4YCJA

Structure of acetobacter aceti pure y154f
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
160
structure length
160
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALFNPALAARLETWRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 53
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4ycjA00
5CTJA 2FW6A 3RGGA 5CLJA 3KUUA 4ZMBA 3RG8A 2FWBA 5BORA 1U11A 4YCBA 4ZK2A 1XMPA 5CLGA 3OPQA 2NSLA 3ORSA 4GRDA 4AY4A 4B4KA 4ZJYA 5C5DA 2FW9A 2FW8A 1QCZA 5BOSB 2FWJA 3OOWA 4YCDA 4ZC8A 3TRHA 4YCCA 4Z7JA 2FWAA 4YCJA 5BOSA 2NSJA 4JA0A 2FWIA 4AY3A 2YWXA 2NSHA 5CLFA 2FW1A 2FW7A 2ATEA 5CLHA 1D7AA 1O4VA 5CVTA 2H31A 3LP6A 5CLIA 2FWPA
chains in the Genus database with same CATH superfamily
4DQUA 3OCUA 1U3UA 3H9BA 3ORRA 5BR4A 1LS6A 1GLVA 2JI9A 4FYPA 2F8SA 2KMLA 3TIIA 4C2UA 2ZEJA 2Q50A 1PNTA 2DFKB 2GPYA 3N59A 4DDMA 2C4NA 5GTDA 4DLRA 4EITA 4B3MB 1T2DA 3TCXB 5JJBA 3CS3A 3CX6A 3FMPB 4DJJA 1IXRC 4CF7A 1EVIA 4G41A 4MKXA 1Z15A 1ZD1A 3O94A 5DM4A 5K0JA 4CW7A 1IY8A 4LGMA 3AR2A 1ULUA 2XAUA 3DEFA 4L0QA 1YGPA 3PTZA 5DEIA 4EELA 4AQYB 1TW3A 2DR2A 4WFKA 4BBPA 2Q2NA 5TV2A 4AJLA 1AM4D 1FP6A 4FUTA 3OPYI 2QNRA 3LUHA 4Y3UA 4N48A 4IGEA 1YQXA 3E6AA 2NXWA 1I4OA 3GGJA 2ET6A 3HADA 2IYTA 2IHVA 3HU2A 4NBWA 2ZUWA 3DMDA 3IS3A 1XK6A 1ZL2A 3JYQA 5FP0A 4TWZA 1YVPA 1ISGA 4PX2A 2Q5FA 1T9GS 3BMOA 1ZBDA 3FDFA 1N57A 3K05A 4HQ6A 4PQYA 1RCTE 4IH9A 4IQ0A 2G9UA 3B2QA 5P8WA 3IE0A 2P2LA 3EW7A 4LZAA 1PDVA 3LXUX 4CKYA 4NS4A 3SU8A 1OOEA 2DBQA 4L0CA 4RJJA 1GNPA 3RFXA 3VBEA 4OG2A 4NFYA 1YL6A 2DHRA 3RUIA 1FXSA 1SCUA 3A6ZA 5TF0A 2P6NA 3GLKA 2J45A 3LVBA 3AEQB 2GESA 4R8KA 3I2KA 3RS3A 3DXFA 3VU0A 5K6AC 1R6DA 3CVOA 3PXCX 2PMKA 1KI4A 4B2IA 3JVEA 3KU1A 5JNLA 1T2FA 4L8GA 1M7GA 1E3JA 3ZNQA 2IDMA 2MMGA 2BGUA 3ERCA 1ELOA 1C30A 5G4KB 4Q5IA 3FPFA 3KOMA 3NFRA 4A5SA 5CDHA 1QF6A 4KNWA 4C43A 4YRCA 1Y7HA 3E9EA 4NZZA 4EA6A 1SXHA 3Q6NA 2HX1A 3LY9A 1M2VB 2QT1A 5DZSA 2PKWA 4B48A 4BMCA 2YIVX 1UK7A 3W2TA 3IVRA 1SH7A 3N2KA 2BGIA 2FWAA 5EIBC 3PQ8A 5GZ6A 4Z5XA 3LCRA 4IJQA 4TX1A 3MMSA 5B4TA 4LE0A 4MCIA 1O8BA 1XVLA 2RGNC 3RSSA 2LE0A 5T4BA 1LFDB 3VPHA 2R6GA 4P7GA 4EGAA 2QQFA 1NPDA 1A76A 4GOXA 4K9NA 4Y2JA 1ZRHA 3AW9A 4RE5A 1KYZA 5DRTA 2QAJA 3VR2D 4A27A 2JIPA 3QFTA 4B35A 5JYBA 2AEEA 1CNMA 5F2KA 1ODTC 1JJFA 2CHQA 3GUVA 4L4ZA 3HU1A 5I3ZA 2H1FA 1GY8A 1YZVA 1A1VA 4WOPA 4F2PA 2YHAA 4N65A 3MWJA 4FFWA 4ARSA 4YO8A 3B85A 4FFVA 3DA8A 4UU7A 5HVNA 4UHKA 1ODJA 1KYIA 1I2BA 2Q1XA 4NDNE 3Q3IA 5EMHA 1JVNA 3ZJ4A 4Q24A 1SB8A 2IDKA 4LI3X 4U0JA 5K3BA 4EW6A 3OT1B 4CT5A 2MR5A 1E18A 4P6VF 5FX2A 3CUSA 3RADC 3L4KA 4Y1GA 5CA1A 2IOYA 3A3OA 2GAIA 4OJYA 5BN5B 2OAP1 1WV1A 4HDAA 3QVJA 3RKRA 3DUFB 3LBIA 1R8XA 4F8JA 4JROA 5JI3E 1G3QA 2QTNA 2IA5A 2J7PD 4G0UA 2O3RA 3IURA 3QPCA 4BNGA 1SHJA 2ZSEA 3IQFA 3KAQA 2PXHA 3EOZA 1GU1A 2QUHA 2XNHA 3L0YA 3OUTA 3PUVA 2PSHA 4F97A 4Z2AA 2XQKA 4N0EA 2FSVC 1QYXA 1F8GA 2FPKA 2GCOA 4BV9A 3PG5A 4RVNA 3EXHC 2BGJA 4KR0A 5BNIA 4LX0A 4HV4A 4DRXB 3ZWKA 5HIAA 3NGLA 3I8SA 2HCTA 4MEBA 1WLYA 2LKCA 4N18A 4YH1A 2HHLA 1L3IA 1UKEA 4UTZA 3J80A 4R83A 3WWDA 3SR4A 4F93B 2G83A 2CJWA 2ACVA 1O95C 3EC1A 1FIUA 1XMVA 2QAIA 5E7IA 2AOTB 5LD2B 3TNDA 2CD7A 2I34A 4J2TA 1NX9A 1IVSA 3EY9A 1YIAA 3OURA 4JT2A 4OA8A 4TTQA 4AUKA 2LPMA 1IM5A 4EUFA 3CE6A 4G5YA 4UZEA 3AEKA 2ZYRA 2ST1A 1BX3A 4OFWA 4UNSA 4XKJA 3SBEA 1E6KA 3UFXB 4L5CA 1ABBA 3LNCA 4Y0VA 2K2QB 3IOBA 4QJIA 3T7SA 2QZPA 1JLHA 1XLTC 3LDHA 3DOEA 2EAUA 4CETA 2D59A 4LRWA 2NNWB 4DJFC 3IVCA 1U0OC 1BZYA 1NG9A 1N6IA 4CR8A 3HDHA 4CGZA 4ZIRB 4Q4JA 3ESYA 2XYVA 4WZBA 1XRLA 2Q9AA 1EUDB 1NNSA 2WMOB 2E49A 3BE6A 3CJTA 3B6IA 3MJ4A 3MSCA 1OGJA 5K4GA 1JAHA 1JBQA 2JDID 2GN8A 1WKBA 4BTLA 1MDFA 2C2OA 3V00A 2ANBA 2QLNA 1B7GO 3E7PA 3KUXA 5JROA 2HK9A 2Q7DA 1KYQA 4KQ2A 3AHJA 1U28C 1TMKA 2ZP1A 1OFGA 4QYIA 5EG5A 3T4EA 1GAEO 1EWTA 5I7AA 1LDMA 1HG0A 5J58A 1W4ZA 5TARA 2BEVA 2W22A 3OU6A 3QBTA 4P33A 1BH6A 3UPTA 3JQ8B 5ARBA 4EBFA 5KDDA 5KS2A 2WA1A 2XNCA 3KQKA 1QIJA 1ZC3A 1QGUB 3TE7A 3NDJA 3OM9A 1YI8A 1SG0A 4RHUA 2ZUCA 3KU4A 2F3TA 1LWOA 2Q9BA 3MOIA 1T8TA 1XOIA 3B5EA 4R7GA 5DXFA 2ICAA 5B2EA 3K35A 4D3YA 3FNQA 2P4EA 3TO5A 5IRCD 3C5HA 4LE1A 4D44A 3O8DA 4DIUA 1ZAYA 3PU6A 4ZHSA 4MUKA 2WVHA 5LQNA 4V0QA 3I30X 3OZRA 1XD2B 4EG7A 1J09A 3UJBA 1K98A 2C3YA 3IJ5A 3AL0C 2V1XA 1L7QA 3VTZA 1HDGO 2QRHA 1ENZA 4GR9A 4U8GA 2PRSA 1NP3A 2LIPA 2XXAB 2AGVA 4L9WA 2OO5A 3ENZA 4HFMA 3HCBA 3JQFC 3HZHA 2WVAA 2PX3A 1YMVA 4HNTA 3SIWA 1MEJA 1QOQB 3PC4A 4YIHA 4JXZA 1G42A 4IV5A 1R0YA 3QJGA 5TY0A 3W3ZB 3FTPA 2N46A 1FNNA 4CF3A 4X1OA 1YRWA 3DNFA 4UFPA 5M5BA 3RS4A 2C7PA 3SFVA 1U04A 3PPWA 4BLRA 3C45A 4CL8A 1Y81A 4RD2A 2V65A 5ARCA 3LQ2A 4YUZA 1RYDA 3C16C 5CAEB 2XMSA 4MYUA 1Y0BA 3UMYA 4HYTA 1WUHS 4W7IA 3ORHA 1BRTA 4MQMA 5AJWA 1GTSA 5CLLA 3CURA 4TT8A 1FDOA 2XY4A 3Q72A 4J91A 2K5UA 1BD4A 3GP3A 4MZDA 1YE3A 3T34A 4M87A 5AVSA 1FFXB 4JA0A 4EZBA 5T57A 5T64A 2AJTA 1Z8NA 2B9VA 4R84A 2WFLA 2WW8A 2RH9B 4ZANA 1BFUA 4NZNA 5A6VA 4Y2VA 3UY4A 1NW5A 2IX3A 3DE6X 5BSKA 2WSYB 3GFGA 4I55F 4YAGA 4GICA 5LMNB 1OI4A 2GEUA 1F2TA 2P9ZA 1T35A 2YYSA 2WF7A 3T5AA 2G4LA 2HDWA 2ZS7A 