A 2XXAB 4DLSA 4MQBA 2FSHA 2WTUA 2PL3A 3K8YA 4JKYA 3GJ7A 3C14C 1JXOA 5CK4A 3B8HA 4DSUA 1G3QA 2IXGA 3RLFA 3IIKA 2QBYB 4B3GA 3M4YA 4OK6A 1S4QA 2IXFA 4A1FA 5CM9C 1UDWA 1E2DA 4B75A 3LY5A 5JJKA 3I72A 3N70A 3AV0B 2J45A 4ZDIA 4QGFA 2XZOA 1KSJA 4BLSA 2LKDA 2ZVQX 3CM0A 3CX8A 4WOPA 4BEJA 2Y8EA 1M1YE 3VR2A 4G1UC 1OHHD 4RKFA 3ICEA 4B47A 1Z6TA 3FKSA 1X6VA 2OEPA 3W3AA 3I5XA 4LV8B 3L8YA 2V7QD 3TH5A 1RE0A 3B60A 1Q57A 4IVQA 2NZJA 1Z28A 1EFRD 4MUAA 1Q12A 2O5VA 3PUWA 4MKHA 3EPKA 4EPXA 5BYKA 4Q01A 1XPOA 2DWQA 2HLDA 3IO3A 4JLVA 1P9RA 2O8BA 3KZ1E 4A2PA 1KI2A 3NC1C 3WHKA 4RSGA 4JSYA 3TSZA 4ASUD 2ZIAA 4FD2A 1GL7A 4BRUA 4DKXA 2OG2A 4XWKA 3CF2A 2G9NA 2B92A 1WCV1 1VYVA 2D3WA 3CUEF 4O2RA 4NCNA 2LKCA 4KODA 4Q4HA 1KY3A 1TEXA 5JRZA 3JZAA 2YINC 3H2YA 1WA5A 3IBYA 5EUMA 2ODNA 1KHTA 1OKKA 3AB3A 2YNMA 4PZLA 1WBDA 2VSOA 2Z4RA 5H1YA 4EJSC 3T34A 1NIJA 3X1YA 1CTQA 4D0LB 3BFXA 4Q1DA 1GFIA 2Z43A 3LNCA 1E9AA 5CIQA 2BKUA 2R6FA 3DKPA 2QAGB 3MAAC 1Q22A 1S1CA 5FOVA 2Q3MA 4LBYA 4XOIA 3G0HA 1ZW6A 2UZIR 4JBXA 4C7OA 3A4LA 1A4RA 1CBUA 2GZAA 1E79D 1KI3A 4A4DA 2ZRFA 4JLPA 1PUIA 1SKYB 2DR3A 4R2IA 3WYFA 4OHZA 3DO6A 3O47A 4NE2A 1MH1A 4KSBA 5HCIA 2QAGC 5KPJA 4KFUA 2ZRCA 2REBA 5GADl 2QUZA 1W5SA 4LJ9A 5KYKA 2REOA 1KO7A 3HPQA 2Q6TA 4IOLA 2XZLA 1FMJA 3I1FA 1KKLA 3HYTA 2G1KA 2IS1A 2JLUA 3ZQJA 3VMFA 5JLJA 3FDIA 3A1SA 3P26A 3FTQA 1FX0B 1UBCA 4DBLC 4MGKR 1VDZA 5IF9A 1SHZA 1U8AA 5JSZA 4XWAA 1ETUA 1XD2A 3QKSB 4A2WA 4L9WA 4KYUA 3TW8B 3EIQA 1UEIA 2AKYA 1E9CA 4BRWA 3BH6A 2HUPA 3TVTA 3X2SA 5GJBA 2ECKA 2XTNA 3TNFA 2KSQA 3TW4A 2AD1A 1Q20A 4M1WA 1YR7A 1MO5A 3UWKA 3REFA 2HEIA 4F7WA 2XB2A 1E2EA 3AEZA 1ZUNB 1DAIA 4B74A 2Z6VA 4GSYA 4XVQA 5FPTA 4CZ2A 2VP2A 3W6NA 5AUPB 3OHMA 3EWAA 1OXUA 2XSZD 2UKDA 3U61B 1GKUB 2IF0A 1IN7A 3K0FB 4KU4A 3GLGA 1G7RA 4TQUS 3NIBA 4AYTA 1XTKA 2R6DA 4BFWA 4EPVA 1KO1A 4TZ0A 2G0TA 4ZIRB 4M9ZA 3KL4A 1HEIA 1LS1A 1G4UR 1GG2A 3BK7A 1KI9A 4FI3C 1E0KA 3ZYCA 1C1YA 2C98A 2F1RA 2C8VA 5BN4A 2C99A 1N5LA 1T8TA 2F43A 3U3OA 1U99A 1HT1E 4TLAA 1G6HA 3KJIA 3UK6A 3FOZA 4S2EA 3AH8A 1P73A 1S3GA 3WBKA 5JBQA 3ZDQA 2J59A 4M4SA 3GLHA 4X8OA 3WP1B 3A1UA 1O3YA 1G3RA 2QE7D 2GCPA 2ZSAA 1TADA 2WV9A 4PFSA 4CDGA 5K8TA 3SR0A 4XD7D 4BE7B 1UFQA 1KK2A 2I3BA 1DAGA 3MJRA 3I62A 2VEDA 1NN3A 1E9BA 3P4YA 4B71A 3FB4A 3U60B 4P31A 1IN6A 2RHDA 2RKOA 1N0WA 4KLZA 5CB8A 3CF6R 3PEWA 1ZJ6A 4EPRA 1YR6A 4H1UA 3TUJC 1X8LA 1TNDA 5D3MA 1E6CA 2G83A 1IONA 3NDPA 2OSBA 4HB2A 2XNDD 5KTYA 1KDRA 2PZEA 2GJAA 1E2PA 1VPLA 3C16C 4OJKA 1E2FA 1KY2A 5IK2D 4XH9B 3AVPA 3BAFA 3BOSA 2JCSA 1G64A 4HI0E 5CJPA 2B21A 4US2R 4US1R 3LDAA 3T15A 1Z8FA 2IK8A 1EFHA 4HUQA 2J7KA 2ANCA 4WVFA 2ODWA 4IOJA 2VP4A 3AVOA 2O8DA 1RJ9A 2ZRGA 1A82A 1OIXA 3NTUA 2FFAA 3MWYW 1SVIA 4FMCF 4KCGA 4BFVA 3QF4A 2IF2A 3PUYA 4EAQA 3GLIE 1PV4A 1KNQA 3B1VA 4I1OA 5EE9A 4NYMR 2WMOB 1G5RA 2O0JA 3CNOA 4MRNA 1CU1A 1WF3A 4NYJR 4Q4AB 1E2LA 4GP6A 1ZM7A 5FBQB 1TPZA 3NG1A 5DYGA 1YZNA 4B3BA 2CMKA 2F1HA 4P32A 1DO2A 3TVDA 3SYKA 5JJIA 5L3SA 1Z83A 1NN5A 4BECA 3P4XA 2GF9A 1CR2A 1KTVA 1U8YA 5FI0B 5LB2A 1Z6GA 2OO7A 4JJKA 4Q21A 4QHYA 1JBKA 2ZRPA 2QROA 2WWGA 5EE0A 4PAOA 5FBRB 1X8JA 3H4MA 3GEIA 2GHIA 3ZLJA 2WKPA 2ZM5A 2ORIA 4KYIB 2CL7X 3GQBA 5SZHB 4AD8A 2OXRA 3AF2A 2ZJZA 2B8TA 2F9MA 3DOEA 4Q00A 4B2PA 4DDUA 4BFSA 2ERXA 2WVJA 3HJNA 3V4FA 1HE1C 3ONWA 1HUQA 