4YCJA

Structure of acetobacter aceti pure y154f
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
160
structure length
160
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALFNPALAARLETWRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
total genus 53
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4ycjA00
3OOWA 1D7AA 2FW8A 5BORA 4YCBA 2FW1A 2ATEA 4ZJYA 3ORSA 4Z7JA 3OPQA 4GRDA 1XMPA 5CLHA 1QCZA 4AY4A 5BOSB 2FWJA 4YCJA 2FWAA 5CLJA 5CLGA 1O4VA 3LP6A 2YWXA 3TRHA 4B4KA 2NSJA 5CLIA 5CLFA 2FW6A 1U11A 2H31A 3RG8A 2NSHA 2FW7A 5CTJA 2FWIA 4ZMBA 4JA0A 4YCCA 2FWPA 2FWBA 3KUUA 4ZC8A 5CVTA 4AY3A 5C5DA 5BOSA 3RGGA 2NSLA 2FW9A 4ZK2A 4YCDA
chains in the Genus database with same CATH superfamily
2ZW9A 4AWAA 1QHSA 4BOYA 1JKMA 4F2DA 1MDBA 4TLAA 2QJOA 3D6VA 2VZ8A 1KMQA 1EUYA 3A2MA 3LX5A 1EGVB 1LPOA 5T4HA 2FI1A 3QF7A 3QTBA 4XYGA 3RVJA 1KEUA 3P0IA 3Q15C 2AMJA 1M1XB 4FD2A 3T5CA 1H22A 3IR6A 1NMQA 1KAGA 1H8HA 2FFQA 3ILVA 3LV8A 4GNRA 4FBGA 4JR2A 2HXYA 5T4BA 3AVYA 1EFCA 4AZWA 1X7GA 2JRCA 2VZEA 2H4XA 1LI4A 1MV8A 3MRTA 1NMZA 1NRJB 2FK7A 5CA1A 2ZSHA 4BRSA 3QSYA 3HFJA 1B26A 4HI0E 2HU8A 3MYYA 4GQIA 1MHTA 4AULA 3A4YA 3N87A 2X0KA 4OQEA 4LA4A 4C6HA 1A9QA 4CYMA 4G1VA 3IUQA 1CQPA 3R7LA 1S1MA 1NVEA 3K30A 1JR2A 4PYLA 4TVKA 1C30A 3EIOA 3PNPA 3L06A 4ZO7A 5BSRA 4KITB 1ECFA 4YAUA 3OE7D 3UJDA 5I8PA 5MN4A 3V42A 4EY5A 2YQ4A 3KQHA 4F1JA 1UXOA 4RM3A 3ZCRA 4UAGA 4OK6A 3PLRA 3VAYA 1OT3A 1D2AA 5LYJF 1SBCA 4Y18A 3TZCA 2R6AA 2OV4A 2BMFA 1ZUIA 4MIEA 5H02A 1YL7A 2BN4A 4RZIA 3GI1A 1PBNA 3QFHA 3EIXA 1ODIA 1UAYA 1O58A 4YJHB 3O0TA 4L78A 2RAUA 1KI4A 4LZZA 4X62B 4Y1EA 3L4KA 3BL6A 3AEKA 1U8CB 2QT9A 4G86A 5A3SA 3PJDA 4B3GA 4KAJA 5D1NA 3W9UA 3JYPA 1B6GA 1TCUA 4B87A 3D7RA 3PFGA 2ODQA 4JLDA 1D07A 4EHHA 2ORYA 3FVWA 1KU0A 2B1IA 1EZZA 1PQYA 1X1DA 3K09C 4G8JA 3R8FA 2ONYA 2W2XA 3GCWA 4NZYA 4AECA 1MXHA 2OENG 4O02B 2ZBEA 4ZZ0A 5CM8B 5JBIA 4RANA 3T7SA 3CIFA 3CISA 4DJFC 3OKFA 4FCCA 1ODSA 2LW7A 3CM0A 3W78A 5BQFA 3CUUA 3B6IA 4YPFA 4Q3CA 1NE2A 2W6QA 1NP7A 1VG0B 1TU4A 3EHDA 3KU1A 1YT5A 1T8RA 5CGZA 1IY8A 1H0RA 2P8SA 3VKWA 4O2AA 1HC7A 3QWIA 2QUAA 4C1BA 4Q1DA 3K35A 4Q9LA 4ZOAA 4GPD1 5CYGA 2PUBA 4QUAA 3V80A 1CT9A 4DC9A 3CH7A 3LK6A 3OJOA 2JFOA 3HN2A 3DS8A 3TG2A 4K9LA 4RKWA 3O83A 3DTVD 1GSOA 1HUQA 4BLUA 4RZUA 5AVQA 3ILSA 1KTIA 2J32A 4GF5A 4EKDA 4ID9A 4PLPA 1L8OA 1V8DA 4MTLA 1TC2A 2PWYA 1VBKA 2XRFA 3H9BA 3VC2A 2RG7A 2Q9BA 2I8CA 2O0HA 3K31A 1L5RA 1F4LA 1UKCA 3EB9A 3O8BA 3P9KA 3TOCA 3OF2A 3G2MA 4ESHA 1IK6A 3PVSA 3QE3A 1XFAA 4FJ0A 3EGWA 2GBGA 1A8QA 1TVMA 4PO3X 2IV3A 4YP6A 3UB4A 5JD3A 1CQIA 4US2R 3NLLA 4OL9A 4M99A 2ZRCA 3MXOA 1IQRA 1E3WB 2WHXA 1O5OA 2X2FA 4EZEA 3PL5A 1GRCA 2FR8C 1TTTA 3AVOA 3N0TA 4OHYA 3V97A 3ILHA 4R8RA 4N0DA 1H2ZA 4GT1A 4LJ7A 4BE9A 5FWNA 1EM6A 2HWYA 2LNDA 1HRDA 1SBZA 5IM4F 2HHHB 1XEFA 4CTNA 1PWHA 1C3XA 4IAOA 2JI8A 3RNLA 3MFQA 1VMDA 3NS7A 1UWVA 4DWOA 1V11A 1VE1A 3TPZA 5JQWA 3RUFA 4R41A 2Z56A 3SZGA 3LCUA 1YHNA 2IV2X 4A26A 3KETA 3S68A 3EJWA 4NOJA 4IJKA 3AJAA 1RQRA 2WNSA 1O6FA 3EGOA 3RKRA 3S4YA 3DAOA 4HPWA 2NU8A 1EU1A 4ZT7A 2HDNB 1V41E 3NCHA 2OUIA 4J76A 5MFZA 2CXSA 4UBLA 2MT9A 2OP0A 1P4RA 1XO1A 2E5FA 2UZ0A 1GGKA 2Q99A 1IZ0A 3JYHA 5EZQA 3L93A 5IVIA 4LRWA 2UYGA 4H17A 4ZEVA 3ABIA 3DG9A 4HYTA 3I58A 3V1KA 2X0FA 5LMNB 3DMHA 4MTCA 3V48A 2PZLA 1S2DA 3I2KA 4NATA 1KY4A 5KKCA 3VUEA 5GJWC 1CQJA 3AL2A 3SSAA 5HK9A 4I8IA 1FJHA 3QTLA 4LPKA 1HKHA 4LBWA 4P33A 1EFLA 1UP7A 3MVEA 3Q6IA 2ZVQX 1MU0A 4ARZB 3H8JA 1CF2O 5F98A 4R8MA 3HL4A 3PT9A 1XVUA 5CDYA 2M1ZA 3MD0A 5D00A 3UQYS 1JDBC 2FFJA 4OKIA 3IEKA 1S6YA 1XJQA 4FWBA 3F7OA 4DMMA 2VDJA 3WHKA 3NVKI 3CVWA 3OFVA 1XK7A 2KI5A 3IILA 3TDMA 5A7HA 4QQKA 5AW0A 4B7CA 5AVOA 1N7GA 3WNDA 4W8GA 2WP8J 1TM4E 3FKSA 4WQMA 4QVGA 5AKHA 3HADA 5L40A 1I14A 3DOFA 3P0RA 4W8HA 4EX6A 1OI4A 4CT0A 2RKWA 4U5QA 1ICEA 2XRYA 3MCZA 4RC9A 4CDRA 2YUIA 3ISVA 3O31A 2FRVA 3LT2A 1A8HA 1W0JA 3HCNA 3HPQA 1CJKC 3LA6A 4B4KA 1W4CA 1YE8A 4B8WA 2ZZMA 2CXPA 1TEHA 4MQLA 2Q1YA 1UBEA 4DCJA 2R48A 1KH1A 1HT3A 3OEYA 4F5EA 1RWQA 1S4QA 2D0IA 3IUYA 3LDUA 2I22A 3M6AA 3W5SA 5D3KA 5IG2A 1M0TA 2H0QA 2O2XA 1TXGA 2CUTA 3ZCTA 2CLSA 2OZLA 1EE1A 2JG3A 1YZUA 2JEYA 2OGWA 4R81A 3D4BA 2ENUA 4MITA 1IN8A 3D8UA 4QBTA 4YRAA 1CJSA 1J0XO 1E1KA 2WHPB 2YZNA 3D7SA 3E5RA 4NMMA 3ZJ4A 4YRTA 5LMUB 1WXHA 1J33A 1SC6A 1NOJA 1RLMA 1SXHA 1GGVA 1R0XA 3I72A 4MUYA 3ZEAA 4CMAA 1CDEA 3BJMA 3I8SA 2GRAA 2BZGA 4Y2VA 4C7OB 3W06A 2HCTA 2ZT6A 4F6RB 3MF4A 4BNNA 1JPVA 3BB1A 2AVDA 5LYYA 2UUOA 1XCOA 5DCWA 1NUHA 4Z53A 2V1XA 4RZ3A 2WTXA 3VC1A 4YC7A 3NOVA 1RBZA 2GHQA 4TKUB 2AJDA 1YUNA 2ID7A 1UBKS 5IT9A 1BE8A 1Y9ZA 1T5BA 3L0ZA 3N74A 3QVOA 5EERA 3ND8A 5REQA 1XPJA 5I4KA 4YMHA 2GYYA 2IXAA 1WE2A 3LUKA 4CM7A 3GY0A 3LWNA 4FSXA 5LD2C 1HKUA 3DAGA 1NW7A 1T36A 2XYGA 5FBRB 3H2HA 1TPYA 1HL7A 3GT3A 1BA2A 1RT9A 3MM4A 1KJJA 2ZRHA 3QVMA 3MGAA 1VI5A 4Q6WA 1L7QA 3SFTA 3RS3A 5LIRA 2H85A 4J9UE 4WNIA 4WE3A 1PEAA 4KNWA 4WMLA 1E2NA 1M0WA 4NDZA 4DB2A 1T1RA 1KDVA 4MCJA 1USKA 5EKSA 5BN1A 6Q21A 4PYQA 5GZ3A 3ESAA 2GJ9A 2BJVA 4Q6BA 2BHLA 2EZ4A 2JFHA 4DLZA 4ZVVA 1P3Y1 