3PT9A 1VG1A 4B4DA 4AC9A 1CZOA 5CDYA 1T4CA 1LS1A 4S1TA 2B94A 4LRTB 4O2AB 5BWNA 1UP4A 3IDZA 1QVAA 3J81k 3U49A 3ADPA 1O94D 3EGVA 4YXWD 4F96A 4IGAA 5J5AA 1JFTA 3OJ0A 1SVLA 4MUBA 3LOUA 2C4TA 1IJEA 3G0BA 3FVTA 3KWJA 1TZKA 2I3GA 4NU6A 2Y99A 3C8DA 4HAZA 3Q8WA 3O31A 5CNMA 2KLBA 2PXAA 2XE7A 1SRQA 2BGNA 2WTEA 3TGLA 1QG2A 4M1KA 2YWFA 5L45A 1NZJA 1HUQA 2MSLA 1MW9X 1NBIA 4Q7MB 1K1EA 3LAWA 1PE0A 2ADOA 4IDFA 3WK4A 5KSYA 4I7EA 4HYQA 4Z3DA 4ER6A 2BMWA 3D1JA 3KWFA 5JSZA 1X1TA 3W9UA 2KS6A 3QV1A 1P3JA 2ZIXA 1RRFA 3JWGA 5COBA 3IVGA 3RFCA 4F6RA 1E5QA 3Q7RA 4GP6A 4AZ3A 5A4JA 1VFPA 2Z4SA 4ARZB 4YMGA 1MZVA 3AL2A 3EVGA 2J33A 3HCCA 4KK3A 3ROTA 1IATA 3V5NA 2JHPA 1XQ1A 2E37A 2O7VA 5LBUA 4F4JA 1F0NA 2X5OA 4LRYA 3WGLA 4IZ6A 2WABA 1E8NA 2YNMA 3RRFA 3WE7A 2J6IA 1C7JA 2V7TA 1Q7EA 4PXSA 4HH3C 1S0UA 3BXGA 1U7XA 1XRPA 3KFVA 4R16A 1S7CA 5JFGA 2FRXA 1XLUA 4IMIB 3DEHA 3UB3A 1YRAA 2D2EA 2BHSA 2DCUA 1CX9B 2W6ID 2QENA 3FCXA 5LQRA 2IEAA 3DDNA 4I1VA 2ZAIA 3RR2A 2C8KA 4JOQA 1FEZA 3O73A 3QEAZ 4OH7A 2OXFA 3KHSA 4MR9A 3I2IA 1O0BA 3CLVA 4X3OA 1YHYA 5ALTA 2O4UX 2QZZA 1I1NA 2MOKA 2QQ5A 4GVXA 3I37X 1WVMA 3ZD8A 4DY4A 2X5KO 3RAFC 4TKLA 2A94A 1N5KA 2XNSA 1E62A 3L8GA 4DBLC 3WWPA 3MWEB 1NAIA 1XRNA 3R23A 4QPCA 3IE1A 3AYZB 2JRCA 3ZU5A 5JSUA 2VBGA 4RF2A 4BB6A 2IGTA 2XE6A 5EL0A 2RKBA 4B6JA 3HXOA 3WAKA 4E5SA 3Q8MA 3NNDA 4IIGA 2ZYUX 4X8LA 3A32A 4BFSA 4IHJF 1Z5UA 4HVLA 1AUOA 1TT5A 3UJDA 4R7TA 1WY7A 1S96A 1IXZA 2E3JA 4F1JA 4MR7B 3HXTA 4HGQA 1ZJ4A 2JASA 3EGXA 2PRYA 1RWXA 1O5OA 2J0UA 3HCAA 4U39A 4V03A 1FJXA 1N2JA 4PSVA 3LDGA 1E5TA 3PFIA 1HSZA 3O74A 5DWQA 2GJAA 4M7OA 4QUAA 1OF1A 5ELXA 3VAYA 2VBFA 3HRKA 4ZOEA 1QVRA 1M0EA 4E12A 3K32A 5D5QA 2D6FA 3A4IA 3FPCA 3K8ZA 3CH5A 4U63A 1ZK4A 1YJ8A 1ZH8A 1IHUA 2AZDA 1NI4B 3EUFA 2QV7A 1YNOA 3JQAA 1PZMA 3GARA 4POAA 1QYVA 2F1IA 4CR7A 3T5DA 5AVTA 1U8EA 4A1OA 2PLFA 1NVWQ 3O8QA 2CB0A 2JIQA 1UR5A 1QHYA 1Z9BA 3OIDA 2FZWA 3WO0A 1QV6A 1U3VA 2I2XB 4WSOA 2ZJAA 4IDCA 1GCAA 2BE7A 2QTRA 1SJ9A 2GLXA 5JR3A 1FMLA 2NM0A 4QGSA 3CVUA 4W1PA 3LX4A 3D6MA 5K8CA 2F4VB 3ZC3A 2WDPA 3P1JA 1NKSA 3R3WA 5L3SB 1G8FA 4KO4S 5KYVA 3RUFA 1N8SA 1AZWA 3LT2A 1PTJA 1V35A 2HLDD 4JSRA 3K9FC 3MLAA 3LRTA 4UREA 1P4SA 1VJGA 4N82A 3IDFA 1RYFA 1F6BA 1VZ3A 4GUDA 3H6HA 1SXQA 5EXDA 2BJHA 3LPNA 4NH4A 2BI7A 5GM2A 4AS1A 4CQMD 1EP1B 4DYHA 4UCQA 4KPUA 2JCYA 4R8LA 4AKHA 1A8QA 3M83A 2NO7A 1FLAA 3CW8X 3Q5EA 3ZDDA 1E9DA 5TDHA 3RSHA 5EJ5A 5DCYA 4MWTA 3W05A 3EXG1 3UG6A 1XVVA 4MUXA 1E6WA 3KYCB 4BLVA 2EEPA 4N7BA 5HM6A 3RGWS 1BHO1 4NJMA 4UM7A 3CONA 5CGZA 5GJCA 2CD9A 4JR1A 4MJ7A 1DTWA 1Z36A 4O08A 5K09A 1XFDA 2GLUA 1K2VN 3CSDA 1NQVA 3A70A 3O4JA 2Y76A 4KUHA 4A6DA 1HDOA 1R6XA 2E4YA 4DIEA 3BA1A 3P32A 4MDEA 3BRQA 2D7JA 1NOJA 5D87A 3AEYA 1D9XA 2EFYA 1OMOA 3LUPA 3GI1A 1JJIA 1QAMA 4RY9A 4MI1A 2QZ4A 3RKUA 3HJTA 4D46A 2WWXA 1QYWA 5FUWA 5A3RA 3P20A 4PC7A 5FPQA 5ALOA 1PUJA 1FX0A 1GVNB 1YR1A 2E7ZA 2VFAA 4H3VA 5THKA 2NV0A 1C2YA 3H19A 3P96A 1X1RA 4Z0HO 3M4JA 3MILA 4IO0A 3BCHA 4DW8A 3FJOA 2IPXA 1X9GA 4S0XA 1V16B 2AOWA 1NN1A 3WO1A 3B1YA 5IEJA 1LBHA 3OJXA 1W73A 3O7WA 3KKNA 1A96A 5K1ZA 3VX3A 3W8NA 2VJNA 1AZLA 3CRNA 1GNQA 1UDRA 1ZRMA 2IUEA 5HOEA 1F17A 5GADl 2F7SA 1Y4ZA 4BP3A 2P90A 2H2GA 2C2YA 3QWAA 4PBRA 1WS6A 1GCGA 2B9EA 1ZM3A 2EZUA 4D4GA 5L3VA 2HK7A 4MKIA 1EVKA 5BUSA 1VHQA 3LDUA 3C74A 2QD1A 4DV6B 1NNLA 5DJ5A 1HKHA 2YZKA 4B3BA 4KQGA 3GJ0A 2AXPA 2AF3C 4OXXA 5LQKA 1QAOA 3D81A 4JNCA 4O4JF 4KE7A 3OQIB 5EPOA 3R6LA 4BNDA 2FUG6 1JHDA 3M9WA 3QY9A 4EPTA 3I01A 2PZEA 1CTQA 3C4JA 5EWJB 3ZLBA 4IF6A 4TTJA 5T3YA 1HK7A 4YPFA 4CG1A 2L42A 4DLZA 2ONKA 4IW3B 3VKVA 2K7ZA 3RHTA 1WZNA 4QA9A 5HX7A 2QMZA 4FFOA 1RTKA 2RH8A 2DP4E 2QL5A 4IJ6A 2P4SA 3QSGA 4LQCA 1Y9EA 2B1IA 2QPLA 3B9RA 1KA9H 1PAUA 3GD5A 5A05A 4W5QA 1NYLA 1JECA 3H9UA 1XXLA 1B16A 1JR3A 4KBGA 1ARZA 2FN3A 1PZHA 3K6SA 1C1XB 3W9BA 2CBZA 3CNLA 1NYTA 1K8YB 1W1IA 1TZ2A 3LQYA 3RAPR 4ZEVA 2ZREA 4XD7D 5DLEA 2W90A 1ECBA 4WXYB 4EF6A 1ZJYA 1MC4A 3H5WA 1ZIYA 3HN7A 4IHQA 4K6CA 4X3PA 3NTQA 4F46A 3I1JA 2EHJA 2VNHA 1TAGA 2BKVA 3BHJA 4XPZA 4D99A 4ZJPA 3IA2A 3LQ1A 1PGQA 2F67A 4F5ZA 4JFAA 2OCAA 2Z4RA 4J7AA 4PGAA 1E98A 3B1ZA 1ZHHA 3OKPA 4LZJA 3KZCA 1HC7A 5JCZA 1U7UA 1INLA 2AX4A 3U19A 1TUGA 2MSWA 5ESDA 5FIUA 2F3UA 5KYYA 3ELDA 3MJVA 3GJRA 3QBVA 1K8ZB 3OM1A 4PONA 4CIXA 3THXB 1YVRA 1POXA 4R9NA 1L7RA 5DHRA 4FINA 4UBMA 1P5FA 4G07A 5EJ7A 5EP1A 1SQ5A 4YAKA 1LW7A 3AZQA 1U5BA 2A84A 4U2DA 1RFGE 1X87A 3T7RA 3VC7A 5F3DA 2ZITA 4NV1A 2HZBA 3RB8A 3OPYB 4XJXA 5HKOA 5BV1A 5F1PA 2GEDA 1VLQA 2R25B 3NS7A 5ULLA 1BKYA 1QYDA 1KFEB 3OEEA 2QKYA 2W6JD 3G3EA 3KB8A 4P92A 3ZTTA 3DEKA 4HNHA 2AG8A 4NCBA 3PNPA 1N5LA 1V4BA 1XZFA 2R6FA 3HFRA 4OY3A 3MFQA 1NI5A 4WEOA 1QFMA 2Y92A 3CU5A 2A57A 4LE2A 4LJ6A 5E7MA 1DT5A 2BSXA 4A2WA 3U6BA 2H31A 1CZUA 2DXIA 1IONA 2GH1A 1RWVA 2VAWA 2WJWA 3RIHA 1COWD 1SBTA 3HUDA 3L0SA 4LHEA 4ECAA 2WKSA 4JIMA 1WZ2A 1XTQA 1FDTA 4ZWNA 4J0FA 1HYEA 1UEXC 3NI2A 1VRCA 3G0DA 2O0HA 5DIFA 4FR0A 4TV8B 3WLRA 1RXWA 3CMCO 5DASA 4ID9A 1TDJA 3N86A 4X7MA 2LW7A 2IQ5A 2NVOA 4O4IA 1H3EA 3FSGA 4LHSA 5DTRA 5ALUA 2BUCA 1FFAA 3MQ2A 4RS3A 