4MKIA 2IWHA 1Z3IX 3LX8A 5B58C 4MYCA 1MKYA 3IBGA 4DCTA 2YYZA 1Z0FA 2ZITA 4UXIA 5JJLA 3AM1A 2VHUA 1CIPA 2ZJBA 2YC2C 2WWYA 2QMHA 4E07A 3AUXA 1KNXA 3RC8A 3LV8A 1M74A 1YE8A 2ODEA 1SVOA 4MRRA 2OFWA 3RYTC 1E3MA 2I1QA 1R2QA 4ZDJA 1QHGA 4RFVA 2FPKA 2AHOA 2W2TA 4MKGA 4Q4JB 5E7MA 2ZXUA 4CIDA 3MWKA 3IIMA 2NO6A 4QHSA 3SS8A 4FCWA 3OAAA 1P2TA 2OLKA 2J7PA 3VKHA 4QBGB 1NLZA 1Q1QA 4HAWA 1NY5A 2XXAA 1H65A 2RB4A 1AS3A 2DY1A 4WA7A 1OXTA 5B2ZA 1YR9A 1ZNYA 4WIAA 3BFKA 4Q1BA 5TARA 2VBCA 3UKDA 4JLMA 2F7SA 2W2XA 4TLCA 4V0LA 1DAHA 1OIWA 8OHMA 1V5WA 1XJ0A 2IYWA 3FMOB 5JCZA 5DE3A 4FWTA 3A1WA 1Z0KA 2XEXA 5K8IA 2H5EA 2L0XA 2BBSA 2A78A 2Q0HA 3LA6A 3PEVA 4Q18A 4LJYA 1ZP6A 3GJXC 2R65A 2HYDA 1UADA 1JR6A 2GK7A 3AKDA 3K53A 3HR8A 4DSNA 3GLHE 2CNWD 4LGMA 1OH6A 1SXJB 1AN0A 2X1VA 1YZGA 2QTHA 2VQSA 1M7GA 1I4DD 2PX3A 4TWZA 3EW9A 2YV5A 1UDXA 3MRSA 3X1DA 5KDLA 4V0NA 3NHAA 1KSGA 3EC2A 2WWXA 1J70A 2FWRA 2YWGA 4CF7A 1HTWA 1XCPA 1YRAA 4DB2A 1SXJC 2VIIA 1KAGA 4O25A 2JLQA 1EG7A 2FV8A 3TGPA 1JPJA 3QKSA 2N42A 1QVRA 1IM2A 1M34E 2IYYA 3X1WA 3T35A 1S9DA 4JLKA 1U0LA 2BDTA 5TY0A 5JI2E 4JLOA 2EU8A 2ASEA 4FXPA 4OBEA 4LHZA 5C2JB 1OFHA 1G19A 5GJWC 1S2MA 4R7ZA 2ZROA 2ZYTX 5JS7A 1E2QA 3QBTA 2FFHA 2GA8A 1FTSA 2GZDA 1LTQA 4PQRA 1JALA 1QG2A 3IIJA 1XXHA 4NU0A 2GNOA 2WHXA 1N6NA 5LB4A 3THWA 4PHGA 4M22A 4ZO4A 4ITRC 3EX7C 4HB0A 4MGZR 1KDOA 2AFHE 4GP7A 4GT1A 2R2AA 3OEHD 4XTRA 4EPWA 1O87A 1ZCAA 4OI4A 4Q4HB 2R6CA 4YXWD 1XF9A 5BN3A 2W6JD 2VHQA 2IYZA 3U7HB 3TAHA 3QKRA 1WXQA 2JJ2D 2V1XA 1HQCA 5FUVA 2N1BA 4KV9A 4UNQA 1G4AE 3ZD7A 3IHLA 2QZ4A 4RD4A 1AKEA 4DCUA 4TTQA 4RCYA 2YC4C 3REGA 1HH4A 2BBWA 5FOTA 3U3RA 5FL3A 3RHFA 3K0SA 5HKKD 2OCBA 3CRMA 1Q3HA 3SJCA 2DFTA 3VHLB 4MYHA 1RPZA 2OBLA 4LC1A 4BEBA 4DXAA 4F38A 4C7OB 2JLSA 1XTIA 3GP8A 4B3CA 3W6OA 2H92A 2QPOA 4D81A 4C30A 1AQUA 4RY2A 4URUR 5TV2A 4LHXA 1BMFA 1MO3A 4B3DA 4IVRA 1G7CA 2PBRA 1KIMA 1UKVY 4GMDA 3BC1A 4D0NA 2WSSA 1F48A 4M1TA 4AG6A 4NDZA 4KAXA 3RS0A 1TF7A 2ZJAA 4M8NE 3OFND 4TYPA 3F0TA 2F1IA 3ADKA 1GOTA 4JKIA 2GJSA 2NZ8A 3RABA 1NG1A 3I5YA 3O8DA 1LV7A 1D9XA 3VX3A 3KQUA 4Q5IA 4D4LA 2RMKA 5FL7A 4DDVA 3UANA 2GZHA 2IYSA 4Q1CA 2DFKB 4DCNA 3OF5A 4QFMA 5JSZB 4V0KA 1II8A 4FW9A 2RGNC 1MR3F 4Q02A 4JS0A 5FTLA 4F4JA 1FUKA 5HTKA 5KNBA 1G8FA 3ASYA 4V03A 1CJVC 4LSGA 1SXJD 2Z5FA 4BPBA 2Q9AA 3DDCA 3VR1A 1N5JA 5EE3A 1NL3A 2BM0A 2NG1A 4HLCA 2EFGA 1QHNA 3QXHA 4DT1A 2PEYA 4A8JA 5LDDC 1UBEA 1P6XA 3OESA 3TJZA 1S3SA 4EDHA 4FN5A 2PMKA 4IKEA 4IDPA 1CLUA 1UJ2A 5K8UA 4Q1FA 3P20A 4TLEA 5JRJA 1W7AA 1SKYE 2IEYA 4S35A 2XOKA 3QKUA 4HDQB 4TMVA 1NIPA 3ECCA 1Y3AA 1RC8A 1W4AA 3GLGB 5CLLA 4B6EA 3RRMA 3PEUA 4AKEA 1KKMA 4MRSA 1QG4A 5H8WA 3DEFA 1V43A 3FKSD 5JS8A 1N6RA 3FFBA 3P27A 4URVR 4CEIA 4RFSA 2FH5B 2BMEA 2KBFA 4YXWA 1R5NA 2VSFA 2F43B 4PPQA 1MOZA 2FSGA 1BKDR 1E2KA 2G77B 3THOA 3KQLA 1KK1A 2A2ZA 2X19A 3WNCA 4LUCA 3U7GA 2HXYA 4HAVA 3RNLA 2D62A 3B1WA 2IYUA 2HLDD 3GLHB 1G5TA 3MWJA 4PZYA 4RZUA 1IBRA 2JATA 4NZYA 3DPUA 4JLJA 4URZR 2WPDD 2YWHA 3TK1A 4AC9A 5HZHA 3GJ8A 3OIYA 4A92A 4PZZA 5BWMA 1YZUA 3KKQA 4RZ2A 4TTPA 1VCOA 1M7BA 5AJZA 4D4MA 3CRVA 1M2OB 1B0UA 3EZ9A 1VG1A 5B57C 4ON9A 4KXFB 3H84A 2EFDB 3GD7A 4LHVA 4TZ6A 1U0JA 3Q5DA 3GJ5A 4G3XA 1AK2A 2ATXA 5D3MB 1RYHA 1AS0A 1AZTA 1OKKD 2C96A 3DKVA 2BJWA 2ZI9A 3FHCB 5E7IA 1UAAA 4P4SB 1II0A 4QGGA 1NSFA 