4UBJA 1GG8A 2IGTA 2Y1OA 4FU0A 4K05A 1W35A 1EE2A 4N12A 2ISQA 1W4AA 2IQ5A 3W3AD 2EGGA 2CZCA 4HX5A 2AQKA 4M76B 4OQ4A 2ZJ5A 4P53A 3KJEA 3MB8A 4PC7A 2IJGX 1C1DA 5L4NA 4KXNA 3DBLB 4WESA 3DBVO 3LXUX 3VNRA 3WQQA 4MGKR 1R0SA 1J2UA 1J06A 1QWOA 2XEXA 3HM2A 4HWRA 4U8HA 3K71B 1UPAA 4DV7B 2GBIA 1SB9A 1WIWA 2WG1A 3GRYA 3WB0A 1IMJA 4MPPA 1ZN9A 3IV9A 4AY2A 1OH7A 1FBTA 1QKIA 3PGKA 2XIJA 4IJMA 1QGUA 3SXUB 3WLHA 4JJZA 1REQB 3PTZA 4RJJA 1E3MA 1OGIA 2KLBA 3U0VA 2VDPB 2R5FA 3GA5A 4FQ8A 4RK1A 1XHEA 1G3RA 2WMYA 2C2HA 2AQ8A 1GPYA 2PR7A 4FMBB 3GJ0A 3CR7A 5CB4F 1DG3A 4ZV7A 2BFFA 4M53A 1VGVA 2A0FA 2B8JA 3MTQA 1U8YA 4LF8B 4TXMA 5F33A 1JR3A 4H6VA 2C3YA 3W6OA 3UPUA 2DECA 3MLBA 1DC3A 3LX6A 2R4QA 4M0UA 1OA1A 2C83A 3I9KA 3ADKA 4Q03A 5BSGA 1FXUA 5CHYA 4R1QA 4Y67A 3GT7A 3VSDA 3MINA 4LNUB 1P1HA 1WCIB 2FPGB 1YC5A 4OXQA 4EW1A 1C4OA 4F0JA 3VH3A 3PFKA 1WMDA 3HB9A 1PR6A 2EKBA 1ISHA 4Z4FA 3EXIB 3P2IA 5ICFA 1EJ6A 2ZGVA 1JSLA 2Z5LA 4ZIRB 1RPAA 1YKSA 5BO5A 3X1KA 4BS9A 5JSQA 2P7HA 3V7WA 4DLKA 3G17A 5JVDF 4QHYA 3LLVA 2LD4A 3G5TA 4QUDA 2R8RA 1BFDA 1W4ZA 4IKPA 1KBZA 1B74A 2DFLA 5D7BA 2YV5A 3CSSA 5E38A 3DHVA 1YRAA 4KQIA 4G0NA 3E6AA 5TMDA 4BNYA 4FONA 1VL2A 5B7QA 1R10A 2UV8A 4DR2B 1W6RA 4WUTA 4GR9A 4NCJA 2EKPA 2PH7A 2QP4A 4BLVA 3D7NA 4BL5A 4L6CA 4PIMA 1MH1A 1KYWA 3FNBA 4IV0A 5CT5A 1A71A 2CLCX 2ZJ8A 3WOHA 1SXPA 1JA9A 4M9UA 2QB5A 2O8CA 3CZQA 3MWGA 4OJKA 2D2EA 4I9HA 3SKYA 2G40A 3BORA 1FDRA 2R6HA 1ZM3A 4FHGA 4JC8A 2H4HA 3EPRA 1UXHA 1ZMOA 4KXQA 5BVGB 1WZEA 3CIOA 4CM9D 1BMQA 1PUIA 1UIMA 2WM3A 4DF3A 2YNMA 4O4IF 2PMCA 2WT8A 1Y5MA 3G8DA 4Z7NB 2IIQA 1DBWA 1OBHA 1KDRA 1U7DA 3O4JA 2FW8A 1P2GA 1Z2NX 3IQWA 2VH5R 5JAIA 2MMGA 4UU1A 5E4TA 1ID8A 5TR9A 1ZN8A 2WC1A 1WKCA 1WZCA 4JC5A 2H4FA 5ALKA 2VATA 3U3XA 4PSVA 4MV3A 2Z6QA 5FAXA 4IX9A 3VR3D 4HEJA 4S35A 2PV0A 2BCJQ 3SC6A 1OYWA 1WUYA 2I34A 3EWNA 4HQFA 3HNPA 2DH6A 3N75A 1LBEA 1DRUA 4NBSA 2FVYA 5LZ4A 4Y3UA 2Y1CA 4NH4A 4RK7A 3CZRA 3DNMA 1NNI1 1O94A 1P2BA 1I0IA 1V3VA 2GASA 1U2EA 3B89A 4U2EA 3PTLA 3W8FA 4XLLA 4D9JA 2VH2A 4GX0A 1BXGA 1RQLA 2Y0DA 1PEKE 2J5QA 3ORQA 5ALIA 3EAGA 2BUAA 1OIXA 4E4TA 1D1TA 3C5WP 3BXZA 4C0AC 3SZRA 1F3OA 3GGOA 1S9HA 3TPCA 1ZH8A 2VJLA 3H5TA 4D3FA 3BE5A 3X1DA 3MWDB 5A7FA 4EI9A 4US0R 1JEYA 1YUMA 4KUHA 1E2DA 1U3WA 4IOMA 5JXIA 5LNK6 4KSBA 3OAAA 5FOUA 2ZZKA 4BP3A 4ZV4A 3ENKA 3ZE8A 3I34X 3QUAA 2FQXA 1K5PA 2AL7A 1E64A 5KOIA 2ZIXA 4M0FA 1J0CA 1H4VB 5KQGA 3DOOA 6CHYA 1T4CA 3UY4A 1NWCA 2WILA 4KW7A 3O8QB 3CB2A 4FX5A 4P80A 3IT0A 4PM4A 3ZI7A 5BMVF 4HQKA 3LUJA 3RROA 1U1IA 1YXMA 1Q7RA 2AG1A 4GI2A 2W71A 4HAVA 3FFAA 5AJZA 4HB2A 3N76A 3AG5A 1EZ4A 5DGXA 4BCCA 1BEEA 4PZEA 1IJFA 5AVZA 1ND6A 4JQYA 5BVGA 4P84A 2BMEA 3BBPA 2PANA 4D99A 3BCUA 5AI9A 1UWCA 5K0TA 1VPTA 4PHHA 1EXNA 2HCFA 2R6ZA 2A0KA 1W5BA 1NFRA 3AERB 2I2BA 2IHZA 3D4NA 3MQFA 1UM9B 3PRYA 4MROA 3O84A 1KZYC 3ENZA 3L7AA 2WWXA 3QOWA 4LWPA 4N5MA 5GV8A 3AXSA 1JIJA 3AGQA 3RJZA 3R24A 4BGVA 1OZFA 5E9WA 5CXQA 1Y8AA 5FX2A 3EZXA 4CFYA 1Z38A 4JJKA 4C4TA 2VLIA 3KVVA 3JD4A 4RFVA 4NBLA 1AJEA 3DDNA 3QEBZ 3UHJA 3EZFA 1J8FA 3W0LB 4GOJA 3KJNA 4IZOA 2PRYA 1SBNE 1UKVY 2WUWE 1I3OA 1NHGA 2YIVX 3LVFO 4D42A 4E5DA 5JAHA 5DM1A 1MX9A 4W9RA 2IY9A 5A71A 2HYDA 4EI7A 5FUWA 2QAGC 4BLTA 5EP1A 2FETA 1BZYA 2ZUSA 1NLUA 4Q9JA 2JLZA 3RVDA 3I83A 4YYZA 1AA9A 2D7CA 1SZCA 2CDNA 2GRJA 4FT2A 1N0UA 1Z5PA 4TSFA 4XR9A 3WB1A 1U04A 4CL2A 2QYSA 4OB8A 2QRKA 3IQGX 1QV9A 1JHZA 3EEQA 4GPIB 1I4DD 1P0IA 2YJ4A 3TXAA 4LJRA 3DWFA 5KVSA 1NXWA 1OB5A 4DR6B 1XTPA 4Q9IA 4E1BA 3ORRA 1IH8A 1KSFX 4BATA 1RLUA 3UH0A 2M6RA 1RKBA 4WASA 3SYMA 1JFFA 2OAP1 4R1NA 1KDYA 1DXHA 3CH5A 3M6XA 4F85A 4MWDA 3T9FA 4PZUA 2J4CA 5D6NA 3B5EA 1Y1QA 4LV5B 1HBJA 4TRJA 5GV7A 5KYGA 2D0OB 3O38A 4EG5A 3FCYA 1WSBA 3R9WA 3LCRA 2PVSA 1JIVA 3AHDA 3BF8A 2X8JA 2Q2OA 5JJCA 4U7HA 3PX3A 4H7JA 5ITWA 1ZMRA 3KEFA 3QEAZ 4QG3A 1VJTA 5HRAA 1I33A 1UZUA 2ISSD 3N8NA 5DH9A 5K3AA 1E9SA 2IPAB 3I6BA 3GRZA 1Y5IA 1K6IA 4MDHA 2VK2A 3HBNA 3I30X 1ATIA 5EY5B 2YWRA 5MFPA 2Y05A 4XH9B 3WRWA 3TRIA 3BN3A 3U5ZB 2BEVA 3WV4A 3JTMA 4KLRA 3WLKX 3RUDA 2H08A 1M8JA 3DCNA 3H1AA 2OC4A 2SKCA 3IC5A 4B3XA 4I50A 2DBVO 3GPBA 3L8CA 3KOYA 3KQPA 5JRJA 2W6OA 1QZUA 3RTBA 2DU8A 1UAAA 1G66A 3Q3VA 1PG5A 1RZUA 4QO7A 1NQOA 2ODBA 2R47A 4DUZB 2XLBA 4C7KA 2VJAA 3R3VA 3PKZA 4OHMA 5K9ZA 5J1TB 4Z1OA 1G8YA 1ZY2A 1N6NA 3V3TA 3OFJA 4LJKA 3QV1A 3JWHA 4MKIA 4E51A 5DHAA 2OG1A 3HCFA 3RS0A 4RWZA 4B3TB 2Q5QA 3RLFA 4B9EA 1FPMA 4AY4A 1Y89A 2HA3A 3JS5A 1V2HE 4QJIA 1ESDA 2IPOA 4HP8A 2LR0A 4TZTA 1X1BA 1E4VA 1VCHA 3CZAA 4OU5A 4IDBA 4B76A 3T0FA 4FWIB 2R96A 4DT1B 4QKQA 4AQ7A 1Q0SA 1VYVA 3KU4A 4C0LA 4G67A 1KI9A 2QVCA 1G21B 2NWQA 1I7DA 3DUFA 1SUCA 4OMUA 1H2XA 3U44B 1U0LA 3EEBA 4EYOA 1JDNA 2Y9PB 4GD3Q 3CG0A 2QK4A 3WGVA 3I39X 2NSLA 1TM3E 2SKEA 4UTZA 3LHDA 3IVXA 4FQ5A 3KOOA 4RS4A 5JLJA 1IUOA 2UYYA 1YIDA 1DC8A 4OQQA 1WRBA 1OLOA 3UCXA 4AS3A 4QM6A 4QU9A 4E5VA 4PVDA 1J24A 1RR6A 2PMKA 5HHTA 2W6MA 5ALEA 4E5YA 2NU6A 2XUQA 2CCJA 4MUAA 4OPMA 2BFEA 2I4OA 2Z1NA 2BUCA 3WKAA 4F93B 1EM8B 1OX4B 3TRDA 5IHPA 4DCNA 1EDEA 2YN0A 1QG4A 1BWSA 3FFBA 3TOSA 1XU9A 1Y3FE 3IAHA 