1WUKS 2HZ7A 5F7OA 1ID8A 3VZPA 4TLLB 5F2NA 4BB9A 3ABZA 1NFRA 2QV0A 3EPRA 4QGAA 4L6IA 5GVRA 4D98A 1KI7A 1KY3A 1ODFA 3U3DA 1PG2A 3VU9B 1UT6A 2EFHB 1RSZA 3O6VA 5CYFA 5EIHA 1SHKA 1WCIB 2J67A 2RGAA 4ID3A 5FO1A 1QNFA 5JO9A 3UV6A 5EINA 1VLVA 4NTZA 1D8TA 1GRVA 4DMGA 1Q11A 2Y2UA 1CB0A 3A1DA 3QVXA 4YWJA 2BHLA 2V6JA 4EQ6A 4M8SA 3HVRA 4D8TA 3CEJA 1M2WA 4K9SA 5ALFA 4AQDA 1JDNA 3NT4A 4Q4DA 3V8QA 4YCJA 4B74A 3N2GA 5JH7A 4JP5A 2YQ5A 3CRVA 3REQB 5B1YA 1A7UA 1K3FA 1NLUA 4X7PA 2NXCA 5K45A 3KDPA 3HSSA 4OUDA 2P6MA 1YQWA 4NYIR 4WWHA 2VH1A 4QEKA 2ZJYA 3D7MA 3KWMA 4IIJF 4JJFA 3V34A 2MSDB 3PNSA 5MGBA 5KHOC 4QFMA 3T7CA 2OORA 4HTFA 1DO2A 3TEJA 2GCIA 2DY1A 1AMUA 1N34B 2DUNA 4JC0A 4RD1A 3SJUA 2WF5A 3ZV4A 2NZJA 3OCCA 2IXEA 4V0RA 1YSCA 2PQ2A 1LLCA 2HPVA 3JVDA 1KJ9A 2QTZA 4LY0A 3DE0X 3OWXA 4R2HA 3IT0A 2IS4A 3C70A 3IOEA 4N12A 3EHEA 4XPIA 3RT9A 2AH5A 1MVLA 2P9TA 3UG7A 1RHRA 2W58A 3A9VA 4BNKA 2GKGA 3KVRA 5CFLA 4MDYA 3UO8B 3RK4A 2BLLA 5D86A 1XVUA 2REQA 1U6KA 2FRVA 4MX8A 5JG7A 2P1ZA 5I7UA 3IUNA 3PTAA 1IPEA 4LK3A 1FP7A 4HWPA 1QAQA 4YJFA 4LXQA 4YFVA 2R1VA 4D4MA 2PV0A 1UADA 4ZN6A 3U6KA 3KUUA 1OIWA 3OFNA 3FDZB 3ZDBA 2FWBA 1XDZA 1XV5A 1H1TA 2HQOA 2OL4A 5I7FA 2I1VB 2VT3A 1GIAA 1J6UA 1BMFA 2PJUA 1Z0KA 4JC4A 4BXOB 1NW3A 2VYCA 5KKNB 5BVHB 1M2JA 3F6CA 3KQTA 1GSIA 2OHVA 4BX9A 4EBBA 1W0KA 4KLNA 1FLNA 5HSGA 5DBOA 1G9TA 4P58A 3WJ1A 1JDSA 1WSBA 3FHJA 3RK0A 1C3VA 4DQVA 1TMYA 1F7UA 4V0SA 1HKUA 1UBMS 3FF4A 4QULA 2Q1YA 2Q5LA 1G4HA 4FFNA 2JZOA 3OQBA 4IIUA 1UBTS 4G4JA 1CS0A 1TNDA 2OHFA 3BKWA 4WW0A 4C6TB 1TQ2A 4DCCA 4RY0A 3K96A 4NEHB 2JGEA 4HDMA 2PKQO 3QIVA 3LZDA 5LXTF 2VYNA 3GDOA 4UM9D 2IL1A 1XWIA 5LA6B 3MTJA 5FV4A 2CNDA 4MPTA 3LDAA 4ZTUB 5CBKA 4DV2B 2YL2A 2G76A 2ZR7A 1RZVA 4LBVA 1WETA 2IS1A 2Z6QA 2D74A 3L4JA 5EJ2A 1J5XA 1U8UA 4FYIA 4YDQA 1V8OA 2YQZA 2Y1LA 4HPWA 5EMJA 1TQHA 3MBOA 3B1JA 1TFUA 3ZUGA 4C4SA 2WOOA 4D4HA 4WQMA 2OXEA 4X61A 3AIKA 4AZWA 2GNPA 2OO5C 2A5JA 3AXTA 2OMEA 2GTPA 5FI5A 1IIRA 1DX9A 1U7HA 2B2CA 3EHDA 1QH8A 1RJ9A 2WD9A 2DT5A 4RJKA 3M2TA 4D26A 3U4IA 4RYLA 4WBNA 1BCRB 1KL7A 2ZUDA 2H1WA 4EH1A 5KYUB 4ZREA 3SF0A 2O8DA 2GZSA 5JFOA 5GM1A 2QVBA 4R1PA 5LFAA 3ELUA 4I1UA 2DBZA 5C18A 3ESZA 4IIXA 1E5DA 1RCFA 1GT6A 2GR9A 3MXOA 4L95C 4X93A 4YJ2B 2HWYA 1VPEA 2W2LD 2X40A 3RS9A 3UAYA 2I4OA 1CUFA 3F6PA 4NEGA 4Q15A 4BN5A 4ARUA 2XGJA 1NVVR 3PFKA 4EMTA 2XTNA 2RD2A 3R5JA 3OG9A 1T1RA 5IM4F 4L6AA 2OBNA 3AV3A 1U0EA 3ZQJA 4JXXA 4HAXA 4JIGA 1SXJA 2W4QA 4Z0PA 1NURA 3DYBA 3QPDA 5AHRA 5DVZA 3A9RA 3C5WP 4E3WA 4KXUA 2A5FA 4XI9A 2XCUA 6NULA 3H1FA 3W7VA 2QBYA 2QTTA 3ZD9A 4RHXA 1Z2AA 2GVDC 4GFDA 1MG0A 1CZLA 3EZ2A 1PGNA 4I4IA 3PR3A 3DLPX 5KC9A 1P7WA 3EIOA 5DBGA 2WPDD 2ZS9A 1KQNA 2GYVA 1IXKA 1UFKA 4BV8A 5CM2Z 4FYWA 3SI7A 4DKXA 3H04A 2B6NA 1M1XB 4D4KA 2PN1A 2BDTA 2PDAA 3UQZA 3M34A 2Z2ZA 4U3JA 1LPSA 2VKQA 1R12A 2XZTA 3COSA 5EKUA 5A4DA 1KK2A 3OX4A 4C76A 3A27A 3L41A 3ROKA 2HIHA 4JN6B 5G0TA 2NACA 2OP1A 2XHZA 1GZUA 3IMEA 4ZVSA 1E3WB 2R6DA 2JJ2A 5JD3A 3LP6A 2I4LA 3M81A 3AF0A 3BWDD 1EHCA 4B4UA 1Z0JA 2OMKA 1MRNA 3UHAA 2XEXA 3UMMA 4KV9A 3ULKA 1J24A 2PSSA 1ZBQA 5SZJA 4PG8A 2WWFA 3DFKA 3I72A 3NC0C 4Z7QB 2AG0A 1QHSA 5D01A 3VA7A 2B8JA 5AVOA 4KJXA 4YJGB 4L4YA 3HNPA 1T0PA 4J16A 3ITNA 3DKIA 2VLIA 5CGQB 2Q5HA 5JPCA 1SKYE 1YS2X 2BDUA 1EP9A 1U4NA 2FCAA 3HDJA 1JHPA 5DYGA 5ELLA 1JB1A 2CXSA 4CCAA 2QN6A 1Y9JA 1U3WA 1K7YA 4GG1A 3M4ZA 3UUWA 3C5EA 2IYVA 4P7FA 1YHZA 3RCBA 1J0BA 5DLPA 1S3IA 2WU1A 1Q92A 3M4NA 1PR2A 2F1RA 2O48X 4B6OA 1YL7A 3P4UA 2WWIA 2NU6B 3X1YA 2CNWA 4X6LA 1AGYA 3F3MA 4JLBA 4JOBA 3ILSA 4CIAA 1K08A 1Z3IX 5JPIA 3O2SB 2VHWA 3IMCA 5HF9A 1WVGA 2QR3A 4OKIA 1NY6A 3C3BA 3CJRA 4WHMA 4IRUB 3R74A 5IFKA 3TMKA 2YJNA 1YQ9A 2G88A 4AY2A 1ZSVA 4GI2A 1VQ1A 2OZEA 2D5AA 3GQVA 4MQ6A 4L8LA 4ZCLA 1C3JA 4RQTA 1P6QA 2EWMA 4QICA 4F3KA 4ZYTA 3DXZA 4XX0A 3U56A 5C52B 3ROEA 4D92A 1SCIA 5I7VA 3MCTA 3QU5A 2OC9A 3CGGA 1YBHA 4LRQA 4BIIA 1ZXBA 1CJVC 3CVVA 5JT1A 3D3QA 4IHKA 3K6RA 1RYMA 4YRFA 5AK4A 5KTYA 3OF3A 3VNAA 1KMIY 3GDGA 3QU4A 1YB5A 1PR4A 3P4YA 3HSKA 4B7CA 4U00A 2YBDA 3JV7A 4MITA 4N7JA 1UBCA 2YHIB 3MBKA 1E2GA 1G98A 4JI4B 3L8ZA 5IH7A 1E7YA 1DDOA 1QJ4A 3LECA 4JBWA 4JGBA 3PUIA 4DWVA 5KYXB 1QV9A 3W5AA 2JARA 3NHRA 1VA4A 4CMIB 2E1PA 3DMGA 3ER6A 1RYBA 2A3NA 3PNOA 1YQDA 1PV1A 1JDUA 2VSFA 2VP4A 3A0RB 3ZW7A 2BM1A 4BJ1A 3K0AB 4D6PA 4RTQA 1WNFA 3MJHA 2NSHA 4IILA 3WYAA 3AU8A 5GONF 1DCTA 4B47A 5ALPA 1U65A 1L5YA 5E9QA 3IPAA 1I94B 5KNLA 3E22A 1EDBA 2CNNA 2CXQA 1P5RA 1IB6A 3O7MA 4YMWA 2I7CA 5CW1A 1TD9A 2P8SA 3SHOA 1NV8A 1RPJA 2H1LA 1KI3A 3RYIA 4A0SA 5DT9A 3I5AA 1XDGA 5FJIA 5P21A 3HZOA 4GZMA 4FQ7A 2V59A 2PL9A 4CIDA 2QM8A 1WQ4A 3FVVA 5GMOA 5CYOA 1GQOA 3FSEA 2IY8A 2V6MA 1V8FA 5IDYA 4KZPA 3H9GA 2VQFB 1ETUA 1OXTA 4ENQA 3UWOA 4EG3A 1YASA 4LS3A 3R5HA 1ZVJA 1LTQA 1WXXA 2GHRA 4HVTA 4RANA 4F5DA 3L6RA 1J0DA 1Z6YA 1VXRA 3IULA 2R11A 4GXTA 4TKUB 1P9LA 2X15A 3LU1A 1M1YA 1TAUA 2GHIA 2DSTA 2Q5IA 4HDRA 4ZODA 1OKKD 5IDWA 1SCQA 3ZWWA 5JLJA 3JATA 4RTLA 2ZUSA 4N9WA 3H5NA 5I51A 4OQZA 2JGRA 3KJXA 5HJ2A 1OXKB 5JBQA 1PTJC 3FMGA 3HGMA 4I3HA 4C4AA 3CY6A 4CKWA 4HQ0A 