1EWRA 3B1ZA 2FSIA 2ZJ5A 2ZSDA 5GJCA 3QXXA 2V9PA 3AVTA 3M1IA 2BOVA 2GJ8A 1DOAA 1W44A 2BEKA 1N25A 3KXKA 4JLNA 1W49A 2RGAA 1VIYA 1YZTA 2AX4A 2JIZA 3TR5A 4JYCA 2ZJYA 1S96A 1RRFA 2R9VA 5FOXA 4B6FA 4BZQA 1GM5A 3K9GA 3P1JA 3G82C 5FTMA 2D06A 2XX3A 2IS2A 2O8DB 1RJ9B 421PA 2RGXA 3K0AA 4M1KA 3QF4B 2ZAMA 4LCBA 1I4LD 1BS1A 1SKQA 1K6MA 2FG5A 4E09A 2QPTA 4Q9IA 1NNEA 4PO9A 3L0PA 5C4GB 1X3SA 2FX3A 3BXZA 4C2TA 2EFEB 4GZMA 1CR0A 1S9HA 1U90A 5FUWA 2FFQA 4X8MA 1JQJC 3X1ZA 4A15A 5L3SB 1G6OA 4OI0A 1FNMA 1TF2A 1VG9B 2B6HA 2FEOA 2FSFA 4BLOA 3K0EA 3B78A 4AIIA 2CK3A 1GIAA 3GEEA 4QGAA 3WMFA 2Z0MA 1EWQA 3FYHA 3RSOA 2ZRIA 2WZQA 5CDFE 1E2HA 2W2VA 2IUTA 3ND8A 4HLUC 4M1SA 3AKYA 2TMKA 5KSOA 1G3IA 1NBMA 3QF7A 1ODFA 3FVQA 4LRWA 1J90A 1KK0A 2AKAB 3EZ2A 2OXCA 1W4RA 2J87A 2V8OA 4YMVA 4NCHA 1ONBA 2R44A 2JLXA 3V4RA 3EG5A 1KAOA 1E98A 1W1WA 2DFNA 1CJTC 1OT3A 1VCIA 4DEYA 2CL6X 3CPHA 3QPUA 4EUNA 2GVZC 4Q03A 5EP4A 2PCJA 2BHRA 3IUYA 4OKSA 5DHAA 1CULC 4V0ME 1IXSB 2PLRA 5G3YA 5SZKB 1W0JA 2CHVA 4DSTA 4R71A 3RS7A 5A4JA 1G8HA 2WKRA 2WPDA 4EKDA 1PLJA 4CW7A 1N5IA 4ZV4A 2CCGA 2J41A 2IS6A 2OCYC 5K8LA 1Z07A 3BB1A 3T06B 1GDDA 4IXNA 4Q48A 4HZIA 1QHHA 2WJGA 3LRPA 1ZVQA 2JJ1A 3MCAA 3DM5A 3SOPA 4B48A 2J5XA 1UM8A 3EA0A 4PC7A 4QJ3A 4QJ5A 5KO2A 3WMEA 3CF0A 3B7GA 4G5RA 1Z5ZA 1VTKA 2VP5A 2ZR0A 4DCVA 4XTCS 4TTRA 2QP4A 1P2VA 4R98A 1CEEA 5C46F 3LQQA 3B82A 4WZAE 4IEEA 1BIFA 2BBOA 2CE7A 4PX9A 3ETLA 4N1AA 5CB6A 3TIFA 2K5UA 2FOLA 4OJQA 1BO6A 3I73A 3CB4A 3QG5A 4URYR 1Y63A 5JHGB 2DCUA 1TX4B 4DZZA 2V1UA 1QDEA 3BH7A 4PC2A 1OB5A 4YC7A 1CR4A 3C5CA 4EPYA 4KFTA 2AFIE 4GZLA 1Z29A 1U0HC 1Z06A 3CIOA 4NONA 4XSGA 3R9IA 4A2QA 4NCKA 1PLKA 2OBNA 3AVWA 2RGCA 1ZBDA 1OE0A 3CLVA 5FPHA 2QTFA 2ZVPX 4E5UA 2IHBA 1RYFA 1L4YA 2RHMA 3SFZA 3BERA 4QHTA 3ZZUA 4DLZA 2AXNA 4BZPA 2NQ2C 1N6LA 2FF7A 5EP3A 3H1TA 3VU9B 3EPLA 3VKGA 4EIWA 2ZRKA 4MH0R 4QC2A 3T12A 2D7DA 2GCOA 3SBDA 4M0LA 1UEJA 4GI7A 1VYUA 3RS3A 1E4YA 3KTAA 2CL0X 2QP9X 1QHIA 3FHTA
chains in the Genus database with same CATH superfamily
2XWPA 4F2WA 5G0SA 2VT6A 4WNAB 2WB4A 1DKMA 2N47A 1ADBA 3IKLA 4LE2A 3K9NA 3D0OA 3NYIA 2NPIA 4J1NA 1XA3A 2KJQA 4P93A 3D8UA 4DMLA 2QN7A 3BE5A 1BN6A 3VZDA 1IY9A 1FCJA 2QAIA 3TOVA 4KVZA 3TAUA 2FGJA 4D4GA 1SGWA 1Y7PA 3FGOA 1CY7A 4JP3A 5LYJF 4HAIA 4R1MA 3FFTA 4D6PA 3B9BA 1IZ0A 2UVPB 2ZSUA 1K6IA 1MV8A 3M89A 2B61A 5AQEA 3EWSA 3G0DA 1G41A 1UZAA 3ASZA 5H68A 1ULUA 4HGOA 3DKIA 5SV2A 4ZEMA 2NO4A 4X7BA 3WLOA 1PT8A 5DI3B 1H8EA 2GBGA 4KXVA 1N6IA 3DE3X 4ZOQI 1NVDA 1OZGA 4CM6A 2OZLA 3PC2A 2ZZNA 4GVLA 1RZRD 1Y4DE 4WN9B 3TN7A 5F9FA 2QK4A 4PAWA 5EWLB 5JNUA 5TQ2B 4MRPA 1XD8A 3IR5A 5H80A 4EATA 5J4LA 5BN3B 1CUUA 3TLMA 1REQA 1SUDA 1E18A 2C3YA 2MMCA 4ZARA 4POAA 1MX1A 1ESMA 1RIIA 2UZAA 4OYHA 4RZXA 4AJIA 1XNHA 2B36A 1M9NA 3JVIA 5I5EA 4AQYB 3ENZA 2RJOA 4OLBA 2O7VA 3WGJA 2EBFX 1GKIA 1Y8AA 2DFLA 2Q2VA 4LSWA 3DCIA 3FKJA 1PWXA 1SQ5A 1R00A 1E4VA 2OGSA 5DIFA 5HIAA 4MVJD 1ZO8A 3NVKI 4P8RA 1D07A 1NI3A 4CDMA 3B6ZA 4DIBA 4TYNA 3TQFA 3ZDAA 1DJPA 1AKNA 1E6WA 3GR6A 1AS2A 3GPDG 3MWLA 2YWDA 5AW9A 4HEA1 3AVXA 2GKOA 2WIKA 3KLNA 2HMSA 4G4SP 3SAJA 3UJ3X 1YS4A 3HO8A 3K0CC 13PKA 4JUDX 1BX0A 4OSPA 1K75A 1G5QA 5BSUA 1ENZA 1R16A 3WIOA 1SVKA 4BLTA 3MT7A 2IU6A 3RTEA 1H6CA 3TL6A 4IIEA 4C14A 3CPEA 3PA6A 4GLLA 2BR4A 2H2IA 1L7NA 2AJDA 2WZDA 