4JNKA 3OM0A 2YWEA 5E6UB 3REGA 4O4HF 1A88A 4KI7A 4O25A 4ZHQB 1G7SA 1HMPA 3BRSA 3CN9A 3PI7A 2A3RA 4PPYA 4WDQA 2DYKA 3NT5A 1QDLB 6ADHA 1DKMA 3H13A 1XQ9A 3IAFA 1W93A 2Z95A 4PZLA 3UFXA 1D2RA 4XQEA 3SS9X 4YFVA 5JBQA 1QH1A 3TAUA 1C4XA 1XIVA 1LLCA 2BHSA 3PWSA 1KZ7B 2FQWA 4KTTE 4JAVC 4MHSA 5CK4A 1RHMA 3KNZA 4U3JB 2HHAA 3VJKA 5K7SA 1GKKA 2C5AA 1E0SA 5LQKA 2XTAA 1S3IA 3VNUA 2GLUA 2IHJA 4EDHA 1ZGHA 4FFBB 5JNRA 3NIWA 1P61B 2EKDA 4ZKEA 4L8WB 2PUDA 1E8NA 1KWGA 5MDHA 5LPNA 3GBPA 5LQMA 3KAPA 1JKJB 1U2DC 5BNFA 2N1BA 3LGSA 3N8IA 3PNYA 5FTJA 2VAWA 2PIDA 3P8ZA 2A0WA 3U3DA 3QMMA 4DQ0A 1QIMA 1RC8A 4G85A 3WIOA 1AK2A 1CHDA 1IN7A 1GY8A 4BX2A 1EVJA 1U5CA 1XI2A 2HAEA 2J6IA 3B1XA 3QMWA 4WK0B 5IM4A 1HR0B 1G4HA 5BMOA 1RWVA 1G5HA 4O6VA 2IXTA 1I7LA 2FN4A 2RGXA 4ISBA 5IH3A 3TINA 2IS6A 2QD1A 1D2HA 1WEHA 2LDBA 4KAAA 2OK8A 4N6OA 3RVBA 4E33A 3G0IA 2YFYA 3CURA 3FG9A 4LHYA 2HA6A 3FJ1A 4M9QA 4ND7A 4C29A 1KMHA 1ZM7A 3VPBA 1K9VF 3GBSA 5KWJA 2NAPA 2C4WA 1AURA 2OBFA 3EZNA 2B8WA 4QVKA 2BBTA 3LCCA 1XKXA 4WCFC 2Q4OA 5IM5A 3KVNA 1IK4A 2P75A 4LSMA 4N40A 3QY9A 1TFRA 2A14A 2J6CA 5EHZA 1QO0A 3BMCA 5D5PA 3A11A 2ODEA 4KMMA 5IK2A 5FB3A 2A33A 2ROQA 3IUPA 4POAA 1M6VB 3W2EA 3BCSA 1BOFA 1RAFA 4JI4B 3JATB 5BY2A 2J3KA 3AF3A 4OOEA 1YVPA 2I71A 3SGLA 1U80A 4JV5B 5CA0F 3I32A 1V7CA 1A97A 2GRUA 1QTIA 2XPCA 3PRJA 5P8WA 3O95A 4AZSA 1NM5C 2A1TS 1MC1A 4QGHA 1KKUA 1H69A 3HXMA 2UXCB 5DI3A 3MWFA 2F1IA 3VHXB 2ASVA 1A2BA 1VIYA 3HP7A 2HD4A 5E4YA 4YONB 4DSTA 2IS4A 4B43A 1AUXA 2ZUVA 4LVUA 5CLFA 4FGWA 2Q3CA 5I7UA 1EFDN 3MAJA 5KKNB 5M29A 3M9LA 3TEMA 4BPRA 5AUPB 5FJIA 4B3SB 3A6JA 3QXSA 5JATA 1GQYA 4YO7A 4BO5A 2XEDA 2J5RA 3L4SO 1SK8A 1ZMXA 3CH6A 4PFQA 2PS0A 4TZ0A 2HDWA 4P3OA 2GM5A 5IKMA 1V7QA 1EJ0A 2GD0A 3A6DA 5CEJA 2C0PA 2XCOA 4MVWA 1U2SA 4BMZA 1E6LA 4E5NA 2G1KA 3WGKA 2OORA 3OZ7A 3Q4GA 5LBUA 3V4FA 5BOSB 3ETLA 4GC9A 1XLTA 4N4AA 1QIIA 2Q1XA 4J16A 4WLEA 1KPIA 1J9EA 1S89A 4Q01A 4JXXA 3P1JA 4GI7A 4IHJF 1E58A 5B3JC 5KTTA 3KLNA 4O5AA 3C8DA 3A2KA 3DTNA 2K5UA 5HXAA 1RXSA 1OUMA 3LD9A 3LVBA 2R62A 4OQNA 3K1AB 1XT6A 3DD1A 1ES9A 1HE4A 4TV8F 4B4DA 5A9SA 1IM2A 1OXXK 1TQ4A 2PGDA 4R9UC 2AN9A 3D8SA 4BAUA 4DMLA 2YW9A 3TEJA 5HSGA 3OCUA 2GN6A 1U4NA 2CNKA 4LOLA 4MV8A 4EGJA 1BYUA 2QTVA 4CHGA 3L8HA 1CUSA 5CP8A 3ZE1B 5H4GA 3SVLA 3WL6A 5F4BA 3ZY4A 4BV3A 5LU9A 1AS3A 4HD8A 5DSTA 2IX9A 1IULA 2Q3HA 2GPBA 3HYSA 2OXTA 1SHUX 3GFFA 4XJTA 3EWIA 1A9YA 5FOWA 3VYWA 3AHHA 3PKIA 1TYCA 4MIKA 5EL0A 4FEYA 4UDOA 3BS4A 1SCUA 4ZVLA 4E30A 2P3SA 1XKQA 3NAMA 1LV7A 3BH7A 3TMYA 1UEJA 1YKFA 2GO1A 1M1YE 2NTJA 4FFMA 1SUPA 4KBYA 3CEJA 4HS4A 4P7GA 4F06A 4ED9A 1Z35A 1E1RA 2RH5A 1KYQA 3OC0A 3RRMA 2D4HA 1PWXA 1YQEA 4UOEA 2JGDB 3QMPA 1XUOA 1K68A 1U1EA 1EFUA 1I1HA 1VTKA 3L4JA 2XKKA 3OIGA 5DASA 1IBRA 3UMRA 1U7UA 2QG6A 3DPSA 3ZHOA 3H9JA 3FKJA 3MXTA 2OXFA 2XNCA 3TQHA 3ZHVA 4BJ1A 2XWQA 5JH7F 4AZTA 1NQVA 4JENA 2CGEA 5A0FA 2FFBA 4HLUA 1EDBA 1QLJA 4DE5A 4P3KA 4DJTA 3B2NA 4N0MA 3SDSA 2J59A 1IRIA 1QHHB 9LDTA 3UGJA 3JR3A 4JI0B 3ZBUA 3ICEA 4ODIA 3EISA 3BMQA 3EG5A 2HSWA 3PUHA 4INOA 4U2GA 2RHHA 1ZO8A 3FSGD 4YJFA 1QJ4A 2OMKA 2Y4OA 3IQDB 4LJYA 4BO4A 2P4SA 1VXRA 3ICOA 4OUKX 1I51A 1MAUA 1YIOA 1NBEA 1WUJS 2X58A 4MUNA 1UBMS 2QL5A 4GI5A 5CDUA 5FWAA 1CUJA 1Z8DA 2C20A 4OHKA 2BFDB 1UOQA 1T0HB 3FOCA 3GOHA 3THYB 1FP6A 4OIMA 1BS2A 2Y99A 5HIMA 2BGMA 3TD9A 3M70A 1IMOA 4LMAA 4B3HA 3H99A 2I8AA 3P9IA 3WDSA 3Q40A 2WA1A 1Z5UA 5KNBD 3TRJA 1IUNA 3F9IA 4MQEB 4EUNA 1WLSA 1M2WA 1I2AA 2B37A 3KDPA 1EVYA 1PSWA 3B7WA 4KEAA 5DX8A 2CLMB 2IA5A 3TOXA 4ISCA 3MGGA 1AGNA 4Y2RA 5ALGA 5AOCA 4DIKA 1LWOA 2FZKA 2ZXEA 1GZVA 1OC2A 1XRPA 3TKAA 3UEOA 4EYQA 4YRRA 4QGFA 4DG9A 3OF5A 1YR9A 3CNQS 3HEMA 3EXHC 4HXFB 3RYIA 4XPZA 3U7JA 4H1WA 2BM1A 2XWBF 3RHTA 1M8FA 3NYIA 4I1UA 4UE6A 1FTQA 1PW5A 2VP6A 1N6HA 2G71A 3ZK9A 2TSYB 3MUFA 1D6MA 2GEUA 4GMKA 5L4SA 1N1DA 2XE7A 3DE1X 4ZQGA 1RAEA 4L74A 5CFOA 5KWVA 1ENPA 1E5VA 1SHZA 2O0JA 1DJLA 3IDSA 4YTEA 3RQIA 3T5PA 1H9AA 4G4IA 3M6WA 2AOVA 1DIAA 4FP9A 4HYEA 4HTAA 3ZHXA 4DDVA 3EFHA 2PBZA 5HMMA 4HDAA 3A36A 1YDMA 2BZ1A 4ZQBA 5FL3A 1FYWA 2X8LA 3LOQA 3GUYA 4QYTA 3BD7A 3EMBA 5NLLA 4AKTA 2JFWA 1Y3IA 3HA7A 2HEGA 1K6XA 5G2OA 1IPEA 4RMJA 1DINA 2V7QD 2QQ5A 4QPPA 2CSXA 1P2SA 4RGQA 4I4IA 3T9DA 1FFAA 4JBXA 3ZVLA 1THZA 3TLMA 2XTNA 4JA2A 3EOZA 5JS8A 4HB0A 3PQ5A 5E8JA 3T34A 1UK8A 2V59A 2V55B 4PFSA 1KDTA 4LRUA 1XMQB 1OXVA 4WKOA 1DQYA 1YCFA 1PZHA 3GK3A 3IRUA 4GYYA 2Q62A 4BVAA 3RNOA 2QUJA 3TCKA 5A9RA 1ZVQA 2WIFA 4GS5A 2P9QA 2XWPA 4ZD6A 4PW0A 721PA 2WIAA 3L7JA 5DNWA 4ZFNA 4KREA 4BEJA 1WV1A 1M6EX 5IC5A 3HU3A 2Y1FA 2VP0A 2CFTA 3BTUA 4E70A 4YCJA 4EI2A 8ADHA 2BH2A 2I7TA 3SD7A 3EMKA 5CVEA 3SQDA 4KYUA 4ZRMA 2WSBA 4YWJA 3R3WA 3SS7X 1KMIY 1KGSA 2JIRA 1BE0A 3O94A 1YGYA 3RG8A 2VYFA 4B6RA 3O9MA 2G09A 1G1AA 5GONF 5F7OA 3AESA 2RC6A 3FSRA 4JB8A 3CBGA 3ENWA 4LRTB 4JROA 3ZV7A 4J1TC 4K6GA 3WTBA 1U2PA 1KJIA 2Y66A 1DCMA 1VHJA 1YZKA 1VIVA 2NO9A 4FE3A 4YNBA 5DNEA 1WY5A 1Y9EA 5MN6A 5KSPA 1GCGA 1UEXC 4CR6A 3ZEIA 4CF4A 2W90A 1CY7A 3NRCA 4R8KA 2H52A 3K9LA 2QPLA 5CAEA 3K5HA 3ZXXA 1PO7A 2H1LA 5B6IA 2HA4A 4C2TA 3TQRA 2PFSA 