2JLZA 3ETLA 5L3QB 1J2YA 3Q9NA 2GJ4A 4KEAA 3R9IA 2YZGA 4DQ0A 3ED1A 3EODA 4EB6A 5FI1B 1PJCA 4RDCA 3X1JA 2G7ZA 2FMHA 1RD4A 3SHVA 2Z5GA 4FGLA 1PFQA 1W581 1FSFA 4U2KA 3WRVA 3F9CA 1GTG1 3ZVRA 1REQB 3PI7A 4P1ZA 4R8RA 4Y2HA 4GL2A 1CYEA 3FOZA 1GZVA 5TEVA 2R5NA 1CVIA 1U8CB 2YX1A 3R3VA 4OB6A 4L5JA 4PHHA 2LCQA 3TFWA 3WGOA 2HIAA 2GKOA 3ZI7A 1NFQA 4LG1A 4DCUA 1K4KA 4YT8A 2VC2B 3HNOA 4MUHA 3AUAA 1Q19A 1I7PA 4GQBA 2H2IA 3BBLA 3G85A 3HPQA 4ZT2A 5U1PA 1VJ1A 3GV0A 3VR0A 3RWOA 4GHWA 2ZJZA 4P7JA 3DGFC 4FDMA 4N49A 4QSHA 5TPZD 1ABEA 5IAAA 1JJAA 1CP3A 4CKCB 5GQSA 3OPMA 1Y8RA 4HAYA 2YXBA 1R6BX 4F4UA 3DO6A 1RYZA 1YMUA 3K7EA 4PTYA 3KAJA 1KIFA 3DO5A 3ZLVA 4FFPA 3NC4A 3GCXA 2W2KB 3DQQA 4OLJA 2B2NA 3LTEA 2O4CA 4HS4A 4UCXA 3CH6A 4RHYA 4R98A 4TMKA 3JAKA 3A2NA 3OX1A 1X39A 4OBXA 1B93A 4P2BA 4DMHA 1GD1O 1PQUA 4C0QC 2NP6A 4M0FA 3ZW8A 4AMBA 2IEBA 3PEEA 3IDOA 3NHSA 4C1NA 1TYAE 3EK2A 2Y71A 4N0QA 1EFRA 4KWEA 2AI2A 4XAQA 1SBYA 3KSUA 3GMSA 1P31A 1SUBA 2QD4A 3KJGA 4Z54A 2FV8A 4MVJG 4ER7A 4O6VA 1TM3E 2C2KA 1I7LA 2COKA 2ZI3A 3FNBA 3FYTA 3UUFA 3GFRA 4OYRA 3BDAA 3S81A 5C53B 2CN1A 2XBMA 3AQIA 1T2AA 3WRWA 2ILTA 4I4LA 1OJLA 4G23A 4OREX 3TKYA 2YHBA 1AIPA 1TKAA 4UTOA 5CX1A 4II2A 5FHQA 2Z58A 4C4XA 1EUZA 1B00A 1RPTA 1NJ5A 1V71A 4MGIR 3K0BA 4EMSA 4HXYA 4KXNA 1VGVA 2AX3A 2G36A 5LQMA 4WGFA 1DWOA 3WGZA 2I3AA 3QF4B 5GZ3A 2FSGA 5CH8A 1DIGA 1FS6A 2VHZA 5LQDA 4XWGA 5KVVA 4GW3A 1U90A 3K1TA 2V7EA 3X1WA 1VP3A 4IUDS 5AVQA 4UJ5A 3OOHA 1XCMA 3C7CB 3AC0A 1CE8A 4LA4A 2Q0XA 5DK4A 4EJFA 3B1KA 1O96B 4ZEMA 1ZKDA 1QTIA 3HBLA 5LNK6 2HWXA 1EKXA 3AF3A 3GWZA 3R3ZA 2JHFA 1EHYA 4U7FA 1QO7A 1SKYB 1CUUA 1ZU4A 1UXIA 2OAEA 5CMLA 4YRNA 3FVRA 3WNZA 4FYMA 4RKYA 3RYHB 5JXWA 3C7AA 1JEQA 1IQUA 2V7GA 3RS2A 3IVAA 1EM8B 2XCTB 1IPHA 1Y3CE 4XTRA 4NXMB 3ZLJA 2Z2JA 3WJAA 1KY2A 2XLBA 1MFPA 1SCAA 3FNEA 4OXKA 2ZJ4A 3RIYA 3UA4A 3KBBA 4QG3A 2D06A 5EUCA 4FXOA 1DEOA 1KEVA 4KV7A 1BQEA 1FQKA 4RBNA 2PZ8A 4FN5A 4YIKA 1GYQA 2F43B 5UKDA 2XH8A 1IUPA 2B30A 5DW0A 5FWYB 2OXTA 1YKFA 1G3MA 3M6VA 5ECDA 4YP6A 1O3YA 5D51S 3HY4A 3U9TA 3GVIA 4MI9A 5KQMA 5HRCA 3K53A 4GMGA 3COVA 1JKMA 5KYWA 4N0DA 5CLGA 5FNVA 5SY6A 3O83A 3PIDA 5DTIA 5A4AA 1BQ4A 2V5VA 1QTRA 3NDRA 1A5ZA 1FJ2A 1XEAA 1J56A 1FU8A 2C8VA 3SZGA 3KQQA 1P74A 3TZ6A 3E3LA 4WACA 1PW7A 4BECA 1BE0A 4EJ2A 2BMDA 3A26A 3BD7A 1WA5A 5IVPA 4YHHB 2EJWA 3L7IA 1X7WA 2BDEA 3GGPA 3N8GA 1Z33A 5F7ZA 4S04A 1SKQA 2FI1A 3RHSA 1I4TD 4BFVA 2HH9A 1DC6A 3U40A 4ZAFA 5H1YA 3SOZA 4I55B 3S44A 5MN5A 1XAIA 4CU5A 2XKAA 3F9RA 4R8SA 3G2IA 4MB2A 5F5LA 1HDZA 3VZCA 1PJTA 4U7GA 4CM9A 5KOJA 2PMEA 2MYUA 1ZD9A 5MGNA 3LT0A 4EHDA 4ZZ0A 2VP0A 4QQFA 2WT4A 1DOHA 2I2CA 4FZ3A 4X8HA 2O8EB 2GPSA 3G9TA 4NZOA 1FRQA 1YC2A 2DUMA 2J5BA 2VRCD 4Q4AB 1TOAA 4IDQA 2ZRDA 2BZ0A 2CVHA 4MVXA 4FFSA 4E22A 3GT0A 1Z34A 4LHYA 3GEGA 3MTEA 4RAQA 5HTKA 3UQYS 3SEQA 2EFJA 4LVUA 2HF8A 2HAEA 3L7OA 1OFUA 1QUEA 4YJHB 1I24A 1JB9A 2PBFA 2P4UA 4WCVA 1VCIA 1U2EA 4U7WA 1H2XA 5ALHA 5LMCA 5DX8A 5H82A 4IOMA 4M2LA 2YW2A 3HLTA 4H18A 2QTVA 4HN9A 1ND6A 1V6SA 4QWWA 4GDFA 4ERXA 5FTMA 1EQUA 4ARAA 2VL7A 5KHLB 1IDN1 3UM9A 3PDHA 2IUSA 2AFHA 4BPRA 3A6EA 3V7WA 4Q3NA 2EKPA 2FW7A 1M8PA 4DA7A 5FD8A 2XUJA 1VOTA 3FB1A 2EX4A 1JH9A 2NZYA 1FNDA 1GZHB 4TLMB 3WBKA 3VM6A 2WRZA 3M1AA 2IXGA 2CXRA 5EE1A 5BV7A 5MFZA 1UJ5A 2NZUG 4E2WA 1NVGA 3PD7A 3DOFA 4H6PA 3KVVA 2M98A 1UMDA 2Z6UA 2Z83A 2JFOA 4E94A 4ZYZA 1CJUC 1A1SA 3QMWA 1AXRA 3GZJA 1EM6A 1ZD5A 5HBGA 1GXSA 4NL4H 1EGQA 4YECA 1PRYA 5AM1A 4C5CA 5FPKA 1TU4A 3HXMA 3AR6A 4LTDA 4XOIA 2XJ4A 2IITA 1B14A 3ONDA 4N5LA 3WLLA 5JATA 5A4KA 3HEMA 1I10A 1N8NA 3ORYA 4I14A 4IP0A 3QKTA 2OORC 2OLKA 2JL1A 4OM8A 4GBMA 4QOGA 5C7IO 4M21A 1K6XA 2QI9F 2IHZA 3I1IA 4JJAA 3RGGA 3UMVA 5C1OA 5DYIA 2OV2A 2QUKA 5HS4A 4WA7A 4OTZA 1N5DA 4QPZA 1VRWA 5DNWA 4E0BA 3PDCA 5H4HA 4YMVA 3LC7O 1JKXA 4B71A 2PGJA 4FFMA 4IHJB 4JLUA 5I4BA 1YIOA 1FDWA 2B5OA 3O47A 1Y3FE 2P5YA 1UIRA 1GPYA 4FUQA 4K9QA 3J7AC 2X0DA 2ZE7A 4HWOA 4R1OA 4PPQA 2HQBA 5ALIA 2CFSA 5CTAA 1Q0QA 4JX8A 3ND7A 4RTKA 3EA4A 5BN1A 5AW3A 1W85B 3LG2A 4YVFA 1NP7A 4XVUA 4GGOA 2XVXA 4ERNA 4DV7B 5IDVA 4L27A 4FLFA 5H8WA 2JJ8A 1R8SA 2HUPA 3HVIA 5IDXA 1YDGA 3PGXA 5HQ3A 1H4VB 2ZJ8A 1NMEA 4W9RA 5ECGC 1Y1RA 2B21A 5THXA 4KC0A 3ZBQA 5FCDA 2I3DA 1GPMA 1KVQA 2ACEA 2WHYA 4RY8A 1F7VA 1T8WA 5DBHX 4TLAA 3DC2A 2TMKA 5FPTA 5CH5A 4X66B 1GJRA 2HBRA 3ZU3A 1HETA 1QS0A 4BP8A 3IPLA 3K1AA 1U0JA 2J85A 2JAWA 2X4IA 4M8IA 4MWSA 1SG6A 3ZZMA 4Y6RA 4P0PB 1XZHA 2C95A 2NAFA 2X58A 4BMDA 1UF9A 2XF8A 4DLUA 3FW1A 3I2YX 4W6QA 1DB3A 4WCFB 3CEPB 4H0CA 3W90A 5C32A 4GSYA 3H1TA 2JFVA 1OBFO 2XUFA 3LYAA 2G0NA 5JBNA 3X2EA 4H6WA 4L0MA 3RVRA 1YZQA 3V33A 1J70A 3U4AA 1G17A 4P4GA 3QE3A 4B84A 3G23A 4HB0A 4P3NA 3IAS6 1V39A 3V1UA 4CTKA 1EUCB 1Z07A 4PF1A 4MR8A 4CEIA 1WUIS 1WJGA 3A4LA 3E5MA 3KUKA 4YUVA 3FZNA 3UHJA 2R0QC 4BMPB 1H2FA 5CUQA 1RS0A 3U4HA 1XYYA 3AY6A 4HD8A 4Q4LA 1GKUB 1S02A 4II3A 3Q87B 3WFZA 3R9XB 2FYTA 2OBYA 4ND7A 3W5IA 3L0CA 4IIVA 2CGEA 2X4LA 1VZ2A 4ZGWA 3T1HB 3P19A 3VNRA 4B6RA 3OZFA 1J8VA 4AULA 3SZLA 3FKJA 3HB0A 3RBVA 1WF6A 3ZQ6A 1EAMA 2PFGA 1KI8A 1WX1A 2E4UA 3GYGA 