2Q8PA 5IUNC 5BV7A 4W7HA 4PSAA 4C7BA 3EVDA 2C5FA 1X8XA 2D1QA 2HUNA 1RXYA 1RBYA 4I9NA 1IHUA 1W30A 4G0ZA 1I2DA 3CURA 1UFVA 2OGWA 1VL1A 4NIMA 3JQCA 4R6WA 1XDBA 3BILA 2NVWA 3DUWA 3LUFA 4KO1S 4P4SA 1P4HA 3AINA 3LPAA 1KOLA 1AQJA 1D04A 4CGZA 2J5BA 3AEUB 4B3XA 1NXVA 3WO1A 1KJWA 3DR3A 2H1OA 4GLFA 4BFTA 4MV6A 1EQAA 1WEKA 2BT4A 2CBZA 2JIBA 3IQXA 1Z13A 3A10A 5KVAA 5DHPA 2QP3A 4WK2B 2JBWA 4WBNA 5CHYA 5LQRA 1UC9A 1AGPA 2Z09A 1JVNA 1FFGA 3KOYA 1YJ5A 2EEZA 3QFTA 4C3ZA 4IBOA 1M6WA 3KEFA 3U2QA 2AR7A 2X0NA 5BT8A 2O8FA 3VPGA 3RWOA 1JSZA 1Q3KA 2Q4BA 1DC8A 2EL7A 3QKTA 5KQRA 3I39X 1JU9A 2GM5A 3ZGVA 2PKXA 1SUFA 1GPJA 4LQ4A 1GSHA 4QOJA 3NOQA 2A3NA 3VR3A 4X44A 3I2GA 2AXPA 5J3JA 3B9RA 2NLOA 3O9MA 3IPXA 3TRIA 1L7BA 3E1SA 4XWYA 2VDMB 4RL6A 5JSFA 1GTRA 2LUOA 4I1VA 4YJ2B 4DZTA 3VGPA 1KRWA 4JGBA 4IJKA 4XWTA 4A8JB 2CUKA 4H60A 2YWBA 4FJ2A 4U6NA 4ZAZA 2OFPA 4QBIA 4QPNA 5C8YA 3K94A 1Y98A 2O4CA 4F3TA 5K99A 6Q21A 2F9FA 5LP1A 1A76A 1MABA 1SCDA 1JQ5A 3BS4A 4N9QA 4W5HA 1S5PA 1VCMA 3AERA 1B6RA 2WFZA 4EMSA 1WWKA 4J07A 4EK9A 2J1LA 1ZH6A 2QLMA 5HKBA 1RHMA 2IOHA 3F7MA 4IJ5A 4MVJH 3RYIB 2G71A 3PXXA 4FDVA 4Z86A 5FBLB 2ZS8A 3EVCA 3JQDA 3WRXC 3BZUA 1QGDA 3BQNB 4PAMA 2PU5A 4B35A 2W6QA 4WKPA 3RAGA 1DMSA 3OIWA 2P9HA 2ZRJA 4G0XA 4ZC8A 3LUAA 3A3YA 1J09A 3CKLA 1XRSB 1XVTA 3N1UA 2EEPA 2IYPA 2ZTLA 3CF4A 4GEGA 4XWGA 5G02A 5HTOA 1D8TA 1XQ1A 2B69A 3GHYA 1MZVA 3NBUA 3RUDA 1VOTA 4FDMA 2ZBVA 4MQEA 3LDFA 5DNVA 5TEWA 1FSZA 4JKOA 1QO0D 1SO8A 2DQZA 5TSDA 2J0UA 1YB5A 1MORA 1NVKA 1TJ4A 3MXTA 4U9HS 5TJHA 3BWBA 3A9SA 1HKUA 1KQ3A 1ZW1A 4X6LA 1PI3A 4MPDA 2X8WA 4OQLA 1LKZA 3IJPA 3RGWS 1KZ7B 2VG8A 4WXEA 4DREA 2NSDA 2WNSA 4OF4A 3WLTA 3LYHA 1H5UA 2IYVA 3GJYA 4K9RA 3WGMA 1FVXA 4NH4A 4GRIA 4DJDC 2NYUA 3GUVA 3Q72A 4CIBA 1P1JA 1DB3A 4NMWA 3K1TA 3OIUA 1F6BA 2PRJA 4IILA 5HFJA 4R9UC 1HDYA 2JIMA 1A9TA 5ARCA 3NOXA 4N9WA 3DMDA 3UXYA 3W7AA 5I7VA 5JEDA 1VSUA 3DFIA 1RJEA 5BVGA 2W7TA 1DT3A 2QUKA 4IHJF 4E03A 5C81A 1O0BA 2J0VA 3ROKA 2QB5A 5LMUB 3OUZA 4I1YA 4AMZA 3UHAA 4C0BA 4I1UA 4B3RB 2QD5A 1ZCJA 3DAFA 1JHQA 2QA5A 3C1OA 4YAWA 3D3WA 3G8DA 5BSWA 2VHVA 4ALJA 1P60A 2BGMA 2W4IA 2OZEA 1DIAA 1WCXA 3FDZA 3K9CA 3LC2O 4J0GA 4Z0NA 5L3VA 2XT6A 2AXQA 4HUJA 4C5AA 5AMXA 3T3DA 3UMVA 4AFNA 1LDGA 1RZ3A 5CVJA 2HHJA 3EAQA 1VGVA 4FK8A 3VPFA 3CX7A 4NEQA 1QMPA 5F9MA 4OK5A 3TCKA 1JJAA 2P6PA 3UMGA 2HMVA 5LYJA 3W2GA 3MCTA 4F1JA 1JDUA 5EKDA 3UPUA 4BFXA 2OXEA 3Q3HA 4CT4B 1BDHA 1TZBA 5AKJA 4OQMA 3RC7A 1W2GA 4P7GA 4G81A 2ZYWX 3SVTA 3EHEA 3IDQA 1EX6A 5EXTA 1V6SA 2OORA 1HTBA 3GJ0A 2OHJA 4YBRA 4EY3A 4J1TA 2N9UA 3IBTA 1T9GR 4KP7A 3GL9A 5KMGA 5G1OA 1YQ9A 4RMHA 2B98A 2Z95A 4P84A 3VV2A 3DE1X 1LNQA 1S2GA 1SEVA 2IYLD 2RGEA 4F9TA 821PA 5J47A 3JQ9C 2DSTA 1NBIA 5CU7A 1FRFS 4YQYA 3AOGA 3FUXA 4MEAA 1YBAA 4BBAA 3LL4A 1J0XO 1SWWA 1I4WA 2M2IA 4R54A 3RUEA 4EARA 3FOBA 2K7FA 4FZJA 2ARKA 4OQPA 3QTLA 1D8AA 3IULA 2QPAA 4ND5A 1W48A 3RAJA 4QSMA 4JX8A 1N1GA 1PUXA 4DIFA 1ZL2A 4DLRA 2I4MA 3D2BA 3PNLA 1HBJA 1TVKA 1AKYA 4JBYA 1U7DA 1BEUB 1CEQA 3ZU5A 3AW9A 3K8ZA 1PEKE 4ZZ0A 3UCFA 2O1WA 3G2OA 3N7AA 1P33A 4ZREA 1X7XB 3FJ1A 2A9OA 4HPWA 2JBHA 4PSKA 4YR9A 3TJMA 5DYYA 1RXVA 3M9XA 3O31A 3BTVA 1KU0A 3LBFA 1ULBA 2P5TB 4GL2A 4CEHB 1AQ6A 4RD1A 4F3CA 3OCCA 1AKVA 2XD9A 1H0SA 1ZDMA 1N3BA 4XPZA 3PTAA 3RK0A 1I0ZA 4F4HA 3PPYA 1EFCA 3I92A 