2VRCD 3RYHB 1N8NA 1VJRA 2G0TA 5KQPA 1OJLA 1G1MA 3WYBA 4A8JB 5BMVA 1IEQA 1U1CA 3FLBA 4RL6A 5T67A 3HMQA 3KR2A 4M8KA 3ZLTA 1GAWA 3VV3A 5JNVA 4UUBA 3AI7A 1QNLA 4BO3A 4FXPA 3VJRA 1F6DA 4HQNA 4DYVA 1M5UA 2AK3A 3FLEA 1MC5A 2QJWA 2ZSEA 3CG4A 4BBJA 3VPXA 4DEYA 1EWQA 4E88A 3VR4A 3WRVA 1VHWA 1IBCA 2P40A 2SKDA 3ZDXB 4ZQHA 2O7NA 1GADO 4L95C 4CCSA 3THSA 1UCFA 2DHCA 4BU1A 1JUDA 3HJRA 3OZUA 4I1VA 2D0PB 3KALA 1NN3A 4CIVA 1CULC 1FFEA 2I6XA 3IPAA 4FYPA 4RZ2A 3TKYA 4TT8A 2HBZA 1W19A 1ZD3A 2FJ0A 3M9XA 2H2IA 3HXKA 3RSCA 5J4LA 1Q2XA 5H59A 4KR6A 1DKOA 1DX6A 3F4LA 16PKA 1OV4A 4DAEA 3M5PA 3O8OB 4L28A 4QGBA 3HI6A 5KYVA 3K0CC 5B4TA 3ZR4B 5C4GB 2ZWOA 2WJ3A 1FU4A 3BZWA 3HACA 4XIJA 2ZT8A 3IP7A 2O6LA 3LY8A 2W00A 2YVLA 1ZJZA 4L2IB 1KAMA 1ZC3A 1ZMBA 4R8SA 3HJTA 4L5AA 4TWBA 4LGYA 2JFFA 4BX8A 2FE1A 1SAYA 4L4ZA 4LHXA 3LVRE 1H65A 2UYHA 5IFLA 1MFPA 2IIPA 1ZPDA 5IC6A 1CF4A 2VOJA 2IKQA 3HB1A 4EB3A 1HDGO 4YAIA 1LZLA 4QIHA 3JZFA 2BFMA 1UANA 2A7QA 1HXHA 4Q16A 2AT1A 3UMSA 4HLCA 1YQGA 4UARA 5DM0A 4GFDA 3AT1A 2HWUA 5EIEA 4TYQA 2PLFA 2ZUUA 3GAAA 1FFXB 1GTG1 2V5VA 3QKRA 1JB9A 2P9BA 2ICAA 3D0RA 1JP7A 2A1UA 3JAWB 3QA9A 1CB0A 3WRYC 4MO9A 4BIMA 3AI1A 1ZI8A 1I0LA 1TUBA 3EEFA 3VVCA 1SKUA 2ZBPA 5IVKA 4LC0A 3I9V1 4RSHA 2OV6A 3K92A 3TN7A 1MXFA 2ZBRA 3WGQA 4CCYB 4GX5A 1Z45A 1DAKA 1NQAO 1JYEA 1N6LA 3BF7A 3BXPA 2X0NA 3Q3EA 4FYWA 5IDYA 4D43A 4EHBA 3UOWA 3AQIA 1NNEA 1W88B 4C5AA 2QN9A 4BKRA 3WRXC 5AJYA 4G89A 2FOLA 1Z15A 4TYNA 3IBCA 3ODGA 4QU0A 4MDEA 4L8VA 3HJFA 4Q7MB 2WEKA 1O87A 2J45A 2XDQB 2MU1A 4BLOA 2GCOB 3GGSA 3PQ6A 1XVAA 1DXYA 2JAUA 4OQFA 5CLGA 2VWPA 5EJ2A 4HQRA 4TL6A 3OTGA 4UTPA 5BSWA 1XMVA 4MRMB 3WWZA 4CPDA 1M54A 5EWMB 4JIGA 4CKZA 1WM1A 4IIVA 3A1VA 2AEEA 1RE0A 3PGJA 4EY7A 2TMDA 3LP5A 1MJGA 3DL2A 2ODPA 4PRZA 5DSXA 1CJBA 5EWJB 5AFSA 1ZAYA 1UBNA 1VJGA 2WOJA 4A10A 2F8TA 1QK3A 4AKGA 1JKXA 1X7XA 1ZIOA 3ICWA 3N05A 3PG5A 5BORA 1NURA 2AJBA 4J0GA 4TLEA 4QAQA 1O96A 5HKKD 1JHDA 1L7AA 2H5LA 4I1RA 1LBHA 4R2WA 4ENWA 1RPJA 3AJDA 3BHNA 3ON5A 4DA6A 2Q49A 3OZGA 1UJ5A 5P21A 3KBBA 2C1EA 1DAMA 5DRYA 4RY9A 2DWOA 4XM0A 1BTOA 3JW8A 4XGNA 1CR4A 1JZSA 4MRRA 3GAZA 4AXBA 4E3ZA 5CDFE 5IH7A 4A1FA 3KB2A 3OOHA 3U37A 4A3SA 3W34A 3PJGA 1A5ZA 2COUA 2WD8A 4I4TB 1A4UA 4CM8B 2AG5A 1RHQA 3BB3A 3D5TA 3TLEA 1LF0A 3G1WA 4E0BA 1YDEA 2XB9A 2Y1WA 2GYUA 1L7OA 3HZOA 4Y9SA 5A62A 2Y67A 5IJAA 4L0CA 2OM2A 4Q02A 5B6PA 1B6SA 3KZKA 2VJCA 5EUBA 4AMVA 1I6KA 1YCGA 4D9EA 5FOSA 4ZT4A 4CM3A 1XPUA 5KNCD 4MLZA 3BIWA 3DTVA 4CJXA 4LDNA 2XUOA 3ZY5A 1XAIA 2HV8A 4B81A 2FG5A 2TMYA 1YB5A 5B55A 2VDQB 3DNPA 1TZMA 2Z04A 5FNVA 5JV5A 1PT7A 3HHPA 1P9WA 4YT4A 2QL9A 3X1XA 3W2GA 4B09A 5F7XA 1E2HA 3JZMA 4LN1A 1GRVA 3DM9B 4WI1A 1VHLA 4Y6GB 5DHRA 3RFCA 1E4YA 3RU9A 2ZDHA 2J3IA 3GLRA 1S2MA 2HI0A 5JMOA 4NESA 2F1HA 2QQEA 3R7SA 4OHCA 4L85A 5E7JA 4C30A 2JKVA 3T15A 3SSMA 3VYUB 2QD3A 1LBTA 2WTBA 2C3OA 4I8XA 1ZGBA 2VG8A 3T4XA 4JVLA 4MW7A 3CKLA 1LLUA 2Q3MA 2ZPAA 2ACWA 3MELA 3FGZA 1NVWQ 5SV2A 4CQMB 2PA0A 1RRCA 1AHPA 2B2NA 3MBKA 1VCIA 4M1EA 3ZDQA 3IMCA 2AC2A 4CKCA 2YHIA 1WBDA 3IXQA 4YACA 1DPGA 3TSYA 1N9ZA 2MSKA 4Q00A 1ZK1A 5FOQA 3C0KA 1M33A 3FOEC 2DC1A 1XSEA 4DBVO 1NPYA 3AU9A 1CV2A 2A8YA 4N5DA 3T38A 2HWWA 3TQQA 4AROA 5GOTA 1GCAA 1Z25A 3IA2A 4RVHA 3BJIC 4KMRA 4LYYA 3HBLA 2P2ZA 3DW1X 3O2NA 3JQ9C 3V2HA 3QUTA 3ZKWA 4OLAA 3VNVA 4C0JA 5DI9A 4DV0B 3FTCA 3GNSA 1T26A 2IYWA 4L5YA 1EUZA 4ZVMA 2V7BA 2WZQA 3WLTA 4HZUB 1HDRA 3FIUA 4EKIA 1RBMA 5DWDA 1SHJA 3OWHA 4G1EB 4N41A 1E94E 1GFWA 3L04A 1T3ZA 4RV5A 3DBOB 1ARZA 1LXCA 1T25A 3GW8A 4RVCA 4CU2A 3I45A 4MQ4A 3RUHA 3HI4A 3TNLA 3EVEA 4D5EA 1DNPA 4DCSA 1YBMA 3D6UA 4EHJA 2C1XA 3K9CA 1QAMA 3MSCA 4O33A 4XDGA 3ZQJA 3F67A 2N75A 2VPZA 4O4IB 3UA4A 5ED4A 2P9EA 3UJHA 2XOXA 4NV1A 2WB2A 2Z57A 4Q4DA 1I3CA 4XIIA 4EEZA 4XJSA 5JSZA 1ONBA 4X7PA 4U9UA 3UJ3X 2YOFA 5DWQA 5DXJA 5EKXA 3U16A 4D56A 3T12A 3SC4A 3VYTB 1GUFA 2IHKA 1F2UB 3HJHA 3AUSA 3W5DA 1E2FA 1HFKA 2NACA 3F7MA 1WVGA 3COYA 3W8NA 4MYTA 1E9DA 2QR5A 1W87A 2WU0A 3D4IA 2ZI4A 4PX2A 2NW6A 4ERNA 3QKUA 3L0YA 3LP6A 4ENPA 2V5AA 1ZM2A 3BC1A 2B0CA 3DAHA 5CA0A 3NTXA 1ILWA 2FPUA 3HNRA 4H7EA 3PNKA 1JQLB 4DL9A 4QUKA 3TR0A 1X7YA 3RRFA 3M3DA 4QTUB 2PSDA 3GLGE 1JFTA 1U2TA 4N3GA 4WIAA 1NLZA 4AN4A 4ZRNA 4OBBA 1U9ZA 4WNAB 4YDHB 4F3KA 1K6EA 3V4LA 1W2GA 2ZYIA 3RSQA 2ATEA 3RE1A 3GP5A 5DCYA 4YJ2F 2DF8A 4YPOA 1Z0DA 1UP4A 3PENA 2XB2A 1H0SA 1R18A 3PE3A 2IUYA 4Q1EA 5FI1B 2X7XA 2PT9A 2COEA 1B6TA 1ISIA 3ULKA 1JF8A 3PT5A 1GXSB 1VKNA 3GYGA 3OIWA 2P0AA 3CZMA 2FUNB 2YMMA 3WKDA 6AT1A 4ER6A 1G8FA 2GCEA 3ESXA 5KOYA 2QP9X 4QE3A 3ETHA 1TVKA 1F6BA 1MX1A 3QPUA 5A6SA 1I6MA 4PAQA 2YTZA 1RJ9A 2DWQA 3WLLA 2QZ9A 5LC1A 1IDOA 4DRXA 4DV6B 1HYGA 4GMDA 4D7AA 1PFVA 2VKQA 3FZQA 4J0QA 2X4DA 2O50A 1V25A 2HF7A 5JYDA 1UQUA 2QLNA 1M83A 2EJBA 3DMNA 4RS3A 1BMFD 3QK7A 4M38A 1TZJA 3IBGA 2O8EA 4LYDA 2WPNA 4FSDA 2H29A 2B99A 2PSJA 4LXGA 2W0SA 5LCXA 2XECA 5E3JA 2Y1LA 3A31A 5SZHB 4IM7A 2BP7B 4MK4A 4D2IA 3IIJA 1Z7GA 2V54A 4F3YA 1VI6A 4B6PA 3T5DA 1P1JA 4R7TA 2H4JA 3O7WA 4ZI7B 1CX9B 5L9AA 1K5HA 1KYZA 3O75A 5AOAA 3TL3A 2ZYSA 3A4VA 3OH8A 1H1LB 4UM9D 2ECKA 