4M36A 1P19A 3RYCB 4KAXA 1BTOA 1RKVA 1X7XB 4IL5A 3KPWA 3TTUA 1T6NA 4QYWA 1SZCA 3QEKA 3ADOA 2E85A 4FKBA 1UP6A 1XMPA 1LJLA 4FGJA 3A05A 3H7AA 2XVYA 3OE1A 4D81A 3NKVA 5JS1A 4JY7A 3BYZA 1C9YA 4C07A 3D4PA 1D6NA 1R0ZA 3CVXA 3TQIA 4HY3A 4D3FA 2WJ3A 2ATCA 4XH9B 1G2QA 2BHRA 3GLRA 4YDHB 1SXJC 1IH8A 4TMTA 1GNSA 1F6DA 3LKZA 3ODPA 5L51A 4A6XA 2SKDA 1IZ7A 1Q95A 3G0OA 3GLVA 3F3SA 1U7ZA 2IOHA 1T6BY 2Y6UA 2D1QA 3TOSA 4PIVA 2H51A 3KDAA 4K9MA 1G59A 2CLDX 3PJEA 4LVOA 2ZIZA 4MVYA 2OQVA 5CLIA 3NHMA 5KJFA 3GLGA 2V0GA 4Q9DA 4U7TB 5EC8A 4BU1A 1GTJ1 2NQTA 3N05A 4KVAA 4S1VA 4NABA 2GZ3A 3I0ZA 1L7DA 1P75A 5ABPA 4RD6A 3K4QA 1OLUB 3SM9A 2A7XA 4UQLA 1F0KA 2PWZA 3JVVA 1VXOA 4GYJA 2WU8A 4AJNA 4BBAA 4Q18A 2VZ9A 1FFHA 3IUSA 2GFIA 3V55A 4EB8A 2IYNA 3EGDB 3NIGB 5DHUA 3KKMA 2O2HA 2CEKA 2C2WA 1U7OA 4NEQA 5LWQA 3DZCA 4AYTA 1ZVQA 3INYA 3TRKA 4FHFA 6PFKA 2OAGA 3VR2A 2JA2A 5BNFA 1RLUA 3OM0A 4GS5A 1EFTA 1HORA 1VMEA 2Q07A 2AJ8A 4ZPXA 1H2WA 1D5CA 3NHWA 1FW8A 4OHKA 2NPIA 3K5HA 5L95A 2B7BA 4O4JB 3R8FA 3BK1A 2OCGA 1BXRA 3CRQA 4AX8A 4B5KA 4UW9A 5HXAA 1D07A 4JXKA 1DAMA 2CW5A 4JI1B 3TH5A 1GZSA 1R6AA 2D0IA 2FU5C 2YRXA 5DEOA 1JHQA 1KAQA 1T8SA 1JXQA 3ZTYA 5K0FA 4J16C 1R50A 1TECE 1CRWG 2Y93A 1ILWA 3W4IA 4MI6A 1IYZA 3IDAA 1T1GA 4QTYA 2JIRA 1RAFA 3TLJA 2M32A 3MTBA 3D31A 3U9SA 5ILOA 1FMFA 4HGOA 5DSXA 1OXUA 3T5BA 3UPDA 2CJFA 4TRMA 1L8AA 1RP7A 1ZDMA 1R0WA 2WUVA 4XVQA 4A8HA 4RV5A 4HMQA 3E9QA 5TEWA 3RD5A 5CA1F 2J7PA 3P2KA 2RHBA 1W4AA 3VJKA 3DEZA 1V96A 2VYQA 3L6BA 3EMKA 2B1GA 3L8YA 4MEJA 3BSFA 5H81A 2D1RA 4NI5A 2B5WA 4X91A 5C34B 3TUZC 3WRXC 2JW5A 5LZ9A 2PFSA 1DDGA 1Y7IA 3CYFA 5K8LA 3HP1A 5DNDA 4NHEA 1L9XA 2X9NA 2X42A 2VJKA 3IAHA 4EGQA 2HM7A 3WNQA 1NP6A 2B3DA 2BFEA 2PKYX 2WJZB 4LDZA 3WKAA 2P40A 3QVMA 2I2WA 4MWCA 1J8MF 5C8DA 1AC5A 4K81B 1ZOPA 3ZGXA 2ZUTA 1K6JA 3IEUA 3P9RA 2NV6A 1B15A 3FMOB 3PQ5A 2G08A 3QHAA 5BYAA 1A98A 1YK0A 2QVXX 5ALDA 5REQB 1KKUA 5B7QA 1BCSB 3E5RA 3D4BA 4L72A 3ZDRA 1LSOA 1ZSNA 3SJCA 2XCSB 1N2BA 3CUTA 3DBHB 1M34A 4MVCA 1ZN2A 4TN1A 1V5WA 4BC0A 1IQ0A 4BBJA 2P9QA 2RJOA 4LBWA 4ZVQA 4D1YA 1FSZA 1ZJ6A 1JI3A 1JIVA 1UPBA 2G17A 2VA9A 3BORA 4S12A 1UKBA 3LLVA 3SDBA 4E88A 3VR5A 1EQAA 2BRUA 1ST3A 4DGQA 1C8KA 2YVKA 3I09A 2GN2A 3EE6A 4FI3C 4JP8A 5KIAA 1NW9B 1I6MA 1KVRA 3INGA 4JQYA 4O59O 1J0EA 4LYYA 1VBMA 2CBXA 3Q98A 1QTQA 3T9DA 1WCYA 2V6BA 2BEUA 2NZ2A 2D2XA 2PUWA 1SK8A 2X0NA 4G8BA 1CS4C 5FBKA 3R1IA 4IQGA 3WMWA 4DUGD 2BL4A 4E6EA 1LI7A 4U7PB 3LI2A 5LMZA 4LMRA 1R27A 2KW5A 5AJTA 3TVDA 2R47A 4ASUD 2JJQA 3EF1A 5KTNA 1USKA 4LZPA 4ZT6A 2OCPA 4DY6A 4F12A 2HA5A 3RHZA 4L08A 4IJWA 5DT2A 3IEVA 3M6LA 2JB9A 3UICA 1HYGA 1XFAA 1F8YA 1LVUA 1L1QA 2SKCA 3AGQA 4LJ4A 2YQ4A 4UQOA 1ZMTA 4JB2A 4I1OA 3ORSA 2M6KA 1BWPA 1QGED 1YNSA 2OGTA 3IBCA 4NVRA 3ZWBA 2GTIA 2QY9A 3FD8A 3USES 4FJ0A 1I1QB 1JRLA 3HCPA 2HNKA 4TYQA 5DYTA 3N2LA 4X54A 2DBRA 3OE5A 2Q99A 1M66A 4FWBA 4B9AA 1NXTA 1DRKA 3SQDA 5EE9A 3DE2X 1JR6A 4E33A 3THYA 3BSSA 2PH5A 5IJXA 5K8UA 2OOSA 3JQGB 5BWMA 2R84A 3KOZA 1H0HA 1MJHA 1QHHA 2I1QA 3Q40A 2AG5A 3EW9A 5I6DA 2FAXA 2Q1TA 3TJRA 4AJJA 1M2KA 1FSPA 2C97A 4HQLA 4KU4A 5EYPB 4P4UA 1JEEA 1JQJC 2VPWA 3EULA 4NPHA 4FYKA 4WLFA 1JE0A 2OFWA 1I1OA 1N1GA 4HB3A 4R8MA 3MHPA 1XDDA 4QC2A 1I3LA 3DKRA 3VPBA 2O2ZA 3EEIA 3H5OA 2HEIA 3NAGA 2ZDQA 4LIPD 4DAOA 4MIYA 5JXHA 2GWHA 1YTLA 2CMDA 2I7VA 3ZI4A 1R64A 1TYDE 1Q3TA 2VAXA 1BC5A 4P86A 3SDZA 1PJ8A 2Q2WA 2C83A 3KLMX 4FBGA 3EVAA 5EQDA 4KNVA 3P0JA 1J42A 3K9NA 4IIJB 4BVFA 4TMZA 2JCSA 2XR1A 3NJRA 4G9EA 4YBZA 2FUCA 1DBSA 5CFRA 2GXAA 2GCNA 3GGDA 4PC3A 1A9YA 4DIKA 1RQRA 3UJNA 3PVZA 2D5CA 2PRZA 3PFHA 3K70D 4GMKA 4R1UA 1H4SA 4H6XA 1HOTA 5BUCA 4ECEA 5LIPA 4ZFNA 3EOBI 2LXNA 3DMRA 3NBYC 5CVUA 5EVCA 2P9EA 2XT0A 2P6UA 2P7HA 2PPLA 3V3TA 3DS8A 3R8XA 1E2BA 3V42A 4C3ZA 4KQMA 1OGYA 5IN5A 4EY5A 4DIOA 2F1HA 1C3EA 1T5DX 1SCNE 2ZSUA 4WPGA 1QE3A 3SJZA 3U7QB 5CX4A 3KTOA 2P2SA 3KB2A 2ZU0C 4OXYA 3P0FA 3CNBA 3CLRC 4TTTS 3MMNA 4E5NA 5IXJA 1YB6A 4RESA 3TQQA 5HMLA 3PNMA 1OX5A 3ISTA 2DJ5A 5ESXA 1AKTA 2P3OA 3DR3A 2XKBA 3IKMB 3O1LA 4YO7A 3D6HA 4XW2A 4G67A 3ZI0A 2RGDA 5G0VA 1JXMA 4CKBA 1AMNA 2ZUVA 3VO8A 4MV5A 4INPA 2QLMA 3VSBA 2H0RA 2J0VA 5F52A 2PKXA 1G6HA 5K0EA 2B69A 2IVFA 4IDHA 1XC7A 3PHCA 3G5LA 1QV7A 2HV9A 1O94A 4ZVOA 1Q83A 3MUFA 1LD3A 2PGXA 3SZUA 3VISA 2VT7A 1EIZA 1OXVA 1SG9A 2CHEA 5KNCA 4U2EA 4DWWA 3EZFA 1M1NA 3OCXA 4Q3AA 3D2CA 4KN5A 3E9RA 4OL0A 4K26A 1OE0A 1TZBA 3K70B 1JIQA 2GJKA 3A9TA 3U13A 3MINB 3FUUA 1CY4A 4L02A 4G85A 4D9FA 5LXTB 1OWOA 1UJNA 2Z8XA 3H2SA 3L5OA 2HSJA 4NE7A 3ZE2B 1L6RA 1KS9A 4G0QA 4I4TA 1TADA 4P98A 2OB1A 2B0CA 4LVCA 3CEHA 4ALKA 1ICIA 4FMDF 2ZZNA 1MAVA 5IAGA 2IXDA 4JKIA 2ZRMA 2GZRA 5BSRA 1U9CA 2OFOA 4PG7A 3IEPA 3GH3A 4LJSA 3O2JA 1W94A 3H4MA 4QYTA 5MF6A 4DE5A 2FFQA 4Q1DA 4LHZA 1DHRA 2NT3A 2ORYA 4Q9JA 4AZTA 1Q1QA 1NNUA 2LZ0A 4PTLA 5C7YA 4EGSA 2FZGA 3I1YA 5TB5A 1DE0A 4H15A 1CUDA 4G4SP 2MINB 3AHEA 4HQNA 1DXYA 3IP1A 3JQRA 5CD9A 4L4XA 2W6IA 5EEHA 4UPEA 1WZEA 3TJZA 1JKIA 4QD3A 1D6JA 5FRDA 3BWBA 1CUBA 2B1JA 2I1LA 1JJVA 3DR5A 4OJKA 4TM8A 4BNTA 5HKKD 5K0SA 1UZUA 3OZBA 1FDVA 3OTOB 3DDWA 