3PGA1 4GRDA 3K15A 4ZO9A 3NBQA 2AL7A 2XOKD 1IBKB 3FGPA 4FX5A 5DI3A 1BX1A 4BQSA 3GFVA 5A9RA 3AM4A 4JVMA 4OUDA 1RCTE 2W43A 2AEMA 3NVAA 5CLHA 4UZEA 1ISSA 4MUEA 3PC3A 2BGWA 4RVOA 4MQLA 1KQFA 4RIFA 4WVLA 3KR9A 3A7EA 5EHZA 5K0SA 1EJBA 1DBPA 3F7TA 5FPYA 3BSYA 2Y1GA 2YXLA 1MB3A 2UVQA 5IDYA 3L05A 2H7CA 3TD6A 2P35A 1BE0A 3LK7A 1N8KA 4GC5A 5CT5A 2BLNA 5AVOA 4PY2A 1KO8A 3ZGNA 3KVNA 4XE5A 4B34A 2O8EA 2PA0A 4HMPA 1TL7C 5DBHX 4ETWA 3QSYA 2YH2A 3RE1A 3GDFA 4ISBA 4AKGA 1D2RA 1LNSA 1QK4A 1JQKA 4UFNA 4DLYA 1TM4E 2PLNA 1QF7A 4GOKA 4P33A 2PX6A 1EEHA 2IYNA 3OZRA 4KRXA 4L9SA 4QG3A 2O3RA 5TIIA 1JNYA 3FGNA 4LQDA 3EXEB 4OQNA 1MX9A 1YUMA 4P4UA 1G5FA 3JQAB 1OREA 1D0SA 4DLUA 3DOIA 2HLNA 1JIUA 4ZANA 5K09A 2DT8A 5KTPA 5HJ5A 2FJ0A 2AFRA 2PRYA 2A9VA 3GVPA 1OQAA 3AV3A 3B3JA 2FMXA 5HW0A 1AKQA 4MVXA 5LA6B 3HBAA 3FSGA 3MLEA 1W46A 3OIDA 5AI6A 10MHA 3RC9A 2XE8A 2ZRHA 4MICA 1RPNA 3EXG2 3VJLA 4KVGA 3U4IA 5E7JA 1U7UA 5KQLA 2VJDA 4KPEC 3DDNA 2VSYA 1XQ9A 3GDHA 3RC3A 3L7YA 3AF6A 3R9WA 5T57A 3OCUA 2HBRA 4LOHA 2XLBA 4B87A 5BXQC 4LMPA 5HGXA 3PT9A 3GAZA 4WLNA 1DC4A 4KXXA 4I9UA 1EVYA 2YMMA 5DJ5A 4BVGA 4NAUA 5A5EA 2QUJA 4QT4A 2VEOA 4ER3A 4AZTA 3Q9UA 1C81A 2C57A 3TB4A 2OAEA 3GX1A 4KK4A 1KYYA 4P2GA 2C95A 1IHXA 1PJ8A 4UNPA 3WBBA 4FW8A 2D1SA 3NEYA 4C0XA 5GOZA 3SJAA 2H06A 5ALDA 4JL5A 3FMVA 4KN8A 1M1YA 3MJFA 3UMYA 5CFMA 1C3LA 2CHGA 3R44A 121PA 2A7QA 3R7BA 3U16A 4OL0A 3I0ZA 3QX8A 3FRJA 4YJHA 5EMKA 4P0PB 1TZCA 1JHOA 3FLMA 4HWKA 2ONYA 1Q3TA 1I3CA 2P4SA 3VOAA 1W5AA 3FETA 2R4TA 1J4AA 1Z16A 2I6QA 2VATA 1DEHA 3CS3A 1Z08A 4ZI7B 1LEHA 3KCNA 2ZUSA 1CF9A 3R5FA 1J0CA 1OIVA 2XD4A 3WRYC 2CVPA 4K81B 2PUGA 5J63A 1B2RA 1HL7A 3A4VA 4OHBA 1NF3A 1KYVA 5EKSA 4R9RA 3RVJA 3EDOA 3DYIA 2I2DA 4OUKX 4ARVA 3CNEA 1KS2A 2LRHA 2FA9A 2PGAA 3HL4A 3MTGA 2D6FA 3O0DA 2FETA 2HIMA 1KJQA 4HS9A 2VJKA 3UGJA 3AJAA 3LP5A 1ZXLA 1QDLB 2RHJA 1LV8A 1NBMD 3PPVA 3QU5A 5LYYA 3KSBC 3CLSD 2QU7A 4FIDA 4XR9A 4IHJA 4EG7A 3E7XA 1L9XA 2IOYA 1AK1A 3TTWA 3BFVA 3DF9A 4M0CA 5BN5B 5KZMB 3UK2A 4B32A 2WFAA 1FDIA 2Q2WA 5LLTA 3NBFA 4PS0A 3ZD9A 1CXZA 3K2BA 4CVNA 1LK0A 5JYEA 2HZBA 3OO1A 1ESCA 4X7RA 5EVJA 1K1EA 2WYOA 3PG5A 3RVLA 3P0EA 5BYBA 4UPVA 3SYRA 4A0RA 1NY6A 3HCOA 4HWSA 3IS3A 3EVTA 4HDMA 3C7CB 2PZ8A 1ZOLA 4K46A 4OHMA 1FP6A 4X45A 1G8PA 4NPCA 3EUAA 1CQJA 2FEWB 3L0OA 3N9IA 1UJMA 2KLBA 1UPBA 2Z8YM 4CEJB 2NU7B 4ZFNA 2AXEA 3D1LA 4AZVA 1BU8A 1XZMA 3TM4A 2ZAOA 1PQUA 3GLFB 1C3OB 1RWWA 4XJVA 4LZAA 5G0VA 2OAP1 1IJKA 2A94A 3PIIA 1ECPA 2O8VA 3EZLA 2W6IA 1R5OA 3K09A 4QFCA 1ZM4A 1B6GA 3KLOA 1E3WB 3BE4A 1KOGA 2VQ3A 5EINA 1UP6A 3DT8A 3SU8A 3TQOA 4WE3A 3C7KA 3RHTA 2P9TA 2MDTA 3EWNA 4JIMA 4X1OA 5DW3A 3WAJA 5JQGB 4MWEA 4A36A 4Y0AA 1KS9A 5F2EA 1DELA 5IT9A 3Q10A 4GECA 1HMPA 1VIMA 1YGYA 1OW3B 2DH5A 3KUXA 2ENUA 3DXZA 3LPDA 4F93B 1HT3A 1NOJA 1JEAA 4EF5A 4ECAA 1DE0A 1TQDA 4D8YA 5C8ZA 5I48A 4IFEA 3WK6A 3ZE2B 3BCUA 1SM4A 3RI3A 4BQNA 4C4ZA 1IRIA 2BC9A 1XMPA 4YP9A 2IPLA 1EM6A 2HCJB 4EMUA 4L8LA 3JYHA 2CMFA 3AHCA 4JVSB 2FQYA 1GY8A 2FPUA 4P1ZA 3CLTC 2PHZA 2B1QA 1ZM9A 2R68A 3WB0A 5JNVA 4JT4A 4OQZA 1DNPA 2BEUA 2O0MA 3E22B 5L7YA 3GBSA 4JFAA 3EZFA 5EZ6B 3KX2A 4KACA 4E1VA 4KXMA 1FC0A 2HF9A 5FTJA 4AO7A 3BDIA 1W87A 1CUSA 1RRPA 3E53A 3HHEA 1NOKA 4UJ3A 3KYDA 4KMMA 2V7BA 1P1IA 1E2NA 2MOKA 3CLRC 4M7OA 3C8ZA 2WOOA 4RD3A 1TO1E 