5F12A 2IP4A 4TRRA 4INPA 2QPOA 1EP2B 3D4LA 4GX1A 4HL6A 3H42B 4WLUA 2YV2A 3M7IA 1KO4A 3WWYA 4GZ5A 2BI4A 4X8LA 3W1EA 4WY5A 2ONZA 1L5MA 2AJ8A 2QMZA 2VTEA 3LUBA 2BRUC 3NHJA 1T4MA 2ORED 1Q16A 5HZKA 3L1VA 1OFTA 3AY3A 1WMBA 5EUCA 4GEGA 4G0YA 1O77A 4BVHA 3JRWA 1I1OA 3ZGLA 5IS2A 2O07A 2JJ1D 4UUNA 4DQUA 1A04A 1RHUA 1WJGA 3KZCA 4W5OA 2YVAA 4FN5A 5BR4A 1U0HC 3C3WA 4BX0A 1WCV1 4P92A 3PX2A 2DHQA 4WVFA 3C74A 4BFCA 1BWPA 4F2WA 1EGMB 5JH7A 4OXYA 2R7NA 3VOSA 4QREA 1AZLA 3P4YA 3Q12A 2C7QA 2GERA 2G63A 2FR8A 1NDUA 2CEKA 3NKFA 4X84A 1T6YA 2UVPA 3EDCA 4YAKA 4W7IA 4MI1A 3JAKB 4WWHA 1CLEA 1UR5A 4MCIA 2DE0X 2FLWA 3DCIA 4JH0A 4V0OA 1H5UA 2QZSA 1HK7A 1N2BA 3Q3GE 3IESA 3ESDA 4BDSA 1L5LA 3FNFA 5CLIA 4BWVA 5C8VA 4EHDA 3V7FA 1Z7BA 1QE5A 4BCDA 4ARVA 4EA6A 3NRJA 5CIYA 4EGCB 4MUIA 1Z8FA 3CLSC 2P6OA 3OZEA 5BSKA 1KQ3A 1NXXA 1UBGA 2F1RA 4P35A 3KQLA 1G8MA 1B23P 3NHMA 3W2IA 4UNNA 2VHWA 3BSWA 5KX5F 4TKVA 2GVZC 2HSGA 2GN0A 3RVSA 3K2QA 2WZBA 3D3NA 4GU5A 4BV2A 3LGXA 3IQIX 3PXXA 1BIFA 2F1KA 1EJ2A 1II8B 2ENWA 3IT2A 3OECA 3Q8WA 3AM4A 3UANA 1QFJA 3KYDB 1J21A 4GX2A 3TZKA 4RV9A 1IIRA 1IHOA 2QRUA 4S24A 4R2IA 2XNJA 4UUPA 1YAHA 1Q44A 4WKNA 3B78A 3VQTA 2Y2VA 1BYIA 1SQ6A 3Q0TA 3C3AA 1LPBB 5C35A 1FK8A 3L0IB 5GJCA 1SRQA 1XTBA 2VSOA 3BHJA 1QYWA 2P4UA 1LDYA 5FA6A 5E4JA 3IOBA 4D0SA 1VE3A 2IS1A 4BUJA 4CM9A 2PM8A 1DQSA 3OPNA 3UIEA 2Q50A 3UH1A 4D4GA 2IHTA 1XTKA 5DNUA 2QTHA 5EP3A 1PJ2A 4BE4A 1V4VA 3NM4A 4K9PA 2HCBA 2XD9A 3AEQA 5EHNA 5EJ4A 1WVIA 4AO7A 2EC5A 2YL2A 4KL8S 1H3FA 1SUWA 2CEAA 4MMXB 4PX3A 3ROTA 4WBNF 5K4GA 4TMYA 3ZJVA 2R751 1Q11A 4O2BA 3O1IC 1B73A 1JILA 5CNJA 3HA5A 2LCIA 3L1UA 2ZAOA 3M6IA 3VR3A 3AIIA 2QMOA 3EULA 5EMMA 4OUDB 5C5IA 5KNDH 2BEJA 4II2A 4E11A 4K9SA 3LFUA 1T35A 2Z98A 4V39A 4KDEA 4GR5A 4Y2YA 3FROA 4YP0A 2WWRA 3LT1A 4AVYA 4QQRA 5D8DA 5IJ9B 1SH7A 1JSCA 3LJKA 5CURA 3O8DA 1S2IA 2PJDA 3I64A 3SSNA 4MWZA 1SQGA 3TPFA 2ZIGA 3FWHA 3UJCA 1IZ7A 1RQ7A 1T2VA 2H00A 4QT4A 4GYKA 2XNDD 3WHLA 3CUYA 2OHHA 1XAGA 5LQAA 2A5JA 2GPWA 2VAVA 3T6KA 4YV0A 2VXYA 2YH2A 2VPXA 1XD8A 3C24A 3TVYA 2OV2A 4M9ZA 5BR8B 1BH6A 1ATZA 1BVUA 4JASB 5JWHA 1NLMA 4RL4A 1PJ8A 5TGTA 3ZWDA 1GQQA 1MQSA 1R8QA 3ME5A 4UC0A 4ZI3A 4BGIA 2ZCUA 4EHNA 5G3ZA 5BOVA 1NXOA 1BMTA 4KRYA 4RH0A 4EJ0A 3ZWOA 1MMFB 2B0JA 2Z9BA 3KZVA 4Q1CA 3ZW7A 5AUOB 3C8HA 4AYXA 2PZEA 3FFTA 1MDFA 5E4FA 2VXCA 2GUGA 4EZBA 5I7EA 2Q3EA 1E0JA 4HNAA 1HDCA 4KPUA 4UUAA 2IODA 1ZK4A 4W5RA 3ZD7A 5HUQA 1WA5A 2A9VA 1XD2B 4LY3A 2PD6A 1NIJA 3PDIB 5K01A 4OXIA 3OLVA 1HRKA 1KBOA 2DTXA 5GONA 2JFGA 1ZNZA 1VL1A 1EB9A 5EJMA 2QW0X 1BVYF 4XVRA 1P7VA 2Y6UA 2ZIFA 4ZO6A 1UK7A 3ZS9A 3N9IA 4B8YA 4BV9A 4EFKA 2QP3A 2GJAA 2W4QA 2Q7OE 2EQ5A 3B8HA 1WPQA 3VO2A 3ROQA 5KU1A 3G8BA 2YVQA 2NTYC 4M1QA 2EJUA 2ID9A 3B82A 5D7NA 2GZ1A 2QU7A 5DNYB 1SD1A 3OTOB 3RWBA 3KJZA 4IUBS 2Y1KA 5L3SB 2IDJA 3NVDA 5C37A 3I12A 4N39A 1S8OA 4BLQA 3O92A 1NNLA 4TV9A 4KI0A 1EFKA 2HBQA 2ZQYA 4V0MA 3BH6A 5AM3A 3DBRA 1NLYA 1ZXLA 1Q3KA 2NXEA 3QX9A 4H7HA 4OLJA 1S8AA 3S8MA 5EN4A 3ADPA 4NFSA 3GFGA 1CUWA 1XHLA 4FKBA 5ENDA 1K6JA 1VKJA 5HF5A 3AEYA 4X63A 5FUMA 1XRMA 2FRDC 4TQ9A 3PHGA 4NFYA 3TZEA 2G08A 3TXYA 1QVWA 3WVNA 2HMTA 3Q88A 1NXQA 3VDMA 5FTMA 5CD1A 2PZ8A 5F4ZA 1JAXA 1XN4A 3ODPA 1NYQA 1UK9A 8ABPA 5DKFA 4HPXB 2ONCA 4UFNA 2QENA 4HWOA 2HBYA 3NBKA 4ROSA 3NU1A 1VOTA 4Q66C 2IYRA 1TTHA 3AUUA 3VOTA 1YBFA 5EJ6A 3W90A 2QPTA 1WR8A 3LQRA 13PKA 3G0BA 1G20A 3LW7A 1NG1A 3ITDA 4B34A 4Q4LA 5KYYB 3HDVA 3COPA 4RZQA 1FRFS 3ROXA 4AN0A 5K6TA 1VG9B 5HFAA 1OH5A 4F3TA 3KSAC 4Z9AA 5HKBA 1ZXBA 1E2KA 4FMDF 1PTJA 4HQ6A 3CEPB 3KS9A 3JQGA 5JFTA 2QI9C 2BF7A 1A9TA 3AONB 5SY6A 3S2YA 5JI3E 1S7GA 5JIBA 1J39A 2EYQA 2XF8A 5C53B 4RJTA 1RHRA 2IKSA 3DV2A 4HNHA 3OU2A 1QHEA 2YBDA 2DZDA 1SJ9A 2H5EA 4X1YB 2JANA 4DXAA 5IJZA 4FE4A 2B69A 5JCXA 2PX4A 1Z7WA 4YMIA 4LOAA 4CMIB 4LE2A 3ROZA 5HQ3B 1TRKA 1LPMA 1I4TD 3MCUA 1KMNA 3OUZA 3WFJA 3PYMA 3FGPA 3OG9A 1FX0B 4PZZA 2I4IA 5CHEA 4B73A 3QVXA 2WM8A 3BFKA 2C2BA 2WLTA 3OVMA 3A6HA 1JB1A 2RGYA 3TS1A 2XGMA 1NTRA 2GTIA 1RHJA 3U9TA 5K05A 3KQMA 4EPVA 4LDRA 4ML3A 1Z0KA 2PG3A 4IHJB 4B3JA 1J5PA 2Q4BA 1WABA 2P9YA 4GZLA 2O8BA 2CUZA 4MLCA 1TKCA 3HGQA 3P97A 3DDUA 4EARA 4JJAA 5BN4B 4MO2A 4A82A 3BBLA 3PXCX 3JD3A 3OSUA 4BNFA 1E1CB 3K70D 3IPRA 4TV8B 4ND3A 1SXJE 2V7WA 4DPKA 2EZUA 2P5TB 3KOZA 3NOQA 1R15A 2APJA 3A1EA 4OJNA 4LF6B 2QUZA 2YY7A 4Q1BA 5BN3B 4WADA 2JIZA 1FXWF 5JHHB 4XM1A 4O08A 2PKEA 2MCFA 1RM0A 1RXEA 3UV7A 1WXWA 4ZAFA 2BR5A 2VEDA 4DQXA 1IBLB 2RAPA 3KWMA 3QELB 2PKRA 3Q7TA 3GJYA 2YW2A 4QOSA 4TRMA 2Y77A 4RADA 3RYFA 5HTOA 4ARCA 1KO1A 3NGMA 2ECQA 3K9WA 3LRTA 3WZMA 3EX7C 1ISPA 2O3SA 3F4BA 2JGKA 3U0BA 1R5OA 4JVMA 2VSFA 3RIHA 4NG5A 4B46A 4G1BA 1FMJA 4F5DA 4IDOA 4MUEA 1MJNA 2JHFA 5FHRA 2RGEA 3NDBB 1G16A 3QYJA 1MAHA 3RTAA 1C3EA 4H3VA 4K3VA 1EK1A 3ZW8A 4EENA 2I91A 2QDXA 2K6GA 5IABA 4TN5A 4YECA 2QNBA 2I54A 5I4CA 2QRJA 4CL8A 5TPWB 1C0PA 1JG4A 5JNTA 4JT2A 5T8KA 3H5NA 4IFEA 4OYYA 3V1LA 3E9NA 5AVWA 2KM1A 2R7KA 1OTXA 3SHQA 3VMFA 1KVUA 2WJIA 4WFQA 2X42A 3EGXA 5CGQB 4YROA 1ZSNA 3L8FA 1PDVA 2PLNA 4PRLA 4CEJA 4PSUA 2PWAA 2NSHA 4RXUA 1BGXT 