3P9YA 2I7XA 4RXUA 1DRJA 3ZHQA 4AKTA 4C0JA 2FW9A 4GLFA 5ICMA 4FE3A 3Q8KA 1S2GA 4BO8A 1DQSA 2AC4A 4M0CA 3NANA 4L2IA 5EIXA 4C7OA 4DV0B 4JS0A 5K8JB 1XK7A 1AX9A 1ABFA 1K27A 4FNMA 2NV2B 1Z6ZA 2X7HA 2HK6A 1T15A 5FV7A 3HHPA 4KVGA 2V6IA 3WL3A 1PIWA 1Q0SA 1YDMA 4ZQIA 5H59A 3UK2A 4LMBA 4BX3A 4EKEA 5DCLA 1S5PA 3OBIA 1GTVA 4Q4HA 5CHYA 5L40A 2AG1A 2F1JA 4P81A 2V8OA 2E55A 1YR2A 4HEQA 1C9KA 2F3PA 5G02A 3RTBA 1QC5A 1RU3A 1QH9A 2D2IA 4NHOA 3G6KA 3OU7A 1JTEA 4AWBA 4YRGA 2D0PB 2VEDA 4R9RA 1QH1A 3Q3JB 4LJ7A 2R8XA 2B98A 3RDPA 4JJ7A 2CCKA 3GJSA 2CHUA 4WV3A 2OTCA 5AKEA 2GAOA 1QR2A 1W76A 4OGLA 1FYFA 3MELA 4HWSA 1B23P 1PT6A 3KEOA 5L3ZA 4DQKA 2I4MA 3R6WA 1PU2A 1TF7A 3L5KA 2CSXA 4D6YA 4HUTA 3WOVA 3KJHA 1T1JA 4EY7A 4RA6A 3TEFA 3QG1A 2HCBA 5D1HA 2EGUA 5IG2A 2I62A 1Q7GA 3BGVA 1KO5A 1OBHA 1Y1SA 1O95D 5DTMA 5EWMA 4L16A 4FW9A 1ONNA 3UT5B 2XGGA 3M6WA 1SU8A 2QVGA 3H5LA 5D3MA 1CQIA 1VJTA 1CY6A 1V4VA 2WIBA 4FMPA 1N4AA 3V46A 4MTLA 1K6EA 1K89A 3QLVA 1ENOA 1E8MA 5JCJD 4JGGA 3L1JA 5AW8A 3I2FA 5EMKA 1CDDA 5IVKA 1GQRA 4PFJA 3AOEA 4K1LA 3KQWA 4CLOA 3Q3HA 3ER8A 4G56A 4B3TB 1T9BA 5E9AA 2WIJA 2WSIA 3GRCA 1QJCA 3UK1A 2GD1O 4LF6B 4UNRA 2XB4A 1JDPA 3LQQA 2QZJA 3GJ5A 1LV8A 4UUNA 4ZRNA 2J9ZB 3BXFA 2OZLB 3AM4A 1JA0A 3GQBB 3KYBA 4P53A 2P2NA 5EMMA 2H4FA 3UFBA 4JLDA 5M7EA 3CMMA 1C9EA 2WV9A 4ODIA 1PL6A 3E03A 3SF8B 1FUKA 3C3DA 5IXSA 3EXHB 3W8FA 3KT6A 2AFIE 3VO9A 4E2YA 1TLLA 5CIYA 1AUVA 4URFA 1JEYB 2DKNA 4OQNA 2WMNB 4WNAB 1ZM9A 4WN9B 2DUUA 4GM0A 1GN9A 4AZ0B 1MW8X 4KMMA 1Y1PA 4CPDA 5BVGB 1T0UA 2WP0A 4PV7A 4UTXA 3AM5A 4DBLE 3OMLA 3PYXA 4JELA 4UM5A 5IKPA 5EP4A 1XTJA 1YR7A 2AYYA 4JUBA 1GNVA 4RTOA 1KI9A 1VL1A 2QRKA 4OI2A 4RKFA 4Q9LA 1K06A 4YR9A 4GZ3A 1UUFA 5AW6A 4RTPA 2CXOA 1P7PA 4HAUA 3HKDA 3A4NA 1CUIA 2H8KA 3N6XA 3QA9A 5C2JB 1PV4A 4TKMA 1C7RA 3EF0A 3U3KA 1E0AA 1EB9A 1QWOA 3D7LA 5GONB 1GEGA 4I6EA 3KPYA 1RRCA 4KSCA 2ZSDA 2NMVA 3HU5A 1A77A 3WYGA 2J5RA 1FTNA 3KE9A 3UWMA 5CDSA 4HQOA 4ANFA 2CJYA 2H6EA 3BMCB 2IJGX 3IKJA 3TQRA 3TQSA 1UXKA 3LKDA 3QIAA 3MQ4A 2UDPA 2M1ZA 3AETA 2QJWA 5ILGA 3JY6A 2DWQA 2PANA 3OIGA 3IXLA 2WB4A 5AWFC 1SIOA 4CEJA 5FUXA 1W1WA 3LO5A 2FW8A 5BR7A 3ITKA 1CDOA 1V9CA 2ZI5A 3DFIA 3SYMA 4Q7LA 2FF7A 2DG2A 2W8ZA 2GPWA 1JQKA 1P9RA 2O0JA 3TD9A 2IH4A 3O4HA 4KJZA 4OQDA 1N7GA 4HOYA 5DNYB 2HU8A 2VA8A 1OXSC 4ZHQA 2ZUFA 3GPLA 4L22A 1UKZA 1VGRA 2O5RA 3BT7A 1WWKA 2Y77A 3AR5A 3IUQA 4I9FA 4QU0A 4G63A 2PZAA 3BGOS 5ED0A 4BB5A 2VZLA 1PQPA 1YOVB 2VJYA 4ZAXA 2A6PA 1XQVA 3CH7A 3QOFA 1SVOA 4OH1A 4LZZA 3IV9A 4F3CA 3QEOA 3QEMB 1JEOA 3T0GA 2CVQA 4QVIA 1N8KA 2YUIA 1YF3A 2JHAA 1ULBA 4AO7A 3PKZA 3QWBA 4LY9A 4A3SA 1XZMA 2JLYA 2O2XA 2DY0A 2FSPA 2SBTA 2WC1A 4C3UA 3JD2A 3QKSB 5GOZA 1WOMA 3UMRA 3RHFA 4NKRA 4QLOA 2Y1KA 5ALXA 4EDHA 3IIIA 4BZPA 3ZLUA 1V3UA 1MR3F 1BA3A 2BV3A 1J4AA 2BMVA 3GRVA 3O26A 5GGYA 4EAQA 3E4DA 4ZDKA 3AHHA 4B46A 2WFMA 3S2IA 1I7DA 1KRWA 3Q0IA 4DDVA 1I3NA 4HL6A 4UMDA 2QE7A 5JZMA 3GLSA 2NUTA 1DEXA 3KR0A 4OHZA 1J1UA 2FEPA 4XGIA 1JG2A 5AESA 1YONA 4F4HA 5I9TA 3BF7A 2VT2A 3O5AA 3CPJB 4RTJA 2OG2A 2QRVB 2GXSA 1HLGA 3IAXA 4L4SA 5DTEA 5IVHA 3KIPA 1CCWA 1OZFA 1H9BA 1RYHA 1IY2A 1QFXA 4IVNA 3RIMA 2PGLA 2DQ4A 2V5AA 2YXEA 4UOQA 1SCKA 3SVTA 4JYBA 1JG3A 3FSRA 1Q5PA 1TL7C 3LK6A 3NM5A 4RPHA 5AICA 4ZI2A 1MHPA 1R66A 2RCYA 2XTZA 4DPMA 4DR6B 1KHHA 3UKDA 3B51X 4A8TA 3RJZA 5FQOA 2I0FA 2BIFA 2QUBA 3NAZA 1Q12A 3VNUA 1CQWA 1PP4A 2YC4C 4WIAA 3TVYA 5J2UB 5IVDA 4NCAA 1VB3A 5B5SA 3GZTB 2X8LA 1IBCA 2W6JA 2DETA 1Q2XA 1X7GA 3GLFA 1TUEA 3B6ZA 4JENA 4K3UA 3RIGA 1PG5A 2XMPA 4HSGA 4MRNA 5EJIA 4J0IA 4BAUA 5HKBA 1NZDA 1Z0AA 4PQFA 3HN6A 2HRZA 4TMYA 3GB9A 2PM8A 3R7LA 2Z5FA 3KT0A 1KBOA 1N2SA 3A04A 1XZEA 2OK7A 1BYIA 3KZ1E 4PCVA 5BWBA 4UEQA 2JBAB 3PFBA 4KFSA 4MQ5A 2Y1XA 2RSLA 5FYDA 2H1VA 1GQ2A 3FF1A 3BXHA 3GK3A 3PR1A 4AG6A 3M6AA 1N77A 4JLNA 5AI6A 2JI4A 2XE4A 4NWIA 2ZT7A 3EVBA 4CMJA 2BBSA 2XMCA 1X1QA 2GCEA 1T5HX 5A9SB 2FN9A 3IT2A 3VNSA 2XUAA 3H4VA 3S70A 2PGIA 1OI2A 2XYRA 1Q16A 2VTDA 3WG9A 3MUEA 1E60A 2VCYA 1NNI1 1W5TA 1XCJA 1TT7A 2Z04A 4C3VA 3EPLA 2O59A 4E30A 3BH0A 2ZSBA 2R6R1 3DWEX 4O4IF 4BFTA 4F3YA 5HFAA 3WVNA 2C1XA 2XDYA 3AF4A 4KN9S 5C80A 2X0KA 2EIXA 2WSMA 5G40A 4MP6A 5BYBA 3CRMA 4W5NA 4GF5A 3TIXB 4K03A 2BR5A 3AERA 4JU8A 2WMYA 3NKLA 4E7PA 5G0SA 1DIHA 3CRZA 1XZCA 1HDCA 1GPBA 1NVAA 1YB7A 3OLQA 4HZIA 1JHAA 2FEMA 2VF2A 2W6QA 4X5OA 4DXDA 5I01A 4YRTA 2PT9A 1EWQA 4CFZA 1N3IA 1XZGA 2RHRA 4KOEC 3QXSA 3FHLA 4XR9A 1DMRA 1J07A 3UH1A 3D3EA 1DEAA 3WQSB 4Z99A 3DLBA 1TCBA 4OL9A 5JE8A 1YU9A 2C9YA 2EKLA 2W6OA 1SVSA 3UB2A 1BEEA 3ONVA 4B0PA 2YICA 1KP2A 4HZUA 5EERA 1FVFA 1R9GA 5LU9A 4ETMA 2AFIB 4Z51A 3PSAA 5JH7F 2BFCB 2I8LA 3NP7A 3SC2B 3TNFA 2PUEA 1L1EA 4FFDA 5CFPA 1HYQA 1SHTX 2NUAA 1ZS9A 3EVTA 3GLHA 2BBWA 3KD3A 3UIEA 1XMJA 2BHTA 3DDSA 3SQNA 4R81A 4YP7A 3U39A 2JG3A 2PAFA 1PKEA 3R5FA 2QXTA 4EWLA 1Y9ZA 3AWDA 4ZZ3A 1W44A 3UOWA 3LPCA 3QUAA 4RNDB 2BRUC 3OIUA 3EUWA 4XQ0A 5F5XA 2XKJE 2XXBA 4OP1A 1SUSA 1YA8A 1Z83A 4C0AC 3VYSB 4DCOA 3FOCA 5JQGA 2Q5QA 4L15A 2VT6A 2X2PA 3FTNA 1NLFA 2XECA 4M38A 3LXXA 1LA2A 3C5VA 4OK5A 4XJVA 4XR4A 2LBPA 4EO4A 