1P7VA 5AR1A 1XYYA 3FWHA 4TM8A 1G8SA 1H6BA 2JPDA 2ZJOA 4WXRA 3VYUB 3ZIAA 1UWCA 1WCYA 2QW1A 2XUIA 2UV8A 3UAGA 2BLLA 4ALMA 1WR8A 3U3MA 4DMUB 2PX8A 1A04A 1IWOA 4TV9F 1WF6A 3ADDA 2XOXA 2P0EA 2YFQA 3ZXXA 4G1BA 2ZJ8A 5AKLA 3RO7A 4LY3A 4L22A 2C9OA 1ULTA 4WZ6A 3MJEA 5B2FA 1SRRA 3HB9A 4LYYA 3KPJA 4AURA 5TQVA 3RVNA 2FJUA 3LQKA 1Y4AE 1FRVA 1SZPA 3KOXA 1EVQA 1MGOA 3M5CA 4PPFA 3W7VA 1W6UA 5I3ZA 4RGBA 4EA8A 2PT6A 3PUHA 1ODJA 2PTGA 1U0BB 1JJBA 3PUVA 4B31A 2ZI4A 3TNDA 3ZOZA 4A5OA 5J40A 4JX9A 4BLUA 2KWIA 4Z4QA 2QQGA 3I4FA 1CUIA 3SHTA 3T54A 5K20A 3HPRA 2C3OA 3L0IB 3I1JA 1BAPA 3IEXA 4AUEA 4ETNA 4Z1MD 4YUXA 2QGZA 1GUBA 2JGJA 1U11A 1M10A 1QYXA 1NATA 3QE4A 5CFRA 4HX5A 2WM9B 4QBHA 5F1YA 1GNTA 1XVUA 3QLUC 3FNGA 3O94A 3GWZA 1H3FA 1OJLA 1D2NA 1NUSA 4IDHA 3B36A 1LFDB 1YL7A 2PD6A 2OV3A 4S1NA 4ZKDA 4GBGA 4J0QA 5ALHA 2C9BA 4GD3Q 1OI2A 1QBKC 5EE1A 3W5SA 5GGYA 1KIAA 4OBBA 2NMVA 3C97A 4AJLA 1JDBB 3DXFA 4HATA 3N6VA 2FWIA 2YOGA 3MWGA 5GZ1A 5DU2A 5HJ2A 1N0VC 1U8TA 4B73A 3THXB 4L8FA 1C7ZA 3F2VA 4LWPA 5LCXA 4K88A 3ROGA 3NM5A 3SR4A 2OHFA 4NBSA 3CMCO 3CT4A 3JD4A 1UKCA 3JCZA 3GCWA 4G0YA 3P0RA 2J67A 4CT0A 5JT1A 1R5JA 5KWIA 3R0ZA 4EHJA 1G9XA 1LU9A 2IYAA 3ETNA 1QVVA 4P3YA 1W94A 3G6KA 4YO7A 1FNNA 3VR4D 4YRZA 1EDDA 5K4AA 1FSSA 4H0NA 4KE6A 3QI2A 4PLGA 2ZR9A 1I6LA 1M83A 2W37A 2VL7A 1H8HA 3HN6A 1RAEA 4OQQA 3S2FA 4N47A 4R81A 2EZTA 3M34A 3A9VA 4UHJA 4ZPXA 5AK4A 3PNKA 1F17A 2V7PA 4EM6A 3Q5EA 3GLIA 1UT5A 2CXHA 2SECE 3IJEB 2VYND 2VPPA 4D4IA 221PA 5AW6A 1Y5MA 2EKZA 3FAKA 5E4TA 1NI4A 3A1DA 3DAPA 4RWEA 4L0DA 4K7JA 5J1SB 4PO8A 1XCMA 3FTDA 3EJWA 1KJYA 3DOHA 3CLTD 4CMGA 3I0NA 3RUAA 2YVLA 3WDSA 1EFVA 1XYGA 2HIGA 2O7SA 4JLWA 3TRKA 4F04A 4LHSA 4MNTA 4IGAA 1PBNA 1CX9B 1QC5B 3JSXA 2ETVA 1OX4B 3KKNA 4KZKA 5F1KA 1GL6A 1Y6ZA 2KLHA 2EJVA 3O8NA 4B40A 1B6TA 3KV3O 4UEWA 2ZRQA 5JMWA 2QI9C 3U13A 5A1JA 1HLFA 4BGEA 2FE1A 3V4PB 5FPSA 1X92A 2HA6A 1L1FA 1E1QD 2CBGA 2RGDA 3LUPA 3PNYA 4KGXA 3EPJA 1EFTA 4HH1A 2EFHB 2XYQA 4P98A 1UPCA 2QD4A 1G18A 2FNAA 2Q1WA 1QWSA 2QRGA 5BY2A 5ESXA 2GK3A 2RGNA 1TYZA 3A1EA 1R0XA 3ETJA 1RP1A 4BLPA 3WNVA 3JRNA 4JOBA 2O20A 1WABA 4FMDB 1RJWA 1KFBB 1KJZA 2Z2KA 4IFBA 2Q6OA 5B30A 2W42A 4DV0B 4C0KA 1VPWA 3OIFA 3OJWA 2BUAA 3WGNA 5EUBA 4FYHA 3FVWA 4DUGD 2WIBA 3WNQA 5J2TF 3U48A 4CM5A 4AX4A 2O06A 4ZDKA 3F2IA 4L8YA 1Y1RA 4RD2A 3SBOA 4B79A 4CCYA 1N0UA 2I1VB 2GILA 4KBFA 4KYVA 5C5CA 3IKTA 3WSWA 1MO4A 5AXBA 1SHJA 3QW4B 3LX5A 2GBIA 4GAEA 1LLUA 1C3EA 1P44A 2WF5A 4QKQA 4P83A 2CJFA 4TMKA 1RLIA 2JEZA 2I87A 4CIXA 1ONPA 1AT1A 1OX5A 2VF7A 3RFVA 2NAPA 3EXG1 1PV1A 1Q5PA 2D2FA 4G5YA 1HY3A 1OTHA 5DHFA 1NNUA 1H42A 2FK7A 2R25B 3VR4H 2PYZA 2WKWA 3Q3EA 4JD5A 1UXOA 3SKXA 4JLBA 1ZIXA 2XUOA 3RSZA 1JQAA 1K7YA 4NBLA 1ZM3A 2GYWA 1CK4A 1MIHA 2B30A 1L8AA 5EMHA 2GZSA 3KJXA 4CLXA 2NXEA 1SKMA 2OCXA 4URFA 5JJCA 1PR0A 4YX9A 5MHTA 1KYQA 1NG9A 1WM1A 3K6KA 1X7ZA 1JIVA 4YCNA 1RQLA 2ERYA 3UJ7A 5CFQA 4PSVA 2WJHA 3RC1A 1XRLA 2ZETA 4DQ0A 4UUOA 1ODTC 2RI0A 4GWKA 4HQLA 3O4GA 4WX2B 3WK4A 4H6PA 5FFNA 3PYLA 1RQ2A 1F20A 1ONNA 5G40A 5AVYA 1VRVA 2QXYA 2P0AA 3RU9A 3S40A 5IVIA 2VP0A 1YD7A 1ZNZA 5EZSA 4KDFA 2ZRBA 4OI1A 2BWJA 3SMVA 1KMCA 1WXXA 2ATVA 3TIIA 3HUDA 5B7NA 2ZBPA 2H5LA 1D1QA 4JLSA 2FZWA 4HAXA 1GARA 1XTQA 2Q4OA 1TPYA 1LS6A 1U9IC 4LBWA 2NP6A 2H2HA 1QH1B 3L2OB 4ZT6A 3O8CA 5JROA 