3W2HA 4YMSA 2BFBA 3OOSA 3KYBA 3Q87B 3C1TA 4J0FA 4AD8A 1JLLA 2AYYA 4E31A 3G2QA 3PYLA 2R86A 2ZWMA 3Q85A 2H9IA 3WA7A 4AIIA 1M2VA 2R6DA 2G88A 5JROA 1AX9A 4DV3B 1YS6A 1IXZA 3WGLA 2YHBA 3K6JA 4XA8A 3TXXA 1J70A 1F17A 2X3UA 2ZLBA 4HADA 4GR4A 4LY6A 4BRUA 3FOFC 3U80A 2FWJA 1HDOA 3EPPA 3FJYA 3WSWA 2QZZA 1KZ6A 1BDBA 3QLVA 2QVGA 4I3HA 3U3JA 2WU3A 4TL8A 2CHEA 3FHJA 4N18A 4MP8A 4W5TA 5ALHA 4KQXA 2OHFA 2FU5C 3F9CA 3HY3A 1ZWLA 4LDJA 4KQKA 2ES4A 2PZMA 5HZHA 2F48A 3ZOKA 2ZTHA 5EWLA 1RXIA 4RBNA 3GJSA 2GXAA 4HUQA 4IDFA 1TADA 2Y0CA 2PO5A 2WTMA 2X6RA 3GWGA 3M4YA 4GXNA 4R2KA 1V1JA 2DJIA 1MJ5A 1E9BA 4U0JA 2FPWA 5IZCC 3CW9A 2ZYAA 3LUFA 2NUTB 1QV7A 3AEXA 2H1SA 4R40A 4OF4A 1ISFA 4PC1A 1QIGA 3R9XA 3G8YA 1SWVA 4OMFG 3G9XA 1QZZA 4U4AA 4YR9A 3VNBA 4IWXA 1XMIA 4BQQA 4E32A 3R5SA 4BMCA 4J1SA 4Z7QB 1P5JA 3SX2A 1S9DA 4BNVA 2QAGA 2YINC 3E03A 3FSJX 4I9NA 3ZWYA 2Z6VA 4EZIA 5JBNA 1L7PA 1XEWX 1TTPB 2REOA 2QLTA 4C0XA 1JQAA 3MCAA 3JZIA 5AM0A 3AVXA 1PGOA 2ZRFA 3R20A 4KWHA 3G9ZA 3IXMA 1EP9A 4QVIA 4AJ4A 4F96A 4ZO4A 5LDHA 3PRKE 2P2YA 4ZMSA 1YS2X 3OLCX 1J1ZA 3LYLA 3PPIA 2ZU6A 4F8JA 4C5BA 4MWSA 1GFSA 3HWWA 4LEIA 1YU9A 2PTGA 2V6MA 2O1EA 3AHJA 2AOUA 4YV1A 4EJ2A 5J2UF 4W9MC 2FF5A 2UAGA 3L0BA 2XZLA 2VH1A 1HNZB 1Q6ZA 2J3HA 4J6FA 1ISJA 2WYVA 4F2GA 3HN7A 1JIQA 4IWYA 2I6SA 5BWCA 5J4YA 2BI8A 2G9QA 2XXBA 3IUNA 2IT1A 4AWBA 1GPAA 3UKJA 4IG4A 4PQFA 4IJQA 1CWUA 1T0JB 5A5EA 5AVRA 2FR0A 4FJ1A 1OZHA 3ROPA 4D6XA 2RE8A 4XFJA 3QQPA 4FFSA 4NCHA 4AMZA 1N6OA 1QGED 4QXRA 2C5EA 1W47A 3CKKA 1ZCZA 1VP3A 2AUMA 3KZOA 3IMGA 2QGZA 1M5TA 1YB7A 3L82B 1HETA 4PGAA 4UM7A 3F7TA 5FBKA 4ZVRA 1RC1A 5BYAA 3D8BA 2P2SA 2O59A 4BFTA 5FBWB 2Q4DA 2BE7A 2DKNA 1BNCA 1OASA 2AX4A 3KQYA 1TD9A 2WIKA 3G85A 4HGQA 2IEYA 4EYSA 4R83A 2G1JA 2JFNA 2OCLA 4ZTZB 3A6GA 2IHNA 4QTZA 2FAXA 2WJZB 1XDSA 3Q72A 1WMSA 4W1QA 4WOBA 3ABRB 3FBGA 4QD3A 3UF0A 5AW3A 1BJKA 3D6MA 4LF4B 4R7GA 3L7OA 3KR0A 4HG2A 3AH8A 2ZI9A 1L3IA 2C07A 2CLEB 1HDEA 2Q9CA 3QTTA 4PHFA 5KQMA 4G0UA 1EUCA 4D8WA 1DEOA 1NR1A 1LK7A 5KYWA 3CO0S 2WOOA 4V24A 5COBA 3BAZA 2W2PA 3OZSA 1Q5PA 3OBBA 3EYWA 1ODTC 4NEQA 5AJVB 1GNLA 1XCMA 5AYVA 3AI2A 4UHHA 3EEOA 3UAWA 2J09A 2RMKA 2E87A 2XT9A 2HPHA 3U39A 2Q5FA 4MINA 2YV1A 1W2HA 2RB4A 3A1CA 4UPVA 4C6TA 4G5YA 1LNSA 4D4IA 1QQBA 2H07A 4DMFA 1X15A 3EXG2 4NIMA 3UT6A 5IFKA 2EZ9A 3C3DA 4HAIA 1KY3A 4JUDX 4UBKA 1CIJA 5HRCA 5J4VA 4RJ2A 3U7HB 4KO2S 3O5AA 3NIDB 1ML3A 1DO8A 1VG1A 2J0EA 3K5IA 1N9GA 4I8DA 4RK0A 4CDGA 2H1OA 3GLFB 1VIAA 3BAFA 3EJ6A 3WLOA 2B7CA 4BVGA 3F3KA 3T9EA 1L1QA 2B20A 1AHHA 1QB8A 2PCJA 2VPQA 3A4MA 4PBSA 1HNXB 4PXSA 1HNNA 1DCTA 3GROA 1ZZEA 1GWNA 3N2NA 3AM5A 3NXKA 2LZ0A 3E18A 2JJYA 1Z7EA 3LQ1A 4LRXA 4UAUA 3ZN2A 4AYTA 1IHYA 4CF5A 4RGBA 5JANA 1Z5ZA 3EIQA 4BXOA 1YR8A 4WBSA 4N47A 4B6GA 4DZRA 2CFSA 4AUEA 1V3QE 2GVDC 1QO7A 1QHIA 3VJMA 3H0EA 3PFNA 1HE3A 2SCUB 3I92A 1CXZA 3QNUA 3BZBA 4OSOA 5DGIA 4H6WA 2WAAA 1QFMA 3QHQA 4O5OA 4CI9A 5C5CA 3JVEA 4JLAA 5FA8A 3EUAA 2GK7A 1E3QA 4ZYTA 4YRIA 4QU5A 2AWOA 2CNWD 4OXXA 4DNXA 5A2QA 2XVMA 4IIHA 5DZSA 3T4EA 2NO4A 3WLRA 1VECA 1NZJA 3QXCA 5AHXA 1LTHR 3A6ZA 4PO9A 1VLZA 4NCIA 5J59A 2OZLB 3MBIA 3PFWO 4ZI5A 8LDHA 4X3OA 1U2DA 1PLLA 3GBVA 5H9WA 4MV7A 4Q15A 3UT5A 5K3DA 3AB8A 3BTOA 3GV0A 4R69A 1FQKA 1FSFA 5JCOA 4H59A 3RIMA 3W04A 2GO7A 4YMLA 4XLZA 2HHJA 3HDTA 4O0LA 3B3GA 5BUSA 4IINA 4NFHA 3PD7A 1EGAA 1P17A 4GPTA 2XOEA 3HKBA 2X1LA 5CCDA 4YFYA 4G5SA 4L73A 5DTJA 1MEEA 3EASA 4NY1A 1NBWB 5CX4A 2ERXA 2Y27A 4M1YA 2PQ2A 3JZDA 3KD3A 5JEEA 4BFVA 2OESA 1J07A 1P1FA 3KPYA 4KVFA 5BR1A 5AVJA 3PXDA 4OM8A 3P4UA 3HLTA 3R3SA 4AUNA 1U0JA 3DMYA 1ZRNA 2IVFA 4TWAA 5F3WB 2JGIA 5KX5A 5JCJD 1BMDA 1VGQA 2G8NA 4FBMA 3FPAA 4UMEA 4UW9A 4CLOB 1TCBA 4WCFA 5FPKA 1IBMB 1KXJA 2ZJOA 1A98A 3DDWA 3LWBA 4M8NE 1DUIA 3OQPA 2WJJA 5DLPA 5TGZA 4W5HA 3FHCB 2WFMA 2ZATA 3E22B 5JJKA 2GF9A 1E2PA 1PS9A 1UQRA 1GZ5A 1ADBA 3CS3A 5C7IO 5IDQA 1SCQA 2A4MA 2PMBA 2WRZA 2M98A 2YMPA 2YIJA 3GMTA 1GPMA 3M3PA 4QARA 4C0WA 1PTKA 1MNQA 4CNBA 4Q4CA 5CCXA 3SVZA 5LUAA 1QYRA 3NWBA 1U02A 2F3UA 1Z0IA 4FHDA 3DC2A 4YLGA 1E3JA 3HXTA 4O4LB 1P45A 4GZMA 1LS1A 2GHTA 4YXWA 4FE7A 1C7JA 1O2DA 2WV9A 3T3HA 3JQAB 1WZUA 2H1IA 3CSDA 1IWBB 4HLDA 1CU1A 2V7QA 3PXAA 4M37A 3SF8A 3UC9A 1LDMA 2C4TA 4BNUA 4DSNA 2YC2C 4QYIA 5I7OA 1W5TA 4MW5A 2PX6A 4B48A 4LDAA 4V1CB 3FTDA 3NTOA 3FETA 4H18A 3ELUA 3H2BA 4EF6A 1ZL0A 2WD9A 5C1PA 2RKOA 3NBZC 4AF8A 4UATA 1XZNA 4JOSA 3ZGOA 4ZCTA 4L4YA 4YP9A 3SEAA 1Q19A 1I4LD 5K3FA 4B4VA 4ZOBA 4FILA 2RDMA 421PA 4E6EA 3GPCA 4JHXA 1V4NA 4I5GA 4L72A 4NAHA 3VH2A 5BV0A 2NZ2A 3GYBA 1D1PA 5IWCA 1LKZA 3ZIAD 2BCGY 2BFFB 3N39C 1IM5A 5IF9A 5L4LA 2RH4A 2FV8A 1QYDA 1JFRA 1T0UA 4MS1A 4A9AA 1TLLA 3E9DA 2TRSB 3ETCA 1PJSA 3WGHA 2SBTA 1C80A 5LJIA 5BN5B 3D7MA 3MINB 5B3JA 4LQCA 5LP6B 3GGPA 2A9PA 1XL1A 4HDNA 2VBFA 3QF4A 2MYUA 2PAFA 1C8KA 4LX8A 1GG5A 1QUFA 3FVTA 1N2IA 3O4GA 4DVGA 2FQQA 4KKXB 2VWQA 3KLBA 2C58A 2DUWA 3KC2A 1VL8A 5IAJA 1ZRHA 1GU1A 2AEFA 1WSWA 3MS7A 3A1TA 1JDJA 4J2OA 1P7ZA 1W7AA 2IYTA 3FPJA 1SCNE 1TM5E 1FP1D 5EGSA 4OFBA 3E7XA 3TBFA 2VT7A 1KY2A 1LX7A 2WUFA 3JWJA 3UICA 4DBZA 1VBMA 1N3LA 