3AGPA 3B52X 3LBYA 4EVRA 4C0SA 1YJCA 3PNKA 5I8WA 1CLUA 3WFIA 2NYUA 3EGIA 4A2PA 4C01A 1ZIXA 2P5TB 1DBQA 2PT7A 5LB2A 3KEMA 4HEA6 3UJ7A 3UJCA 1BE6A 4KL8S 2WY2D 2VQ3A 4IXTA 4NULA 4YJ3A 1Q77A 4DIBA 4DLYA 3DEIA 1T9AA 1E9AA 3CPEA 2HY7A 3KKLA 4NC9A 3U4GA 2G6BA 1XVAA 2P9HA 4G97A 4Q3DA 2ENUA 1FXWA 3ASYA 4DT1B 1X0XA 3REFA 4UTPA 1RWPA 3K0FB 2R6JA 4I8DA 5JMPA 4EFMA 5E6UB 3QKUA 1OZGA 5AOAA 1M10A 4M83A 2MSEB 1EK5A 3D0OA 2PMCA 5LOVA 1MRSA 5A04A 1E92A 2YY5A 1IBKB 3V1KA 5AVRA 2JIOA 2YWEA 4Q9HA 3P2EA 5C5IA 1PSDA 1R0SA 2EGGA 2EKBA 3H3XA 1ONPA 5EP2A 1OY1A 4EP1A 3MWYW 3FCSB 4C89A 3B12A 2BTQB 3OAAA 2BCJQ 4KYTA 1RYYA 3I6YA 1TKCA 3GEPA 3NIBA 2QP9X 3ZWAA 1V41E 3AFOA 4O02B 4H1VA 3TLXA 3QBEA 4PRKA 4U2CA 1EESA 2OWDA 1ZX1A 4K2AA 4RDIA 4DDKA 2D5LA 2DQYA 3UANA 5CVVA 2W43A 2O7RA 3A4TA 4GQAA 4MRSA 4WE3A 1FRFS 3HCOA 4FDLA 1WE2A 2FFJA 4AVYA 5KO2A 2NSYA 2PX5A 3NATA 4PC2A 1XCLA 2CHGA 2UUCB 2JJYA 1DO0A 4HNAA 1UDAA 3NM4A 4NNPA 4ZOCA 3ZE6A 5A9TA 5JRDS 2GBCA 5KOHA 5MN6A 2PJRA 3TM5A 4YRIA 4UNPA 1RAIA 4H7DA 5J4LA 2PGOA 1EVYA 4Q21A 4LOHA 4PZCA 3EDOA 1UPFA 1P62B 4C4YA 1VGQA 5ER9A 1E2IA 1NQ5A 3EBLA 4MUYA 4F3NA 1DARA 4WXMA 3COYA 3HJBA 4BRSA 3FGZA 3FWNA 4YY3B 4MGHA 4WBNF 3IBTA 3NJ8A 4IQFA 5EXTA 4IXWA 1HFEL 2YJ3A 3U3XA 3PFWO 1WB5A 2W2LA 4LN1A 4TTRA 4A0GA 5CLJA 5EKSA 4V39A 3OCYA 2B6HA 2YYAA 3IAAA 1GFSA 3N2EA 4REOA 4CKEA 4HDKB 3U1TA 4WOKA 3IDSA 4EENA 4HDCA 6YASA 5EXEA 4KFUA 3X3HA 3EIQA 4JB0A 1VSQA 2VJBA 3MWDA 3NEYA 1L7BA 1A9TA 3WLSA 3EG9B 3G2HA 2YZ2A 3OY2A 1OA0A 1JMKC 3L4BA 3TF5A 3FTQA 4EF4A 2BCEA 1HZZC 4MRRA 2WWVD 3ZHUA 2C7QA 4FBMA 1XMSA 1ULSA 2C5LA 3J81A 5EXPA 2QG4A 2W8BA 4D56A 4B73A 4D5GA 2J9GA 4E21A 5EHZA 4G5RA 4WZBE 2H4JA 4CFSA 5ITZB 4ALLA 4PLZA 2H2FA 3F7OA 4P4NA 5DSZA 1AB5A 4FZRA 2BJWA 4M1TA 2FKAA 2WT8A 4CKXA 1UDWA 4ZU3A 2NTJA 3GPDG 4FU0A 4UAVA 1CD5A 1U8FO 5DM60 5A1TA 1O94C 4UD6A 2BONA 4R9UC 4GM4A 3WGYA 3B3JA 2H1OA 4DSZA 1FNSA 3OQVA 3T5GA 5JVDA 1M7HA 5FR2A 4AMUA 3C6BA 2AMLA 1W52X 2A86A 2ZJFA 3HH8A 3FHCB 1PNVA 1XG5A 2PPVA 3NIFB 4H27A 2Z1NA 1P1FA 3V7NA 4V02A 4TV9A 4TKZA 3V2GA 1K8RA 2AD5A 4Q82A 1CQJA 5E4YA 2FFBA 4YAOA 3V2IA 5JO0A 1EMDA 3SBDA 4XB2A 4O2LA 1X77A 4ZA2A 1S8NA 2VP9A 3PEWA 4FE7A 1FPQA 2BGLA 2J3HA 3G2PA 5CW2A 5JJIA 2OV8A 1O4WA 1CG6A 1SWWA 2J4FA 3X1DA 1AXEA 1ZPDA 2IYQA 4PR0A 2BMJA 1E2EA 4PS0A 2WE8A 4TT3D 4PHTA 1YZGA 3CT4A 2F8TA 3BE5A 2OBLA 2ZPAA 1ORIA 1XN1A 1SMKA 3CR7A 3FG9A 5CYPA 4Q9KA 3OQNA 3V8VA 4KDEA 2JLSA 1P0PA 3ACDA 3BWEA 4MA5A 1TO2E 3H2GA 1L5WA 5L6MB 1EGHA 2C5AA 4FP9A 3QKWA 5FA6A 5GOTA 3ZXYA 3TK1A 4QSMA 5AW1A 4KB5A 1XQYA 1Y33E 6CHYA 1FP4A 2ZPUA 3AF5A 3I9V6 3MMXA 4YALA 3ZVNA 3O90A 3A1NA 3CBQA 1AK9A 4EY8A 1GGVA 1Y1KE 2EQAA 2FEOA 3ZDAA 3Q2IA 1U31A 2DPGA 2WWRA 1AKWA 5H5JA 3IOYA 2ODAA 1M9NA 2HOQA 3GG9A 4U2FA 2GHTA 3RUDA 2WIGA 1M8KA 4A8JA 1B4DA 1KU0A 3NXKA 1NWCA 4JI2B 1FS5A 1M2OA 3R77A 2GVZC 3FCEA 4WK4B 3ZWPA 3BMOB 3BJMA 2FFRA 4YCLA 1HDEA 1UOOA 1PVOA 2NU7B 1TPYA 2PBZA 3C8ZA 1MT0A 2MSCB 3EIFA 4TN5A 3L7MA 3QGMA 1GG8A 1TTHA 3VR1A 4R3WA 4B83A 5LN1A 1L7PA 1VMIA 3JTMA 2O8BA 2BGKA 1EFKA 2FPXA 1RQXA 1XJCA 1ZI8A 1I4EB 2P67A 1UXHA 3D9QX 4JBYA 3WSVA 5IAKA 1WU7A 5AK0A 1SCUB 4TS1A 1DC4A 1KNXA 1U1CA 5HIIA 3B70A 5A7HA 1DZIA 2I9PA 1QMPA 3IQDB 3VR3D 1XDSA 5FOWA 4KGDA 4QUDA 1DG1G 1XD8A 2I7DA 4G1MB 5AJUA 3HYRA 4DJ5X 3ICQB 2O2EA 4M0PA 1T6XA 1S4MA 4FVTA 2PJDA 3ILXA 1CUYA 1C30B 1FW6A 2H2AA 2ILVA 1XHLA 1J5EB 2C2BA 4DZZA 4JJKA 2JD1A 2XT9A 4C9BA 3LP5A 4KR9A 3AF1A 3DD1A 3L07A 2B5VA 1O6CA 3BX1A 2X9VA 5EP3A 1Q1AA 1HZJA 3OPQA 2IC5A 3RSOA 1HV8A 4FI3F 1YVUA 2HF9A 3N2KB 4ZU6X 4DMLA 3BJRA 4DLTA 2L2QA 3GJ3A 3IT3A 4LZNA 3V80A 5LBTA 1L4FA 1CVLA 6LDHA 2OECA 2JJMA 1NQWA 2WWGA 1QVZA 3S5UA 3AVWA 1A5AB 4BNLA 1E7WA 2ZROA 3BREA 1C8BA 4P38A 3RJMA 1GVHA 4OOEA 2X8AA 5IBCA 3LXMA 1ZI9A 3HCWA 2SCUA 4JLJA 4H17A 2OVBA 2FZVA 2PKRA 1D04A 1Z6GA 2A9QA 4CNQA 3RTEA 1PT8A 4NMMA 3QRWA 2HPAA 3FFWA 5NLLA 4HPJB 5EMLA 4A23A 3KR2A 3EVZA 4WD3A 2FZLA 2XQVA 2BY4A 3ZWOA 4BLOA 4MXDA 4CN8A 4QREA 1T9ZA 4EUKA 4QPDA 3FETA 5JSKA 5AXCA 2KBFA 2WKRA 1OKKA 4C03A 1DAPA 1G5PA 1UFOA 1VLZA 1Z7GA 2EZ8A 2GLTA 4BVGA 1XNRB 5CA1B 3V2HA 1KIAA 3HABA 4DQDA 2BR3A 3N0TA 4ZGGA 1VKOA 4DKJA 4ROSA 4RSGA 1K75A 1OFHA 4OPMA 4MV4A 3BFXA 5CLQA 3F4LA 5BV2P 4UBOA 5IEBA 1U7DA 5KNBA 3AVTA 1KDZA 2JGJA 1RYEA 1J2RA 3ESBA 1VMDA 3P71T 1QK4A 3A9UA 5EIEA 2RHMA 1OHHD 3RROA 1LFAA 4EUEA 1YACA 4UDYX 1JSCA 1UWCA 4AX4A 3LGAA 4FX2A 4YTEA 4DQLA 4HLQB 4E14A 4V0NA 5DOZA 2AZTA 3EWNA 2PTHA 5I9BA 4DC0A 4ICIA 3RBAA 2AJCA 1C4KA 2FZCA 1FUEA 2X1LA 5CP8A 4Y67A 1J7JA 5IUKC 5BMOA 3DOOA 3A4MA 2MHCA 4UMVA 4JL8A 3HYNA 4M8KA 1RHQA 3VDXA 1ZISA 1VRVA 1GILA 2PQMA 3FFBA 3Q0TA 3M5DA 3HVJA 1CDZA 3NWBA 2AXNA 4WFIA 4CIWA 3GRUA 5EJFA 3ND5A 2IELA 2LDBA 4M1ZA 5DBEX 2AI3A 5H0IA 4OQ4A 2EW8A 5FPYA 3ZDXB 5CFMA 1VJCA 2OGUA 3CO0S 2YIDA 2QY6A 4BN4A 1NDQA 5BY2A 4LJ8A 2NVWA 3V1MA 4JVOA 3AEKB 1FUYB 3OZAA 5F21A 1CY7A 1ZJZA 2LUOA 5A71A 4AY6A 3W2FA 1UMKA 4JOSA 2OK8A 3EPJA 3DXXA 4NCNA 3WIEA 2ZTVA 2A9PA 3RRYA 5BR8B 4EY4A 1GPKA 1L4GA 3MSXA 3QKIA 3A2LA 1J5PA 1LBSA 5I5EA 1IUNA 1XE3A 3AEXA 4WOCA 2FKNA 1YO6A 