2OC4A 3AIMA 1V16A 2H17A 3I04M 4HGNA 4RKEA 1BFDA 5BUQA 2G76A 2RAPA 3SNKA 4TV9A 4OHXA 4REQA 5A4MS 1HYGA 2WKSA 4B45A 4L73A 4C01A 3FHOA 1VHJA 1EUCB 4PM4A 3QPAA 1GL9B 1J33A 2I0FA 2ZULA 2DBQA 4BAGA 2ES4A 3WLHA 3IEMA 5CA1F 4FGKA 4O0MA 2KYRA 3BRSA 3DQZA 1YZVA 1Z6ZA 4I1SA 2GNAA 1E3QA 2QZ9A 4J49A 4TT3D 1E79A 4UM5A 3VPHA 4BMZA 1AV6A 5DP1A 3TECE 5F2KA 4EG3A 2XV1A 3ZNPA 1F2TB 4BCBA 1FK8A 1KJJA 3AF5A 3EQ2A 4IMPA 3PB3A 2Y27A 3MD0A 4WXPA 5EJGA 3WL8A 4N48A 1WX1A 1ZIDA 2FZ4A 3VC3A 2BFNA 2PQ6A 3PDHA 2QEQA 3K1YA 3G23A 4Q37A 3R7WB 4AZWA 1U2TA 4M88A 1JILA 1WQ4A 2HTFA 2FW0A 4TXNA 3UBTA 4UAGA 1P3DA 5IUKC 1EVJA 1FP4B 4G5OA 3LG2A 1Z2CA 1VLHA 3PVSA 5E95A 5IDVA 2MTBA 4D45A 4DR3B 5IHPA 2J9FA 4JJ7A 5A4AA 2ZYRA 1TGVA 3CXRA 4J0HA 1J5EB 1UUFA 2GS9A 3MS2A 2FW8A 5KKNB 3MT8A 4N7RA 4ZOEA 5H81A 4DTIA 4FKZA 4BBPA 3HWRA 3QXJA 2ALJA 1EZ1A 3C3BA 2ZCJA 2P9YA 2OOSA 4AW9A 1CUVA 1V7ZA 1V48A 2ZTSA 5A7GA 3DTTA 1T5LA 5FI5A 3A1VA 4OHCA 4QRIA 3CC8A 4M9CA 1A9XA 4RMNA 1YOVB 3QPBA 3W2FA 1WBJB 4I55F 4BLVA 3BEOA 5GWXA 2VFAA 2F1JA 1HORA 3R77A 2YWXA 3RWMB 5HCNA 3RSLA 3H3FA 3RARA 4HGQA 1L5MA 5F73A 3HCEA 3BIWA 1F7UA 4HLUA 2R66A 4E22A 4CR7A 5I01A 1F4LA 1KU6A 1MIOA 1UFKA 3DAHA 3IMEA 5FFMA 1ORTA 1RYZA 1EBBA 1TKCA 5D84A 2B25A 1DDOA 1GQRA 3ZS9A 2BMFA 2QOEA 2FAXA 3DNFA 3NTXA 2AOWA 1C0PA 4PLYA 4PXSA 1QCZA 2QL9A 5DASA 3T4UA 5KWJA 1Y6RA 5DH9A 2NQTA 4PGAA 1EP1B 3QVVA 1JEDA 3HU1A 2FOXA 4BNHA 4ZOCA 4KGDA 1Y8ZA 3RAPR 1VJDA 1YQUA 4M54A 4NEGA 1VIAA 5D1HA 1T9CA 2P65A 3HP7A 4KWHA 4DLXA 4LWOA 4MTCA 3OEWA 4MKFA 4QDUA 4MVCA 5SYAA 4N5IX 1RI1A 1JAZA 1EFUA 2ETXA 1KARA 3MYRA 2MSWA 1F06A 1PKXA 2AG8A 3WZMA 2FQQA 4IM7A 4QWWA 1DLIA 3NHLA 4I14A 2G1UA 1XQ6A 2BMDA 3OE7A 3MOSA 1XK7A 5AJYA 6NULA 4KAFA 4GPEA 4NKRA 2C1ZA 1GEEA 5TGTA 3D2AA 3RRBA 1DINA 3TM5A 4OM7A 4QGHA 2B5OA 2WJVA 3HFSA 4W7SA 5EKUA 3P7MA 3IILA 4Y2YA 4G2TA 6ABPA 1NR7A 3SQXA 1FJHA 3F5FA 3H99A 4AJ2A 1H2HA 5BW6B 2UUBB 3EIEA 2IE8A 5KDOA 2FW6A 4HNVA 2ZRNA 1GAQA 5KAPA 1U3CA 5CM8B 1LY1A 4L2IA 1P75A 3VPAA 2PMDA 4C08A 4G5XA 1SRQA 1YVDA 3DDOA 4BXOA 2QF7A 1TCAA 1P2BA 2WYWA 3DD5A 4ND4A 2C83A 5ERYA 3C6BA 1OA0A 1QTRA 3HO1A 1NW9B 1CY4A 4HYYA 3QUAA 3VM6A 1M0TA 4I8IA 3ZPXA 1FDTA 3H1AA 4N5DA 4S0XA 1UZMA 3JTEA 2C3UA 2PZFA 4HDKA 5FBZA 3JAKA 5J2TA 1SC1A 2ZQYA 1Q50A 2RK4A 1IK4A 3PZRA 4QX6A 3L6CA 3VAAA 1PNQA 4EFMA 1U0TA 3CE6A 1W9MA 4G8JA 4GGMX 1L5HA 4RU1A 2OFFA 1DARA 3ZS8A 2JW5A 1P72A 1KI8A 2H18A 1KPGA 1WUYA 3LCUA 5TB5A 2H16A 2VRNA 1YVEI 1V47A 2JANA 5BOVA 1I4EB 1R18A 1Z74A 2JFQA 2ZR7A 3W8NA 3WQQA 3GLFE 1FYFA 1XN4A 2LP4Y 5A03A 1BJTA 3DXXA 4NU8X 4WJZA 2JFXA 4Q1AA 3N0TA 1F2UB 1XV5A 2CLHB 3AP2A 1P3JA 2ZJ0A 2QRHA 1CNFA 4G07A 4O1IA 3V1TC 3QX3A 5JXHA 2FWPA 1ZGJA 4N0EA 3WGVA 1ZNQO 1KRHA 4H1HA 5E2IA 3RS4A 4D9HA 3ESBA 2I9PA 3CZ9A 1YL5A 1N2GA 3DR5A 4DJFC 5CNIA 2CBXA 5AKKA 2G28A 4F5DA 5B64A 4L6IA 1H2RS 1NPYA 3AY3A 4YJFA 2HSGA 4W8OA 4ARZB 5LM3A 2P0YA 1NHWA 5B4VA 1DG1G 1XQYA 3OP1A 4KC0A 3LRTA 3WLLA 4L6AA 2R85A 1IY2A 1JDPA 4QNMA 2J4CA 5D5QA 5HCUA 4CV2A 1TA0A 2XGMA 1ZMOA 3ZDBA 4ZZ2A 5IC5A 3H6HA 3K9FC 4F3NA 1FX0A 3BMQA 3F5QA 2YY7A 1UMCA 2ZJ1A 2F2TA 4QRHA 1PRYA 4HAOA 3FMIA 4UQOA 5EZ5A 3IVMA 5C51B 2YWEA 1QX3A 1X1BA 1UC4B 4MWSA 4M98A 4MTLA 4NOMA 3CZPA 4G0VA 5KHAA 4UEOA 4UREA 3ND6A 4H1WA 1LNZA 2CV2A 2O8CA 1X9GA 2CLSA 2EFCB 2XB6A 5DSZA 