2FGJA 2R8EA 2XR1A 3KHUA 4UCWA 4WBNB 4BFUA 5C4IA 3FGNA 5JZ9A 2R6R1 1WP4A 1R8SA 3AW8A 3OJ0A 2HLDD 3KHKA 2JVJA 2CY0A 3HVIA 4MJ3A 3SHTA 4IOLA 4DA8A 4Z54A 4JGGA 3T3OA 1DVRA 1BS1A 1Z28A 1PG2A 3K16A 1SU8A 3N2YA 4RKRA 5LXTF 3TNJA 1ENZA 2JGEA 1H4TA 2MIIA 3V00A 1OV6A 4KV9A 3NEPX 1RAHA 1E0DA 1RXUA 1XMPA 4N01A 4D3XA 1C9JA 2A9JA 3CVYA 4DLVA 4TS3A 5FLKA 3O4RA 1J4AA 1WTAA 3PGA1 3BD9A 3QGMA 4CCWA 2IH2A 1DG9A 1J7JA 2BLNA 2CYCA 2D2XA 2GOYA 5CNKA 1XVLA 5JYCA 5ERYA 2J3QA 4P2GA 1TEZA 3IL2A 5H3CA 4QGGA 1SO8A 3J81k 1FMFA 2XTZA 4UTNA 3H19A 5C7YA 4W5QA 3PQEA 3JALB 3EVFA 2OB2A 4P2BA 1ECCA 2P3OA 2VJNA 4PG4A 2A5FA 2KJQA 1C7QA 4AX8A 1QFZA 4ARIA 3JX9A 5IZ4A 3KXIA 2O3UA 5AXDA 2HRRA 1ETUA 1GEGA 3MMPA 3TLKA 4BVLA 4DHWA 1GD1O 2PUJA 1U8EA 2WSMA 1VFNA 1WU7A 3V1MA 2H5IA 5DT2A 4ZOQI 5T7BA 4ER0A 1VC2A 3RK1A 4M0LA 2VRNA 3HEBA 3JYQA 3EFBA 3H8VA 4Q5IA 5D01A 3R3YA 3UGKA 2B7BA 3OEED 2BYTA 4Z8YA 2VQSA 4L8FA 4X9XA 1JDUA 1NP3A 1PJBA 2J0VA 2Y4NA 1T6NA 3EMVA 4IGFA 1JQDA 1QGOA 1O08A 3V7NA 2FWBA 5C8XA 1HOTA 2O19A 3MGKA 1T3HA 3DE5X 3FYUB 1QG2A 4YJ2B 5DXAA 4DLNA 3IVAA 4C4RA 3SOPA 1M10A 1U8FO 2VQDA 3E53A 1KY5A 4HN4B 3GQVA 3N0RA 3VTFA 4DC0A 4GI3A 2WYWA 4U2KA 2IPMA 3NX4A 1SY7A 1ORWA 4GXTA 3I1YA 3T4PA 1JL3A 4K8RB 4KQCA 1E32A 1G0OA 4PZCA 1LK5A 2DQZA 1EFRA 4YJ3A 2ISCA 3BMNA 3HZHA 3RC1A 3SJAA 3N3AC 3WL3A 1TKRA 1V5IA 2YICA 1JHUA 1QVRA 4MIYA 2XCRB 5EJIA 1XQWA 3R5JA 4LYFA 3MWJA 5KSOA 1CJUC 1SIUA 4U5XA 4KYVA 1Y8QB 3DQQA 5JAPA 1QQ6A 3R09A 1DC6A 2XNSA 1RLIA 1V9LA 4OGFA 3FW1A 1UF9A 3T0GA 4OQDA 3GLSA 5HKKA 5FQNA 1AA6A 3G89A 3TI9A 4DA7A 1NF9A 2Q0SA 1UC8A 4CLRA 3UK7A 4V02A 2YKGA 4HGNA 3S1LA 4J49A 3SZLA 2E5LB 1IU9A 1PFQA 1A2QA 4OTZA 3ETJA 4YDRA 3IS3A 1BXRA 1K4MA 1KA9H 5AJXA 5AOBA 3TH5A 3OFKA 4YMTA 3HLKA 3P0EA 2OHIA 5U9CA 3NGXA 4IDGA 2L82A 2ZYGA 1C3OB 1TAGA 2I3AA 2R7MA 3IAUA 1UJ6A 1XZCA 1I6WA 2BFCA 2RHWA 3B60A 4FEEA 1O5IA 4YCCA 1HZZA 1WO8A 3P5SA 3DZKA 2QNIA 4UJ5A 1GIAA 4EGAA 5AW4A 1PNRA 5C5EA 4TT3D 1YFJA 1K06A 1X7ZA 3JQ8B 4UVHA 3T7JA 4AJIA 3EEYA 1KP3A 3LKZA 3U4QA 1XEXA 4R1TA 3AP1A 1NBIA 1G5TA 2V45A 1SB8A 5EJAA 4CV1A 2H9YA 1CEYA 2GKGA 1ZI9A 5DNVA 3U13A 4LNAA 1M34E 1K7CA 1XX6A 2MJLA 3E7PA 4QAJA 2PKQO 3M9WA 3IV6A 1JA0A 2PD3A 2ZPTX 3QEOA 4MVJH 3RIEA 1DT3A 4CR7A 4QECA 4EA8A 4RH1A 1JI0A 2XQGA 1E59A 1T3GA 4CM5A 4LHVA 3PE4A 2P1DA 1RS0A 2ZAYA 3FX2A 4BU0A 2CV2A 5C52B 3V1YA 4RKYA 1UWKA 3PF9A 3PQ4A 2PXHA 3KKOA 1NJ5A 1IHXA 5KHAA 2IXGA 2QLJA 4UEQA 5AKIA 5ADUS 1WG8A 221PA 2J67A 3AF6A 1B8NA 1CEEA 4J1TA 1U8TA 2GWRA 5D84A 2I2DA 1TMOA 4CM4A 2BSQA 1P75A 2MSDB 5J23A 3GLHE 4DTIA 3QLUA 3FMFA 2FW0A 2W6CX 5LN1A 5IU6A 4ALKA 4CKBA 1CK4A 2PS9A 1CPYA 1ISGA 1NYTA 2NV6A 3VVLA 4NHOA 3E4CA 2AHOA 4ZQFA 1RW4A 2NUPB 3L6EA 1NN5A 1OLXA 1UBTS 3AR5A 4ZOLA 4EVSA 1RRGA 5K8JB 3OU7A 2GPJA 3VR2D 2GN4A 3K8YA 3FNGA 2HIMA 1KH2A 5FBHA 4MW2A 1ZP6A 2CMFA 1IY0A 1UWLA 4J7AA 4CLEA 5L45A 1FLDA 1GL6A 1M2EA 4RQTA 1Z6GA 1DTWA 4NONA 5IX8A 3VPDA 3RVKA 5I7VA 2EDAA 4WCDA 4DCUA 4D26A 2YJ6A 3VZCA 1EMDA 2AD1A 1SC9A 2VS1A 3DKPA 5KYUA 4MS4B 2H6EA 3URKA 4LZWA 3STVA 2QEQA 1E7QA 4NABA 3DOUA 3OMWA 1Q0UA 3SR4A 2CLOB 2CE2X 2W2OA 3HBMA 3ONFA 5KB3A 4KSCA 3VM6A 4BE7B 1JR6A 3MJVA 3R3HA 1YFZA 3BULA 5DW0A 2QE7A 3EQ6A 4FT4A 2ZAGA 1FUKA 2B4AA 4G4SO 4C0KA 1RI5A 4IIBA 3BMOA 2BFAA 4D3YA 2M6SA 1E1MA 1KEZA 2J07A 4ZOEA 2W22A 4MUJA 4AURA 3ASZA 3DDOA 2WHYA 4CQJA 5DJ5A 3K0CA 1QZXA 3GH3A 3TDNA 3RUPA 2I78A 4G1FA 2C42A 5H81A 3QU5A 4LZJA 2H7YA 3DL4A 2NVUB 4AFNA 5CBPA 1BXKA 1IHPA 1X9GA 3L7IA 3MT7A 2K2WA 1N5JA 1N5MA 2WUEA 2ZROA 4KUEA 5FYQA 3MOGA 1WUKS 4RTSA 3KKPA 5KOJA 2VQFB 3I42A 4G65A 2VHTA 3JQ7A 2Z6UA 3PF8A 4II3A 4KUGA 4YGYA 2Z6AA 2YZGA 1M2GA 1U9CA 1XZEA 2OV1A 3L8EA 2P6RA 4DR4B 2NU6B 4QQFA 1V6AA 2WNIA 2JFBA 3F1LA 1OHHD 3ZTWA 3RJ5A 4EH1A 1YDFA 3G02A 4C3VA 4TTTS 3P0FA 2OO3A 2GJ4A 3QVLA 3H5VA 4MEAA 4UU8A 4PLZA 1U1DA 1I13A 2O2HA 2P3QA 2Q07A 1C9DB 2F43A 1RYYA 2XVZA 2F2TA 1HA3A 5G0TA 2GAFA 5J2UA 9MHTA 1WB5A 5FIUA 1DCKA 3LT5A 2GK4A 3P96A 1D09A 1AMUA 5FADA 3MW8A 1T5OA 1NXTA 1X3SA 2Z2YA 3ESQA 4RDIA 1YI0A 5G4LA 3ZD8A 2WIGA 1XNGA 1KPGA 5JW6A 4R8LA 4C3UA 2QU8A 2XGSA 3C41J 2UZ1B 2GA9A 1H2AS 3M1IA 4FCTA 4EFNA 2L0XA 2VNAA 2BFWA 1DAHA 2XY4A 2HGZA 2ONJA 2WJAA 3I04A 1NUTA 1N2CE 2II6A 3F2VA 2BUBA 4U7WA 1VBFA 2EGUA 1QP8A 4LOIA 3VR5A 4Q3OA 3Q7EA 2WWHA 3B1KA 5DLEA 3FVVA 2BTQA 1R4NB 1DZ3A 2HRQA 3HXLA 4IXTA 1UZLA 3JASA 3HB0A 4PTZA 5GMOA 1QK4A 2LE0A 2QX9A 1O0BA 1PX0A 2VUIB 2DX7A 4KXMA 2BGRA 1DADA 4TZ6A 4CFZA 3L8YA 3HKCA 1ZNYA 2ZIZA 4FIZA 4PNPA 1RWBA 1C7FA 3NUGA 2IHUA 3HCPA 1UFOA 1NU6A 1FTYA 2EAUA 1P9RA 3IGFA 1S4MA 2RBKA 3EZYA 4FGKA 1TQ6A 4Z4EA 2IBMA 1Z74A 5LQNA 2UYCA 4UTVA 2C77A 3OY7A 4GZ6A 3W2FA 3HB5X 3EC2A 1K27A 2RHDA 2ZRQA 4ND1A 5DPMA 3NEAA 4MUKA 5EFOA 1VJ1A 1RMYA 2A0YA 3S2ZA 5EQTA 1ZH2A 2RHOA 2D3TA 4ZC8A 3O6VA 4BMDA 5DXFA 1ULUA 2IY8A 2EG9A 3GEEA 2PSHA 2M32A 3IEXA 4GKAA 1RIIA 4LFBB 1VHTA 3ABZA 1UJNA 2V4ZA 3W3AH 1RMTA 2D00A 3EFEA 1R9MA 1CUCA 1UMBB 4EVIA 3AVPA 5I47A 4F9FA 3GJ4A 3ZUPA 1LBQA 5B58C 5A5FA 1C5KA 5K4HA 2B1RA 2Q2VA 5E7QA 3UK6A 2GN2A 4TRNA 5EGNA 2AG8A 2QSZA 2CXQA 3DTTA 3QUCA 