2HMSA 4Q4JB 5E0OA 2IF2A 1E2MA 3RU3A 2R1ZA 5JTTA 1I6WA 4RL4A 1P4RA 4WZBB 1XA0A 2HTFA 2YFQA 3AW8A 4K05A 3GRRA 4OAOA 4OLBA 4MQFA 5LZ4A 2YTZA 2BM8A 5AI9A 3FPJA 4LTMA 3I6IA 2GD2A 1E4OA 1ZRSA 3IILA 2XGOA 3GO4A 3SSOA 1U1IA 1KTIA 4X84A 4BVAA 1G8HA 4XIYA 4LGYA 3RBXA 4BWFB 2FMFA 4MWZA 1LJ8A 4QYIB 5T6BA 3OA2A 2CXXA 1PJLA 4O4HA 4BVEA 2UVPA 2GOYA 1JH8A 3H1AA 2OXCA 1ATIA 3C7TA 5ENDA 1NOKA 2BEVB 3LMKA 4G5GA 4MUGA 2R1UA 2POCA 4G25A 1ZA2A 2IYWA 2ZPTX 3CUKA 3RVDA 4DLPA 3IMFA 4JWKA 1XCGB 2YXNA 1CYDA 4IMPA 3KXDA 4MYTA 1ORWA 5HIKA 1T0JB 4H7KA 4F92B 2X0RA 1Q7RA 3O4FA 5DF1A 3GFBA 5LQUA 1N6NA 4Y9TA 2DTDA 2IEYA 3ZKAA 3TLYA 1E0DA 2H18A 4MO2A 4LOJA 4KX3A 1UJBA 1DKPA 3OEWA 4XASA 1RC1A 3EPKA 3EJWA 5JAMA 1PJRA 2XB6A 2CVOA 5SZHB 4DR1B 5B37A 2OESA 1C0IA 3AB7A 1GGNA 1TA0A 1FYDA 1GV1A 1XPJA 2QQGA 3L0DA 3PQ7A 1ZM7A 4DCMA 3RRXA 3IL2A 3KYDB 1C1YA 2FEKA 3R09A 2QMEA 3W6OA 1PWZA 3F5QA 5ECYA 3NWOA 3Q2OA 1Y5NA 4RIFA 4HN2A 1PDWA 4TOIA 2QB5A 5AQ1A 4EHAA 2VDRB 3LIIA 4IOJA 721PA 1AVTA 1SC3A 1U9IA 2I6QA 1XZQA 3PC2A 2IQIA 4PFSA 4R54A 5HK8A 2BE9A 1PWYE 5IVIA 3S3TA 1PTKA 4YCMA 5BSFA 2ODPA 1E9EA 1KEPA 2C4MA 3WK7A 1N5MA 1L5MA 2J3KA 2Y1CA 2YIJA 5BT9A 3ZWMA 3PJGA 1RLOA 1FUUA 2A9RA 2WJVA 4O2BA 4UHJA 1Z7YA 1CQZA 2WFAA 5DHAA 4DAEA 2UYYA 1N3LA 2XTAA 1NMXA 3KLPX 4UVDA 5FNVF 2Z5VA 3CLSD 3NKFA 3R5KA 3TFQA 2J0QA 4MUAA 5HEKA 3F67A 3R0QA 4S35A 1WXHA 4CEHA 4FILA 2WHPA 1L7MA 3H9JA 1POWA 1QHEA 3SCZA 1VPVA 3ZJVA 2AMFA 2RHOA 1LF0A 5AJZA 1OLSB 2FNAA 2YDXA 3EDRA 3EMDA 4GMDA 4N3AA 1JWAB 1UZAA 2XTMA 2ZTSA 4QBGB 3Q7SA 1QOPB 2FQ1A 4KFRA 3I0MA 1N6RA 3L06A 3RQIA 2FPGB 2HXGA 4I1YA 3OETA 4YROA 1KDVA 4E1VA 2J3MA 5E2BA 4YQFA 3A1FA 3HZZA 1PR0A 5K0LA 5J5CA 1QIMA 4I08A 1F2TB 3QLUC 2ZRIA 4ZXFA 5FBRB 3RVKA 3LUGA 3SMQA 3VVBA 2YNMD 3IELA 3BQMB 2YS7A 4YQYA 3WLHA 2C2XA 3P0IA 2ODQA 2XIJA 4H60A 4TLCA 1I2AA 1XJWA 1I2ZA 5F51A 3H97A 3QWFA 3WBFA 3SC3A 3ZHRA 1W93A 1MABA 3RPEA 2FJPA 3UZUA 4EX6A 2PUHA 5DU2A 3CXUA 2FMIA 1MJNA 4MULA 5F35A 5JWHA 1MDBA 1Q20A 2Y1GA 1AGRA 3ACCA 2GN6A 3QX7A 5LQCA 2F4NA 4KFTA 3AJ8A 4LF7B 3HDYA 3K2BA 4A4DA 1E79A 1GKKA 5ILQA 1WKCA 2H06A 2ZRAA 3ZD7A 2B61A 4PTZA 4J3FA 2OHJA 5TT0A 4PYKA 1LZKA 4REQA 2FH5B 2P7IA 3FROA 1SIBE 1U2ZA 2GERA 2A5LA 2GEVA 2XW6A 3JQBA 4FMDB 3TXYA 5I3CA 3EFOA 4M46A 3RK1A 3TW8A 2ZIXB 4RFSA 1DWQA 2NVUB 3MRVA 1C7QA 5TRTA 2VHJA 1QQ7A 2GUWA 3I04M 3M5CA 3N53A 2OFXA 4EG6A 3TRHA 5AW2A 4PRZA 4AZ3B 2YFHA 4L73A 4TYMA 4BRWA 3HUFA 2YIMA 4BE4A 2QLFA 3W3AA 4QEZA 1P2TA 3QHPA 4RPGA 5BW6B 1AUQA 1VG0B 1NIPA 2GRUA 4G0PA 1L6IA 4HLNA 1OI3A 4DSAA 1NBMA 1R10A 2CFOA 2OCBA 2RIPA 1TQDA 3UW1A 1QNLA 2PWAA 3ZBUA 2BR4A 4Q48A 4Y8VA 4AQ7A 1JR3E 1RIFA 4KQKA 2GFHA 4NMLA 3FKSD 4B2PA 3KELA 1TZMA 1A82A 3WBBA 4HUQA 1N25A 1QRRA 4ZVRA 5KTSA 2YMLA 3D7NA 1RADA 5DTJA 1TU3A 1DAEA 3ZXXA 4X44A 1H6BA 1FDSA 5E1DA 2ZI7A 3IIEA 1T8PA 2B4QA 2JFUA 2TYSB 2W2PA 3L01A 3OCVA 4LV8B 3ASZA 5FTNA 2VCEA 4I9HA 4MMZB 1UKYA 4K9KA 3RVJA 1AA9A 1KZ1A 4MR9B 3C1UA 1Z29A 3JQAD 4QDOA 3AHDA 3CUVA 1FYWA 1TB4A 3CLUD 4UHEA 5CCDA 4ZCIA 3RC7A 9LDBA 5IWAB 1UJMA 2PLAA 2V58A 3ORFA 1JGTA 3OHPA 3SM3A 1PT7A 3CCBA 3JZDA 1RC8A 4KXYA 2ZFUA 1Q1EA 4NBVA 2O5EA 3AV0B 3ET5A 5HFJA 1C9JA 2XCOA 3F3YA 3STHA 2EX1A 3Q2KA 3ENNA 2YBEA 4E6PA 5TJHA 5B53A 1DG3A 1XT6A 1QB7A 4AJ9A 2V5UA 1Z4LA 2FW0A 2RJNA 1U5CA 2RGWA 5GY7A 3AMVA 1NXSA 1DJPA 3E9ZA 4KN8A 3PENA 4GAEA 4OIFA 5L7YA 5IAOA 3QLTA 3CNOA 5LP6C 2J0UB 1I36A 4ND1A 3LQRA 1ULZA 4G0YA 3OMXA 2C9DA 3RYTC 1XPUA 2PX2A 2XOKD 1CR6A 4AF6A 1MXFA 2DGDA 3F97A 3H2IA 3HWWA 1N7IA 1KIMA 3PWTA 4P32A 4AYWA 1KBQA 2X3UA 4W4TA 3TQCA 3SWWA 1US8A 1FNMA 1RVDA 4G6ZA 1P1KA 1OREA 2JPDA 3PC6A 5TX7A 4QATA 2QUJA 1LK0A 4P5EA 4ENRA 4Q3EA 2GETA 3ZD6A 2R48A 4M0MA 3RT7A 3P27A 3MJCA 1EE2A 1Y6QA 1ZGAA 4MROA 2ZYSA 4PLPA 3OC0A 4RE6A 2EGHA 4RD4A 3KS9A 1LUAA 2D0DA 4DLAA 1ZCZA 3KQNA 1FSSA 3DTVB 3O8QB 1XZDA 4NESA 1E6LA 1XU9A 5KVQA 1HT0A 3DFFA 2R1TA 2ZIFA 3LLUA 3TRDA 1CQPA 3HMKA 4DDWA 4CKZA 1PT5A 2B92A 2XJ9A 4EI8A 1RQNA 1H66A 1ZVVA 2R8BA 3FM9A 1ZOLA 2V74B 4MO9A 2O3QA 2X0EA 4B34A 4BO6A 2N42A 2GYUA 1BWRA 3VSAA 1LGYA 2A9JA 4QYXA 1OASA 1C4XA 4PY2A 3PNQA 1G21A 3KKPA 2FSHA 1UPXA 1YR9A 1J22A 2R7MA 4PQGA 5AW9A 1P44A 1QVWA 3H9QA 4UU0A 2CT8A 1EK0A 2FN8A 3FNFA 2C5HA 4M86A 1NHWA 4KOAA 4ZKDA 1NZFA 3AEZA 4P9NA 5DGTA 4YRSA 1Z6XA 2A35A 3MTDA 3TMAA 1YJQA 1X9HA 2QYTA 1Z17A 2QXYA 1BKSB 3NBUA 3C8MA 4XDZA 3U5TA 2GBFA 2PZJA 2IEZA 3MD0A 3DP9A 1MQ9A 2JLXA 3RRZA 3JWHA 4FGUA 4KI0A 4YAJA 1VL6A 3AQ4A 3NETA 3AEQA 4Y2GA 3FVQA 5L6LB 3WISA 4EIWA 3SK0A 2I8AA 2GZ1A 3SNKA 4D57A 3CT6A 5K8TA 3ADDA 5FBWB 4HB2A 1P7VA 4NJMB 1Z13A 2W0MA 3QHQA 1DTWB 1GGEA 1WLSA 3G9XA 3ZWYA 4C0KA 4AJKA 5G4KA 4ALNA 1YAJA 1PLLA 3OQPA 3P0RA 5T67A 4ZEOA 2HQRA 3SC6A 3L4BC 2NU9A 2ZM5A 3E5HA 4ALMA 2BC9A 1X0VA 2OHXA 3ICCA 1S3GA 3O03A 1IK4A 3C6MA 2O7QA 1MZPA 5T41A 4B6PA 1WR8A 2LVBA 2ZRFA 2Q29A 1BXGB 1FX0B 1FE8A 1RXVA 1AD2A 3IYLW 5BPFA 4MAFA 1NKTA 5KTMA 3SJ7A 3AM3A 2H92A 4NCIA 1ZM4A 3LYHA 4LGVA 3UC9A 4ALJA 1IOLA 3HR8A 1J06A 3KT8A 3T99A 3SG0A 3MJDA 4UHDA 2XD9A 4AKGA 5FADA 2B0JA 5E8RA 3HA7A 3Q3GE 3AKZA 3CTPA 3F5MA 3P2YA