5KI6A 2HWYA 1R0YA 1IAQA 4K6FA 4NSNA 3IOBA 1R8SA 1XHLA 2BEVA 2ZPTX 4GGOA 4OP2A 1Z37A 3DEAA 3CNQS 1QLHA 1T0UA 4N3CA 3RANA 1RZUA 4JL6A 2OZVA 6REQB 1XBTA 1TECE 2WG2A 5KHOC 1N36B 2PY6A 4UJ5A 5CA1A 5JU6A 2GLXA 3DP9A 5KNDH 3OCWA 1RKXA 2P1RA 2X2EA 3DHWC 4WV3A 4HFJA 3RC2A 2XRZA 3UB4A 3C1UA 1R88A 1Q7TA 2ZIGA 2D2IA 4JJEA 1EJ0A 4ADSG 2NVUA 4CQMB 3UT5A 1HNNA 2PGNA 3ZDEA 1YL6A 2CWDA 3A9CA 4RXMA 1NXPA 5E4YA 5K45A 5CLQA 3GJQA 5AVQA 1SD5A 2ZIXB 3DUFB 4N0DA 4OB6A 5AVJA 5JNSA 1DADA 3T61A 3T7RA 3DTVB 3EFHA 2XJ4A 2DQKA 2ZOSA 1E1RD 1G8MA 1WKBA 2IGTA 5LNK1 3SHFA 3SFVA 4DUPA 1V96A 4YRKA 4LN1A 1LX6A 1U5CA 2PSFA 2WFLB 3U39A 1PHRA 3PQCA 4H7JA 4QZVA 2GSDA 1ZK0A 1E0DA 2YV4A 4CLOB 1A0OA 2DSNA 3QU2A 5ILQA 1RYEA 1TKBA 5IAGA 3NRBA 3PWZA 4N6GA 4WEQA 1SOVA 1G7TA 2C2HA 1OROA 3GJSA 3LCRA 1WDMA 4C0WA 4ZU6X 3SP1A 1CRQA 3L7BA 3M8KA 4K9SA 3ROXA 4C0QC 1JLLB 2JGDB 2BMJA 2AR9A 3MK31 4FQ7A 1ZM2A 4I3GA 5KSZA 4RS4A 5EHXA 2VOJA 1T2FA 3MMSA 1I2BA 4I55A 2H0AA 1BVYF 4WMLA 2WWIA 1EUCA 2QRPA 2A88A 1JG4A 4CYMA 3FFAA 2G9VA 4O8CA 2ZAGA 3JQFC 4HDSB 1JQ3A 4TL8A 3ZLUA 3STHA 4AULA 1XROA 4CQLA 3T7JA 1JDTA 1XTPA 2GBLA 3LBYA 1N4AA 3CLKA 5JS1A 1PR1A 3Q0TA 4G56A 3CJTA 3LBHA 3MA0A 4W6QA 3IT1A 3QWAA 1US8B 2HV8A 1ATZA 2YYAA 3SSOA 1KOFA 3DMTC 3K8QA 5JASA 1M2EA 4CM3A 2F4VB 1KZ6A 1MQSA 2CJYA 2IZZA 4RTNA 3L7KA 5THKA 3EVBA 1E1LA 3GCDA 3HI4A 4UE2A 3CEPB 1TMKA 4UASA 3UPDA 4XCVA 4RTRA 1GILA 2V4MA 2F3UA 3HFRA 1Y6QA 4MVJI 2JAWA 4PCVA 3VTKA 3ZXUB 1S3IA 4HZGA 1GZ6A 2YWCA 1T0PA 4LXTA 4PPNA 3WLKX 3TJRA 3F6RA 3HCPA 4G5FA 1JQBA 3CTPA 2XB9A 3Q9NA 4HH3C 4C04A 4LAFA 4I99A 2NT4A 1FU4A 5KOHA 2ZKIA 3EZ7A 5DXFA 5DM60 3AIOA 2Y1XA 4TN1A 3ZH9B 5DM70 1C9JA 2FPIB 3B9QA 3L40A 4D3YA 1XZAA 4DLPA 5BNWA 4JJ4A 1ZIYA 4PXAA 3EXHB 3UMMA 2O0HA 4QBTA 4UARA 4ENRA 3L4EA 1S3FA 3UAXA 2QW0X 3WJAA 1KMNA 1ND6A 3GJ4A 4FEAA 4I3FA 1THZA 2HZ7A 3PKIA 3ENWA 3M6UA 3QX9A 4PAQA 1FTYA 2HBYA 3PFGA 1HX7A 4W1SA 4B33A 5DNYB 2B1GA 5C18A 1PD1A 1OYYA 3GFOA 5ELMA 5GINE 4NXNB 3G59A 1KQGA 4EMBA 5T5QA 1GN8A 2CE2X 1AN9A 3KJGA 4JI4B 4MVJP 1AO3A 4BGUA 2GPYA 4WZZA 3YASA 3ZNOA 4KITB 2PWPA 5I7AA 2A58A 3P5BA 3ZHOA 4ZK2A 3RJTA 2C4HA 1SFRA 4OQFA 3MOIA 4BCCA 4DR5B 1IOZA 5ECWA 2RHGB 4QQFA 1Y8CA 2C7QA 4LRSB 4P3XA 4BVAA 1KEKA 1WB9A 2PBZA 2WDPA 3V7NA 4LC0A 4YS6A 4B1FA 5B3JC 1DJNA 5CIWA 2CFSA 2J32A 4QAJA 1DAPA 4MWCA 4KQ1A 3UXHA 5HJ7A 5KWVA 1PG0A 3CX6A 1RIFA 4XJXA 1XDDA 3LO5A 2IYXA 5CLIA 4WZAA 3K6SB 5AOCA 3UWMA 2QUHA 2EJCA 4I4IA 4IJQA 5A3QA 4FGZA 1VGRA 1T4GA 4LRUA 4BMVA 3DS8A 1I4TD 2GCIA 3OQ6A 4C2AA 3UAYA 4Q9KA 2NN3C 3DWIA 5BW8A 4JZKA 4L1KA 3DEHA 1RW4A 1M2VB 4C4PA 4XARA 2VUHB 1P5HA 3QW2A 4PLFA 4BS9A 1K86A 1K63A 3ELDA 5EJ5A 1C5KA 3B3GA 2BD0A 3UV6A 1CCWA 4H7FA 5AHWA 2LTAA 2L69A 5D86A 1DQSA 4MO9A 4Q9LA 1J0EA 2OFOA 3DFUA 5EFZA 1CC1S 3U9SA 1MH9A 5B58T 3P9SA 4GE0A 2FWMX 4KQWA 2DQ4A 3THSA 5HM8A 1PK7A 1A1VA 3D6AA 1AXEA 4LC9A 5I7FA 1DP4A 5AK0A 4LDPA 4Z4EA 4RDCA 4X0EA 3O8RA 4ESVA 4UVHA 3E5HA 3ICWA 5K1ZA 3OZXA 2O1XA 1YHNA 1VJ1A 4TQAA 1M2KA 4CLRB 1A4IA 3V1UA 4PRZA 2RIPA 3IMCA 3JWPA 2QSZA 4H6WA 8ATCA 4MUMA 4MW4A 2R1VA 2X0RA 4EVIA 2V6FA 5CUQA 4BIIA 2IEAA 4TMTA 1YT5A 2FWAA 3MD9A 2IDKA 4JUAA 4RORA 3EZ6A 4WERA 3AKCA 3AF4A 4GNKA 4AECA 1QS0A 2ZBFA 3WXMA 2CV1A 1PU2A 4TS4A 4R1SA 1NF8A 4Y9SA 4Q4JA 1OXKB 1W5TA 2Q5OA 3JWHA 3E2IA 2I2CA 1YQQA