4DJEC 4ZV9A 1G8PA 4A8TA 2ZRIA 3LQKA 5DBIA 3EGCA 4EY8A 3GLTA 3L7DA 5HX7A 1IOLA 5JWOA 1SOMA 4IBOA 3IQHX 4RMIA 4D9BA 3KUCA 4G5XA 4O29A 3I6IA 1JDSA 3B38A 4I99A 2WAXA 3FHLA 4BEBA 1QYCA 3PUXA 3R9KA 3I2YX 3R0VA 1SVNA 5EZSA 3ND9A 1X7WA 4X1IA 1B0PA 3S44A 2GNAA 1AVTA 3GFVA 3E35A 4KU4A 4EUHA 4ZJUA 1QP0A 3SK0A 2UZ4A 1R5BA 2RSLA 3ZV5A 2ZS9A 1J7KA 3LECA 4LYGA 3WAJA 4F3CA 3KP1A 3HV0A 2X5JO 2YFQA 3INRA 5JI2E 1WOYA 2PRJA 5LQCA 3IEMA 3DCJA 1DKQA 1R4MA 4PBRA 5TQ2A 1U90A 1FS6A 4N7MA 3ROKA 3ZU5A 1W9HA 4ENQA 4EHLA 2C9YA 4LWZA 4RDCA 1BU8A 1U1FA 3FTEA 3DXZA 3WQRA 4Q18A 4Y2QA 2QR2A 5U1PA 4PC3A 3RVQA 1O97C 5FP0A 2EP7A 4NPAA 1WCWA 4L15A 4MAAA 1DGQA 3W7VA 5A9TA 1P7CA 4GBMA 3WNQA 5IVPA 4F60A 1COWD 1A5BB 1GUYA 3HNOA 4KQ1A 3PLAE 3FPLA 1KHTA 5HIIA 3N86A 2EG5A 3LNTA 2Y1GA 4V0NA 4WZBE 1DXOA 3RFXA 4L16A 3QYPA 1J1IA 1I4EB 2J5XA 4DIEA 1UMCB 5FBQB 3LK7A 3INTA 4IIFA 5HWSA 3W5UA 1IQ0A 4DHEA 2IF0A 5GTDA 1Q92A 3ITNA 1GO2A 4Q05A 4DDUA 2NVWA 1TEVA 4INJA 4YP5A 1EX7A 2XMRA 1YDHA 3JWEA 1R66A 4AJ9A 3ED5A 4URXR 3TRFA 1SU4A 4NBTA 4PO1A 3PYXA 2H59A 5JU6A 2BR4A 4B7AA 3RC7A 1A7UA 1W46A 1LX6A 3X1YA 4NL4H 3TZLA 2E4XA 4JLUA 4C7BA 1N33B 2RBGA 1I32A 3ASVA 1SIOA 1SXJD 1JWBB 1NC1A 2DY1A 3RSLA 1VKOA 2FPPA 1P18A 2HYIC 4IMIB 4EI8A 3U60B 2XRZA 4BB6A 1FLVA 3KSRA 1Z6TA 2DUJA 3B3FA 5J5VA 5EUMA 3PJEA 3AHEA 4N49A 5CTJA 5IXJA 3HYNA 2A84A 2BKEA 1YJAA 1MENA 3HGMA 3LBAA 5HDQA 5TMBA 3J81A 2WWYA 1QH9A 1X8XA 3C45A 2YMQA 2QN3A 3K94A 1DMSA 1U0OC 1C3LA 1W52X 2DULA 3MT8A 1ZONA 2Q5EA 1PL8A 4RK5A 3R7WA 4DVJA 1LEHA 2R0QC 2AZXA 4MQFA 2PY6A 4OIFA 2OOKA 4U7GA 3MS4A 4YI3A 1FSSA 1M8GA 4H7FA 2VPYA 3G2NA 2FX2A 3HO8A 3O3CA 1GGJA 2N9UA 3TW8A 4IL5A 1KSHA 2R4UA 2VWGA 3L1JA 1RWNA 3FFWA 4H9GA 4GLJA 2QT1A 1YBVA 4XUGB 1BE6A 3G2IA 1SELA 2BBOA 1UH5A 4MUGA 3G5UA 1TUIA 5YASA 1MABA 3I4LA 4DSZA 5TIIA 3Q1LA 4GIBA 2CF6A 3MEQA 5TF0A 3JXEA 5DYYA 4RF5A 4QBGB 2C4HA 3FWPA 5HMLA 1IONA 5JWRA 2WQ6A 1HYBA 4KX3A 2BSAA 3EA4A 4EWLA 3NTLA 1KORA 2ZI6A 4JLVA 3MJRA 1XXHE 4RGYA 2GD6A 1U8XX 1AQ6A 1D0IA 3N07A 4OBXA 3ADBA 2F8LA 4BFWA 4O2LA 3B6KA 2FGKA 4ECEA 4XWAA 2XOKD 2BM9A 1ZGGA 4LJSA 1TC1A 2ZBGA 1AGYA 4ARBA 2PUEA 2G0NA 1L4LA 2DSTA 5HJ5A 3GVIA 3DEZA 4YJDA 4BWYA 2LBPA 3I6ZA 1GUZA 1D2NA 3DOEA 4DMRA 2ABWA 3SJZA 3VSCA 2DWCA 3LY7A 4OYLA 4C4PA 2VJDA 4TLDA 9ATCA 2IYPA 3ETDA 3VYRB 1USGA 3LBYA 5FKJA 2FSPA 2FZ4A 3QBJA 3OU6A 4NSNA 1GA1A 4RD4A 2A6PA 1V37A 3OIUA 1RRMA 3W5VA 4PNEA 4LZNA 3RIGA 2VK8A 1SR8A 3TTYA 3QPVA 1G8GA 4GUAA 3EDQA 1GPDG 2FF7A 3HSKA 5DM4A 2FWRA 5EIBD 3DB1A 3LF1A 1P8JA 4JYMA 1A8SA 1JWAB 3ZVRA 3KJGA 3EUFA 4RPCA 3OT1A 4M9RA 4G0ZA 2YWXA 1I3KA 3H75A 1WMEA 1GPWB 3OC6A 1Q22A 3Q2IA 2D59A 5LMZA 5LXTA 2H8KA 2A30A 4NULA 1FZTA 2ARKA 3ZZ1A 5JPCA 4R2MA 4MJLA 3N2KB 1HLFA 2X9VA 1NSYA 1OWMA 3KKKA 3QQ5A 3TX6A 1NMXA 1JLRA 4Y7CA 1GAJA 1UKBA 3NPMA 1QPGA 3WX0A 1NYRA 3F74A 3G1TA 4IMJB 1OGYA 2Y71A 1VRCA 4JQCA 3A70A 1B1AA 2JA2A 2W2KB 5EE1A 1T2DA 2VO1A 2HY7A 3LHKA 4BYMA 4ZK6A 4D3SA 2P4HX 3UPDA 1Y42X 2I4NA 1NG9A 3R75A 1FMCA 1EVLA 2XH8A 1W9MA 1DJNA 3OPYA 1FDUA 2WF9A 3D3EA 3NYQA 4AJNA 3KDSE 1WBBA 2RIPA 3EQ7A 3B13B 5FFNA 4H08A 1QYXA 1OE0A 2YNMC 3GD7A 3QE9Y 1K2WA 1GTSA 1ZSVA 2VOEA 3NUQA 4PHGA 2YOGA 1WD7A 5C4MA 4E5PA 1ZRMA 3AI3A 1Y3HA 1S2GA 3U61B 2C0CA 2PRZA 3GHHA 3HSSA 4PN3A 4EPTA 3C5HA 5M04A 3BREA 1OBCA 4UE2A 3FRJA 3E2IA 2VT3A 3ZZ0A 4NAVA 1KZHA 1EUDB 1ZGAA 3BWVA 4UPDA 1J6UA 5EMLA 3BCRA 4BN5A 5E2AA 1CUBA 4FMCB 4WZZA 3AESB 5G0UA 4AS1A 3NHBA 4DWJA 1J97A 2C2MA 4Y0VA 2ATVA 2QW8A 1PE0A 1SEPA 2V7GA 3HEAA 4L07A 5LM3A 2Q3DA 3AJ8A 5LQJA 3LRXA 2ZSIA 3UMCA 4EGFA 2NTNA 4K6MA 1O94C 1EK0A 1Y1LA 3GXBA 1PUJA 1CE8A 3JVUA 1AKWA 4I55A 1AGRA 2CJPA 3NI2A 4UHEA 1WULS 4FHFA 4U63A 3ZCVA 3HC7A 2GM4A 5CAEB 1B93A 1E3EA 4J7CA 1EIWA 1E0KA 1Z34A 3TE7A 1WXEA 1MOSA 4K9NA 1FUIA 3LZ6A 4LYHA 2DGDA 2HV9A 2IU3A 1N5OX 4X93A 1Z17A 4IGAA 5H7XA 1O4WA 2ERYA 2YWBA 5JZMA 3SAJA 4EJSA 4GBGA 4UM9B 4D8VA 3BG5A 2X9LA 3UHPA 3NJ4A 4RKQA 3I5XA 2DMRA 3NDJA 1TF2A 2C57A 3S1AB 3UAOA 3VYVA 3SCZA 4IXWA 4P82A 4V0QA 1LUAA 2EP5A 2FPRA 4YJGA 3QVUA 1LDNA 3L02A 5L53A 4OQMA 1A69A 4MR9A 2ORWA 3SI7A 2BGNA 3AVQA 1PF7E 1NQ5A 1MIOB 3A1FA 3LT4A 3MNFA 4NWIA 2QYOA 1RWKA 1DKRA 7REQB 4E13A 4MLPA 1OGJA 3LKVA 3N0XA 3OHMA 1X74A 2W8BA 3GLIE 3IP6A 3Q1KA 1V1RA 3RYCA 4U6QA 3DM5A 3PX7A 1G3MA 1DQRA 1HLPA 3OCYA 4IZIA 2VHZA 4YN3A 3I5MA 4RJLA 3H3JA 1SOWA 1W5SA 1H05A 3BWEA 4IY1A 4BUCA 2VI5A 4A0QA 2J31A 3V8QA 3WLNA 1IOWA 4F46A 5BQOA 2RJ3A 3H1PA 2BDTA 3DV0A 2Z1MA 4ZAWA 3ZU2A 1LWNA 2P0EA 1MG0A 2QD4A 3OE5A 3UAGA 5CJPA 4I1SA 2QTAA 1MVLA 4YV2A 2C03A 4Q3BA 4JX8A 2OEPA 2PS1A 4FGSA 4RD3A 2C5LA 3R2JA 2CWDA 3AR9A 3GG2A 3LCVB 3PICA 2D1SA 2IZOA 4J0JA 4J94A 1GTMA 3K1YA 3I8XA 3QSGA 4G56A 3F5FA 1YKGA 1EE9A 3D1VA 1GSAA 1AU9A 2PV7A 3K20A 3KO8A 4URHA 5HCNA 4O3MA 1TJNA 4EGSA 1Q0QA 2GGSA 2BY4A 2ZRDA 2IYFA 4KXLA 3WJ2A 3IDOA 4ENSA 2C95A 1U99A 3GMDA 4DJJA 1N4DA 2VYCA 3QWAA 3DZ8A 1TI7A 1LLQA 3QYFA 4LBVA 3AVWA 2X41A 2V58A 2RHLA 2XNKA 3BK2A 3ZJTA 3GR6A 4MUXA 4YRMA 3TQCA 5DIFA 4UHFA 3CVUA 3THXA 4D96A 5ALSA 1GGMA 1L9XA 2I2AA 1FP4B 3P9NA 3AIMA 4N7JA 1GEEA 4K3UA 5ECGC